1W6XA

Sh3 domain of p40phox, component of the nadph oxidase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
MRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEUTROPHIL CYTOSOL FACTOR 4
publication title Effects of P47Phox C-Terminus Phosphorylation on Binding Interactions with P40Phox and P67Phox: Structural and Functional Comparison of P40Phox P67Phox SH3 Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
total genus 11
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w6xA00
3VRZA 1OPKA 1YP5A 2D0NA 2YUPA 2RPNA 2VVKA 1JXOA 1I1JA 5I22A 2JM8A 3PE0A 1UJ0A 4JJDA 2EYZA 4HVWA 2V1QA 5GJWB 1MUZA 2KXDA 2A36A 1GCQC 5EC7A 4JJCA 1X2KA 2KT1A 1AWXA 2M51A 1AZGB 2YSQA 3ULRB 1SPKA 3EG1A 4IIMA 1UG1A 1KIKA 2L3SA 2J6KA 3H0HA 4FSSA 1JO8A 2A28A 2M0YA 1QCFA 2K79A 3REBB 5IXBA 2PNIA 4RTYA 2PTKA 1WIEA 4ESRA 1M3AA 4DEYA 2KNBB 3REAB 1LCKA 2CUDA 2GNCA 3CQTA 2CSQA 3KFVA 2J06A 4E6RA 1UECA 2J05A 2FG0A 1W1FA 4OMOA 3VS6A 4A63B 1KJWA 1JEGA 1ZLMA 1YCSB 1AD5A 1SRLA 1U5SA 3JV3A 2DYBA 3UF4A 1BB9A 4J9EA 3VS3A 4D8DA 4LNPA 2OAWA 4GBQA 2D8HA 1X6GA 4Z88A 3I9QA 2AKLA 2K3BA 2DX1A 1U3OA 1UJYA 1UUEA 3C0CA 1ARKA 2C0TA 2AK5A 4J9GA 4AFZC 2NUZA 1UDLA 1M8MA 2DRKA 1W70A 4D8KA 4DEXA 2LQNA 2KRMA 2K2MA 4Z8AA 4M4ZA 2RMOA 1T3SA 4KRTA 2RNAA 4JZ4A 3M0UA 2GGRA 1XOVA 1T0HA 2D1XA 4LUDA 2F2VA 5IHNA 1M3CA 2EBPA 3H41A 1W6XA 2CREA 1SEMA 4ORZA 3U23A 4RTVA 1NLPC 1NYGA 2DM1A 1X27A 3VS1A 4CC4B 3M0SA 2EYXA 1T0JA 4JPBW 2O88A 2OI3A 3NPFA 4AG1C 3VS5A 4LE9A 2CSIA 1WI7A 2JM9A 3RNJA 2CDTA 4OMNA 2RF0A 1HSQA 3M0TA 2JMCA 1Y0MA 2DBMA 2J6FA 2D8JA 1GFDA 1SSHA 1AOJA 2DILA 2DVJA 1CKAA 3TSZA 2LMJA 3RBBB 1TG0A 4ZNXA 1KSWA 1J3TA 1JXMA 1Z9QA 3A98A 1FMKA 2DBKA 2L3PA 5IHIA 1JU5C 2DL3A 2C0IA 1WXTA 1PWTA 2JS0A 3R6NA 1GRIA 4J9BA 1T3LA 4EIKA 2AZSA 2EW3A 3LH5A 1ABQA 1NEGA 2LJ3A 2QDLA 2O31A 2X3WD 5L23A 1WYXA 2KXCA 4OMLA 2FRWA 1X6BA 2DF6A 5IXFA 1RLQC 2G6FX 4JJBA 2DL4A 4IIOA 3SEMA 4CC7A 2JT4A 2MOXA 2YDLA 1OEBA 1IO6A 2A37A 3TVTA 1N5ZA 1WFWA 2DA9A 3IQLA 2DNUA 1HD3A 1GCQA 2EGCA 2H8HA 4AFUC 2KYMA 4HCKA 2K9GA 2KE9A 1OV3A 1RLPC 1TUDA 2EYWA 2EKHA 1CKBA 2JMAA 1Y57A 1G2BA 4R0KA 4F17A 1H8KA 1YNZA 1GBQA 1UFFA 3M0PA 1YWOA 1SHGA 2CH4W 3M0RA 1M3BA 1H3HA 2KT8A 3NGPA 4CC2A 1QWFA 1NEBA 1WX6A 5HCKA 1V1CA 1H92A 2YUQA 1PRLC 2KRSA 2NWMA 4X1VA 4Y92A 1M30A 1VA7A 3M0QA 2AKKA 1S1NA 2DJQA 1E6HA 4RTWA 2FEIA 2CH4A 1GFCA 1BBZA 2EYYA 4LN2A 1K76A 2LCSA 1WA7A 2I0NA 2ED0A 4J9DA 1VYVA 1AWWA 1A0NB 1PHTA 4RTZA 4J9HA 2L0AA 1ABOA 3VRYA 4AFSC 2HSPA 1WXUA 3H0IA 2OJ2A 2DL5A 2XMFA 2EPDA 3VS4A 4J9FA 5IH2A 2ROTA 2F2WA 2ESWA 4HVVA 3UATA 4QT7A 1CSKA 2CT4A 1K9AA 4GLMA 2EQIA 2RQVA 3QWYA 1TUCA 5FWCA 3UA6A 2FRYA 1E7OA 1UE9A 2AZVA 1VYUA 2KBTA 1AEYA 2ROLA 2KYBA 3VS0A 2EGEA 4AG2C 2DRMA 2HCKA 2L2PA 1YN8A 2C0OA 2LZ6B 2VKNA 2O9VA 1B07A 1OPLA 2W0ZA 1I0CA 3I5SA 3TSWA 3EHRA 4J9CA 3ZL7C 2DLPA 1ZUUA 1Z9ZA 1ZUYA 2VWFA 3I5RA 2FPDA 1I07A 1HJDA 1PRMC 1X2QA 2JXBA 2J6OA 4OMPA 1X69A 1RUWA 4JZ3A 3EHQA 2X3XD 2SEMA 4CC3A 5ECAA 4HXJA 4J9IA 2GTOA 5FWBA 1GCPA 4WCIA 3UA7A 2K7AA 3VS7A 1K4US 5GJVB 2V1RA 1MV0B 2FPEA 2O9SA 3EG3A 3GBQA 2EVRA 3SHWA 5I11A 3EGUA 1M27C 2GBQA 2KGTA 1NYFA 2ABLA 2KR3A 4F16A 2MIOA 1B3QA 3EG0A 2O2OA 1WDXA 1BK2A 2DL7A 1MV3A 1UTIA 2P4RA 1G83A 3EG2A 2LJ1A 3O5ZA 2MCNA 2DE0X 1UHFA 4F14A 1QKXA 1K0SA 1PKSA 1VYTA 4HVUA 4OMQA 3VS2A 1K0XA 1BU1A 1K1ZA 3NHNA 2JS2A 3PVQA 4Z89A 4RUGA 2LP5A 2J7IA 1EFNA 1RI9A 2BZ8A 4RTXA 4OMMA 2A08A 1UHCA 2W10A 3NMZC 2RQUA 2LX7A 1OOTA 2EGAA 1GBRA 4K11A 1AVZC 1NM7A 2GTJA 2IIMA 1KFZA 1ZX6A 1U06A 1ZBJA 1NLOC 3I35A 2LJ0A 2YUNA 2BZXA 2L3QA 2CT3A 1QLYA 4RTTA 2RQRA 2HDAA 2ENMA 1AWOA 2BZYA 2RN8A 1ZUKA 2FPFA 4AFQC 1FYNA 2JTEA 2YT6A 2PZ1A 1QKWA 1UGVA 2LQWA 1AZEA 1GL5A 4LUEA 1AWJA 1WXBA 2DMOA 2SRCA 5FW9A 2BTTA 2CUBA 1E6GA 1SRMA 2DL8A 2ED1A 2ECZA 1YWPA 1WLPB 2K6DA 1JQQA 1NG2A 2KROA 2YUOA 2RQTA 2KEAA 3QWXX 2HBWA 2KRNA 3THKA 4RTUA 2HEQA 1QWEA 1SHFA 2RQWA 1PKTA 2B86A 1PNJA 2JW4A 3FJ5A 2F2XA 1ZSGA 2GQIA 3PVLA 1X43A 2FO0A 3H0FA 2E5KA 2LNHB 5IHKA
chains in the Genus database with same CATH superfamily
3VRZA 2PVOB 3OSVA 3GP8A 1VQ8T 1IGQA 1JXOA 2EQMA 4EPCA 5I22A 5GMKh 3OYYA 4JRKA 1UJ0A 4JJDA 1Q81R 2EYZA 2V1QA 1LNXA 5EC7A 1X2KA 4JS4A 2KT1A 5GAN7 4FIBA 2YSQA 3H6ZA 5FU6C 4N4IA 3MP8A 1TH7A 4MDXA 2LDMA 2FYKA 3P8DA 3CCET 3CCUQ 1YJ9T 3OYJA 2AIRB 2LQKA 1WIEA 5GAOp 4DEYA 1D0XA 2IVWA 4DBFA 4J8OA 1VQ5A 1VQKA 5GMKm 2YWWA 4E7IA 2RHXA 3VS6A 4A63B 1JEGA 2VGMA 4C92B 1AD5A 2HKNA 1U5SA 3CCMQ 1BB9A 2CP6A 2VC8A 3QKJA 2KK4A 4PJOD 2HD0A 3A8OB 1KQSA 3I9QA 2AKLA 3VUZA 3DLMA 2K3BA 1NJIC 5DM7R 3C0CA 4M78D 2M0OA 4AFZC 1IRXA 1UDLA 1M8MA 3LGLA 3QDRB 4DEXA 2K5FA 2LRQA 2E10A 2K2MA 2DIGA 3OS1A 1X75C 2A0FB 4LDUA 2RJFA 4A4EA 4KRTA 1BKBA 2V8IA 4KGXB 1M90C 4LUDA 2D1XA 3P8HA 2WACA 1SEMA 4RTVA 2DM1A 3UWNA 1X27A 1BI3A 1M9SA 3M0SA 1M1KR 3UDCA 1T0JA 4JPBW 1VOMA 4M75G 2O88A 4KULA 2XIDA 3CCJA 3DKMA 4OB1B 5HY6A 4Y91A 3A8LB 4LE9A 3EFOA 1PCXA 4M7AA 4ATOA 3NTHA 1UGQB 1HSQA 2B8AA 2DBMA 2RJEA 2EQUA 2MYSA 1CKAA 4EDUA 3BY7A 4ZNXA 1VQNQ 4XU2A 3CD6A 1FMKA 4YTLA 1YITQ 4HCCA 3OSSC 4M7AF 2L3PA 2LT4A 1JU5C 2DL3A 2OTJT 1PWTA 1QVPA 3JCMJ 5D6WA 3R6NA 4A4GA 5CR2A 5CIUA 4BDYA 5GAOr 4C5GA 2BUDA 1T3LA 1FXXA 2DPPB 1WHJA 2MAMA 4C8QF 2O4XA 2LJ3A 2QA4A 3RERA 2EJGA 5L23A 4OMLA 3JCMc 1PD1A 1TTHB 1UGPB 2G6FX 2DL4A 2JT4A 4RG2A 2QTXA 1BI2A 5GANg 3CC4A 2DA9A 2DNUA 2LQ8A 2X4JA 1BCMA 5GAN6 1AT1B 1BIAA 1HD3A 3CCQT 2LT1A 3OBWA 4FM4B 2E3IA 4M7DG 3ME9A 3MP6A 4PJOG 5CKEA 1OV3A 1RLPC 3HKSA 2EKHA 8AT1B 1H8KA 1YNZA 2DIQA 3QO3A 5GANh 4M77E 1NZ9A 4FW1A 1C6VX 3M0PA 3JRZA 3CMET 1H3HA 4MMLA 5CKFA 3OYKA 4CC2A 1NEBA 2IG0A 2P0QA 1HXDA 2MPXC 5IT9E 1VQ6A 2YUQA 2XDBA 1D1AA 4Y92A 1D3BB 1WZOA 2RI3A 2NUTB 2Y4YA 4JUVA 3CC2A 4RTWA 4RCBA 4BE2A 1PG5B 3JCMg 2ED0A 3CCLT 1VYVA 3CCRA 1PM3A 2L0AA 1QP2A 4M77C 2JVVA 2QEXA 4Z02A 4N0AA 4F7UG 2GQVA 2EPDA 5IH2A 2RHUA 3OY9A 4OB3B 4ZGEB 4JRPA 5LJ5d 1MGQA 2JOYA 3JCMh 2ESWA 1WQWA 1HK9A 3UATA 4A4FA 2R5MA 4QT7A 3OYCA 4IURA 1U1SA 2QQRA 3G71T 1Q86C 2EFIA 4MZTA 1D1CA 2RQVA 2RB6A 2CYZB 2FRYA 3L2ZA 4QVDA 1UE9A 3J80E 1YIJT 2KBTA 1YBYA 1R8OB 2RK1A 3M9QA 4ZGJB 3A8GB 1MNEA 2EGEA 2E3HA 2JUFA 1NJIR 3OB9A 3OYFA 2L2PA 