2XDDA

A processed non-coding rna regulates a bacterial antiviral system
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
162
structure length
162
Chain Sequence
MKFYTISSKYIEYLKEFDDKVPNSEDPTYQNPKAFIGIVLEIQGHKYLAPLTSPKKWHNNVKESSLSCFKLHENGVPENQLGLINLKFMIPIIEAEVSLLDLGNMPNTPYKRMLYKQLQFIRANSDKIASKSDTLRNLVLQGKMQGTCNFSLLEEKYRDFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Phage Abortive Infection System, Toxin, Functions as a Protein-RNA Toxin-Antitoxin Pair.
pubmed doi rcsb
source organism Pectobacterium atrosepticum
molecule tags Toxin/rna
molecule keywords TOXN
total genus 46
structure length 162
sequence length 162
chains with identical sequence B, E
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13958 ToxN_toxin Toxin ToxN, type III toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.890 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xddA00
4RMOA 2XDDA 2XD0A 4GLKA 2XDBA 4ATOA
chains in the Genus database with same CATH superfamily
5FRNA 4OMNA 1AT1B 2ZPGB 3OYCA 1WFWA 1VQNQ 3CC2Q 2FRYA 2OTJA 2BZXA 1WXTA 3PIOA 4OB2B 4HVUA 3SWNC 2QQAA 2WSEE 2ZAEA 1QMCA 2QA4T 1RAIB 1ZBJA 2VASA 4AFSC 5IHNA 4HT9A 2NUZA 3F70A 5AT1B 2DL8A 4E7SA 2O9SA 3E1SA 1VQ8A 1VQ6Q 2VYTA 2KSSA 1VOMA 3CC4T 2DKGA 4IKFA 1X6BA 2HEQA 4NS5A 4C92D 2CZ6B 3L42A 1WHHA 2FO0A 3NPFA 3I5RA 3CC2A 2O31A 4GLKA 1KHIA 2D1XA 3JB9I 2DL7A 5GMKm 1WJSA 2KVQG 1UJYA 1UGPB 4LDUA 5J39A 3QO3A 3G1JA 2SEMA 2YRVA 3CMAQ 1UGQB 1RACB 2L0AA 1XJWB 5A0LA 4FSXA 2F1LA 4BACA 3HHTB 3GP8A 2EYWA 1TWBA 4A4HA 4J9IA 2XDPA 4XTWA 3GOXA 2AZVA 2K4YA 2KT8A 4M78C 2GNCA 4MMKA 4KGVB 3U23A 3GBQA 3CC7Q 3CC7T 4Z02A 2PVDB 5DM7R 4M78E 3H6ZA 3FB9A 2OAUA 3TU4K 3V8KA 3CCRA 3JB9F 4F14A 5CK9A 6AT1B 1AHJB 2ZZDA 1JXMA 1FMKA 3RR6A 2X4XA 4B6MA 3M56A 2DEQA 5D6YA 1VQPQ 3P8DA 3D7SB 3QIIA 1W6XA 4KULA 4ZTJA 2CZ1B 2FZCB 5GAOq 3CPWP 