2EYXA

C-terminal sh3 domain of ct10-regulated kinase
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
67
structure length
67
Chain Sequence
NLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords v-crk sarcoma virus CT10 oncogene homolog isoform a
publication title Structural basis for the transforming activity of human cancer-related signaling adaptor protein CRK.
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2eyxA00
3EGUA 1AWJA 1SPKA 2ABLA 4GLMA 3ZL7C 2D8JA 1JEGA 1UJ0A 1PKTA 1G2BA 2SRCA 1WXTA 3M0UA 1WA7A 2FO0A 2W10A 1I0CA 4RTUA 2FEIA 2CSIA 2DF6A 2OI3A 1AD5A 4OMPA 2B86A 2O2OA 4J9CA 2VKNA 1V1CA 2K9GA 2RF0A 4M4ZA 2JMAA 1Z9ZA 2GTOA 1HJDA 1M30A 2ED0A 3EHQA 1ABQA 2DMOA 2BZXA 4J9GA 2PNIA 4J9FA 4J9HA 4OMLA 4JZ3A 2A28A 1NEGA 2BZ8A 2C0TA 2V1RA 2FPEA 2DRMA 3UF4A 1OOTA 1WDXA 3CQTA 3PE0A 1YCSB 2VVKA 1M3BA 1VA7A 1UDLA 1G83A 1GRIA 2KT1A 4K11A 2RQVA 2V1QA 2CT3A 1T0HA 2EYWA 5FWBA 1K1ZA 3M0SA 5IHIA 1SRLA 4EIKA 1W1FA 1UHFA 1PNJA 2RQWA 1BK2A 2GBQA 1YNZA 4CC7A 3NHNA 1E6HA 1QCFA 3VS5A 3I35A 2O88A 1VYVA 4LUEA 3JV3A 2KROA 2DJQA 2CUDA 1SEMA 3NGPA 1I07A 1MV0B 2AKKA 1AZGB 2RPNA 2EGAA 2KYMA 2KRNA 1LCKA 2EW3A 2DX1A 2EKHA 1TUCA 1QWEA 1X69A 1AOJA 2EGEA 1T3SA 2F2VA 1TG0A 1VYUA 5IXBA 1K4US 1UG1A 1IO6A 1YP5A 3EG3A 2D1XA 2KEAA 2ED1A 1ARKA 2EYZA 1WLPB 4HVWA 4CC4B 3TSWA 2FPFA 3REBB 1B07A 2L3SA 4LE9A 1FYNA 1NLOC 3C0CA 2LQWA 2LJ3A 2YT6A 5GJVB 2YSQA 1U5SA 1AZEA 2JT4A 2FPDA 3I5SA 1W70A 2YUNA 2F2XA 2C0OA 3H0FA 1WFWA 1UHCA 2M51A 2W0ZA 5IHNA 1BBZA 4AFUC 3VRYA 5IH2A 2O9VA 2DL4A 1E6GA 1WYXA 2C0IA 1M3CA 2DRKA 2O9SA 2K7AA 4Y92A 2DBMA 1Y57A 4RTTA 5EC7A 1U3OA 1GCQC 2KNBB 1ZUUA 1PHTA 1YWOA 4IIOA 1QLYA 4JJBA 2HSPA 3M0PA 4J9DA 1RI9A 1RUWA 3VS3A 1K76A 2HDAA 4LUDA 4RTXA 2SEMA 2KXCA 1UE9A 1U06A 3A98A 2A37A 2EQIA 2LZ6B 3M0QA 3O5ZA 3FJ5A 3M0RA 5I22A 1WX6A 3VS7A 4LN2A 3QWXX 2VWFA 2DBKA 3M0TA 2MIOA 2EBPA 2DNUA 2YUPA 5FWCA 2GQIA 3UATA 2JTEA 2KR3A 1OPKA 4RUGA 1FMKA 2KYBA 4HVVA 1B3QA 3I5RA 2ROTA 4RTZA 4JJDA 1X2KA 2KT8A 2FRWA 4AFZC 1NEBA 4AFSC 4A63B 2AZVA 4CC2A 1PWTA 2J06A 2KXDA 2XMFA 2KE9A 1BB9A 2P4RA 2DM1A 1SRMA 2HBWA 1AWXA 3R6NA 1GFCA 1JXMA 4JJCA 2DE0X 4Z89A 4KRTA 1ZUKA 3NPFA 2LX7A 1KJWA 5I11A 2DYBA 4DEXA 1NM7A 2CDTA 4F16A 1H92A 1X27A 2D0NA 4F17A 1N5ZA 1BU1A 1SHFA 2L3QA 5GJWB 2IIMA 2X3WD 3KFVA 2DLPA 2ENMA 1CKBA 2AZSA 2CREA 1K0SA 4WCIA 4OMQA 1CKAA 2DA9A 1AWOA 2K79A 1TUDA 2OAWA 1E7OA 2JS0A 5IHKA 1XOVA 2DL5A 2CH4W 1W6XA 2BZYA 2EGCA 2LNHB 4OMMA 1UECA 1WIEA 2F2WA 2GTJA 1AEYA 2CH4A 1ABOA 1GCQA 2J05A 1RLPC 1JXOA 2A08A 4R0KA 1AWWA 2GGRA 4D8DA 4ORZA 3TVTA 1UJYA 4ZNXA 3NMZC 1UUEA 2YDLA 1M3AA 2KGTA 1JO8A 3RNJA 3U23A 4JPBW 2FRYA 3PVQA 2K6DA 2RQRA 3VS0A 1WI7A 4J9EA 1PRLC 1SHGA 2FG0A 4LNPA 3I9QA 1GFDA 2H8HA 3H41A 2RQTA 1PKSA 2LJ1A 1NYFA 2AK5A 3VRZA 1I1JA 2E5KA 1M27C 2K3BA 1YN8A 1GCPA 1OPLA 2L3PA 2J7IA 1ZBJA 2J6FA 3UA6A 4HCKA 2YUOA 1SSHA 1X6GA 1ZLMA 2D8HA 1K9AA 2ECZA 4IIMA 2NWMA 3RBBB 1X43A 1X6BA 2JM8A 3EHRA 3VS4A 1T3LA 2MCNA 2X3XD 2YUQA 2LMJA 3LH5A 2A36A 1QKWA 1WXBA 1QWFA 2KBTA 2K2MA 1NLPC 2JW4A 1CSKA 2PTKA 2LCSA 1NG2A 4HVUA 3TSZA 2L2PA 2ROLA 5HCKA 4JZ4A 4QT7A 1X2QA 1EFNA 2EYXA 1A0NB 1GL5A 1MUZA 5IXFA 3VS1A 1OV3A 1ZSGA 1JQQA 4OMNA 4CC3A 3EG2A 4GBQA 3SEMA 1AVZC 2KRSA 3QWYA 2MOXA 3SHWA 3GBQA 2DILA 2OJ2A 4D8KA 4HXJA 1Z9QA 4Z88A 4ESRA 2CT4A 2RQUA 5L23A 1M8MA 1J3TA 1K0XA 1ZX6A 1RLQC 2RNAA 2CUBA 2CSQA 2JMCA 4RTYA 3VS2A 2EVRA 4Z8AA 2LP5A 2JXBA 3PVLA 2ESWA 2J6KA 3H0HA 1H3HA 4J9IA 2KRMA 1ZUYA 2M0YA 1GBRA 1UTIA 1JU5C 1YWPA 2L0AA 5FW9A 2JS2A 1H8KA 1OEBA 3VS6A 1UGVA 1WXUA 1KSWA 1GBQA 2BTTA 2GNCA 1UFFA 2LJ0A 3ULRB 2RN8A 1HD3A 1KIKA 1S1NA 2PZ1A 4DEYA 4F14A 2AKLA 1PRMC 3THKA 2QDLA 1KFZA 2J6OA 3EG1A 2RMOA 4AG2C 4FSSA 4RTWA 2I0NA 2HEQA 4J9BA 2DVJA 4AFQC 2NUZA 3IQLA 1T0JA 2LQNA 1NYGA 4AG1C 4X1VA 2DL8A 4OMOA 2DL7A 4E6RA 1VYTA 1MV3A 1HSQA 1QKXA 1Y0MA 4RTVA 2EYYA 2O31A 2JM9A 3H0IA 2EPDA 3UA7A 3REAB 2G6FX 3EG0A 5ECAA 2DL3A 2HCKA
chains in the Genus database with same CATH superfamily
1M90R 3ZL7C 4GLMA 1JEGA 2SRCA 1G2BA 1OX8A 4JRIA 2E64A 2DF6A 2G3RA 2P0PA 4E7HA 2VKNA 2X4XA 1QCNA 1QP3A 3LLRA 3CPWA 3ZFJA 4LDYA 1M30A 2QQAA 2DMOA 3QDFA 2RHYA 3JCMf 4J9GA 4JZ3A 5FLXE 3VKIA 3MP1A 3G4ST 5A0LA 2BZ8A 3OY9A 4C8QD 2FPEA 3E9GA 5CAIA 6AT1B 1OOTA 1MMNA 2VVKA 3P8HA 2NUTB 8ATCB 2QEXQ 1VQ5Q 4L59A 3T9NA 3G6EQ 3CPWP 2OTLT 2CT3A 5LL6S 1NZ9A 5IHIA 4EIKA 2CP6A 1NJIC 2LC4A 2RQWA 1C1AA 4CC7A 4N0AA 1MNEA 1IRXA 2F5KA 1I07A 2RPNA 3BY7A 2EGAA 3RESA 3CCJT 2EW3A 1G3TA 3J7AF 1AOJA 1PD0A 1YJWA 3P8BB 4FW1A 1K4US 4FYVB 4OGCA 1YP5A 2ED1A 3CCJA 4PJOG 1M1FA 2VYTA 3SWNA 2Z0WA 3REBB 1B07A 3LWHA 1NLOC 2HKNA 2YT6A 5GJVB 3CCST 2YSQA 5KYUB 1G3YA 2K2VA 3CCLT 3OB9A 1H3ZA 2DD4A 3L2WA 5LJ3j 4DBFA 3NFCA 3QKJA 2FPDA 1IHWA 2YUNA 2OTJT 4IURA 1TS9A 2C0OA 5LJ5g 3CMEA 1R8OB 1YJ9Q 3CCSA 1WFWA 2M51A 3JRZA 3DB3A 1VQ4Q 3E2UA 1VQ9T 1RAAB 2O9VA 4C92D 1B34B 4FCYA 2C0IA 3RIRA 4E7ZA 5KE3A 2EJFA 4PJOB 4XU2A 1QMCA 2DBMA 4C0DC 4XU1A 1NE8A 1U3OA 1KQ1A 1SG5A 1VQ9A 3A5ZB 4EDUA 4QW2A 1QLYA 4JJBA 2HSPA 1BI2A 3JCMb 1KK7A 2LX9A 2GQVA 2QASA 4RTXA 1LJOA 1UE9A 3A98A 3BFMA 2LZ6B 3M0QA 3FJ5A 1Q82U 2M9UA 3CXCS 2DBKA 2DERA 2MIOA 4PLIA 3JCMd 5FU7C 5FWCA 1YITT 2PUOB 1R77A 1OPKA 1BIBA 2EJ9A 2ROTA 1PM3A 4Z02A 1VQNQ 5KYUA 1X2KA 2YXYA 1K8AR 4AFSC 3OYDA 1YITA 3JB9F 3MPUB 2H3JA 3H6ZA 2KXDA 2XMFA 2ZCFB 4XTWA 2GFAA 4M7DE 1Q86C 2DM1A 1YHQQ 3TU4K 1KQSS 2LCLA 2IG0A 4JJCA 4BE2A 1VQOT 4KRTA 2VUBA 4F7UG 1B34A 4F16A 1Q7YU 3OA6A 4C5IA 1JB0E 4ELYC 3JCMW 2AIRB 2HZYA 5CR2A 1SHFA 3PIPA 1VQOA 1CKBA 2KAFA 1K0SA 4OMQA 2KSSA 1TUDA 4ATOA 2OAWA 1ACMB 3OW2S 1FMWA 4M7DC 3CBPA 4M77D 1VQ6A 3CC2T 3LH0A 2RI3A 2LTOA 5CCAA 2DL5A 2CH4W 1VUBA 2LNHB 4OF1A 4X34A 1ZA2B 1N6AA 5LJ3g 1AEYA 3GLXA 1S72T 4BY6C 2RO0A 2J05A 3PTAA 3CC2A 2GGRA 2MWOA 4F7UB 3NMZC 3A8OB 2GF7A 2QTXA 2VASA 3EFRA 3U23A 4C0GA 1S72A 3CC4Q 3VS0A 2L89A 3QUIA 1QVPA 4J9EA 1BI3A 2AT1B 3WVEB 1D1CA 3FC3A 2QK0A 3JB9H 4PJJA 2QQSA 2KK4A 1D1BA 3CCMT 1YI2T 2H8HA 3H41A 2JTFA 5IN1A 2LT4A 2AK5A 1JRIA 1QQJA 1DJ7B 1OULA 4KULA 1YI2A 3MO8A 2J6FA 5GMKl 3UA6A 4EMGA 2LDMA 4C8QF 3LGFA 1YCYA 4VUBA 5GAMe 1ZLMA 1KC8U 2D8HA 3HPWA 3CCEA 4X9DA 1TU0B 1X6BA 