2XDDA

A processed non-coding rna regulates a bacterial antiviral system
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
162
structure length
162
Chain Sequence
MKFYTISSKYIEYLKEFDDKVPNSEDPTYQNPKAFIGIVLEIQGHKYLAPLTSPKKWHNNVKESSLSCFKLHENGVPENQLGLINLKFMIPIIEAEVSLLDLGNMPNTPYKRMLYKQLQFIRANSDKIASKSDTLRNLVLQGKMQGTCNFSLLEEKYRDFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/rna
molecule keywords TOXN
publication title The Phage Abortive Infection System, Toxin, Functions as a Protein-RNA Toxin-Antitoxin Pair.
pubmed doi rcsb
source organism Pectobacterium atrosepticum
total genus 46
structure length 162
sequence length 162
chains with identical sequence B, E
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13958 ToxN_toxin Toxin ToxN, type III toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.890 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xddA00
4ATOA 2XDBA 2XD0A 4GLKA 2XDDA 4RMOA
chains in the Genus database with same CATH superfamily
2XK0A 2EYZA 3PNWC 2A0FB 3PVQA 5KYNA 1WI7A 2A7YA 1YCSB 2Y90A 2LQ8A 1WLPB 2MIOA 1MMAA 2RM4A 2CH4A 2ZZDA 2K6DA 4DQ2A 2FG0A 2DTIA 2FHDA 1WQWA 2LQNA 3WVEB 1WXBA 4EMKA 2PVGB 2CP7A 1SEMA 4CC4B 1BIBA 4J9IA 1VQ5A 5FWBA 1JXOA 3BW1A 3OYNA 5LJ3f 1ARKA 5DM7R 3FB9A 2G3RA 2DEUA 2RHYA 3EGDA 1UE9A 4Y91A 2QG9B 1C1AA 2YRCA 1QLYA 2GBQA 4J9GA 1KHCA 3SEMA 2CP6A 2LDMA 2HAXA 4F16A 1PRMC 2QYZA 2LVMA 4C92D 3D7SB 2ECZA 4JRIA 5LJ3j 2P0QA 2QEXQ 3META 3G6ET 2DXCA 2E4HA 2QGGA 4CC7A 5C0MA 5I22A 3NFCA 2F69A 1FMVA 2HL3A 3NTIA 4J6WA 4C92F 2FPDA 2QXFA 3JSCA 1YITA 4EMHA 2F2XA 5D7UA 1LJOA 3DKMA 2NYSA 5FU7C 4Y28E 1VQ5Q 2E65A 3CCST 3CCLA 1HXDA 4F7UF 1QVFS 1H641 2K9GA 1PM3A 2DF6A 2A28A 4HA8A 3OYEA 1X6BA 2YLBA 2EW3A 2MMPA 3E9FA 4N0AA 2RI2A 4M75A 3HPWA 2LJ1A 2LT4A 5IN1A 2EGCA 1JJ2A 2A08A 4GBQA 2O9VA 3A8GB 4AFUC 1KQ1A 2KRSA 1OULA 4MMKA 1Y0MA 3VRZA 2R5MA 1VQLT 2ENMA 3GOXA 4L5GA 2OX7A 5IXBA 1OV3A 1VQ7Q 3AHUA 2YUOA 4M78C 2P84A 5GAN5 1UGSB 2KYBA 4OF1A 4NL3A 2RJFA 4M75G 2EQJA 4BD3A 4PNOA 2RB6A 3MEAA 5J3BA 2F1LA 4JLGA 3J81E 4PLLA 2ESWA 4LUEA 4M77E 4DBHA 5CK9A 2R5AA 3URGA 4EDUA 1ZSGA 1YITQ 1M5Q1 3JRZA 3THKA 3OYMA 2PUOB 1UUEA 2NUTB 5LJ5h 3VS3A 4LDWA 3L2QA 3CCET 5LJ5e 3PVLA 2E6NA 1YJWA 2KI7A 2KYMA 1VQMT 4HCKA 4X9DA 1W2BP 2DL3A 3JB9G 3EG1A 2D8HA 2E10A 1SHFA 3REBB 2CT3A 4FU6A 4HVUA 3M4GA 4JRKA 3FJPA 2GFUA 3M54A 2NLUA 3CQTA 5KYUA 2YSQA 1TG0A 1YJ9A 2K5LA 1WHGA 4M7AA 4M7DE 3PGGA 2JTFA 4ANJA 1T3LA 3QJYA 1TOVA 1AOJA 3GBQA 5D6XA 1VQ8A 1WNLA 2YXYA 1Q86R 2V26A 3PMTA 4RCBA 4EMKC 4J6YA 1HD3A 2JS0A 1UHFA 4JZ3A 3BY7A 1HJDA 4Z88A 3G71T 3CCMT 3CCVT 1WX6A 4MZTA 3GF5A 2LX7A 2JOYA 1UHCA 4M7AG 1TSFA 4LDYA 2LX9A 3OYJA 2HSEB 3O5ZA 2DIGA 2K57A 2L3SA 3JCMb 2RMOA 2JN0A 1OZ2A 2EKOA 1JXMA 4RTWA 4A4FA 5GAN6 2D0NA 5J39A 3CC2A 1HK9A 3IQLA 3CPFA 3V8JA 2EWNA 4ESRA 5GANj 1NEGA 5KYYA 2E5KA 2RJEA 1HSQA 2VUBA 3CXCS 1N9SA 2DX1A 4PJLA 1B3QA 4OP0A 1YJ9Q 1ZQ1A 2FB7A 5GAN8 2ZPBB 1ZA1B 1GBQA 2BIVA 2EGEA 5KYWA 4BY6B 4E7KA 3JCMW 1VQOT 4NS5A 1RL2A 3OS1A 2HSPA 5IHNA 1Q81C 1S1NA 1VQ8Q 2I0NA 1H3HA 2ROLA 5HK0A 2EQUA 3RMSA 3CCUT 2KNBB 1I0CA 5CIUA 1E7OA 5IAYA 2W10A 3OYYA 3CMAA 4D8KA 2DERA 2VGMA 4ZGJB 3EGXB 4N0AC 4R55A 1FYNA 2IIMA 4M75C 4C0DB 3X20B 4OVAA 4HKEA 3OW2P 1M3AA 4ZTJA 5DLQE 2CSIA 1QCNA 3CC2Q 1RAGB 4JJNK 4RKUE 4XQ3A 3RERA 1M8MA 3VKIA 2CZ1B 5GMKj 4HT9A 3C4SA 3OYKA 3OSVA 4OB2B 4OMMA 4L6V5 2CP2A 4IUTA 1FXXA 2P4RA 5HCKA 6AT1B 2H3JA 3CC4A 1QWEA 1N8RC 1N6AA 3E1SA 4KGXB 2AHJB 5LJ5d 1IHWA 3DLMA 1PCXA 3HRUA 3HHTB 3EH1A 5I2MA 4DBQA 2KT8A 1GFDA 3EHQA 1ABQA 5GAN2 2ROTA 2FPEA 1MV3A 1UG1A 4JUVA 3TCJA 1WFWA 1KQSP 4PFOA 3CMAQ 4M78D 3PTAA 3E19A 2L3QA 2LQKA 3JCMX 2E64A 1BI2A 1I07A 4PJOB 4J9HA 3EFRA 2EIFA 4RCCA 1AD5A 2NUZA 1T3SA 5J26A 2DYBA 3QZ9B 4LUDA 4M78F 3OS2A 1WDXA 4C8QB 1VQNT 4IKFA 3P8BB 3TU4K 2M1HA 2DE0X 2DRKA 3TREA 1LCKA 1V1CA 5KH6A 1GCPA 4J5YA 3MCAB 3QDRB 2LT1A 2KQWA 1PWTA 1Y07A 4BDYA 2RI3A 3BE3A 1VQPA 1M8VA 1SF9A 4KRTA 4MMLA 1PG5B 3M0SA 5LJ5g 5D6YA 2QDLA 3HFNA 2MK5A 2XU8A 2VV5A 2RHZA 5IH2A 3LH0A 1T0HA 4IUPA 3FDRA 3CMET 1RAAB 4DEYA 1RAFB 2QQBA 2J7IA 2DA9A 1XJWB 2AZSA 3CPWP 1M1GA 1W4SA 2KK4A 1C6VX 2DEQA 1OX8A 2CS7A 2EAYA 3FEOA 3VS0A 4E7HA 2MCNA 2XMFA 2FZKB 2O4XB 2EBPA 1RAIB 1Q81U 4A4KA 2J6KA 2CGHA 4JRPA 5FU6C 2MI6A 1WZOA 3CCJA 1Y71A 2XKOC 3G4ST 4J9BA 1PKTA 3V7SA 3CXCA 3RNJA 2K4YA 1VQPQ 4B6MA 4C5IA 2HCKA 1WGSA 4A63B 3JB9J 1ABOA 1R0CB 2NWMA 1KHIA 5GMKl 2NUPB 1NM7A 3QXEB 2RQWA 4DEXA 1JJ2S 1QP2A 3V7RA 3CCRA 2F5TX 4AFQC 4FM4B 2ZGWA 4PKCC 1EX4A 1N8RU 1IHVA 1RABB 2E41A 1MMDA 1TUDA 4EMGA 3M57A 2NUTA 4XU0A 2EFIA 4KGVB 1B34A 2KSSA 2CUBA 4C92B 2DILA 4Z8AA 1E6HA 4A4HA 1NLPC 1VIFA 3X26B 3FIFA 4Z89A 4IUQA 2EPDA 4BB7A 2QQSA 1TH7A 2FZGB 3VV0A 1Y7XA 3SB2A 2DIQA 4PK4A 1M9SA 4RG8A 1U8RA 4F7UB 1YCYA 2DPPB 3HRTA 4CI0C 3OS0A 3N5BB 1KD1C 2ABLA 1YHQT 1K1ZA 4BI4A 3DLLA 1O9SA 2PNIA 2GTJA 4CC2A 2QASA 5GAMf 4JPBW 1NG2A 3CCRQ 2AK5A 1D0XA 1IGQA 2DNUA 1VYUA 2DL5A 2E5QA 3L42A 3OYGA 4WF2A 5CQXA 3NTKA 4O6JA 3QBYA 4E7ZA 4C0GA 3EFOB 1K73C 1UECA 3M59A 2BKDN 3I55T 4IUUA 1QVGA 4QVZA 4M77G 2D8JA 2L5QA 3JAME 4J8OA 2P4TA 4M7DA 1M30A 1EIFA 5HKCA 2BE7D 4XU1A 3SWNA 1YIJA 4E7JA 1VQNA 4MDWA 4BUGA 1KQ2A 1IRXA 3AT1B 1J3TA 3OY9A 1MHNA 2ZPFB 1ZSZB 3JCMJ 4JZ4A 3VRYA 3WVDB 1AWOA 3JCMP 2L0AA 4DBRA 4M7DG 4QVDA 5GMKm 2SEMA 3ZBDA 2KMTA 4FL6A 2CP5A 4IIMA 3BFMA 1UGQB 1WJSA 1WA7A 4E2FB 2K3BA 4X9CA 5HK3A 1B07A 2DFUA 2HQEA 5FWCA 3RKYA 3NPFA 4ZNXA 3A8MB 1F1BB 2P0KA 3CMEA 1N27A 4X34A 1IZ6A 3CC7T 1QVFP 1VQ7A 1X6OA 5GAOq 1IGUA 4XTYA 2X4WA 1GCQC 5CR2A 2C0IA 1YIJQ 3JCMe 2D0QB 4E7SA 1VQNQ 1K9MR 3RKWA 3JCMc 2K7AA 3F70A 3GLXA 5FROA 1K76A 2CDTA 4KH0B 5KYXB 1UTIA 2CZ7B 3EG2A 3OYAA 5CKEA 4ZGEB 2DMOA 5FRMA 3LH5A 2ZPHB 2EYWA 2OTJT 1XOVA 2JMCA 2GQVA 2LJ3A 2COWA 4YTLA 1VQKA 1MV0B 1TXQA 1NJIR 5GAOn 2A36A 1JQQA 3QWXX 2KY9A 2QA4T 1Q81R 1EFNA 2CP3A 2DBMA 1VQ6A 4VUBA 2YUPA 1Z9QA 2AIRB 3CMEQ 4PJOA 1D0ZA 4RUGA 3NTHA 5LJ5j 1PSFA 1JEGA 1PSEA 2P0PA 1Q95G 2SRCA 2CP0A 1R8OB 1KD1U 4M77C 3RBBB 4XTXA 2YDLA 1XTDA 4C8QA 2DVEA 2OTLA 1ZBJA 2JM9A 2J06A 4XAXB 4N4HA 5DLOA 1H92A 1U06A 4PJOG 3OBWA 1BYMA 2LCSA 1MUZA 4PJNA 1WJQA 4BACA 3NHNA 1M2VB 3G4SQ 1AWWA 1AEYA 4DBFA 1VQ4T 1K73U 5AYFA 3TSZA 1Y96A 2KROA 4DA4A 4C8QG 