1W6XA

Sh3 domain of p40phox, component of the nadph oxidase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
b'MRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEUTROPHIL CYTOSOL FACTOR 4
publication title Effects of P47Phox C-Terminus Phosphorylation on Binding Interactions with P40Phox and P67Phox: Structural and Functional Comparison of P40Phox P67Phox SH3 Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
total genus 11
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w6xA00
1Z9QA 1WXTA 1SRMA 1UHCA 2K2MA 2EKHA 1VYTA 2ROLA 1T0HA 3I5SA 2JM8A 2FPEA 3FJ5A 3H0IA 1IO6A 2K79A 2AZSA 3NPFA 4E6RA 2BZ8A 1VYUA 1X2QA 3R6NA 1J3TA 5FWCA 2DE0X 3M0TA 2JTEA 4LN2A 4OMPA 3QWXX 3UF4A 4OMQA 5IXFA 1BU1A 1RUWA 2K9GA 2D8HA 1AWXA 2YDLA 2YUOA 3H0HA 3SHWA 2EBPA 1ZX6A 4AFZC 3LH5A 1YCSB 1JQQA 3TSWA 3EG0A 2DLPA 1SSHA 3RNJA 2EYYA 3I9QA 4M4ZA 1K9AA 4J9EA 2LQNA 1ZBJA 4J9DA 1SPKA 2DA9A 1YNZA 1KJWA 2MOXA 4OMOA 1BB9A 1S1NA 1GCQC 1MV3A 1W6XA 3VS0A 5I11A 2ESWA 4LUDA 4K11A 3EG3A 1CSKA 1VYVA 1E7OA 2GGRA 5IHIA 2GQIA 4OMLA 2ED1A 1BBZA 1AEYA 4HVWA 2EQIA 2LJ1A 2J05A 1UG1A 1NYGA 4EIKA 2CUBA 3I35A 2DM1A 4FSSA 1KIKA 2FPFA 2RPNA 2GTJA 2A08A 1H3HA 3A98A 4JJDA 1AWWA 2AKKA 2JT4A 3VRYA 4GLMA 1YN8A 2DL7A 2ECZA 4RTYA 1PKTA 2CSIA 1PWTA 3C0CA 2JS2A 1X6BA 3UA6A 4R0KA 1ZUYA 1CKBA 1G83A 2RQWA 1G2BA 2J7IA 2LJ3A 2EYWA 2E5KA 4HVVA 1SHGA 2RQTA 2FEIA 2GNCA 1PRMC 3M0UA 4Z89A 1AVZC 2J6OA 2DL3A 4DEXA 1YWOA 2RMOA 3THKA 4RTVA 2K3BA 3PVLA 2DVJA 2LJ0A 1GBRA 2OAWA 3TVTA 1OV3A 2DMOA 2DILA 1SHFA 1VA7A 2C0OA 2VVKA 2EVRA 2K7AA 1PRLC 2J06A 4ZNXA 2KEAA 2EPDA 1NM7A 2YUPA 2MCNA 4IIOA 3RBBB 1B3QA 3IQLA 2J6FA 3QWYA 1CKAA 1HD3A 2JXBA 3VS1A 1U3OA 1ABOA 2KR3A 4RTTA 2KGTA 4JJCA 1M3AA 4DEYA 1E6GA 4WCIA 2VKNA 3SEMA 2RN8A 2SEMA 5IH2A 2A28A 2P4RA 4HCKA 2PNIA 2LNHB 1NLOC 1AWJA 1K76A 1QLYA 4JPBW 2CDTA 2YUNA 2KROA 2PZ1A 1GFCA 1X2KA 1SRLA 3VS3A 2DNUA 2O9SA 2CREA 2O31A 2H8HA 1UTIA 2BZYA 1B07A 1W1FA 2ED0A 1V1CA 2KXCA 1UE9A 1WIEA 1K0XA 4OMMA 2V1QA 2KT8A 2RQRA 1YP5A 4Y92A 1OPKA 5HCKA 4AFSC 1WLPB 2OI3A 2KYMA 2OJ2A 2W10A 2DF6A 1SEMA 2KYBA 4J9HA 4D8KA 1GCPA 2DX1A 1ZSGA 2V1RA 4AG1C 1UECA 3EG1A 2FRWA 2KRSA 2AK5A 2DRMA 1OOTA 4ORZA 4CC2A 3I5RA 1T3SA 1PNJA 1ZUKA 3M0PA 1ZLMA 4CC4B 3M0SA 2L3SA 4AFQC 2EGAA 2FRYA 1LCKA 2A36A 1EFNA 2AKLA 4RTZA 1TG0A 1RLQC 2M51A 3NHNA 4HXJA 3VS5A 1Z9ZA 4JZ3A 1GCQA 1JU5C 1WXBA 4CC7A 1NG2A 2JW4A 2F2XA 4D8DA 1UGVA 4J9CA 1K0SA 2LQWA 1I1JA 2DYBA 2O2OA 1K4US 1M30A 3EHQA 1M8MA 2DJQA 1WI7A 2JMCA 2BTTA 4QT7A 2EGCA 1K1ZA 1RLPC 1FMKA 2EYXA 1UJ0A 1QWEA 3U23A 1QCFA 2D1XA 4CC3A 1MV0B 1H8KA 1UFFA 2L2PA 4AFUC 2JMAA 2BZXA 2O88A 3EGUA 1T3LA 2X3XD 2LZ6B 1JXMA 1X27A 1WA7A 1JXOA 5EC7A 1HJDA 2DL4A 3H41A 2EYZA 1WFWA 2X3WD 1U06A 2FG0A 2F2VA 2RF0A 4RUGA 4OMNA 2FO0A 4AG2C 2XMFA 4J9FA 3TSZA 2HSPA 3VS4A 4X1VA 2CH4A 4LNPA 1NYFA 2PTKA 2MIOA 2EW3A 2VWFA 1E6HA 1ARKA 1ZUUA 2SRCA 4IIMA 1I0CA 2L0AA 2O9VA 1JO8A 3UATA 2LX7A 1HSQA 4KRTA 3O5ZA 2M0YA 3EHRA 1WX6A 3VS6A 4ESRA 3VRZA 4JJBA 5FW9A 3VS7A 4HVUA 2K6DA 2DL8A 2DBKA 2QDLA 1TUCA 4J9GA 1U5SA 2J6KA 3PVQA 2LCSA 1YWPA 2LP5A 2EGEA 1M27C 2I0NA 1T0JA 1MUZA 2HBWA 3EG2A 3M0QA 1KFZA 3REAB 4RTXA 1JEGA 1W70A 2JM9A 2ROTA 1UJYA 2NUZA 4A63B 2C0IA 2GBQA 1ABQA 2KNBB 1M3CA 1OEBA 1GBQA 3JV3A 1PKSA 2G6FX 2FPDA 2KBTA 1X6GA 2L3PA 2RQVA 4Z8AA 1WDXA 2DRKA 2RQUA 4F17A 5IHNA 2C0TA 2YT6A 3ULRB 5FWBA 2CT4A 2KRNA 1NEBA 2CUDA 3NGPA 5ECAA 4RTUA 2HEQA 2RNAA 3UA7A 1QKWA 2YSQA 4RTWA 4Z88A 1Y57A 1GRIA 2CT3A 1UHFA 2HDAA 3H0FA 1H92A 3ZL7C 1WYXA 1AZEA 1TUDA 1GFDA 2JS0A 2DL5A 1UDLA 1UUEA 2YUQA 4LE9A 5IXBA 3GBQA 1OPLA 3NMZC 2NWMA 1QKXA 4LUEA 2CSQA 4GBQA 1WXUA 2LMJA 1RI9A 4J9IA 2ABLA 2D8JA 1PHTA 1X43A 3VS2A 3KFVA 4JZ4A 1AWOA 1FYNA 5IHKA 2KRMA 2GTOA 2CH4W 1Y0MA 2DBMA 1N5ZA 1I07A 1AOJA 1NLPC 2AZVA 2F2WA 1A0NB 2KE9A 1KSWA 2KXDA 1GL5A 5GJVB 2D0NA 1BK2A 5GJWB 4F14A 2B86A 2KT1A 1AD5A 1AZGB 2HCKA 2A37A 1M3BA 3REBB 3PE0A 4F16A 3M0RA 2W0ZA 3CQTA 5I22A 2IIMA 2L3QA 1X69A 5L23A 1QWFA 4J9BA 2ENMA 1XOVA 1NEGA
chains in the Genus database with same CATH superfamily
2FHDA 2EKHA 2QEXA 2ROLA 3I5SA 2E4HA 4N4GA 3D7SB 5GAOp 3QDFA 1MNDA 4KGZB 2LCLA 1X2QA 1J3TA 3A8HB 2JTEA 3QWXX 2K9GA 1NJIU 2OTJA 3CXCS 1VQ4T 1VQ8T 2F1LA 1VOMA 3SHWA 2EBPA 1ZX6A 3LH5A 1M5Q1 1YCSB 5AT1B 1M1KC 2XDDA 2RJEA 4M4ZA 3G4SQ 1K9AA 4J9EA 5GANe 2CZ1B 1Q86C 4PJOA 2DA9A 2WSEE 2MOXA 2KSSA 1GCQC 1W6XA 3HSBA 2QQSA 3DLLA 3CCVA 4M7AE 2RI2A 4JRPA 3FJPA 4MMLA 3WVDB 1AEYA 1VQ7A 4OVAA 3MPUB 1RADB 2EQIA 2LJ1A 3NTIA 3HPWA 1FMVA 3F70A 2CUBA 2OX7A 2R57A 3I35A 3EFOB 1MHNA 1YITA 3OYDA 3L2ZA 1KIKA 3JB9D 2FPFA 2A08A 1H3HA 2OTLT 4PFZA 2X4XA 2AKKA 2JT4A 2MYSA 2P4TA 1BYMA 1C1AA 4BE2A 2DL7A 2ECZA 2HKNA 5GAMe 2CSIA 2QA4Q 4P5NA 4M75D 2EQJA 2X4JA 2JZ2A 1G83A 4M7DF 2DZCA 3QIIA 2AT1B 4E47A 4KGXB 2EWNA 5HY6A 5FROA 1V76A 4Z89A 4MMKA 1AVZC 4N0AA 3QYGB 4DEXA 1ACMB 1MGQA 2LJ0A 3VU3C 1IGQA 4M77C 3QO3A 4CRIA 1SHFA 7AT1B 3CCQA 3I55A 1QMCA 4QQ6A 3CMAT 4M7DE 2KEAA 1UGPB 3LWHA 4IIOA 3RBBB 1M1FA 3X28B 5CKFA 1QVGA 4C8QA 4BE1A 1D1CA 1KC8U 4RTTA 4E7JA 4DEYA 4WCIA 3I56Q 3SEMA 3QG1A 3M57A 3A1PA 3RKYA 4M77G 2K57A 5LJ5g 4HKEA 3OS0A 1VQ5Q 1O75A 1S72T 4JPBW 3GLXA 5DM7R 2CDTA 4XTZA 2QA4T 2KROA 4M77E 3VS3A 5KE3A 2O9SA 1YI2A 2CREA 4RMOA 1RAFB 2H8HA 1SSFA 1B07A 1VQKA 2LT4A 3JCMJ 5HK0A 4FYWB 5A0LA 3OW2P 1JJ2S 1HXDA 2CZ6B 2KQWA 1K0XA 2V1QA 1N8RR 4C0FA 1YP5A 4AFSC 1Q82C 1G3TA 1RAHB 3L2RA 1OU9A 4D8KA 1GCPA 2F5KA 2V1RA 1UECA 1TOVA 2FRWA 1BIAA 3V7RA 2KRSA 3X25B 2DO3A 1YJNA 1LOJA 3BE3A 4ORZA 5GAMj 2XI9A 1IHWA 4CC4B 3M0SA 2HZYA 3MP6A 4LDUA 2MAMA 3MEUA 1EFNA 2K5LA 3J7AF 4HXJA 1ZSZB 5HKCA 2RHIA 4C0DB 1Z9ZA 2QDYB 1GCQA 4JZ3A 4J83A 4PL6A 3QZ5B 1JU5C 1DJ7B 3CXCA 3JSCA 2K3YA 2HL3A 4A4HA 1NJIC 1WQ7A 2KVQG 3G71Q 1FMWA 3EFOA 4M7AD 2V8KA 2HD0A 2NUTB 2ZPHB 3EHQA 1VQNQ 2COYA 3LW5E 1KD1U 4ELYC 2JMCA 2BTTA 1I8FA 5L8RE 5IN1A 3U23A 4M78F 2VGNA 3BDUA 1TH7A 3VUBA 5LJ5h 4XK8E 5KCOA 3GOXA 1WHKA 1YFNA 2CYZB 1LPLA 5CO7A 5EC7A 1K8AU 1VQ6T 2DL4A 2NYSA 4BB7A 1WFWA 4XTXA 3E9GA 4F7UE 2GQVA 1Q95G 1D0YA 4XTUA 2YLBA 2FG0A 3OYEA 2YWWA 3TU4K 2YHTA 4C92F 1M8VA 2QTXA 2GFAA 1C0MA 2QGFB 4F04B 2XMFA 1U1TA 1OYXA 4IUTA 1I5OB 3MKDA 2DKGA 