2EYXA

C-terminal sh3 domain of ct10-regulated kinase
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
67
structure length
67
Chain Sequence
NLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords v-crk sarcoma virus CT10 oncogene homolog isoform a
publication title Structural basis for the transforming activity of human cancer-related signaling adaptor protein CRK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2eyxA00
4GLMA 5GJVB 2HCKA 4LNPA 4J9GA 4DEXA 2YUQA 2PZ1A 3RNJA 2A37A 3THKA 1QWFA 1GCPA 1UECA 2EBPA 1YCSB 1TG0A 1VYUA 4J9EA 2OJ2A 2JS0A 2SRCA 1FMKA 5IHKA 4AFQC 1X2QA 2DMOA 2GGRA 1UJ0A 3H0IA 2LCSA 3UA7A 1JU5C 3VRZA 4Z89A 1T0HA 2EQIA 1H8KA 2DE0X 1QKWA 1KFZA 1HSQA 2LJ0A 3EHQA 1Z9ZA 1KSWA 1VYVA 4LE9A 1JXMA 3QWXX 1M27C 2KYMA 2EGEA 2RQWA 3VS2A 4J9FA 4AG2C 1B3QA 2DX1A 2RPNA 2X3WD 2KBTA 2LP5A 1YWPA 2AKKA 2KXCA 2ESWA 2DRKA 1RLQC 2LX7A 2VWFA 1N5ZA 2GTOA 2ED0A 3PVQA 2M0YA 1NEGA 1WFWA 1U5SA 3VS5A 1QWEA 2BZXA 3M0QA 1PHTA 2L0AA 4WCIA 2ROLA 2JXBA 1RI9A 1H92A 2EYXA 1JO8A 1EFNA 2GQIA 4HCKA 1U06A 1UFFA 2K2MA 2DL8A 1E6GA 1NYFA 2L3PA 3NPFA 1PRLC 1VA7A 2O9VA 1M3AA 3C0CA 3UF4A 4HVUA 2J05A 2C0OA 3M0RA 2CH4A 3VS1A 2FO0A 4J9DA 1W70A 2HSPA 2C0TA 4OMOA 2O88A 1U3OA 2O9SA 1H3HA 1UGVA 4CC3A 1PRMC 4K11A 4LN2A 1UHFA 2CSIA 2DNUA 4F14A 1UDLA 4RTYA 5IXFA 1HD3A 2RQRA 5EC7A 2DL3A 2JM8A 1I0CA 4JZ3A 3H0HA 1M8MA 3M0SA 3UATA 1Y0MA 5FW9A 1WYXA 4GBQA 2YUPA 1SEMA 4R0KA 5IHNA 2KRSA 3EG1A 3KFVA 3ZL7C 4KRTA 2K7AA 1M30A 4JJDA 4DEYA 1UG1A 4OMMA 3VS3A 2OI3A 2DYBA 5I22A 2RQVA 2CT3A 4Y92A 1SPKA 2MIOA 1SSHA 4OMQA 3CQTA 2I0NA 3SEMA 1E7OA 2ABLA 1SRLA 4EIKA 4JZ4A 1ZUYA 3I35A 3I5RA 2BZ8A 1OPLA 1E6HA 1NM7A 2HDAA 3VS4A 2KRMA 2KEAA 4CC2A 2K3BA 1J3TA 2FPDA 2LQNA 4JJCA 1QKXA 1Y57A 1GFDA 2YUNA 1WLPB 2JMCA 3M0UA 2V1QA 2A08A 2EYWA 4D8DA 2EW3A 3R6NA 2PTKA 2GTJA 4F17A 2GBQA 4RTZA 2ECZA 1SHGA 1YNZA 1SRMA 3EG3A 1OOTA 2JMAA 4RTWA 5ECAA 4RUGA 4HVVA 3H41A 2KNBB 1K1ZA 1ABOA 1I07A 1JQQA 1GCQA 1KIKA 2DL5A 2LQWA 2NUZA 4AFUC 1OPKA 2CDTA 2DL7A 1QLYA 1G83A 1AD5A 2XMFA 4J9HA 1CSKA 2DA9A 3PVLA 1TUDA 1PWTA 2KXDA 2F2VA 2O31A 1MUZA 1GFCA 2MOXA 4AG1C 1YWOA 2L3SA 1AZGB 1ZX6A 1NG2A 1WA7A 1PNJA 1FYNA 1RLPC 2J7IA 5HCKA 1K0SA 2DBKA 1UTIA 2KGTA 2YUOA 1NYGA 1MV0B 1AVZC 4D8KA 1T3SA 1GBRA 2IIMA 4HVWA 4RTUA 2KR3A 1QCFA 4LUDA 1ZUUA 3PE0A 1G2BA 1HJDA 2ROTA 2W10A 2DILA 1AZEA 1WDXA 2CH4W 4ZNXA 2EYZA 4F16A 2GNCA 4Z8AA 2MCNA 3H0FA 1YP5A 3REBB 2RNAA 1BBZA 1X2KA 2D8JA 1UUEA 5IH2A 2HEQA 2CUBA 2DBMA 2F2WA 2RQUA 4J9IA 2SEMA 1BK2A 2BZYA 2DF6A 2QDLA 2AK5A 1XOVA 3A98A 4AFSC 2J6KA 4RTVA 3SHWA 2FEIA 1X6GA 1M3CA 1W1FA 1LCKA 2OAWA 4RTTA 4CC7A 1IO6A 2LMJA 1WI7A 2KRNA 1JEGA 3FJ5A 3IQLA 2YSQA 2P4RA 2JT4A 2LJ1A 4AFZC 4OMPA 1UHCA 2JM9A 1OEBA 1WXBA 1AWOA 1AWXA 2CT4A 1T0JA 1VYTA 2CREA 2W0ZA 2AZSA 2KT1A 4RTXA 5FWBA 2RMOA 1X69A 2EGAA 2A28A 1OV3A 2FPEA 1PKSA 3VRYA 1CKBA 2VKNA 2A36A 2VVKA 2KROA 2DJQA 2NWMA 2M51A 2DM1A 2V1RA 2K9GA 1GL5A 1ZSGA 3QWYA 2YDLA 4QT7A 2EPDA 5GJWB 2DLPA 3I9QA 2DRMA 2J6FA 2D0NA 4HXJA 2DL4A 1T3LA 2YT6A 2FPFA 1PKTA 1WX6A 3VS6A 2C0IA 3NHNA 2BTTA 3U23A 5L23A 2F2XA 4JJBA 1ZLMA 2LNHB 3I5SA 1BU1A 2J06A 1ZUKA 1ARKA 2O2OA 2D8HA 1K9AA 1X43A 1AOJA 4CC4B 1AEYA 3M0PA 3LH5A 1X27A 4IIOA 3ULRB 1K0XA 1JXOA 1UE9A 4ESRA 2AKLA 2ED1A 4X1VA 1ABQA 1WIEA 1NLOC 1TUCA 2B86A 4OMLA 2FRWA 5I11A 4FSSA 3NGPA 1AWJA 2KYBA 3EG2A 2LZ6B 1V1CA 2KE9A 3TSZA 4J9CA 2E5KA 2PNIA 3O5ZA 1A0NB 1WXTA 4Z88A 4A63B 2RF0A 5IHIA 2DVJA 2FRYA 3GBQA 3VS7A 2LJ3A 1BB9A 1GCQC 1KJWA 4JPBW 2FG0A 3EG0A 2K6DA 4OMNA 1I1JA 3VS0A 5FWCA 2HBWA 3REAB 3EGUA 2KT8A 1WXUA 1M3BA 2EGCA 3M0TA 2AZVA 4E6RA 3TSWA 3TVTA 2H8HA 1K4US 2RQTA 1Z9QA 3UA6A 1S1NA 2RN8A 4J9BA 4IIMA 1MV3A 2J6OA 2X3XD 5IXBA 2JS2A 3JV3A 2EYYA 2ENMA 1CKAA 2L3QA 1W6XA 4M4ZA 1NLPC 1RUWA 1AWWA 1UJYA 2CSQA 2L2PA 2K79A 2JTEA 1NEBA 1SHFA 2EKHA 2D1XA 2EVRA 1B07A 2G6FX 2CUDA 1ZBJA 1GBQA 1YN8A 3RBBB 4LUEA 1K76A 4ORZA 3EHRA 2JW4A 1GRIA 1X6BA 3NMZC
chains in the Genus database with same CATH superfamily
5GANe 3HFOA 3S3OA 2A0FB 4BE1A 3VV0A 4DEXA 1I4K1 2PZ1A 1ZSZA 1QWFA 1GCPA 1LPLA 1Q86R 2QEXQ 2KK4A 3BDUA 1EIFA 2QGGA 2COWA 3JAME 1WNLA 5LJ5h 1TTHB 2GGRA 4PFOA 1GXIE 3A5ZB 4C8QE 2CS7A 3JSCA 1T0HA 1KG1A 2EQIA 1H8KA 4HT9A 2EAYA 2LJ0A 5CKBA 2VC8A 4J8OA 2KYMA 1BCOA 4J9FA 2P0QA 2IVWA 3I55Q 4OVAA 2HD0A 2LP5A 3LLRA 2MF2A 1QMCA 1VQLA 4RG2A 2GTOA 1YITQ 4D6WA 3PVQA 1NEGA 1WFWA 1TXQA 1U5SA 4PJOA 3P8HA 5CQXA 4LDXA 1D0ZA 1PHTA 4XTYA 2OTLA 2MAMA 2JXBA 1IHVA 1KQ1A 1JO8A 1ZA1B 1EFNA 4HCKA 1SSFA 1JBMA 2DL8A 3M9QA 4M77E 4BB7A 2L3PA 1PRLC 1VA7A 1N9SA 2O9VA 3UF4A 4B9XA 2JZ2A 4GY5A 3M0RA 2E12A 1QVGS 3VS1A 2FO0A 2QQBA 2NUPB 4OMOA 1ZHIA 4PJNA 1VQMQ 2MWPA 3CCRA 3JCMb 5GAN2 3QG1A 4K11A 3CCMQ 3OYKA 1UHFA 1VQ9Q 5HY6A 1VQ6T 4MZMA 2VYTA 3OYNA 2DL3A 4EMKC 1I0CA 4M78G 4EMGA 5LJ3j 5GANj 4J7IA 2YRDA 2DXCA 3KBGA 2WSFE 3M0SA 3UATA 1Y0MA 5I2MA 1KD1U 2DIQA 1D0XA 2R5AA 4NL3A 2YUPA 1K8AU 4R0KA 2NLUA 1R8OB 1TSFA 1M30A 4A4GA 1UG1A 4OMMA 3PMTA 4C92E 3Q1JA 1JB0E 2DYBA 3CCLT 2LQKA 5GAMg 2DPPB 2RK1A 4RCBA 4M7AB 1WHKA 4OMQA 2FB7A 1SRLA 3AT1B 3I35A 2PVGB 2H3EB 3VS4A 4QVZA 2I2LA 4FM4B 1KC8R 2LQNA 3FDRA 4M7AD 3VUBA 1KHCA 1F1BB 1PC0A 3KUFA 2K3XA 3R6OA 4JRQA 3M0UA 2A08A 2ZPGB 3CD6T 3R6NA 1UGPB 3RMSA 4M7DF 4BI3A 5EG2A 4RTWA 2ATCB 1QP3A 3BE3A 5DM7R 3CC7Q 2D6FA 4FCYA 1RI0A 4QQGA 3G71A 2QA4Q 1R0BG 4A53A 5FLXE 4ELYC 1ZSZC 1K73C 2LC4A 1QLYA 2LTOA 1NZ9A 1AD5A 3UPUA 2PQWA 2XMFA 1TH7A 2XDDA 2DA9A 1PWTA 2KXDA 2AHJB 2R58A 1YWOA 4M77B 1AZGB 5GANh 3JB9J 3JB9F 1FX7A 3JB9H 1C0MA 3PTAA 5CKEA 4QW2A 2KGTA 2YUOA 1B7TA 1NYGA 2M0OA 3QSUA 2CYZB 3LH0A 2DVEA 1T3SA 1GBRA 2VGNA 4HVWA 4RTUA 2QEXT 3CCJQ 4NOYA 5IT9E 4L6V5 4LUDA 1ZUUA 5DLOA 2ROTA 2W10A 3CXCA 4PJOC 3REBB 2VV5A 2RNAA 2D8JA 1X2KA 5GAMf 2VXEA 1UUEA 4C0ZA 2HEQA 3OQ5A 4C8QA 2RQUA 2CP5A 2EKOA 4J9IA 3SB2A 1XOVA 4AFSC 2D9TA 2M16A 1PCXA 3OW2S 3SHWA 2DAQA 3OYCA 2FEIA 4ZTFA 1W1FA 1JJ2P 2YLBA 4RTTA 4FL6A 5HK3A 3DKMA 1YITT 4C92B 2P4RA 1VQOQ 1WQWA 4AFZC 1OEBA 2CP3A 4DOWA 2CREA 2W0ZA 3BDLA 5FWBA 4QVDA 3L2QA 4Q5WA 2GFUA 4E7IA 3L2UA 2QGFB 3HRSA 3HSBA 4M77A 4X34A 1ACMB 4DBRA 1B34A 2V1RA 2K9GA 1GL5A 5KYUA 3I56Q 1R0CB 1C1AA 1LOJA 