1W6XA

Sh3 domain of p40phox, component of the nadph oxidase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
MRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Effects of P47Phox C-Terminus Phosphorylation on Binding Interactions with P40Phox and P67Phox: Structural and Functional Comparison of P40Phox P67Phox SH3 Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
molecule keywords NEUTROPHIL CYTOSOL FACTOR 4
total genus 11
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w6xA00
3NGPA 2K3BA 2KR3A 5I11A 2DL4A 1GFCA 2YT6A 1ZUUA 2RQTA 2K79A 1ZLMA 4RTTA 4LN2A 4RTZA 1W1FA 2KBTA 2DL8A 1T0HA 1E6HA 5HCKA 1M3AA 1ARKA 4QT7A 2CH4W 4OMOA 4RTUA 1HJDA 1PHTA 1BBZA 3M0PA 2LZ6B 1WI7A 2GBQA 2FO0A 4LUDA 4IIOA 1TUDA 4GBQA 4Z8AA 1SRLA 4RUGA 4OMLA 4LUEA 1NEGA 2DE0X 1Y57A 4HCKA 3EG0A 3TSWA 1JXOA 2KGTA 2LMJA 3EHRA 4J9HA 1RI9A 3SEMA 4DEYA 2OI3A 2XMFA 3RNJA 2K6DA 1WX6A 2HDAA 2CREA 3VS0A 3M0SA 1PKSA 4JPBW 4RTWA 1JEGA 2L0AA 1YN8A 1ZUKA 4ESRA 3VS4A 3NHNA 2O9VA 1TUCA 1SRMA 1K1ZA 4R0KA 4AG2C 1M30A 1E6GA 1UJYA 1S1NA 2NUZA 2O2OA 1W6XA 2RN8A 1UJ0A 1JXMA 2FG0A 2W10A 3I5RA 4KRTA 2A08A 1VYTA 1WDXA 1CSKA 1EFNA 3M0TA 1ZBJA 1H3HA 1JO8A 2W0ZA 1GFDA 2F2WA 2RF0A 1VYVA 3H0FA 4CC4B 1QCFA 4D8DA 2PZ1A 1T0JA 2EKHA 4EIKA 2KXCA 2DYBA 2CT4A 4J9FA 3EG3A 4HVUA 4RTXA 5IXBA 2RQUA 2LQWA 2FRWA 1E7OA 1X27A 2CUDA 1UTIA 2C0TA 2VWFA 3VS7A 2KXDA 2LX7A 2DF6A 1V1CA 4F17A 2RQWA 4CC3A 2EQIA 1SSHA 1BU1A 1AZGB 2EYYA 2AK5A 5EC7A 3VS5A 2GGRA 2JW4A 2J7IA 3VS6A 2SRCA 5GJWB 2L2PA 2J6OA 2DM1A 3TSZA 1YP5A 5IXFA 2VVKA 4OMQA 3H0IA 1LCKA 4IIMA 2ROLA 4OMNA 3H0HA 4Y92A 1KFZA 3LH5A 4AFZC 1NM7A 4HXJA 2G6FX 2DL3A 1K4US 2LJ3A 2JS2A 4HVVA 4AFSC 2RNAA 4CC2A 5FW9A 3EG1A 1RLQC 1M8MA 1FMKA 2KRSA 2EYWA 2FPDA 3I9QA 3RBBB 1N5ZA 1MV3A 1Y0MA 2NWMA 3PVLA 3QWYA 2KRMA 2GTJA 5GJVB 1OEBA 1AWOA 4JZ3A 2DNUA 3NPFA 1U5SA 1WFWA 2H8HA 1T3SA 2AKLA 1PKTA 2RQVA 1K0XA 1AZEA 1J3TA 1H92A 2CT3A 2AZVA 2JMCA 1MUZA 2X3WD 1AD5A 2YUPA 1WXUA 2KT1A 4X1VA 2J05A 2KYBA 2YUOA 1A0NB 2EGAA 1U3OA 1QWFA 2A37A 4LNPA 4J9BA 4AFUC 1G83A 1SHFA 2BZXA 2BZ8A 1X69A 2GNCA 3H41A 2KROA 2V1QA 3A98A 1GCPA 2JTEA 1OPKA 4RTYA 2D8HA 1UHCA 5IHNA 2F2XA 1WIEA 2DBKA 5IH2A 5I22A 2ROTA 3U23A 3UA7A 2KYMA 2YSQA 2LNHB 2DILA 3M0UA 4JJCA 4M4ZA 2LQNA 2MCNA 1TG0A 2FPFA 1M3BA 1W70A 3ULRB 2OJ2A 1MV0B 5ECAA 1IO6A 4J9GA 2P4RA 3VS1A 3C0CA 4F16A 3THKA 1KIKA 1NG2A 2KRNA 2HSPA 2F2VA 2B86A 2RMOA 1HD3A 1AWXA 1H8KA 1PNJA 1UDLA 2A36A 2JS0A 2ED0A 3SHWA 3QWXX 1UHFA 2L3SA 2LJ1A 1NLPC 3UA6A 1K9AA 1B07A 2ABLA 1GRIA 1ZX6A 4A63B 2DRKA 1U06A 2FEIA 4E6RA 2RPNA 2KNBB 1KSWA 1XOVA 2QDLA 2DX1A 3PE0A 2YDLA 3I35A 2MIOA 3R6NA 3TVTA 2O88A 2DVJA 1VYUA 4JZ4A 3EG2A 4K11A 2KE9A 1GBQA 1WXTA 2AZSA 1Z9ZA 2EGCA 2SEMA 1PRLC 2K9GA 2L3QA 1OPLA 2OAWA 2LCSA 1HSQA 5FWCA 1X6GA 3REBB 1GCQA 2DL7A 1UECA 1NEBA 2EBPA 2DMOA 3O5ZA 3VS2A 4Z89A 1M27C 3PVQA 3I5SA 2LP5A 4RTVA 2J6KA 1WLPB 1GBRA 2JXBA 2FPEA 4J9CA 1ZSGA 2O9SA 1UG1A 2ENMA 2VKNA 2V1RA 1YNZA 1M3CA 2JMAA 3GBQA 1SHGA 1RLPC 4F14A 2GTOA 1VA7A 2DJQA 1PRMC 2EPDA 2YUQA 2KT8A 1ABQA 1SEMA 1UGVA 1QKWA 2GQIA 2C0OA 4AG1C 2DL5A 2HEQA 3UF4A 2DLPA 1K76A 3M0QA 1AOJA 2C0IA 2PTKA 4LE9A 2CUBA 1OOTA 3VS3A 2BTTA 1X43A 3IQLA 5L23A 4JJDA 4ORZA 3VRZA 1NYGA 2JM9A 5IHIA 2CDTA 2EYXA 2IIMA 1Z9QA 4HVWA 2FRYA 1QLYA 2K7AA 4CC7A 2JT4A 1NYFA 2ESWA 2JM8A 1YWOA 2ECZA 2DA9A 1X2KA 2LJ0A 2M51A 1JQQA 4J9IA 1T3LA 1B3QA 4Z88A 3ZL7C 5IHKA 1G2BA 2DRMA 3UATA 3JV3A 2D0NA 1YWPA 1I1JA 1X6BA 4ZNXA 2EW3A 5FWBA 1PWTA 2MOXA 1SPKA 2EYZA 2A28A 1ZUYA 2EGEA 1ABOA 1WA7A 1BB9A 2DBMA 1UUEA 1NLOC 2J6FA 1QKXA 4FSSA 3REAB 2RQRA 1KJWA 2ED1A 2KEAA 3EHQA 3KFVA 3M0RA 1FYNA 3NMZC 3EGUA 4OMPA 1JU5C 2YUNA 1AWJA 1WXBA 1GL5A 1AEYA 2HBWA 2PNIA 2BZYA 2I0NA 3FJ5A 1I07A 2AKKA 3CQTA 2D8JA 4WCIA 4J9EA 4AFQC 2J06A 2HCKA 1K0SA 3VRYA 4OMMA 1I0CA 1GCQC 4JJBA 2EVRA 2O31A 1CKAA 1X2QA 2L3PA 2D1XA 2M0YA 1AWWA 2E5KA 1BK2A 2K2MA 4GLMA 2X3XD 2CSIA 2CSQA 1AVZC 1WYXA 4D8KA 1UFFA 4J9DA 1RUWA 1OV3A 1CKBA 1QWEA 1UE9A 1YCSB 4DEXA 2CH4A
chains in the Genus database with same CATH superfamily
2KR3A 2DZ9A 2YT6A 4FT4A 5CKEA 2K79A 4RTTA 1RAEB 4LN2A 3JSCA 2HKQB 4X9CA 4NOYA 1WI7A 2RO0A 1YI2A 2FO0A 1IHWA 1D3BA 1WHJA 4IIOA 2QYZA 4GBQA 4RUGA 2FL7A 1VQNT 2CP5A 1K9MR 2COYA 3TSWA 5EG2A 2LMJA 4LD9K 2LTOA 1G3YA 5GAMe 2AT1B 1TS9A 4C8QC 3LWHA 2K6DA 2CGHA 4M7DD 1BCMA 3QJ6A 5LJ3g 2E41A 3OBYA 3QZ9B 4A4FA 2CP6A 1VQ4Q 3OB9A 5LJ5f 2QQSA 1B34B 3L2ZA 2K3XA 2LNVA 4M75B 1VQKQ 4R0KA 4AG2C 3MP1A 3CCMT 3PNWC 4C92G 1BI0A 1UJ0A 1JXMA 3G6ET 4HT8A 3I5RA 1UB4A 1WDXA 1EFNA 1ZA1B 4FT2A 1WHLA 3LW5E 2MK5A 2X4YA 3MKDA 1JO8A 2F69A 2W0ZA 4ZGJB 2F5KA 3E1SA 4D8DA 3HRSA 2HAXA 4IUPA 4EIKA 3CCUA 2RI5A 3N5BB 2OTLT 3CC2A 4J6WA 3C12A 4BE0A 1WPYA 5GAN4 2RQUA 4BDYA 2K5FA 1K73R 1RAGB 3SFMA 3VS7A 1BI2A 2DF6A 1V1CA 4BDZA 2O4XA 3CMAT 1N8RU 2XK0A 3EAEA 2GGRA 3VS6A 2XDBA 1R0BG 1NJIC 2H3JA 1YJNA 2JJ9A 2MYSA 5IXFA 4RG8A 3EFOA 1LCKA 3CC2Q 5FU7B 4PK4A 2CZ0B 3GP8A 2G6FX 2R5MA 1Q81R 5FW9A 3L2QA 2VASA 1KQ2A 3KUFA 4PLLA 2FPDA 2Y4YA 3RBBB 1XJWB 1G8XA 1N5ZA 3TU4K 2QA4T 2GTJA 5GJVB 2OTLQ 3E2UA 3OS2A 3PTAA 4PKCC 2DKGA 3A8LB 2GCXA 2RHZA 1U5SA 5GMKm 5CVIA 3HP9A 1K0XA 1QCOA 4M75D 1TTHB 4HCZA 2NUPA 3OQ5A 4HT9A 2BUDA 1JBMA 3H9NA 2EYQA 1U3OA 2A37A 4J9BA 2PVDB 2BZ8A 2GNCA 2KROA 3HKSA 3CPFA 5GANd 4XU3A 4RCCA 2QEXA 3J80E 2F2XA 4JS5A 3UA7A 3JCMd 2LNHB 2DILA 3QG1A 3RR6A 2QTXA 3L1AA 3SB2A 3OS5A 3JCMe 2QXFA 4M4ZA 3NTIA 1TG0A 1Y96B 2DYIA 3ULRB 4N4HA 3JCMP 3MJXA 4J9GA 3G4SA 3M9QA 4HCCA 2MAMA 2WSCE 1UGSB 3M54A 5AYFA 2F2VA 1AWXA 1FX7A 2JS0A 2ED0A 4MZTA 1UHFA 2L5QA 4C8QD 1NE8A 3UA6A 1WQ7A 1NPPA 1ZX6A 5GANh 4AT1B 4JUVA 2QGFB 3SWNC 1MGQA 1WQWA 1KSWA 2QDLA 3PE0A 3RKWA 3M4YA 4XTVA 1W2BP 2L8DA 4FYWB 2MIOA 1RAFB 1YITQ 3JB9J 1VQLT 2RB6A 4JZ4A 1PSEA 5LJ5d 1KC8C 1WXTA 2EGCA 2NLUA 4MZPA 3QDRB 1U1TA 1PRLC 2VXFA 3JAME 1HXDA 2EQMA 7AT1B 3BFMA 1LVKA 2BKDN 1GCQA 5D7UA 1VQ5T 1ZSZA 2EBPA 2DMOA 4PJOC 1YCYA 4HCBA 3I5SA 1VQ4A 1QVGA 4ATOA 1K8AR 3EH1A 2K5LA 5LJ3e 2JXBA 1UGQB 1U8RA 2M02A 1X75C 3ER0A 5LJ3d 4FW1A 2VKNA 2V1RA 5IT9E 1IREB 3X24B 5KYWB 2GTOA 4MMLA 1VA7A 4P5NA 3HSBA 3C4SA 3DB3A 2DEUA 1MNDA 1KG1A 1PRMC 1D1CA 4Y28E 5KCOA 4WTOB 