5GAMj

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
total genus 16
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamj00
1MGQA 3RIRA 5LJ3h 4HT8A 1I4K1 1LNXA 4M7AG 3JB9G 2HNIA 4M7DB 3JCMh 1TH7A 2ZGWA 4PJOF 4QVDA 2DZ9A 5LJ5e 5GAMg 5GAN4 5LJ3f 5GANd 4XTVA 5GAN3 3EFSA 5GAOm 4JRIA 1KQ2A 4M7DE 4C8QA 3JCMf 5GAN6 5GAN2 4M75F 2E1HA 4WF2A 4XU1A 3V8JA 1U1SA 5GAOl 4C92F 1WQ7A 2YHTA 4F7UF 1Y96A 5LJ5h 3JCMX 2FYKA 4M77G 4M78G 5GMKj 4M7DC 5LJ3d 3JB9D 4PJOE 2VC8A 2YLCA 3JB9J 3INZA 3JCMd 4C92B 1I5LA 4M7AF 5GMKh 3EFRA 3RESA 5LJ5f 2YLBA 4HT9A 4NOYA 4JUVA 4M75E 1JBMA 2DXTA 4J6WA 3JCMc 3JCMW 2FB7A 1D3BB 5CAIA 3JB9I 4PJOD 4C92E 2I2LA 1HXDA 4M7AB 2E10A 3V7SA 3M4GA 4F7UE 3JB9H 2RD1A 1JRIA 3GIBA 2E64A 4JLIA 3L2ZA 3BDUA 4M75D 4XTZA 3RKYA 5GAMe 4XTXA 3V7RA 5LJ5d 5GAN8 4M7AE 4EMKB 3V7CA 1X01A 4MMKA 4C92D 3JCMQ 2DZCA 1BIBA 4M77F 4M78F 2RB6A 4XU2A 5LJ5j 4PJOB 4XTUA 3L1AA 2DTHA 4MMLA 3SWNB 1H641 4C8QG 5GAMj 2EJ9A 1WPYA 2EWNA 4M7DA 3RKXA 4QVCA 1BIAA 3V8KA 3QSUA 4M75B 5GAMh 4M7AD 4OP0A 4J5YA 3VU3C 4M77B 4M78B 4RCBA 2DTIA 3QHSA 4JRKA 3HSBA 4DQ2A 2EJGA 2EJFA 2RM4A 4N0AC 4F7UB 5GANg 2CGHA 1B34B 5GAMf 4EMKC 3PGGA 5GMKi 4HA8A 4M78E 4M77E 3BY7A 4V2SA 5GAN7 3JCMP 3BW1A 2QTXA 4PJOC 1M5Q1 3RUXA 5I21A 2DXUA 4NL3A 2DVEA 2E65A 3HFOA 2DKGA 2RA2A 1U1TA 5LJ3g 4XTYA 4M75C 4C8QF 4J6XA 4M77D 4M78D 4C92A 4M77C 2K57A 3JCMg 4EMGA 5GAMd 4C92C 3FIFA 1I8FA 3AHUA 3FJPA 4M7DF 1D3BA 4C8QB 4XU0A 1LOJA 1YCYA 3HFNA 4M7AA 3QO3A 1M8VA 4M7AC 3RKWA 4X9CA 1I81A 4PNOA 4N0AA 3V8LA 5GAOr 2DEQA 1HK9A 4M7DG 3JCMV 4EMHA 4C8QE 1Y96B 2JN0A 4EMKA 4XQ3A 5GANe 5LJ5g 5GAOp 2Y90A 2VXFA 1WNLA 4PJOA 3QUIA 1LJOA 1KQ1A 2EAYA 3SWNA 3SB2A 1N9RA 3FB9A 3JCMJ 3SWNC 5GANj 2VXEA 4PJOG 4C8QD 4XTWA 5GMKe 1WQWA 4X9DA 4M75A 4C8QC 2DJZA 3RERA 4XU3A 4M77A 4M78A 4A54A 5GANh 4Y91A 4M78C 5LJ3e 4M75G 4RCCA 4F7UA 4M7DD 5GAOn 5GMKm 3JCMe 1B34A 2DTOA 2E41A 4C92G 5GAOq 1N9SA 4F7UG 3JCMb 5LJ3j 4A53A 5GANf 3JB9F 4J6YA 4NL2A 5GMKl 3BFMA 5DY9A 5GAN5
chains in the Genus database with same CATH superfamily
4MZPA 1VQPA 2MYSA 3OYIA 2KNBB 2XHCA 1OYXA 5KYXA 5LJ3f 1QVFA 4M75F 1KC8C 3UPUA 4C92F 4IUQA 4JRQA 3OYEA 3FC3A 2JS0A 2YLCA 3JB9J 5KE2A 1JB0E 3MKDA 4JZ3A 2XDBA 2X3XD 2KEAA 3E1SA 1MMAA 3M56A 2L5QA 3CCET 3P8BB 4PJOD 1TSFA 3EFOB 2KYMA 5FRMA 1TS9A 2E10A 4Z8AA 4F7UE 4GY5A 4B6MA 1Q82C 3M9QA 1UECA 3PMTA 4JLIA 2DFUA 3PNWC 4ZGEB 1YP5A 2C06A 3ER0A 1K8AR 5IHKA 3CCVT 2PZ1A 1PM3A 2A3LA 2EJ9A 4QVCA 2F2WA 4OMQA 2MMPA 1KD1U 2ABLA 2DE0X 2FPFA 2RH2A 1VQOA 2D6FA 1M4ZA 2FL7A 4M78E 3BY7A 2QEXT 2GTOA 3VYHB 3CCQA 2RNAA 4DOWA 2JM9A 1M30A 2NUPB 2V26A 5CIUA 1NZ9A 3MP8A 3OSVA 3G4SA 1NEBA 2LQNA 4QW2A 2EYYA 2Y90A 1LJOA 3I9QA 2VB6A 2XICA 3SWNA 1K0XA 1ARKA 2CZ0B 2VXEA 2K4YA 3EGDB 3H41A 2E3IA 2XK0A 4N4GA 5GANh 5LJ3e 4F7UA 5C6SA 2HBPA 3VS3A 1QVGP 4IUUA 5GMKl 2ZPGB 2D0NA 2HKNA 2P0PA 4KT0E 5I2MA 1BI2A 4FYYB 4WCIA 2NUTB 2B8AA 3FLGA 4C5GA 3CD6T 1TXQA 1MNEA 2DZ9A 1OPKA 1OZ3A 2F5TX 3ZBDA 1WQ7A 3HL8A 1V76A 4EPCA 1VQMT 1TWBA 1Q7YC 2PVDB 2JNGA 3JCMd 3RESA 1WA7A 2QDLA 5CKFA 3JCMc 1VQNT 2G3RA 2ZZDA 3OS0A 4RG8A 3CCRT 2SEMA 1X75C 2CS7A 2EQJA 3QXEB 2OTJA 2GTJA 1VQPT 3M0QA 1YIJQ 1RLPC 6AT1B 4FL6A 4F17A 4LE9A 3EG9B 1KC8R 1AWJA 1RAAB 3KFVA 2OI3A 2EJFA 2EQUA 2A37A 3PGGA 1VQ6A 3BW1A 1IXDA 3U23A 4E7KA 4LDUA 1HD3A 2QI2A 2YUPA 2E3HA 4ELZC 1O9SA 1X27A 4EMGA 2O88A 3LWIA 5FU7B 2CZ6B 1MMGA 2YUQA 1X2KA 2LC4A 4HVVA 1Q82R 2QQ9A 3KBGA 3REAB 2VGNA 2DEUA 2KR3A 3SFMA 4N0AA 1PD1A 3OW2A 1CSKA 2V1RA 3O5ZA 4XQ3A 3QZ9B 3M54A 5HY6A 5LJ5g 3CPWA 1FMVA 1FMWA 4MZTA 4KUDK 4BB7A 4HXJA 5FU7C 2H3EB 1X6BA 4CC4B 1VIEA 2O31A 3RERA 1R8OB 1E7OA 1IGUA 4LDWA 1VQOT 1OX9A 3CCEQ 1D0ZA 1PKTA 1YI2Q 1N9SA 3CCQT 5GANf 4J6YA 4NL2A 4OF1A 5FWBA 3GLXA 1OU9A 3RIRA 2VVKA 4JS5A 2L0AA 2GQVA 3CCVQ 4JJBA 3CBPA 4J9FA 1YCSB 4C5IA 3G4ST 5CQYA 2LX7A 4N4IA 1Y96A 2QEXQ 4OMFB 1M2OA 3L2VA 1DJ7B 2RHIA 3OYMA 2QAZA 3CXCS 2F2XA 2EVRA 1ZBJA 3L1AA 2KXCA 4BI4A 2YXYA 1PWTA 4M7DA 4J9BA 1N5ZA 1J3TA 4OVAA 3TREA 4M78B 2L3RA 3VS7A 1K9MC 5A0DA 3OS2A 2DLPA 2D9TA 3RUXA 1GCPA 2CKKA 2LVMA 4JJDA 1ZX6A 2ROTA 4E47A 1NBEB 3G1JA 4C0GA 2JMCA 1G2BA 1QP2A 2JVVA 1ZSZB 2P84A 3SD4A 3CD6Q 4L5GA 1BCMA 1WHJA 1M8VA 1PSFA 2OTJT 1QCFA 3JCMV 3CCUA 4C0ZA 5GANe 4HCBA 3QWXX 2XDDA 4AFSC 1D09B 1IB8A 5IAYA 8ATCB 3Q1JA 1FX7A 1FWZA 1KD1C 1VQ5A 2RJFA 3QDFA 1GCQA 2YDLA 1C1AA 1VQNQ 1B34A 1VQ6T 4J7IA 2MAMA 1CKAA 5LJ3j 2J6KA 2K6DA 1JQQA 3DB3A 4R56A 4M7AG 2E70A 2JS2A 5IXFA 1UGPB 3PIOA 2Z0WA 2CP6A 1VQPQ 3LLRA 3V8JA 2XU8A 3VV0A 1QLYA 4DEXA 1WJQA 3VYGA 4FW1A 3H8ZA 5GMKj 3OYYA 5LJ3d 3JB9D 8AT1B 2PVGB 1UJYA 4C0FA 4NOYA 1G8XA 4J6WA 4FSSA 4LDXA 4JDSA 4HVUA 1P92A 2XI9A 3JB9H 2KSSA 2ZPBB 2MIOA 1M8MA 4HKEA 4JJCA 2AZSA 3CC7A 1AWXA 5I22A 1BU1A 2M1HA 2WACA 4M75B 1H3HA 4Z02A 2CREA 2K7AA 2HSEB 4V2SA 1VQOQ 2JXBA 4KRTA 1IHWA 3OS1A 1RAHB 1BB9A 3CCQQ 4M75C 1YIJA 2EPDA 4FYWB 3JCMg 4C92C 2CH4A 2E6NA 4BD3A 1D3BA 1OOTA 1YCYA 3QO3A 2QGGA 1AZGB 1W70A 4DBFA 4IUPA 3G4SQ 2R58A 2DBKA 1FMKA 1GBQA 3HTRA 1WNLA 3GNFB 1UB4A 3FB9A 3L2WA 2OAUA 4O5VA 1K9MR 3QWYA 4E2FB 4Y28E 4J9DA 5L8RE 1YWPA 4Y91A 2A36A 2ZPFB 4KGXB 4J9IA 5DY9A 4A4EA 1CKBA 1M1KC 4UC4A 2L3SA 1XJWB 1TH7A 3EG2A 1M3BA 1QVFP 3E9FA 1WHLA 4AG2C 1KQ2A 5GAN2 2BKDN 3I55A 1VQ4A 1QQJA 3A8HB 3CCUT 1ZBXA 3X28B 4F7UF 3VS1A 2F1LA 2RK1A 1RAEB 2DRKA 2RJEA 3M0PA 1KD1R 4JZ4A 2XD0A 3E2UA 1JBMA 2EQKA 1VQ5T 1LPLA 1JRIA 2EYQA 1I1JA 1ZUKA 5KH6A 3BDUA 1RAGB 4QQGA 4M7AE 4BUGA 3JCMQ 3T9NA 1BIBA 4M78F 5LJ5j 2OTJQ 2QTVA 3CPFA 3LH0A 1VQ7A 3QZ5B 3QHSA 3GNGA 3CMEA 4DQ2A 2V8KA 5HK3A 4BY6B 2C0IA 2YUNA 2ZPEB 2LP5A 2JTEA 3M0UA 1AVZC 1NLPC 1YBYA 2RI5A 2RI3A 5I21A 2JTFA 2EBPA 2QXFA 4MZMA 2LCLA 2KQWA 5A0GA 2K57A 4WTOB 2DBMA 4BY6C 1IREB 1U06A 1MV0B 2R57A 2O01E 1QVGS 4IURA 1JEGA 5KYUB 2AK5A 1I81A 4ZTJA 3PMIA 5GAOp 2VXFA 2O4XB 3CC7T 4PKCC 3EHRA 1U5SA 3SB2A 5GANj 4PJOG 2BE9B 2V8JA 4XU3A 4Z88A 1W1FA 1NYGA 4RCCA 2OJ2A 2PU9B 2JT4A 4A4GA 3NHNA 5GAOq 2PQWA 1SKUB 2K9GA 2QA4A 2HKQB 2HNIA 1YIJT 1K73U 2DA9A 3MP6A 2YUOA 4J9GA 5GANd 3J80E 3OYAA 5FWCA 3JV3A 2E1HA 2AHJB 3DLLA 4F16A 5KYYB 2RO0A 2YHTA 1GXIE 2KRNA 5IT9E 1QWEA 3ZL7C 3UATA 5FU6B 5CVIA 4D8DA 2RQRA 1W2BP 1KFZA 5CO7A 3PVLA 2FB7A 4DA4A 2JTMA 5FROA 1K4US 1I0CA 1JXMA 3L2ZA 1M1KR 1R77A 3UA6A 5FU6C 1X01A 3LH5A 4OB2B 3V7CA 2DZCA 3M0RA 2EYXA 1V1CA 3H6ZA 1Z9QA 4J9HA 4J83A 3S3MA 3LWHA 1YNZA 3LGLA 2MPXC 3I55T 1VQ4T 4AFZC 4A4KA 1YI2T 2BE7D 1OZ2A 3GPLA 2EIFA 1ZA2B 3P8DA 4OB1B 1ZA1B 1QMCA 3EG9A 5LJ3g 1UEBA 4M77D 4Q5WA 1WLPB 2KBTA 2LRQA 3TQ7P 4M7DF 3A8LB 1LOJA 2EFIA 1SRLA 2DYIA 2QQAA 2ZPHB 3CPWP 4M7DG 1WZOA 1HSQA 4ZTFA 1Q86U 3PVQA 4DBQA 1E6HA 3CCUQ 1TUDA 1YJNQ 4IKFA 2E12A 4C5EA 1FYNA 4A4HA 4C8QD 3CMET 4HCKA 2LZ6B 2M0YA 4KH1B 1FXXA 3CC2Q 2LTOA 