5GAMj

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
b'RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA
molecule tags Transcription
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
total genus 16
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamj00
2DKGA 5GMKj 3EFSA 4EMKB 2FYKA 3PGGA 4M78D 2DXTA 3SWNA 4C8QA 4M7DE 5LJ3d 3EFRA 4C8QC 5CAIA 4M7AD 5GAOm 4C8QB 3JCMb 5LJ3h 1U1SA 5LJ5f 2DTOA 4EMKC 4EMHA 3V8LA 2EJ9A 3QUIA 3V7SA 4M78E 3JCMd 3VU3C 4C92A 3BW1A 5LJ3e 2E41A 4M7DF 3GIBA 1HK9A 2E10A 1I4K1 4F7UB 1X01A 5GMKl 4M7AG 4M7AE 2EAYA 4M75B 3JCMV 3M4GA 2YHTA 5LJ5e 5LJ3g 2RA2A 4J6WA 3JCMW 4XTZA 4M75G 2E1HA 5GAMd 4PJOF 1YCYA 4F7UG 5GAMg 4M78F 2VXFA 3BY7A 3V7CA 3QO3A 5LJ5g 3RERA 2EJFA 5LJ5d 4M7DB 4M75A 4M75D 4X9CA 4QVDA 2DXUA 1LJOA 5LJ5j 2FB7A 4M78C 4XU2A 1U1TA 1JBMA 4C92B 4XU1A 4A54A 4F7UA 4M77F 4HT9A 4J6YA 3JB9D 1MGQA 4C92G 5I21A 1LOJA 2YLBA 4M77G 2EJGA 4M7AB 4F7UE 1M5Q1 4M75E 1HXDA 3HSBA 4A53A 4C92C 4XTVA 3L2ZA 3SWNB 4C92D 3JB9G 4N0AA 4XTWA 3V7RA 4C8QG 5GMKe 3V8JA 4M78G 2K57A 4EMGA 3HFOA 4M75F 4V2SA 4HA8A 3JCMX 2DTIA 4XQ3A 5GAN7 5GMKh 1LNXA 3JCMP 2RM4A 4Y91A 1N9RA 2CGHA 1I81A 2DZ9A 3FB9A 4M78A 4X9DA 4XTUA 4C92E 5GAMe 1N9SA 4NOYA 4M75C 4M7DG 2YLCA 2I2LA 3RKXA 1KQ2A 1WNLA 3JCMc 5GAOl 2RB6A 4MMLA 4PNOA 5GAN5 1WPYA 4PJOC 2ZGWA 1WQ7A 2EWNA 3AHUA 5GANd 2Y90A 4M7DA 5GAN6 5LJ3f 4WF2A 5GMKm 4RCCA 3L1AA 5GAOq 1D3BA 1B34B 4C8QF 1I8FA 5GAMf 2JN0A 4F7UF 5GAMh 2DVEA 5GAMj 5GAN2 4NL2A 5GAN8 2QTXA 4JRKA 5GANg 4QVCA 4J5YA 4PJOB 2DJZA 4XTYA 3JB9J 4M7AA 1BIBA 4JUVA 2DZCA 2VXEA 3RIRA 4OP0A 3JCMh 3JCMf 1I5LA 5GMKi 4M7AC 2HNIA 2VC8A 1TH7A 4M77A 5GANe 3JCMg 3FIFA 3FJPA 2E65A 3JB9F 3BFMA 3QHSA 4PJOD 2E64A 1Y96B 3BDUA 4M77B 3JB9H 5LJ3j 5GAN4 3JCMJ 4C8QD 3QSUA 4M7DC 3JB9I 1JRIA 4C92F 4N0AC 4DQ2A 3HFNA 3RKWA 3SWNC 3SB2A 5LJ5h 4JRIA 4MMKA 4XU0A 3V8KA 4J6XA 2DTHA 5GAN3 1WQWA 4RCBA 5GAOr 4NL3A 4EMKA 5GAOn 1Y96A 4JLIA 4M77D 4M7AF 4PJOE 4XTXA 4XU3A 1BIAA 5GANj 4C8QE 3INZA 1KQ1A 1B34A 3RESA 4PJOG 2DEQA 4M78B 3JCMe 2RD1A 1D3BB 3JCMQ 4M7DD 3RKYA 5GAOp 5DY9A 1M8VA 4M77E 4HT8A 5GANf 4PJOA 3RUXA 4M77C 5GANh 1H641
chains in the Genus database with same CATH superfamily
3ZFJA 1Q86U 1S72A 4HCBA 5L8RE 2L0AA 3MEWA 3CC2T 5D6XA 3CC2Q 2DD5A 4EMHA 3V8LA 3QUIA 3V7SA 4BY6C 3VU3C 4DEYA 3EG2A 1OEBA 2L2PA 1VQMT 4PJJA 1YHQT 4J6WA 3CCQQ 1YCYA 4F14A 4JZ3A 4D8KA 4E7KA 1G3TA 3E9FA 4C0DB 2QA4Q 1BCOA 3I35A 3CMEQ 3O5ZA 1G3SA 1VQLA 2C0TA 3JB9G 4XTWA 1CKAA 2RJCA 2CZ1B 2RJFA 2CUDA 4BDYA 3EGXB 1M27C 2EGAA 1TXQA 3M0UA 1K0XA 3JCMP 3ASKA 4BB7A 4NOYA 5A2QE 4HXJA 1Y0MA 3GP8A 2EWNA 3CCQA 5CK9A 2HAXA 3L1AA 3U23A 3FRNA 4LDWA 1VQPQ 2GTJA 3QDRB 1XTDA 1D1BA 2JOYA 1IHWA 4ZTFA 1YWOA 4DOVA 4XTYA 1G83A 1E6HA 1FWZA 8ATCB 4LUDA 1I0CA 1OU8A 3RR6A 1QW1A 2DJQA 4OGCA 2OJ2A 3M59A 1WIEA 3KFVA 2RN8A 1VQ6Q 4J83A 2K5FA 1SHGA 4RTVA 4GBQA 1YJ9T 2JUFA 4FW2A 1VQPT 1RADB 2ABLA 4JDSA 3OYAA 2PNIA 3CCQT 2COWA 3CCRA 2LQKA 3LX7A 1V76A 1D0ZA 1MMDA 2JS0A 2LP5A 1VQOQ 1VQ9A 5GANh 3NFCA 2C0OA 3GF5A 2YUOA 2RHIA 3F70A 4ANJA 1D1AA 1QLYA 3WVEB 2K2MA 3VS7A 3DLLA 3JAME 3EG9B 4M75B 1IHVA 1TUGB 5GAMd 4PJOF 1MV0B 3CC7T 4OGEA 1TTHB 2RPNA 3M56A 2D1XA 2JJ9A 2BTTA 2K7AA 3J81E 1FMKA 4LDYA 3JSCA 1N27A 5CCAA 2DYBA 2O4XA 1OPLA 5A0DA 3L2WA 1ZHIA 2PZ1A 4N0AA 1S1NA 2L3SA 3G4SQ 2MK5A 1NJIR 2R58A 1QVGP 1M90R 2DL7A 3OBWA 2ATCB 2LT1A 2OX7A 2I0NA 2BE7D 1M3AA 1K76A 1KQ2A 1DJ7B 3E9GA 1JQQA 4A4KA 3EH1A 4XAXB 3GLXA 1UJYA 2J7IA 2JT4A 1VQ4Q 5GAMj 2E5KA 4FT4A 4KGXB 2EYZA 2LQNA 4JUVA 1VYVA 2CT4A 2EIFA 2MAMA 4DBHA 3CBMA 1IXDA 3CPWP 4N4IA 3QDFA 5FU7C 4D6WA 3EH2A 2IIMA 4M77B 4LNPA 4BE2A 3I56A 3OB9A 2EVRA 1YBYA 3VYGA 5GAOr 1X6BA 4XU3A 5GJWB 4E7IA 3C4SA 3G7ZA 4OMOA 2XICA 1UHCA 3ULRB 4BY6B 1QKXA 2FYKA 2DXTA 1O9SA 2P0QA 4AG1C 1ZSZA 4FSXA 1B3QA 2JMAA 1VQ5A 4JPBW 4GLKA 1MMNA 2L3QA 1I4K1 1YJWA 3NTKA 1QCNA 3EGDB 3G71A 3E2UA 3EAEA 1PC0A 4XTZA 3PVLA 5KYNA 4F7UG 1N5ZA 3OYCA 1N8RC 2LJ3A 2MIOA 2LX9A 1LJOA 4C92B 1JB0E 2NUTB 3S3OA 2AZVA 3PTAA 1JJ2S 1KD1C 1NJIC 5KYXA 3OYLA 1ACMB 2DO3A 3OYMA 4EDUA 3M0RA 4RTTA 2BKDN 1T0JA 5KYUB 1K9MC 2MWOA 5EC7A 5GMKh 4Y91A 1RI0A 3L2QA 2RO0A 4QQDA 2EKHA 3CCLT 1SEMA 3NMZC 4PJMA 1PKTA 3P8HA 1D0YA 2VB6A 1GBQA 5GAOq 3CMEA 3OW2S 1I8FA 1H92A 1WJQA 3C95A 3MP8A 5GAN8 4QVCA 2H3EB 5FROA 2RQRA 3PMIA 4J9HA 1QVGS 4OVAA 2ENMA 2KBTA 4E2FB 3FIFA 3BFMA 1D0XA 4KUDK 3BDUA 2J6FA 3G6EQ 1UGRB 3DLMA 1G3YA 3QSUA 2CZ0B 1MNEA 3CPWA 1K8AC 4MMKA 1BI3A 3G4ST 3HRUA 1WQWA 4NL3A 4ZTJA 2QEXQ 2NYSA 1UHFA 3VS4A 2BE9B 4L6V5 4HKEA 2FO0A 1XQHA 3H6ZA 4ZN1A 2AIRB 2E3IA 4JLGA 2FZCB 4IIMA 2GTOA 1D1CA 2EQMA 2HL3A 4RG8A 4C8QC 2QQAA 3A8OB 3T9NA 4KH0B 4OB2B 2OI3A 1F1BB 4CC2A 5I2SA 1VQ6T 2QQBA 1XOVA 1K9MU 2YHTA 2DAQA 3QBYA 1VYTA 2RI5A 4DEXA 1AWOA 3MEAA 2FPFA 1VQ9Q 3UPUA 1VQKT 1FYNA 2YRVA 5KYYA 4J6YA 4OF1A 5J3BA 1Q81U 2A3LA 1PNJA 2EJGA 1WXBA 2L3PA 1YI2T 1BU1A 1IO6A 3THKA 4C92C 3L2VA 4OB3B 4R56A 2L3RA 2A08A 1VQ6A 5CO7A 2KQWA 1RI9A 3HFOA 4FSSA 1I07A 1ZBJA 1ZUUA 1LNXA 3FB9A 4X9DA 2EFIA 5DM7R 1R0CB 4PNOA 3TVTA 3LWIA 3EG3A 3LGFA 1H3HA 2K4YA 3HP9A 4EPCA 1M1KR 2KXCA 2D6FA 9ATCB 4RTYA 3L42A 3CCRT 1K9MR 1Z9ZA 3M0PA 1YI2A 3JCMf 4RTXA 3JCMh 2PU9B 4JS4A 1OV3A 1PHTA 4ZNXA 4IKFA 2E65A 1RL2A 1WDXA 3RMQA 2LJ1A 3JB9I 2VASA 2WACA 2KY9A 1ABQA 2DPPB 1G3WA 1HSQA 4EMKA 4KBMB 1X43A 2D9TA 3E19A 2A37A 2MI6A 2MOXA 4LDXA 1IREB 1PRLC 4M77E 2EPDA 2QA4T 5GMKm 3H0FA 5GMKj 1IGQA 1RAAB 1X27A 1AOJA 4M78D 4C8QA 2AZSA 1B7TA 1UB4A 3MEVA 4RTWA 2JTEA 3ER0A 3H0HA 1SF9A 2GGRA 3VS3A 2F1LA 2MCNA 3WVDB 2KSSA 1KC8U 4J9DA 4WTOB 2ZPFB 3V7CA 1AVZC 2E6ZA 1AT1B 3CXCS 4Z8AA 1OX9A 3M4YA 2ESWA 1MGQA 5I21A 3OW2A 1YJ9Q 3A8GB 4AFSC 1HXDA 4L59A 5KYXB 3CCVA 3OQ5A 2ED0A 2FHDA 1JO8A 1JU5C 3Q1JA 3CMAA 3CC4Q 1FMWA 4CC4B 4C92E 4OMMA 5HKCA 1OI1A 1IB8A 4J9IA 1UJ0A 3HL8A 2L8DA 3PMTA 5GANd 3OYHA 4JJCA 3LLRA 3X20B 4C5IA 2PUOB 3LH0A 1WI7A 3OMGA 4B9XA 5L23A 2DE0X 5GANg 3GPLA 3OY9A 1VIEA 3CCSA 2LC4A 2V26A 2QQSA 3JCMg 3URGA 1VQMA 2OTLT 2K3BA 4PJOD 1OU9A 1Y96B 1YJWQ 3X24B 1M1FA 3G71Q 2BZXA 2JM9A 2PQWA 4DQ2A 2HQEA 3FJ5A 3HFNA 7AT1B 2JM8A 3VUBA 3V8KA 1VQOA 2HQXA 1O75A 5GAOn 4FYYB 3LWHA 2Z0WA 3M53A 2MPXC 4PJOG 5KYWA 2RD1A 2EYXA 3LYIA 2FL7A 2HDAA 2LVMA 1H641 3A1PA 3QYGB 1FMVA 3M0SA 2NUZA 1GBRA 1KQSA 1ZX6A 4BI8B 1NPPA 2KYBA 1OULA 2CS7A 3NTIA 3GIBA 1SRLA 2COZA 5C0MA 3I5SA 2RHYA 3JCMW 4M75G 2CYZB 2SEMA 3I56T 2EKOA 1VQKQ 5I22A 1MUZA 1BYMA 1AWJA 2Y4XA 4CRIA 2YRDA 5KE2A 2KE9A 2XI9A 3UT1A 3CD6Q 1P92A 3V8JA 4QVZA 2L89A 4J7IA 2XU8A 4V2SA 5GAN7 4FL6A 3FC3A 2CGHA 5FRMA 3TQ7P 2EYQA 1U8RA 3CBPA 1WPYA 1VQ5T 5AYFA 4BE0A 1VQ9T 1GXIE 1K0SA 1KK7A 4JRQA 5IT9E 2V8IA 4RTZA 2EBPA 1B34B 2KR3A 5GAMh 2CT3A 4KH1B 4IUPA 1HJDA 1NLOC 3EG0A 2DK3A 1WJRA 2QG9B 1SKUB 2RHUA 5LJ3j 