2JM8A 2E65A 3LW5E 3EHRA 1T3LA 4O5VA 1WHKA 4E7KA 1RI0A 4C8QE 1NG2A 4HVUA 2ROLA 2MYSA 2BE7D 1SKUB 5HCKA 3L2RA 4QT7A 4JS4A 1ZHIA 1Y96B 1O75A 1UGQB 3CC7T 1PSFA 3ZEHA 4F7UA 2HSEB 1I4K1 1GL5A 2HQHA 2PUKB 1JQQA 4L6V5 2EIFA 4OMNA 1M8VA 3VU3C 4DQ2A 3OW2A 3QDRB 2KRSA 1V29B 3QWYA 4OB0B 1VQKT 1WJRA 3N5BB 2EFIA 1NJIR 2RK2A 4XU3A 4D8KA 2DIGA 3CC7A 1Z9QA 4EMKB 4RCBA 1J3TA 3L1AA 2XDDA 1VQKA 2JMCA 3VS2A 4MMKA 3H8ZA 3G1JA 4JLIA 3C94A 2J6KA 3AT1B 4II1A 1M2VB 3S3NA 2ZGWA 4N0AC 3OW2P 3UWNA 4M75D 1YWPA 2L0AA 3ASKA 3VUBA 1GBQA 5GAOn 2PZ1A 5HKCA 5EG2A 3THKA 2J6OA 1ZBXA 2XHCA 3DLLA 4FSSA 2I0NA 2LT1A 4C92F 4X1VA 4J8OA 1MV3A 2QYZA 4A4KA 2O31A 3SWNC 2JM9A 1TTHB 2RHZA 4X9CA 3UA7A 1F1BB 3M9QA 2VB6A 4PLLA 2G6FX 5CVIA 5J3BA 1VQ8T 4LXCA 5ECAA 1Y96A 1UJ0A 4NL3A 4DBQA 1K9MU 1AWJA 1KD1C 1ZSZA 2M0OA 2D8JA 4C92E 1LNXA 2FO0A 1G8XA 1I0CA 2M1HA 2FEIA 2CSIA 1VQ8A 1YIJT 2A3LA 4LD9K 1X6OA 4EMKA 1QP2A 4XU0A 4E2FB 3CCUT 3E9FA 2L8DA 2JMAA 1Z9ZA 4E7JA 4RMOA 3FIFA 1Q82R 5D6WA 1C6VX 1HK9A 2DZCA 3CBOA 3Q1JA 3A8MB 3L2VA 1M5Q1 3CCVA 2FL7A 1M2VA 3V7RA 1K8AC 3CCUA 5GAOm 4FSXA 2DRMA 1VQLT 1IHVA 3I55A 5CO7A 1YBYA 1YJWQ 3KUFA 4YTLA 2DVEA 1HYOA 1GRIA 2KT1A 4K11A 3CEYA 2ZPFB 2V1QA 2WSFE 5GANe 3CCJQ 5LJ5f 1VQLA 3CBMA 4EPCA 1SRLA 1BKBA 4C8QG 5DM7R 1PNJA 2YRVA 2DIQA 3VS5A 4PJNA 1WHMA 1VYVA 2CUDA 1EIFA 1MV0B 2AKKA 4A4EA 4OB1B 2KRNA 2EKHA 1QWEA 2MF2A 1X69A 4BD3A 2DXTA 3CMEQ 3OS0A 1VYUA 4M77F 5IXBA 3S3OA 3OMCA 3CCSQ 2HL5C 3HRSA 2D1XA 3GF5A 1SSFA 3CCRA 4N4HA 2RD1A 2EYZA 1WLPB 3PMIA 4CC4B 3MCAB 3TSWA 2FPFA 2L3SA 4LE9A 3CPFA 3C0CA 5J26A 4C8QB 4AMCA 2XIDA 4M77E 1VQ9Q 2E4HA 4CRIA 4Q5WA 4IKFA 5GAN5 2JUFA 2RI2A 2W0ZA 5IHNA 1NPRA 2HQXA 5GAN6 5GAOr 4EMHA 1D0XA 1WNLA 4IUQA 3INZA 1M2OA 1M3CA 4KUIA 2Y90A 3OYHA 2K7AA 3RKWA 2HD0A 1Y57A 2EYQA 5A0DA 3X26B 2CZ0B 2PVDB 5FU6B 5I2MA 4IIOA 3SWNB 1W2BS 3QZ5B 2YRCA 3PFSA 1WPYA 1RI9A 3GNGA 4C92G 1RUWA 2BIVA 2K5FA 1YITQ 2SEMA 2CP3A 1D3BB 2EQJA 2EQIA 2FZCB 3M0RA 3META 1PC0A 1KC8R 2E5QA 1VQPT 4LN2A 2R58A 4F7UF 5GAN8 2DNUA 4BE0A 2YUPA 3VV0A 5D6YA 2PQWA 2D9TA 2MI6A 3UATA 2JTEA 2KR3A 3OBYA 4RUGA 1FMKA 1IB8A 1D1AA 1B3QA 2KYBA 3G4SA 5LJ3f 4C8QA 2BKDN 4OGEA 2GFUA 3URGA 4JJDA 1X01A 4ME7A 1VQOQ 3HRUA 1XTDA 2KT8A 3M4YA 4GY5A 2K57A 2LQKA 1MHNA 4A63B 4F7UE 1LOJA 1U8RA 4CC2A 2E6NA 4OP0A 2KE9A 5LJ5d 2MK5A 3MP8A 4PKCC 4C92B 1VQ6Q 5GAOq 1D0YA 2OTLA 3UT1A 2QA4T 3OSVA 1MMGA 4Z89A 1ZUKA 2VV5A 3MJXA 3NPFA 3JCMh 2DYBA 2OX7A 1X27A 4F17A 1N5ZA 3DKMA 4J83A 2JJ9A 4XAXB 5KCHA 3CC2Q 5J39A 3C4SA 2L3QA 5GJWB 2QGFB 2DLPA 2QA4A 2ENMA 5I2SA 2F5TX 4J7FA 4BACA 1WQWA 2AZSA 4WCIA 1S72Q 1CKAA 3PT9A 4M78D 1BIAA 3EGXA 2JS0A 1D3BA 3L42A 3X25B 2CYZB 4FYYB 1W6XA 3MEWA 4KGZB 4MMLA 4E7LA 2MMPA 1UECA 2FZKB 2F2WA 3OYFA 1KG1A 2COYA 1M1KC 1ABOA 3QXEB 1GCQA 2K3XA 1JXOA 3M55A 1R0CB 2A08A 4OB3B 3JCMe 4D8DA 3CCLA 4RKUE 5DLQE 3TREA 1UJYA 4M77G 1M1KU 1YI2Q 3VJPA 1VQ7T 2DJZA 4MZTA 2RB6A 2OTJA 1JO8A 4JPBW 2RJDA 1BCMA 2K6DA 2RQRA 3M5AA 3CCEQ 2QQBA 4KUDK 2DYIA 1SHGA 2FG0A 4NS5A 3MEAA 5KYYB 3G71T 3I9QA 3P8DA 2E1HA 1VQ7A 3LWIA 1K73U 4C92A 7AT1B 2FB7A 2JZ2A 1PKSA 2V8IA 2VGNA 1KD1R 1NYFA 2A0FB 2CS7A 3VRZA 1D09B 2ZPEB 1Q82C 4M7AD 1VQMT 3MP6A 2K3BA 3G71A 1YN8A 3OYKA 4IUTA 5GAN7 2J7IA 2C06A 1HXDA 4V2SA 3M53A 3FLGA 4MDXA 2YUOA 4M77B 1K9AA 2ECZA 2E6ZA 3OYGA 1XQHA 1U1TA 4HCZA 1ZSZC 4PFOA 2ZAEA 1XNIA 3CC7Q 2X3XD 2LMJA 1PCXA 3ER0A 2XDPA 3JCMQ 1Q81C 5CKHA 2PTKA 2LCSA 1VQKQ 4ELZC 5LJ3d 2L2PA 3TSZA 4EMKC 1G3WA 2KVQG 1Q81U 3GP8A 2L5QA 4N4IA 1Q7YC 1WZOA 2RA2A 5IXFA 1ZSGA 3EG2A 3SEMA 1AVZC 3ME9A 4BI8B 2DILA 4BI3A 1VQ5T 5KYYA 2CT4A 3RMSA 4PJOD 3HRTA 1KHIA 2RNAA 3RKYA 2Y4XA 2EVRA 2XK0A 5AYFA 3SFMA 1ZQ1A 4J9IA 2DTOA 1ZUYA 1UTIA 1JU5C 5KCOA 5FW9A 1IXDA 1H8KA 1RAIB 1KIKA 1UFFA 1HD3A 1RABB 1S1NA 5GMKh 4M77A 4DEYA 4F14A 1PRMC 2YHTA 2XG8D 3EG1A 5GAMh 4AG2C 1VQ8Q 1Q95G 2HEQA 3JCMX 2NUZA 3IQLA 2LQNA 2DL8A 3PIOA 3C95A 2QTVA 2DL7A 3GNFB 2KQWA 1QKXA 1IZ6A 1QCOA 1UGRB 2NYSA 1WHLA 2EYYA 2R5MA 2V8JA 4RCCA 3CXCA 3CCVQ 5GMKj 3OQ5A 2E10A 3OMGA 1OX9A 3ZBDA 3CCUQ 1O9SA 3FJPA 3J81E 1SPKA 2ABLA 3V7CA 4C5HA 5GAMj 1TWBA 1WXTA 3I55Q 2W10A 2M02A 4HA8A 3PGGA 1M90U 1N8RU 3CCMA 1AT1B 3JB9I 1KC8C 5GMKe 2B86A 2O2OA 4J9CA 2P4TA 1VQ4T 2NLUA 4Y91A 1V1CA 4MZMA 3HFOA 5IAYA 1VQLQ 2D6FA 5DY9A 2X4JA 1OU9A 1EZZB 2E3HA 3E1SA 1ABQA 3CXCP 3TCJA 1YJNQ 4OMFB 2BZXA 1B7TA 2PNIA 1KQSA 4OMLA 4ANJA 2A28A 2R5AA 4PJLA 2C0TA 4ZTFA 2V1RA 1NBEB 1QVGS 3E19A 1TSFA 3UF4A 3CQTA 1TUGB 1YCSB 3M59A 4A4HA 2OAUA 1MGQA 2CP2A 4C0FA 2ZPHB 2RQVA 3QJYA 1ZSZB 1T0HA 3CCRQ 1K1ZA 2P0KA 4PL6A 5CIUA 3M0SA 3PNWC 1W1FA 3OSSC 1KQSP 4FU6A 1BK2A 1E6HA 2WACA 3TQ7P 3NTIA 1QCFA 3I35A 2O88A 4LUEA 3JV3A 2KROA 2DJQA 1SEMA 3R6OA 2KI7A 3OYEA 4UC4A 4P5NA 4M78F 4C8QC 1NPPA 4FW2A 1T3SA 4B9XA 2X4WA 2F2VA 4QKUA 1TG0A 1JBMA 1UG1A 1IO6A 4HT8A 2WSCE 3EG3A 1FWZA 1WQ7A 1ARKA 2CKKA 3MEVA 1I8FA 4HVWA 2K4YA 3QO3A 5GAOp 3QYGB 3RR6A 2LJ3A 3I56T 3EFOB 3SDZA 4M75A 4CI0C 1AZEA 4QQGA 1TXQA 2JT4A 3I5SA 1W70A 4A4FA 3EGDB 2F2XA 1M1KR 1K9MC 1I5OB 5FU6C 3I56A 1TOVA 3X20B 1SF9A 1BBZA 3QHSA 4IUVA 3VRYA 3FB9A 3A8GB 4O6JA 2BUDA 2DL4A 3BDLA 1H641 4M7AF 2DRKA 4B6MA 3GIBA 2CP7A 1QVFS 5GAMg 5GANh 2BE9B 3LGLA 2RHUA 1I5LA 1GCQC 4HCBA 1ZUUA 2FYKA 1D0ZA 1PHTA 1YWOA 2K5LA 3G4SQ 4NL2A 4PJMA 1QVGA 3JAME 2CZ1B 4J9DA 3SD4A 3VS3A 4WTOB 3TEEA 2KXCA 2LRQA 1U06A 2A37A 4M7AE 4FIBA 4A54A 1YIJA 3HP9A 2OTLQ 4IUPA 1RL2A 3QWXX 1GXIE 5GANj 4Y28E 2K3YA 4C92C 2V26A 4QVCA 2GQIA 1BYMA 3V8JA 1QVGP 4HVVA 4TVRA 3BE3A 3EFOA 2QA4Q 2GCXA 3CMAT 2FRWA 4AFZC 1Q81R 4NOYA 3EH2A 3JCMV 3RMQA 4M7DD 3BDUA 5FROA 2AZVA 3CPWS 1PWTA 3EGDA 2NUPB 3NTHA 1IGUA 2P4RA 1OZ2A 1SRMA 2HBWA 1AWXA 1Q7YR 3R6NA 1GFCA 3CMAA 1JXMA 5DLOA 3OYJA 3RDVA 3HL8A 5I11A 4DEXA 2CDTA 2RH2A 3OYAA 2D0NA 3JB9D 2CZ7B 3QSUA 4B9WA 4FL6A 1U1SA 3CCLQ 4PFPA 4JUVA 2HNIA 2IIMA 3KFVA 4PNOA 5L8RE 2MAMA 4J7IA 4JS5A 2CREA 2IPOB 2OTJQ 1AWOA 2K79A 2O01E 5GAOl 3EH1A 2LVMA 2E41A 2RJFA 5IHKA 4KGVB 4R56A 1RADB 4IUUA 2BZYA 2EGCA 1VQ7Q 4OMMA 3KBGA 2LQ8A 5C0MA 4JRQA 2JNGA 1Y07A 1G3SA 2ZPIB 4M78G 2CP0A 3FEOA 1QVFA 3CD6T 1RLPC 4R0KA 1G5VA 4ORZA 3G71Q 4ZNXA 3SB2A 3PMTA 2YDLA 2QI2A 4KH0B 4DBHA 1M3AA 1UGSB 4LD6A 3RNJA 2P84A 4LDXA 