5GAMj

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamj00
5GAMd 2EAYA 4PJOC 5GAOr 1I4K1 4MMLA 4QVDA 4PJOE 4NOYA 5LJ3e 4M7DA 4M7AE 2I2LA 1WQWA 5LJ5d 2DZCA 4JRIA 4XU1A 3JCMW 1D3BB 3HFNA 4M75C 1LOJA 1HK9A 2EJFA 4WF2A 4PJOG 2YLCA 2VC8A 4M7AD 2RM4A 4M78G 3JCMV 3HFOA 3SWNC 2E1HA 3JB9F 4XTWA 5LJ3d 1X01A 5GAN2 4M7DG 5GANj 4N0AC 4M75G 3JCMX 3RKWA 4X9CA 4C8QE 4EMKA 2E64A 4PJOA 4M7AF 5GANe 2FYKA 1I8FA 3RKYA 2DTOA 4M78A 1LJOA 1M8VA 4C8QB 4F7UG 4J5YA 4XU2A 5GAOp 1WNLA 1Y96A 1YCYA 2HNIA 4JLIA 1N9SA 4M77C 4M75A 3QUIA 4XQ3A 4C8QD 4C92E 4EMGA 3JCMQ 4RCCA 4XTXA 3JB9D 4M78E 4MMKA 2DTHA 3JCMg 5GAN3 5GAN6 1B34B 4M7AB 2QTXA 3SWNA 2YLBA 4M7DE 5GANd 4C92B 3V7RA 4M75E 4C8QF 4F7UA 5GAN8 5GAN4 3GIBA 1KQ2A 2VXFA 2K57A 2DJZA 3INZA 4M77G 4M78B 4N0AA 4C92D 3JCMf 3JB9J 4M78D 2CGHA 4M7DB 2RD1A 2DZ9A 3JB9I 3BFMA 3AHUA 4PNOA 4M7DD 3L1AA 4F7UE 1I5LA 4X9DA 5GAOq 4M75D 4PJOF 5GAOm 5GAMg 4C92F 4NL3A 5GMKi 1M5Q1 1U1SA 3V8JA 3FB9A 4XTZA 2DKGA 4M78F 3V7SA 4M77A 4J6YA 4XU0A 5GAN7 5LJ5g 4M7DF 5GAMf 4M75F 3JCMh 2YHTA 4XU3A 5GMKm 3JCMc 1HXDA 1LNXA 4JUVA 4M77E 5LJ5f 4M7DC 2RA2A 4EMKB 3BY7A 4J6XA 4OP0A 4C8QC 5GMKh 5GAN5 3JCMJ 3M4GA 1MGQA 4PJOB 1KQ1A 2E10A 2E41A 1D3BA 4F7UF 3RERA 1JBMA 3PGGA 4PJOD 5LJ3g 3JCMb 2DXUA 5GANf 5GMKj 4XTUA 3JCMe 1H641 4M77D 5I21A 1Y96B 2JN0A 5GAMh 4M75B 3QO3A 4M7AC 4V2SA 5LJ3f 1WPYA 4C92C 3V8LA 4C8QG 5GMKe 4A54A 4M78C 2DTIA 1JRIA 2ZGWA 3QSUA 2Y90A 5LJ5h 3JB9G 3FIFA 5GAMj 3JB9H 2DEQA 4M77F 2DXTA 3EFRA 3RIRA 3RKXA 3SWNB 3V7CA 4RCBA 4EMHA 4F7UB 2EJGA 4XTVA 5CAIA 5GMKl 3HSBA 4J6WA 4HT9A 5GAMe 3QHSA 5LJ5j 1BIBA 1U1TA 4DQ2A 1WQ7A 3RUXA 4M7AG 4C92G 2EWNA 4C8QA 3V8KA 4A53A 3JCMd 5GANh 3VU3C 1BIAA 4HA8A 5LJ5e 5GANg 1N9RA 3EFSA 2RB6A 1TH7A 5LJ3h 3L2ZA 5DY9A 4Y91A 2DVEA 3RESA 2VXEA 2E65A 4NL2A 3BDUA 5GAOn 2FB7A 2EJ9A 3BW1A 4JRKA 4XTYA 4M77B 3JCMP 1B34A 3FJPA 3SB2A 5LJ3j 4M7AA 4C92A 5GAOl 4HT8A 4EMKC 4QVCA 1I81A
chains in the Genus database with same CATH superfamily
2V8IA 4FM4B 5A0LA 1OYXA 2RQVA 4LDUA 2J6OA 2QA4T 3HFNA 2XG8D 2HKNA 2H3EB 2VC8A 4FW1A 2L8DA 1AOJA 2K2VA 2JM9A 2E1HA 3GNFB 5LJ3d 4N0AC 2AK5A 4ELYC 4BI8B 1SPKA 2F2XA 5GANe 1KK7A 3PIOA 4AFSC 4DBFA 1WNLA 1TUGB 1N9SA 5GJWB 1ZSZB 1PWTA 2C0TA 1VQ9T 3O5ZA 4PJMA 1RAAB 2M1HA 4C8QF 4M75E 3VV0A 1X75C 3H9NA 1MMNA 3CCRA 2JTFA 5I11A 3BFMA 2CZ0B 2ZPGB 5J26A 4X9DA 1K8AU 3CCSQ 5CIUA 2DXCA 2DYIA 3UT1A 1UB4A 1YHQT 1YJNQ 2V8KA 2FZGB 3VKIA 1YJWT 3JV3A 4ZTFA 4JS4A 5FWBA 3JCMJ 1Y57A 2JJ9A 2CKKA 2E41A 4RKUE 5IHNA 3JCMb 1K73U 3MPUB 5GMKj 3JCMe 4DBRA 2RQRA 2J7IA 2WACA 2A28A 3V8LA 1RAFB 3QIIA 1D1CA 1JU5C 1PCXA 2XDPA 1VQKA 5LJ5h 2JZ2A 5KYXB 3C95A 4KUIA 3SWNB 4ORZA 3G71Q 1Y07A 5HK3A 1XQHA 2P0PA 4C92G 1JO8A 1NLPC 2F5TX 1Y0MA 4LXCA 4RG2A 2GQVA 2C0IA 2NUTB 2MOXA 5KYUB 4JRQA 4IUVA 2M02A 3HPWA 4QKUA 3CCVA 3CCLQ 2X35A 5LJ3j 3CBMA 2JS2A 2RJCA 4MMLA 2O01E 4M7DA 3I9QA 4MDWA 4J9CA 3OYFA 1PKTA 4M75C 5A0DA 3CCST 1X2QA 3CMAQ 1YJNT 3M54A 4PL6A 3CCUQ 4VUBA 3LWIA 2QA4A 1WI7A 2FYKA 4M78A 3HL8A 3CPWS 2EBPA 2DXBA 1OZ2A 3DB3A 4JLIA 2OTJQ 4C5HA 4XTXA 4E7HA 2CP3A 4FSXA 1AZGB 3QPHA 4F7UA 1WHMA 1IXDA 2QQRA 2KQWA 3G71T 1NE8A 1RLQC 1VQ4Q 2HQXA 4IUTA 2DEUA 5GMKi 1VQ9A 1ZSGA 4J6YA 5CQYA 2P0KA 4XU3A 3CCLT 1UJYA 1AWJA 1TS9A 3VYHB 2FPFA 3ME9A 3M5AA 1D3BA 3RERA 2QYZA 2BTTA 2X3WD 1YHQA 2BZYA 2HEQA 5I21A 2DVJA 1IZ6A 1Y96B 1YJWA 5LJ3f 2JOYA 4C8QG 2YUPA 4F04B 1VQPQ 3OS1A 3QSUA 1D09B 3LGLA 3REAB 2CZ1B 3CMAT 3TU4K 5CAIA 3UPUA 3VS0A 4XAXB 3CCUT 1OOTA 1UGSB 3NTIA 2COYA 5D6YA 3HP9A 3RESA 1PHTA 2OTJT 4JRKA 3JCMP 3M59A 2LT4A 1NYFA 3OYHA 4HCKA 4HXJA 1K9AA 3QDFA 4ZGJB 4BE1A 1WQWA 2COWA 3EGUA 4WF2A 3H0IA 2E3HA 1NJIR 1WXTA 3D7SB 1GL5A 4M7AD 2MPXC 3HFOA 3MP8A 3HHTB 1EZZB 2FRYA 2ESWA 3OW2P 3HRUA 1X6OA 4GLMA 3RKYA 1D0XA 2MI6A 3IQLA 3CCSA 5FRMA 2EYYA 2QK0A 1YJNA 2XK0A 3QDRB 4M78E 2HKQB 2HSEB 1KQSP 3L2VA 3EFOA 5DLOA 1VQPT 4OMMA 2QAZA 4LDWA 2LQ8A 4J9FA 4IIOA 1M90R 1IHWA 1VA7A 3PFSA 1AEYA 4J9HA 3AHUA 4F7UE 1YITQ 3MHXA 1U1SA 3CCMQ 2HL5C 5HCKA 1X2KA 3H0FA 3CXCP 2WSCE 2LX7A 3UWNA 3X28B 3G71A 3EHRA 5GMKm 4C0DC 2O2OA 4PJOB 2X3XD 3M4YA 3P8BB 3KXTA 4BACA 3A8HB 4K11A 5GAMh 3CCLA 1CKBA 4J9EA 1PKSA 3JB9H 3M55A 4M77F 4M7DC 3VRYA 3FC3A 1F1BB 1IB8A 2JTEA 5GANg 1OX8A 5FW9A 2KROA 3CMAA 1B34A 3GOXA 5EG2A 3CCUA 1ZUUA 1TG0A 3PVQA 2EKOA 3OYYA 1K8AC 2COZA 3NPFA 1RUWA 2FO0A 3ZL7C 3LLRA 3X20B 2OTJA 3LH5A 3OW2A 2QASA 3I55Q 3CC2Q 1YITT 3HKSA 1KD1R 2P4TA 1IO6A 4M75G 2LJ3A 4EMKA 1PG5B 1VQOQ 2X4JA 2R57A 1KQSA 5HY6A 1M1KC 2MK5A 4Z02A 1LJOA 2JUFA 3OSSC 4LNPA 1NYGA 4LDVA 1NLOC 4A4GA 1H92A 4C92E 1I0CA 4MMKA 5FWCA 2DTHA 3JCMg 2YLBA 5GANd 5GAN4 2ABLA 1BCMA 1PD1A 5IXBA 2LDMA 4JJBA 4KT0E 3OYGA 5CO7A 1TXQA 2EW3A 2RN8A 4J8OA 1VQPA 3DLMA 4E6RA 4JLGA 4M7DF 2LMJA 1W1FA 1B7TA 2BUDA 2NYSA 2LC4A 2EYXA 2RA2A 2GCXA 5GAN5 2K4YA 3OW2S 1QP3A 3M0PA 1JBMA 2AZVA 5IXFA 2AKKA 4FIBA 2XDDA 4FW2A 3EGXA 4OB3B 1QWFA 2CREA 3R6OA 1UGQB 3META 3OYEA 3I55T 3CC2T 1UE9A 3O8VA 1KQSS 4OGCA 2KI7A 4LDXA 4RTZA 1VQOT 2D0QB 1XNIA 3JCMd 2VUBA 2HSPA 1S1NA 2MMPA 1K0SA 2O9SA 4J83A 2LX9A 2QDLA 4HVUA 3OMCA 3EGDB 2IG0A 1I4K1 3OYBA 5AT1B 2DM1A 4DOWA 4OB2B 4JRIA 4OMOA 4XU1A 3QJYA 3OYCA 1YWPA 1Q7YU 3Q1JA 1GXIE 2WSEE 3M9QA 4JZ3A 4A4KA 3JB9F 2GTJA 3M57A 5GANj 3NHNA 2KE9A 4C8QE 2QXFA 1FMVA 4FT2A 4FYVB 1NPRA 2DE0X 1YITA 1H3HA 1JB0E 1M3CA 4XU2A 5CQXA 4EMGA 3M56A 3JB9D 1UGVA 5L8RE 2L2PA 4J9BA 4M7AB 2SEMA 2JM8A 1WA7A 3BE3A 2AIRB 3CCQQ 2KYMA 2X51A 2EPDA 4M4ZA 4R55A 4OMFB 3M0RA 3SD4A 3P8DA 1DJ7B 2E6NA 4IUUA 3WVEB 3H6ZA 2PUKB 1ABOA 2DXUA 4OB1B 4OMLA 1FWZA 2MWOA 1PNJA 4RUGA 2V1QA 1N8RC 2CT3A 3FIFA 1LPLA 3QBYA 3MCAB 2XHCA 5D6XA 4LN2A 1BIBA 3MEWA 4NS5A 2EQKA 3V8KA 2DFUA 5L23A 5FLXE 1BIAA 2ZPFB 2DA9A 1EIFA 3M0SA 5LJ5e 3I55A 3CC2A 1TH7A 3J80E 4DBQA 2NUPA 2M0OA 2ZPBB 5GAOn 1EX4A 4D8KA 3QXEB 3I5RA 4EMKC 1VQOA 2RQWA 2NUZA 2L3PA 2I2LA 1D0ZA 1WX6A 3EG9A 4IUQA 2LZ6B 4QQGA 3CCQT 3GF5A 2PNIA 4M78G 3CEYA 1JXMA 2EYWA 2DL4A 1JJ2A 1YJWQ 3RKWA 2DD5A 2SRCA 2L0AA 1FMKA 1NBEB 2DPPB 2DL8A 2X9HA 1TSFA 3H41A 4F7UG 3RNJA 1YCYA 3OMGA 1SKUB 1RAIB 2VKNA 4FCYA 2DL5A 2DBKA 3H0HA 1QVFA 4RTWA 1ZBJA 2L3RA 4E7KA 2LNVA 1C6VX 2CH4W 1QVPA 1U5SA 1WJSA 1XOVA 2KNBB 2YSQA 3JCMf 2K5LA 4PJOF 3QYHB 3M0UA 2A37A 3FB9A 4M77A 4XU0A 4ESRA 4Z8AA 4AFZC 1Q82R 2EQMA 2H8HA 4EPCA 1GCPA 7AT1B 4D6WA 4PJOD 1C1AA 2GBQA 4ZN1A 3OYJA 4CI0C 3UF4A 1VOMA 1NEGA 2LVMA 1WPYA 1JJ2S 4HVVA 2Y90A 1I07A 2EGEA 1RADB 3RIRA 3V7CA 5M9OA 5EC7A 1WLPB 4N4GA 1RL2A 1U1TA 2JS0A 3WXMB 3G7ZA 3QZ5B 5IAYA 2RB6A 3A98A 1ZSZA 3VS2A 1VQ5Q 1QVFS 1Q86C 3EH1A 3VS5A 3CPWA 1K9MU 4HT8A 5DM7R 3T9NA 1R77A 2F2WA 2DZCA 4EDUA 1UECA 3UDCA 1WHKA 2KY9A 3NGPA 2PVOB 1UFFA 1M30A 5CKFA 2DERA 1H8KA 4E7ZA 1QCOA 4F17A 1PD0A 1PSFA 2P0QA 4O6JA 