1VQ5Q 1PD0A 4FCYA 4KGVB 1E6GA 4FSXA 4OMPA 2HQXA 2SRCA 1YN8A 3KXTA 3UA7A 2PTKA 5KYNA 2QYZA 1UUEA 3CCJA 4D6WA 4FM4B 2DX1A 3O8VA 1AD5A 1UGSB 3QDRB 4FW2A 2F5KA 1BI0A 3M0TA 2KXDA 3C4SA 1QKWA 2BUDA 4E7SA 2XDPA 4PJOE 2WSFE 2DRMA 3OBYA 4OB3B 3N5BB 5IN1A 4HT9A 2DXTA 4M7AB 2RHUA 1KQSA 2CUDA 1BYMA 3UF4A 4ZGJB 3GIBA 1EFNA 4VUBA 2LX9A 4M75D 3NTHA 1Y57A 4C92D 3M55A 1T0JA 2E5QA 1QCOA 2QA4T 4MMLA 2DTHA 4C0DB 3CC7Q 1BIAA 4J5YA 2LMJA 3GF5A 1LVKA 2JW4A 1KSWA 1TOVA 3I5RA 2RQVA 4QT7A 4AFQC 1X43A 2DXUA 1VOMA 3MCAB 4J7FA 3HFOA 2RA2A 4LXCA 4X34A 1U1TA 3X25B 1QVPA 2LT4A 3PTAA 3FIFA 2HQHA 2DETA 5KYXB 4BI8B 2XIDA 2P4TA 2OTLA 4PFOA 3UT1A 3QJ6A 3V8LA 3TSWA 1VYUA 2RPNA 3G71A 4EMKA 2I0NA 4PJOA 1IO6A 1KQ1A 1AWOA 4AFUC 4ANJA 4M77A 4RTZA 3OA6A 1PRMC 2E41A 1M3CA 1BI1A 1SEMA 2QQRA 2V8IA 4RTVA 5A2QE 4KULA 4JJNK 2O2OA 3M57A 1U3OA 2JZ2A 2ATCB 3KUFA 4QVDA 5GAN4 2CDTA 1D1BA 3EFSA 4JRIA 4M7DE 1WHHA 4C8QA 5GJWB 4E7HA 1M2VB 1IRXA 1NG2A 3I55Q 1VQ4Q 1BI3A 3OYFA 1UHFA 2VC8A 1VYVA 3INZA 2NUZA 1YITA 2DAQA 2DO3A 2QGFB 2LDMA 2MF2A 2KROA 1C6VX 1OX8A 2AKKA 1D1CA 1K8AU 4OMNA 1XTDA 2VKNA 3SWNB 1H641 1K73C 3CCJT 5GAMh 4RCBA 5KE3A 1WI7A 5GANg 1VQ7Q 2HAXA 4F7UB 3CMEQ 3VS0A 2PUOB 3ZFJA 2EQMA 2D8JA 2L8DA 2DL7A 5FRNA 4LD9K 1ZQ1A 2A7YA 1ZUYA 4C92A 1RADB 1I8FA 2GF7A 3X20B 3HFNA 4NS5A 5L23A 2CUBA 4EMHA 1PNJA 2LNVA 1Q7YR 1QVFS 3VJPA 5DLOA 3QUIA 2EAYA 4EIKA 4E6RA 3JCMJ 4J8OA 4AT1B 2KT1A 2DIGA 3OYNA 4BE1A 4IUVA 2FZGB 4M78C 5CQXA 2J05A 3RR6A 3JSCA 3VS6A 3H9NA 5GAN5 3H0IA 1S72A 1VQ8Q 2QK0A 1YJNA 2QA4Q 5J39A 2K5IA 4LUEA 4PLIA 3HRTA 3IQLA 1VUBA 2OTLT 2RF0A 2FPDA 3OYDA 3CCMQ 1ZSZC 2DD5A 1HYOA 3G71T 3CC2A 2HD0A 3JRZA 4Y92A 1VQ9A 1VQLQ 1Q86C 2FYKA 1K0SA 4OMLA 4M7AF 2ECZA 5ECAA 3EFRA 3RNJA 2RHZA 3I5SA 1M90U 1M1FA 2DPPB 1OQKA 3M4GA 2E64A 2BIVA 2BTTA 5GAN8 2KDSA 1GRIA 4MMKA 2CZ7B 2RB6A 2HDAA 4XTUA 2Y4YA 5FW9A 3MO8A 2EWNA 3LX7A 5KCOA 5CR2A 2O9VA 4J9EA 1HJDA 1PCXA 2DJQA 3J81E 4N0AC 4BI3A 2AKLA 2GGRA 1UTIA 4RMOA 1JJ2P 5GAMf 4ELYC 1LCKA 2RK2A 4A4FA 1VQKQ 1SG5A 2DVEA 2KK4A 1OI1A 4XTYA 2CP7A 2PNIA 2HEQA 4AMCA 1YITT 1Q82U 4RTYA 1QKXA 1T3LA 3RMSA 3VKIA 2P0QA 4RTWA 2DYBA 2L89A 2BZXA 3RKWA 1HK9A 1KIKA 1B07A 1Y96B 4RTUA 2K79A 1K73R 1SSHA 2KRSA 4JRPA 3MEWA 5KYUA 3VRZA 2G6FX 1BKBA 2QASA 3REBB 1GFDA 4PFPA 4ATOA 3BFMA 1W2BS 1MGQA 1G3WA 4M7DB 4QQ6A 1TUGB 1XQHA 2CT3A 2NWMA 5C0MA 3CCJQ 2D1XA 1U1SA 1EIFA 2F69A 1PC0A 1Y07A 1UE9A 2RJCA 3VUZA 4KH0B 4M7DC 1AWWA 1QP3A 2L2PA 3OYGA 1SPKA 4RG2A 4E7IA 1VA7A 3A8OB 3OMGA 4DOVA 2FG0A 2DL5A 2JMAA 4BE0A 5EG2A 5CKDA 4XTZA 5GAMe 1MUZA 2X35A 3FDRA 3V7RA 1Y0MA 2DL3A 4OMMA 4ZNXA 5I11A 2A28A 1S72T 2FZKB 2J6FA 1YJNT 4HCCA 1WXTA 2RMOA 2JOYA 1PG5B 2DTIA 1VIFA 2EGCA 3CPWS 1M3AA 3EG3A 1I07A 2HL3A 1B34B 5DM7R 1Q86R 1ZLMA 3CC2T 1VQ9T 1M5Q1 1A0NB 2CSIA 3CMAA 2RQUA 4LDVA 2IVWA 1GCQC 1X2QA 5AT1B 2RI2A 3EFOA 3EGUA 5D6WA 3OQ5A 1D1AA 4PNOA 2DEQA 2OTLQ 2BZ8A 3G71Q 3L2UA 1AEYA 1WFWA 2E6ZA 3OYLA 2RHYA 3NTIA 3EG1A 1NJIU 4E7LA 1Q81U 4BDYA 1RI0A 1BBZA 4MDXA 4XK8E 4FYVB 2DXBA 3BE3A 5GJVB 1R0BG 2H3JA 5J3BA 2Y4XA 2NUPA 2XKOC 2CP2A 4PJOF 2K5LA 3NPFA 4BACA 4PJMA 4XTVA 3VS2A 5GAOm 2DD4A 1ABOA 1JO8A 1K9AA 2O9SA 2A0FB 2QQBA 3OS5A 4KBMB 1WXBA 2AT1B 2EQIA 4M77G 3EGXB 2ED1A 1H3ZA 2D8HA 4R0KA 1KQSP 1VQ8A 3EGDA 2CZ1B 3TEEA 1ABQA 1D3BB 4AG1C 1YITQ 3CCLA 1BK2A 3LW5E 3CCMA 2K3YA 1VQLA 5IHNA 4C8QG 1WPYA 2DL8A 4HVWA 4RTTA 1K76A 3ULRB 2NUTA 3V8KA 1GFCA 3OYCA 2F2VA 1UG1A 1MV3A 1AOJA 3A1PA 1VQMA 3AT1B 2X9HA 2YWWA 5KYWB 2NLUA 2X4WA 3GP8A 3JCMP 2HMAA 3PT9A 1YJWA 2JM8A 1PRLC 2KGTA 3DLMA 3OYKA 1C0MA 4M78D 2XMFA 1K1ZA 4MDWA 3CCRA 3CXCA 3MEAA 2M9UA 3L42A 5HK0A 3EH2A 2CP3A 3META 1M90C 5AYFA 1NPRA 1UJ0A 3QYHB 3LYIA 3G6EA 1JU5C 2DILA 4FU6A 4ME7A 1UGQB 1KK7A 1YJ9A 1M27C 3M0SA 4F04B 2R5MA 3R6NA 3SHWA 1VQKA 2KMTA 1K9MU 3C94A 1N9RA 1PHTA 2KE9A 1IZ6A 2VWFA 3WVDB 4M75G 3X26B 4C92G 1UHCA 1KHIA 4R55A 3OW2P 3I56A 4A53A 3OYHA 3CEYA 3CMAT 2FEIA 1NM7A 1G3SA 3M53A 3E9GA 2E4HA 4DEYA 2LNHB 1S72Q 3QBYA 1PKSA 3EHQA 3NTKA 2L3QA 2LJ3A 3S3NA 4GLMA 3HKSA 1VQ7T 1Y7XA 5GAOl 2YSQA 1MMNA 1MNDA 5M9OA 5CKBA 2W10A 1U8RA 5LJ5h 1TU0B 2FO0A 1VQ9Q 1TTHB 2IPOB 3PIPA 1RUWA 3I35A 2KRMA 5CAIA 4ESRA 1M2VA 2LT1A 4D8KA 3M5AA 2RD1A 1H92A 2D0QB 3RKYA 4XTXA 2KY9A 2GQIA 3A98A 3OB9A 2ZPIB 4XU2A 5GAMj 3MJXA 1IGQA 3QIIA 4OP0A 2E5KA 2CT4A 2DNUA 3CC4A 3MEUA 1NE8A 1RACB 1R0CB 4M77E 4E7ZA 3TVTA 2DKGA 3CCSA 2YRCA 9ATCB 1N8RU 5GAMd 1VQ8T 2FRYA 2WSEE 2MK5A 3CCLT 2ZCFB 4XU0A 4ZGDB 5D6YA 2HL5C 4M7AC 1N6AA 4M4ZA 1OULA 3CCMT 4ORZA 4C8QE 1TUCA 4OGCA 1VQLT 1RABB 4OB0B 4QKUA 2EYWA 2RN8A 2VV5A 2YRVA 4C0DC 3TU4K 5GMKe 4X9DA 2PUKB 1G5VA 4M78A 5J26A 3URGA 4LD6A 3MP1A 4M7DD 4KGZB 2MI6A 2X4JA 1M1GA 3P8HA 2CP0A 1YJWT 1JXOA 4HT8A 2DERA 2COZA 1W2BA 2PVOB 1M90R 2KVQG 3EAEA 2RJDA 5CKEA 1G3TA 1ZSZA 2ROLA 3OYBA 3MHXA 3E19A 4XU1A 3G6ET 2ED0A 2J7IA 1G83A 1YJ9T 1VQKT 1N27A 2X4XA 3OSSC 3CBOA 1I5LA 4FIBA 2HQEA 3MEVA 3L2RA 5LJ5f 2YLBA 4M75E 3VS4A 3JCMW 1NJIC 1JJ2S 1Q81C 4C92E 1RAFB 3UWNA 1EZZB 1M1KU 1AHJB 4DBHA 2CP5A 2VGMA 3I56T 1WHMA 1OU8A 2P4RA 3LGFA 4J9CA 1B7TA 1KG1A 2JJ9A 2DL4A 1AT1B 2FRWA 2BZYA 1IHVA 3VU3C 2P0KA 3OBWA 4IUTA 5CCAA 3GBQA 1Q95G 2HSPA 3ASKA 2COYA 3X24B 4JPBW 2QTXA 5CK9A 4P5NA 1RI9A 2X3WD 2DM1A 2EKHA 3VRYA 5DLQE 2YT6A 1NPPA 3CMAQ 3TCJA 4KUIA 1WYXA 3H0FA 5I2SA 1ACMB 5HCKA 4TVRA 4CC2A 1OEBA 3QYGB 4PJNA 3SWNC 2M16A 1Y71A 1WQWA 4M75A 4PLLA 3THKA 3OYJA 3CC4T 3RBBB 1YWOA 1YHQA 4BDZA 2CSQA 5GAOn 2JUFA 1ZUUA 3WXMB 1EX4A 3NGPA 3JCMb 1O75A 3JB9F 1QVGA 5HKCA 3CCST 4GBQA 1I4K1 1LNXA 3JB9G 7AT1B 3JCMh 4LNPA 3MPUB 4B9XA 2EYZA 2ZGWA 5LJ5e 1F1BB 4X1VA 3ME9A 3ZEHA 2LJ0A 5GAN6 4FT2A 4WF2A 3A8GB 1AZEA 1YFNA 1WHGA 3M58A 4PL6A 5CKHA 2NYSA 3JCMX 1WGSA 2HCKA 3H0HA 2XG8D 3L2QA 4LUDA 2I2LA 3FJ5A 1SHFA 3CCLQ 3QPHA 4CRIA 4EMKB 1GBRA 3OMCA 4ZN3A 4PJOB 1V29B 2RHXA 3RDVA 2MOXA 5LL6S 3RKXA 2CYZB 5D7UA 4M77B 3HSBA 4DBRA 2R5AA 4RUGA 3VUBA 2VUBA 4LDYA 4EMKC 1VQMQ 2DVJA 4PJOC 3A8MB 2LJ1A 3PE0A 2EKOA 2B86A 1WIEA 1T3SA 1YJWQ 1NJIR 4J6XA 4M77C 1Q81R 4N4HA 3C95A 4F14A 3FJPA 4E7JA 2ENMA 4C8QB 3CCRQ 2FVUA 1KC8U 2KI7A 2H8HA 1WJSA 2GFUA 4PJLA 2JN0A 4PJJA 3G6EQ 4RTXA 1YJ9Q 3HPWA 2RQWA 2C0TA 1UDLA 4K11A 4C8QC 2IIMA 2FZCB 3FRNA 2DIQA 4HCZA 2KT8A 1ZHIA 3R6OA 5FLXE 3QKJA 1RL2A 2AZVA 2J06A 4JS4A 1KQSS 3I56Q 4B9WA 1D0YA 3A5ZB 2K3XA 1N8RC 1WX6A 5GAMg 4Z89A 3FEOA 5GAN3 3JCMf 1SSFA 3OY9A 1WXUA 2FHDA 1RLQC 5IHIA 5EC7A 3S6WA 4PK4A 2O4XA 1X69A 3D7SB 2LCCA 4C92B 3CQTA 2DK3A 4JUVA 4IIOA 4CC3A 1YHQT 1VYTA 1HXDA 2GBQA 5IXBA 1XNIA 1W4SA 3EGXA 3TSZA 4FT4A 2K2MA 1XOVA 1WJRA 3QSUA 4M7AD 2VASA 4RKUE 4L59A 2EJGA 2RM4A 2CGHA 2K2VA 2M0OA 2HBWA 4CI0C 3CC4Q 5GMKi 2VYTA 3NMZC 5KYYA 4A63B 2CH4W 3CXCP 2X4YA 3CBMA 1WHKA 2DXCA 3CCSQ 3AHUA 5KYWA 