2O88A 3SDZA 4M78E 4M7DC 1BU1A 1VQKQ 1GL5A 1N8RR 5FU7B 3TEEA 3SWNC 1M1KC 5L23A 4J7FA 1YBYA 1SG5A 2RA2A 4J9FA 4WCIA 3S3NA 2DETA 1YJNA 3I56A 1VQ6Q 4XK8E 3T9NA 3I5SA 4FCYA 4C0ZA 1QWFA 4OMFB 1YI2A 3E9GA 5M9OA 3EG0A 2Y4XA 1OOTA 2HQXA 3INZA 2BZ8A 4AG2C 2LZ6B 3CXCP 3QWYA 4RTZA 2DLPA 2OTLQ 1RLQC 4D6WA 2DJQA 5GANf 4PLIA 2EYQA 2QQAA 1UB4A 4M78B 3S3MA 2RQUA 2WSCE 1BKBA 1K9MC 1X43A 2HKNA 3KFVA 2J05A 1KIKA 1I4K1 1G3TA 1M27C 2R58A 1RI9A 4HXJA 5ECAA 2K3YA 1OI1A 1VYVA 5CKDA 2NUPA 3CEYA 1S72T 2C06A 2L8DA 3VS5A 2KRNA 1YJNQ 1LOJA 5EC7A 3I56Q 2X4XA 4FSSA 4GLMA 1T0JA 2M16A 2CREA 1OEBA 1BBZA 3LGLA 3OYFA 1NJIC 2LCLA 1C0MA 2JVVA 4ZN3A 2YLCA 3LYIA 4KH1B 1TU0B 3RUXA 2CYZB 2MF2A 1YI2Q 4AT1B 3KXTA 3PMIA 4HT8A 1VIEA 2KRMA 2KE9A 4KGZB 4TVRA 5IXFA 2CUDA 4RTUA 4J9CA 4E47A 4C92A 2YHTA 3TVTA 2RHUA 1OPLA 4QW2A 3U23A 3UPUA 1G5VA 3R6OA 5KCHA 3L2UA 3G6EA 2YUQA 3UDCA 1YFNA 3SHWA 2DL4A 8AT1B 1WHJA 2R57A 1E6GA 4RG2A 1Q82C 1TUGB 1JU5C 2JNGA 2XI9A 4AFZC 1PC0A 4PJOE 3QO3A 3VS4A 4DOWA 4C92G 1UGPB 2C0TA 1WYXA 1BCMA 3H0IA 2F2WA 1K0XA 1BI1A 1I5OB 2PVDB 4BE1A 3OMCA 3CCSA 3OYHA 4C8QE 4J9DA 2CSQA 2VYTA 1ACMB 3VYHB 3PFSA 5IT9E 3QJ6A 2FVUA 2O01E 2DAQA 2KAFA 2CZ6B 5IHKA 2KDSA 3X25B 2DXBA 1Q7YC 1K0SA 4M77D 5I11A 2J6OA 2IPOB 2QK0A 2RD1A 1VQLA 4FIBA 3GPLA 3CC7Q 1BIAA 3G6EQ 2FO0A 2M0OA 4M7AC 4A53A 1M1KU 3ULRB 1QVGS 5GMKe 5KE2A 4M75B 3UATA 2EJFA 2LRQA 2H3EB 4M77F 2EQIA 4WTOB 2Y4YA 4FYVB 2ED0A 1D09B 1RACB 2K79A 4LDVA 3H0FA 2QEXT 2X3WD 1QQJA 3CCEA 4OB0B 1R77A 1TWBA 2KXCA 3CCSQ 1VQMA 4E6RA 2LTOA 3HTRA 2WSFE 1KD1R 2GNCA 2E6ZA 3FLGA 1G83A 2GGRA 1D1CA 1AZGB 2LQWA 1G3SA 1K9MU 7AT1B 1MMGA 4ME7A 2V8IA 2XG8D 1VQ5T 2RN8A 4HVVA 1VQLQ 3S3OA 4PL6A 3BDLA 4ELYC 1MNEA 1AWJA 1ZUKA 2GTOA 1K73R 3JB9H 1SSHA 1GRIA 1VUBA 2FYKA 3M0QA 3G71A 1SHGA 3CCMA 1WHLA 3CCVA 3OMGA 2IVWA 2RNAA 5AT1B 1NJIU 1WXTA 1W2BA 4JS4A 1QW1A 5FW9A 4AFSC 1GFCA 1JJ2P 3CCEQ 4KBMB 4IURA 3MPUB 3E2UA 2CT4A 1W1FA 1U3OA 1LPLA 4PJJA 1VQMQ 4QKUA 1H8KA 4OGCA 2MAMA 1SSFA 2D6FA 1WQ7A 3CD6T 2FEIA 1NLOC 3JCMV 1I5LA 5CQYA 4C5GA 4C92E 3RMQA 1YITT 4FW1A 3KUFA 3RIRA 5CAIA 4ZTFA 1CKAA 3H8ZA 3OB9A 3SFMA 3M0RA 4O5VA 3G1JA 1VQOA 1Q82U 4OMLA 3CCLT 5FRNA 3OA6A 4F7UE 4M75D 4FSXA 3CCUA 1OYXA 5KYYB 4II1A 1WJRA 1M2OA 1AHJB 3SD4A 3G71Q 3CCMQ 3CCVQ 1PKSA 2LNVA 2QTXA 1M3CA 2JT4A 1TTHB 2H8HA 1UJYA 1FMKA 1NPPA 4R0KA 1ZUUA 2JTMA 3CBPA 3JB9I 2K3XA 2EVRA 3ZFJA 5KYWB 4MZPA 2MPXC 4M75F 2X9HA 4ZN1A 3JB9D 4GLKA 2BUDA 3L2RA 3QHSA 1Q7YU 1FX7A 2B86A 5GAOl 3VJPA 4NL2A 2COYA 2KT1A 5FU6B 4OB3B 1G3YA 4MZMA 1IREB 3UA7A 3A8LB 3VS7A 3JB9F 1YJWT 1VQOQ 2ED1A 1FMWA 1WIEA 4XTVA 2LJ0A 2M0YA 2LC4A 2CKKA 2DRMA 2G6FX 3P8DA 1W6XA 2MWOA 1H3ZA 3CCUQ 1I81A 2D9TA 2F2VA 3QUIA 3OW2A 3H6ZA 1CKBA 4M7AD 4JRQA 3M9QA 1YJ9T 4XTZA 2X51A 3OS5A 4M78A 4LD9K 1QKXA 2HZYA 1SRMA 1VQ8T 2GF7A 3ASKA 1QMCA 3WXMB 4ORZA 1V76A 2EGAA 8ATCB 2LMJA 1KC8C 1VYTA 1P92A 3Q1JA 4M7AF 2YUNA 1NBEB 2WSEE 3CCQT 2ZPIB 1ZUYA 4M78G 4RTVA 1G2BA 2V8JA 2FPFA 1K9AA 1SRLA 2VB6A 2HKQB 2C0OA 1TS9A 1JRIA 1AWXA 1JB0E 3M56A 3EG9B 2KVQG 3CC2T 1AT1B 5A2QE 1X75C 2XD0A 1KQSA 2A3LA 1IO6A 2DK3A 2ZPGB 5GAN4 1M1KR 4RTXA 1BI3A 4RTYA 2RJCA 4GY5A 1I8FA 3VUZA 2HBWA 3A98A 4FW2A 1IB8A 3EHRA 5KCOA 1U1SA 2DZCA 3V7CA 5GAMh 1KG1A 3EGXA 4J6XA 5GAMe 3REAB 1K8AC 2RF0A 4QQDA 5D6WA 2I2LA 3UF4A 2JW4A 3UWNA 1OX9A 4HCZA 2DTHA 2DD5A 4P5NA 5GAN3 2HMAA 4OMPA 3JCMh 1D3BB 3VUBA 4OMNA 3OBYA 4LDXA 2DL7A 1BI0A 3CMAT 4RTTA 2YRVA 4JJCA 3H41A 1SKUB 2YT6A 4BDZA 4LE9A 4HCCA 2ZCFB 5GAOm 2HL5C 4XTWA 2Z0WA 3DB3A 3JV3A 1NE8A 1TUCA 1YWPA 3EGUA 4LD6A 4ELZC 4KULA 3G4SA 1ZX6A 2XDDA 2X35A 1M90C 5LJ5f 2HDAA 3CD6A 2VKNA 4X1VA 3LWHA 3PIOA 2MOXA 2VC8A 3OYDA 2AKKA 2EJ9A 3CPWA 5LJ3h 4AMCA 2PVOB 1ZLMA 3CC4T 5LJ3e 3MJXA 2RK1A 4DOVA 2L3RA 2E3HA 1AVZC 5FLXE 1N9RA 2JZ2A 1OPKA 4CRIA 1NYGA 1HYOA 3LX7A 3M0TA 3FJ5A 3MO8A 2GQIA 2RQRA 2HEQA 4AG1C 1G8XA 3HRSA 4M4ZA 3MP6A 1GXIE 2GCXA 1WHHA 2DO3A 3HSBA 1MMNA 5CO7A 1W70A 2JMAA 3FRNA 1AZEA 4Y92A 3LLRA 1D1BA 4N4GA 2RI5A 2FRYA 3V8KA 2HQHA 3QYHB 1Q82R 2EJGA 2QTVA 2XHCA 2W0ZA 2KR3A 3PIPA 2RO0A 2DXTA 2DZ9A 4Z02A 2VGNA 9ATCB 1QCFA 4XU3A 3CD6Q 2QDYB 1WHKA 1YHQA 4B9XA 4F14A 3QKJA 1B34B 1KC8U 3QPHA 3MKDA 1QVPA 4LXCA 1RAEB 3CCLQ 3CBMA 3MHXA 1VQPT 1JO8A 2COZA 4OMOA 1PD1A 3QG1A 2QGFB 1MGQA 4BY6C 2HD0A 1Q7YR 3LWIA 3FC3A 2DD4A 1JBMA 2O4XA 1UEBA 2QQRA 3GNFB 3C94A 5A0DA 1WHMA 3M53A 2O2OA 2VXFA 4JJDA 1QP3A 4A4GA 2V1QA 3MEUA 5GAMd 3I55A 4EIKA 2BTTA 3ER0A 2RJDA 4M77B 4BE0A 1UJ0A 4KUDK 3PT9A 1CSKA 2OI3A 1U5SA 1RUWA 3ZL7C 1W2BS 2JS2A 4C0DC 4LNPA 5CKBA 3OSSC 1KFZA 1UDLA 3H0HA 4BE2A 3JCMd 1K8AU 3CCQA 1YWOA 3X28B 3EG3A 4JS5A 4FT2A 1YHQQ 3HFOA 1BCOA 1X01A 2E3IA 4QQ6A 3CCJT 2VXEA 1YJWQ 4M7DB 2JTEA 2YRDA 3SWNB 1VQ9T 3DB4A 4R56A 2E12A 4K11A 2XDPA 5GJWB 2DTOA 2PQWA 2X3XD 3PE0A 1Y57A 2XDBA 2RQTA 2X4JA 2DJZA 5CVIA 3CBOA 3VS1A 3M0UA 1X6GA 3HKSA 3I55Q 5LJ3d 2YWWA 4EMKB 2XIDA 1M90U 3J7AF 3A8HB 2PTKA 1OQKA 3HP9A 1PNJA 3CC7A 1OU9A 1ZBXA 2M9UA 5GANh 2K2VA 5GAMg 3CCRT 3TQ7P 5GANe 1D0YA 3VS6A 1M4ZA 4BI8B 4PJOC 3QIIA 4PFZA 5GAOp 2L3PA 2BZXA 3EGDB 3TSWA 3CCQQ 4F7UA 3MP8A 3OYLA 3OYCA 2J6FA 1G3WA 3NMZC 3UA6A 4C8QC 2RQVA 2A37A 3JCMg 2LP5A 2IG0A 2EYXA 3VU3C 3OYIA 2OTJA 2CZ0B 4M75E 3UT1A 1XNIA 5L8RE 1UGRB 1QVGP 1WXUA 5CCAA 2KBTA 2V1RA 4F7UG 1PD0A 4CC3A 1PRLC 1LVKA 3EFOA 2EYYA 4KT0E 1FWZA 3ME9A 3C0CA 4JJBA 1QVFA 2DKGA 2QA4A 2D1XA 2VVKA 5CKFA 3L2ZA 3OW2S 1NEBA 1RAHB 1M1FA 3S6WA 2DXUA 3LW5E 3QYGB 4NOYA 4QVCA 4OB1B 5LJ3g 2V8KA 2QI2A 5GMKh 1Q86C 4E7IA 1YNZA 1MNDA 2K5IA 3V8LA 4OMQA 5GAN7 3JCMQ 3M4YA 4LN2A 3J80E 5HY6A 3QSUA 4HCBA 2DVJA 2E70A 4D8DA 3M55A 1ZSZA 2AZVA 2PZ1A 5A0GA 4M7DD 2RH2A 3EG9A 2MYSA 3OQ5A 2HBPA 4C5EA 1EZZB 4PJMA 2HNIA 4IUVA 4RMOA 2OTJQ 4N4IA 1OZ3A 1YIJT 1VQ4A 5CKHA 3ZEHA 2B8AA 4M7AE 3R6NA 1I1JA 1UGVA 1KQSS 4QT7A 1ZA2B 3H9NA 3I5RA 4M7DF 1B7TA 3A8OB 4FYXB 1R0BG 4XU2A 3RDVA 2DYIA 3CC4Q 2QA4Q 1NZ9A 2ATCB 4UC4A 1N5ZA 2JM8A 2DM1A 2QAZA 2BE9B 3MP1A 3EH2A 3EAEA 1Y96B 2K2MA 1D3BA 2KGTA 3A5ZB 3MEWA 4EPCA 3LGFA 2AKLA 2EQMA 1RADB 2MWPA 2EKHA 4F04B 5KYUB 3I9QA 5KYXA 4M7AB 1NYFA 3EFSA 2E1HA 1KC8R 4IIOA 5KE3A 4C5HA 1DJ7B 1RLPC 2O31A 1VQ7T 1M3BA 4FT4A 3VYGA 2LNHB 3M58A 5GANd 1VQ4Q 4C92C 1QKWA 3RR6A 4FYWB 2ZPEB 2K5FA 4Q5WA 1BB9A 2JUFA 2ZAEA 1K4US 4JLIA 1KJWA 