3M58A 1SRLA 2LCSA 1C0MA 3QKJA 1TUDA 1GBQA 3CCQA 3EG0A 3ULRB 1JXOA 2HNIA 1X27A 3JCMQ 2RQTA 3MP6A 1QCNA 2F2VA 1NJIU 2RO0A 1HSQA 2R58A 5KYXA 1CSKA 1K4US 3U23A 3SWNA 1KJWA 2FG0A 2K5FA 4RTVA 2DJZA 4M78B 1Y7XA 5FU7C 3LWHA 2RD1A 2DNUA 3JB9I 5I2SA 2KVQG 2NUTA 5KYUA 1SHFA 4QQDA 2QQBA 4Y28E 4KGZB 1OU9A 1VQ5T 4M77E 4A4FA 2FPDA 4J6XA 1M90U 2QQAA 2J06A 1BI0A 1WIEA 1Q7YC 1ZLMA 2OTLT 1KSWA 1RAGB 3GP8A 4AFQC 2ED0A 2DTIA 2RK2A 2O4XB 4AFUC 3OS0A 5KE3A 1AWOA 4RCBA 1TOVA 2A0FB 5GAMe 4FL6A 5GANh 1KC8R 4PFPA 1ACMB 4E7SA 1K1ZA 4IIMA 1G3TA 4MZPA 1VYTA 2DL7A 3I35A 3C94A 2ZAEA 1WFWA 4LD9K 8ATCB 3G1JA 2CS7A 3MO8A 1X69A 3M53A 2DJQA 1K9MR 4ZGDB 2CSQA 1QCFA 4J9IA 2XDBA 2CSIA 1YNZA 2DETA 5I2MA 1M1KR 4M7AF 2DILA 1IREB 1QMCA 3HRSA 1Y96A 1WJQA 4M77C 5IH2A 3I5SA 4ZTJA 1Z9ZA 3ER0A 3NFCA 2QDYB 3L2RA 1KD1U 1RI9A 5KYNA 4M7DE 1A0NB 3OA6A 4RTTA 4C92B 3CPFA 1MV3A 3OQ5A 1M3BA 3J7AF 3OY9A 4BI4A 1G83A 4AG2C 2FRWA 1UHCA 4M75D 4KRTA 4Z88A 4C0GA 2RJFA 2CUDA 5GAN7 1ZUKA 4C5EA 5LJ5g 3CC4Q 4C0ZA 2RI2A 2MWPA 3DKMA 1LNXA 4YTLA 2QTVA 3SHWA 2JNGA 2E10A 2GFAA 2CT4A 2A7YA 4R56A 2EQIA 1HJDA 1ZSZC 1H641 1VQ5A 1Q81C 4ELZC 2HQHA 2DYBA 2DMOA 3RKXA 3A8MB 2DXTA 4HT9A 4RTUA 2OTLA 3JSCA 3VS1A 2RJDA 4CC3A 5C6SA 2RHUA 3E19A 4HA8A 3EG2A 1QWEA 2F69A 1BBZA 3H8ZA 2HBPA 3J81E 2HL3A 1P92A 4HCZA 3HTRA 1WXUA 1YIJT 3VUZA 4CRIA 3G6EQ 2PUOB 1M2VB 2D1XA 4QVDA 1IHVA 1BCOA 4PK4A 3I56Q 1I1JA 5LJ5d 4JS5A 1HYOA 1MHNA 2X4XA 3VS7A 4B9XA 2C06A 3KFVA 3M0QA 2YUOA 3SWNC 3GBQA 4E7JA 2LRQA 3CC4T 5KYYB 1YP5A 3EG3A 4LDYA 4ZN3A 2BKDN 4PJOA 1D0YA 2QQSA 2D0NA 2HDAA 3FRNA 2FZKB 4C8QB 1QP2A 3VRZA 2KT8A 3OBWA 5FROA 2EYZA 1W2BP 4BY6B 4JRPA 1VQNQ 2FVUA 3THKA 4A4HA 2FPEA 2VXFA 2XU8A 3OYKA 1VQMQ 4N4IA 2F5KA 2KRNA 5FU6B 4GBQA 1GRIA 1PRMC 3OYMA 1K73C 4DEYA 5KYWB 1PSEA 1WHHA 2FL7A 4E47A 3A1PA 3G6ET 4Y92A 4F16A 5GMKh 2AT1B 2NWMA 2V1RA 1QW1A 2YXYA 3I56T 2D6FA 3R6NA 3CXCA 2KXDA 2JN0A 4JJNK 2CUBA 3G4SQ 2PZ1A 5IHIA 4L5GA 1BI1A 2GF7A 4KULA 1OU8A 2KYBA 4JJDA 1FMWA 1V1CA 2VGNA 3VS3A 3QHSA 5LJ5j 4HCBA 4WTOB 2KGTA 4RTXA 5LJ3h 3UATA 1NJIC 2RF0A 4PJJA 2KDSA 2FB7A 3BW1A 2GTOA 2CP7A 2H3JA 3OYDA 1NZ9A 2KAFA 1VQNT 2X4YA 2ZCFB 4LE9A 2MAMA 3FEOA 1BU1A 2PVGB 2JT4A 1T0HA 2W10A 4FT4A 1VQMT 2EJFA 1D1BA 3JCMV 1M9SA 2XI9A 5CKHA 2KSSA 2PVDB 3S3OA 1W2BA 2E64A 3L2WA 4OF1A 4ZGEB 3E1SA 3PMIA 4AMCA 3OSVA 3CXCS 2RK1A 4PJOE 2ZPEB 3CC4A 1W4SA 4KBMB 3G4ST 3ZBDA 2GGRA 1M27C 1G5VA 1B3QA 3GIBA 1KQ2A 4M77G 1RABB 3QYGB 4M78D 1R0CB 2A08A 4R0KA 1BK2A 2VV5A 4NL3A 4XK8E 5GAMg 1V76A 1M8MA 3PNWC 4FYYB 2VWFA 1M4ZA 3EGDA 4HKEA 1PRLC 2E6ZA 5LJ5f 1H3ZA 3BY7A 1W6XA 1UUEA 3PMTA 1SG5A 1OI1A 5GJVB 1G3WA 3CQTA 4M75B 3QO3A 1J3TA 2GQIA 4A4EA 4A54A 1IRXA 1W2BS 3G6EA 2KBTA 1M1GA 1Q82U 4Q5WA 3I56A 2ED1A 1GFCA 4DEXA 4N4HA 3X25B 1Q86R 2K3YA 3TSWA 1E7OA 1MMGA 2AHJB 4PKCC 2DO3A 4RG8A 1HD3A 2OX7A 4M7AA 4BD3A 1AHJB 5GAMd 2EAYA 4PJOC 1MV0B 3L2UA 1TUCA 1ZHIA 1UG1A 2K2MA 1IGQA 1MNEA 1QLYA 2K79A 4J9DA 2DRMA 4QVZA 4J7IA 5HKCA 1VQNA 2Y4XA 2LQKA 5CR2A 1M1FA 4JDSA 5GAN2 4M7DG 2LTOA 5CCAA 1VQMA 3X26B 2HMAA 2QGGA 3M0TA 3VJPA 3WVDB 2IPOB 3BDLA 5GAOp 2GNCA 2ZPIB 2KRSA 4OVAA 4RMOA 2R5AA 4Z89A 2O9VA 5GAN6 3A8LB 2M51A 1TTHB 4J7FA 3INZA 4C92D 1PM3A 3OYAA 2LNHB 2DZ9A 2NLUA 4BE2A 2PU9B 3A8GB 3V8JA 3G4SA 3S3MA 3V7SA 1KHCA 2ECZA 3N5BB 4BI3A 2E12A 4CC2A 5J3BA 4JJCA 3M4GA 4ANJA 4CC4B 4V2SA 2QGFB 1TU0B 2BZXA 3JB9G 5GAMj 3CMEQ 3MEUA 2O31A 3MEVA 4IKFA 2P4RA 1U06A 2EWNA 4A53A 1NPPA 2CP5A 1X6GA 1SEMA 1N9RA 2K3XA 4Y91A 5DY9A 3A5ZB 1Q95G 1FXXA 4OMQA 3QG1A 4XQ3A 1M3AA 1YJ9Q 3E2UA 3X24B 5GAOr 2LQNA 3OYLA 4M7AE 1T3SA 2CYZB 1VYVA 5KH6A 4A63B 2DLPA 1GCQA 1KC8U 1G8XA 3ZFJA 2KT1A 1N6AA 2YLCA 2RM4A 2RJEA 3RMQA 2EYQA 1K76A 2CDTA 3PVLA 2HZYA 2JTMA 1WDXA 1G2BA 3JCMX 2OAWA 4C0DB 1S72Q 1KHIA 2OTLQ 2M0YA 2VGMA 4C8QD 4L6V5 4KH1B 4RCCA 2OJ2A 4JPBW 5HK0A 2HD0A 3SDZA 2G6FX 3RMSA 5AYFA 5D6WA 1M1KU 3CMET 4M7DB 4C5IA 5CKEA 1SF9A 4IUPA 4D8DA 3AT1B 1WGSA 2HCKA 5KE2A 3DB4A 2K3BA 3L2QA 2XD0A 3TQ7P 1KIKA 3OYNA 1VYUA 5GAMf 3GNGA 4CC7A 2KR3A 3CBOA 2E5QA 3CCEQ 2YRDA 1JEGA 3VS4A 4ME7A 1YJ9T 3CC7Q 4ZNXA 4HVWA 1VIEA 1Q81R 2B86A 4AT1B 2DBMA 2RHYA 3SEMA 1R8OB 1ZA1B 4M7AC 1UTIA 2EIFA 2DX1A 3PT9A 4FU6A 3FLGA 1UJ0A 4F7UB 2J6FA 4GLKA 1X43A 2YRCA 3JAME 1GBRA 2CZ7B 4BDZA 1S72T 3L2ZA 4NL2A 2HBWA 1T3LA 4XTYA 3FJPA 3FJ5A 1XTDA 1KFZA 1RAEB 3ZEHA 1TWBA 4NOYA 1VIFA 4FYXB 2A3LA 2K9GA 1FYNA 2VASA 1RI0A 1PC0A 1D1AA 4UC4A 2KK4A 1D3BB 1HK9A 4PJOG 1XJWB 3PTAA 1VQ8Q 2VVKA 2EGCA 3ASKA 3NTHA 2JMCA 4C0FA 1X01A 1E6HA 2FEIA 4MZMA 2RI3A 4X9CA 1OPKA 3CCET 2DL3A 1I8FA 1YN8A 1K8AR 3CC7T 3CCJQ 1QKXA 4C5GA 1YWOA 3LX7A 4KGXB 5GAN3 1Q82C 2FHDA 2O4XA 1UEBA 2XICA 2Y4YA 4BDYA 4MDXA 4BUGA 3RR6A 5D7UA 2ATCB 2RQUA 3VS6A 3MP1A 1K73R 3JRZA 4OGEA 2YDLA 2X4WA 2HAXA 1OPLA 2DKGA 1G3SA 5I22A 3VYGA 2ZPHB 4M75F 3S6WA 3CMEA 3JCMh 1YIJQ 1VQ7Q 2LP5A 1AT1B 2E4HA 2WSFE 4JUVA 2L3QA 1AZEA 1ZUYA 1QQJA 3LW5E 3PGGA 3UA6A 2XKOC 1VUBA 2EQUA 2IIMA 2Z0WA 4PFOA 1NEBA 4XTUA 1IGUA 4X1VA 6AT1B 5GMKe 1VQ8T 1JRIA 2YT6A 2ZGWA 1YJ9A 2YUNA 3EFOB 4HCCA 2DEQA 4IURA 4PJNA 5GMKl 1CKAA 1VQ6Q 3HSBA 8AT1B 1K0XA 3RUXA 1GCQC 2V26A 3OB9A 1VQ4T 3C0CA 1OEBA 2KXCA 4P5NA 1W70A 3RBBB 3F70A 3CCJT 2K5IA 1N8RU 3SB2A 2GFUA 3PIPA 4C92A 1U8RA 4BB7A 2W0ZA 2LJ0A 5LJ3e 3DLLA 5ECAA 5C0MA 2QEXQ 2MCNA 1S72A 1M2OA 1AWWA 1I5OB 3CD6Q 2YRVA 1ZBXA 1BB9A 2OI3A 2E5KA 4KH0B 3C12A 1YI2Q 1E6GA 1U3OA 2XMFA 1UHFA 4LUDA 3OBYA 1RACB 1QKWA 4KGVB 1VQ7T 2QQ9A 2DTOA 1RLPC 3CBPA 4QQ6A 4J5YA 3GPLA 2RHXA 1OZ3A 3QUIA 1O75A 2J6KA 1UGRB 5LL6S 5IHKA 1B34B 3CCEA 1V29B 5CVIA 5GAN8 2MF2A 2K57A 4OB0B 1MMAA 3CC7A 1WHGA 4J9GA 3NMZC 2EFIA 2CGHA 5IT9E 1VQ6T 4B9WA 1SHGA 1O9SA 4PNOA 3L1AA 1I5LA 2B8AA 3OYIA 1M2VA 2YHTA 4DBHA 2P84A 4TVRA 4EMKB 1KC8C 5J39A 5FRNA 2ROLA 3TREA 2QEXT 3PE0A 4RTYA 4M77D 3TVTA 3CD6T 2HQEA 2EKHA 1UDLA 3GLXA 1YI2T 4FSSA 4M78C 5KYYA 2OAUA 3EFRA 1K9MC 3TCJA 1T0JA 2EJGA 4XTVA 4J6WA 1SRMA 4M7AG 4DQ2A 4PLIA 1WQ7A 2LQWA 2BIVA 4C8QA 2AKLA 4AG1C 1OQKA 3CCMT 3P8HA 3EFSA 2J05A 1VQ8A 5A2QE 1VQLQ 1QVGP 5GAOl 5CK9A 2M16A 1N8RR 3RDVA 4BE0A 2DD4A 3MEAA 1VQ4A 3L42A 3TSZA 1R0BG 2KRMA 3URGA 1ARKA 2D8HA 3CCJA 2CP2A 2DF6A 5CKDA 2L3SA 2V8JA 1LOJA 2RI5A 3EGXB 1Q86U 2JW4A 4DOVA 4O5VA 5KYWA 2MYSA 4QW2A 5DLQE 1SSHA 2RHZA 2RNAA 4XTWA 1WHLA 1WJRA 2JVVA 1ZQ1A 4OMNA 4LD6A 2BZ8A 2L89A 3S3NA 1M8VA 4F14A 3EH2A 1N5ZA 3REBB 1BI3A 1YCSB 1YIJA 1VQ7A 2QTXA 5KCOA 4PFZA 2EGAA 3HRTA 4N0AA 2CH4A 1JQQA 4GY5A 5CKBA 2EVRA 1M90C 1Y71A 4M7DD 2QG9B 3KBGA 1OULA 5GAOq 5GAOm 1KG1A 2KMTA 1M5Q1 5A0GA 4E7IA 2K6DA 4XTZA 4M78F 4OMPA 2AZSA 1B07A 1VQLT 2E70A 2LT1A 1VQ6A 2CP6A 3JCMc 2ENMA 1X6BA 1RAHB 4FYWB 2R5MA 4OP0A 2DK3A 4II1A 1MGQA 3CCRQ 2O88A 4KUDK 4F7UF 2D9TA 2BE9B 2QI2A 2RH2A 3EG1A 