5GAMj

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamj00
4EMKB 4EMGA 4M77B 1WQWA 1B34A 5GMKe 4M7DA 2I2LA 1I81A 2DZ9A 2DZCA 2E41A 3HFNA 4M75C 5LJ3h 4C92E 4NOYA 2EWNA 3INZA 3V7SA 2DXTA 2YHTA 4RCBA 4XU0A 1H641 2HNIA 3RESA 4M7DB 4M75G 1BIBA 4M75E 5GAMg 4RCCA 2Y90A 5GAOr 5LJ3j 1JBMA 2JN0A 4XTZA 4OP0A 4C8QD 4XU2A 4M78D 4M7DD 3BFMA 2EJFA 3L2ZA 3JB9F 1WPYA 3JCMW 1U1SA 3QUIA 2EJ9A 4M7AD 3FJPA 2RM4A 4C92A 3BDUA 1N9SA 3JB9G 3EFRA 1M5Q1 2DEQA 3JCMQ 3RKWA 3FB9A 4M75A 2E10A 4A54A 3JB9H 3RERA 1WNLA 3SWNB 5GAMd 5GAOq 4M7AB 4J5YA 1D3BA 3QHSA 3QO3A 1Y96B 4M75F 4A53A 4C92C 4V2SA 3AHUA 3JCMf 4JRKA 4C92G 1X01A 3GIBA 2DTOA 4HT8A 1LNXA 4XU3A 3JB9D 4J6WA 3V8JA 2QTXA 1LJOA 4QVCA 4HT9A 1B34B 3FIFA 1HXDA 5GAMj 4WF2A 3JB9J 1N9RA 3RKYA 5GAOp 2E65A 2RA2A 5GANf 4PJOC 5GAN8 1HK9A 2DJZA 2VC8A 3HFOA 4F7UG 4F7UE 5LJ3f 4PJOG 5LJ5f 5GAOl 4PJOE 1M8VA 2CGHA 2FYKA 3RKXA 5GAOm 4C92D 3V8LA 4EMKC 5GAMe 3JCMJ 4M75D 2DTIA 4MMLA 4MMKA 3V7RA 2EAYA 4M77E 3JCMc 1I8FA 4EMHA 5GANg 4C92F 1I4K1 4Y91A 2YLBA 5GMKm 4C92B 3L1AA 2DTHA 4F7UA 5GMKi 5LJ5g 4J6YA 4PJOA 1WQ7A 4NL2A 4M75B 3V7CA 4XTYA 2ZGWA 5GAMh 4M7DG 4C8QA 3PGGA 4QVDA 3JCMd 4M7DE 4M78A 3HSBA 4F7UF 2DKGA 1BIAA 1D3BB 4PJOF 4X9CA 4EMKA 4M77A 3JB9I 3EFSA 2RD1A 5I21A 4XTUA 4PJOB 4XTWA 4XTVA 1MGQA 1KQ1A 5GANd 4C8QC 4M7AF 2K57A 3JCMP 3JCMg 4M78C 4JLIA 5LJ3d 3VU3C 4C8QE 4C8QG 4N0AA 5LJ5d 4HA8A 4M78E 2E1HA 4M78G 3RIRA 4M77C 3V8KA 5GAOn 4M7AC 5GAN5 5GANh 4M77G 4J6XA 4M7AG 2VXEA 4M7AE 5GMKl 2DVEA 4X9DA 4NL3A 4M7DF 5LJ5h 1YCYA 4PNOA 3M4GA 5GANj 3JCMV 3JCMb 1KQ2A 4N0AC 5LJ3g 1LOJA 3JCMe 4M7DC 4PJOD 5GAN4 5LJ5j 2E64A 5GMKh 3JCMX 4DQ2A 1JRIA 4JRIA 4JUVA 5CAIA 2VXFA 3RUXA 5GAN3 4XTXA 3SWNA 5GMKj 3BW1A 4F7UB 4M77D 5GANe 5GAN6 4M7AA 4XQ3A 4C8QF 1TH7A 2RB6A 1Y96A 4M78F 3SB2A 3JCMh 5LJ3e 2EJGA 4C8QB 5LJ5e 1U1TA 2DXUA 5GAN2 5GAN7 2FB7A 4M78B 5GAMf 3BY7A 3QSUA 1I5LA 4M77F 4XU1A 5DY9A 2YLCA 3SWNC
chains in the Genus database with same CATH superfamily
1IHVA 2JTMA 2DBMA 2R5MA 2A7YA 4M7DB 3OYHA 4HVUA 1S72Q 1RACB 2RM4A 2VYTA 5J26A 2F5TX 2DX1A 1G3YA 3Q1JA 4LD6A 3FRNA 3PIOA 2KT1A 2IG0A 4A63B 2A08A 1W6XA 4M7AB 2LTOA 1X75C 3QHSA 5D6XA 1M2OA 3CC4T 2PTKA 2QA4T 2KGTA 2JVVA 3VS4A 3LH5A 1R8OB 5GAOp 1MV3A 2L5QA 2RQVA 1CKAA 2KRSA 1XOVA 1YNZA 2COWA 4ATOA 3OMCA 2YUOA 4MMLA 3V7RA 5HK0A 1VQMA 4J9DA 5LL6S 4AG2C 4NL2A 4M7DE 2JZ2A 1N27A 1S1NA 2K7AA 3H9NA 4JJNK 2RK1A 3EHQA 2HMAA 5GAOn 5KYUA 1E6GA 4M77G 4M7AE 4X9DA 2L8DA 3JSCA 3EFOA 1KC8C 1KQSS 2P0QA 4OB2B 2LX7A 3UPUA 5A0LA 4FT2A 3CCMQ 2JMAA 1UGSB 1ZUKA 1UJ0A 2QQSA 3SB2A 1PC0A 5LJ3e 4C8QB 5IH2A 2LNHB 1HYOA 1S72T 3CPWS 1YJNA 1PWTA 1Z9QA 3OS0A 3M4YA 1V1CA 4E7LA 4JRQA 1TG0A 4A4HA 1VOMA 2QDYB 3CPFA 4D8DA 2CYZB 2DL8A 2AK5A 2O4XA 1XNIA 3M9QA 1M3CA 4F04B 3QIIA 1WPYA 4OB3B 1W4SA 2RQTA 2RO0A 3E19A 1N9SA 4KULA 2ATCB 2X4JA 4PL6A 2CH4A 3VRYA 4ANJA 2CP0A 1TUGB 3QJ6A 2EYWA 1LJOA 3C4SA 1VQKT 5IAYA 1GBQA 2GBQA 4BE0A 2A3LA 3OS1A 1BCOA 1TTHB 1QKXA 4AFZC 1NLPC 2F5KA 4WTOB 2FZCB 1AHJB 2F2VA 3G4SQ 3CCLA 2PU9B 1VQ6Q 4LD9K 1WJSA 4J9BA 2JM9A 3AT1B 1M1FA 5HKCA 4MZMA 2NUZA 1ABOA 3OYAA 3HTRA 2PZ1A 2KI7A 5FU7B 1MGQA 3CQTA 4AFQC 2FL7A 3CCMT 4JLIA 1VQ4Q 2DRKA 4N0AA 2F2WA 3PNWC 2RJCA 1AWJA 1O9SA 4D6WA 4E6RA 3THKA 4EIKA 3PFSA 3OYMA 3OBYA 5KYYB 1QMCA 1Y0MA 4M77D 1T3SA 2LJ3A 1X6OA 2KRMA 2CSIA 1EZZB 1GXIE 2KSSA 4N4GA 4X34A 1D1CA 2HL3A 2DIGA 4Q5WA 4ZNXA 2VUBA 1PM3A 4FW2A 2RPNA 4OMOA 2RQUA 1VYVA 1VQ7Q 4M75A 2E3HA 2NYSA 3CC2Q 3PT9A 1W1FA 1ZBJA 3MEVA 3G4ST 4IKFA 3HKSA 3RR6A 2V8IA 1WDXA 1X27A 1RADB 1X01A 1VQ6T 3QJYA 4FYVB 4QT7A 4HT9A 2CT3A 3MP6A 2RQRA 4AFSC 2R58A 3H41A 4ZGJB 1N9RA 1WHHA 1Q81U 1UG1A 1AOJA 1VQ4T 2EGAA 1C0MA 3ZEHA 4N4IA 3G6EA 4A4EA 1ZSZC 3HSBA 3MO8A 4XAXB 2QGFB 1JEGA 1SSFA 2A37A 1YWPA 4MDXA 2XKOC 2QA4A 1Q81R 3JCMP 1VQMQ 1BI0A 1K76A 1KHIA 1UFFA 1TSFA 2D0NA 5GAN5 2XI9A 3ULRB 2JMCA 3JCMV 4N0AC 4PJOD 2OTLQ 3H6ZA 4K11A 2HEQA 2VXFA 2PUKB 2QASA 4PLLA 4II1A 3RUXA 5L23A 2HSPA 1NBEB 1K73C 1IHWA 2W0ZA 1H3HA 3MP8A 3BY7A 1QCNA 1VQ7T 3EGDB 2I2LA 4FU6A 4MZPA 2KVQG 4BB7A 3CC2T 2E41A 2OJ2A 2K9GA 5LJ3h 3V7SA 4L59A 1N8RC 2DO3A 1KQSA 1AWWA 1YJNQ 2E70A 3G7ZA 1Q86U 2K5LA 3FJPA 1K9MC 4C92A 1R0CB 2CH4W 4PJMA 2X4WA 3OS5A 5CKEA 3PTAA 1KD1U 3CCSQ 3CPWA 3VUZA 1K9AA 1RI0A 3JCMf 4JRKA 3GLXA 2HZYA 4PFPA 3E9FA 5EC7A 3WVDB 3NGPA 1Q86R 3EG1A 3R6OA 4F7UG 2ED0A 4E47A 1FYNA 1AVZC 3ER0A 1KD1R 1OZ2A 5GAMe 2LT4A 1VQMT 2MK5A 5KE3A 2P84A 3X24B 4JDSA 4ME7A 4C0DB 4Z89A 1EFNA 1M8MA 4Z02A 1N6AA 1F1BB 2KE9A 1ABQA 2OTLT 1PKTA 1K4US 4OMLA 2CSQA 2MCNA 1H92A 3DB3A 2E6NA 1QVGS 2MWPA 2V26A 1IO6A 4J6XA 4IUVA 4LDYA 1YCYA 3QYHB 3OYIA 1D1BA 5GMKh 3SEMA 3MHXA 1ZUYA 3EG9B 4F7UB 3OYFA 2KXDA 2QQAA 1YIJQ 1YJNT 2C0IA 1VQ8Q 4JLGA 4F14A 4HT8A 1QP2A 1ARKA 2RH2A 4OB0B 2PUOB 3OB9A 1AZEA 1Z9ZA 1G3TA 3CCST 2X51A 2KT8A 2CKKA 2JN0A 5C0MA 4M78D 2Y4YA 2RJDA 3QUIA 3G1JA 1CKBA 2YRDA 2YUNA 2DL5A 2LZ6B 4HCBA 1NLOC 1C1AA 2AZVA 2LNVA 4CC4B 1ZSGA 1G8XA 1NJIU 1LCKA 4ELYC 2QGGA 3OYGA 3P8BB 3PVQA 4C92C 1TXQA 1NG2A 1OV3A 4RMOA 4AMCA 1ZUUA 5GAMj 3OMGA 4PJOC 1TOVA 4F7UE 5LJ5f 4CC2A 2AT1B 4OVAA 2CGHA 3G71Q 3CCRQ 4RKUE 3UT1A 1NJIR 2K5FA 2M16A 3JCMc 4C0GA 1I4K1 1G5VA 2YLBA 4BE1A 2EQKA 5LJ5g 1NYGA 1OU8A 2DL3A 1JJ2S 4M78A 3OYBA 1YI2A 5C6SA 3JB9I 1VQ6A 5IHKA 2ZPIB 3R6NA 4X1VA 2K57A 3G6EQ 3UA6A 3VU3C 1YIJT 1Q7YU 4E7IA 1VQ8T 1AD5A 5I2SA 2KROA 1RUWA 3IQLA 1UHCA 2LCCA 2V8JA 3X25B 2ZZDA 1T0HA 4PKCC 2H3JA 3HL8A 2RF0A 2J7IA 1DJ7B 1AZGB 3CEYA 3OYLA 1G2BA 1G83A 1Q7YR 2FRWA 1KSWA 2ZPHB 2YXYA 4LDVA 2DL4A 5FWBA 3CXCS 1BYMA 1AT1B 2I0NA 5KE2A 1MMNA 5CIUA 1UECA 4KUDK 2RHZA 5KYUB 3NTIA 3FEOA 1TUCA 3UWNA 1MMAA 2VB6A 1JQQA 2JM8A 3CC7Q 3EFOB 3BDUA 4J9CA 2NUTB 1EX4A 1FMKA 3JB9H 3G71T 1K0XA 3RERA 4DOVA 2XD0A 2GF7A 3I5SA 3CCRT 3EH2A 4PFOA 2X35A 3OYJA 4N4HA 3DLMA 3CCQA 2QQ9A 2DRMA 1VQ7A 4XU3A 1RAGB 3M0QA 5KCOA 3CC2A 1HXDA 2EYXA 1T3LA 2RJEA 2C0TA 5GAN8 4DBFA 2EGEA 3QXEB 2DL7A 2CZ1B 2CDTA 1ZQ1A 3H8ZA 3REAB 2DE0X 2O4XB 4EMKC 2DTIA 1ZBXA 3G6ET 4C92F 4ZTJA 2LMJA 3L2VA 2BZ8A 2YRVA 5D6WA 4HKEA 5GAMh 3OQ5A 2ZPFB 2FEIA 1I07A 4LUEA 4EPCA 4IURA 4PJOF 1JJ2P 2OTJQ 5I21A 1SEMA 2JS0A 4XTVA 1KQ1A 1YFNA 5FWCA 3RMSA 4M78C 3ME9A 4C8QG 4NL3A 4RTXA 4IUUA 4Z88A 3H0HA 5KCHA 3OSSC 1BB9A 3JCMb 2HQEA 2E6ZA 1D1AA 1SRMA 2JXBA 4PK4A 3SWNA 3A1PA 3I9QA 2B86A 3NTKA 1U1TA 2EPDA 1YHQQ 3QSUA 3LX7A 3CC7T 5DY9A 2OTLA 4M7DD 1B34A 2OI3A 1QVGA 1TWBA 3M0TA 4OMNA 2KDSA 1VQOQ 2DZ9A 3JCMQ 1JXMA 4NOYA 1SSHA 4LNPA 4C5IA 3CXCP 5HCKA 3RESA 4M75G 1X6GA 2Y90A 1YITQ 4JRPA 1M1KC 2NUTA 2EJFA 2NWMA 1Y57A 2RK2A 2ZCFB 4ELZC 4M7AD 2D1XA 2HSEB 4RTZA 2E10A 2KEAA 2QI2A 2DFUA 1K8AC 4J5YA 3ZBDA 3GNFB 2EVRA 2V8KA 1D0YA 2LQWA 1PG5B 3MCAB 3GBQA 1X2KA 4CC7A 2P4RA 3GF5A 3CCSA 2DYIA 