2O88A 3QG1A 2XDPA 4PJOE 1PSEA 4JRPA 4QT7A 1ZSZB 1AWXA 4PJOA 1QWEA 2O9SA 2YUQA 3JV3A 4ELYC 2DMOA 2DLPA 5CAIA 5DLOA 1TU0B 2LDMA 2KT8A 4KT0E 4C92A 3BW1A 2E41A 1QCOA 4C5HA 2H3JA 1IRXA 1QQJA 1FX7A 4PLLA 5FWBA 2R5AA 1VQ7Q 2E1HA 4J8OA 1ZBXA 2QEXA 1TG0A 3OYJA 5LJ5j 3VS6A 2F2VA 3DKMA 4C92G 4J9EA 3PIPA 2GQIA 1WXUA 1MMAA 2DYIA 2VYTA 4C8QG 1RAFB 2P0PA 3I55A 4HA8A 2KK4A 2IVWA 1YITT 1I81A 4LXCA 1AEYA 2D0NA 4AMCA 3REBB 3RKXA 1Q86R 2NUPB 2JVVA 4PFZA 1NG2A 3TU4K 2M16A 2EGCA 4RCCA 2X51A 1YJNA 1UECA 4F04B 2F2XA 3VJPA 3OS5A 2O4XB 3G6EA 4J5YA 4F17A 1BIBA 2DILA 4JS5A 3RIRA 3OYGA 2D8HA 4PL6A 1EFNA 1VQPA 2RQTA 3META 4LDVA 1RAEB 1C0MA 3CCJA 3I55T 1X6GA 5CQXA 3IQLA 1M2VB 3JB9H 1KQSS 2L5QA 4ZN3A 4BE1A 1TOVA 1SHFA 2HQHA 2M1HA 3RKWA 3EHQA 3HRSA 3CCST 4FYWB 1IZ6A 2FG0A 3UATA 1Y96A 1FXXA 1XJWB 3PNWC 4ELZC 1R0BG 4HVUA 2EQIA 4PJNA 2DL3A 3MP1A 1RAIB 1BCMA 1JEGA 2GCXA 3CXCA 3EFRA 3RNJA 1WX6A 1OOTA 1U1SA 2YT6A 4ZGJB 1X69A 4RUGA 4IURA 1OQKA 3TREA 2KAFA 3JRZA 3EGUA 1HD3A 2NLUA 1VQ8Q 3MKDA 3LGLA 4AFQC 2E70A 2BZYA 1E6GA 2XMFA 2QGGA 3QO3A 4FU6A 4AT1B 4M75A 2XIDA 1AZGB 2FZKB 4ORZA 1JBMA 2CP5A 4XU1A 5CKFA 4F7UA 2W10A 3OBYA 5A0GA 1YIJA 3VS2A 2GNCA 1LOJA 2H8HA 1UDLA 2CZ7B 1M30A 3A5ZB 1UFFA 4OB1B 3SWNB 2NUTA 1ZUKA 1Y57A 3LW5E 2ZPIB 3UA7A 2DZ9A 4J9CA 4M78A 4M7DG 3CCVQ 3M9QA 1ABOA 1ARKA 2ROLA 1NYFA 2FPDA 3PVQA 1WGSA 3GBQA 2DXBA 2GFUA 2EQUA 1NEBA 4E6RA 3M0QA 3CCUA 2RQWA 1K4US 2HBWA 3FDRA 4FIBA 4BUGA 2AK5A 1TH7A 1WLPB 1UGSB 5IHIA 2E64A 3MHXA 2MF2A 5ECAA 4A4FA 4C92F 4N0AC 4OMFB 5LJ5h 3SB2A 4A4EA 2QYZA 1LPLA 4CI0C 1WFWA 2G3RA 1BB9A 4O5VA 2ROTA 3OSVA 1GCPA 1VQKA 2KRMA 3CCMA 1B34A 4PLIA 1D3BB 4KULA 2P4RA 2J06A 1BI2A 3VYHB 4X34A 2P4TA 3OYBA 1GFCA 5D6WA 1YIJQ 1RAHB 3I9QA 1RAGB 2QASA 1VQLT 2KI7A 5LJ5f 1BKBA 2EQJA 1VQLQ 3MCAB 2ED1A 4M7AG 2E10A 5GMKl 3VS5A 2EAYA 3UWNA 5D7UA 2OAUA 5IN1A 2OTLA 2CUBA 4P5NA 4MZTA 1R8OB 3BY7A 4OMNA 1D09B 4X9CA 4M78C 2OAWA 3R6OA 3P8DA 4F7UE 3CC4T 4OMLA 1VOMA 3EHRA 4XTVA 3CC2A 3V7RA 3EFOA 5KYWB 5FRNA 1Q95G 4LD6A 1W70A 2KYMA 4PFOA 2YUPA 1NBEB 2DTIA 3OYFA 1KD1R 1VQ7A 1N9RA 2PTKA 1YHQA 3AT1B 2YXYA 3MEUA 2QA4A 2LT4A 5LJ3f 3M54A 1U3OA 2QGFB 4F7UF 2LCSA 1TSFA 3GNGA 2QQRA 3PT9A 2V1QA 2VC8A 2VGMA 2K6DA 2EYYA 4A63B 3QPHA 1OZ2A 1G8XA 1UTIA 1KD1U 6AT1B 1SSHA 4AFZC 1JJ2P 3M5AA 3OW2P 4JRIA 4XU0A 5GAN3 2DTHA 5KH6A 4DBRA 4M7AF 3VUZA 4KRTA 3CCMQ 3OYNA 3CC7A 2YSQA 4C0FA 1Q82U 1QP2A 3LH5A 2QAZA 5CIUA 1TUCA 2HBPA 1R77A 1Q81R 1N6AA 5C6SA 3X26B 4LE9A 2PUKB 3PGGA 3QWYA 4M7DE 4E7HA 2CREA 2ZAEA 2B86A 2RHZA 2MWPA 2DTOA 4EMKC 2JXBA 2E12A 2R5MA 3C94A 3CXCP 4B6MA 4KGZB 5LJ5e 1UE9A 3NTHA 1Y07A 5CVIA 3M58A 4FYVB 3TSWA 3OA6A 5LJ5d 2K79A 2RK1A 1WHMA 1E7OA 1YFNA 2YUNA 1KFZA 2FEIA 2OTJT 3NGPA 5FLXE 1M5Q1 2LNHB 4E7ZA 1EZZB 1U5SA 4A53A 1ZLMA 3N5BB 3TCJA 1K73U 2B8AA 2K3XA 2PVGB 3HPWA 1C6VX 2W0ZA 4JZ4A 3RDVA 3CPWS 2LCCA 3CCLQ 1G5VA 2E4HA 2RM4A 4RKUE 2CH4A 2XDDA 4M7DA 3I5RA 4Y92A 3VRZA 1NM7A 5GAMf 1QP3A 3CEYA 1VQ4A 1OZ3A 2DA9A 4DBQA 5EG2A 3J80E 5D6YA 4RTUA 2C06A 2DZCA 3C0CA 4OP0A 5GMKi 1EIFA 2LNVA 4DA4A 3CCUT 3H9NA 4Z88A 2EW3A 4J6XA 1Q7YU 1AZEA 1PM3A 1ZQ1A 2BUDA 1BIAA 5GANj 2AHJB 2M0YA 3INZA 1B07A 1WHJA 1M4ZA 3JCMe 5DY9A 2Y4YA 1MNDA 2DKGA 2RI2A 4LDUA 2BIVA 5LJ3d 2ZPHB 3QZ9B 3C12A 1VQOT 2JTFA 2X3WD 1TS9A 3CCJQ 4YTLA 2K5LA 3SDZA 1YCSB 1QVFA 1NPRA 3CCLA 3H8ZA 1JXMA 2F5TX 2K2VA 2XKOC 3SD4A 3L2UA 2DL5A 2QI2A 4FYXB 1W4SA 4QQGA 3CCVT 2VUBA 1VQ8A 1U1TA 2CP3A 1QWFA 2KEAA 3I55Q 3MPUB 3OYIA 3ZBDA 2RQUA 4OB0B 1KJWA 2JTMA 4MDWA 4LUEA 1W2BP 1X2QA 5GAMe 1YHQQ 1N9SA 1RUWA 1VA7A 5HK0A 4C5EA 1TWBA 5CKDA 1TUDA 1QVPA 1W1FA 2DM1A 2Y90A 1OX8A 2DD4A 4C8QF 3KBGA 1YWPA 3HKSA 4J9BA 2QTXA 4JRKA 3CCMT 2D8JA 2QQ9A 4M7AA 1I5LA 2VXEA 1UUEA 1W2BA 2FPEA 2V8JA 1NEGA 3DB3A 3SFMA 2JMCA 2SRCA 5GANe 1K8AU 3UA6A 1ZSGA 3SEMA 2X3XD 2DL4A 2OTLQ 2CKKA 1T0HA 2HMAA 4ZGEB 2E5QA 3X25B 2RI3A 4PKCC 1I1JA 1VQMQ 3CD6T 1LVKA 1YN8A 3FEOA 5HCKA 1HYOA 3E1SA 1YP5A 3I56Q 4M78B 3JCMQ 1M90U 1M8VA 4HT8A 3OSSC 1GL5A 5CKEA 2RF0A 1NE8A 2V8KA 3SWNA 4F16A 3EG9A 4IUVA 4MDXA 3JCMb 3QZ5B 5LJ3h 2WSEE 1KQSP 1OPKA 1X75C 2M02A 2DRMA 4M7AE 2RA2A 2LMJA 1M1KC 2KROA 2EYWA 1VIFA 1I5OB 3RERA 1RLPC 2KT1A 1WHHA 2YDLA 4C0GA 1K73C 2GQVA 2DXUA 2CP0A 1VQNA 2FB7A 2LX7A 3JB9D 2M9UA 4PFPA 2YLBA 3QWXX 3EGDA 4M75E 1UGVA 2JZ2A 4IIOA 2CZ6B 2DIGA 3MO8A 4OMQA 3KUFA 3NHNA 2KRNA 2LCLA 3UDCA 2YLCA 1J3TA 2X35A 5J26A 4IUTA 2DERA 1WNLA 5GAOl 5GAN5 4BD3A 2DIQA 3CC7Q 3A8MB 2WSFE 2CSQA 2HCKA 2JNGA 2PVOB 5GAN2 4NL2A 5CKBA 2GF7A 2DJZA 4PJOB 2NUPA 2HNIA 2DX1A 1Q7YC 4M77A 4MZPA 3FJPA 4CC3A 2KVQG 2P0KA 1K9AA 2VV5A 2X9HA 1YJNT 3SWNC 1KC8C 2HKQB 3GNFB 2ZCFB 4CC7A 2V1RA 3G6ET 2DFUA 4Q5WA 3CCRQ 4E7SA 4M7DD 2DETA 3QYHB 2J05A 2X4XA 1Y7XA 2XK0A 2DF6A 1WZOA 4X1VA 4EMKB 3O8VA 2QDLA 4JJBA 4E7LA 2RJEA 2RQVA 5I11A 4RG2A 2LRQA 2RK2A 2OTJA 3REAB 2EJ9A 3S3NA 3KXTA 3HHTB 1UEBA 2K9GA 5HY6A 4DOWA 3JCMV 2NWMA 4BACA 2G6FX 1KHIA 2MMPA 8AT1B 2VWFA 3MJXA 5LJ5g 2A7YA 1YJWT 2A0FB 2WSCE 1H3ZA 3PE0A 1K8AR 1YITA 5KYUA 3HSBA 1SG5A 3HRTA 2KNBB 5GMKe 1VQ8T 4FT2A 1T3SA 4E7JA 4EMGA 2CDTA 4EIKA 2LQ8A 4XQ3A 3OYEA 4DBFA 1M2OA 2EQKA 4M75C 1JXOA 5J39A 2RB6A 4MMLA 3SHWA 1WQ7A 1GCQC 5GAN6 4HCKA 1V29B 4TVRA 4WF2A 2RMOA 3H41A 4UC4A 2LQWA 2FVUA 3CBOA 4PK4A 4L5GA 4RMOA 1Q86C 4N4GA 2KGTA 2YWWA 5KE3A 1K1ZA 2X4WA 4M7AC 4K11A 1YJNQ 2R57A 3CMAQ 3CCSQ 1M2VA 2YRCA 3QHSA 4IUQA 3MP6A 4II1A 3UF4A 2DBMA 2A36A 2E6NA 4B9WA 2VGNA 1C1AA 3QJYA 4C8QE 1KQ1A 3CCUQ 2VVKA 1BI1A 3RKYA 5CR2A 4AG2C 5GANf 1N8RR 1KHCA 2O2OA 1RLQC 3GOXA 1VQ4T 1LCKA 5FW9A 3OYDA 5FWCA 4JJDA 2JW4A 1M90C 3HTRA 2JS2A 1PD1A 3JCMd 4M78E 4M7DF 2E3HA 1HK9A 4BI4A 2LZ6B 4ATOA 4KUIA 3VKIA 3OYKA 4Z02A 1ZA1B 2A28A 3A98A 2J6KA 5IHNA 3EG1A 3CQTA 4HCZA 2P84A 2EJFA 4QVDA 1S72T 2HL5C 3CCEQ 5FU7B 4M77F 1PD0A 4D8DA 4M7AB 4M4ZA 1Q81C 1A0NB 4C0DC 3L2ZA 2VKNA 1S72Q 3VS1A 3M57A 4M78G 4LD9K 5IXBA 2O31A 3BDLA 2KXDA 3JCMJ 4XTUA 1W2BS 2K5IA 2CP6A 1PCXA 1ZUYA 2O9VA 2QK0A 3OMCA 2XHCA 1N8RU 2DXCA 2F69A 1WHLA 1GCQA 1NZ9A 3AHUA 4J9GA 3CC4A 1PG5B 5M9OA 2C0IA 2QXFA 1M1GA 3VRYA 1AD5A 3CD6A 5GJVB 1BK2A 3JB9J 1X2KA 1VQ7T 2IG0A 1CKBA 2X4YA 5AT1B 3JB9F 3CCET 1RACB 1Y71A 1XNIA 1UGPB 4A4HA 1X6OA 2AT1B 1M8MA 3QXEB 4Z89A 2XD0A 4VUBA 3X28B 4RCBA 3A8LB 2RJDA 2FRWA 4XTXA 3M55A 1WHGA 2AKKA 1VQNQ 2DEQA 2M0OA 3TEEA 5GAOp 1M9SA 4KGVB 3ZL7C 4J7FA 1K73R 3R6NA 2KMTA 2FRYA 3EFSA 1Z9QA 1QVFP 1VQNT 2RHXA 2KDSA 4M7AD 3DB4A 2DRKA 3QIIA 1WHKA 4C0ZA 3NPFA 5DLQE 2DBKA 2HZYA 4R0KA 1X01A 4F7UB 2GBQA 1Q82R 3RMSA 2DNUA 4Y28E 2O01E 1PKSA 2ZPGB 5GAMg 2CSIA 1WA7A 4M75D 1SPKA 4XU2A 5IAYA 2HEQA 4HVVA 4A54A 3P8BB 2COYA 3VV0A 4MZMA 1NLPC 2ZPEB 2D0QB 2BZ8A 3G1JA 4A4GA 3EFOB 3EGXA 4GY5A 3WXMB 2IPOB 4OMPA 1YI2Q 2PVDB 1EX4A 1PSFA 3CCJT 3D7SB 1Q7YR 4ESRA 1YNZA 