2KEAA 3QJ6A 2M9UA 4LUEA 1NM7A 2F1LA 4C92C 2DIQA 3MKDA 3LYIA 3MJXA 1EFNA 2I0NA 5IN1A 4EMHA 2CP0A 2QEXA 3C4SA 1QVGA 1BYMA 3CD6A 4B6MA 3QWXX 1AVZC 1FX7A 3TEEA 1YI2A 2DVEA 2G3RA 2EJ9A 4ATOA 2XIDA 1MNDA 1BKBA 1VQKQ 1ABQA 1AD5A 2E3IA 3CCMA 1G3YA 4MZTA 1JJ2P 1BI2A 2DIGA 5FU7B 3JCMW 2LJ1A 2YWWA 5KCHA 4X34A 1WXBA 3LH0A 9ATCB 3CCVQ 3OS2A 1KD1C 2RHIA 2RPNA 3QZ9B 1QVFP 2VB6A 4DA4A 1LVKA 3CCRT 4M75A 1OX9A 2NUPB 1LCKA 1YFNA 2PQWA 3LGFA 3EHQA 3V7RA 1QVGS 2L5QA 2CZ6B 3FDRA 3JB9J 2QA4Q 4QT7A 4E7LA 2ROTA 2JMAA 1WZOA 3EG9B 1Z9QA 3SFMA 4C92F 3UA7A 2K7AA 2DRKA 2EQJA 1AWXA 2MIOA 2D8JA 3E9GA 1HXDA 1ZA2B 3E9FA 1VQKT 4C8QC 3QWYA 1KQ1A 2JXBA 4E2FB 2ZZDA 2RMOA 2PTKA 5LJ3g 2IVWA 4BY6C 5GANf 1OV3A 1VQLA 1VQ9Q 1GFDA 2YUQA 2BE7D 3NTKA 2FZCB 4WCIA 1NG2A 3CCVT 1SSFA 5FU6C 2A36A 3OS5A 1MUZA 2C0OA 2LCCA 4L59A 3CPWP 4EIKA 1MMDA 4JZ4A 1WYXA 1N27A 1WHJA 3KUFA 4PLLA 2LCLA 3VU3C 1Q7YR 1YHQQ 1UGPB 1Q81U 2VYTA 4PJLA 2VXEA 2E65A 3BDUA 3VUBA 3EAEA 4M77B 3A8OB 1ZX6A 2DAQA 1YBYA 4QVCA 1I81A
chains in the Genus database with same CATH topology
2PUOB 1I4K1 2V8IA 3ZEHA 4QVDA 4NOYA 3OYBA 4FM4B 1VIFA 5A0LA 2A3LA 1OYXA 5LJ5d 4DOWA 4OB2B 1RI0A 4JS5A 4LDUA 4JRIA 4UC4A 2KK4A 1D3BB 3HFNA 3QJYA 2XG8D 4XU1A 3OYCA 1MHNA 2QA4T 2X4XA 4B9XA 1Q7YU 1HK9A 3Q1JA 4PJOG 1GXIE 3PTAA 2WSEE 2VC8A 2L8DA 3M9QA 2C06A 2K2VA 3ASKA 3NTHA 2E1HA 3SWNC 4A4KA 3GNFB 3M57A 3JB9F 5LJ3d 4C0FA 4M7AG 1X01A 5GANj 4N0AC 4E7JA 2LRQA 3CC4T 4MZMA 4ELYC 2RI3A 4BI8B 4LDYA 4X9CA 4C8QE 4ZN3A 2BKDN 4PJOA 5GANe 3CCET 2QXFA 1I8FA 2QQSA 3FRNA 4FT2A 1NPRA 3PIOA 3CC7T 1YITA 1JB0E 1QP2A 4C8QB 4XU2A 1WNLA 5CQXA 4EMGA 1N9SA 3OBWA 5FROA 4C5GA 3M56A 4BY6B 3LX7A 3JB9D 4JRPA 5L8RE 1Q82C 5GAN3 1VQ9T 2FHDA 2O4XA 1UEBA 4M7AB 2FVUA 2XICA 2M1HA 2Y4YA 4M75E 4A4HA 4C8QF 4BDYA 4MDXA 3VV0A 2VXFA 1X75C 4BUGA 2XU8A 3OYKA 3CCRA 2JTFA 2F5KA 4N4IA 5FU6B 3MP1A 3BFMA 2CZ0B 2ZPGB 3JRZA 4OGEA 5J26A 4X9DA 4R55A 3OYMA 1K8AU 2X4WA 4OMFB 5CIUA 2DXCA 2HAXA 3SD4A 1K73C 2DKGA 3UT1A 1UB4A 1YHQT 3P8DA 2V8KA 1G3SA 1PSEA 1DJ7B 2E6NA 3VKIA 3VYGA 2ZPHB 4IUUA 4M75F 3S6WA 3CMEA 1YJWT 3JCMh 3WVEB 2FL7A 3H6ZA 2PUKB 2WSFE 4JUVA 4E47A 4ZTFA 3G6ET 4JS4A 5GMKh 3JCMJ 3LW5E 2CKKA 2E41A 4RKUE 3PGGA 2XKOC 1QW1A 3JCMb 3I56T 1VUBA 2EQUA 1K73U 2D6FA 2DXUA 4OB1B 5GMKj 4XTUA 3JCMe 3CXCA 1FWZA 2MWOA 2WACA 2JN0A 4JJNK 3V8LA 5GMKe 3QIIA 1N8RC 4L5GA 1BI1A 2XDPA 1VQ8T 1JRIA 2ZGWA 1YJ9A 2GF7A 2JZ2A 5LJ5h 3FIFA 1VQKA 4HCCA 4KULA 2DEQA 3C95A 3QBYA 4IURA 4KUIA 3MCAB 3SWNB 5GMKl 3HSBA 1Y07A 2XHCA 5D6XA 5HK3A 2VGNA 1XQHA 2P0PA 3QHSA 5LJ5j 1BIBA 3MEWA 4HCBA 3RUXA 4C92G 3OB9A 2EQKA 2F5TX 4NS5A 4RG2A 3V8KA 2GQVA 1VQ4T 5FLXE 1BIAA 2ZPFB 1EIFA 4P5NA 5LJ5e 3I55A 3CC2A 1TH7A 5LJ3h 4JRQA 1NJIC 3J80E 4IUVA 2M0OA 3F70A 3CCJT 2K5IA 2ZPBB 3HPWA 2KDSA 5GAOn 2FB7A 1N8RU 3BW1A 3CCVA 3SB2A 2GFUA 2H3JA 2X35A 4QVCA 3CBMA 1NZ9A 2KAFA 4C92A 5LJ3j 3PIPA 3OYDA 3QXEB 4EMKC 1U8RA 4BB7A 1VQNT 1VQOA 2RJCA 4MMLA 2O01E 2X4YA 5LJ3e 2ZCFB 3DLLA 4M7DA 5C0MA 2MAMA 2I2LA 3FEOA 2PVGB 1S72A 4MDWA 4FT4A 4IUQA 3OYFA 1VQMT 4M75C 2YRVA 1ZBXA 4QQGA 3CCQT 3GF5A 2EJFA 5A0DA 3C12A 3CCST 4M78G 3JCMV 1M9SA 3CEYA 3OBYA 2XI9A 1YJNT 5CKHA 2KSSA 2PVDB 3M54A 1JJ2A 3RKWA 2DD5A 4PL6A 3S3OA 1W2BA 4VUBA 2E64A 3LWIA 3L2WA 2QA4A 1VQ7T 2FYKA 4OF1A 2QQ9A 4ZGEB 2DTOA 3E1SA 3PMIA 2DPPB 4M78A 3OSVA 3CXCS 3HL8A 3CBPA 4QQ6A 3CPWS 4F7UG 2RK1A 4J5YA 3GPLA 2DXBA 1OZ2A 1YCYA 2RHXA 3DB3A 3OMGA 4JLIA 4C5HA 1OZ3A 3QUIA 4PJOE 1O75A 2ZPEB 4XTXA 4E7HA 3CC4A 1W4SA 1UGRB 5LL6S 4FSXA 4KBMB 1QVFA 3G4ST 3ZBDA 1B34B 3CCEA 2L3RA 4E7KA 3QPHA 1V29B 5CVIA 4F7UA 5GAN8 2MF2A 2LNVA 3GIBA 1G5VA 1KQ2A 2QQRA 2K57A 4OB0B 4M77G 1QVPA 3CC7A 1WJSA 1XOVA 2KQWA 3QYGB 3JCMf 4M78D 5IT9E 2EFIA 2CGHA 1NE8A 3G71T 1VQ6T 2K5LA 4B9WA 1O9SA 4PNOA 3L1AA 1I5LA 2B8AA 2VV5A 3QYHB 2HQXA 4IUTA 4XK8E 4PJOF 5GAMg 4NL3A 5GMKi 1VQ9A 3FB9A 3PNWC 3OYIA 4M77A 4J6YA 4XU0A 5CQYA 1M4ZA 2P0KA 4HKEA 2YHTA 4XU3A 3CCLT 4TVRA 2E6ZA 5LJ5f 1H3ZA 3VYHB 4EMKB 2EQMA 3BY7A 3ME9A 4EPCA 3M5AA 1KC8C 4D6WA 1D3BA 5J39A 5FRNA 3RERA 4PJOD 3TREA 3OYJA 4ZN1A 1YHQA 2QEXT 4CI0C 3PMTA 4M77D 5I21A 1IZ6A 1Y96B 1OI1A 3CD6T 1YJWA 1G3WA 4M75B 3QO3A 2LVMA 5LJ3f 2HQEA 1WPYA 2JOYA 4A4EA 4C8QG 1JJ2S 3GLXA 4A54A 1YI2T 4M78C 3OS1A 3G6EA 1W2BS 3QSUA 2Y90A 1M1GA 3LGLA 2CZ1B 2OAUA 3RIRA 3EFRA 3V7CA 3TU4K 5CAIA 5M9OA 3TCJA 1Q82U 1K9MC 2EJGA 4Q5WA 4XTVA 3I56A 3UPUA 4J6WA 4N4GA 1RL2A 4N4HA 1U1TA 4PLIA 1WQ7A 4XAXB 4DQ2A 1UGSB 2BIVA 3NTIA 3WXMB 4C8QA 3CCUT 3X25B 3G7ZA 3QZ5B 3CCMT 2K3YA 3P8HA 3EFSA 5IAYA 2RB6A 5D6YA 1VQ8A 2AHJB 4PKCC 3HP9A 3RESA 5A2QE 1QVFS 2DO3A 1Q86C 4RG8A 2OTJT 4JRKA 3JCMP 4M7AA 3M59A 4BD3A 1AHJB 2LT4A 5GAOl 3OYHA 3CPWA 1K9MU 5CK9A 2M16A 4HT8A 5DM7R 2EAYA 5GAMd 4PJOC 3T9NA 2DD4A 3MEAA 4BE0A 1VQ4A 3L42A 3L2UA 4ZGJB 4BE1A 1WQWA 1ZHIA 2DZCA 3URGA 3CCJA 4EDUA 5CKDA 3UDCA 2V8JA 2KY9A 1LOJA 2RI5A 1Q86U 4WF2A 2PVOB 4QVZA 4DOVA 4O5VA 4J7IA 5HKCA 5CKFA 4QW2A 1VQNA 4M7AD 5DLQE 2Y4XA 3HFOA 3MP8A 2LQKA 5CR2A 2RHZA 1M1FA 4JDSA 4XTWA 3HHTB 5GAN2 4M7DG 2LTOA 1PSFA 2P0QA 4O6JA 3M58A 5CCAA 1WJRA 3HRUA 3X26B 1VQMA 1X6OA 2JVVA 1ZQ1A 3QKJA 3RKYA 3VJPA 3WVDB 3CCQA 2MI6A 4LD6A 3S3NA 2L89A 3CCSA 1M8VA 3BDLA 5GAOp 5FRMA 2HNIA 3JCMQ 2ZPIB 1YJNA 3MP6A 4OVAA 2XK0A 1BI3A 3QDRB 4M78E 2R5AA 4RMOA 2RO0A 1NJIU 2R58A 3L2VA 5GAN6 3A8LB 1YIJA 2QTXA 3SWNA 5DLOA 1VQPT 1VQ7A 2K5FA 5KCOA 4LDWA 2LQ8A 3HRTA 4N0AA 2DJZA 3INZA 1Y7XA 4J7FA 4M78B 5FU7C 4C92D 3LWHA 3PFSA 4GY5A 3OYAA 2RD1A 5CKBA 2DZ9A 3JB9I 3AHUA 2NLUA 5I2SA 1Y71A 2KVQG 1M90C 4M7DD 4F7UE 4BE2A 3KBGA 2PU9B 5GAOq 4QQDA 5GAOm 3MHXA 1KG1A 2KMTA 1M5Q1 1U1SA 3A8GB 3V8JA 2QQBA 4XTZA 4Y28E 5A0GA 3G4SA 3S3MA 4M78F 3V7SA 1KHCA 1VQ5T 2WSCE 3N5BB 3UWNA 1VQLT 2E70A 3X28B 4BI3A 3G71A 2E12A 5GMKm 2LT1A 1VQ6A 3JCMc 4C0DC 5J3BA 4M77E 4A4FA 2R5MA 4J6XA 2DK3A 4OP0A 1M90U 4II1A 4PJOB 3M4GA 2QQAA 1MGQA 3M4YA 3P8BB 4KUDK 3KXTA 4F7UF 1BI0A 4BACA 1Q7YC 2D9TA 2QI2A 2RH2A 2OTLT 3QJ6A 3A8HB 2M9UA 3GP8A 5GAMh 4V2SA 4C92C 3CCLA 2DIQA 3LYIA 2DTIA 2RK2A 3JB9G 5GAMj 2O4XB 3JB9H 3M55A 4M77F 3MEUA 5IN1A 5KE3A 4EMHA 3OS0A 4RCBA 4M7DC 2QEXA 3C4SA 1QVGA 3MEVA 4IKFA 5GAMe 3FC3A 1BYMA 4FL6A 5GANh 2EWNA 4A53A 3CD6A 1NPPA 5GANg 1N9RA 1FX7A 3TEEA 1YI2A 2K3XA 1G3TA 4Y91A 5DY9A 2DVEA 2G3RA 3A5ZB 4MZPA 2EJ9A 3CMAA 1B34A 3C94A 4ATOA 2XIDA 4LD9K 1FXXA 1BKBA 3GOXA 3QG1A 4XQ3A 2CS7A 3MO8A 5EG2A 3CCUA 3X24B 5GAOr 3M53A 2EKOA 3OYYA 3OYLA 4ZGDB 3CCMA 1G3YA 4M7AE 4MZTA 1K8AC 1BI2A 2DIGA 2CYZB 5KH6A 5FU7B 3JCMW 3LLRA 3X20B 2OTJA 1KC8U 3OW2A 5KCHA 3ZFJA 2XDBA 3CMAT 4X34A 1N6AA 2YLCA 1YITT 2RM4A 3HKSA 2RJEA 3LH0A 3RMQA 2EYQA 3OS2A 2P4TA 2JTMA 5I2MA 4M75G 2RHIA 3JCMX 1KD1C 4EMKA 2X4JA 3QZ9B 4M7AF 2R57A 1KQSA 5HY6A 1M1KC 1IREB 4Z02A 