2LCCA 4KH0B 2YDLA 3LGFA 3RIRA 2J6FA 2D0NA 4HXJA 2DL4A 4E7SA 3CPWA 3MEUA 1M5Q1 1WX6A 3C4SA 4QVCA 1YIJQ 3CCET 2NYSA 2EQJA 2F5KA 2C0IA 1VQ9T 1N8RU 4M78D 4JJBA 2G3RA 3HRTA 2HQEA 3V8KA 1SKUB 1OI1A 1ZUKA 4XTXA 3CCQQ 1K9AA 4CC4B 1AEYA 2CP2A 3CCSA 1K0XA 4F7UE 4HCBA 2ED1A 4X1VA 3EFSA 1WIEA 1TUCA 4DBHA 2B86A 2FRWA 4C0DB 2XU8A 3VJPA 3G4SQ 4C92A 5GAN5 2YRCA 3ME9A 1YI2T 2A7YA 4FT2A 5DY9A 1NJIU 2X4XA 4N0AA 2KE9A 2E5KA 3OMGA 1WXTA 2K2VA 2RF0A 2DVJA 4E7ZA 1QVFA 3TQ7P 2DXTA 3D7SB 1IZ6A 2ZZDA 2E6ZA 2FG0A 1YFNA 2YLCA 3CCVT 2E41A 3OB9A 2VXFA 3RR6A 4FYXB 2YXYA 3EFOB 3MP8A 3CBPA 1JJ2S 4PLLA 4KULA 3TSWA 2RJFA 1Z9QA 1YJNA 2RN8A 4IIMA 5IXBA 4J5YA 2JS2A 2EYYA 2ENMA 1CKAA 1Y07A 5KYNA 3CC7T 3PGGA 1NLPC 2QA4T 2X4YA 1FMVA 3JCMJ 2QYZA 2L2PA 4PLIA 1BCMA 1OU8A 1SHFA 2DZ9A 2G6FX 2CUDA 1K9MU 4JS4A 3QDRB 3A8MB 2DETA 3A8LB 4LUEA 1BIAA 3H8ZA 2V8JA 2K3YA 2LT1A 1QW1A 4BACA 2WSCE 2HL5C 1X6BA 1M1KR 1M2OA 1BI0A 4C8QC 2HCKA 2L3RA 4LNPA 1YHQQ 3RESA 4C5IA 4Y28E 1K8AC 2YUQA 2LRQA 4HCZA 5KH6A 2JOYA 2A37A 3EAEA 4O6JA 3S6WA 2CZ0B 1TG0A 2EJ9A 2IPOB 2OJ2A 3S3MA 4JLGA 3G1JA 3QKJA 5IHKA 4AFQC 1VQNQ 1X2QA 1HYOA 2E4HA 4KH1B 1OX9A 3UA7A 3WXMB 4XTZA 1JU5C 3MO8A 4DBQA 2DE0X 3TEEA 1KFZA 3MHXA 4R55A 1VYVA 4LE9A 3QWXX 2EGEA 1Q81U 2BE9B 2LNVA 1BI2A 1YWPA 4M77C 6AT1B 2DRKA 1RLQC 2LX7A 2QXFA 3CCLQ 1N5ZA 5LJ5j 3OS5A 4BY6C 3OYAA 3VS5A 5GAN6 4M78F 3INZA 2L0AA 2F1LA 2ROLA 1VQKA 1U1SA 1VQOT 4OF1A 2EYXA 2GQIA 2MYSA 1UFFA 3WVDB 2E5QA 2JTFA 3CC2A 2QQ9A 2DXUA 4RKUE 2XG8D 5GAMe 4A4FA 4E7KA 4J9DA 2HSPA 3QPHA 5KYWB 3CD6Q 1YCYA 4QQ6A 4M75A 2QQAA 2O9SA 1UGVA 4LN2A 3CBOA 2KY9A 1KQ2A 1Q86U 1UGSB 3E1SA 4FSXA 1WHJA 5KCHA 1VQPT 2X9HA 3WVEB 2L89A 4C92C 2FYKA 4J7FA 3L2RA 1YIJT 1QVGA 2OTLQ 1Q95G 4XU2A 1VQ7A 4N0AC 4XQ3A 2EJGA 2GCXA 1RAHB 5GMKe 4GBQA 1SEMA 1D1BA 2RHYA 3MCAB 4KBMB 4M7DB 2EQMA 3F70A 2KRSA 3EG1A 3KFVA 3OS1A 3CCQT 3ZL7C 4KRTA 4E7JA 2K7AA 3A8OB 3SDZA 3X20B 4DEYA 4F7UA 3CPFA 4TVRA 1VQ5A 2OI3A 4KUIA 4M7AE 2P84A 5I22A 1HK9A 3CMEA 4C8QG 4Y92A 1SSHA 2I0NA 4B9WA 3G4ST 5C6SA 4M7DD 1VQ8A 4EIKA 4JZ4A 3P8BB 4BE2A 4RG8A 3I5RA 1OZ2A 1O9SA 1E6HA 1NM7A 1UEBA 5I2SA 3GP8A 2K3BA 4KGZB 1J3TA 2FPDA 4JJCA 4YTLA 1QKXA 2RI3A 3JCMg 3G7ZA 3G6EA 2LQ8A 4OGCA 2EYWA 1VQ4A 1Q82R 2EW3A 2PTKA 2GTJA 1NPRA 1M4ZA 2EQUA 5ECAA 3M4GA 3GLXA 3H41A 1PM3A 2MK5A 1K1ZA 1ABOA 1D3BA 1AHJB 3JB9D 2XDBA 5A0LA 5GAMj 2DL5A 2DJZA 2PUKB 2NUZA 3UT1A 2DL7A 2CDTA 2JVVA 4ATOA 3SFMA 5FRNA 1OU9A 4IUTA 2X35A 4J9HA 3URGA 4P5NA 2F2VA 4E7LA 2QDYB 3MKDA 5KYXB 1N8RC 1MUZA 1PSEA 4XAXB 2L3SA 2DKGA 3VYHB 1NG2A 3CMAA 2CZ7B 2J7IA 2ZPEB 3E19A 1K0SA 3VU3C 2DBKA 5HK0A 3UWNA 3J81E 1WQ7A 1YHQT 3RKYA 4D8KA 1PG5B 2CP0A 3G71Q 3FIFA 3CCEQ 2BUDA 1QCFA 1ZQ1A 1YBYA 2GQVA 5A0DA 3QDFA 4C92G 2DXBA 2KQWA 1KC8U 3PE0A 1VQNT 1NJIC 5L8RE 4IUPA 2EYZA 3JCMd 2MCNA 3VYGA 1YP5A 2QQRA 1BBZA 4EMHA 1UGQB 4NS5A 4QQDA 1BK2A 1QQJA 2BZYA 2AK5A 5DLQE 4RCCA 1X6GA 1V29B 2OAWA 4CC7A 1YI2Q 2KRNA 7AT1B 2E3IA 4M75C 3JCMf 3ER0A 3OW2P 1WPYA 3FEOA 2LJ1A 4OMPA 1UHCA 1WXBA 1AWOA 4LDWA 2CT4A 3TCJA 2X4JA 1T0JA 1SF9A 1VYTA 2AZSA 2KT1A 1D1AA 4XU3A 1BI1A 1IB8A 5KYXA 1I5OB 2VKNA 3A8GB 3BFMA 5C0MA 2VVKA 3I55A 3QUIA 2DM1A 2HSEB 5GAMh 3CCVQ 2E70A 2NUPA 4M78E 3M54A 1K9MC 2FL7A 2MI6A 5GAOr 5GAN7 5D6YA 4JJNK 3ZFJA 1VQLT 3U23A 5L23A 3SD4A 2DYIA 3JCMQ 2F2XA 1ZLMA 2OTLT 2LNHB 4MMLA 1IHWA 4F04B 5GMKh 4CI0C 1VQMA 2O2OA 3LH5A 1X27A 3C95A 4OB2B 1JXOA 4ESRA 5KE2A 4AMCA 3CCMA 2EFIA 1ABQA 1OQKA 3LW5E 4PL6A 3OA6A 2WACA 3QZ5B 4OMLA 4HA8A 5I11A 3CCUA 3V8JA 4M7AA 2QAZA 2LCLA 3CCRT 4OB0B 4FSSA 3LYIA 4AT1B 1AWJA 2RJDA 1W2BP 3M57A 1V1CA 1Q81C 3TSZA 2PVDB 1A0NB 2FZKB 2LJ3A 4II1A 1BYMA 2VASA 2QASA 3OYDA 4FYYB 1KQSP 1KK7A 1M8VA 3REAB 3CCSQ 3SWNB 2C06A 2KT8A 2HKQB 1WXUA 4MDWA 3OY9A 3O8VA 1D1CA 2EGCA 4E6RA 3PNWC 5FU6B 1K4US 1ZA2B 3OYEA 2J6OA 2X3XD 5FROA 1SG5A 3QYHB 1TWBA 2L3QA 2P0PA 4M75G 1MNDA 1HXDA 2QG9B 2K79A 1Q7YR 1MNEA 1JJ2A 4E47A 1Q86C 2RK2A 2EVRA 2WSEE 1YJ9A 2DK3A 1ZBJA 1YN8A 3JB9I 5CQYA 3GOXA 4R56A 3EG9B 1M90R 4RMOA 2PVOB 2Y4XA 2JW4A 4PKCC 3JCMV 5LJ3d 4DOVA 5GANd 1WJQA 5FU7B 2HQXA 1M2VB 3RNJA 4M78B 1YJNQ 3THKA 3QBYA 1UECA 3P8DA 2EBPA 4BI8B 4ANJA 3HRUA 4J9EA 3ZBDA 2OTJA 4F7UG 2JS0A 3QXEB 1VQPQ 3G71T 2DMOA 2LCSA 2A3LA 5LJ3f 1UB4A 3BY7A 1HSQA 3EHQA 3VUZA 1KSWA 1M1GA 2EJFA 2GFAA 4MZTA 2RQWA 3VS2A 4AG2C 4LXCA 1B3QA 3LWIA 3OSSC 2AKKA 3RMQA 1W2BS 2KXCA 2ESWA 3CCUT 1N6AA 2VWFA 4J6YA 3GIBA 2EWNA 4BE0A 3NFCA 2O4XB 2BZXA 4ELZC 4WTOB 1H92A 1LVKA 5GAN8 5CVIA 1U06A 2K2MA 1KQSS 3EGXB 1E6GA 3NPFA 3QIIA 3C0CA 1M3AA 4IURA 2J05A 4PJOG 2R57A 3M5AA 2QK0A 2JUFA 1W70A 2R5MA 2C0TA 1M1KU 4C8QF 2O88A 4IKFA 1I81A 1U3OA 2DERA 5IAYA 1H3HA 5CKDA 1PRMC 1BKBA 2RI2A 3L2WA 2M02A 4FU6A 1UDLA 2BKDN 5IXFA 1BIBA 4IUQA 4BD3A 3BW1A 2Y90A 4M7AC 3JCMe 2LDMA 1N27A 2JM8A 4LD6A 1G3TA 4JZ3A 1OX8A 3H0HA 2RI5A 3OYGA 3CC4A 4M7DE 4C5HA 2L8DA 2QI2A 4DQ2A 5CK9A 1S72A 1KC8C 3HKSA 2MMPA 4JJDA 3VS3A 1Y71A 2H3JA 1YJWA 4A54A 2O4XA 1SPKA 2MIOA 1IREB 1KD1C 4EPCA 2RM4A 1E7OA 3ZEHA 1OULA 4L59A 2BZ8A 1OPLA 4MMKA 3EGXA 2KRMA 2KEAA 3JCMc 2HL3A 1VQ7Q 1R77A 2CKKA 1WLPB 2EYQA 4XTVA 2JMCA 3EFOA 4KGVB 2V1QA 3A8HB 4LDUA 2RA2A 3CCST 4F17A 1KHIA 4RTZA 2ECZA 1RL2A 3OYFA 1YNZA 1SRMA 1VQ5Q 1OOTA 1H3ZA 4FIBA 4RUGA 5A2QE 1RADB 1NBEB 1I07A 1JQQA 1WGSA 4M75D 1GCQA 4HKEA 1OZ3A 2LQWA 1I5LA 3PT9A 1V76A 4AFUC 2RHUA 3PFSA 1OPKA 4IUUA 4X9DA 2HMAA 2Z0WA 2RHXA 3C94A 5J3BA 1QCOA 3HPWA 2JN0A 3MEVA 3PVLA 1QVFS 1C6VX 1TUDA 1RACB 2BIVA 2O31A 1H641 3G6EQ 1MHNA 1RABB 4NL2A 2MOXA 1ZX6A 1WA7A 4JRIA 5CCAA 2V26A 1FYNA 1RLPC 1UTIA 4E2FB 2E64A 1MV0B 5FU6C 1ZSZB 1AVZC 4BUGA 1K73R 4LDVA 2AIRB 3X24B 5GAOn 1PD0A 1YJNT 1VQLQ 2K5LA 3JRZA 3V7RA 2V8KA 3M55A 5D6WA 2KR3A 2DD4A 1FWZA 2M9UA 4M7AG 1Y96B 2VB6A 1HJDA 1G2BA 3VKIA 2PUOB 1AZEA 2E1HA 2HAXA 2CH4W 4ZNXA 4F16A 3FLGA 3H0FA 8ATCB 3EGDB 1IGUA 1TOVA 1LNXA 2DBMA 2F2WA 2LX9A 1XQHA 3H6ZA 1Q82U 2SEMA 2XI9A 2DF6A 2QDLA 2VUBA 2HQHA 4RTVA 3OBWA 4Z02A 2M1HA 1LJOA 1VQ6A 4PJLA 3CCRQ 2LMJA 1JEGA 1D0YA 3FJ5A 3JCMX 3CEYA 4OB1B 4FYWB 3META 2B8AA 2JT4A 4WF2A 1AWXA 4RTXA 2X4WA 2RMOA 2EGAA 3VRYA 2KROA 3OYMA 4PJOD 2KVQG 1RAEB 2RHZA 2RO0A 5LJ3e 2YRVA 1ZSGA 3CCLA 3HL8A 5KYWA 4Y91A 3JCMW 