1W6XA 3QJ6A 4R55A 2K3YA 1RABB 4BI3A 2HD0A 4PJLA 2J6OA 2ZGWA 2MYSA 2F2WA 2QEXT 1D3BA 1YITQ 5A0LA 1MMGA 1QVFS 1H8KA 5FU6C 1ZSZC 4QKUA 4BDZA 1QKWA 1YJ9A 1GRIA 3G71T 1KG1A 3FLGA 1ZA2B 1M3BA 1BI0A 4M7DC 5HK3A 2LJ0A 3L2RA 3QKJA 4M7DB 4M77D 2HKNA 2RH2A 3RESA 3J7AF 4HVWA 3TSZA 1KC8R 3BE3A 5KCOA 4M77C 3S3MA 1YIJT 1M1KU 1WYXA 1OYXA 2ECZA 3CPFA 4WCIA 5CKHA 3H0IA 1M3CA 5GAOm 2F5KA 4C8QB 2QDYB 5FU6B 5KYYB 1U06A 1IGUA 4ZGDB 2X4JA 5LJ3e 3M4GA 5LJ3g 2XDBA 2HSPA 2AKLA 1VYUA 3S6WA 3PFSA 2GFAA 4M78F 2OTJQ 3CMAT 2FZGB 2VXFA 4C5GA 1T3LA 1AHJB 4IUUA 4O6JA 4E47A 4FCYA 2RNAA 1VUBA 1V1CA 5IHKA 4NS5A 2QTVA 1QVGA 4HT9A 1QMCA 1AWWA 4M77G 1WJSA 3OS2A 4HCCA 1JJ2A 2ZPBB 4N4HA 4C92D 2XG8D 4FM4B 2DL8A 4GLMA 1KIKA 2K57A 2CP2A 3G4SA 4M75F 1G2BA 3JCMX 1CSKA 2I2LA 3VS0A 3JCMc 4PJOC 1UGQB 3ZEHA 3OS0A 1KSWA 1SSFA 1GFDA 2CP7A 2JN0A 2KRSA 2DVEA 4JJNK 3OS1A 1NYGA 2HSEB 1MHNA 5I2MA 4ME7A 4LN2A 5KCHA 1PRMC 5CQYA 3M0TA 4XK8E 5IH2A 5LL6S 4J9FA 2DEUA 4QW2A 1Q82C 1BBZA 5GAN4 4C8QD 1UG1A 3A8HB 2CH4W 1PWTA 2LTOA 1JRIA 2EGEA 4QQ6A 3CMET 3ME9A 1VQ5Q 2DVJA 1NJIU 4JLIA 5IXFA 4FW1A 1QCFA 1SRMA 3CCEA 1MV3A 4AFUC 2M51A 1WXTA 3PIOA 3RBBB 2ZZDA 3RUXA 3OYYA
chains in the Genus database with same CATH topology
2X4XA 3VYHB 3ZFJA 4X34A 1Q86U 2P4TA 2XK0A 5GMKj 3OYBA 4EMKB 3O8VA 4M78D 5D6WA 4C8QA 1S72A 4HCBA 5L8RE 3MEWA 1VQLT 3CC2T 1UB4A 4E7LA 2RJEA 3MEVA 4RG2A 3ER0A 5LJ5f 2LRQA 2RK2A 1BKBA 2OTJA 2EQJA 5D6XA 2DD5A 4EMHA 3V8LA 2EJ9A 3MCAB 3QUIA 3V7SA 3WVDB 4BY6C 3VU3C 3S3NA 3KXTA 4M7AG 2E10A 3HHTB 5GMKl 1UEBA 5HY6A 2KSSA 4DOWA 2EAYA 3UWNA 3JCMV 2OAUA 1VQMT 5IN1A 2OTLA 4BACA 1YHQT 1KC8U 4J6WA 1KHIA 2MMPA 4P5NA 1YCYA 4MZTA 1R8OB 2ZPFB 3BY7A 3V7CA 5LJ5g 2E6ZA 4X9CA 4E7KA 3CXCS 2A7YA 4M78C 1G3TA 3E9FA 4C0DB 1YJWT 3M4YA 3R6OA 2WSCE 1H3ZA 1MGQA 5I21A 3OW2A 1YITA 3P8DA 4F7UE 3CC4T 3A8GB 1HXDA 3HSBA 4L59A 1G3SA 4XTVA 3HRTA 1VQLA 3JB9G 3V7RA 4XTWA 3CCVA 3CC2A 3OQ5A 5FRNA 4LD6A 2FHDA 2RJCA 5GMKe 1VQ8T 4FT2A 2CZ1B 2RJFA 4E7JA 4EMGA 3Q1JA 4BDYA 2LQ8A 3CMAA 2DTIA 4XQ3A 3OYEA 3OYFA 3JCMP 1VQ7A 1N9RA 4C92E 3ASKA 4BB7A 5HKCA 1OI1A 4NOYA 5A2QE 2EQKA 4M75C 1YHQA 3GP8A 5J39A 2RB6A 4MMLA 3HL8A 2L8DA 1WQ7A 2EWNA 3CCQA 3MEUA 3PMTA 5GANd 3OYHA 2LT4A 5GAN6 5LJ3f 2QA4A 3M54A 1V29B 3LLRA 4TVRA 4WF2A 3X20B 4C5IA 5CK9A 3L1AA 4UC4A 3FRNA 2PUOB 3LH0A 4LDWA 2FVUA 3CBOA 3QDRB 4F7UF 3OMGA 1XTDA 4B9XA 2JOYA 4L5GA 4RMOA 4ZTFA 1Q86C 3GNGA 2QQRA 4DOVA 5GANg 4N4GA 4XTYA 3PT9A 5KE3A 2X4WA 3GPLA 3OY9A 4M7AC 1VIEA 3CCSA 2VC8A 1Q81U 2VGMA 1FWZA 2R57A 3QPHA 2LC4A 2QQSA 3JCMg 3URGA 1QW1A 4OGCA 1VQMA 2OTLT 3QHSA 4PJOD 3M59A 1Y96B 1OZ2A 4IUQA 4J83A 1KD1U 2K5FA 3MP6A 1M1FA 4II1A 3X24B 2PQWA 4DQ2A 2HQEA 3M5AA 3HFNA 2E6NA 4B9WA 1YJ9T 4JRIA 3V8KA 2VGNA 2JUFA 4XU0A 2DTHA 3VUBA 5KH6A 2HQXA 4JDSA 5GAN3 3OYAA 1O75A 5GAOn 1VQOA 4M7AF 3CCQT 3CCRA 3QJYA 4C8QE 3LWHA 3VUZA 1KQ1A 2LQKA 3M53A 3OYNA 3CC7A 4C0FA 1Q82U 3LX7A 1BI1A 1QP2A 4PJOG 2RD1A 3RKYA 5CIUA 5CR2A 3LYIA 2FL7A 5GANf 1VQ9A 5GANh 2LVMA 2HBPA 1H641 3QYGB 1N6AA 5C6SA 3NFCA 3GF5A 1KHCA 3X26B 1YJNT 2PUKB 3PGGA 3GOXA 4M7DE 4E7HA 2RHIA 1VQ4T 3F70A 3OYDA 1KQSA 4BI8B 2RHZA 2MWPA 1NPPA 3WVEB 1M90C 2DTOA 4EMKC 3DLLA 2CS7A 3NTIA 4M78E 2E12A 2R5MA 3JCMd 4M7DF 3C94A 3GIBA 1HK9A 4BI4A 4ATOA 4KUIA 3JAME 4M75B 3VKIA 5LJ5e 5C0MA 3OYKA 3NTHA 1Y07A 4Z02A 2RHYA 3JCMW 4M75G 5CVIA 5GAMd 4PJOF 3M58A 2CYZB 4HCZA 3I56T 2EKOA 3CC7T 4OGEA 2EJFA 5LJ5d 3OA6A 4M7DB 2RK1A 4QVDA 1S72T 3M56A 1BYMA 5FU7B 2Y4XA 4M77F 3J81E 4CRIA 4LDYA 2OTJT 3JSCA 4M7AB 1N27A 1M5Q1 5FLXE 5CCAA 5KE2A 2XI9A 2O4XA 1Q81C 4A53A 3UT1A 4C0DC 5A0DA 1ZHIA 3L2ZA 3L2WA 3N5BB 4N0AA 1P92A 3TCJA 1K73U 2B8AA 2K3XA 2PVGB 3HPWA 3V8JA 3M57A 4M78G 4QVZA 3CPWS 2L89A 4J7IA 2LCCA 4LD9K 2XU8A 4V2SA 5GAN7 3BDLA 1G5VA 4FL6A 3FC3A 2R58A 2RM4A 3JCMJ 2CGHA 5FRMA 2EYQA 3OBWA 2K5IA 4XTUA 1W2BS 2LT1A 3OMCA 2XHCA 4RKUE 1N8RU 1KQ2A 1U8RA 3CBPA 2DXCA 2F69A 1DJ7B 1WPYA 1VQ5T 3E9GA 5AYFA 2XDDA 1NZ9A 4BE0A 1VQ9T 3AHUA 4M7DA 1GXIE 3CC4A 4A4KA 4JRQA 5IT9E 2V8IA 5M9OA 4XAXB 1B34B 2QXFA 3GLXA 1M1GA 1QP3A 5GAMf 3CEYA 5GAMh 5GAMj 1VQ4A 1OZ3A 4FT4A 3CD6A 5EG2A 3J80E 4IUPA 5D6YA 3JB9J 2C06A 4JUVA 2DZCA 2DK3A 1WJRA 4OP0A 1VQ7T 2IG0A 2EIFA 5GMKi 1EIFA 2MAMA 3CBMA 2X4YA 2LNVA 4N4IA 5FU7C 4DA4A 3JB9F 4D6WA 3CCUT 3CCET 2RHUA 1Y71A 1XNIA 4M77B 5LJ3j 1UGPB 4BE2A 4A4HA 1X6OA 3I56A 3QG1A 3OB9A 3QXEB 1YBYA 4C92F 4J6XA 3VYGA 2XDPA 4VUBA 3X28B 4RCBA 5GAOr 3A8LB 2RJDA 4PJOE 1Q7YU 2BUDA 1PSEA 1ZQ1A 3M55A 1BIAA 4XTXA 4XU3A 4JRPA 5GANj 2AHJB 3INZA 1M4ZA 4E7IA 3C4SA 2DEQA 3G7ZA 2M0OA 3JCMe 3TEEA 5GAOp 1M9SA 2XICA 5DY9A 4J7FA 4PJOA 2Y4YA 2DKGA 2RI2A 2KMTA 4BY6B 4LDUA 2BIVA 3EFSA 2FYKA 4ELYC 2DXTA 1VQNT 2RHXA 2KDSA 5LJ3d 2ZPHB 5CAIA 5DLOA 4M7AD 1O9SA 2P0QA 3C12A 3DB4A 3QZ9B 1VQOT 2JTFA 3QIIA 4FSXA 2LDMA 4C0ZA 4KT0E 4YTLA 1VQ5A 4GLKA 4C92A 2K5LA 3BW1A 2E41A 3SDZA 5DLQE 4C5HA 1I4K1 4F7UB 1X01A 2H3JA 1YJWA 1QVFA 1NPRA 3RMSA 3NTKA 1FX7A 2XD0A 3G71A 3CCLA 4PLLA 3H8ZA 3EAEA 2F5TX 4XTZA 2R5AA 2K2VA 4Y28E 2E1HA 2O01E 2ZPGB 2XKOC 4F7UG 5GAMg 3SD4A 3OYCA 4J8OA 3L2UA 1ZBXA 1N8RC 2QI2A 1W4SA 2QEXA 4QQGA 4M75D 3OYJA 3CCVT 2VUBA 2LX9A 1LJOA 5LJ5j 4XU2A 5IAYA 1VQ8A 1U1TA 4C92B 1JB0E 4A54A 3P8BB 3VV0A 3S3OA 4MZMA 3DKMA 4C92G 2ZPEB 2D0QB 3PTAA 1KD1C 1NJIC 4A4GA 3OYIA 1JJ2S 3PIPA 4GY5A 3ZBDA 3OYLA 3WXMB 2DO3A 2VYTA 4OB0B 4EDUA 3OYMA 2JTMA 4C8QG 2PVDB 1PSFA 2P0PA 4MDWA 3CCJT 2BKDN 3I55A 1K9MC 2MWOA 2KK4A 4HA8A 3QJ6A 5GMKh 2IVWA 4R55A 1YITT 4Y91A 5GAMe 1I81A 1RI0A 3L2QA 2K3YA 2RO0A 4QQDA 1N9SA 3CCLT 4BI3A 5HK0A 4C5EA 5CKDA 2HD0A 3RKXA 1QVPA 2ZGWA 2JVVA 2Y90A 2QEXT 3P8HA 3TU4K 2M16A 4RCCA 2DD4A 5GAOq 1YJNA 1D3BA 3CMEA 5A0LA 4C8QF 1I8FA 3OW2S 3KBGA 1QVFS 3HKSA 1WJQA 3C95A 3VJPA 3MP8A 5GAN8 3OS5A 5FU6C 4BDZA 2O4XB 2QTXA 4JRKA 3G6EA 3CCMT 4QVCA 4J5YA 2QQ9A 5FROA 4M7AA 3PMIA 1BIBA 4JS5A 2VXEA 3RIRA 1I5LA 1W2BA 1YJ9A 2V8JA 3OYGA 4PL6A 1VQPA 3DB3A 1QVGS 3SFMA 4OVAA 1BI2A 3META 4LDVA 5GANe 3FIFA 3CCJA 3I55T 3BFMA 1K8AU 3G71T 4KUDK 1KG1A 3FLGA 5CQXA 3BDUA 3JB9H 1UGRB 1KQSS 3DLMA 1BI0A 1G3YA 2L5QA 3QSUA 4M7DC 5HK3A 2CZ0B 4ZN3A 4BE1A 3L2RA 1YIJA 2M1HA 3RKWA 2CKKA 3CPWA 3QKJA 1K8AC 3HRSA 4MMKA 4ZGEB 3CCST 1IZ6A 1BI3A 2E5QA 2RI3A 1WQWA 3HRUA 4PKCC 3X25B 4NL3A 3G4ST 1Y96A 1FXXA 3PNWC 4M77D 4ZTJA 3CD6T 4ELZC 2RH2A 3FEOA 3RESA 3J7AF 4L6V5 4HKEA 3E1SA 1XQHA 3H6ZA 4M78B 4ZN1A 3JCMQ 1M90U 4JLGA 1M8VA 3MP1A 5KCOA 4HT8A 4M77C 3S3MA 3OSSC 1YIJT 5CKEA 1M1KU 1OYXA 3CPFA 1NE8A 5CKHA 2EQMA 2V8KA 3SWNA 4RG8A 2GCXA 3CXCA 3EFRA 4C8QC 5GAOm 2F5KA 2QQAA 3A8OB 4IUVA 3T9NA 4MDXA 4OB2B 4C8QB 3JCMb 3QZ5B 1U1SA 2WSEE 5LJ3h 4ZGJB 5I2SA 2QDYB 5FU6B 1VQ6T 4IURA 2QQBA 3TREA 1XOVA 2KAFA 1X75C 3JRZA 4ZGDB 2X4JA 5LJ3e 1K9MU 4M7AE 2NLUA 3M4GA 2YHTA 5LJ3g 