2QI2A 2VKNA 1I0CA 2FZKB 3MEWA 4BUGA 5AT1B 5D6XA 2DLPA 1Z9ZA 2XD0A 3M59A 4Q5WA 2DJZA 3PNWC 1PRMC 3OYDA 5A2QE 2LTOA 2J6OA 3FB9A 1W4SA 2RH2A 4RG8A 1C0MA 1M90R 4CC3A 3MCAB 3PTAA 2H3EB 4KUDK 3I55A 3OMCA 5D6YA 1U1TA 2KMTA 3G71Q 4LDWA 5HK3A 3EG3A 3SHWA 5I11A 3G7ZA 3FRNA 2MWOA 1QCNA 5GAMd 1Q82C 1XTDA 1OQKA 2HZYA 2X35A 2QQBA 5LJ3d 3CCVT 2P4RA 3EGXB 1VQ9A 2L89A 1UHFA 5GAOn 1PKSA 4B9XA 1VYTA 4OMQA 3VS2A 3FC3A 1QVFP 1N9SA 3J7AF 4Y28E 3RUXA 2DTHA 4C8QB 2LP5A 2M1HA 4RTXA 1VQ5Q 1VQKQ 3LLRA 1UB4A 2RQUA 2LX7A 4C0DC 5C6SA 2DAQA 4M75E 1NM7A 1Y71A 4II1A 3CC7T 3UPUA 3I35A 2JJ9A 4HCZA 5HKCA 4IUUA 2L3QA 5J3BA 3VU3C 4M77D 2RQRA 3JSCA 2ENMA 5FRNA 2BZYA 4LDYA 1QQJA 1ZUKA 3GOXA 1LJOA 2YT6A 3PFSA 2LQWA 5J39A 1AZEA 1VQNA 1YITA 1WXBA 3C4SA 1FMWA 1UGSB 5FW9A 3CD6T 1AHJB 3VJPA 4M75C 1E6GA 4DBQA 4E7LA 2DL8A 3A8MB 2K6DA 1QVFS 4WTOB 1NG2A 4QQDA 4C92A 4HKEA 3OA6A 2RQTA 2HBWA 5KYXB 4M78F 5KYUB 9ATCB 2QA4T 3OYGA 2VXFA 3CCJQ 2XHCA 1M1FA 2MF2A 1ZSGA 2L5QA 3V7CA 1KQSP 1M5Q1 3HP9A 3L42A 2ZCFB 1LVKA 1R77A 5CKHA 1M2OA 1YFNA 4FYXB 3OW2P 4M7DE 2KXDA 2A36A 1GCQC 3LWIA 1RAIB 1AZGB 3CCSA 2VASA 1IHWA 3QDFA 5GAN4 4EMKB 1SPKA 4IIMA 2WSCE 2J6KA 3H0HA 2D6FA 2M0YA 2K79A 4PK4A 5IXBA 2OAUA 3G4SA 3MP1A 3FDRA 2CP5A 1EX4A 1Q86R 2CUDA 3CQTA 1VIFA 2CSQA 2HQXA 2QA4Q 2ZPIB 2RA2A 4PJMA 4OMOA 4C0GA 1ZLMA 4M7DC 1SRLA 3E9FA 3JV3A 4PJOC 3G6EA 3VS3A 4J9EA 2OAWA 3CCRT 3CC4Q 1KQSS 2RHZA 1RACB 3OYLA 3JB9I 4F7UE 1QMCA 4J9GA 3L2QA 1TSFA 2NUZA 2JZ2A 5C0MA 4D8KA 4PJLA 2QG9B 4L59A 3M58A 2Y90A 3ER0A 2RMOA 3HRSA 2C06A 3BDUA 4EMGA 3J81E 2F2VA 1MHNA 2ZGWA 3LH0A 1TU0B 3ZEHA 2CP3A 4JRIA 5CQYA 5IN1A 4ORZA 2EYQA 1I5LA 1NYGA 2JTMA 3E2UA 4X9CA 4CC4B 3QG1A 4CI0C 1VQ6Q 1K8AU 3HL8A 4IUTA 2AHJB 5A0GA 2EYXA 1Q82R 2OI3A 3CC2Q 5EG2A 2VUBA 1K9MU 4M75D 5CQXA 5HK0A 1V29B 2E6ZA 2CSIA 2JM9A 5FU7C 3HFOA 4OMNA 2OX7A 2QEXQ 4J6YA 3M0TA 4O6JA 5KYYB 2M16A 2CZ1B 4BY6C 4XTZA 1GFDA 1AOJA 2DILA 4NL2A 3CCMT 5LL6S 2VV5A 3A98A 1D3BA 4FSXA 4DA4A 2C0IA 3CBMA 2NUTA 2JS0A 1S72A 2HL3A 4O5VA 2HSEB 4EIKA 2PUOB 2EW3A 3CXCA 3LH5A 1PD0A 1YJWA 1NEGA 2GCXA 1OZ2A 1X01A 3S3OA 1PC0A 4L5GA 4PJOB 2KXCA 3CBPA 1VQ9T 2CZ0B 1X6BA 1RLQC 1IZ6A 4IIOA 2XG8D 4M78B 2MOXA 4R55A 3OBYA 1VQLA 2A37A 3V7SA 4FU6A 3TVTA 5FLXE 1G3YA 3S6WA 1C1AA 4PFZA 5GAMj 3HRTA 2VB6A 2QQSA 4GLKA 5DLOA 1ZSZC 2KE9A 3X26B 3I55Q 1TUDA 3MKDA 5LJ3j 2OTLQ 1W2BA 4M7DD 2ATCB 2JMAA 1Y57A 3SWNB 4R0KA 4J83A 3QYGB 5GANf 4BB7A 4C5IA 1VQ7A 3X20B 1SHGA 2CH4W 2KT8A 4E7SA 1QWFA 3OW2A 4E7JA 3SD4A 3GNFB 1VQPQ 1VQNT 1M30A 1VA7A 1YITT 1VQ9Q 1S1NA 2GFUA 3TREA 1YJNA 2FEIA 2CH4A 1BCOA 3P8BB 5GMKe 1K76A 2LCSA 3META 1WA7A 1TOVA 2I0NA 4RTZA 1H3ZA 4J9HA 3KXTA 4QKUA 1ABOA 1WHKA 1KD1U 3F70A 2V26A 2NLUA 2OJ2A 4LXCA 2R58A 2XMFA 3VS4A 4J9FA 2NUPB 4C92D 2ROTA 2VGNA 3PIOA 3MEAA 2HKQB 1JJ2A 5D7UA 2QK0A 2FHDA 3JCMf 4HVVA 3QSUA 3H8ZA 4V2SA 1CSKA 4GLMA 3EGXA 1O9SA 1KD1R 6AT1B 3EFSA 2ZAEA 5FU6B 1IREB 4E7KA 3HHTB 2PQWA 1QCOA 1AEYA 4C8QA 2LX9A 1G8XA 2DRMA 2QQAA 2C0OA 2D0QB 4RCCA 3D7SB 1B07A 2QDYB 1QVGA 1Q95G 3TSWA 3EHRA 4A4HA 2VWFA 3I5RA 1FWZA 2FPDA 1RAAB 1VUBA 4KT0E 4M77F 3C94A 1SG5A 3OQ5A 1ZSZB 5ECAA 4XTXA 4NS5A 4XU1A 1EZZB 1D09B 2GTOA 3PGGA 2DTIA 4QVZA 3JB9H 1K4US 2DXUA 1MV0B 3GBQA 1VQOA 2EVRA 1NYFA 2M9UA 1K73U 4F16A 4F04B 1PSEA 1B3QA 2RD1A 3EG0A 5FROA 1WDXA 4JRQA 1BK2A 2DL7A 3X25B 1MV3A 3CCSQ 3JB9D 5KYXA 3KUFA 2X4XA 5KYUA 2DE0X 2WSFE 3I56Q 3G1JA 4M7AE 1BU1A 1WHGA 1K73R 1HYOA 3PVQA 3G4SQ 1FMVA 2BE7D 1KQ2A 1EFNA 1WGSA 1RI9A 2BZ8A 3O8VA 5KE2A 4OF1A 2A3LA 3JCMX 1UHCA 1XNIA 3VYGA 3NMZC 2V8KA 2RJDA 1GBRA 4QQ6A 1AVZC 2GTJA 4DQ2A 1KFZA 1ZX6A 1NLOC 3OYEA 1Q7YU 1B7TA 3GIBA 4BE0A 3RDVA 3G6EQ 1I81A 2YUNA 5LJ5g 2FZGB 4C92G 2HBPA 2DZ9A 3S3NA 4EMKA 2E70A 4RTTA 3OS5A 4M7AC 4XTYA 2JTEA 4E2FB 1GL5A 1Q7YR 4PJNA 5LJ5h 2DMOA 4CRIA 2CZ6B 3ZBDA 2ZPFB 2SRCA 5KYWB 2QQ9A 4OB0B 2JN0A 1SRMA 1YWPA 2R5AA 4XTVA 2EIFA 2YUOA 2YRCA 1S72T 4FT4A 3QJYA 7AT1B 1IB8A 3OMGA 2FL7A 4RTUA 5GANe 3R6OA 1SHFA 2F5TX 2E5QA 4DOVA 1PNJA 2JW4A 5GAN3 4JDSA 2F2XA 2GQIA 1YI2A 2QGGA 1X43A 2XK0A 4E47A 1TWBA 1XJWB 2FO0A 3H0FA 1MMAA 4OGEA 5IHKA 1OPKA 1VQLT 1RL2A 2YUPA 2RPNA 1VQ5T 1VQKT 2VVKA 1JB0E 4GY5A 3PE0A 5GAOq 1VQMA 4HVWA 3JCMQ 1WHLA 4KGVB 5GJWB 2OTLA 5GMKj 2M51A 3EG9B 2L8DA 4M75F 2ZPHB 3VUBA 2YLCA 1KIKA 4FSSA 1JO8A 2E64A 1RADB 8ATCB 4DOWA 3JB9G 2QXFA 2FB7A 2PNIA 2PTKA 1S72Q 4J7IA 4ESRA 1VQPA 1KHCA 4AMCA 3JCMe 4JJNK 1LCKA 2GNCA 1VQ8A 1YJWQ 2CGHA 2DTOA 2J06A 3KFVA 3TU4K 1O75A 5KYYA 1K8AC 2CP0A 5LJ3h 2J05A 2PU9B 2FG0A 2HQEA 1KG1A 3QZ5B 4M77B 1W1FA 4C5EA 5CK9A 1YJNT 3V7RA 3RIRA 1RAGB 2K5LA 3UF4A 3TEEA 2E65A 1K9MC 1VQLQ 1X6GA 4Z88A 5L8RE 3NTIA 4PNOA 1BYMA 3JCMP 4ZTJA 1U3OA 1UUEA 1ARKA 1BI0A 3GPLA 5A0LA 4N0AC 3CCJT 2EKOA 2QTVA 5KCOA 2LQNA 2KRMA 3CPFA 2MI6A 3V8JA 3OYNA 2MWPA 1BIBA 4Z8AA 1VQ7Q 3SFMA 3UT1A 4MZPA 1U8RA 4PJOA 1T3SA 2RNAA 4JZ4A 5KCHA 1VQ4A 2GGRA 4FYWB 3CXCP 1M3CA 4M7AD 4XU3A 2EBPA 3H41A 2CREA 3U23A 1SKUB 4M78A 2E41A 4RKUE 4PFOA 1EIFA 5KH6A 2KDSA 1GXIE 3SB2A 1YJNQ 4M7DF 3M57A 4PJOF 4B9WA 4PFPA 3NPFA 3RKWA 4BI3A 4AG1C 4HA8A 3VS5A 3MEVA 1OULA 2CDTA 2O01E 3SWNA 2RF0A 3L2UA 4ZN3A 4X34A 2JMCA 3QJ6A 3NTKA 1Y0MA 2E6NA 2VYTA 2DZCA 1SSHA 1W2BP 1OZ3A 2HNIA 3TSZA 3HFNA 2A7YA 4JLIA 3VKIA 2H3JA 4MZMA 1KSWA 1JXMA 2DBKA 2R57A 3CC4T 5IHIA 4BE1A 5GAN5 3KBGA 2BKDN 3M56A 1VQOT 3FIFA 1GRIA 2X4YA 4J9BA 2E4HA 4BACA 2AZSA 3CXCS 1ABQA 1N8RU 2CKKA 1LOJA 3I56A 4KH0B 4F7UF 5DLQE 2XDDA 3CMAQ 2X3WD 4QQGA 3CEYA 3L2RA 2FZCB 2X51A 3WVEB 1M2VB 2GF7A 2EJ9A 2RO0A 2NUPA 3GLXA 2FRWA 2DF6A 2G3RA 5IXFA 4JJBA 4CC7A 2K5IA 4C0DB 4BDZA 3A1PA 3MEUA 1N5ZA 1WFWA 1VQ6T 3IQLA 3LX7A 3PT9A 2OTJA 4PKCC 3H9NA 2V8JA 1JJ2P 1KD1C 3CC2T 4HCKA 4XK8E 4JS5A 2K9GA 1XQHA 1MNDA 4C0ZA 1W2BS 1I5OB 5IAYA 2DD4A 1WHMA 1KC8U 1WNLA 4LD9K 3E1SA 5A0DA 4C92E 2DO3A 2QEXT 1VQOQ 3N5BB 1YWOA 3M0RA 1Y96B 2DD5A 3NGPA 1TUGB 3EH1A 1FX7A 2YXYA 3OW2S 2X4WA 4PJJA 1V1CA 4M75B 1H92A 4R56A 2LCCA 1PRLC 2KRSA 4X1VA 1QVGP 1NPRA 3HPWA 4M7AG 3M0QA 2AKKA 1ZSZA 1KC8R 2DJQA 1E6HA 1GFCA 2EYYA 4LN2A 4BI8B 3CPWA 3FLGA 3OS2A 5CAIA 2KI7A 1H641 4J9DA 1AWWA 1A0NB 2HSPA 4C8QG 3L2WA 3HRUA 4C92C 2P84A 3CMEA 1WXUA 3H0IA 2DL5A 2GFAA 2ZPBB 3E9GA 2RK2A 3JCMW 