3G7ZA 2L2PA 1S72A 1SPKA 2KXDA 4F17A 2JXBA 2RPNA 4XTUA 2FZCB 4B9WA 4E7LA 3HL8A 4MDXA 1V29B 4ZGDB 3CPWS 1VQ9A 1VA7A 4QQGA 3RKXA 4BI3A 1VQKT 2AT1B 1LNXA 1K8AR 4A4EA 4FYYB 3GNGA 1Z9ZA 1X2KA 4ATOA 1YN8A 2VASA 2JJ9A 4PJOD 1VQ6T 2OAUA 3KBGA 1X27A 1GCQA 3L2VA 5A0LA 2BZYA 2RHIA 2RK2A 4PFPA 3RESA 2O9SA 2X4YA 5I2SA 3OYBA 1O75A 1M2VA 2RHXA 2QQ9A 3L1AA 2KEAA 5GJVB 4KUIA 1U1TA 4C8QD 5LL6S 1A0NB 2PUKB 2M51A 2OTLT 2WACA 5C6SA 4PJOF 1YP5A 1KSWA 5IHIA 4J83A 5GANg 1S72Q 2VWFA 1XQHA 5GMKi 1PHTA 3I35A 2DBKA 2FRWA 1M90R 3CCJQ 1X2QA 1Q86U 1ZSZC 4C8QF 1WPYA 2PU9B 1IXDA 1GBRA 3VS2A 1VQ9Q 2XICA 4LDUA 1UFFA 4A54A 1ZHIA 4J7IA 2LCCA 3M5AA 1BK2A 1D1AA 2F5KA 5I21A 3A1PA 1KK7A 1OU8A 1YJNT 3I56T 3QDFA 2FL7A 3P8HA 2OJ2A 5EG2A 4C0FA 4V2SA 4M77A 4HVWA 4J9EA 3GIBA 2DL8A 1NPRA 1YI2T 1RI0A 2OAWA 3C95A 1QCOA 4OGEA 4L59A 3L2WA 1X69A 2GFAA 3M0PA 1VOMA 3NGPA 2EQKA 2M02A 3JCMf 3X24B 5GAMj 3BDUA 5GAOr 5DY9A 3QZ5B 2CH4W 3C12A 3O8VA 2QEXA 3GP8A 2L89A 4JDSA 3MEVA
chains in the Genus database with same CATH topology
2JNGA 4A4KA 2XI9A 2XK0A 2DZ9A 4Z02A 2CGHA 2VGNA 4JRPA 4PJOE 3PNWC 5FU6C 3QO3A 4DOWA 2MI6A 4XU3A 2A7YA 4C92G 3CCJA 1UGPB 1Y71A 2XKOC 2QDYB 3G4ST 2Y90A 2LQ8A 1BI1A 3V7SA 3CXCA 2K4YA 1YHQA 2RM4A 2ZZDA 4C5IA 2PVDB 4DQ2A 4BE1A 2DTIA 1WGSA 3OMCA 4B9XA 2FHDA 1WQWA 3QKJA 3CCSA 1B34B 3OYHA 3WVEB 4C8QE 3QPHA 1KC8U 1QVPA 3JB9J 2VYTA 4EMKA 2PVGB 1KHIA 5GMKl 3CBMA 3MHXA 3VYHB 1VQPT 1BIBA 3PFSA 5IT9E 1VQ5A 3QJ6A 2FVUA 2O01E 3QG1A 3BW1A 2DAQA 2KAFA 3QXEB 1MGQA 4BY6C 3OYNA 2CZ6B 2HD0A 2KDSA 5LJ3f 3X25B 3LWIA 2DXBA 1Q7YC 3FC3A 5DM7R 2DD4A 3FB9A 1JBMA 4M77D 1JJ2S 1QP2A 2G3RA 2O4XA 1UEBA 2QQRA 3GNFB 3C94A 5A0DA 3M53A 2RHYA 4Y91A 2VXFA 2RD1A 1VQLA 1QP3A 4A4GA 3MEUA 5GAMd 3I55A 3V7RA 3CCRA 4FIBA 3GPLA 1KHCA 1BIAA 2LDMA 2F5TX 2HAXA 3ER0A 2M0OA 2LVMA 4FM4B 4M7AC 4A53A 2RJDA 2ZGWA 4C92D 4M77B 4PKCC 4BE0A 4JRIA 1M1KU 4KUDK 3PT9A 1N8RU 5LJ3j 1QVGS 5GMKe 5KE2A 2P0QA 4M75B 1W2BS 4C0DC 2EJFA 2E41A 2LRQA 3META 5CKBA 3OSSC 4EMGA 3M57A 3G6ET 2DXCA 4XU0A 4M77F 2EFIA 1B34A 4BE2A 2KSSA 2Y4YA 3JCMd 4C92B 3CCQA 1K8AU 5C0MA 3X28B 3NFCA 4LDVA 4A4HA 2F69A 2QEXT 1VIFA 4JS5A 3NTIA 3X26B 3FIFA 4FT2A 3CCEA 4IUQA 3HFOA 2QQSA 4J6WA 1TH7A 4OB0B 4BB7A 4C92F 3VV0A 2QXFA 1X01A 1Y7XA 3SB2A 1VQMA 2DIQA 3JSCA 1M9SA 1YITA 4RG8A 4QQ6A 4EMHA 3CCJT 2VXEA 1YCYA 2LTOA 2DPPB 3HRTA 4F7UB 2WSFE 1U8RA 4M7DB 1LJOA 4CI0C 2E6ZA 3FLGA 3DKMA 3N5BB 5FU7C 3OS0A 1YHQT 1KD1C 3SWNB 4Y28E 1VQ9T 3DB4A 2E65A 4R56A 3CCST 4BI4A 3CCLA 2E12A 1HXDA 2XDPA 4F7UF 1G3SA 3DLLA 1H641 1K9MU 1QVFS 1O9SA 2DTOA 2PQWA 4ME7A 2V8IA 4HA8A 3OYEA 2XG8D 2YLBA 2XDBA 2MMPA 3E9FA 4N0AA 2X4JA 5GAMf 2DJZA 2RI2A 3CBOA 5CVIA 4M75A 1VQ5T 3HPWA 2LT4A 5IN1A 3HKSA 3S3OA 1JJ2A 4PL6A 3BDLA 4ELYC 5LJ3d 4EMKB 2E5QA 3L42A 3OYGA 2XIDA 4WF2A 3A8GB 3NTKA 4O6JA 5CQXA 1M90U 3J7AF 3A8HB 3JB9H 3QBYA 1KQ1A 4C0GA 3HP9A 1K73C 1VUBA 3CC7A 2FYKA 4MMKA 1ZBXA 2R5MA 3G71A 3M59A 3CCMA 2M9UA 5GANh 3CCVA 2K2VA 1VQLT 2BKDN 3I55T 3OMGA 2IVWA 5GAMg 3CCRT 3GOXA 4L5GA 5GANe 4IUUA 1M4ZA 4BI8B 4PJOC 3QIIA 1QVGA 1NJIU 4QVZA 4M78C 4M77G 5GAOp 2L5QA 5GAN5 3AHUA 1UGSB 4OF1A 1W2BA 4NL3A 1QW1A 4J8OA 2P4TA 2RJFA 3MP8A 4F7UA 3JAME 4M75G 3OYCA 3OYLA 4M7DA 2EQJA 4BD3A 1EIFA 5HKCA 4PNOA 1G3WA 4XU1A 3SWNA 2RB6A 3MEAA 5J3BA 1YIJA 4JLGA 3J81E 4E7JA 4KBMB 4IURA 4PLLA 4C8QC 3JCMg 1VQNA 4M77E 4MDWA 2IG0A 5CK9A 3VU3C 2R5AA 3URGA 4EDUA 4BUGA 1KQ2A 1M5Q1 3JRZA 3OYMA 3OYIA 2PUOB 2OTJA 2CZ0B 4M75E 4OGCA 3UT1A 5LJ5h 1MHNA 2ZPFB 4LDWA 3OY9A 3L2QA 3CCET 1XNIA 2MAMA 1SSFA 5LJ5e 5L8RE 3JCMJ 2E6NA 2D6FA 1UGRB 1WQ7A 3WVDB 3CD6T 1YJWA 3JCMV 3JCMP 5CQYA 4C5GA 5CCAA 1VQMT 4C92E 3RMQA 4X9DA 1YITT 1I5LA 3KUFA 3RIRA 4F7UG 5CAIA 4JS4A 3JB9G 4ZTFA 4M7DG 4QVDA 3H8ZA 5GMKm 2E10A 4KT0E 3ZBDA 2KMTA 1FWZA 3ME9A 3OB9A 4FU6A 1Q81U 3M4GA 3FJPA 2DKGA 4FL6A 4JRKA 3SFMA 1QVFA 4O5VA 2GFUA 3BFMA 1VQOA 1UGQB 3M54A 2QA4A 1WJSA 1Q82U 3CCLT 2NLUA 5CKFA 5FRNA 1YJ9A 3L2ZA 4X9CA 2K5LA 5HK3A 2HQEA 3OA6A 4F7UE 3OW2S 4M7AA 4M7DE 3PGGA 4M75D 2JTFA 3RKYA 1M1FA 3QJYA 4FSXA 3CCUA 3S6WA 1OYXA 2DXUA 4II1A 1WJRA 1AHJB 3LW5E 3QYGB 3SD4A 4NOYA 4QVCA 5D6XA 4OB1B 1VQ8A 1WNLA 3A8MB 5LJ3g 2LNVA 3PMTA 2V8KA 2QTXA 2P0KA 2QI2A 5GMKh 4RCBA 4EMKC 3CMEA 1Q86C 4E7IA 1N27A 4X34A 1NPPA 2K5IA 3V8LA 4J6YA 5GAN7 3JCMQ 1IZ6A 2JTMA 3CBPA 3M4YA 3JB9I 3J80E 3CC7T 2K3XA 3BY7A 5HY6A 3QSUA 3G71T 3CCMT 3ZFJA 3CCVT 1VQ7A 4HCBA 4MZPA 1X6OA 5GAOq 2E70A 4MZTA 2X4WA 3GF5A 3M55A 4XTYA 5CR2A 5A0GA 2JOYA 3JCMe 4M75F 4M7DD 4M7AG 4ZN1A 2RH2A 3JB9D 2D0QB 4GLKA 2BUDA 3L2RA 3OQ5A 2HBPA 2LX9A 4LDYA 4C5EA 3OYJA 3QHSA 3RKWA 1Q7YU 2HNIA 4IUVA 4RMOA 3JCMc 1FX7A 2DIGA 2K57A 5GAOl 3F70A 3GLXA 3JCMb 4N4IA 1OZ3A 5FROA 1YIJT 2JN0A 1OZ2A 2EKOA 1VQ4A 5CKHA 3VJPA 4NL2A 4A4FA 5FU6B 5GAN6 2CZ7B 3CC2A 5J39A 3ZEHA 3OYAA 5CKEA 2B8AA 1HK9A 4OB3B 4ZGEB 5FRMA 4M7AE 1G3YA 3CPFA 2ZPHB 2EWNA 3V8JA 4MZMA 1IREB 5GANj 1KQSS 2OTJT 3A8LB 1XOVA 2RJEA 2GQVA 4M7DF 2VUBA 3JB9F 3A8OB 4XU2A 3CXCS 1YJWT 1N9SA 4YTLA 1NZ9A 4OP0A 1VQKA 4UC4A 4XTVA 2LC4A 2CKKA 3P8DA 1ZQ1A 2FB7A 2MWOA 5GAOn 5GAN8 2ZPBB 1H3ZA 2BIVA 1I81A 2D9TA 4BY6B 4E7KA 2KY9A 4NS5A 2QA4T 3JCMW 1VQOT 3EAEA 1RL2A 3MP1A 3QUIA 1Y96B 3H6ZA 1D3BA 3OS1A 3OW2A 1Q81C 1VQ6A 4M7AD 3A5ZB 3MEWA 4JRQA 4VUBA 3M9QA 4EPCA 3LGFA 4XTZA 5HK0A 1YJ9T 4PJOA 3OS5A 2EQUA 3RMSA 4M78A 3NTHA 5LJ5j 1PSFA 4LD9K 2EQMA 3CCUT 2MWPA 1PSEA 5CIUA 2P0PA 5IAYA 3OYYA 3CMAA 1R8OB 1VQ8T 2GF7A 3ASKA 4M7AB 3WXMB 2VGMA 1KD1U 4M77C 3EFSA 4XTXA 4ZGJB 4C8QA 1XTDA 2E1HA 4N0AC 4R55A 2DVEA 5KE3A 1KC8C 2OTLA 4M75C 4C5HA 1DJ7B 1P92A 3Q1JA 4C0DB 1VQ7T 4XAXB 4FT4A 4OVAA 3X20B 4M7AF 4HKEA 4N4HA 5DLOA 3VYGA 2WSEE 3CCQT 3M58A 5GANd 4ZTJA 4PJOG 5DLQE 2ZPIB 3OBWA 4C92C 1BYMA 4M78G 4JJNK 2ZPEB 4RKUE 2K5FA 2V8JA 1WJQA 4XQ3A 4BACA 4Q5WA 2JUFA 3CC2T 3RERA 4JLIA 3VKIA 1JRIA 1JB0E 2CZ1B 3G7ZA 3M56A 1VQ4T 1K73U 1S72A 5GMKj 2KVQG 5AYFA 4HT9A 3C4SA 1Y96A 5A2QE 1X75C 4C8QG 4DA4A 3OYKA 1KQSA 2A3LA 3SDZA 2XD0A 4XTUA 2DK3A 3OSVA 4M78E 4OB2B 4M7DC 4L6V5 2ZPGB 4IUTA 5GAN4 1FXXA 4B9WA 5FU7B 4E7LA 1BI3A 2H3JA 3HL8A 3SWNC 3TEEA 4J7FA 1M1KC 1N8RC 3CC4A 1N6AA 4MDXA 1V29B 1YBYA 2RJCA 1I8FA 4GY5A 2RA2A 3VUZA 4ZGDB 3CPWS 3E1SA 3S3NA 1VQ9A 2AHJB 5LJ5d 1YJNA 3DLMA 3I56A 3HRUA 3RKXA 4QQGA 4BI3A 5KCOA 