3FJ5A 2E65A 2DJZA 3RBBB 1RAAB 1KC8U 5FU6B 2OTJT 1WLPB 4LDWA 2JJ9A 2HAXA 3JCMJ 2CREA 5CQYA 1I8FA 4BY6B 2FPDA 5ECAA 5GMKi 4J6YA 2H8HA 2HQXA 4M75B 3JCMd 3VS7A 1YJWQ 4LE9A 1W70A 3LLRA 2LJ0A 1WYXA 4Y28E 2G3RA 4F17A 1KC8R 4XTUA 4QVZA 4HVVA 5KYWA 1QCFA 3D7SB 2EYQA 1I0CA 4C8QE 1U3OA 1K1ZA 4KT0E 4BDZA 1YHQT 3L2UA 1ZSZA 1YI2Q 1SG5A 1JB0E 2KBTA 2KMTA 1XQHA 2Z0WA 3EGUA 8AT1B 5KYXA 1VQOT 1UE9A 2A36A 3S3NA 1JJ2A 4MZTA 4PLIA 1G3WA 1OZ3A 4XTXA 2FO0A 1YITT 3GPLA 2L3QA 4RTUA 4M78F 1YJ9Q 4CI0C 3PE0A 1B07A 3HRSA 3SWNC 1I1JA 2DAQA 5GMKe 2L2PA 3VS5A 3X20B 1PD1A 2DVJA 3META 1YIJA 1VQ8A 2DXTA 4XU0A 1M3AA 4M75E 3TREA 5LJ3j 3CCUA 3KFVA 2KYMA 3TEEA 3BFMA 4BACA 1U1SA 3I56A 2R5AA 2ESWA 3BDLA 3EFRA 2AIRB 2DEQA 1Q82C 5CKDA 4OMQA 1D3BA 3MKDA 4DBQA 3NHNA 2LDMA 4A53A 3DB4A 3CXCA 2DLPA 1VQ9A 2O9VA 4IUQA 3VYGA 1M90C 2M1HA 5GANf 3HHTB 3OYYA 2EQUA 1YJWT 2AHJB 2CP7A 2XDPA 1TS9A 2WSCE 3CCQQ 1WHJA 2DMOA 2O2OA 3S3MA 1IREB 2O01E 4EMHA 3HPWA 5GANg 4Y91A 3I55A 1FMVA 2F69A 4C92B 1YI2T 3G71A 3REBB 4DEYA 1M2VA 3CMEA 2E5QA 3V7CA 3VV0A 2G6FX 3CCRA 1YN8A 4OB1B 2AKLA 1GFDA 2DD5A 4M77A 2EQIA 4PJOB 4XTWA 3QG1A 3EG3A 4KUIA 2EKHA 1WX6A 4ZTFA 5LJ5d 1PCXA 3QDRB 3RNJA 3P8HA 4M7AC 3EGXA 1RLPC 2K79A 1G3SA 3FC3A 2KQWA 1D09B 1GCPA 1QLYA 5I2MA 1VQLA 2EYYA 2M51A 3M54A 3OS2A 2L0AA 5GMKj 5IN1A 3JV3A 2YWWA 2M02A 3VRZA 5I22A 1Y96A 3T9NA 1Y07A 2CZ6B 3EG2A 1WJQA 2K5IA 1ZHIA 4GY5A 1WQWA 3UF4A 3VS2A 1OULA 3MEAA 3WXMB 2DZCA 2ROTA 4C92E 3INZA 3VKIA 2CZ0B 1VUBA 3UA7A 1YCSB 2MPXC 2HL5C 3I35A 1C6VX 1ZA2B 3GP8A 3L2ZA 4JS5A 3LYIA 3JB9G 1R77A 4KRTA 2GCXA 4BD3A 2YRCA 1QWEA 3CCQT 5GAOq 4B6MA 1RLQC 3CC7A 4CRIA 1UHFA 5FLXE 4DA4A 2EIFA 2JOYA 4RTTA 2DJQA 4FCYA 3DLLA 2DYBA 3LWHA 4FW1A 2VGMA 2EQMA 3CBMA 3HRTA 3M59A 1ZLMA 4P5NA 1TUDA 4PJOA 3QWYA 4XTYA 2ZGWA 1X43A 1MNDA 2K2VA 5CKFA 3TSWA 1VQ5A 2CUDA 1UDLA 5GJWB 2NUPA 2ZPBB 1VQNQ 5KYNA 5DLOA 2VKNA 4C5GA 1UTIA 3JCMg 2EGCA 3QZ5B 1HD3A 3RIRA 4M77C 4KGVB 4A4FA 4E7JA 2OTJA 2RI5A 1NPRA 2VXEA 3S6WA 1YWOA 4M7DF 5LJ5h 1M9SA 2QYZA 4PNOA 4RG8A 4GLKA 4E7ZA 4E7KA 4AG1C 1JRIA 4JUVA 2C0OA 4Y92A 2QG9B 4M4ZA 3ZFJA 2RHXA 5GAN2 2HKNA 1I5OB 4M78B 3M53A 1WIEA 5L8RE 4M7AF 3NTHA 3MP1A 4AT1B 1FWZA 1HSQA 2QXFA 2LX9A 3GOXA 3VS1A 3X26B 4JJBA 4R0KA 1YHQA 2P0PA 1QVFP 3L2RA 1U5SA 5D6YA 3E9GA 4QQGA 1UJYA 1VQOA 1KHCA 3MJXA 2LC4A 3M55A 5HK3A 2JT4A 2J06A 3RKWA 4BDYA 2XICA 1YITA 3VS0A 3CCUQ 2KAFA 3I56Q 3M0RA 3JB9D 2XMFA 2OAUA 3O8VA 2QTXA 4HVWA 3OYDA 1UGQB 4L5GA 4J7FA 1HK9A 1FMWA 2CS7A 8ATCB 3FDRA 1NJIC 5LJ3f 1M8VA 2DXCA 1VQ9Q 5KH6A 3CCEQ 1VQNT 2GQIA 3CCJQ 2D8JA 4QQDA 2V1QA 2WSFE 4BI4A 1KJWA 2CP6A 4ORZA 1IRXA 4JS4A 4EMKA 4CC3A 2RD1A 5HY6A 3I55Q 4J9HA 2F1LA 3C12A 4O5VA 4E7SA 3CMEQ 1WXBA 4HA8A 4A4GA 1YJWA 2EKOA 2ZAEA 4IIMA 4KBMB 3P8DA 2ABLA 4DEXA 2RJFA 4FSXA 2A28A 3KXTA 5FROA 3M0UA 1KQ2A 5CO7A 1U06A 2FG0A 4JRIA 5CAIA 2GTJA 2HD0A 2DF6A 4J9EA 4LDUA 3URGA 5GAN6 5CR2A 4QKUA 1TH7A 3LGLA 3OYNA 2OAWA 5GAN7 4J9FA 3QWXX 4JJDA 1VQLQ 4M77F 2COYA 4JZ4A 4EMGA 1ACMB 1UGRB 2MAMA 3A8LB 4J7IA 3CCUT 1PRLC 1YJ9A 4RCBA 4IUPA 1A0NB 2DNUA 2DPPB 1IGQA 3CBOA 4RCCA 4RUGA 3I56T 1HJDA 2RNAA 4OP0A 1WXUA 5GJVB 3E2UA 2MWOA 1D0XA 1OPKA 3A8HB 1M5Q1 2QEXA 3TCJA 1Q95G 1M30A 3WVEB 1VQ9T 3SWNB 3M0PA 3CCET 2M0OA 5AT1B 2P4TA 4WCIA 3CCJT 3GIBA 2ED1A 2IIMA 4QVCA 1B34B 1H8KA 3M5AA 5DM7R 3HP9A 2QK0A 2KRNA 2JS2A 2RA2A 1QVPA 2J6KA 3NFCA 1E7OA 5FRMA 2NLUA 1OYXA 5GAOl 1SHFA 4QW2A 3CCVA 3I55T 2OX7A 1V29B 2HKQB 1WZOA 1OI1A 3CMET 2DIQA 2LT1A 5D7UA 1OQKA 2RHUA 3C94A 3JAME 2C06A 2K6DA 1SHGA 2WACA 3A98A 3EFSA 3LWIA 1WI7A 2M9UA 4C5EA 5GANd 3NMZC 1FX7A 2GQVA 1KG1A 2HQHA 2D9TA 2RMOA 3OSVA 1UUEA 3CD6A 4JJCA 1VQ5Q 3M56A 4FYWB 2GGRA 2PVOB 1VQLT 2RHIA 4RTVA 2DVEA 2L3PA 3EAEA 3JCMe 5GAN4 3ASKA 2E64A 3QBYA 4DQ2A 2LQ8A 4OGCA 5DLQE 3FLGA 3QDFA 4J8OA 2RB6A 1WA7A 2V1RA 2EBPA 4RG2A 2YLCA 2YUPA 5FW9A 1BBZA 5KYWB 4C0DC 4J9IA 2EWNA 4ZN3A 2ENMA 1OX9A 2QQBA 2PNIA 4C0FA 1RAEB 2FZKB 4PJNA 1GL5A 1ZSZB 2XG8D 3F70A 3JCMW 5AYFA 1VA7A 1PRMC 5KYXB 1OPLA 1P92A 4OMPA 3CMAA 2K3YA 2YUQA 1WHGA 3QO3A 2X3WD 1WHMA 1VQKQ 4O6JA 1AWXA 4J6WA 5A2QE 1KIKA 2LVMA 4MDWA 3HFOA 5CVIA 1KFZA 2KXCA 1QQJA 4OMFB 4D8KA 2EAYA 1VQ5T 3OBWA 5GMKm 3OA6A 1XTDA 3C0CA 2LJ1A 4QVDA 5IXBA 4FL6A 1D3BB 4PJLA 4PFZA 1BK2A 2EFIA 4KGZB 1M1KU 2L3SA 1Y7XA 4M7DA 1SKUB 1BI2A 2K4YA 2DD4A 3SDZA 5GANh 1QP3A 5A0DA 3LGFA 5GMKl 1VQNA 2O9SA 1OX8A 2DA9A 5A0GA 3J80E 1H3ZA 2D6FA 3L42A 4FM4B 1K8AU 3JCMX 1JXOA 3KUFA 3N5BB 1VQPA 1NEGA 4M7AA 3OYKA 1RABB 1M1KR 2X3XD 3I5RA 1M2VB 5LJ5e 5GAMf 1AEYA 3QPHA 2GFAA 2FVUA 2MOXA 2JTEA 3TQ7P 4M77B 1PD0A 3TU4K 1K8AR 2D0QB 4IUTA 5GAMg 3OYEA 3EGXB 4C8QD 4XU2A 4FYYB 3VS3A 3JB9F 2VASA 3VS6A 3A8MB 2EQJA 4B9XA 2JNGA 3E1SA 9ATCB 2XIDA 1NZ9A 2DK3A 2ZPEB 2FHDA 2E4HA 3VUBA 1RAFB 1Y96B 2DEUA 3AHUA 1W2BS 4C92G 2DTOA 4LXCA 3PMIA 2QEXQ 1O75A 3JB9J 1PHTA 3RDVA 2CP3A 2AZSA 4OGEA 1PSEA 1M1GA 4PJOG 2GNCA 3C95A 4FIBA 4ZGEB 3DKMA 3CBPA 2H3EB 4M75D 4M77E 2MF2A 2J05A 1V76A 5EG2A 3CCEA 3CCVQ 4C8QA 3SD4A 2W10A 1PKSA 2XHCA 4F7UF 1KQSP 1QKWA 1MMGA 3M57A 3CCJA 1IB8A 2DBKA 2RN8A 4LUDA 2O88A 2CP2A 1WGSA 1M27C 2BIVA 4F16A 1OEBA 5LJ3d 1RAHB 4ZN1A 1M3BA 4LN2A 3CPWP 1B7TA 4R55A 2VWFA 1JU5C 2BE9B 2R57A 4OMMA 1Q82U 4NS5A 4M7DC 1LOJA 2BUDA 3TSZA 5LJ5j 3QZ9B 3CD6Q 5IT9E 2JUFA 1PSFA 1Q81C 3HRUA 1XJWB 3BW1A 3JCMh 1M90U 2VV5A 2DXUA 4VUBA 2FB7A 1GCQA 4R56A 1WHLA 1AWOA 4B9WA 3OW2S 3X28B 2RQWA 2F2XA 2NUPB 1YJ9T 2L89A 4YTLA 2RI3A 4E2FB 1Q82R 3S3OA 3SHWA 1BIBA 5GAOr 2Y4XA 4XTZA 2QEXT 3GNGA 1M90R 5IHIA 2KYBA 4DBRA 5IHNA 4EDUA 4GLMA 1NYFA 2E12A 1VYUA 2LQNA 2LQKA 1GFCA 1MMDA 2HCKA 4GBQA 4V2SA 1GRIA 4BI8B 2EYZA 1LNXA 2X4XA 1QVFS 1J3TA 1W2BP 1MV0B 1IZ6A 3CMAQ 3FIFA 3CC4A 4WF2A 3CCVT 4PJOE 1YP5A 4C92D 1FXXA 2QAZA 2FPFA 7AT1B 5KYYA 3QYGB 1MHNA 3QKJA 2DTHA 2YDLA 4ESRA 3EH1A 1Q86C 3PGGA 1RI9A 2K3BA 4FYXB 2DXBA 1TU0B 4X9CA 1UGVA 3CD6T 1KD1C 4C8QC 2PQWA 2O31A 2E1HA 4M78G 2COZA 3PVLA 2CP5A 1K73U 2CUBA 3OYCA 1BU1A 3EG0A 1EIFA 1NPPA 5FU6C 1N8RU 2EJGA 2GTOA 2B8AA 4RTYA 3UDCA 4EMKB 4BY6C 4J9GA 2K2MA 1K73R 3O5ZA 3VJPA 1NE8A 3TVTA 3OW2P 1VQPQ 1K9MU 1BCMA 1S72A 3U23A 1I81A 3BE3A 1GCQC 4M75C 2YHTA 1H641 2HNIA 2KNBB 1JBMA 4IIOA 1NEBA 3A8GB 1YBYA 2DETA 1SF9A 2ECZA 4L6V5 1N8RR 1IGUA 3CMAT 1LVKA 2AKKA 1RL2A 5CKHA 3NPFA 4E7HA 4A54A 5CK9A 1WNLA 1K9MR 2SEMA 2L3RA 2LP5A 5CKBA 2FZGB 1VIEA 3EHRA 1OOTA 1R0BG 4A4KA 2QQRA 5M9OA 1BI1A 3CCLQ 2MYSA 3RKYA 2KK4A 2RI2A 4C5HA 5FU7C 1ZX6A 1VQKA 3VYHB 1QWFA 4J83A 2BTTA 2FRYA 2LCSA 4DOWA 2M0YA 4DBHA 4MMKA 5CCAA 2DILA 2LCLA 1QCOA 1CSKA 3A5ZB 3H0FA 4UC4A 1W2BA 2BZYA 2K3XA 3JRZA 5IXFA 4BUGA 1BIAA 2YSQA 3EGDA 4XK8E 2JW4A 2MMPA 4TVRA 2YT6A 4M78E 3LW5E 3CCMA 3UATA 3L2WA 1KK7A 1UEBA 2MIOA 1QW1A 3M4GA 2EW3A 5LJ3g 