5GJWB 3NTKA 1BI3A 3I9QA 3HTRA 4XTWA 4M77G 1PKTA 5J26A 1Y96A 4C0DC 2L5QA 1O75A 2DIGA 3JCMh 3J80E 5M9OA 5KYYB 3EGDA 1MMDA 5CKHA 3OS0A 2XICA 2COZA 1VQKT 1VIFA 3GNFB 3I5SA 1BU1A 2J06A 3CD6A 2D8HA 1X43A 1QVPA 4ZGDB 3M0PA 4DBFA 4M7DA 2DTIA 3CC2T 3OYYA 4JRKA 2KMTA 2V8IA 1NLOC 5FRMA 3V7SA 3MPUB 2MPXC 4M75F 2KYBA 1JRIA 3EG2A 2CZ1B 4J9CA 4J6WA 4A4KA 2RJEA 1X6OA 5GMKj 2K4YA 3O5ZA 4N4HA 5IHIA 3EH1A 2FRYA 2D0QB 4BDZA 1VUBA 3GBQA 5LJ5d 1GCQC 2PU9B 1U8RA 1DJ7B 1VQ7T 2OX7A 3OYBA 3EG0A 4ZN3A 1MGQA 2K6DA 4OMNA 5I21A 1I1JA 3VS0A 3OMCA 2HBWA 2OAUA 4FYVB 1M3BA 1WZOA 2AZVA 4BI4A 4CRIA 2H8HA 4HT8A 4OP0A 2RQTA 5HKCA 2ZPFB 2GF7A 4F7UF 1S1NA 3CCUQ 1VQ5T 2HKNA 1W4SA 2DD5A 2QEXA 3CMET 1M1KC 5LJ5f 1M9SA 3LWHA 1WJRA 1WJSA 3MP1A 5KYYA 3QYGB 1VQ8T 3MEAA 1AWWA 1UJYA 2CSQA 2JTEA 1NEBA 2ZAEA 1VIEA 2D1XA 1B07A 2KDSA 3ASKA 3RDVA 2LVMA 3RBBB 3OW2A 1K76A 3EH2A 3E9FA 1RAFB 3G6ET 3NMZC 3A1PA 3MJXA 4GLMA 5GJVB 3RUXA 4KGXB 5KCOA 1VQ4T 1YITA 4J9GA 4HCCA 3OBYA 3L42A 3V8LA 1YCSB 1VYUA 2QQSA 2SRCA 2DEUA 2CZ6B 2K5FA 1FMKA 2CGHA 1M1FA 3OYLA 3E2UA 3HP9A 3FC3A 1UJ0A 3H0IA 2DTHA 3FB9A 4PJOF 3VRZA 2XDPA 4Z89A 1XTDA 1QKWA 4O5VA 1YJ9Q 1KD1R 5CAIA 4C8QB 1Z9ZA 1TUGB 8AT1B 4FW2A 4C0GA 4MZPA 1K8AR 1JXMA 1M27C 1I8FA 4BDYA 2DO3A 2RB6A 4UC4A 2RPNA 2DX1A 3S3NA 2X3WD 2KBTA 3PIPA 3CCEA 3L2ZA 3M53A 2ED0A 4C8QD 1VQ9A 3CMAT 3DLMA 2M0YA 1WHHA 5LJ3g 5GANg 2ZPIB 1QWEA 1EX4A 2OTJQ 1PD1A 4C5GA 3M0QA 4FT4A 4WCIA 4N4GA 1RI9A 4XTUA 4PK4A 1Q7YU 4PNOA 2DEQA 1WHMA 3E9GA 4OB3B 4ZGEB 1NYFA 3NTHA 1W2BA 4HVUA 4B6MA 1M90U 2C0OA 4QKUA 5GAMd 1B34B 2CH4A 5LJ3h 5KYUB 4BY6B 3GF5A 1YI2A 4CC3A 3CXCP 4M7DC 1ZBXA 2CSIA 2DNUA 2QTXA 4F14A 4M77D 2FHDA 1KQSA 4RTYA 1HD3A 2RQRA 5EC7A 1U1TA 3M4YA 5GAOl 3OYIA 2RJCA 5GAOm 1M8MA 1X01A 2QTVA 3CCVA 4VUBA 5FW9A 3QJ6A 1WYXA 2ZPHB 5IHNA 3RERA 3I55T 1NE8A 1IRXA 1WHLA 3JCMP 4ZTJA 2RQVA 4IUVA 2CT3A 4J83A 3L1AA 3RKWA 4PFZA 3M56A 3CC7A 3CQTA 5A0GA 1Q82C 2QA4A 3LGLA 3SEMA 2ABLA 3QZ9B 1ZUYA 3M59A 3OS2A 5GAN3 2E3HA 2HDAA 4CC2A 3UDCA 1QCNA 2CP7A 5CKFA 4C92D 3OYHA 3GNGA 5GAN4 2FVUA 3OSVA 1Y57A 3MEWA 2EIFA 2MWOA 2XHCA 2YUNA 4ZN1A 3DLLA 4M75E 1GFDA 2K5IA 3CC4Q 3OYJA 3CPWP 3X25B 5GANf 3SWNA 4D8DA 1VQMT 1S72Q 2AT1B 5CR2A 2GBQA 1SHGA 3L2VA 3CCMT 2EQKA 3EG3A 4DA4A 2JMAA 1D09B 1YJWQ 4HVVA 5AT1B 3V7CA 2COYA 2ZCFB 2KNBB 3M58A 3KXTA 2KSSA 1RAAB 3J7AF 3HHTB 4M7AF 4EDUA 2XD0A 1KIKA 2DTOA 3CCJA 2YHTA 1G83A 1CSKA 3EG9A 3T9NA 9ATCB 3GPLA 5CIUA 2XKOC 1RAIB 1GFCA 4AG1C 3CXCS 2DFUA 4KT0E 1PNJA 1QVFP 3CBMA 1G5VA 5HCKA 4ME7A 2DZCA 1MMAA 1M2VA 4M78A 4M7DG 2KAFA 5D6XA 4JRPA 1IXDA 1G3YA 1VQOA 3FRNA 2IIMA 4XK8E 3PIOA 3QHSA 2P0KA 1P92A 3X28B 5LJ5e 5IN1A 2X51A 1N8RR 2DILA 1WDXA 4V2SA 2GNCA 4Z8AA 1PSFA 1VQKQ 4C0FA 5IH2A 2CUBA 5GMKl 1YJ9T 3I56A 1G3SA 2BE7D 5GMKm 3CC2Q 4LD9K 3A98A 2J6KA 3H9NA 1OYXA 4N4IA 3AHUA 4M77F 1M3CA 3N5BB 1LCKA 1VQPA 4PJOE 3JB9G 1IO6A 1WI7A 2HZYA 1YIJA 3IQLA 1AT1B 1NJIR 4GLKA 2RHIA 2YSQA 3TREA 1VOMA 2O01E 4EMKB 2JM9A 2OTJT 4L5GA 4PJJA 1X69A 2A28A 1OV3A 3CPWS 2FPEA 5J39A 1PKSA 1CKBA 3CCQA 3DB3A 2ZPBB 2A36A 1G3WA 2DJQA 2NWMA 2M51A 5GAOp 1NPPA 3LX7A 5KE3A 3QJYA 4OGEA 1WHGA 2KI7A 3MP6A 3QWYA 4M75B 1RAGB 3G4SA 2CP6A 4ZGJB 4QT7A 3RKXA 2EPDA 2DLPA 4JS5A 4J6XA 1K73U 2JTMA 2DRMA 4FW1A 3EFRA 1MMGA 1T3LA 1VQ6Q 1XJWB 1MMNA 2YT6A 2FPFA 3VS6A 3CMEQ 3TU4K 3CCJT 3NHNA 2BTTA 2XIDA 4JUVA 2LT4A 4C92F 4KUDK 1VQ8Q 2P4TA 1QP2A 1FXXA 2RD1A 1TU0B 1FMWA 1K9MR 1ARKA 4E7HA 1AOJA 2ZGWA 3ULRB 4IIOA 1UE9A 2JNGA 2AKLA 2F69A 3X26B 2NUTB 4A4HA 4F7UB 4XU0A 2FZCB 1VQ4Q 3SWNC 3NGPA 2YWWA 4PFPA 4EMKA 2LZ6B 4OMFB 2F5TX 3DB4A 4A4EA 2PNIA 1IGQA 4Z88A 4A63B 2VGMA 3C12A 4C5EA 3VS7A 1BB9A 1KJWA 5LL6S 2HNIA 5D7UA 4JDSA 4JPBW 1EZZB 1X75C 1G8XA 5FWCA 3I56T 3CC4T 1Q7YC 1UGRB 3EGUA 4PJMA 5CO7A 1QVGP 2K57A 3M0TA 1S72T 1YHQA 1Q81R 3TVTA 1N9RA 1M90C 3UA6A 4J9BA 1D3BB 1MV3A 1YJWT 5AYFA 3CMAQ 2HBPA 3JV3A 3NTIA 4MDXA 1W6XA 4X9CA 5FU7C 1VQNA 4M4ZA 3FJPA 1RUWA 2E65A 5GAOq 4XU1A 4PJOB 4M78C 2IG0A 3PMIA 3QO3A 2FZGB 4LDYA 1Y7XA 5GMKi 2EKHA 2XK0A 1GBQA 1XNIA 2RH2A 2NUTA 4JLIA 4ORZA 2E6NA 2E10A 3EHRA 2JJ9A 2Y4YA 1GRIA 5LJ5g 1TS9A 3HFNA
chains in the Genus database with same CATH topology
4GLMA 5GJVB 2HCKA 4LNPA 4J9GA 4DEXA 2YUQA 2PZ1A 3RNJA 2A37A 3THKA 1QWFA 1GCPA 1UECA 2EBPA 1YCSB 1TG0A 1VYUA 4J9EA 2OJ2A 2JS0A 2SRCA 1FMKA 5IHKA 4AFQC 1X2QA 2DMOA 2GGRA 1UJ0A 3H0IA 2LCSA 3UA7A 1JU5C 3VRZA 4Z89A 1T0HA 2EQIA 1H8KA 2DE0X 1QKWA 1KFZA 1HSQA 2LJ0A 3EHQA 1Z9ZA 1KSWA 1VYVA 4LE9A 1JXMA 3QWXX 1M27C 2KYMA 2EGEA 2RQWA 3VS2A 4J9FA 4AG2C 1B3QA 2DX1A 2RPNA 2X3WD 2KBTA 2LP5A 1YWPA 2AKKA 2KXCA 2ESWA 2DRKA 1RLQC 2LX7A 2VWFA 1N5ZA 2GTOA 2ED0A 3PVQA 2M0YA 1NEGA 1WFWA 1U5SA 3VS5A 1QWEA 2BZXA 3M0QA 1PHTA 2L0AA 4WCIA 2ROLA 2JXBA 1RI9A 1H92A 2EYXA 1JO8A 1EFNA 2GQIA 4HCKA 1U06A 1UFFA 2K2MA 2DL8A 1E6GA 1NYFA 2L3PA 3NPFA 1PRLC 1VA7A 2O9VA 1M3AA 3C0CA 3UF4A 4HVUA 2J05A 2C0OA 3M0RA 2CH4A 3VS1A 2FO0A 4J9DA 1W70A 2HSPA 2C0TA 4OMOA 2O88A 1U3OA 2O9SA 1H3HA 1UGVA 4CC3A 1PRMC 4K11A 4LN2A 1UHFA 2CSIA 2DNUA 4F14A 1UDLA 4RTYA 5IXFA 1HD3A 2RQRA 5EC7A 2DL3A 2JM8A 1I0CA 4JZ3A 3H0HA 1M8MA 3M0SA 3UATA 1Y0MA 5FW9A 1WYXA 4GBQA 2YUPA 1SEMA 4R0KA 5IHNA 2KRSA 3EG1A 3KFVA 3ZL7C 4KRTA 2K7AA 1M30A 4JJDA 4DEYA 1UG1A 4OMMA 3VS3A 2OI3A 2DYBA 5I22A 2RQVA 2CT3A 4Y92A 1SPKA 2MIOA 1SSHA 4OMQA 3CQTA 2I0NA 3SEMA 1E7OA 2ABLA 1SRLA 4EIKA 4JZ4A 1ZUYA 3I35A 3I5RA 2BZ8A 1OPLA 1E6HA 1NM7A 2HDAA 3VS4A 2KRMA 2KEAA 4CC2A 2K3BA 1J3TA 2FPDA 2LQNA 4JJCA 1QKXA 1Y57A 1GFDA 2YUNA 1WLPB 2JMCA 3M0UA 2V1QA 2A08A 2EYWA 4D8DA 2EW3A 3R6NA 2PTKA 2GTJA 4F17A 2GBQA 4RTZA 2ECZA 1SHGA 1YNZA 1SRMA 3EG3A 1OOTA 2JMAA 4RTWA 5ECAA 4RUGA 4HVVA 3H41A 2KNBB 1K1ZA 1ABOA 1I07A 1JQQA 1GCQA 1KIKA 2DL5A 2LQWA 2NUZA 4AFUC 1OPKA 2CDTA 2DL7A 1QLYA 1G83A 1AD5A 2XMFA 4J9HA 1CSKA 2DA9A 3PVLA 1TUDA 1PWTA 2KXDA 2F2VA 2O31A 1MUZA 1GFCA 2MOXA 4AG1C 1YWOA 2L3SA 1AZGB 1ZX6A 1NG2A 1WA7A 1PNJA 1FYNA 1RLPC 2J7IA 5HCKA 1K0SA 2DBKA 1UTIA 2KGTA 2YUOA 1NYGA 1MV0B 1AVZC 4D8KA 1T3SA 1GBRA 2IIMA 4HVWA 4RTUA 2KR3A 1QCFA 4LUDA 1ZUUA 3PE0A 1G2BA 1HJDA 2ROTA 2W10A 2DILA 1AZEA 1WDXA 2CH4W 4ZNXA 2EYZA 4F16A 2GNCA 4Z8AA 2MCNA 3H0FA 1YP5A 3REBB 2RNAA 1BBZA 