3OW2S 2FPEA 2MWOA 3DKMA 4IIMA 4LN2A 3HP9A 2EGAA 2DMOA 1Q7YU 1D0XA 3QJYA 2MCNA 4XAXB 2YRDA 4OGEA 4EDUA 1W6XA 4CC7A 4L6V5 2AIRB 2COWA 1UGRB 2DJZA 2MWPA 2KYBA 3CCEA 2X51A 4A54A 1MHNA 1YI2A 3JCMe 3G7ZA 1MMDA 2QG9B 2RQTA 3F70A 4F7UG 1SRMA 2GFAA 5LJ3h 3CCVA 3SEMA 3WVEB 3J7AF 1K8AC 4FYXB 4O6JA 1UFFA 1SF9A 2DF6A 3M59A 1M9SA 3DB4A 1WDXA 1NEGA 2K5FA 3EG0A 2V1QA 3GOXA 2QEXA 1NYFA 1B3QA 4M78G 2GNCA 3SDZA 1KHCA 5IH2A 1GL5A 4PFZA 1S1NA 4OMOA 5GMKh 1G3YA 4QQDA 2WSCE 4BE2A 3JB9I 3QG1A 3HRSA 3V7SA 1JJ2A 1VQ6Q 2LQWA 1H8KA 2M02A 5LJ5d 2A08A 4QVZA 3C0CA 4M77F 1N8RR 3PFSA 1NLOC 4C5HA 3BDLA 2EW3A 2LCSA 3UDCA 1SHGA 2LQKA 5D6XA 2L3PA 1QW1A 4JRKA 3JAME 1KJWA 1BCOA 3VS5A 3HRUA 2QQSA 4HA8A 4GLKA 5GAN7 3RMQA 3S3OA 2ZAEA 2ESWA 4NL3A 1PSEA 2M51A 2E65A 4ZN1A 4JLGA 4C8QF 2K3BA 1RAIB 3CD6A 1QWFA 1QCNA 4M7AA 1Z9ZA 2LQ8A 4X9CA 5GAOr 3C12A 2C0OA 2QDYB 5KCHA 1TG0A 4II1A 1OV3A 2IG0A 3HHTB 1UGVA 4XTWA 2HZYA 2EGEA 1T0HA 4YTLA 1VQNA 2OX7A 1ZSGA 3NFCA 1I5OB 2W0ZA 5GMKm 1X6GA 2J6OA 2DTOA 1YHQQ 3M4YA 3EH1A 2KAFA 2GCXA 1OPLA 2OAWA 5A0LA 1X6OA
chains in the Genus database with same CATH topology
4MZPA 1M1KC 4UC4A 1VQPA 4HT8A 3OYIA 1S72A 1W2BA 1TH7A 1YJNA 2XHCA 5J39A 2PVOB 2KVQG 2K5IA 1OYXA 3E9FA 2RJDA 3EAEA 4PLIA 5LJ3f 5CKEA 3HRTA 1KQ2A 1G3TA 1VUBA 2OTLT 5GAN2 1QVFA 3OYBA 3MHXA 4M75F 3OYDA 2BKDN 2DD5A 3E19A 4XU1A 3UPUA 3I55A 1VQ4A 1KC8C 3A8HB 4C92F 3G6ET 3G71T 3CCUT 1ZBXA 2HD0A 3JRZA 4IUQA 3X28B 3OYEA 4F7UF 3FC3A 4JRQA 1YJ9T 1VQ9A 1Q86C 2RK1A 2FYKA 1VQKT 1N27A 2X4XA 3OSSC 2RJEA 3CBOA 2YLCA 3JB9J 5KE2A 1I5LA 4M7AF 1JB0E 4FIBA 2HQEA 3MEVA 3EFRA 3L2RA 2XDBA 5LJ5f 2YLBA 3E1SA 2XD0A 4M75E 1JBMA 3M56A 3JCMW 2EQKA 2L5QA 1NJIC 1JJ2S 3CCET 1VQ5T 2RHZA 3P8BB 1Q81C 4PJOD 4C92E 3UWNA 5FRMA 1M90U 2E10A 1M1FA 2DPPB 3M4GA 4F7UE 4GY5A 1JRIA 2EYQA 1Q82C 1M1KU 3M9QA 2E64A 3PMTA 4JLIA 5KH6A 1AHJB 3BDUA 2BIVA 3PNWC 2VGMA 4QQGA 4ZGEB 3I56T 5GAN8 2KDSA 4BUGA 4M7AE 4MMKA 3JCMQ 3LGFA 3T9NA 2C06A 3ER0A 1BIBA 2CZ7B 4M78F 2RB6A 5LJ5j 4XTUA 3CCVT 2Y4YA 1KG1A 2A3LA 3MO8A 2EJ9A 2EWNA 3LX7A 5KCOA 5CR2A 3CPFA 3LH0A 4QVCA 2MMPA 1VQ7A 3VU3C 3QZ5B 2P0KA 3OBWA 3QHSA 4IUTA 3GNGA 5CCAA 4DQ2A 2V8KA 5HK3A 3J81E 4BY6B 2RH2A 3CMEA 1VQOA 4N0AC 4BI3A 2D6FA 1M4ZA 3ASKA 2ZPEB 4RMOA 5GAMf 4ELYC 2FL7A 1YBYA 4M78E 2RI5A 2RI3A 3BY7A 3X24B 2QEXT 2QTXA 2RK2A 3VYHB 5CK9A 4A4FA 2JTFA 4P5NA 4DOWA 2QXFA 5I21A 3CCQA 2DVEA 4MZMA 2KK4A 1OI1A 2LCLA 4XTYA 2KQWA 5DLQE 5A0GA 2K57A 1YITT 1NPPA 5CIUA 1Q82U 4BY6C 1NZ9A 3MP8A 1IREB 3TCJA 3OSVA 2R57A 3RMSA 3VKIA 3G4SA 2O01E 2P0QA 4KUIA 1QVGS 4IURA 2L89A 3RKWA 4QW2A 1I81A 5I2SA 1HK9A 4ZTJA 1Y96B 3PMIA 4TVRA 5GAOp 2Y90A 2VXFA 2O4XB 3CC7T 1LJOA 3QYGB 4PKCC 2XICA 3SWNA 4JRPA 3MEWA 3SB2A 3SWNC 5GANj 2CZ0B 2M16A 2K4YA 2VXEA 1Y71A 4PJOG 1WQWA 4M75A 2V8JA 4PLLA 4XU3A 2XK0A 1BKBA 3OYJA 4N4GA 3CC4T 1YHQA 5GANh 4BDZA 5LJ3e 4RCCA 4F7UA 2PU9B 5C6SA 5GAOn 2HBPA 2JUFA 4A4GA 4IUUA 5GAOq 3WXMB 2PQWA 3JCMb 1O75A 3JB9F 4ATOA 5GMKl 3BFMA 2ZPGB 2P0PA 5I2MA 5HKCA 4KT0E 1W2BS 3CCST 1BI2A 1MGQA 2QA4A 1QVGA 1I4K1 1LNXA 3CC2A 3JB9G 2HNIA 1G3WA 1YIJT 4M7DB 3JCMh 1K73U 4QQ6A 2B8AA 3FLGA 4B9XA 3MP6A 4C5GA 3CD6T 2ZGWA 1XQHA 2DZ9A 5LJ5e 5GANd 3J80E 3ME9A 3ZEHA 3OYAA 5GAN6 5C0MA 4FT2A 2E1HA 1OZ3A 2AHJB 3A8GB 4WF2A 3DLLA 1U1SA 3M58A 2F5TX 3ZBDA 1EIFA 1WQ7A 2F69A 2RO0A 2YHTA 3HL8A 1Y07A 4PL6A 5CKHA 4EPCA 3JCMX 1VQMT 5IT9E 1Q7YC 2RJCA 3VUZA 1GXIE 4M7DC 2PVDB 5FU6B 1WGSA 1QP3A 2JNGA 3JCMd 3OYGA 5CVIA 3RESA 2XG8D 4RG2A 4E7IA 3L2QA 5CO7A 3A8OB 3OMGA 3JCMc 5CKFA 4DOVA 1VQNT 2FB7A 2G3RA 2I2LA 2ZZDA 3OS0A 4DA4A 2JTMA 4RG8A 3CCRT 5FROA 4BE0A 1X75C 5EG2A 3L2ZA 2CS7A 2EQJA 3QPHA 3QXEB 4XTZA 4CRIA 5GAMe 5CKDA 2OTJA 2X35A 3FDRA 3V7RA 4EMKB 5FU6C 1X01A 3V7CA 3OMCA 4OB2B 1KD1U 4ZN3A 2DZCA 4PJOB 1V29B 1VQPT 1S72T 3H6ZA 2RHXA 1YJNT 4HCCA 5LL6S 3RKXA 4J83A 4FL6A 3S3MA 2CYZB 2JOYA 3LWHA 4M77B 2DTIA 3HSBA 1VIFA 2R5AA 3CPWS 3LGLA 2EJFA 2EQUA 3VUBA 2VUBA 4LDYA 1B34B 5DM7R 3I55T 1VQ4T 4EMKC 3PGGA 3CC2T 1VQ6A 4A4KA 3BW1A 1VQ9T 1YI2T 1M5Q1 3A8MB 4E7KA 4PJOC 4LDUA 1OZ2A 2QI2A 3GPLA 2EIFA 2EKOA 3P8DA 4OB1B 4ELZC 1O9SA 3CMAA 5LJ3g 1UEBA 4J6XA 4M77D 4LDVA 4Q5WA 4M77C 4N4HA 4EMGA 3C95A 3LWIA 5FU7B 2CZ6B 2LRQA 2IVWA 3FJPA 4E7JA 2LC4A 4M7DF 2QQ9A 2RI2A 4C8QB 3KBGA 3A8LB 1LOJA 2VGNA 2FVUA 1KC8U 5D6WA 2EFIA 2QQAA 3OQ5A 3SFMA 2ZPHB 4PNOA 4M7DG 4N0AA 3OW2A 1WJSA 2DEQA 4ZTFA 2GFUA 1Q86U 2JN0A 4XQ3A 3QZ9B 3M54A 5HY6A 5LJ5g 3CPWA 4MZTA 4KUDK 3L2UA 4BB7A 3HPWA 5FU7C 4IKFA 2E6ZA 3OYLA 2E12A 4C5EA 2RHYA 3NTIA 1VIEA 4A4HA 4C8QD 4C8QC 1NJIU 3RERA 1R8OB 4E7LA 1Q81U 3CMET 3FRNA 2DIQA 4LDWA 4BDYA 1RI0A 1VQOT 1FXXA 4MDXA 4HCZA 2LTOA 5FLXE 1ZHIA 3R6OA 3JCMJ 4XK8E 1N9SA 3QKJA 3CCQT 5GANf 4J6YA 4NL2A 2DXBA 1RL2A 4FSXA 4OF1A 3GLXA 2HQXA 4JS4A 1KQSS 3RIRA 2H3JA 5J3BA 2Y4XA 3KXTA 4B9WA 3A5ZB 2K3XA 2XKOC 4JS5A 1N8RC 2GQVA 4PJOF 3CCJA 2K5LA 5GAMg 4D6WA 3CBPA 3FEOA 4FM4B 4XTVA 4C5IA 5GAN3 3G4ST 5GAOm 4BACA 2DD4A 3JCMf 1SSFA 3OY9A 3O8VA 2QQBA 1UGSB 3OS5A 2F5KA 1BI0A 3QDRB 2FHDA 4KBMB 5CQYA 3C4SA 4N4IA 2BUDA 1Y96A 4M77G 3S6WA 2O4XA 2XDPA 4PJOE 2WSFE 4OMFB 1H3ZA 2LCCA 3OBYA 4OB3B 4C92B 3N5BB 5IN1A 4HT9A 3L2VA 2DK3A 1VQ8A 1DJ7B 4JUVA 2DXTA 2CZ1B 2RHIA 3TEEA 1YHQT 1D3BB 1HXDA 4M7AB 3CCLA 2RHUA 1KQSA 3OYMA 1BYMA 3LW5E 4ZGJB 3GIBA 3CCMA 4VUBA 1XNIA 1W4SA 2LX9A 4M75D 3CXCS 3NTHA 2K3YA 4C92D 3M55A 1VQLA 2E5QA 2QA4T 3L1AA 2DTHA 4MMLA 4BI4A 4C8QG 4C0DB 4FT4A 1WPYA 4M7DA 1XOVA 1WJRA 1BIAA 3V8KA 3QSUA 4M7AD 3OYCA 4OVAA 4J5YA 3TREA 4M78B 2L3RA 4RKUE 3GF5A 4L59A 2EJGA 2RM4A 1K9MC 5A0DA 3OS2A 1VQMA 2CGHA 2K2VA 2M0OA 4CI0C 5GMKi 2D9TA 2VYTA 2NLUA 2X4WA 3GP8A 3JCMP 3PT9A 3RUXA 2DXUA 1YJWA 2CKKA 2LVMA 3DLMA 3MCAB 3OYKA 4J7FA 3HFOA 4E47A 2RA2A 4X34A 1U1TA 3X25B 4C0GA 2X4YA 4M78D 1QVPA 3CBMA 2LT4A 4MDWA 3PTAA 3CCRA 2DXCA 3FIFA 3AHUA 1QP2A 3CXCA 2JVVA 2XIDA 3MEAA 4BI8B 2M9UA 3L42A 5HK0A 2P4TA 3SD4A 4L5GA 3META 3OW2S 5AYFA 1NPRA 2MWOA 1M90C 3DKMA 2OTLA 1M8VA 1PSFA 3UT1A 3QJ6A 3V8LA 3HP9A 3QYHB 3LYIA 2OTJT 3G6EA 3G71A 3JCMV 3CCUA 4C0ZA 4FU6A 1YJ9A 4ME7A 1UGQB 1Q7YU 3QJYA 4EMKA 5GANe 4HCBA 4XAXB 1VQKA 2R5MA 4PJOA 2XDDA 4OGEA 4EDUA 1KQ1A 2KMTA 1K9MU 3C94A 1N9RA 4L6V5 5IAYA 1UGRB 3Q1JA 1FX7A 2DJZA 2MWPA 1FWZA 4M77A 3CCEA 1KD1C 1VQ5A 2RJFA 4A54A 1IZ6A 3OA6A 1MHNA 3WVDB 1YI2A 4M75G 3X26B 3JCMe 3G7ZA 1B34A 2E41A 4C92G 1VQ6T 1KHIA 4J7IA 4R55A 2MAMA 1BI1A 3F70A 4F7UG 3I56A 5LJ3j 4A53A 2GFAA 2QQRA 3OYHA 2V8IA 3DB3A 4R56A 5LJ3h 3CEYA 3CMAT 2E70A 5A2QE 4KULA 3CCVA 4JJNK 4M7AG 3M53A 1G3SA 3PIOA 1UGPB 3WVEB 3E9GA 3M57A 3J7AF 1K8AC 2JZ2A 4O6JA 3KUFA 4QVDA 3LLRA 3QBYA 3NTKA 5GAN4 3EFSA 4JRIA 4M7DE 4C8QA 3S3NA 3HKSA 1VQ7T 3M59A 1Y7XA 3V8JA 1M9SA 2XU8A 3DB4A 3VV0A 2K5FA 5GAOl 4E7HA 3GOXA 2QEXA 