1VQPT 3A8OB 2BKDN 1WXTA 2XU8A 3H0IA 2VVKA 5GAN3 2PVDB 5GANe 4XQ3A 4C8QF 4KH1B 1JO8A 1Y71A 2XDDA 1VYTA 1E6HA 5FRNA 1D0ZA 2BE7D 2D8HA 2QDLA 1I5LA 1T0JA 4FSSA 1U8RA 2KY9A 2MI6A 2X9HA 2A0FB 4JZ3A 4KH0B 2IPOB 2GFUA 1WJRA 2CT4A 3OY9A 3M58A 3HFNA 1X2QA 3MEUA 1ZA1B 2LRQA 4JPBW 4BE2A 4LDXA 3KBGA 2CZ7B 2HBWA 1WFWA 2E5KA 1X69A 1OU9A 1Q7YC 2DM1A 3CCLT 2EJ9A 3ZL7C 2E3IA 4HCKA 4FT4A 3SFMA 3FB9A 1SRLA 1UB4A 3OW2A 5GAMd 1NM7A 3MPUB 2BZXA 4KGXB 4M75F 3PIPA 2IVWA 1K0SA 3L2QA 3V8JA 3G4SA 2J6OA 2X4YA 1BKBA 4QQ6A 2J6FA 2PVGB 2VC8A 1X6BA 1M4ZA 2XDBA 4Z8AA 2FYKA 3RKXA 5GAOm 3V8LA 1VIFA 3LH0A 3CC4Q 2ZPGB 5I11A 4PJJA 4AFUC 2QA4Q 1QVGP 2DERA 3EG9A 4C0ZA 3M0SA 3L1AA 4F7UA 1PNJA 1WQ7A 3J81E 1VQ4A 3J7AF 2ROLA 4ZGDB 2HDAA 4M7DG 1QVFA 1WHKA 2HBPA 2DKGA 2RHYA 4HXJA 2FPEA 6AT1B 3V8KA 1GBRA 3MEWA 1BI3A 4OF1A 4BI3A 2QTVA 4M7AG 4RTWA 5J39A 5GANj 2P0KA 1N5ZA 1MUZA 1B3QA 1RAIB 1MNEA 4HCCA 4HCZA 5CQXA 2WSEE 2SRCA 1UGPB 3RMQA 1LPLA 1SPKA 1IXDA 2XK0A 3PMTA 2JTFA 2VGNA 4XU1A 5J3BA 2KR3A
chains in the Genus database with same CATH topology
4GY5A 4M77B 1WQWA 4OB0B 2JTMA 2PUOB 3OB9A 2R5MA 3TU4K 3MEAA 1G3TA 3CCST 3WXMB 2DZCA 4C92E 3INZA 2A7YA 2D0QB 2CZ0B 1VUBA 4IUTA 3VKIA 5GAMg 3OYEA 3OYHA 4M7DB 2CKKA 2JN0A 4C8QD 5C0MA 4XU2A 4M78D 3GP8A 2Y4YA 3L2ZA 3JB9F 2RJDA 3QUIA 4JS5A 3A8MB 3LYIA 5GANh 2RM4A 2VYTA 5J26A 2EQJA 2F5TX 3JB9G 4B9XA 2JNGA 1G3YA 3Q1JA 4LD6A 2GCXA 3E1SA 3FRNA 4BD3A 3PIOA 2LNVA 2IG0A 4HCBA 2XIDA 3CCQT 5GAOq 1NJIU 1NZ9A 2DK3A 2LTOA 2ZPEB 2FHDA 4M7AB 4ELYC 3P8BB 3OYGA 1X75C 3VUBA 3QHSA 4C92C 1Y96B 5D6XA 3CC4T 3AHUA 3CC7A 1W2BS 4C92G 4CRIA 2DTOA 2QA4T 5FLXE 3PMIA 4RMOA 1O75A 4DA4A 2EIFA 5GAMj 2JOYA 2JVVA 3JB9J 1R8OB 5GAOp 3OMGA 4PJOC 2L5QA 4F7UE 4OGEA 3DLLA 1PSEA 1M1GA 4PJOG 5LJ5f 1XOVA 3LWHA 3C95A 4FIBA 4ZGEB 4OVAA 2CGHA 3DKMA 2VGMA 2EQMA 3CBMA 3CBPA 4ATOA 3HRTA 3M59A 4RKUE 3UT1A 3OMCA 4M75D 4MMLA 2K5FA 4P5NA 3V7RA 4M77E 2M16A 2MF2A 3JCMc 4C0GA 1I4K1 1G5VA 2YLBA 5HK0A 4BE1A 2EQKA 1VQMA 5LL6S 5LJ5g 4PJOA 5EG2A 4NL2A 4XTYA 2ZGWA 3CCEA 4M7DE 4C8QA 3SD4A 2JZ2A 2K2VA 5CKFA 4M78A 1JJ2S 1N27A 3OYBA 1VQ5A 2XHCA 4F7UF 1YI2A 5C6SA 3JB9I 3M57A 2ZPBB 3CCJA 1VQ6A 4JJNK 2ZPIB 5DLOA 4C5GA 2RK1A 2K57A 3JCMg 1WGSA 3QZ5B 2BIVA 5LJ3d 3VU3C 1YIJT 1Q7YU 4E7IA 3RIRA 5GAOn 4ZN1A 1VQ8T 4M77C 5I2SA 4A4FA 4E7JA 4R55A 2OTJA 2RI5A 4M77G 4M7AE 1NPRA 2VXEA 3S6WA 2GFAA 4X9DA 2R57A 4M7DF 5LJ5h 1M9SA 4PNOA 1Q82U 4NS5A 4RG8A 4GLKA 4M7DC 2L8DA 1LOJA 2BUDA 2LCCA 3JSCA 2V8JA 4E7KA 5LJ5j 3X25B 1KC8C 2P0QA 1KQSS 4OB2B 3QZ9B 2ZZDA 1JRIA 2JUFA 1PSFA 4FT2A 4JUVA 5A0LA 3UPUA 1UGSB 5IT9E 1Q81C 3HRUA 4PKCC 2H3JA 3BW1A 3HL8A 4XU1A 2QQSA 3ZFJA 3SB2A 2RHXA 1DJ7B 3CEYA 3JCMh 5LJ3e 5GAN2 2VV5A 4C8QB 3OYLA 1M90U 2DXUA 4VUBA 2FB7A 4M78B 3M53A 4R56A 1S72T 5L8RE 4M7AF 3NTHA 4B9WA 3CPWS 3OW2S 3X28B 1YJNA 3MP1A 1YJ9T 2L89A 2ZPHB 4LDVA 3M4YA 4YTLA 3OS0A 1FWZA 2RI3A 4E7LA 3CXCS 2QXFA 4JRQA 2LX9A 3GOXA 4A4HA 1BYMA 3X26B 3S3OA 2QDYB 5KE2A 3CPFA 5CIUA 4KUDK 2RHZA 1YHQA 1BIBA 2CYZB 2P0PA 3NTIA 5GAOr 3FEOA 2O4XA 2Y4XA 1XNIA 3M9QA 4XTZA 3L2RA 5D6YA 3UWNA 3QIIA 1WPYA 3E9GA 4OB3B 4QQGA 3GNGA 2QEXT 1VQOA 1W4SA 1KHCA 2LC4A 2RO0A 3BDUA 1N9SA 3E19A 3M55A 5HK3A 4KULA 3RKWA 4BDYA 2X4JA 4PL6A 2XICA 1YITA 3G71T 4EDUA 3JB9H 3RERA 4DOVA 2XD0A 2KAFA 2E12A 2GF7A 3CCRT 2LQKA 4V2SA 2X35A 4BI8B 3OYJA 4N4HA 3DLMA 3CCQA 2QQ9A 3QJ6A 1LNXA 2X4XA 4XU3A 3JB9D 1VQ7A 2OAUA 1QVFS 3O8VA 2QTXA 5KCOA 1IZ6A 1LJOA 3C4SA 3OYDA 3FIFA 1UGQB 1HXDA 1VQKT 3CC2A 3CC4A 4WF2A 4L5GA 5IAYA 3CCVT 2RJEA 4J7FA 4BE0A 5GAN8 2A3LA 1HK9A 3OS1A 2CS7A 1NJIC 3FDRA 2F5KA 3QXEB 5LJ3f 2CZ1B 4PJOE 1ZQ1A 1QVGS 1AHJB 1M8VA 2DXCA 3H8ZA 4C92D 1FXXA 5KH6A 1VQNT 2O4XB 4EMKC 2DTIA 3CCLA 1ZBXA 2PU9B 3G6ET 4C92F 4LD9K 3QYGB 4ZTJA 1MHNA 1WJSA 3L2VA 3QKJA 4QQDA 2YRVA 2DTHA 2WSFE 1Q86C 1M1FA 5D6WA 4BI4A 4HKEA 5GAMh 3OQ5A 3PGGA 5HKCA 4MZMA 2ZPFB 3OYAA 2DXBA 4EPCA 4IURA 4PJOF 4JS4A 4X9CA 4EMKA 5I21A 2RD1A 3CD6T 1KD1C 5FU7B 5HY6A 4XTVA 1MGQA 1KQ1A 3CCMT 2FL7A 3C12A 4O5VA 4C8QC 3RMSA 4M78C 2PQWA 3ME9A 4JLIA 4C8QG 4NL3A 4N0AA 4HA8A 4M78G 2E1HA 4IUUA 4A4GA 3PNWC 2RJCA 1YJWA 2EKOA 1O9SA 4KBMB 3P8DA 4D6WA 1K73U 2RJFA 5KCHA 4FSXA 3OSSC 3OYCA 3KXTA 5FROA 3JCMb 1KQ2A 2HQEA 2E6ZA 5CO7A 1EIFA 3PFSA 4JRIA 5CAIA 3OBYA 3OYMA 1NPPA 3SWNA 2HD0A 4LDUA 5GAN6 4M77D 5FU6C 3URGA 5CR2A 1N8RU 1TH7A 3LGLA 3OYNA 5GAN7 2EJGA 3NTKA 1U1TA 1X6OA 3QSUA 2B8AA 3LX7A 4M77F 3UDCA 3CC7T 5DY9A 2OTLA 4M7DD 4EMKB 4BY6C 4EMGA 1B34A 3VJPA 1NE8A 1QVGA 1K9MU 2KDSA 1GXIE 1S72A 1I81A 1UGRB 2DZ9A 2KSSA 2MAMA 3A8LB 4J7IA 4M75C 4N4GA 4X34A 4NOYA 3JCMQ 3CCUT 2YHTA 4RCBA 4IUPA 4C5IA 1YJ9A 1H641 2HNIA 3RESA 4M75G 2DPPB 3CBOA 3I56T 4RCCA 2DIGA 2Y90A 1JBMA 4Q5WA 4JRPA 1M1KC 4OP0A 3A8GB 1YBYA 2EJFA 2VUBA 2RK2A 4L6V5 2MWOA 2ZCFB 3CMAT 3A8HB 4ELZC 4M7AD 1RL2A 5CKHA 1M5Q1 2QEXA 3TCJA 4M75A 4E7HA 2E10A 3WVEB 4A54A 3PT9A 5CK9A 2QI2A 1WNLA 3SWNB 1VQ9T 1K8AC 3CCET 2M0OA 4J5YA 3ZBDA 3GNFB 2V8KA 2L3RA 3MEVA 5CKBA 3G4ST 4IKFA 3HKSA 1VIEA 2P4TA 2V8IA 1VQ6T 3CCJT 1X01A 4A4KA 3GIBA 2QQRA 3MCAB 5M9OA 3QJYA 4QVCA 4HT9A 1B34B 3GF5A 1BI1A 3CCSA 3MP6A 2R58A 3M5AA 4ZGJB 3HP9A 1N9RA 5DM7R 3RKYA 2KK4A 2E65A 2RA2A 1QVPA 2RI2A 5FU7C 4C5HA 2DJZA 3NFCA 5FRMA 2NLUA 1KC8U 1OYXA 5GAOl 5FU6B 1VQKA 3VYHB 2OTJT 4J83A 4QW2A 3CCVA 1Q81U 3I55T 4LDWA 4DOWA 2HAXA 3JCMJ 1V29B 4MMKA 5CQYA 1OI1A 1VQ4T 3CMET 3ZEHA 2DIQA 5CCAA 1I8FA 4BY6B 2LT1A 2LCLA 4N4IA 2RHUA 5GMKi 3A5ZB 3C94A 4J6YA 4UC4A 3G6EA 1W2BA 2HQXA 4M75B 3JAME 2C06A 4A4EA 3JCMd 2WACA 3HSBA 3MO8A 2K3XA 3JRZA 4XAXB 3LLRA 4BUGA 1SSFA 1BIAA 4Y28E 2G3RA 3EFSA 4MDXA 4XTUA 2XKOC 4QVZA 2QA4A 3LWIA 2M9UA 4C5EA 5GANd 4XK8E 3JCMP 2EYQA 1FX7A 1BI0A 2GQVA 1KG1A 1KHIA 2D9TA 3OSVA 2MMPA 4C8QE 4TVRA 3CD6A 4M78E 3LW5E 4KT0E 3CCMA 4BDZA 3M56A 1YHQT 5GAN5 3L2WA 3L2UA 2PVOB 1UEBA 2RHIA 1VQLT 2DVEA 1JB0E 2XI9A 3EAEA 2KMTA 1QW1A 1XQHA 3M4GA 3JCMV 4N0AC 5LJ3g 3JCMe 1VQPT 3A8OB 4PJOD 2BKDN 1VQOT 5GAN4 3ASKA 2E64A 2XU8A 3QBYA 3S3NA 4DQ2A 2LQ8A 4MZTA 4OGCA 3H6ZA 4PLIA 1G3WA 1JJ2A 2VXFA 2PUKB 1OZ3A 4PLLA 3RUXA 4II1A 4XTXA 2PVDB 5GAN3 5DLQE 1YITT 3FLGA 5GANe 3GPLA 4J8OA 4XQ3A 4C8QF 2XDDA 1Y71A 2RB6A 4M78F 1K73C 4CI0C 5FRNA 3MP8A 3BY7A 1I5LA 4RG2A 2YLCA 3HRSA 2MI6A 2KY9A 3SWNC 2DAQA 5GMKe 1U8RA 1VQ7T 4MZPA 2I2LA 4FU6A 2KVQG 2GFUA 1WJRA 3X20B 4BB7A 3OY9A 3CC2T 2E41A 3M58A 3HFNA 3META 4C0DC 5LJ3h 1YIJA 2EWNA 4L59A 3MEUA 2DXTA 3V7SA 2LRQA 4ZN3A 4XU0A 1N8RC 1VQ8A 2QQBA 4C0FA 4BE2A 4M75E 4LDXA 3TREA 3KBGA 2DO3A 5LJ3j 1KQSA 2CZ7B 3CCUA 3TEEA 2E70A 2XG8D 3BFMA 3F70A 3G7ZA 5AYFA 1U1SA 4BACA 2K5LA 3JCMW 1Q7YC 3I56A 1Q86U 3CCLT 2R5AA 2EJ9A 3FJPA 1K9MC 4C92A 3BDLA 1P92A 3EFRA 2X4WA 2DEQA 3OS5A 3CMAA 4FT4A 3SFMA 3FB9A 5CKEA 3PTAA 