4C0DB 4DA4A 1LJOA 2JUFA 3HRSA 3OSSC 4LDVA 3CCRT 1KHIA 4A4GA 1Y96A 1WJQA 2VGMA 4M77C 4C8QD 4L6V5 4M75A 4C92E 4RCCA 4ZTJA 3ER0A 3NFCA 2QDYB 4MMKA 2DTHA 3L2RA 2PQWA 3LGFA 3JCMg 5HK0A 1KD1U 4M7DE 2HD0A 3SDZA 2YLBA 3OA6A 3RMSA 4C92B 3V7RA 5GANd 5AYFA 5GAN4 1QVGS 3CPFA 5D6WA 2L5QA 3OQ5A 2CZ6B 3FDRA 1M1KU 3JB9J 3J7AF 3OY9A 3CMET 2LDMA 4BI4A 4E7LA 4M7DB 4C5IA 5CKEA 4IUPA 1WGSA 4M75D 4KT0E 5KE2A 3OYGA 5CO7A 4C92F 3SFMA 3DB4A 4C0GA 4E7IA 2RJFA 2EQJA 4J8OA 3DLMA 3L2QA 1VQPA 5GAN7 2XD0A 4C5EA 4JLGA 5LJ5g 3OYNA 4M7DF 5GAMf 3GNGA 4C0ZA 3E9GA 3CBOA 2E5QA 2BUDA 2RI2A 2MWPA 3DKMA 1HXDA 1LNXA 4YTLA 2LC4A 4ME7A 1VQKT 2RA2A 3E9FA 1YJ9T 2GCXA 4C8QC 5GAN5 2K4YA 2JNGA 1KQ1A 2E10A 1QP3A 2GFAA 3OW2S 2A7YA 1JBMA 2ZZDA 1VIEA 5LJ3g 4R56A 2IVWA 4FIBA 2XDDA 4BY6C 4OB3B 5GANf 1H641 1VQ5A 1Q81C 2RHYA 1R8OB 4ELZC 1VQLA 3R6OA 4M7AC 1UGQB 3META 3OYEA 2EIFA 3I55T 3CC2T 3NTKA 3PT9A 4FU6A 3O8VA 3RKXA 3A8MB 2DXTA 3FLGA 1SSFA 5FU6C 3CCVT 3OS5A 4F7UB 1KQSS 4HT9A 2LCCA 4L59A 4OGCA 3JSCA 2OTLA 4LDXA 4GLKA 2RJDA 1VQOT 1N27A 1XNIA 2D0QB 3KUFA 4PLLA 5C6SA 3JCMd 2VUBA 3JAME 2LCLA 3VU3C 2RHUA 3E19A 1UGPB 4HA8A 1Q81U 2MMPA 2F69A 2VYTA 2CZ7B 4BDZA 3H8ZA 1S72T 2HBPA 3L2ZA 3J81E 2VXEA 2E65A 4NL2A 3BDUA 3VUBA 1P92A 3EAEA 4HCZA 4XTYA 3A8OB 4M77B 3FJPA 4J83A 2LX9A 2DAQA 1YIJT 3VUZA 1YBYA 3OMCA 4CRIA 1I81A 2IG0A 1XTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM d;  2EAY A;  4PJO C;  5GAO r;  1I4K 1;  4MML A;  4QVD A;  4PJO E;  4NOY A;  5LJ3 e;  4M7D A;  4M7A E;  2I2L A;  1WQW A;  5LJ5 d;  2DZC A;  4JRI A;  4XU1 A;  3JCM W;  1D3B B;  3HFN A;  4M75 C;  1LOJ A;  1HK9 A;  2EJF A;  4WF2 A;  4PJO G;  2YLC A;  2VC8 A;  4M7A D;  2RM4 A;  4M78 G;  3JCM V;  3HFO A;  3SWN C;  2E1H A;  3JB9 F;  4XTW A;  5LJ3 d;  1X01 A;  5GAN 2;  4M7D G;  5GAN j;  4N0A C;  4M75 G;  3JCM X;  3RKW A;  4X9C A;  4C8Q E;  4EMK A;  2E64 A;  4PJO A;  4M7A F;  5GAN e;  2FYK A;  1I8F A;  3RKY A;  2DTO A;  4M78 A;  1LJO A;  1M8V A;  4C8Q B;  4F7U G;  4J5Y A;  4XU2 A;  5GAO p;  1WNL A;  1Y96 A;  1YCY A;  2HNI A;  4JLI A;  1N9S A;  4M77 C;  4M75 A;  3QUI A;  4XQ3 A;  4C8Q D;  4C92 E;  4EMG A;  3JCM Q;  4RCC A;  4XTX A;  3JB9 D;  4M78 E;  4MMK A;  2DTH A;  3JCM g;  5GAN 3;  5GAN 6;  1B34 B;  4M7A B;  2QTX A;  3SWN A;  2YLB A;  4M7D E;  5GAN d;  4C92 B;  3V7R A;  4M75 E;  4C8Q F;  4F7U A;  5GAN 8;  5GAN 4;  3GIB A;  1KQ2 A;  2VXF A;  2K57 A;  2DJZ A;  3INZ A;  4M77 G;  4M78 B;  4N0A A;  4C92 D;  3JCM f;  3JB9 J;  4M78 D;  2CGH A;  4M7D B;  2RD1 A;  2DZ9 A;  3JB9 I;  3BFM A;  3AHU A;  4PNO A;  4M7D D;  3L1A A;  4F7U E;  1I5L A;  4X9D A;  5GAO q;  4M75 D;  4PJO F;  5GAO m;  5GAM g;  4C92 F;  4NL3 A;  5GMK i;  1M5Q 1;  1U1S A;  3V8J A;  3FB9 A;  4XTZ A;  2DKG A;  4M78 F;  3V7S A;  4M77 A;  4J6Y A;  4XU0 A;  5GAN 7;  5LJ5 g;  4M7D F;  5GAM f;  4M75 F;  3JCM h;  2YHT A;  4XU3 A;  5GMK m;  3JCM c;  1HXD A;  1LNX A;  4JUV A;  4M77 E;  5LJ5 f;  4M7D C;  2RA2 A;  4EMK B;  3BY7 A;  4J6X A;  4OP0 A;  4C8Q C;  5GMK h;  5GAN 5;  3JCM J;  3M4G A;  1MGQ A;  4PJO B;  1KQ1 A;  2E10 A;  2E41 A;  1D3B A;  4F7U F;  3RER A;  1JBM A;  3PGG A;  4PJO D;  5LJ3 g;  3JCM b;  2DXU A;  5GAN f;  5GMK j;  4XTU A;  3JCM e;  1H64 1;  4M77 D;  5I21 A;  1Y96 B;  2JN0 A;  5GAM h;  4M75 B;  3QO3 A;  4M7A C;  4V2S A;  5LJ3 f;  1WPY A;  4C92 C;  3V8L A;  4C8Q G;  5GMK e;  4A54 A;  4M78 C;  2DTI A;  1JRI A;  2ZGW A;  3QSU A;  2Y90 A;  5LJ5 h;  3JB9 G;  3FIF A;  5GAM j;  3JB9 H;  2DEQ A;  4M77 F;  2DXT A;  3EFR A;  3RIR A;  3RKX A;  3SWN B;  3V7C A;  4RCB A;  4EMH A;  4F7U B;  2EJG A;  4XTV A;  5CAI A;  5GMK l;  3HSB A;  4J6W A;  4HT9 A;  5GAM e;  3QHS A;  5LJ5 j;  1BIB A;  1U1T A;  4DQ2 A;  1WQ7 A;  3RUX A;  4M7A G;  4C92 G;  2EWN A;  4C8Q A;  3V8K A;  4A53 A;  3JCM d;  5GAN h;  3VU3 C;  1BIA A;  4HA8 A;  5LJ5 e;  5GAN g;  1N9R A;  3EFS A;  2RB6 A;  1TH7 A;  5LJ3 h;  3L2Z A;  5DY9 A;  4Y91 A;  2DVE A;  3RES A;  2VXE A;  2E65 A;  4NL2 A;  3BDU A;  5GAO n;  2FB7 A;  2EJ9 A;  3BW1 A;  4JRK A;  4XTY A;  4M77 B;  3JCM P;  1B34 A;  3FJP A;  3SB2 A;  5LJ3 j;  4M7A A;  4C92 A;  5GAO l;  4HT8 A;  4EMK C;  4QVC A;  1I81 A; 
#chains in the Genus database with same CATH topology
 2V8I A;  4FM4 B;  5A0L A;  1OYX A;  2RQV A;  4LDU A;  2J6O A;  2QA4 T;  3HFN A;  2XG8 D;  2HKN A;  2H3E B;  2VC8 A;  4FW1 A;  2L8D A;  1AOJ A;  2K2V A;  2JM9 A;  2E1H A;  3GNF B;  5LJ3 d;  4N0A C;  2AK5 A;  4ELY C;  4BI8 B;  1SPK A;  2F2X A;  5GAN e;  1KK7 A;  3PIO A;  4AFS C;  4DBF A;  1WNL A;  1TUG B;  1N9S A;  5GJW B;  1ZSZ B;  1PWT A;  2C0T A;  1VQ9 T;  3O5Z A;  4PJM A;  1RAA B;  2M1H A;  4C8Q F;  4M75 E;  3VV0 A;  1X75 C;  3H9N A;  1MMN A;  3CCR A;  2JTF A;  5I11 A;  3BFM A;  2CZ0 B;  2ZPG B;  5J26 A;  4X9D A;  1K8A U;  3CCS Q;  5CIU A;  2DXC A;  2DYI A;  3UT1 A;  1UB4 A;  1YHQ T;  1YJN Q;  2V8K A;  2FZG B;  3VKI A;  1YJW T;  3JV3 A;  4ZTF A;  4JS4 A;  5FWB A;  3JCM J;  1Y57 A;  2JJ9 A;  2CKK A;  2E41 A;  4RKU E;  5IHN A;  3JCM b;  1K73 U;  3MPU B;  5GMK j;  3JCM e;  4DBR A;  2RQR A;  2J7I A;  2WAC A;  2A28 A;  3V8L A;  1RAF B;  3QII A;  1D1C A;  1JU5 C;  1PCX A;  2XDP A;  1VQK A;  5LJ5 h;  2JZ2 A;  5KYX B;  3C95 A;  4KUI A;  3SWN B;  4ORZ A;  3G71 Q;  1Y07 A;  5HK3 A;  1XQH A;  2P0P A;  4C92 G;  1JO8 A;  1NLP C;  2F5T X;  1Y0M A;  4LXC A;  4RG2 A;  2GQV A;  2C0I A;  2NUT B;  2MOX A;  5KYU B;  4JRQ A;  4IUV A;  2M02 A;  3HPW A;  4QKU A;  3CCV A;  3CCL Q;  2X35 A;  5LJ3 j;  3CBM A;  2JS2 A;  2RJC A;  4MML A;  2O01 E;  4M7D A;  3I9Q A;  4MDW A;  4J9C A;  3OYF A;  1PKT A;  4M75 C;  5A0D A;  3CCS T;  1X2Q A;  3CMA Q;  1YJN T;  3M54 A;  4PL6 A;  3CCU Q;  4VUB A;  3LWI A;  2QA4 A;  1WI7 A;  2FYK A;  4M78 A;  3HL8 A;  3CPW S;  2EBP A;  2DXB A;  1OZ2 A;  3DB3 A;  4JLI A;  2OTJ Q;  4C5H A;  4XTX A;  4E7H A;  2CP3 A;  4FSX A;  1AZG B;  3QPH A;  4F7U A;  1WHM A;  1IXD A;  2QQR A;  2KQW A;  3G71 T;  1NE8 A;  1RLQ C;  1VQ4 Q;  2HQX A;  4IUT A;  2DEU A;  5GMK i;  1VQ9 A;  1ZSG A;  4J6Y A;  5CQY A;  2P0K A;  4XU3 A;  3CCL T;  1UJY A;  1AWJ A;  1TS9 A;  3VYH B;  2FPF A;  3ME9 A;  3M5A A;  1D3B A;  3RER A;  2QYZ A;  2BTT A;  2X3W D;  1YHQ A;  2BZY A;  2HEQ A;  5I21 A;  2DVJ A;  1IZ6 A;  1Y96 B;  1YJW A;  5LJ3 f;  2JOY A;  4C8Q G;  2YUP A;  4F04 B;  1VQP Q;  3OS1 A;  3QSU A;  1D09 B;  3LGL A;  3REA B;  2CZ1 B;  3CMA T;  3TU4 K;  5CAI A;  3UPU A;  3VS0 A;  4XAX B;  3CCU T;  1OOT A;  1UGS B;  3NTI A;  2COY A;  5D6Y A;  3HP9 A;  3RES A;  1PHT A;  2OTJ T;  4JRK A;  3JCM P;  3M59 A;  2LT4 A;  1NYF A;  3OYH A;  4HCK A;  4HXJ A;  1K9A A;  3QDF A;  4ZGJ B;  4BE1 A;  1WQW A;  