4V2SA 3PFSA 1SEMA 3JCMQ 4AG1C 2YRVA 1OOTA 4IUQA 4PJOA 1MHNA 3HHTB 2BTTA 4BY6C 2FHDA 1YHQT 1YIJA 4PJOD 4JJDA 4C8QF 4OGEA 3QPHA 5J39A 2HQHA 3S3NA 1K9MC 3OYBA 2IIMA 2QI2A 3CXCA 1W4SA 4HVWA 1Y96A 1QLYA 2ESWA 1I8FA 1X2KA 4C0FA 4EMKA 4F7UG 1YJNT 1YJ9T 1JJ2P 3CCLA 2OTJT 1G2BA 4MMKA 4J6XA 3JV3A 3META 3L2UA 1YWPA 1TUGB 2QK0A 2EW3A 2P0KA 1PWTA 1VQOA 3HTRA 4JRKA 1NPRA 3CMET 3JCMb 3JCMJ 4RG2A 3OYIA 5IN1A 2EGEA 2YLBA 1ABOA 1UUEA 3F70A 1WJQA 1QKXA 1NJIR 1AT1B 3SWNB 4M77D 1VQPT 1KJWA 2H3EB 5GMKe 3KFVA 1KQ1A 2WSEE 1AEYA 2BZYA 2I0NA 2D6FA 4XTUA 1I07A 2AKKA 4L6V5 2D8JA 1MMDA 4C92A 2CP2A 2OTJA 2QTVA 3DLMA 2J06A 2AIRB 2NUPB 5KYUB 3GOXA 3M5AA 3TCJA 4OMMA 1M1KR 2WACA 3OW2P 3RDVA 2DTIA 1OYXA 4M75G 1I0CA 2DVEA 2EVRA 2L3PA 2K5IA 2E5QA 3KBGA 1AWWA 3RESA 2E5KA 2CZ7B 4BD3A 2EIFA 1BK2A 3VYGA 4M78C 2RI3A 4GLMA 2CSIA 5FU6C 3JB9D 4PJOF 2OTJQ 1UFFA 4J9DA 9ATCB 5LJ5e 1QWEA 1UE9A 1KHCA 2EJFA 2CH4A 1KQSS 1F1BB 1M8VA 3CC4A 4Y91A 4NL2A 1ZLMA 1YJNQ 1GXIE 1FWZA 5GMKh 4M7DC 2DL8A 3EFRA 5HCKA 1M3AA 4BUGA 4QT7A 2CH4W 4OMOA 3URGA 3CCEA 1K8AC 1M5Q1 3LWIA 1BKBA 3M0PA 2LZ6B 5CKFA 4LD6A 2KDSA 2LT1A 2E10A 2C06A 5A0GA 1TUDA 4Z8AA 3LGFA 1M2VA 2YRCA 2VYTA 4OMLA 4OMFB 1PD0A 5KYWA 2DJZA 2DERA 4HCKA 1G3SA 3EG0A 3SEMA 1RI9A 2MWOA 4BI8B 4ZGEB 2XDDA 5CO7A 3FEOA 2YXYA 5CCAA 1VQ5A 4JPBW 1OULA 2Y4XA 2HZYA 1Q7YU 2XI9A 2MI6A 3G1JA 4ZN3A 4BI3A 2YHTA 5I2MA 4PL6A 1IGQA 2P84A 3EFSA 3SD4A 1QP3A 1PC0A 2DEQA 5KE2A 3EGXB 2E3HA 3UWNA 2NUZA 2O2OA 1OZ2A 2W10A 2LCCA 4KRTA 1CSKA 4RKUE 3M0TA 1KD1C 5FU6B 4JS4A 5HKCA 4JLIA 2DTHA 4CC4B 1YHQQ 3CCQA 4ZTFA 1YJWA 2DXUA 4UC4A 1UGPB 1S72T 2KXCA 2EJ9A 4J9FA 5GAMd 3CCEQ 3VUZA 3L2RA 3VJPA 3CPWS 4DBHA 5GAOl 1VQMQ 1D0YA 3TREA 4MDWA 2LQWA 2FRWA 1E7OA 4M77G 1X27A 5GAN8 2VB6A 2VWFA 1WHHA 2DIQA 2GFAA 4CC3A 5FU7C 2EQIA 4NS5A 1QVFA 1AZGB 2AK5A 5EC7A 3VS5A 2SRCA 3RERA 2DM1A 1YITA 1YP5A 2VVKA 4DBQA 5HK0A 2HKNA 4M7AD 4BACA 4IIMA 1Q82R 2ROLA 4Y92A 1ZSZB 1KFZA 1NM7A 2XKOC 3BE3A 1M2OA 3M4GA 4KGVB 1K4US 4HVVA 4AFSC 4CC2A 2P0PA 3V7SA 1RLQC 2ATCB 4E2FB 1KC8R 2KRSA 2EYWA 4LDUA 1YITT 3CCJQ 4PJJA 1MV3A 1Y0MA 2NWMA 4DBRA 1PG5B 3PVLA 3QWYA 2KRMA 2QA4A 5LJ5j 1OEBA 1H3ZA 4JZ3A 2DNUA 3NPFA 1EIFA 4PJOE 1WFWA 4IUTA 4J6YA 2DETA 2M16A 4PFOA 1N9RA 2B8AA 2CT3A 2YWWA 2JMCA 3RKYA 1MUZA 2X3WD 1WXUA 3VU3C 2KT1A 2J05A 1D1AA 3L42A 1TSFA 5LJ3f 4XTWA 3CBOA 3NTHA 1S72A 1Q81C 1VQNQ 5GAOp 4LNPA 1G83A 1SHFA 3PT9A 2DXBA 3NTKA 4PJLA 2QQBA 4C0DB 1M90U 3J81E 1KHIA 2ROTA 3CPWP 1M9SA 2KYMA 4IURA 1N27A 1WNLA 1V29B 2JUFA 2DAQA 4KGXB 1VQ7A 3G4ST 3CXCP 1Q86R 2DTOA 4JJCA 2XICA 3BDLA 4QQDA 3EG9B 2MCNA 2FPFA 1Q7YR 2MPXC 2OJ2A 5ECAA 3CCUT 1IO6A 3LYIA 1C6VX 4EDUA 1IGUA 1KIKA 4M7DF 2KRNA 1HYOA 4M77A 2OTLA 3OSSC 2RMOA 4BB7A 3SHWA 2FVUA 4TVRA 5FLXE 3X20B 2MWPA 3D7SB 1YJ9A 3RIRA 1O9SA 1K9AA 4A63B 2JOYA 1U06A 2COZA 2BE9B 2IG0A 4C8QE 3ZEHA 2V8KA 4XK8E 4J7IA 2XU8A 3QO3A 2O88A 2DPPB 2DVJA 3LH0A 3JCMV 3CCMA 8AT1B 3QSUA 3HRTA 3EG2A 2X4WA 2EWNA 1GBQA 2AZSA 1Z9ZA 5GAMh 5GANj 2VUBA 4M77C 2SEMA 4C0DC 2K9GA 1I5OB 1ZSZC 1OPLA 3JCMc 3GLXA 2KI7A 2EFIA 4QQGA 2LVMA 1NEBA 3HL8A 3CCJT 4B9WA 3O5ZA 3VS2A 3PVQA 2F5TX 2LP5A 2J6KA 1GBRA 3OYEA 3G71Q 4BE1A 1UG1A 4JRPA 2ENMA 2P4TA 1YNZA 1M3CA 2RHIA 1VQ4T 3DKMA 4M78E 5GAN5 3CCST 2RJDA 3A8GB 2RJEA 4N0AA 5FROA 3CCQT 4F7UF 2RHUA 4OB2B 3EGDA 4ELYC 2GQIA 3UF4A 2DLPA 1K76A 3M0QA 4HA8A 4J83A 3JCMf 4EMGA 2PTKA 3VS3A 5CAIA 3IQLA 4Q5WA 4F7UB 2JM9A 4VUBA 2PVGB 1D1BA 3ZBDA 4JDSA 4A53A 1P92A 4XU0A 1Z9QA 4YTLA 1YBYA 4EMKC 4CC7A 5CR2A 3CMEA 2D9TA 2ECZA 1BCOA 5GAMg 3QUIA 2LCLA 3L2VA 2LJ0A 1S72Q 4FSXA 5IHKA 1B3QA 2DRMA 1IZ6A 2VV5A 5L8RE 4DQ2A 1FXXA 1XQHA 2E65A 3JCMX 1X6BA 2RI2A 3CEYA 6AT1B 3T9NA 4E7ZA 1LOJA 2A28A 1ZUYA 2PU9B 3X25B 4F7UE 1VQ9T 4M75A 1Y71A 1RABB 3EGDB 1TWBA 1NLOC 4FSSA 5GAN2 3REAB 2RQRA 2KEAA 3CCJA 3EGUA 1JU5C 1AWJA 4O6JA 4JJNK 1GL5A 2HBWA 4II1A 2HBPA 1TU0B 2A3LA 4E47A 3FJ5A 3CCRT 2QQ9A 4J7FA 5I2SA 3OBWA 4WCIA 4DOWA 1M90C 1M4ZA 2LQKA 1WHKA 2X51A 1K8AU 4M78A 1VQ8Q 1G3TA 3DLLA 2K2MA 3QBYA 2HNIA 2E3IA 2X3XD 1WZOA 2CSQA 2JTMA 1WYXA 4D8KA 3WVEB 3OYFA 3FIFA 1YCSB 4C5GA 4JRIA 1GFCA 1ZUUA 1MNEA 1KD1U 4RTZA 1W1FA 4M7DG 4OGCA 1TXQA 3CMAQ 1ACMB 3M53A 3ZFJA 3CXCS 4B9XA 1N9SA 1BBZA 1AHJB 1R77A 3CD6Q 3V8JA 4L59A 1YJWQ 4M7AG 1HK9A 3I56A 2HQXA 4LUEA 2VGMA 2CZ1B 1VQPA 3MCAB 5A2QE 1M1KC 1QCNA 1JXOA 2XD0A 2KGTA 2R57A 4J9HA 4DEYA 3QIIA 2X4XA 2XMFA 2V8JA 3M56A 3WVDB 3JCMW 2HDAA 4C92C 2CREA 3I55A 3FLGA 3M0SA 1PM3A 1PKSA 1V76A 3FB9A 3OSVA 5HY6A 4ANJA 3CCLT 1ZUKA 4ESRA 3VS4A 3NHNA 1RAHB 2O9VA 1SRMA 1K1ZA 4J8OA 3OYAA 3OYDA 4DOVA 3PGGA 1M30A 3JRZA 1S1NA 1RAIB 3SDZA 3VYHB 4A54A 3OS0A 2DZCA 1BIBA 2RK1A 3CC7A 1YIJT 1YHQA 2QEXT 1VYTA 2ZAEA 1LPLA 3OYNA 1ZBJA 4QVDA 4OB3B 3GF5A 4XTYA 2RF0A 3H0FA 1QCFA 2E1HA 1KD1R 2EKHA 3X26B 2DYBA 3QYHB 4FW2A 4HVUA 2HL3A 4RTXA 1LNXA 4J5YA 2LX7A 3CCSQ 2KAFA 1MMAA 4F17A 4R55A 2M0OA 3CC7Q 1YI2Q 2HMAA 5CKHA 1IHVA 2EYYA 4A4GA 3CCRA 2L2PA 2QAZA 1RACB 1Q81U 3GNFB 3HRUA 4OMQA 3H0IA 4M78B 4IKFA 4PJNA 2JN0A 3H0HA 3LH5A 4AFZC 2ZPFB 4OB0B 3CC7T 4HXJA 2HD0A 2DIGA 1VQ9A 1SG5A 2YRDA 1QVPA 2FZKB 4EMHA 1YI2T 3EG1A 1MMNA 4FYXB 1M8MA 1FMKA 4KUIA 2RJCA 4C92E 3E19A 4FIBA 3H6ZA 1M1KU 1PD1A 1ZQ1A 2QA4Q 3SWNA 1C1AA 1WJSA 2PQWA 1U1SA 3CMAA 3QZ5B 1T3SA 2AKLA 2KY9A 1PKTA 2I2LA 1AZEA 1H92A 4M75F 5IAYA 2DD4A 4KUDK 2YUPA 1AD5A 1K73C 3CC2T 3A1PA 1VQLQ 2ZZDA 1WHGA 4LDWA 5D6XA 2KYBA 4ME7A 2EGAA 4PJOG 2MF2A 3G6EQ 3OS1A 4N0AC 1VQOT 2PVOB 2X9HA 2BZXA 2O4XB 1X69A 2V1QA 4ZN1A 2XIDA 1GCPA 4LXCA 5GMKi 3MP6A 3MP8A 1OPKA 3CPWA 2D8HA 1UEBA 5CIUA 2G3RA 1UHCA 5IHNA 1WIEA 2DBKA 5IH2A 5I22A 3U23A 1NBEB 5GAN7 2CP3A 2YSQA 4PJOB 4OF1A 1RAAB 2EQUA 3CCSA 2V8IA 3JB9G 3M0UA 4N4GA 2JNGA 2HSEB 3G6EA 2LQNA 2E6NA 1MV0B 3FJPA 2AHJB 3VS1A 2D0QB 3C0CA 4FL6A 1B7TA 1QVFS 3CD6A 2M1HA 2HSPA 3CCQQ 2B86A 1HD3A 2QEXQ 2DK3A 4QKUA 1PNJA 1UDLA 2A36A 2LC4A 4O5VA 2CP7A 3CD6T 3BY7A 3S6WA 2E70A 3ME9A 1VIEA 2K2VA 4KBMB 1VQMT 4M7DB 4C92D 2ABLA 1GRIA 2DRKA 2NUTA 1QW1A 1K73U 4X9DA 2A7YA 4M78F 1VQNA 2EJGA 1YFNA 4M7AC 2M9UA 4XU1A 4LDYA 1VQOQ 3E9FA 3I35A 3TVTA 3INZA 1VYUA 1IRXA 2OX7A 4C5EA 1W2BS 2DD5A 2KK4A 5GAN3 3UPUA 5KH6A 2WSFE 3FRNA 1Q7YC 2L3QA 4A4EA 1HSQA 