1Q82C 1KD1U 5CKDA 1UB4A 3CPWA 2K3YA 3OW2A 5GAMd 3VUZA 1RI0A 1D3BA 2FVUA 3QO3A 2LDMA 4M75F 3DB4A 4A53A 3PIPA 3CXCA 3JCMf 2IVWA 4JRKA 1VQ9A 3GLXA 4IUQA 4O6JA 4J6WA 3VYGA 3L2QA 3V8JA 3G4SA 3E9FA 2X4YA 5A2QE 1M90C 2M1HA 3WVDB 1BKBA 4QQ6A 2LVMA 2PVGB 4MDWA 5GANf 3HHTB 3OYYA 2EQUA 3R6OA 1YJWT 2VC8A 4F7UG 3HFOA 2AHJB 1M4ZA 2XDPA 2XDBA 2WSCE 4E47A 5CVIA 5GAOm 2FYKA 3RKXA 3ER0A 3V8LA 1OZ2A 5GAMe 2LT4A 4OMFB 1VQMT 1VIFA 3LH0A 3S3MA 2EAYA 2ZPGB 1IREB 5KE3A 2O01E 4EMHA 3HPWA 3X24B 5GANg 1VQ5T 4JDSA 4Y91A 3OBWA 5GMKm 3OA6A 3I55A 2F69A 4C0ZA 1XTDA 3L1AA 4ME7A 4C92B 4F7UA 1YI2T 3G71A 1WQ7A 4C0DB 3J81E 3CMEA 2E5QA 3V7CA 4ZGDB 1VQ4A 3J7AF 4M7DG 4QVDA 3VV0A 1QVFA 3CCRA 4Z02A 4FL6A 2HBPA 1N6AA 2DKGA 2RHYA 4OB1B 1D3BB 2DD5A 4M77A 2OTLT 4PJOB 4XTWA 3QG1A 2EFIA 4KUIA 1M1KU 1Y7XA 4ZTFA 5LJ5d 4M7DA 3QDRB 3V8KA 3P8HA 4M7AC 2K4YA 1BI2A 3MEWA 2DD4A 1BI3A 2E6NA 3DB3A 1QP3A 1G3SA 4OF1A 3SDZA 4BI3A 2MWPA 3LGFA 4J6XA 5A0DA 3FC3A 2KQWA 4IUVA 5J39A 5GMKl 4M7AG 4LDYA 1YCYA 5A0GA 1VQNA 3J80E 5GANj 1H3ZA 2P0KA 2D6FA 3L42A 3QYHB 4FM4B 1K8AU 3OYIA 5I2MA 1VQLA 5GMKh 3JCMX 4HCCA 3KUFA 3MHXA 3M54A 3N5BB 4HCZA 5CQXA 3OS2A 1VQPA 5GMKj 5IN1A 2WSEE 4F7UB 3OYFA 4M7AA 1UGPB 3RMQA 3OYKA 2QQAA 1YJNT 1Y96A 4JLGA 3T9NA 4HT8A 1QP2A 5LJ5e 1Y07A 2XK0A 3PMTA 5GAMf 2RH2A 2JTFA 2CZ6B 3QPHA 2VGNA 1WJQA 2K5IA 5J3BA 1ZHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMK B;  4EMG A;  4M77 B;  1WQW A;  1B34 A;  5GMK e;  4M7D A;  2I2L A;  1I81 A;  2DZ9 A;  2DZC A;  2E41 A;  3HFN A;  4M75 C;  5LJ3 h;  4C92 E;  4NOY A;  2EWN A;  3INZ A;  3V7S A;  2DXT A;  2YHT A;  4RCB A;  4XU0 A;  1H64 1;  2HNI A;  3RES A;  4M7D B;  4M75 G;  1BIB A;  4M75 E;  5GAM g;  4RCC A;  2Y90 A;  5GAO r;  5LJ3 j;  1JBM A;  2JN0 A;  4XTZ A;  4OP0 A;  4C8Q D;  4XU2 A;  4M78 D;  4M7D D;  3BFM A;  2EJF A;  3L2Z A;  3JB9 F;  1WPY A;  3JCM W;  1U1S A;  3QUI A;  2EJ9 A;  4M7A D;  3FJP A;  2RM4 A;  4C92 A;  3BDU A;  1N9S A;  3JB9 G;  3EFR A;  1M5Q 1;  2DEQ A;  3JCM Q;  3RKW A;  3FB9 A;  4M75 A;  2E10 A;  4A54 A;  3JB9 H;  3RER A;  1WNL A;  3SWN B;  5GAM d;  5GAO q;  4M7A B;  4J5Y A;  1D3B A;  3QHS A;  3QO3 A;  1Y96 B;  4M75 F;  4A53 A;  4C92 C;  4V2S A;  3AHU A;  3JCM f;  4JRK A;  4C92 G;  1X01 A;  3GIB A;  2DTO A;  4HT8 A;  1LNX A;  4XU3 A;  3JB9 D;  4J6W A;  3V8J A;  2QTX A;  1LJO A;  4QVC A;  4HT9 A;  1B34 B;  3FIF A;  1HXD A;  5GAM j;  4WF2 A;  3JB9 J;  1N9R A;  3RKY A;  5GAO p;  2E65 A;  2RA2 A;  5GAN f;  4PJO C;  5GAN 8;  1HK9 A;  2DJZ A;  2VC8 A;  3HFO A;  4F7U G;  4F7U E;  5LJ3 f;  4PJO G;  5LJ5 f;  5GAO l;  4PJO E;  1M8V A;  2CGH A;  2FYK A;  3RKX A;  5GAO m;  4C92 D;  3V8L A;  4EMK C;  5GAM e;  3JCM J;  4M75 D;  2DTI A;  4MML A;  4MMK A;  3V7R A;  2EAY A;  4M77 E;  3JCM c;  1I8F A;  4EMH A;  5GAN g;  4C92 F;  1I4K 1;  4Y91 A;  2YLB A;  5GMK m;  4C92 B;  3L1A A;  2DTH A;  4F7U A;  5GMK i;  5LJ5 g;  4J6Y A;  4PJO A;  1WQ7 A;  4NL2 A;  4M75 B;  3V7C A;  4XTY A;  2ZGW A;  5GAM h;  4M7D G;  4C8Q A;  3PGG A;  4QVD A;  3JCM d;  4M7D E;  4M78 A;  3HSB A;  4F7U F;  2DKG A;  1BIA A;  1D3B B;  4PJO F;  4X9C A;  4EMK A;  4M77 A;  3JB9 I;  3EFS A;  2RD1 A;  5I21 A;  4XTU A;  4PJO B;  4XTW A;  4XTV A;  1MGQ A;  1KQ1 A;  5GAN d;  4C8Q C;  4M7A F;  2K57 A;  3JCM P;  3JCM g;  4M78 C;  4JLI A;  5LJ3 d;  3VU3 C;  4C8Q E;  4C8Q G;  4N0A A;  5LJ5 d;  4HA8 A;  4M78 E;  2E1H A;  4M78 G;  3RIR A;  4M77 C;  3V8K A;  5GAO n;  4M7A C;  5GAN 5;  5GAN h;  4M77 G;  4J6X A;  4M7A G;  2VXE A;  4M7A E;  5GMK l;  2DVE A;  4X9D A;  4NL3 A;  4M7D F;  5LJ5 h;  1YCY A;  4PNO A;  3M4G A;  5GAN j;  3JCM V;  3JCM b;  1KQ2 A;  4N0A C;  5LJ3 g;  1LOJ A;  3JCM e;  4M7D C;  4PJO D;  5GAN 4;  5LJ5 j;  2E64 A;  5GMK h;  3JCM X;  4DQ2 A;  1JRI A;  4JRI A;  4JUV A;  5CAI A;  2VXF A;  3RUX A;  5GAN 3;  4XTX A;  3SWN A;  5GMK j;  3BW1 A;  4F7U B;  4M77 D;  5GAN e;  5GAN 6;  4M7A A;  4XQ3 A;  4C8Q F;  1TH7 A;  2RB6 A;  1Y96 A;  4M78 F;  3SB2 A;  3JCM h;  5LJ3 e;  2EJG A;  4C8Q B;  5LJ5 e;  1U1T A;  2DXU A;  5GAN 2;  5GAN 7;  2FB7 A;  4M78 B;  5GAM f;  3BY7 A;  3QSU A;  1I5L A;  4M77 F;  4XU1 A;  5DY9 A;  2YLC A;  3SWN C; 
#chains in the Genus database with same CATH topology
 1IHV A;  2JTM A;  2DBM A;  2R5M A;  2A7Y A;  4M7D B;  3OYH A;  4HVU A;  1S72 Q;  1RAC B;  2RM4 A;  2VYT A;  5J26 A;  2F5T X;  2DX1 A;  1G3Y A;  3Q1J A;  4LD6 A;  3FRN A;  3PIO A;  2KT1 A;  2IG0 A;  4A63 B;  2A08 A;  1W6X A;  4M7A B;  2LTO A;  1X75 C;  3QHS A;  5D6X A;  1M2O A;  3CC4 T;  2PTK A;  2QA4 T;  2KGT A;  2JVV A;  3VS4 A;  3LH5 A;  1R8O B;  5GAO p;  1MV3 A;  2L5Q A;  2RQV A;  1CKA A;  2KRS A;  1XOV A;  1YNZ A;  2COW A;  4ATO A;  3OMC A;  2YUO A;  4MML A;  3V7R A;  5HK0 A;  1VQM A;  4J9D A;  5LL6 S;  4AG2 C;  4NL2 A;  4M7D E;  2JZ2 A;  1N27 A;  1S1N A;  2K7A A;  3H9N A;  4JJN K;  2RK1 A;  3EHQ A;  2HMA A;  5GAO n;  5KYU A;  1E6G A;  4M77 G;  4M7A E;  4X9D A;  2L8D A;  3JSC A;  3EFO A;  1KC8 C;  1KQS S;  2P0Q A;  4OB2 B;  2LX7 A;  3UPU A;  5A0L A;  4FT2 A;  3CCM Q;  2JMA A;  1UGS B;  1ZUK A;  1UJ0 A;  2QQS A;  3SB2 A;  1PC0 A;  5LJ3 e;  4C8Q B;  5IH2 A;  2LNH B;  1HYO A;  1S72 T;  3CPW S;  1YJN A;  1PWT A;  1Z9Q A;  3OS0 A;  3M4Y A;  1V1C A;  4E7L A;  4JRQ A;  1TG0 A;  4A4H A;  1VOM A;  2QDY B;  3CPF A;  4D8D A;  2CYZ B;  2DL8 A;  2AK5 A;  2O4X A;  1XNI A;  3M9Q A;  1M3C A;  4F04 B;  3QII A;  1WPY A;  4OB3 B;  1W4S A;  2RQT A;  2RO0 A;  3E19 A;  1N9S A;  4KUL A;  2ATC B;  2X4J A;  4PL6 A;  2CH4 A;  3VRY A;  4ANJ A;  2CP0 A;  1TUG B;  3QJ6 A;  2EYW A;  1LJO A;  3C4S A;  1VQK T;  5IAY A;  1GBQ A;  2GBQ A;  4BE0 A;  2A3L A;  3OS1 A;  1BCO A;  1TTH B;  1QKX A;  4AFZ C;  1NLP C;  2F5K A;  4WTO B;  2FZC B;  1AHJ B;  2F2V A;  3G4S Q;  3CCL A;  2PU9 B;  1VQ6 Q;  4LD9 K;  1WJS A;  4J9B A;  2JM9 A;  3AT1 B;  1M1F A;  5HKC A;  4MZM A;  2NUZ A;  1ABO A;  3OYA A;  3HTR A;  2PZ1 A;  2KI7 A;  5FU7 B;  1MGQ A;  3CQT A;  4AFQ C;  2FL7 A;  3CCM T;  4JLI A;  1VQ4 Q;  2DRK A;  4N0A A;  2F2W A;  3PNW C;  2RJC A;  1AWJ A;  1O9S A;  4D6W A;  4E6R A;  3THK A;  4EIK A;  3PFS A;  3OYM A;  3OBY A;  5KYY B;  1QMC A;  1Y0M A;  4M77 D;  1T3S A;  2LJ3 A;  1X6O A;  2KRM A;  2CSI A;  1EZZ B;  1GXI E;  2KSS A;  4N4G A;  4X34 A;  1D1C A;  2HL3 A;  2DIG A;  4Q5W A;  4ZNX A;  2VUB A;  1PM3 A;  4FW2 A;  2RPN A;  4OMO A;  2RQU A;  1VYV A;  1VQ7 Q;  4M75 A;  2E3H A;  2NYS A;  3CC2 Q;  3PT9 A;  1W1F A;  1ZBJ A;  3MEV A;  3G4S T;  4IKF A;  3HKS A;  3RR6 A;  2V8I A;  1WDX A;  1X27 A;  1RAD B;  1X01 A;  1VQ6 T;  3QJY A;  4FYV B;  4QT7 A;  4HT9 A;  2CT3 A;  3MP6 A;  2RQR A;  4AFS C;  2R58 A;  