1RAFB 3Q1JA 1JJ2S 1G3SA 2DFUA 1K8AR 1K9AA 2RI2A 1G3TA 2EQIA 4C0FA 3QWYA 1TUCA 3UA6A 4PLIA 1D1BA 1E7OA 3CCLA 2K2VA 1K9MR 2AZVA 4PL6A 3QIIA 1K73C 3I55T 3RKXA 2OTLT 3PMIA 2RHIA 2O9VA 1QVGS 3L1AA 1Q81U 2CS7A 3DLLA 4J9CA 2DXCA 1KHIA 2DETA 1I07A 1HJDA 1X2QA 4XTWA 2JXBA 3C12A 4UC4A 1VQPT 1RUWA 4M7DB 4JZ3A 1JRIA 3EHQA 2X3XD 2SEMA 5FRMA 3INZA 4J9IA 2JNGA 1YIJA 4WCIA 1YI2Q 1F1BB 2K7AA 3EH2A 2XKOC 3VS7A 5GJVB 1Q7YC 1OU8A 1OU9A 5GAN2 3ASKA 1M27C 2GBQA 2DYIA 5KYWA 5CVIA 2P4TA 2KR3A 2LNVA 1VQMQ 3X24B 1KK7A 4NL3A 5GAOl 1WHHA 4IUPA 2YLBA 4ZTFA 4KH1B 2D9TA 2RI5A 2VXEA 4HT9A 2LJ1A 4ANJA 4F14A 1QKXA 1K0SA 1ZBXA 1K0XA 3NHNA 4D6WA 1VQ4T 4ZN1A 4Z89A 4F7UB 2KSSA 4RUGA 3M55A 2A08A 1VQ8Q 3BFMA 1I8FA 5FU7B 4XU0A 1U06A 1ZBJA 3RMSA 3HSBA 2LJ0A 3URGA 4KBMB 2BZXA 4HT8A 3CCVA 4BY6B 1M1KU 1OX9A 3EAEA 3EG9A 1YHQA 1RI0A 5CKBA 4B6MA 3JB9J 2RN8A 3CCEQ 3V8LA 4KUIA 4A53A 1YJ9Q 1FYNA 1QP3A 2ZZDA 2PZ1A 3RMQA 1QKWA 1WPYA 2P0PA 4LUEA 3RKYA 3A5ZB 1IXDA 5LJ5f 3L2VA 1M8VA 4J6WA 2XDPA 1G3WA 3FJPA 1BI1A 2BTTA 1WJSA 2KAFA 4A4KA 3CC7A 2CUBA 2QAZA 1VQ4Q 4M77A 2ECZA 3X28B 1LPLA 2CP7A 1ZQ1A 2KROA 1ZHIA 1SSFA 3QWXX 1UGRB 1WJRA 2KRNA 3THKA 3CMAA 3CCST 2JTFA 1QWEA 3I56T 2MK5A 4FYVB 5I21A 1UEBA 4X9DA 3LWHA 2B86A 3FEOA 3FJ5A 4PLLA 1OYXA 2E12A 3G4ST 1NE8A 2E5KA 2BIVA 5GAOm 1YP5A 2D0NA 2KY9A 5M9OA 1YCYA 1I1JA 2JM8A 3M4GA 1I4K1 4EMHA 1B34B 2DXBA 1NPPA 1MUZA 4JJCA 1P92A 1AWXA 3G6ET 3ULRB 3EG1A 1UG1A 2EJFA 2L3SA 1IGUA 2A28A 1QCFA 3REBB 4RTYA 4QVCA 5GAMf 1M3AA 2KNBB 3REAB 3AHUA 4NOYA 3EGDB 3EFRA 4N4GA 2XICA 2COWA 4E6RA 5LJ3f 1UECA 4OB2B 4J7FA 1KJWA 1YCSB 4FCYA 2CP2A 5GANd 2DYBA 4D8DA 4LNPA 4GBQA 2D8HA 2DEQA 2M02A 4M78G 2OTJQ 2DX1A 1UJYA 4C8QE 2E1HA 2C0TA 2AK5A 2FVUA 3QYHB 4A54A 2F1LA 2QASA 2DRKA 1W70A 2HMAA 4FL6A 2RHYA 2K3XA 1G5VA 4M4ZA 3DB3A 3M0UA 1XOVA 1T0HA 1M2VA 5IHNA 1W6XA 2Y4XA 4OGCA 3RESA 1NLPC 1PSFA 2YRVA 3VS1A 3OYMA 1N6AA 4VUBA 2HQHA 4BI4A 3CCQQ 3M5AA 3M54A 4C8QC 1N8RC 3JCMd 3CBOA 2QYZA 4MDWA 3JCMV 5GMKi 4DBRA 3TQ7P 3MHXA 1NJIU 2DK3A 4XAXB 1WI7A 3RNJA 2IPOB 1YJWT 1MMNA 3QBYA 3CMEQ 4E7HA 4TVRA 4FT2A 1R0BG 2DKGA 2J6FA 2D8JA 1Y96A 5DY9A 2DVJA 4ELZC 3OS0A 2LMJA 2DXTA 3AT1B 1TG0A 3RBBB 1J3TA 1VIEA 4M75A 1Z9QA 1M90U 2EAYA 3OYBA 5CO7A 1WXTA 3M4YA 3RR6A 1RAEB 2NYSA 1KC8C 3CCUA 5GAMg 3CCLQ 3QZ9B 2I2LA 4XTUA 2X9HA 3BE3A 2QDLA 2O31A 5LJ3g 3MJXA 1VQ7T 1WYXA 3CPWP 3E19A 4L6V5 1QW1A 3CCMA 3SEMA 5GAMh 3LGFA 2YDLA 1OEBA 1IO6A 4J6XA 3PIPA 4HCBA 4IUVA 3A8HB 2EWNA 5LJ5e 2MMPA 2EGCA 1GCQA 2H8HA 1WQ7A 1Y7XA 4AFUC 2KYMA 3SDZA 1YIJQ 3OYIA 2EYWA 2K4YA 3EFOB 4M7AB 1CKBA 4OP0A 1G2BA 4F17A 1MMGA 2BE9B 2ZPGB 4IUQA 1GBQA 1UFFA 1KQ1A 3CCEA 2Z0WA 1YHQT 1YJ9A 1M3BA 1WX6A 3LYIA 4EMKC 5HCKA 2DEUA 1JBMA 1R0CB 2RM4A 2NWMA 4M7DA 2HAXA 3NFCA 4XQ3A 3TCJA 3QHSA 1N27A 1BBZA 3CPWS 2P0KA 1Q81C 1PHTA 1DJ7B 4LD6A 2XI9A 2O4XB 4DBHA 3VRYA 4AFSC 1ACMB 4FYYB 2XU8A 4JLGA 3CMAT 2F5KA 3M53A 4C8QD 2F2WA 3GNGA 1TS9A 5GAMe 3CCVQ 2CT4A 1YHQQ 1M4ZA 3JAME 5GAN8 4ME7A 5CCAA 5FWCA 1OX8A 5LJ3e 1VYUA 2YRDA 3OYHA 2ROLA 2KYBA 1NBEB 3VS0A 4F7UA 4AG2C 4E7ZA 2HCKA 2LZ6B 1YN8A 5KE3A 1OPLA 2W0ZA 2AT1B 3VV0A 4IKFA 3I5SA 4RMOA 2L3RA 3CC7Q 3ZL7C 2KQWA 1D0ZA 1ZUUA 1ZUYA 3T9NA 2K57A 2WSEE 4FW2A 2LCLA 3BDLA 3JCMb 4C92F 1WJQA 4OMPA 1X69A 4LDXA 1RABB 2QGFB 2LC4A 4HXJA 2PVDB 5FWBA 1GCPA 3WVDB 3V8KA 4ZGDB 1X6OA 4N4HA 3UA7A 1Q86U 4PJOE 3DB4A 4ELYC 3HTRA 1M1GA 1N8RR 2V1RA 2FPEA 3CD6Q 2O9SA 2DERA 3EGUA 1M1KC 4M78E 2KGTA 3C95A 4MMKA 2ABLA 4LDVA 2MIOA 3MO8A 2O2OA 2PUKB 1UTIA 3GF5A 1G83A 3EG2A 2HL5C 3O5ZA 2MCNA 1ZA2B 4HVUA 5GANj 2F69A 1K1ZA 1RAHB 2JS2A 2EQJA 3MPUB 2J7IA 3CCQA 4OMMA 2W10A 2LVMA 5KYNA 5AYFA 1OOTA 2EGAA 4M78C 4K11A 5I2MA 2IIMA 1ZA1B 5CKDA 1B34A 1Y07A 3WXMB 5GMKl 1IHVA 4M77G 2CT3A 1Q82U 1QLYA 2KVQG 3PMTA 2HDAA 1AWOA 4P5NA 2FPFA 4AFQC 1OI1A 3SWNC 3JB9F 1MMDA 2K3YA 4J5YA 1UGVA 3VYHB 1D0YA 2EQKA 2CZ7B 1V76A 1AWJA 1YI2T 2COZA 3LW5E 3OYAA 3EGDA 3BW1A 4C5HA 3QUIA 5LJ5j 3QXEB 2ED1A 4BD3A 3S3MA 1WLPB 1VQMT 3ZFJA 2PVGB 1QVFA 1SF9A 1JQQA 3CCUT 2ZPEB 4OVAA 5I2SA 3CCRQ 2KEAA 2RJCA 2YHTA 2HEQA 2COYA 1N9RA 1TXQA 2RQWA 4WF2A 4QW2A 5J26A 2DVEA 4KGZB 1PKTA 4AT1B 3PVLA 3G71A 3QPHA 4OMFB 2LNHB
chains in the Genus database with same CATH topology
3VRZA 1OPKA 1YP5A 2D0NA 2YUPA 2RPNA 2VVKA 1JXOA 1I1JA 5I22A 2JM8A 3PE0A 1UJ0A 4JJDA 2EYZA 4HVWA 2V1QA 5GJWB 1MUZA 2KXDA 2A36A 1GCQC 5EC7A 4JJCA 1X2KA 2KT1A 1AWXA 2M51A 1AZGB 2YSQA 3ULRB 1SPKA 3EG1A 4IIMA 1UG1A 1KIKA 2L3SA 2J6KA 3H0HA 4FSSA 1JO8A 2A28A 2M0YA 1QCFA 2K79A 3REBB 5IXBA 2PNIA 4RTYA 2PTKA 1WIEA 4ESRA 1M3AA 4DEYA 2KNBB 3REAB 1LCKA 2CUDA 2GNCA 3CQTA 2CSQA 3KFVA 2J06A 4E6RA 1UECA 2J05A 2FG0A 1W1FA 4OMOA 3VS6A 4A63B 1KJWA 1JEGA 1ZLMA 1YCSB 1AD5A 1SRLA 1U5SA 3JV3A 2DYBA 3UF4A 1BB9A 4J9EA 3VS3A 4D8DA 4LNPA 2OAWA 4GBQA 2D8HA 1X6GA 4Z88A 3I9QA 2AKLA 2K3BA 2DX1A 1U3OA 1UJYA 1UUEA 3C0CA 1ARKA 2C0TA 2AK5A 4J9GA 4AFZC 2NUZA 1UDLA 1M8MA 2DRKA 1W70A 4D8KA 4DEXA 2LQNA 2KRMA 2K2MA 4Z8AA 4M4ZA 2RMOA 1T3SA 4KRTA 2RNAA 4JZ4A 3M0UA 2GGRA 1XOVA 1T0HA 2D1XA 4LUDA 2F2VA 5IHNA 1M3CA 2EBPA 3H41A 1W6XA 2CREA 1SEMA 4ORZA 3U23A 4RTVA 1NLPC 1NYGA 2DM1A 1X27A 3VS1A 4CC4B 3M0SA 2EYXA 1T0JA 4JPBW 2O88A 2OI3A 3NPFA 4AG1C 3VS5A 4LE9A 2CSIA 1WI7A 2JM9A 3RNJA 2CDTA 4OMNA 2RF0A 1HSQA 3M0TA 2JMCA 1Y0MA 2DBMA 2J6FA 2D8JA 1GFDA 1SSHA 1AOJA 2DILA 2DVJA 1CKAA 3TSZA 2LMJA 3RBBB 1TG0A 4ZNXA 1KSWA 1J3TA 1JXMA 1Z9QA 3A98A 1FMKA 2DBKA 2L3PA 5IHIA 1JU5C 2DL3A 2C0IA 1WXTA 1PWTA 2JS0A 3R6NA 1GRIA 4J9BA 1T3LA 4EIKA 2AZSA 2EW3A 3LH5A 1ABQA 1NEGA 2LJ3A 2QDLA 2O31A 2X3WD 5L23A 1WYXA 2KXCA 4OMLA 2FRWA 1X6BA 2DF6A 5IXFA 1RLQC 2G6FX 4JJBA 2DL4A 4IIOA 3SEMA 4CC7A 2JT4A 2MOXA 2YDLA 1OEBA 1IO6A 2A37A 3TVTA 1N5ZA 1WFWA 2DA9A 3IQLA 2DNUA 1HD3A 1GCQA 2EGCA 2H8HA 4AFUC 2KYMA 4HCKA 2K9GA 2KE9A 1OV3A 1RLPC 1TUDA 2EYWA 2EKHA 1CKBA 2JMAA 1Y57A 1G2BA 4R0KA 4F17A 1H8KA 1YNZA 1GBQA 1UFFA 3M0PA 1YWOA 1SHGA 2CH4W 3M0RA 1M3BA 1H3HA 2KT8A 3NGPA 4CC2A 1QWFA 1NEBA 1WX6A 5HCKA 1V1CA 1H92A 2YUQA 1PRLC 2KRSA 2NWMA 4X1VA 4Y92A 1M30A 1VA7A 3M0QA 2AKKA 1S1NA 2DJQA 1E6HA 4RTWA 2FEIA 2CH4A 1GFCA 1BBZA 2EYYA 4LN2A 1K76A 2LCSA 1WA7A 2I0NA 2ED0A 4J9DA 1VYVA 1AWWA 1A0NB 1PHTA 4RTZA 