3HHTB 1U1SA 5I2MA 1VQKT 2DZCA 3V7CA 5GAMh 4XK8E 1LNXA 3T9NA 1KG1A 5GAN2 4J6XA 4A4EA 5GAMe 3GNGA 1K8AC 4C0ZA 4ATOA 4QQDA 5D6WA 4OMFB 1YI2A 3E9GA 4JUVA 2I2LA 5M9OA 3TCJA 1VQ6T 3UWNA 2OAUA 4PJOD 3KBGA 4M78D 2Y4XA 3L2VA 4HCZA 2HQXA 2DTHA 3INZA 5A0LA 3E19A 2RHIA 3PTAA 2DD5A 2RK2A 3RESA 2X4YA 4P5NA 5GAN3 5I2SA 2LQKA 3JCMh 4D6WA 1D3BB 3VUBA 2E64A 3JCMX 1BI2A 1O75A 3OBYA 3OYBA 2RHXA 2QQ9A 3L1AA 5GANf 1BI0A 3CMAT 4LDXA 4KUIA 1U1TA 4PLIA 4C8QD 2EYQA 2QQAA 2YRVA 4PJOB 5LL6S 1UB4A 4M78B 3EFRA 2EIFA 2PUKB 4RCCA 4BDZA 3S3MA 2WSCE 1BKBA 1K9MC 2OTLT 4HCCA 2WACA 5J26A 5C6SA 2ZCFB 4PJOF 5GAOm 4XTWA 3QZ9B 4M78F 4J83A 3DB3A 3OS2A 1VQNT 4C8QB 1I4K1 5GANg 1NE8A 4IKFA 1G3TA 2R58A 3P8BB 3TU4K 1XQHA 4LD6A 5GMKi 2M1HA 4ELZC 4KULA 3TREA 3G4SA 2K3YA 1OI1A 5KH6A 2XDDA 1Q86U 2X35A 5CKDA 1M90C 4C8QF 1WPYA 5LJ5f 4J5YA 2PU9B 3CEYA 1S72T 2C06A 2L8DA 3MCAB 2XICA 3QDRB 4LDUA 3CD6A 4A54A 1LOJA 1ZHIA 2KQWA 2LT1A 4J7IA 1Y07A 3LWHA 3PIOA 2LCCA 2VC8A 2X4XA 3M5AA 3OYDA 4BDYA 2RI3A 2EJ9A 1VQPA 2M16A 3CPWA 3OYFA 3LGLA 5LJ3h 1NJIC 1M8VA 2LCLA 2PVOB 3CC4T 2JVVA 4ZN3A 2F5KA 2YLCA 5I21A 5LJ3e 3LYIA 3RUXA 2RK1A 4MMLA 2CYZB 4DOVA 2MF2A 1YJNT 5LJ5g 2L3RA 3I56T 5FLXE 2FL7A 3P8HA 1N9RA 2JZ2A 5D6YA 4CRIA 3KXTA 3HFNA 3PMIA 5EG2A 4C0FA 4V2SA 2XU8A 4M77A 2VV5A 4HT8A 1VIEA 2RHZA 3LX7A 3LH0A 3GIBA 3MO8A 1NPRA 1YI2T 4IUPA 3HRSA 3FDRA 3CMET 1RI0A 3C95A 3MP6A 2GCXA 4OGEA 4TVRA 1GXIE 2QQBA 4L59A 2DO3A 3HSBA 5CO7A 3L2WA 4E47A 4C92A 1M1GA 1W4SA 2KK4A 2RHUA 2GFAA 2YHTA 3FRNA 4QW2A 2DEQA 3UPUA 2CS7A 2EAYA 3FEOA 3LLRA 3R6OA 5KCHA 4E7HA 3L2UA 3G6EA 1G5VA 4N4GA 2RI5A 3UDCA 3V8KA 3QYHB 2EQKA 2O4XB 3JCMf 5GAMj 2R57A 3X24B 3BDUA 5GAOr 2EJGA 4RG2A 1Q82C 2XHCA 3QZ5B 5DY9A 3C12A 3O8VA 3PIPA 2RO0A 2QEXA 3GP8A 2L89A 4JDSA 3MEVA 2DXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ATO A;  2XDB A;  2XD0 A;  4GLK A;  2XDD A;  4RMO A; 
#chains in the Genus database with same CATH topology
 2XK0 A;  2EYZ A;  3PNW C;  2A0F B;  3PVQ A;  5KYN A;  1WI7 A;  2A7Y A;  1YCS B;  2Y90 A;  2LQ8 A;  1WLP B;  2MIO A;  1MMA A;  2RM4 A;  2CH4 A;  2ZZD A;  2K6D A;  4DQ2 A;  2FG0 A;  2DTI A;  2FHD A;  1WQW A;  2LQN A;  3WVE B;  1WXB A;  4EMK A;  2PVG B;  2CP7 A;  1SEM A;  4CC4 B;  1BIB A;  4J9I A;  1VQ5 A;  5FWB A;  1JXO A;  3BW1 A;  3OYN A;  5LJ3 f;  1ARK A;  5DM7 R;  3FB9 A;  2G3R A;  2DEU A;  2RHY A;  3EGD A;  1UE9 A;  4Y91 A;  2QG9 B;  1C1A A;  2YRC A;  1QLY A;  2GBQ A;  4J9G A;  1KHC A;  3SEM A;  2CP6 A;  2LDM A;  2HAX A;  4F16 A;  1PRM C;  2QYZ A;  2LVM A;  4C92 D;  3D7S B;  2ECZ A;  4JRI A;  5LJ3 j;  2P0Q A;  2QEX Q;  3MET A;  3G6E T;  2DXC A;  2E4H A;  2QGG A;  4CC7 A;  5C0M A;  5I22 A;  3NFC A;  2F69 A;  1FMV A;  2HL3 A;  3NTI A;  4J6W A;  4C92 F;  2FPD A;  2QXF A;  3JSC A;  1YIT A;  4EMH A;  2F2X A;  5D7U A;  1LJO A;  3DKM A;  2NYS A;  5FU7 C;  4Y28 E;  1VQ5 Q;  2E65 A;  3CCS T;  3CCL A;  1HXD A;  4F7U F;  1QVF S;  1H64 1;  2K9G A;  1PM3 A;  2DF6 A;  2A28 A;  4HA8 A;  3OYE A;  1X6B A;  2YLB A;  2EW3 A;  2MMP A;  3E9F A;  4N0A A;  2RI2 A;  4M75 A;  3HPW A;  2LJ1 A;  2LT4 A;  5IN1 A;  2EGC A;  1JJ2 A;  2A08 A;  4GBQ A;  2O9V A;  3A8G B;  4AFU C;  1KQ1 A;  2KRS A;  1OUL A;  4MMK A;  1Y0M A;  3VRZ A;  2R5M A;  1VQL T;  2ENM A;  3GOX A;  4L5G A;  2OX7 A;  5IXB A;  1OV3 A;  1VQ7 Q;  3AHU A;  2YUO A;  4M78 C;  2P84 A;  5GAN 5;  1UGS B;  2KYB A;  4OF1 A;  4NL3 A;  2RJF A;  4M75 G;  2EQJ A;  4BD3 A;  4PNO A;  2RB6 A;  3MEA A;  5J3B A;  2F1L A;  4JLG A;  3J81 E;  4PLL A;  2ESW A;  4LUE A;  4M77 E;  4DBH A;  5CK9 A;  2R5A A;  3URG A;  4EDU A;  1ZSG A;  1YIT Q;  1M5Q 1;  3JRZ A;  3THK A;  3OYM A;  2PUO B;  1UUE A;  2NUT B;  5LJ5 h;  3VS3 A;  4LDW A;  3L2Q A;  3CCE T;  5LJ5 e;  3PVL A;  2E6N A;  1YJW A;  2KI7 A;  2KYM A;  1VQM T;  4HCK A;  4X9D A;  1W2B P;  2DL3 A;  3JB9 G;  3EG1 A;  2D8H A;  2E10 A;  1SHF A;  3REB B;  2CT3 A;  4FU6 A;  4HVU A;  3M4G A;  4JRK A;  3FJP A;  2GFU A;  3M54 A;  2NLU A;  3CQT A;  5KYU A;  2YSQ A;  1TG0 A;  1YJ9 A;  2K5L A;  1WHG A;  4M7A A;  4M7D E;  3PGG A;  2JTF A;  4ANJ A;  1T3L A;  3QJY A;  1TOV A;  1AOJ A;  3GBQ A;  5D6X A;  1VQ8 A;  1WNL A;  2YXY A;  1Q86 R;  2V26 A;  3PMT A;  4RCB A;  4EMK C;  4J6Y A;  1HD3 A;  2JS0 A;  1UHF A;  4JZ3 A;  3BY7 A;  1HJD A;  4Z88 A;  3G71 T;  3CCM T;  3CCV T;  1WX6 A;  4MZT A;  3GF5 A;  2LX7 A;  2JOY A;  1UHC A;  4M7A G;  1TSF A;  4LDY A;  2LX9 A;  3OYJ A;  2HSE B;  3O5Z A;  2DIG A;  2K57 A;  2L3S A;  3JCM b;  2RMO A;  2JN0 A;  1OZ2 A;  2EKO A;  1JXM A;  4RTW A;  4A4F A;  5GAN 6;  2D0N A;  5J39 A;  3CC2 A;  1HK9 A;  3IQL A;  3CPF A;  3V8J A;  2EWN A;  4ESR A;  5GAN j;  1NEG A;  5KYY A;  2E5K A;  2RJE A;  1HSQ A;  2VUB A;  3CXC S;  1N9S A;  2DX1 A;  4PJL A;  1B3Q A;  4OP0 A;  1YJ9 Q;  1ZQ1 A;  2FB7 A;  5GAN 8;  2ZPB B;  1ZA1 B;  1GBQ A;  2BIV A;  2EGE A;  5KYW A;  4BY6 B;  4E7K A;  3JCM W;  1VQO T;  4NS5 A;  1RL2 A;  3OS1 A;  2HSP A;  5IHN A;  1Q81 C;  1S1N A;  1VQ8 Q;  2I0N A;  1H3H A;  2ROL A;  5HK0 A;  2EQU A;  3RMS A;  3CCU T;  2KNB B;  1I0C A;  5CIU A;  1E7O A;  5IAY A;  2W10 A;  3OYY A;  3CMA A;  4D8K A;  2DER A;  2VGM A;  4ZGJ B;  3EGX B;  4N0A C;  4R55 A;  1FYN A;  2IIM A;  4M75 C;  4C0D B;  3X20 B;  4OVA A;  4HKE A;  3OW2 P;  1M3A A;  4ZTJ A;  5DLQ E;  2CSI A;  1QCN A;  3CC2 Q;  1RAG B;  4JJN K;  4RKU E;  4XQ3 A;  3RER A;  1M8M A;  3VKI A;  2CZ1 B;  5GMK j;  4HT9 A;  3C4S A;  3OYK A;  3OSV A;  4OB2 B;  4OMM A;  4L6V 5;  2CP2 A;  4IUT A;  1FXX A;  2P4R A;  5HCK A;  6AT1 B;  2H3J A;  3CC4 A;  1QWE A;  1N8R C;  1N6A A;  3E1S A;  4KGX B;  2AHJ B;  5LJ5 d;  1IHW A;  3DLM A;  1PCX A;  3HRU A;  3HHT B;  3EH1 A;  5I2M A;  4DBQ A;  2KT8 A;  1GFD A;  3EHQ A;  1ABQ A;  5GAN 2;  2ROT A;  2FPE A;  1MV3 A;  1UG1 A;  4JUV A;  3TCJ A;  1WFW A;  1KQS P;  4PFO A;  3CMA Q;  4M78 D;  3PTA A;  3E19 A;  2L3Q A;  2LQK A;  3JCM X;  2E64 A;  1BI2 A;  1I07 A;  4PJO B;  4J9H A;  3EFR A;  2EIF A;  4RCC A;  1AD5 A;  2NUZ A;  1T3S A;  5J26 A;  2DYB A;  3QZ9 B;  4LUD A;  4M78 F;  3OS2 A;  1WDX A;  4C8Q B;  1VQN T;  4IKF A;  3P8B B;  3TU4 K;  2M1H A;  2DE0 X;  2DRK A;  3TRE A;  1LCK A;  1V1C A;  5KH6 A;  1GCP A;  4J5Y A;  