1W6XA

Sh3 domain of p40phox, component of the nadph oxidase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
56
Chain Sequence
MRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sh3 domain
molecule keywords NEUTROPHIL CYTOSOL FACTOR 4
publication title Effects of P47Phox C-Terminus Phosphorylation on Binding Interactions with P40Phox and P67Phox: Structural and Functional Comparison of P40Phox P67Phox SH3 Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1w6xA00
5IHNA 2EGAA 3H0HA 1I1JA 2MIOA 1PHTA 1KJWA 2DE0X 2C0TA 1PRMC 2D8JA 2YUPA 1FYNA 1M30A 4Z88A 3CQTA 1K4US 1A0NB 3REAB 4RTZA 4ZNXA 1E6GA 4JJDA 3UA6A 1S1NA 3H41A 2J6KA 1U06A 1SRMA 2JW4A 2VWFA 5EC7A 2JS0A 2DVJA 4CC7A 2XMFA 1QWFA 1YCSB 1LCKA 3EG0A 4R0KA 1YN8A 2D1XA 4J9GA 2DILA 2W0ZA 3VS5A 2FEIA 2RMOA 1JQQA 2AKLA 2J7IA 4HVVA 3SHWA 5IXFA 1B07A 1AEYA 1U3OA 3PE0A 2KBTA 2EGEA 2GQIA 3M0QA 1RLPC 2X3WD 1FMKA 3U23A 1WXBA 4JPBW 4E6RA 2DLPA 1X69A 2F2XA 2RQTA 1GL5A 2L3QA 3GBQA 5IHKA 1NG2A 2EBPA 5FW9A 1GBRA 1W6XA 2EQIA 2OAWA 1CKBA 2GGRA 2V1QA 3PVLA 4LN2A 2DX1A 2JS2A 3VRYA 4AFQC 1U5SA 1OOTA 1QCFA 3I35A 1T0JA 4OMLA 2DMOA 2A36A 2CREA 1ZX6A 2OI3A 3EG3A 1QKXA 1WIEA 3NMZC 1W70A 2CSIA 2GTJA 2RQWA 2LQNA 5GJVB 2DBMA 2A37A 1E7OA 3H0IA 2B86A 5FWCA 1CKAA 1WXTA 2O88A 3TSWA 5HCKA 3THKA 1W1FA 1GCQC 3NHNA 1X2QA 2YDLA 5IH2A 2J05A 1K1ZA 4LUDA 4OMMA 1UG1A 4J9CA 4X1VA 3EHRA 2JXBA 2NUZA 1OEBA 1B3QA 1X27A 1QWEA 1Y57A 4HXJA 4AFUC 4F16A 2DNUA 1UGVA 5IXBA 2AK5A 3NPFA 1Y0MA 2AKKA 2VKNA 4OMPA 1VYVA 1H92A 1UUEA 3REBB 2DL8A 1IO6A 2EPDA 2JM9A 5I11A 1AVZC 1AZGB 2IIMA 1E6HA 3LH5A 4ORZA 2X3XD 1X6BA 3M0UA 1WI7A 1SHFA 4Y92A 4F14A 2E5KA 1AWWA 2J6FA 2FRWA 1QKWA 4J9BA 2J06A 1UFFA 3M0RA 4D8DA 2QDLA 4HCKA 4RTYA 1OPLA 3VS1A 3QWYA 2KNBB 2NWMA 3UF4A 4Z89A 4KRTA 2RQRA 2LCSA 2KE9A 4IIMA 2CH4W 2DL3A 3I9QA 2L2PA 2VVKA 1AOJA 4D8KA 2DA9A 4QT7A 1T3LA 3M0TA 4RTTA 3R6NA 1PKSA 2KXCA 2OJ2A 2C0IA 2LJ3A 2JMAA 4RUGA 2O9SA 2KR3A 2YUQA 4FSSA 4LUEA 1M3BA 2BZ8A 3M0SA 2DJQA 3UATA 3VS6A 2RNAA 4GLMA 2EGCA 4RTXA 4OMNA 2KYBA 2JM8A 1G2BA 4RTVA 1ZBJA 2LP5A 1JXMA 3A98A 1VYTA 3KFVA 4CC3A 2AZVA 3VS4A 2PNIA 2EKHA 1PWTA 4J9FA 2HDAA 2BZYA 2EYYA 1T0HA 1RLQC 1UJ0A 1VA7A 2KRSA 2C0OA 1KFZA 3ULRB 4WCIA 1X43A 3C0CA 4CC2A 3EG2A 1K0XA 3VS0A 1AZEA 1HJDA 1M8MA 2KRMA 1WXUA 2LNHB 4J9HA 4AG2C 2D8HA 1GCQA 1TUCA 4K11A 2F2VA 2H8HA 1H8KA 3IQLA 4LE9A 5FWBA 1UTIA 1RI9A 1NLOC 2DL5A 2MOXA 2ROLA 3QWXX 2I0NA 2PTKA 1AWXA 2BZXA 2CH4A 2DM1A 1BU1A 1V1CA 2K2MA 2RQVA 2DRMA 2HBWA 2YUOA 2JTEA 1WLPB 5ECAA 1KSWA 2J6OA 3VS2A 2JT4A 3I5RA 4EIKA 2GBQA 4JZ3A 4F17A 2HEQA 2L3PA 3EG1A 1GCPA 1UHCA 1I0CA 2GNCA 1Z9ZA 1ZUKA 2L0AA 2DL7A 2A28A 2W10A 3H0FA 4AFZC 1GFCA 4RTUA 1WX6A 3NGPA 2KROA 2FPDA 2FPFA 2YT6A 1M27C 2HCKA 1VYUA 3SEMA 4A63B 1TG0A 1TUDA 1YNZA 3RBBB 1NLPC 2KXDA 3JV3A 1AWJA 1PKTA 4RTWA 1ARKA 1GBQA 1YWOA 2YUNA 2D0NA 4HVWA 4Z8AA 2KGTA 4IIOA 2ABLA 1X6GA 2PZ1A 1OPKA 4HVUA 2F2WA 2SRCA 1ZLMA 1YP5A 5I22A 2ENMA 1ZUUA 3FJ5A 1BB9A 2HSPA 2EYXA 2JMCA 2EVRA 1SPKA 1JO8A 1JU5C 2GTOA 2DBKA 1JEGA 4OMQA 1QLYA 2A08A 3ZL7C 1WYXA 5GJWB 3TSZA 2K9GA 2SEMA 1NEBA 2CT3A 1ZUYA 3VS7A 4AG1C 4DEYA 2FPEA 1MV0B 1AWOA 2KYMA 1BBZA 1PNJA 1UECA 2ED0A 4J9EA 4ESRA 2O2OA 2ESWA 1X2KA 3RNJA 3TVTA 3VS3A 2O9VA 2LX7A 2RPNA 1YWPA 1AD5A 2ED1A 2DYBA 1SSHA 2FG0A 2K3BA 3O5ZA 2V1RA 1WA7A 1N5ZA 2KT8A 2O31A 1OV3A 1EFNA 1ABQA 2P4RA 1UHFA 2K7AA 2K79A 2LQWA 1J3TA 1SHGA 2CT4A 4JZ4A 2RQUA 1K76A 4GBQA 4CC4B 1I07A 1CSKA 1UJYA 1SRLA 1NYGA 2RF0A 3M0PA 2LMJA 1ABOA 2EYWA 3EGUA 2G6FX 1M3AA 2M0YA 3I5SA 1MUZA 2RN8A 2DL4A 2CDTA 2LJ1A 1JXOA 1NEGA 1BK2A 1XOVA 1MV3A 1GRIA 5L23A 1NM7A 1KIKA 2KT1A 1HD3A 4DEXA 2FO0A 4J9DA 2LZ6B 2BTTA 2ECZA 4AFSC 3EHQA 3UA7A 2DRKA 2YSQA 4JJBA 2EYZA 1K0SA 1GFDA 5IHIA 2ROTA 2CUDA 1SEMA 3VRZA 2MCNA 2DF6A 1T3SA 1ZSGA 1RUWA 4J9IA 1UDLA 2KEAA 1WDXA 2AZSA 2L3SA 2LJ0A 1G83A 1UE9A 1WFWA 1H3HA 1PRLC 2CSQA 4LNPA 1K9AA 4OMOA 1M3CA 1NYFA 4JJCA 2FRYA 2CUBA 2EW3A 2K6DA 3PVQA 2M51A 2KRNA 1HSQA 4M4ZA 1Z9QA
chains in the Genus database with same CATH superfamily
3HKSA 4LXCA 4M78B 4ANJA 2FHDA 2V8KA 4XU1A 3A8GB 1OX9A 5A0DA 2YUPA 3FEOA 1FYNA 3JCMJ 1M30A 4RTZA 4CI0C 4RCBA 4C92F 1KK7A 1R77A 3UA6A 1S1NA 1U06A 4FYVB 4QW2A 3JCMd 2VWFA 4F7UB 5GAOn 5GAN3 4J8OA 2RJEA 1QWFA 1LCKA 4NL3A 4R0KA 4ZTJA 5GAOq 2RHZA 1SSFA 2E10A 3QUIA 4B9XA 3VS5A 4JRPA 4CRIA 5C6SA 5KYXB 2AKLA 1QCNA 1VQ8A 3A1PA 4IURA 3SHWA 5IXFA 1G3WA 1AEYA 2VUBA 4KH0B 3L2UA 1KC8U 3JSCA 4Q5WA 5LJ5g 4ELYC 4FYYB 2L3QA 4C0ZA 2LTOA 4FIBA 5FW9A 1BKBA 2QQSA 4GLKA 2OAWA 1VQ6Q 3MCAB 2RJDA 1QCFA 1PCXA 3I35A 4DQ2A 3CC2T 4E7ZA 3PFSA 3OYLA 4LDUA 2HSEB 2DMOA 1VQLQ 1ZX6A 2EAYA 1JJ2A 1YFNA 7AT1B 2O4XA 1IGUA 1WIEA 2BKDN 3UDCA 2VASA 1G8XA 4BI4A 1W70A 2CSIA 2RQWA 1UGPB 3RKYA 2D9TA 4ELZC 2X4JA 2CP2A 2XKOC 1K8AU 4LUDA 1C1AA 4FL6A 1PSFA 1W4SA 2WSEE 3EHRA 4L5GA 1OEBA 2KMTA 2LCCA 4AFUC 1UGVA 2AK5A 3LX7A 5GMKi 4M7AE 3NPFA 1WJRA 2AKKA 1RAIB 3HRTA 1UUEA 4J5YA 3I55Q 3REBB 1AHJB 2JM9A 5I11A 3CMAQ 4A4EA 2A7YA 2IIMA 2QTVA 2XHCA 4ORZA 4EMKA 4E7SA 3I56T 4BI8B 3EFOA 4R56A 4M75C 1WI7A 1YJWT 2F1LA 2O4XB 2AIRB 4BE1A 3OBYA 3CC4T 2LC4A 4MZTA 2MYSA 2DEQA 2E5KA 5CR2A 5LJ3j 2GF7A 1LOJA 4M77G 1QVPA 1VQPT 2M0OA 2KNBB 3UF4A 4Z89A 4ATOA 4KRTA 5KCOA 1BIBA 2LCSA 2KE9A 2M02A 4IIMA 2DL3A 3CCUQ 3JCMV 2K5LA 1BI2A 2RHUA 2FVUA 2HL5C 3L2QA 1JJ2S 1U8RA 2KXCA 3WVDB 3Q1JA 1HYOA 2O9SA 4FSSA 4LUEA 1M3BA 4PFPA 3M0SA 4M78F 2K5FA 3VS6A 4RTXA 4OMNA 4MMLA 4BB7A 3CMEQ 1ZBJA 3A98A 2AZVA 3FDRA 2EKHA 1K9MR 3EFOB 1UGSB 2HNIA 1QVGA 4J9FA 3L2VA 1YHQT 9ATCB 4F7UF 3TEEA 3ULRB 4HKEA 1X43A 3C0CA 4CC2A 3G4SQ 1PSEA 3M4YA 4J9HA 4XAXB 4PJOG 2PUKB 4OB0B 2F2VA 2QQAA 3FB9A 2H8HA 5KYWA 4MZMA 3ER0A 2DXUA 3QIIA 4C92G 1UTIA 3CBOA 2DJZA 3FRNA 4KULA 3QHSA 2CKKA 3CCLA 1YJ9Q 2KQWA 2PTKA 1M8VA 1VQOA 4B9WA 4OB2B 1VQ7Q 5GAMe 3M59A 3KXTA 3OY9A 1D1CA 1BU1A 1V1CA 2KI7A 3WXMB 1QQJA 3NTKA 1V29B 3MKDA 4E7KA 2OTJA 2DRMA 5GANd 2JTEA 1VQ4T 1KSWA 2J6OA 2LRQA 1SKUB 3LWHA 3LLRA 8ATCB 2JT4A 4EMGA 4JZ3A 4XK8E 5CKBA 5LJ3g 2L3PA 3V8JA 3RERA 1S72T 3VUBA 1Z9ZA 3JRZA 1ZUKA 2EQMA 1HXDA 2L0AA 2XI9A 4XTZA 4ZGJB 4C92D 3H0FA 5HK3A 5CKDA 4RTUA 4C0DB 1M2VA 4PK4A 5KYWB 3SEMA 1D1AA 2RB6A 