1X2KA 2D8JA 1UUEA 5IH2A 2HEQA 2CUBA 2DBMA 2F2WA 2RQUA 4J9IA 2SEMA 1BK2A 2BZYA 2DF6A 2QDLA 2AK5A 1XOVA 3A98A 4AFSC 2J6KA 4RTVA 3SHWA 2FEIA 1X6GA 1M3CA 1W1FA 1LCKA 2OAWA 4RTTA 4CC7A 1IO6A 2LMJA 1WI7A 2KRNA 1JEGA 3FJ5A 3IQLA 2YSQA 2P4RA 2JT4A 2LJ1A 4AFZC 4OMPA 1UHCA 2JM9A 1OEBA 1WXBA 1AWOA 1AWXA 2CT4A 1T0JA 1VYTA 2CREA 2W0ZA 2AZSA 2KT1A 4RTXA 5FWBA 2RMOA 1X69A 2EGAA 2A28A 1OV3A 2FPEA 1PKSA 3VRYA 1CKBA 2VKNA 2A36A 2VVKA 2KROA 2DJQA 2NWMA 2M51A 2DM1A 2V1RA 2K9GA 1GL5A 1ZSGA 3QWYA 2YDLA 4QT7A 2EPDA 5GJWB 2DLPA 3I9QA 2DRMA 2J6FA 2D0NA 4HXJA 2DL4A 1T3LA 2YT6A 2FPFA 1PKTA 1WX6A 3VS6A 2C0IA 3NHNA 2BTTA 3U23A 5L23A 2F2XA 4JJBA 1ZLMA 2LNHB 3I5SA 1BU1A 2J06A 1ZUKA 1ARKA 2O2OA 2D8HA 1K9AA 1X43A 1AOJA 4CC4B 1AEYA 3M0PA 3LH5A 1X27A 4IIOA 3ULRB 1K0XA 1JXOA 1UE9A 4ESRA 2AKLA 2ED1A 4X1VA 1ABQA 1WIEA 1NLOC 1TUCA 2B86A 4OMLA 2FRWA 5I11A 4FSSA 3NGPA 1AWJA 2KYBA 3EG2A 2LZ6B 1V1CA 2KE9A 3TSZA 4J9CA 2E5KA 2PNIA 3O5ZA 1A0NB 1WXTA 4Z88A 4A63B 2RF0A 5IHIA 2DVJA 2FRYA 3GBQA 3VS7A 2LJ3A 1BB9A 1GCQC 1KJWA 4JPBW 2FG0A 3EG0A 2K6DA 4OMNA 1I1JA 3VS0A 5FWCA 2HBWA 3REAB 3EGUA 2KT8A 1WXUA 1M3BA 2EGCA 3M0TA 2AZVA 4E6RA 3TSWA 3TVTA 2H8HA 1K4US 2RQTA 1Z9QA 3UA6A 1S1NA 2RN8A 4J9BA 4IIMA 1MV3A 2J6OA 2X3XD 5IXBA 2JS2A 3JV3A 2EYYA 2ENMA 1CKAA 2L3QA 1W6XA 4M4ZA 1NLPC 1RUWA 1AWWA 1UJYA 2CSQA 2L2PA 2K79A 2JTEA 1NEBA 1SHFA 2EKHA 2D1XA 2EVRA 1B07A 2G6FX 2CUDA 1ZBJA 1GBQA 1YN8A 3RBBB 4LUEA 1K76A 4ORZA 3EHRA 2JW4A 1GRIA 1X6BA 3NMZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLM A;  5GJV B;  2HCK A;  4LNP A;  4J9G A;  4DEX A;  2YUQ A;  2PZ1 A;  3RNJ A;  2A37 A;  3THK A;  1QWF A;  1GCP A;  1UEC A;  2EBP A;  1YCS B;  1TG0 A;  1VYU A;  4J9E A;  2OJ2 A;  2JS0 A;  2SRC A;  1FMK A;  5IHK A;  4AFQ C;  1X2Q A;  2DMO A;  2GGR A;  1UJ0 A;  3H0I A;  2LCS A;  3UA7 A;  1JU5 C;  3VRZ A;  4Z89 A;  1T0H A;  2EQI A;  1H8K A;  2DE0 X;  1QKW A;  1KFZ A;  1HSQ A;  2LJ0 A;  3EHQ A;  1Z9Z A;  1KSW A;  1VYV A;  4LE9 A;  1JXM A;  3QWX X;  1M27 C;  2KYM A;  2EGE A;  2RQW A;  3VS2 A;  4J9F A;  4AG2 C;  1B3Q A;  2DX1 A;  2RPN A;  2X3W D;  2KBT A;  2LP5 A;  1YWP A;  2AKK A;  2KXC A;  2ESW A;  2DRK A;  1RLQ C;  2LX7 A;  2VWF A;  1N5Z A;  2GTO A;  2ED0 A;  3PVQ A;  2M0Y A;  1NEG A;  1WFW A;  1U5S A;  3VS5 A;  1QWE A;  2BZX A;  3M0Q A;  1PHT A;  2L0A A;  4WCI A;  2ROL A;  2JXB A;  1RI9 A;  1H92 A;  2EYX A;  1JO8 A;  1EFN A;  2GQI A;  4HCK A;  1U06 A;  1UFF A;  2K2M A;  2DL8 A;  1E6G A;  1NYF A;  2L3P A;  3NPF A;  1PRL C;  1VA7 A;  2O9V A;  1M3A A;  3C0C A;  3UF4 A;  4HVU A;  2J05 A;  2C0O A;  3M0R A;  2CH4 A;  3VS1 A;  2FO0 A;  4J9D A;  1W70 A;  2HSP A;  2C0T A;  4OMO A;  2O88 A;  1U3O A;  2O9S A;  1H3H A;  1UGV A;  4CC3 A;  1PRM C;  4K11 A;  4LN2 A;  1UHF A;  2CSI A;  2DNU A;  4F14 A;  1UDL A;  4RTY A;  5IXF A;  1HD3 A;  2RQR A;  5EC7 A;  2DL3 A;  2JM8 A;  1I0C A;  4JZ3 A;  3H0H A;  1M8M A;  3M0S A;  3UAT A;  1Y0M A;  5FW9 A;  1WYX A;  4GBQ A;  2YUP A;  1SEM A;  4R0K A;  5IHN A;  2KRS A;  3EG1 A;  3KFV A;  3ZL7 C;  4KRT A;  2K7A A;  1M30 A;  4JJD A;  4DEY A;  1UG1 A;  4OMM A;  3VS3 A;  2OI3 A;  2DYB A;  5I22 A;  2RQV A;  2CT3 A;  4Y92 A;  1SPK A;  2MIO A;  1SSH A;  4OMQ A;  3CQT A;  2I0N A;  3SEM A;  1E7O A;  2ABL A;  1SRL A;  4EIK A;  4JZ4 A;  1ZUY A;  3I35 A;  3I5R A;  2BZ8 A;  1OPL A;  1E6H A;  1NM7 A;  2HDA A;  3VS4 A;  2KRM A;  2KEA A;  4CC2 A;  2K3B A;  1J3T A;  2FPD A;  2LQN A;  4JJC A;  1QKX A;  1Y57 A;  1GFD A;  2YUN A;  1WLP B;  2JMC A;  3M0U A;  2V1Q A;  2A08 A;  2EYW A;  4D8D A;  2EW3 A;  3R6N A;  2PTK A;  2GTJ A;  4F17 A;  2GBQ A;  4RTZ A;  2ECZ A;  1SHG A;  1YNZ A;  1SRM A;  3EG3 A;  1OOT A;  2JMA A;  4RTW A;  5ECA A;  4RUG A;  4HVV A;  3H41 A;  2KNB B;  1K1Z A;  1ABO A;  1I07 A;  1JQQ A;  1GCQ A;  1KIK A;  2DL5 A;  2LQW A;  2NUZ A;  4AFU C;  1OPK A;  2CDT A;  2DL7 A;  1QLY A;  1G83 A;  1AD5 A;  2XMF A;  4J9H A;  1CSK A;  2DA9 A;  3PVL A;  1TUD A;  1PWT A;  2KXD A;  2F2V A;  2O31 A;  1MUZ A;  1GFC A;  2MOX A;  4AG1 C;  1YWO A;  2L3S A;  1AZG B;  1ZX6 A;  1NG2 A;  1WA7 A;  1PNJ A;  1FYN A;  1RLP C;  2J7I A;  5HCK A;  1K0S A;  2DBK A;  1UTI A;  2KGT A;  2YUO A;  1NYG A;  1MV0 B;  1AVZ C;  4D8K A;  1T3S A;  1GBR A;  2IIM A;  4HVW A;  4RTU A;  2KR3 A;  1QCF A;  4LUD A;  1ZUU A;  3PE0 A;  1G2B A;  1HJD A;  2ROT A;  2W10 A;  2DIL A;  1AZE A;  1WDX A;  2CH4 W;  4ZNX A;  2EYZ A;  4F16 A;  2GNC A;  4Z8A A;  2MCN A;  3H0F A;  1YP5 A;  3REB B;  2RNA A;  1BBZ A;  1X2K A;  2D8J A;  1UUE A;  5IH2 A;  2HEQ A;  2CUB A;  2DBM A;  2F2W A;  2RQU A;  4J9I A;  2SEM A;  1BK2 A;  2BZY A;  2DF6 A;  2QDL A;  2AK5 A;  1XOV A;  3A98 A;  4AFS C;  2J6K A;  4RTV A;  3SHW A;  2FEI A;  1X6G A;  1M3C A;  1W1F A;  1LCK A;  2OAW A;  4RTT A;  4CC7 A;  1IO6 A;  2LMJ A;  1WI7 A;  2KRN A;  1JEG A;  3FJ5 A;  3IQL A;  2YSQ A;  2P4R A;  2JT4 A;  2LJ1 A;  4AFZ C;  4OMP A;  1UHC A;  2JM9 A;  1OEB A;  1WXB A;  1AWO A;  1AWX A;  2CT4 A;  1T0J A;  1VYT A;  2CRE A;  2W0Z A;  2AZS A;  2KT1 A;  4RTX A;  5FWB A;  2RMO A;  1X69 A;  2EGA A;  2A28 A;  1OV3 A;  2FPE A;  1PKS A;  3VRY A;  1CKB A;  2VKN A;  2A36 A;  2VVK A;  2KRO A;  2DJQ A;  2NWM A;  2M51 A;  2DM1 A;  2V1R A;  2K9G A;  1GL5 A;  1ZSG A;  3QWY A;  2YDL A;  4QT7 A;  2EPD A;  5GJW B;  2DLP A;  3I9Q A;  2DRM A;  2J6F A;  2D0N A;  4HXJ A;  2DL4 A;  1T3L A;  2YT6 A;  2FPF A;  1PKT A;  1WX6 A;  3VS6 A;  2C0I A;  3NHN A;  2BTT A;  3U23 A;  5L23 A;  2F2X A;  4JJB A;  1ZLM A;  2LNH B;  3I5S A;  1BU1 A;  2J06 A;  1ZUK A;  1ARK A;  2O2O A;  2D8H A;  1K9A A;  1X43 A;  1AOJ A;  4CC4 B;  1AEY A;  3M0P A;  3LH5 A;  1X27 A;  4IIO A;  3ULR B;  1K0X A;  1JXO A;  1UE9 A;  4ESR A;  2AKL A;  2ED1 A;  4X1V A;  1ABQ A;  1WIE A;  1NLO C;  1TUC A;  2B86 A;  4OML A;  2FRW A;  5I11 A;  4FSS A;  3NGP A;  1AWJ A;  2KYB A;  3EG2 A;  2LZ6 B;  1V1C A;  2KE9 A;  3TSZ A;  4J9C A;  2E5K A;  2PNI A;  3O5Z A;  1A0N B;  1WXT A;  4Z88 A;  4A63 B;  2RF0 A;  5IHI A;  2DVJ A;  2FRY A;  3GBQ A;  3VS7 A;  2LJ3 A;  1BB9 A;  1GCQ C;  1KJW A;  4JPB W;  2FG0 A;  3EG0 A;  2K6D A;  4OMN A;  1I1J A;  3VS0 A;  5FWC A;  2HBW A;  3REA B;  3EGU A;  2KT8 A;  1WXU A;  1M3B A;  2EGC A;  3M0T A;  2AZV A;  4E6R A;  3TSW A;  3TVT A;  2H8H A;  1K4U S;  2RQT A;  1Z9Q A;  3UA6 A;  1S1N A;  2RN8 A;  4J9B A;  4IIM A;  1MV3 A;  2J6O A;  2X3X D;  5IXB A;  2JS2 A;  3JV3 A;  2EYY A;  2ENM A;  1CKA A;  2L3Q A;  1W6X A;  4M4Z A;  1NLP C;  1RUW A;  1AWW A;  1UJY A;  2CSQ A;  2L2P A;  2K79 A;  2JTE A;  1NEB A;  1SHF A;  2EKH A;  2D1X A;  2EVR A;  1B07 A;  2G6F X;  2CUD A;  1ZBJ A;  1GBQ A;  1YN8 A;  3RBB B;  4LUE A;  1K76 A;  4ORZ A;  3EHR A;  2JW4 A;  1GRI A;  1X6B A;  3NMZ C; 