5FWCA 1D0XA 4GLKA 1VUBA 1X6GA 3RMQA 2DL7A 2KMTA 2XG8D 4ZGDB 3CCRQ 3M58A 1M27C 5J26A 4RTVA 4ZTJA 3LGLA 2LRQA 1VQ5Q 2FPEA 4WF2A 1ZSGA 1OZ3A 5GMKj 2ZPGB 3I56Q 2JMAA 3GBQA 3G71A 1SHGA 1RLPC 4F14A 3LX7A 2GF7A 5GAMf 2DJQA 5GMKl 2RJFA 5LJ5h 1IXDA 1N8RC 2YUQA 2QQRA 3VKIA 1VOMA 1UGVA 4M75E 4OP0A 2C0OA 2Z0WA 2HEQA 3CC4Q 2QDYB 4QQ6A 3M55A 1AOJA 5KYXA 1FMWA 4LE9A 3OYJA 5L23A 1X43A 3JCMg 2R5AA 1TOVA 3L2WA 1WHMA 3RUXA 2CDTA 3I56T 2EYXA 5A0LA 3V8KA 3OYMA 2FRYA 2K7AA 2O01E 2JT4A 1NYFA 3GNGA 4BI4A 2JM8A 1YWOA 2RHYA 4DA4A 5CQXA 3OW2A 1TH7A 4F04B 3ZL7C 4BY6B 3I55Q 3UATA 2DXTA 2D0NA 3P8DA 3QJYA 1I1JA 2QASA 4E7HA 3A8HB 1OU9A 3FDRA 1R8OB 5CQYA 2JTFA 3CCVA 4D6WA 2EYZA 5DLQE 2K57A 5GANg 3OYGA 1OX8A 1BI1A 1K9MU 3MPUB 2GQVA 2ED1A 2XHCA 2ZPEB 1JB0E 1FYNA 3NMZC 1PSFA 3OY9A 3OYHA 4OMPA 3JB9H 5LJ5g 2QG9B 2EKOA 3CQTA 3AT1B 3OW2S 4AFQC 3JB9I 2HCKA 3CCLQ 1JJ2A 1BIAA 4AMCA 1Q86U 1Y07A 4FU6A 3VV0A 4JJBA 2O31A 2CKKA 4R56A 3CMEQ 1SF9A 2D1XA 2M0YA 2IVWA 1QVGP 1MMGA 1I4K1 5LL6S 3Q1JA 4XTZA 3BW1A 1SKUB 2VXEA 3PIOA 4A4HA 4DEXA 3NGPA 2K3BA 1PCXA 4C5HA 5I11A 2DL4A 8ATCB 3I55T 1Q86C 2RQTA 4GY5A 3GIBA 1YJ9Q 3S3MA 4IUUA 1YJWT 2KBTA 3UDCA 4FCYA 2KSSA 1T0HA 1E6HA 3WXMB 1ARKA 4RTUA 2FYKA 1HJDA 1PHTA 3G71T 2LX9A 5KE3A 4C8QB 2OAUA 4LDVA 2GBQA 5GAOm 4LUDA 4C92B 3PMIA 1SRLA 2EQKA 4M7AF 4KULA 1NEGA 3QKJA 2DE0X 3TEEA 1Y57A 4M7DE 4E7LA 2X35A 3CCVQ 4E7IA 2XDPA 1X6OA 1VQ8T 3EHRA 1X01A 2NUTB 1N8RR 2OI3A 4M7AE 3RNJA 1WX6A 3VS0A 2ZPIB 1XTDA 1VQKA 5KYNA 4RTWA 1JEGA 4DBFA 2L0AA 4F7UA 5KYYB 1M1FA 1YN8A 1JRIA 2ZPBB 1TUCA 2X4JA 3PMTA 1E6GA 5GAOn 1UJYA 3UT1A 1OQKA 1W6XA 2RN8A 2FG0A 1D3BB 2CS7A 1VQMA 2A08A 1H3HA 3OYLA 3HFNA 1G3WA 2DFUA 1GFDA 2F2WA 1OX9A 1VYVA 2E6ZA 3QYGB 1I5LA 3V8LA 3JCMh 2CP0A 2PZ1A 1T0JA 3G4SQ 2FZCB 2CT4A 2DXCA 3CC4T 3EG3A 4M7DA 2L3RA 5IXBA 1BI3A 1QMCA 3QHSA 2KQWA 2LT4A 2CUDA 2CZ6B 1UTIA 3EG9A 1QP2A 2C0TA 5KCHA 4KGZB 2KXDA 3A8MB 4OVAA 3TQ7P 4C0GA 2RQWA 1Q82U 1SSHA 2BIVA 1BU1A 3C94A 2JW4A 2J7IA 1FMVA 5GJWB 2J6OA 2PUOB 2E4HA 3TSZA 1O75A 4E7KA 3P8BB 4XAXB 1IB8A 3MEWA 1VQ6T 3MEAA 4L5GA 3C95A 2RA2A 4OMNA 4M77F 4PLIA 3GPLA 5GANe 2HQEA 1D09B 1VIFA 2DL3A 1SSFA 2QGGA 2K4YA 2JS2A 2LJ3A 2RNAA 2EAYA 1N6AA 4M77B 1ZA2B 1RL2A 3I9QA 3X28B 5I21A 3CBPA 5KYUA 1RI0A 4MDXA 2VC8A 3QDFA 4PFPA 1WGSA 4QW2A 4OB1B 1AWOA 4C8QA 3NFCA 2LDMA 2R58A 3VUBA 2H8HA 4C8QG 2RK2A 4Z02A 2RQVA 2PUKB 1J3TA 2ZPHB 5CKBA 3QXEB 2AZVA 3OYYA 2LQ8A 4RMOA 1M90R 4X1VA 2COWA 3HPWA 2F1LA 2YUOA 5LJ3j 1A0NB 2FZGB 4PNOA 4M77E 1QVGS 2EQJA 4QVZA 1QWFA 2GFUA 5DM7R 1NJIU 1VQ7Q 4AFUC 4XTXA 4QVCA 3H41A 3A98A 4M75C 4EMKB 2JTEA 3FC3A 4RTYA 4CRIA 3DB4A 1EX4A 3OMGA 4JLGA 5KYYA 3R6OA 3S3OA 1B34A 2VGNA 5GANf 3E9GA 1ZBXA 1WJRA 4KT0E 3PIPA 2ZCFB 1R0CB 4M78G 1UGRB 2A0FB 3MO8A 1M3BA 1W70A 5A0DA 3CCUQ 3CCVT 2P4RA 1KC8U 4F16A 3THKA 3MEVA 1QQJA 4N4IA 4X34A 1NG2A 1Q95G 2QQAA 4IUVA 3OA6A 1H8KA 4C92F 4KH1B 1QVFP 2JVVA 3QWXX 3RMSA 1RADB 2L3SA 3V7CA 3A5ZB 2LJ1A 4HKEA 2BE7D 1I81A 5D6WA 1NLPC 3MHXA 1VQ8A 4M7AA 1B07A 3CBMA 2FEIA 4E6RA 2RPNA 2KNBB 4LDXA 1XOVA 2DX1A 4FYYB 1VQ7T 2YDLA 4A4KA 4XQ3A 3R6NA 3OYKA 4E7JA 2FB7A 3V7RA 4K11A 5GAOr 1D0ZA 2KE9A 2CYZB 4XU2A 1YIJQ 4B6MA 1VQ6A 3M59A 2OAWA 2LCSA 2NYSA 1OI1A 3REBB 1KK7A 1UECA 5M9OA 5GAOq 1Y7XA 4Z89A 5LJ3h 2KVQG 3CCMQ 1WLPB 5GAN6 4J9CA 4MZMA 2O9SA 3A8OB 3ASKA 1M2VB 1EZZB 3J7AF 3HFOA 4KH0B 4EPCA 3EGXA 1M1GA 4ELZC 5HK3A 1VQ6Q 2EPDA 2KT8A 1ABQA 4NL3A 1QKWA 4PJMA 4C5IA 5DY9A 2DL5A 1C0MA 5CK9A 3EH2A 1KQSA 2C0IA 2RD1A 2CUBA 4CI0C 4M7AB 4ORZA 3VRZA 1NYGA 5IHIA 3MEUA 4JRQA 3P8HA 4E7SA 4C0ZA 5CKDA 1JJ2S 2DA9A 2RM4A 1Q82C 3CCET 2M51A 1DJ7B 1JQQA 3RKXA 4J9IA 1T3LA 4Z88A 3BDUA 1OU8A 4M78D 1VQKT 3O8VA 2HL5C 2MMPA 2DO3A 4ZNXA 1VQPQ 5FWBA 2MOXA 1BYMA 1SPKA 3AHUA 2ZGWA 1WA7A 1BB9A 2DBMA 3LLRA 3KXTA 1VQLA 1H641 2J6FA 1NZ9A 4BE2A 5KYXB 3EHQA 3H8ZA 3M0RA 1W2BA 1XNIA 2YUNA 5D6YA 1WXBA 3OYCA 2PNIA 3M57A 3OMCA 3G7ZA 2YLCA 4J9EA 2K3YA 4FYVB 1KQSP 5J3BA 1K0SA 2E12A 3VRYA 1G5VA 1GCQC 2IPOB 1CKAA 1X2QA 4PFZA 3EFOB 1LJOA 3JB9F 5DLOA 1VQ9Q 2E64A 5C0MA 5GAMj 2RH2A 5FRNA 2L89A 2JZ2A 2V26A 1AVZC 2Y90A 4FM4B 1RUWA 1OV3A 5FRMA 5AT1B 2RHXA 1CKBA 1ZHIA 5C6SA 4RCBA 2P0QA
chains in the Genus database with same CATH topology
3NGPA 2K3BA 2KR3A 5I11A 2DL4A 1GFCA 2YT6A 1ZUUA 2RQTA 2K79A 1ZLMA 4RTTA 4LN2A 4RTZA 1W1FA 2KBTA 2DL8A 1T0HA 1E6HA 5HCKA 1M3AA 1ARKA 4QT7A 2CH4W 4OMOA 4RTUA 1HJDA 1PHTA 1BBZA 3M0PA 2LZ6B 1WI7A 2GBQA 2FO0A 4LUDA 4IIOA 1TUDA 4GBQA 4Z8AA 1SRLA 4RUGA 4OMLA 4LUEA 1NEGA 2DE0X 1Y57A 4HCKA 3EG0A 3TSWA 1JXOA 2KGTA 2LMJA 3EHRA 4J9HA 1RI9A 3SEMA 4DEYA 2OI3A 2XMFA 3RNJA 2K6DA 1WX6A 2HDAA 2CREA 3VS0A 3M0SA 1PKSA 4JPBW 4RTWA 1JEGA 2L0AA 1YN8A 1ZUKA 4ESRA 3VS4A 3NHNA 2O9VA 1TUCA 1SRMA 1K1ZA 4R0KA 4AG2C 1M30A 1E6GA 1UJYA 1S1NA 2NUZA 2O2OA 1W6XA 2RN8A 1UJ0A 1JXMA 2FG0A 2W10A 3I5RA 4KRTA 2A08A 1VYTA 1WDXA 1CSKA 1EFNA 3M0TA 1ZBJA 1H3HA 1JO8A 2W0ZA 1GFDA 2F2WA 2RF0A 1VYVA 3H0FA 4CC4B 1QCFA 4D8DA 2PZ1A 1T0JA 2EKHA 4EIKA 2KXCA 2DYBA 2CT4A 4J9FA 3EG3A 4HVUA 4RTXA 5IXBA 2RQUA 2LQWA 2FRWA 1E7OA 1X27A 2CUDA 1UTIA 2C0TA 2VWFA 3VS7A 2KXDA 2LX7A 2DF6A 1V1CA 4F17A 2RQWA 4CC3A 2EQIA 1SSHA 1BU1A 1AZGB 2EYYA 2AK5A 5EC7A 3VS5A 2GGRA 2JW4A 2J7IA 3VS6A 2SRCA 5GJWB 2L2PA 2J6OA 2DM1A 3TSZA 1YP5A 5IXFA 2VVKA 4OMQA 3H0IA 1LCKA 4IIMA 2ROLA 4OMNA 3H0HA 4Y92A 1KFZA 3LH5A 4AFZC 1NM7A 4HXJA 2G6FX 2DL3A 1K4US 2LJ3A 2JS2A 4HVVA 4AFSC 2RNAA 4CC2A 5FW9A 3EG1A 1RLQC 1M8MA 1FMKA 2KRSA 2EYWA 2FPDA 3I9QA 3RBBB 1N5ZA 1MV3A 1Y0MA 2NWMA 3PVLA 3QWYA 2KRMA 2GTJA 5GJVB 1OEBA 1AWOA 4JZ3A 2DNUA 3NPFA 1U5SA 1WFWA 2H8HA 1T3SA 2AKLA 1PKTA 2RQVA 1K0XA 1AZEA 1J3TA 1H92A 2CT3A 2AZVA 2JMCA 1MUZA 2X3WD 1AD5A 2YUPA 1WXUA 2KT1A 4X1VA 2J05A 2KYBA 2YUOA 1A0NB 2EGAA 1U3OA 1QWFA 2A37A 4LNPA 4J9BA 4AFUC 1G83A 1SHFA 2BZXA 2BZ8A 1X69A 2GNCA 3H41A 2KROA 2V1QA 3A98A 1GCPA 2JTEA 1OPKA 4RTYA 2D8HA 1UHCA 5IHNA 2F2XA 1WIEA 2DBKA 5IH2A 5I22A 2ROTA 3U23A 3UA7A 2KYMA 2YSQA 2LNHB 2DILA 3M0UA 4JJCA 4M4ZA 2LQNA 2MCNA 1TG0A 2FPFA 1M3BA 1W70A 3ULRB 2OJ2A 1MV0B 5ECAA 1IO6A 4J9GA 2P4RA 3VS1A 3C0CA 4F16A 3THKA 1KIKA 1NG2A 2KRNA 2HSPA 2F2VA 2B86A 2RMOA 1HD3A 1AWXA 1H8KA 1PNJA 1UDLA 2A36A 2JS0A 2ED0A 