3RBBB 2FYKA 2DIQA 1AWJA 4Z8AA 2YUNA 2D0NA 2QXFA 3OQ5A 3SWNC 2V26A 4IIOA 3HRUA 4M77A 2PZ1A 1VQNA 4OGEA 2SRCA 1Q81U 4EDUA 1ZUUA 3FJ5A 5KYUA 4IUUA 2JMCA 5IN1A 1JO8A 2RO0A 1IGQA 5GAMh 2DBKA 5CKFA 4OMQA 4BY6C 2A08A 3ZL7C 4QKUA 1RI0A 5FROA 2K9GA 4PJOE 2SEMA 4E7JA 3R6OA 3VS7A 4AG1C 4BUGA 4IUVA 2FPEA 2LVMA 2HBPA 4QVCA 3V7SA 2KYMA 1M2VB 4NOYA 2FZCB 4ME7A 3TQ7P 4ESRA 1N8RC 4JS5A 2X4XA 2ESWA 3RNJA 2WSCE 2RK2A 5KH6A 1I81A 1R8OB 3G6EA 3VS3A 1Q7YR 1VQ8T 2O9VA 2LX7A 2RPNA 3OYAA 4M77B 4LD9K 4PJOA 2D0QB 5J3BA 2KT8A 1OV3A 5KYUB 2QQRA 4C92A 2AT1B 4MZPA 1UHFA 2DO3A 1XNIA 1ZBXA 1J3TA 2CT4A 3DB4A 2VB6A 3L1AA 1VQMA 3VKIA 1KHIA 2RHIA 1K76A 4GBQA 1I07A 1CSKA 3OYFA 2X4YA 3NTHA 4IUPA 4RMOA 2XDBA 2CP6A 1DJ7B 3I5SA 1MUZA 2DL4A 2CDTA 2K57A 5KE2A 1JXOA 3MEVA 1BK2A 1NZ9A 3BE3A 1PD0A 1NM7A 2KT1A 3BY7A 4N0AC 4LDWA 3A8MB 1VQPQ 3MHXA 3RDVA 4M7AF 1R0BG 4FYWB 4PJOB 2RH2A 3MP6A 1JRIA 1MGQA 2KAFA 3UA7A 3CBMA 1K0SA 1GFDA 2DK3A 2CUDA 4C92B 2JZ2A 1RADB 1ZSGA 2YLBA 2MF2A 2ZPGB 4J9IA 3DLMA 4FW1A 2KEAA 1WDXA 5CKHA 1MMAA 4OMOA 1PG5B 1I5LA 2CUBA 3CCMA 1KHCA 3DLLA 1M1KU 2MWOA 2GFAA 1QVFP 4M78D 3H0HA 2A3LA 1KJWA 1YBYA 4AMCA 2DE0X 3L2WA 1PRMC 2D8JA 3UWNA 5LJ5d 1K4US 5GAMj 1A0NB 1UGQB 3REAB 1JBMA 1YITA 2EQUA 3H41A 2J6KA 3OS0A 3S3OA 5FU7B 1RAEB 5CVIA 1SRMA 4CC7A 2XMFA 3OYBA 3EG0A 2D1XA 4J9GA 1X6OA 3MEWA 5GAN5 1OYXA 3O8VA 1D1BA 3PGGA 2FEIA 1RAFB 1IXDA 2RMOA 1B34A 2EKOA 3H8ZA 1QP3A 3X20B 3CCVA 1VQ4Q 1YHQA 1U3OA 3PE0A 3A8LB 3URGA 4MDXA 3M0QA 1FMKA 3U23A 1WXBA 4JPBW 5GMKe 2F2XA 5A0LA 3JB9I 1YIJA 3GBQA 1I5OB 1VUBA 2HQXA 2YXYA 4HCZA 1W6XA 2EQIA 4PLIA 3PVLA 2E12A 2JS2A 1U5SA 1WHLA 3E9GA 2QGGA 1MMDA 1VQ9Q 2BE9B 2DPPB 3CCJA 2QEXQ 4P5NA 2EYQA 1MMGA 4FM4B 1B34B 4GY5A 1VQOT 2IG0A 1QVFS 4L59A 3NMZC 4M7DG 2FZGB 1TH7A 4OP0A 3H0IA 3RKWA 2L89A 1K8AC 2M1HA 2B86A 5FWCA 3MJXA 4FCYA 3CD6Q 3THKA 3C95A 1GCQC 3CPWP 3MEAA 3NHNA 3LGLA 3P8BB 1N27A 2K3XA 4J9CA 3VYGA 4X1VA 5GAMg 4XQ3A 1YJNQ 2JXBA 3EG9A 4NS5A 1D09B 3SFMA 3JB9F 1X27A 4HXJA 4F16A 4M75G 1TWBA 1EIFA 1PC0A 3META 1C6VX 2V8IA 3CCQQ 2VKNA 4OMPA 1VYVA 2DD4A 3CCEA 2EPDA 4M78C 1AVZC 3S3NA 3LH5A 1JB0E 2R58A 1X6BA 3M0UA 2KDSA 4D6WA 4PJOF 2XDDA 3T9NA 1VQNT 2R5MA 1AWWA 1QKWA 4J9BA 2J06A 1UFFA 2E70A 3M0RA 4D8DA 4RTYA 3VS1A 3CCRQ 1SF9A 1G3SA 1KD1R 1G3TA 2BUDA 2RQRA 3MEUA 2QGFB 1RAHB 3J80E 2DXCA 4M7AG 1M2OA 2CH4W 4A4GA 3EG9B 3HTRA 4J6XA 4D8KA 2DA9A 1T3LA 4RTTA 3R6NA 2OJ2A 3M55A 2LJ3A 2ZPBB 5FRMA 3TREA 3OYMA 3QSUA 2JMAA 2VC8A 3EH2A 4X9DA 2YUQA 2JVVA 2DJQA 3ME9A 3EGXA 1WQ7A 2ZPHB 2KYBA 2E65A 4RTVA 2M9UA 1JXMA 3A8OB 3G6ET 4M7DE 3CPWS 2BE7D 4PNOA 1AT1B 3JB9J 3MPUB 4JUVA 3V8LA 4QQGA 2BZYA 1RLQC 5LJ3d 1F1BB 4EPCA 1KFZA 4BDYA 2IPOB 1K0XA 1IB8A 1M8MA 2KRMA 1OZ2A 5CIUA 1TUCA 1TUGB 1H8KA 4LE9A 5FWBA 4M75E 2OTLQ 2DL5A 2MOXA 1M90R 1IHWA 1VQMT 4M7DA 2QI2A 5DLQE 3X26B 1UB4A 5CO7A 1YI2Q 2CH4A 3FLGA 2NYSA 3EGXB 2HBWA 2YUOA 1W2BP 1K9MU 5HY6A 4X34A 5CAIA 4QQDA 3UPUA 4M75A 1UGRB 2QTXA 1I0CA 4E7LA 2M16A 2A28A 1Q82R 4IKFA 5GMKj 2YT6A 1VQ6A 1YNZA 4NL2A 1WHMA 4M7DB 1WJSA 2X9HA 2KXDA 4RTWA 1LNXA 1ARKA 4HVWA 2EFIA 1Q81C 2ABLA 1VQLA 1X6GA 2L3RA 2NUPA 2FZKB 3CCMT 3E1SA 5GAOr 1ZLMA 5I22A 2LT4A 3RR6A 2ENMA 4M7AA 2DXTA 2HSPA 1VQKQ 2EYXA 1SPKA 1KQ2A 5J26A 3HRSA 4QVZA 1JEGA 3OW2P 5IT9E 4Y28E 1WYXA 4C8QG 3OW2A 3A5ZB 2VXEA 1N6AA 1YITT 5FRNA 3TSZA 4EMHA 4A4KA 3C4SA 2E64A 1AWOA 4PJJA 3CCLQ 1PNJA 1UECA 4KGZB 3JB9G 2RI5A 3OS1A 2CZ1B 2O2OA 4L6V5 4PJLA 4EMKB 4A54A 1X2KA 2P0QA 2OTJQ 3I55A 1LJOA 1GXIE 4PFOA 5CQXA 3CCVT 2QAZA 2ED1A 2Z0WA 4R55A 4M77D 3FIFA 2NUPB 2QA4Q 2WSFE 1WA7A 3ZBDA 2E5QA 5GANh 2CP0A 1QMCA 4M7AB 2GQVA 3CC7Q 3RESA 2K79A 1YIJT 3A8HB 2RQUA 3JCMQ 4PJMA 2H3EB 3JCMf 4CC4B 3HSBA 3G71T 3CCSQ 3JCMc 6AT1B 2CZ0B 3JB9D 5CKEA 3CCUA 1VQ5Q 1MHNA 2E3IA 2RF0A 1ABOA 2PVOB 4DBRA 4PKCC 1IZ6A 3CCJT 3PTAA 1NEGA 3OYYA 1Q7YU 5M9OA 3WVEB 4XU2A 5L23A 1KIKA 4BDZA 1HD3A 3BW1A 1FXXA 4J9DA 4A4FA 5KYYA 3CMEA 1WZOA 3GOXA 2HMAA 1ZSZA 4PJOD 3OW2S 3EHQA 2YRCA 3HHTB 2RA2A 4C0DC 1FWZA 1XTDA 2FB7A 3GNGA 4OMFB 1SEMA 4C8QE 3C12A 1UDLA 1NBEB 3M5AA 3G4SA 2JN0A 4Z02A 2MPXC 1WFWA 1H3HA 2MWPA 4XTYA 4DA4A 3MP1A 1K9AA 1M1KC 2LQ8A 3SDZA 3D7SB 4JJCA 3CCET 1M9SA 2QASA 4RG2A 2EW3A 3JCMP 4OF1A 1BI3A 4JRIA 3QZ5B 2X51A 1IRXA 4OB3B 3RKXA 4C5IA 1KQSP 1VQ7A 2EGAA 1I1JA 4C8QA 2X35A 2VGNA 1VIEA 2C0TA 3QZ9B 5AT1B 5KYYB 3OYHA 1ZSZB 4ZNXA 3CC2Q 4JJDA 4LDYA 2DIGA 3S3MA 3FJPA 3DB3A 2JS0A 2DVJA 4M7DF 1YCSB 1YN8A 2Y4YA 3X24B 4C5HA 2JOYA 2MI6A 1JQQA 5L8RE 4M77C 3KUFA 4HVVA 2KY9A 2DFUA 2XDPA 2DERA 2PVDB 2ZPIB 2GQIA 2PU9B 2KK4A 2VYTA 4M75F 4KBMB 2DLPA 4E6RA 1X69A 4C8QB 5GAMd 1GL5A 2X4WA 3M58A 2AHJB 1K73U 4N0AA 1GBRA 2LT1A 2I2LA 4ZN3A 2DAQA 2RM4A 2GGRA 2V1QA 4LN2A 2DX1A 3VRYA 1V76A 4AFQC 3I56Q 5I2SA 4C0GA 5KYNA 1YJWQ 4OMLA 4HT8A 2E1HA 3CC4Q 2A36A 2CREA 4JRQA 4MDWA 3EG3A 1QKXA 2DVEA 2GTJA 4JLIA 2LQNA 5GJVB 2DBMA 1BCMA 5A0GA 1E7OA 1CKAA 1WXTA 2O88A 3TSWA 5HCKA 1W1FA 4C92C 1X2QA 2J05A 2MMPA 1UG1A 3E2UA 5GAN4 4HCCA 2RJCA 4E47A 2NUZA 5EG2A 4E7HA 3VU3C 3OBWA 1QWEA 1Y57A 2QDYB 4DOWA 1D0XA 1MNDA 3UT1A 1M90C 1M5Q1 4ZTFA 1H92A 2D6FA 4KUIA 1VQ6T 5D6WA 1AZGB 5FU6C 2RI2A 2CP3A 3FC3A 1YHQQ 1QVFA 2X3XD 1SHFA 1U1TA 1VQLT 2P4TA 4E2FB 4UC4A 2J6FA 2FRWA 5FU7C 1K73R 5GANf 3JAME 2QDLA 4HCKA 1OX8A 3OYDA 2MAMA 2ZGWA 3F70A 2XK0A 2LNVA 4XTVA 1I4K1 4PLLA 3I9QA 2VVKA 1AOJA 1Q82C 1M1GA 1MNEA 4QT7A 1IHVA 3GLXA 3PIPA 1BYMA 4DBFA 2EQKA 4N4GA 4RUGA 3E9FA 3CBPA 4LDXA 2BZ8A 2COYA 1WHJA 3UATA 3QJ6A 2RNAA 2E6NA 2EGCA 2JUFA 3QYHB 1G2BA 1BCOA 4O6JA 2ATCB 2PNIA 3JCMe 3I55T 1PWTA 3CMAT 1S72Q 2HDAA 3PMIA 2EYYA 4IUTA 1VOMA 1VA7A 1ZQ1A 2C0OA 2HZYA 5LL6S 2YRDA 4WCIA 3NTIA 1KD1U 3H6ZA 1AZEA 1HJDA 4AT1B 3EGDA 3G71A 1WXUA 2LNHB 2D8HA 1GCQA 4K11A 2V8JA 3N5BB 2JJ9A 1WPYA 1B7TA 3ZFJA 1NLOC 2ROLA 3QWXX 4BACA 2DETA 2LCLA 3ZEHA 2KSSA 2YLCA 3CCUT 1AWXA 1TTHB 4FT2A 1K9MC 1EZZB 1Y07A 2DM1A 2F5TX 4RCCA 4C8QF 5J39A 1D0YA 3CPWA 1WLPB 5ECAA 3L2RA 1XJWB 2E3HA 3I5RA 3CMET 4F17A 2GBQA 2DZCA 5CK9A 2E41A 2HEQA 2VV5A 1GCPA 3NFCA 2RD1A 2GNCA 1OU8A 3JCMh 1Q86R 3EGDB 4C5GA 4PJNA 2W10A 1WX6A 2FPDA 2XU8A 3G4ST 1VQ8Q 1M27C 4KGXB 3LH0A 1M90U 1VYUA 1TUDA 1OI1A 2COWA 4M7DD 3S6WA 3QXEB 3JV3A 1G3YA 1N8RR 