5FROA 2P84A 3C12A 2GCXA 2MYSA 3EFRA 3HFOA 4M75D 4NL2A 1OI1A 4QVCA 1VQ4T 2DYBA 3SWNB 2DXBA 2GTJA 1UFFA 1G3YA 5HK0A 2RJFA 4M78G 1JJ2A 2GQIA 2CP5A 4JJDA 2XDBA 2H3EB 5GAN5 3N5BB 3M0UA 1V29B 1WHKA 2K3BA 2V8KA 4EMKC 2KK4A 2WACA 2H8HA 2KY9A 2M0YA 1YHQT 1G3WA 1XTDA 1QQJA 5CCAA 5L23A 3C95A 1VYTA 2MF2A 2XDDA 3EG1A 1NEBA 2A36A 2C06A 4BY6B 3QDRB 1M27C 3EH1A 3MP1A 4M7AC 1WNLA 4ORZA 1P92A 4QQGA 3L1AA 2LQWA 4LD6A 2CYZB 3J7AF 2FRWA 3GNFB 4BDZA 1KK7A 1TG0A 4M77B 2LZ6B 1U8RA 1FMVA 4DBQA 3EG2A 1PNJA 1PCXA 2EGAA 2XG8D 1OPLA 5KYXB 3HSBA 3JCMf 1PSEA 2QEXT 2RQUA 4EMKB 1H8KA 4A4KA 3G7ZA 1IZ6A 3OBWA 1VQLT 1M1KC 3I56A 5GAMg 3EHRA 1YIJQ 2DEUA 4CC4B 1ZA1B 1T3SA 3CCST 3VUBA 3UWNA 2G6FX 3CMAT 1PWTA 4WCIA 1NBEB 4FYWB 2K57A 2RN8A 4M77F 1I5OB 2E5QA 2CUBA 3BDUA 5CKEA 1KQ2A 1UHCA 2C0IA 3M0TA 4L6V5 4M75A 4C8QA 1ZSZC 3CCET 3C94A 1IRXA 2X4WA 2GFUA 2JS2A 2HKNA 3KFVA 3CCLA 2BE7D 3ULRB 1OU8A 4LUDA 1YJNA 3H41A 3CCMQ 2JM8A 4FL6A 4E7LA 1Q7YR 4J9BA 4XTUA 2COYA 5D6XA 2MIOA 1ABQA 1AWOA 3M59A 2LTOA 3MO8A 3HRSA 4PFOA 4F7UA 3BE3A 5LJ5h 3BY7A 4ZGEB 4X34A 5LJ5j 2KE9A 2GBQA 3CCMA 3X25B 1M90U 3MJXA 2ED0A 1YJNQ 2IPOB 1SSHA 2VWFA 2ATCB 1JJ2S 3VS6A 4M7DD 3LWIA 2JN0A 5KYYA 4HXJA 5GMKh 4P5NA 3RESA 3EG3A 4LE9A 3VS7A 3REBB 2K5IA 1Q81R 2LVMA 2RMOA 1I8FA 1JU5C 4N0AC 2HD0A 4PNOA 5GAN2 3NTKA 4OGEA 4CI0C 2QDLA 4OMLA 4RTTA 2D8JA 2RI2A 3RKYA 4XTZA 5FU6C 2HL3A 1O9SA 3HTRA 2L5QA 4F16A 2RO0A 1WQ7A 5GANf 2A28A 2V1RA 3CPFA 2G3RA 4PJJA 4B9XA 1Q81U 3VKIA 1F1BB 2R57A 2EGCA 2L2PA 4E6RA 2KMTA 1RAHB 3OA6A 3AT1B 2VGNA 5A2QE 1X6OA 3ZFJA 4C8QD 2QA4A 4BE2A 1N27A 4GBQA 3JB9G 2JTEA 4FT2A 2GQVA 2W10A 4AG2C 4FM4B 5CR2A 1VQNT 3CCEA 4C0ZA 2VB6A 1AD5A 4KRTA 1WJQA 1Q7YU 2JMCA 3OW2S 2LNHB 3SD4A 1QCNA 1IXDA 1TTHB 4OGCA 3JCMX 3QUIA 4MZPA 1VQ9A 3JCMg 3OYEA 3JB9J 1Q82R 4JJNK 2DZCA 1FMWA 1I07A 2EPDA 4LDYA 2PNIA 3CCQQ 1D0XA 1IGQA 3UATA 1WA7A 