3H41 A;  4ZGJ B;  1N9R A;  1WHH A;  1Q81 U;  1UG1 A;  1AOJ A;  1VQ4 T;  2EGA A;  1C0M A;  3ZEH A;  4N4I A;  3G6E A;  4A4E A;  1ZSZ C;  3HSB A;  3MO8 A;  4XAX B;  2QGF B;  1JEG A;  1SSF A;  2A37 A;  1YWP A;  4MDX A;  2XKO C;  2QA4 A;  1Q81 R;  3JCM P;  1VQM Q;  1BI0 A;  1K76 A;  1KHI A;  1UFF A;  1TSF A;  2D0N A;  5GAN 5;  2XI9 A;  3ULR B;  2JMC A;  3JCM V;  4N0A C;  4PJO D;  2OTL Q;  3H6Z A;  4K11 A;  2HEQ A;  2VXF A;  2PUK B;  2QAS A;  4PLL A;  4II1 A;  3RUX A;  5L23 A;  2HSP A;  1NBE B;  1K73 C;  1IHW A;  2W0Z A;  1H3H A;  3MP8 A;  3BY7 A;  1QCN A;  1VQ7 T;  3EGD B;  2I2L A;  4FU6 A;  4MZP A;  2KVQ G;  4BB7 A;  3CC2 T;  2E41 A;  2OJ2 A;  2K9G A;  5LJ3 h;  3V7S A;  4L59 A;  1N8R C;  2DO3 A;  1KQS A;  1AWW A;  1YJN Q;  2E70 A;  3G7Z A;  1Q86 U;  2K5L A;  3FJP A;  1K9M C;  4C92 A;  1R0C B;  2CH4 W;  4PJM A;  2X4W A;  3OS5 A;  5CKE A;  3PTA A;  1KD1 U;  3CCS Q;  3CPW A;  3VUZ A;  1K9A A;  1RI0 A;  3JCM f;  4JRK A;  3GLX A;  2HZY A;  4PFP A;  3E9F A;  5EC7 A;  3WVD B;  3NGP A;  1Q86 R;  3EG1 A;  3R6O A;  4F7U G;  2ED0 A;  4E47 A;  1FYN A;  1AVZ C;  3ER0 A;  1KD1 R;  1OZ2 A;  5GAM e;  2LT4 A;  1VQM T;  2MK5 A;  5KE3 A;  2P84 A;  3X24 B;  4JDS A;  4ME7 A;  4C0D B;  4Z89 A;  1EFN A;  1M8M A;  4Z02 A;  1N6A A;  1F1B B;  2KE9 A;  1ABQ A;  2OTL T;  1PKT A;  1K4U S;  4OML A;  2CSQ A;  2MCN A;  1H92 A;  3DB3 A;  2E6N A;  1QVG S;  2MWP A;  2V26 A;  1IO6 A;  4J6X A;  4IUV A;  4LDY A;  1YCY A;  3QYH B;  3OYI A;  1D1B A;  5GMK h;  3SEM A;  3MHX A;  1ZUY A;  3EG9 B;  4F7U B;  3OYF A;  2KXD A;  2QQA A;  1YIJ Q;  1YJN T;  2C0I A;  1VQ8 Q;  4JLG A;  4F14 A;  4HT8 A;  1QP2 A;  1ARK A;  2RH2 A;  4OB0 B;  2PUO B;  3OB9 A;  1AZE A;  1Z9Z A;  1G3T A;  3CCS T;  2X51 A;  2KT8 A;  2CKK A;  2JN0 A;  5C0M A;  4M78 D;  2Y4Y A;  2RJD A;  3QUI A;  3G1J A;  1CKB A;  2YRD A;  2YUN A;  2DL5 A;  2LZ6 B;  4HCB A;  1NLO C;  1C1A A;  2AZV A;  2LNV A;  4CC4 B;  1ZSG A;  1G8X A;  1NJI U;  1LCK A;  4ELY C;  2QGG A;  3OYG A;  3P8B B;  3PVQ A;  4C92 C;  1TXQ A;  1NG2 A;  1OV3 A;  4RMO A;  4AMC A;  1ZUU A;  5GAM j;  3OMG A;  4PJO C;  1TOV A;  4F7U E;  5LJ5 f;  4CC2 A;  2AT1 B;  4OVA A;  2CGH A;  3G71 Q;  3CCR Q;  4RKU E;  3UT1 A;  1NJI R;  2K5F A;  2M16 A;  3JCM c;  4C0G A;  1I4K 1;  1G5V A;  2YLB A;  4BE1 A;  2EQK A;  5LJ5 g;  1NYG A;  1OU8 A;  2DL3 A;  1JJ2 S;  4M78 A;  3OYB A;  1YI2 A;  5C6S A;  3JB9 I;  1VQ6 A;  5IHK A;  2ZPI B;  3R6N A;  4X1V A;  2K57 A;  3G6E Q;  3UA6 A;  3VU3 C;  1YIJ T;  1Q7Y U;  4E7I A;  1VQ8 T;  1AD5 A;  5I2S A;  2KRO A;  1RUW A;  3IQL A;  1UHC A;  2LCC A;  2V8J A;  3X25 B;  2ZZD A;  1T0H A;  4PKC C;  2H3J A;  3HL8 A;  2RF0 A;  2J7I A;  1DJ7 B;  1AZG B;  3CEY A;  3OYL A;  1G2B A;  1G83 A;  1Q7Y R;  2FRW A;  1KSW A;  2ZPH B;  2YXY A;  4LDV A;  2DL4 A;  5FWB A;  3CXC S;  1BYM A;  1AT1 B;  2I0N A;  5KE2 A;  1MMN A;  5CIU A;  1UEC A;  4KUD K;  2RHZ A;  5KYU B;  3NTI A;  3FEO A;  1TUC A;  3UWN A;  1MMA A;  2VB6 A;  1JQQ A;  2JM8 A;  3CC7 Q;  3EFO B;  3BDU A;  4J9C A;  2NUT B;  1EX4 A;  1FMK A;  3JB9 H;  3G71 T;  1K0X A;  3RER A;  4DOV A;  2XD0 A;  2GF7 A;  3I5S A;  3CCR T;  3EH2 A;  4PFO A;  2X35 A;  3OYJ A;  4N4H A;  3DLM A;  3CCQ A;  2QQ9 A;  2DRM A;  1VQ7 A;  4XU3 A;  1RAG B;  3M0Q A;  5KCO A;  3CC2 A;  1HXD A;  2EYX A;  1T3L A;  2RJE A;  2C0T A;  5GAN 8;  4DBF A;  2EGE A;  3QXE B;  2DL7 A;  2CZ1 B;  2CDT A;  1ZQ1 A;  3H8Z A;  3REA B;  2DE0 X;  2O4X B;  4EMK C;  2DTI A;  1ZBX A;  3G6E T;  4C92 F;  4ZTJ A;  2LMJ A;  3L2V A;  2BZ8 A;  2YRV A;  5D6W A;  4HKE A;  5GAM h;  3OQ5 A;  2ZPF B;  2FEI A;  1I07 A;  4LUE A;  4EPC A;  4IUR A;  4PJO F;  1JJ2 P;  2OTJ Q;  5I21 A;  1SEM A;  2JS0 A;  4XTV A;  1KQ1 A;  1YFN A;  5FWC A;  3RMS A;  4M78 C;  3ME9 A;  4C8Q G;  4NL3 A;  4RTX A;  4IUU A;  4Z88 A;  3H0H A;  5KCH A;  3OSS C;  1BB9 A;  3JCM b;  2HQE A;  2E6Z A;  1D1A A;  1SRM A;  2JXB A;  4PK4 A;  3SWN A;  3A1P A;  3I9Q A;  2B86 A;  3NTK A;  1U1T A;  2EPD A;  1YHQ Q;  3QSU A;  3LX7 A;  3CC7 T;  5DY9 A;  2OTL A;  4M7D D;  1B34 A;  2OI3 A;  1QVG A;  1TWB A;  3M0T A;  4OMN A;  2KDS A;  1VQO Q;  2DZ9 A;  3JCM Q;  1JXM A;  4NOY A;  1SSH A;  4LNP A;  4C5I A;  3CXC P;  5HCK A;  3RES A;  4M75 G;  1X6G A;  2Y90 A;  1YIT Q;  4JRP A;  1M1K C;  2NUT A;  2EJF A;  2NWM A;  1Y57 A;  2RK2 A;  2ZCF B;  4ELZ C;  4M7A D;  2D1X A;  2HSE B;  4RTZ A;  2E10 A;  2KEA A;  2QI2 A;  2DFU A;  1K8A C;  4J5Y A;  3ZBD A;  3GNF B;  2EVR A;  2V8K A;  1D0Y A;  2LQW A;  1PG5 B;  3MCA B;  3GBQ A;  1X2K A;  4CC7 A;  2P4R A;  3GF5 A;  3CCS A;  2DYI A;  3FJ5 A;  2E65 A;  2DJZ A;  3RBB B;  1RAA B;  1KC8 U;  5FU6 B;  2OTJ T;  1WLP B;  4LDW A;  2JJ9 A;  2HAX A;  3JCM J;  2CRE A;  5CQY A;  1I8F A;  4BY6 B;  2FPD A;  5ECA A;  5GMK i;  4J6Y A;  2H8H A;  2HQX A;  4M75 B;  3JCM d;  3VS7 A;  1YJW Q;  4LE9 A;  1W70 A;  3LLR A;  2LJ0 A;  1WYX A;  4Y28 E;  2G3R A;  4F17 A;  1KC8 R;  4XTU A;  4QVZ A;  4HVV A;  5KYW A;  1QCF A;  3D7S B;  2EYQ A;  1I0C A;  4C8Q E;  1U3O A;  1K1Z A;  4KT0 E;  4BDZ A;  1YHQ T;  3L2U A;  1ZSZ A;  1YI2 Q;  1SG5 A;  1JB0 E;  2KBT A;  2KMT A;  1XQH A;  2Z0W A;  3EGU A;  8AT1 B;  5KYX A;  1VQO T;  1UE9 A;  2A36 A;  3S3N A;  1JJ2 A;  4MZT A;  4PLI A;  1G3W A;  1OZ3 A;  4XTX A;  2FO0 A;  1YIT T;  3GPL A;  2L3Q A;  4RTU A;  4M78 F;  1YJ9 Q;  4CI0 C;  3PE0 A;  1B07 A;  3HRS A;  3SWN C;  1I1J A;  2DAQ A;  5GMK e;  2L2P A;  3VS5 A;  3X20 B;  1PD1 A;  2DVJ A;  3MET A;  1YIJ A;  1VQ8 A;  2DXT A;  4XU0 A;  1M3A A;  4M75 E;  3TRE A;  5LJ3 j;  3CCU A;  3KFV A;  2KYM A;  3TEE A;  3BFM A;  4BAC A;  1U1S A;  3I56 A;  2R5A A;  2ESW A;  3BDL A;  3EFR A;  2AIR B;  2DEQ A;  1Q82 C;  5CKD A;  4OMQ A;  1D3B A;  3MKD A;  4DBQ A;  3NHN A;  2LDM A;  4A53 A;  3DB4 A;  3CXC A;  2DLP A;  1VQ9 A;  2O9V A;  4IUQ A;  3VYG A;  1M90 C;  2M1H A;  5GAN f;  3HHT B;  3OYY A;  2EQU A;  1YJW T;  2AHJ B;  2CP7 A;  2XDP A;  1TS9 A;  2WSC E;  3CCQ Q;  1WHJ A;  2DMO A;  2O2O A;  3S3M A;  1IRE B;  2O01 E;  4EMH A;  3HPW A;  5GAN g;  4Y91 A;  3I55 A;  1FMV A;  2F69 A;  4C92 B;  1YI2 T;  3G71 A;  3REB B;  4DEY A;  1M2V A;  3CME A;  2E5Q A;  3V7C A;  3VV0 A;  2G6F X;  3CCR A;  1YN8 A;  4OB1 B;  2AKL A;  1GFD A;  2DD5 A;  4M77 A;  2EQI A;  4PJO B;  4XTW A;  3QG1 A;  3EG3 A;  4KUI A;  2EKH A;  1WX6 A;  4ZTF A;  5LJ5 d;  1PCX A;  3QDR B;  3RNJ A;  3P8H A;  4M7A C;  3EGX A;  1RLP C;  2K79 A;  1G3S A;  3FC3 A;  2KQW A;  1D09 B;  1GCP A;  1QLY A;  5I2M A;  1VQL A;  2EYY A;  2M51 A;  3M54 A;  3OS2 A;  2L0A A;  5GMK j;  5IN1 A;  3JV3 A;  2YWW A;  2M02 A;  3VRZ A;  5I22 A;  1Y96 A;  3T9N A;  1Y07 A;  2CZ6 