3SHWA 3QWXX 1UHFA 2L3SA 2LJ1A 1NLPC 3UA6A 1K9AA 1B07A 2ABLA 1GRIA 1ZX6A 4A63B 2DRKA 1U06A 2FEIA 4E6RA 2RPNA 2KNBB 1KSWA 1XOVA 2QDLA 2DX1A 3PE0A 2YDLA 3I35A 2MIOA 3R6NA 3TVTA 2O88A 2DVJA 1VYUA 4JZ4A 3EG2A 4K11A 2KE9A 1GBQA 1WXTA 2AZSA 1Z9ZA 2EGCA 2SEMA 1PRLC 2K9GA 2L3QA 1OPLA 2OAWA 2LCSA 1HSQA 5FWCA 1X6GA 3REBB 1GCQA 2DL7A 1UECA 1NEBA 2EBPA 2DMOA 3O5ZA 3VS2A 4Z89A 1M27C 3PVQA 3I5SA 2LP5A 4RTVA 2J6KA 1WLPB 1GBRA 2JXBA 2FPEA 4J9CA 1ZSGA 2O9SA 1UG1A 2ENMA 2VKNA 2V1RA 1YNZA 1M3CA 2JMAA 3GBQA 1SHGA 1RLPC 4F14A 2GTOA 1VA7A 2DJQA 1PRMC 2EPDA 2YUQA 2KT8A 1ABQA 1SEMA 1UGVA 1QKWA 2GQIA 2C0OA 4AG1C 2DL5A 2HEQA 3UF4A 2DLPA 1K76A 3M0QA 1AOJA 2C0IA 2PTKA 4LE9A 2CUBA 1OOTA 3VS3A 2BTTA 1X43A 3IQLA 5L23A 4JJDA 4ORZA 3VRZA 1NYGA 2JM9A 5IHIA 2CDTA 2EYXA 2IIMA 1Z9QA 4HVWA 2FRYA 1QLYA 2K7AA 4CC7A 2JT4A 1NYFA 2ESWA 2JM8A 1YWOA 2ECZA 2DA9A 1X2KA 2LJ0A 2M51A 1JQQA 4J9IA 1T3LA 1B3QA 4Z88A 3ZL7C 5IHKA 1G2BA 2DRMA 3UATA 3JV3A 2D0NA 1YWPA 1I1JA 1X6BA 4ZNXA 2EW3A 5FWBA 1PWTA 2MOXA 1SPKA 2EYZA 2A28A 1ZUYA 2EGEA 1ABOA 1WA7A 1BB9A 2DBMA 1UUEA 1NLOC 2J6FA 1QKXA 4FSSA 3REAB 2RQRA 1KJWA 2ED1A 2KEAA 3EHQA 3KFVA 3M0RA 1FYNA 3NMZC 3EGUA 4OMPA 1JU5C 2YUNA 1AWJA 1WXBA 1GL5A 1AEYA 2HBWA 2PNIA 2BZYA 2I0NA 3FJ5A 1I07A 2AKKA 3CQTA 2D8JA 4WCIA 4J9EA 4AFQC 2J06A 2HCKA 1K0SA 3VRYA 4OMMA 1I0CA 1GCQC 4JJBA 2EVRA 2O31A 1CKAA 1X2QA 2L3PA 2D1XA 2M0YA 1AWWA 2E5KA 1BK2A 2K2MA 4GLMA 2X3XD 2CSIA 2CSQA 1AVZC 1WYXA 4D8KA 1UFFA 4J9DA 1RUWA 1OV3A 1CKBA 1QWEA 1UE9A 1YCSB 4DEXA 2CH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGP A;  2K3B A;  2KR3 A;  5I11 A;  2DL4 A;  1GFC A;  2YT6 A;  1ZUU A;  2RQT A;  2K79 A;  1ZLM A;  4RTT A;  4LN2 A;  4RTZ A;  1W1F A;  2KBT A;  2DL8 A;  1T0H A;  1E6H A;  5HCK A;  1M3A A;  1ARK A;  4QT7 A;  2CH4 W;  4OMO A;  4RTU A;  1HJD A;  1PHT A;  1BBZ A;  3M0P A;  2LZ6 B;  1WI7 A;  2GBQ A;  2FO0 A;  4LUD A;  4IIO A;  1TUD A;  4GBQ A;  4Z8A A;  1SRL A;  4RUG A;  4OML A;  4LUE A;  1NEG A;  2DE0 X;  1Y57 A;  4HCK A;  3EG0 A;  3TSW A;  1JXO A;  2KGT A;  2LMJ A;  3EHR A;  4J9H A;  1RI9 A;  3SEM A;  4DEY A;  2OI3 A;  2XMF A;  3RNJ A;  2K6D A;  1WX6 A;  2HDA A;  2CRE A;  3VS0 A;  3M0S A;  1PKS A;  4JPB W;  4RTW A;  1JEG A;  2L0A A;  1YN8 A;  1ZUK A;  4ESR A;  3VS4 A;  3NHN A;  2O9V A;  1TUC A;  1SRM A;  1K1Z A;  4R0K A;  4AG2 C;  1M30 A;  1E6G A;  1UJY A;  1S1N A;  2NUZ A;  2O2O A;  1W6X A;  2RN8 A;  1UJ0 A;  1JXM A;  2FG0 A;  2W10 A;  3I5R A;  4KRT A;  2A08 A;  1VYT A;  1WDX A;  1CSK A;  1EFN A;  3M0T A;  1ZBJ A;  1H3H A;  1JO8 A;  2W0Z A;  1GFD A;  2F2W A;  2RF0 A;  1VYV A;  3H0F A;  4CC4 B;  1QCF A;  4D8D A;  2PZ1 A;  1T0J A;  2EKH A;  4EIK A;  2KXC A;  2DYB A;  2CT4 A;  4J9F A;  3EG3 A;  4HVU A;  4RTX A;  5IXB A;  2RQU A;  2LQW A;  2FRW A;  1E7O A;  1X27 A;  2CUD A;  1UTI A;  2C0T A;  2VWF A;  3VS7 A;  2KXD A;  2LX7 A;  2DF6 A;  1V1C A;  4F17 A;  2RQW A;  4CC3 A;  2EQI A;  1SSH A;  1BU1 A;  1AZG B;  2EYY A;  2AK5 A;  5EC7 A;  3VS5 A;  2GGR A;  2JW4 A;  2J7I A;  3VS6 A;  2SRC A;  5GJW B;  2L2P A;  2J6O A;  2DM1 A;  3TSZ A;  1YP5 A;  5IXF A;  2VVK A;  4OMQ A;  3H0I A;  1LCK A;  4IIM A;  2ROL A;  4OMN A;  3H0H A;  4Y92 A;  1KFZ A;  3LH5 A;  4AFZ C;  1NM7 A;  4HXJ A;  2G6F X;  2DL3 A;  1K4U S;  2LJ3 A;  2JS2 A;  4HVV A;  4AFS C;  2RNA A;  4CC2 A;  5FW9 A;  3EG1 A;  1RLQ C;  1M8M A;  1FMK A;  2KRS A;  2EYW A;  2FPD A;  3I9Q A;  3RBB B;  1N5Z A;  1MV3 A;  1Y0M A;  2NWM A;  3PVL A;  3QWY A;  2KRM A;  2GTJ A;  5GJV B;  1OEB A;  1AWO A;  4JZ3 A;  2DNU A;  3NPF A;  1U5S A;  1WFW A;  2H8H A;  1T3S A;  2AKL A;  1PKT A;  2RQV A;  1K0X A;  1AZE A;  1J3T A;  1H92 A;  2CT3 A;  2AZV A;  2JMC A;  1MUZ A;  2X3W D;  1AD5 A;  2YUP A;  1WXU A;  2KT1 A;  4X1V A;  2J05 A;  2KYB A;  2YUO A;  1A0N B;  2EGA A;  1U3O A;  1QWF A;  2A37 A;  4LNP A;  4J9B A;  4AFU C;  1G83 A;  1SHF A;  2BZX A;  2BZ8 A;  1X69 A;  2GNC A;  3H41 A;  2KRO A;  2V1Q A;  3A98 A;  1GCP A;  2JTE A;  1OPK A;  4RTY A;  2D8H A;  1UHC A;  5IHN A;  2F2X A;  1WIE A;  2DBK A;  5IH2 A;  5I22 A;  2ROT A;  3U23 A;  3UA7 A;  2KYM A;  2YSQ A;  2LNH B;  2DIL A;  3M0U A;  4JJC A;  4M4Z A;  2LQN A;  2MCN A;  1TG0 A;  2FPF A;  1M3B A;  1W70 A;  3ULR B;  2OJ2 A;  1MV0 B;  5ECA A;  1IO6 A;  4J9G A;  2P4R A;  3VS1 A;  3C0C A;  4F16 A;  3THK A;  1KIK A;  1NG2 A;  2KRN A;  2HSP A;  2F2V A;  2B86 A;  2RMO A;  1HD3 A;  1AWX A;  1H8K A;  1PNJ A;  1UDL A;  2A36 A;  2JS0 A;  2ED0 A;  3SHW A;  3QWX X;  1UHF A;  2L3S A;  2LJ1 A;  1NLP C;  3UA6 A;  1K9A A;  1B07 A;  2ABL A;  1GRI A;  1ZX6 A;  4A63 B;  2DRK A;  1U06 A;  2FEI A;  4E6R A;  2RPN A;  2KNB B;  1KSW A;  1XOV A;  2QDL A;  2DX1 A;  3PE0 A;  2YDL A;  3I35 A;  2MIO A;  3R6N A;  3TVT A;  2O88 A;  2DVJ A;  1VYU A;  4JZ4 A;  3EG2 A;  4K11 A;  2KE9 A;  1GBQ A;  1WXT A;  2AZS A;  1Z9Z A;  2EGC A;  2SEM A;  1PRL C;  2K9G A;  2L3Q A;  1OPL A;  2OAW A;  2LCS A;  1HSQ A;  5FWC A;  1X6G A;  3REB B;  1GCQ A;  2DL7 A;  1UEC A;  1NEB A;  2EBP A;  2DMO A;  3O5Z A;  3VS2 A;  4Z89 A;  1M27 C;  3PVQ A;  3I5S A;  2LP5 A;  4RTV A;  2J6K A;  1WLP B;  1GBR A;  2JXB A;  2FPE A;  4J9C A;  1ZSG A;  2O9S A;  1UG1 A;  2ENM A;  2VKN A;  2V1R A;  1YNZ A;  1M3C A;  2JMA A;  3GBQ A;  1SHG A;  1RLP C;  4F14 A;  2GTO A;  1VA7 A;  2DJQ A;  1PRM C;  2EPD A;  2YUQ A;  2KT8 A;  1ABQ A;  1SEM A;  1UGV A;  1QKW A;  2GQI A;  2C0O A;  4AG1 C;  2DL5 A;  2HEQ A;  3UF4 A;  2DLP A;  1K76 A;  3M0Q A;  1AOJ A;  2C0I A;  2PTK A;  4LE9 A;  2CUB A;  1OOT A;  3VS3 A;  2BTT A;  1X43 A;  3IQL A;  5L23 A;  4JJD A;  4ORZ A;  3VRZ A;  1NYG A;  2JM9 A;  5IHI A;  2CDT A;  2EYX A;  2IIM A;  1Z9Q A;  4HVW A;  2FRY A;  1QLY A;  2K7A A;  4CC7 A;  2JT4 A;  1NYF A;  2ESW A;  2JM8 A;  1YWO A;  2ECZ A;  2DA9 A;  1X2K A;  2LJ0 A;  2M51 A;  1JQQ A;  4J9I A;  1T3L A;  1B3Q A;  4Z88 A;  3ZL7 C;  5IHK A;  1G2B A;  2DRM A;  3UAT A;  3JV3 A;  2D0N A;  1YWP A;  1I1J A;  1X6B A;  4ZNX A;  2EW3 A;  5FWB A;  1PWT A;  2MOX A;  1SPK A;  2EYZ A;  2A28 A;  1ZUY A;  2EGE A;  1ABO A;  1WA7 A;  1BB9 A;  2DBM A;  1UUE A;  1NLO C;  2J6F A;  1QKX A;  4FSS A;  3REA B;  2RQR A;  1KJW A;  2ED1 A;  2KEA A;  3EHQ A;  3KFV A;  3M0R A;  1FYN A;  3NMZ C;  3EGU A;  4OMP A;  1JU5 C;  2YUN A;  1AWJ A;  1WXB A;  1GL5 A;  1AEY A;  2HBW A;  2PNI A;  2BZY A;  2I0N A;  3FJ5 A;  1I07 A;  2AKK A;  3CQT A;  2D8J A;  4WCI A;  4J9E A;  4AFQ C;  2J06 A;  2HCK A;  1K0S A;  3VRY A;  4OMM A;  1I0C A;  1GCQ C;  4JJB A;  2EVR A;  2O31 A;  1CKA A;  1X2Q A;  2L3P A;  2D1X A;  2M0Y A;  1AWW A;  2E5K A;  1BK2 A;  2K2M A;  4GLM A;  2X3X D;  2CSI A;  2CSQ A;  1AVZ C;  1WYX A;  4D8K A;  1UFF A;  4J9D A;  1RUW A;  1OV3 A;  1CKB A;  1QWE A;  1UE9 A;  1YCS B;  4DEX A;  2CH4 A; 