3MCA B;  3QDR B;  2LT1 A;  2KQW A;  1PWT A;  1Y07 A;  4BDY A;  2RI3 A;  3BE3 A;  1VQP A;  1M8V A;  1SF9 A;  4KRT A;  4MML A;  1PG5 B;  3M0S A;  5LJ5 g;  5D6Y A;  2QDL A;  3HFN A;  2MK5 A;  2XU8 A;  2VV5 A;  2RHZ A;  5IH2 A;  3LH0 A;  1T0H A;  4IUP A;  3FDR A;  3CME T;  1RAA B;  4DEY A;  1RAF B;  2QQB A;  2J7I A;  2DA9 A;  1XJW B;  2AZS A;  3CPW P;  1M1G A;  1W4S A;  2KK4 A;  1C6V X;  2DEQ A;  1OX8 A;  2CS7 A;  2EAY A;  3FEO A;  3VS0 A;  4E7H A;  2MCN A;  2XMF A;  2FZK B;  2O4X B;  2EBP A;  1RAI B;  1Q81 U;  4A4K A;  2J6K A;  2CGH A;  4JRP A;  5FU6 C;  2MI6 A;  1WZO A;  3CCJ A;  1Y71 A;  2XKO C;  3G4S T;  4J9B A;  1PKT A;  3V7S A;  3CXC A;  3RNJ A;  2K4Y A;  1VQP Q;  4B6M A;  4C5I A;  2HCK A;  1WGS A;  4A63 B;  3JB9 J;  1ABO A;  1R0C B;  2NWM A;  1KHI A;  5GMK l;  2NUP B;  1NM7 A;  3QXE B;  2RQW A;  4DEX A;  1JJ2 S;  1QP2 A;  3V7R A;  3CCR A;  2F5T X;  4AFQ C;  4FM4 B;  2ZGW A;  4PKC C;  1EX4 A;  1N8R U;  1IHV A;  1RAB B;  2E41 A;  1MMD A;  1TUD A;  4EMG A;  3M57 A;  2NUT A;  4XU0 A;  2EFI A;  4KGV B;  1B34 A;  2KSS A;  2CUB A;  4C92 B;  2DIL A;  4Z8A A;  1E6H A;  4A4H A;  1NLP C;  1VIF A;  3X26 B;  3FIF A;  4Z89 A;  4IUQ A;  2EPD A;  4BB7 A;  2QQS A;  1TH7 A;  2FZG B;  3VV0 A;  1Y7X A;  3SB2 A;  2DIQ A;  4PK4 A;  1M9S A;  4RG8 A;  1U8R A;  4F7U B;  1YCY A;  2DPP B;  3HRT A;  4CI0 C;  3OS0 A;  3N5B B;  1KD1 C;  2ABL A;  1YHQ T;  1K1Z A;  4BI4 A;  3DLL A;  1O9S A;  2PNI A;  2GTJ A;  4CC2 A;  2QAS A;  5GAM f;  4JPB W;  1NG2 A;  3CCR Q;  2AK5 A;  1D0X A;  1IGQ A;  2DNU A;  1VYU A;  2DL5 A;  2E5Q A;  3L42 A;  3OYG A;  4WF2 A;  5CQX A;  3NTK A;  4O6J A;  3QBY A;  4E7Z A;  4C0G A;  3EFO B;  1K73 C;  1UEC A;  3M59 A;  2BKD N;  3I55 T;  4IUU A;  1QVG A;  4QVZ A;  4M77 G;  2D8J A;  2L5Q A;  3JAM E;  4J8O A;  2P4T A;  4M7D A;  1M30 A;  1EIF A;  5HKC A;  2BE7 D;  4XU1 A;  3SWN A;  1YIJ A;  4E7J A;  1VQN A;  4MDW A;  4BUG A;  1KQ2 A;  1IRX A;  3AT1 B;  1J3T A;  3OY9 A;  1MHN A;  2ZPF B;  1ZSZ B;  3JCM J;  4JZ4 A;  3VRY A;  3WVD B;  1AWO A;  3JCM P;  2L0A A;  4DBR A;  4M7D G;  4QVD A;  5GMK m;  2SEM A;  3ZBD A;  2KMT A;  4FL6 A;  2CP5 A;  4IIM A;  3BFM A;  1UGQ B;  1WJS A;  1WA7 A;  4E2F B;  2K3B A;  4X9C A;  5HK3 A;  1B07 A;  2DFU A;  2HQE A;  5FWC A;  3RKY A;  3NPF A;  4ZNX A;  3A8M B;  1F1B B;  2P0K A;  3CME A;  1N27 A;  4X34 A;  1IZ6 A;  3CC7 T;  1QVF P;  1VQ7 A;  1X6O A;  5GAO q;  1IGU A;  4XTY A;  2X4W A;  1GCQ C;  5CR2 A;  2C0I A;  1YIJ Q;  3JCM e;  2D0Q B;  4E7S A;  1VQN Q;  1K9M R;  3RKW A;  3JCM c;  2K7A A;  3F70 A;  3GLX A;  5FRO A;  1K76 A;  2CDT A;  4KH0 B;  5KYX B;  1UTI A;  2CZ7 B;  3EG2 A;  3OYA A;  5CKE A;  4ZGE B;  2DMO A;  5FRM A;  3LH5 A;  2ZPH B;  2EYW A;  2OTJ T;  1XOV A;  2JMC A;  2GQV A;  2LJ3 A;  2COW A;  4YTL A;  1VQK A;  1MV0 B;  1TXQ A;  1NJI R;  5GAO n;  2A36 A;  1JQQ A;  3QWX X;  2KY9 A;  2QA4 T;  1Q81 R;  1EFN A;  2CP3 A;  2DBM A;  1VQ6 A;  4VUB A;  2YUP A;  1Z9Q A;  2AIR B;  3CME Q;  4PJO A;  1D0Z A;  4RUG A;  3NTH A;  5LJ5 j;  1PSF A;  1JEG A;  1PSE A;  2P0P A;  1Q95 G;  2SRC A;  2CP0 A;  1R8O B;  1KD1 U;  4M77 C;  3RBB B;  4XTX A;  2YDL A;  1XTD A;  4C8Q A;  2DVE A;  2OTL A;  1ZBJ A;  2JM9 A;  2J06 A;  4XAX B;  4N4H A;  5DLO A;  1H92 A;  1U06 A;  4PJO G;  3OBW A;  1BYM A;  2LCS A;  1MUZ A;  4PJN A;  1WJQ A;  4BAC A;  3NHN A;  1M2V B;  3G4S Q;  1AWW A;  1AEY A;  4DBF A;  1VQ4 T;  1K73 U;  5AYF A;  3TSZ A;  1Y96 A;  2KRO A;  4DA4 A;  4C8Q G;  2O88 A;  3SDZ A;  4M78 E;  4M7D C;  1BU1 A;  1VQK Q;  1GL5 A;  1N8R R;  5FU7 B;  3TEE A;  3SWN C;  1M1K C;  5L23 A;  4J7F A;  1YBY A;  1SG5 A;  2RA2 A;  4J9F A;  4WCI A;  3S3N A;  2DET A;  1YJN A;  3I56 A;  1VQ6 Q;  4XK8 E;  3T9N A;  3I5S A;  4FCY A;  4C0Z A;  1QWF A;  4OMF B;  1YI2 A;  3E9G A;  5M9O A;  3EG0 A;  2Y4X A;  1OOT A;  2HQX A;  3INZ A;  2BZ8 A;  4AG2 C;  2LZ6 B;  3CXC P;  3QWY A;  4RTZ A;  2DLP A;  2OTL Q;  1RLQ C;  4D6W A;  2DJQ A;  5GAN f;  4PLI A;  2EYQ A;  2QQA A;  1UB4 A;  4M78 B;  3S3M A;  2RQU A;  2WSC E;  1BKB A;  1K9M C;  1X43 A;  2HKN A;  3KFV A;  2J05 A;  1KIK A;  1I4K 1;  1G3T A;  1M27 C;  2R58 A;  1RI9 A;  4HXJ A;  5ECA A;  2K3Y A;  1OI1 A;  1VYV A;  5CKD A;  2NUP A;  3CEY A;  1S72 T;  2C06 A;  2L8D A;  3VS5 A;  2KRN A;  1YJN Q;  1LOJ A;  5EC7 A;  3I56 Q;  2X4X A;  4FSS A;  4GLM A;  1T0J A;  2M16 A;  2CRE A;  1OEB A;  1BBZ A;  3LGL A;  3OYF A;  1NJI C;  2LCL A;  1C0M A;  2JVV A;  4ZN3 A;  2YLC A;  3LYI A;  4KH1 B;  1TU0 B;  3RUX A;  2CYZ B;  2MF2 A;  1YI2 Q;  4AT1 B;  3KXT A;  3PMI A;  4HT8 A;  1VIE A;  2KRM A;  2KE9 A;  4KGZ B;  4TVR A;  5IXF A;  2CUD A;  4RTU A;  4J9C A;  4E47 A;  4C92 A;  2YHT A;  3TVT A;  2RHU A;  1OPL A;  4QW2 A;  3U23 A;  3UPU A;  1G5V A;  3R6O A;  5KCH A;  3L2U A;  3G6E A;  2YUQ A;  3UDC A;  1YFN A;  3SHW A;  2DL4 A;  8AT1 B;  1WHJ A;  2R57 A;  1E6G A;  4RG2 A;  1Q82 C;  1TUG B;  1JU5 C;  2JNG A;  2XI9 A;  4AFZ C;  1PC0 A;  4PJO E;  3QO3 A;  3VS4 A;  4DOW A;  4C92 G;  1UGP B;  2C0T A;  1WYX A;  1BCM A;  3H0I A;  2F2W A;  1K0X A;  1BI1 A;  1I5O B;  2PVD B;  4BE1 A;  3OMC A;  3CCS A;  3OYH A;  4C8Q E;  4J9D A;  2CSQ A;  2VYT A;  1ACM B;  3VYH B;  3PFS A;  5IT9 E;  3QJ6 A;  2FVU A;  2O01 E;  2DAQ A;  2KAF A;  2CZ6 B;  5IHK A;  2KDS A;  3X25 B;  2DXB A;  1Q7Y C;  1K0S A;  4M77 D;  5I11 A;  2J6O A;  2IPO B;  2QK0 A;  2RD1 A;  1VQL A;  4FIB A;  3GPL A;  3CC7 Q;  1BIA A;  3G6E Q;  2FO0 A;  2M0O A;  4M7A C;  4A53 A;  1M1K U;  3ULR B;  1QVG S;  5GMK e;  5KE2 A;  4M75 B;  3UAT A;  2EJF A;  2LRQ A;  2H3E B;  4M77 F;  2EQI A;  4WTO B;  2Y4Y A;  4FYV B;  2ED0 A;  1D09 B;  1RAC B;  2K79 A;  4LDV A;  3H0F A;  2QEX T;  2X3W D;  1QQJ A;  3CCE A;  4OB0 B;  1R77 A;  1TWB A;  2KXC A;  3CCS Q;  1VQM A;  4E6R A;  2LTO A;  3HTR A;  2WSF E;  1KD1 R;  2GNC A;  2E6Z A;  3FLG A;  1G83 A;  2GGR A;  1D1C A;  1AZG B;  2LQW A;  1G3S A;  1K9M U;  7AT1 B;  1MMG A;  4ME7 A;  2V8I A;  2XG8 D;  1VQ5 T;  2RN8 A;  4HVV A;  1VQL Q;  3S3O A;  4PL6 A;  3BDL A;  4ELY C;  1MNE A;  1AWJ A;  1ZUK A;  2GTO A;  1K73 R;  3JB9 H;  1SSH A;  1GRI A;  1VUB A;  2FYK A;  3M0Q A;  3G71 A;  1SHG A;  3CCM A;  1WHL A;  3CCV