#chains in the Genus database with same CATH topology
 5GAN e;  3HFO A;  3S3O A;  2A0F B;  4BE1 A;  3VV0 A;  4DEX A;  1I4K 1;  2PZ1 A;  1ZSZ A;  1QWF A;  1GCP A;  1LPL A;  1Q86 R;  2QEX Q;  2KK4 A;  3BDU A;  1EIF A;  2QGG A;  2COW A;  3JAM E;  1WNL A;  5LJ5 h;  1TTH B;  2GGR A;  4PFO A;  1GXI E;  3A5Z B;  4C8Q E;  2CS7 A;  3JSC A;  1T0H A;  1KG1 A;  2EQI A;  1H8K A;  4HT9 A;  2EAY A;  2LJ0 A;  5CKB A;  2VC8 A;  4J8O A;  2KYM A;  1BCO A;  4J9F A;  2P0Q A;  2IVW A;  3I55 Q;  4OVA A;  2HD0 A;  2LP5 A;  3LLR A;  2MF2 A;  1QMC A;  1VQL A;  4RG2 A;  2GTO A;  1YIT Q;  4D6W A;  3PVQ A;  1NEG A;  1WFW A;  1TXQ A;  1U5S A;  4PJO A;  3P8H A;  5CQX A;  4LDX A;  1D0Z A;  1PHT A;  4XTY A;  2OTL A;  2MAM A;  2JXB A;  1IHV A;  1KQ1 A;  1JO8 A;  1ZA1 B;  1EFN A;  4HCK A;  1SSF A;  1JBM A;  2DL8 A;  3M9Q A;  4M77 E;  4BB7 A;  2L3P A;  1PRL C;  1VA7 A;  1N9S A;  2O9V A;  3UF4 A;  4B9X A;  2JZ2 A;  4GY5 A;  3M0R A;  2E12 A;  1QVG S;  3VS1 A;  2FO0 A;  2QQB A;  2NUP B;  4OMO A;  1ZHI A;  4PJN A;  1VQM Q;  2MWP A;  3CCR A;  3JCM b;  5GAN 2;  3QG1 A;  4K11 A;  3CCM Q;  3OYK A;  1UHF A;  1VQ9 Q;  5HY6 A;  1VQ6 T;  4MZM A;  2VYT A;  3OYN A;  2DL3 A;  4EMK C;  1I0C A;  4M78 G;  4EMG A;  5LJ3 j;  5GAN j;  4J7I A;  2YRD A;  2DXC A;  3KBG A;  2WSF E;  3M0S A;  3UAT A;  1Y0M A;  5I2M A;  1KD1 U;  2DIQ A;  1D0X A;  2R5A A;  4NL3 A;  2YUP A;  1K8A U;  4R0K A;  2NLU A;  1R8O B;  1TSF A;  1M30 A;  4A4G A;  1UG1 A;  4OMM A;  3PMT A;  4C92 E;  3Q1J A;  1JB0 E;  2DYB A;  3CCL T;  2LQK A;  5GAM g;  2DPP B;  2RK1 A;  4RCB A;  4M7A B;  1WHK A;  4OMQ A;  2FB7 A;  1SRL A;  3AT1 B;  3I35 A;  2PVG B;  2H3E B;  3VS4 A;  4QVZ A;  2I2L A;  4FM4 B;  1KC8 R;  2LQN A;  3FDR A;  4M7A D;  3VUB A;  1KHC A;  1F1B B;  1PC0 A;  3KUF A;  2K3X A;  3R6O A;  4JRQ A;  3M0U A;  2A08 A;  2ZPG B;  3CD6 T;  3R6N A;  1UGP B;  3RMS A;  4M7D F;  4BI3 A;  5EG2 A;  4RTW A;  2ATC B;  1QP3 A;  3BE3 A;  5DM7 R;  3CC7 Q;  2D6F A;  4FCY A;  1RI0 A;  4QQG A;  3G71 A;  2QA4 Q;  1R0B G;  4A53 A;  5FLX E;  4ELY C;  1ZSZ C;  1K73 C;  2LC4 A;  1QLY A;  2LTO A;  1NZ9 A;  1AD5 A;  3UPU A;  2PQW A;  2XMF A;  1TH7 A;  2XDD A;  2DA9 A;  1PWT A;  2KXD A;  2AHJ B;  2R58 A;  1YWO A;  4M77 B;  1AZG B;  5GAN h;  3JB9 J;  3JB9 F;  1FX7 A;  3JB9 H;  1C0M A;  3PTA A;  5CKE A;  4QW2 A;  2KGT A;  2YUO A;  1B7T A;  1NYG A;  2M0O A;  3QSU A;  2CYZ B;  3LH0 A;  2DVE A;  1T3S A;  1GBR A;  2VGN A;  4HVW A;  4RTU A;  2QEX T;  3CCJ Q;  4NOY A;  5IT9 E;  4L6V 5;  4LUD A;  1ZUU A;  5DLO A;  2ROT A;  2W10 A;  3CXC A;  4PJO C;  3REB B;  2VV5 A;  2RNA A;  2D8J A;  1X2K A;  5GAM f;  2VXE A;  1UUE A;  4C0Z A;  2HEQ A;  3OQ5 A;  4C8Q A;  2RQU A;  2CP5 A;  2EKO A;  4J9I A;  3SB2 A;  1XOV A;  4AFS C;  2D9T A;  2M16 A;  1PCX A;  3OW2 S;  3SHW A;  2DAQ A;  3OYC A;  2FEI A;  4ZTF A;  1W1F A;  1JJ2 P;  2YLB A;  4RTT A;  4FL6 A;  5HK3 A;  3DKM A;  1YIT T;  4C92 B;  2P4R A;  1VQO Q;  1WQW A;  4AFZ C;  1OEB A;  2CP3 A;  4DOW A;  2CRE A;  2W0Z A;  3BDL A;  5FWB A;  4QVD A;  3L2Q A;  4Q5W A;  2GFU A;  4E7I A;  3L2U A;  2QGF B;  3HRS A;  3HSB A;  4M77 A;  4X34 A;  1ACM B;  4DBR A;  1B34 A;  2V1R A;  2K9G A;  1GL5 A;  5KYU A;  3I56 Q;  1R0C B;  1C1A A;  1LOJ A;  2LCC A;  4KH0 B;  2YDL A;  3LGF A;  3RIR A;  2J6F A;  2D0N A;  4HXJ A;  2DL4 A;  4E7S A;  3CPW A;  3MEU A;  1M5Q 1;  1WX6 A;  3C4S A;  4QVC A;  1YIJ Q;  3CCE T;  2NYS A;  2EQJ A;  2F5K A;  2C0I A;  1VQ9 T;  1N8R U;  4M78 D;  4JJB A;  2G3R A;  3HRT A;  2HQE A;  3V8K A;  1SKU B;  1OI1 A;  1ZUK A;  4XTX A;  3CCQ Q;  1K9A A;  4CC4 B;  1AEY A;  2CP2 A;  3CCS A;  1K0X A;  4F7U E;  4HCB A;  2ED1 A;  4X1V A;  3EFS A;  1WIE A;  1TUC A;  4DBH A;  2B86 A;  2FRW A;  4C0D B;  2XU8 A;  3VJP A;  3G4S Q;  4C92 A;  5GAN 5;  2YRC A;  3ME9 A;  1YI2 T;  2A7Y A;  4FT2 A;  5DY9 A;  1NJI U;  2X4X A;  4N0A A;  2KE9 A;  2E5K A;  3OMG A;  1WXT A;  2K2V A;  2RF0 A;  2DVJ A;  4E7Z A;  1QVF A;  3TQ7 P;  2DXT A;  3D7S B;  1IZ6 A;  2ZZD A;  2E6Z A;  2FG0 A;  1YFN A;  2YLC A;  3CCV T;  2E41 A;  3OB9 A;  2VXF A;  3RR6 A;  4FYX B;  2YXY A;  3EFO B;  3MP8 A;  3CBP A;  1JJ2 S;  4PLL A;  4KUL A;  3TSW A;  2RJF A;  1Z9Q A;  1YJN A;  2RN8 A;  4IIM A;  5IXB A;  4J5Y A;  2JS2 A;  2EYY A;  2ENM A;  1CKA A;  1Y07 A;  5KYN A;  3CC7 T;  3PGG A;  1NLP C;  2QA4 T;  2X4Y A;  1FMV A;  3JCM J;  2QYZ A;  2L2P A;  4PLI A;  1BCM A;  1OU8 A;  1SHF A;  2DZ9 A;  2G6F X;  2CUD A;  1K9M U;  4JS4 A;  3QDR B;  3A8M B;  2DET A;  3A8L B;  4LUE A;  1BIA A;  3H8Z A;  2V8J A;  2K3Y A;  2LT1 A;  1QW1 A;  4BAC A;  2WSC E;  2HL5 C;  1X6B A;  1M1K R;  1M2O A;  1BI0 A;  4C8Q C;  2HCK A;  2L3R A;  4LNP A;  1YHQ Q;  3RES A;  4C5I A;  4Y28 E;  1K8A C;  2YUQ A;  2LRQ A;  4HCZ A;  5KH6 A;  2JOY A;  2A37 A;  3EAE A;  4O6J A;  3S6W A;  2CZ0 B;  1TG0 A;  2EJ9 A;  2IPO B;  2OJ2 A;  3S3M A;  4JLG A;  3G1J A;  3QKJ A;  5IHK A;  4AFQ C;  1VQN Q;  1X2Q A;  1HYO A;  2E4H A;  4KH1 B;  1OX9 A;  3UA7 A;  3WXM B;  4XTZ A;  1JU5 C;  3MO8 A;  4DBQ A;  2DE0 X;  3TEE A;  1KFZ A;  3MHX A;  4R55 A;  1VYV A;  4LE9 A;  3QWX X;  2EGE A;  1Q81 U;  2BE9 B;  2LNV A;  1BI2 A;  1YWP A;  4M77 C;  6AT1 B;  2DRK A;  1RLQ C;  2LX7 A;  2QXF A;  3CCL Q;  1N5Z A;  5LJ5 j;  3OS5 A;  4BY6 C;  3OYA A;  3VS5 A;  5GAN 6;  4M78 F;  3INZ A;  2L0A A;  2F1L A;  2ROL A;  1VQK A;  1U1S A;  1VQO T;  4OF1 A;  2EYX A;  2GQI A;  2MYS A;  1UFF A;  3WVD B;  2E5Q A;  2JTF A;  3CC2 A;  2QQ9 A;  2DXU A;  4RKU E;  2XG8 D;  5GAM