#chains in the Genus database with same CATH topology
 2KR3 A;  2DZ9 A;  2YT6 A;  4FT4 A;  5CKE A;  2K79 A;  4RTT A;  1RAE B;  4LN2 A;  3JSC A;  2HKQ B;  4X9C A;  4NOY A;  1WI7 A;  2RO0 A;  1YI2 A;  2FO0 A;  1IHW A;  1D3B A;  1WHJ A;  4IIO A;  2QYZ A;  4GBQ A;  4RUG A;  2FL7 A;  1VQN T;  2CP5 A;  1K9M R;  2COY A;  3TSW A;  5EG2 A;  2LMJ A;  4LD9 K;  2LTO A;  1G3Y A;  5GAM e;  2AT1 B;  1TS9 A;  4C8Q C;  3LWH A;  2K6D A;  2CGH A;  4M7D D;  1BCM A;  3QJ6 A;  5LJ3 g;  2E41 A;  3OBY A;  3QZ9 B;  4A4F A;  2CP6 A;  1VQ4 Q;  3OB9 A;  5LJ5 f;  2QQS A;  1B34 B;  3L2Z A;  2K3X A;  2LNV A;  4M75 B;  1VQK Q;  4R0K A;  4AG2 C;  3MP1 A;  3CCM T;  3PNW C;  4C92 G;  1BI0 A;  1UJ0 A;  1JXM A;  3G6E T;  4HT8 A;  3I5R A;  1UB4 A;  1WDX A;  1EFN A;  1ZA1 B;  4FT2 A;  1WHL A;  3LW5 E;  2MK5 A;  2X4Y A;  3MKD A;  1JO8 A;  2F69 A;  2W0Z A;  4ZGJ B;  2F5K A;  3E1S A;  4D8D A;  3HRS A;  2HAX A;  4IUP A;  4EIK A;  3CCU A;  2RI5 A;  3N5B B;  2OTL T;  3CC2 A;  4J6W A;  3C12 A;  4BE0 A;  1WPY A;  5GAN 4;  2RQU A;  4BDY A;  2K5F A;  1K73 R;  1RAG B;  3SFM A;  3VS7 A;  1BI2 A;  2DF6 A;  1V1C A;  4BDZ A;  2O4X A;  3CMA T;  1N8R U;  2XK0 A;  3EAE A;  2GGR A;  3VS6 A;  2XDB A;  1R0B G;  1NJI C;  2H3J A;  1YJN A;  2JJ9 A;  2MYS A;  5IXF A;  4RG8 A;  3EFO A;  1LCK A;  3CC2 Q;  5FU7 B;  4PK4 A;  2CZ0 B;  3GP8 A;  2G6F X;  2R5M A;  1Q81 R;  5FW9 A;  3L2Q A;  2VAS A;  1KQ2 A;  3KUF A;  4PLL A;  2FPD A;  2Y4Y A;  3RBB B;  1XJW B;  1G8X A;  1N5Z A;  3TU4 K;  2QA4 T;  2GTJ A;  5GJV B;  2OTL Q;  3E2U A;  3OS2 A;  3PTA A;  4PKC C;  2DKG A;  3A8L B;  2GCX A;  2RHZ A;  1U5S A;  5GMK m;  5CVI A;  3HP9 A;  1K0X A;  1QCO A;  4M75 D;  1TTH B;  4HCZ A;  2NUP A;  3OQ5 A;  4HT9 A;  2BUD A;  1JBM A;  3H9N A;  2EYQ A;  1U3O A;  2A37 A;  4J9B A;  2PVD B;  2BZ8 A;  2GNC A;  2KRO A;  3HKS A;  3CPF A;  5GAN d;  4XU3 A;  4RCC A;  2QEX A;  3J80 E;  2F2X A;  4JS5 A;  3UA7 A;  3JCM d;  2LNH B;  2DIL A;  3QG1 A;  3RR6 A;  2QTX A;  3L1A A;  3SB2 A;  3OS5 A;  3JCM e;  2QXF A;  4M4Z A;  3NTI A;  1TG0 A;  1Y96 B;  2DYI A;  3ULR B;  4N4H A;  3JCM P;  3MJX A;  4J9G A;  3G4S A;  3M9Q A;  4HCC A;  2MAM A;  2WSC E;  1UGS B;  3M54 A;  5AYF A;  2F2V A;  1AWX A;  1FX7 A;  2JS0 A;  2ED0 A;  4MZT A;  1UHF A;  2L5Q A;  4C8Q D;  1NE8 A;  3UA6 A;  1WQ7 A;  1NPP A;  1ZX6 A;  5GAN h;  4AT1 B;  4JUV A;  2QGF B;  3SWN C;  1MGQ A;  1WQW A;  1KSW A;  2QDL A;  3PE0 A;  3RKW A;  3M4Y A;  4XTV A;  1W2B P;  2L8D A;  4FYW B;  2MIO A;  1RAF B;  1YIT Q;  3JB9 J;  1VQL T;  2RB6 A;  4JZ4 A;  1PSE A;  5LJ5 d;  1KC8 C;  1WXT A;  2EGC A;  2NLU A;  4MZP A;  3QDR B;  1U1T A;  1PRL C;  2VXF A;  3JAM E;  1HXD A;  2EQM A;  7AT1 B;  3BFM A;  1LVK A;  2BKD N;  1GCQ A;  5D7U A;  1VQ5 T;  1ZSZ A;  2EBP A;  2DMO A;  4PJO C;  1YCY A;  4HCB A;  3I5S A;  1VQ4 A;  1QVG A;  4ATO A;  1K8A R;  3EH1 A;  2K5L A;  5LJ3 e;  2JXB A;  1UGQ B;  1U8R A;  2M02 A;  1X75 C;  3ER0 A;  5LJ3 d;  4FW1 A;  2VKN A;  2V1R A;  5IT9 E;  1IRE B;  3X24 B;  5KYW B;  2GTO A;  4MML A;  1VA7 A;  4P5N A;  3HSB A;  3C4S A;  3DB3 A;  2DEU A;  1MND A;  1KG1 A;  1PRM C;  1D1C A;  4Y28 E;  5KCO A;  4WTO B;  4V2S A;  3PFS A;  1SEM A;  3JCM Q;  4AG1 C;  2YRV A;  1OOT A;  4IUQ A;  4PJO A;  1MHN A;  3HHT B;  2BTT A;  4BY6 C;  2FHD A;  1YHQ T;  1YIJ A;  4PJO D;  4JJD A;  4C8Q F;  4OGE A;  3QPH A;  5J39 A;  2HQH A;  3S3N A;  1K9M C;  3OYB A;  2IIM A;  2QI2 A;  3CXC A;  1W4S A;  4HVW A;  1Y96 A;  1QLY A;  2ESW A;  1I8F A;  1X2K A;  4C0F A;  4EMK A;  4F7U G;  1YJN T;  1YJ9 T;  1JJ2 P;  3CCL A;  2OTJ T;  1G2B A;  4MMK A;  4J6X A;  3JV3 A;  3MET A;  3L2U A;  1YWP A;  1TUG B;  2QK0 A;  2EW3 A;  2P0K A;  1PWT A;  1VQO A;  3HTR A;  4JRK A;  1NPR A;  3CME T;  3JCM b;  3JCM J;  4RG2 A;  3OYI A;  5IN1 A;  2EGE A;  2YLB A;  1ABO A;  1UUE A;  3F70 A;  1WJQ A;  1QKX A;  1NJI R;  1AT1 B;  3SWN B;  4M77 D;  1VQP T;  1KJW A;  2H3E B;  5GMK e;  3KFV A;  1KQ1 A;  2WSE E;  1AEY A;  2BZY A;  2I0N A;  2D6F A;  4XTU A;  1I07 A;  2AKK A;  4L6V 5;  2D8J A;  1MMD A;  4C92 A;  2CP2 A;  2OTJ A;  2QTV A;  3DLM A;  2J06 A;  2AIR B;  2NUP B;  5KYU B;  3GOX A;  3M5A A;  3TCJ A;  4OMM A;  1M1K R;  2WAC A;  3OW2 P;  3RDV A;  2DTI A;  1OYX A;  4M75 G;  1I0C A;  2DVE A;  2EVR A;  2L3P A;  2K5I A;  2E5Q A;  3KBG A;  1AWW A;  3RES A;  2E5K A;  2CZ7 B;  4BD3 A;  2EIF A;  1BK2 A;  3VYG A;  4M78 C;  2RI3 A;  4GLM A;  2CSI A;  5FU6 C;  3JB9 D;  4PJO F;  2OTJ Q;  1UFF A;  4J9D A;  9ATC B;  5LJ5 e;  1QWE A;  1UE9 A;  1KHC A;  2EJF A;  2CH4 A;  1KQS S;  1F1B B;  1M8V A;  3CC4 A;  4Y91 A;  4NL2 A;  1ZLM A;  1YJN Q;  1GXI E;  1FWZ A;  5GMK h;  4M7D C;  2DL8 A;  3EFR A;  5HCK A;  1M3A A;  4BUG A;  4QT7 A;  2CH4 W;  4OMO A;  3URG A;  3CCE A;  1K8A C;  1M5Q 1;  3LWI A;  1BKB A;  3M0P A;  2LZ6 B;  5CKF A;  4LD6 A;  2KDS A;  2LT1 A;  2E10 A;  2C06 A;  5A0G A;  1TUD A;  4Z8A A;  3LGF A;  1M2V A;  2YRC A;  2VYT A;  4OML A;  4OMF B;  1PD0 A;  5KYW A;  2DJZ A;  2DER A;  4HCK A;  1G3S A;  3EG0 A;  3SEM A;  1RI9 A;  2MWO A;  4BI8 B;  4ZGE B;  2XDD A;  5CO7 A;  3FEO A;  2YXY A;  5CCA A;  1VQ5 A;  4JPB W;  1OUL A;  2Y4X A;  2HZY A;  1Q7Y U;  2XI9 A;  2MI6 A;  3G1J A;  4ZN3 A;  4BI3 A;  2YHT A;  5I2M A;  4PL6 A;  1IGQ A;  2P84 A;  3EFS A;  3SD4 A;  1QP3 A;  1PC0 A;  2DEQ A;  5KE2 A;  3EGX B;  2E3H A;  3UWN A;  2NUZ A;  2O2O A;  1OZ2 A;  2W10 A;  2LCC A;  4KRT A;  1CSK A;  4RKU E;  3M0T A;  1KD1 C;  5FU6 B;  4JS4 A;  5HKC A;  