A;  3OMG A;  2IVW A;  2RNA A;  5AT1 B;  1NJI U;  1WXT A;  1W2B A;  4JS4 A;  1QW1 A;  5FW9 A;  4AFS C;  1GFC A;  1JJ2 P;  3CCE Q;  4KBM B;  4IUR A;  3MPU B;  3E2U A;  2CT4 A;  1W1F A;  1U3O A;  1LPL A;  4PJJ A;  1VQM Q;  4QKU A;  1H8K A;  4OGC A;  2MAM A;  1SSF A;  2D6F A;  1WQ7 A;  3CD6 T;  2FEI A;  1NLO C;  3JCM V;  1I5L A;  5CQY A;  4C5G A;  4C92 E;  3RMQ A;  1YIT T;  4FW1 A;  3KUF A;  3RIR A;  5CAI A;  4ZTF A;  1CKA A;  3H8Z A;  3OB9 A;  3SFM A;  3M0R A;  4O5V A;  3G1J A;  1VQO A;  1Q82 U;  4OML A;  3CCL T;  5FRN A;  3OA6 A;  4F7U E;  4M75 D;  4FSX A;  3CCU A;  1OYX A;  5KYY B;  4II1 A;  1WJR A;  1M2O A;  1AHJ B;  3SD4 A;  3G71 Q;  3CCM Q;  3CCV Q;  1PKS A;  2LNV A;  2QTX A;  1M3C A;  2JT4 A;  1TTH B;  2H8H A;  1UJY A;  1FMK A;  1NPP A;  4R0K A;  1ZUU A;  2JTM A;  3CBP A;  3JB9 I;  2K3X A;  2EVR A;  3ZFJ A;  5KYW B;  4MZP A;  2MPX C;  4M75 F;  2X9H A;  4ZN1 A;  3JB9 D;  4GLK A;  2BUD A;  3L2R A;  3QHS A;  1Q7Y U;  1FX7 A;  2B86 A;  5GAO l;  3VJP A;  4NL2 A;  2COY A;  2KT1 A;  5FU6 B;  4OB3 B;  1G3Y A;  4MZM A;  1IRE B;  3UA7 A;  3A8L B;  3VS7 A;  3JB9 F;  1YJW T;  1VQO Q;  2ED1 A;  1FMW A;  1WIE A;  4XTV A;  2LJ0 A;  2M0Y A;  2LC4 A;  2CKK A;  2DRM A;  2G6F X;  3P8D A;  1W6X A;  2MWO A;  1H3Z A;  3CCU Q;  1I81 A;  2D9T A;  2F2V A;  3QUI A;  3OW2 A;  3H6Z A;  1CKB A;  4M7A D;  4JRQ A;  3M9Q A;  1YJ9 T;  4XTZ A;  2X51 A;  3OS5 A;  4M78 A;  4LD9 K;  1QKX A;  2HZY A;  1SRM A;  1VQ8 T;  2GF7 A;  3ASK A;  1QMC A;  3WXM B;  4ORZ A;  1V76 A;  2EGA A;  8ATC B;  2LMJ A;  1KC8 C;  1VYT A;  1P92 A;  3Q1J A;  4M7A F;  2YUN A;  1NBE B;  2WSE E;  3CCQ T;  2ZPI B;  1ZUY A;  4M78 G;  4RTV A;  1G2B A;  2V8J A;  2FPF A;  1K9A A;  1SRL A;  2VB6 A;  2HKQ B;  2C0O A;  1TS9 A;  1JRI A;  1AWX A;  1JB0 E;  3M56 A;  3EG9 B;  2KVQ G;  3CC2 T;  1AT1 B;  5A2Q E;  1X75 C;  2XD0 A;  1KQS A;  2A3L A;  1IO6 A;  2DK3 A;  2ZPG B;  5GAN 4;  1M1K R;  4RTX A;  1BI3 A;  4RTY A;  2RJC A;  4GY5 A;  1I8F A;  3VUZ A;  2HBW A;  3A98 A;  4FW2 A;  1IB8 A;  3EHR A;  5KCO A;  1U1S A;  2DZC A;  3V7C A;  5GAM h;  1KG1 A;  3EGX A;  4J6X A;  5GAM e;  3REA B;  1K8A C;  2RF0 A;  4QQD A;  5D6W A;  2I2L A;  3UF4 A;  2JW4 A;  3UWN A;  1OX9 A;  4HCZ A;  2DTH A;  2DD5 A;  4P5N A;  5GAN 3;  2HMA A;  4OMP A;  3JCM h;  1D3B B;  3VUB A;  4OMN A;  3OBY A;  4LDX A;  2DL7 A;  1BI0 A;  3CMA T;  4RTT A;  2YRV A;  4JJC A;  3H41 A;  1SKU B;  2YT6 A;  4BDZ A;  4LE9 A;  4HCC A;  2ZCF B;  5GAO m;  2HL5 C;  4XTW A;  2Z0W A;  3DB3 A;  3JV3 A;  1NE8 A;  1TUC A;  1YWP A;  3EGU A;  4LD6 A;  4ELZ C;  4KUL A;  3G4S A;  1ZX6 A;  2XDD A;  2X35 A;  1M90 C;  5LJ5 f;  2HDA A;  3CD6 A;  2VKN A;  4X1V A;  3LWH A;  3PIO A;  2MOX A;  2VC8 A;  3OYD A;  2AKK A;  2EJ9 A;  3CPW A;  5LJ3 h;  4AMC A;  2PVO B;  1ZLM A;  3CC4 T;  5LJ3 e;  3MJX A;  2RK1 A;  4DOV A;  2L3R A;  2E3H A;  1AVZ C;  5FLX E;  1N9R A;  2JZ2 A;  1OPK A;  4CRI A;  1NYG A;  1HYO A;  3LX7 A;  3M0T A;  3FJ5 A;  3MO8 A;  2GQI A;  2RQR A;  2HEQ A;  4AG1 C;  1G8X A;  3HRS A;  4M4Z A;  3MP6 A;  1GXI E;  2GCX A;  1WHH A;  2DO3 A;  3HSB A;  1MMN A;  5CO7 A;  1W70 A;  2JMA A;  3FRN A;  1AZE A;  4Y92 A;  3LLR A;  1D1B A;  4N4G A;  2RI5 A;  2FRY A;  3V8K A;  2HQH A;  3QYH B;  1Q82 R;  2EJG A;  2QTV A;  2XHC A;  2W0Z A;  2KR3 A;  3PIP A;  2RO0 A;  2DXT A;  2DZ9 A;  4Z02 A;  2VGN A;  9ATC B;  1QCF A;  4XU3 A;  3CD6 Q;  2QDY B;  1WHK A;  1YHQ A;  4B9X A;  4F14 A;  3QKJ A;  1B34 B;  1KC8 U;  3QPH A;  3MKD A;  1QVP A;  4LXC A;  1RAE B;  3CCL Q;  3CBM A;  3MHX A;  1VQP T;  1JO8 A;  2COZ A;  4OMO A;  1PD1 A;  3QG1 A;  2QGF B;  1MGQ A;  4BY6 C;  2HD0 A;  1Q7Y R;  3LWI A;  3FC3 A;  2DD4 A;  1JBM A;  2O4X A;  1UEB A;  2QQR A;  3GNF B;  3C94 A;  5A0D A;  1WHM A;  3M53 A;  2O2O A;  2VXF A;  4JJD A;  1QP3 A;  4A4G A;  2V1Q A;  3MEU A;  5GAM d;  3I55 A;  4EIK A;  2BTT A;  3ER0 A;  2RJD A;  4M77 B;  4BE0 A;  1UJ0 A;  4KUD K;  3PT9 A;  1CSK A;  2OI3 A;  1U5S A;  1RUW A;  3ZL7 C;  1W2B S;  2JS2 A;  4C0D C;  4LNP A;  5CKB A;  3OSS C;  1KFZ A;  1UDL A;  3H0H A;  4BE2 A;  3JCM d;  1K8A U;  3CCQ A;  1YWO A;  3X28 B;  3EG3 A;  4JS5 A;  4FT2 A;  1YHQ Q;  3HFO A;  1BCO A;  1X01 A;  2E3I A;  4QQ6 A;  3CCJ T;  2VXE A;  1YJW Q;  4M7D B;  2JTE A;  2YRD A;  3SWN B;  1VQ9 T;  3DB4 A;  4R56 A;  2E12 A;  4K11 A;  2XDP A;  5GJW B;  2DTO A;  2PQW A;  2X3X D;  3PE0 A;  1Y57 A;  2XDB A;  2RQT A;  2X4J A;  2DJZ A;  5CVI A;  3CBO A;  3VS1 A;  3M0U A;  1X6G A;  3HKS A;  3I55 Q;  5LJ3 d;  2YWW A;  4EMK B;  2XID A;  1M90 U;  3J7A F;  3A8H B;  2PTK A;  1OQK A;  3HP9 A;  1PNJ A;  3CC7 A;  1OU9 A;  1ZBX A;  2M9U A;  5GAN h;  2K2V A;  5GAM g;  3CCR T;  3TQ7 P;  5GAN e;  1D0Y A;  3VS6 A;  1M4Z A;  4BI8 B;  4PJO C;  3QII A;  4PFZ A;  5GAO p;  2L3P A;  2BZX A;  3EGD B;  3TSW A;  3CCQ Q;  4F7U A;  3MP8 A;  3OYL A;  3OYC A;  2J6F A;  1G3W A;  3NMZ C;  3UA6 A;  4C8Q C;  2RQV A;  2A37 A;  3JCM g;  2LP5 A;  2IG0 A;  2EYX A;  3VU3 C;  3OYI A;  2OTJ A;  2CZ0 B;  4M75 E;  3UT1 A;  1XNI A;  5L8R E;  1UGR B;  1QVG P;  1WXU A;  5CCA A;  2KBT A;  2V1R A;  4F7U G;  1PD0 A;  4CC3 A;  1PRL C;  1LVK A;  3EFO A;  2EYY A;  4KT0 E;  1FWZ A;  3ME9 A;  3C0C A;  4JJB A;  1QVF A;  2DKG A;  2QA4 A;  2D1X A;  2VVK A;  5CKF A;  3L2Z A;  3OW2 S;  1NEB A;  1RAH B;  1M1F A;  3S6W A;  2DXU A;  3LW5 E;  3QYG B;  4NOY A;  4QVC A;  4OB1 B;  5LJ3 g;  2V8K A;  2QI2 A;  5GMK h;  1Q86 C;  4E7I A;  1YNZ A;  1MND A;  2K5I A;  3V8L A;  4OMQ A;  5GAN 7;  3JCM Q;  3M4Y A;  4LN2 A;  3J80 E;  5HY6 A;  3QSU A;  4HCB A;  2DVJ A;  2E70 A;  4D8D A;  3M55 A;  1ZSZ A;  2AZV A;  2PZ1 A;  5A0G A;  4M7D D;  2RH2 A;  3EG9 A;  2MYS A;  3OQ5 A;  2HBP A;  4C5E A;  1EZZ B;  4PJM A;  2HNI A;  4IUV A;  4RMO A;  2OTJ Q;  4N4I A;  1OZ3 A;  1YIJ T;  1VQ4 A;  5CKH A;  3ZEH A;  2B8A A;  4M7A E;  3R6N A;  1I1J A;  1UGV A;  1KQS S;  4QT7 A;  1ZA2 B;  3H9N A;  3I5R A;  4M7D F;  1B7T A;  3A8O B;  4FYX B;  1R0B G;  4XU2 A;  3RDV A;  2DYI A;  3CC4 Q;  2QA4 Q;  1NZ9 A;  2ATC B;  4UC4 A;  1N5Z A;  2JM8 A;  2DM1 A;  2QAZ A;  2BE9 B;  3MP1 A;  3EH2 A;  3EAE A;  1Y96 B;  2K2M A;  1D3B A;  2KGT A;  3A5Z B;  3MEW A;  4EPC