2COW A;  3EGU A;  4WF2 A;  3H0I A;  2E3H A;  1NJI R;  1WXT A;  3D7S B;  1GL5 A;  4M7A D;  2MPX C;  3HFO A;  3MP8 A;  3HHT B;  1EZZ B;  2FRY A;  2ESW A;  3OW2 P;  3HRU A;  1X6O A;  4GLM A;  3RKY A;  1D0X A;  2MI6 A;  3IQL A;  3CCS A;  5FRM A;  2EYY A;  2QK0 A;  1YJN A;  2XK0 A;  3QDR B;  4M78 E;  2HKQ B;  2HSE B;  1KQS P;  3L2V A;  3EFO A;  5DLO A;  1VQP T;  4OMM A;  2QAZ A;  4LDW A;  2LQ8 A;  4J9F A;  4IIO A;  1M90 R;  1IHW A;  1VA7 A;  3PFS A;  1AEY A;  4J9H A;  3AHU A;  4F7U E;  1YIT Q;  3MHX A;  1U1S A;  3CCM Q;  2HL5 C;  5HCK A;  1X2K A;  3H0F A;  3CXC P;  2WSC E;  2LX7 A;  3UWN A;  3X28 B;  3G71 A;  3EHR A;  5GMK m;  4C0D C;  2O2O A;  4PJO B;  2X3X D;  3M4Y A;  3P8B B;  3KXT A;  4BAC A;  3A8H B;  4K11 A;  5GAM h;  3CCL A;  1CKB A;  4J9E A;  1PKS A;  3JB9 H;  3M55 A;  4M77 F;  4M7D C;  3VRY A;  3FC3 A;  1F1B B;  1IB8 A;  2JTE A;  5GAN g;  1OX8 A;  5FW9 A;  2KRO A;  3CMA A;  1B34 A;  3GOX A;  5EG2 A;  3CCU A;  1ZUU A;  1TG0 A;  3PVQ A;  2EKO A;  3OYY A;  1K8A C;  2COZ A;  3NPF A;  1RUW A;  2FO0 A;  3ZL7 C;  3LLR A;  3X20 B;  2OTJ A;  3LH5 A;  3OW2 A;  2QAS A;  3I55 Q;  3CC2 Q;  1YIT T;  3HKS A;  1KD1 R;  2P4T A;  1IO6 A;  4M75 G;  2LJ3 A;  4EMK A;  1PG5 B;  1VQO Q;  2X4J A;  2R57 A;  1KQS A;  5HY6 A;  1M1K C;  2MK5 A;  4Z02 A;  1LJO A;  2JUF A;  3OSS C;  4LNP A;  1NYG A;  4LDV A;  1NLO C;  4A4G A;  1H92 A;  4C92 E;  1I0C A;  4MMK A;  5FWC A;  2DTH A;  3JCM g;  2YLB A;  5GAN d;  5GAN 4;  2ABL A;  1BCM A;  1PD1 A;  5IXB A;  2LDM A;  4JJB A;  4KT0 E;  3OYG A;  5CO7 A;  1TXQ A;  2EW3 A;  2RN8 A;  4J8O A;  1VQP A;  3DLM A;  4E6R A;  4JLG A;  4M7D F;  2LMJ A;  1W1F A;  1B7T A;  2BUD A;  2NYS A;  2LC4 A;  2EYX A;  2RA2 A;  2GCX A;  5GAN 5;  2K4Y A;  3OW2 S;  1QP3 A;  3M0P A;  1JBM A;  2AZV A;  5IXF A;  2AKK A;  4FIB A;  2XDD A;  4FW2 A;  3EGX A;  4OB3 B;  1QWF A;  2CRE A;  3R6O A;  1UGQ B;  3MET A;  3OYE A;  3I55 T;  3CC2 T;  1UE9 A;  3O8V A;  1KQS S;  4OGC A;  2KI7 A;  4LDX A;  4RTZ A;  1VQO T;  2D0Q B;  1XNI A;  3JCM d;  2VUB A;  2HSP A;  1S1N A;  2MMP A;  1K0S A;  2O9S A;  4J83 A;  2LX9 A;  2QDL A;  4HVU A;  3OMC A;  3EGD B;  2IG0 A;  1I4K 1;  3OYB A;  5AT1 B;  2DM1 A;  4DOW A;  4OB2 B;  4JRI A;  4OMO A;  4XU1 A;  3QJY A;  3OYC A;  1YWP A;  1Q7Y U;  3Q1J A;  1GXI E;  2WSE E;  3M9Q A;  4JZ3 A;  4A4K A;  3JB9 F;  2GTJ A;  3M57 A;  5GAN j;  3NHN A;  2KE9 A;  4C8Q E;  2QXF A;  1FMV A;  4FT2 A;  4FYV B;  1NPR A;  2DE0 X;  1YIT A;  1H3H A;  1JB0 E;  1M3C A;  4XU2 A;  5CQX A;  4EMG A;  3M56 A;  3JB9 D;  1UGV A;  5L8R E;  2L2P A;  4J9B A;  4M7A B;  2SEM A;  2JM8 A;  1WA7 A;  3BE3 A;  2AIR B;  3CCQ Q;  2KYM A;  2X51 A;  2EPD A;  4M4Z A;  4R55 A;  4OMF B;  3M0R A;  3SD4 A;  3P8D A;  1DJ7 B;  2E6N A;  4IUU A;  3WVE B;  3H6Z A;  2PUK B;  1ABO A;  2DXU A;  4OB1 B;  4OML A;  1FWZ A;  2MWO A;  1PNJ A;  4RUG A;  2V1Q A;  1N8R C;  2CT3 A;  3FIF A;  1LPL A;  3QBY A;  3MCA B;  2XHC A;  5D6X A;  4LN2 A;  1BIB A;  3MEW A;  4NS5 A;  2EQK A;  3V8K A;  2DFU A;  5L23 A;  5FLX E;  1BIA A;  2ZPF B;  2DA9 A;  1EIF A;  3M0S A;  5LJ5 e;  3I55 A;  3CC2 A;  1TH7 A;  3J80 E;  4DBQ A;  2NUP A;  2M0O A;  2ZPB B;  5GAO n;  1EX4 A;  4D8K A;  3QXE B;  3I5R A;  4EMK C;  1VQO A;  2RQW A;  2NUZ A;  2L3P A;  2I2L A;  1D0Z A;  1WX6 A;  3EG9 A;  4IUQ A;  2LZ6 B;  4QQG A;  3CCQ T;  3GF5 A;  2PNI A;  4M78 G;  3CEY A;  1JXM A;  2EYW A;  2DL4 A;  1JJ2 A;  1YJW Q;  3RKW A;  2DD5 A;  2SRC A;  2L0A A;  1FMK A;  1NBE B;  2DPP B;  2DL8 A;  2X9H A;  1TSF A;  3H41 A;  4F7U G;  3RNJ A;  1YCY A;  3OMG A;  1SKU B;  1RAI B;  2VKN A;  4FCY A;  2DL5 A;  2DBK A;  3H0H A;  1QVF A;  4RTW A;  1ZBJ A;  2L3R A;  4E7K A;  2LNV A;  1C6V X;  2CH4 W;  1QVP A;  1U5S A;  1WJS A;  1XOV A;  2KNB B;  2YSQ A;  3JCM f;  2K5L A;  4PJO F;  3QYH B;  3M0U A;  2A37 A;  3FB9 A;  4M77 A;  4XU0 A;  4ESR A;  4Z8A A;  4AFZ C;  1Q82 R;  2EQM A;  2H8H A;  4EPC A;  1GCP A;  7AT1 B;  4D6W A;  4PJO D;  1C1A A;  2GBQ A;  4ZN1 A;  3OYJ A;  4CI0 C;  3UF4 A;  1VOM A;  1NEG A;  2LVM A;  1WPY A;  1JJ2 S;  4HVV A;  2Y90 A;  1I07 A;  2EGE A;  1RAD B;  3RIR A;  3V7C A;  5M9O A;  5EC7 A;  1WLP B;  4N4G A;  1RL2 A;  1U1T A;  2JS0 A;  3WXM B;  3G7Z A;  3QZ5 B;  5IAY A;  2RB6 A;  3A98 A;  1ZSZ A;  3VS2 A;  1VQ5 Q;  1QVF S;  1Q86 C;  3EH1 A;  3VS5 A;  3CPW A;  1K9M U;  4HT8 A;  5DM7 R;  3T9N A;  1R77 A;  2F2W A;  2DZC A;  4EDU A;  1UEC A;  3UDC A;  1WHK A;  2KY9 A;  3NGP A;  2PVO B;  1UFF A;  1M30 A;  5CKF A;  2DER A;  1H8K A;  4E7Z A;  1QCO A;  4F17 A;  1PD0 A;  1PSF A;  2P0Q A;  4O6J A;  3M58 A;  1SRL A;  2LCS A;  1C0M A;  3QKJ A;  1TUD A;  1GBQ A;  3CCQ A;  3EG0 A;  3ULR B;  1JXO A;  2HNI A;  1X27 A;  3JCM Q;  2RQT A;  3MP6 A;  1QCN A;  2F2V A;  1NJI U;  2RO0 A;  1HSQ A;  2R58 A;  5KYX A;  1CSK A;  1K4U S;  3U23 A;  3SWN A;  1KJW A;  2FG0 A;  2K5F A;  4RTV A;  2DJZ A;  4M78 B;  1Y7X A;  5FU7 C;  3LWH A;  2RD1 A;  2DNU A;  3JB9 I;  5I2S A;  2KVQ G;  2NUT A;  5KYU A;  1SHF A;  4QQD A;  2QQB A;  4Y28 E;  4KGZ B;  1OU9 A;  1VQ5 T;  4M77 E;  4A4F A;  2FPD A;  4J6X A;  1M90 U;  2QQA A;  2J06 A;  1BI0 A;  1WIE A;  1Q7Y C;  1ZLM A;  2OTL T;  1KSW A;  1RAG B;  3GP8 A;  4AFQ C;  2ED0 A;  2DTI A;  2RK2 A;  2O4X B;  4AFU C;  3OS0 A;  5KE3 A;  1AWO A;  4RCB A;  1TOV A;  2A0F B;  5GAM e;  4FL6 A;  5GAN h;  1KC8 R;  4PFP A;  1ACM B;  4E7S A;  1K1Z A;  4IIM A;  1G3T A;  4MZP A;  1VYT A;  2DL7 A;  3I35 A;  3C94 A;  2ZAE A;  1WFW A;  4LD9 K;  8ATC B;  3G1J A;  2CS7 A;  3MO8 A;  1X69 A;  3M53 A;  2DJQ A;  1K9M R;  4ZGD B;  2CSQ A;  1QCF A;  4J9I A;  2XDB A;  2CSI A;  1YNZ A;  2DET A;  5I2M A;  1M1K R;  4M7A F;  2DIL A;  1IRE B;  1QMC A;  3HRS A;  1Y96 A;  1WJQ A;  4M77 C;  5IH2 A;  3I5S A;  4ZTJ A;  1Z9Z A;  3ER0 A;  3NFC A;  2QDY B;  3L2R A;  1KD1 U;  1RI9 A;  5KYN A;  4M7D E;  1A0N B;  3OA6 A;  4RTT A;  4C92 B;  3CPF A;  1MV3 A;  3OQ5 A;  1M3B A;  3J7A F;  3OY9 A;  4BI4 A;  1G83 A;  4AG2 C;  2FRW A;  1UHC A;  4M75 D;  4KRT A;  4Z88 A;  4C0G A;  2RJF A;  2CUD A;  5GAN 7;  1ZUK A;  4C5E A;  5LJ5 g;  3CC4 Q;  4C0Z A;  2RI2 A;  2MWP A;  3DKM A;  1LNX A;  4YTL A;  2QTV A;  3SHW A;  2JNG A;  2E10 A;  2GFA A;  2CT4 A;  2A7Y A;  4R56 A;  2EQI A;  1HJD A;  1ZSZ C;  1H64 1;  1VQ5 A;  1Q81 C;  4ELZ C;  2HQH A;  2DYB A;  2DMO A;  3RKX A;  3A8M B;  2DXT A;  4HT9 A;  4RTU A;  2OTL A;  3JSC A;  3VS1 A;  2RJD A;  4CC3 A;  5C6S A;  2RHU A;  3E19 A;  4HA8 A;  3EG2 A;  1QWE A;  2F69 A;  1BBZ A;  3H8Z A;  2HBP A;  3J81 E;  2HL3 A;  1P92 A;  4HCZ A;  3HTR A;  1WXU A;  1YIJ T;  3VUZ A;  4CRI A;  3G6E Q;  2PUO B;  1M2V B;  2D1X A;  4QVD