9ATCB 3EAEA 2FRYA 3CD6A 1WI7A 2CP5A 2DETA 4N4GA 4LNPA 2NUPA 4QVDA 3LYIA 3G7ZA 4M77C 5IT9E 3EGXB 2LNVA 5LJ5e 1QVFP 1N8RR 4DOWA 3OYIA 2DEUA 1I1JA 2ZPGB 2E5KA 1KQ2A 1GCPA 4FT2A 1OPLA 2JTMA 2L3PA 2X9HA 2WSEE 4M78B 3JCMc 2RI5A 1Y71A 4JRKA 2DXBA 2P0QA 3MHXA 4HCKA 2E70A 1IREB 3GPLA 3M4GA 5GANg 1X6GA 4M7AG 2NWMA 3OYNA 3RBBB 4PK4A 3OS2A 1OU8A 1VQPA 2RK1A 2EJGA 2VXFA 1WXBA 1QWFA 2KDSA 1PSEA 2DPPB 4JZ4A 3OBWA 4XTYA 4BDZA 1A0NB 3O8VA 1OV3A 4CC3A 4XTXA 3RUXA 1LVKA 1JJ2S 2MOXA 4QQ6A 1YJWT 3GBQA 2EQMA 2OJ2A 4HXJA 4ESRA 3CCQT 4LDVA 4RG2A 4MZPA 4M75F 4M7AB 1NJIU 2EQKA 2DEQA 2O4XB 1M8MA 2FHDA 1RLQC 3M58A 1WHHA 2CSQA 2FZGB 5LJ3h 2RHXA 2VGMA 3WVDB 2ESWA 3CCQA 4C5EA 2DKGA 3JCMJ 2M0YA 3L2ZA 1GBRA 3HSBA 2HL3A 4M78A 1OEBA 3VS6A 1UGVA 1WXUA 2LJ0A 2BTTA 4M75E 1C0MA 2RJEA 4DBRA 2F1LA 2EAYA 3QIIA 3CMET 2QDLA 3BW1A 1KFZA 1M9SA 3CCMQ 5AT1B 1OZ3A 1W2BA 3UDCA 2JN0A 4LDUA 4RTWA 4FM4B 3JSCA 4BDYA 1NYGA 4ZN1A 4AG1C 1BCOA 1K73C 4E6RA 1WHJA 2DXUA 1VYTA 1HSQA 4RTVA 5GMKi 1K9MR 3L2UA 1YFNA 1FXXA 3H0IA 2EPDA 2NUTA 5LJ3e 4QQDA 3OS1A 2DL3A 3EGUA 4ZN3A 1WJQA 4M75C 4XTZA 2DAQA 3EG9B 4RG8A 1PKTA 5GAN2 3M0UA 1WA7A 1W2BP 2EKOA 4RTUA 2OI3A 1AD5A 1Y7XA 4OMPA 5KE2A 1TH7A 2K5IA 2K9GA 4M7AA 2RF0A 4M4ZA 2O4XA 2GTOA 1VQMA 1HJDA 2RHIA 4QVZA 3DB4A 3S3MA 2ED0A 3EHQA 2QXFA 3V8LA 1QW1A 4J9FA 4J9HA 4JDSA 3A8LB 3AHUA 1AHJB 1NEGA 5CKBA 1JJ2A 4M7DF 1WDXA 3PE0A 2B8AA 1M3BA 2R57A 2DFUA 1VA7A 1UDLA 1G83A 2YRDA 1MNDA 4FYXB 4D6WA 2EYWA 5FWBA 4XQ3A 5CKFA 3VYHB 5CQXA 1UHFA 2HQEA 2GBQA 1I81A 1YNZA 2PU9B 3NHNA 3RERA 2QEXT 3OYBA 2COZA 5M9OA 1OQKA 3NGPA 3VUZA 1AZGB 5HY6A 3G6ET 1JJ2P 2KYMA 1LCKA 2HKQB 2DX1A 4ZGJB 1TUCA 3M56A 5GAMf 2MPXC 3M54A 3RKXA 1Q86U 2XU8A 2V8KA 3L2QA 2EGEA 3F70A 3UPUA 2QEXA 3HFNA 3EG9A 2D0QB 3I56Q 1X75C 1VQ5A 2DD5A 2HMAA 3OYMA 4OVAA 4PJOA 1VQ6T 3G6EA 2KEAA 3JCMg 3QPHA 3H9NA 3JB9J 3QYHB 1FYNA 2LQWA 2XI9A 3OYYA 1MMAA 5GMKm 2KMTA 3DLMA 2EQUA 4JRPA 1U5SA 2E3IA 5HK0A 2YLBA 2XDBA 4M75G 4C0ZA 1VIEA 2DK3A 5CQYA 3H0FA 2RM4A 2VC8A 3MKDA 2AHJB 1WHGA 1UHCA 1YIJQ 3C12A 3MEUA 4AFUC 3X24B 1IGQA 5IH2A 1M90C 2X35A 1N8RC 1WJSA 1E6GA 3A1PA 4KT0E 1WYXA 2LCCA 4JJNK 4BB7A 2O9SA 1YJ9T 4Y92A 2QAZA 4RTTA 5EC7A 2KNBB 4FYWB 4XTUA 2PVOB 3NTKA 2XD0A 2I2LA 3M0PA 2E12A 1OYXA 1K76A 1BI0A 2HDAA 4LUDA 1YJ9A 3CCET 4M75B 3O5ZA 1N9RA 1MMDA 4XK8E 5I22A 1VQ4A 1WX6A 3VS7A 2DTHA 2XKOC 3CMAQ 5CKEA 1RACB 2VWFA 2DTIA 4C0DB 3M0TA 2EBPA 2QDYB 2F69A 2RJCA 5KYNA 1PG5B 3VYGA 2FVUA 1RAEB 2KY9A 3I5RA 3HKSA 1N27A 3QBYA 2JVVA 4RTZA 2QG9B 2Y4YA 4KGXB 2CZ6B 1NEBA 3FRNA 2QGGA 2J06A 3V7SA 1BB9A 4E7SA 5FU7B 1KHCA 1VOMA 4BI4A 1VQNT 2DE0X 1UB4A 2LX7A 1KJWA 1NM7A 4LDWA 1H92A 2YWWA 2DXCA 4M7DG 4ZGDB 1BU1A 1BI1A 4HT9A 4KH1B 5GAMd 1YHQT 2X3WD 1VQNA 2ZZDA 3M57A 2ATCB 2DZ9A 2QQ9A 2XICA 2DA9A 3HTRA 3CD6Q 1E7OA 4A53A 4M78E 3JB9G 1YHQA 1RAHB 3D7SB 1XOVA 5D6XA 5KH6A 5GANf 5C6SA 1WIEA 2PVGB 2GTJA 2CH4A 4J6WA 2X51A 1AWWA 4BUGA 3JCMP 3TVTA 4L5GA 1UUEA 4M7DB 2KGTA 1FMVA 3KXTA 3A8HB 2COWA 4J5YA 3PVQA 5HK3A 5KYXB 1K73R 4C5GA 4M78C 5KYWB 2YLCA 1PRLC 2DO3A 2HBPA 4BY6B 1W4SA 1GFDA 4E47A 1VQPQ 4FT4A 2RQTA 5A0GA 4ZGEB 8AT1B 1FX7A 5I21A 2LJ1A 3OYLA 3HHTB 3S6WA 3CC4T 5CK9A 2ZPBB 2IVWA 4J6XA 4DA4A 1M27C 1KD1U 1ZBJA 3GOXA 2H3EB 3CCVT 1XJWB 4E7IA 3J80E 2L3RA 3CC4A 5GAN3 3EFSA 1SSHA 5D7UA 1RAGB 4A4GA 4IIMA 4XTVA 3I55T 1VIFA 1X43A 3WXMB 3VS4A 2MCNA 4OB2B 2YUQA 3LH5A 1PD1A 1QKWA 2A36A 4WF2A 3LX7A 2KBTA 4ZTJA 2A7YA 3X28B 2K2MA 1NLPC 2JW4A 4AT1B 5A2QE 4J6YA 1CSKA 2MWPA 1K8AU 4M7AC 1WGSA 3V8KA 1X2QA 1EFNA 1M4ZA 1YJNT 2CGHA 4JLGA 2EYXA 2VXEA 3CCQQ 4PJOF 3OS5A 1MUZA 3VS1A 1N9SA 4M7DA 4GBQA 3FDRA 4KBMB 3OYCA 2X4YA 1ZA1B 1OI1A 3SHWA 1YJNA 5KYXA 5KYWA 4R55A 4HKEA 4Z88A 1Q86R 2JOYA 2RQUA 1UGPB 5L23A 3CCRT 1K0XA 1ZX6A 1UEBA 2M16A 4PJOE 2CUBA 4RTYA 4PFZA 4Z8AA 2LP5A 5FRNA 2JXBA 3PVLA 4HCCA 1RAFB 3H0HA 5LJ5h 1H3HA 1LPLA 3QG1A 4MDWA 2KRMA 4F04B 3QJ6A 2HAXA 1V76A 2JS2A 5FRMA 1P92A 1KSWA 2GNCA 3ULRB 4GLKA 2RN8A 3QZ9B 5GANd 2AKLA 2QQRA 2RMOA 4BE1A 4J9BA 2DVJA 4AFQC 1T0JA 5LJ5j 4PJOC 4OMOA 1VQMQ 5GAN4 1M1GA 1EX4A 1Y0MA 4DOVA 5CKDA 3REAB 2EWNA 3EG0A 1R0BG 2HCKA
chains in the Genus database with same CATH topology
3EGUA 1AWJA 1SPKA 2ABLA 4GLMA 3ZL7C 2D8JA 1JEGA 1UJ0A 1PKTA 1G2BA 2SRCA 1WXTA 3M0UA 1WA7A 2FO0A 2W10A 1I0CA 4RTUA 2FEIA 2CSIA 2DF6A 2OI3A 1AD5A 4OMPA 2B86A 2O2OA 4J9CA 2VKNA 1V1CA 2K9GA 2RF0A 4M4ZA 2JMAA 1Z9ZA 2GTOA 1HJDA 1M30A 2ED0A 3EHQA 1ABQA 2DMOA 2BZXA 4J9GA 2PNIA 4J9FA 4J9HA 4OMLA 4JZ3A 2A28A 1NEGA 2BZ8A 2C0TA 2V1RA 2FPEA 2DRMA 3UF4A 1OOTA 1WDXA 3CQTA 3PE0A 1YCSB 2VVKA 1M3BA 1VA7A 1UDLA 1G83A 1GRIA 2KT1A 4K11A 2RQVA 2V1QA 2CT3A 1T0HA 2EYWA 5FWBA 1K1ZA 3M0SA 5IHIA 1SRLA 4EIKA 1W1FA 1UHFA 1PNJA 2RQWA 1BK2A 2GBQA 1YNZA 4CC7A 3NHNA 1E6HA 1QCFA 3VS5A 3I35A 2O88A 1VYVA 4LUEA 3JV3A 2KROA 2DJQA 2CUDA 1SEMA 3NGPA 1I07A 1MV0B 2AKKA 1AZGB 2RPNA 2EGAA 2KYMA 2KRNA 1LCKA 2EW3A 2DX1A 2EKHA 1TUCA 1QWEA 1X69A 1AOJA 2EGEA 1T3SA 2F2VA 1TG0A 1VYUA 5IXBA 1K4US 1UG1A 1IO6A 1YP5A 3EG3A 2D1XA 2KEAA 2ED1A 1ARKA 2EYZA 1WLPB 4HVWA 4CC4B 3TSWA 2FPFA 3REBB 1B07A 2L3SA 4LE9A 1FYNA 1NLOC 3C0CA 2LQWA 2LJ3A 2YT6A 5GJVB 2YSQA 1U5SA 1AZEA 2JT4A 2FPDA 3I5SA 1W70A 2YUNA 2F2XA 2C0OA 3H0FA 1WFWA 1UHCA 2M51A 2W0ZA 5IHNA 1BBZA 4AFUC 3VRYA 5IH2A 2O9VA 2DL4A 1E6GA 1WYXA 2C0IA 1M3CA 2DRKA 2O9SA 2K7AA 4Y92A 2DBMA 1Y57A 4RTTA 5EC7A 1U3OA 1GCQC 2KNBB 1ZUUA 1PHTA 1YWOA 4IIOA 1QLYA 4JJBA 2HSPA 3M0PA 4J9DA 1RI9A 1RUWA 3VS3A 1K76A 2HDAA 4LUDA 4RTXA 2SEMA 2KXCA 1UE9A 1U06A 3A98A 2A37A 2EQIA 2LZ6B 3M0QA 3O5ZA 3FJ5A 3M0RA 5I22A 1WX6A 3VS7A 4LN2A 3QWXX 2VWFA 2DBKA 3M0TA 2MIOA 2EBPA 2DNUA 2YUPA 5FWCA 2GQIA 3UATA 2JTEA 2KR3A 1OPKA 4RUGA 1FMKA 2KYBA 4HVVA 1B3QA 3I5RA 2ROTA 4RTZA 4JJDA 1X2KA 2KT8A 2FRWA 4AFZC 1NEBA 4AFSC 4A63B 2AZVA 4CC2A 1PWTA 2J06A 2KXDA 2XMFA 2KE9A 1BB9A 2P4RA 2DM1A 1SRMA 2HBWA 1AWXA 3R6NA 1GFCA 1JXMA 4JJCA 2DE0X 4Z89A 4KRTA 1ZUKA 3NPFA 2LX7A 1KJWA 5I11A 2DYBA 4DEXA 1NM7A 2CDTA 4F16A 1H92A 1X27A 2D0NA 4F17A 1N5ZA 1BU1A 1SHFA 2L3QA 5GJWB 2IIMA 2X3WD 3KFVA 2DLPA 2ENMA 1CKBA 2AZSA 2CREA 1K0SA 4WCIA 4OMQA 1CKAA 2DA9A 1AWOA 2K79A 1TUDA 2OAWA 1E7OA 2JS0A 5IHKA 1XOVA 2DL5A 2CH4W 1W6XA 