2DXTA 2MIOA 2EW3A 1NPRA 4M7DD 1ZUUA 2SRCA 3PIPA 2DD4A 4IIMA 2K2VA 2L0AA 5KYYB 3QBYA 1WX6A 3N5BB 3MCAB 1ZBXA 2QQBA 3OYKA 3ZEHA 5LJ5f 3VS7A 1VQMA 4C92E 5GMKe 1VQOQ 3MO8A 3JCMd 3VJPA 1Q7YR 2LP5A 4XU2A 1VQ9A 4A54A 1YHQA 1RI0A 4PLLA 2KNBB 1ABQA 1HK9A 1OEBA 1QW1A 5FRNA 1PKSA 2D0QB 2KBTA 2L3PA 2RQVA 3OB9A 1KC8C 4J5YA 4C0GA 2C06A 3SDZA 4F17A 3EGDB 2YT6A 5CKBA 3EG9A 5GAN7 5FWBA 4JDSA 2QK0A 4N4IA 2X9HA 1G8XA 3ZFJA 3M58A 2ZZDA 1BCMA 1UHFA 3A8OB 3CCLQ 2Z0WA 4NL3A 5CAIA 1JJ2A 2QYZA 3M55A 1TUDA 2X4WA 1UUEA 1NBEB 1Q81R 3JCMb 3G6ET 1OZ2A 2E3IA 4XU0A 2ABLA 4OB0B 1X43A 5FU7C 1G3SA 4Z02A 2E1HA 3V8KA 2CH4W 5I21A 4PNOA 4JRKA 5FU7B 2NUTA 2AZVA 1KSWA 4AMCA 2CP6A 1GL5A 2E41A 3CCMT 4A4GA 4F14A 2HQHA 1UGRB 1AD5A 3L2WA 3VUZA 1IB8A 3CCJA 4ZGEB 3NTKA 4MZPA 4F16A 3M0RA 3CPWA 2IIMA 1YJWQ 1QWFA 2YLCA 1VQPQ 2XIDA 5LJ3e 3MP1A 1SRMA 2K2MA 5FLXE 1VYTA 2CP3A 4DBRA 3LGLA 3JCMQ 4M75C 2FPEA 1FX7A 3H0IA 4B6MA 2QQRA 5GMKj 5CQYA 4M75B 4FCYA 4IKFA 5HK3A 4E6RA 1VYUA 3CMEQ 1F1BB 1KQSA 2DE0X 4OMPA 1KD1C 4OB1B 4OMQA 1BU1A 5IXFA 3JB9G 2YDLA 2R5MA 2YRCA 4AFZC 3G4SA 4M78D 1JQQA 4XTWA 1IXDA 4M75G 2DLPA 1SSHA 4XTYA 3RKXA 4FW2A 4QVZA 4QKUA 4ME7A 2LQNA 2PVGB 5KYYA 2BIVA 4KUIA 3LX7A 4JS5A 4OMOA 2E6NA 3CXCP 1S1NA 1N8RU 1K8AC 1MV3A 4L5GA 5I11A 4X34A 3FEOA 1YIJQ 1CSKA 3AHUA 3LLRA 4OMLA 2B8AA 3INZA 3JCMg 3RR6A 1QVGS 3SD4A 4C92D 1Y07A 1VQPT 3HFNA 1U1SA 5CK9A 4FSSA 4ZTJA 5KYUB 3GP8A 4EMHA 2RPNA 3KBGA 3CC2T 3A98A 3OYMA 1AWWA 2QA4A 4OP0A 3EGDA 1KK7A 4GLMA 4MDWA 1G3WA 1PSEA 1VQ4Q 1PKTA 3OYNA 3EGXB 2EJ9A 1RACB 4PFOA 3E2UA 4WTOB 1QVFS 3UA6A 1ZUYA 2J7IA 3OYYA 2HAXA 3ASKA 2EYWA 4A4KA 3JCMW 2F69A 2E5KA 4HVVA 3OYGA 2RQTA 4JJNK 2FEIA 4C8QG 2JVVA 2ZGWA 4BE0A 2XDPA 2J6OA 2ZPIB 2M9UA 1D0XA 2RMOA 3THKA 4RTVA 3GPLA 1FXXA 3PVLA 3OS5A 1EZZB 4IUVA 2CP5A 1QCOA 3TVTA 1OV3A 2DILA 1VA7A 1ZQ1A 2DTHA 2EVRA 2RK2A 1PRLC 4O5VA 2EPDA 1YIJT 2YUPA 1WGSA 4PJLA 2HSEB 2DEUA 4C8QF 1HD3A 3VS1A 3OSVA 3I56A 2OTLQ 4MZTA 1I4K1 4M7AC 1QVPA 2MK5A 2HNIA 1VQ5A 3H6ZA 2BKDN 3HRUA 4HCKA 1OQKA 2LCCA 2LNHB 3JAME 4M7AB 1H3ZA 2O01E 2PZ1A 2DVEA 2DNUA 3JCMh 3CCUT 1AHJB 1MMGA 4M75A 1UE9A 4KUDK 4M7AG 1OI1A 2LX9A 1OPKA 4Y92A 5HCKA 3CMAQ 2DD5A 4A4EA 2OJ2A 2W10A 1Q7YU 1ZSGA 4AG1C 1OU8A 3M59A 2AK5A 1WHHA 2DEQA 3HP9A 1M1GA 1OOTA 2M1HA 2EFIA 1WJRA 2EIFA 3I5RA 2JTFA 2QTVA 1PNJA 5AYFA 1FWZA 3QDRB 3QKJA 2YRDA 1TXQA 2AKLA 4M7DC 2M51A 3NHNA 3VS5A 1S72Q 3V8JA 2JTMA 3G71A 2JW4A 2F2XA 3JCMf 1VIEA 4D8DA 1K9MR 2QAZA 1VQNA 5KYUA 3MJXA 3CC4T 3VYHB 1K4US 2RI3A 2VC8A 1RL2A 4OF1A 1WI7A 1Q81U 4QT7A 2EGCA 1RLPC 1M2VA 1NZ9A 2EYXA 3EGXA 5D6XA 2DJZA 1QWEA 4M7DG 1TU0B 1QCFA 2D1XA 4KH1B 3SWNC 1H8KA 1N8RC 3C12A 4OMFB 5CIUA 4QVCA 4AFUC 3LH0A 2JMAA 1M9SA 2O88A 3OSSC 4M77B 2DZ9A 1JXMA 3V8LA 1WA7A 1HJDA 3OS1A 2CP2A 4HT9A 2A3LA 1U06A 4E7SA 2F2VA 1W2BS 2RF0A 4FSXA 3L2UA 3R6OA 2PUKB 3QYHB 3OYIA 2FO0A 5GAMd 4X9DA 1QVFA 1N6AA 2LDMA 4J9FA 1V29B 2CH4A 5D6YA 2CZ7B 5GANj 1VQLT 2PTKA 2VWFA 4EMKC 4O6JA 4PKCC 1E6HA 3G7ZA 1ARKA 2RB6A 5C0MA 1I0CA 1YJ9T 1HSQA 2M0YA 3VS6A 4LDYA 1VQOA 1X01A 3CD6T 4JJBA 3CCRT 4IUQA 3M4YA 4M7AA 2DBKA 2K6DA 1N9RA 3H8ZA 5KE2A 4PFPA 2JJ9A 4J9GA 2J6KA 4KBMB 3PVQA 3CCST 2VXFA 3EG9B 1T0JA 2HBWA 4RTXA 2E12A 8AT1B 2MMPA 2QQAA 2FVUA 2L5QA 1VQ6Q 3OYCA 2ROTA 1UJYA 2NUZA 3V7CA 3X20B 2FZKB 3JV3A 3GNFB 2FPDA 2DRKA 2QGGA 1D3BB 3QXEB 3GNGA 3CPWS 4C5HA 3OYJA 2KRNA 3NGPA 5ECAA 1MMAA 2K5FA 1N9SA 2DIGA 2RNAA 3UA7A 2YSQA 1BCOA 4KULA 3CCLA 1PM3A 1Y57A 9ATCB 2BE9B 2HDAA 3C4SA 2QEXT 4BUGA 2MF2A 4F7UB 4EPCA 1KQSS 2YUQA 4LE9A 2RA2A 3META 3GBQA 2CSQA 1WXUA 4M7DA 2RHYA 3C94A 2GF7A 2P84A 1K73R 2D8JA 2KY9A 1FYNA 5IHKA 4Y91A 1KG1A 2V8IA 2L8DA 4IUPA 3L2VA 2OTJT 1Q7YC 4RG8A 2DBMA 4E2FB 4X9CA 1AOJA 4FW1A 4F7UG 2LC4A 2KE9A 1R8OB 3M9QA 1P92A 2KMTA 1BK2A 4M78G 4C92C 2HCKA 1AZGB 3OYHA 3RUXA 1YJWA 3M54A 1VQPA 1PD1A 2K3XA 3PNWC 3REBB 4AT1B 4KT0E 3S3MA 4M78E 2EQMA 2KDSA 4FYXB 5L23A 4J9BA 2X4YA 4M77A 3TREA 3SWNA 2YXYA 1Z9QA 5KYNA 3NFCA 2PUOB 3CCVT 2HQEA 3BFMA 2LTOA 3JRZA 2D9TA 2RJFA 3HKSA 4Y28E 4C5GA 1OX9A 1TSFA 3CMEA 1VQ7T 2XDBA 2XICA 3NPFA 4C92G 2ZAEA 3R6NA 4JLGA 3G6EQ 1YITT 4LN2A 1W4SA 1Q81C 1AWXA 2YUOA 1ZHIA 4PJNA 5FU6C 3P8BB 5GAMg 2CZ0B 3BDLA 3EG0A 4ANJA 2P0PA 2EYYA 3I9QA 5KYXA 2H3EB 1ZBJA 4J9DA 1RAAB 1SPKA 3CCMQ 1PD0A 1VQKQ 3EFRA 2ZPFB 4N4HA 3Q1JA 1BB9A 4ZTFA 1RABB 4C5IA 3VS0A 1RAEB 3S3OA 2RO0A 2ESWA 3EG3A 1W2BA 2GGRA 5M9OA 5IHIA 3EAEA 2DXBA 5A2QE 2VUBA 2ED1A 3QPHA 4HVWA 3SB2A 2J05A 3CCQT 1NYGA 4EIKA 3I55T 4B9WA 3CBPA 3OYBA 4QQDA 1YJNQ 1OZ3A 1SKUB 2FZGB 2L3RA 2XKOC 2R5AA 1VQ4A 1VQ8A 3WXMB 3URGA 1Y96B 1D3BA 4RTYA 1PWTA 1QVGP 1X6BA 2JUFA 4R0KA 1CKBA 2RQWA 1K9MU 3VV0A 4BD3A 2M16A 2LJ3A 2HBPA 1SHGA 2RHZA 2HKQB 2VXEA 4DOVA 3QSUA 2DL3A 3TEEA 4F7UA 1YWOA 1H641 3OBYA 1YI2T 2KI7A 4ATOA 1QVFP 1VQKT 5CQXA 4DBQA 4J7IA 2NUPB 4ZNXA 5GAN5 4UC4A 2VGMA 2CGHA 3T9NA 2J6FA 5GAMh 1CKAA 2OTLA 2JXBA 4PJJA 3CC2Q 4EDUA 4JJCA 2HQXA 5GANf 2DETA 1E6GA 2VKNA 1YJNT 4A53A 1LVKA 2JN0A 2SEMA 4C92A 5IH2A 2P4RA 2PNIA 1NLOC 3MEWA 1AWJA 1K76A 1QLYA 2RD1A 2YUNA 2DXUA 1GFCA 1X2KA 1AT1B 1SRLA 5GAOr 2O31A 1UTIA 2BZYA 1W1FA 3VYGA 5KCHA 3KUFA 4PJOF 4PJMA 4HCCA 1BI0A 3CMAA 2KT8A 3S3NA 1BIBA 2RQRA 2X51A 3M4GA 5D7UA 1BI1A 2XG8D 2OI3A 4C0ZA 2KYMA 2DF6A 2FB7A 5GAMf 2Y4XA 4J9HA 4PLIA 1UGSB 2H3JA 3QJ6A 3LWIA 2CP7A 3UWNA 2KK4A 1VQ9Q 4CC2A 3HL8A 2DFUA 1M2OA 4PJOE 2ZPBB 1ZLMA 5LJ5e 1S72A 2L3SA 2M02A 2FRYA 5CR2A 2A36A 4RG2A 4RTZA 2HL5C 1TG0A 3DB3A 1RLQC 3OW2A 5GAN4 2RJDA 2V26A 4E7LA 1U8RA 4HCBA 1R0CB 1M2VB 4EMGA 1XNIA 4KH0B 4MZMA 2PQWA 2P0KA 3CCUQ 1K0SA 4NL2A 4BI3A 1I1JA 3UT1A 2O2OA 3OA6A 1R77A 1R0BG 1M30A 1WJSA 1M8MA 2DJQA 3RESA 3WVEB 4BY6C 1Y96A 4OGEA 1K1ZA 1FMKA 2X35A 2K5IA 4XAXB 2EKOA 3CEYA 5IT9E 4CI0C 3FLGA 1K73U 5LJ3j 1MV0B 4C5EA 1UFFA 3L2QA 4LD6A 3E1SA 3RERA 3OMCA 3MEAA 3HTRA 2BZXA 2XK0A 1VQMT 1KQ1A 3X24B 3EGUA 5I2SA 2LZ6B 3DLMA 3CCEQ 1JXOA 3CC7Q 3OYAA 1Y71A 3H41A 4JRIA 4JUVA 5LL6S 1VQ9T 4LDVA 3FIFA 2V8JA 1I5LA 4QW2A 3GF5A 4RUGA 4OMNA 2NUPA 4OB2B 4AG2C 3TSZA 2HSPA 3OMGA 3VS4A 4LNPA 2L89A 4ZGDB 2EJFA 1ZA1B 3CC4Q 3PMTA 1K9MC 3UDCA 3PT9A 4C8QE 4JS4A 1XJWB 2KAFA 1W2BP 2LRQA 2MWPA 1M90R 2LX7A 4KRTA 2PVOB 3EHRA 1YBYA 4XQ3A 