1VQ9A 3OYJA 1D3BA 2XIDA 2QEXA 3V7RA 1YJ9T 3OS5A 2COZA 2F2WA 3OSVA 1VQ7T 2DTIA 4II1A 4XTWA 5KE3A 2GTOA 4DBHA 2EJFA 3CD6A 3EFSA 3HFNA 5KCHA 1QLYA 4M75D 5GJWB 5LJ3h 2E6ZA 1WJQA 1I8FA 4XU3A 1NEBA 5A2QE 2CT3A 1FX7A 3OMGA 4J6YA 1Q82U 2LX9A 1YJNA 1WHKA 4BE0A 1MV0B 1BBZA 2CGHA 4J9EA 1PM3A 2XD0A 4ZGEB 1NPPA 3CCQA 3VYHB 3TVTA 4B6MA 1YWPA 2HL3A 4HT9A 2DYBA 1SSHA 5GAN2 1D3BB 1M1FA 1N5ZA 2GCXA 4M7AD 1EFNA 3G1JA 1ABQA 2P4RA 5LJ5f 5GAOl 2E4HA 1RAAB 2OAUA 3AT1B 5HK0A 2ZPFB 4JZ4A 3CCRA 2GFUA 2EJGA 4BI3A 1QW1A 2HKQB 1TOVA 1NYGA 3M0PA 2LMJA 5C0MA 3JCMX 1Q7YC 5DM7R 2YHTA 2EYWA 3EGUA 2CS7A 2KVQG 1Q95G 2F69A 2M0YA 4JLGA 3RUXA 2DTOA 1JJ2P 2MK5A 1W2BA 1XOVA 2RHXA 1MV3A 2VXFA 4X9CA 2F5KA 3HFOA 2LZ6B 3X28B 4HCBA 2C06A 4ZGDB 3L42A 2DRKA 4JJBA 8AT1B 3M53A 3VRZA 3V8KA 2MCNA 3VUZA 1TU0B 1X75C 4M7DC 2BIVA 3P8DA 3EFRA 3LWIA 1FMWA 1LPLA 5GANe 3OB9A 1UE9A 1PRLC 2CSQA 1RACB 4LNPA 4O5VA 2OTLA 3PVQA 2IVWA 4PFZA 2M51A 2KRNA 2RI3A 1HSQA 4KGVB 5GAOm 1KC8R 1NJIU 1IREB 3BFMA 5IHNA 5D6YA 2MIOA 1PHTA 1YI2A 3KBGA 3ASKA 4M75B 4Z88A 3CQTA 4FYXB 3CXCP 3LYIA 3CXCA 1E6GA 3OYIA 4A4HA 3M56A 5HKCA 2PQWA 2RK1A 3PNWC 1RL2A 2JW4A 4QVDA 5EC7A 3QDFA 3QBYA 2ZPEB 2Y90A 3OS2A 2A0FB 4EMKC 1VQOQ 4KH1B 1FMVA 1OU9A 1WNLA 2DILA 1D0ZA 2LQKA 2W0ZA 3EH1A 3OYGA 2EWNA 1W2BS 1OQKA 1VIFA 3QO3A 2G3RA 1TXQA 2R57A 2J7IA 3CMAA 2XG8D 2P84A 3M4GA 3OYCA 2ZAEA 1B07A 1XQHA 1O9SA 4M7AC 4LD6A 2KBTA 2EGEA 3QYGB 4N4IA 1RLPC 2X3WD 1H3ZA 1PD1A 3RMQA 4YTLA 3VV0A 2DEUA 5CQYA 1K73C 4C8QD 1K8AR 2RQTA 1QVGP 2ZCFB 4KT0E 3JCMW 5IHKA 2LDMA 2P0PA 2O01E 4JRKA 1NG2A 1VQKA 2EBPA 2XICA 3SB2A 2ZZDA 3JCMg 1CKBA 3V7CA 1OOTA 1KG1A 3QDRB 5D7UA 1T0JA 2PVGB 2QG9B 3BDLA 1UEBA 2OI3A 1VQNQ 4PL6A 4TVRA 1ZA1B 4WF2A 1QP2A 1NJIR 3QJYA 2QK0A 1O75A 2A37A 3DKMA 4V2SA 4XU0A 2EQJA 1Y7XA 3SWNA 3CXCS 3BDUA 2YDLA 2DZ9A 5IH2A 2HQHA 1K1ZA 3L2ZA 1EX4A 4FU6A 4OMMA 2QA4A 5LJ3f 1B3QA 4M77E 4FT4A 3CC7A 2EIFA 2DNUA 3PMTA 3TCJA 5IXBA 1Y0MA 2FL7A 3G6EQ 4HA8A 3RIRA 2VGMA 3GP8A 1NPRA 1YJ9A 2DL8A 1IO6A 3CCSA 1E6HA 1VQ5A 1Y96A 1KQSA 2H3JA 4Y92A 1VQ9T 1ZSZC 2QEXT 1QVGS 4F14A 1OZ3A 3PT9A 3SWNB 3OYKA 1OPLA 3QWYA 2NWMA 2R5AA 1VQMQ 2NLUA 1M4ZA 3MP8A 5CCAA 3CD6T 1Q86C 2L2PA 3C94A 4JS4A 3M0TA 4BY6B 4DOVA 1PKSA 2C0IA 5D6XA 2DYIA 1YJNT 1TS9A 2HKNA 2DTHA 3G7ZA 5LJ5e 4RG8A 4C92E 2KR3A 5GAN8 3GPLA 4BD3A 2RHYA 2L5QA 1TSFA 4GLMA 4OGCA 2JM8A 2RJFA 4C8QC 3CCQT 2LP5A 1HK9A 4OB1B 5I2MA 3KFVA 1VYTA 5GANj 4CC3A 3VS4A 1Y96B 2HD0A 2JTFA 1KD1C 4J6WA 3GNFB 1T0HA 4A53A 4QQ6A 3TU4K 1UJ0A 1BI0A 2KRSA 4Y91A 4OVAA 5GAN7 3M54A 2EJ9A 3EG2A 2QQBA 3VS0A 3J7AF 4AG2C 2K5IA 3CC2A 3IQLA 3CCRT 1RI9A 3INZA 1P92A 3JCMb 1BIAA 2CYZB 2I0NA 3CCMQ 5AYFA 1KQSS 4PJOC 2BZXA 2JNGA 2OX7A 2B8AA 2K2MA 2RQVA 3RMSA 2DD5A 1U1SA 1R0CB 1Q81R 1YITQ 3VS2A 5LJ5h 3EAEA 4EIKA 4M78G 2CZ7B 3M57A 4J7IA 4N4HA 1X01A 3EG1A 3GIBA 1YCYA 1UHCA 3OMCA 3QG1A 4LDVA 1H641 2DL7A 2WACA 4AFZC 1GFCA 3NGPA 2KROA 1WGSA 1BI1A 2FPFA 3GF5A 4F7UG 2HCKA 1C0MA 4A63B 1TG0A 5FLXE 3CPFA 3CCVQ 1NLPC 1LVKA 2L8DA 2YWWA 1N9RA 4WTOB 3I56A 2CP7A 4E7IA 1PKTA 1GBQA 1YWOA 1YJWA 5DLOA 2OTLT 2KGTA 3CC4A 1OPKA 4HVUA 5GANg 1YIJQ 1YP5A 2P0KA 4C5EA 5I21A 3MO8A 1BB9A 1YI2T 1VQPA 3QPHA 2EVRA 5FU6B 1JU5C 4VUBA 3OYNA 3G71Q 1OULA 4ZN1A 1ACMB 3LW5E 1ZA2B 1Q86U 4J83A 3VJPA 1ZUYA 3CEYA 4DEYA 3CCJQ 2K3YA 2ED0A 1RABB 3E19A 1Y71A 2CP5A 5GMKl 4JDSA 1WHGA 1N8RU 1AD5A 1G5VA 1KC8C 2K2VA 3AHUA 2FG0A 3PIOA 2K3BA 3O5ZA 4J7FA 2V1RA 5GAOp 2O31A 4F04B 4RKUE 4MMKA 4M78E 4XTXA 1QCOA 4FSXA 2NUTA 2K7AA 3HP9A 2LQWA 3X25B 1SHGA 1VQKT 3J81E 1SG5A 3CCEQ 2K4YA 3H9NA 3HPWA 3OSSC 1UJYA 1SRLA 2DXBA 4F7UE 3QKJA 3M9QA 4KUDK 1N9SA 2G6FX 4C0FA 2YRVA 5LJ3e 1M3AA 2RN8A 2LJ1A 3OYEA 3JB9H 1MMNA 2PUOB 4DBQA 3CCLT 1KQ1A 4M78A 1VQ4A 1M1KR 2Y4XA 1GRIA 4M77F 2HAXA 5GAN6 5IAYA 4DEXA 3HL8A 2FO0A 2BTTA 3OA6A 5LJ5j 2QQ9A 1NE8A 2ECZA 4BE2A 2QYZA 4AFSC 2OTJT 1ZHIA 2YSQA 2DKGA 2EYZA 1S72A 2HQEA 5IHIA 4F7UA 2ROTA 2DF6A 2QA4T 5GAMf 1T3SA 2NUTB 1RUWA 5GMKm 2CZ6B 1WQWA 3CC7T 3P8HA 2AZSA 2L3SA 2LJ0A 5KYXA 1G83A 5GMKh 4JJNK 4IUQA 5DY9A 1M3CA 1NYFA 1NJIC 2JTMA 3SD4A 4XTUA 2FRYA 3LGFA 1WHHA 2K6DA 3CCST 1RAGB 4FW2A 1VQ5T 4M4ZA 1Z9QA
chains in the Genus database with same CATH topology
5IHNA 2EGAA 3H0HA 1I1JA 2MIOA 1PHTA 1KJWA 2DE0X 2C0TA 1PRMC 2D8JA 2YUPA 1FYNA 1M30A 4Z88A 3CQTA 1K4US 1A0NB 3REAB 4RTZA 4ZNXA 1E6GA 4JJDA 3UA6A 1S1NA 3H41A 2J6KA 1U06A 1SRMA 2JW4A 2VWFA 5EC7A 2JS0A 2DVJA 4CC7A 2XMFA 1QWFA 1YCSB 1LCKA 3EG0A 4R0KA 1YN8A 2D1XA 4J9GA 2DILA 2W0ZA 3VS5A 2FEIA 2RMOA 1JQQA 2AKLA 2J7IA 4HVVA 3SHWA 5IXFA 1B07A 1AEYA 1U3OA 3PE0A 2KBTA 2EGEA 2GQIA 3M0QA 1RLPC 2X3WD 1FMKA 3U23A 1WXBA 4JPBW 4E6RA 2DLPA 1X69A 2F2XA 2RQTA 1GL5A 2L3QA 3GBQA 5IHKA 1NG2A 2EBPA 5FW9A 1GBRA 1W6XA 2EQIA 2OAWA 1CKBA 2GGRA 2V1QA 3PVLA 4LN2A 2DX1A 2JS2A 3VRYA 4AFQC 1U5SA 1OOTA 1QCFA 3I35A 1T0JA 4OMLA 2DMOA 2A36A 2CREA 1ZX6A 2OI3A 3EG3A 1QKXA 1WIEA 3NMZC 1W70A 2CSIA 2GTJA 2RQWA 2LQNA 5GJVB 2DBMA 2A37A 1E7OA 3H0IA 2B86A 5FWCA 1CKAA 1WXTA 2O88A 3TSWA 5HCKA 3THKA 1W1FA 1GCQC 3NHNA 1X2QA 2YDLA 5IH2A 2J05A 1K1ZA 4LUDA 4OMMA 1UG1A 4J9CA 4X1VA 3EHRA 2JXBA 2NUZA 1OEBA 1B3QA 1X27A 1QWEA 1Y57A 4HXJA 4AFUC 4F16A 2DNUA 1UGVA 5IXBA 2AK5A 3NPFA 1Y0MA 2AKKA 2VKNA 4OMPA 1VYVA 1H92A 1UUEA 3REBB 2DL8A 1IO6A 2EPDA 2JM9A 5I11A 1AVZC 1AZGB 2IIMA 1E6HA 3LH5A 4ORZA 2X3XD 1X6BA 3M0UA 1WI7A 1SHFA 4Y92A 4F14A 2E5KA 1AWWA 2J6FA 2FRWA 1QKWA 4J9BA 2J06A 1UFFA 3M0RA 4D8DA 2QDLA 4HCKA 4RTYA 1OPLA 3VS1A 3QWYA 2KNBB 2NWMA 3UF4A 4Z89A 4KRTA 2RQRA 2LCSA 2KE9A 4IIMA 2CH4W 2DL3A 3I9QA 2L2PA 2VVKA 1AOJA 4D8KA 2DA9A 4QT7A 1T3LA 3M0TA 4RTTA 3R6NA 1PKSA 2KXCA 2OJ2A 2C0IA 2LJ3A 2JMAA 4RUGA 2O9SA 2KR3A 2YUQA 4FSSA 4LUEA 1M3BA 2BZ8A 3M0SA 2DJQA 3UATA 3VS6A 2RNAA 4GLMA 2EGCA 4RTXA 4OMNA 2KYBA 2JM8A 1G2BA 4RTVA 1ZBJA 2LP5A 1JXMA 3A98A 1VYTA 3KFVA 4CC3A 2AZVA 3VS4A 2PNIA 2EKHA 1PWTA 4J9FA 2HDAA 2BZYA 2EYYA 1T0HA 1RLQC 1UJ0A 1VA7A 2KRSA 2C0OA 1KFZA 3ULRB 4WCIA 1X43A 3C0CA 4CC2A 3EG2A 1K0XA 3VS0A 1AZEA 1HJDA 1M8MA 2KRMA 1WXUA 2LNHB 4J9HA 4AG2C 2D8HA 1GCQA 1TUCA 4K11A 2F2VA 2H8HA 1H8KA 3IQLA 4LE9A 5FWBA 1UTIA 1RI9A 1NLOC 2DL5A 2MOXA 2ROLA 3QWXX 2I0NA 2PTKA 1AWXA 2BZXA 2CH4A 