e;  4A4F A;  4E7K A;  4J9D A;  2HSP A;  3QPH A;  5KYW B;  3CD6 Q;  1YCY A;  4QQ6 A;  4M75 A;  2QQA A;  2O9S A;  1UGV A;  4LN2 A;  3CBO A;  2KY9 A;  1KQ2 A;  1Q86 U;  1UGS B;  3E1S A;  4FSX A;  1WHJ A;  5KCH A;  1VQP T;  2X9H A;  3WVE B;  2L89 A;  4C92 C;  2FYK A;  4J7F A;  3L2R A;  1YIJ T;  1QVG A;  2OTL Q;  1Q95 G;  4XU2 A;  1VQ7 A;  4N0A C;  4XQ3 A;  2EJG A;  2GCX A;  1RAH B;  5GMK e;  4GBQ A;  1SEM A;  1D1B A;  2RHY A;  3MCA B;  4KBM B;  4M7D B;  2EQM A;  3F70 A;  2KRS A;  3EG1 A;  3KFV A;  3OS1 A;  3CCQ T;  3ZL7 C;  4KRT A;  4E7J A;  2K7A A;  3A8O B;  3SDZ A;  3X20 B;  4DEY A;  4F7U A;  3CPF A;  4TVR A;  1VQ5 A;  2OI3 A;  4KUI A;  4M7A E;  2P84 A;  5I22 A;  1HK9 A;  3CME A;  4C8Q G;  4Y92 A;  1SSH A;  2I0N A;  4B9W A;  3G4S T;  5C6S A;  4M7D D;  1VQ8 A;  4EIK A;  4JZ4 A;  3P8B B;  4BE2 A;  4RG8 A;  3I5R A;  1OZ2 A;  1O9S A;  1E6H A;  1NM7 A;  1UEB A;  5I2S A;  3GP8 A;  2K3B A;  4KGZ B;  1J3T A;  2FPD A;  4JJC A;  4YTL A;  1QKX A;  2RI3 A;  3JCM g;  3G7Z A;  3G6E A;  2LQ8 A;  4OGC A;  2EYW A;  1VQ4 A;  1Q82 R;  2EW3 A;  2PTK A;  2GTJ A;  1NPR A;  1M4Z A;  2EQU A;  5ECA A;  3M4G A;  3GLX A;  3H41 A;  1PM3 A;  2MK5 A;  1K1Z A;  1ABO A;  1D3B A;  1AHJ B;  3JB9 D;  2XDB A;  5A0L A;  5GAM j;  2DL5 A;  2DJZ A;  2PUK B;  2NUZ A;  3UT1 A;  2DL7 A;  2CDT A;  2JVV A;  4ATO A;  3SFM A;  5FRN A;  1OU9 A;  4IUT A;  2X35 A;  4J9H A;  3URG A;  4P5N A;  2F2V A;  4E7L A;  2QDY B;  3MKD A;  5KYX B;  1N8R C;  1MUZ A;  1PSE A;  4XAX B;  2L3S A;  2DKG A;  3VYH B;  1NG2 A;  3CMA A;  2CZ7 B;  2J7I A;  2ZPE B;  3E19 A;  1K0S A;  3VU3 C;  2DBK A;  5HK0 A;  3UWN A;  3J81 E;  1WQ7 A;  1YHQ T;  3RKY A;  4D8K A;  1PG5 B;  2CP0 A;  3G71 Q;  3FIF A;  3CCE Q;  2BUD A;  1QCF A;  1ZQ1 A;  1YBY A;  2GQV A;  5A0D A;  3QDF A;  4C92 G;  2DXB A;  2KQW A;  1KC8 U;  3PE0 A;  1VQN T;  1NJI C;  5L8R E;  4IUP A;  2EYZ A;  3JCM d;  2MCN A;  3VYG A;  1YP5 A;  2QQR A;  1BBZ A;  4EMH A;  1UGQ B;  4NS5 A;  4QQD A;  1BK2 A;  1QQJ A;  2BZY A;  2AK5 A;  5DLQ E;  4RCC A;  1X6G A;  1V29 B;  2OAW A;  4CC7 A;  1YI2 Q;  2KRN A;  7AT1 B;  2E3I A;  4M75 C;  3JCM f;  3ER0 A;  3OW2 P;  1WPY A;  3FEO A;  2LJ1 A;  4OMP A;  1UHC A;  1WXB A;  1AWO A;  4LDW A;  2CT4 A;  3TCJ A;  2X4J A;  1T0J A;  1SF9 A;  1VYT A;  2AZS A;  2KT1 A;  1D1A A;  4XU3 A;  1BI1 A;  1IB8 A;  5KYX A;  1I5O B;  2VKN A;  3A8G B;  3BFM A;  5C0M A;  2VVK A;  3I55 A;  3QUI A;  2DM1 A;  2HSE B;  5GAM h;  3CCV Q;  2E70 A;  2NUP A;  4M78 E;  3M54 A;  1K9M C;  2FL7 A;  2MI6 A;  5GAO r;  5GAN 7;  5D6Y A;  4JJN K;  3ZFJ A;  1VQL T;  3U23 A;  5L23 A;  3SD4 A;  2DYI A;  3JCM Q;  2F2X A;  1ZLM A;  2OTL T;  2LNH B;  4MML A;  1IHW A;  4F04 B;  5GMK h;  4CI0 C;  1VQM A;  2O2O A;  3LH5 A;  1X27 A;  3C95 A;  4OB2 B;  1JXO A;  4ESR A;  5KE2 A;  4AMC A;  3CCM A;  2EFI A;  1ABQ A;  1OQK A;  3LW5 E;  4PL6 A;  3OA6 A;  2WAC A;  3QZ5 B;  4OML A;  4HA8 A;  5I11 A;  3CCU A;  3V8J A;  4M7A A;  2QAZ A;  2LCL A;  3CCR T;  4OB0 B;  4FSS A;  3LYI A;  4AT1 B;  1AWJ A;  2RJD A;  1W2B P;  3M57 A;  1V1C A;  1Q81 C;  3TSZ A;  2PVD B;  1A0N B;  2FZK B;  2LJ3 A;  4II1 A;  1BYM A;  2VAS A;  2QAS A;  3OYD A;  4FYY B;  1KQS P;  1KK7 A;  1M8V A;  3REA B;  3CCS Q;  3SWN B;  2C06 A;  2KT8 A;  2HKQ B;  1WXU A;  4MDW A;  3OY9 A;  3O8V A;  1D1C A;  2EGC A;  4E6R A;  3PNW C;  5FU6 B;  1K4U S;  1ZA2 B;  3OYE A;  2J6O A;  2X3X D;  5FRO A;  1SG5 A;  3QYH B;  1TWB A;  2L3Q A;  2P0P A;  4M75 G;  1MND A;  1HXD A;  2QG9 B;  2K79 A;  1Q7Y R;  1MNE A;  1JJ2 A;  4E47 A;  1Q86 C;  2RK2 A;  2EVR A;  2WSE E;  1YJ9 A;  2DK3 A;  1ZBJ A;  1YN8 A;  3JB9 I;  5CQY A;  3GOX A;  4R56 A;  3EG9 B;  1M90 R;  4RMO A;  2PVO B;  2Y4X A;  2JW4 A;  4PKC C;  3JCM V;  5LJ3 d;  4DOV A;  5GAN d;  1WJQ A;  5FU7 B;  2HQX A;  1M2V B;  3RNJ A;  4M78 B;  1YJN Q;  3THK A;  3QBY A;  1UEC A;  3P8D A;  2EBP A;  4BI8 B;  4ANJ A;  3HRU A;  4J9E A;  3ZBD A;  2OTJ A;  4F7U G;  2JS0 A;  3QXE B;  1VQP Q;  3G71 T;  2DMO A;  2LCS A;  2A3L A;  5LJ3 f;  1UB4 A;  3BY7 A;  1HSQ A;  3EHQ A;  3VUZ A;  1KSW A;  1M1G A;  2EJF A;  2GFA A;  4MZT A;  2RQW A;  3VS2 A;  4AG2 C;  4LXC A;  1B3Q A;  3LWI A;  3OSS C;  2AKK A;  3RMQ A;  1W2B S;  2KXC A;  2ESW A;  3CCU T;  1N6A A;  2VWF A;  4J6Y A;  3GIB A;  2EWN A;  4BE0 A;  3NFC A;  2O4X B;  2BZX A;  4ELZ C;  4WTO B;  1H92 A;  1LVK A;  5GAN 8;  5CVI A;  1U06 A;  2K2M A;  1KQS S;  3EGX B;  1E6G A;  3NPF A;  3QII A;  3C0C A;  1M3A A;  4IUR A;  2J05 A;  4PJO G;  2R57 A;  3M5A A;  2QK0 A;  2JUF A;  1W70 A;  2R5M A;  2C0T A;  1M1K U;  4C8Q F;  2O88 A;  4IKF A;  1I81 A;  1U3O A;  2DER A;  5IAY A;  1H3H A;  5CKD A;  1PRM C;  1BKB A;  2RI2 A;  3L2W A;  2M02 A;  4FU6 A;  1UDL A;  2BKD N;  5IXF A;  1BIB A;  4IUQ A;  4BD3 A;  3BW1 A;  2Y90 A;  4M7A C;  3JCM e;  2LDM A;  1N27 A;  2JM8 A;  4LD6 A;  1G3T A;  4JZ3 A;  1OX8 A;  3H0H A;  2RI5 A;  3OYG A;  3CC4 A;  4M7D E;  4C5H A;  2L8D A;  2QI2 A;  4DQ2 A;  5CK9 A;  1S72 A;  1KC8 C;  3HKS A;  2MMP A;  4JJD A;  3VS3 A;  1Y71 A;  2H3J A;  1YJW A;  4A54 A;  2O4X A;  1SPK A;  2MIO A;  1IRE B;  1KD1 C;  4EPC A;  2RM4 A;  1E7O A;  3ZEH A;  1OUL A;  4L59 A;  2BZ8 A;  1OPL A;  4MMK A;  3EGX A;  2KRM A;  2KEA A;  3JCM c;  2HL3 A;  1VQ7 Q;  1R77 A;  2CKK A;  1WLP B;  2EYQ A;  4XTV A;  2JMC A;  3EFO A;  4KGV B;  2V1Q A;  3A8H B;  4LDU A;  2RA2 A;  3CCS T;  4F17 A;  1KHI A;  4RTZ A;  2ECZ A;  1RL2 A;  3OYF A;  1YNZ A;  1SRM A;  1VQ5 Q;  1OOT A;  1H3Z A;  4FIB A;  4RUG A;  5A2Q E;  1RAD B;  1NBE B;  1I07 A;  1JQQ A;  1WGS A;  4M75 D;  1GCQ A;  4HKE A;  1OZ3 A;  2LQW A;  1I5L A;  3PT9 A;  1V76 A;  4AFU C;  2RHU A;  3PFS A;  1OPK A;  4IUU A;  4X9D A;  2HMA A;  2Z0W A;  2RHX A;  3C94 A;  5J3B A;  1QCO A;  3HPW A;  2JN0 A;  3MEV A;  3PVL A;  1QVF S;  1C6V X;  1TUD A;  1RAC B;  2BIV A;  2O31 A;  1H64 1;  3G6E Q;  1MHN A;  1RAB B;  4NL2 A;  2MOX A;  1ZX6 A;  1WA7 A;  4JRI A;  5CCA A;  2V26 A;  1FYN A;  1RLP C;  1UTI A;  4E2F B;  2E64 A;  1MV0 B;  5FU6 C;  1ZSZ B;  1AVZ C;  4BUG A;  1K73 R;  4LDV A;  2AIR B;  3X24 B;  5GAO n;  1PD0 