2RA2A 2DAQA 3LGLA 2XDBA 3QBYA 2RI5A 2E70A 3S6WA 1M1KC 3PFSA 2GFAA 4M78F 1VIFA 3CMAT 2VXFA 3MEAA 4C5GA 3RERA 1AHJB 3QO3A 4FU6A 4IUUA 4C0GA 4M75A 4O6JA 4E47A 2GQVA 2XIDA 2DXUA 3UPUA 1K73C 1VQNA 1VUBA 2FB7A 1VQPT 1JBMA 4XU1A 4NS5A 5CKFA 1VQKT 2YRVA 4F7UA 1QVGA 4HT9A 4J6YA 3OBYA 4OF1A 2M9UA 5J3BA 5A0GA 3JB9D 1LOJA 2A3LA 2YLBA 1WJSA 4M77G 2EJGA 3OS2A 4M75E 2CZ7B 4HCCA 3A5ZB 1YI2T 2JZ2A 1JJ2A 2ZPBB 4N4HA 4C92C 4OB1B 3SWNB 4C92D 3L2VA 4OB3B 2XG8D 4R56A 4FM4B 2L3RA 2CZ6B 5CO7A 2DIGA 3MO8A 1VQ6A 2K57A 2KQWA 3G4SA 3HFOA 4M75F 3JCMX 3LW5E 2ZPIB 1LNXA 3KUFA 2DZ9A 3FB9A 4M78A 4X9DA 2LCLA 2EFIA 3UDCA 4M7DG 2YLCA 5DM7R 2X35A 2I2LA 3M9QA 5J26A 4IUTA 1WNLA 3JCMc 5GAOl 4PNOA 4BD3A 5GAN5 4PJOC 2DIQA 1UGQB 3ZEHA 3OS0A 3A8MB 3LWIA 1WGSA 3LGFA 2DXBA 2GFUA 2K4YA 2EQUA 2WSFE 3HP9A 4EPCA 1SSFA 2JNGA 2JN0A 2D6FA 2DVEA 2PVOB 5GAN2 4NL2A 3CCUA 4JJNK 5CKBA 3L42A 3OS1A 3CCRT 3FDRA 2GF7A 1MHNA 2DJZA 4ME7A 5I2MA 1YI2A 5KCHA 4FIBA 5CQYA 3JCMf 4BUGA 3JCMh 2PU9B 4XK8E 2HNIA 1TH7A 5LL6S 4JS4A 1Q7YC 4M77A 4MZPA 4IKFA 4PJOB 3FJPA 2E65A 1UGSB 4QW2A 2KVQG 2P0KA 1Q82C 1RL2A 2E64A 3MHXA 5GAN4 3RMQA 2MF2A 4C8QD 3A8HB 2VV5A 3JB9I 2LTOA 1JRIA 2WACA 4N0AC 4QQ6A 4OMFB 4A4FA 3SWNC 2KY9A 3ME9A 3SB2A 4A4EA 2DPPB 5LJ5h 3CMET 1G3WA 1KC8C 4CI0C 3GNFB 2ZCFB 4KBMB 2G3RA 4JLIA 3OSVA 4O5VA 4EMKA 1NJIU 1VQKA 2D9TA 3G6ET 3CCMA 1B34A 3E19A 3CCEA 4Q5WA 2MI6A 2HAXA 4LDXA 1IREB 4PLIA 1D3BB 4M7DD 4KULA 4M77E 3PIOA 2ZZDA 3QYHB 3RUXA 2QA4T 5GMKm 3OYYA 1Y7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKG A;  5GMK j;  3EFS A;  4EMK B;  2FYK A;  3PGG A;  4M78 D;  2DXT A;  3SWN A;  4C8Q A;  4M7D E;  5LJ3 d;  3EFR A;  4C8Q C;  5CAI A;  4M7A D;  5GAO m;  4C8Q B;  3JCM b;  5LJ3 h;  1U1S A;  5LJ5 f;  2DTO A;  4EMK C;  4EMH A;  3V8L A;  2EJ9 A;  3QUI A;  3V7S A;  4M78 E;  3JCM d;  3VU3 C;  4C92 A;  3BW1 A;  5LJ3 e;  2E41 A;  4M7D F;  3GIB A;  1HK9 A;  2E10 A;  1I4K 1;  4F7U B;  1X01 A;  5GMK l;  4M7A G;  4M7A E;  2EAY A;  4M75 B;  3JCM V;  3M4G A;  2YHT A;  5LJ5 e;  5LJ3 g;  2RA2 A;  4J6W A;  3JCM W;  4XTZ A;  4M75 G;  2E1H A;  5GAM d;  4PJO F;  1YCY A;  4F7U G;  5GAM g;  4M78 F;  2VXF A;  3BY7 A;  3V7C A;  3QO3 A;  5LJ5 g;  3RER A;  2EJF A;  5LJ5 d;  4M7D B;  4M75 A;  4M75 D;  4X9C A;  4QVD A;  2DXU A;  1LJO A;  5LJ5 j;  2FB7 A;  4M78 C;  4XU2 A;  1U1T A;  1JBM A;  4C92 B;  4XU1 A;  4A54 A;  4F7U A;  4M77 F;  4HT9 A;  4J6Y A;  3JB9 D;  1MGQ A;  4C92 G;  5I21 A;  1LOJ A;  2YLB A;  4M77 G;  2EJG A;  4M7A B;  4F7U E;  1M5Q 1;  4M75 E;  1HXD A;  3HSB A;  4A53 A;  4C92 C;  4XTV A;  3L2Z A;  3SWN B;  4C92 D;  3JB9 G;  4N0A A;  4XTW A;  3V7R A;  4C8Q G;  5GMK e;  3V8J A;  4M78 G;  2K57 A;  4EMG A;  3HFO A;  4M75 F;  4V2S A;  4HA8 A;  3JCM X;  2DTI A;  4XQ3 A;  5GAN 7;  5GMK h;  1LNX A;  3JCM P;  2RM4 A;  4Y91 A;  1N9R A;  2CGH A;  1I81 A;  2DZ9 A;  3FB9 A;  4M78 A;  4X9D A;  4XTU A;  4C92 E;  5GAM e;  1N9S A;  4NOY A;  4M75 C;  4M7D G;  2YLC A;  2I2L A;  3RKX A;  1KQ2 A;  1WNL A;  3JCM c;  5GAO l;  2RB6 A;  4MML A;  4PNO A;  5GAN 5;  1WPY A;  4PJO C;  2ZGW A;  1WQ7 A;  2EWN A;  3AHU A;  5GAN d;  2Y90 A;  4M7D A;  5GAN 6;  5LJ3 f;  4WF2 A;  5GMK m;  4RCC A;  3L1A A;  5GAO q;  1D3B A;  1B34 B;  4C8Q F;  1I8F A;  5GAM f;  2JN0 A;  4F7U F;  5GAM h;  2DVE A;  5GAM j;  5GAN 2;  4NL2 A;  5GAN 8;  2QTX A;  4JRK A;  5GAN g;  4QVC A;  4J5Y A;  4PJO B;  2DJZ A;  4XTY A;  3JB9 J;  4M7A A;  1BIB A;  4JUV A;  2DZC A;  2VXE A;  3RIR A;  4OP0 A;  3JCM h;  3JCM f;  1I5L A;  5GMK i;  4M7A C;  2HNI A;  2VC8 A;  1TH7 A;  4M77 A;  5GAN e;  3JCM g;  3FIF A;  3FJP A;  2E65 A;  3JB9 F;  3BFM A;  3QHS A;  4PJO D;  2E64 A;  1Y96 B;  3BDU A;  4M77 B;  3JB9 H;  5LJ3 j;  5GAN 4;  3JCM J;  4C8Q D;  3QSU A;  4M7D C;  3JB9 I;  1JRI A;  4C92 F;  4N0A C;  4DQ2 A;  3HFN A;  3RKW A;  3SWN C;  3SB2 A;  5LJ5 h;  4JRI A;  4MMK A;  4XU0 A;  3V8K A;  4J6X A;  2DTH A;  5GAN 3;  1WQW A;  4RCB A;  5GAO r;  4NL3 A;  4EMK A;  5GAO n;  1Y96 A;  4JLI A;  4M77 D;  4M7A F;  4PJO E;  4XTX A;  4XU3 A;  1BIA A;  5GAN j;  4C8Q E;  3INZ A;  1KQ1 A;  1B34 A;  3RES A;  4PJO G;  2DEQ A;  4M78 B;  3JCM e;  2RD1 A;  1D3B B;  3JCM Q;  4M7D D;  3RKY A;  5GAO p;  5DY9 A;  1M8V A;  4M77 E;  4HT8 A;  5GAN f;  4PJO A;  3RUX A;  4M77 C;  5GAN h;  1H64 1; 
#chains in the Genus database with same CATH topology
 3ZFJ A;  1Q86 U;  1S72 A;  4HCB A;  5L8R E;  2L0A A;  3MEW A;  3CC2 T;  5D6X A;  3CC2 Q;  2DD5 A;  4EMH A;  3V8L A;  3QUI A;  3V7S A;  4BY6 C;  3VU3 C;  4DEY A;  3EG2 A;  1OEB A;  2L2P A;  1VQM T;  4PJJ A;  1YHQ T;  4J6W A;  3CCQ Q;  1YCY A;  4F14 A;  4JZ3 A;  4D8K A;  4E7K A;  1G3T A;  3E9F A;  4C0D B;  2QA4 Q;  1BCO A;  3I35 A;  3CME Q;  3O5Z A;  1G3S A;  1VQL A;  2C0T A;  3JB9 G;  4XTW A;  1CKA A;  2RJC A;  2CZ1 B;  2RJF A;  2CUD A;  4BDY A;  3EGX B;  1M27 C;  2EGA A;  1TXQ A;  3M0U A;  1K0X A;  3JCM P;  3ASK A;  4BB7 A;  4NOY A;  5A2Q E;  4HXJ A;  1Y0M A;  3GP8 A;  2EWN A;  3CCQ A;  5CK9 A;  2HAX A;  3L1A A;  3U23 A;  3FRN A;  4LDW A;  1VQP Q;  2GTJ A;  3QDR B;  1XTD A;  1D1B A;  2JOY A;  1IHW A;  4ZTF A;  1YWO A;  4DOV A;  4XTY A;  1G83 A;  1E6H A;  1FWZ A;  8ATC B;  4LUD A;  1I0C A;  1OU8 A;  3RR6 A;  1QW1 A;  2DJQ A;  4OGC A;  2OJ2 A;  3M59 A;  1WIE A;  3KFV A;  2RN8 A;  1VQ6 Q;  4J83 A;  2K5F A;  1SHG A;  4RTV A;  4GBQ A;  1YJ9 T;  2JUF A;  4FW2 A;  1VQP T;  1RAD B;  2ABL A;  4JDS A;  3OYA A;  2PNI A;  3CCQ T;  2COW A;  3CCR A;  2LQK A;  3LX7 A;  1V76 A;  1D0Z A;  1MMD A;  2JS0 A;  2LP5 A;  1VQO Q;  1VQ9 A;  5GAN h;  3NFC A;  2C0O A;  3GF5 A;  2YUO A;  2RHI A;  3F70 A;  4ANJ A;  1D1A A;  1QLY A;  3WVE B;  2K2M A;  3VS7 A;  3DLL A;  3JAM E;  3EG9 B;  4M75 B;  1IHV A;  1TUG B;  5GAM d;  4PJO F;  1MV0 B;  3CC7 T;  4OGE A;  1TTH B;  2RPN A;  3M56 A;  2D1X A;  2JJ9 A;  2BTT A;  2K7A A;  3J81 E;  1FMK A;  4LDY A;  3JSC A;  1N27 A;  5CCA A;  2DYB A;  2O4X A;  1OPL A;  5A0D A;  3L2W A;  1ZHI A;  2PZ1 A;  4N0A A;  1S1N A;  2L3S A;  3G4S Q;  2MK5 A;  1NJI R;  2R58 A;  1QVG P;  1M90 R;  2DL7 A;  3OBW A;  2ATC B;  2LT1 A;  2OX7 A;  2I0N A;  2BE7 D;  1M3A A;  1K76 A;  1KQ2 A;  1DJ7 B;  3E9G A;  1JQQ A;  4A4K A;  3EH1 A;  4XAX B;  3GLX A;  1UJY A;  2J7I A;  2JT4 A;  1VQ4 Q;  5GAM j;  2E5K A;  4FT4 A;  4KGX B;  2EYZ A;  2LQN A;  4JUV A;  1VYV A;  2CT4 A;  2EIF A;  2MAM A;  4DBH A;  3CBM A;  1IXD A;  3CPW P;  4N4I A;  3QDF A;  5FU7 C;  4D6W A;  3EH2 A;  2IIM A;  4M77 B;  4LNP A;  4BE2 A;  3I56 A;  3OB9 A;  2EVR A;  1YBY A;  3VYG A;  5GAO r;  1X6B A;  4XU3 A;  5GJW B;  4E7I A;  3C4S A;  3G7Z A;  4OMO A;  2XIC A;  1UHC A;  3ULR B;  4BY6 B;  1QKX A;  2FYK A;  2DXT