2DM1A 1BU1A 1V1CA 2K2MA 2RQVA 2DRMA 2HBWA 2YUOA 2JTEA 1WLPB 5ECAA 1KSWA 2J6OA 3VS2A 2JT4A 3I5RA 4EIKA 2GBQA 4JZ3A 4F17A 2HEQA 2L3PA 3EG1A 1GCPA 1UHCA 1I0CA 2GNCA 1Z9ZA 1ZUKA 2L0AA 2DL7A 2A28A 2W10A 3H0FA 4AFZC 1GFCA 4RTUA 1WX6A 3NGPA 2KROA 2FPDA 2FPFA 2YT6A 1M27C 2HCKA 1VYUA 3SEMA 4A63B 1TG0A 1TUDA 1YNZA 3RBBB 1NLPC 2KXDA 3JV3A 1AWJA 1PKTA 4RTWA 1ARKA 1GBQA 1YWOA 2YUNA 2D0NA 4HVWA 4Z8AA 2KGTA 4IIOA 2ABLA 1X6GA 2PZ1A 1OPKA 4HVUA 2F2WA 2SRCA 1ZLMA 1YP5A 5I22A 2ENMA 1ZUUA 3FJ5A 1BB9A 2HSPA 2EYXA 2JMCA 2EVRA 1SPKA 1JO8A 1JU5C 2GTOA 2DBKA 1JEGA 4OMQA 1QLYA 2A08A 3ZL7C 1WYXA 5GJWB 3TSZA 2K9GA 2SEMA 1NEBA 2CT3A 1ZUYA 3VS7A 4AG1C 4DEYA 2FPEA 1MV0B 1AWOA 2KYMA 1BBZA 1PNJA 1UECA 2ED0A 4J9EA 4ESRA 2O2OA 2ESWA 1X2KA 3RNJA 3TVTA 3VS3A 2O9VA 2LX7A 2RPNA 1YWPA 1AD5A 2ED1A 2DYBA 1SSHA 2FG0A 2K3BA 3O5ZA 2V1RA 1WA7A 1N5ZA 2KT8A 2O31A 1OV3A 1EFNA 1ABQA 2P4RA 1UHFA 2K7AA 2K79A 2LQWA 1J3TA 1SHGA 2CT4A 4JZ4A 2RQUA 1K76A 4GBQA 4CC4B 1I07A 1CSKA 1UJYA 1SRLA 1NYGA 2RF0A 3M0PA 2LMJA 1ABOA 2EYWA 3EGUA 2G6FX 1M3AA 2M0YA 3I5SA 1MUZA 2RN8A 2DL4A 2CDTA 2LJ1A 1JXOA 1NEGA 1BK2A 1XOVA 1MV3A 1GRIA 5L23A 1NM7A 1KIKA 2KT1A 1HD3A 4DEXA 2FO0A 4J9DA 2LZ6B 2BTTA 2ECZA 4AFSC 3EHQA 3UA7A 2DRKA 2YSQA 4JJBA 2EYZA 1K0SA 1GFDA 5IHIA 2ROTA 2CUDA 1SEMA 3VRZA 2MCNA 2DF6A 1T3SA 1ZSGA 1RUWA 4J9IA 1UDLA 2KEAA 1WDXA 2AZSA 2L3SA 2LJ0A 1G83A 1UE9A 1WFWA 1H3HA 1PRLC 2CSQA 4LNPA 1K9AA 4OMOA 1M3CA 1NYFA 4JJCA 2FRYA 2CUBA 2EW3A 2K6DA 3PVQA 2M51A 2KRNA 1HSQA 4M4ZA 1Z9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IHN A;  2EGA A;  3H0H A;  1I1J A;  2MIO A;  1PHT A;  1KJW A;  2DE0 X;  2C0T A;  1PRM C;  2D8J A;  2YUP A;  1FYN A;  1M30 A;  4Z88 A;  3CQT A;  1K4U S;  1A0N B;  3REA B;  4RTZ A;  4ZNX A;  1E6G A;  4JJD A;  3UA6 A;  1S1N A;  3H41 A;  2J6K A;  1U06 A;  1SRM A;  2JW4 A;  2VWF A;  5EC7 A;  2JS0 A;  2DVJ A;  4CC7 A;  2XMF A;  1QWF A;  1YCS B;  1LCK A;  3EG0 A;  4R0K A;  1YN8 A;  2D1X A;  4J9G A;  2DIL A;  2W0Z A;  3VS5 A;  2FEI A;  2RMO A;  1JQQ A;  2AKL A;  2J7I A;  4HVV A;  3SHW A;  5IXF A;  1B07 A;  1AEY A;  1U3O A;  3PE0 A;  2KBT A;  2EGE A;  2GQI A;  3M0Q A;  1RLP C;  2X3W D;  1FMK A;  3U23 A;  1WXB A;  4JPB W;  4E6R A;  2DLP A;  1X69 A;  2F2X A;  2RQT A;  1GL5 A;  2L3Q A;  3GBQ A;  5IHK A;  1NG2 A;  2EBP A;  5FW9 A;  1GBR A;  1W6X A;  2EQI A;  2OAW A;  1CKB A;  2GGR A;  2V1Q A;  3PVL A;  4LN2 A;  2DX1 A;  2JS2 A;  3VRY A;  4AFQ C;  1U5S A;  1OOT A;  1QCF A;  3I35 A;  1T0J A;  4OML A;  2DMO A;  2A36 A;  2CRE A;  1ZX6 A;  2OI3 A;  3EG3 A;  1QKX A;  1WIE A;  3NMZ C;  1W70 A;  2CSI A;  2GTJ A;  2RQW A;  2LQN A;  5GJV B;  2DBM A;  2A37 A;  1E7O A;  3H0I A;  2B86 A;  5FWC A;  1CKA A;  1WXT A;  2O88 A;  3TSW A;  5HCK A;  3THK A;  1W1F A;  1GCQ C;  3NHN A;  1X2Q A;  2YDL A;  5IH2 A;  2J05 A;  1K1Z A;  4LUD A;  4OMM A;  1UG1 A;  4J9C A;  4X1V A;  3EHR A;  2JXB A;  2NUZ A;  1OEB A;  1B3Q A;  1X27 A;  1QWE A;  1Y57 A;  4HXJ A;  4AFU C;  4F16 A;  2DNU A;  1UGV A;  5IXB A;  2AK5 A;  3NPF A;  1Y0M A;  2AKK A;  2VKN A;  4OMP A;  1VYV A;  1H92 A;  1UUE A;  3REB B;  2DL8 A;  1IO6 A;  2EPD A;  2JM9 A;  5I11 A;  1AVZ C;  1AZG B;  2IIM A;  1E6H A;  3LH5 A;  4ORZ A;  2X3X D;  1X6B A;  3M0U A;  1WI7 A;  1SHF A;  4Y92 A;  4F14 A;  2E5K A;  1AWW A;  2J6F A;  2FRW A;  1QKW A;  4J9B A;  2J06 A;  1UFF A;  3M0R A;  4D8D A;  2QDL A;  4HCK A;  4RTY A;  1OPL A;  3VS1 A;  3QWY A;  2KNB B;  2NWM A;  3UF4 A;  4Z89 A;  4KRT A;  2RQR A;  2LCS A;  2KE9 A;  4IIM A;  2CH4 W;  2DL3 A;  3I9Q A;  2L2P A;  2VVK A;  1AOJ A;  4D8K A;  2DA9 A;  4QT7 A;  1T3L A;  3M0T A;  4RTT A;  3R6N A;  1PKS A;  2KXC A;  2OJ2 A;  2C0I A;  2LJ3 A;  2JMA A;  4RUG A;  2O9S A;  2KR3 A;  2YUQ A;  4FSS A;  4LUE A;  1M3B A;  2BZ8 A;  3M0S A;  2DJQ A;  3UAT A;  3VS6 A;  2RNA A;  4GLM A;  2EGC A;  4RTX A;  4OMN A;  2KYB A;  2JM8 A;  1G2B A;  4RTV A;  1ZBJ A;  2LP5 A;  1JXM A;  3A98 A;  1VYT A;  3KFV A;  4CC3 A;  2AZV A;  3VS4 A;  2PNI A;  2EKH A;  1PWT A;  4J9F A;  2HDA A;  2BZY A;  2EYY A;  1T0H A;  1RLQ C;  1UJ0 A;  1VA7 A;  2KRS A;  2C0O A;  1KFZ A;  3ULR B;  4WCI A;  1X43 A;  3C0C A;  4CC2 A;  3EG2 A;  1K0X A;  3VS0 A;  1AZE A;  1HJD A;  1M8M A;  2KRM A;  1WXU A;  2LNH B;  4J9H A;  4AG2 C;  2D8H A;  1GCQ A;  1TUC A;  4K11 A;  2F2V A;  2H8H A;  1H8K A;  3IQL A;  4LE9 A;  5FWB A;  1UTI A;  1RI9 A;  1NLO C;  2DL5 A;  2MOX A;  2ROL A;  3QWX X;  2I0N A;  2PTK A;  1AWX A;  2BZX A;  2CH4 A;  2DM1 A;  1BU1 A;  1V1C A;  2K2M A;  2RQV A;  2DRM A;  2HBW A;  2YUO A;  2JTE A;  1WLP B;  5ECA A;  1KSW A;  2J6O A;  3VS2 A;  2JT4 A;  3I5R A;  4EIK A;  2GBQ A;  4JZ3 A;  4F17 A;  2HEQ A;  2L3P A;  3EG1 A;  1GCP A;  1UHC A;  1I0C A;  2GNC A;  1Z9Z A;  1ZUK A;  2L0A A;  2DL7 A;  2A28 A;  2W10 A;  3H0F A;  4AFZ C;  1GFC A;  4RTU A;  1WX6 A;  3NGP A;  2KRO A;  2FPD A;  2FPF A;  2YT6 A;  1M27 C;  2HCK A;  1VYU A;  3SEM A;  4A63 B;  1TG0 A;  1TUD A;  1YNZ A;  3RBB B;  1NLP C;  2KXD A;  3JV3 A;  1AWJ A;  1PKT A;  4RTW A;  1ARK A;  1GBQ A;  1YWO A;  2YUN A;  2D0N A;  4HVW A;  4Z8A A;  2KGT A;  4IIO A;  2ABL A;  1X6G A;  2PZ1 A;  1OPK A;  4HVU A;  2F2W A;  2SRC A;  1ZLM A;  1YP5 A;  5I22 A;  2ENM A;  1ZUU A;  3FJ5 A;  1BB9 A;  2HSP A;  2EYX A;  2JMC A;  2EVR A;  1SPK A;  1JO8 A;  1JU5 C;  2GTO A;  2DBK A;  1JEG A;  4OMQ A;  1QLY A;  2A08 A;  3ZL7 C;  1WYX A;  5GJW B;  3TSZ A;  2K9G A;  2SEM A;  1NEB A;  2CT3 A;  1ZUY A;  3VS7 A;  4AG1 C;  4DEY A;  2FPE A;  1MV0 B;  1AWO A;  2KYM A;  1BBZ A;  1PNJ A;  1UEC A;  2ED0 A;  4J9E A;  4ESR A;  2O2O A;  2ESW A;  1X2K A;  3RNJ A;  3TVT A;  3VS3 A;  2O9V A;  2LX7 A;  2RPN A;  1YWP A;  1AD5 A;  2ED1 A;  2DYB A;  1SSH A;  2FG0 A;  2K3B A;  3O5Z A;  2V1R A;  1WA7 A;  1N5Z A;  2KT8 A;  2O31 A;  1OV3 A;  1EFN A;  1ABQ A;  2P4R A;  1UHF A;  2K7A A;  2K79 A;  2LQW A;  1J3T A;  1SHG A;  2CT4 A;  4JZ4 A;  2RQU A;  1K76 A;  4GBQ A;  4CC4 B;  1I07 A;  1CSK A;  1UJY A;  1SRL A;  1NYG A;  2RF0 A;  3M0P A;  2LMJ A;  1ABO A;  2EYW A;  3EGU A;  2G6F X;  1M3A A;  2M0Y A;  3I5S A;  1MUZ A;  2RN8 A;  2DL4 A;  2CDT A;  2LJ1 A;  1JXO A;  1NEG A;  1BK2 A;  1XOV A;  1MV3 A;  1GRI A;  5L23 A;  1NM7 A;  1KIK A;  2KT1 A;  1HD3 A;  4DEX A;  2FO0 A;  4J9D A;  2LZ6 B;  2BTT A;  2ECZ A;  4AFS C;  3EHQ A;  3UA7 A;  2DRK A;  2YSQ A;  4JJB A;  2EYZ A;  1K0S A;  1GFD A;  5IHI A;  2ROT A;  2CUD A;  1SEM A;  3VRZ A;  2MCN A;  2DF6 A;  1T3S A;  1ZSG A;  1RUW A;  4J9I A;  1UDL A;  2KEA A;  1WDX A;  2AZS A;  2L3S A;  2LJ0 A;  1G83 A;  1UE9 A;  1WFW A;  1H3H A;  1PRL C;  2CSQ A;  4LNP A;  1K9A A;  4OMO A;  1M3C A;  1NYF A;  4JJC A;  2FRY A;  2CUB A;  2EW3 A;  2K6D A;  3PVQ A;  2M51 A;  2KRN A;  1HSQ A;  4M4Z A;  1Z9Q A; 