2COWA 3PVLA 5DLOA 5HK3A 3SWNA 3VYGA 1OX8A 4N4HA 4M7DA 4V2SA 1D1BA 1AZEA 1AOJA 3SDZA 1YP5A 4M77G 2O2OA 2RK2A 1QP3A 5KCHA 2F5KA 1WZOA 2RHXA 1D0YA 3WVEB 3I56Q 2JM9A 1QWFA 1UGVA 5HCKA 3ZBDA 4M75E 1K9MU 2CSQA 3PE0A 2XK0A 3FJPA 1XNIA 2FZGB 3QDFA 3OS0A 1VQ7A 5GANg 2L8DA 1LOJA 3ZL7C 4EDUA 1SKUB 1OV3A 1ZSZB 1WX6A 2E10A 1W70A 3MEVA 2J6FA 1KC8R 1X01A 2RH2A 5KE3A 2E70A 1SRMA 2MOXA 4XU3A 4OMQA 3PIPA 2DD4A 1B7TA 4M7DF 4J9FA 4EMKA 1PRLC 4JRKA 3QPHA 2MCNA 1W1FA 3WVDB 4PJOD 1ARKA 2A7YA 3EH2A 4L59A 4C92G 4BDYA 3HRTA 2X3WD 4QQ6A 1H641 1U3OA 1KIKA 4C5GA 4AFZC 1Q82U 1QLYA 1O75A 4JJCA 1KD1U 2DF6A 2K3YA 2DILA 3PTAA 2K79A 4BUGA 2LDMA 5IAYA 4BI4A 2KRNA 5IXFA 3M0RA 3DB4A 4AFQC 1ZBXA 5I2SA 3BW1A 1RAGB 2JJ9A 1AWXA 2VKNA 2JOYA 5ECAA 5I22A 5CQYA 2HQXA 3CCRQ 3VUZA 2M1HA 5DY9A 4KH0B 1D3BA 2ZPBB 1Y0MA 1M5Q1 1H92A 1I81A 4EIKA 3M54A 1UHFA 1C0MA 4PJLA 2DTHA 1UECA 3HKSA 1N9SA 4IURA 4M4ZA 2FG0A 5FLXE 4HCZA 2E41A 1VQ5Q 1BI3A 2QGGA 3CBPA 4F7UB 1BCMA 2X35A 4PJOA 1WXBA 5LJ3d 4RTYA 1RAFB 1YJWQ 3CXCP 3JCMP 2DZ9A 1T3LA 1OYXA 1N8RR 4OMPA 1K8AR 3ASKA 3ZEHA 1YIJA 1FXXA 1OQKA 3H0IA 1QVGP 4IIMA 4A53A 3UPUA 5GANh 1QKWA 3CMAA 1MUZA 1S72A 4C5IA 3I55A 3RKWA 3E9FA 3GLXA 4WTOB 3EGDB 2KROA 1K9MR 3OS5A 3DLLA 3I5SA 4PJOG 2A3LA 1WYXA 4DA4A 5KYUA 1KQ1A 1SF9A 4M7DB 3RMSA 3X24B 4F7UF 2YUPA 3OYBA 3MKDA 4VUBA 1G3SA 3PVQA 3J81E 3VV0A 1AEYA 1K8AC 5LJ5f 5C6SA 2DTIA 1M4ZA 1WPYA 2JTFA 2KT1A 9ATCB 2YLCA 1AWWA 1Q86U 2V1QA 4Y28E 3TSWA 4DBHA 1N9RA 1KQSP 3QJ6A 2RHIA 4RG2A 3CCJA 4TVRA 1VQ9T 1K0XA 4C92F 5HY6A 1VQ6T 1ZSGA 2FB7A 3QSUA 1LVKA 2QEXQ 1TS9A 2DXCA 3CMEQ 4M7AB 1Q95G 3L2QA 4M7DG 1Y96B 1VQNA 4C0DC 3A8OB 4PJOE 5GAOp 3QYGB 4EPCA 2QTXA 1G5VA 4II1A 1KC8C 4E7IA 3JRZA 1NM7A 1TXQA 2QYZA 1YN8A 4M7DC 4AG1C 1OU9A 1HSQA 5KE2A 2HQHA 1VQMT 2KGTA 4XTVA 4J9EA 4OMFB 2RM4A 1Q7YC 2EKOA 3RBBB 2L3PA 4HCKA 3A8LB 1FYNA 1M8VA 3A5ZB 1YI2T 