A;  1O9S A;  2P0Q A;  4AG1 C;  1ZSZ A;  4FSX A;  1B3Q A;  2JMA A;  1VQ5 A;  4JPB W;  4GLK A;  1MMN A;  2L3Q A;  1I4K 1;  1YJW A;  3NTK A;  1QCN A;  3EGD B;  3G71 A;  3E2U A;  3EAE A;  1PC0 A;  4XTZ A;  3PVL A;  5KYN A;  4F7U G;  1N5Z A;  3OYC A;  1N8R C;  2LJ3 A;  2MIO A;  2LX9 A;  1LJO A;  4C92 B;  1JB0 E;  2NUT B;  3S3O A;  2AZV A;  3PTA A;  1JJ2 S;  1KD1 C;  1NJI C;  5KYX A;  3OYL A;  1ACM B;  2DO3 A;  3OYM A;  4EDU A;  3M0R A;  4RTT A;  2BKD N;  1T0J A;  5KYU B;  1K9M C;  2MWO A;  5EC7 A;  5GMK h;  4Y91 A;  1RI0 A;  3L2Q A;  2RO0 A;  4QQD A;  2EKH A;  3CCL T;  1SEM A;  3NMZ C;  4PJM A;  1PKT A;  3P8H A;  1D0Y A;  2VB6 A;  1GBQ A;  5GAO q;  3CME A;  3OW2 S;  1I8F A;  1H92 A;  1WJQ A;  3C95 A;  3MP8 A;  5GAN 8;  4QVC A;  2H3E B;  5FRO A;  2RQR A;  3PMI A;  4J9H A;  1QVG S;  4OVA A;  2ENM A;  2KBT A;  4E2F B;  3FIF A;  3BFM A;  1D0X A;  4KUD K;  3BDU A;  2J6F A;  3G6E Q;  1UGR B;  3DLM A;  1G3Y A;  3QSU A;  2CZ0 B;  1MNE A;  3CPW A;  1K8A C;  4MMK A;  1BI3 A;  3G4S T;  3HRU A;  1WQW A;  4NL3 A;  4ZTJ A;  2QEX Q;  2NYS A;  1UHF A;  3VS4 A;  2BE9 B;  4L6V 5;  4HKE A;  2FO0 A;  1XQH A;  3H6Z A;  4ZN1 A;  2AIR B;  2E3I A;  4JLG A;  2FZC B;  4IIM A;  2GTO A;  1D1C A;  2EQM A;  2HL3 A;  4RG8 A;  4C8Q C;  2QQA A;  3A8O B;  3T9N A;  4KH0 B;  4OB2 B;  2OI3 A;  1F1B B;  4CC2 A;  5I2S A;  1VQ6 T;  2QQB A;  1XOV A;  1K9M U;  2YHT A;  2DAQ A;  3QBY A;  1VYT A;  2RI5 A;  4DEX A;  1AWO A;  3MEA A;  2FPF A;  1VQ9 Q;  3UPU A;  1VQK T;  1FYN A;  2YRV A;  5KYY A;  4J6Y A;  4OF1 A;  5J3B A;  1Q81 U;  2A3L A;  1PNJ A;  2EJG A;  1WXB A;  2L3P A;  1YI2 T;  1BU1 A;  1IO6 A;  3THK A;  4C92 C;  3L2V A;  4OB3 B;  4R56 A;  2L3R A;  2A08 A;  1VQ6 A;  5CO7 A;  2KQW A;  1RI9 A;  3HFO A;  4FSS A;  1I07 A;  1ZBJ A;  1ZUU A;  1LNX A;  3FB9 A;  4X9D A;  2EFI A;  5DM7 R;  1R0C B;  4PNO A;  3TVT A;  3LWI A;  3EG3 A;  3LGF A;  1H3H A;  2K4Y A;  3HP9 A;  4EPC A;  1M1K R;  2KXC A;  2D6F A;  9ATC B;  4RTY A;  3L42 A;  3CCR T;  1K9M R;  1Z9Z A;  3M0P A;  1YI2 A;  3JCM f;  4RTX A;  3JCM h;  2PU9 B;  4JS4 A;  1OV3 A;  1PHT A;  4ZNX A;  4IKF A;  2E65 A;  1RL2 A;  1WDX A;  3RMQ A;  2LJ1 A;  3JB9 I;  2VAS A;  2WAC A;  2KY9 A;  1ABQ A;  2DPP B;  1G3W A;  1HSQ A;  4EMK A;  4KBM B;  1X43 A;  2D9T A;  3E19 A;  2A37 A;  2MI6 A;  2MOX A;  4LDX A;  1IRE B;  1PRL C;  4M77 E;  2EPD A;  2QA4 T;  5GMK m;  3H0F A;  5GMK j;  1IGQ A;  1RAA B;  1X27 A;  1AOJ A;  4M78 D;  4C8Q A;  2AZS A;  1B7T A;  1UB4 A;  3MEV A;  4RTW A;  2JTE A;  3ER0 A;  3H0H A;  1SF9 A;  2GGR A;  3VS3 A;  2F1L A;  2MCN A;  3WVD B;  2KSS A;  1KC8 U;  4J9D A;  4WTO B;  2ZPF B;  3V7C A;  1AVZ C;  2E6Z A;  1AT1 B;  3CXC S;  4Z8A A;  1OX9 A;  3M4Y A;  2ESW A;  1MGQ A;  5I21 A;  3OW2 A;  1YJ9 Q;  3A8G B;  4AFS C;  1HXD A;  4L59 A;  5KYX B;  3CCV A;  3OQ5 A;  2ED0 A;  2FHD A;  1JO8 A;  1JU5 C;  3Q1J A;  3CMA A;  3CC4 Q;  1FMW A;  4CC4 B;  4C92 E;  4OMM A;  5HKC A;  1OI1 A;  1IB8 A;  4J9I A;  1UJ0 A;  3HL8 A;  2L8D A;  3PMT A;  5GAN d;  3OYH A;  4JJC A;  3LLR A;  3X20 B;  4C5I A;  2PUO B;  3LH0 A;  1WI7 A;  3OMG A;  4B9X A;  5L23 A;  2DE0 X;  5GAN g;  3GPL A;  3OY9 A;  1VIE A;  3CCS A;  2LC4 A;  2V26 A;  2QQS A;  3JCM g;  3URG A;  1VQM A;  2OTL T;  2K3B A;  4PJO D;  1OU9 A;  1Y96 B;  1YJW Q;  3X24 B;  1M1F A;  3G71 Q;  2BZX A;  2JM9 A;  2PQW A;  4DQ2 A;  2HQE A;  3FJ5 A;  3HFN A;  7AT1 B;  2JM8 A;  3VUB A;  3V8K A;  1VQO A;  2HQX A;  1O75 A;  5GAO n;  4FYY B;  3LWH A;  2Z0W A;  3M53 A;  2MPX C;  4PJO G;  5KYW A;  2RD1 A;  2EYX A;  3LYI A;  2FL7 A;  2HDA A;  2LVM A;  1H64 1;  3A1P A;  3QYG B;  1FMV A;  3M0S A;  2NUZ A;  1GBR A;  1KQS A;  1ZX6 A;  4BI8 B;  1NPP A;  2KYB A;  1OUL A;  2CS7 A;  3NTI A;  3GIB A;  1SRL A;  2COZ A;  5C0M A;  3I5S A;  2RHY A;  3JCM W;  4M75 G;  2CYZ B;  2SEM A;  3I56 T;  2EKO A;  1VQK Q;  5I22 A;  1MUZ A;  1BYM A;  1AWJ A;  2Y4X A;  4CRI A;  2YRD A;  5KE2 A;  2KE9 A;  2XI9 A;  3UT1 A;  3CD6 Q;  1P92 A;  3V8J A;  4QVZ A;  2L89 A;  4J7I A;  2XU8 A;  4V2S A;  5GAN 7;  4FL6 A;  3FC3 A;  2CGH A;  5FRM A;  3TQ7 P;  2EYQ A;  1U8R A;  3CBP A;  1WPY A;  1VQ5 T;  5AYF A;  4BE0 A;  1VQ9 T;  1GXI E;  1K0S A;  1KK7 A;  4JRQ A;  5IT9 E;  2V8I A;  4RTZ A;  2EBP A;  1B34 B;  2KR3 A;  5GAM h;  2CT3 A;  4KH1 B;  4IUP A;  1HJD A;  1NLO C;  3EG0 A;  2DK3 A;  1WJR A;  2QG9 B;  1SKU B;  2RHU A;  5LJ3 j;  2O88 A;  3QG1 A;  2XDP A;  4PJO E;  1PSE A;  4JRP A;  4QT7 A;  1ZSZ B;  1AWX A;  4PJO A;  1QWE A;  2O9S A;  2YUQ A;  3JV3 A;  4ELY C;  2DMO A;  2DLP A;  5CAI A;  5DLO A;  1TU0 B;  2LDM A;  2KT8 A;  4KT0 E;  4C92 A;  3BW1 A;  2E41 A;  1QCO A;  4C5H A;  2H3J A;  1IRX A;  1QQJ A;  1FX7 A;  4PLL A;  5FWB A;  2R5A A;  1VQ7 Q;  2E1H A;  4J8O A;  1ZBX A;  2QEX A;  1TG0 A;  3OYJ A;  5LJ5 j;  3VS6 A;  2F2V A;  3DKM A;  4C92 G;  4J9E A;  3PIP A;  2GQI A;  1WXU A;  1MMA A;  2DYI A;  2VYT A;  4C8Q G;  1RAF B;  2P0P A;  3I55 A;  4HA8 A;  2KK4 A;  2IVW A;  1YIT T;  1I81 A;  4LXC A;  1AEY A;  2D0N A;  4AMC A;  3REB B;  3RKX A;  1Q86 R;  2NUP B;  2JVV A;  4PFZ A;  1NG2 A;  3TU4 K;  2M16 A;  2EGC A;  4RCC A;  2X51 A;  1YJN A;  1UEC A;  4F04 B;  2F2X A;  3VJP A;  3OS5 A;  2O4X B;  3G6E A;  4J5Y A;  4F17 A;  1BIB A;  2DIL A;  4JS5 A;  3RIR A;  3OYG A;  2D8H A;  4PL6 A;  1EFN A;  1VQP A;  2RQT A;  3MET A;  4LDV A;  1RAE B;  1C0M A;  3CCJ A;  3I55 T;  1X6G A;  5CQX A;  3IQL A;  1M2V B;  3JB9 H;  1KQS S;  2L5Q A;  4ZN3 A;  4BE1 A;  1TOV A;  1SHF A;  2HQH A;  2M1H A;  3RKW A;  3EHQ A;  3HRS A;  3CCS T;  4FYW B;  1IZ6 A;  2FG0 A;  3UAT A;  1Y96 A;  1FXX A;  1XJW B;  3PNW C;  4ELZ C;  1R0B G;  4HVU A;  2EQI A;  4PJN A;  2DL3 A;  3MP1 A;  1RAI B;  1BCM A;  1JEG A;  2GCX A;  3CXC A;  3EFR A;  3RNJ A;  1WX6 A;  1OOT A;  1U1S A;  2YT6 A;  4ZGJ B;  1X69 A;  4RUG A;  4IUR A;  1OQK A;  3TRE A;  2KAF A;  3JRZ A;  3EGU A;  1HD3 A;  2NLU A;  1VQ8 Q;  3MKD A;  3LGL A;  4AFQ C;  2E70 A;  2BZY A;  1E6G A;  2XMF A;  2QGG A;  3QO3 A;  4FU6 A;  4AT1 B;  4M75 A;  2XID A;  1AZG B;  2FZK B;  4ORZ A;  1JBM A;  2CP5 A;  4XU1 A;  5CKF A;  4F7U A;  2W10 A;  3OBY A;  5A0G A;  1YIJ A;  3VS2 A;  2GNC A;  1LOJ A;  2H8H A;  1UDL A;  2CZ7 B;  1M30 A;  3A5Z B;  1UFF A;  4OB1 B;  3SWN B;  2NUT A;  1ZUK A;  1Y57 A;  3LW5 E;  2ZPI B;  3UA7 A;  2DZ9 A;  4J9C A;  4M78 A;  4M7D G;  3CCV Q;  3M9Q A;  1ABO A;  1ARK A;  2ROL A;  1NYF A;  2FPD A;  3PVQ A;  1WGS A;  3GBQ A;  2DXB A;  2GFU A;  2EQU A;  1NEB A;  4E6R A;  3M0Q A;  3CCU A;  2RQW A;  1K4U S;  2HBW A;  3FDR A;  4FIB A;  4BUG A;  2AK5 A;  1TH7 A;  1WLP B;  1UGS B;  5IHI A;  2E64 A;  3MHX A;  2MF2 A;  5ECA A;  4A4F A;  