1U8RA 1WJQA 5CKBA 3VYGA 5M9OA 5LJ5h 3H8ZA 5GMKj 4M78G 3OYYA 1BI3A 5LJ3d 3OYFA 3SDZA 3JB9D 2PVGB 2VC8A 1KHCA 3INZA 3PIPA 5GMKh 1YITA 4C0FA 4NOYA 4J6WA 1G3YA 2DAQA 4QQDA 2WSCE 4BE2A 4LDXA 4JDSA 5CAIA 2DO3A 3QG1A 3JB9I 1P92A 3HRSA 2LT1A 2XI9A 2LDMA 2MF2A 3V7SA 1JJ2A 3JB9H 3M5AA 2RD1A 2KSSA 2ZPBB 2D0QB 3RKYA 4HKEA 4XTXA 5LJ5d 4QVZA 1K8AU 2KY9A 3OB9A 1XTDA 2ZPIB 4M77F 4XU2A 3CC7A 3PFSA 5GAMj 3SWNB 1H641 3QIIA 4C5HA 3BDLA 3UDCA 2M1HA 1K73C 3CCJT 2WACA 2LQKA 4M75B 5GAMh 4OP0A 5D6XA 4RCBA 1QW1A 4JRKA 4Z02A 5KE3A 3JAME 3CC4A 3MEUA 1NE8A 5GANg 2HAXA 4F7UB 3HRUA 2QQSA 4V2SA 4HA8A 4M77E 4GLKA 5GAN7 3RMQA 3S3OA 2PUOB 3ZFJA 3OS1A 2EQMA 4NL3A 1PSEA 2L8DA 2E65A 4ZN1A 4JLGA 5FRNA 2DKGA 3CCSA 4LD9K 4C8QF 1ZQ1A 2A7YA 4M75C 4C92A 1YIJA 1N8RU 3JCMg 5GAMd 4C92C 1VQ8T 1I8FA 3CD6A 2E6NA 4BD3A 2WSEE 2GF7A 3X20B 1D3BA 3CCLT 2ZCFB 4XU0A 4ZGDB 1YCYA 4M7AA 3HFNA 4NS5A 3QO3A 5D6YA 2LQ8A 4M7AC 1N6AA 4IUPA 3CCMT 4X9CA 5GAOr 3C12A 2R58A 4EMHA 4C8QE 2LNVA 4OGCA 1VQLT 2QDYB 5KCHA 1WNLA 3VJPA 4OB0B 5DLOA 1QVFS 3QUIA 4II1A 2EAYA 2IG0A 3GNFB 1UB4A 2VV5A 3FB9A 3L2WA 2OAUA 2YRVA 3HHTB 4J8OA 4O5VA 4XTWA 4C0DC 5GMKe 4X9DA 2PUKB 3TU4K 4Y28E 1G5VA 2DIGA 4M78A 3OYNA 4YTLA 4BE1A 4IUVA 5L8RE 5J26A 4Y91A 1VQNA 4M78C 3URGA 3NFCA 5CQXA 4LD6A 3MP1A 2ZPFB 4M7DD 5GMKm 2MI6A 2DTOA 5A0LA 2X4JA 3M4YA 1M1GA 3JSCA 3P8HA 1YJWT 2KAFA 2GCXA 5DY9A 4A4EA 5GAN5 1X6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGQ A;  3RIR A;  5LJ3 h;  4HT8 A;  1I4K 1;  1LNX A;  4M7A G;  3JB9 G;  2HNI A;  4M7D B;  3JCM h;  1TH7 A;  2ZGW A;  4PJO F;  4QVD A;  2DZ9 A;  5LJ5 e;  5GAM g;  5GAN 4;  5LJ3 f;  5GAN d;  4XTV A;  5GAN 3;  3EFS A;  5GAO m;  4JRI A;  1KQ2 A;  4M7D E;  4C8Q A;  3JCM f;  5GAN 6;  5GAN 2;  4M75 F;  2E1H A;  4WF2 A;  4XU1 A;  3V8J A;  1U1S A;  5GAO l;  4C92 F;  1WQ7 A;  2YHT A;  4F7U F;  1Y96 A;  5LJ5 h;  3JCM X;  2FYK A;  4M77 G;  4M78 G;  5GMK j;  4M7D C;  5LJ3 d;  3JB9 D;  4PJO E;  2VC8 A;  2YLC A;  3JB9 J;  3INZ A;  3JCM d;  4C92 B;  1I5L A;  4M7A F;  5GMK h;  3EFR A;  3RES A;  5LJ5 f;  2YLB A;  4HT9 A;  4NOY A;  4JUV A;  4M75 E;  1JBM A;  2DXT A;  4J6W A;  3JCM c;  3JCM W;  2FB7 A;  1D3B B;  5CAI A;  3JB9 I;  4PJO D;  4C92 E;  2I2L A;  1HXD A;  4M7A B;  2E10 A;  3V7S A;  3M4G A;  4F7U E;  3JB9 H;  2RD1 A;  1JRI A;  3GIB A;  2E64 A;  4JLI A;  3L2Z A;  3BDU A;  4M75 D;  4XTZ A;  3RKY A;  5GAM e;  4XTX A;  3V7R A;  5LJ5 d;  5GAN 8;  4M7A E;  4EMK B;  3V7C A;  1X01 A;  4MMK A;  4C92 D;  3JCM Q;  2DZC A;  1BIB A;  4M77 F;  4M78 F;  2RB6 A;  4XU2 A;  5LJ5 j;  4PJO B;  4XTU A;  3L1A A;  2DTH A;  4MML A;  3SWN B;  1H64 1;  4C8Q G;  5GAM j;  2EJ9 A;  1WPY A;  2EWN A;  4M7D A;  3RKX A;  4QVC A;  1BIA A;  3V8K A;  3QSU A;  4M75 B;  5GAM h;  4M7A D;  4OP0 A;  4J5Y A;  3VU3 C;  4M77 B;  4M78 B;  4RCB A;  2DTI A;  3QHS A;  4JRK A;  3HSB A;  4DQ2 A;  2EJG A;  2EJF A;  2RM4 A;  4N0A C;  4F7U B;  5GAN g;  2CGH A;  1B34 B;  5GAM f;  4EMK C;  3PGG A;  5GMK i;  4HA8 A;  4M78 E;  4M77 E;  3BY7 A;  4V2S A;  5GAN 7;  3JCM P;  3BW1 A;  2QTX A;  4PJO C;  1M5Q 1;  3RUX A;  5I21 A;  2DXU A;  4NL3 A;  2DVE A;  2E65 A;  3HFO A;  2DKG A;  2RA2 A;  1U1T A;  5LJ3 g;  4XTY A;  4M75 C;  4C8Q F;  4J6X A;  4M77 D;  4M78 D;  4C92 A;  4M77 C;  2K57 A;  3JCM g;  4EMG A;  5GAM d;  4C92 C;  3FIF A;  1I8F A;  3AHU A;  3FJP A;  4M7D F;  1D3B A;  4C8Q B;  4XU0 A;  1LOJ A;  1YCY A;  3HFN A;  4M7A A;  3QO3 A;  1M8V A;  4M7A C;  3RKW A;  4X9C A;  1I81 A;  4PNO A;  4N0A A;  3V8L A;  5GAO r;  2DEQ A;  1HK9 A;  4M7D G;  3JCM V;  4EMH A;  4C8Q E;  1Y96 B;  2JN0 A;  4EMK A;  4XQ3 A;  5GAN e;  5LJ5 g;  5GAO p;  2Y90 A;  2VXF A;  1WNL A;  4PJO A;  3QUI A;  1LJO A;  1KQ1 A;  2EAY A;  3SWN A;  3SB2 A;  1N9R A;  3FB9 A;  3JCM J;  3SWN C;  5GAN j;  2VXE A;  4PJO G;  4C8Q D;  4XTW A;  5GMK e;  1WQW A;  4X9D A;  4M75 A;  4C8Q C;  2DJZ A;  3RER A;  4XU3 A;  4M77 A;  4M78 A;  4A54 A;  5GAN h;  4Y91 A;  4M78 C;  5LJ3 e;  4M75 G;  4RCC A;  4F7U A;  4M7D D;  5GAO n;  5GMK m;  3JCM e;  1B34 A;  2DTO A;  2E41 A;  4C92 G;  5GAO q;  1N9S A;  4F7U G;  3JCM b;  5LJ3 j;  4A53 A;  5GAN f;  3JB9 F;  4J6Y A;  4NL2 A;  5GMK l;  3BFM A;  5DY9 A;  5GAN 5; 
#chains in the Genus database with same CATH topology
 4MZP A;  1VQP A;  2MYS A;  3OYI A;  2KNB B;  2XHC A;  1OYX A;  5KYX A;  5LJ3 f;  1QVF A;  4M75 F;  1KC8 C;  3UPU A;  4C92 F;  4IUQ A;  4JRQ A;  3OYE A;  3FC3 A;  2JS0 A;  2YLC A;  3JB9 J;  5KE2 A;  1JB0 E;  3MKD A;  4JZ3 A;  2XDB A;  2X3X D;  2KEA A;  3E1S A;  1MMA A;  3M56 A;  2L5Q A;  3CCE T;  3P8B B;  4PJO D;  1TSF A;  3EFO B;  2KYM A;  5FRM A;  1TS9 A;  2E10 A;  4Z8A A;  4F7U E;  4GY5 A;  4B6M A;  1Q82 C;  3M9Q A;  1UEC A;  3PMT A;  4JLI A;  2DFU A;  3PNW C;  4ZGE B;  1YP5 A;  2C06 A;  3ER0 A;  1K8A R;  5IHK A;  3CCV T;  2PZ1 A;  1PM3 A;  2A3L A;  2EJ9 A;  4QVC A;  2F2W A;  4OMQ A;  2MMP A;  1KD1 U;  2ABL A;  2DE0 X;  2FPF A;  2RH2 A;  1VQO A;  2D6F A;  1M4Z A;  2FL7 A;  4M78 E;  3BY7 A;  2QEX T;  2GTO A;  3VYH B;  3CCQ A;  2RNA A;  4DOW A;  2JM9 A;  1M30 A;  2NUP B;  2V26 A;  5CIU A;  1NZ9 A;  3MP8 A;  3OSV A;  3G4S A;  1NEB A;  2LQN A;  4QW2 A;  2EYY A;  2Y90 A;  1LJO A;  3I9Q A;  2VB6 A;  2XIC A;  3SWN A;  1K0X A;  1ARK A;  2CZ0 B;  2VXE A;  2K4Y A;  3EGD B;  3H41 A;  2E3I A;  2XK0 A;  4N4G A;  5GAN h;  5LJ3 e;  4F7U A;  5C6S A;  2HBP A;  3VS3 A;  1QVG P;  4IUU A;  5GMK l;  2ZPG B;  2D0N A;  2HKN A;  2P0P A;  4KT0 E;  5I2M A;  1BI2 A;  4FYY B;  4WCI A;  2NUT B;  2B8A A;  3FLG A;  4C5G A;  3CD6 T;  1TXQ A;  1MNE A;  2DZ9 A;  1OPK A;  1OZ3 A;  2F5T X;  3ZBD A;  1WQ7 A;  3HL8 A;  1V76 A;  4EPC A;  1VQM T;  1TWB A;  1Q7Y C;  2PVD B;  2JNG A;  3JCM d;  3RES A;  1WA7 A;  2QDL A;  5CKF A;  3JCM c;  1VQN T;  2G3R A;  2ZZD A;  3OS0 A;  4RG8 A;  3CCR T;  2SEM A;  1X75 C;  2CS7 A;  2EQJ A;  3QXE B;  2OTJ A;  2GTJ A;  1VQP T;  3M0Q A;  1YIJ Q;  1RLP C;  6AT1 B;  4FL6 A;  4F17 A;  4LE9 A;  3EG9 B;  1KC8 R;  1AWJ A;  1RAA B;  3KFV A;  2OI3 A;  2EJF A;  2EQU A;  2A37 A;  3PGG A;  1VQ6 A;  3BW1 A;  1IXD A;  3U23 A;  4E7K A;  4LDU A;  1HD3 A;  2QI2 A;  2YUP A;  2E3H A;  4ELZ C;  1O9S A;  1X27 A;  4EMG A;  2O88 A;  3LWI A;  5FU7 B;  2CZ6 B;  1MMG A;  2YUQ A;  1X2K A;  2LC4 A;  4HVV A;  1Q82 R;  2QQ9 A;  3KBG A;  3REA B;  2VGN A;  2DEU A;  2KR3 A;  3SFM A;  4N0A A;  1PD1 A;  3OW2 A;  1CSK A;  2V1R A;  3O5Z A;  4XQ3 A;  3QZ9 B;  3M54 A;  5HY6 A;  5LJ5 g;  3CPW A;  1FMV A;  1FMW A;  4MZT A;  4KUD K;  4BB7 A;  4HXJ A;  5FU7 C;  2H3E B;  1X6B A;  4CC4 B;  1VIE A;  2O31 A;  3RER A;  1R8O B;  1E7O A;  1IGU A;  4LDW A;  1VQO T;  1OX9 A;  3CCE