5EG2A 1SHGA 1SG5A 1WQWA 1W2BA 2VC8A 3UA6A 2KYBA 2LP5A 1TUDA 1IREB 2M0OA 3QYHB 2E12A 2PTKA 1BB9A 5KH6A 1JRIA 2EQKA 2KEAA 2ZPHB 3M9QA 1JO8A 2FPFA 3M0QA 3LX7A 3VS1A 5GAOn 2QQBA 4F7UE 1UGRB 4R55A 2XU8A 3OYNA 2J6OA 1JEGA 2JUFA 4Y92A 4Z88A 5CKHA 3HRUA 4N0AA 1NZ9A 1RI9A 3S3MA 3OMGA 2JXBA 2L89A 2OTLQ 3CCVT 4JZ4A 2DLPA 3CCVQ 3CBOA 2O9VA 5KYWA 1DJ7B 1QCOA 4D8KA 2RI5A 2I0NA 3UDCA 2Y4YA 4OF1A 1YJWT 2L3RA 1YHQA 2AKLA 5EC7A 3JCMW 2KAFA 2ENMA 2MWOA 5LJ3g 1M90C 1Q86R 1IB8A 4XAXB 4RMOA 1WJRA 2QASA 3EFSA 4C8QC 2HZYA 1SSFA 1K73R 2LJ3A 4J6YA 1I5LA 1YHQQ 2RNAA 3UA7A 5A0DA 3CCQT 1GL5A 2JS0A 1MV0B 4J6WA 4HT8A 2DTOA 2EYXA 4M78D 2CP0A 2SRCA 3R6NA 2CH4W 3OS1A 2Y90A 4D6WA 4Q5WA 1VQ5A 1VQMA 1M1KR 1K73U 1VQOQ 1YNZA 5C0MA 4XTXA 3PT9A 1WIEA 1NLPC 4BE1A 4ZNXA 2EKHA 1UEBA 1GXIE 1OZ3A 2OTJT 2C0TA 4DQ2A 2LT1A 5GAMd 1D1CA 4A4EA 5GJWB 2DE0X 2DJQA 3CC4Q 1VQLQ 4ESRA 1M1KU 1YITA 2RHZA 1Y07A 3CC7A 2LCLA 4QVZA 1A0NB 1QVFP 2QQRA 3X26B 1TH7A 4BE0A 4O6JA 1X6GA 3FC3A 2KXCA 5CKBA 1BIAA 1I1JA 1MV3A 4ATOA 1NG2A 5GAMe 1UG1A 2QK0A 4PK4A 3MEAA 2D6FA 1YI2Q 2OX7A 1U5SA 1T0HA 1OPKA 3G4SQ 2K2VA 3HFNA 3TSZA 3OYDA 1Z9QA 1R0CB 2ZCFB 2LRQA 1TSFA 3C4SA 3JAME 4XU1A 4DOWA 2X51A 3DLMA 2RB6A 2MK5A 1CSKA 2EQIA 5M9OA 1PD0A 3CEYA 3L2ZA 3OYIA 3OYMA 1U06A 1YJWA 4J9DA 1Q86C 4OB3B 4M7AA 4M78A 3REAB 2J05A 5LL6S 5LJ3j 4LNPA 1Y96A 3RUXA 3CCRT 4GLMA 5CIUA 3PFSA 2E65A 3QKJA 1G3TA 1G2BA 4JDSA 5L8RE 2FPDA 1LJOA 3CCJT 5IH2A 3VS0A 2E4HA 4L5GA 1VQ8Q 1FX7A 2CUDA 1VQ4Q 3S3OA 5LJ5e 1BYMA 4NL3A 2K7AA 4PJOF 1VIFA 2RK1A 3EG9A 2HL5C 1BI2A 2ECZA 2O01E 3URGA 1SHFA 2DA9A 5GMKj 4IUPA 1QVGS 2LJ0A 1ACMB 3A8GB 2LC4A 3MHXA 1TOVA 2FPEA 5D6WA 4QW2A 1LPLA 4CC2A 4JPBW 3EFOA 3GPLA 2QDYB 3MPUB 2EJ9A 4M7AE 1D1AA 3E19A 1RADB 2PVGB 3V7CA 2CT3A 2QQ9A 3JCMJ 4FIBA 3G6EQ 3A98A 2HSPA 3VS5A 3KUFA 4ME7A 3PNWC 3QWXX 2EQMA 4J6XA 3OW2A 2ROLA 4ZN3A 2XD0A 1OOTA 1JB0E 