#chains in the Genus database with same CATH topology
 3HKS A;  4LXC A;  4M78 B;  4ANJ A;  2FHD A;  2V8K A;  4XU1 A;  3A8G B;  1OX9 A;  5A0D A;  2YUP A;  3FEO A;  1FYN A;  3JCM J;  1M30 A;  4RTZ A;  4CI0 C;  4RCB A;  4C92 F;  1KK7 A;  1R77 A;  3UA6 A;  1S1N A;  1U06 A;  4FYV B;  4QW2 A;  3JCM d;  2VWF A;  4F7U B;  5GAO n;  5GAN 3;  4J8O A;  2RJE A;  1QWF A;  1LCK A;  4NL3 A;  4R0K A;  4ZTJ A;  5GAO q;  2RHZ A;  1SSF A;  2E10 A;  3QUI A;  4B9X A;  3VS5 A;  4JRP A;  4CRI A;  5C6S A;  5KYX B;  2AKL A;  1QCN A;  1VQ8 A;  3A1P A;  4IUR A;  3SHW A;  5IXF A;  1G3W A;  1AEY A;  2VUB A;  4KH0 B;  3L2U A;  1KC8 U;  3JSC A;  4Q5W A;  5LJ5 g;  4ELY C;  4FYY B;  2L3Q A;  4C0Z A;  2LTO A;  4FIB A;  5FW9 A;  1BKB A;  2QQS A;  4GLK A;  2OAW A;  1VQ6 Q;  3MCA B;  2RJD A;  1QCF A;  1PCX A;  3I35 A;  4DQ2 A;  3CC2 T;  4E7Z A;  3PFS A;  3OYL A;  4LDU A;  2HSE B;  2DMO A;  1VQL Q;  1ZX6 A;  2EAY A;  1JJ2 A;  1YFN A;  7AT1 B;  2O4X A;  1IGU A;  1WIE A;  2BKD N;  3UDC A;  2VAS A;  1G8X A;  4BI4 A;  1W70 A;  2CSI A;  2RQW A;  1UGP B;  3RKY A;  2D9T A;  4ELZ C;  2X4J A;  2CP2 A;  2XKO C;  1K8A U;  4LUD A;  1C1A A;  4FL6 A;  1PSF A;  1W4S A;  2WSE E;  3EHR A;  4L5G A;  1OEB A;  2KMT A;  2LCC A;  4AFU C;  1UGV A;  2AK5 A;  3LX7 A;  5GMK i;  4M7A E;  3NPF A;  1WJR A;  2AKK A;  1RAI B;  3HRT A;  1UUE A;  4J5Y A;  3I55 Q;  3REB B;  1AHJ B;  2JM9 A;  5I11 A;  3CMA Q;  4A4E A;  2A7Y A;  2IIM A;  2QTV A;  2XHC A;  4ORZ A;  4EMK A;  4E7S A;  3I56 T;  4BI8 B;  3EFO A;  4R56 A;  4M75 C;  1WI7 A;  1YJW T;  2F1L A;  2O4X B;  2AIR B;  4BE1 A;  3OBY A;  3CC4 T;  2LC4 A;  4MZT A;  2MYS A;  2DEQ A;  2E5K A;  5CR2 A;  5LJ3 j;  2GF7 A;  1LOJ A;  4M77 G;  1QVP A;  1VQP T;  2M0O A;  2KNB B;  3UF4 A;  4Z89 A;  4ATO A;  4KRT A;  5KCO A;  1BIB A;  2LCS A;  2KE9 A;  2M02 A;  4IIM A;  2DL3 A;  3CCU Q;  3JCM V;  2K5L A;  1BI2 A;  2RHU A;  2FVU A;  2HL5 C;  3L2Q A;  1JJ2 S;  1U8R A;  2KXC A;  3WVD B;  3Q1J A;  1HYO A;  2O9S A;  4FSS A;  4LUE A;  1M3B A;  4PFP A;  3M0S A;  4M78 F;  2K5F A;  3VS6 A;  4RTX A;  4OMN A;  4MML A;  4BB7 A;  3CME Q;  1ZBJ A;  3A98 A;  2AZV A;  3FDR A;  2EKH A;  1K9M R;  3EFO B;  1UGS B;  2HNI A;  1QVG A;  4J9F A;  3L2V A;  1YHQ T;  9ATC B;  4F7U F;  3TEE A;  3ULR B;  4HKE A;  1X43 A;  3C0C A;  4CC2 A;  3G4S Q;  1PSE A;  3M4Y A;  4J9H A;  4XAX B;  4PJO G;  2PUK B;  4OB0 B;  2F2V A;  2QQA A;  3FB9 A;  2H8H A;  5KYW A;  4MZM A;  3ER0 A;  2DXU A;  3QII A;  4C92 G;  1UTI A;  3CBO A;  2DJZ A;  3FRN A;  4KUL A;  3QHS A;  2CKK A;  3CCL A;  1YJ9 Q;  2KQW A;  2PTK A;  1M8V A;  1VQO A;  4B9W A;  4OB2 B;  1VQ7 Q;  5GAM e;  3M59 A;  3KXT A;  3OY9 A;  1D1C A;  1BU1 A;  1V1C A;  2KI7 A;  3WXM B;  1QQJ A;  3NTK A;  1V29 B;  3MKD A;  4E7K A;  2OTJ A;  2DRM A;  5GAN d;  2JTE A;  1VQ4 T;  1KSW A;  2J6O A;  2LRQ A;  1SKU B;  3LWH A;  3LLR A;  8ATC B;  2JT4 A;  4EMG A;  4JZ3 A;  4XK8 E;  5CKB A;  5LJ3 g;  2L3P A;  3V8J A;  3RER A;  1S72 T;  3VUB A;  1Z9Z A;  3JRZ A;  1ZUK A;  2EQM A;  1HXD A;  2L0A A;  2XI9 A;  4XTZ A;  4ZGJ B;  4C92 D;  3H0F A;  5HK3 A;  5CKD A;  4RTU A;  4C0D B;  1M2V A;  4PK4 A;  5KYW B;  3SEM A;  1D1A A;  2RB6 A;  3RBB B;  2FYK A;  2DIQ A;  1AWJ A;  4Z8A A;  2YUN A;  2D0N A;  2QXF A;  3OQ5 A;  3SWN C;  2V26 A;  4IIO A;  3HRU A;  4M77 A;  2PZ1 A;  1VQN A;  4OGE A;  2SRC A;  1Q81 U;  4EDU A;  1ZUU A;  3FJ5 A;  5KYU A;  4IUU A;  2JMC A;  5IN1 A;  1JO8 A;  2RO0 A;  1IGQ A;  5GAM h;  2DBK A;  5CKF A;  4OMQ A;  4BY6 C;  2A08 A;  3ZL7 C;  4QKU A;  1RI0 A;  5FRO A;  2K9G A;  4PJO E;  2SEM A;  4E7J A;  3R6O A;  3VS7 A;  4AG1 C;  4BUG A;  4IUV A;  2FPE A;  2LVM A;  2HBP A;  4QVC A;  3V7S A;  2KYM A;  1M2V B;  4NOY A;  2FZC B;  4ME7 A;  3TQ7 P;  4ESR A;  1N8R C;  4JS5 A;  2X4X A;  2ESW A;  3RNJ A;  2WSC E;  2RK2 A;  5KH6 A;  1I81 A;  1R8O B;  3G6E A;  3VS3 A;  1Q7Y R;  1VQ8 T;  2O9V A;  2LX7 A;  2RPN A;  3OYA A;  4M77 B;  4LD9 K;  4PJO A;  2D0Q B;  5J3B A;  2KT8 A;  1OV3 A;  5KYU B;  2QQR A;  4C92 A;  2AT1 B;  4MZP A;  1UHF A;  2DO3 A;  1XNI A;  1ZBX A;  1J3T A;  2CT4 A;  3DB4 A;  2VB6 A;  3L1A A;  1VQM A;  3VKI A;  1KHI A;  2RHI A;  1K76 A;  4GBQ A;  1I07 A;  1CSK A;  3OYF A;  2X4Y A;  3NTH A;  4IUP A;  4RMO A;  2XDB A;  2CP6 A;  1DJ7 B;  3I5S A;  1MUZ A;  2DL4 A;  2CDT A;  2K57 A;  5KE2 A;  1JXO A;  3MEV A;  1BK2 A;  1NZ9 A;  3BE3 A;  1PD0 A;  1NM7 A;  2KT1 A;  3BY7 A;  4N0A C;  4LDW A;  3A8M B;  1VQP Q;  3MHX A;  3RDV A;  4M7A F;  1R0B G;  4FYW B;  4PJO B;  2RH2 A;  3MP6 A;  1JRI A;  1MGQ A;  2KAF A;  3UA7 A;  3CBM A;  1K0S A;  1GFD A;  2DK3 A;  2CUD A;  4C92 B;  2JZ2 A;  1RAD B;  1ZSG A;  2YLB A;  2MF2 A;  2ZPG B;  4J9I A;  3DLM A;  4FW1 A;  2KEA A;  1WDX A;  5CKH A;  1MMA A;  4OMO A;  1PG5 B;  1I5L A;  2CUB A;  3CCM A;  1KHC A;  3DLL A;  1M1K U;  2MWO A;  2GFA A;  1QVF P;  4M78 D;  3H0H A;  2A3L A;  1KJW A;  1YBY A;  4AMC A;  2DE0 X;  3L2W A;  1PRM C;  2D8J A;  3UWN A;  5LJ5 d;  1K4U S;  5GAM j;  1A0N B;  1UGQ B;  3REA B;  1JBM A;  1YIT A;  2EQU A;  3H41 A;  2J6K A;  3OS0 A;  3S3O A;  5FU7 B;  1RAE B;  5CVI A;  1SRM A;  4CC7 A;  2XMF A;  3OYB A;  3EG0 A;  2D1X A;  4J9G A;  1X6O A;  3MEW A;  5GAN 5;  1OYX A;  3O8V A;  1D1B A;  3PGG A;  2FEI A;  1RAF B;  1IXD A;  2RMO A;  1B34 A;  2EKO A;  3H8Z A;  1QP3 A;  3X20 B;  3CCV A;  1VQ4 Q;  1YHQ A;  1U3O A;  3PE0 A;  3A8L B;  3URG A;  4MDX A;  3M0Q A;  1FMK A;  3U23 A;  1WXB A;  4JPB W;  5GMK e;  2F2X A;  5A0L