4J9HA 2L0AA 1ABOA 3VRYA 4AFSC 2HSPA 1WXUA 3H0IA 2OJ2A 2DL5A 2XMFA 2EPDA 3VS4A 4J9FA 5IH2A 2ROTA 2F2WA 2ESWA 4HVVA 3UATA 4QT7A 1CSKA 2CT4A 1K9AA 4GLMA 2EQIA 2RQVA 3QWYA 1TUCA 5FWCA 3UA6A 2FRYA 1E7OA 1UE9A 2AZVA 1VYUA 2KBTA 1AEYA 2ROLA 2KYBA 3VS0A 2EGEA 4AG2C 2DRMA 2HCKA 2L2PA 1YN8A 2C0OA 2LZ6B 2VKNA 2O9VA 1B07A 1OPLA 2W0ZA 1I0CA 3I5SA 3TSWA 3EHRA 4J9CA 3ZL7C 2DLPA 1ZUUA 1Z9ZA 1ZUYA 2VWFA 3I5RA 2FPDA 1I07A 1HJDA 1PRMC 1X2QA 2JXBA 2J6OA 4OMPA 1X69A 1RUWA 4JZ3A 3EHQA 2X3XD 2SEMA 4CC3A 5ECAA 4HXJA 4J9IA 2GTOA 5FWBA 1GCPA 4WCIA 3UA7A 2K7AA 3VS7A 1K4US 5GJVB 2V1RA 1MV0B 2FPEA 2O9SA 3EG3A 3GBQA 2EVRA 3SHWA 5I11A 3EGUA 1M27C 2GBQA 2KGTA 1NYFA 2ABLA 2KR3A 4F16A 2MIOA 1B3QA 3EG0A 2O2OA 1WDXA 1BK2A 2DL7A 1MV3A 1UTIA 2P4RA 1G83A 3EG2A 2LJ1A 3O5ZA 2MCNA 2DE0X 1UHFA 4F14A 1QKXA 1K0SA 1PKSA 1VYTA 4HVUA 4OMQA 3VS2A 1K0XA 1BU1A 1K1ZA 3NHNA 2JS2A 3PVQA 4Z89A 4RUGA 2LP5A 2J7IA 1EFNA 1RI9A 2BZ8A 4RTXA 4OMMA 2A08A 1UHCA 2W10A 3NMZC 2RQUA 2LX7A 1OOTA 2EGAA 1GBRA 4K11A 1AVZC 1NM7A 2GTJA 2IIMA 1KFZA 1ZX6A 1U06A 1ZBJA 1NLOC 3I35A 2LJ0A 2YUNA 2BZXA 2L3QA 2CT3A 1QLYA 4RTTA 2RQRA 2HDAA 2ENMA 1AWOA 2BZYA 2RN8A 1ZUKA 2FPFA 4AFQC 1FYNA 2JTEA 2YT6A 2PZ1A 1QKWA 1UGVA 2LQWA 1AZEA 1GL5A 4LUEA 1AWJA 1WXBA 2DMOA 2SRCA 5FW9A 2BTTA 2CUBA 1E6GA 1SRMA 2DL8A 2ED1A 2ECZA 1YWPA 1WLPB 2K6DA 1JQQA 1NG2A 2KROA 2YUOA 2RQTA 2KEAA 3QWXX 2HBWA 2KRNA 3THKA 4RTUA 2HEQA 1QWEA 1SHFA 2RQWA 1PKTA 2B86A 1PNJA 2JW4A 3FJ5A 2F2XA 1ZSGA 2GQIA 3PVLA 1X43A 2FO0A 3H0FA 2E5KA 2LNHB 5IHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRZ A;  1OPK A;  1YP5 A;  2D0N A;  2YUP A;  2RPN A;  2VVK A;  1JXO A;  1I1J A;  5I22 A;  2JM8 A;  3PE0 A;  1UJ0 A;  4JJD A;  2EYZ A;  4HVW A;  2V1Q A;  5GJW B;  1MUZ A;  2KXD A;  2A36 A;  1GCQ C;  5EC7 A;  4JJC A;  1X2K A;  2KT1 A;  1AWX A;  2M51 A;  1AZG B;  2YSQ A;  3ULR B;  1SPK A;  3EG1 A;  4IIM A;  1UG1 A;  1KIK A;  2L3S A;  2J6K A;  3H0H A;  4FSS A;  1JO8 A;  2A28 A;  2M0Y A;  1QCF A;  2K79 A;  3REB B;  5IXB A;  2PNI A;  4RTY A;  2PTK A;  1WIE A;  4ESR A;  1M3A A;  4DEY A;  2KNB B;  3REA B;  1LCK A;  2CUD A;  2GNC A;  3CQT A;  2CSQ A;  3KFV A;  2J06 A;  4E6R A;  1UEC A;  2J05 A;  2FG0 A;  1W1F A;  4OMO A;  3VS6 A;  4A63 B;  1KJW A;  1JEG A;  1ZLM A;  1YCS B;  1AD5 A;  1SRL A;  1U5S A;  3JV3 A;  2DYB A;  3UF4 A;  1BB9 A;  4J9E A;  3VS3 A;  4D8D A;  4LNP A;  2OAW A;  4GBQ A;  2D8H A;  1X6G A;  4Z88 A;  3I9Q A;  2AKL A;  2K3B A;  2DX1 A;  1U3O A;  1UJY A;  1UUE A;  3C0C A;  1ARK A;  2C0T A;  2AK5 A;  4J9G A;  4AFZ C;  2NUZ A;  1UDL A;  1M8M A;  2DRK A;  1W70 A;  4D8K A;  4DEX A;  2LQN A;  2KRM A;  2K2M A;  4Z8A A;  4M4Z A;  2RMO A;  1T3S A;  4KRT A;  2RNA A;  4JZ4 A;  3M0U A;  2GGR A;  1XOV A;  1T0H A;  2D1X A;  4LUD A;  2F2V A;  5IHN A;  1M3C A;  2EBP A;  3H41 A;  1W6X A;  2CRE A;  1SEM A;  4ORZ A;  3U23 A;  4RTV A;  1NLP C;  1NYG A;  2DM1 A;  1X27 A;  3VS1 A;  4CC4 B;  3M0S A;  2EYX A;  1T0J A;  4JPB W;  2O88 A;  2OI3 A;  3NPF A;  4AG1 C;  3VS5 A;  4LE9 A;  2CSI A;  1WI7 A;  2JM9 A;  3RNJ A;  2CDT A;  4OMN A;  2RF0 A;  1HSQ A;  3M0T A;  2JMC A;  1Y0M A;  2DBM A;  2J6F A;  2D8J A;  1GFD A;  1SSH A;  1AOJ A;  2DIL A;  2DVJ A;  1CKA A;  3TSZ A;  2LMJ A;  3RBB B;  1TG0 A;  4ZNX A;  1KSW A;  1J3T A;  1JXM A;  1Z9Q A;  3A98 A;  1FMK A;  2DBK A;  2L3P A;  5IHI A;  1JU5 C;  2DL3 A;  2C0I A;  1WXT A;  1PWT A;  2JS0 A;  3R6N A;  1GRI A;  4J9B A;  1T3L A;  4EIK A;  2AZS A;  2EW3 A;  3LH5 A;  1ABQ A;  1NEG A;  2LJ3 A;  2QDL A;  2O31 A;  2X3W D;  5L23 A;  1WYX A;  2KXC A;  4OML A;  2FRW A;  1X6B A;  2DF6 A;  5IXF A;  1RLQ C;  2G6F X;  4JJB A;  2DL4 A;  4IIO A;  3SEM A;  4CC7 A;  2JT4 A;  2MOX A;  2YDL A;  1OEB A;  1IO6 A;  2A37 A;  3TVT A;  1N5Z A;  1WFW A;  2DA9 A;  3IQL A;  2DNU A;  1HD3 A;  1GCQ A;  2EGC A;  2H8H A;  4AFU C;  2KYM A;  4HCK A;  2K9G A;  2KE9 A;  1OV3 A;  1RLP C;  1TUD A;  2EYW A;  2EKH A;  1CKB A;  2JMA A;  1Y57 A;  1G2B A;  4R0K A;  4F17 A;  1H8K A;  1YNZ A;  1GBQ A;  1UFF A;  3M0P A;  1YWO A;  1SHG A;  2CH4 W;  3M0R A;  1M3B A;  1H3H A;  2KT8 A;  3NGP A;  4CC2 A;  1QWF A;  1NEB A;  1WX6 A;  5HCK A;  1V1C A;  1H92 A;  2YUQ A;  1PRL C;  2KRS A;  2NWM A;  4X1V A;  4Y92 A;  1M30 A;  1VA7 A;  3M0Q A;  2AKK A;  1S1N A;  2DJQ A;  1E6H A;  4RTW A;  2FEI A;  2CH4 A;  1GFC A;  1BBZ A;  2EYY A;  4LN2 A;  1K76 A;  2LCS A;  1WA7 A;  2I0N A;  2ED0 A;  4J9D A;  1VYV A;  1AWW A;  1A0N B;  1PHT A;  4RTZ A;  4J9H A;  2L0A A;  1ABO A;  3VRY A;  4AFS C;  2HSP A;  1WXU A;  3H0I A;  2OJ2 A;  2DL5 A;  2XMF A;  2EPD A;  3VS4 A;  4J9F A;  5IH2 A;  2ROT A;  2F2W A;  2ESW A;  4HVV A;  3UAT A;  4QT7 A;  1CSK A;  2CT4 A;  1K9A A;  4GLM A;  2EQI A;  2RQV A;  3QWY A;  1TUC A;  5FWC A;  3UA6 A;  2FRY A;  1E7O A;  1UE9 A;  2AZV A;  1VYU A;  2KBT A;  1AEY A;  2ROL A;  2KYB A;  3VS0 A;  2EGE A;  4AG2 C;  2DRM A;  2HCK A;  2L2P A;  1YN8 A;  2C0O A;  2LZ6 B;  2VKN A;  2O9V A;  1B07 A;  1OPL A;  2W0Z A;  1I0C A;  3I5S A;  3TSW A;  3EHR A;  4J9C A;  3ZL7 C;  2DLP A;  1ZUU A;  1Z9Z A;  1ZUY A;  2VWF A;  3I5R A;  2FPD A;  1I07 A;  1HJD A;  1PRM C;  1X2Q A;  2JXB A;  2J6O A;  4OMP A;  1X69 A;  1RUW A;  4JZ3 A;  3EHQ A;  2X3X D;  2SEM A;  4CC3 A;  5ECA A;  4HXJ A;  4J9I A;  2GTO A;  5FWB A;  1GCP A;  4WCI A;  3UA7 A;  2K7A A;  3VS7 A;  1K4U S;  5GJV B;  2V1R A;  1MV0 B;  2FPE A;  2O9S A;  3EG3 A;  3GBQ A;  2EVR A;  3SHW A;  5I11 A;  3EGU A;  1M27 C;  2GBQ A;  2KGT A;  1NYF A;  2ABL A;  2KR3 A;  4F16 A;  2MIO A;  1B3Q A;  3EG0 A;  2O2O A;  1WDX A;  1BK2 A;  2DL7 A;  1MV3 A;  1UTI A;  2P4R A;  1G83 A;  3EG2 A;  2LJ1 A;  3O5Z A;  2MCN A;  2DE0 X;  1UHF A;  4F14 A;  1QKX A;  1K0S A;  1PKS A;  1VYT A;  4HVU A;  4OMQ A;  3VS2 A;  1K0X A;  1BU1 A;  1K1Z A;  3NHN A;  2JS2 A;  3PVQ A;  4Z89 A;  4RUG A;  2LP5 A;  2J7I A;  1EFN A;  1RI9 A;  2BZ8 A;  4RTX A;  4OMM A;  2A08 A;  1UHC A;  2W10 A;  3NMZ C;  2RQU A;  2LX7 A;  1OOT A;  2EGA A;  1GBR A;  4K11 A;  1AVZ C;  1NM7 A;  2GTJ A;  2IIM A;  1KFZ A;  1ZX6 A;  1U06 A;  1ZBJ A;  1NLO C;  3I35 A;  2LJ0 A;  2YUN A;  2BZX A;  2L3Q A;  2CT3 A;  1QLY A;  4RTT A;  2RQR A;  2HDA A;  2ENM A;  1AWO A;  2BZY A;  2RN8 A;  1ZUK A;  2FPF A;  4AFQ C;  1FYN A;  2JTE A;  2YT6 A;  2PZ1 A;  1QKW A;  1UGV A;  2LQW A;  1AZE A;  1GL5 A;  4LUE A;  1AWJ A;  1WXB A;  2DMO A;  2SRC A;  5FW9 A;  2BTT A;  2CUB A;  1E6G A;  1SRM A;  2DL8 A;  2ED1 A;  2ECZ A;  1YWP A;  1WLP B;  2K6D A;  1JQQ A;  1NG2 A;  2KRO A;  2YUO A;  2RQT A;  2KEA A;  3QWX X;  2HBW A;  2KRN A;  3THK A;  4RTU A;  2HEQ A;  1QWE A;  1SHF A;  2RQW A;  1PKT A;  2B86 A;  1PNJ A;  2JW4 A;  3FJ5 A;  2F2X A;  1ZSG A;  2GQI A;  3PVL A;  1X43 A;  2FO0 A;  3H0F A;  2E5K A;  2LNH B;  5IHK A; 