B;  3EG2 A;  1WJQ A;  2K5I A;  1ZHI A;  4GY5 A;  1WQW A;  3UF4 A;  3VS2 A;  1OUL A;  3MEA A;  3WXM B;  2DZC A;  2ROT A;  4C92 E;  3INZ A;  3VKI A;  2CZ0 B;  1VUB A;  3UA7 A;  1YCS B;  2MPX C;  2HL5 C;  3I35 A;  1C6V X;  1ZA2 B;  3GP8 A;  3L2Z A;  4JS5 A;  3LYI A;  3JB9 G;  1R77 A;  4KRT A;  2GCX A;  4BD3 A;  2YRC A;  1QWE A;  3CCQ T;  5GAO q;  4B6M A;  1RLQ C;  3CC7 A;  4CRI A;  1UHF A;  5FLX E;  4DA4 A;  2EIF A;  2JOY A;  4RTT A;  2DJQ A;  4FCY A;  3DLL A;  2DYB A;  3LWH A;  4FW1 A;  2VGM A;  2EQM A;  3CBM A;  3HRT A;  3M59 A;  1ZLM A;  4P5N A;  1TUD A;  4PJO A;  3QWY A;  4XTY A;  2ZGW A;  1X43 A;  1MND A;  2K2V A;  5CKF A;  3TSW A;  1VQ5 A;  2CUD A;  1UDL A;  5GJW B;  2NUP A;  2ZPB B;  1VQN Q;  5KYN A;  5DLO A;  2VKN A;  4C5G A;  1UTI A;  3JCM g;  2EGC A;  3QZ5 B;  1HD3 A;  3RIR A;  4M77 C;  4KGV B;  4A4F A;  4E7J A;  2OTJ A;  2RI5 A;  1NPR A;  2VXE A;  3S6W A;  1YWO A;  4M7D F;  5LJ5 h;  1M9S A;  2QYZ A;  4PNO A;  4RG8 A;  4GLK A;  4E7Z A;  4E7K A;  4AG1 C;  1JRI A;  4JUV A;  2C0O A;  4Y92 A;  2QG9 B;  4M4Z A;  3ZFJ A;  2RHX A;  5GAN 2;  2HKN A;  1I5O B;  4M78 B;  3M53 A;  1WIE A;  5L8R E;  4M7A F;  3NTH A;  3MP1 A;  4AT1 B;  1FWZ A;  1HSQ A;  2QXF A;  2LX9 A;  3GOX A;  3VS1 A;  3X26 B;  4JJB A;  4R0K A;  1YHQ A;  2P0P A;  1QVF P;  3L2R A;  1U5S A;  5D6Y A;  3E9G A;  4QQG A;  1UJY A;  1VQO A;  1KHC A;  3MJX A;  2LC4 A;  3M55 A;  5HK3 A;  2JT4 A;  2J06 A;  3RKW A;  4BDY A;  2XIC A;  1YIT A;  3VS0 A;  3CCU Q;  2KAF A;  3I56 Q;  3M0R A;  3JB9 D;  2XMF A;  2OAU A;  3O8V A;  2QTX A;  4HVW A;  3OYD A;  1UGQ B;  4L5G A;  4J7F A;  1HK9 A;  1FMW A;  2CS7 A;  8ATC B;  3FDR A;  1NJI C;  5LJ3 f;  1M8V A;  2DXC A;  1VQ9 Q;  5KH6 A;  3CCE Q;  1VQN T;  2GQI A;  3CCJ Q;  2D8J A;  4QQD A;  2V1Q A;  2WSF E;  4BI4 A;  1KJW A;  2CP6 A;  4ORZ A;  1IRX A;  4JS4 A;  4EMK A;  4CC3 A;  2RD1 A;  5HY6 A;  3I55 Q;  4J9H A;  2F1L A;  3C12 A;  4O5V A;  4E7S A;  3CME Q;  1WXB A;  4HA8 A;  4A4G A;  1YJW A;  2EKO A;  2ZAE A;  4IIM A;  4KBM B;  3P8D A;  2ABL A;  4DEX A;  2RJF A;  4FSX A;  2A28 A;  3KXT A;  5FRO A;  3M0U A;  1KQ2 A;  5CO7 A;  1U06 A;  2FG0 A;  4JRI A;  5CAI A;  2GTJ A;  2HD0 A;  2DF6 A;  4J9E A;  4LDU A;  3URG A;  5GAN 6;  5CR2 A;  4QKU A;  1TH7 A;  3LGL A;  3OYN A;  2OAW A;  5GAN 7;  4J9F A;  3QWX X;  4JJD A;  1VQL Q;  4M77 F;  2COY A;  4JZ4 A;  4EMG A;  1ACM B;  1UGR B;  2MAM A;  3A8L B;  4J7I A;  3CCU T;  1PRL C;  1YJ9 A;  4RCB A;  4IUP A;  1A0N B;  2DNU A;  2DPP B;  1IGQ A;  3CBO A;  4RCC A;  4RUG A;  3I56 T;  1HJD A;  2RNA A;  4OP0 A;  1WXU A;  5GJV B;  3E2U A;  2MWO A;  1D0X A;  1OPK A;  3A8H B;  1M5Q 1;  2QEX A;  3TCJ A;  1Q95 G;  1M30 A;  3WVE B;  1VQ9 T;  3SWN B;  3M0P A;  3CCE T;  2M0O A;  5AT1 B;  2P4T A;  4WCI A;  3CCJ T;  3GIB A;  2ED1 A;  2IIM A;  4QVC A;  1B34 B;  1H8K A;  3M5A A;  5DM7 R;  3HP9 A;  2QK0 A;  2KRN A;  2JS2 A;  2RA2 A;  1QVP A;  2J6K A;  3NFC A;  1E7O A;  5FRM A;  2NLU A;  1OYX A;  5GAO l;  1SHF A;  4QW2 A;  3CCV A;  3I55 T;  2OX7 A;  1V29 B;  2HKQ B;  1WZO A;  1OI1 A;  3CME T;  2DIQ A;  2LT1 A;  5D7U A;  1OQK A;  2RHU A;  3C94 A;  3JAM E;  2C06 A;  2K6D A;  1SHG A;  2WAC A;  3A98 A;  3EFS A;  3LWI A;  1WI7 A;  2M9U A;  4C5E A;  5GAN d;  3NMZ C;  1FX7 A;  2GQV A;  1KG1 A;  2HQH A;  2D9T A;  2RMO A;  3OSV A;  1UUE A;  3CD6 A;  4JJC A;  1VQ5 Q;  3M56 A;  4FYW B;  2GGR A;  2PVO B;  1VQL T;  2RHI A;  4RTV A;  2DVE A;  2L3P A;  3EAE A;  3JCM e;  5GAN 4;  3ASK A;  2E64 A;  3QBY A;  4DQ2 A;  2LQ8 A;  4OGC A;  5DLQ E;  3FLG A;  3QDF A;  4J8O A;  2RB6 A;  1WA7 A;  2V1R A;  2EBP A;  4RG2 A;  2YLC A;  2YUP A;  5FW9 A;  1BBZ A;  5KYW B;  4C0D C;  4J9I A;  2EWN A;  4ZN3 A;  2ENM A;  1OX9 A;  2QQB A;  2PNI A;  4C0F A;  1RAE B;  2FZK B;  4PJN A;  1GL5 A;  1ZSZ B;  2XG8 D;  3F70 A;  3JCM W;  5AYF A;  1VA7 A;  1PRM C;  5KYX B;  1OPL A;  1P92 A;  4OMP A;  3CMA A;  2K3Y A;  2YUQ A;  1WHG A;  3QO3 A;  2X3W D;  1WHM A;  1VQK Q;  4O6J A;  1AWX A;  4J6W A;  5A2Q E;  1KIK A;  2LVM A;  4MDW A;  3HFO A;  5CVI A;  1KFZ A;  2KXC A;  1QQJ A;  4OMF B;  4D8K A;  2EAY A;  1VQ5 T;  3OBW A;  5GMK m;  3OA6 A;  1XTD A;  3C0C A;  2LJ1 A;  4QVD A;  5IXB A;  4FL6 A;  1D3B B;  4PJL A;  4PFZ A;  1BK2 A;  2EFI A;  4KGZ B;  1M1K U;  2L3S A;  1Y7X A;  4M7D A;  1SKU B;  1BI2 A;  2K4Y A;  2DD4 A;  3SDZ A;  5GAN h;  1QP3 A;  5A0D A;  3LGF A;  5GMK l;  1VQN A;  2O9S A;  1OX8 A;  2DA9 A;  5A0G A;  3J80 E;  1H3Z A;  2D6F A;  3L42 A;  4FM4 B;  1K8A U;  3JCM X;  1JXO A;  3KUF A;  3N5B B;  1VQP A;  1NEG A;  4M7A A;  3OYK A;  1RAB B;  1M1K R;  2X3X D;  3I5R A;  1M2V B;  5LJ5 e;  5GAM f;  1AEY A;  3QPH A;  2GFA A;  2FVU A;  2MOX A;  2JTE A;  3TQ7 P;  4M77 B;  1PD0 A;  3TU4 K;  1K8A R;  2D0Q B;  4IUT A;  5GAM g;  3OYE A;  3EGX B;  4C8Q D;  4XU2 A;  4FYY B;  3VS3 A;  3JB9 F;  2VAS A;  3VS6 A;  3A8M B;  2EQJ A;  4B9X A;  2JNG A;  3E1S A;  9ATC B;  2XID A;  1NZ9 A;  2DK3 A;  2ZPE B;  2FHD A;  2E4H A;  3VUB A;  1RAF B;  1Y96 B;  2DEU A;  3AHU A;  1W2B S;  4C92 G;  2DTO A;  4LXC A;  3PMI A;  2QEX Q;  1O75 A;  3JB9 J;  1PHT A;  3RDV A;  2CP3 A;  2AZS A;  4OGE A;  1PSE A;  1M1G A;  4PJO G;  2GNC A;  3C95 A;  4FIB A;  4ZGE B;  3DKM A;  3CBP A;  2H3E B;  4M75 D;  4M77 E;  2MF2 A;  2J05 A;  1V76 A;  5EG2 A;  3CCE A;  3CCV Q;  4C8Q A;  3SD4 A;  2W10 A;  1PKS A;  2XHC A;  4F7U F;  1KQS P;  1QKW A;  1MMG A;  3M57 A;  3CCJ A;  1IB8 A;  2DBK A;  2RN8 A;  4LUD A;  2O88 A;  2CP2 A;  1WGS A;  1M27 C;  2BIV A;  4F16 A;  1OEB A;  5LJ3 d;  1RAH B;  4ZN1 A;  1M3B A;  4LN2 A;  3CPW P;  1B7T A;  4R55 A;  2VWF A;  1JU5 C;  2BE9 B;  2R57 A;  4OMM A;  1Q82 U;  4NS5 A;  4M7D C;  1LOJ A;  2BUD A;  3TSZ A;  5LJ5 j;  3QZ9 B;  3CD6 Q;  5IT9 E;  2JUF A;  1PSF A;  1Q81 C;  3HRU A;  1XJW B;  3BW1 A;  3JCM h;  1M90 U;  2VV5 A;  2DXU A;  4VUB A;  2FB7 A;  1GCQ A;  4R56 A;  1WHL A;  1AWO A;  4B9W A;  3OW2 S;  3X28 B;  2RQW A;  2F2X A;  2NUP B;  1YJ9 T;  2L89 A;  4YTL A;  2RI3 A;  4E2F B;  1Q82 R;  3S3O A;  3SHW A;  1BIB A;  5GAO r;  2Y4X A;  4XTZ A;  2QEX T;  3GNG A;  1M90 R;  5IHI A;  2KYB A;  4DBR A;  5IHN A;  4EDU A;  4GLM A;  1NYF A;  2E12 A;  1VYU A;  2LQN A;  2LQK A;  1GFC A;  1MMD A;  2HCK A;  4GBQ A;  4V2S A;  1GRI A;  4BI8 B;  2EYZ A;  1LNX A;  2X4X A;  1QVF S;  1J3T A;  1W2B P;  1MV0 B;  1IZ6 A;  3CMA Q;  3FIF A;  3CC4 A;  4WF2 A;  3CCV T;  4PJO E;  1YP5 A;  4C92 D;  1FXX A;  2QAZ A;  2FPF A;  7AT1 B;  5KYY A;  3QYG B;  1MHN A;  3QKJ A;  2DTH A;  2YDL A;  4ESR A;  3EH1 A;  1Q86 C;  3PGG A;  1RI9 A;  2K3B A;  4FYX B;  2DXB A;  1TU0 B;  4X9C A;  1UGV A;  3CD6 T;  