A;  1IHV A;  1BCO A;  4PK4 A;  3I56 Q;  1I1J A;  5LJ5 d;  4JS5 A;  1HYO A;  1MHN A;  2X4X A;  3VS7 A;  4B9X A;  2C06 A;  3KFV A;  3M0Q A;  2YUO A;  3SWN C;  3GBQ A;  4E7J A;  2LRQ A;  3CC4 T;  5KYY B;  1YP5 A;  3EG3 A;  4LDY A;  4ZN3 A;  2BKD N;  4PJO A;  1D0Y A;  2QQS A;  2D0N A;  2HDA A;  3FRN A;  2FZK B;  4C8Q B;  1QP2 A;  3VRZ A;  2KT8 A;  3OBW A;  5FRO A;  2EYZ A;  1W2B P;  4BY6 B;  4JRP A;  1VQN Q;  2FVU A;  3THK A;  4A4H A;  2FPE A;  2VXF A;  2XU8 A;  3OYK A;  1VQM Q;  4N4I A;  2F5K A;  2KRN A;  5FU6 B;  4GBQ A;  1GRI A;  1PRM C;  3OYM A;  1K73 C;  4DEY A;  5KYW B;  1PSE A;  1WHH A;  2FL7 A;  4E47 A;  3A1P A;  3G6E T;  4Y92 A;  4F16 A;  5GMK h;  2AT1 B;  2NWM A;  2V1R A;  1QW1 A;  2YXY A;  3I56 T;  2D6F A;  3R6N A;  3CXC A;  2KXD A;  2JN0 A;  4JJN K;  2CUB A;  3G4S Q;  2PZ1 A;  5IHI A;  4L5G A;  1BI1 A;  2GF7 A;  4KUL A;  1OU8 A;  2KYB A;  4JJD A;  1FMW A;  1V1C A;  2VGN A;  3VS3 A;  3QHS A;  5LJ5 j;  4HCB A;  4WTO B;  2KGT A;  4RTX A;  5LJ3 h;  3UAT A;  1NJI C;  2RF0 A;  4PJJ A;  2KDS A;  2FB7 A;  3BW1 A;  2GTO A;  2CP7 A;  2H3J A;  3OYD A;  1NZ9 A;  2KAF A;  1VQN T;  2X4Y A;  2ZCF B;  4LE9 A;  2MAM A;  3FEO A;  1BU1 A;  2PVG B;  2JT4 A;  1T0H A;  2W10 A;  4FT4 A;  1VQM T;  2EJF A;  1D1B A;  3JCM V;  1M9S A;  2XI9 A;  5CKH A;  2KSS A;  2PVD B;  3S3O A;  1W2B A;  2E64 A;  3L2W A;  4OF1 A;  4ZGE B;  3E1S A;  3PMI A;  4AMC A;  3OSV A;  3CXC S;  2RK1 A;  4PJO E;  2ZPE B;  3CC4 A;  1W4S A;  4KBM B;  3G4S T;  3ZBD A;  2GGR A;  1M27 C;  1G5V A;  1B3Q A;  3GIB A;  1KQ2 A;  4M77 G;  1RAB B;  3QYG B;  4M78 D;  1R0C B;  2A08 A;  4R0K A;  1BK2 A;  2VV5 A;  4NL3 A;  4XK8 E;  5GAM g;  1V76 A;  1M8M A;  3PNW C;  4FYY B;  2VWF A;  1M4Z A;  3EGD A;  4HKE A;  1PRL C;  2E6Z A;  5LJ5 f;  1H3Z A;  3BY7 A;  1W6X A;  1UUE A;  3PMT A;  1SG5 A;  1OI1 A;  5GJV B;  1G3W A;  3CQT A;  4M75 B;  3QO3 A;  1J3T A;  2GQI A;  4A4E A;  4A54 A;  1IRX A;  1W2B S;  3G6E A;  2KBT A;  1M1G A;  1Q82 U;  4Q5W A;  3I56 A;  2ED1 A;  1GFC A;  4DEX A;  4N4H A;  3X25 B;  1Q86 R;  2K3Y A;  3TSW A;  1E7O A;  1MMG A;  2AHJ B;  4PKC C;  2DO3 A;  4RG8 A;  1HD3 A;  2OX7 A;  4M7A A;  4BD3 A;  1AHJ B;  5GAM d;  2EAY A;  4PJO C;  1MV0 B;  3L2U A;  1TUC A;  1ZHI A;  1UG1 A;  2K2M A;  1IGQ A;  1MNE A;  1QLY A;  2K79 A;  4J9D A;  2DRM A;  4QVZ A;  4J7I A;  5HKC A;  1VQN A;  2Y4X A;  2LQK A;  5CR2 A;  1M1F A;  4JDS A;  5GAN 2;  4M7D G;  2LTO A;  5CCA A;  1VQM A;  3X26 B;  2HMA A;  2QGG A;  3M0T A;  3VJP A;  3WVD B;  2IPO B;  3BDL A;  5GAO p;  2GNC A;  2ZPI B;  2KRS A;  4OVA A;  4RMO A;  2R5A A;  4Z89 A;  2O9V A;  5GAN 6;  3A8L B;  2M51 A;  1TTH B;  4J7F A;  3INZ A;  4C92 D;  1PM3 A;  3OYA A;  2LNH B;  2DZ9 A;  2NLU A;  4BE2 A;  2PU9 B;  3A8G B;  3V8J A;  3G4S A;  3S3M A;  3V7S A;  1KHC A;  2ECZ A;  3N5B B;  4BI3 A;  2E12 A;  4CC2 A;  5J3B A;  4JJC A;  3M4G A;  4ANJ A;  4CC4 B;  4V2S A;  2QGF B;  1TU0 B;  2BZX A;  3JB9 G;  5GAM j;  3CME Q;  3MEU A;  2O31 A;  3MEV A;  4IKF A;  2P4R A;  1U06 A;  2EWN A;  4A53 A;  1NPP A;  2CP5 A;  1X6G A;  1SEM A;  1N9R A;  2K3X A;  4Y91 A;  5DY9 A;  3A5Z B;  1Q95 G;  1FXX A;  4OMQ A;  3QG1 A;  4XQ3 A;  1M3A A;  1YJ9 Q;  3E2U A;  3X24 B;  5GAO r;  2LQN A;  3OYL A;  4M7A E;  1T3S A;  2CYZ B;  1VYV A;  5KH6 A;  4A63 B;  2DLP A;  1GCQ A;  1KC8 U;  1G8X A;  3ZFJ A;  2KT1 A;  1N6A A;  2YLC A;  2RM4 A;  2RJE A;  3RMQ A;  2EYQ A;  1K76 A;  2CDT A;  3PVL A;  2HZY A;  2JTM A;  1WDX A;  1G2B A;  3JCM X;  2OAW A;  4C0D B;  1S72 Q;  1KHI A;  2OTL Q;  2M0Y A;  2VGM A;  4C8Q D;  4L6V 5;  4KH1 B;  4RCC A;  2OJ2 A;  4JPB W;  5HK0 A;  2HD0 A;  3SDZ A;  2G6F X;  3RMS A;  5AYF A;  5D6W A;  1M1K U;  3CME T;  4M7D B;  4C5I A;  5CKE A;  1SF9 A;  4IUP A;  4D8D A;  3AT1 B;  1WGS A;  2HCK A;  5KE2 A;  3DB4 A;  2K3B A;  3L2Q A;  2XD0 A;  3TQ7 P;  1KIK A;  3OYN A;  1VYU A;  5GAM f;  3GNG A;  4CC7 A;  2KR3 A;  3CBO A;  2E5Q A;  3CCE Q;  2YRD A;  1JEG A;  3VS4 A;  4ME7 A;  1YJ9 T;  3CC7 Q;  4ZNX A;  4HVW A;  1VIE A;  1Q81 R;  2B86 A;  4AT1 B;  2DBM A;  2RHY A;  3SEM A;  1R8O B;  1ZA1 B;  4M7A C;  1UTI A;  2EIF A;  2DX1 A;  3PT9 A;  4FU6 A;  3FLG A;  1UJ0 A;  4F7U B;  2J6F A;  4GLK A;  1X43 A;  2YRC A;  3JAM E;  1GBR A;  2CZ7 B;  4BDZ A;  1S72 T;  3L2Z A;  4NL2 A;  2HBW A;  1T3L A;  4XTY A;  3FJP A;  3FJ5 A;  1XTD A;  1KFZ A;  1RAE B;  3ZEH A;  1TWB A;  4NOY A;  1VIF A;  4FYX B;  2A3L A;  2K9G A;  1FYN A;  2VAS A;  1RI0 A;  1PC0 A;  1D1A A;  4UC4 A;  2KK4 A;  1D3B B;  1HK9 A;  4PJO G;  1XJW B;  3PTA A;  1VQ8 Q;  2VVK A;  2EGC A;  3ASK A;  3NTH A;  2JMC A;  4C0F A;  1X01 A;  1E6H A;  2FEI A;  4MZM A;  2RI3 A;  4X9C A;  1OPK A;  3CCE T;  2DL3 A;  1I8F A;  1YN8 A;  1K8A R;  3CC7 T;  3CCJ Q;  1QKX A;  4C5G A;  1YWO A;  3LX7 A;  4KGX B;  5GAN 3;  1Q82 C;  2FHD A;  2O4X A;  1UEB A;  2XIC A;  2Y4Y A;  4BDY A;  4MDX A;  4BUG A;  3RR6 A;  5D7U A;  2ATC B;  2RQU A;  3VS6 A;  3MP1 A;  1K73 R;  3JRZ A;  4OGE A;  2YDL A;  2X4W A;  2HAX A;  1OPL A;  2DKG A;  1G3S A;  5I22 A;  3VYG A;  2ZPH B;  4M75 F;  3S6W A;  3CME A;  3JCM h;  1YIJ Q;  1VQ7 Q;  2LP5 A;  1AT1 B;  2E4H A;  2WSF E;  4JUV A;  2L3Q A;  1AZE A;  1ZUY A;  1QQJ A;  3LW5 E;  3PGG A;  3UA6 A;  2XKO C;  1VUB A;  2EQU A;  2IIM A;  2Z0W A;  4PFO A;  1NEB A;  4XTU A;  1IGU A;  4X1V A;  6AT1 B;  5GMK e;  1VQ8 T;  1JRI A;  2YT6 A;  2ZGW A;  1YJ9 A;  2YUN A;  3EFO B;  4HCC A;  2DEQ A;  4IUR A;  4PJN A;  5GMK l;  1CKA A;  1VQ6 Q;  3HSB A;  8AT1 B;  1K0X A;  3RUX A;  1GCQ C;  2V26 A;  3OB9 A;  1VQ4 T;  3C0C A;  1OEB A;  2KXC A;  4P5N A;  1W70 A;  3RBB B;  3F70 A;  3CCJ T;  2K5I A;  1N8R U;  3SB2 A;  2GFU A;  3PIP A;  4C92 A;  1U8R A;  4BB7 A;  2W0Z A;  2LJ0 A;  5LJ3 e;  3DLL A;  5ECA A;  5C0M A;  2QEX Q;  2MCN A;  1S72 A;  1M2O A;  1AWW A;  1I5O B;  3CD6 Q;  2YRV A;  1ZBX A;  1BB9 A;  2OI3 A;  2E5K A;  4KH0 B;  3C12 A;  1YI2 Q;  1E6G A;  1U3O A;  2XMF A;  1UHF A;  4LUD A;  3OBY A;  1RAC B;  1QKW A;  4KGV B;  1VQ7 T;  2QQ9 A;  2DTO A;  1RLP C;  3CBP A;  4QQ6 A;  4J5Y A;  3GPL A;  2RHX A;  1OZ3 A;  3QUI A;  1O75 A;  2J6K A;  1UGR B;  5LL6 S;  5IHK A;  1B34 B;  3CCE A;  1V29 B;  5CVI A;  5GAN 8;  2MF2 A;  2K57 A;  4OB0 B;  1MMA A;  3CC7 A;  1WHG A;  4J9G A;  3NMZ C;  2EFI A;  2CGH A;  5IT9 E;  1VQ6 T;  4B9W A;  1SHG A;  1O9S A;  4PNO A;  3L1A A;  1I5L A;  2B8A A;  3OYI A;  1M2V A;  2YHT A;  4DBH A;  2P84 A;  4TVR A;  4EMK B;  1KC8 C;  5J39 A;  5FRN A;  2ROL A;  3TRE A;  2QEX T;  3PE0 A;  4RTY A;  4M77 D;  3TVT A;  3CD6 T;  2HQE A;  2EKH A;  1UDL A;  3GLX A;  1YI2 T;  4FSS A;  4M78 C;  5KYY A;  2OAU A;  3EFR A;  