4C92 F;  4N0A C;  4OMF B;  5LJ5 h;  3SB2 A;  4A4E A;  2QYZ A;  1LPL A;  4CI0 C;  1WFW A;  2G3R A;  1BB9 A;  4O5V A;  2ROT A;  3OSV A;  1GCP A;  1VQK A;  2KRM A;  3CCM A;  1B34 A;  4PLI A;  1D3B B;  4KUL A;  2P4R A;  2J06 A;  1BI2 A;  3VYH B;  4X34 A;  2P4T A;  3OYB A;  1GFC A;  5D6W A;  1YIJ Q;  1RAH B;  3I9Q A;  1RAG B;  2QAS A;  1VQL T;  2KI7 A;  5LJ5 f;  1BKB A;  2EQJ A;  1VQL Q;  3MCA B;  2ED1 A;  4M7A G;  2E10 A;  5GMK l;  3VS5 A;  2EAY A;  3UWN A;  5D7U A;  2OAU A;  5IN1 A;  2OTL A;  2CUB A;  4P5N A;  4MZT A;  1R8O B;  3BY7 A;  4OMN A;  1D09 B;  4X9C A;  4M78 C;  2OAW A;  3R6O A;  3P8D A;  4F7U E;  3CC4 T;  4OML A;  1VOM A;  3EHR A;  4XTV A;  3CC2 A;  3V7R A;  3EFO A;  5KYW B;  5FRN A;  1Q95 G;  4LD6 A;  1W70 A;  2KYM A;  4PFO A;  2YUP A;  1NBE B;  2DTI A;  3OYF A;  1KD1 R;  1VQ7 A;  1N9R A;  2PTK A;  1YHQ A;  3AT1 B;  2YXY A;  3MEU A;  2QA4 A;  2LT4 A;  5LJ3 f;  3M54 A;  1U3O A;  2QGF B;  4F7U F;  2LCS A;  1TSF A;  3GNG A;  2QQR A;  3PT9 A;  2V1Q A;  2VC8 A;  2VGM A;  2K6D A;  2EYY A;  4A63 B;  3QPH A;  1OZ2 A;  1G8X A;  1UTI A;  1KD1 U;  6AT1 B;  1SSH A;  4AFZ C;  1JJ2 P;  3M5A A;  3OW2 P;  4JRI A;  4XU0 A;  5GAN 3;  2DTH A;  5KH6 A;  4DBR A;  4M7A F;  3VUZ A;  4KRT A;  3CCM Q;  3OYN A;  3CC7 A;  2YSQ A;  4C0F A;  1Q82 U;  1QP2 A;  3LH5 A;  2QAZ A;  5CIU A;  1TUC A;  2HBP A;  1R77 A;  1Q81 R;  1N6A A;  5C6S A;  3X26 B;  4LE9 A;  2PUK B;  3PGG A;  3QWY A;  4M7D E;  4E7H A;  2CRE A;  2ZAE A;  2B86 A;  2RHZ A;  2MWP A;  2DTO A;  4EMK C;  2JXB A;  2E12 A;  2R5M A;  3C94 A;  3CXC P;  4B6M A;  4KGZ B;  5LJ5 e;  1UE9 A;  3NTH A;  1Y07 A;  5CVI A;  3M58 A;  4FYV B;  3TSW A;  3OA6 A;  5LJ5 d;  2K79 A;  2RK1 A;  1WHM A;  1E7O A;  1YFN A;  2YUN A;  1KFZ A;  2FEI A;  2OTJ T;  3NGP A;  5FLX E;  1M5Q 1;  2LNH B;  4E7Z A;  1EZZ B;  1U5S A;  4A53 A;  1ZLM A;  3N5B B;  3TCJ A;  1K73 U;  2B8A A;  2K3X A;  2PVG B;  3HPW A;  1C6V X;  2W0Z A;  4JZ4 A;  3RDV A;  3CPW S;  2LCC A;  3CCL Q;  1G5V A;  2E4H A;  2RM4 A;  4RKU E;  2CH4 A;  2XDD A;  4M7D A;  3I5R A;  4Y92 A;  3VRZ A;  1NM7 A;  5GAM f;  1QP3 A;  3CEY A;  1VQ4 A;  1OZ3 A;  2DA9 A;  4DBQ A;  5EG2 A;  3J80 E;  5D6Y A;  4RTU A;  2C06 A;  2DZC A;  3C0C A;  4OP0 A;  5GMK i;  1EIF A;  2LNV A;  4DA4 A;  3CCU T;  3H9N A;  4Z88 A;  2EW3 A;  4J6X A;  1Q7Y U;  1AZE A;  1PM3 A;  1ZQ1 A;  2BUD A;  1BIA A;  5GAN j;  2AHJ B;  2M0Y A;  3INZ A;  1B07 A;  1WHJ A;  1M4Z A;  3JCM e;  5DY9 A;  2Y4Y A;  1MND A;  2DKG A;  2RI2 A;  4LDU A;  2BIV A;  5LJ3 d;  2ZPH B;  3QZ9 B;  3C12 A;  1VQO T;  2JTF A;  2X3W D;  1TS9 A;  3CCJ Q;  4YTL A;  2K5L A;  3SDZ A;  1YCS B;  1QVF A;  1NPR A;  3CCL A;  3H8Z A;  1JXM A;  2F5T X;  2K2V A;  2XKO C;  3SD4 A;  3L2U A;  2DL5 A;  2QI2 A;  4FYX B;  1W4S A;  4QQG A;  3CCV T;  2VUB A;  1VQ8 A;  1U1T A;  2CP3 A;  1QWF A;  2KEA A;  3I55 Q;  3MPU B;  3OYI A;  3ZBD A;  2RQU A;  4OB0 B;  1KJW A;  2JTM A;  4MDW A;  4LUE A;  1W2B P;  1X2Q A;  5GAM e;  1YHQ Q;  1N9S A;  1RUW A;  1VA7 A;  5HK0 A;  4C5E A;  1TWB A;  5CKD A;  1TUD A;  1QVP A;  1W1F A;  2DM1 A;  2Y90 A;  1OX8 A;  2DD4 A;  4C8Q F;  3KBG A;  1YWP A;  3HKS A;  4J9B A;  2QTX A;  4JRK A;  3CCM T;  2D8J A;  2QQ9 A;  4M7A A;  1I5L A;  2VXE A;  1UUE A;  1W2B A;  2FPE A;  2V8J A;  1NEG A;  3DB3 A;  3SFM A;  2JMC A;  2SRC A;  5GAN e;  1K8A U;  3UA6 A;  1ZSG A;  3SEM A;  2X3X D;  2DL4 A;  2OTL Q;  2CKK A;  1T0H A;  2HMA A;  4ZGE B;  2E5Q A;  3X25 B;  2RI3 A;  4PKC C;  1I1J A;  1VQM Q;  3CD6 T;  1LVK A;  1YN8 A;  3FEO A;  5HCK A;  1HYO A;  3E1S A;  1YP5 A;  3I56 Q;  4M78 B;  3JCM Q;  1M90 U;  1M8V A;  4HT8 A;  3OSS C;  1GL5 A;  5CKE A;  2RF0 A;  1NE8 A;  2V8K A;  3SWN A;  4F16 A;  3EG9 A;  4IUV A;  4MDX A;  3JCM b;  3QZ5 B;  5LJ3 h;  2WSE E;  1KQS P;  1OPK A;  1X75 C;  2M02 A;  2DRM A;  4M7A E;  2RA2 A;  2LMJ A;  1M1K C;  2KRO A;  2EYW A;  1VIF A;  1I5O B;  3RER A;  1RLP C;  2KT1 A;  1WHH A;  2YDL A;  4C0G A;  1K73 C;  2GQV A;  2DXU A;  2CP0 A;  1VQN A;  2FB7 A;  2LX7 A;  3JB9 D;  2M9U A;  4PFP A;  2YLB A;  3QWX X;  3EGD A;  4M75 E;  1UGV A;  2JZ2 A;  4IIO A;  2CZ6 B;  2DIG A;  3MO8 A;  4OMQ A;  3KUF A;  3NHN A;  2KRN A;  2LCL A;  3UDC A;  2YLC A;  1J3T A;  2X35 A;  5J26 A;  4IUT A;  2DER A;  1WNL A;  5GAO l;  5GAN 5;  4BD3 A;  2DIQ A;  3CC7 Q;  3A8M B;  2WSF E;  2CSQ A;  2HCK A;  2JNG A;  2PVO B;  5GAN 2;  4NL2 A;  5CKB A;  2GF7 A;  2DJZ A;  4PJO B;  2NUP A;  2HNI A;  2DX1 A;  1Q7Y C;  4M77 A;  4MZP A;  3FJP A;  4CC3 A;  2KVQ G;  2P0K A;  1K9A A;  2VV5 A;  2X9H A;  1YJN T;  3SWN C;  1KC8 C;  2HKQ B;  3GNF B;  2ZCF B;  4CC7 A;  2V1R A;  3G6E T;  2DFU A;  4Q5W A;  3CCR Q;  4E7S A;  4M7D D;  2DET A;  3QYH B;  2J05 A;  2X4X A;  1Y7X A;  2XK0 A;  2DF6 A;  1WZO A;  4X1V A;  4EMK B;  3O8V A;  2QDL A;  4JJB A;  4E7L A;  2RJE A;  2RQV A;  5I11 A;  4RG2 A;  2LRQ A;  2RK2 A;  2OTJ A;  3REA B;  2EJ9 A;  3S3N A;  3KXT A;  3HHT B;  1UEB A;  2K9G A;  5HY6 A;  4DOW A;  3JCM V;  2NWM A;  4BAC A;  2G6F X;  1KHI A;  2MMP A;  8AT1 B;  2VWF A;  3MJX A;  5LJ5 g;  2A7Y A;  1YJW T;  2A0F B;  2WSC E;  1H3Z A;  3PE0 A;  1K8A R;  1YIT A;  5KYU A;  3HSB A;  1SG5 A;  3HRT A;  2KNB B;  5GMK e;  1VQ8 T;  4FT2 A;  1T3S A;  4E7J A;  4EMG A;  2CDT A;  4EIK A;  2LQ8 A;  4XQ3 A;  3OYE A;  4DBF A;  1M2O A;  2EQK A;  4M75 C;  1JXO A;  5J39 A;  2RB6 A;  4MML A;  3SHW A;  1WQ7 A;  1GCQ C;  5GAN 6;  4HCK A;  1V29 B;  4TVR A;  4WF2 A;  2RMO A;  3H41 A;  4UC4 A;  2LQW A;  2FVU A;  3CBO A;  4PK4 A;  4L5G A;  4RMO A;  1Q86 C;  4N4G A;  2KGT A;  2YWW A;  5KE3 A;  1K1Z A;  2X4W A;  4M7A C;  4K11 A;  1YJN Q;  2R57 A;  3CMA Q;  3CCS Q;  1M2V A;  2YRC A;  3QHS A;  4IUQ A;  3MP6 A;  4II1 A;  3UF4 A;  2DBM A;  2A36 A;  2E6N A;  4B9W A;  2VGN A;  1C1A A;  3QJY A;  4C8Q E;  1KQ1 A;  3CCU Q;  2VVK A;  1BI1 A;  3RKY A;  5CR2 A;  4AG2 C;  5GAN f;  1N8R R;  1KHC A;  2O2O A;  1RLQ C;  3GOX A;  1VQ4 T;  1LCK A;  5FW9 A;  3OYD A;  5FWC A;  4JJD A;  2JW4 A;  1M90 C;  3HTR A;  2JS2 A;  1PD1 A;  3JCM d;  4M78 E;  4M7D F;  2E3H A;  1HK9 A;  4BI4 A;  2LZ6 B;  4ATO A;  4KUI A;  3VKI A;  3OYK A;  4Z02 A;  1ZA1 B;  2A28 A;  3A98 A;  2J6K A;  5IHN A;  3EG1 A;  3CQT A;  4HCZ A;  2P84 A;  2EJF A;  4QVD A;  1S72 T;  2HL5 C;  3CCE Q;  5FU7 B;  4M77 F;  1PD0 A;  4D8D A;  4M7A B;  4M4Z A;  1Q81 C;  1A0N B;  4C0D C;  3L2Z A;  2VKN A;  1S72 Q;  3VS1 A;  3M57 A;  4M78 G;  4LD9 K;  5IXB A;  2O31 A;  3BDL A;  2KXD A;  3JCM J;  4XTU A;  1W2B S;  2K5I A;  2CP6 A;  1PCX A;  1ZUY A;  2O9V A;  2QK0 A;  3OMC A;  2XHC A;  1N8R U;  2DXC A;  2F69 A;  1WHL A;  1GCQ A;  1NZ9 A;  3AHU A;  4J9G A;  3CC4 A;  1PG5 B;  