2BZYA 2EGCA 2LNHB 4OMMA 1UECA 1WIEA 2F2WA 2GTJA 1AEYA 2CH4A 1ABOA 1GCQA 2J05A 1RLPC 1JXOA 2A08A 4R0KA 1AWWA 2GGRA 4D8DA 4ORZA 3TVTA 1UJYA 4ZNXA 3NMZC 1UUEA 2YDLA 1M3AA 2KGTA 1JO8A 3RNJA 3U23A 4JPBW 2FRYA 3PVQA 2K6DA 2RQRA 3VS0A 1WI7A 4J9EA 1PRLC 1SHGA 2FG0A 4LNPA 3I9QA 1GFDA 2H8HA 3H41A 2RQTA 1PKSA 2LJ1A 1NYFA 2AK5A 3VRZA 1I1JA 2E5KA 1M27C 2K3BA 1YN8A 1GCPA 1OPLA 2L3PA 2J7IA 1ZBJA 2J6FA 3UA6A 4HCKA 2YUOA 1SSHA 1X6GA 1ZLMA 2D8HA 1K9AA 2ECZA 4IIMA 2NWMA 3RBBB 1X43A 1X6BA 2JM8A 3EHRA 3VS4A 1T3LA 2MCNA 2X3XD 2YUQA 2LMJA 3LH5A 2A36A 1QKWA 1WXBA 1QWFA 2KBTA 2K2MA 1NLPC 2JW4A 1CSKA 2PTKA 2LCSA 1NG2A 4HVUA 3TSZA 2L2PA 2ROLA 5HCKA 4JZ4A 4QT7A 1X2QA 1EFNA 2EYXA 1A0NB 1GL5A 1MUZA 5IXFA 3VS1A 1OV3A 1ZSGA 1JQQA 4OMNA 4CC3A 3EG2A 4GBQA 3SEMA 1AVZC 2KRSA 3QWYA 2MOXA 3SHWA 3GBQA 2DILA 2OJ2A 4D8KA 4HXJA 1Z9QA 4Z88A 4ESRA 2CT4A 2RQUA 5L23A 1M8MA 1J3TA 1K0XA 1ZX6A 1RLQC 2RNAA 2CUBA 2CSQA 2JMCA 4RTYA 3VS2A 2EVRA 4Z8AA 2LP5A 2JXBA 3PVLA 2ESWA 2J6KA 3H0HA 1H3HA 4J9IA 2KRMA 1ZUYA 2M0YA 1GBRA 1UTIA 1JU5C 1YWPA 2L0AA 5FW9A 2JS2A 1H8KA 1OEBA 3VS6A 1UGVA 1WXUA 1KSWA 1GBQA 2BTTA 2GNCA 1UFFA 2LJ0A 3ULRB 2RN8A 1HD3A 1KIKA 1S1NA 2PZ1A 4DEYA 4F14A 2AKLA 1PRMC 3THKA 2QDLA 1KFZA 2J6OA 3EG1A 2RMOA 4AG2C 4FSSA 4RTWA 2I0NA 2HEQA 4J9BA 2DVJA 4AFQC 2NUZA 3IQLA 1T0JA 2LQNA 1NYGA 4AG1C 4X1VA 2DL8A 4OMOA 2DL7A 4E6RA 1VYTA 1MV3A 1HSQA 1QKXA 1Y0MA 4RTVA 2EYYA 2O31A 2JM9A 3H0IA 2EPDA 3UA7A 3REAB 2G6FX 3EG0A 5ECAA 2DL3A 2HCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGU A;  1AWJ A;  1SPK A;  2ABL A;  4GLM A;  3ZL7 C;  2D8J A;  1JEG A;  1UJ0 A;  1PKT A;  1G2B A;  2SRC A;  1WXT A;  3M0U A;  1WA7 A;  2FO0 A;  2W10 A;  1I0C A;  4RTU A;  2FEI A;  2CSI A;  2DF6 A;  2OI3 A;  1AD5 A;  4OMP A;  2B86 A;  2O2O A;  4J9C A;  2VKN A;  1V1C A;  2K9G A;  2RF0 A;  4M4Z A;  2JMA A;  1Z9Z A;  2GTO A;  1HJD A;  1M30 A;  2ED0 A;  3EHQ A;  1ABQ A;  2DMO A;  2BZX A;  4J9G A;  2PNI A;  4J9F A;  4J9H A;  4OML A;  4JZ3 A;  2A28 A;  1NEG A;  2BZ8 A;  2C0T A;  2V1R A;  2FPE A;  2DRM A;  3UF4 A;  1OOT A;  1WDX A;  3CQT A;  3PE0 A;  1YCS B;  2VVK A;  1M3B A;  1VA7 A;  1UDL A;  1G83 A;  1GRI A;  2KT1 A;  4K11 A;  2RQV A;  2V1Q A;  2CT3 A;  1T0H A;  2EYW A;  5FWB A;  1K1Z A;  3M0S A;  5IHI A;  1SRL A;  4EIK A;  1W1F A;  1UHF A;  1PNJ A;  2RQW A;  1BK2 A;  2GBQ A;  1YNZ A;  4CC7 A;  3NHN A;  1E6H A;  1QCF A;  3VS5 A;  3I35 A;  2O88 A;  1VYV A;  4LUE A;  3JV3 A;  2KRO A;  2DJQ A;  2CUD A;  1SEM A;  3NGP A;  1I07 A;  1MV0 B;  2AKK A;  1AZG B;  2RPN A;  2EGA A;  2KYM A;  2KRN A;  1LCK A;  2EW3 A;  2DX1 A;  2EKH A;  1TUC A;  1QWE A;  1X69 A;  1AOJ A;  2EGE A;  1T3S A;  2F2V A;  1TG0 A;  1VYU A;  5IXB A;  1K4U S;  1UG1 A;  1IO6 A;  1YP5 A;  3EG3 A;  2D1X A;  2KEA A;  2ED1 A;  1ARK A;  2EYZ A;  1WLP B;  4HVW A;  4CC4 B;  3TSW A;  2FPF A;  3REB B;  1B07 A;  2L3S A;  4LE9 A;  1FYN A;  1NLO C;  3C0C A;  2LQW A;  2LJ3 A;  2YT6 A;  5GJV B;  2YSQ A;  1U5S A;  1AZE A;  2JT4 A;  2FPD A;  3I5S A;  1W70 A;  2YUN A;  2F2X A;  2C0O A;  3H0F A;  1WFW A;  1UHC A;  2M51 A;  2W0Z A;  5IHN A;  1BBZ A;  4AFU C;  3VRY A;  5IH2 A;  2O9V A;  2DL4 A;  1E6G A;  1WYX A;  2C0I A;  1M3C A;  2DRK A;  2O9S A;  2K7A A;  4Y92 A;  2DBM A;  1Y57 A;  4RTT A;  5EC7 A;  1U3O A;  1GCQ C;  2KNB B;  1ZUU A;  1PHT A;  1YWO A;  4IIO A;  1QLY A;  4JJB A;  2HSP A;  3M0P A;  4J9D A;  1RI9 A;  1RUW A;  3VS3 A;  1K76 A;  2HDA A;  4LUD A;  4RTX A;  2SEM A;  2KXC A;  1UE9 A;  1U06 A;  3A98 A;  2A37 A;  2EQI A;  2LZ6 B;  3M0Q A;  3O5Z A;  3FJ5 A;  3M0R A;  5I22 A;  1WX6 A;  3VS7 A;  4LN2 A;  3QWX X;  2VWF A;  2DBK A;  3M0T A;  2MIO A;  2EBP A;  2DNU A;  2YUP A;  5FWC A;  2GQI A;  3UAT A;  2JTE A;  2KR3 A;  1OPK A;  4RUG A;  1FMK A;  2KYB A;  4HVV A;  1B3Q A;  3I5R A;  2ROT A;  4RTZ A;  4JJD A;  1X2K A;  2KT8 A;  2FRW A;  4AFZ C;  1NEB A;  4AFS C;  4A63 B;  2AZV A;  4CC2 A;  1PWT A;  2J06 A;  2KXD A;  2XMF A;  2KE9 A;  1BB9 A;  2P4R A;  2DM1 A;  1SRM A;  2HBW A;  1AWX A;  3R6N A;  1GFC A;  1JXM A;  4JJC A;  2DE0 X;  4Z89 A;  4KRT A;  1ZUK A;  3NPF A;  2LX7 A;  1KJW A;  5I11 A;  2DYB A;  4DEX A;  1NM7 A;  2CDT A;  4F16 A;  1H92 A;  1X27 A;  2D0N A;  4F17 A;  1N5Z A;  1BU1 A;  1SHF A;  2L3Q A;  5GJW B;  2IIM A;  2X3W D;  3KFV A;  2DLP A;  2ENM A;  1CKB A;  2AZS A;  2CRE A;  1K0S A;  4WCI A;  4OMQ A;  1CKA A;  2DA9 A;  1AWO A;  2K79 A;  1TUD A;  2OAW A;  1E7O A;  2JS0 A;  5IHK A;  1XOV A;  2DL5 A;  2CH4 W;  1W6X A;  2BZY A;  2EGC A;  2LNH B;  4OMM A;  1UEC A;  1WIE A;  2F2W A;  2GTJ A;  1AEY A;  2CH4 A;  1ABO A;  1GCQ A;  2J05 A;  1RLP C;  1JXO A;  2A08 A;  4R0K A;  1AWW A;  2GGR A;  4D8D A;  4ORZ A;  3TVT A;  1UJY A;  4ZNX A;  3NMZ C;  1UUE A;  2YDL A;  1M3A A;  2KGT A;  1JO8 A;  3RNJ A;  3U23 A;  4JPB W;  2FRY A;  3PVQ A;  2K6D A;  2RQR A;  3VS0 A;  1WI7 A;  4J9E A;  1PRL C;  1SHG A;  2FG0 A;  4LNP A;  3I9Q A;  1GFD A;  2H8H A;  3H41 A;  2RQT A;  1PKS A;  2LJ1 A;  1NYF A;  2AK5 A;  3VRZ A;  1I1J A;  2E5K A;  1M27 C;  2K3B A;  1YN8 A;  1GCP A;  1OPL A;  2L3P A;  2J7I A;  1ZBJ A;  2J6F A;  3UA6 A;  4HCK A;  2YUO A;  1SSH A;  1X6G A;  1ZLM A;  2D8H A;  1K9A A;  2ECZ A;  4IIM A;  2NWM A;  3RBB B;  1X43 A;  1X6B A;  2JM8 A;  3EHR A;  3VS4 A;  1T3L A;  2MCN A;  2X3X D;  2YUQ A;  2LMJ A;  3LH5 A;  2A36 A;  1QKW A;  1WXB A;  1QWF A;  2KBT A;  2K2M A;  1NLP C;  2JW4 A;  1CSK A;  2PTK A;  2LCS A;  1NG2 A;  4HVU A;  3TSZ A;  2L2P A;  2ROL A;  5HCK A;  4JZ4 A;  4QT7 A;  1X2Q A;  1EFN A;  2EYX A;  1A0N B;  1GL5 A;  1MUZ A;  5IXF A;  3VS1 A;  1OV3 A;  1ZSG A;  1JQQ A;  4OMN A;  4CC3 A;  3EG2 A;  4GBQ A;  3SEM A;  1AVZ C;  2KRS A;  3QWY A;  2MOX A;  3SHW A;  3GBQ A;  2DIL A;  2OJ2 A;  4D8K A;  4HXJ A;  1Z9Q A;  4Z88 A;  4ESR A;  2CT4 A;  2RQU A;  5L23 A;  1M8M A;  1J3T A;  1K0X A;  1ZX6 A;  1RLQ C;  2RNA A;  2CUB A;  2CSQ A;  2JMC A;  4RTY A;  3VS2 A;  2EVR A;  4Z8A A;  2LP5 A;  2JXB A;  3PVL A;  2ESW A;  2J6K A;  3H0H A;  1H3H A;  4J9I A;  2KRM A;  1ZUY A;  2M0Y A;  1GBR A;  1UTI A;  1JU5 C;  1YWP A;  2L0A A;  5FW9 A;  2JS2 A;  1H8K A;  1OEB A;  3VS6 A;  1UGV A;  1WXU A;  1KSW A;  1GBQ A;  2BTT A;  2GNC A;  1UFF A;  2LJ0 A;  3ULR B;  2RN8 A;  1HD3 A;  1KIK A;  1S1N A;  2PZ1 A;  4DEY A;  4F14 A;  2AKL A;  1PRM C;  3THK A;  2QDL A;  1KFZ A;  2J6O A;  3EG1 A;  2RMO A;  4AG2 C;  4FSS A;  4RTW A;  2I0N A;  2HEQ A;  4J9B A;  2DVJ A;  4AFQ C;  2NUZ A;  3IQL A;  1T0J A;  2LQN A;  1NYG A;  4AG1 C;  4X1V A;  2DL8 A;  4OMO A;  2DL7 A;  4E6R A;  1VYT A;  1MV3 A;  1HSQ A;  1QKX A;  1Y0M A;  4RTV A;  2EYY A;  2O31 A;  2JM9 A;  3H0I A;  2EPD A;  3UA7 A;  3REA B;  2G6F X;  3EG0 A;  5ECA A;  2DL3 A;  2HCK A; 