A;  1YJN T;  1VQL Q;  2K5L A;  3JRZ A;  3V7R A;  2V8K A;  3M55 A;  5D6W A;  2KR3 A;  2DD4 A;  1FWZ A;  2M9U A;  4M7A G;  1Y96 B;  2VB6 A;  1HJD A;  1G2B A;  3VKI A;  2PUO B;  1AZE A;  2E1H A;  2HAX A;  2CH4 W;  4ZNX A;  4F16 A;  3FLG A;  3H0F A;  8ATC B;  3EGD B;  1IGU A;  1TOV A;  1LNX A;  2DBM A;  2F2W A;  2LX9 A;  1XQH A;  3H6Z A;  1Q82 U;  2SEM A;  2XI9 A;  2DF6 A;  2QDL A;  2VUB A;  2HQH A;  4RTV A;  3OBW A;  4Z02 A;  2M1H A;  1LJO A;  1VQ6 A;  4PJL A;  3CCR Q;  2LMJ A;  1JEG A;  1D0Y A;  3FJ5 A;  3JCM X;  3CEY A;  4OB1 B;  4FYW B;  3MET A;  2B8A A;  2JT4 A;  4WF2 A;  1AWX A;  4RTX A;  2X4W A;  2RMO A;  2EGA A;  3VRY A;  2KRO A;  3OYM A;  4PJO D;  2KVQ G;  1RAE B;  2RHZ A;  2RO0 A;  5LJ3 e;  2YRV A;  1ZSG A;  3CCL A;  3HL8 A;  5KYW A;  4Y91 A;  3JCM W;  5GJW B;  3NTK A;  1BI3 A;  3I9Q A;  3HTR A;  4XTW A;  4M77 G;  1PKT A;  5J26 A;  1Y96 A;  4C0D C;  2L5Q A;  1O75 A;  2DIG A;  3JCM h;  3J80 E;  5M9O A;  5KYY B;  3EGD A;  1MMD A;  5CKH A;  3OS0 A;  2XIC A;  2COZ A;  1VQK T;  1VIF A;  3GNF B;  3I5S A;  1BU1 A;  2J06 A;  3CD6 A;  2D8H A;  1X43 A;  1QVP A;  4ZGD B;  3M0P A;  4DBF A;  4M7D A;  2DTI A;  3CC2 T;  3OYY A;  4JRK A;  2KMT A;  2V8I A;  1NLO C;  5FRM A;  3V7S A;  3MPU B;  2MPX C;  4M75 F;  2KYB A;  1JRI A;  3EG2 A;  2CZ1 B;  4J9C A;  4J6W A;  4A4K A;  2RJE A;  1X6O A;  5GMK j;  2K4Y A;  3O5Z A;  4N4H A;  5IHI A;  3EH1 A;  2FRY A;  2D0Q B;  4BDZ A;  1VUB A;  3GBQ A;  5LJ5 d;  1GCQ C;  2PU9 B;  1U8R A;  1DJ7 B;  1VQ7 T;  2OX7 A;  3OYB A;  3EG0 A;  4ZN3 A;  1MGQ A;  2K6D A;  4OMN A;  5I21 A;  1I1J A;  3VS0 A;  3OMC A;  2HBW A;  2OAU A;  4FYV B;  1M3B A;  1WZO A;  2AZV A;  4BI4 A;  4CRI A;  2H8H A;  4HT8 A;  4OP0 A;  2RQT A;  5HKC A;  2ZPF B;  2GF7 A;  4F7U F;  1S1N A;  3CCU Q;  1VQ5 T;  2HKN A;  1W4S A;  2DD5 A;  2QEX A;  3CME T;  1M1K C;  5LJ5 f;  1M9S A;  3LWH A;  1WJR A;  1WJS A;  3MP1 A;  5KYY A;  3QYG B;  1VQ8 T;  3MEA A;  1AWW A;  1UJY A;  2CSQ A;  2JTE A;  1NEB A;  2ZAE A;  1VIE A;  2D1X A;  1B07 A;  2KDS A;  3ASK A;  3RDV A;  2LVM A;  3RBB B;  3OW2 A;  1K76 A;  3EH2 A;  3E9F A;  1RAF B;  3G6E T;  3NMZ C;  3A1P A;  3MJX A;  4GLM A;  5GJV B;  3RUX A;  4KGX B;  5KCO A;  1VQ4 T;  1YIT A;  4J9G A;  4HCC A;  3OBY A;  3L42 A;  3V8L A;  1YCS B;  1VYU A;  2QQS A;  2SRC A;  2DEU A;  2CZ6 B;  2K5F A;  1FMK A;  2CGH A;  1M1F A;  3OYL A;  3E2U A;  3HP9 A;  3FC3 A;  1UJ0 A;  3H0I A;  2DTH A;  3FB9 A;  4PJO F;  3VRZ A;  2XDP A;  4Z89 A;  1XTD A;  1QKW A;  4O5V A;  1YJ9 Q;  1KD1 R;  5CAI A;  4C8Q B;  1Z9Z A;  1TUG B;  8AT1 B;  4FW2 A;  4C0G A;  4MZP A;  1K8A R;  1JXM A;  1M27 C;  1I8F A;  4BDY A;  2DO3 A;  2RB6 A;  4UC4 A;  2RPN A;  2DX1 A;  3S3N A;  2X3W D;  2KBT A;  3PIP A;  3CCE A;  3L2Z A;  3M53 A;  2ED0 A;  4C8Q D;  1VQ9 A;  3CMA T;  3DLM A;  2M0Y A;  1WHH A;  5LJ3 g;  5GAN g;  2ZPI B;  1QWE A;  1EX4 A;  2OTJ Q;  1PD1 A;  4C5G A;  3M0Q A;  4FT4 A;  4WCI A;  4N4G A;  1RI9 A;  4XTU A;  4PK4 A;  1Q7Y U;  4PNO A;  2DEQ A;  1WHM A;  3E9G A;  4OB3 B;  4ZGE B;  1NYF A;  3NTH A;  1W2B A;  4HVU A;  4B6M A;  1M90 U;  2C0O A;  4QKU A;  5GAM d;  1B34 B;  2CH4 A;  5LJ3 h;  5KYU B;  4BY6 B;  3GF5 A;  1YI2 A;  4CC3 A;  3CXC P;  4M7D C;  1ZBX A;  2CSI A;  2DNU A;  2QTX A;  4F14 A;  4M77 D;  2FHD A;  1KQS A;  4RTY A;  1HD3 A;  2RQR A;  5EC7 A;  1U1T A;  3M4Y A;  5GAO l;  3OYI A;  2RJC A;  5GAO m;  1M8M A;  1X01 A;  2QTV A;  3CCV A;  4VUB A;  5FW9 A;  3QJ6 A;  1WYX A;  2ZPH B;  5IHN A;  3RER A;  3I55 T;  1NE8 A;  1IRX A;  1WHL A;  3JCM P;  4ZTJ A;  2RQV A;  4IUV A;  2CT3 A;  4J83 A;  3L1A A;  3RKW A;  4PFZ A;  3M56 A;  3CC7 A;  3CQT A;  5A0G A;  1Q82 C;  2QA4 A;  3LGL A;  3SEM A;  2ABL A;  3QZ9 B;  1ZUY A;  3M59 A;  3OS2 A;  5GAN 3;  2E3H A;  2HDA A;  4CC2 A;  3UDC A;  1QCN A;  2CP7 A;  5CKF A;  4C92 D;  3OYH A;  3GNG A;  5GAN 4;  2FVU A;  3OSV A;  1Y57 A;  3MEW A;  2EIF A;  2MWO A;  2XHC A;  2YUN A;  4ZN1 A;  3DLL A;  4M75 E;  1GFD A;  2K5I A;  3CC4 Q;  3OYJ A;  3CPW P;  3X25 B;  5GAN f;  3SWN A;  4D8D A;  1VQM T;  1S72 Q;  2AT1 B;  5CR2 A;  2GBQ A;  1SHG A;  3L2V A;  3CCM T;  2EQK A;  3EG3 A;  4DA4 A;  2JMA A;  1D09 B;  1YJW Q;  4HVV A;  5AT1 B;  3V7C A;  2COY A;  2ZCF B;  2KNB B;  3M58 A;  3KXT A;  2KSS A;  1RAA B;  3J7A F;  3HHT B;  4M7A F;  4EDU A;  2XD0 A;  1KIK A;  2DTO A;  3CCJ A;  2YHT A;  1G83 A;  1CSK A;  3EG9 A;  3T9N A;  9ATC B;  3GPL A;  5CIU A;  2XKO C;  1RAI B;  1GFC A;  4AG1 C;  3CXC S;  2DFU A;  4KT0 E;  1PNJ A;  1QVF P;  3CBM A;  1G5V A;  5HCK A;  4ME7 A;  2DZC A;  1MMA A;  1M2V A;  4M78 A;  4M7D G;  2KAF A;  5D6X A;  4JRP A;  1IXD A;  1G3Y A;  1VQO A;  3FRN A;  2IIM A;  4XK8 E;  3PIO A;  3QHS A;  2P0K A;  1P92 A;  3X28 B;  5LJ5 e;  5IN1 A;  2X51 A;  1N8R R;  2DIL A;  1WDX A;  4V2S A;  2GNC A;  4Z8A A;  1PSF A;  1VQK Q;  4C0F A;  5IH2 A;  2CUB A;  5GMK l;  1YJ9 T;  3I56 A;  1G3S A;  2BE7 D;  5GMK m;  3CC2 Q;  4LD9 K;  3A98 A;  2J6K A;  3H9N A;  1OYX A;  4N4I A;  3AHU A;  4M77 F;  1M3C A;  3N5B B;  1LCK A;  1VQP A;  4PJO E;  3JB9 G;  1IO6 A;  1WI7 A;  2HZY A;  1YIJ A;  3IQL A;  1AT1 B;  1NJI R;  4GLK A;  2RHI A;  2YSQ A;  3TRE A;  1VOM A;  2O01 E;  4EMK B;  2JM9 A;  2OTJ T;  4L5G A;  4PJJ A;  1X69 A;  2A28 A;  1OV3 A;  3CPW S;  2FPE A;  5J39 A;  1PKS A;  1CKB A;  3CCQ A;  3DB3 A;  2ZPB B;  2A36 A;  1G3W A;  2DJQ A;  2NWM A;  2M51 A;  5GAO p;  1NPP A;  3LX7 A;  5KE3 A;  3QJY A;  4OGE A;  1WHG A;  2KI7 A;  3MP6 A;  3QWY A;  4M75 B;  1RAG B;  3G4S A;  2CP6 A;  4ZGJ B;  4QT7 A;  3RKX A;  2EPD A;  2DLP A;  4JS5 A;  4J6X A;  1K73 U;  2JTM A;  2DRM A;  4FW1 A;  3EFR A;  1MMG A;  1T3L A;  1VQ6 Q;  1XJW B;  1MMN A;  2YT6 A;  2FPF A;  3VS6 A;  3CME Q;  3TU4 K;  3CCJ T;  3NHN A;  2BTT A;  2XID A;  4JUV A;  2LT4 A;  4C92 F;  4KUD K;  1VQ8 Q;  2P4T A;  1QP2 A;  1FXX A;  2RD1 A;  1TU0 B;  1FMW A;  1K9M R;  1ARK A;  4E7H A;  1AOJ A;  2ZGW A;  3ULR B;  4IIO A;  1UE9 A;  2JNG A;  2AKL A;  2F69 A;  3X26 B;  2NUT B;  4A4H A;  4F7U B;  4XU0 A;  2FZC B;  1VQ4 Q;  3SWN C;  3NGP A;  2YWW A;  4PFP A;  4EMK A;  2LZ6 B;  4OMF B;  2F5T X;  3DB4 A;  4A4E A;  2PNI A;  1IGQ A;  4Z88 A;  4A63 B;  2VGM A;  3C12 A;  4C5E A;  3VS7 A;  1BB9 A;  1KJW A;  5LL6 S;  2HNI A;  5D7U A;  4JDS A;  4JPB W;  1EZZ B;  1X75 C;  1G8X A;  5FWC A;  3I56 T;  3CC4 T;  1Q7Y C;  1UGR B;  3EGU A;  4PJM A;  5CO7 A;  1QVG P;  2K57 A;  3M0T A;  1S72 T;  1YHQ A;  1Q81 R;  3TVT A;  1N9R A;  1M90 C;  3UA6 A;  4J9B A;  1D3B B;  1MV3 A;  1YJW T;  5AYF A;  3CMA Q;  2HBP A;  3JV3 A;  3NTI A;  4MDX A;  1W6X A;  4X9C A;  5FU7 C;  1VQN A;  4M4Z A;  3FJP A;  1RUW A;  2E65 A;  5GAO q;  4XU1 A;  4PJO B;  4M78 C;  2IG0 A;  3PMI A;  3QO3 A;  2FZG B;  4LDY A;  1Y7X A;  5GMK i;  2EKH A;  2XK0 A;  1GBQ A;  1XNI A;  2RH2 A;  2NUT A;  4JLI A;  4ORZ A;  2E6N A;  2E10 A;  3EHR A;  2JJ9 A;  2Y4Y A;  1GRI A;  5LJ5 g;  1TS9 A;  3HFN A; 
#chains in the Genus database with same CATH homology
 4GLM A;  5GJV B;  2HCK A;  4LNP A;  4J9G A;  4DEX A;  2YUQ A;  2PZ1 A;  3RNJ A;  2A37 A;  3THK A;  1QWF A;  1GCP A;  1UEC A;  2EBP A;  1YCS B;  1TG0 A;  1VYU A;  4J9E A;  2OJ2 A;  2JS0 A;  2SRC A;  1FMK A;  5IHK A;  4AFQ C;  1X2Q A;  2DMO A;  2GGR A;  1UJ0 A;  3H0I A;  2LCS A;  3UA7 A;  1JU5 C;  3VRZ A;  4Z89 A;  1T0H A;  2EQI A;  1H8K A;  2DE0 X;  1QKW A;  1KFZ A;  1HSQ A;  2LJ0 A;  3EHQ A;  1Z9Z A;  1KSW A;  1VYV A;  4LE9 A;  1JXM A;  3QWX X;  1M27 C;  2KYM A;  2EGE A;  2RQW A;  3VS2 A;  4J9F A;  4AG2 C;  1B3Q A;  2DX1 A;  2RPN A;  2X3W D;  2KBT A;  2LP5 A;  1YWP A;  2AKK A;  2KXC A;  2ESW A;  2DRK A;  1RLQ C;  2LX7 A;  2VWF A;  1N5Z A;  2GTO A;  2ED0 A;  3PVQ A;  2M0Y A;  1NEG A;  1WFW A;  1U5S A;  3VS5 A;  1QWE A;  2BZX A;  3M0Q A;  1PHT A;  2L0A A;  4WCI A;  2ROL A;  2JXB A;  1RI9 A;  1H92 A;  2EYX A;  1JO8 A;  1EFN A;  2GQI A;  4HCK A;  1U06 A;  1UFF A;  2K2M A;  2DL8 A;  1E6G A;  1NYF A;  2L3P A;  3NPF A;  1PRL C;  1VA7 A;  2O9V A;  1M3A A;  3C0C A;  3UF4 A;  4HVU A;  2J05 A;  2C0O A;  3M0R A;  2CH4 A;  3VS1 A;  2FO0 A;  4J9D A;  1W70 A;  2HSP A;  2C0T A;  4OMO A;  2O88 A;  1U3O A;  2O9S A;  1H3H A;  1UGV A;  4CC3 A;  1PRM C;  4K11 A;  4LN2 A;  1UHF A;  2CSI A;  2DNU A;  4F14 A;  1UDL A;  4RTY A;  5IXF A;  1HD3 A;  2RQR A;  5EC7 A;  2DL3 A;  2JM8 A;  1I0C A;  4JZ3 A;  3H0H A;  1M8M A;  3M0S A;  3UAT A;  1Y0M A;  5FW9 A;  1WYX A;  4GBQ A;  2YUP A;  1SEM A;  4R0K A;  5IHN A;  2KRS A;  3EG1 A;  3KFV A;  3ZL7 C;  4KRT A;  2K7A A;  1M30 A;  4JJD A;  4DEY A;  1UG1 A;  4OMM A;  3VS3 A;  2OI3 A;  2DYB A;  5I22 A;  2RQV A;  2CT3 A;  4Y92 A;  1SPK A;  2MIO A;  1SSH A;  4OMQ A;  3CQT A;  2I0N A;  3SEM A;  1E7O A;  2ABL A;  1SRL A;  4EIK A;  4JZ4 A;  1ZUY A;  3I35 A;  3I5R A;  2BZ8 A;  1OPL A;  1E6H A;  1NM7 A;  2HDA A;  3VS4 A;  2KRM A;  2KEA A;  4CC2 A;  2K3B A;  1J3T A;  2FPD A;  2LQN A;  4JJC A;  1QKX A;  1Y57 A;  1GFD A;  2YUN A;  1WLP B;  2JMC A;  3M0U A;  2V1Q A;  2A08 A;  2EYW A;  4D8D A;  2EW3 A;  3R6N A;  2PTK A;  2GTJ A;  4F17 A;  2GBQ A;  4RTZ A;  2ECZ A;  1SHG A;  1YNZ A;  1SRM A;  3EG3 A;  1OOT A;  2JMA A;  4RTW A;  5ECA A;  4RUG A;  4HVV A;  3H41 A;  2KNB B;  1K1Z A;  1ABO A;  1I07 A;  1JQQ A;  1GCQ A;  1KIK A;  2DL5 A;  2LQW A;  2NUZ A;  4AFU C;  1OPK A;  2CDT A;  2DL7 A;  1QLY A;  1G83 A;  1AD5 A;  2XMF A;  4J9H A;  1CSK A;  2DA9 A;  3PVL A;  1TUD A;  1PWT A;  2KXD A;  2F2V A;  2O31 A;  1MUZ A;  1GFC A;  2MOX A;  4AG1 C;  1YWO A;  2L3S A;  1AZG B;  1ZX6 A;  1NG2 A;  1WA7 A;  1PNJ A;  1FYN A;  1RLP C;  2J7I A;  5HCK A;  1K0S A;  2DBK A;  1UTI A;  2KGT A;  2YUO A;  1NYG A;  1MV0 B;  1AVZ C;  4D8K A;  1T3S A;  1GBR A;  2IIM A;  4HVW A;  4RTU A;  2KR3 A;  1QCF A;  4LUD A;  1ZUU A;  3PE0 A;  1G2B A;  1HJD A;  2ROT A;  2W10 A;  2DIL A;  1AZE A;  1WDX A;  2CH4 W;  4ZNX A;  2EYZ A;  4F16 A;  2GNC A;  4Z8A A;  2MCN A;  3H0F A;  1YP5 A;  3REB B;  2RNA A;  1BBZ A;  1X2K A;  2D8J A;  1UUE A;  5IH2 A;  2HEQ A;  2CUB A;  2DBM A;  2F2W A;  2RQU A;  4J9I A;  2SEM A;  1BK2 A;  2BZY A;  2DF6 A;  2QDL A;  2AK5 A;  1XOV A;  3A98 A;  4AFS C;  2J6K A;  4RTV A;  3SHW A;  2FEI A;  1X6G A;  1M3C A;  1W1F A;  1LCK A;  2OAW A;  4RTT A;  4CC7 A;  1IO6 A;  2LMJ A;  1WI7 A;  2KRN A;  1JEG A;  3FJ5 A;  3IQL A;  2YSQ A;  2P4R A;  2JT4 A;  2LJ1 A;  4AFZ C;  4OMP A;  1UHC A;  2JM9 A;  1OEB A;  1WXB A;  1AWO A;  1AWX A;  2CT4 A;  1T0J A;  1VYT A;  2CRE A;  2W0Z A;  2AZS A;  2KT1 A;  4RTX A;  5FWB A;  2RMO A;  1X69 A;  2EGA A;  2A28 A;  1OV3 A;  2FPE A;  1PKS A;  3VRY A;  1CKB A;  2VKN A;  2A36 A;  2VVK A;  2KRO A;  2DJQ A;  2NWM A;  2M51 A;  2DM1 A;  2V1R A;  2K9G A;  1GL5 A;  1ZSG A;  3QWY A;  2YDL A;  4QT7 A;  2EPD A;  5GJW B;  2DLP A;  3I9Q A;  2DRM A;  2J6F A;  2D0N A;  4HXJ A;  2DL4 A;  1T3L A;  2YT6 A;  2FPF A;  1PKT A;  1WX6 A;  3VS6 A;  2C0I A;  3NHN A;  2BTT A;  3U23 A;  5L23 A;  2F2X A;  4JJB A;  1ZLM A;  2LNH B;  3I5S A;  1BU1 A;  2J06 A;  1ZUK A;  1ARK A;  2O2O A;  2D8H A;  1K9A A;  1X43 A;  1AOJ A;  4CC4 B;  1AEY A;  3M0P A;  3LH5 A;  1X27 A;  4IIO A;  3ULR B;  1K0X A;  1JXO A;  1UE9 A;  4ESR A;  2AKL A;  2ED1 A;  4X1V A;  1ABQ A;  1WIE A;  1NLO C;  1TUC A;  2B86 A;  4OML A;  2FRW A;  5I11 A;  4FSS A;  3NGP A;  1AWJ A;  2KYB A;  3EG2 A;  2LZ6 B;  1V1C A;  2KE9 A;  3TSZ A;  4J9C A;  2E5K A;  2PNI A;  3O5Z A;  1A0N B;  1WXT A;  4Z88 A;  4A63 B;  2RF0 A;  5IHI A;  2DVJ A;  2FRY A;  3GBQ A;  3VS7 A;  2LJ3 A;  1BB9 A;  1GCQ C;  1KJW A;  4JPB W;  2FG0 A;  3EG0 A;  2K6D A;  4OMN A;  1I1J A;  3VS0 A;  5FWC A;  2HBW A;  3REA B;  3EGU A;  2KT8 A;  1WXU A;  1M3B A;  2EGC A;  3M0T A;  2AZV A;  4E6R A;  3TSW A;  3TVT A;  2H8H A;  1K4U S;  2RQT A;  1Z9Q A;  3UA6 A;  1S1N A;  2RN8 A;  4J9B A;  4IIM A;  1MV3 A;  2J6O A;  2X3X D;  5IXB A;  2JS2 A;  3JV3 A;  2EYY A;  2ENM A;  1CKA A;  2L3Q A;  1W6X A;  4M4Z A;  1NLP C;  1RUW A;  1AWW A;  1UJY A;  2CSQ A;  2L2P A;  2K79 A;  2JTE A;  1NEB A;  1SHF A;  2EKH A;  2D1X A;  2EVR A;  1B07 A;  2G6F X;  2CUD A;  1ZBJ A;  1GBQ A;  1YN8 A;  3RBB B;  4LUE A;  1K76 A;  4ORZ A;  3EHR A;  2JW4 A;  1GRI A;  1X6B A;  3NMZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...