1WHLA 3M56A 3VRZA 3JB9I 2LT1A 3M5AA 5GAOn 2IPOB 4M7AF 2E5QA 3TQ7P 1G5VA 2QDLA 3JB9H 1U5SA 3VKIA 5DLOA 2LCSA 1YWPA 1VQ6A 2RM4A 3EG2A 5LJ5j 2JOYA 1JJ2P 1QQJA 2JM9A 4A63B 2F5TX 2C0IA 1M3CA 2YRVA 3CCET 1WPYA 2DAQA 2RI5A 2QASA 2G6FX 5I2MA 2G3RA 2DTIA 3CC7T 1UB4A 4II1A 2RQUA 5IHNA 4WF2A 3QJYA 4DA4A 4FU6A 2C0TA 1JB0E 3ULRB 2CT4A 2E10A 5DLQE 4RTUA 1X75C 4RCCA 2HEQA 3CCJT 1VQLQ 4M7DB 1PG5B 5GMKh 3JCMc 2CT3A 5LJ3g 1YJ9Q 2DERA 3FDRA 5C6SA 2E70A 1H92A 1WYXA 2VYTA 3CD6Q 3CCRQ 5J3BA 3CPWP 5GANd 1GFDA 2CS7A 2JS0A 1UDLA 5IXBA 5GAN8 5CKHA 1OPLA 4LUEA 1QKXA 5CVIA 4PJOD 1X6OA 2LMJA 3CCSQ 3CPFA 3MEVA 2RHUA 3VS2A 2A0FB 3KFVA 4JZ4A 3FB9A 1OULA 1M1KR 1WNLA 2GTOA 4R55A 2DTOA 2EAYA 4ZN3A 1Y0MA 4XU1A 1N5ZA 1I07A 2LQKA 3SWNB 3V7SA 1Q86R 1NLPC 1KQSP 3M53A 2EJGA 5KYWB 3J81E 3FC3A 4JRQA 1A0NB 2KXDA 3G4ST 5GJVB 3PIOA 3HFOA 5GAOq 2D0NA 1BI3A 4L6V5 2P0QA 2B86A 2ZCFB 2WACA 1UGQB 3OYLA 3PE0A 2W0ZA 2L3QA 2OAUA 4QQGA 2ENMA 1XOVA 4PK4A 1C6VX 4M77F 1NEGA 1WXTA 4J8OA 1UHCA 1RAIB 2I2LA 1T0HA 2JM8A 3QZ9B 3FJ5A 1M4ZA 2QEXQ 1IO6A 2K79A 2AZSA 3HRSA 4JLIA 3G6EA 5KYXB 2BZ8A 6AT1B 4EMKB 5FWCA 3M0TA 3UF4A 1RUWA 2D8HA 4LDXA 4DOWA 3H0HA 3A8LB 3OQ5A 5FRMA 2OTJQ 3OYFA 1K73C 2WSCE 2ZPEB 3AT1B 2FYKA 1D1AA 3RKWA 3TSWA 3CCMA 2NLUA 4NS5A 3RNJA 2Y90A 2E64A 3JCMX 1YNZA 3LGFA 5LJ3h 1KJWA 4BDYA 4OGCA 4C8QD 1WHJA 4LUDA 4K11A 3HRTA 1VYVA 2WSFE 1E7OA 5CCAA 2BE7D 4LXCA 1RAGB 3P8DA 2GQIA 4MDXA 3CCVQ 2K4YA 1BBZA 3PTAA 1UG1A 1TS9A 1VQ7Q 1TWBA 2DM1A 4FYVB 2QG9B 1ZSZC 2CKKA 4C0DC 3L42A 1PSFA 1YCYA 2GTJA 4BACA 4JJDA 1YITQ 5GMKi 2DPPB 4M78C 3VRYA 2FZCB 5GMKm 3I56T 1YN8A 3C95A 4J6YA 5GAOm 3C0CA 2JS2A 2LVMA 4ZGJB 4M78B 3OBWA 2EQUA 3QHSA 1G2BA 1VQ5T 3PFSA 4ZN1A 5LJ3f 2GNCA 1PRMC 3M0UA 4J6XA 1TUGB 3A5ZB 4F7UF 1ZA2B 1JBMA 3EFSA 1KHCA 2K3BA 2DVJA 1GBRA 2OAWA 1Q82R 4BI4A 5GANg 2DMOA 1JRIA 3CBMA 3JCMe 2C0OA 2DIQA 2VVKA 2K7AA 4KGVB 4C92B 5J26A 2J06A 2FL7A 4E7IA 1NM7A 1LJOA 4TVRA 3CCQQ 5DY9A 2MCNA 2ATCB 3I55Q 4V2SA 4HA8A 1B3QA 3CC2A 3IQLA 3QWYA 4FYYB 1B34B 5KYWA 2IG0A 1PC0A 1U3OA 1D1BA 1ABOA 2KR3A 3L1AA 4RKUE 2KGTA 1M3AA 4ELZC 1WHMA 4XU3A 3ZBDA 1IZ6A 4B9XA 2LQ8A 1EIFA 3O8VA 2RN8A 3TCJA 3OW2S 2A28A 4GLKA 1SF9A 1G3YA 2COWA 4FL6A 3CBOA 3X26B 2O4XB 1NJIR 1WQWA 4BI8B 1KQ2A 4FM4B 2QXFA 2AHJB 3G71T 1IREB 2GCXA 1M90U 1PCXA 5FU6B 2ED0A 1V1CA 2KXCA 1YI2Q 3NTHA 1I81A 1WIEA 4EMKA 1QP3A 1VQNT 4QVDA 1NPPA 4BDZA 4OMMA 1YIJA 4DBHA 3PGGA 1MMNA 1Y7XA 4VUBA 3A8GB 1WLPB 2KYBA 1SEMA 2DK3A 2HMAA 2D6FA 2DX1A 1BKBA 3EG1A 3PMIA 2VV5A 2DRMA 1QP2A 2E65A 4DBFA 4M77D 3A8MB 2RH2A 1T3SA 1ZUKA 3M0PA 4IURA 2XD0A 2GFUA 4J6WA 1N27A 2RJCA 4AFQC 2EGAA 1LCKA 1GXIE 2MI6A 5GANh 2MWOA 1WXBA 2JNGA 2Y4YA 4CC7A 2LNVA 1NG2A 3CCUA 3JCMV 1HYOA 1UGVA 4D6WA 4J9CA 1XQHA 2LQWA 2DYBA 4E7KA 3ME9A 2DYIA 3E19A 1ZSZA 1SG5A 3DKMA 4L59A 1UJ0A 2A7YA 4FT2A 4M78A 4CC3A 1M1KU 3RDVA 2L2PA 5CKDA 1VQOT 2PVDB 2QI2A 4YTLA 1QCNA 1TTHB 3CCEA 1T3LA 1Q86U 3CC7A 2X3XD 3RIRA 1X27A 5GAN2 2QQ9A 3MHXA 5EG2A 1O9SA 3EH1A 3LYIA 5GMKl 3MP8A 1KC8R 2AIRB 2EYZA 3GIBA 5GAOl 2EYQA 2X3WD 1MMDA 1WZOA 1WJQA 3CC4A 4X1VA 3JB9F 1B34A 1IRXA 2VASA 2E3HA 3RMSA 1NYFA 4PJOC 4A4FA 5GAN6 2BUDA 3BY7A 2O9VA 1JO8A 1EX4A 3CCLT 3UATA 4M75F 4PJOB 3O5ZA 4ESRA 2XU8A 3RMQA 4OB3B 5FW9A 1UEBA 3S6WA 1B7TA 4HVUA 2DL8A 2O4XA 3G1JA 3HHTB 1TUCA 3P8HA 4FT4A 1VQMQ 1BI2A 2EGEA 1M27C 2PU9B 2I0NA 1MUZA 3M0QA 1KFZA 3REAB 4HT8A 1JEGA 1W70A 5LJ3d 4PJOG 3JB9J 4HCZA 4E7ZA 4RCBA 1NE8A 2GBQA 2RK1A 4NOYA 4DQ2A 2CP0A 1GBQA 1YHQQ 4M75E 3DB4A 3OS2A 1X6GA 2R58A 4Z8AA 2DXCA 1WDXA 3BW1A 2E6ZA 5A0DA 1D0ZA 5CKEA 1VQLA 2M0OA 5A0GA 1NEBA 2CUDA 1YJWT 3EH2A 1WHGA 1YJ9A 1QKWA 1D09B 4RTWA 4Z88A 4N0AC 1GRIA 1LNXA 5J39A 3CD6A 3CCRA 1IHVA 3ER0A 2RHXA 3H0FA 4Q5WA 3ZL7C 1IGUA 5GAN3 3H9NA 3FRNA 1AZEA 1VIFA 2DL5A 1KD1R 5D6WA 1M90C 4LD9K 3CCSA 3E9FA 3OY9A 1VQ8Q 3JCMP 4R56A 1VUBA 3CMET 1XTDA 3NMZC 3UPUA 2NWMA 1KHIA 2MPXC 4GBQA 2XHCA 1RI9A 2VB6A 4J9IA 4BY6B 1PHTA 2COZA 5KH6A 1AWOA 4C8QC 2KRMA 4FIBA 1MNEA 4E7HA 2F2WA 4C8QB 4GY5A 3QUIA 4LDWA 1K8AR 1Q82U 5IAYA 5GJWB 2KT1A 5LJ5d 1YHQT 2EQKA 2A37A 1M3BA 3J80E 8ATCB 1OX8A 2IVWA 3SFMA 3CQTA 5I22A 4IUUA 1X69A 3CCJQ 2ZPGB 4XTVA 3KXTA 4J7FA
chains in the Genus database with same CATH topology
1Z9QA 1WXTA 1SRMA 1UHCA 2K2MA 2EKHA 1VYTA 2ROLA 1T0HA 3I5SA 2JM8A 2FPEA 3FJ5A 3H0IA 1IO6A 2K79A 2AZSA 3NPFA 4E6RA 2BZ8A 1VYUA 1X2QA 3R6NA 1J3TA 5FWCA 2DE0X 3M0TA 2JTEA 4LN2A 4OMPA 3QWXX 3UF4A 4OMQA 5IXFA 1BU1A 1RUWA 2K9GA 2D8HA 1AWXA 2YDLA 2YUOA 3H0HA 3SHWA 2EBPA 1ZX6A 4AFZC 3LH5A 1YCSB 1JQQA 3TSWA 3EG0A 2DLPA 1SSHA 3RNJA 2EYYA 3I9QA 4M4ZA 1K9AA 4J9EA 2LQNA 1ZBJA 4J9DA 1SPKA 2DA9A 1YNZA 1KJWA 2MOXA 4OMOA 1BB9A 1S1NA 1GCQC 1MV3A 1W6XA 3VS0A 5I11A 2ESWA 4LUDA 4K11A 3EG3A 1CSKA 1VYVA 1E7OA 2GGRA 5IHIA 2GQIA 4OMLA 2ED1A 1BBZA 1AEYA 4HVWA 2EQIA 2LJ1A 2J05A 1UG1A 1NYGA 4EIKA 2CUBA 3I35A 2DM1A 4FSSA 1KIKA 2FPFA 2RPNA 2GTJA 2A08A 1H3HA 3A98A 4JJDA 1AWWA 2AKKA 2JT4A 3VRYA 4GLMA 1YN8A 2DL7A 2ECZA 4RTYA 1PKTA 2CSIA 1PWTA 3C0CA 2JS2A 1X6BA 3UA6A 4R0KA 1ZUYA 1CKBA 1G83A 2RQWA 1G2BA 2J7IA 2LJ3A 2EYWA 2E5KA 4HVVA 1SHGA 2RQTA 2FEIA 2GNCA 1PRMC 3M0UA 4Z89A 1AVZC 2J6OA 2DL3A 4DEXA 1YWOA 2RMOA 3THKA 4RTVA 2K3BA 3PVLA 2DVJA 2LJ0A 1GBRA 2OAWA 3TVTA 1OV3A 2DMOA 2DILA 1SHFA 1VA7A 2C0OA 2VVKA 2EVRA 2K7AA 1PRLC 2J06A 4ZNXA 2KEAA 2EPDA 1NM7A 2YUPA 2MCNA 4IIOA 3RBBB 1B3QA 3IQLA 2J6FA 3QWYA 1CKAA 1HD3A 2JXBA 3VS1A 1U3OA 1ABOA 2KR3A 4RTTA 2KGTA 4JJCA 1M3AA 4DEYA 1E6GA 4WCIA 2VKNA 3SEMA 2RN8A 2SEMA 5IH2A 2A28A 2P4RA 4HCKA 2PNIA 2LNHB 1NLOC 1AWJA 1K76A 1QLYA 4JPBW 2CDTA 2YUNA 2KROA 2PZ1A 1GFCA 1X2KA 1SRLA 3VS3A 2DNUA 2O9SA 2CREA 2O31A 2H8HA 1UTIA 2BZYA 1B07A 1W1FA 2ED0A 1V1CA 2KXCA 1UE9A 1WIEA 1K0XA 4OMMA 2V1QA 2KT8A 2RQRA 1YP5A 4Y92A 1OPKA 5HCKA 4AFSC 1WLPB 2OI3A 2KYMA 2OJ2A 2W10A 2DF6A 1SEMA 2KYBA 4J9HA 4D8KA 1GCPA 2DX1A 1ZSGA 2V1RA 4AG1C 1UECA 3EG1A 2FRWA 2KRSA 2AK5A 2DRMA 1OOTA 4ORZA 4CC2A 3I5RA 1T3SA 1PNJA 1ZUKA 3M0PA 1ZLMA 4CC4B 3M0SA 2L3SA 4AFQC 2EGAA 2FRYA 1LCKA 2A36A 1EFNA 2AKLA 4RTZA 1TG0A 1RLQC 2M51A 3NHNA 4HXJA 3VS5A 1Z9ZA 4JZ3A 1GCQA 1JU5C 1WXBA 4CC7A 1NG2A 2JW4A 2F2XA 4D8DA 1UGVA 4J9CA 1K0SA 2LQWA 1I1JA 2DYBA 2O2OA 1K4US 