#chains in the Genus database with same CATH topology
 1M90 R;  3ZL7 C;  4GLM A;  1JEG A;  2SRC A;  1G2B A;  1OX8 A;  4JRI A;  2E64 A;  2DF6 A;  2G3R A;  2P0P A;  4E7H A;  2VKN A;  2X4X A;  1QCN A;  1QP3 A;  3LLR A;  3CPW A;  3ZFJ A;  4LDY A;  1M30 A;  2QQA A;  2DMO A;  3QDF A;  2RHY A;  3JCM f;  4J9G A;  4JZ3 A;  5FLX E;  3VKI A;  3MP1 A;  3G4S T;  5A0L A;  2BZ8 A;  3OY9 A;  4C8Q D;  2FPE A;  3E9G A;  5CAI A;  6AT1 B;  1OOT A;  1MMN A;  2VVK A;  3P8H A;  2NUT B;  8ATC B;  2QEX Q;  1VQ5 Q;  4L59 A;  3T9N A;  3G6E Q;  3CPW P;  2OTL T;  2CT3 A;  5LL6 S;  1NZ9 A;  5IHI A;  4EIK A;  2CP6 A;  1NJI C;  2LC4 A;  2RQW A;  1C1A A;  4CC7 A;  4N0A A;  1MNE A;  1IRX A;  2F5K A;  1I07 A;  2RPN A;  3BY7 A;  2EGA A;  3RES A;  3CCJ T;  2EW3 A;  1G3T A;  3J7A F;  1AOJ A;  1PD0 A;  1YJW A;  3P8B B;  4FW1 A;  1K4U S;  4FYV B;  4OGC A;  1YP5 A;  2ED1 A;  3CCJ A;  4PJO G;  1M1F A;  2VYT A;  3SWN A;  2Z0W A;  3REB B;  1B07 A;  3LWH A;  1NLO C;  2HKN A;  2YT6 A;  5GJV B;  3CCS T;  2YSQ A;  5KYU B;  1G3Y A;  2K2V A;  3CCL T;  3OB9 A;  1H3Z A;  2DD4 A;  3L2W A;  5LJ3 j;  4DBF A;  3NFC A;  3QKJ A;  2FPD A;  1IHW A;  2YUN A;  2OTJ T;  4IUR A;  1TS9 A;  2C0O A;  5LJ5 g;  3CME A;  1R8O B;  1YJ9 Q;  3CCS A;  1WFW A;  2M51 A;  3JRZ A;  3DB3 A;  1VQ4 Q;  3E2U A;  1VQ9 T;  1RAA B;  2O9V A;  4C92 D;  1B34 B;  4FCY A;  2C0I A;  3RIR A;  4E7Z A;  5KE3 A;  2EJF A;  4PJO B;  4XU2 A;  1QMC A;  2DBM A;  4C0D C;  4XU1 A;  1NE8 A;  1U3O A;  1KQ1 A;  1SG5 A;  1VQ9 A;  3A5Z B;  4EDU A;  4QW2 A;  1QLY A;  4JJB A;  2HSP A;  1BI2 A;  3JCM b;  1KK7 A;  2LX9 A;  2GQV A;  2QAS A;  4RTX A;  1LJO A;  1UE9 A;  3A98 A;  3BFM A;  2LZ6 B;  3M0Q A;  3FJ5 A;  1Q82 U;  2M9U A;  3CXC S;  2DBK A;  2DER A;  2MIO A;  4PLI A;  3JCM d;  5FU7 C;  5FWC A;  1YIT T;  2PUO B;  1R77 A;  1OPK A;  1BIB A;  2EJ9 A;  2ROT A;  1PM3 A;  4Z02 A;  1VQN Q;  5KYU A;  1X2K A;  2YXY A;  1K8A R;  4AFS C;  3OYD A;  1YIT A;  3JB9 F;  3MPU B;  2H3J A;  3H6Z A;  2KXD A;  2XMF A;  2ZCF B;  4XTW A;  2GFA A;  4M7D E;  1Q86 C;  2DM1 A;  1YHQ Q;  3TU4 K;  1KQS S;  2LCL A;  2IG0 A;  4JJC A;  4BE2 A;  1VQO T;  4KRT A;  2VUB A;  4F7U G;  1B34 A;  4F16 A;  1Q7Y U;  3OA6 A;  4C5I A;  1JB0 E;  4ELY C;  3JCM W;  2AIR B;  2HZY A;  5CR2 A;  1SHF A;  3PIP A;  1VQO A;  1CKB A;  2KAF A;  1K0S A;  4OMQ A;  2KSS A;  1TUD A;  4ATO A;  2OAW A;  1ACM B;  3OW2 S;  1FMW A;  4M7D C;  3CBP A;  4M77 D;  1VQ6 A;  3CC2 T;  3LH0 A;  2RI3 A;  2LTO A;  5CCA A;  2DL5 A;  2CH4 W;  1VUB A;  2LNH B;  4OF1 A;  4X34 A;  1ZA2 B;  1N6A A;  5LJ3 g;  1AEY A;  3GLX A;  1S72 T;  4BY6 C;  2RO0 A;  2J05 A;  3PTA A;  3CC2 A;  2GGR A;  2MWO A;  4F7U B;  3NMZ C;  3A8O B;  2GF7 A;  2QTX A;  2VAS A;  3EFR A;  3U23 A;  4C0G A;  1S72 A;  3CC4 Q;  3VS0 A;  2L89 A;  3QUI A;  1QVP A;  4J9E A;  1BI3 A;  2AT1 B;  3WVE B;  1D1C A;  3FC3 A;  2QK0 A;  3JB9 H;  4PJJ A;  2QQS A;  2KK4 A;  1D1B A;  3CCM T;  1YI2 T;  2H8H A;  3H41 A;  2JTF A;  5IN1 A;  2LT4 A;  2AK5 A;  1JRI A;  1QQJ A;  1DJ7 B;  1OUL A;  4KUL A;  1YI2 A;  3MO8 A;  2J6F A;  5GMK l;  3UA6 A;  4EMG A;  2LDM A;  4C8Q F;  3LGF A;  1YCY A;  4VUB A;  5GAM e;  1ZLM A;  1KC8 U;  2D8H A;  3HPW A;  3CCE A;  4X9D A;  1TU0 B;  1X6B A;  2JM8 A;  2E65 A;  3LW5 E;  3EHR A;  1T3L A;  4O5V A;  1WHK A;  4E7K A;  1RI0 A;  4C8Q E;  1NG2 A;  4HVU A;  2ROL A;  2MYS A;  2BE7 D;  1SKU B;  5HCK A;  3L2R A;  4QT7 A;  4JS4 A;  1ZHI A;  1Y96 B;  1O75 A;  1UGQ B;  3CC7 T;  1PSF A;  3ZEH A;  4F7U A;  2HSE B;  1I4K 1;  1GL5 A;  2HQH A;  2PUK B;  1JQQ A;  4L6V 5;  2EIF A;  4OMN A;  1M8V A;  3VU3 C;  4DQ2 A;  3OW2 A;  3QDR B;  2KRS A;  1V29 B;  3QWY A;  4OB0 B;  1VQK T;  1WJR A;  3N5B B;  2EFI A;  1NJI R;  2RK2 A;  4XU3 A;  4D8K A;  2DIG A;  3CC7 A;  1Z9Q A;  4EMK B;  4RCB A;  1J3T A;  3L1A A;  2XDD A;  1VQK A;  2JMC A;  3VS2 A;  4MMK A;  3H8Z A;  3G1J A;  4JLI A;  3C94 A;  2J6K A;  3AT1 B;  4II1 A;  1M2V B;  3S3N A;  2ZGW A;  4N0A C;  3OW2 P;  3UWN A;  4M75 D;  1YWP A;  2L0A A;  3ASK A;  3VUB A;  1GBQ A;  5GAO n;  2PZ1 A;  5HKC A;  5EG2 A;  3THK A;  2J6O A;  1ZBX A;  2XHC A;  3DLL A;  4FSS A;  2I0N A;  2LT1 A;  4C92 F;  4X1V A;  4J8O A;  1MV3 A;  2QYZ A;  4A4K A;  2O31 A;  3SWN C;  2JM9 A;  1TTH B;  2RHZ A;  4X9C A;  3UA7 A;  1F1B B;  3M9Q A;  2VB6 A;  4PLL A;  2G6F X;  5CVI A;  5J3B A;  1VQ8 T;  4LXC A;  5ECA A;  1Y96 A;  1UJ0 A;  4NL3 A;  4DBQ A;  1K9M U;  1AWJ A;  1KD1 C;  1ZSZ A;  2M0O A;  2D8J A;  4C92 E;  1LNX A;  2FO0 A;  1G8X A;  1I0C A;  2M1H A;  2FEI A;  2CSI A;  1VQ8 A;  1YIJ T;  2A3L A;  4LD9 K;  1X6O A;  4EMK A;  1QP2 A;  4XU0 A;  4E2F B;  3CCU T;  3E9F A;  2L8D A;  2JMA A;  1Z9Z A;  4E7J A;  4RMO A;  3FIF A;  1Q82 R;  5D6W A;  1C6V X;  1HK9 A;  2DZC A;  3CBO A;  3Q1J A;  3A8M B;  3L2V A;  1M5Q 1;  3CCV A;  2FL7 A;  1M2V A;  3V7R A;  1K8A C;  3CCU A;  5GAO m;  4FSX A;  2DRM A;  1VQL T;  1IHV A;  3I55 A;  5CO7 A;  1YBY A;  1YJW Q;  3KUF A;  4YTL A;  2DVE A;  1HYO A;  1GRI A;  2KT1 A;  4K11 A;  3CEY A;  2ZPF B;  2V1Q A;  2WSF E;  5GAN e;  3CCJ Q;  5LJ5 f;  1VQL A;  3CBM A;  4EPC A;  1SRL A;  1BKB A;  4C8Q G;  5DM7 R;  1PNJ A;  2YRV A;  2DIQ A;  3VS5 A;  4PJN A;  1WHM A;  1VYV A;  2CUD A;  1EIF A;  1MV0 B;  2AKK A;  4A4E A;  4OB1 B;  2KRN A;  2EKH A;  1QWE A;  2MF2 A;  1X69 A;  4BD3 A;  2DXT A;  3CME Q;  3OS0 A;  1VYU A;  4M77 F;  5IXB A;  3S3O A;  3OMC A;  3CCS Q;  2HL5 C;  3HRS A;  2D1X A;  3GF5 A;  1SSF A;  3CCR A;  4N4H A;  2RD1 A;  2EYZ A;  1WLP B;  3PMI A;  4CC4 B;  3MCA B;  3TSW A;  2FPF A;  2L3S A;  4LE9 A;  3CPF A;  3C0C A;  5J26 A;  4C8Q B;  4AMC A;  2XID A;  4M77 E;  1VQ9 Q;  2E4H A;  4CRI A;  4Q5W A;  4IKF A;  5GAN 5;  2JUF A;  2RI2 A;  2W0Z A;  5IHN A;  1NPR A;  2HQX A;  5GAN 6;  5GAO r;  4EMH A;  1D0X A;  1WNL A;  4IUQ A;  3INZ A;  1M2O A;  1M3C A;  4KUI A;  2Y90 A;  3OYH A;  2K7A A;  3RKW A;  2HD0 A;  1Y57 A;  2EYQ A;  5A0D A;  3X26 B;  2CZ0 B;  2PVD B;  5FU6 B;  5I2M A;  4IIO A;  3SWN B;  1W2B S;  3QZ5 B;  2YRC A;  3PFS A;  1WPY A;  1RI9 A;  3GNG A;  4C92 G;  1RUW A;  2BIV A;  2K5F A;  1YIT Q;  2SEM A;  2CP3 A;  1D3B B;  2EQJ A;  2EQI A;  2FZC B;  3M0R A;  3MET A;  1PC0 A;  1KC8 R;  2E5Q A;  1VQP T;  4LN2 A;  2R58 A;  4F7U F;  5GAN 8;  2DNU A;  4BE0 A;  2YUP A;  3VV0 A;  5D6Y A;  2PQW A;  2D9T A;  2MI6 A;  3UAT A;  2JTE A;  2KR3 A;  3OBY A;  4RUG A;  1FMK A;  1IB8 A;  1D1A A;  1B3Q A;  2KYB A;  3G4S A;  5LJ3 f;  4C8Q A;  2BKD N;  4OGE A;  2GFU A;  3URG A;  4JJD A;  1X01 A;  4ME7 A;  1VQO Q;  3HRU A;  1XTD A;  2KT8 A;  3M4Y A;  4GY5 A;  2K57 A;  2LQK A;  1MHN A;  4A63 B;  4F7U E;  1LOJ A;  1U8R A;  4CC2 A;  2E6N A;  4OP0 A;  2KE9 A;  5LJ5 d;  2MK5 A;  3MP8 A;  4PKC C;  4C92 B;  1VQ6 Q;  5GAO q;  1D0Y A;  2OTL A;  3UT1 A;  2QA4 T;  3OSV A;  1MMG A;  4Z89 A;  1ZUK A;  2VV5 A;  3MJX A;  3NPF A;  3JCM h;  2DYB A;  2OX7 A;  1X27 A;  4F17 A;  1N5Z A;  3DKM A;  4J83 A;  2JJ9 A;  4XAX B;  5KCH A;  3CC2 Q;  5J39 A;  3C4S A;  2L3Q A;  5GJW B;  2QGF B;  2DLP A;  2QA4 A;  2ENM A;  5I2S A;  2F5T X;  4J7F A;  4BAC A;  1WQW A;  2AZS A;  4WCI A;  1S72 Q;  1CKA A;  3PT9 A;  4M78 D;  1BIA A;  3EGX A;  2JS0 A;  1D3B A;  3L42 A;  3X25 B;  2CYZ B;  4FYY B;  1W6X A;  3MEW A;  4KGZ B;  4MML A;  4E7L A;  2MMP A;  1UEC A;  2FZK B;  2F2W A;  3OYF A;  1KG1 A;  2COY A;  1M1K C;  1ABO A;  3QXE B;  1GCQ A;  2K3X A;  1JXO A;  3M55 A;  1R0C B;  2A08 A;  4OB3 B;  3JCM e;  4D8D A;  3CCL A;  4RKU E;  5DLQ E;  3TRE A;  1UJY A;  4M77 G;  1M1K U;  1YI2 Q;  3VJP A;  1VQ7 T;  2DJZ A;  4MZT A;  2RB6 A;  2OTJ A;  1JO8 A;  4JPB W;  2RJD A;  1BCM A;  2K6D A;  2RQR A;  3M5A A;  3CCE Q;  2QQB A;  4KUD K;  2DYI A;  1SHG A;  2FG0 A;  4NS5 A;  3MEA A;  5KYY B;  3G71 T;  3I9Q A;  3P8D A;  2E1H A;  1VQ7 A;  3LWI A;  1K73 U;  4C92 A;  7AT1 B;  2FB7 A;  2JZ2 A;  1PKS A;  2V8I A;  2VGN A;  1KD1 R;  1NYF A;  2A0F B;  2CS7 A;  3VRZ A;  1D09 B;  2ZPE B;  1Q82 C;  4M7A D;  1VQM T;  3MP6 A;  2K3B A;  3G71 A;  1YN8 A;  3OYK A;  4IUT A;  5GAN 7;  2J7I A;  2C06 A;  1HXD A;  4V2S A;  3M53 A;  3FLG A;  4MDX A;  2YUO A;  4M77 B;  1K9A A;  2ECZ A;  2E6Z A;  3OYG A;  1XQH A;  1U1T A;  4HCZ A;  1ZSZ C;  4PFO A;  2ZAE A;  1XNI A;  3CC7 Q;  2X3X D;  2LMJ A;  1PCX A;  3ER0 A;  2XDP A;  3JCM Q;  1Q81 C;  5CKH A;  2PTK A;  2LCS A;  1VQK Q;  4ELZ C;  5LJ3 d;  2L2P A;  3TSZ A;  4EMK C;  1G3W A;  2KVQ G;  1Q81 U;  3GP8 A;  2L5Q A;  4N4I A;  1Q7Y C;  1WZO A;  2RA2 A;  5IXF A;  1ZSG A;  3EG2 A;  3SEM A;  1AVZ C;  3ME9 A;  4BI8 B;  2DIL A;  4BI3 A;  1VQ5 T;  5KYY A;  2CT4 A;  3RMS A;  4PJO D;  3HRT A;  1KHI A;  2RNA A;  3RKY A;  2Y4X A;  2EVR A;  2XK0 A;  5AYF A;  3SFM A;  1ZQ1 A;  4J9I A;  2DTO A;  1ZUY A;  1UTI A;  1JU5 C;  5KCO A;  5FW9 A;  1IXD A;  1H8K A;  1RAI B;  1KIK A;  1UFF A;  1HD3 A;  1RAB B;  1S1N A;  5GMK h;  4M77 A;  4DEY A;  4F14 A;  1PRM C;  2YHT A;  2XG8 D;  3EG1 A;  5GAM h;  4AG2 C;  1VQ8 Q;  1Q95 G;  2HEQ A;  3JCM X;  2NUZ A;  3IQL A;  2LQN A;  2DL8 A;  3PIO A;  3C95 A;  2QTV A;  2DL7 A;  3GNF B;  2KQW A;  1QKX A;  1IZ6 A;  1QCO A;  1UGR B;  2NYS A;  1WHL A;  2EYY A;  2R5M A;  2V8J A;  4RCC A;  3CXC A;  3CCV Q;  5GMK j;  3OQ5 A;  2E10 A;  3OMG A;  1OX9 A;  3ZBD A;  3CCU Q;  1O9S A;  3FJP A;  3J81 E;  1SPK A;  2ABL A;  3V7C A;  4C5H A;  5GAM j;  1TWB A;  1WXT A;  3I55 Q;  2W10 A;  2M02 A;  4HA8 A;  3PGG A;  1M90 U;  1N8R U;  3CCM A;  1AT1 B;  3JB9 I;  1KC8 C;  5GMK e;  2B86 A;  2O2O A;  4J9C A;  2P4T A;  1VQ4 T;  2NLU A;  4Y91 A;  1V1C A;  4MZM A;  3HFO A;  5IAY A;  1VQL Q;  2D6F A;  5DY9 A;  2X4J A;  1OU9 A;  1EZZ B;  2E3H A;  3E1S A;  1ABQ A;  3CXC P;  3TCJ A;  1YJN Q;  4OMF B;  2BZX A;  1B7T A;  2PNI A;  1KQS A;  4OML A;  4ANJ A;  2A28 A;  2R5A A;  4PJL A;  2C0T A;  4ZTF A;  2V1R A;  1NBE B;  1QVG S;  3E19 A;  1TSF A;  3UF4 A;  3CQT A;  1TUG B;  1YCS B;  3M59 A;  4A4H A;  2OAU A;  1MGQ A;  2CP2 A;  4C0F A;  2ZPH B;  2RQV A;  3QJY A;  1ZSZ B;  1T0H A;  3CCR Q;  1K1Z A;  2P0K A;  4PL6 A;  5CIU A;  3M0S A;  3PNW C;  1W1F A;  3OSS C;  1KQS P;  4FU6 A;  1BK2 A;  1E6H A;  2WAC A;  3TQ7 P;  3NTI A;  1QCF A;  3I35 A;  2O88 A;  4LUE A;  3JV3 A;  2KRO A;  2DJQ A;  1SEM A;  3R6O A;  2KI7 A;  3OYE A;  4UC4 A;  4P5N A;  4M78 F;  4C8Q C;  1NPP A;  4FW2 A;  1T3S A;  4B9X A;  2X4W A;  2F2V A;  4QKU A;  1TG0 A;  1JBM A;  1UG1 A;  1IO6 A;  4HT8 A;  2WSC E;  3EG3 A;  1FWZ A;  1WQ7 A;  1ARK A;  2CKK A;  3MEV A;  1I8F A;  4HVW A;  2K4Y A;  3QO3 A;  5GAO p;  3QYG B;  3RR6 A;  2LJ3 A;  3I56 T;  3EFO B;  3SDZ A;  4M75 A;  4CI0 C;  1AZE A;  4QQG A;  1TXQ A;  2JT4 A;  3I5S A;  1W70 A;  4A4F A;  3EGD B;  2F2X A;  1M1K R;  1K9M C;  1I5O B;  5FU6 C;  3I56 A;  1TOV A;  3X20 B;  1SF9 A;  1BBZ A;  3QHS A;  4IUV A;  3VRY A;  3FB9 A;  3A8G B;  4O6J A;  2BUD A;  2DL4 A;  3BDL A;  1H64 1;  4M7A F;  2DRK A;  4B6M A;  3GIB A;  2CP7 A;  1QVF S;  5GAM g;  5GAN h;  2BE9 B;  3LGL A;  2RHU A;  1I5L A;  1GCQ C;  4HCB A;  1ZUU A;  2FYK A;  1D0Z A;  1PHT A;  1YWO A;  2K5L A;  3G4S Q;  4NL2 A;  4PJM A;  1QVG A;  3JAM E;  2CZ1 B;  4J9D A;  3SD4 A;  3VS3 A;  4WTO B;  3TEE A;  2KXC A;  2LRQ A;  1U06 A;  2A37 A;  4M7A E;  4FIB A;  4A54 A;  1YIJ A;  3HP9 A;  2OTL Q;  4IUP A;  1RL2 A;  3QWX X;  1GXI E;  5GAN j;  4Y28 E;  2K3Y A;  4C92 C;  2V26 A;  4QVC A;  2GQI A;  1BYM A;  3V8J A;  1QVG P;  4HVV A;  4TVR A;  3BE3 A;  3EFO A;  2QA4 Q;  2GCX A;  3CMA T;  2FRW A;  4AFZ C;  1Q81 R;  4NOY A;  3EH2 A;  3JCM V;  3RMQ A;  4M7D D;  3BDU A;  5FRO A;  2AZV A;  3CPW S;  1PWT A;  3EGD A;  2NUP B;  3NTH A;  1IGU A;  2P4R A;  1OZ2 A;  1SRM