4JLI A;  2DTH A;  4CC4 B;  1YHQ Q;  3CCQ A;  4ZTF A;  1YJW A;  2DXU A;  4UC4 A;  1UGP B;  1S72 T;  2KXC A;  2EJ9 A;  4J9F A;  5GAM d;  3CCE Q;  3VUZ A;  3L2R A;  3VJP A;  3CPW S;  4DBH A;  5GAO l;  1VQM Q;  1D0Y A;  3TRE A;  4MDW A;  2LQW A;  2FRW A;  1E7O A;  4M77 G;  1X27 A;  5GAN 8;  2VB6 A;  2VWF A;  1WHH A;  2DIQ A;  2GFA A;  4CC3 A;  5FU7 C;  2EQI A;  4NS5 A;  1QVF A;  1AZG B;  2AK5 A;  5EC7 A;  3VS5 A;  2SRC A;  3RER A;  2DM1 A;  1YIT A;  1YP5 A;  2VVK A;  4DBQ A;  5HK0 A;  2HKN A;  4M7A D;  4BAC A;  4IIM A;  1Q82 R;  2ROL A;  4Y92 A;  1ZSZ B;  1KFZ A;  1NM7 A;  2XKO C;  3BE3 A;  1M2O A;  3M4G A;  4KGV B;  1K4U S;  4HVV A;  4AFS C;  4CC2 A;  2P0P A;  3V7S A;  1RLQ C;  2ATC B;  4E2F B;  1KC8 R;  2KRS A;  2EYW A;  4LDU A;  1YIT T;  3CCJ Q;  4PJJ A;  1MV3 A;  1Y0M A;  2NWM A;  4DBR A;  1PG5 B;  3PVL A;  3QWY A;  2KRM A;  2QA4 A;  5LJ5 j;  1OEB A;  1H3Z A;  4JZ3 A;  2DNU A;  3NPF A;  1EIF A;  4PJO E;  1WFW A;  4IUT A;  4J6Y A;  2DET A;  2M16 A;  4PFO A;  1N9R A;  2B8A A;  2CT3 A;  2YWW A;  2JMC A;  3RKY A;  1MUZ A;  2X3W D;  1WXU A;  3VU3 C;  2KT1 A;  2J05 A;  1D1A A;  3L42 A;  1TSF A;  5LJ3 f;  4XTW A;  3CBO A;  3NTH A;  1S72 A;  1Q81 C;  1VQN Q;  5GAO p;  4LNP A;  1G83 A;  1SHF A;  3PT9 A;  2DXB A;  3NTK A;  4PJL A;  2QQB A;  4C0D B;  1M90 U;  3J81 E;  1KHI A;  2ROT A;  3CPW P;  1M9S A;  2KYM A;  4IUR A;  1N27 A;  1WNL A;  1V29 B;  2JUF A;  2DAQ A;  4KGX B;  1VQ7 A;  3G4S T;  3CXC P;  1Q86 R;  2DTO A;  4JJC A;  2XIC A;  3BDL A;  4QQD A;  3EG9 B;  2MCN A;  2FPF A;  1Q7Y R;  2MPX C;  2OJ2 A;  5ECA A;  3CCU T;  1IO6 A;  3LYI A;  1C6V X;  4EDU A;  1IGU A;  1KIK A;  4M7D F;  2KRN A;  1HYO A;  4M77 A;  2OTL A;  3OSS C;  2RMO A;  4BB7 A;  3SHW A;  2FVU A;  4TVR A;  5FLX E;  3X20 B;  2MWP A;  3D7S B;  1YJ9 A;  3RIR A;  1O9S A;  1K9A A;  4A63 B;  2JOY A;  1U06 A;  2COZ A;  2BE9 B;  2IG0 A;  4C8Q E;  3ZEH A;  2V8K A;  4XK8 E;  4J7I A;  2XU8 A;  3QO3 A;  2O88 A;  2DPP B;  2DVJ A;  3LH0 A;  3JCM V;  3CCM A;  8AT1 B;  3QSU A;  3HRT A;  3EG2 A;  2X4W A;  2EWN A;  1GBQ A;  2AZS A;  1Z9Z A;  5GAM h;  5GAN j;  2VUB A;  4M77 C;  2SEM A;  4C0D C;  2K9G A;  1I5O B;  1ZSZ C;  1OPL A;  3JCM c;  3GLX A;  2KI7 A;  2EFI A;  4QQG A;  2LVM A;  1NEB A;  3HL8 A;  3CCJ T;  4B9W A;  3O5Z A;  3VS2 A;  3PVQ A;  2F5T X;  2LP5 A;  2J6K A;  1GBR A;  3OYE A;  3G71 Q;  4BE1 A;  1UG1 A;  4JRP A;  2ENM A;  2P4T A;  1YNZ A;  1M3C A;  2RHI A;  1VQ4 T;  3DKM A;  4M78 E;  5GAN 5;  3CCS T;  2RJD A;  3A8G B;  2RJE A;  4N0A A;  5FRO A;  3CCQ T;  4F7U F;  2RHU A;  4OB2 B;  3EGD A;  4ELY C;  2GQI A;  3UF4 A;  2DLP A;  1K76 A;  3M0Q A;  4HA8 A;  4J83 A;  3JCM f;  4EMG A;  2PTK A;  3VS3 A;  5CAI A;  3IQL A;  4Q5W A;  4F7U B;  2JM9 A;  4VUB A;  2PVG B;  1D1B A;  3ZBD A;  4JDS A;  4A53 A;  1P92 A;  4XU0 A;  1Z9Q A;  4YTL A;  1YBY A;  4EMK C;  4CC7 A;  5CR2 A;  3CME A;  2D9T A;  2ECZ A;  1BCO A;  5GAM g;  3QUI A;  2LCL A;  3L2V A;  2LJ0 A;  1S72 Q;  4FSX A;  5IHK A;  1B3Q A;  2DRM A;  1IZ6 A;  2VV5 A;  5L8R E;  4DQ2 A;  1FXX A;  1XQH A;  2E65 A;  3JCM X;  1X6B A;  2RI2 A;  3CEY A;  6AT1 B;  3T9N A;  4E7Z A;  1LOJ A;  2A28 A;  1ZUY A;  2PU9 B;  3X25 B;  4F7U E;  1VQ9 T;  4M75 A;  1Y71 A;  1RAB B;  3EGD B;  1TWB A;  1NLO C;  4FSS A;  5GAN 2;  3REA B;  2RQR A;  2KEA A;  3CCJ A;  3EGU A;  1JU5 C;  1AWJ A;  4O6J A;  4JJN K;  1GL5 A;  2HBW A;  4II1 A;  2HBP A;  1TU0 B;  2A3L A;  4E47 A;  3FJ5 A;  3CCR T;  2QQ9 A;  4J7F A;  5I2S A;  3OBW A;  4WCI A;  4DOW A;  1M90 C;  1M4Z A;  2LQK A;  1WHK A;  2X51 A;  1K8A U;  4M78 A;  1VQ8 Q;  1G3T A;  3DLL A;  2K2M A;  3QBY A;  2HNI A;  2E3I A;  2X3X D;  1WZO A;  2CSQ A;  2JTM A;  1WYX A;  4D8K A;  3WVE B;  3OYF A;  3FIF A;  1YCS B;  4C5G A;  4JRI A;  1GFC A;  1ZUU A;  1MNE A;  1KD1 U;  4RTZ A;  1W1F A;  4M7D G;  4OGC A;  1TXQ A;  3CMA Q;  1ACM B;  3M53 A;  3ZFJ A;  3CXC S;  4B9X A;  1N9S A;  1BBZ A;  1AHJ B;  1R77 A;  3CD6 Q;  3V8J A;  4L59 A;  1YJW Q;  4M7A G;  1HK9 A;  3I56 A;  2HQX A;  4LUE A;  2VGM A;  2CZ1 B;  1VQP A;  3MCA B;  5A2Q E;  1M1K C;  1QCN A;  1JXO A;  2XD0 A;  2KGT A;  2R57 A;  4J9H A;  4DEY A;  3QII A;  2X4X A;  2XMF A;  2V8J A;  3M56 A;  3WVD B;  3JCM W;  2HDA A;  4C92 C;  2CRE A;  3I55 A;  3FLG A;  3M0S A;  1PM3 A;  1PKS A;  1V76 A;  3FB9 A;  3OSV A;  5HY6 A;  4ANJ A;  3CCL T;  1ZUK A;  4ESR A;  3VS4 A;  3NHN A;  1RAH B;  2O9V A;  1SRM A;  1K1Z A;  4J8O A;  3OYA A;  3OYD A;  4DOV A;  3PGG A;  1M30 A;  3JRZ A;  1S1N A;  1RAI B;  3SDZ A;  3VYH B;  4A54 A;  3OS0 A;  2DZC A;  1BIB A;  2RK1 A;  3CC7 A;  1YIJ T;  1YHQ A;  2QEX T;  1VYT A;  2ZAE A;  1LPL A;  3OYN A;  1ZBJ A;  4QVD A;  4OB3 B;  3GF5 A;  4XTY A;  2RF0 A;  3H0F A;  1QCF A;  2E1H A;  1KD1 R;  2EKH A;  3X26 B;  2DYB A;  3QYH B;  4FW2 A;  4HVU A;  2HL3 A;  4RTX A;  1LNX A;  4J5Y A;  2LX7 A;  3CCS Q;  2KAF A;  1MMA A;  4F17 A;  4R55 A;  2M0O A;  3CC7 Q;  1YI2 Q;  2HMA A;  5CKH A;  1IHV A;  2EYY A;  4A4G A;  3CCR A;  2L2P A;  2QAZ A;  1RAC B;  1Q81 U;  3GNF B;  3HRU A;  4OMQ A;  3H0I A;  4M78 B;  4IKF A;  4PJN A;  2JN0 A;  3H0H A;  3LH5 A;  4AFZ C;  2ZPF B;  4OB0 B;  3CC7 T;  4HXJ A;  2HD0 A;  2DIG A;  1VQ9 A;  1SG5 A;  2YRD A;  1QVP A;  2FZK B;  4EMH A;  1YI2 T;  3EG1 A;  1MMN A;  4FYX B;  1M8M A;  1FMK A;  4KUI A;  2RJC A;  4C92 E;  3E19 A;  4FIB A;  3H6Z A;  1M1K U;  1PD1 A;  1ZQ1 A;  2QA4 Q;  3SWN A;  1C1A A;  1WJS A;  2PQW A;  1U1S A;  3CMA A;  3QZ5 B;  1T3S A;  2AKL A;  2KY9 A;  1PKT A;  2I2L A;  1AZE A;  1H92 A;  4M75 F;  5IAY A;  2DD4 A;  4KUD K;  2YUP A;  1AD5 A;  1K73 C;  3CC2 T;  3A1P A;  1VQL Q;  2ZZD A;  1WHG A;  4LDW A;  5D6X A;  2KYB A;  4ME7 A;  2EGA A;  4PJO G;  2MF2 A;  3G6E Q;  3OS1 A;  4N0A C;  1VQO T;  2PVO B;  2X9H A;  2BZX A;  2O4X B;  1X69 A;  2V1Q A;  4ZN1 A;  2XID A;  1GCP A;  4LXC A;  5GMK i;  3MP6 A;  3MP8 A;  1OPK A;  3CPW A;  2D8H A;  1UEB A;  5CIU A;  2G3R A;  1UHC A;  5IHN A;  1WIE A;  2DBK A;  5IH2 A;  5I22 A;  3U23 A;  1NBE B;  5GAN 7;  2CP3 A;  2YSQ A;  4PJO B;  4OF1 A;  1RAA B;  2EQU A;  3CCS A;  2V8I A;  3JB9 G;  