#chains in the Genus database with same CATH topology
 3VRZ A;  2PVO B;  3OSV A;  3GP8 A;  1VQ8 T;  1IGQ A;  1JXO A;  2EQM A;  4EPC A;  5I22 A;  5GMK h;  3OYY A;  4JRK A;  1UJ0 A;  4JJD A;  1Q81 R;  2EYZ A;  2V1Q A;  1LNX A;  5EC7 A;  1X2K A;  4JS4 A;  2KT1 A;  5GAN 7;  4FIB A;  2YSQ A;  3H6Z A;  5FU6 C;  4N4I A;  3MP8 A;  1TH7 A;  4MDX A;  2LDM A;  2FYK A;  3P8D A;  3CCE T;  3CCU Q;  1YJ9 T;  3OYJ A;  2AIR B;  2LQK A;  1WIE A;  5GAO p;  4DEY A;  1D0X A;  2IVW A;  4DBF A;  4J8O A;  1VQ5 A;  1VQK A;  5GMK m;  2YWW A;  4E7I A;  2RHX A;  3VS6 A;  4A63 B;  1JEG A;  2VGM A;  4C92 B;  1AD5 A;  2HKN A;  1U5S A;  3CCM Q;  1BB9 A;  2CP6 A;  2VC8 A;  3QKJ A;  2KK4 A;  4PJO D;  2HD0 A;  3A8O B;  1KQS A;  3I9Q A;  2AKL A;  3VUZ A;  3DLM A;  2K3B A;  1NJI C;  5DM7 R;  3C0C A;  4M78 D;  2M0O A;  4AFZ C;  1IRX A;  1UDL A;  1M8M A;  3LGL A;  3QDR B;  4DEX A;  2K5F A;  2LRQ A;  2E10 A;  2K2M A;  2DIG A;  3OS1 A;  1X75 C;  2A0F B;  4LDU A;  2RJF A;  4A4E A;  4KRT A;  1BKB A;  2V8I A;  4KGX B;  1M90 C;  4LUD A;  2D1X A;  3P8H A;  2WAC A;  1SEM A;  4RTV A;  2DM1 A;  3UWN A;  1X27 A;  1BI3 A;  1M9S A;  3M0S A;  1M1K R;  3UDC A;  1T0J A;  4JPB W;  1VOM A;  4M75 G;  2O88 A;  4KUL A;  2XID A;  3CCJ A;  3DKM A;  4OB1 B;  5HY6 A;  4Y91 A;  3A8L B;  4LE9 A;  3EFO A;  1PCX A;  4M7A A;  4ATO A;  3NTH A;  1UGQ B;  1HSQ A;  2B8A A;  2DBM A;  2RJE A;  2EQU A;  2MYS A;  1CKA A;  4EDU A;  3BY7 A;  4ZNX A;  1VQN Q;  4XU2 A;  3CD6 A;  1FMK A;  4YTL A;  1YIT Q;  4HCC A;  3OSS C;  4M7A F;  2L3P A;  2LT4 A;  1JU5 C;  2DL3 A;  2OTJ T;  1PWT A;  1QVP A;  3JCM J;  5D6W A;  3R6N A;  4A4G A;  5CR2 A;  5CIU A;  4BDY A;  5GAO r;  4C5G A;  2BUD A;  1T3L A;  1FXX A;  2DPP B;  1WHJ A;  2MAM A;  4C8Q F;  2O4X A;  2LJ3 A;  2QA4 A;  3RER A;  2EJG A;  5L23 A;  4OML A;  3JCM c;  1PD1 A;  1TTH B;  1UGP B;  2G6F X;  2DL4 A;  2JT4 A;  4RG2 A;  2QTX A;  1BI2 A;  5GAN g;  3CC4 A;  2DA9 A;  2DNU A;  2LQ8 A;  2X4J A;  1BCM A;  5GAN 6;  1AT1 B;  1BIA A;  1HD3 A;  3CCQ T;  2LT1 A;  3OBW A;  4FM4 B;  2E3I A;  4M7D G;  3ME9 A;  3MP6 A;  4PJO G;  5CKE A;  1OV3 A;  1RLP C;  3HKS A;  2EKH A;  8AT1 B;  1H8K A;  1YNZ A;  2DIQ A;  3QO3 A;  5GAN h;  4M77 E;  1NZ9 A;  4FW1 A;  1C6V X;  3M0P A;  3JRZ A;  3CME T;  1H3H A;  4MML A;  5CKF A;  3OYK A;  4CC2 A;  1NEB A;  2IG0 A;  2P0Q A;  1HXD A;  2MPX C;  5IT9 E;  1VQ6 A;  2YUQ A;  2XDB A;  1D1A A;  4Y92 A;  1D3B B;  1WZO A;  2RI3 A;  2NUT B;  2Y4Y A;  4JUV A;  3CC2 A;  4RTW A;  4RCB A;  4BE2 A;  1PG5 B;  3JCM g;  2ED0 A;  3CCL T;  1VYV A;  3CCR A;  1PM3 A;  2L0A A;  1QP2 A;  4M77 C;  2JVV A;  2QEX A;  4Z02 A;  4N0A A;  4F7U G;  2GQV A;  2EPD A;  5IH2 A;  2RHU A;  3OY9 A;  4OB3 B;  4ZGE B;  4JRP A;  5LJ5 d;  1MGQ A;  2JOY A;  3JCM h;  2ESW A;  1WQW A;  1HK9 A;  3UAT A;  4A4F A;  2R5M A;  4QT7 A;  3OYC A;  4IUR A;  1U1S A;  2QQR A;  3G71 T;  1Q86 C;  2EFI A;  4MZT A;  1D1C A;  2RQV A;  2RB6 A;  2CYZ B;  2FRY A;  3L2Z A;  4QVD A;  1UE9 A;  3J80 E;  1YIJ T;  2KBT A;  1YBY A;  1R8O B;  2RK1 A;  3M9Q A;  4ZGJ B;  3A8G B;  1MNE A;  2EGE A;  2E3H A;  2JUF A;  1NJI R;  3OB9 A;  3OYF A;  2L2P A;  2QI2 A;  2VKN A;  1I0C A;  2FZK B;  3MEW A;  4BUG A;  5AT1 B;  5D6X A;  2DLP A;  1Z9Z A;  2XD0 A;  3M59 A;  4Q5W A;  2DJZ A;  3PNW C;  1PRM C;  3OYD A;  5A2Q E;  2LTO A;  2J6O A;  3FB9 A;  1W4S A;  2RH2 A;  4RG8 A;  1C0M A;  1M90 R;  4CC3 A;  3MCA B;  3PTA A;  2H3E B;  4KUD K;  3I55 A;  3OMC A;  5D6Y A;  1U1T A;  2KMT A;  3G71 Q;  4LDW A;  5HK3 A;  3EG3 A;  3SHW A;  5I11 A;  3G7Z A;  3FRN A;  2MWO A;  1QCN A;  5GAM d;  1Q82 C;  1XTD A;  1OQK A;  2HZY A;  2X35 A;  2QQB A;  5LJ3 d;  3CCV T;  2P4R A;  3EGX B;  1VQ9 A;  2L89 A;  1UHF A;  5GAO n;  1PKS A;  4B9X A;  1VYT A;  4OMQ A;  3VS2 A;  3FC3 A;  1QVF P;  1N9S A;  3J7A F;  4Y28 E;  3RUX A;  2DTH A;  4C8Q B;  2LP5 A;  2M1H A;  4RTX A;  1VQ5 Q;  1VQK Q;  3LLR A;  1UB4 A;  2RQU A;  2LX7 A;  4C0D C;  5C6S A;  2DAQ A;  4M75 E;  1NM7 A;  1Y71 A;  4II1 A;  3CC7 T;  3UPU A;  3I35 A;  2JJ9 A;  4HCZ A;  5HKC A;  4IUU A;  2L3Q A;  5J3B A;  3VU3 C;  4M77 D;  2RQR A;  3JSC A;  2ENM A;  5FRN A;  2BZY A;  4LDY A;  1QQJ A;  1ZUK A;  3GOX A;  1LJO A;  2YT6 A;  3PFS A;  2LQW A;  5J39 A;  1AZE A;  1VQN A;  1YIT A;  1WXB A;  3C4S A;  1FMW A;  1UGS B;  5FW9 A;  3CD6 T;  1AHJ B;  3VJP A;  4M75 C;  1E6G A;  4DBQ A;  4E7L A;  2DL8 A;  3A8M B;  2K6D A;  1QVF S;  4WTO B;  1NG2 A;  4QQD A;  4C92 A;  4HKE A;  3OA6 A;  2RQT A;  2HBW A;  5KYX B;  4M78 F;  5KYU B;  9ATC B;  2QA4 T;  3OYG A;  2VXF A;  3CCJ Q;  2XHC A;  1M1F A;  2MF2 A;  1ZSG A;  2L5Q A;  3V7C A;  1KQS P;  1M5Q 1;  3HP9 A;  3L42 A;  2ZCF B;  1LVK A;  1R77 A;  5CKH A;  1M2O A;  1YFN A;  4FYX B;  3OW2 P;  4M7D E;  2KXD A;  2A36 A;  1GCQ C;  3LWI A;  1RAI B;  1AZG B;  3CCS A;  2VAS A;  1IHW A;  3QDF A;  5GAN 4;  4EMK B;  1SPK A;  4IIM A;  2WSC E;  2J6K A;  3H0H A;  2D6F A;  2M0Y A;  2K79 A;  4PK4 A;  5IXB A;  2OAU A;  3G4S A;  3MP1 A;  3FDR A;  2CP5 A;  1EX4 A;  1Q86 R;  2CUD A;  3CQT A;  1VIF A;  2CSQ A;  2HQX A;  2QA4 Q;  2ZPI B;  2RA2 A;  4PJM A;  4OMO A;  4C0G A;  1ZLM A;  4M7D C;  1SRL A;  3E9F A;  3JV3 A;  4PJO C;  3G6E A;  3VS3 A;  4J9E A;  2OAW A;  3CCR T;  3CC4 Q;  1KQS S;  2RHZ A;  1RAC B;  3OYL A;  3JB9 I;  4F7U E;  1QMC A;  4J9G A;  3L2Q A;  1TSF A;  2NUZ A;  2JZ2 A;  5C0M A;  4D8K A;  4PJL A;  2QG9 B;  4L59 A;  3M58 A;  2Y90 A;  3ER0 A;  2RMO A;  3HRS A;  2C06 A;  