A;  2HBW A;  1AWX A;  1Q7Y R;  3R6N A;  1GFC A;  3CMA A;  1JXM A;  5DLO A;  3OYJ A;  3RDV A;  3HL8 A;  5I11 A;  4DEX A;  2CDT A;  2RH2 A;  3OYA A;  2D0N A;  3JB9 D;  2CZ7 B;  3QSU A;  4B9W A;  4FL6 A;  1U1S A;  3CCL Q;  4PFP A;  4JUV A;  2HNI A;  2IIM A;  3KFV A;  4PNO A;  5L8R E;  2MAM A;  4J7I A;  4JS5 A;  2CRE A;  2IPO B;  2OTJ Q;  1AWO A;  2K79 A;  2O01 E;  5GAO l;  3EH1 A;  2LVM A;  2E41 A;  2RJF A;  5IHK A;  4KGV B;  4R56 A;  1RAD B;  4IUU A;  2BZY A;  2EGC A;  1VQ7 Q;  4OMM A;  3KBG A;  2LQ8 A;  5C0M A;  4JRQ A;  2JNG A;  1Y07 A;  1G3S A;  2ZPI B;  4M78 G;  2CP0 A;  3FEO A;  1QVF A;  3CD6 T;  1RLP C;  4R0K A;  1G5V A;  4ORZ A;  3G71 Q;  4ZNX A;  3SB2 A;  3PMT A;  2YDL A;  2QI2 A;  4KH0 B;  4DBH A;  1M3A A;  1UGS B;  4LD6 A;  3RNJ A;  2P84 A;  4LDX A;  9ATC B;  3EAE A;  2FRY A;  3CD6 A;  1WI7 A;  2CP5 A;  2DET A;  4N4G A;  4LNP A;  2NUP A;  4QVD A;  3LYI A;  3G7Z A;  4M77 C;  5IT9 E;  3EGX B;  2LNV A;  5LJ5 e;  1QVF P;  1N8R R;  4DOW A;  3OYI A;  2DEU A;  1I1J A;  2ZPG B;  2E5K A;  1KQ2 A;  1GCP A;  4FT2 A;  1OPL A;  2JTM A;  2L3P A;  2X9H A;  2WSE E;  4M78 B;  3JCM c;  2RI5 A;  1Y71 A;  4JRK A;  2DXB A;  2P0Q A;  3MHX A;  4HCK A;  2E70 A;  1IRE B;  3GPL A;  3M4G A;  5GAN g;  1X6G A;  4M7A G;  2NWM A;  3OYN A;  3RBB B;  4PK4 A;  3OS2 A;  1OU8 A;  1VQP A;  2RK1 A;  2EJG A;  2VXF A;  1WXB A;  1QWF A;  2KDS A;  1PSE A;  2DPP B;  4JZ4 A;  3OBW A;  4XTY A;  4BDZ A;  1A0N B;  3O8V A;  1OV3 A;  4CC3 A;  4XTX A;  3RUX A;  1LVK A;  1JJ2 S;  2MOX A;  4QQ6 A;  1YJW T;  3GBQ A;  2EQM A;  2OJ2 A;  4HXJ A;  4ESR A;  3CCQ T;  4LDV A;  4RG2 A;  4MZP A;  4M75 F;  4M7A B;  1NJI U;  2EQK A;  2DEQ A;  2O4X B;  1M8M A;  2FHD A;  1RLQ C;  3M58 A;  1WHH A;  2CSQ A;  2FZG B;  5LJ3 h;  2RHX A;  2VGM A;  3WVD B;  2ESW A;  3CCQ A;  4C5E A;  2DKG A;  3JCM J;  2M0Y A;  3L2Z A;  1GBR A;  3HSB A;  2HL3 A;  4M78 A;  1OEB A;  3VS6 A;  1UGV A;  1WXU A;  2LJ0 A;  2BTT A;  4M75 E;  1C0M A;  2RJE A;  4DBR A;  2F1L A;  2EAY A;  3QII A;  3CME T;  2QDL A;  3BW1 A;  1KFZ A;  1M9S A;  3CCM Q;  5AT1 B;  1OZ3 A;  1W2B A;  3UDC A;  2JN0 A;  4LDU A;  4RTW A;  4FM4 B;  3JSC A;  4BDY A;  1NYG A;  4ZN1 A;  4AG1 C;  1BCO A;  1K73 C;  4E6R A;  1WHJ A;  2DXU A;  1VYT A;  1HSQ A;  4RTV A;  5GMK i;  1K9M R;  3L2U A;  1YFN A;  1FXX A;  3H0I A;  2EPD A;  2NUT A;  5LJ3 e;  4QQD A;  3OS1 A;  2DL3 A;  3EGU A;  4ZN3 A;  1WJQ A;  4M75 C;  4XTZ A;  2DAQ A;  3EG9 B;  4RG8 A;  1PKT A;  5GAN 2;  3M0U A;  1WA7 A;  1W2B P;  2EKO A;  4RTU A;  2OI3 A;  1AD5 A;  1Y7X A;  4OMP A;  5KE2 A;  1TH7 A;  2K5I A;  2K9G A;  4M7A A;  2RF0 A;  4M4Z A;  2O4X A;  2GTO A;  1VQM A;  1HJD A;  2RHI A;  4QVZ A;  3DB4 A;  3S3M A;  2ED0 A;  3EHQ A;  2QXF A;  3V8L A;  1QW1 A;  4J9F A;  4J9H A;  4JDS A;  3A8L B;  3AHU A;  1AHJ B;  1NEG A;  5CKB A;  1JJ2 A;  4M7D F;  1WDX A;  3PE0 A;  2B8A A;  1M3B A;  2R57 A;  2DFU A;  1VA7 A;  1UDL A;  1G83 A;  2YRD A;  1MND A;  4FYX B;  4D6W A;  2EYW A;  5FWB A;  4XQ3 A;  5CKF A;  3VYH B;  5CQX A;  1UHF A;  2HQE A;  2GBQ A;  1I81 A;  1YNZ A;  2PU9 B;  3NHN A;  3RER A;  2QEX T;  3OYB A;  2COZ A;  5M9O A;  1OQK A;  3NGP A;  3VUZ A;  1AZG B;  5HY6 A;  3G6E T;  1JJ2 P;  2KYM A;  1LCK A;  2HKQ B;  2DX1 A;  4ZGJ B;  1TUC A;  3M56 A;  5GAM f;  2MPX C;  3M54 A;  3RKX A;  1Q86 U;  2XU8 A;  2V8K A;  3L2Q A;  2EGE A;  3F70 A;  3UPU A;  2QEX A;  3HFN A;  3EG9 A;  2D0Q B;  3I56 Q;  1X75 C;  1VQ5 A;  2DD5 A;  2HMA A;  3OYM A;  4OVA A;  4PJO A;  1VQ6 T;  3G6E A;  2KEA A;  3JCM g;  3QPH A;  3H9N A;  3JB9 J;  3QYH B;  1FYN A;  2LQW A;  2XI9 A;  3OYY A;  1MMA A;  5GMK m;  2KMT A;  3DLM A;  2EQU A;  4JRP A;  1U5S A;  2E3I A;  5HK0 A;  2YLB A;  2XDB A;  4M75 G;  4C0Z A;  1VIE A;  2DK3 A;  5CQY A;  3H0F A;  2RM4 A;  2VC8 A;  3MKD A;  2AHJ B;  1WHG A;  1UHC A;  1YIJ Q;  3C12 A;  3MEU A;  4AFU C;  3X24 B;  1IGQ A;  5IH2 A;  1M90 C;  2X35 A;  1N8R C;  1WJS A;  1E6G A;  3A1P A;  4KT0 E;  1WYX A;  2LCC A;  4JJN K;  4BB7 A;  2O9S A;  1YJ9 T;  4Y92 A;  2QAZ A;  4RTT A;  5EC7 A;  2KNB B;  4FYW B;  4XTU A;  2PVO B;  3NTK A;  2XD0 A;  2I2L A;  3M0P A;  2E12 A;  1OYX A;  1K76 A;  1BI0 A;  2HDA A;  4LUD A;  1YJ9 A;  3CCE T;  4M75 B;  3O5Z A;  1N9R A;  1MMD A;  4XK8 E;  5I22 A;  1VQ4 A;  1WX6 A;  3VS7 A;  2DTH A;  2XKO C;  3CMA Q;  5CKE A;  1RAC B;  2VWF A;  2DTI A;  4C0D B;  3M0T A;  2EBP A;  2QDY B;  2F69 A;  2RJC A;  5KYN A;  1PG5 B;  3VYG A;  2FVU A;  1RAE B;  2KY9 A;  3I5R A;  3HKS A;  1N27 A;  3QBY A;  2JVV A;  4RTZ A;  2QG9 B;  2Y4Y A;  4KGX B;  2CZ6 B;  1NEB A;  3FRN A;  2QGG A;  2J06 A;  3V7S A;  1BB9 A;  4E7S A;  5FU7 B;  1KHC A;  1VOM A;  4BI4 A;  1VQN T;  2DE0 X;  1UB4 A;  2LX7 A;  1KJW A;  1NM7 A;  4LDW A;  1H92 A;  2YWW A;  2DXC A;  4M7D G;  4ZGD B;  1BU1 A;  1BI1 A;  4HT9 A;  4KH1 B;  5GAM d;  1YHQ T;  2X3W D;  1VQN A;  2ZZD A;  3M57 A;  2ATC B;  2DZ9 A;  2QQ9 A;  2XIC A;  2DA9 A;  3HTR A;  3CD6 Q;  1E7O A;  4A53 A;  4M78 E;  3JB9 G;  1YHQ A;  1RAH B;  3D7S B;  1XOV A;  5D6X A;  5KH6 A;  5GAN f;  5C6S A;  1WIE A;  2PVG B;  2GTJ A;  2CH4 A;  4J6W A;  2X51 A;  1AWW A;  4BUG A;  3JCM P;  3TVT A;  4L5G A;  1UUE A;  4M7D B;  2KGT A;  1FMV A;  3KXT A;  3A8H B;  2COW A;  4J5Y A;  3PVQ A;  5HK3 A;  5KYX B;  1K73 R;  4C5G A;  4M78 C;  5KYW B;  2YLC A;  1PRL C;  2DO3 A;  2HBP A;  4BY6 B;  1W4S A;  1GFD A;  4E47 A;  1VQP Q;  4FT4 A;  2RQT A;  5A0G A;  4ZGE B;  8AT1 B;  1FX7 A;  5I21 A;  2LJ1 A;  3OYL A;  3HHT B;  3S6W A;  3CC4 T;  5CK9 A;  2ZPB B;  2IVW A;  4J6X A;  4DA4 A;  1M27 C;  1KD1 U;  1ZBJ A;  3GOX A;  2H3E B;  3CCV T;  1XJW B;  4E7I A;  3J80 E;  2L3R A;  3CC4 A;  5GAN 3;  3EFS A;  1SSH A;  5D7U A;  1RAG B;  4A4G A;  4IIM A;  4XTV A;  3I55 T;  1VIF A;  1X43 A;  3WXM B;  3VS4 A;  2MCN A;  4OB2 B;  2YUQ A;  3LH5 A;  1PD1 A;  1QKW A;  2A36 A;  4WF2 A;  3LX7 A;  2KBT A;  4ZTJ A;  2A7Y A;  3X28 B;  2K2M A;  1NLP C;  2JW4 A;  4AT1 B;  5A2Q E;  4J6Y A;  1CSK A;  2MWP A;  1K8A U;  4M7A C;  1WGS A;  3V8K A;  1X2Q A;  1EFN A;  1M4Z A;  1YJN T;  2CGH A;  4JLG A;  2EYX A;  2VXE A;  3CCQ Q;  4PJO F;  3OS5 A;  1MUZ A;  3VS1 A;  1N9S A;  4M7D A;  4GBQ A;  3FDR A;  4KBM B;  3OYC A;  2X4Y A;  1ZA1 B;  1OI1 A;  3SHW A;  1YJN A;  5KYX A;  5KYW A;  4R55 A;  4HKE A;  4Z88 A;  1Q86 R;  2JOY A;  2RQU A;  1UGP B;  5L23 A;  3CCR T;  1K0X A;  1ZX6 A;  1UEB A;  2M16 A;  4PJO E;  2CUB A;  4RTY A;  4PFZ A;  4Z8A A;  2LP5 A;  5FRN A;  2JXB A;  3PVL A;  4HCC A;  1RAF B;  3H0H A;  5LJ5 h;  1H3H A;  1LPL A;  3QG1 A;  4MDW A;  2KRM A;  4F04 B;  3QJ6 A;  2HAX A;  1V76 A;  2JS2 A;  5FRM A;  1P92 A;  1KSW A;  2GNC A;  3ULR B;  4GLK A;  2RN8 A;  3QZ9 B;  5GAN d;  2AKL A;  2QQR A;  2RMO A;  4BE1 A;  4J9B A;  2DVJ A;  4AFQ C;  1T0J A;  5LJ5 j;  4PJO C;  4OMO A;  1VQM Q;  5GAN 4;  1M1G A;  1EX4 A;  1Y0M A;  4DOV A;  5CKD A;  3REA B;  2EWN A;  3EG0 A;  1R0B G;  2HCK A; 