Q;  1D0Z A;  1PKT A;  1YI2 Q;  1N9S A;  3CCQ T;  5GAN f;  4J6Y A;  4NL2 A;  4OF1 A;  5FWB A;  3GLX A;  1OU9 A;  3RIR A;  2VVK A;  4JS5 A;  2L0A A;  2GQV A;  3CCV Q;  4JJB A;  3CBP A;  4J9F A;  1YCS B;  4C5I A;  3G4S T;  5CQY A;  2LX7 A;  4N4I A;  1Y96 A;  2QEX Q;  4OMF B;  1M2O A;  3L2V A;  1DJ7 B;  2RHI A;  3OYM A;  2QAZ A;  3CXC S;  2F2X A;  2EVR A;  1ZBJ A;  3L1A A;  2KXC A;  4BI4 A;  2YXY A;  1PWT A;  4M7D A;  4J9B A;  1N5Z A;  1J3T A;  4OVA A;  3TRE A;  4M78 B;  2L3R A;  3VS7 A;  1K9M C;  5A0D A;  3OS2 A;  2DLP A;  2D9T A;  3RUX A;  1GCP A;  2CKK A;  2LVM A;  4JJD A;  1ZX6 A;  2ROT A;  4E47 A;  1NBE B;  3G1J A;  4C0G A;  2JMC A;  1G2B A;  1QP2 A;  2JVV A;  1ZSZ B;  2P84 A;  3SD4 A;  3CD6 Q;  4L5G A;  1BCM A;  1WHJ A;  1M8V A;  1PSF A;  2OTJ T;  1QCF A;  3JCM V;  3CCU A;  4C0Z A;  5GAN e;  4HCB A;  3QWX X;  2XDD A;  4AFS C;  1D09 B;  1IB8 A;  5IAY A;  8ATC B;  3Q1J A;  1FX7 A;  1FWZ A;  1KD1 C;  1VQ5 A;  2RJF A;  3QDF A;  1GCQ A;  2YDL A;  1C1A A;  1VQN Q;  1B34 A;  1VQ6 T;  4J7I A;  2MAM A;  1CKA A;  5LJ3 j;  2J6K A;  2K6D A;  1JQQ A;  3DB3 A;  4R56 A;  4M7A G;  2E70 A;  2JS2 A;  5IXF A;  1UGP B;  3PIO A;  2Z0W A;  2CP6 A;  1VQP Q;  3LLR A;  3V8J A;  2XU8 A;  3VV0 A;  1QLY A;  4DEX A;  1WJQ A;  3VYG A;  4FW1 A;  3H8Z A;  5GMK j;  3OYY A;  5LJ3 d;  3JB9 D;  8AT1 B;  2PVG B;  1UJY A;  4C0F A;  4NOY A;  1G8X A;  4J6W A;  4FSS A;  4LDX A;  4JDS A;  4HVU A;  1P92 A;  2XI9 A;  3JB9 H;  2KSS A;  2ZPB B;  2MIO A;  1M8M A;  4HKE A;  4JJC A;  2AZS A;  3CC7 A;  1AWX A;  5I22 A;  1BU1 A;  2M1H A;  2WAC A;  4M75 B;  1H3H A;  4Z02 A;  2CRE A;  2K7A A;  2HSE B;  4V2S A;  1VQO Q;  2JXB A;  4KRT A;  1IHW A;  3OS1 A;  1RAH B;  1BB9 A;  3CCQ Q;  4M75 C;  1YIJ A;  2EPD A;  4FYW B;  3JCM g;  4C92 C;  2CH4 A;  2E6N A;  4BD3 A;  1D3B A;  1OOT A;  1YCY A;  3QO3 A;  2QGG A;  1AZG B;  1W70 A;  4DBF A;  4IUP A;  3G4S Q;  2R58 A;  2DBK A;  1FMK A;  1GBQ A;  3HTR A;  1WNL A;  3GNF B;  1UB4 A;  3FB9 A;  3L2W A;  2OAU A;  4O5V A;  1K9M R;  3QWY A;  4E2F B;  4Y28 E;  4J9D A;  5L8R E;  1YWP A;  4Y91 A;  2A36 A;  2ZPF B;  4KGX B;  4J9I A;  5DY9 A;  4A4E A;  1CKB A;  1M1K C;  4UC4 A;  2L3S A;  1XJW B;  1TH7 A;  3EG2 A;  1M3B A;  1QVF P;  3E9F A;  1WHL A;  4AG2 C;  1KQ2 A;  5GAN 2;  2BKD N;  3I55 A;  1VQ4 A;  1QQJ A;  3A8H B;  3CCU T;  1ZBX A;  3X28 B;  4F7U F;  3VS1 A;  2F1L A;  2RK1 A;  1RAE B;  2DRK A;  2RJE A;  3M0P A;  1KD1 R;  4JZ4 A;  2XD0 A;  3E2U A;  1JBM A;  2EQK A;  1VQ5 T;  1LPL A;  1JRI A;  2EYQ A;  1I1J A;  1ZUK A;  5KH6 A;  3BDU A;  1RAG B;  4QQG A;  4M7A E;  4BUG A;  3JCM Q;  3T9N A;  1BIB A;  4M78 F;  5LJ5 j;  2OTJ Q;  2QTV A;  3CPF A;  3LH0 A;  1VQ7 A;  3QZ5 B;  3QHS A;  3GNG A;  3CME A;  4DQ2 A;  2V8K A;  5HK3 A;  4BY6 B;  2C0I A;  2YUN A;  2ZPE B;  2LP5 A;  2JTE A;  3M0U A;  1AVZ C;  1NLP C;  1YBY A;  2RI5 A;  2RI3 A;  5I21 A;  2JTF A;  2EBP A;  2QXF A;  4MZM A;  2LCL A;  2KQW A;  5A0G A;  2K57 A;  4WTO B;  2DBM A;  4BY6 C;  1IRE B;  1U06 A;  1MV0 B;  2R57 A;  2O01 E;  1QVG S;  4IUR A;  1JEG A;  5KYU B;  2AK5 A;  1I81 A;  4ZTJ A;  3PMI A;  5GAO p;  2VXF A;  2O4X B;  3CC7 T;  4PKC C;  3EHR A;  1U5S A;  3SB2 A;  5GAN j;  4PJO G;  2BE9 B;  2V8J A;  4XU3 A;  4Z88 A;  1W1F A;  1NYG A;  4RCC A;  2OJ2 A;  2PU9 B;  2JT4 A;  4A4G A;  3NHN A;  5GAO q;  2PQW A;  1SKU B;  2K9G A;  2QA4 A;  2HKQ B;  2HNI A;  1YIJ T;  1K73 U;  2DA9 A;  3MP6 A;  2YUO A;  4J9G A;  5GAN d;  3J80 E;  3OYA A;  5FWC A;  3JV3 A;  2E1H A;  2AHJ B;  3DLL A;  4F16 A;  5KYY B;  2RO0 A;  2YHT A;  1GXI E;  2KRN A;  5IT9 E;  1QWE A;  3ZL7 C;  3UAT A;  5FU6 B;  5CVI A;  4D8D A;  2RQR A;  1W2B P;  1KFZ A;  5CO7 A;  3PVL A;  2FB7 A;  4DA4 A;  2JTM A;  5FRO A;  1K4U S;  1I0C A;  1JXM A;  3L2Z A;  1M1K R;  1R77 A;  3UA6 A;  5FU6 C;  1X01 A;  3LH5 A;  4OB2 B;  3V7C A;  2DZC A;  3M0R A;  2EYX A;  1V1C A;  3H6Z A;  1Z9Q A;  4J9H A;  4J83 A;  3S3M A;  3LWH A;  1YNZ A;  3LGL A;  2MPX C;  3I55 T;  1VQ4 T;  4AFZ C;  4A4K A;  1YI2 T;  2BE7 D;  1OZ2 A;  3GPL A;  2EIF A;  1ZA2 B;  3P8D A;  4OB1 B;  1ZA1 B;  1QMC A;  3EG9 A;  5LJ3 g;  1UEB A;  4M77 D;  4Q5W A;  1WLP B;  2KBT A;  2LRQ A;  3TQ7 P;  4M7D F;  3A8L B;  1LOJ A;  2EFI A;  1SRL A;  2DYI A;  2QQA A;  2ZPH B;  3CPW P;  4M7D G;  1WZO A;  1HSQ A;  4ZTF A;  1Q86 U;  3PVQ A;  4DBQ A;  1E6H A;  3CCU Q;  1TUD A;  1YJN Q;  4IKF A;  2E12 A;  4C5E A;  1FYN A;  4A4H A;  4C8Q D;  3CME T;  4HCK A;  2LZ6 B;  2M0Y A;  4KH1 B;  1FXX A;  3CC2 Q;  2LTO A;  1VQ5 Q;  1PD0 A;  4FCY A;  4KGV B;  1E6G A;  4FSX A;  4OMP A;  2HQX A;  2SRC A;  1YN8 A;  3KXT A;  3UA7 A;  2PTK A;  5KYN A;  2QYZ A;  1UUE A;  3CCJ A;  4D6W A;  4FM4 B;  2DX1 A;  3O8V A;  1AD5 A;  1UGS B;  3QDR B;  4FW2 A;  2F5K A;  1BI0 A;  3M0T A;  2KXD A;  3C4S A;  1QKW A;  2BUD A;  4E7S A;  2XDP A;  4PJO E;  2WSF E;  2DRM A;  3OBY A;  4OB3 B;  3N5B B;  5IN1 A;  4HT9 A;  2DXT A;  4M7A B;  2RHU A;  1KQS A;  2CUD A;  1BYM A;  3UF4 A;  4ZGJ B;  3GIB A;  1EFN A;  4VUB A;  2LX9 A;  4M75 D;  3NTH A;  1Y57 A;  4C92 D;  3M55 A;  1T0J A;  2E5Q A;  1QCO A;  2QA4 T;  4MML A;  2DTH A;  4C0D B;  3CC7 Q;  1BIA A;  4J5Y A;  2LMJ A;  3GF5 A;  1LVK A;  2JW4 A;  1KSW A;  1TOV A;  3I5R A;  2RQV A;  4QT7 A;  4AFQ C;  1X43 A;  2DXU A;  1VOM A;  3MCA B;  4J7F A;  3HFO A;  2RA2 A;  4LXC A;  4X34 A;  1U1T A;  3X25 B;  1QVP A;  2LT4 A;  3PTA A;  3FIF A;  2HQH A;  2DET A;  5KYX B;  4BI8 B;  2XID A;  2P4T A;  2OTL A;  4PFO A;  3UT1 A;  3QJ6 A;  3V8L A;  3TSW A;  1VYU A;  2RPN A;  3G71 A;  4EMK A;  2I0N A;  4PJO A;  1IO6 A;  1KQ1 A;  1AWO A;  4AFU C;  4ANJ A;  4M77 A;  4RTZ A;  3OA6 A;  1PRM C;  2E41 A;  1M3C A;  1BI1 A;  1SEM A;  2QQR A;  2V8I A;  4RTV A;  5A2Q E;  4KUL A;  4JJN K;  2O2O A;  3M57 A;  1U3O A;  2JZ2 A;  2ATC B;  3KUF A;  4QVD A;  5GAN 4;  2CDT A;  1D1B A;  3EFS A;  4JRI A;  4M7D E;  1WHH A;  4C8Q A;  5GJW B;  4E7H A;  1M2V B;  1IRX A;  1NG2 A;  3I55 Q;  1VQ4 Q;  1BI3 A;  3OYF A;  1UHF A;  2VC8 A;  1VYV A;  3INZ A;  2NUZ A;  1YIT A;  2DAQ A;  2DO3 A;  2QGF B;  2LDM A;  2MF2 A;  2KRO A;  1C6V X;  1OX8 A;  2AKK A;  1D1C A;  1K8A U;  4OMN A;  1XTD A;  2VKN A;  3SWN B;  1H64 1;  1K73 C;  3CCJ T;  5GAM h;  4RCB A;  5KE3 A;  1WI7 A;  5GAN g;  1VQ7 Q;  2HAX A;  4F7U B;  3CME Q;  3VS0 A;  2PUO B;  3ZFJ A;  2EQM A;  2D8J A;  2L8D A;  2DL7 A;  5FRN A;  4LD9 K;  1ZQ1 A;  2A7Y A;  1ZUY A;  4C92 A;  1RAD B;  1I8F A;  2GF7 A;  3X20 B;  3HFN A;  4NS5 A;  5L23 A;  2CUB A;  4EMH A;  1PNJ A;  2LNV A;  1Q7Y R;  1QVF S;  3VJP A;  5DLO A;  3QUI A;  2EAY A;  4EIK A;  4E6R A;  3JCM J;  4J8O A;  4AT1 B;  2KT1 