3BDU A;  4EMG A;  3J81 E;  2F2V A;  1MHN A;  2ZGW A;  3LH0 A;  1TU0 B;  3ZEH A;  2CP3 A;  4JRI A;  5CQY A;  5IN1 A;  4ORZ A;  2EYQ A;  1I5L A;  1NYG A;  2JTM A;  3E2U A;  4X9C A;  4CC4 B;  3QG1 A;  4CI0 C;  1VQ6 Q;  1K8A U;  3HL8 A;  4IUT A;  2AHJ B;  5A0G A;  2EYX A;  1Q82 R;  2OI3 A;  3CC2 Q;  5EG2 A;  2VUB A;  1K9M U;  4M75 D;  5CQX A;  5HK0 A;  1V29 B;  2E6Z A;  2CSI A;  2JM9 A;  5FU7 C;  3HFO A;  4OMN A;  2OX7 A;  2QEX Q;  4J6Y A;  3M0T A;  4O6J A;  5KYY B;  2M16 A;  2CZ1 B;  4BY6 C;  4XTZ A;  1GFD A;  1AOJ A;  2DIL A;  4NL2 A;  3CCM T;  5LL6 S;  2VV5 A;  3A98 A;  1D3B A;  4FSX A;  4DA4 A;  2C0I A;  3CBM A;  2NUT A;  2JS0 A;  1S72 A;  2HL3 A;  4O5V A;  2HSE B;  4EIK A;  2PUO B;  2EW3 A;  3CXC A;  3LH5 A;  1PD0 A;  1YJW A;  1NEG A;  2GCX A;  1OZ2 A;  1X01 A;  3S3O A;  1PC0 A;  4L5G A;  4PJO B;  2KXC A;  3CBP A;  1VQ9 T;  2CZ0 B;  1X6B A;  1RLQ C;  1IZ6 A;  4IIO A;  2XG8 D;  4M78 B;  2MOX A;  4R55 A;  3OBY A;  1VQL A;  2A37 A;  3V7S A;  4FU6 A;  3TVT A;  5FLX E;  1G3Y A;  3S6W A;  1C1A A;  4PFZ A;  5GAM j;  3HRT A;  2VB6 A;  2QQS A;  4GLK A;  5DLO A;  1ZSZ C;  2KE9 A;  3X26 B;  3I55 Q;  1TUD A;  3MKD A;  5LJ3 j;  2OTL Q;  1W2B A;  4M7D D;  2ATC B;  2JMA A;  1Y57 A;  3SWN B;  4R0K A;  4J83 A;  3QYG B;  5GAN f;  4BB7 A;  4C5I A;  1VQ7 A;  3X20 B;  1SHG A;  2CH4 W;  2KT8 A;  4E7S A;  1QWF A;  3OW2 A;  4E7J A;  3SD4 A;  3GNF B;  1VQP Q;  1VQN T;  1M30 A;  1VA7 A;  1YIT T;  1VQ9 Q;  1S1N A;  2GFU A;  3TRE A;  1YJN A;  2FEI A;  2CH4 A;  1BCO A;  3P8B B;  5GMK e;  1K76 A;  2LCS A;  3MET A;  1WA7 A;  1TOV A;  2I0N A;  4RTZ A;  1H3Z A;  4J9H A;  3KXT A;  4QKU A;  1ABO A;  1WHK A;  1KD1 U;  3F70 A;  2V26 A;  2NLU A;  2OJ2 A;  4LXC A;  2R58 A;  2XMF A;  3VS4 A;  4J9F A;  2NUP B;  4C92 D;  2ROT A;  2VGN A;  3PIO A;  3MEA A;  2HKQ B;  1JJ2 A;  5D7U A;  2QK0 A;  2FHD A;  3JCM f;  4HVV A;  3QSU A;  3H8Z A;  4V2S A;  1CSK A;  4GLM A;  3EGX A;  1O9S A;  1KD1 R;  6AT1 B;  3EFS A;  2ZAE A;  5FU6 B;  1IRE B;  4E7K A;  3HHT B;  2PQW A;  1QCO A;  1AEY A;  4C8Q A;  2LX9 A;  1G8X A;  2DRM A;  2QQA A;  2C0O A;  2D0Q B;  4RCC A;  3D7S B;  1B07 A;  2QDY B;  1QVG A;  1Q95 G;  3TSW A;  3EHR A;  4A4H A;  2VWF A;  3I5R A;  1FWZ A;  2FPD A;  1RAA B;  1VUB A;  4KT0 E;  4M77 F;  3C94 A;  1SG5 A;  3OQ5 A;  1ZSZ B;  5ECA A;  4XTX A;  4NS5 A;  4XU1 A;  1EZZ B;  1D09 B;  2GTO A;  3PGG A;  2DTI A;  4QVZ A;  3JB9 H;  1K4U S;  2DXU A;  1MV0 B;  3GBQ A;  1VQO A;  2EVR A;  1NYF A;  2M9U A;  1K73 U;  4F16 A;  4F04 B;  1PSE A;  1B3Q A;  2RD1 A;  3EG0 A;  5FRO A;  1WDX A;  4JRQ A;  1BK2 A;  2DL7 A;  3X25 B;  1MV3 A;  3CCS Q;  3JB9 D;  5KYX A;  3KUF A;  2X4X A;  5KYU A;  2DE0 X;  2WSF E;  3I56 Q;  3G1J A;  4M7A E;  1BU1 A;  1WHG A;  1K73 R;  1HYO A;  3PVQ A;  3G4S Q;  1FMV A;  2BE7 D;  1KQ2 A;  1EFN A;  1WGS A;  1RI9 A;  2BZ8 A;  3O8V A;  5KE2 A;  4OF1 A;  2A3L A;  3JCM X;  1UHC A;  1XNI A;  3VYG A;  3NMZ C;  2V8K A;  2RJD A;  1GBR A;  4QQ6 A;  1AVZ C;  2GTJ A;  4DQ2 A;  1KFZ A;  1ZX6 A;  1NLO C;  3OYE A;  1Q7Y U;  1B7T A;  3GIB A;  4BE0 A;  3RDV A;  3G6E Q;  1I81 A;  2YUN A;  5LJ5 g;  2FZG B;  4C92 G;  2HBP A;  2DZ9 A;  3S3N A;  4EMK A;  2E70 A;  4RTT A;  3OS5 A;  4M7A C;  4XTY A;  2JTE A;  4E2F B;  1GL5 A;  1Q7Y R;  4PJN A;  5LJ5 h;  2DMO A;  4CRI A;  2CZ6 B;  3ZBD A;  2ZPF B;  2SRC A;  5KYW B;  2QQ9 A;  4OB0 B;  2JN0 A;  1SRM A;  1YWP A;  2R5A A;  4XTV A;  2EIF A;  2YUO A;  2YRC A;  1S72 T;  4FT4 A;  3QJY A;  7AT1 B;  1IB8 A;  3OMG A;  2FL7 A;  4RTU A;  5GAN e;  3R6O A;  1SHF A;  2F5T X;  2E5Q A;  4DOV A;  1PNJ A;  2JW4 A;  5GAN 3;  4JDS A;  2F2X A;  2GQI A;  1YI2 A;  2QGG A;  1X43 A;  2XK0 A;  4E47 A;  1TWB A;  1XJW B;  2FO0 A;  3H0F A;  1MMA A;  4OGE A;  5IHK A;  1OPK A;  1VQL T;  1RL2 A;  2YUP A;  2RPN A;  1VQ5 T;  1VQK T;  2VVK A;  1JB0 E;  4GY5 A;  3PE0 A;  5GAO q;  1VQM A;  4HVW A;  3JCM Q;  1WHL A;  4KGV B;  5GJW B;  2OTL A;  5GMK j;  2M51 A;  3EG9 B;  2L8D A;  4M75 F;  2ZPH B;  3VUB A;  2YLC A;  1KIK A;  4FSS A;  1JO8 A;  2E64 A;  1RAD B;  8ATC B;  4DOW A;  3JB9 G;  2QXF A;  2FB7 A;  2PNI A;  2PTK A;  1S72 Q;  4J7I A;  4ESR A;  1VQP A;  1KHC A;  4AMC A;  3JCM e;  4JJN K;  1LCK A;  2GNC A;  1VQ8 A;  1YJW Q;  2CGH A;  2DTO A;  2J06 A;  3KFV A;  3TU4 K;  1O75 A;  5KYY A;  1K8A C;  2CP0 A;  5LJ3 h;  2J05 A;  2PU9 B;  2FG0 A;  2HQE A;  1KG1 A;  3QZ5 B;  4M77 B;  1W1F A;  4C5E A;  5CK9 A;  1YJN T;  3V7R A;  3RIR A;  1RAG B;  2K5L A;  3UF4 A;  3TEE A;  2E65 A;  1K9M C;  1VQL Q;  1X6G A;  4Z88 A;  5L8R E;  3NTI A;  4PNO A;  1BYM A;  3JCM P;  4ZTJ A;  1U3O A;  1UUE A;  1ARK A;  1BI0 A;  3GPL A;  5A0L A;  4N0A C;  3CCJ T;  2EKO A;  2QTV A;  5KCO A;  2LQN A;  2KRM A;  3CPF A;  2MI6 A;  3V8J A;  3OYN A;  2MWP A;  1BIB A;  4Z8A A;  1VQ7 Q;  3SFM A;  3UT1 A;  4MZP A;  1U8R A;  4PJO A;  1T3S A;  2RNA A;  4JZ4 A;  5KCH A;  1VQ4 A;  2GGR A;  4FYW B;  3CXC P;  1M3C A;  4M7A D;  4XU3 A;  2EBP A;  3H41 A;  2CRE A;  3U23 A;  1SKU B;  4M78 A;  2E41 A;  4RKU E;  4PFO A;  1EIF A;  5KH6 A;  2KDS A;  1GXI E;  3SB2 A;  1YJN Q;  4M7D F;  3M57 A;  4PJO F;  4B9W A;  4PFP A;  3NPF A;  3RKW A;  4BI3 A;  4AG1 C;  4HA8 A;  3VS5 A;  3MEV A;  1OUL A;  2CDT A;  2O01 E;  3SWN A;  2RF0 A;  3L2U A;  4ZN3 A;  4X34 A;  2JMC A;  3QJ6 A;  3NTK A;  1Y0M A;  2E6N A;  2VYT A;  2DZC A;  1SSH A;  1W2B P;  1OZ3 A;  2HNI A;  3TSZ A;  3HFN A;  2A7Y A;  4JLI A;  3VKI A;  2H3J A;  4MZM A;  1KSW A;  1JXM A;  2DBK A;  2R57 A;  3CC4 T;  5IHI A;  4BE1 A;  5GAN 5;  3KBG A;  2BKD N;  3M56 A;  1VQO T;  3FIF A;  1GRI A;  2X4Y A;  4J9B A;  2E4H A;  4BAC A;  2AZS A;  3CXC S;  1ABQ A;  1N8R U;  2CKK A;  1LOJ A;  3I56 A;  4KH0 B;  4F7U F;  5DLQ E;  2XDD A;  3CMA Q;  2X3W D;  4QQG A;  3CEY A;  3L2R A;  2FZC B;  2X51 A;  3WVE B;  1M2V B;  2GF7 A;  2EJ9 A;  2RO0 A;  2NUP A;  3GLX A;  2FRW A;  2DF6 A;  2G3R A;  5IXF A;  4JJB A;  4CC7 A;  2K5I A;  4C0D B;  4BDZ A;  3A1P A;  3MEU A;  1N5Z A;  1WFW A;  1VQ6 T;  3IQL A;  3LX7 A;  3PT9 A;  2OTJ A;  4PKC C;  3H9N A;  2V8J A;  1JJ2 P;  1KD1 C;  3CC2 T;  4HCK A;  