A;  3JB9 I;  1YIJ A;  3GBQ A;  1I5O B;  1VUB A;  2HQX A;  2YXY A;  4HCZ A;  1W6X A;  2EQI A;  4PLI A;  3PVL A;  2E12 A;  2JS2 A;  1U5S A;  1WHL A;  3E9G A;  2QGG A;  1MMD A;  1VQ9 Q;  2BE9 B;  2DPP B;  3CCJ A;  2QEX Q;  4P5N A;  2EYQ A;  1MMG A;  4FM4 B;  1B34 B;  4GY5 A;  1VQO T;  2IG0 A;  1QVF S;  4L59 A;  3NMZ C;  4M7D G;  2FZG B;  1TH7 A;  4OP0 A;  3H0I A;  3RKW A;  2L89 A;  1K8A C;  2M1H A;  2B86 A;  5FWC A;  3MJX A;  4FCY A;  3CD6 Q;  3THK A;  3C95 A;  1GCQ C;  3CPW P;  3MEA A;  3NHN A;  3LGL A;  3P8B B;  1N27 A;  2K3X A;  4J9C A;  3VYG A;  4X1V A;  5GAM g;  4XQ3 A;  1YJN Q;  2JXB A;  3EG9 A;  4NS5 A;  1D09 B;  3SFM A;  3JB9 F;  1X27 A;  4HXJ A;  4F16 A;  4M75 G;  1TWB A;  1EIF A;  1PC0 A;  3MET A;  1C6V X;  2V8I A;  3CCQ Q;  2VKN A;  4OMP A;  1VYV A;  2DD4 A;  3CCE A;  2EPD A;  4M78 C;  1AVZ C;  3S3N A;  3LH5 A;  1JB0 E;  2R58 A;  1X6B A;  3M0U A;  2KDS A;  4D6W A;  4PJO F;  2XDD A;  3T9N A;  1VQN T;  2R5M A;  1AWW A;  1QKW A;  4J9B A;  2J06 A;  1UFF A;  2E70 A;  3M0R A;  4D8D A;  4RTY A;  3VS1 A;  3CCR Q;  1SF9 A;  1G3S A;  1KD1 R;  1G3T A;  2BUD A;  2RQR A;  3MEU A;  2QGF B;  1RAH B;  3J80 E;  2DXC A;  4M7A G;  1M2O A;  2CH4 W;  4A4G A;  3EG9 B;  3HTR A;  4J6X A;  4D8K A;  2DA9 A;  1T3L A;  4RTT A;  3R6N A;  2OJ2 A;  3M55 A;  2LJ3 A;  2ZPB B;  5FRM A;  3TRE A;  3OYM A;  3QSU A;  2JMA A;  2VC8 A;  3EH2 A;  4X9D A;  2YUQ A;  2JVV A;  2DJQ A;  3ME9 A;  3EGX A;  1WQ7 A;  2ZPH B;  2KYB A;  2E65 A;  4RTV A;  2M9U A;  1JXM A;  3A8O B;  3G6E T;  4M7D E;  3CPW S;  2BE7 D;  4PNO A;  1AT1 B;  3JB9 J;  3MPU B;  4JUV A;  3V8L A;  4QQG A;  2BZY A;  1RLQ C;  5LJ3 d;  1F1B B;  4EPC A;  1KFZ A;  4BDY A;  2IPO B;  1K0X A;  1IB8 A;  1M8M A;  2KRM A;  1OZ2 A;  5CIU A;  1TUC A;  1TUG B;  1H8K A;  4LE9 A;  5FWB A;  4M75 E;  2OTL Q;  2DL5 A;  2MOX A;  1M90 R;  1IHW A;  1VQM T;  4M7D A;  2QI2 A;  5DLQ E;  3X26 B;  1UB4 A;  5CO7 A;  1YI2 Q;  2CH4 A;  3FLG A;  2NYS A;  3EGX B;  2HBW A;  2YUO A;  1W2B P;  1K9M U;  5HY6 A;  4X34 A;  5CAI A;  4QQD A;  3UPU A;  4M75 A;  1UGR B;  2QTX A;  1I0C A;  4E7L A;  2M16 A;  2A28 A;  1Q82 R;  4IKF A;  5GMK j;  2YT6 A;  1VQ6 A;  1YNZ A;  4NL2 A;  1WHM A;  4M7D B;  1WJS A;  2X9H A;  2KXD A;  4RTW A;  1LNX A;  1ARK A;  4HVW A;  2EFI A;  1Q81 C;  2ABL A;  1VQL A;  1X6G A;  2L3R A;  2NUP A;  2FZK B;  3CCM T;  3E1S A;  5GAO r;  1ZLM A;  5I22 A;  2LT4 A;  3RR6 A;  2ENM A;  4M7A A;  2DXT A;  2HSP A;  1VQK Q;  2EYX A;  1SPK A;  1KQ2 A;  5J26 A;  3HRS A;  4QVZ A;  1JEG A;  3OW2 P;  5IT9 E;  4Y28 E;  1WYX A;  4C8Q G;  3OW2 A;  3A5Z B;  2VXE A;  1N6A A;  1YIT T;  5FRN A;  3TSZ A;  4EMH A;  4A4K A;  3C4S A;  2E64 A;  1AWO A;  4PJJ A;  3CCL Q;  1PNJ A;  1UEC A;  4KGZ B;  3JB9 G;  2RI5 A;  3OS1 A;  2CZ1 B;  2O2O A;  4L6V 5;  4PJL A;  4EMK B;  4A54 A;  1X2K A;  2P0Q A;  2OTJ Q;  3I55 A;  1LJO A;  1GXI E;  4PFO A;  5CQX A;  3CCV T;  2QAZ A;  2ED1 A;  2Z0W A;  4R55 A;  4M77 D;  3FIF A;  2NUP B;  2QA4 Q;  2WSF E;  1WA7 A;  3ZBD A;  2E5Q A;  5GAN h;  2CP0 A;  1QMC A;  4M7A B;  2GQV A;  3CC7 Q;  3RES A;  2K79 A;  1YIJ T;  3A8H B;  2RQU A;  3JCM Q;  4PJM A;  2H3E B;  3JCM f;  4CC4 B;  3HSB A;  3G71 T;  3CCS Q;  3JCM c;  6AT1 B;  2CZ0 B;  3JB9 D;  5CKE A;  3CCU A;  1VQ5 Q;  1MHN A;  2E3I A;  2RF0 A;  1ABO A;  2PVO B;  4DBR A;  4PKC C;  1IZ6 A;  3CCJ T;  3PTA A;  1NEG A;  3OYY A;  1Q7Y U;  5M9O A;  3WVE B;  4XU2 A;  5L23 A;  1KIK A;  4BDZ A;  1HD3 A;  3BW1 A;  1FXX A;  4J9D A;  4A4F A;  5KYY A;  3CME A;  1WZO A;  3GOX A;  2HMA A;  1ZSZ A;  4PJO D;  3OW2 S;  3EHQ A;  2YRC A;  3HHT B;  2RA2 A;  4C0D C;  1FWZ A;  1XTD A;  2FB7 A;  3GNG A;  4OMF B;  1SEM A;  4C8Q E;  3C12 A;  1UDL A;  1NBE B;  3M5A A;  3G4S A;  2JN0 A;  4Z02 A;  2MPX C;  1WFW A;  1H3H A;  2MWP A;  4XTY A;  4DA4 A;  3MP1 A;  1K9A A;  1M1K C;  2LQ8 A;  3SDZ A;  3D7S B;  4JJC A;  3CCE T;  1M9S A;  2QAS A;  4RG2 A;  2EW3 A;  3JCM P;  4OF1 A;  1BI3 A;  4JRI A;  3QZ5 B;  2X51 A;  1IRX A;  4OB3 B;  3RKX A;  4C5I A;  1KQS P;  1VQ7 A;  2EGA A;  1I1J A;  4C8Q A;  2X35 A;  2VGN A;  1VIE A;  2C0T A;  3QZ9 B;  5AT1 B;  5KYY B;  3OYH A;  1ZSZ B;  4ZNX A;  3CC2 Q;  4JJD A;  4LDY A;  2DIG A;  3S3M A;  3FJP A;  3DB3 A;  2JS0 A;  2DVJ A;  4M7D F;  1YCS B;  1YN8 A;  2Y4Y A;  3X24 B;  4C5H A;  2JOY A;  2MI6 A;  1JQQ A;  5L8R E;  4M77 C;  3KUF A;  4HVV A;  2KY9 A;  2DFU A;  2XDP A;  2DER A;  2PVD B;  2ZPI B;  2GQI A;  2PU9 B;  2KK4 A;  2VYT A;  4M75 F;  4KBM B;  2DLP A;  4E6R A;  1X69 A;  4C8Q B;  5GAM d;  1GL5 A;  2X4W A;  3M58 A;  2AHJ B;  1K73 U;  4N0A A;  1GBR A;  2LT1 A;  2I2L A;  4ZN3 A;  2DAQ A;  2RM4 A;  2GGR A;  2V1Q A;  4LN2 A;  2DX1 A;  3VRY A;  1V76 A;  4AFQ C;  3I56 Q;  5I2S A;  4C0G A;  5KYN A;  1YJW Q;  4OML A;  4HT8 A;  2E1H A;  3CC4 Q;  2A36 A;  2CRE A;  4JRQ A;  4MDW A;  3EG3 A;  1QKX A;  2DVE A;  2GTJ A;  4JLI A;  2LQN A;  5GJV B;  2DBM A;  1BCM A;  5A0G A;  1E7O A;  1CKA A;  1WXT A;  2O88 A;  3TSW A;  5HCK A;  1W1F A;  4C92 C;  1X2Q A;  2J05 A;  2MMP A;  1UG1 A;  3E2U A;  5GAN 4;  4HCC A;  2RJC A;  4E47 A;  2NUZ A;  5EG2 A;  4E7H A;  3VU3 C;  3OBW A;  1QWE A;  1Y57 A;  2QDY B;  4DOW A;  1D0X A;  1MND A;  3UT1 A;  1M90 C;  1M5Q 1;  4ZTF A;  1H92 A;  2D6F A;  4KUI A;  1VQ6 T;  5D6W A;  1AZG B;  5FU6 C;  2RI2 A;  2CP3 A;  3FC3 A;  1YHQ Q;  1QVF A;  2X3X D;  1SHF A;  1U1T A;  1VQL T;  2P4T A;  4E2F B;  4UC4 A;  2J6F A;  2FRW A;  5FU7 C;  1K73 R;  5GAN f;  3JAM E;  2QDL A;  4HCK A;  1OX8 A;  3OYD A;  2MAM A;  2ZGW A;  3F70 A;  2XK0 A;  2LNV A;  4XTV A;  1I4K 1;  4PLL A;  3I9Q A;  2VVK A;  1AOJ A;  1Q82 C;  1M1G A;  1MNE A;  4QT7 A;  1IHV A;  3GLX A;  3PIP A;  1BYM A;  4DBF A;  2EQK A;  4N4G A;  4RUG A;  3E9F A;  3CBP A;  4LDX A;  2BZ8 A;  2COY A;  1WHJ A;  3UAT A;  3QJ6 A;  2RNA A;  2E6N A;  2EGC A;  2JUF A;  3QYH B;  1G2B A;  1BCO A;  4O6J A;  2ATC B;  2PNI A;  3JCM e;  3I55 T;  1PWT A;  3CMA T;  1S72 Q;  2HDA A;  3PMI A;  2EYY A;  4IUT A;  1VOM A;  1VA7 A;  1ZQ1 A;  2C0O A;  2HZY A;  5LL6 S;  2YRD A;  4WCI A;  3NTI A;  1KD1 U;  3H6Z A;  1AZE A;  1HJD