A;  3LGF A;  2AKL A;  2EQM A;  1RAD B;  2MWP A;  2EKH A;  4F04 B;  5KYU B;  3I9Q A;  5KYX A;  4M7A B;  1NYF A;  3EFS A;  2E1H A;  1KC8 R;  4IIO A;  5KE3 A;  4C5H A;  1DJ7 B;  1RLP C;  2O31 A;  1VQ7 T;  1M3B A;  4FT4 A;  3VYG A;  2LNH B;  3M58 A;  5GAN d;  1VQ4 Q;  4C92 C;  1QKW A;  3RR6 A;  4FYW B;  2ZPE B;  2K5F A;  4Q5W A;  1BB9 A;  2JUF A;  2ZAE A;  1K4U S;  4JLI A;  1KJW A;  3G7Z A;  2L2P A;  1S72 A;  1SPK A;  2KXD A;  4F17 A;  2JXB A;  2RPN A;  4XTU A;  2FZC B;  4B9W A;  4E7L A;  3HL8 A;  4MDX A;  1V29 B;  4ZGD B;  3CPW S;  1VQ9 A;  1VA7 A;  4QQG A;  3RKX A;  4BI3 A;  1VQK T;  2AT1 B;  1LNX A;  1K8A R;  4A4E A;  4FYY B;  3GNG A;  1Z9Z A;  1X2K A;  4ATO A;  1YN8 A;  2VAS A;  2JJ9 A;  4PJO D;  1VQ6 T;  2OAU A;  3KBG A;  1X27 A;  1GCQ A;  3L2V A;  5A0L A;  2BZY A;  2RHI A;  2RK2 A;  4PFP A;  3RES A;  2O9S A;  2X4Y A;  5I2S A;  3OYB A;  1O75 A;  1M2V A;  2RHX A;  2QQ9 A;  3L1A A;  2KEA A;  5GJV B;  4KUI A;  1U1T A;  4C8Q D;  5LL6 S;  1A0N B;  2PUK B;  2M51 A;  2OTL T;  2WAC A;  5C6S A;  4PJO F;  1YP5 A;  1KSW A;  5IHI A;  4J83 A;  5GAN g;  1S72 Q;  2VWF A;  1XQH A;  5GMK i;  1PHT A;  3I35 A;  2DBK A;  2FRW A;  1M90 R;  3CCJ Q;  1X2Q A;  1Q86 U;  1ZSZ C;  4C8Q F;  1WPY A;  2PU9 B;  1IXD A;  1GBR A;  3VS2 A;  1VQ9 Q;  2XIC A;  4LDU A;  1UFF A;  4A54 A;  1ZHI A;  4J7I A;  2LCC A;  3M5A A;  1BK2 A;  1D1A A;  2F5K A;  5I21 A;  3A1P A;  1KK7 A;  1OU8 A;  1YJN T;  3I56 T;  3QDF A;  2FL7 A;  3P8H A;  2OJ2 A;  5EG2 A;  4C0F A;  4V2S A;  4M77 A;  4HVW A;  4J9E A;  3GIB A;  2DL8 A;  1NPR A;  1YI2 T;  1RI0 A;  2OAW A;  3C95 A;  1QCO A;  4OGE A;  4L59 A;  3L2W A;  1X69 A;  2GFA A;  3M0P A;  1VOM A;  3NGP A;  2EQK A;  2M02 A;  3JCM f;  3X24 B;  5GAM j;  3BDU A;  5GAO r;  5DY9 A;  3QZ5 B;  2CH4 W;  3C12 A;  3O8V A;  2QEX A;  3GP8 A;  2L89 A;  4JDS A;  3MEV A; 
#chains in the Genus database with same CATH homology
 2JNG A;  4A4K A;  2XI9 A;  2XK0 A;  2DZ9 A;  4Z02 A;  2CGH A;  2VGN A;  4JRP A;  4PJO E;  3PNW C;  5FU6 C;  3QO3 A;  4DOW A;  2MI6 A;  4XU3 A;  2A7Y A;  4C92 G;  3CCJ A;  1UGP B;  1Y71 A;  2XKO C;  2QDY B;  3G4S T;  2Y90 A;  2LQ8 A;  1BI1 A;  3V7S A;  3CXC A;  2K4Y A;  1YHQ A;  2RM4 A;  2ZZD A;  4C5I A;  2PVD B;  4DQ2 A;  4BE1 A;  2DTI A;  1WGS A;  3OMC A;  4B9X A;  2FHD A;  1WQW A;  3QKJ A;  3CCS A;  1B34 B;  3OYH A;  3WVE B;  4C8Q E;  3QPH A;  1KC8 U;  1QVP A;  3JB9 J;  2VYT A;  4EMK A;  2PVG B;  1KHI A;  5GMK l;  3CBM A;  3MHX A;  3VYH B;  1VQP T;  1BIB A;  3PFS A;  5IT9 E;  1VQ5 A;  3QJ6 A;  2FVU A;  2O01 E;  3QG1 A;  3BW1 A;  2DAQ A;  2KAF A;  3QXE B;  1MGQ A;  4BY6 C;  3OYN A;  2CZ6 B;  2HD0 A;  2KDS A;  5LJ3 f;  3X25 B;  3LWI A;  2DXB A;  1Q7Y C;  3FC3 A;  5DM7 R;  2DD4 A;  3FB9 A;  1JBM A;  4M77 D;  1JJ2 S;  1QP2 A;  2G3R A;  2O4X A;  1UEB A;  2QQR A;  3GNF B;  3C94 A;  5A0D A;  3M53 A;  2RHY A;  4Y91 A;  2VXF A;  2RD1 A;  1VQL A;  1QP3 A;  4A4G A;  3MEU A;  5GAM d;  3I55 A;  3V7R A;  3CCR A;  4FIB A;  3GPL A;  1KHC A;  1BIA A;  2LDM A;  2F5T X;  2HAX A;  3ER0 A;  2M0O A;  2LVM A;  4FM4 B;  4M7A C;  4A53 A;  2RJD A;  2ZGW A;  4C92 D;  4M77 B;  4PKC C;  4BE0 A;  4JRI A;  1M1K U;  4KUD K;  3PT9 A;  1N8R U;  5LJ3 j;  1QVG S;  5GMK e;  5KE2 A;  2P0Q A;  4M75 B;  1W2B S;  4C0D C;  2EJF A;  2E41 A;  2LRQ A;  3MET A;  5CKB A;  3OSS C;  4EMG A;  3M57 A;  3G6E T;  2DXC A;  4XU0 A;  4M77 F;  2EFI A;  1B34 A;  4BE2 A;  2KSS A;  2Y4Y A;  3JCM d;  4C92 B;  3CCQ A;  1K8A U;  5C0M A;  3X28 B;  3NFC A;  4LDV A;  4A4H A;  2F69 A;  2QEX T;  1VIF A;  4JS5 A;  3NTI A;  3X26 B;  3FIF A;  4FT2 A;  3CCE A;  4IUQ A;  3HFO A;  2QQS A;  4J6W A;  1TH7 A;  4OB0 B;  4BB7 A;  4C92 F;  3VV0 A;  2QXF A;  1X01 A;  1Y7X A;  3SB2 A;  1VQM A;  2DIQ A;  3JSC A;  1M9S A;  1YIT A;  4RG8 A;  4QQ6 A;  4EMH A;  3CCJ T;  2VXE A;  1YCY A;  2LTO A;  2DPP B;  3HRT A;  4F7U B;  2WSF E;  1U8R A;  4M7D B;  1LJO A;  4CI0 C;  2E6Z A;  3FLG A;  3DKM A;  3N5B B;  5FU7 C;  3OS0 A;  1YHQ T;  1KD1 C;  3SWN B;  4Y28 E;  1VQ9 T;  3DB4 A;  2E65 A;  4R56 A;  3CCS T;  4BI4 A;  3CCL A;  2E12 A;  1HXD A;  2XDP A;  4F7U F;  1G3S A;  3DLL A;  1H64 1;  1K9M U;  1QVF S;  1O9S A;  2DTO A;  2PQW A;  4ME7 A;  2V8I A;  4HA8 A;  3OYE A;  2XG8 D;  2YLB A;  2XDB A;  2MMP A;  3E9F A;  4N0A A;  2X4J A;  5GAM f;  2DJZ A;  2RI2 A;  3CBO A;  5CVI A;  4M75 A;  1VQ5 T;  3HPW A;  2LT4 A;  5IN1 A;  3HKS A;  3S3O A;  1JJ2 A;  4PL6 A;  3BDL A;  4ELY C;  5LJ3 d;  4EMK B;  2E5Q A;  3L42 A;  3OYG A;  2XID A;  4WF2 A;  3A8G B;  3NTK A;  4O6J A;  5CQX A;  1M90 U;  3J7A F;  3A8H B;  3JB9 H;  3QBY A;  1KQ1 A;  4C0G A;  3HP9 A;  1K73 C;  1VUB A;  3CC7 A;  2FYK A;  4MMK A;  1ZBX A;  2R5M A;  3G71 A;  3M59 A;  3CCM A;  2M9U A;  5GAN h;  3CCV A;  2K2V A;  1VQL T;  2BKD N;  3I55 T;  3OMG A;  2IVW A;  5GAM g;  3CCR T;  3GOX A;  4L5G A;  5GAN e;  4IUU A;  1M4Z A;  4BI8 B;  4PJO C;  3QII A;  1QVG A;  1NJI U;  4QVZ A;  4M78 C;  4M77 G;  5GAO p;  2L5Q A;  5GAN 5;  3AHU A;  1UGS B;  4OF1 A;  1W2B A;  4NL3 A;  1QW1 A;  4J8O A;  2P4T A;  2RJF A;  3MP8 A;  4F7U A;  3JAM E;  4M75 G;  3OYC A;  3OYL A;  4M7D A;  2EQJ A;  4BD3 A;  1EIF A;  5HKC A;  4PNO A;  1G3W A;  4XU1 A;  3SWN A;  2RB6 A;  3MEA A;  5J3B A;  1YIJ A;  4JLG A;  3J81 E;  4E7J A;  4KBM B;  4IUR A;  4PLL A;  4C8Q C;  3JCM g;  1VQN A;  4M77 E;  4MDW A;  2IG0 A;  5CK9 A;  3VU3 C;  2R5A A;  3URG A;  4EDU A;  4BUG A;  1KQ2 A;  1M5Q 1;  3JRZ A;  3OYM A;  3OYI A;  2PUO B;  2OTJ A;  2CZ0 B;  4M75 E;  4OGC A;  3UT1 A;  5LJ5 h;  1MHN A;  2ZPF B;  4LDW A;  3OY9 A;  3L2Q A;  3CCE T;  1XNI A;  2MAM A;  1SSF A;  5LJ5 e;  5L8R E;  3JCM J;  2E6N A;  2D6F A;  1UGR B;  1WQ7 A;  3WVD B;  3CD6 T;  1YJW A;  3JCM V;  3JCM P;  5CQY A;  4C5G A;  5CCA A;  1VQM T;  4C92 E;  3RMQ A;  4X9D A;  1YIT T;  1I5L A;  3KUF A;  3RIR A;  4F7U G;  5CAI A;  4JS4 A;  3JB9 G;  4ZTF A;  4M7D G;  4QVD A;  3H8Z A;  5GMK m;  2E10 A;  4KT0 E;  3ZBD A;  2KMT A;  1FWZ A;  3ME9 A;  3OB9 A;  4FU6 A;  1Q81 U;  3M4G A;  3FJP A;  2DKG A;  4FL6 A;  4JRK A;  3SFM A;  1QVF A;  4O5V A;  2GFU A;  3BFM A;  1VQO A;  1UGQ B;  3M54 A;  2QA4 A;  1WJS A;  1Q82 U;  3CCL