1KD1 C;  4C8Q C;  2PQW A;  2O31 A;  2E1H A;  4M78 G;  2COZ A;  3PVL A;  2CP5 A;  1K73 U;  2CUB A;  3OYC A;  1BU1 A;  3EG0 A;  1EIF A;  1NPP A;  5FU6 C;  1N8R U;  2EJG A;  2GTO A;  2B8A A;  4RTY A;  3UDC A;  4EMK B;  4BY6 C;  4J9G A;  2K2M A;  1K73 R;  3O5Z A;  3VJP A;  1NE8 A;  3TVT A;  3OW2 P;  1VQP Q;  1K9M U;  1BCM A;  1S72 A;  3U23 A;  1I81 A;  3BE3 A;  1GCQ C;  4M75 C;  2YHT A;  1H64 1;  2HNI A;  2KNB B;  1JBM A;  4IIO A;  1NEB A;  3A8G B;  1YBY A;  2DET A;  1SF9 A;  2ECZ A;  4L6V 5;  1N8R R;  1IGU A;  3CMA T;  1LVK A;  2AKK A;  1RL2 A;  5CKH A;  3NPF A;  4E7H A;  4A54 A;  5CK9 A;  1WNL A;  1K9M R;  2SEM A;  2L3R A;  2LP5 A;  5CKB A;  2FZG B;  1VIE A;  3EHR A;  1OOT A;  1R0B G;  4A4K A;  2QQR A;  5M9O A;  1BI1 A;  3CCL Q;  2MYS A;  3RKY A;  2KK4 A;  2RI2 A;  4C5H A;  5FU7 C;  1ZX6 A;  1VQK A;  3VYH B;  1QWF A;  4J83 A;  2BTT A;  2FRY A;  2LCS A;  4DOW A;  2M0Y A;  4DBH A;  4MMK A;  5CCA A;  2DIL A;  2LCL A;  1QCO A;  1CSK A;  3A5Z B;  3H0F A;  4UC4 A;  1W2B A;  2BZY A;  2K3X A;  3JRZ A;  5IXF A;  4BUG A;  1BIA A;  2YSQ A;  3EGD A;  4XK8 E;  2JW4 A;  2MMP A;  4TVR A;  2YT6 A;  4M78 E;  3LW5 E;  3CCM A;  3UAT A;  3L2W A;  1KK7 A;  1UEB A;  2MIO A;  1QW1 A;  3M4G A;  2EW3 A;  5LJ3 g;  1VQP T;  3A8O B;  2BKD N;  1WXT A;  2XU8 A;  3H0I A;  2VVK A;  5GAN 3;  2PVD B;  5GAN e;  4XQ3 A;  4C8Q F;  4KH1 B;  1JO8 A;  1Y71 A;  2XDD A;  1VYT A;  1E6H A;  5FRN A;  1D0Z A;  2BE7 D;  2D8H A;  2QDL A;  1I5L A;  1T0J A;  4FSS A;  1U8R A;  2KY9 A;  2MI6 A;  2X9H A;  2A0F B;  4JZ3 A;  4KH0 B;  2IPO B;  2GFU A;  1WJR A;  2CT4 A;  3OY9 A;  3M58 A;  3HFN A;  1X2Q A;  3MEU A;  1ZA1 B;  2LRQ A;  4JPB W;  4BE2 A;  4LDX A;  3KBG A;  2CZ7 B;  2HBW A;  1WFW A;  2E5K A;  1X69 A;  1OU9 A;  1Q7Y C;  2DM1 A;  3CCL T;  2EJ9 A;  3ZL7 C;  2E3I A;  4HCK A;  4FT4 A;  3SFM A;  3FB9 A;  1SRL A;  1UB4 A;  3OW2 A;  5GAM d;  1NM7 A;  3MPU B;  2BZX A;  4KGX B;  4M75 F;  3PIP A;  2IVW A;  1K0S A;  3L2Q A;  3V8J A;  3G4S A;  2J6O A;  2X4Y A;  1BKB A;  4QQ6 A;  2J6F A;  2PVG B;  2VC8 A;  1X6B A;  1M4Z A;  2XDB A;  4Z8A A;  2FYK A;  3RKX A;  5GAO m;  3V8L A;  1VIF A;  3LH0 A;  3CC4 Q;  2ZPG B;  5I11 A;  4PJJ A;  4AFU C;  2QA4 Q;  1QVG P;  2DER A;  3EG9 A;  4C0Z A;  3M0S A;  3L1A A;  4F7U A;  1PNJ A;  1WQ7 A;  3J81 E;  1VQ4 A;  3J7A F;  2ROL A;  4ZGD B;  2HDA A;  4M7D G;  1QVF A;  1WHK A;  2HBP A;  2DKG A;  2RHY A;  4HXJ A;  2FPE A;  6AT1 B;  3V8K A;  1GBR A;  3MEW A;  1BI3 A;  4OF1 A;  4BI3 A;  2QTV A;  4M7A G;  4RTW A;  5J39 A;  5GAN j;  2P0K A;  1N5Z A;  1MUZ A;  1B3Q A;  1RAI B;  1MNE A;  4HCC A;  4HCZ A;  5CQX A;  2WSE E;  2SRC A;  1UGP B;  3RMQ A;  1LPL A;  1SPK A;  1IXD A;  2XK0 A;  3PMT A;  2JTF A;  2VGN A;  4XU1 A;  5J3B A;  2KR3 A; 
#chains in the Genus database with same CATH homology
 4GY5 A;  4M77 B;  1WQW A;  4OB0 B;  2JTM A;  2PUO B;  3OB9 A;  2R5M A;  3TU4 K;  3MEA A;  1G3T A;  3CCS T;  3WXM B;  2DZC A;  4C92 E;  3INZ A;  2A7Y A;  2D0Q B;  2CZ0 B;  1VUB A;  4IUT A;  3VKI A;  5GAM g;  3OYE A;  3OYH A;  4M7D B;  2CKK A;  2JN0 A;  4C8Q D;  5C0M A;  4XU2 A;  4M78 D;  3GP8 A;  2Y4Y A;  3L2Z A;  3JB9 F;  2RJD A;  3QUI A;  4JS5 A;  3A8M B;  3LYI A;  5GAN h;  2RM4 A;  2VYT A;  5J26 A;  2EQJ A;  2F5T X;  3JB9 G;  4B9X A;  2JNG A;  1G3Y A;  3Q1J A;  4LD6 A;  2GCX A;  3E1S A;  3FRN A;  4BD3 A;  3PIO A;  2LNV A;  2IG0 A;  4HCB A;  2XID A;  3CCQ T;  5GAO q;  1NJI U;  1NZ9 A;  2DK3 A;  2LTO A;  2ZPE B;  2FHD A;  4M7A B;  4ELY C;  3P8B B;  3OYG A;  1X75 C;  3VUB A;  3QHS A;  4C92 C;  1Y96 B;  5D6X A;  3CC4 T;  3AHU A;  3CC7 A;  1W2B S;  4C92 G;  4CRI A;  2DTO A;  2QA4 T;  5FLX E;  3PMI A;  4RMO A;  1O75 A;  4DA4 A;  2EIF A;  5GAM j;  2JOY A;  2JVV A;  3JB9 J;  1R8O B;  5GAO p;  3OMG A;  4PJO C;  2L5Q A;  4F7U E;  4OGE A;  3DLL A;  1PSE A;  1M1G A;  4PJO G;  5LJ5 f;  1XOV A;  3LWH A;  3C95 A;  4FIB A;  4ZGE B;  4OVA A;  2CGH A;  3DKM A;  2VGM A;  2EQM A;  3CBM A;  3CBP A;  4ATO A;  3HRT A;  3M59 A;  4RKU E;  3UT1 A;  3OMC A;  4M75 D;  4MML A;  2K5F A;  4P5N A;  3V7R A;  4M77 E;  2M16 A;  2MF2 A;  3JCM c;  4C0G A;  1I4K 1;  1G5V A;  2YLB A;  5HK0 A;  4BE1 A;  2EQK A;  1VQM A;  5LL6 S;  5LJ5 g;  4PJO A;  5EG2 A;  4NL2 A;  4XTY A;  2ZGW A;  3CCE A;  4M7D E;  4C8Q A;  3SD4 A;  2JZ2 A;  2K2V A;  5CKF A;  4M78 A;  1JJ2 S;  1N27 A;  3OYB A;  1VQ5 A;  2XHC A;  4F7U F;  1YI2 A;  5C6S A;  3JB9 I;  3M57 A;  2ZPB B;  3CCJ A;  1VQ6 A;  4JJN K;  2ZPI B;  5DLO A;  4C5G A;  2RK1 A;  2K57 A;  3JCM g;  1WGS A;  3QZ5 B;  2BIV A;  5LJ3 d;  3VU3 C;  1YIJ T;  1Q7Y U;  4E7I A;  3RIR A;  5GAO n;  4ZN1 A;  1VQ8 T;  4M77 C;  5I2S A;  4A4F A;  4E7J A;  4R55 A;  2OTJ A;  2RI5 A;  4M77 G;  4M7A E;  1NPR A;  2VXE A;  3S6W A;  2GFA A;  4X9D A;  2R57 A;  4M7D F;  5LJ5 h;  1M9S A;  4PNO A;  1Q82 U;  4NS5 A;  4RG8 A;  4GLK A;  4M7D C;  2L8D A;  1LOJ A;  2BUD A;  2LCC A;  3JSC A;  2V8J A;  4E7K A;  5LJ5 j;  3X25 B;  1KC8 C;  2P0Q A;  1KQS S;  4OB2 B;  3QZ9 B;  2ZZD A;  1JRI A;  2JUF A;  1PSF A;  4FT2 A;  4JUV A;  5A0L A;  3UPU A;  1UGS B;  5IT9 E;  1Q81 C;  3HRU A;  4PKC C;  2H3J A;  3BW1 A;  3HL8 A;  4XU1 A;  2QQS A;  3ZFJ A;  3SB2 A;  2RHX A;  1DJ7 B;  3CEY A;  3JCM h;  5LJ3 e;  5GAN 2;  2VV5 A;  4C8Q B;  3OYL A;  1M90 U;  2DXU A;  4VUB A;  2FB7 A;  4M78 B;  3M53 A;  4R56 A;  1S72 T;  5L8R E;  4M7A F;  3NTH A;  4B9W A;  3CPW S;  3OW2 S;  3X28 B;  1YJN A;  3MP1 A;  1YJ9 T;  2L89 A;  2ZPH B;  4LDV A;  3M4Y A;  4YTL A;  3OS0 A;  1FWZ A;  2RI3 A;  4E7L A;  3CXC S;  2QXF A;  4JRQ A;  2LX9 A;  3GOX A;  4A4H A;  1BYM A;  3X26 B;  3S3O A;  2QDY B;  5KE2 A;  3CPF A;  5CIU A;  4KUD K;  2RHZ A;  1YHQ A;  1BIB A;  2CYZ B;  2P0P A;  3NTI A;  5GAO r;  3FEO A;  2O4X A;  2Y4X A;  1XNI A;  3M9Q A;  4XTZ A;  3L2R A;  5D6Y A;  3UWN A;  3QII A;  1WPY A;  3E9G A;  4OB3 B;  4QQG A;  3GNG A;  2QEX T;  1VQO A;  1W4S A;  1KHC A;  2LC4 A;  2RO0 A;  3BDU A;  1N9S A;  3E19 A;  3M55 A;  5HK3 A;  4KUL A;  3RKW A;  4BDY A;  2X4J A;  4PL6 A;  2XIC A;  1YIT A;  3G71 T;  4EDU A;  3JB9 H;  3RER A;  4DOV A;  2XD0 A;  2KAF A;  2E12 A;  2GF7 A;  3CCR T;  2LQK A;  4V2S A;  2X35 A;  4BI8 B;  3OYJ A;  4N4H A;  3DLM A;  3CCQ A;  2QQ9 A;  3QJ6 A;  1LNX A;  2X4X A;  4XU3 A;  3JB9 D;  1VQ7 A;  2OAU A;  1QVF S;  3O8V A;  2QTX A;  5KCO A;  1IZ6 A;  1LJO A;  3C4S A;  3OYD A;  3FIF A;  1UGQ B;  1HXD A;  1VQK T;  3CC2 A;  3CC4 A;  4WF2 A;  4L5G A;  5IAY A;  3CCV T;  2RJE A;  4J7F A;  4BE0 A;  5GAN 8;  2A3L A;  1HK9 A;  3OS1 A;  2CS7 A;  1NJI C;  3FDR A;  2F5K A;  3QXE B;  5LJ3 f;  2CZ1 B;  4PJO E;  1ZQ1 A;  1QVG S;  