1K9M C;  3TCJ A;  1T0J A;  2EJG A;  4XTV A;  4J6W A;  1SRM A;  4M7A G;  4DQ2 A;  4PLI A;  1WQ7 A;  2LQW A;  2BIV A;  4C8Q A;  2AKL A;  4AG1 C;  1OQK A;  3CCM T;  3P8H A;  3EFS A;  2J05 A;  1VQ8 A;  5A2Q E;  1VQL Q;  1QVG P;  5GAO l;  5CK9 A;  2M16 A;  1N8R R;  3RDV A;  4BE0 A;  2DD4 A;  3MEA A;  1VQ4 A;  3L42 A;  3TSZ A;  1R0B G;  2KRM A;  3URG A;  1ARK A;  2D8H A;  3CCJ A;  2CP2 A;  2DF6 A;  5CKD A;  2L3S A;  2V8J A;  1LOJ A;  2RI5 A;  3EGX B;  1Q86 U;  2JW4 A;  4DOV A;  4O5V A;  5KYW A;  2MYS A;  4QW2 A;  5DLQ E;  1SSH A;  2RHZ A;  2RNA A;  4XTW A;  1WHL A;  1WJR A;  2JVV A;  1ZQ1 A;  4OMN A;  4LD6 A;  2BZ8 A;  2L89 A;  3S3N A;  1M8V A;  4F14 A;  3EH2 A;  1N5Z A;  3REB B;  1BI3 A;  1YCS B;  1YIJ A;  1VQ7 A;  2QTX A;  5KCO A;  4PFZ A;  2EGA A;  3HRT A;  4N0A A;  2CH4 A;  1JQQ A;  4GY5 A;  5CKB A;  2EVR A;  1M90 C;  1Y71 A;  4M7D D;  2QG9 B;  3KBG A;  1OUL A;  5GAO q;  5GAO m;  1KG1 A;  2KMT A;  1M5Q 1;  5A0G A;  4E7I A;  2K6D A;  4XTZ A;  4M78 F;  4OMP A;  2AZS A;  1B07 A;  1VQL T;  2E70 A;  2LT1 A;  1VQ6 A;  2CP6 A;  3JCM c;  2ENM A;  1X6B A;  1RAH B;  4FYW B;  2R5M A;  4OP0 A;  2DK3 A;  4II1 A;  1MGQ A;  3CCR Q;  2O88 A;  4KUD K;  4F7U F;  2D9T A;  2BE9 B;  2QI2 A;  2RH2 A;  3EG1 A;  2KEA A;  3QJ6 A;  2M9U A;  4LUE A;  1NM7 A;  2F1L A;  4C92 C;  2DIQ A;  3MKD A;  3LYI A;  3MJX A;  1EFN A;  2I0N A;  5IN1 A;  4EMH A;  2CP0 A;  2QEX A;  3C4S A;  1QVG A;  1BYM A;  3CD6 A;  4B6M A;  3QWX X;  1AVZ C;  1FX7 A;  3TEE A;  1YI2 A;  2DVE A;  2G3R A;  2EJ9 A;  4ATO A;  2XID A;  1MND A;  1BKB A;  1VQK Q;  1ABQ A;  1AD5 A;  2E3I A;  3CCM A;  1G3Y A;  4MZT A;  1JJ2 P;  1BI2 A;  2DIG A;  5FU7 B;  3JCM W;  2LJ1 A;  2YWW A;  5KCH A;  4X34 A;  1WXB A;  3LH0 A;  9ATC B;  3CCV Q;  3OS2 A;  1KD1 C;  2RHI A;  2RPN A;  3QZ9 B;  1QVF P;  2VB6 A;  4DA4 A;  1LVK A;  3CCR T;  4M75 A;  1OX9 A;  2NUP B;  1LCK A;  1YFN A;  2PQW A;  3LGF A;  3EHQ A;  3V7R A;  1QVG S;  2L5Q A;  2CZ6 B;  3FDR A;  3JB9 J;  2QA4 Q;  4QT7 A;  4E7L A;  2ROT A;  2JMA A;  1WZO A;  3EG9 B;  1Z9Q A;  3SFM A;  4C92 F;  3UA7 A;  2K7A A;  2DRK A;  2EQJ A;  1AWX A;  2MIO A;  2D8J A;  3E9G A;  1HXD A;  1ZA2 B;  3E9F A;  1VQK T;  4C8Q C;  3QWY A;  1KQ1 A;  2JXB A;  4E2F B;  2ZZD A;  2RMO A;  2PTK A;  5LJ3 g;  2IVW A;  4BY6 C;  5GAN f;  1OV3 A;  1VQL A;  1VQ9 Q;  1GFD A;  2YUQ A;  2BE7 D;  3NTK A;  2FZC B;  4WCI A;  1NG2 A;  3CCV T;  1SSF A;  5FU6 C;  2A36 A;  3OS5 A;  1MUZ A;  2C0O A;  2LCC A;  4L59 A;  3CPW P;  4EIK A;  1MMD A;  4JZ4 A;  1WYX A;  1N27 A;  1WHJ A;  3KUF A;  4PLL A;  2LCL A;  3VU3 C;  1Q7Y R;  1YHQ Q;  1UGP B;  1Q81 U;  2VYT A;  4PJL A;  2VXE A;  2E65 A;  3BDU A;  3VUB A;  3EAE A;  4M77 B;  3A8O B;  1ZX6 A;  2DAQ A;  1YBY A;  4QVC A;  1I81 A; 
#chains in the Genus database with same CATH homology
 2PUO B;  1I4K 1;  2V8I A;  3ZEH A;  4QVD A;  4NOY A;  3OYB A;  4FM4 B;  1VIF A;  5A0L A;  2A3L A;  1OYX A;  5LJ5 d;  4DOW A;  4OB2 B;  1RI0 A;  4JS5 A;  4LDU A;  4JRI A;  4UC4 A;  2KK4 A;  1D3B B;  3HFN A;  3QJY A;  2XG8 D;  4XU1 A;  3OYC A;  1MHN A;  2QA4 T;  2X4X A;  4B9X A;  1Q7Y U;  1HK9 A;  3Q1J A;  4PJO G;  1GXI E;  3PTA A;  2WSE E;  2VC8 A;  2L8D A;  3M9Q A;  2C06 A;  2K2V A;  3ASK A;  3NTH A;  2E1H A;  3SWN C;  4A4K A;  3GNF B;  3M57 A;  3JB9 F;  5LJ3 d;  4C0F A;  4M7A G;  1X01 A;  5GAN j;  4N0A C;  4E7J A;  2LRQ A;  3CC4 T;  4MZM A;  4ELY C;  2RI3 A;  4BI8 B;  4LDY A;  4X9C A;  4C8Q E;  4ZN3 A;  2BKD N;  4PJO A;  5GAN e;  3CCE T;  2QXF A;  1I8F A;  2QQS A;  3FRN A;  4FT2 A;  1NPR A;  3PIO A;  3CC7 T;  1YIT A;  1JB0 E;  1QP2 A;  4C8Q B;  4XU2 A;  1WNL A;  5CQX A;  4EMG A;  1N9S A;  3OBW A;  5FRO A;  4C5G A;  3M56 A;  4BY6 B;  3LX7 A;  3JB9 D;  4JRP A;  5L8R E;  1Q82 C;  5GAN 3;  1VQ9 T;  2FHD A;  2O4X A;  1UEB A;  4M7A B;  2FVU A;  2XIC A;  2M1H A;  2Y4Y A;  4M75 E;  4A4H A;  4C8Q F;  4BDY A;  4MDX A;  3VV0 A;  2VXF A;  1X75 C;  4BUG A;  2XU8 A;  3OYK A;  3CCR A;  2JTF A;  2F5K A;  4N4I A;  5FU6 B;  3MP1 A;  3BFM A;  2CZ0 B;  2ZPG B;  3JRZ A;  4OGE A;  5J26 A;  4X9D A;  4R55 A;  3OYM A;  1K8A U;  2X4W A;  4OMF B;  5CIU A;  2DXC A;  2HAX A;  3SD4 A;  1K73 C;  2DKG A;  3UT1 A;  1UB4 A;  1YHQ T;  3P8D A;  2V8K A;  1G3S A;  1PSE A;  1DJ7 B;  2E6N A;  3VKI A;  3VYG A;  2ZPH B;  4IUU A;  4M75 F;  3S6W A;  3CME A;  1YJW T;  3JCM h;  3WVE B;  2FL7 A;  3H6Z A;  2PUK B;  2WSF E;  4JUV A;  4E47 A;  4ZTF A;  3G6E T;  4JS4 A;  5GMK h;  3JCM J;  3LW5 E;  2CKK A;  2E41 A;  4RKU E;  3PGG A;  2XKO C;  1QW1 A;  3JCM b;  3I56 T;  1VUB A;  2EQU A;  1K73 U;  2D6F A;  2DXU A;  4OB1 B;  5GMK j;  4XTU A;  3JCM e;  3CXC A;  1FWZ A;  2MWO A;  2WAC A;  2JN0 A;  4JJN K;  3V8L A;  5GMK e;  3QII A;  1N8R C;  4L5G A;  1BI1 A;  2XDP A;  1VQ8 T;  1JRI A;  2ZGW A;  1YJ9 A;  2GF7 A;  2JZ2 A;  5LJ5 h;  3FIF A;  1VQK A;  4HCC A;  4KUL A;  2DEQ A;  3C95 A;  3QBY A;  4IUR A;  4KUI A;  3MCA B;  3SWN B;  5GMK l;  3HSB A;  1Y07 A;  2XHC A;  5D6X A;  5HK3 A;  2VGN A;  1XQH A;  2P0P A;  3QHS A;  5LJ5 j;  1BIB A;  3MEW A;  4HCB A;  3RUX A;  4C92 G;  3OB9 A;  2EQK A;  2F5T X;  4NS5 A;  4RG2 A;  3V8K A;  2GQV A;  1VQ4 T;  5FLX E;  1BIA A;  2ZPF B;  1EIF A;  4P5N A;  5LJ5 e;  3I55 A;  3CC2 A;  1TH7 A;  5LJ3 h;  4JRQ A;  1NJI C;  3J80 E;  4IUV A;  2M0O A;  3F70 A;  3CCJ T;  2K5I A;  2ZPB B;  3HPW A;  2KDS A;  5GAO n;  2FB7 A;  1N8R U;  3BW1 A;  3CCV A;  3SB2 A;  2GFU A;  2H3J A;  2X35 A;  4QVC A;  3CBM A;  1NZ9 A;  2KAF A;  4C92 A;  5LJ3 j;  3PIP A;  3OYD A;  3QXE B;  4EMK C;  1U8R A;  4BB7 A;  1VQN T;  1VQO A;  2RJC A;  4MML A;  2O01 E;  2X4Y A;  5LJ3 e;  2ZCF B;  3DLL A;  4M7D A;  5C0M A;  2MAM A;  2I2L A;  3FEO A;  2PVG B;  1S72 A;  4MDW A;  4FT4 A;  4IUQ A;  3OYF A;  1VQM T;  4M75 C;  2YRV A;  1ZBX A;  4QQG A;  3CCQ T;  3GF5 A;  2EJF A;  5A0D A;  3C12 A;  3CCS T;  4M78 G;  3JCM V;  1M9S A;  3CEY A;  3OBY A;  2XI9 A;  1YJN T;  5CKH A;  2KSS A;  2PVD B;  3M54 A;  1JJ2 A;  3RKW A;  2DD5 A;  4PL6 A;  3S3O A;  1W2B A;  4VUB A;  2E64 A;  3LWI A;  3L2W A;  2QA4 A;  1VQ7 T;  2FYK A;  4OF1 A;  2QQ9 A;  4ZGE B;  2DTO A;  3E1S A;  3PMI A;  2DPP B;  4M78 A;  3OSV A;  3CXC S;  3HL8 A;  3CBP A;  4QQ6 A;  3CPW S;  4F7U G;  2RK1 A;  4J5Y A;  3GPL A;  2DXB A;  1OZ2 A;  1YCY A;  2RHX A;  3DB3 A;  3OMG A;  4JLI A;  4C5H A;  1OZ3 A;  3QUI A;  4PJO E;  1O75 A;  2ZPE B;  4XTX A;  4E7H A;  3CC4 A;  1W4S A;  1UGR B;  5LL6 S;  4FSX A;  4KBM B;  1QVF A;  3G4S T;  3ZBD A;  1B34 B;  3CCE A;  2L3R A;  4E7K A;  3QPH A;  1V29 B;  5CVI A;  4F7U A;  5GAN 8;  2MF2 A;  2LNV A;  3GIB A;  1G5V A;  1KQ2 A;  2QQR A;  