4XK8 E;  4JS5 A;  2K9G A;  1XQH A;  1MND A;  4C0Z A;  1W2B S;  1I5O B;  5IAY A;  2DD4 A;  1WHM A;  1KC8 U;  1WNL A;  4LD9 K;  3E1S A;  5A0D A;  4C92 E;  2DO3 A;  2QEX T;  1VQO Q;  3N5B B;  1YWO A;  3M0R A;  1Y96 B;  2DD5 A;  3NGP A;  1TUG B;  3EH1 A;  1FX7 A;  2YXY A;  3OW2 S;  2X4W A;  4PJJ A;  1V1C A;  4M75 B;  1H92 A;  4R56 A;  2LCC A;  1PRL C;  2KRS A;  4X1V A;  1QVG P;  1NPR A;  3HPW A;  4M7A G;  3M0Q A;  2AKK A;  1ZSZ A;  1KC8 R;  2DJQ A;  1E6H A;  1GFC A;  2EYY A;  4LN2 A;  4BI8 B;  3CPW A;  3FLG A;  3OS2 A;  5CAI A;  2KI7 A;  1H64 1;  4J9D A;  1AWW A;  1A0N B;  2HSP A;  4C8Q G;  3L2W A;  3HRU A;  4C92 C;  2P84 A;  3CME A;  1WXU A;  3H0I A;  2DL5 A;  2GFA A;  2ZPB B;  3E9G A;  2RK2 A;  3JCM W;  1RAF B;  3Q1J A;  1JJ2 S;  1G3S A;  2DFU A;  1K8A R;  1K9A A;  2RI2 A;  1G3T A;  2EQI A;  4C0F A;  3QWY A;  1TUC A;  3UA6 A;  4PLI A;  1D1B A;  1E7O A;  3CCL A;  2K2V A;  1K9M R;  2AZV A;  4PL6 A;  3QII A;  1K73 C;  3I55 T;  3RKX A;  2OTL T;  3PMI A;  2RHI A;  2O9V A;  1QVG S;  3L1A A;  1Q81 U;  2CS7 A;  3DLL A;  4J9C A;  2DXC A;  1KHI A;  2DET A;  1I07 A;  1HJD A;  1X2Q A;  4XTW A;  2JXB A;  3C12 A;  4UC4 A;  1VQP T;  1RUW A;  4M7D B;  4JZ3 A;  1JRI A;  3EHQ A;  2X3X D;  2SEM A;  5FRM A;  3INZ A;  4J9I A;  2JNG A;  1YIJ A;  4WCI A;  1YI2 Q;  1F1B B;  2K7A A;  3EH2 A;  2XKO C;  3VS7 A;  5GJV B;  1Q7Y C;  1OU8 A;  1OU9 A;  5GAN 2;  3ASK A;  1M27 C;  2GBQ A;  2DYI A;  5KYW A;  5CVI A;  2P4T A;  2KR3 A;  2LNV A;  1VQM Q;  3X24 B;  1KK7 A;  4NL3 A;  5GAO l;  1WHH A;  4IUP A;  2YLB A;  4ZTF A;  4KH1 B;  2D9T A;  2RI5 A;  2VXE A;  4HT9 A;  2LJ1 A;  4ANJ A;  4F14 A;  1QKX A;  1K0S A;  1ZBX A;  1K0X A;  3NHN A;  4D6W A;  1VQ4 T;  4ZN1 A;  4Z89 A;  4F7U B;  2KSS A;  4RUG A;  3M55 A;  2A08 A;  1VQ8 Q;  3BFM A;  1I8F A;  5FU7 B;  4XU0 A;  1U06 A;  1ZBJ A;  3RMS A;  3HSB A;  2LJ0 A;  3URG A;  4KBM B;  2BZX A;  4HT8 A;  3CCV A;  4BY6 B;  1M1K U;  1OX9 A;  3EAE A;  3EG9 A;  1YHQ A;  1RI0 A;  5CKB A;  4B6M A;  3JB9 J;  2RN8 A;  3CCE Q;  3V8L A;  4KUI A;  4A53 A;  1YJ9 Q;  1FYN A;  1QP3 A;  2ZZD A;  2PZ1 A;  3RMQ A;  1QKW A;  1WPY A;  2P0P A;  4LUE A;  3RKY A;  3A5Z B;  1IXD A;  5LJ5 f;  3L2V A;  1M8V A;  4J6W A;  2XDP A;  1G3W A;  3FJP A;  1BI1 A;  2BTT A;  1WJS A;  2KAF A;  4A4K A;  3CC7 A;  2CUB A;  2QAZ A;  1VQ4 Q;  4M77 A;  2ECZ A;  3X28 B;  1LPL A;  2CP7 A;  1ZQ1 A;  2KRO A;  1ZHI A;  1SSF A;  3QWX X;  1UGR B;  1WJR A;  2KRN A;  3THK A;  3CMA A;  3CCS T;  2JTF A;  1QWE A;  3I56 T;  2MK5 A;  4FYV B;  5I21 A;  1UEB A;  4X9D A;  3LWH A;  2B86 A;  3FEO A;  3FJ5 A;  4PLL A;  1OYX A;  2E12 A;  3G4S T;  1NE8 A;  2E5K A;  2BIV A;  5GAO m;  1YP5 A;  2D0N A;  2KY9 A;  5M9O A;  1YCY A;  1I1J A;  2JM8 A;  3M4G A;  1I4K 1;  4EMH A;  1B34 B;  2DXB A;  1NPP A;  1MUZ A;  4JJC A;  1P92 A;  1AWX A;  3G6E T;  3ULR B;  3EG1 A;  1UG1 A;  2EJF A;  2L3S A;  1IGU A;  2A28 A;  1QCF A;  3REB B;  4RTY A;  4QVC A;  5GAM f;  1M3A A;  2KNB B;  3REA B;  3AHU A;  4NOY A;  3EGD B;  3EFR A;  4N4G A;  2XIC A;  2COW A;  4E6R A;  5LJ3 f;  1UEC A;  4OB2 B;  4J7F A;  1KJW A;  1YCS B;  4FCY A;  2CP2 A;  5GAN d;  2DYB A;  4D8D A;  4LNP A;  4GBQ A;  2D8H A;  2DEQ A;  2M02 A;  4M78 G;  2OTJ Q;  2DX1 A;  1UJY A;  4C8Q E;  2E1H A;  2C0T A;  2AK5 A;  2FVU A;  3QYH B;  4A54 A;  2F1L A;  2QAS A;  2DRK A;  1W70 A;  2HMA A;  4FL6 A;  2RHY A;  2K3X A;  1G5V A;  4M4Z A;  3DB3 A;  3M0U A;  1XOV A;  1T0H A;  1M2V A;  5IHN A;  1W6X A;  2Y4X A;  4OGC A;  3RES A;  1NLP C;  1PSF A;  2YRV A;  3VS1 A;  3OYM A;  1N6A A;  4VUB A;  2HQH A;  4BI4 A;  3CCQ Q;  3M5A A;  3M54 A;  4C8Q C;  1N8R C;  3JCM d;  3CBO A;  2QYZ A;  4MDW A;  3JCM V;  5GMK i;  4DBR A;  3TQ7 P;  3MHX A;  1NJI U;  2DK3 A;  4XAX B;  1WI7 A;  3RNJ A;  2IPO B;  1YJW T;  1MMN A;  3QBY A;  3CME Q;  4E7H A;  4TVR A;  4FT2 A;  1R0B G;  2DKG A;  2J6F A;  2D8J A;  1Y96 A;  5DY9 A;  2DVJ A;  4ELZ C;  3OS0 A;  2LMJ A;  2DXT A;  3AT1 B;  1TG0 A;  3RBB B;  1J3T A;  1VIE A;  4M75 A;  1Z9Q A;  1M90 U;  2EAY A;  3OYB A;  5CO7 A;  1WXT A;  3M4Y A;  3RR6 A;  1RAE B;  2NYS A;  1KC8 C;  3CCU A;  5GAM g;  3CCL Q;  3QZ9 B;  2I2L A;  4XTU A;  2X9H A;  3BE3 A;  2QDL A;  2O31 A;  5LJ3 g;  3MJX A;  1VQ7 T;  1WYX A;  3CPW P;  3E19 A;  4L6V 5;  1QW1 A;  3CCM A;  3SEM A;  5GAM h;  3LGF A;  2YDL A;  1OEB A;  1IO6 A;  4J6X A;  3PIP A;  4HCB A;  4IUV A;  3A8H B;  2EWN A;  5LJ5 e;  2MMP A;  2EGC A;  1GCQ A;  2H8H A;  1WQ7 A;  1Y7X A;  4AFU C;  2KYM A;  3SDZ A;  1YIJ Q;  3OYI A;  2EYW A;  2K4Y A;  3EFO B;  4M7A B;  1CKB A;  4OP0 A;  1G2B A;  4F17 A;  1MMG A;  2BE9 B;  2ZPG B;  4IUQ A;  1GBQ A;  1UFF A;  1KQ1 A;  3CCE A;  2Z0W A;  1YHQ T;  1YJ9 A;  1M3B A;  1WX6 A;  3LYI A;  4EMK C;  5HCK A;  2DEU A;  1JBM A;  1R0C B;  2RM4 A;  2NWM A;  4M7D A;  2HAX A;  3NFC A;  4XQ3 A;  3TCJ A;  3QHS A;  1N27 A;  1BBZ A;  3CPW S;  2P0K A;  1Q81 C;  1PHT A;  1DJ7 B;  4LD6 A;  2XI9 A;  2O4X B;  4DBH A;  3VRY A;  4AFS C;  1ACM B;  4FYY B;  2XU8 A;  4JLG A;  3CMA T;  2F5K A;  3M53 A;  4C8Q D;  2F2W A;  3GNG A;  1TS9 A;  5GAM e;  3CCV Q;  2CT4 A;  1YHQ Q;  1M4Z A;  3JAM E;  5GAN 8;  4ME7 A;  5CCA A;  5FWC A;  1OX8 A;  5LJ3 e;  1VYU A;  2YRD A;  3OYH A;  2ROL A;  2KYB A;  1NBE B;  3VS0 A;  4F7U A;  4AG2 C;  4E7Z A;  2HCK A;  2LZ6 B;  1YN8 A;  5KE3 A;  1OPL A;  2W0Z A;  2AT1 B;  3VV0 A;  4IKF A;  3I5S A;  4RMO A;  2L3R A;  3CC7 Q;  3ZL7 C;  2KQW A;  1D0Z A;  1ZUU A;  1ZUY A;  3T9N A;  2K57 A;  2WSE E;  4FW2 A;  2LCL A;  3BDL A;  3JCM b;  4C92 F;  1WJQ A;  4OMP A;  1X69 A;  4LDX A;  1RAB B;  2QGF B;  2LC4 A;  4HXJ A;  2PVD B;  5FWB A;  1GCP A;  3WVD B;  3V8K A;  4ZGD B;  1X6O A;  4N4H A;  3UA7 A;  1Q86 U;  4PJO E;  3DB4 A;  4ELY C;  3HTR A;  1M1G A;  1N8R R;  2V1R A;  2FPE A;  3CD6 Q;  2O9S A;  2DER A;  3EGU A;  1M1K C;  4M78 E;  2KGT A;  3C95 A;  4MMK A;  2ABL A;  4LDV A;  2MIO A;  3MO8 A;  2O2O A;  2PUK B;  1UTI A;  3GF5 A;  1G83 A;  3EG2 A;  2HL5 C;  3O5Z A;  2MCN A;  1ZA2 B;  4HVU A;  5GAN j;  2F69 A;  1K1Z A;  1RAH B;  2JS2 A;  2EQJ A;  3MPU B;  2J7I A;  3CCQ A;  4OMM A;  2W10 A;  2LVM A;  5KYN A;  5AYF A;  1OOT A;  2EGA A;  4M78 C;  4K11 A;  5I2M A;  2IIM A;  1ZA1 B;  5CKD A;  1B34 A;  1Y07 A;  3WXM B;  5GMK l;  1IHV A;  4M77 G;  2CT3 A;  1Q82 U;  1QLY A;  2KVQ G;  3PMT A;  2HDA A;  1AWO A;  4P5N A;  2FPF A;  4AFQ C;  1OI1 A;  3SWN C;  3JB9 F;  1MMD A;  2K3Y A;  4J5Y A;  1UGV A;  3VYH B;  1D0Y A;  2EQK A;  2CZ7 B;  1V76 A;  1AWJ A;  1YI2 T;  2COZ A;  3LW5 E;  3OYA A;  3EGD A;  3BW1 A;  4C5H A;  3QUI A;  5LJ5 j;  3QXE B;  2ED1 A;  4BD3 A;  3S3M A;  1WLP B;  1VQM T;  3ZFJ A;  2PVG B;  1QVF A;  1SF9 A;  1JQQ A;  3CCU T;  2ZPE B;  4OVA A;  5I2S A;  3CCR Q;  2KEA A;  2RJC A;  2YHT A;  2HEQ A;  2COY A;  1N9R A;  1TXQ A;  2RQW A;  4WF2 A;  4QW2 A;  5J26 A;  2DVE A;  4KGZ B;  1PKT A;  4AT1 B;  3PVL A;  3G71 A;  3QPH A;  4OMF B;  2LNH B; 