1M30A 3EHQA 1M8MA 2DJQA 1WI7A 2JMCA 2BTTA 4QT7A 2EGCA 1K1ZA 1RLPC 1FMKA 2EYXA 1UJ0A 1QWEA 3U23A 1QCFA 2D1XA 4CC3A 1MV0B 1H8KA 1UFFA 2L2PA 4AFUC 2JMAA 2BZXA 2O88A 3EGUA 1T3LA 2X3XD 2LZ6B 1JXMA 1X27A 1WA7A 1JXOA 5EC7A 1HJDA 2DL4A 3H41A 2EYZA 1WFWA 2X3WD 1U06A 2FG0A 2F2VA 2RF0A 4RUGA 4OMNA 2FO0A 4AG2C 2XMFA 4J9FA 3TSZA 2HSPA 3VS4A 4X1VA 2CH4A 4LNPA 1NYFA 2PTKA 2MIOA 2EW3A 2VWFA 1E6HA 1ARKA 1ZUUA 2SRCA 4IIMA 1I0CA 2L0AA 2O9VA 1JO8A 3UATA 2LX7A 1HSQA 4KRTA 3O5ZA 2M0YA 3EHRA 1WX6A 3VS6A 4ESRA 3VRZA 4JJBA 5FW9A 3VS7A 4HVUA 2K6DA 2DL8A 2DBKA 2QDLA 1TUCA 4J9GA 1U5SA 2J6KA 3PVQA 2LCSA 1YWPA 2LP5A 2EGEA 1M27C 2I0NA 1T0JA 1MUZA 2HBWA 3EG2A 3M0QA 1KFZA 3REAB 4RTXA 1JEGA 1W70A 2JM9A 2ROTA 1UJYA 2NUZA 4A63B 2C0IA 2GBQA 1ABQA 2KNBB 1M3CA 1OEBA 1GBQA 3JV3A 1PKSA 2G6FX 2FPDA 2KBTA 1X6GA 2L3PA 2RQVA 4Z8AA 1WDXA 2DRKA 2RQUA 4F17A 5IHNA 2C0TA 2YT6A 3ULRB 5FWBA 2CT4A 2KRNA 1NEBA 2CUDA 3NGPA 5ECAA 4RTUA 2HEQA 2RNAA 3UA7A 1QKWA 2YSQA 4RTWA 4Z88A 1Y57A 1GRIA 2CT3A 1UHFA 2HDAA 3H0FA 1H92A 3ZL7C 1WYXA 1AZEA 1TUDA 1GFDA 2JS0A 2DL5A 1UDLA 1UUEA 2YUQA 4LE9A 5IXBA 3GBQA 1OPLA 3NMZC 2NWMA 1QKXA 4LUEA 2CSQA 4GBQA 1WXUA 2LMJA 1RI9A 4J9IA 2ABLA 2D8JA 1PHTA 1X43A 3VS2A 3KFVA 4JZ4A 1AWOA 1FYNA 5IHKA 2KRMA 2GTOA 2CH4W 1Y0MA 2DBMA 1N5ZA 1I07A 1AOJA 1NLPC 2AZVA 2F2WA 1A0NB 2KE9A 1KSWA 2KXDA 1GL5A 5GJVB 2D0NA 1BK2A 5GJWB 4F14A 2B86A 2KT1A 1AD5A 1AZGB 2HCKA 2A37A 1M3BA 3REBB 3PE0A 4F16A 3M0RA 2W0ZA 3CQTA 5I22A 2IIMA 2L3QA 1X69A 5L23A 1QWFA 4J9BA 2ENMA 1XOVA 1NEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9Q A;  1WXT A;  1SRM A;  1UHC A;  2K2M A;  2EKH A;  1VYT A;  2ROL A;  1T0H A;  3I5S A;  2JM8 A;  2FPE A;  3FJ5 A;  3H0I A;  1IO6 A;  2K79 A;  2AZS A;  3NPF A;  4E6R A;  2BZ8 A;  1VYU A;  1X2Q A;  3R6N A;  1J3T A;  5FWC A;  2DE0 X;  3M0T A;  2JTE A;  4LN2 A;  4OMP A;  3QWX X;  3UF4 A;  4OMQ A;  5IXF A;  1BU1 A;  1RUW A;  2K9G A;  2D8H A;  1AWX A;  2YDL A;  2YUO A;  3H0H A;  3SHW A;  2EBP A;  1ZX6 A;  4AFZ C;  3LH5 A;  1YCS B;  1JQQ A;  3TSW A;  3EG0 A;  2DLP A;  1SSH A;  3RNJ A;  2EYY A;  3I9Q A;  4M4Z A;  1K9A A;  4J9E A;  2LQN A;  1ZBJ A;  4J9D A;  1SPK A;  2DA9 A;  1YNZ A;  1KJW A;  2MOX A;  4OMO A;  1BB9 A;  1S1N A;  1GCQ C;  1MV3 A;  1W6X A;  3VS0 A;  5I11 A;  2ESW A;  4LUD A;  4K11 A;  3EG3 A;  1CSK A;  1VYV A;  1E7O A;  2GGR A;  5IHI A;  2GQI A;  4OML A;  2ED1 A;  1BBZ A;  1AEY A;  4HVW A;  2EQI A;  2LJ1 A;  2J05 A;  1UG1 A;  1NYG A;  4EIK A;  2CUB A;  3I35 A;  2DM1 A;  4FSS A;  1KIK A;  2FPF A;  2RPN A;  2GTJ A;  2A08 A;  1H3H A;  3A98 A;  4JJD A;  1AWW A;  2AKK A;  2JT4 A;  3VRY A;  4GLM A;  1YN8 A;  2DL7 A;  2ECZ A;  4RTY A;  1PKT A;  2CSI A;  1PWT A;  3C0C A;  2JS2 A;  1X6B A;  3UA6 A;  4R0K A;  1ZUY A;  1CKB A;  1G83 A;  2RQW A;  1G2B A;  2J7I A;  2LJ3 A;  2EYW A;  2E5K A;  4HVV A;  1SHG A;  2RQT A;  2FEI A;  2GNC A;  1PRM C;  3M0U A;  4Z89 A;  1AVZ C;  2J6O A;  2DL3 A;  4DEX A;  1YWO A;  2RMO A;  3THK A;  4RTV A;  2K3B A;  3PVL A;  2DVJ A;  2LJ0 A;  1GBR A;  2OAW A;  3TVT A;  1OV3 A;  2DMO A;  2DIL A;  1SHF A;  1VA7 A;  2C0O A;  2VVK A;  2EVR A;  2K7A A;  1PRL C;  2J06 A;  4ZNX A;  2KEA A;  2EPD A;  1NM7 A;  2YUP A;  2MCN A;  4IIO A;  3RBB B;  1B3Q A;  3IQL A;  2J6F A;  3QWY A;  1CKA A;  1HD3 A;  2JXB A;  3VS1 A;  1U3O A;  1ABO A;  2KR3 A;  4RTT A;  2KGT A;  4JJC A;  1M3A A;  4DEY A;  1E6G A;  4WCI A;  2VKN A;  3SEM A;  2RN8 A;  2SEM A;  5IH2 A;  2A28 A;  2P4R A;  4HCK A;  2PNI A;  2LNH B;  1NLO C;  1AWJ A;  1K76 A;  1QLY A;  4JPB W;  2CDT A;  2YUN A;  2KRO A;  2PZ1 A;  1GFC A;  1X2K A;  1SRL A;  3VS3 A;  2DNU A;  2O9S A;  2CRE A;  2O31 A;  2H8H A;  1UTI A;  2BZY A;  1B07 A;  1W1F A;  2ED0 A;  1V1C A;  2KXC A;  1UE9 A;  1WIE A;  1K0X A;  4OMM A;  2V1Q A;  2KT8 A;  2RQR A;  1YP5 A;  4Y92 A;  1OPK A;  5HCK A;  4AFS C;  1WLP B;  2OI3 A;  2KYM A;  2OJ2 A;  2W10 A;  2DF6 A;  1SEM A;  2KYB A;  4J9H A;  4D8K A;  1GCP A;  2DX1 A;  1ZSG A;  2V1R A;  4AG1 C;  1UEC A;  3EG1 A;  2FRW A;  2KRS A;  2AK5 A;  2DRM A;  1OOT A;  4ORZ A;  4CC2 A;  3I5R A;  1T3S A;  1PNJ A;  1ZUK A;  3M0P A;  1ZLM A;  4CC4 B;  3M0S A;  2L3S A;  4AFQ C;  2EGA A;  2FRY A;  1LCK A;  2A36 A;  1EFN A;  2AKL A;  4RTZ A;  1TG0 A;  1RLQ C;  2M51 A;  3NHN A;  4HXJ A;  3VS5 A;  1Z9Z A;  4JZ3 A;  1GCQ A;  1JU5 C;  1WXB A;  4CC7 A;  1NG2 A;  2JW4 A;  2F2X A;  4D8D A;  1UGV A;  4J9C A;  1K0S A;  2LQW A;  1I1J A;  2DYB A;  2O2O A;  1K4U S;  1M30 A;  3EHQ A;  1M8M A;  2DJQ A;  1WI7 A;  2JMC A;  2BTT A;  4QT7 A;  2EGC A;  1K1Z A;  1RLP C;  1FMK A;  2EYX A;  1UJ0 A;  1QWE A;  3U23 A;  1QCF A;  2D1X A;  4CC3 A;  1MV0 B;  1H8K A;  1UFF A;  2L2P A;  4AFU C;  2JMA A;  2BZX A;  2O88 A;  3EGU A;  1T3L A;  2X3X D;  2LZ6 B;  1JXM A;  1X27 A;  1WA7 A;  1JXO A;  5EC7 A;  1HJD A;  2DL4 A;  3H41 A;  2EYZ A;  1WFW A;  2X3W D;  1U06 A;  2FG0 A;  2F2V A;  2RF0 A;  4RUG A;  4OMN A;  2FO0 A;  4AG2 C;  2XMF A;  4J9F A;  3TSZ A;  2HSP A;  3VS4 A;  4X1V A;  2CH4 A;  4LNP A;  1NYF A;  2PTK A;  2MIO A;  2EW3 A;  2VWF A;  1E6H A;  1ARK A;  1ZUU A;  2SRC A;  4IIM A;  1I0C A;  2L0A A;  2O9V A;  1JO8 A;  3UAT A;  2LX7 A;  1HSQ A;  4KRT A;  3O5Z A;  2M0Y A;  3EHR A;  1WX6 A;  3VS6 A;  4ESR A;  3VRZ A;  4JJB A;  5FW9 A;  3VS7 A;  4HVU A;  2K6D A;  2DL8 A;  2DBK A;  2QDL A;  1TUC A;  4J9G A;  1U5S A;  2J6K A;  3PVQ A;  2LCS A;  1YWP A;  2LP5 A;  2EGE A;  1M27 C;  2I0N A;  1T0J A;  1MUZ A;  2HBW A;  3EG2 A;  3M0Q A;  1KFZ A;  3REA B;  4RTX A;  1JEG A;  1W70 A;  2JM9 A;  2ROT A;  1UJY A;  2NUZ A;  4A63 B;  2C0I A;  2GBQ A;  1ABQ A;  2KNB B;  1M3C A;  1OEB A;  1GBQ A;  3JV3 A;  1PKS A;  2G6F X;  2FPD A;  2KBT A;  1X6G A;  2L3P A;  2RQV A;  4Z8A A;  1WDX A;  2DRK A;  2RQU A;  4F17 A;  5IHN A;  2C0T A;  2YT6 A;  3ULR B;  5FWB A;  2CT4 A;  2KRN A;  1NEB A;  2CUD A;  3NGP A;  5ECA A;  4RTU A;  2HEQ A;  2RNA A;  3UA7 A;  1QKW A;  2YSQ A;  4RTW A;  4Z88 A;  1Y57 A;  1GRI A;  2CT3 A;  1UHF A;  2HDA A;  3H0F A;  1H92 A;  3ZL7 C;  1WYX A;  1AZE A;  1TUD A;  1GFD A;  2JS0 A;  2DL5 A;  1UDL A;  1UUE A;  2YUQ A;  4LE9 A;  5IXB A;  3GBQ A;  1OPL A;  3NMZ C;  2NWM A;  1QKX A;  4LUE A;  2CSQ A;  4GBQ A;  1WXU A;  2LMJ A;  1RI9 A;  4J9I A;  2ABL A;  2D8J A;  1PHT A;  1X43 A;  3VS2 A;  3KFV A;  4JZ4 A;  1AWO A;  1FYN A;  5IHK A;  2KRM A;  2GTO A;  2CH4 W;  1Y0M A;  2DBM A;  1N5Z A;  1I07 A;  1AOJ A;  1NLP C;  2AZV A;  2F2W A;  1A0N B;  2KE9 A;  1KSW A;  2KXD A;  1GL5 A;  5GJV B;  2D0N A;  1BK2 A;  5GJW B;  4F14 A;  2B86 A;  2KT1 A;  1AD5 A;  1AZG B;  2HCK A;  2A37 A;  1M3B A;  3REB B;  3PE0 A;  4F16 A;  3M0R A;  2W0Z A;  3CQT A;  5I22 A;  2IIM A;  2L3Q A;  1X69 A;  5L23 A;  1QWF A;  4J9B A;  2ENM A;  1XOV A;  1NEG A; 