A;  2DIG A;  3OYN A;  4BE1 A;  4IUV A;  2FZG B;  4M78 C;  5CQX A;  2J05 A;  3RR6 A;  3JSC A;  3VS6 A;  3H9N A;  5GAN 5;  3H0I A;  1S72 A;  1VQ8 Q;  2QK0 A;  1YJN A;  2QA4 Q;  5J39 A;  2K5I A;  4LUE A;  4PLI A;  3HRT A;  3IQL A;  1VUB A;  2OTL T;  2RF0 A;  2FPD A;  3OYD A;  3CCM Q;  1ZSZ C;  2DD5 A;  1HYO A;  3G71 T;  3CC2 A;  2HD0 A;  3JRZ A;  4Y92 A;  1VQ9 A;  1VQL Q;  1Q86 C;  2FYK A;  1K0S A;  4OML A;  4M7A F;  2ECZ A;  5ECA A;  3EFR A;  3RNJ A;  2RHZ A;  3I5S A;  1M90 U;  1M1F A;  2DPP B;  1OQK A;  3M4G A;  2E64 A;  2BIV A;  2BTT A;  5GAN 8;  2KDS A;  1GRI A;  4MMK A;  2CZ7 B;  2RB6 A;  2HDA A;  4XTU A;  2Y4Y A;  5FW9 A;  3MO8 A;  2EWN A;  3LX7 A;  5KCO A;  5CR2 A;  2O9V A;  4J9E A;  1HJD A;  1PCX A;  2DJQ A;  3J81 E;  4N0A C;  4BI3 A;  2AKL A;  2GGR A;  1UTI A;  4RMO A;  1JJ2 P;  5GAM f;  4ELY C;  1LCK A;  2RK2 A;  4A4F A;  1VQK Q;  1SG5 A;  2DVE A;  2KK4 A;  1OI1 A;  4XTY A;  2CP7 A;  2PNI A;  2HEQ A;  4AMC A;  1YIT T;  1Q82 U;  4RTY A;  1QKX A;  1T3L A;  3RMS A;  3VKI A;  2P0Q A;  4RTW A;  2DYB A;  2L89 A;  2BZX A;  3RKW A;  1HK9 A;  1KIK A;  1B07 A;  1Y96 B;  4RTU A;  2K79 A;  1K73 R;  1SSH A;  2KRS A;  4JRP A;  3MEW A;  5KYU A;  3VRZ A;  2G6F X;  1BKB A;  2QAS A;  3REB B;  1GFD A;  4PFP A;  4ATO A;  3BFM A;  1W2B S;  1MGQ A;  1G3W A;  4M7D B;  4QQ6 A;  1TUG B;  1XQH A;  2CT3 A;  2NWM A;  5C0M A;  3CCJ Q;  2D1X A;  1U1S A;  1EIF A;  2F69 A;  1PC0 A;  1Y07 A;  1UE9 A;  2RJC A;  3VUZ A;  4KH0 B;  4M7D C;  1AWW A;  1QP3 A;  2L2P A;  3OYG A;  1SPK A;  4RG2 A;  4E7I A;  1VA7 A;  3A8O B;  3OMG A;  4DOV A;  2FG0 A;  2DL5 A;  2JMA A;  4BE0 A;  5EG2 A;  5CKD A;  4XTZ A;  5GAM e;  1MUZ A;  2X35 A;  3FDR A;  3V7R A;  1Y0M A;  2DL3 A;  4OMM A;  4ZNX A;  5I11 A;  2A28 A;  1S72 T;  2FZK B;  2J6F A;  1YJN T;  4HCC A;  1WXT A;  2RMO A;  2JOY A;  1PG5 B;  2DTI A;  1VIF A;  2EGC A;  3CPW S;  1M3A A;  3EG3 A;  1I07 A;  2HL3 A;  1B34 B;  5DM7 R;  1Q86 R;  1ZLM A;  3CC2 T;  1VQ9 T;  1M5Q 1;  1A0N B;  2CSI A;  3CMA A;  2RQU A;  4LDV A;  2IVW A;  1GCQ C;  1X2Q A;  5AT1 B;  2RI2 A;  3EFO A;  3EGU A;  5D6W A;  3OQ5 A;  1D1A A;  4PNO A;  2DEQ A;  2OTL Q;  2BZ8 A;  3G71 Q;  3L2U A;  1AEY A;  1WFW A;  2E6Z A;  3OYL A;  2RHY A;  3NTI A;  3EG1 A;  1NJI U;  4E7L A;  1Q81 U;  4BDY A;  1RI0 A;  1BBZ A;  4MDX A;  4XK8 E;  4FYV B;  2DXB A;  3BE3 A;  5GJV B;  1R0B G;  2H3J A;  5J3B A;  2Y4X A;  2NUP A;  2XKO C;  2CP2 A;  4PJO F;  2K5L A;  3NPF A;  4BAC A;  4PJM A;  4XTV A;  3VS2 A;  5GAO m;  2DD4 A;  1ABO A;  1JO8 A;  1K9A A;  2O9S A;  2A0F B;  2QQB A;  3OS5 A;  4KBM B;  1WXB A;  2AT1 B;  2EQI A;  4M77 G;  3EGX B;  2ED1 A;  1H3Z A;  2D8H A;  4R0K A;  1KQS P;  1VQ8 A;  3EGD A;  2CZ1 B;  3TEE A;  1ABQ A;  1D3B B;  4AG1 C;  1YIT Q;  3CCL A;  1BK2 A;  3LW5 E;  3CCM A;  2K3Y A;  1VQL A;  5IHN A;  4C8Q G;  1WPY A;  2DL8 A;  4HVW A;  4RTT A;  1K76 A;  3ULR B;  2NUT A;  3V8K A;  1GFC A;  3OYC A;  2F2V A;  1UG1 A;  1MV3 A;  1AOJ A;  3A1P A;  1VQM A;  3AT1 B;  2X9H A;  2YWW A;  5KYW B;  2NLU A;  2X4W A;  3GP8 A;  3JCM P;  2HMA A;  3PT9 A;  1YJW A;  2JM8 A;  1PRL C;  2KGT A;  3DLM A;  3OYK A;  1C0M A;  4M78 D;  2XMF A;  1K1Z A;  4MDW A;  3CCR A;  3CXC A;  3MEA A;  2M9U A;  3L42 A;  5HK0 A;  3EH2 A;  2CP3 A;  3MET A;  1M90 C;  5AYF A;  1NPR A;  1UJ0 A;  3QYH B;  3LYI A;  3G6E A;  1JU5 C;  2DIL A;  4FU6 A;  4ME7 A;  1UGQ B;  1KK7 A;  1YJ9 A;  1M27 C;  3M0S A;  4F04 B;  2R5M A;  3R6N A;  3SHW A;  1VQK A;  2KMT A;  1K9M U;  3C94 A;  1N9R A;  1PHT A;  2KE9 A;  1IZ6 A;  2VWF A;  3WVD B;  4M75 G;  3X26 B;  4C92 G;  1UHC A;  1KHI A;  4R55 A;  3OW2 P;  3I56 A;  4A53 A;  3OYH A;  3CEY A;  3CMA T;  2FEI A;  1NM7 A;  1G3S A;  3M53 A;  3E9G A;  2E4H A;  4DEY A;  2LNH B;  1S72 Q;  3QBY A;  1PKS A;  3EHQ A;  3NTK A;  2L3Q A;  2LJ3 A;  3S3N A;  4GLM A;  3HKS A;  1VQ7 T;  1Y7X A;  5GAO l;  2YSQ A;  1MMN A;  1MND A;  5M9O A;  5CKB A;  2W10 A;  1U8R A;  5LJ5 h;  1TU0 B;  2FO0 A;  1VQ9 Q;  1TTH B;  2IPO B;  3PIP A;  1RUW A;  3I35 A;  2KRM A;  5CAI A;  4ESR A;  1M2V A;  2LT1 A;  4D8K A;  3M5A A;  2RD1 A;  1H92 A;  2D0Q B;  3RKY A;  4XTX A;  2KY9 A;  2GQI A;  3A98 A;  3OB9 A;  2ZPI B;  4XU2 A;  5GAM j;  3MJX A;  1IGQ A;  3QII A;  4OP0 A;  2E5K A;  2CT4 A;  2DNU A;  3CC4 A;  3MEU A;  1NE8 A;  1RAC B;  1R0C B;  4M77 E;  4E7Z A;  3TVT A;  2DKG A;  3CCS A;  2YRC A;  9ATC B;  1N8R U;  5GAM d;  1VQ8 T;  2FRY A;  2WSE E;  2MK5 A;  3CCL T;  2ZCF B;  4XU0 A;  4ZGD B;  5D6Y A;  2HL5 C;  4M7A C;  1N6A A;  4M4Z A;  1OUL A;  3CCM T;  4ORZ A;  4C8Q E;  1TUC A;  4OGC A;  1VQL T;  1RAB B;  4OB0 B;  4QKU A;  2EYW A;  2RN8 A;  2VV5 A;  2YRV A;  4C0D C;  3TU4 K;  5GMK e;  4X9D A;  2PUK B;  1G5V A;  4M78 A;  5J26 A;  3URG A;  4LD6 A;  3MP1 A;  4M7D D;  4KGZ B;  2MI6 A;  2X4J A;  1M1G A;  3P8H A;  2CP0 A;  1YJW T;  1JXO A;  4HT8 A;  2DER A;  2COZ A;  1W2B A;  2PVO B;  1M90 R;  2KVQ G;  3EAE A;  2RJD A;  5CKE A;  1G3T A;  1ZSZ A;  2ROL A;  3OYB A;  3MHX A;  3E19 A;  4XU1 A;  3G6E T;  2ED0 A;  2J7I A;  1G83 A;  1YJ9 T;  1VQK T;  1N27 A;  2X4X A;  3OSS C;  3CBO A;  1I5L A;  4FIB A;  2HQE A;  3MEV A;  3L2R A;  5LJ5 f;  2YLB A;  4M75 E;  3VS4 A;  3JCM W;  1NJI C;  1JJ2 S;  1Q81 C;  4C92 E;  1RAF B;  3UWN A;  1EZZ B;  1M1K U;  1AHJ B;  4DBH A;  2CP5 A;  2VGM A;  3I56 T;  1WHM A;  1OU8 A;  2P4R A;  3LGF A;  4J9C A;  1B7T A;  1KG1 A;  2JJ9 A;  2DL4 A;  1AT1 B;  2FRW A;  2BZY A;  1IHV A;  3VU3 C;  2P0K A;  3OBW A;  4IUT A;  5CCA A;  3GBQ A;  1Q95 G;  2HSP A;  3ASK A;  2COY A;  3X24 B;  4JPB W;  2QTX A;  5CK9 A;  4P5N A;  1RI9 A;  2X3W D;  2DM1 A;  2EKH A;  3VRY A;  5DLQ E;  2YT6 A;  1NPP A;  3CMA Q;  3TCJ A;  4KUI A;  1WYX A;  3H0F A;  5I2S A;  1ACM B;  5HCK A;  4TVR A;  4CC2 A;  1OEB A;  3QYG B;  4PJN A;  3SWN C;  2M16 A;  1Y71 A;  1WQW A;  4M75 A;  4PLL A;  3THK A;  3OYJ A;  3CC4 T;  3RBB B;  1YWO A;  1YHQ A;  4BDZ A;  2CSQ A;  5GAO n;  2JUF A;  1ZUU A;  3WXM B;  1EX4 A;  3NGP A;  3JCM b;  1O75 A;  3JB9 F;  1QVG A;  5HKC A;  3CCS T;  4GBQ A;  1I4K 1;  1LNX A;  3JB9 G;  7AT1 B;  3JCM h;  4LNP A;  3MPU B;  4B9X A;  2EYZ A;  2ZGW A;  5LJ5 e;  1F1B B;  4X1V A;  3ME9 A;  3ZEH A;  2LJ0 A;  5GAN 6;  4FT2 A;  4WF2 A;  3A8G B;  1AZE A;  1YFN A;  1WHG A;  3M58 A;  4PL6 A;  5CKH A;  2NYS A;  3JCM X;  1WGS A;  2HCK A;  3H0H A;  2XG8 D;  3L2Q A;  4LUD A;  2I2L A;  3FJ5 A;  1SHF A;  3CCL Q;  3QPH A;  4CRI A;  4EMK B;  1GBR A;  3OMC A;  4ZN3 A;  4PJO B;  1V29 B;  2RHX A;  3RDV A;  2MOX A;  5LL6 S;  3RKX A;  2CYZ B;  5D7U A;  4M77 B;  3HSB A;  4DBR A;  2R5A A;  4RUG A;  3VUB A;  2VUB A;  4LDY A;  4EMK C;  