3M0U A;  4N4G A;  2JNG A;  2HSE B;  3G6E A;  2LQN A;  2E6N A;  1MV0 B;  3FJP A;  2AHJ B;  3VS1 A;  2D0Q B;  3C0C A;  4FL6 A;  1B7T A;  1QVF S;  3CD6 A;  2M1H A;  2HSP A;  3CCQ Q;  2B86 A;  1HD3 A;  2QEX Q;  2DK3 A;  4QKU A;  1PNJ A;  1UDL A;  2A36 A;  2LC4 A;  4O5V A;  2CP7 A;  3CD6 T;  3BY7 A;  3S6W A;  2E70 A;  3ME9 A;  1VIE A;  2K2V A;  4KBM B;  1VQM T;  4M7D B;  4C92 D;  2ABL A;  1GRI A;  2DRK A;  2NUT A;  1QW1 A;  1K73 U;  4X9D A;  2A7Y A;  4M78 F;  1VQN A;  2EJG A;  1YFN A;  4M7A C;  2M9U A;  4XU1 A;  4LDY A;  1VQO Q;  3E9F A;  3I35 A;  3TVT A;  3INZ A;  1VYU A;  1IRX A;  2OX7 A;  4C5E A;  1W2B S;  2DD5 A;  2KK4 A;  5GAN 3;  3UPU A;  5KH6 A;  2WSF E;  3FRN A;  1Q7Y C;  2L3Q A;  4A4E A;  1HSQ A;  5FWC A;  1D0X A;  4GLK A;  1VUB A;  1X6G A;  3RMQ A;  2DL7 A;  2KMT A;  2XG8 D;  4ZGD B;  3CCR Q;  3M58 A;  1M27 C;  5J26 A;  4RTV A;  4ZTJ A;  3LGL A;  2LRQ A;  1VQ5 Q;  2FPE A;  4WF2 A;  1ZSG A;  1OZ3 A;  5GMK j;  2ZPG B;  3I56 Q;  2JMA A;  3GBQ A;  3G71 A;  1SHG A;  1RLP C;  4F14 A;  3LX7 A;  2GF7 A;  5GAM f;  2DJQ A;  5GMK l;  2RJF A;  5LJ5 h;  1IXD A;  1N8R C;  2YUQ A;  2QQR A;  3VKI A;  1VOM A;  1UGV A;  4M75 E;  4OP0 A;  2C0O A;  2Z0W A;  2HEQ A;  3CC4 Q;  2QDY B;  4QQ6 A;  3M55 A;  1AOJ A;  5KYX A;  1FMW A;  4LE9 A;  3OYJ A;  5L23 A;  1X43 A;  3JCM g;  2R5A A;  1TOV A;  3L2W A;  1WHM A;  3RUX A;  2CDT A;  3I56 T;  2EYX A;  5A0L A;  3V8K A;  3OYM A;  2FRY A;  2K7A A;  2O01 E;  2JT4 A;  1NYF A;  3GNG A;  4BI4 A;  2JM8 A;  1YWO A;  2RHY A;  4DA4 A;  5CQX A;  3OW2 A;  1TH7 A;  4F04 B;  3ZL7 C;  4BY6 B;  3I55 Q;  3UAT A;  2DXT A;  2D0N A;  3P8D A;  3QJY A;  1I1J A;  2QAS A;  4E7H A;  3A8H B;  1OU9 A;  3FDR A;  1R8O B;  5CQY A;  2JTF A;  3CCV A;  4D6W A;  2EYZ A;  5DLQ E;  2K57 A;  5GAN g;  3OYG A;  1OX8 A;  1BI1 A;  1K9M U;  3MPU B;  2GQV A;  2ED1 A;  2XHC A;  2ZPE B;  1JB0 E;  1FYN A;  3NMZ C;  1PSF A;  3OY9 A;  3OYH A;  4OMP A;  3JB9 H;  5LJ5 g;  2QG9 B;  2EKO A;  3CQT A;  3AT1 B;  3OW2 S;  4AFQ C;  3JB9 I;  2HCK A;  3CCL Q;  1JJ2 A;  1BIA A;  4AMC A;  1Q86 U;  1Y07 A;  4FU6 A;  3VV0 A;  4JJB A;  2O31 A;  2CKK A;  4R56 A;  3CME Q;  1SF9 A;  2D1X A;  2M0Y A;  2IVW A;  1QVG P;  1MMG A;  1I4K 1;  5LL6 S;  3Q1J A;  4XTZ A;  3BW1 A;  1SKU B;  2VXE A;  3PIO A;  4A4H A;  4DEX A;  3NGP A;  2K3B A;  1PCX A;  4C5H A;  5I11 A;  2DL4 A;  8ATC B;  3I55 T;  1Q86 C;  2RQT A;  4GY5 A;  3GIB A;  1YJ9 Q;  3S3M A;  4IUU A;  1YJW T;  2KBT A;  3UDC A;  4FCY A;  2KSS A;  1T0H A;  1E6H A;  3WXM B;  1ARK A;  4RTU A;  2FYK A;  1HJD A;  1PHT A;  3G71 T;  2LX9 A;  5KE3 A;  4C8Q B;  2OAU A;  4LDV A;  2GBQ A;  5GAO m;  4LUD A;  4C92 B;  3PMI A;  1SRL A;  2EQK A;  4M7A F;  4KUL A;  1NEG A;  3QKJ A;  2DE0 X;  3TEE A;  1Y57 A;  4M7D E;  4E7L A;  2X35 A;  3CCV Q;  4E7I A;  2XDP A;  1X6O A;  1VQ8 T;  3EHR A;  1X01 A;  2NUT B;  1N8R R;  2OI3 A;  4M7A E;  3RNJ A;  1WX6 A;  3VS0 A;  2ZPI B;  1XTD A;  1VQK A;  5KYN A;  4RTW A;  1JEG A;  4DBF A;  2L0A A;  4F7U A;  5KYY B;  1M1F A;  1YN8 A;  1JRI A;  2ZPB B;  1TUC A;  2X4J A;  3PMT A;  1E6G A;  5GAO n;  1UJY A;  3UT1 A;  1OQK A;  1W6X A;  2RN8 A;  2FG0 A;  1D3B B;  2CS7 A;  1VQM A;  2A08 A;  1H3H A;  3OYL A;  3HFN A;  1G3W A;  2DFU A;  1GFD A;  2F2W A;  1OX9 A;  1VYV A;  2E6Z A;  3QYG B;  1I5L A;  3V8L A;  3JCM h;  2CP0 A;  2PZ1 A;  1T0J A;  3G4S Q;  2FZC B;  2CT4 A;  2DXC A;  3CC4 T;  3EG3 A;  4M7D A;  2L3R A;  5IXB A;  1BI3 A;  1QMC A;  3QHS A;  2KQW A;  2LT4 A;  2CUD A;  2CZ6 B;  1UTI A;  3EG9 A;  1QP2 A;  2C0T A;  5KCH A;  4KGZ B;  2KXD A;  3A8M B;  4OVA A;  3TQ7 P;  4C0G A;  2RQW A;  1Q82 U;  1SSH A;  2BIV A;  1BU1 A;  3C94 A;  2JW4 A;  2J7I A;  1FMV A;  5GJW B;  2J6O A;  2PUO B;  2E4H A;  3TSZ A;  1O75 A;  4E7K A;  3P8B B;  4XAX B;  1IB8 A;  3MEW A;  1VQ6 T;  3MEA A;  4L5G A;  3C95 A;  2RA2 A;  4OMN A;  4M77 F;  4PLI A;  3GPL A;  5GAN e;  2HQE A;  1D09 B;  1VIF A;  2DL3 A;  1SSF A;  2QGG A;  2K4Y A;  2JS2 A;  2LJ3 A;  2RNA A;  2EAY A;  1N6A A;  4M77 B;  1ZA2 B;  1RL2 A;  3I9Q A;  3X28 B;  5I21 A;  3CBP A;  5KYU A;  1RI0 A;  4MDX A;  2VC8 A;  3QDF A;  4PFP A;  1WGS A;  4QW2 A;  4OB1 B;  1AWO A;  4C8Q A;  3NFC A;  2LDM A;  2R58 A;  3VUB A;  2H8H A;  4C8Q G;  2RK2 A;  4Z02 A;  2RQV A;  2PUK B;  1J3T A;  2ZPH B;  5CKB A;  3QXE B;  2AZV A;  3OYY A;  2LQ8 A;  4RMO A;  1M90 R;  4X1V A;  2COW A;  3HPW A;  2F1L A;  2YUO A;  5LJ3 j;  1A0N B;  2FZG B;  4PNO A;  4M77 E;  1QVG S;  2EQJ A;  4QVZ A;  1QWF A;  2GFU A;  5DM7 R;  1NJI U;  1VQ7 Q;  4AFU C;  4XTX A;  4QVC A;  3H41 A;  3A98 A;  4M75 C;  4EMK B;  2JTE A;  3FC3 A;  4RTY A;  4CRI A;  3DB4 A;  1EX4 A;  3OMG A;  4JLG A;  5KYY A;  3R6O A;  3S3O A;  1B34 A;  2VGN A;  5GAN f;  3E9G A;  1ZBX A;  1WJR A;  4KT0 E;  3PIP A;  2ZCF B;  1R0C B;  4M78 G;  1UGR B;  2A0F B;  3MO8 A;  1M3B A;  1W70 A;  5A0D A;  3CCU Q;  3CCV T;  2P4R A;  1KC8 U;  4F16 A;  3THK A;  3MEV A;  1QQJ A;  4N4I A;  4X34 A;  1NG2 A;  1Q95 G;  2QQA A;  4IUV A;  3OA6 A;  1H8K A;  4C92 F;  4KH1 B;  1QVF P;  2JVV A;  3QWX X;  3RMS A;  1RAD B;  2L3S A;  3V7C A;  3A5Z B;  2LJ1 A;  4HKE A;  2BE7 D;  1I81 A;  5D6W A;  1NLP C;  3MHX A;  1VQ8 A;  4M7A A;  1B07 A;  3CBM A;  2FEI A;  4E6R A;  2RPN A;  2KNB B;  4LDX A;  1XOV A;  2DX1 A;  4FYY B;  1VQ7 T;  2YDL A;  4A4K A;  4XQ3 A;  3R6N A;  3OYK A;  4E7J A;  2FB7 A;  3V7R A;  4K11 A;  5GAO r;  1D0Z A;  2KE9 A;  2CYZ B;  4XU2 A;  1YIJ Q;  4B6M A;  1VQ6 A;  3M59 A;  2OAW A;  2LCS A;  2NYS A;  1OI1 A;  3REB B;  1KK7 A;  1UEC A;  5M9O A;  5GAO q;  1Y7X A;  4Z89 A;  5LJ3 h;  2KVQ G;  3CCM Q;  1WLP B;  5GAN 6;  4J9C A;  4MZM A;  2O9S A;  3A8O B;  3ASK A;  1M2V B;  1EZZ B;  3J7A F;  3HFO A;  4KH0 B;  4EPC A;  3EGX A;  1M1G A;  4ELZ C;  5HK3 A;  1VQ6 Q;  2EPD A;  2KT8 A;  1ABQ A;  4NL3 A;  1QKW A;  4PJM A;  4C5I A;  5DY9 A;  2DL5 A;  1C0M A;  5CK9 A;  3EH2 A;  1KQS A;  2C0I A;  2RD1 A;  2CUB A;  4CI0 C;  4M7A B;  4ORZ A;  3VRZ A;  1NYG A;  5IHI A;  3MEU A;  4JRQ A;  3P8H A;  4E7S A;  4C0Z A;  5CKD A;  1JJ2 S;  2DA9 A;  2RM4 A;  1Q82 C;  3CCE T;  2M51 A;  1DJ7 B;  1JQQ A;  3RKX A;  4J9I A;  1T3L A;  4Z88 A;  3BDU A;  1OU8 A;  4M78 D;  1VQK T;  3O8V A;  2HL5 C;  2MMP A;  2DO3 A;  4ZNX A;  1VQP Q;  5FWB A;  2MOX A;  1BYM A;  1SPK A;  3AHU A;  2ZGW A;  1WA7 A;  1BB9 A;  2DBM A;  3LLR A;  3KXT A;  1VQL A;  1H64 1;  2J6F A;  1NZ9 A;  4BE2 A;  5KYX B;  3EHQ A;  3H8Z A;  3M0R A;  1W2B A;  1XNI A;  2YUN A;  5D6Y A;  1WXB A;  3OYC A;  2PNI A;  3M57 A;  3OMC A;  3G7Z A;  2YLC A;  4J9E A;  2K3Y A;  4FYV B;  1KQS P;  5J3B A;  1K0S A;  2E12 A;  3VRY A;  1G5V A;  1GCQ C;  2IPO B;  1CKA A;  1X2Q A;  4PFZ A;  3EFO B;  1LJO A;  3JB9 F;  5DLO A;  1VQ9 Q;  2E64 A;  5C0M A;  5GAM j;  2RH2 A;  5FRN A;  2L89 A;  2JZ2 A;  2V26 A;  1AVZ C;  2Y90 A;  4FM4 B;  1RUW A;  1OV3 A;  5FRM A;  5AT1 B;  2RHX A;  1CKB A;  1ZHI A;  5C6S A;  4RCB A;  2P0Q A; 