#chains in the Genus database with same CATH topology
 2FHD A;  2EKH A;  2QEX A;  2ROL A;  3I5S A;  2E4H A;  4N4G A;  3D7S B;  5GAO p;  3QDF A;  1MND A;  4KGZ B;  2LCL A;  1X2Q A;  1J3T A;  3A8H B;  2JTE A;  3QWX X;  2K9G A;  1NJI U;  2OTJ A;  3CXC S;  1VQ4 T;  1VQ8 T;  2F1L A;  1VOM A;  3SHW A;  2EBP A;  1ZX6 A;  3LH5 A;  1M5Q 1;  1YCS B;  5AT1 B;  1M1K C;  2XDD A;  2RJE A;  4M4Z A;  3G4S Q;  1K9A A;  4J9E A;  5GAN e;  2CZ1 B;  1Q86 C;  4PJO A;  2DA9 A;  2WSE E;  2MOX A;  2KSS A;  1GCQ C;  1W6X A;  3HSB A;  2QQS A;  3DLL A;  3CCV A;  4M7A E;  2RI2 A;  4JRP A;  3FJP A;  4MML A;  3WVD B;  1AEY A;  1VQ7 A;  4OVA A;  3MPU B;  1RAD B;  2EQI A;  2LJ1 A;  3NTI A;  3HPW A;  1FMV A;  3F70 A;  2CUB A;  2OX7 A;  2R57 A;  3I35 A;  3EFO B;  1MHN A;  1YIT A;  3OYD A;  3L2Z A;  1KIK A;  3JB9 D;  2FPF A;  2A08 A;  1H3H A;  2OTL T;  4PFZ A;  2X4X A;  2AKK A;  2JT4 A;  2MYS A;  2P4T A;  1BYM A;  1C1A A;  4BE2 A;  2DL7 A;  2ECZ A;  2HKN A;  5GAM e;  2CSI A;  2QA4 Q;  4P5N A;  4M75 D;  2EQJ A;  2X4J A;  2JZ2 A;  1G83 A;  4M7D F;  2DZC A;  3QII A;  2AT1 B;  4E47 A;  4KGX B;  2EWN A;  5HY6 A;  5FRO A;  1V76 A;  4Z89 A;  4MMK A;  1AVZ C;  4N0A A;  3QYG B;  4DEX A;  1ACM B;  1MGQ A;  2LJ0 A;  3VU3 C;  1IGQ A;  4M77 C;  3QO3 A;  4CRI A;  1SHF A;  7AT1 B;  3CCQ A;  3I55 A;  1QMC A;  4QQ6 A;  3CMA T;  4M7D E;  2KEA A;  1UGP B;  3LWH A;  4IIO A;  3RBB B;  1M1F A;  3X28 B;  5CKF A;  1QVG A;  4C8Q A;  4BE1 A;  1D1C A;  1KC8 U;  4RTT A;  4E7J A;  4DEY A;  4WCI A;  3I56 Q;  3SEM A;  3QG1 A;  3M57 A;  3A1P A;  3RKY A;  4M77 G;  2K57 A;  5LJ5 g;  4HKE A;  3OS0 A;  1VQ5 Q;  1O75 A;  1S72 T;  4JPB W;  3GLX A;  5DM7 R;  2CDT A;  4XTZ A;  2QA4 T;  2KRO A;  4M77 E;  3VS3 A;  5KE3 A;  2O9S A;  1YI2 A;  2CRE A;  4RMO A;  1RAF B;  2H8H A;  1SSF A;  1B07 A;  1VQK A;  2LT4 A;  3JCM J;  5HK0 A;  4FYW B;  5A0L A;  3OW2 P;  1JJ2 S;  1HXD A;  2CZ6 B;  2KQW A;  1K0X A;  2V1Q A;  1N8R R;  4C0F A;  1YP5 A;  4AFS C;  1Q82 C;  1G3T A;  1RAH B;  3L2R A;  1OU9 A;  4D8K A;  1GCP A;  2F5K A;  2V1R A;  1UEC A;  1TOV A;  2FRW A;  1BIA A;  3V7R A;  2KRS A;  3X25 B;  2DO3 A;  1YJN A;  1LOJ A;  3BE3 A;  4ORZ A;  5GAM j;  2XI9 A;  1IHW A;  4CC4 B;  3M0S A;  2HZY A;  3MP6 A;  4LDU A;  2MAM A;  3MEU A;  1EFN A;  2K5L A;  3J7A F;  4HXJ A;  1ZSZ B;  5HKC A;  2RHI A;  4C0D B;  1Z9Z A;  2QDY B;  1GCQ A;  4JZ3 A;  4J83 A;  4PL6 A;  3QZ5 B;  1JU5 C;  1DJ7 B;  3CXC A;  3JSC A;  2K3Y A;  2HL3 A;  4A4H A;  1NJI C;  1WQ7 A;  2KVQ G;  3G71 Q;  1FMW A;  3EFO A;  4M7A D;  2V8K A;  2HD0 A;  2NUT B;  2ZPH B;  3EHQ A;  1VQN Q;  2COY A;  3LW5 E;  1KD1 U;  4ELY C;  2JMC A;  2BTT A;  1I8F A;  5L8R E;  5IN1 A;  3U23 A;  4M78 F;  2VGN A;  3BDU A;  1TH7 A;  3VUB A;  5LJ5 h;  4XK8 E;  5KCO A;  3GOX A;  1WHK A;  1YFN A;  2CYZ B;  1LPL A;  5CO7 A;  5EC7 A;  1K8A U;  1VQ6 T;  2DL4 A;  2NYS A;  4BB7 A;  1WFW A;  4XTX A;  3E9G A;  4F7U E;  2GQV A;  1Q95 G;  1D0Y A;  4XTU A;  2YLB A;  2FG0 A;  3OYE A;  2YWW A;  3TU4 K;  2YHT A;  4C92 F;  1M8V A;  2QTX A;  2GFA A;  1C0M A;  2QGF B;  4F04 B;  2XMF A;  1U1T A;  1OYX A;  4IUT A;  1I5O B;  3MKD A;  2DKG A;  2DXT A;  2MIO A;  2EW3 A;  1NPR A;  4M7D D;  1ZUU A;  2SRC A;  3PIP A;  2DD4 A;  4IIM A;  2K2V A;  2L0A A;  5KYY B;  3QBY A;  1WX6 A;  3N5B B;  3MCA B;  1ZBX A;  2QQB A;  3OYK A;  3ZEH A;  5LJ5 f;  3VS7 A;  1VQM A;  4C92 E;  5GMK e;  1VQO Q;  3MO8 A;  3JCM d;  3VJP A;  1Q7Y R;  2LP5 A;  4XU2 A;  1VQ9 A;  4A54 A;  1YHQ A;  1RI0 A;  4PLL A;  2KNB B;  1ABQ A;  1HK9 A;  1OEB A;  1QW1 A;  5FRN A;  1PKS A;  2D0Q B;  2KBT A;  2L3P A;  2RQV A;  3OB9 A;  1KC8 C;  4J5Y A;  4C0G A;  2C06 A;  3SDZ A;  4F17 A;  3EGD B;  2YT6 A;  5CKB A;  3EG9 A;  5GAN 7;  5FWB A;  4JDS A;  2QK0 A;  4N4I A;  2X9H A;  1G8X A;  3ZFJ A;  3M58 A;  2ZZD A;  1BCM A;  1UHF A;  3A8O B;  3CCL Q;  2Z0W A;  4NL3 A;  5CAI A;  1JJ2 A;  2QYZ A;  3M55 A;  1TUD A;  2X4W A;  1UUE A;  1NBE B;  1Q81 R;  3JCM b;  3G6E T;  1OZ2 A;  2E3I A;  4XU0 A;  2ABL A;  4OB0 B;  1X43 A;  5FU7 C;  1G3S A;  4Z02 A;  2E1H A;  3V8K A;  2CH4 W;  5I21 A;  4PNO A;  4JRK A;  5FU7 B;  2NUT A;  2AZV A;  1KSW A;  4AMC A;  2CP6 A;  1GL5 A;  2E41 A;  3CCM T;  4A4G A;  4F14 A;  2HQH A;  1UGR B;  1AD5 A;  3L2W A;  3VUZ A;  1IB8 A;  3CCJ A;  4ZGE B;  3NTK A;  4MZP A;  4F16 A;  3M0R A;  3CPW A;  2IIM A;  1YJW Q;  1QWF A;  2YLC A;  1VQP Q;  2XID A;  5LJ3 e;  3MP1 A;  1SRM A;  2K2M A;  5FLX E;  1VYT A;  2CP3 A;  4DBR A;  3LGL A;  3JCM Q;  4M75 C;  2FPE A;  1FX7 A;  3H0I A;  4B6M A;  2QQR A;  5GMK j;  5CQY A;  4M75 B;  4FCY A;  4IKF A;  5HK3 A;  4E6R A;  1VYU A;  3CME Q;  1F1B B;  1KQS A;  2DE0 X;  4OMP A;  1KD1 C;  4OB1 B;  4OMQ A;  1BU1 A;  5IXF A;  3JB9 G;  2YDL A;  2R5M A;  2YRC A;  4AFZ C;  3G4S A;  4M78 D;  1JQQ A;  4XTW A;  1IXD A;  4M75 G;  2DLP A;  1SSH A;  4XTY A;  3RKX A;  4FW2 A;  4QVZ A;  4QKU A;  4ME7 A;  2LQN A;  2PVG B;  5KYY A;  2BIV A;  4KUI A;  3LX7 A;  4JS5 A;  4OMO A;  2E6N A;  3CXC P;  1S1N A;  1N8R U;  1K8A C;  1MV3 A;  4L5G A;  5I11 A;  4X34 A;  3FEO A;  1YIJ Q;  1CSK A;  3AHU A;  3LLR A;  4OML A;  2B8A A;  3INZ A;  3JCM g;  3RR6 A;  1QVG S;  3SD4 A;  4C92 D;  1Y07 A;  1VQP T;  3HFN A;  1U1S A;  5CK9 A;  4FSS A;  4ZTJ A;  5KYU B;  3GP8 A;  4EMH A;  2RPN A;  3KBG A;  3CC2 T;  3A98 A;  3OYM A;  1AWW A;  2QA4 A;  4OP0 A;  3EGD A;  1KK7 A;  4GLM A;  4MDW A;  1G3W A;  1PSE A;  1VQ4 Q;  1PKT A;  3OYN A;  3EGX B;  2EJ9 A;  