2K57 A;  4OB0 B;  4M77 G;  1QVP A;  3CC7 A;  1WJS A;  1XOV A;  2KQW A;  3QYG B;  3JCM f;  4M78 D;  5IT9 E;  2EFI A;  2CGH A;  1NE8 A;  3G71 T;  1VQ6 T;  2K5L A;  4B9W A;  1O9S A;  4PNO A;  3L1A A;  1I5L A;  2B8A A;  2VV5 A;  3QYH B;  2HQX A;  4IUT A;  4XK8 E;  4PJO F;  5GAM g;  4NL3 A;  5GMK i;  1VQ9 A;  3FB9 A;  3PNW C;  3OYI A;  4M77 A;  4J6Y A;  4XU0 A;  5CQY A;  1M4Z A;  2P0K A;  4HKE A;  2YHT A;  4XU3 A;  3CCL T;  4TVR A;  2E6Z A;  5LJ5 f;  1H3Z A;  3VYH B;  4EMK B;  2EQM A;  3BY7 A;  3ME9 A;  4EPC A;  3M5A A;  1KC8 C;  4D6W A;  1D3B A;  5J39 A;  5FRN A;  3RER A;  4PJO D;  3TRE A;  3OYJ A;  4ZN1 A;  1YHQ A;  2QEX T;  4CI0 C;  3PMT A;  4M77 D;  5I21 A;  1IZ6 A;  1Y96 B;  1OI1 A;  3CD6 T;  1YJW A;  1G3W A;  4M75 B;  3QO3 A;  2LVM A;  5LJ3 f;  2HQE A;  1WPY A;  2JOY A;  4A4E A;  4C8Q G;  1JJ2 S;  3GLX A;  4A54 A;  1YI2 T;  4M78 C;  3OS1 A;  3G6E A;  1W2B S;  3QSU A;  2Y90 A;  1M1G A;  3LGL A;  2CZ1 B;  2OAU A;  3RIR A;  3EFR A;  3V7C A;  3TU4 K;  5CAI A;  5M9O A;  3TCJ A;  1Q82 U;  1K9M C;  2EJG A;  4Q5W A;  4XTV A;  3I56 A;  3UPU A;  4J6W A;  4N4G A;  1RL2 A;  4N4H A;  1U1T A;  4PLI A;  1WQ7 A;  4XAX B;  4DQ2 A;  1UGS B;  2BIV A;  3NTI A;  3WXM B;  4C8Q A;  3CCU T;  3X25 B;  3G7Z A;  3QZ5 B;  3CCM T;  2K3Y A;  3P8H A;  3EFS A;  5IAY A;  2RB6 A;  5D6Y A;  1VQ8 A;  2AHJ B;  4PKC C;  3HP9 A;  3RES A;  5A2Q E;  1QVF S;  2DO3 A;  1Q86 C;  4RG8 A;  2OTJ T;  4JRK A;  3JCM P;  4M7A A;  3M59 A;  4BD3 A;  1AHJ B;  2LT4 A;  5GAO l;  3OYH A;  3CPW A;  1K9M U;  5CK9 A;  2M16 A;  4HT8 A;  5DM7 R;  2EAY A;  5GAM d;  4PJO C;  3T9N A;  2DD4 A;  3MEA A;  4BE0 A;  1VQ4 A;  3L42 A;  3L2U A;  4ZGJ B;  4BE1 A;  1WQW A;  1ZHI A;  2DZC A;  3URG A;  3CCJ A;  4EDU A;  5CKD A;  3UDC A;  2V8J A;  2KY9 A;  1LOJ A;  2RI5 A;  1Q86 U;  4WF2 A;  2PVO B;  4QVZ A;  4DOV A;  4O5V A;  4J7I A;  5HKC A;  5CKF A;  4QW2 A;  1VQN A;  4M7A D;  5DLQ E;  2Y4X A;  3HFO A;  3MP8 A;  2LQK A;  5CR2 A;  2RHZ A;  1M1F A;  4JDS A;  4XTW A;  3HHT B;  5GAN 2;  4M7D G;  2LTO A;  1PSF A;  2P0Q A;  4O6J A;  3M58 A;  5CCA A;  1WJR A;  3HRU A;  3X26 B;  1VQM A;  1X6O A;  2JVV A;  1ZQ1 A;  3QKJ A;  3RKY A;  3VJP A;  3WVD B;  3CCQ A;  2MI6 A;  4LD6 A;  3S3N A;  2L89 A;  3CCS A;  1M8V A;  3BDL A;  5GAO p;  5FRM A;  2HNI A;  3JCM Q;  2ZPI B;  1YJN A;  3MP6 A;  4OVA A;  2XK0 A;  1BI3 A;  3QDR B;  4M78 E;  2R5A A;  4RMO A;  2RO0 A;  1NJI U;  2R58 A;  3L2V A;  5GAN 6;  3A8L B;  1YIJ A;  2QTX A;  3SWN A;  5DLO A;  1VQP T;  1VQ7 A;  2K5F A;  5KCO A;  4LDW A;  2LQ8 A;  3HRT A;  4N0A A;  2DJZ A;  3INZ A;  1Y7X A;  4J7F A;  4M78 B;  5FU7 C;  4C92 D;  3LWH A;  3PFS A;  4GY5 A;  3OYA A;  2RD1 A;  5CKB A;  2DZ9 A;  3JB9 I;  3AHU A;  2NLU A;  5I2S A;  1Y71 A;  2KVQ G;  1M90 C;  4M7D D;  4F7U E;  4BE2 A;  3KBG A;  2PU9 B;  5GAO q;  4QQD A;  5GAO m;  3MHX A;  1KG1 A;  2KMT A;  1M5Q 1;  1U1S A;  3A8G B;  3V8J A;  2QQB A;  4XTZ A;  4Y28 E;  5A0G A;  3G4S A;  3S3M A;  4M78 F;  3V7S A;  1KHC A;  1VQ5 T;  2WSC E;  3N5B B;  3UWN A;  1VQL T;  2E70 A;  3X28 B;  4BI3 A;  3G71 A;  2E12 A;  5GMK m;  2LT1 A;  1VQ6 A;  3JCM c;  4C0D C;  5J3B A;  4M77 E;  4A4F A;  2R5M A;  4J6X A;  2DK3 A;  4OP0 A;  1M90 U;  4II1 A;  4PJO B;  3M4G A;  2QQA A;  1MGQ A;  3M4Y A;  3P8B B;  4KUD K;  3KXT A;  4F7U F;  1BI0 A;  4BAC A;  1Q7Y C;  2D9T A;  2QI2 A;  2RH2 A;  2OTL T;  3QJ6 A;  3A8H B;  2M9U A;  3GP8 A;  5GAM h;  4V2S A;  4C92 C;  3CCL A;  2DIQ A;  3LYI A;  2DTI A;  2RK2 A;  3JB9 G;  5GAM j;  2O4X B;  3JB9 H;  3M55 A;  4M77 F;  3MEU A;  5IN1 A;  5KE3 A;  4EMH A;  3OS0 A;  4RCB A;  4M7D C;  2QEX A;  3C4S A;  1QVG A;  3MEV A;  4IKF A;  5GAM e;  3FC3 A;  1BYM A;  4FL6 A;  5GAN h;  2EWN A;  4A53 A;  3CD6 A;  1NPP A;  5GAN g;  1N9R A;  1FX7 A;  3TEE A;  1YI2 A;  2K3X A;  1G3T A;  4Y91 A;  5DY9 A;  2DVE A;  2G3R A;  3A5Z B;  4MZP A;  2EJ9 A;  3CMA A;  1B34 A;  3C94 A;  4ATO A;  2XID A;  4LD9 K;  1FXX A;  1BKB A;  3GOX A;  3QG1 A;  4XQ3 A;  2CS7 A;  3MO8 A;  5EG2 A;  3CCU A;  3X24 B;  5GAO r;  3M53 A;  2EKO A;  3OYY A;  3OYL A;  4ZGD B;  3CCM A;  1G3Y A;  4M7A E;  4MZT A;  1K8A C;  1BI2 A;  2DIG A;  2CYZ B;  5KH6 A;  5FU7 B;  3JCM W;  3LLR A;  3X20 B;  2OTJ A;  1KC8 U;  3OW2 A;  5KCH A;  3ZFJ A;  2XDB A;  3CMA T;  4X34 A;  1N6A A;  2YLC A;  1YIT T;  2RM4 A;  3HKS A;  2RJE A;  3LH0 A;  3RMQ A;  2EYQ A;  3OS2 A;  2P4T A;  2JTM A;  5I2M A;  4M75 G;  2RHI A;  3JCM X;  1KD1 C;  4EMK A;  2X4J A;  3QZ9 B;  4M7A F;  2R57 A;  1KQS A;  5HY6 A;  1M1K C;  1IRE B;  4Z02 A;  4C0D B;  4DA4 A;  1LJO A;  2JUF A;  3HRS A;  3OSS C;  4LDV A;  3CCR T;  1KHI A;  4A4G A;  1Y96 A;  1WJQ A;  2VGM A;  4M77 C;  4C8Q D;  4L6V 5;  4M75 A;  4C92 E;  4RCC A;  4ZTJ A;  3ER0 A;  3NFC A;  2QDY B;  4MMK A;  2DTH A;  3L2R A;  2PQW A;  3LGF A;  3JCM g;  5HK0 A;  1KD1 U;  4M7D E;  2HD0 A;  3SDZ A;  2YLB A;  3OA6 A;  3RMS A;  4C92 B;  3V7R A;  5GAN d;  5AYF A;  5GAN 4;  1QVG S;  3CPF A;  5D6W A;  2L5Q A;  3OQ5 A;  2CZ6 B;  3FDR A;  1M1K U;  3JB9 J;  3J7A F;  3OY9 A;  3CME T;  2LDM A;  4BI4 A;  4E7L A;  4M7D B;  4C5I A;  5CKE A;  4IUP A;  1WGS A;  4M75 D;  4KT0 E;  5KE2 A;  3OYG A;  5CO7 A;  4C92 F;  3SFM A;  3DB4 A;  4C0G A;  4E7I A;  2RJF A;  2EQJ A;  4J8O A;  3DLM A;  3L2Q A;  1VQP A;  5GAN 7;  2XD0 A;  4C5E A;  4JLG A;  5LJ5 g;  3OYN A;  4M7D F;  5GAM f;  3GNG A;  4C0Z A;  3E9G A;  3CBO A;  2E5Q A;  2BUD A;  2RI2 A;  2MWP A;  3DKM A;  1HXD A;  1LNX A;  4YTL A;  2LC4 A;  4ME7 A;  1VQK T;  2RA2 A;  3E9F A;  1YJ9 T;  2GCX A;  4C8Q C;  5GAN 5;  2K4Y A;  2JNG A;  1KQ1 A;  2E10 A;  1QP3 A;  2GFA A;  3OW2 S;  2A7Y A;  1JBM A;  2ZZD A;  1VIE A;  5LJ3 g;  4R56 A;  2IVW A;  4FIB A;  2XDD A;  4BY6 C;  4OB3 B;  5GAN f;  1H64 1;  1VQ5 A;  1Q81 C;  2RHY A;  1R8O B;  4ELZ C;  1VQL A;  3R6O A;  4M7A C;  1UGQ B;  3MET A;  3OYE A;  2EIF A;  3I55 T;  3CC2 T;  3NTK A;  3PT9 A;  4FU6 A;  3O8V A;  3RKX A;  3A8M B;  2DXT A;  3FLG A;  1SSF A;  5FU6 C;  3CCV T;  3OS5 A;  4F7U B;  1KQS S;  4HT9 A;  2LCC A;  4L59 A;  4OGC A;  3JSC A;  2OTL A;  4LDX A;  4GLK A;  2RJD A;  1VQO T;  1N27 A;  1XNI A;  2D0Q B;  3KUF A;  4PLL A;  5C6S A;  3JCM d;  2VUB A;  3JAM E;  2LCL A;  3VU3 C;  2RHU A;  3E19 A;  1UGP B;  4HA8 A;  1Q81 U;  2MMP A;  2F69 A;  2VYT A;  2CZ7 B;  4BDZ A;  3H8Z A;  1S72 T;  2HBP A;  3L2Z A;  3J81 E;  2VXE A;  2E65 A;  4NL2 A;  3BDU A;  3VUB A;  1P92 A;  3EAE A;  4HCZ A;  4XTY A;  3A8O B;  4M77 B;  3FJP A;  4J83 A;  2LX9 A;  2DAQ A;  1YIJ T;  3VUZ A;  1YBY A;  3OMC A;  4CRI A;  1I81 A;  2IG0 A;  1XTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...