A;  4AT1 B;  3EGD A;  3G71 A;  1WXU A;  2LNH B;  2D8H A;  1GCQ A;  4K11 A;  2V8J A;  3N5B B;  2JJ9 A;  1WPY A;  1B7T A;  3ZFJ A;  1NLO C;  2ROL A;  3QWX X;  4BAC A;  2DET A;  2LCL A;  3ZEH A;  2KSS A;  2YLC A;  3CCU T;  1AWX A;  1TTH B;  4FT2 A;  1K9M C;  1EZZ B;  1Y07 A;  2DM1 A;  2F5T X;  4RCC A;  4C8Q F;  5J39 A;  1D0Y A;  3CPW A;  1WLP B;  5ECA A;  3L2R A;  1XJW B;  2E3H A;  3I5R A;  3CME T;  4F17 A;  2GBQ A;  2DZC A;  5CK9 A;  2E41 A;  2HEQ A;  2VV5 A;  1GCP A;  3NFC A;  2RD1 A;  2GNC A;  1OU8 A;  3JCM h;  1Q86 R;  3EGD B;  4C5G A;  4PJN A;  2W10 A;  1WX6 A;  2FPD A;  2XU8 A;  3G4S T;  1VQ8 Q;  1M27 C;  4KGX B;  3LH0 A;  1M90 U;  1VYU A;  1TUD A;  1OI1 A;  2COW A;  4M7D D;  3S6W A;  3QXE B;  3JV3 A;  1G3Y A;  1N8R R;  1VQ9 A;  3OYJ A;  1D3B A;  2XID A;  2QEX A;  3V7R A;  1YJ9 T;  3OS5 A;  2COZ A;  2F2W A;  3OSV A;  1VQ7 T;  2DTI A;  4II1 A;  4XTW A;  5KE3 A;  2GTO A;  4DBH A;  2EJF A;  3CD6 A;  3EFS A;  3HFN A;  5KCH A;  1QLY A;  4M75 D;  5GJW B;  5LJ3 h;  2E6Z A;  1WJQ A;  1I8F A;  4XU3 A;  1NEB A;  5A2Q E;  2CT3 A;  1FX7 A;  3OMG A;  4J6Y A;  1Q82 U;  2LX9 A;  1YJN A;  1WHK A;  4BE0 A;  1MV0 B;  1BBZ A;  2CGH A;  4J9E A;  1PM3 A;  2XD0 A;  4ZGE B;  1NPP A;  3CCQ A;  3VYH B;  3TVT A;  4B6M A;  1YWP A;  2HL3 A;  4HT9 A;  2DYB A;  1SSH A;  5GAN 2;  1D3B B;  1M1F A;  1N5Z A;  2GCX A;  4M7A D;  1EFN A;  3G1J A;  1ABQ A;  2P4R A;  5LJ5 f;  5GAO l;  2E4H A;  1RAA B;  2OAU A;  3AT1 B;  5HK0 A;  2ZPF B;  4JZ4 A;  3CCR A;  2GFU A;  2EJG A;  4BI3 A;  1QW1 A;  2HKQ B;  1TOV A;  1NYG A;  3M0P A;  2LMJ A;  5C0M A;  3JCM X;  1Q7Y C;  5DM7 R;  2YHT A;  2EYW A;  3EGU A;  2CS7 A;  2KVQ G;  1Q95 G;  2F69 A;  2M0Y A;  4JLG A;  3RUX A;  2DTO A;  1JJ2 P;  2MK5 A;  1W2B A;  1XOV A;  2RHX A;  1MV3 A;  2VXF A;  4X9C A;  2F5K A;  3HFO A;  2LZ6 B;  3X28 B;  4HCB A;  2C06 A;  4ZGD B;  3L42 A;  2DRK A;  4JJB A;  8AT1 B;  3M53 A;  3VRZ A;  3V8K A;  2MCN A;  3VUZ A;  1TU0 B;  1X75 C;  4M7D C;  2BIV A;  3P8D A;  3EFR A;  3LWI A;  1FMW A;  1LPL A;  5GAN e;  3OB9 A;  1UE9 A;  1PRL C;  2CSQ A;  1RAC B;  4LNP A;  4O5V A;  2OTL A;  3PVQ A;  2IVW A;  4PFZ A;  2M51 A;  2KRN A;  2RI3 A;  1HSQ A;  4KGV B;  5GAO m;  1KC8 R;  1NJI U;  1IRE B;  3BFM A;  5IHN A;  5D6Y A;  2MIO A;  1PHT A;  1YI2 A;  3KBG A;  3ASK A;  4M75 B;  4Z88 A;  3CQT A;  4FYX B;  3CXC P;  3LYI A;  3CXC A;  1E6G A;  3OYI A;  4A4H A;  3M56 A;  5HKC A;  2PQW A;  2RK1 A;  3PNW C;  1RL2 A;  2JW4 A;  4QVD A;  5EC7 A;  3QDF A;  3QBY A;  2ZPE B;  2Y90 A;  3OS2 A;  2A0F B;  4EMK C;  1VQO Q;  4KH1 B;  1FMV A;  1OU9 A;  1WNL A;  2DIL A;  1D0Z A;  2LQK A;  2W0Z A;  3EH1 A;  3OYG A;  2EWN A;  1W2B S;  1OQK A;  1VIF A;  3QO3 A;  2G3R A;  1TXQ A;  2R57 A;  2J7I A;  3CMA A;  2XG8 D;  2P84 A;  3M4G A;  3OYC A;  2ZAE A;  1B07 A;  1XQH A;  1O9S A;  4M7A C;  4LD6 A;  2KBT A;  2EGE A;  3QYG B;  4N4I A;  1RLP C;  2X3W D;  1H3Z A;  1PD1 A;  3RMQ A;  4YTL A;  3VV0 A;  2DEU A;  5CQY A;  1K73 C;  4C8Q D;  1K8A R;  2RQT A;  1QVG P;  2ZCF B;  4KT0 E;  3JCM W;  5IHK A;  2LDM A;  2P0P A;  2O01 E;  4JRK A;  1NG2 A;  1VQK A;  2EBP A;  2XIC A;  3SB2 A;  2ZZD A;  3JCM g;  1CKB A;  3V7C A;  1OOT A;  1KG1 A;  3QDR B;  5D7U A;  1T0J A;  2PVG B;  2QG9 B;  3BDL A;  1UEB A;  2OI3 A;  1VQN Q;  4PL6 A;  4TVR A;  1ZA1 B;  4WF2 A;  1QP2 A;  1NJI R;  3QJY A;  2QK0 A;  1O75 A;  2A37 A;  3DKM A;  4V2S A;  4XU0 A;  2EQJ A;  1Y7X A;  3SWN A;  3CXC S;  3BDU A;  2YDL A;  2DZ9 A;  5IH2 A;  2HQH A;  1K1Z A;  3L2Z A;  1EX4 A;  4FU6 A;  4OMM A;  2QA4 A;  5LJ3 f;  1B3Q A;  4M77 E;  4FT4 A;  3CC7 A;  2EIF A;  2DNU A;  3PMT A;  3TCJ A;  5IXB A;  1Y0M A;  2FL7 A;  3G6E Q;  4HA8 A;  3RIR A;  2VGM A;  3GP8 A;  1NPR A;  1YJ9 A;  2DL8 A;  1IO6 A;  3CCS A;  1E6H A;  1VQ5 A;  1Y96 A;  1KQS A;  2H3J A;  4Y92 A;  1VQ9 T;  1ZSZ C;  2QEX T;  1QVG S;  4F14 A;  1OZ3 A;  3PT9 A;  3SWN B;  3OYK A;  1OPL A;  3QWY A;  2NWM A;  2R5A A;  1VQM Q;  2NLU A;  1M4Z A;  3MP8 A;  5CCA A;  3CD6 T;  1Q86 C;  2L2P A;  3C94 A;  4JS4 A;  3M0T A;  4BY6 B;  4DOV A;  1PKS A;  2C0I A;  5D6X A;  2DYI A;  1YJN T;  1TS9 A;  2HKN A;  2DTH A;  3G7Z A;  5LJ5 e;  4RG8 A;  4C92 E;  2KR3 A;  5GAN 8;  3GPL A;  4BD3 A;  2RHY A;  2L5Q A;  1TSF A;  4GLM A;  4OGC A;  2JM8 A;  2RJF A;  4C8Q C;  3CCQ T;  2LP5 A;  1HK9 A;  4OB1 B;  5I2M A;  3KFV A;  1VYT A;  5GAN j;  4CC3 A;  3VS4 A;  1Y96 B;  2HD0 A;  2JTF A;  1KD1 C;  4J6W A;  3GNF B;  1T0H A;  4A53 A;  4QQ6 A;  3TU4 K;  1UJ0 A;  1BI0 A;  2KRS A;  4Y91 A;  4OVA A;  5GAN 7;  3M54 A;  2EJ9 A;  3EG2 A;  2QQB A;  3VS0 A;  3J7A F;  4AG2 C;  2K5I A;  3CC2 A;  3IQL A;  3CCR T;  1RI9 A;  3INZ A;  1P92 A;  3JCM b;  1BIA A;  2CYZ B;  2I0N A;  3CCM Q;  5AYF A;  1KQS S;  4PJO C;  2BZX A;  2JNG A;  2OX7 A;  2B8A A;  2K2M A;  2RQV A;  3RMS A;  2DD5 A;  1U1S A;  1R0C B;  1Q81 R;  1YIT Q;  3VS2 A;  5LJ5 h;  3EAE A;  4EIK A;  4M78 G;  2CZ7 B;  3M57 A;  4J7I A;  4N4H A;  1X01 A;  3EG1 A;  3GIB A;  1YCY A;  1UHC A;  3OMC A;  3QG1 A;  4LDV A;  1H64 1;  2DL7 A;  2WAC A;  4AFZ C;  1GFC A;  3NGP A;  2KRO A;  1WGS A;  1BI1 A;  2FPF A;  3GF5 A;  4F7U G;  2HCK A;  1C0M A;  4A63 B;  1TG0 A;  5FLX E;  3CPF A;  3CCV Q;  1NLP C;  1LVK A;  2L8D A;  2YWW A;  1N9R A;  4WTO B;  3I56 A;  2CP7 A;  4E7I A;  1PKT A;  1GBQ A;  1YWO A;  1YJW A;  5DLO A;  2OTL T;  2KGT A;  3CC4 A;  1OPK A;  4HVU A;  5GAN g;  1YIJ Q;  1YP5 A;  2P0K A;  4C5E A;  5I21 A;  3MO8 A;  1BB9 A;  1YI2 T;  1VQP A;  3QPH A;  2EVR A;  5FU6 B;  1JU5 C;  4VUB A;  3OYN A;  3G71 Q;  1OUL A;  4ZN1 A;  1ACM B;  3LW5 E;  1ZA2 B;  1Q86 U;  4J83 A;  3VJP A;  1ZUY A;  3CEY A;  4DEY A;  3CCJ Q;  2K3Y A;  2ED0 A;  1RAB B;  3E19 A;  1Y71 A;  2CP5 A;  5GMK l;  4JDS A;  1WHG A;  1N8R U;  1AD5 A;  1G5V A;  1KC8 C;  2K2V A;  3AHU A;  2FG0 A;  3PIO A;  2K3B A;  3O5Z A;  4J7F A;  2V1R A;  5GAO p;  2O31 A;  4F04 B;  4RKU E;  4MMK A;  4M78 E;  4XTX A;  1QCO A;  4FSX A;  2NUT A;  2K7A A;  3HP9 A;  2LQW A;  3X25 B;  1SHG A;  1VQK T;  3J81 E;  1SG5 A;  3CCE Q;  2K4Y A;  3H9N A;  3HPW A;  3OSS C;  1UJY A;  1SRL A;  2DXB A;  4F7U E;  3QKJ A;  3M9Q A;  4KUD K;  1N9S A;  2G6F X;  4C0F A;  2YRV A;  5LJ3 e;  1M3A A;  2RN8 A;  2LJ1 A;  3OYE A;  3JB9 H;  1MMN A;  2PUO B;  4DBQ A;  3CCL T;  1KQ1 A;  4M78 A;  1VQ4 A;  1M1K R;  2Y4X A;  1GRI A;  4M77 F;  2HAX A;  5GAN 6;  5IAY A;  4DEX A;  3HL8 A;  2FO0 A;  2BTT A;  3OA6 A;  5LJ5 j;  2QQ9 A;  1NE8 A;  2ECZ A;  4BE2 A;  2QYZ A;  4AFS C;  2OTJ T;  1ZHI A;  2YSQ A;  2DKG A;  2EYZ A;  1S72 A;  2HQE A;  5IHI A;  4F7U A;  2ROT A;  2DF6 A;  2QA4 T;  5GAM f;  1T3S A;  2NUT B;  1RUW A;  5GMK m;  2CZ6 B;  1WQW A;  3CC7 T;  3P8H A;  2AZS A;  2L3S A;  2LJ0 A;  5KYX A;  1G83 A;  5GMK h;  4JJN K;  4IUQ A;  5DY9 A;  1M3C A;  1NYF A;  1NJI C;  2JTM A;  3SD4 A;  4XTU A;  2FRY A;  3LGF A;  1WHH A;  2K6D A;  3CCS T;  1RAG B;  4FW2 A;  1VQ5 T;  4M4Z A;  1Z9Q A; 