1RAC B;  4PFO A;  3E2U A;  4WTO B;  1QVF S;  3UA6 A;  1ZUY A;  2J7I A;  3OYY A;  2HAX A;  3ASK A;  2EYW A;  4A4K A;  3JCM W;  2F69 A;  2E5K A;  4HVV A;  3OYG A;  2RQT A;  4JJN K;  2FEI A;  4C8Q G;  2JVV A;  2ZGW A;  4BE0 A;  2XDP A;  2J6O A;  2ZPI B;  2M9U A;  1D0X A;  2RMO A;  3THK A;  4RTV A;  3GPL A;  1FXX A;  3PVL A;  3OS5 A;  1EZZ B;  4IUV A;  2CP5 A;  1QCO A;  3TVT A;  1OV3 A;  2DIL A;  1VA7 A;  1ZQ1 A;  2DTH A;  2EVR A;  2RK2 A;  1PRL C;  4O5V A;  2EPD A;  1YIJ T;  2YUP A;  1WGS A;  4PJL A;  2HSE B;  2DEU A;  4C8Q F;  1HD3 A;  3VS1 A;  3OSV A;  3I56 A;  2OTL Q;  4MZT A;  1I4K 1;  4M7A C;  1QVP A;  2MK5 A;  2HNI A;  1VQ5 A;  3H6Z A;  2BKD N;  3HRU A;  4HCK A;  1OQK A;  2LCC A;  2LNH B;  3JAM E;  4M7A B;  1H3Z A;  2O01 E;  2PZ1 A;  2DVE A;  2DNU A;  3JCM h;  3CCU T;  1AHJ B;  1MMG A;  4M75 A;  1UE9 A;  4KUD K;  4M7A G;  1OI1 A;  2LX9 A;  1OPK A;  4Y92 A;  5HCK A;  3CMA Q;  2DD5 A;  4A4E A;  2OJ2 A;  2W10 A;  1Q7Y U;  1ZSG A;  4AG1 C;  1OU8 A;  3M59 A;  2AK5 A;  1WHH A;  2DEQ A;  3HP9 A;  1M1G A;  1OOT A;  2M1H A;  2EFI A;  1WJR A;  2EIF A;  3I5R A;  2JTF A;  2QTV A;  1PNJ A;  5AYF A;  1FWZ A;  3QDR B;  3QKJ A;  2YRD A;  1TXQ A;  2AKL A;  4M7D C;  2M51 A;  3NHN A;  3VS5 A;  1S72 Q;  3V8J A;  2JTM A;  3G71 A;  2JW4 A;  2F2X A;  3JCM f;  1VIE A;  4D8D A;  1K9M R;  2QAZ A;  1VQN A;  5KYU A;  3MJX A;  3CC4 T;  3VYH B;  1K4U S;  2RI3 A;  2VC8 A;  1RL2 A;  4OF1 A;  1WI7 A;  1Q81 U;  4QT7 A;  2EGC A;  1RLP C;  1M2V A;  1NZ9 A;  2EYX A;  3EGX A;  5D6X A;  2DJZ A;  1QWE A;  4M7D G;  1TU0 B;  1QCF A;  2D1X A;  4KH1 B;  3SWN C;  1H8K A;  1N8R C;  3C12 A;  4OMF B;  5CIU A;  4QVC A;  4AFU C;  3LH0 A;  2JMA A;  1M9S A;  2O88 A;  3OSS C;  4M77 B;  2DZ9 A;  1JXM A;  3V8L A;  1WA7 A;  1HJD A;  3OS1 A;  2CP2 A;  4HT9 A;  2A3L A;  1U06 A;  4E7S A;  2F2V A;  1W2B S;  2RF0 A;  4FSX A;  3L2U A;  3R6O A;  2PUK B;  3QYH B;  3OYI A;  2FO0 A;  5GAM d;  4X9D A;  1QVF A;  1N6A A;  2LDM A;  4J9F A;  1V29 B;  2CH4 A;  5D6Y A;  2CZ7 B;  5GAN j;  1VQL T;  2PTK A;  2VWF A;  4EMK C;  4O6J A;  4PKC C;  1E6H A;  3G7Z A;  1ARK A;  2RB6 A;  5C0M A;  1I0C A;  1YJ9 T;  1HSQ A;  2M0Y A;  3VS6 A;  4LDY A;  1VQO A;  1X01 A;  3CD6 T;  4JJB A;  3CCR T;  4IUQ A;  3M4Y A;  4M7A A;  2DBK A;  2K6D A;  1N9R A;  3H8Z A;  5KE2 A;  4PFP A;  2JJ9 A;  4J9G A;  2J6K A;  4KBM B;  3PVQ A;  3CCS T;  2VXF A;  3EG9 B;  1T0J A;  2HBW A;  4RTX A;  2E12 A;  8AT1 B;  2MMP A;  2QQA A;  2FVU A;  2L5Q A;  1VQ6 Q;  3OYC A;  2ROT A;  1UJY A;  2NUZ A;  3V7C A;  3X20 B;  2FZK B;  3JV3 A;  3GNF B;  2FPD A;  2DRK A;  2QGG A;  1D3B B;  3QXE B;  3GNG A;  3CPW S;  4C5H A;  3OYJ A;  2KRN A;  3NGP A;  5ECA A;  1MMA A;  2K5F A;  1N9S A;  2DIG A;  2RNA A;  3UA7 A;  2YSQ A;  1BCO A;  4KUL A;  3CCL A;  1PM3 A;  1Y57 A;  9ATC B;  2BE9 B;  2HDA A;  3C4S A;  2QEX T;  4BUG A;  2MF2 A;  4F7U B;  4EPC A;  1KQS S;  2YUQ A;  4LE9 A;  2RA2 A;  3MET A;  3GBQ A;  2CSQ A;  1WXU A;  4M7D A;  2RHY A;  3C94 A;  2GF7 A;  2P84 A;  1K73 R;  2D8J A;  2KY9 A;  1FYN A;  5IHK A;  4Y91 A;  1KG1 A;  2V8I A;  2L8D A;  4IUP A;  3L2V A;  2OTJ T;  1Q7Y C;  4RG8 A;  2DBM A;  4E2F B;  4X9C A;  1AOJ A;  4FW1 A;  4F7U G;  2LC4 A;  2KE9 A;  1R8O B;  3M9Q A;  1P92 A;  2KMT A;  1BK2 A;  4M78 G;  4C92 C;  2HCK A;  1AZG B;  3OYH A;  3RUX A;  1YJW A;  3M54 A;  1VQP A;  1PD1 A;  2K3X A;  3PNW C;  3REB B;  4AT1 B;  4KT0 E;  3S3M A;  4M78 E;  2EQM A;  2KDS A;  4FYX B;  5L23 A;  4J9B A;  2X4Y A;  4M77 A;  3TRE A;  3SWN A;  2YXY A;  1Z9Q A;  5KYN A;  3NFC A;  2PUO B;  3CCV T;  2HQE A;  3BFM A;  2LTO A;  3JRZ A;  2D9T A;  2RJF A;  3HKS A;  4Y28 E;  4C5G A;  1OX9 A;  1TSF A;  3CME A;  1VQ7 T;  2XDB A;  2XIC A;  3NPF A;  4C92 G;  2ZAE A;  3R6N A;  4JLG A;  3G6E Q;  1YIT T;  4LN2 A;  1W4S A;  1Q81 C;  1AWX A;  2YUO A;  1ZHI A;  4PJN A;  5FU6 C;  3P8B B;  5GAM g;  2CZ0 B;  3BDL A;  3EG0 A;  4ANJ A;  2P0P A;  2EYY A;  3I9Q A;  5KYX A;  2H3E B;  1ZBJ A;  4J9D A;  1RAA B;  1SPK A;  3CCM Q;  1PD0 A;  1VQK Q;  3EFR A;  2ZPF B;  4N4H A;  3Q1J A;  1BB9 A;  4ZTF A;  1RAB B;  4C5I A;  3VS0 A;  1RAE B;  3S3O A;  2RO0 A;  2ESW A;  3EG3 A;  1W2B A;  2GGR A;  5M9O A;  5IHI A;  3EAE A;  2DXB A;  5A2Q E;  2VUB A;  2ED1 A;  3QPH A;  4HVW A;  3SB2 A;  2J05 A;  3CCQ T;  1NYG A;  4EIK A;  3I55 T;  4B9W A;  3CBP A;  3OYB A;  4QQD A;  1YJN Q;  1OZ3 A;  1SKU B;  2FZG B;  2L3R A;  2XKO C;  2R5A A;  1VQ4 A;  1VQ8 A;  3WXM B;  3URG A;  1Y96 B;  1D3B A;  4RTY A;  1PWT A;  1QVG P;  1X6B A;  2JUF A;  4R0K A;  1CKB A;  2RQW A;  1K9M U;  3VV0 A;  4BD3 A;  2M16 A;  2LJ3 A;  2HBP A;  1SHG A;  2RHZ A;  2HKQ B;  2VXE A;  4DOV A;  3QSU A;  2DL3 A;  3TEE A;  4F7U A;  1YWO A;  1H64 1;  3OBY A;  1YI2 T;  2KI7 A;  4ATO A;  1QVF P;  1VQK T;  5CQX A;  4DBQ A;  4J7I A;  2NUP B;  4ZNX A;  5GAN 5;  4UC4 A;  2VGM A;  2CGH A;  3T9N A;  2J6F A;  5GAM h;  1CKA A;  2OTL A;  2JXB A;  4PJJ A;  3CC2 Q;  4EDU A;  4JJC A;  2HQX A;  5GAN f;  2DET A;  1E6G A;  2VKN A;  1YJN T;  4A53 A;  1LVK A;  2JN0 A;  2SEM A;  4C92 A;  5IH2 A;  2P4R A;  2PNI A;  1NLO C;  3MEW A;  1AWJ A;  1K76 A;  1QLY A;  2RD1 A;  2YUN A;  2DXU A;  1GFC A;  1X2K A;  1AT1 B;  1SRL A;  5GAO r;  2O31 A;  1UTI A;  2BZY A;  1W1F A;  3VYG A;  5KCH A;  3KUF A;  4PJO F;  4PJM A;  4HCC A;  1BI0 A;  3CMA A;  2KT8 A;  3S3N A;  1BIB A;  2RQR A;  2X51 A;  3M4G A;  5D7U A;  1BI1 A;  2XG8 D;  2OI3 A;  4C0Z A;  2KYM A;  2DF6 A;  2FB7 A;  5GAM f;  2Y4X A;  4J9H A;  4PLI A;  1UGS B;  2H3J A;  3QJ6 A;  3LWI A;  2CP7 A;  3UWN A;  2KK4 A;  1VQ9 Q;  4CC2 A;  3HL8 A;  2DFU A;  1M2O A;  4PJO E;  2ZPB B;  1ZLM A;  5LJ5 e;  1S72 A;  2L3S A;  2M02 A;  2FRY A;  5CR2 A;  2A36 A;  4RG2 A;  4RTZ A;  2HL5 C;  1TG0 A;  3DB3 A;  1RLQ C;  3OW2 A;  5GAN 4;  2RJD A;  2V26 A;  4E7L A;  1U8R A;  4HCB A;  1R0C B;  1M2V B;  4EMG A;  1XNI A;  4KH0 B;  4MZM A;  2PQW A;  2P0K A;  3CCU Q;  1K0S A;  4NL2 A;  4BI3 A;  1I1J A;  3UT1 A;  2O2O A;  3OA6 A;  1R77 A;  1R0B G;  1M30 A;  1WJS A;  1M8M A;  2DJQ A;  3RES A;  3WVE B;  4BY6 C;  1Y96 A;  4OGE A;  1K1Z