1VQM Q;  2DVJ A;  4PJO C;  3A8M B;  2LJ1 A;  3PE0 A;  2EKO A;  2B86 A;  1WIE A;  1T3S A;  1YJW Q;  1NJI R;  4J6X A;  4M77 C;  1Q81 R;  4N4H A;  3C95 A;  4F14 A;  3FJP A;  4E7J A;  2ENM A;  4C8Q B;  3CCR Q;  2FVU A;  1KC8 U;  2KI7 A;  2H8H A;  1WJS A;  2GFU A;  4PJL A;  2JN0 A;  4PJJ A;  3G6E Q;  4RTX A;  1YJ9 Q;  3HPW A;  2RQW A;  2C0T A;  1UDL A;  4K11 A;  4C8Q C;  2IIM A;  2FZC B;  3FRN A;  2DIQ A;  4HCZ A;  2KT8 A;  1ZHI A;  3R6O A;  5FLX E;  3QKJ A;  1RL2 A;  2AZV A;  2J06 A;  4JS4 A;  1KQS S;  3I56 Q;  4B9W A;  1D0Y A;  3A5Z B;  2K3X A;  1N8R C;  1WX6 A;  5GAM g;  4Z89 A;  3FEO A;  5GAN 3;  3JCM f;  1SSF A;  3OY9 A;  1WXU A;  2FHD A;  1RLQ C;  5IHI A;  5EC7 A;  3S6W A;  4PK4 A;  2O4X A;  1X69 A;  3D7S B;  2LCC A;  4C92 B;  3CQT A;  2DK3 A;  4JUV A;  4IIO A;  4CC3 A;  1YHQ T;  1VYT A;  1HXD A;  2GBQ A;  5IXB A;  1XNI A;  1W4S A;  3EGX A;  3TSZ A;  4FT4 A;  2K2M A;  1XOV A;  1WJR A;  3QSU A;  4M7A D;  2VAS A;  4RKU E;  4L59 A;  2EJG A;  2RM4 A;  2CGH A;  2K2V A;  2M0O A;  2HBW A;  4CI0 C;  3CC4 Q;  5GMK i;  2VYT A;  3NMZ C;  5KYY A;  4A63 B;  2CH4 W;  3CXC P;  2X4Y A;  3CBM A;  1WHK A;  2DXC A;  3CCS Q;  3AHU A;  5KYW A;  3OW2 S;  2FPE A;  2MWO A;  3DKM A;  4IIM A;  4LN2 A;  3HP9 A;  2EGA A;  2DMO A;  1Q7Y U;  1D0X A;  3QJY A;  2MCN A;  4XAX B;  2YRD A;  4OGE A;  4EDU A;  1W6X A;  4CC7 A;  4L6V 5;  2AIR B;  2COW A;  1UGR B;  2DJZ A;  2MWP A;  2KYB A;  3CCE A;  2X51 A;  4A54 A;  1MHN A;  1YI2 A;  3JCM e;  3G7Z A;  1MMD A;  2QG9 B;  2RQT A;  3F70 A;  4F7U G;  1SRM A;  2GFA A;  5LJ3 h;  3CCV A;  3SEM A;  3WVE B;  3J7A F;  1K8A C;  4FYX B;  4O6J A;  1UFF A;  1SF9 A;  2DF6 A;  3M59 A;  1M9S A;  3DB4 A;  1WDX A;  1NEG A;  2K5F A;  3EG0 A;  2V1Q A;  3GOX A;  2QEX A;  1NYF A;  1B3Q A;  4M78 G;  2GNC A;  3SDZ A;  1KHC A;  5IH2 A;  1GL5 A;  4PFZ A;  1S1N A;  4OMO A;  5GMK h;  1G3Y A;  4QQD A;  2WSC E;  4BE2 A;  3JB9 I;  3QG1 A;  3HRS A;  3V7S A;  1JJ2 A;  1VQ6 Q;  2LQW A;  1H8K A;  2M02 A;  5LJ5 d;  2A08 A;  4QVZ A;  3C0C A;  4M77 F;  1N8R R;  3PFS A;  1NLO C;  4C5H A;  3BDL A;  2EW3 A;  2LCS A;  3UDC A;  1SHG A;  2LQK A;  5D6X A;  2L3P A;  1QW1 A;  4JRK A;  3JAM E;  1KJW A;  1BCO A;  3VS5 A;  3HRU A;  2QQS A;  4HA8 A;  4GLK A;  5GAN 7;  3RMQ A;  3S3O A;  2ZAE A;  2ESW A;  4NL3 A;  1PSE A;  2M51 A;  2E65 A;  4ZN1 A;  4JLG A;  4C8Q F;  2K3B A;  1RAI B;  3CD6 A;  1QWF A;  1QCN A;  4M7A A;  1Z9Z A;  2LQ8 A;  4X9C A;  5GAO r;  3C12 A;  2C0O A;  2QDY B;  5KCH A;  1TG0 A;  4II1 A;  1OV3 A;  2IG0 A;  3HHT B;  1UGV A;  4XTW A;  2HZY A;  2EGE A;  1T0H A;  4YTL A;  1VQN A;  2OX7 A;  1ZSG A;  3NFC A;  1I5O B;  2W0Z A;  5GMK m;  1X6G A;  2J6O A;  2DTO A;  1YHQ Q;  3M4Y A;  3EH1 A;  2KAF A;  2GCX A;  1OPL A;  2OAW A;  5A0L A;  1X6O A; 
#chains in the Genus database with same CATH homology
 4MZP A;  1M1K C;  4UC4 A;  1VQP A;  4HT8 A;  3OYI A;  1S72 A;  1W2B A;  1TH7 A;  1YJN A;  2XHC A;  5J39 A;  2PVO B;  2KVQ G;  2K5I A;  1OYX A;  3E9F A;  2RJD A;  3EAE A;  4PLI A;  5LJ3 f;  5CKE A;  3HRT A;  1KQ2 A;  1G3T A;  1VUB A;  2OTL T;  5GAN 2;  1QVF A;  3OYB A;  3MHX A;  4M75 F;  3OYD A;  2BKD N;  2DD5 A;  3E19 A;  4XU1 A;  3UPU A;  3I55 A;  1VQ4 A;  1KC8 C;  3A8H B;  4C92 F;  3G6E T;  3G71 T;  3CCU T;  1ZBX A;  2HD0 A;  3JRZ A;  4IUQ A;  3X28 B;  3OYE A;  4F7U F;  3FC3 A;  4JRQ A;  1YJ9 T;  1VQ9 A;  1Q86 C;  2RK1 A;  2FYK A;  1VQK T;  1N27 A;  2X4X A;  3OSS C;  2RJE A;  3CBO A;  2YLC A;  3JB9 J;  5KE2 A;  1I5L A;  4M7A F;  1JB0 E;  4FIB A;  2HQE A;  3MEV A;  3EFR A;  3L2R A;  2XDB A;  5LJ5 f;  2YLB A;  3E1S A;  2XD0 A;  4M75 E;  1JBM A;  3M56 A;  3JCM W;  2EQK A;  2L5Q A;  1NJI C;  1JJ2 S;  3CCE T;  1VQ5 T;  2RHZ A;  3P8B B;  1Q81 C;  4PJO D;  4C92 E;  3UWN A;  5FRM A;  1M90 U;  2E10 A;  1M1F A;  2DPP B;  3M4G A;  4F7U E;  4GY5 A;  1JRI A;  2EYQ A;  1Q82 C;  1M1K U;  3M9Q A;  2E64 A;  3PMT A;  4JLI A;  5KH6 A;  1AHJ B;  3BDU A;  2BIV A;  3PNW C;  2VGM A;  4QQG A;  4ZGE B;  3I56 T;  5GAN 8;  2KDS A;  4BUG A;  4M7A E;  4MMK A;  3JCM Q;  3LGF A;  3T9N A;  2C06 A;  3ER0 A;  1BIB A;  2CZ7 B;  4M78 F;  2RB6 A;  5LJ5 j;  4XTU A;  3CCV T;  2Y4Y A;  1KG1 A;  2A3L A;  3MO8 A;  2EJ9 A;  2EWN A;  3LX7 A;  5KCO A;  5CR2 A;  3CPF A;  3LH0 A;  4QVC A;  2MMP A;  1VQ7 A;  3VU3 C;  3QZ5 B;  2P0K A;  3OBW A;  3QHS A;  4IUT A;  3GNG A;  5CCA A;  4DQ2 A;  2V8K A;  5HK3 A;  3J81 E;  4BY6 B;  2RH2 A;  3CME A;  1VQO A;  4N0A C;  4BI3 A;  2D6F A;  1M4Z A;  3ASK A;  2ZPE B;  4RMO A;  5GAM f;  4ELY C;  2FL7 A;  1YBY A;  4M78 E;  2RI5 A;  2RI3 A;  3BY7 A;  3X24 B;  2QEX T;  2QTX A;  2RK2 A;  3VYH B;  5CK9 A;  4A4F A;  2JTF A;  4P5N A;  4DOW A;  2QXF A;  5I21 A;  3CCQ A;  2DVE A;  4MZM A;  2KK4 A;  1OI1 A;  2LCL A;  4XTY A;  2KQW A;  5DLQ E;  5A0G A;  2K57 A;  1YIT T;  1NPP A;  5CIU A;  1Q82 U;  4BY6 C;  1NZ9 A;  3MP8 A;  1IRE B;  3TCJ A;  3OSV A;  2R57 A;  3RMS A;  3VKI A;  3G4S A;  2O01 E;  2P0Q A;  4KUI A;  1QVG S;  4IUR A;  2L89 A;  3RKW A;  4QW2 A;  1I81 A;  5I2S A;  1HK9 A;  4ZTJ A;  1Y96 B;  3PMI A;  4TVR A;  5GAO p;  2Y90 A;  2VXF A;  2O4X B;  3CC7 T;  1LJO A;  3QYG B;  4PKC C;  2XIC A;  3SWN A;  4JRP A;  3MEW A;  3SB2 A;  3SWN C;  5GAN j;  2CZ0 B;  2M16 A;  2K4Y A;  2VXE A;  1Y71 A;  4PJO G;  1WQW A;  4M75 A;  2V8J A;  4PLL A;  4XU3 A;  2XK0 A;  1BKB A;  3OYJ A;  4N4G A;  3CC4 T;  1YHQ A;  5GAN h;  4BDZ A;  5LJ3 e;  4RCC A;  4F7U A;  2PU9 B;  5C6S A;  5GAO n;  2HBP A;  2JUF A;  4A4G A;  4IUU A;  5GAO q;  3WXM B;  2PQW A;  3JCM b;  1O75 A;  3JB9 F;  4ATO A;  5GMK l;  3BFM A;  2ZPG B;  2P0P A;  5I2M A;  5HKC A;  4KT0 E;  1W2B S;  3CCS T;  1BI2 A;  1MGQ A;  2QA4 A;  1QVG A;  1I4K 1;  1LNX A;  3CC2 A;  3JB9 G;  2HNI A;  1G3W A;  1YIJ T;  4M7D B;  3JCM h;  1K73 U;  4QQ6 A;  2B8A A;  3FLG A;  4B9X A;  3MP6 A;  4C5G A;  3CD6 T;  2ZGW A;  1XQH A;  2DZ9 A;  5LJ5 e;  5GAN d;  3J80 E;  3ME9 A;  3ZEH A;  3OYA A;  5GAN 6;  5C0M A;  4FT2 A;  2E1H A;  1OZ3 A;  2AHJ B;  3A8G B;  4WF2 A;  3DLL A;  1U1S A;  3M58 A;  2F5T X;  3ZBD A;  1EIF A;  1WQ7 A;  2F69 A;  2RO0 A;  2YHT A;  3HL8 A;  1Y07 A;  4PL6 A;  5CKH A;  4EPC A;  3JCM X;  1VQM T;  5IT9 E;  1Q7Y C;  2RJC A;  3VUZ A;  1GXI E;  4M7D C;  2PVD B;  5FU6 B;  1WGS A;  1QP3 A;  2JNG A;  3JCM d;  3OYG A;  5CVI A;  3RES A;  2XG8 D;  4RG2 A;  4E7I A;  3L2Q A;  5CO7 A;  3A8O B;  3OMG A;  3JCM c;  5CKF A;  4DOV A;  1VQN T;  2FB7 A;  2G3R A;  2I2L A;  2ZZD A;  3OS0 A;  4DA4 A;  2JTM A;  4RG8 A;  3CCR T;  5FRO A;  4BE0 A;  1X75 C;  5EG2 A;  3L2Z A;  2CS7 A;  2EQJ A;  3QPH A;  3QXE B;  4XTZ A;  4CRI A;  5GAM e;  5CKD A;  