#chains in the Genus database with same CATH homology
 5IHN A;  2EGA A;  3H0H A;  1I1J A;  2MIO A;  1PHT A;  1KJW A;  2DE0 X;  2C0T A;  1PRM C;  2D8J A;  2YUP A;  1FYN A;  1M30 A;  4Z88 A;  3CQT A;  1K4U S;  1A0N B;  3REA B;  4RTZ A;  4ZNX A;  1E6G A;  4JJD A;  3UA6 A;  1S1N A;  3H41 A;  2J6K A;  1U06 A;  1SRM A;  2JW4 A;  2VWF A;  5EC7 A;  2JS0 A;  2DVJ A;  4CC7 A;  2XMF A;  1QWF A;  1YCS B;  1LCK A;  3EG0 A;  4R0K A;  1YN8 A;  2D1X A;  4J9G A;  2DIL A;  2W0Z A;  3VS5 A;  2FEI A;  2RMO A;  1JQQ A;  2AKL A;  2J7I A;  4HVV A;  3SHW A;  5IXF A;  1B07 A;  1AEY A;  1U3O A;  3PE0 A;  2KBT A;  2EGE A;  2GQI A;  3M0Q A;  1RLP C;  2X3W D;  1FMK A;  3U23 A;  1WXB A;  4JPB W;  4E6R A;  2DLP A;  1X69 A;  2F2X A;  2RQT A;  1GL5 A;  2L3Q A;  3GBQ A;  5IHK A;  1NG2 A;  2EBP A;  5FW9 A;  1GBR A;  1W6X A;  2EQI A;  2OAW A;  1CKB A;  2GGR A;  2V1Q A;  3PVL A;  4LN2 A;  2DX1 A;  2JS2 A;  3VRY A;  4AFQ C;  1U5S A;  1OOT A;  1QCF A;  3I35 A;  1T0J A;  4OML A;  2DMO A;  2A36 A;  2CRE A;  1ZX6 A;  2OI3 A;  3EG3 A;  1QKX A;  1WIE A;  3NMZ C;  1W70 A;  2CSI A;  2GTJ A;  2RQW A;  2LQN A;  5GJV B;  2DBM A;  2A37 A;  1E7O A;  3H0I A;  2B86 A;  5FWC A;  1CKA A;  1WXT A;  2O88 A;  3TSW A;  5HCK A;  3THK A;  1W1F A;  1GCQ C;  3NHN A;  1X2Q A;  2YDL A;  5IH2 A;  2J05 A;  1K1Z A;  4LUD A;  4OMM A;  1UG1 A;  4J9C A;  4X1V A;  3EHR A;  2JXB A;  2NUZ A;  1OEB A;  1B3Q A;  1X27 A;  1QWE A;  1Y57 A;  4HXJ A;  4AFU C;  4F16 A;  2DNU A;  1UGV A;  5IXB A;  2AK5 A;  3NPF A;  1Y0M A;  2AKK A;  2VKN A;  4OMP A;  1VYV A;  1H92 A;  1UUE A;  3REB B;  2DL8 A;  1IO6 A;  2EPD A;  2JM9 A;  5I11 A;  1AVZ C;  1AZG B;  2IIM A;  1E6H A;  3LH5 A;  4ORZ A;  2X3X D;  1X6B A;  3M0U A;  1WI7 A;  1SHF A;  4Y92 A;  4F14 A;  2E5K A;  1AWW A;  2J6F A;  2FRW A;  1QKW A;  4J9B A;  2J06 A;  1UFF A;  3M0R A;  4D8D A;  2QDL A;  4HCK A;  4RTY A;  1OPL A;  3VS1 A;  3QWY A;  2KNB B;  2NWM A;  3UF4 A;  4Z89 A;  4KRT A;  2RQR A;  2LCS A;  2KE9 A;  4IIM A;  2CH4 W;  2DL3 A;  3I9Q A;  2L2P A;  2VVK A;  1AOJ A;  4D8K A;  2DA9 A;  4QT7 A;  1T3L A;  3M0T A;  4RTT A;  3R6N A;  1PKS A;  2KXC A;  2OJ2 A;  2C0I A;  2LJ3 A;  2JMA A;  4RUG A;  2O9S A;  2KR3 A;  2YUQ A;  4FSS A;  4LUE A;  1M3B A;  2BZ8 A;  3M0S A;  2DJQ A;  3UAT A;  3VS6 A;  2RNA A;  4GLM A;  2EGC A;  4RTX A;  4OMN A;  2KYB A;  2JM8 A;  1G2B A;  4RTV A;  1ZBJ A;  2LP5 A;  1JXM A;  3A98 A;  1VYT A;  3KFV A;  4CC3 A;  2AZV A;  3VS4 A;  2PNI A;  2EKH A;  1PWT A;  4J9F A;  2HDA A;  2BZY A;  2EYY A;  1T0H A;  1RLQ C;  1UJ0 A;  1VA7 A;  2KRS A;  2C0O A;  1KFZ A;  3ULR B;  4WCI A;  1X43 A;  3C0C A;  4CC2 A;  3EG2 A;  1K0X A;  3VS0 A;  1AZE A;  1HJD A;  1M8M A;  2KRM A;  1WXU A;  2LNH B;  4J9H A;  4AG2 C;  2D8H A;  1GCQ A;  1TUC A;  4K11 A;  2F2V A;  2H8H A;  1H8K A;  3IQL A;  4LE9 A;  5FWB A;  1UTI A;  1RI9 A;  1NLO C;  2DL5 A;  2MOX A;  2ROL A;  3QWX X;  2I0N A;  2PTK A;  1AWX A;  2BZX A;  2CH4 A;  2DM1 A;  1BU1 A;  1V1C A;  2K2M A;  2RQV A;  2DRM A;  2HBW A;  2YUO A;  2JTE A;  1WLP B;  5ECA A;  1KSW A;  2J6O A;  3VS2 A;  2JT4 A;  3I5R A;  4EIK A;  2GBQ A;  4JZ3 A;  4F17 A;  2HEQ A;  2L3P A;  3EG1 A;  1GCP A;  1UHC A;  1I0C A;  2GNC A;  1Z9Z A;  1ZUK A;  2L0A A;  2DL7 A;  2A28 A;  2W10 A;  3H0F A;  4AFZ C;  1GFC A;  4RTU A;  1WX6 A;  3NGP A;  2KRO A;  2FPD A;  2FPF A;  2YT6 A;  1M27 C;  2HCK A;  1VYU A;  3SEM A;  4A63 B;  1TG0 A;  1TUD A;  1YNZ A;  3RBB B;  1NLP C;  2KXD A;  3JV3 A;  1AWJ A;  1PKT A;  4RTW A;  1ARK A;  1GBQ A;  1YWO A;  2YUN A;  2D0N A;  4HVW A;  4Z8A A;  2KGT A;  4IIO A;  2ABL A;  1X6G A;  2PZ1 A;  1OPK A;  4HVU A;  2F2W A;  2SRC A;  1ZLM A;  1YP5 A;  5I22 A;  2ENM A;  1ZUU A;  3FJ5 A;  1BB9 A;  2HSP A;  2EYX A;  2JMC A;  2EVR A;  1SPK A;  1JO8 A;  1JU5 C;  2GTO A;  2DBK A;  1JEG A;  4OMQ A;  1QLY A;  2A08 A;  3ZL7 C;  1WYX A;  5GJW B;  3TSZ A;  2K9G A;  2SEM A;  1NEB A;  2CT3 A;  1ZUY A;  3VS7 A;  4AG1 C;  4DEY A;  2FPE A;  1MV0 B;  1AWO A;  2KYM A;  1BBZ A;  1PNJ A;  1UEC A;  2ED0 A;  4J9E A;  4ESR A;  2O2O A;  2ESW A;  1X2K A;  3RNJ A;  3TVT A;  3VS3 A;  2O9V A;  2LX7 A;  2RPN A;  1YWP A;  1AD5 A;  2ED1 A;  2DYB A;  1SSH A;  2FG0 A;  2K3B A;  3O5Z A;  2V1R A;  1WA7 A;  1N5Z A;  2KT8 A;  2O31 A;  1OV3 A;  1EFN A;  1ABQ A;  2P4R A;  1UHF A;  2K7A A;  2K79 A;  2LQW A;  1J3T A;  1SHG A;  2CT4 A;  4JZ4 A;  2RQU A;  1K76 A;  4GBQ A;  4CC4 B;  1I07 A;  1CSK A;  1UJY A;  1SRL A;  1NYG A;  2RF0 A;  3M0P A;  2LMJ A;  1ABO A;  2EYW A;  3EGU A;  2G6F X;  1M3A A;  2M0Y A;  3I5S A;  1MUZ A;  2RN8 A;  2DL4 A;  2CDT A;  2LJ1 A;  1JXO A;  1NEG A;  1BK2 A;  1XOV A;  1MV3 A;  1GRI A;  5L23 A;  1NM7 A;  1KIK A;  2KT1 A;  1HD3 A;  4DEX A;  2FO0 A;  4J9D A;  2LZ6 B;  2BTT A;  2ECZ A;  4AFS C;  3EHQ A;  3UA7 A;  2DRK A;  2YSQ A;  4JJB A;  2EYZ A;  1K0S A;  1GFD A;  5IHI A;  2ROT A;  2CUD A;  1SEM A;  3VRZ A;  2MCN A;  2DF6 A;  1T3S A;  1ZSG A;  1RUW A;  4J9I A;  1UDL A;  2KEA A;  1WDX A;  2AZS A;  2L3S A;  2LJ0 A;  1G83 A;  1UE9 A;  1WFW A;  1H3H A;  1PRL C;  2CSQ A;  4LNP A;  1K9A A;  4OMO A;  1M3C A;  1NYF A;  4JJC A;  2FRY A;  2CUB A;  2EW3 A;  2K6D A;  3PVQ A;  2M51 A;  2KRN A;  1HSQ A;  4M4Z A;  1Z9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...