A;  1FMK A;  2X35 A;  2K5I A;  4XAX B;  2EKO A;  3CEY A;  5IT9 E;  4CI0 C;  3FLG A;  1K73 U;  5LJ3 j;  1MV0 B;  4C5E A;  1UFF A;  3L2Q A;  4LD6 A;  3E1S A;  3RER A;  3OMC A;  3MEA A;  3HTR A;  2BZX A;  2XK0 A;  1VQM T;  1KQ1 A;  3X24 B;  3EGU A;  5I2S A;  2LZ6 B;  3DLM A;  3CCE Q;  1JXO A;  3CC7 Q;  3OYA A;  1Y71 A;  3H41 A;  4JRI A;  4JUV A;  5LL6 S;  1VQ9 T;  4LDV A;  3FIF A;  2V8J A;  1I5L A;  4QW2 A;  3GF5 A;  4RUG A;  4OMN A;  2NUP A;  4OB2 B;  4AG2 C;  3TSZ A;  2HSP A;  3OMG A;  3VS4 A;  4LNP A;  2L89 A;  4ZGD B;  2EJF A;  1ZA1 B;  3CC4 Q;  3PMT A;  1K9M C;  3UDC A;  3PT9 A;  4C8Q E;  4JS4 A;  1XJW B;  2KAF A;  1W2B P;  2LRQ A;  2MWP A;  1M90 R;  2LX7 A;  4KRT A;  2PVO B;  3EHR A;  1YBY A;  4XQ3 A;  1WHL A;  3M56 A;  3VRZ A;  3JB9 I;  2LT1 A;  3M5A A;  5GAO n;  2IPO B;  4M7A F;  2E5Q A;  3TQ7 P;  1G5V A;  2QDL A;  3JB9 H;  1U5S A;  3VKI A;  5DLO A;  2LCS A;  1YWP A;  1VQ6 A;  2RM4 A;  3EG2 A;  5LJ5 j;  2JOY A;  1JJ2 P;  1QQJ A;  2JM9 A;  4A63 B;  2F5T X;  2C0I A;  1M3C A;  2YRV A;  3CCE T;  1WPY A;  2DAQ A;  2RI5 A;  2QAS A;  2G6F X;  5I2M A;  2G3R A;  2DTI A;  3CC7 T;  1UB4 A;  4II1 A;  2RQU A;  5IHN A;  4WF2 A;  3QJY A;  4DA4 A;  4FU6 A;  2C0T A;  1JB0 E;  3ULR B;  2CT4 A;  2E10 A;  5DLQ E;  4RTU A;  1X75 C;  4RCC A;  2HEQ A;  3CCJ T;  1VQL Q;  4M7D B;  1PG5 B;  5GMK h;  3JCM c;  2CT3 A;  5LJ3 g;  1YJ9 Q;  2DER A;  3FDR A;  5C6S A;  2E70 A;  1H92 A;  1WYX A;  2VYT A;  3CD6 Q;  3CCR Q;  5J3B A;  3CPW P;  5GAN d;  1GFD A;  2CS7 A;  2JS0 A;  1UDL A;  5IXB A;  5GAN 8;  5CKH A;  1OPL A;  4LUE A;  1QKX A;  5CVI A;  4PJO D;  1X6O A;  2LMJ A;  3CCS Q;  3CPF A;  3MEV A;  2RHU A;  3VS2 A;  2A0F B;  3KFV A;  4JZ4 A;  3FB9 A;  1OUL A;  1M1K R;  1WNL A;  2GTO A;  4R55 A;  2DTO A;  2EAY A;  4ZN3 A;  1Y0M A;  4XU1 A;  1N5Z A;  1I07 A;  2LQK A;  3SWN B;  3V7S A;  1Q86 R;  1NLP C;  1KQS P;  3M53 A;  2EJG A;  5KYW B;  3J81 E;  3FC3 A;  4JRQ A;  1A0N B;  2KXD A;  3G4S T;  5GJV B;  3PIO A;  3HFO A;  5GAO q;  2D0N A;  1BI3 A;  4L6V 5;  2P0Q A;  2B86 A;  2ZCF B;  2WAC A;  1UGQ B;  3OYL A;  3PE0 A;  2W0Z A;  2L3Q A;  2OAU A;  4QQG A;  2ENM A;  1XOV A;  4PK4 A;  1C6V X;  4M77 F;  1NEG A;  1WXT A;  4J8O A;  1UHC A;  1RAI B;  2I2L A;  1T0H A;  2JM8 A;  3QZ9 B;  3FJ5 A;  1M4Z A;  2QEX Q;  1IO6 A;  2K79 A;  2AZS A;  3HRS A;  4JLI A;  3G6E A;  5KYX B;  2BZ8 A;  6AT1 B;  4EMK B;  5FWC A;  3M0T A;  3UF4 A;  1RUW A;  2D8H A;  4LDX A;  4DOW A;  3H0H A;  3A8L B;  3OQ5 A;  5FRM A;  2OTJ Q;  3OYF A;  1K73 C;  2WSC E;  2ZPE B;  3AT1 B;  2FYK A;  1D1A A;  3RKW A;  3TSW A;  3CCM A;  2NLU A;  4NS5 A;  3RNJ A;  2Y90 A;  2E64 A;  3JCM X;  1YNZ A;  3LGF A;  5LJ3 h;  1KJW A;  4BDY A;  4OGC A;  4C8Q D;  1WHJ A;  4LUD A;  4K11 A;  3HRT A;  1VYV A;  2WSF E;  1E7O A;  5CCA A;  2BE7 D;  4LXC A;  1RAG B;  3P8D A;  2GQI A;  4MDX A;  3CCV Q;  2K4Y A;  1BBZ A;  3PTA A;  1UG1 A;  1TS9 A;  1VQ7 Q;  1TWB A;  2DM1 A;  4FYV B;  2QG9 B;  1ZSZ C;  2CKK A;  4C0D C;  3L42 A;  1PSF A;  1YCY A;  2GTJ A;  4BAC A;  4JJD A;  1YIT Q;  5GMK i;  2DPP B;  4M78 C;  3VRY A;  2FZC B;  5GMK m;  3I56 T;  1YN8 A;  3C95 A;  4J6Y A;  5GAO m;  3C0C A;  2JS2 A;  2LVM A;  4ZGJ B;  4M78 B;  3OBW A;  2EQU A;  3QHS A;  1G2B A;  1VQ5 T;  3PFS A;  4ZN1 A;  5LJ3 f;  2GNC A;  1PRM C;  3M0U A;  4J6X A;  1TUG B;  3A5Z B;  4F7U F;  1ZA2 B;  1JBM A;  3EFS A;  1KHC A;  2K3B A;  2DVJ A;  1GBR A;  2OAW A;  1Q82 R;  4BI4 A;  5GAN g;  2DMO A;  1JRI A;  3CBM A;  3JCM e;  2C0O A;  2DIQ A;  2VVK A;  2K7A A;  4KGV B;  4C92 B;  5J26 A;  2J06 A;  2FL7 A;  4E7I A;  1NM7 A;  1LJO A;  4TVR A;  3CCQ Q;  5DY9 A;  2MCN A;  2ATC B;  3I55 Q;  4V2S A;  4HA8 A;  1B3Q A;  3CC2 A;  3IQL A;  3QWY A;  4FYY B;  1B34 B;  5KYW A;  2IG0 A;  1PC0 A;  1U3O A;  1D1B A;  1ABO A;  2KR3 A;  3L1A A;  4RKU E;  2KGT A;  1M3A A;  4ELZ C;  1WHM A;  4XU3 A;  3ZBD A;  1IZ6 A;  4B9X A;  2LQ8 A;  1EIF A;  3O8V A;  2RN8 A;  3TCJ A;  3OW2 S;  2A28 A;  4GLK A;  1SF9 A;  1G3Y A;  2COW A;  4FL6 A;  3CBO A;  3X26 B;  2O4X B;  1NJI R;  1WQW A;  4BI8 B;  1KQ2 A;  4FM4 B;  2QXF A;  2AHJ B;  3G71 T;  1IRE B;  2GCX A;  1M90 U;  1PCX A;  5FU6 B;  2ED0 A;  1V1C A;  2KXC A;  1YI2 Q;  3NTH A;  1I81 A;  1WIE A;  4EMK A;  1QP3 A;  1VQN T;  4QVD A;  1NPP A;  4BDZ A;  4OMM A;  1YIJ A;  4DBH A;  3PGG A;  1MMN A;  1Y7X A;  4VUB A;  3A8G B;  1WLP B;  2KYB A;  1SEM A;  2DK3 A;  2HMA A;  2D6F A;  2DX1 A;  1BKB A;  3EG1 A;  3PMI A;  2VV5 A;  2DRM A;  1QP2 A;  2E65 A;  4DBF A;  4M77 D;  3A8M B;  2RH2 A;  1T3S A;  1ZUK A;  3M0P A;  4IUR A;  2XD0 A;  2GFU A;  4J6W A;  1N27 A;  2RJC A;  4AFQ C;  2EGA A;  1LCK A;  1GXI E;  2MI6 A;  5GAN h;  2MWO A;  1WXB A;  2JNG A;  2Y4Y A;  4CC7 A;  2LNV A;  1NG2 A;  3CCU A;  3JCM V;  1HYO A;  1UGV A;  4D6W A;  4J9C A;  1XQH A;  2LQW A;  2DYB A;  4E7K A;  3ME9 A;  2DYI A;  3E19 A;  1ZSZ A;  1SG5 A;  3DKM A;  4L59 A;  1UJ0 A;  2A7Y A;  4FT2 A;  4M78 A;  4CC3 A;  1M1K U;  3RDV A;  2L2P A;  5CKD A;  1VQO T;  2PVD B;  2QI2 A;  4YTL A;  1QCN A;  1TTH B;  3CCE A;  1T3L A;  1Q86 U;  3CC7 A;  2X3X D;  3RIR A;  1X27 A;  5GAN 2;  2QQ9 A;  3MHX A;  5EG2 A;  1O9S A;  3EH1 A;  3LYI A;  5GMK l;  3MP8 A;  1KC8 R;  2AIR B;  2EYZ A;  3GIB A;  5GAO l;  2EYQ A;  2X3W D;  1MMD A;  1WZO A;  1WJQ A;  3CC4 A;  4X1V A;  3JB9 F;  1B34 A;  1IRX A;  2VAS A;  2E3H A;  3RMS A;  1NYF A;  4PJO C;  4A4F A;  5GAN 6;  2BUD A;  3BY7 A;  2O9V A;  1JO8 A;  1EX4 A;  3CCL T;  3UAT A;  4M75 F;  4PJO B;  3O5Z A;  4ESR A;  2XU8 A;  3RMQ A;  4OB3 B;  5FW9 A;  1UEB A;  3S6W A;  1B7T A;  4HVU A;  2DL8 A;  2O4X A;  3G1J A;  3HHT B;  1TUC A;  3P8H A;  4FT4 A;  1VQM Q;  1BI2 A;  2EGE A;  1M27 C;  2PU9 B;  2I0N A;  1MUZ A;  3M0Q A;  1KFZ A;  3REA B;  4HT8 A;  1JEG A;  1W70 A;  5LJ3 d;  4PJO G;  3JB9 J;  4HCZ A;  4E7Z A;  4RCB A;  1NE8 A;  2GBQ A;  2RK1 A;  4NOY A;  4DQ2 A;  2CP0 A;  1GBQ A;  1YHQ Q;  4M75 E;  3DB4 A;  3OS2 A;  1X6G A;  2R58 A;  4Z8A A;  2DXC A;  1WDX A;  3BW1 A;  2E6Z A;  5A0D A;  1D0Z A;  5CKE A;  1VQL A;  2M0O A;  5A0G A;  1NEB A;  2CUD A;  1YJW T;  3EH2 A;  1WHG A;  1YJ9 A;  1QKW A;  1D09 B;  4RTW A;  4Z88 A;  4N0A C;  1GRI A;  1LNX A;  5J39 A;  3CD6 A;  3CCR A;  1IHV A;  3ER0 A;  2RHX A;  3H0F A;  4Q5W A;  3ZL7 C;  1IGU A;  5GAN 3;  3H9N A;  3FRN A;  1AZE A;  1VIF A;  2DL5 A;  1KD1 R;  5D6W A;  1M90 C;  4LD9 K;  3CCS A;  3E9F A;  3OY9 A;  1VQ8 Q;  3JCM P;  4R56 A;  1VUB A;  3CME T;  1XTD A;  3NMZ C;  3UPU A;  2NWM A;  1KHI A;  2MPX C;  4GBQ A;  2XHC A;  1RI9 A;  2VB6 A;  4J9I A;  4BY6 B;  1PHT A;  2COZ A;  5KH6 A;  1AWO A;  4C8Q C;  2KRM A;  4FIB A;  1MNE A;  4E7H A;  2F2W A;  4C8Q B;  4GY5 A;  3QUI A;  4LDW A;  1K8A R;  1Q82 U;  5IAY A;  5GJW B;  2KT1 A;  5LJ5 d;  1YHQ T;  2EQK A;  2A37 A;  1M3B A;  3J80 E;  8ATC B;  1OX8 A;  2IVW A;  3SFM A;  3CQT A;  5I22 A;  4IUU A;  1X69 A;  3CCJ Q;  2ZPG B;  4XTV A;  3KXT A;  4J7F A; 