#chains in the Genus database with same CATH homology
 3VRZ A;  1OPK A;  1YP5 A;  2D0N A;  2YUP A;  2RPN A;  2VVK A;  1JXO A;  1I1J A;  5I22 A;  2JM8 A;  3PE0 A;  1UJ0 A;  4JJD A;  2EYZ A;  4HVW A;  2V1Q A;  5GJW B;  1MUZ A;  2KXD A;  2A36 A;  1GCQ C;  5EC7 A;  4JJC A;  1X2K A;  2KT1 A;  1AWX A;  2M51 A;  1AZG B;  2YSQ A;  3ULR B;  1SPK A;  3EG1 A;  4IIM A;  1UG1 A;  1KIK A;  2L3S A;  2J6K A;  3H0H A;  4FSS A;  1JO8 A;  2A28 A;  2M0Y A;  1QCF A;  2K79 A;  3REB B;  5IXB A;  2PNI A;  4RTY A;  2PTK A;  1WIE A;  4ESR A;  1M3A A;  4DEY A;  2KNB B;  3REA B;  1LCK A;  2CUD A;  2GNC A;  3CQT A;  2CSQ A;  3KFV A;  2J06 A;  4E6R A;  1UEC A;  2J05 A;  2FG0 A;  1W1F A;  4OMO A;  3VS6 A;  4A63 B;  1KJW A;  1JEG A;  1ZLM A;  1YCS B;  1AD5 A;  1SRL A;  1U5S A;  3JV3 A;  2DYB A;  3UF4 A;  1BB9 A;  4J9E A;  3VS3 A;  4D8D A;  4LNP A;  2OAW A;  4GBQ A;  2D8H A;  1X6G A;  4Z88 A;  3I9Q A;  2AKL A;  2K3B A;  2DX1 A;  1U3O A;  1UJY A;  1UUE A;  3C0C A;  1ARK A;  2C0T A;  2AK5 A;  4J9G A;  4AFZ C;  2NUZ A;  1UDL A;  1M8M A;  2DRK A;  1W70 A;  4D8K A;  4DEX A;  2LQN A;  2KRM A;  2K2M A;  4Z8A A;  4M4Z A;  2RMO A;  1T3S A;  4KRT A;  2RNA A;  4JZ4 A;  3M0U A;  2GGR A;  1XOV A;  1T0H A;  2D1X A;  4LUD A;  2F2V A;  5IHN A;  1M3C A;  2EBP A;  3H41 A;  1W6X A;  2CRE A;  1SEM A;  4ORZ A;  3U23 A;  4RTV A;  1NLP C;  1NYG A;  2DM1 A;  1X27 A;  3VS1 A;  4CC4 B;  3M0S A;  2EYX A;  1T0J A;  4JPB W;  2O88 A;  2OI3 A;  3NPF A;  4AG1 C;  3VS5 A;  4LE9 A;  2CSI A;  1WI7 A;  2JM9 A;  3RNJ A;  2CDT A;  4OMN A;  2RF0 A;  1HSQ A;  3M0T A;  2JMC A;  1Y0M A;  2DBM A;  2J6F A;  2D8J A;  1GFD A;  1SSH A;  1AOJ A;  2DIL A;  2DVJ A;  1CKA A;  3TSZ A;  2LMJ A;  3RBB B;  1TG0 A;  4ZNX A;  1KSW A;  1J3T A;  1JXM A;  1Z9Q A;  3A98 A;  1FMK A;  2DBK A;  2L3P A;  5IHI A;  1JU5 C;  2DL3 A;  2C0I A;  1WXT A;  1PWT A;  2JS0 A;  3R6N A;  1GRI A;  4J9B A;  1T3L A;  4EIK A;  2AZS A;  2EW3 A;  3LH5 A;  1ABQ A;  1NEG A;  2LJ3 A;  2QDL A;  2O31 A;  2X3W D;  5L23 A;  1WYX A;  2KXC A;  4OML A;  2FRW A;  1X6B A;  2DF6 A;  5IXF A;  1RLQ C;  2G6F X;  4JJB A;  2DL4 A;  4IIO A;  3SEM A;  4CC7 A;  2JT4 A;  2MOX A;  2YDL A;  1OEB A;  1IO6 A;  2A37 A;  3TVT A;  1N5Z A;  1WFW A;  2DA9 A;  3IQL A;  2DNU A;  1HD3 A;  1GCQ A;  2EGC A;  2H8H A;  4AFU C;  2KYM A;  4HCK A;  2K9G A;  2KE9 A;  1OV3 A;  1RLP C;  1TUD A;  2EYW A;  2EKH A;  1CKB A;  2JMA A;  1Y57 A;  1G2B A;  4R0K A;  4F17 A;  1H8K A;  1YNZ A;  1GBQ A;  1UFF A;  3M0P A;  1YWO A;  1SHG A;  2CH4 W;  3M0R A;  1M3B A;  1H3H A;  2KT8 A;  3NGP A;  4CC2 A;  1QWF A;  1NEB A;  1WX6 A;  5HCK A;  1V1C A;  1H92 A;  2YUQ A;  1PRL C;  2KRS A;  2NWM A;  4X1V A;  4Y92 A;  1M30 A;  1VA7 A;  3M0Q A;  2AKK A;  1S1N A;  2DJQ A;  1E6H A;  4RTW A;  2FEI A;  2CH4 A;  1GFC A;  1BBZ A;  2EYY A;  4LN2 A;  1K76 A;  2LCS A;  1WA7 A;  2I0N A;  2ED0 A;  4J9D A;  1VYV A;  1AWW A;  1A0N B;  1PHT A;  4RTZ A;  4J9H A;  2L0A A;  1ABO A;  3VRY A;  4AFS C;  2HSP A;  1WXU A;  3H0I A;  2OJ2 A;  2DL5 A;  2XMF A;  2EPD A;  3VS4 A;  4J9F A;  5IH2 A;  2ROT A;  2F2W A;  2ESW A;  4HVV A;  3UAT A;  4QT7 A;  1CSK A;  2CT4 A;  1K9A A;  4GLM A;  2EQI A;  2RQV A;  3QWY A;  1TUC A;  5FWC A;  3UA6 A;  2FRY A;  1E7O A;  1UE9 A;  2AZV A;  1VYU A;  2KBT A;  1AEY A;  2ROL A;  2KYB A;  3VS0 A;  2EGE A;  4AG2 C;  2DRM A;  2HCK A;  2L2P A;  1YN8 A;  2C0O A;  2LZ6 B;  2VKN A;  2O9V A;  1B07 A;  1OPL A;  2W0Z A;  1I0C A;  3I5S A;  3TSW A;  3EHR A;  4J9C A;  3ZL7 C;  2DLP A;  1ZUU A;  1Z9Z A;  1ZUY A;  2VWF A;  3I5R A;  2FPD A;  1I07 A;  1HJD A;  1PRM C;  1X2Q A;  2JXB A;  2J6O A;  4OMP A;  1X69 A;  1RUW A;  4JZ3 A;  3EHQ A;  2X3X D;  2SEM A;  4CC3 A;  5ECA A;  4HXJ A;  4J9I A;  2GTO A;  5FWB A;  1GCP A;  4WCI A;  3UA7 A;  2K7A A;  3VS7 A;  1K4U S;  5GJV B;  2V1R A;  1MV0 B;  2FPE A;  2O9S A;  3EG3 A;  3GBQ A;  2EVR A;  3SHW A;  5I11 A;  3EGU A;  1M27 C;  2GBQ A;  2KGT A;  1NYF A;  2ABL A;  2KR3 A;  4F16 A;  2MIO A;  1B3Q A;  3EG0 A;  2O2O A;  1WDX A;  1BK2 A;  2DL7 A;  1MV3 A;  1UTI A;  2P4R A;  1G83 A;  3EG2 A;  2LJ1 A;  3O5Z A;  2MCN A;  2DE0 X;  1UHF A;  4F14 A;  1QKX A;  1K0S A;  1PKS A;  1VYT A;  4HVU A;  4OMQ A;  3VS2 A;  1K0X A;  1BU1 A;  1K1Z A;  3NHN A;  2JS2 A;  3PVQ A;  4Z89 A;  4RUG A;  2LP5 A;  2J7I A;  1EFN A;  1RI9 A;  2BZ8 A;  4RTX A;  4OMM A;  2A08 A;  1UHC A;  2W10 A;  3NMZ C;  2RQU A;  2LX7 A;  1OOT A;  2EGA A;  1GBR A;  4K11 A;  1AVZ C;  1NM7 A;  2GTJ A;  2IIM A;  1KFZ A;  1ZX6 A;  1U06 A;  1ZBJ A;  1NLO C;  3I35 A;  2LJ0 A;  2YUN A;  2BZX A;  2L3Q A;  2CT3 A;  1QLY A;  4RTT A;  2RQR A;  2HDA A;  2ENM A;  1AWO A;  2BZY A;  2RN8 A;  1ZUK A;  2FPF A;  4AFQ C;  1FYN A;  2JTE A;  2YT6 A;  2PZ1 A;  1QKW A;  1UGV A;  2LQW A;  1AZE A;  1GL5 A;  4LUE A;  1AWJ A;  1WXB A;  2DMO A;  2SRC A;  5FW9 A;  2BTT A;  2CUB A;  1E6G A;  1SRM A;  2DL8 A;  2ED1 A;  2ECZ A;  1YWP A;  1WLP B;  2K6D A;  1JQQ A;  1NG2 A;  2KRO A;  2YUO A;  2RQT A;  2KEA A;  3QWX X;  2HBW A;  2KRN A;  3THK A;  4RTU A;  2HEQ A;  1QWE A;  1SHF A;  2RQW A;  1PKT A;  2B86 A;  1PNJ A;  2JW4 A;  3FJ5 A;  2F2X A;  1ZSG A;  2GQI A;  3PVL A;  1X43 A;  2FO0 A;  3H0F A;  2E5K A;  2LNH B;  5IHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...