5M9O A;  2C0I A;  2QXF A;  1M1G A;  3VRY A;  1AD5 A;  3CD6 A;  5GJV B;  1BK2 A;  3JB9 J;  1X2K A;  1VQ7 T;  2IG0 A;  1CKB A;  2X4Y A;  5AT1 B;  3JB9 F;  3CCE T;  1RAC B;  1Y71 A;  1XNI A;  1UGP B;  4A4H A;  1X6O A;  2AT1 B;  1M8M A;  3QXE B;  4Z89 A;  2XD0 A;  4VUB A;  3X28 B;  4RCB A;  3A8L B;  2RJD A;  2FRW A;  4XTX A;  3M55 A;  1WHG A;  2AKK A;  1VQN Q;  2DEQ A;  2M0O A;  3TEE A;  5GAO p;  1M9S A;  4KGV B;  3ZL7 C;  4J7F A;  1K73 R;  3R6N A;  2KMT A;  2FRY A;  3EFS A;  1Z9Q A;  1QVF P;  1VQN T;  2RHX A;  2KDS A;  4M7A D;  3DB4 A;  2DRK A;  3QII A;  1WHK A;  4C0Z A;  3NPF A;  5DLQ E;  2DBK A;  2HZY A;  4R0K A;  1X01 A;  4F7U B;  2GBQ A;  1Q82 R;  3RMS A;  2DNU A;  4Y28 E;  2O01 E;  1PKS A;  2ZPG B;  5GAM g;  2CSI A;  1WA7 A;  4M75 D;  1SPK A;  4XU2 A;  5IAY A;  2HEQ A;  4HVV A;  4A54 A;  3P8B B;  2COY A;  3VV0 A;  4MZM A;  1NLP C;  2ZPE B;  2D0Q B;  2BZ8 A;  3G1J A;  4A4G A;  3EFO B;  3EGX A;  4GY5 A;  3WXM B;  2IPO B;  4OMP A;  1YI2 Q;  2PVD B;  1EX4 A;  1PSF A;  3CCJ T;  3D7S B;  1Q7Y R;  4ESR A;  1YNZ A;  1W6X A;  3QJ6 A;  4R55 A;  2K3Y A;  1RAB B;  4BI3 A;  2HD0 A;  4PJL A;  2J6O A;  2ZGW A;  2MYS A;  2F2W A;  2QEX T;  1D3B A;  1YIT Q;  5A0L A;  1MMG A;  1QVF S;  1H8K A;  5FU6 C;  1ZSZ C;  4QKU A;  4BDZ A;  1QKW A;  1YJ9 A;  1GRI A;  3G71 T;  1KG1 A;  3FLG A;  1ZA2 B;  1M3B A;  1BI0 A;  4M7D C;  5HK3 A;  2LJ0 A;  3L2R A;  3QKJ A;  4M7D B;  4M77 D;  2HKN A;  2RH2 A;  3RES A;  3J7A F;  4HVW A;  3TSZ A;  1KC8 R;  3BE3 A;  5KCO A;  4M77 C;  3S3M A;  1YIJ T;  1M1K U;  1WYX A;  1OYX A;  2ECZ A;  3CPF A;  4WCI A;  5CKH A;  3H0I A;  1M3C A;  5GAO m;  2F5K A;  4C8Q B;  2QDY B;  5FU6 B;  5KYY B;  1U06 A;  1IGU A;  4ZGD B;  2X4J A;  5LJ3 e;  3M4G A;  5LJ3 g;  2XDB A;  2HSP A;  2AKL A;  1VYU A;  3S6W A;  3PFS A;  2GFA A;  4M78 F;  2OTJ Q;  3CMA T;  2FZG B;  2VXF A;  4C5G A;  1T3L A;  1AHJ B;  4IUU A;  4O6J A;  4E47 A;  4FCY A;  2RNA A;  1VUB A;  1V1C A;  5IHK A;  4NS5 A;  2QTV A;  1QVG A;  4HT9 A;  1QMC A;  1AWW A;  4M77 G;  1WJS A;  3OS2 A;  4HCC A;  1JJ2 A;  2ZPB B;  4N4H A;  4C92 D;  2XG8 D;  4FM4 B;  2DL8 A;  4GLM A;  1KIK A;  2K57 A;  2CP2 A;  3G4S A;  4M75 F;  1G2B A;  3JCM X;  1CSK A;  2I2L A;  3VS0 A;  3JCM c;  4PJO C;  1UGQ B;  3ZEH A;  3OS0 A;  1KSW A;  1SSF A;  1GFD A;  2CP7 A;  2JN0 A;  2KRS A;  2DVE A;  4JJN K;  3OS1 A;  1NYG A;  2HSE B;  1MHN A;  5I2M A;  4ME7 A;  4LN2 A;  5KCH A;  1PRM C;  5CQY A;  3M0T A;  4XK8 E;  5IH2 A;  5LL6 S;  4J9F A;  2DEU A;  4QW2 A;  1Q82 C;  1BBZ A;  5GAN 4;  4C8Q D;  1UG1 A;  3A8H B;  2CH4 W;  1PWT A;  2LTO A;  1JRI A;  2EGE A;  4QQ6 A;  3CME T;  3ME9 A;  1VQ5 Q;  2DVJ A;  1NJI U;  4JLI A;  5IXF A;  4FW1 A;  1QCF A;  1SRM A;  3CCE A;  1MV3 A;  4AFU C;  2M51 A;  1WXT A;  3PIO A;  3RBB B;  2ZZD A;  3RUX A;  3OYY A; 
#chains in the Genus database with same CATH homology
 2X4X A;  3VYH B;  3ZFJ A;  4X34 A;  1Q86 U;  2P4T A;  2XK0 A;  5GMK j;  3OYB A;  4EMK B;  3O8V A;  4M78 D;  5D6W A;  4C8Q A;  1S72 A;  4HCB A;  5L8R E;  3MEW A;  1VQL T;  3CC2 T;  1UB4 A;  4E7L A;  2RJE A;  3MEV A;  4RG2 A;  3ER0 A;  5LJ5 f;  2LRQ A;  2RK2 A;  1BKB A;  2OTJ A;  2EQJ A;  5D6X A;  2DD5 A;  4EMH A;  3V8L A;  2EJ9 A;  3MCA B;  3QUI A;  3V7S A;  3WVD B;  4BY6 C;  3VU3 C;  3S3N A;  3KXT A;  4M7A G;  2E10 A;  3HHT B;  5GMK l;  1UEB A;  5HY6 A;  2KSS A;  4DOW A;  2EAY A;  3UWN A;  3JCM V;  2OAU A;  1VQM T;  5IN1 A;  2OTL A;  4BAC A;  1YHQ T;  1KC8 U;  4J6W A;  1KHI A;  2MMP A;  4P5N A;  1YCY A;  4MZT A;  1R8O B;  2ZPF B;  3BY7 A;  3V7C A;  5LJ5 g;  2E6Z A;  4X9C A;  4E7K A;  3CXC S;  2A7Y A;  4M78 C;  1G3T A;  3E9F A;  4C0D B;  1YJW T;  3M4Y A;  3R6O A;  2WSC E;  1H3Z A;  1MGQ A;  5I21 A;  3OW2 A;  1YIT A;  3P8D A;  4F7U E;  3CC4 T;  3A8G B;  1HXD A;  3HSB A;  4L59 A;  1G3S A;  4XTV A;  3HRT A;  1VQL A;  3JB9 G;  3V7R A;  4XTW A;  3CCV A;  3CC2 A;  3OQ5 A;  5FRN A;  4LD6 A;  2FHD A;  2RJC A;  5GMK e;  1VQ8 T;  4FT2 A;  2CZ1 B;  2RJF A;  4E7J A;  4EMG A;  3Q1J A;  4BDY A;  2LQ8 A;  3CMA A;  2DTI A;  4XQ3 A;  3OYE A;  3OYF A;  3JCM P;  1VQ7 A;  1N9R A;  4C92 E;  3ASK A;  4BB7 A;  5HKC A;  1OI1 A;  4NOY A;  5A2Q E;  2EQK A;  4M75 C;  1YHQ A;  3GP8 A;  5J39 A;  2RB6 A;  4MML A;  3HL8 A;  2L8D A;  1WQ7 A;  2EWN A;  3CCQ A;  3MEU A;  3PMT A;  5GAN d;  3OYH A;  2LT4 A;  5GAN 6;  5LJ3 f;  2QA4 A;  3M54 A;  1V29 B;  3LLR A;  4TVR A;  4WF2 A;  3X20 B;  4C5I A;  5CK9 A;  3L1A A;  4UC4 A;  3FRN A;  2PUO B;  3LH0 A;  4LDW A;  2FVU A;  3CBO A;  3QDR B;  4F7U F;  3OMG A;  1XTD A;  4B9X A;  2JOY A;  4L5G A;  4RMO A;  4ZTF A;  1Q86 C;  3GNG A;  2QQR A;  4DOV A;  5GAN g;  4N4G A;  4XTY A;  3PT9 A;  5KE3 A;  2X4W A;  3GPL A;  3OY9 A;  4M7A C;  1VIE A;  3CCS A;  2VC8 A;  1Q81 U;  2VGM A;  1FWZ A;  2R57 A;  3QPH A;  2LC4 A;  2QQS A;  3JCM g;  3URG A;  1QW1 A;  4OGC A;  1VQM A;  2OTL T;  3QHS A;  4PJO D;  3M59 A;  1Y96 B;  1OZ2 A;  4IUQ A;  4J83 A;  1KD1 U;  2K5F A;  3MP6 A;  1M1F A;  4II1 A;  3X24 B;  2PQW A;  4DQ2 A;  2HQE A;  3M5A A;  3HFN A;  2E6N A;  4B9W A;  1YJ9 T;  4JRI A;  3V8K A;  2VGN A;  2JUF A;  4XU0 A;  2DTH A;  3VUB A;  5KH6 A;  2HQX A;  4JDS A;  5GAN 3;  3OYA A;  1O75 A;  5GAO n;  1VQO A;  4M7A F;  3CCQ T;  3CCR A;  3QJY A;  4C8Q E;  3LWH A;  3VUZ A;  1KQ1 A;  2LQK A;  3M53 A;  3OYN A;  3CC7 A;  4C0F A;  1Q82 U;  3LX7 A;  1BI1 A;  1QP2 A;  4PJO G;  2RD1 A;  3RKY A;  5CIU A;  5CR2 A;  3LYI A;  2FL7 A;  5GAN f;  1VQ9 A;  5GAN h;  2LVM A;  2HBP A;  1H64 1;  3QYG B;  1N6A A;  5C6S A;  3NFC A;  3GF5 A;  1KHC A;  3X26 B;  1YJN T;  2PUK B;  3PGG A;  3GOX A;  4M7D E;  4E7H A;  2RHI A;  1VQ4 T;  3F70 A;  3OYD A;  1KQS A;  4BI8 B;  2RHZ A;  2MWP A;  1NPP A;  3WVE B;  1M90 C;  2DTO A;  4EMK C;  3DLL A;  2CS7 A;  3NTI A;  4M78 E;  2E12 A;  2R5M A;  3JCM d;  4M7D F;  3C94 A;  3GIB A;  1HK9 A;  4BI4 A;  4ATO A;  4KUI A;  3JAM E;  4M75 B;  3VKI A;  5LJ5 e;  5C0M A;  3OYK A;  3NTH A;  1Y07 A;  4Z02 A;  2RHY A;  3JCM W;  4M75 G;  5CVI A;  5GAM d;  4PJO F;  3M58 A;  2CYZ B;  4HCZ A;  3I56 T;  2EKO A;  3CC7 T;  4OGE A;  2EJF A;  5LJ5 d;  3OA6 A;  4M7D B;  2RK1 A;  4QVD A;  1S72 T;  3M56 A;  1BYM A;  5FU7 B;  2Y4X A;  4M77 F;  3J81 E;  4CRI A;  4LDY A;  2OTJ T;  3JSC A;  4M7A B;  1N27 A;  1M5Q 1;  5FLX E;  5CCA A;  5KE2 A;  2XI9 A;  2O4X A;  1Q81 C;  4A53 A;  3UT1 A;  4C0D C;  5A0D A;  1ZHI A;  3L2Z A;  3L2W A;  3N5B B;  4N0A A;  1P92 A;  3TCJ A;  1K73 U;  2B8A A;  2K3X A;  2PVG B;  3HPW A;  3V8J A;  3M57 A;  4M78 G;  4QVZ A;  3CPW S;  2L89 A;  4J7I A;  2LCC A;  4LD9 K;  2XU8 A;  4V2S A;  5GAN 7;  3BDL A;  1G5V A;  4FL6 A;  3FC3 A;  2R58 