#chains in the Genus database with same CATH homology
 1Z9Q A;  1WXT A;  1SRM A;  1UHC A;  2K2M A;  2EKH A;  1VYT A;  2ROL A;  1T0H A;  3I5S A;  2JM8 A;  2FPE A;  3FJ5 A;  3H0I A;  1IO6 A;  2K79 A;  2AZS A;  3NPF A;  4E6R A;  2BZ8 A;  1VYU A;  1X2Q A;  3R6N A;  1J3T A;  5FWC A;  2DE0 X;  3M0T A;  2JTE A;  4LN2 A;  4OMP A;  3QWX X;  3UF4 A;  4OMQ A;  5IXF A;  1BU1 A;  1RUW A;  2K9G A;  2D8H A;  1AWX A;  2YDL A;  2YUO A;  3H0H A;  3SHW A;  2EBP A;  1ZX6 A;  4AFZ C;  3LH5 A;  1YCS B;  1JQQ A;  3TSW A;  3EG0 A;  2DLP A;  1SSH A;  3RNJ A;  2EYY A;  3I9Q A;  4M4Z A;  1K9A A;  4J9E A;  2LQN A;  1ZBJ A;  4J9D A;  1SPK A;  2DA9 A;  1YNZ A;  1KJW A;  2MOX A;  4OMO A;  1BB9 A;  1S1N A;  1GCQ C;  1MV3 A;  1W6X A;  3VS0 A;  5I11 A;  2ESW A;  4LUD A;  4K11 A;  3EG3 A;  1CSK A;  1VYV A;  1E7O A;  2GGR A;  5IHI A;  2GQI A;  4OML A;  2ED1 A;  1BBZ A;  1AEY A;  4HVW A;  2EQI A;  2LJ1 A;  2J05 A;  1UG1 A;  1NYG A;  4EIK A;  2CUB A;  3I35 A;  2DM1 A;  4FSS A;  1KIK A;  2FPF A;  2RPN A;  2GTJ A;  2A08 A;  1H3H A;  3A98 A;  4JJD A;  1AWW A;  2AKK A;  2JT4 A;  3VRY A;  4GLM A;  1YN8 A;  2DL7 A;  2ECZ A;  4RTY A;  1PKT A;  2CSI A;  1PWT A;  3C0C A;  2JS2 A;  1X6B A;  3UA6 A;  4R0K A;  1ZUY A;  1CKB A;  1G83 A;  2RQW A;  1G2B A;  2J7I A;  2LJ3 A;  2EYW A;  2E5K A;  4HVV A;  1SHG A;  2RQT A;  2FEI A;  2GNC A;  1PRM C;  3M0U A;  4Z89 A;  1AVZ C;  2J6O A;  2DL3 A;  4DEX A;  1YWO A;  2RMO A;  3THK A;  4RTV A;  2K3B A;  3PVL A;  2DVJ A;  2LJ0 A;  1GBR A;  2OAW A;  3TVT A;  1OV3 A;  2DMO A;  2DIL A;  1SHF A;  1VA7 A;  2C0O A;  2VVK A;  2EVR A;  2K7A A;  1PRL C;  2J06 A;  4ZNX A;  2KEA A;  2EPD A;  1NM7 A;  2YUP A;  2MCN A;  4IIO A;  3RBB B;  1B3Q A;  3IQL A;  2J6F A;  3QWY A;  1CKA A;  1HD3 A;  2JXB A;  3VS1 A;  1U3O A;  1ABO A;  2KR3 A;  4RTT A;  2KGT A;  4JJC A;  1M3A A;  4DEY A;  1E6G A;  4WCI A;  2VKN A;  3SEM A;  2RN8 A;  2SEM A;  5IH2 A;  2A28 A;  2P4R A;  4HCK A;  2PNI A;  2LNH B;  1NLO C;  1AWJ A;  1K76 A;  1QLY A;  4JPB W;  2CDT A;  2YUN A;  2KRO A;  2PZ1 A;  1GFC A;  1X2K A;  1SRL A;  3VS3 A;  2DNU A;  2O9S A;  2CRE A;  2O31 A;  2H8H A;  1UTI A;  2BZY A;  1B07 A;  1W1F A;  2ED0 A;  1V1C A;  2KXC A;  1UE9 A;  1WIE A;  1K0X A;  4OMM A;  2V1Q A;  2KT8 A;  2RQR A;  1YP5 A;  4Y92 A;  1OPK A;  5HCK A;  4AFS C;  1WLP B;  2OI3 A;  2KYM A;  2OJ2 A;  2W10 A;  2DF6 A;  1SEM A;  2KYB A;  4J9H A;  4D8K A;  1GCP A;  2DX1 A;  1ZSG A;  2V1R A;  4AG1 C;  1UEC A;  3EG1 A;  2FRW A;  2KRS A;  2AK5 A;  2DRM A;  1OOT A;  4ORZ A;  4CC2 A;  3I5R A;  1T3S A;  1PNJ A;  1ZUK A;  3M0P A;  1ZLM A;  4CC4 B;  3M0S A;  2L3S A;  4AFQ C;  2EGA A;  2FRY A;  1LCK A;  2A36 A;  1EFN A;  2AKL A;  4RTZ A;  1TG0 A;  1RLQ C;  2M51 A;  3NHN A;  4HXJ A;  3VS5 A;  1Z9Z A;  4JZ3 A;  1GCQ A;  1JU5 C;  1WXB A;  4CC7 A;  1NG2 A;  2JW4 A;  2F2X A;  4D8D A;  1UGV A;  4J9C A;  1K0S A;  2LQW A;  1I1J A;  2DYB A;  2O2O A;  1K4U S;  1M30 A;  3EHQ A;  1M8M A;  2DJQ A;  1WI7 A;  2JMC A;  2BTT A;  4QT7 A;  2EGC A;  1K1Z A;  1RLP C;  1FMK A;  2EYX A;  1UJ0 A;  1QWE A;  3U23 A;  1QCF A;  2D1X A;  4CC3 A;  1MV0 B;  1H8K A;  1UFF A;  2L2P A;  4AFU C;  2JMA A;  2BZX A;  2O88 A;  3EGU A;  1T3L A;  2X3X D;  2LZ6 B;  1JXM A;  1X27 A;  1WA7 A;  1JXO A;  5EC7 A;  1HJD A;  2DL4 A;  3H41 A;  2EYZ A;  1WFW A;  2X3W D;  1U06 A;  2FG0 A;  2F2V A;  2RF0 A;  4RUG A;  4OMN A;  2FO0 A;  4AG2 C;  2XMF A;  4J9F A;  3TSZ A;  2HSP A;  3VS4 A;  4X1V A;  2CH4 A;  4LNP A;  1NYF A;  2PTK A;  2MIO A;  2EW3 A;  2VWF A;  1E6H A;  1ARK A;  1ZUU A;  2SRC A;  4IIM A;  1I0C A;  2L0A A;  2O9V A;  1JO8 A;  3UAT A;  2LX7 A;  1HSQ A;  4KRT A;  3O5Z A;  2M0Y A;  3EHR A;  1WX6 A;  3VS6 A;  4ESR A;  3VRZ A;  4JJB A;  5FW9 A;  3VS7 A;  4HVU A;  2K6D A;  2DL8 A;  2DBK A;  2QDL A;  1TUC A;  4J9G A;  1U5S A;  2J6K A;  3PVQ A;  2LCS A;  1YWP A;  2LP5 A;  2EGE A;  1M27 C;  2I0N A;  1T0J A;  1MUZ A;  2HBW A;  3EG2 A;  3M0Q A;  1KFZ A;  3REA B;  4RTX A;  1JEG A;  1W70 A;  2JM9 A;  2ROT A;  1UJY A;  2NUZ A;  4A63 B;  2C0I A;  2GBQ A;  1ABQ A;  2KNB B;  1M3C A;  1OEB A;  1GBQ A;  3JV3 A;  1PKS A;  2G6F X;  2FPD A;  2KBT A;  1X6G A;  2L3P A;  2RQV A;  4Z8A A;  1WDX A;  2DRK A;  2RQU A;  4F17 A;  5IHN A;  2C0T A;  2YT6 A;  3ULR B;  5FWB A;  2CT4 A;  2KRN A;  1NEB A;  2CUD A;  3NGP A;  5ECA A;  4RTU A;  2HEQ A;  2RNA A;  3UA7 A;  1QKW A;  2YSQ A;  4RTW A;  4Z88 A;  1Y57 A;  1GRI A;  2CT3 A;  1UHF A;  2HDA A;  3H0F A;  1H92 A;  3ZL7 C;  1WYX A;  1AZE A;  1TUD A;  1GFD A;  2JS0 A;  2DL5 A;  1UDL A;  1UUE A;  2YUQ A;  4LE9 A;  5IXB A;  3GBQ A;  1OPL A;  3NMZ C;  2NWM A;  1QKX A;  4LUE A;  2CSQ A;  4GBQ A;  1WXU A;  2LMJ A;  1RI9 A;  4J9I A;  2ABL A;  2D8J A;  1PHT A;  1X43 A;  3VS2 A;  3KFV A;  4JZ4 A;  1AWO A;  1FYN A;  5IHK A;  2KRM A;  2GTO A;  2CH4 W;  1Y0M A;  2DBM A;  1N5Z A;  1I07 A;  1AOJ A;  1NLP C;  2AZV A;  2F2W A;  1A0N B;  2KE9 A;  1KSW A;  2KXD A;  1GL5 A;  5GJV B;  2D0N A;  1BK2 A;  5GJW B;  4F14 A;  2B86 A;  2KT1 A;  1AD5 A;  1AZG B;  2HCK A;  2A37 A;  1M3B A;  3REB B;  3PE0 A;  4F16 A;  3M0R A;  2W0Z A;  3CQT A;  5I22 A;  2IIM A;  2L3Q A;  1X69 A;  5L23 A;  1QWF A;  4J9B A;  2ENM A;  1XOV A;  1NEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...