1AHJ B;  1M8V A;  2DXC A;  3H8Z A;  4C92 D;  1FXX A;  5KH6 A;  1VQN T;  2O4X B;  4EMK C;  2DTI A;  3CCL A;  1ZBX A;  2PU9 B;  3G6E T;  4C92 F;  4LD9 K;  3QYG B;  4ZTJ A;  1MHN A;  1WJS A;  3L2V A;  3QKJ A;  4QQD A;  2YRV A;  2DTH A;  2WSF E;  1Q86 C;  1M1F A;  5D6W A;  4BI4 A;  4HKE A;  5GAM h;  3OQ5 A;  3PGG A;  5HKC A;  4MZM A;  2ZPF B;  3OYA A;  2DXB A;  4EPC A;  4IUR A;  4PJO F;  4JS4 A;  4X9C A;  4EMK A;  5I21 A;  2RD1 A;  3CD6 T;  1KD1 C;  5FU7 B;  5HY6 A;  4XTV A;  1MGQ A;  1KQ1 A;  3CCM T;  2FL7 A;  3C12 A;  4O5V A;  4C8Q C;  3RMS A;  4M78 C;  2PQW A;  3ME9 A;  4JLI A;  4C8Q G;  4NL3 A;  4N0A A;  4HA8 A;  4M78 G;  2E1H A;  4IUU A;  4A4G A;  3PNW C;  2RJC A;  1YJW A;  2EKO A;  1O9S A;  4KBM B;  3P8D A;  4D6W A;  1K73 U;  2RJF A;  5KCH A;  4FSX A;  3OSS C;  3OYC A;  3KXT A;  5FRO A;  3JCM b;  1KQ2 A;  2HQE A;  2E6Z A;  5CO7 A;  1EIF A;  3PFS A;  4JRI A;  5CAI A;  3OBY A;  3OYM A;  1NPP A;  3SWN A;  2HD0 A;  4LDU A;  5GAN 6;  4M77 D;  5FU6 C;  3URG A;  5CR2 A;  1N8R U;  1TH7 A;  3LGL A;  3OYN A;  5GAN 7;  2EJG A;  3NTK A;  1U1T A;  1X6O A;  3QSU A;  2B8A A;  3LX7 A;  4M77 F;  3UDC A;  3CC7 T;  5DY9 A;  2OTL A;  4M7D D;  4EMK B;  4BY6 C;  4EMG A;  1B34 A;  3VJP A;  1NE8 A;  1QVG A;  1K9M U;  2KDS A;  1GXI E;  1S72 A;  1I81 A;  1UGR B;  2DZ9 A;  2KSS A;  2MAM A;  3A8L B;  4J7I A;  4M75 C;  4N4G A;  4X34 A;  4NOY A;  3JCM Q;  3CCU T;  2YHT A;  4RCB A;  4IUP A;  4C5I A;  1YJ9 A;  1H64 1;  2HNI A;  3RES A;  4M75 G;  2DPP B;  3CBO A;  3I56 T;  4RCC A;  2DIG A;  2Y90 A;  1JBM A;  4Q5W A;  4JRP A;  1M1K C;  4OP0 A;  3A8G B;  1YBY A;  2EJF A;  2VUB A;  2RK2 A;  4L6V 5;  2MWO A;  2ZCF B;  3CMA T;  3A8H B;  4ELZ C;  4M7A D;  1RL2 A;  5CKH A;  1M5Q 1;  2QEX A;  3TCJ A;  4M75 A;  4E7H A;  2E10 A;  3WVE B;  4A54 A;  3PT9 A;  5CK9 A;  2QI2 A;  1WNL A;  3SWN B;  1VQ9 T;  1K8A C;  3CCE T;  2M0O A;  4J5Y A;  3ZBD A;  3GNF B;  2V8K A;  2L3R A;  3MEV A;  5CKB A;  3G4S T;  4IKF A;  3HKS A;  1VIE A;  2P4T A;  2V8I A;  1VQ6 T;  3CCJ T;  1X01 A;  4A4K A;  3GIB A;  2QQR A;  3MCA B;  5M9O A;  3QJY A;  4QVC A;  4HT9 A;  1B34 B;  3GF5 A;  1BI1 A;  3CCS A;  3MP6 A;  2R58 A;  3M5A A;  4ZGJ B;  3HP9 A;  1N9R A;  5DM7 R;  3RKY A;  2KK4 A;  2E65 A;  2RA2 A;  1QVP A;  2RI2 A;  5FU7 C;  4C5H A;  2DJZ A;  3NFC A;  5FRM A;  2NLU A;  1KC8 U;  1OYX A;  5GAO l;  5FU6 B;  1VQK A;  3VYH B;  2OTJ T;  4J83 A;  4QW2 A;  3CCV A;  1Q81 U;  3I55 T;  4LDW A;  4DOW A;  2HAX A;  3JCM J;  1V29 B;  4MMK A;  5CQY A;  1OI1 A;  1VQ4 T;  3CME T;  3ZEH A;  2DIQ A;  5CCA A;  1I8F A;  4BY6 B;  2LT1 A;  2LCL A;  4N4I A;  2RHU A;  5GMK i;  3A5Z B;  3C94 A;  4J6Y A;  4UC4 A;  3G6E A;  1W2B A;  2HQX A;  4M75 B;  3JAM E;  2C06 A;  4A4E A;  3JCM d;  2WAC A;  3HSB A;  3MO8 A;  2K3X A;  3JRZ A;  4XAX B;  3LLR A;  4BUG A;  1SSF A;  1BIA A;  4Y28 E;  2G3R A;  3EFS A;  4MDX A;  4XTU A;  2XKO C;  4QVZ A;  2QA4 A;  3LWI A;  2M9U A;  4C5E A;  5GAN d;  4XK8 E;  3JCM P;  2EYQ A;  1FX7 A;  1BI0 A;  2GQV A;  1KG1 A;  1KHI A;  2D9T A;  3OSV A;  2MMP A;  4C8Q E;  4TVR A;  3CD6 A;  4M78 E;  3LW5 E;  4KT0 E;  3CCM A;  4BDZ A;  3M56 A;  1YHQ T;  5GAN 5;  3L2W A;  3L2U A;  2PVO B;  1UEB A;  2RHI A;  1VQL T;  2DVE A;  1JB0 E;  2XI9 A;  3EAE A;  2KMT A;  1QW1 A;  1XQH A;  3M4G A;  3JCM V;  4N0A C;  5LJ3 g;  3JCM e;  1VQP T;  3A8O B;  4PJO D;  2BKD N;  1VQO T;  5GAN 4;  3ASK A;  2E64 A;  2XU8 A;  3QBY A;  3S3N A;  4DQ2 A;  2LQ8 A;  4MZT A;  4OGC A;  3H6Z A;  4PLI A;  1G3W A;  1JJ2 A;  2VXF A;  2PUK B;  1OZ3 A;  4PLL A;  3RUX A;  4II1 A;  4XTX A;  2PVD B;  5GAN 3;  5DLQ E;  1YIT T;  3FLG A;  5GAN e;  3GPL A;  4J8O A;  4XQ3 A;  4C8Q F;  2XDD A;  1Y71 A;  2RB6 A;  4M78 F;  1K73 C;  4CI0 C;  5FRN A;  3MP8 A;  3BY7 A;  1I5L A;  4RG2 A;  2YLC A;  3HRS A;  2MI6 A;  2KY9 A;  3SWN C;  2DAQ A;  5GMK e;  1U8R A;  1VQ7 T;  4MZP A;  2I2L A;  4FU6 A;  2KVQ G;  2GFU A;  1WJR A;  3X20 B;  4BB7 A;  3OY9 A;  3CC2 T;  2E41 A;  3M58 A;  3HFN A;  3MET A;  4C0D C;  5LJ3 h;  1YIJ A;  2EWN A;  4L59 A;  3MEU A;  2DXT A;  3V7S A;  2LRQ A;  4ZN3 A;  4XU0 A;  1N8R C;  1VQ8 A;  2QQB A;  4C0F A;  4BE2 A;  4M75 E;  4LDX A;  3TRE A;  3KBG A;  2DO3 A;  5LJ3 j;  1KQS A;  2CZ7 B;  3CCU A;  3TEE A;  2E70 A;  2XG8 D;  3BFM A;  3F70 A;  3G7Z A;  5AYF A;  1U1S A;  4BAC A;  2K5L A;  3JCM W;  1Q7Y C;  3I56 A;  1Q86 U;  3CCL T;  2R5A A;  2EJ9 A;  3FJP A;  1K9M C;  4C92 A;  3BDL A;  1P92 A;  3EFR A;  2X4W A;  2DEQ A;  3OS5 A;  3CMA A;  4FT4 A;  3SFM A;  3FB9 A;  5CKE A;  3PTA A;  1Q82 C;  1KD1 U;  5CKD A;  1UB4 A;  3CPW A;  2K3Y A;  3OW2 A;  5GAM d;  3VUZ A;  1RI0 A;  1D3B A;  2FVU A;  3QO3 A;  2LDM A;  4M75 F;  3DB4 A;  4A53 A;  3PIP A;  3CXC A;  3JCM f;  2IVW A;  4JRK A;  1VQ9 A;  3GLX A;  4IUQ A;  4O6J A;  4J6W A;  3VYG A;  3L2Q A;  3V8J A;  3G4S A;  3E9F A;  2X4Y A;  5A2Q E;  1M90 C;  2M1H A;  3WVD B;  1BKB A;  4QQ6 A;  2LVM A;  2PVG B;  4MDW A;  5GAN f;  3HHT B;  3OYY A;  2EQU A;  3R6O A;  1YJW T;  2VC8 A;  4F7U G;  3HFO A;  2AHJ B;  1M4Z A;  2XDP A;  2XDB A;  2WSC E;  4E47 A;  5CVI A;  5GAO m;  2FYK A;  3RKX A;  3ER0 A;  3V8L A;  1OZ2 A;  5GAM e;  2LT4 A;  4OMF B;  1VQM T;  1VIF A;  3LH0 A;  3S3M A;  2EAY A;  2ZPG B;  1IRE B;  5KE3 A;  2O01 E;  4EMH A;  3HPW A;  3X24 B;  5GAN g;  1VQ5 T;  4JDS A;  4Y91 A;  3OBW A;  5GMK m;  3OA6 A;  3I55 A;  2F69 A;  4C0Z A;  1XTD A;  3L1A A;  4ME7 A;  4C92 B;  4F7U A;  1YI2 T;  3G71 A;  1WQ7 A;  4C0D B;  3J81 E;  3CME A;  2E5Q A;  3V7C A;  4ZGD B;  1VQ4 A;  3J7A F;  4M7D G;  4QVD A;  3VV0 A;  1QVF A;  3CCR A;  4Z02 A;  4FL6 A;  2HBP A;  1N6A A;  2DKG A;  2RHY A;  4OB1 B;  1D3B B;  2DD5 A;  4M77 A;  2OTL T;  4PJO B;  4XTW A;  3QG1 A;  2EFI A;  4KUI A;  1M1K U;  1Y7X A;  4ZTF A;  5LJ5 d;  4M7D A;  3QDR B;  3V8K A;  3P8H A;  4M7A C;  2K4Y A;  1BI2 A;  3MEW A;  2DD4 A;  1BI3 A;  2E6N A;  3DB3 A;  1QP3 A;  1G3S A;  4OF1 A;  3SDZ A;  4BI3 A;  2MWP A;  3LGF A;  4J6X A;  5A0D A;  3FC3 A;  2KQW A;  4IUV A;  5J39 A;  5GMK l;  4M7A G;  4LDY A;  1YCY A;  5A0G A;  1VQN A;  3J80 E;  5GAN j;  1H3Z A;  2P0K A;  2D6F A;  3L42 A;  3QYH B;  4FM4 B;  1K8A U;  3OYI A;  5I2M A;  1VQL A;  5GMK h;  3JCM X;  4HCC A;  3KUF A;  3MHX A;  3M54 A;  3N5B B;  4HCZ A;  5CQX A;  3OS2 A;  1VQP A;  5GMK j;  5IN1 A;  2WSE E;  4F7U B;  3OYF A;  4M7A A;  1UGP B;  3RMQ A;  3OYK A;  2QQA A;  1YJN T;  1Y96 A;  4JLG A;  3T9N A;  4HT8 A;  1QP2 A;  5LJ5 e;  1Y07 A;  2XK0 A;  3PMT A;  5GAM f;  2RH2 A;  2JTF A;  2CZ6 B;  3QPH A;  2VGN A;  1WJQ A;  2K5I A;  5J3B A;  1ZHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...