A;  2RM4 A;  3JCM J;  2CGH A;  5FRM A;  2EYQ A;  3OBW A;  2K5I A;  4XTU A;  1W2B S;  2LT1 A;  3OMC A;  2XHC A;  4RKU E;  1N8R U;  1KQ2 A;  1U8R A;  3CBP A;  2DXC A;  2F69 A;  1DJ7 B;  1WPY A;  1VQ5 T;  3E9G A;  5AYF A;  2XDD A;  1NZ9 A;  4BE0 A;  1VQ9 T;  3AHU A;  4M7D A;  1GXI E;  3CC4 A;  4A4K A;  4JRQ A;  5IT9 E;  2V8I A;  5M9O A;  4XAX B;  1B34 B;  2QXF A;  3GLX A;  1M1G A;  1QP3 A;  5GAM f;  3CEY A;  5GAM h;  5GAM j;  1VQ4 A;  1OZ3 A;  4FT4 A;  3CD6 A;  5EG2 A;  3J80 E;  4IUP A;  5D6Y A;  3JB9 J;  2C06 A;  4JUV A;  2DZC A;  2DK3 A;  1WJR A;  4OP0 A;  1VQ7 T;  2IG0 A;  2EIF A;  5GMK i;  1EIF A;  2MAM A;  3CBM A;  2X4Y A;  2LNV A;  4N4I A;  5FU7 C;  4DA4 A;  3JB9 F;  4D6W A;  3CCU T;  3CCE T;  2RHU A;  1Y71 A;  1XNI A;  4M77 B;  5LJ3 j;  1UGP B;  4BE2 A;  4A4H A;  1X6O A;  3I56 A;  3QG1 A;  3OB9 A;  3QXE B;  1YBY A;  4C92 F;  4J6X A;  3VYG A;  2XDP A;  4VUB A;  3X28 B;  4RCB A;  5GAO r;  3A8L B;  2RJD A;  4PJO E;  1Q7Y U;  2BUD A;  1PSE A;  1ZQ1 A;  3M55 A;  1BIA A;  4XTX A;  4XU3 A;  4JRP A;  5GAN j;  2AHJ B;  3INZ A;  1M4Z A;  4E7I A;  3C4S A;  2DEQ A;  3G7Z A;  2M0O A;  3JCM e;  3TEE A;  5GAO p;  1M9S A;  2XIC A;  5DY9 A;  4J7F A;  4PJO A;  2Y4Y A;  2DKG A;  2RI2 A;  2KMT A;  4BY6 B;  4LDU A;  2BIV A;  3EFS A;  2FYK A;  4ELY C;  2DXT A;  1VQN T;  2RHX A;  2KDS A;  5LJ3 d;  2ZPH B;  5CAI A;  5DLO A;  4M7A D;  1O9S A;  2P0Q A;  3C12 A;  3DB4 A;  3QZ9 B;  1VQO T;  2JTF A;  3QII A;  4FSX A;  2LDM A;  4C0Z A;  4KT0 E;  4YTL A;  1VQ5 A;  4GLK A;  4C92 A;  2K5L A;  3BW1 A;  2E41 A;  3SDZ A;  5DLQ E;  4C5H A;  1I4K 1;  4F7U B;  1X01 A;  2H3J A;  1YJW A;  1QVF A;  1NPR A;  3RMS A;  3NTK A;  1FX7 A;  2XD0 A;  3G71 A;  3CCL A;  4PLL A;  3H8Z A;  3EAE A;  2F5T X;  4XTZ A;  2R5A A;  2K2V A;  4Y28 E;  2E1H A;  2O01 E;  2ZPG B;  2XKO C;  4F7U G;  5GAM g;  3SD4 A;  3OYC A;  4J8O A;  3L2U A;  1ZBX A;  1N8R C;  2QI2 A;  1W4S A;  2QEX A;  4QQG A;  4M75 D;  3OYJ A;  3CCV T;  2VUB A;  2LX9 A;  1LJO A;  5LJ5 j;  4XU2 A;  5IAY A;  1VQ8 A;  1U1T A;  4C92 B;  1JB0 E;  4A54 A;  3P8B B;  3VV0 A;  3S3O A;  4MZM A;  3DKM A;  4C92 G;  2ZPE B;  2D0Q B;  3PTA A;  1KD1 C;  1NJI C;  4A4G A;  3OYI A;  1JJ2 S;  3PIP A;  4GY5 A;  3ZBD A;  3OYL A;  3WXM B;  2DO3 A;  2VYT A;  4OB0 B;  4EDU A;  3OYM A;  2JTM A;  4C8Q G;  2PVD B;  1PSF A;  2P0P A;  4MDW A;  3CCJ T;  2BKD N;  3I55 A;  1K9M C;  2MWO A;  2KK4 A;  4HA8 A;  3QJ6 A;  5GMK h;  2IVW A;  4R55 A;  1YIT T;  4Y91 A;  5GAM e;  1I81 A;  1RI0 A;  3L2Q A;  2K3Y A;  2RO0 A;  4QQD A;  1N9S A;  3CCL T;  4BI3 A;  5HK0 A;  4C5E A;  5CKD A;  2HD0 A;  3RKX A;  1QVP A;  2ZGW A;  2JVV A;  2Y90 A;  2QEX T;  3P8H A;  3TU4 K;  2M16 A;  4RCC A;  2DD4 A;  5GAO q;  1YJN A;  1D3B A;  3CME A;  5A0L A;  4C8Q F;  1I8F A;  3OW2 S;  3KBG A;  1QVF S;  3HKS A;  1WJQ A;  3C95 A;  3VJP A;  3MP8 A;  5GAN 8;  3OS5 A;  5FU6 C;  4BDZ A;  2O4X B;  2QTX A;  4JRK A;  3G6E A;  3CCM T;  4QVC A;  4J5Y A;  2QQ9 A;  5FRO A;  4M7A A;  3PMI A;  1BIB A;  4JS5 A;  2VXE A;  3RIR A;  1I5L A;  1W2B A;  1YJ9 A;  2V8J A;  3OYG A;  4PL6 A;  1VQP A;  3DB3 A;  1QVG S;  3SFM A;  4OVA A;  1BI2 A;  3MET A;  4LDV A;  5GAN e;  3FIF A;  3CCJ A;  3I55 T;  3BFM A;  1K8A U;  3G71 T;  4KUD K;  1KG1 A;  3FLG A;  5CQX A;  3BDU A;  3JB9 H;  1UGR B;  1KQS S;  3DLM A;  1BI0 A;  1G3Y A;  2L5Q A;  3QSU A;  4M7D C;  5HK3 A;  2CZ0 B;  4ZN3 A;  4BE1 A;  3L2R A;  1YIJ A;  2M1H A;  3RKW A;  2CKK A;  3CPW A;  3QKJ A;  1K8A C;  3HRS A;  4MMK A;  4ZGE B;  3CCS T;  1IZ6 A;  1BI3 A;  2E5Q A;  2RI3 A;  1WQW A;  3HRU A;  4PKC C;  3X25 B;  4NL3 A;  3G4S T;  1Y96 A;  1FXX A;  3PNW C;  4M77 D;  4ZTJ A;  3CD6 T;  4ELZ C;  2RH2 A;  3FEO A;  3RES A;  3J7A F;  4L6V 5;  4HKE A;  3E1S A;  1XQH A;  3H6Z A;  4M78 B;  4ZN1 A;  3JCM Q;  1M90 U;  4JLG A;  1M8V A;  3MP1 A;  5KCO A;  4HT8 A;  4M77 C;  3S3M A;  3OSS C;  1YIJ T;  5CKE A;  1M1K U;  1OYX A;  3CPF A;  1NE8 A;  5CKH A;  2EQM A;  2V8K A;  3SWN A;  4RG8 A;  2GCX A;  3CXC A;  3EFR A;  4C8Q C;  5GAO m;  2F5K A;  2QQA A;  3A8O B;  4IUV A;  3T9N A;  4MDX A;  4OB2 B;  4C8Q B;  3JCM b;  3QZ5 B;  1U1S A;  2WSE E;  5LJ3 h;  4ZGJ B;  5I2S A;  2QDY B;  5FU6 B;  1VQ6 T;  4IUR A;  2QQB A;  3TRE A;  1XOV A;  2KAF A;  1X75 C;  3JRZ A;  4ZGD B;  2X4J A;  5LJ3 e;  1K9M U;  4M7A E;  2NLU A;  3M4G A;  2YHT A;  5LJ3 g;  2RA2 A;  2DAQ A;  3LGL A;  2XDB A;  3QBY A;  2RI5 A;  2E70 A;  3S6W A;  1M1K C;  3PFS A;  2GFA A;  4M78 F;  1VIF A;  3CMA T;  2VXF A;  3MEA A;  4C5G A;  3RER A;  1AHJ B;  3QO3 A;  4FU6 A;  4IUU A;  4C0G A;  4M75 A;  4O6J A;  4E47 A;  2GQV A;  2XID A;  2DXU A;  3UPU A;  1K73 C;  1VQN A;  1VUB A;  2FB7 A;  1VQP T;  1JBM A;  4XU1 A;  4NS5 A;  5CKF A;  1VQK T;  2YRV A;  4F7U A;  1QVG A;  4HT9 A;  4J6Y A;  3OBY A;  4OF1 A;  2M9U A;  5J3B A;  5A0G A;  3JB9 D;  1LOJ A;  2A3L A;  2YLB A;  1WJS A;  4M77 G;  2EJG A;  3OS2 A;  4M75 E;  2CZ7 B;  4HCC A;  3A5Z B;  1YI2 T;  2JZ2 A;  1JJ2 A;  2ZPB B;  4N4H A;  4C92 C;  4OB1 B;  3SWN B;  4C92 D;  3L2V A;  4OB3 B;  2XG8 D;  4R56 A;  4FM4 B;  2L3R A;  2CZ6 B;  5CO7 A;  2DIG A;  3MO8 A;  1VQ6 A;  2K57 A;  2KQW A;  3G4S A;  3HFO A;  4M75 F;  3JCM X;  3LW5 E;  2ZPI B;  1LNX A;  3KUF A;  2DZ9 A;  3FB9 A;  4M78 A;  4X9D A;  2LCL A;  2EFI A;  3UDC A;  4M7D G;  2YLC A;  5DM7 R;  2X35 A;  2I2L A;  3M9Q A;  5J26 A;  4IUT A;  1WNL A;  3JCM c;  5GAO l;  4PNO A;  4BD3 A;  5GAN 5;  4PJO C;  2DIQ A;  1UGQ B;  3ZEH A;  3OS0 A;  3A8M B;  3LWI A;  1WGS A;  3LGF A;  2DXB A;  2GFU A;  2K4Y A;  2EQU A;  2WSF E;  3HP9 A;  4EPC A;  1SSF A;  2JNG A;  2JN0 A;  2D6F A;  2DVE A;  2PVO B;  5GAN 2;  4NL2 A;  3CCU A;  4JJN K;  5CKB A;  3L42 A;  3OS1 A;  3CCR T;  3FDR A;  2GF7 A;  1MHN A;  2DJZ A;  4ME7 A;  5I2M A;  1YI2 A;  5KCH A;  4FIB A;  5CQY A;  3JCM f;  4BUG A;  3JCM h;  2PU9 B;  4XK8 E;  2HNI A;  1TH7 A;  5LL6 S;  4JS4 A;  1Q7Y C;  4M77 A;  4MZP A;  4IKF A;  4PJO B;  3FJP A;  2E65 A;  1UGS B;  4QW2 A;  2KVQ G;  2P0K A;  1Q82 C;  1RL2 A;  2E64 A;  3MHX A;  5GAN 4;  3RMQ A;  2MF2 A;  4C8Q D;  3A8H B;  2VV5 A;  3JB9 I;  2LTO A;  1JRI A;  2WAC A;  4N0A C;  4QQ6 A;  4OMF B;  4A4F A;  3SWN C;  2KY9 A;  3ME9 A;  3SB2 A;  4A4E A;  2DPP B;  5LJ5 h;  3CME T;  1G3W A;  1KC8 C;  4CI0 C;  3GNF B;  2ZCF B;  4KBM B;  2G3R A;  4JLI A;  3OSV A;  4O5V A;  4EMK A;  1NJI U;  1VQK A;  2D9T A;  3G6E T;  3CCM A;  1B34 A;  3E19 A;  3CCE A;  4Q5W A;  2MI6 A;  2HAX A;  4LDX A;  1IRE B;  4PLI A;  1D3B B;  4M7D D;  4KUL A;  4M77 E;  3PIO A;  2ZZD A;  3QYH B;  3RUX A;  2QA4 T;  5GMK m;  3OYY A;  1Y7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...