2OTJ A;  2X35 A;  3FDR A;  3V7R A;  4EMK B;  5FU6 C;  1X01 A;  3V7C A;  3OMC A;  4OB2 B;  1KD1 U;  4ZN3 A;  2DZC A;  4PJO B;  1V29 B;  1VQP T;  1S72 T;  3H6Z A;  2RHX A;  1YJN T;  4HCC A;  5LL6 S;  3RKX A;  4J83 A;  4FL6 A;  3S3M A;  2CYZ B;  2JOY A;  3LWH A;  4M77 B;  2DTI A;  3HSB A;  1VIF A;  2R5A A;  3CPW S;  3LGL A;  2EJF A;  2EQU A;  3VUB A;  2VUB A;  4LDY A;  1B34 B;  5DM7 R;  3I55 T;  1VQ4 T;  4EMK C;  3PGG A;  3CC2 T;  1VQ6 A;  4A4K A;  3BW1 A;  1VQ9 T;  1YI2 T;  1M5Q 1;  3A8M B;  4E7K A;  4PJO C;  4LDU A;  1OZ2 A;  2QI2 A;  3GPL A;  2EIF A;  2EKO A;  3P8D A;  4OB1 B;  4ELZ C;  1O9S A;  3CMA A;  5LJ3 g;  1UEB A;  4J6X A;  4M77 D;  4LDV A;  4Q5W A;  4M77 C;  4N4H A;  4EMG A;  3C95 A;  3LWI A;  5FU7 B;  2CZ6 B;  2LRQ A;  2IVW A;  3FJP A;  4E7J A;  2LC4 A;  4M7D F;  2QQ9 A;  2RI2 A;  4C8Q B;  3KBG A;  3A8L B;  1LOJ A;  2VGN A;  2FVU A;  1KC8 U;  5D6W A;  2EFI A;  2QQA A;  3OQ5 A;  3SFM A;  2ZPH B;  4PNO A;  4M7D G;  4N0A A;  3OW2 A;  1WJS A;  2DEQ A;  4ZTF A;  2GFU A;  1Q86 U;  2JN0 A;  4XQ3 A;  3QZ9 B;  3M54 A;  5HY6 A;  5LJ5 g;  3CPW A;  4MZT A;  4KUD K;  3L2U A;  4BB7 A;  3HPW A;  5FU7 C;  4IKF A;  2E6Z A;  3OYL A;  2E12 A;  4C5E A;  2RHY A;  3NTI A;  1VIE A;  4A4H A;  4C8Q D;  4C8Q C;  1NJI U;  3RER A;  1R8O B;  4E7L A;  1Q81 U;  3CME T;  3FRN A;  2DIQ A;  4LDW A;  4BDY A;  1RI0 A;  1VQO T;  1FXX A;  4MDX A;  4HCZ A;  2LTO A;  5FLX E;  1ZHI A;  3R6O A;  3JCM J;  4XK8 E;  1N9S A;  3QKJ A;  3CCQ T;  5GAN f;  4J6Y A;  4NL2 A;  2DXB A;  1RL2 A;  4FSX A;  4OF1 A;  3GLX A;  2HQX A;  4JS4 A;  1KQS S;  3RIR A;  2H3J A;  5J3B A;  2Y4X A;  3KXT A;  4B9W A;  3A5Z B;  2K3X A;  2XKO C;  4JS5 A;  1N8R C;  2GQV A;  4PJO F;  3CCJ A;  2K5L A;  5GAM g;  4D6W A;  3CBP A;  3FEO A;  4FM4 B;  4XTV A;  4C5I A;  5GAN 3;  3G4S T;  5GAO m;  4BAC A;  2DD4 A;  3JCM f;  1SSF A;  3OY9 A;  3O8V A;  2QQB A;  1UGS B;  3OS5 A;  2F5K A;  1BI0 A;  3QDR B;  2FHD A;  4KBM B;  5CQY A;  3C4S A;  4N4I A;  2BUD A;  1Y96 A;  4M77 G;  3S6W A;  2O4X A;  2XDP A;  4PJO E;  2WSF E;  4OMF B;  1H3Z A;  2LCC A;  3OBY A;  4OB3 B;  4C92 B;  3N5B B;  5IN1 A;  4HT9 A;  3L2V A;  2DK3 A;  1VQ8 A;  1DJ7 B;  4JUV A;  2DXT A;  2CZ1 B;  2RHI A;  3TEE A;  1YHQ T;  1D3B B;  1HXD A;  4M7A B;  3CCL A;  2RHU A;  1KQS A;  3OYM A;  1BYM A;  3LW5 E;  4ZGJ B;  3GIB A;  3CCM A;  4VUB A;  1XNI A;  1W4S A;  2LX9 A;  4M75 D;  3CXC S;  3NTH A;  2K3Y A;  4C92 D;  3M55 A;  1VQL A;  2E5Q A;  2QA4 T;  3L1A A;  2DTH A;  4MML A;  4BI4 A;  4C8Q G;  4C0D B;  4FT4 A;  1WPY A;  4M7D A;  1XOV A;  1WJR A;  1BIA A;  3V8K A;  3QSU A;  4M7A D;  3OYC A;  4OVA A;  4J5Y A;  3TRE A;  4M78 B;  2L3R A;  4RKU E;  3GF5 A;  4L59 A;  2EJG A;  2RM4 A;  1K9M C;  5A0D A;  3OS2 A;  1VQM A;  2CGH A;  2K2V A;  2M0O A;  4CI0 C;  5GMK i;  2D9T A;  2VYT A;  2NLU A;  2X4W A;  3GP8 A;  3JCM P;  3PT9 A;  3RUX A;  2DXU A;  1YJW A;  2CKK A;  2LVM A;  3DLM A;  3MCA B;  3OYK A;  4J7F A;  3HFO A;  4E47 A;  2RA2 A;  4X34 A;  1U1T A;  3X25 B;  4C0G A;  2X4Y A;  4M78 D;  1QVP A;  3CBM A;  2LT4 A;  4MDW A;  3PTA A;  3CCR A;  2DXC A;  3FIF A;  3AHU A;  1QP2 A;  3CXC A;  2JVV A;  2XID A;  3MEA A;  4BI8 B;  2M9U A;  3L42 A;  5HK0 A;  2P4T A;  3SD4 A;  4L5G A;  3MET A;  3OW2 S;  5AYF A;  1NPR A;  2MWO A;  1M90 C;  3DKM A;  2OTL A;  1M8V A;  1PSF A;  3UT1 A;  3QJ6 A;  3V8L A;  3HP9 A;  3QYH B;  3LYI A;  2OTJ T;  3G6E A;  3G71 A;  3JCM V;  3CCU A;  4C0Z A;  4FU6 A;  1YJ9 A;  4ME7 A;  1UGQ B;  1Q7Y U;  3QJY A;  4EMK A;  5GAN e;  4HCB A;  4XAX B;  1VQK A;  2R5M A;  4PJO A;  2XDD A;  4OGE A;  4EDU A;  1KQ1 A;  2KMT A;  1K9M U;  3C94 A;  1N9R A;  4L6V 5;  5IAY A;  1UGR B;  3Q1J A;  1FX7 A;  2DJZ A;  2MWP A;  1FWZ A;  4M77 A;  3CCE A;  1KD1 C;  1VQ5 A;  2RJF A;  4A54 A;  1IZ6 A;  3OA6 A;  1MHN A;  3WVD B;  1YI2 A;  4M75 G;  3X26 B;  3JCM e;  3G7Z A;  1B34 A;  2E41 A;  4C92 G;  1VQ6 T;  1KHI A;  4J7I A;  4R55 A;  2MAM A;  1BI1 A;  3F70 A;  4F7U G;  3I56 A;  5LJ3 j;  4A53 A;  2GFA A;  2QQR A;  3OYH A;  2V8I A;  3DB3 A;  4R56 A;  5LJ3 h;  3CEY A;  3CMA T;  2E70 A;  5A2Q E;  4KUL A;  3CCV A;  4JJN K;  4M7A G;  3M53 A;  1G3S A;  3PIO A;  1UGP B;  3WVE B;  3E9G A;  3M57 A;  3J7A F;  1K8A C;  2JZ2 A;  4O6J A;  3KUF A;  4QVD A;  3LLR A;  3QBY A;  3NTK A;  5GAN 4;  3EFS A;  4JRI A;  4M7D E;  4C8Q A;  3S3N A;  3HKS A;  1VQ7 T;  3M59 A;  1Y7X A;  3V8J A;  1M9S A;  2XU8 A;  3DB4 A;  3VV0 A;  2K5F A;  5GAO l;  4E7H A;  3GOX A;  2QEX A;  1U8R A;  1WJQ A;  5CKB A;  3VYG A;  5M9O A;  5LJ5 h;  3H8Z A;  5GMK j;  4M78 G;  3OYY A;  1BI3 A;  5LJ3 d;  3OYF A;  3SDZ A;  3JB9 D;  2PVG B;  2VC8 A;  1KHC A;  3INZ A;  3PIP A;  5GMK h;  1YIT A;  4C0F A;  4NOY A;  4J6W A;  1G3Y A;  2DAQ A;  4QQD A;  2WSC E;  4BE2 A;  4LDX A;  4JDS A;  5CAI A;  2DO3 A;  3QG1 A;  3JB9 I;  1P92 A;  3HRS A;  2LT1 A;  2XI9 A;  2LDM A;  2MF2 A;  3V7S A;  1JJ2 A;  3JB9 H;  3M5A A;  2RD1 A;  2KSS A;  2ZPB B;  2D0Q B;  3RKY A;  4HKE A;  4XTX A;  5LJ5 d;  4QVZ A;  1K8A U;  2KY9 A;  3OB9 A;  1XTD A;  2ZPI B;  4M77 F;  4XU2 A;  3CC7 A;  3PFS A;  5GAM j;  3SWN B;  1H64 1;  3QII A;  4C5H A;  3BDL A;  3UDC A;  2M1H A;  1K73 C;  3CCJ T;  2WAC A;  2LQK A;  4M75 B;  5GAM h;  4OP0 A;  5D6X A;  4RCB A;  1QW1 A;  4JRK A;  4Z02 A;  5KE3 A;  3JAM E;  3CC4 A;  3MEU A;  1NE8 A;  5GAN g;  2HAX A;  4F7U B;  3HRU A;  2QQS A;  4V2S A;  4HA8 A;  4M77 E;  4GLK A;  5GAN 7;  3RMQ A;  3S3O A;  2PUO B;  3ZFJ A;  3OS1 A;  2EQM A;  4NL3 A;  1PSE A;  2L8D A;  2E65 A;  4ZN1 A;  4JLG A;  5FRN A;  2DKG A;  3CCS A;  4LD9 K;  4C8Q F;  1ZQ1 A;  2A7Y A;  4M75 C;  4C92 A;  1YIJ A;  1N8R U;  3JCM g;  5GAM d;  4C92 C;  1VQ8 T;  1I8F A;  3CD6 A;  2E6N A;  4BD3 A;  2WSE E;  2GF7 A;  3X20 B;  1D3B A;  3CCL T;  2ZCF B;  4XU0 A;  4ZGD B;  1YCY A;  4M7A A;  3HFN A;  4NS5 A;  3QO3 A;  5D6Y A;  2LQ8 A;  4M7A C;  1N6A A;  4IUP A;  3CCM T;  4X9C A;  5GAO r;  3C12 A;  2R58 A;  4EMH A;  4C8Q E;  2LNV A;  4OGC A;  1VQL T;  2QDY B;  5KCH A;  1WNL A;  3VJP A;  4OB0 B;  5DLO A;  1QVF S;  3QUI A;  4II1 A;  2EAY A;  2IG0 A;  3GNF B;  1UB4 A;  2VV5 A;  3FB9 A;  3L2W A;  2OAU A;  2YRV A;  3HHT B;  4J8O A;  4O5V A;  4XTW A;  4C0D C;  5GMK e;  4X9D A;  2PUK B;  3TU4 K;  4Y28 E;  1G5V A;  2DIG A;  4M78 A;  3OYN A;  4YTL A;  4BE1 A;  4IUV A;  5L8R E;  5J26 A;  4Y91 A;  1VQN A;  4M78 C;  3URG A;  3NFC A;  5CQX A;  4LD6 A;  3MP1 A;  2ZPF B;  4M7D D;  5GMK m;  2MI6 A;  2DTO A;  5A0L A;  2X4J A;  3M4Y A;  1M1G A;  3JSC A;  3P8H A;  1YJW T;  2KAF A;  2GCX A;  5DY9 A;  4A4E A;  5GAN 5;  1X6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...