#chains in the Genus database with same CATH homology
 3NGP A;  2K3B A;  2KR3 A;  5I11 A;  2DL4 A;  1GFC A;  2YT6 A;  1ZUU A;  2RQT A;  2K79 A;  1ZLM A;  4RTT A;  4LN2 A;  4RTZ A;  1W1F A;  2KBT A;  2DL8 A;  1T0H A;  1E6H A;  5HCK A;  1M3A A;  1ARK A;  4QT7 A;  2CH4 W;  4OMO A;  4RTU A;  1HJD A;  1PHT A;  1BBZ A;  3M0P A;  2LZ6 B;  1WI7 A;  2GBQ A;  2FO0 A;  4LUD A;  4IIO A;  1TUD A;  4GBQ A;  4Z8A A;  1SRL A;  4RUG A;  4OML A;  4LUE A;  1NEG A;  2DE0 X;  1Y57 A;  4HCK A;  3EG0 A;  3TSW A;  1JXO A;  2KGT A;  2LMJ A;  3EHR A;  4J9H A;  1RI9 A;  3SEM A;  4DEY A;  2OI3 A;  2XMF A;  3RNJ A;  2K6D A;  1WX6 A;  2HDA A;  2CRE A;  3VS0 A;  3M0S A;  1PKS A;  4JPB W;  4RTW A;  1JEG A;  2L0A A;  1YN8 A;  1ZUK A;  4ESR A;  3VS4 A;  3NHN A;  2O9V A;  1TUC A;  1SRM A;  1K1Z A;  4R0K A;  4AG2 C;  1M30 A;  1E6G A;  1UJY A;  1S1N A;  2NUZ A;  2O2O A;  1W6X A;  2RN8 A;  1UJ0 A;  1JXM A;  2FG0 A;  2W10 A;  3I5R A;  4KRT A;  2A08 A;  1VYT A;  1WDX A;  1CSK A;  1EFN A;  3M0T A;  1ZBJ A;  1H3H A;  1JO8 A;  2W0Z A;  1GFD A;  2F2W A;  2RF0 A;  1VYV A;  3H0F A;  4CC4 B;  1QCF A;  4D8D A;  2PZ1 A;  1T0J A;  2EKH A;  4EIK A;  2KXC A;  2DYB A;  2CT4 A;  4J9F A;  3EG3 A;  4HVU A;  4RTX A;  5IXB A;  2RQU A;  2LQW A;  2FRW A;  1E7O A;  1X27 A;  2CUD A;  1UTI A;  2C0T A;  2VWF A;  3VS7 A;  2KXD A;  2LX7 A;  2DF6 A;  1V1C A;  4F17 A;  2RQW A;  4CC3 A;  2EQI A;  1SSH A;  1BU1 A;  1AZG B;  2EYY A;  2AK5 A;  5EC7 A;  3VS5 A;  2GGR A;  2JW4 A;  2J7I A;  3VS6 A;  2SRC A;  5GJW B;  2L2P A;  2J6O A;  2DM1 A;  3TSZ A;  1YP5 A;  5IXF A;  2VVK A;  4OMQ A;  3H0I A;  1LCK A;  4IIM A;  2ROL A;  4OMN A;  3H0H A;  4Y92 A;  1KFZ A;  3LH5 A;  4AFZ C;  1NM7 A;  4HXJ A;  2G6F X;  2DL3 A;  1K4U S;  2LJ3 A;  2JS2 A;  4HVV A;  4AFS C;  2RNA A;  4CC2 A;  5FW9 A;  3EG1 A;  1RLQ C;  1M8M A;  1FMK A;  2KRS A;  2EYW A;  2FPD A;  3I9Q A;  3RBB B;  1N5Z A;  1MV3 A;  1Y0M A;  2NWM A;  3PVL A;  3QWY A;  2KRM A;  2GTJ A;  5GJV B;  1OEB A;  1AWO A;  4JZ3 A;  2DNU A;  3NPF A;  1U5S A;  1WFW A;  2H8H A;  1T3S A;  2AKL A;  1PKT A;  2RQV A;  1K0X A;  1AZE A;  1J3T A;  1H92 A;  2CT3 A;  2AZV A;  2JMC A;  1MUZ A;  2X3W D;  1AD5 A;  2YUP A;  1WXU A;  2KT1 A;  4X1V A;  2J05 A;  2KYB A;  2YUO A;  1A0N B;  2EGA A;  1U3O A;  1QWF A;  2A37 A;  4LNP A;  4J9B A;  4AFU C;  1G83 A;  1SHF A;  2BZX A;  2BZ8 A;  1X69 A;  2GNC A;  3H41 A;  2KRO A;  2V1Q A;  3A98 A;  1GCP A;  2JTE A;  1OPK A;  4RTY A;  2D8H A;  1UHC A;  5IHN A;  2F2X A;  1WIE A;  2DBK A;  5IH2 A;  5I22 A;  2ROT A;  3U23 A;  3UA7 A;  2KYM A;  2YSQ A;  2LNH B;  2DIL A;  3M0U A;  4JJC A;  4M4Z A;  2LQN A;  2MCN A;  1TG0 A;  2FPF A;  1M3B A;  1W70 A;  3ULR B;  2OJ2 A;  1MV0 B;  5ECA A;  1IO6 A;  4J9G A;  2P4R A;  3VS1 A;  3C0C A;  4F16 A;  3THK A;  1KIK A;  1NG2 A;  2KRN A;  2HSP A;  2F2V A;  2B86 A;  2RMO A;  1HD3 A;  1AWX A;  1H8K A;  1PNJ A;  1UDL A;  2A36 A;  2JS0 A;  2ED0 A;  3SHW A;  3QWX X;  1UHF A;  2L3S A;  2LJ1 A;  1NLP C;  3UA6 A;  1K9A A;  1B07 A;  2ABL A;  1GRI A;  1ZX6 A;  4A63 B;  2DRK A;  1U06 A;  2FEI A;  4E6R A;  2RPN A;  2KNB B;  1KSW A;  1XOV A;  2QDL A;  2DX1 A;  3PE0 A;  2YDL A;  3I35 A;  2MIO A;  3R6N A;  3TVT A;  2O88 A;  2DVJ A;  1VYU A;  4JZ4 A;  3EG2 A;  4K11 A;  2KE9 A;  1GBQ A;  1WXT A;  2AZS A;  1Z9Z A;  2EGC A;  2SEM A;  1PRL C;  2K9G A;  2L3Q A;  1OPL A;  2OAW A;  2LCS A;  1HSQ A;  5FWC A;  1X6G A;  3REB B;  1GCQ A;  2DL7 A;  1UEC A;  1NEB A;  2EBP A;  2DMO A;  3O5Z A;  3VS2 A;  4Z89 A;  1M27 C;  3PVQ A;  3I5S A;  2LP5 A;  4RTV A;  2J6K A;  1WLP B;  1GBR A;  2JXB A;  2FPE A;  4J9C A;  1ZSG A;  2O9S A;  1UG1 A;  2ENM A;  2VKN A;  2V1R A;  1YNZ A;  1M3C A;  2JMA A;  3GBQ A;  1SHG A;  1RLP C;  4F14 A;  2GTO A;  1VA7 A;  2DJQ A;  1PRM C;  2EPD A;  2YUQ A;  2KT8 A;  1ABQ A;  1SEM A;  1UGV A;  1QKW A;  2GQI A;  2C0O A;  4AG1 C;  2DL5 A;  2HEQ A;  3UF4 A;  2DLP A;  1K76 A;  3M0Q A;  1AOJ A;  2C0I A;  2PTK A;  4LE9 A;  2CUB A;  1OOT A;  3VS3 A;  2BTT A;  1X43 A;  3IQL A;  5L23 A;  4JJD A;  4ORZ A;  3VRZ A;  1NYG A;  2JM9 A;  5IHI A;  2CDT A;  2EYX A;  2IIM A;  1Z9Q A;  4HVW A;  2FRY A;  1QLY A;  2K7A A;  4CC7 A;  2JT4 A;  1NYF A;  2ESW A;  2JM8 A;  1YWO A;  2ECZ A;  2DA9 A;  1X2K A;  2LJ0 A;  2M51 A;  1JQQ A;  4J9I A;  1T3L A;  1B3Q A;  4Z88 A;  3ZL7 C;  5IHK A;  1G2B A;  2DRM A;  3UAT A;  3JV3 A;  2D0N A;  1YWP A;  1I1J A;  1X6B A;  4ZNX A;  2EW3 A;  5FWB A;  1PWT A;  2MOX A;  1SPK A;  2EYZ A;  2A28 A;  1ZUY A;  2EGE A;  1ABO A;  1WA7 A;  1BB9 A;  2DBM A;  1UUE A;  1NLO C;  2J6F A;  1QKX A;  4FSS A;  3REA B;  2RQR A;  1KJW A;  2ED1 A;  2KEA A;  3EHQ A;  3KFV A;  3M0R A;  1FYN A;  3NMZ C;  3EGU A;  4OMP A;  1JU5 C;  2YUN A;  1AWJ A;  1WXB A;  1GL5 A;  1AEY A;  2HBW A;  2PNI A;  2BZY A;  2I0N A;  3FJ5 A;  1I07 A;  2AKK A;  3CQT A;  2D8J A;  4WCI A;  4J9E A;  4AFQ C;  2J06 A;  2HCK A;  1K0S A;  3VRY A;  4OMM A;  1I0C A;  1GCQ C;  4JJB A;  2EVR A;  2O31 A;  1CKA A;  1X2Q A;  2L3P A;  2D1X A;  2M0Y A;  1AWW A;  2E5K A;  1BK2 A;  2K2M A;  4GLM A;  2X3X D;  2CSI A;  2CSQ A;  1AVZ C;  1WYX A;  4D8K A;  1UFF A;  4J9D A;  1RUW A;  1OV3 A;  1CKB A;  1QWE A;  1UE9 A;  1YCS B;  4DEX A;  2CH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...