#chains in the Genus database with same CATH homology
 3EGU A;  1AWJ A;  1SPK A;  2ABL A;  4GLM A;  3ZL7 C;  2D8J A;  1JEG A;  1UJ0 A;  1PKT A;  1G2B A;  2SRC A;  1WXT A;  3M0U A;  1WA7 A;  2FO0 A;  2W10 A;  1I0C A;  4RTU A;  2FEI A;  2CSI A;  2DF6 A;  2OI3 A;  1AD5 A;  4OMP A;  2B86 A;  2O2O A;  4J9C A;  2VKN A;  1V1C A;  2K9G A;  2RF0 A;  4M4Z A;  2JMA A;  1Z9Z A;  2GTO A;  1HJD A;  1M30 A;  2ED0 A;  3EHQ A;  1ABQ A;  2DMO A;  2BZX A;  4J9G A;  2PNI A;  4J9F A;  4J9H A;  4OML A;  4JZ3 A;  2A28 A;  1NEG A;  2BZ8 A;  2C0T A;  2V1R A;  2FPE A;  2DRM A;  3UF4 A;  1OOT A;  1WDX A;  3CQT A;  3PE0 A;  1YCS B;  2VVK A;  1M3B A;  1VA7 A;  1UDL A;  1G83 A;  1GRI A;  2KT1 A;  4K11 A;  2RQV A;  2V1Q A;  2CT3 A;  1T0H A;  2EYW A;  5FWB A;  1K1Z A;  3M0S A;  5IHI A;  1SRL A;  4EIK A;  1W1F A;  1UHF A;  1PNJ A;  2RQW A;  1BK2 A;  2GBQ A;  1YNZ A;  4CC7 A;  3NHN A;  1E6H A;  1QCF A;  3VS5 A;  3I35 A;  2O88 A;  1VYV A;  4LUE A;  3JV3 A;  2KRO A;  2DJQ A;  2CUD A;  1SEM A;  3NGP A;  1I07 A;  1MV0 B;  2AKK A;  1AZG B;  2RPN A;  2EGA A;  2KYM A;  2KRN A;  1LCK A;  2EW3 A;  2DX1 A;  2EKH A;  1TUC A;  1QWE A;  1X69 A;  1AOJ A;  2EGE A;  1T3S A;  2F2V A;  1TG0 A;  1VYU A;  5IXB A;  1K4U S;  1UG1 A;  1IO6 A;  1YP5 A;  3EG3 A;  2D1X A;  2KEA A;  2ED1 A;  1ARK A;  2EYZ A;  1WLP B;  4HVW A;  4CC4 B;  3TSW A;  2FPF A;  3REB B;  1B07 A;  2L3S A;  4LE9 A;  1FYN A;  1NLO C;  3C0C A;  2LQW A;  2LJ3 A;  2YT6 A;  5GJV B;  2YSQ A;  1U5S A;  1AZE A;  2JT4 A;  2FPD A;  3I5S A;  1W70 A;  2YUN A;  2F2X A;  2C0O A;  3H0F A;  1WFW A;  1UHC A;  2M51 A;  2W0Z A;  5IHN A;  1BBZ A;  4AFU C;  3VRY A;  5IH2 A;  2O9V A;  2DL4 A;  1E6G A;  1WYX A;  2C0I A;  1M3C A;  2DRK A;  2O9S A;  2K7A A;  4Y92 A;  2DBM A;  1Y57 A;  4RTT A;  5EC7 A;  1U3O A;  1GCQ C;  2KNB B;  1ZUU A;  1PHT A;  1YWO A;  4IIO A;  1QLY A;  4JJB A;  2HSP A;  3M0P A;  4J9D A;  1RI9 A;  1RUW A;  3VS3 A;  1K76 A;  2HDA A;  4LUD A;  4RTX A;  2SEM A;  2KXC A;  1UE9 A;  1U06 A;  3A98 A;  2A37 A;  2EQI A;  2LZ6 B;  3M0Q A;  3O5Z A;  3FJ5 A;  3M0R A;  5I22 A;  1WX6 A;  3VS7 A;  4LN2 A;  3QWX X;  2VWF A;  2DBK A;  3M0T A;  2MIO A;  2EBP A;  2DNU A;  2YUP A;  5FWC A;  2GQI A;  3UAT A;  2JTE A;  2KR3 A;  1OPK A;  4RUG A;  1FMK A;  2KYB A;  4HVV A;  1B3Q A;  3I5R A;  2ROT A;  4RTZ A;  4JJD A;  1X2K A;  2KT8 A;  2FRW A;  4AFZ C;  1NEB A;  4AFS C;  4A63 B;  2AZV A;  4CC2 A;  1PWT A;  2J06 A;  2KXD A;  2XMF A;  2KE9 A;  1BB9 A;  2P4R A;  2DM1 A;  1SRM A;  2HBW A;  1AWX A;  3R6N A;  1GFC A;  1JXM A;  4JJC A;  2DE0 X;  4Z89 A;  4KRT A;  1ZUK A;  3NPF A;  2LX7 A;  1KJW A;  5I11 A;  2DYB A;  4DEX A;  1NM7 A;  2CDT A;  4F16 A;  1H92 A;  1X27 A;  2D0N A;  4F17 A;  1N5Z A;  1BU1 A;  1SHF A;  2L3Q A;  5GJW B;  2IIM A;  2X3W D;  3KFV A;  2DLP A;  2ENM A;  1CKB A;  2AZS A;  2CRE A;  1K0S A;  4WCI A;  4OMQ A;  1CKA A;  2DA9 A;  1AWO A;  2K79 A;  1TUD A;  2OAW A;  1E7O A;  2JS0 A;  5IHK A;  1XOV A;  2DL5 A;  2CH4 W;  1W6X A;  2BZY A;  2EGC A;  2LNH B;  4OMM A;  1UEC A;  1WIE A;  2F2W A;  2GTJ A;  1AEY A;  2CH4 A;  1ABO A;  1GCQ A;  2J05 A;  1RLP C;  1JXO A;  2A08 A;  4R0K A;  1AWW A;  2GGR A;  4D8D A;  4ORZ A;  3TVT A;  1UJY A;  4ZNX A;  3NMZ C;  1UUE A;  2YDL A;  1M3A A;  2KGT A;  1JO8 A;  3RNJ A;  3U23 A;  4JPB W;  2FRY A;  3PVQ A;  2K6D A;  2RQR A;  3VS0 A;  1WI7 A;  4J9E A;  1PRL C;  1SHG A;  2FG0 A;  4LNP A;  3I9Q A;  1GFD A;  2H8H A;  3H41 A;  2RQT A;  1PKS A;  2LJ1 A;  1NYF A;  2AK5 A;  3VRZ A;  1I1J A;  2E5K A;  1M27 C;  2K3B A;  1YN8 A;  1GCP A;  1OPL A;  2L3P A;  2J7I A;  1ZBJ A;  2J6F A;  3UA6 A;  4HCK A;  2YUO A;  1SSH A;  1X6G A;  1ZLM A;  2D8H A;  1K9A A;  2ECZ A;  4IIM A;  2NWM A;  3RBB B;  1X43 A;  1X6B A;  2JM8 A;  3EHR A;  3VS4 A;  1T3L A;  2MCN A;  2X3X D;  2YUQ A;  2LMJ A;  3LH5 A;  2A36 A;  1QKW A;  1WXB A;  1QWF A;  2KBT A;  2K2M A;  1NLP C;  2JW4 A;  1CSK A;  2PTK A;  2LCS A;  1NG2 A;  4HVU A;  3TSZ A;  2L2P A;  2ROL A;  5HCK A;  4JZ4 A;  4QT7 A;  1X2Q A;  1EFN A;  2EYX A;  1A0N B;  1GL5 A;  1MUZ A;  5IXF A;  3VS1 A;  1OV3 A;  1ZSG A;  1JQQ A;  4OMN A;  4CC3 A;  3EG2 A;  4GBQ A;  3SEM A;  1AVZ C;  2KRS A;  3QWY A;  2MOX A;  3SHW A;  3GBQ A;  2DIL A;  2OJ2 A;  4D8K A;  4HXJ A;  1Z9Q A;  4Z88 A;  4ESR A;  2CT4 A;  2RQU A;  5L23 A;  1M8M A;  1J3T A;  1K0X A;  1ZX6 A;  1RLQ C;  2RNA A;  2CUB A;  2CSQ A;  2JMC A;  4RTY A;  3VS2 A;  2EVR A;  4Z8A A;  2LP5 A;  2JXB A;  3PVL A;  2ESW A;  2J6K A;  3H0H A;  1H3H A;  4J9I A;  2KRM A;  1ZUY A;  2M0Y A;  1GBR A;  1UTI A;  1JU5 C;  1YWP A;  2L0A A;  5FW9 A;  2JS2 A;  1H8K A;  1OEB A;  3VS6 A;  1UGV A;  1WXU A;  1KSW A;  1GBQ A;  2BTT A;  2GNC A;  1UFF A;  2LJ0 A;  3ULR B;  2RN8 A;  1HD3 A;  1KIK A;  1S1N A;  2PZ1 A;  4DEY A;  4F14 A;  2AKL A;  1PRM C;  3THK A;  2QDL A;  1KFZ A;  2J6O A;  3EG1 A;  2RMO A;  4AG2 C;  4FSS A;  4RTW A;  2I0N A;  2HEQ A;  4J9B A;  2DVJ A;  4AFQ C;  2NUZ A;  3IQL A;  1T0J A;  2LQN A;  1NYG A;  4AG1 C;  4X1V A;  2DL8 A;  4OMO A;  2DL7 A;  4E6R A;  1VYT A;  1MV3 A;  1HSQ A;  1QKX A;  1Y0M A;  4RTV A;  2EYY A;  2O31 A;  2JM9 A;  3H0I A;  2EPD A;  3UA7 A;  3REA B;  2G6F X;  3EG0 A;  5ECA A;  2DL3 A;  2HCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...