T;  2NLU A;  5CKF A;  5FRN A;  1YJ9 A;  3L2Z A;  4X9C A;  2K5L A;  5HK3 A;  2HQE A;  3OA6 A;  4F7U E;  3OW2 S;  4M7A A;  4M7D E;  3PGG A;  4M75 D;  2JTF A;  3RKY A;  1M1F A;  3QJY A;  4FSX A;  3CCU A;  3S6W A;  1OYX A;  2DXU A;  4II1 A;  1WJR A;  1AHJ B;  3LW5 E;  3QYG B;  3SD4 A;  4NOY A;  4QVC A;  5D6X A;  4OB1 B;  1VQ8 A;  1WNL A;  3A8M B;  5LJ3 g;  2LNV A;  3PMT A;  2V8K A;  2QTX A;  2P0K A;  2QI2 A;  5GMK h;  4RCB A;  4EMK C;  3CME A;  1Q86 C;  4E7I A;  1N27 A;  4X34 A;  1NPP A;  2K5I A;  3V8L A;  4J6Y A;  5GAN 7;  3JCM Q;  1IZ6 A;  2JTM A;  3CBP A;  3M4Y A;  3JB9 I;  3J80 E;  3CC7 T;  2K3X A;  3BY7 A;  5HY6 A;  3QSU A;  3G71 T;  3CCM T;  3ZFJ A;  3CCV T;  1VQ7 A;  4HCB A;  4MZP A;  1X6O A;  5GAO q;  2E70 A;  4MZT A;  2X4W A;  3GF5 A;  3M55 A;  4XTY A;  5CR2 A;  5A0G A;  2JOY A;  3JCM e;  4M75 F;  4M7D D;  4M7A G;  4ZN1 A;  2RH2 A;  3JB9 D;  2D0Q B;  4GLK A;  2BUD A;  3L2R A;  3OQ5 A;  2HBP A;  2LX9 A;  4LDY A;  4C5E A;  3OYJ A;  3QHS A;  3RKW A;  1Q7Y U;  2HNI A;  4IUV A;  4RMO A;  3JCM c;  1FX7 A;  2DIG A;  2K57 A;  5GAO l;  3F70 A;  3GLX A;  3JCM b;  4N4I A;  1OZ3 A;  5FRO A;  1YIJ T;  2JN0 A;  1OZ2 A;  2EKO A;  1VQ4 A;  5CKH A;  3VJP A;  4NL2 A;  4A4F A;  5FU6 B;  5GAN 6;  2CZ7 B;  3CC2 A;  5J39 A;  3ZEH A;  3OYA A;  5CKE A;  2B8A A;  1HK9 A;  4OB3 B;  4ZGE B;  5FRM A;  4M7A E;  1G3Y A;  3CPF A;  2ZPH B;  2EWN A;  3V8J A;  4MZM A;  1IRE B;  5GAN j;  1KQS S;  2OTJ T;  3A8L B;  1XOV A;  2RJE A;  2GQV A;  4M7D F;  2VUB A;  3JB9 F;  3A8O B;  4XU2 A;  3CXC S;  1YJW T;  1N9S A;  4YTL A;  1NZ9 A;  4OP0 A;  1VQK A;  4UC4 A;  4XTV A;  2LC4 A;  2CKK A;  3P8D A;  1ZQ1 A;  2FB7 A;  2MWO A;  5GAO n;  5GAN 8;  2ZPB B;  1H3Z A;  2BIV A;  1I81 A;  2D9T A;  4BY6 B;  4E7K A;  2KY9 A;  4NS5 A;  2QA4 T;  3JCM W;  1VQO T;  3EAE A;  1RL2 A;  3MP1 A;  3QUI A;  1Y96 B;  3H6Z A;  1D3B A;  3OS1 A;  3OW2 A;  1Q81 C;  1VQ6 A;  4M7A D;  3A5Z B;  3MEW A;  4JRQ A;  4VUB A;  3M9Q A;  4EPC A;  3LGF A;  4XTZ A;  5HK0 A;  1YJ9 T;  4PJO A;  3OS5 A;  2EQU A;  3RMS A;  4M78 A;  3NTH A;  5LJ5 j;  1PSF A;  4LD9 K;  2EQM A;  3CCU T;  2MWP A;  1PSE A;  5CIU A;  2P0P A;  5IAY A;  3OYY A;  3CMA A;  1R8O B;  1VQ8 T;  2GF7 A;  3ASK A;  4M7A B;  3WXM B;  2VGM A;  1KD1 U;  4M77 C;  3EFS A;  4XTX A;  4ZGJ B;  4C8Q A;  1XTD A;  2E1H A;  4N0A C;  4R55 A;  2DVE A;  5KE3 A;  1KC8 C;  2OTL A;  4M75 C;  4C5H A;  1DJ7 B;  1P92 A;  3Q1J A;  4C0D B;  1VQ7 T;  4XAX B;  4FT4 A;  4OVA A;  3X20 B;  4M7A F;  4HKE A;  4N4H A;  5DLO A;  3VYG A;  2WSE E;  3CCQ T;  3M58 A;  5GAN d;  4ZTJ A;  4PJO G;  5DLQ E;  2ZPI B;  3OBW A;  4C92 C;  1BYM A;  4M78 G;  4JJN K;  2ZPE B;  4RKU E;  2K5F A;  2V8J A;  1WJQ A;  4XQ3 A;  4BAC A;  4Q5W A;  2JUF A;  3CC2 T;  3RER A;  4JLI A;  3VKI A;  1JRI A;  1JB0 E;  2CZ1 B;  3G7Z A;  3M56 A;  1VQ4 T;  1K73 U;  1S72 A;  5GMK j;  2KVQ G;  5AYF A;  4HT9 A;  3C4S A;  1Y96 A;  5A2Q E;  1X75 C;  4C8Q G;  4DA4 A;  3OYK A;  1KQS A;  2A3L A;  3SDZ A;  2XD0 A;  4XTU A;  2DK3 A;  3OSV A;  4M78 E;  4OB2 B;  4M7D C;  4L6V 5;  2ZPG B;  4IUT A;  5GAN 4;  1FXX A;  4B9W A;  5FU7 B;  4E7L A;  1BI3 A;  2H3J A;  3HL8 A;  3SWN C;  3TEE A;  4J7F A;  1M1K C;  1N8R C;  3CC4 A;  1N6A A;  4MDX A;  1V29 B;  1YBY A;  2RJC A;  1I8F A;  4GY5 A;  2RA2 A;  3VUZ A;  4ZGD B;  3CPW S;  3E1S A;  3S3N A;  1VQ9 A;  2AHJ B;  5LJ5 d;  1YJN A;  3DLM A;  3I56 A;  3HRU A;  3RKX A;  4QQG A;  4BI3 A;  5KCO A;  3HHT B;  1U1S A;  5I2M A;  1VQK T;  2DZC A;  3V7C A;  5GAM h;  4XK8 E;  1LNX A;  3T9N A;  1KG1 A;  5GAN 2;  4J6X A;  4A4E A;  5GAM e;  3GNG A;  1K8A C;  4C0Z A;  4ATO A;  4QQD A;  5D6W A;  4OMF B;  1YI2 A;  3E9G A;  4JUV A;  2I2L A;  5M9O A;  3TCJ A;  1VQ6 T;  3UWN A;  2OAU A;  4PJO D;  3KBG A;  4M78 D;  2Y4X A;  3L2V A;  4HCZ A;  2HQX A;  2DTH A;  3INZ A;  5A0L A;  3E19 A;  2RHI A;  3PTA A;  2DD5 A;  2RK2 A;  3RES A;  2X4Y A;  4P5N A;  5GAN 3;  5I2S A;  2LQK A;  3JCM h;  4D6W A;  1D3B B;  3VUB A;  2E64 A;  3JCM X;  1BI2 A;  1O75 A;  3OBY A;  3OYB A;  2RHX A;  2QQ9 A;  3L1A A;  5GAN f;  1BI0 A;  3CMA T;  4LDX A;  4KUI A;  1U1T A;  4PLI A;  4C8Q D;  2EYQ A;  2QQA A;  2YRV A;  4PJO B;  5LL6 S;  1UB4 A;  4M78 B;  3EFR A;  2EIF A;  2PUK B;  4RCC A;  4BDZ A;  3S3M A;  2WSC E;  1BKB A;  1K9M C;  2OTL T;  4HCC A;  2WAC A;  5J26 A;  5C6S A;  2ZCF B;  4PJO F;  5GAO m;  4XTW A;  3QZ9 B;  4M78 F;  4J83 A;  3DB3 A;  3OS2 A;  1VQN T;  4C8Q B;  1I4K 1;  5GAN g;  1NE8 A;  4IKF A;  1G3T A;  2R58 A;  3P8B B;  3TU4 K;  1XQH A;  4LD6 A;  5GMK i;  2M1H A;  4ELZ C;  4KUL A;  3TRE A;  3G4S A;  2K3Y A;  1OI1 A;  5KH6 A;  2XDD A;  1Q86 U;  2X35 A;  5CKD A;  1M90 C;  4C8Q F;  1WPY A;  5LJ5 f;  4J5Y A;  2PU9 B;  3CEY A;  1S72 T;  2C06 A;  2L8D A;  3MCA B;  2XIC A;  3QDR B;  4LDU A;  3CD6 A;  4A54 A;  1LOJ A;  1ZHI A;  2KQW A;  2LT1 A;  4J7I A;  1Y07 A;  3LWH A;  3PIO A;  2LCC A;  2VC8 A;  2X4X A;  3M5A A;  3OYD A;  4BDY A;  2RI3 A;  2EJ9 A;  1VQP A;  2M16 A;  3CPW A;  3OYF A;  3LGL A;  5LJ3 h;  1NJI C;  1M8V A;  2LCL A;  2PVO B;  3CC4 T;  2JVV A;  4ZN3 A;  2F5K A;  2YLC A;  5I21 A;  5LJ3 e;  3LYI A;  3RUX A;  2RK1 A;  4MML A;  2CYZ B;  4DOV A;  2MF2 A;  1YJN T;  5LJ5 g;  2L3R A;  3I56 T;  5FLX E;  2FL7 A;  3P8H A;  1N9R A;  2JZ2 A;  5D6Y A;  4CRI A;  3KXT A;  3HFN A;  3PMI A;  5EG2 A;  4C0F A;  4V2S A;  2XU8 A;  4M77 A;  2VV5 A;  4HT8 A;  1VIE A;  2RHZ A;  3LX7 A;  3LH0 A;  3GIB A;  3MO8 A;  1NPR A;  1YI2 T;  4IUP A;  3HRS A;  3FDR A;  3CME T;  1RI0 A;  3C95 A;  3MP6 A;  2GCX A;  4OGE A;  4TVR A;  1GXI E;  2QQB A;  4L59 A;  2DO3 A;  3HSB A;  5CO7 A;  3L2W A;  4E47 A;  4C92 A;  1M1G A;  1W4S A;  2KK4 A;  2RHU A;  2GFA A;  2YHT A;  3FRN A;  4QW2 A;  2DEQ A;  3UPU A;  2CS7 A;  2EAY A;  3FEO A;  3LLR A;  3R6O A;  5KCH A;  4E7H A;  3L2U A;  3G6E A;  1G5V A;  4N4G A;  2RI5 A;  3UDC A;  3V8K A;  3QYH B;  2EQK A;  2O4X B;  3JCM f;  5GAM j;  2R57 A;  3X24 B;  3BDU A;  5GAO r;  2EJG A;  4RG2 A;  1Q82 C;  2XHC A;  3QZ5 B;  5DY9 A;  3C12 A;  3O8V A;  3PIP A;  2RO0 A;  2QEX A;  3GP8 A;  2L89 A;  4JDS A;  3MEV A;  2DXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...