2MAMA 3VJPA 5LJ3h 5D7UA 4K11A 3VRZA 5GAN6 1WHGA 3FLGA 1YJ9Q 4ZGJB 1KD1C 1RAEB 2RA2A 3CCUA 1Q82C 1QWEA 5GAN3 2YXYA 2K5FA 3EGXA 3HL8A 4ELYC 1QCFA 4E7HA 2LCSA 3OYYA 1OX9A 2JW4A 3OYHA 1JQQA 1SRLA 2M02A 1K9AA 2YUOA 4C5HA 5GAOr 3FIFA 2NUPA 2RHYA 2BUDA 1ABOA 1YBYA 1RI0A 2X3XD 1VQPA 4ANJA 4EMHA 2CT4A 4M77C 2E6NA 4N4IA 4ELZC 4B9WA 4DBFA 4IUVA 3OQ5A 1PKSA 4C8QE 1EFNA 2J7IA 1KG1A 3X28B 1ZUKA 2X4JA 2AT1B 2GTOA 2K6DA 2QTVA 1UDLA 5FWBA 1S72T 4PKCC 4BY6C 2QQSA 4QVDA 1E7OA 3SEMA 1X75C 1GFCA 2CH4A 2LX7A 1D09B 2EGEA 2OTLA 1Y7XA 4YTLA 1K73C 4M7AF 4LXCA 1QVPA 4OB0B 4XTYA 4MZTA 1G83A 1WHJA 5J3BA 3H8ZA 3EG0A 1U1TA 4C0GA 1H3ZA 4BD3A 2Y4XA 2EJGA 1NYGA 2XIDA 1QVGA 3JCMe 3P8HA 2RD1A 4IUUA 2DIQA 5GMKl 2RQWA 1PSFA 2OTLT 3EG9B 3C0CA 2EJFA 2JZ2A 1W2BP 2X4YA 2HSEB 2BE9B 3QXEB 1GCQC 1R77A 1QVFA 3QZ5B 4A63B 2KYMA 1LCKA 1VIEA 2GF7A 4JLGA 4JS5A 4HVVA 4Z8AA 1OZ2A 2NUTA 4F17A 1MMAA 4OMMA 3JCMd 4PJMA 4DEXA 4PL6A 1WHMA 3M57A 5I2MA 4ZN1A 1X69A 3LYIA 4XU2A 2X9HA 4X9DA 1C6VX 4A4FA 5FWCA 5LJ3e 3WXMB 2BKDN 2RJEA 2LQ8A 3CC2T 1B34B 1Q81C 4C92B 2FVUA 4M78B 3LWHA 2CZ7B 2E64A 2CS7A 4C92C 5CO7A 4RG8A 3TQ7P 2DL3A 2DL4A 3QZ9B 5GANd 3SB2A 1KJWA 1WI7A 3H0HA 1IHVA 2LNVA 5IT9E 1GFDA 2DM1A 4PJOC 1MHNA 1NEGA 5DLQE 3LH0A 2XICA 3GNGA 3CCVA 1K4US 2IG0A 2HCKA 2YUQA 2JVVA 4R56A 2QXFA 4OMOA 2O4XA 4LD9K 4DOVA 2HDAA 1K76A 1YCYA 2J6KA 1X43A 2GFAA 1VQOT 2YDLA 2FHDA 4JJBA 1VQ9Q 1PHTA 2YRCA 2V8JA 1VQMQ 2D8HA 2JTMA 2OTJQ 1KC8U 2KR3A 2KI7A 2GGRA 5CAIA 2XI9A 3M0SA 3CPWA 3EFOB 3I56T 3META 1PG5B 2DXUA 1X2QA 3E9GA 3OYKA 3L2RA 1G8XA 3MEWA 3LH5A 3CCMT 1QKXA 2QAZA 2NWMA 2LX9A 2VUBA 3JCMQ 4FYYB 4BI3A 4C8QG 4JRQA 2DBMA 2ZGWA 2JMAA 2LT4A 1KD1R 2XHCA 4LDVA 1AWJA 1ZQ1A 3M4YA 5GAOm 3CPWS 1K8AU 5CQXA 4HCBA 3BDLA 1YJNT 3QWYA 1VYUA 1VQPT 3OY9A 1PM3A 3CXCS 4JRPA 4LUEA 3RMQA 2RQTA 2YWWA 3L2VA 4M77E 2OJ2A 1AZGB 4E7KA 1VUBA 4J8OA 3BFMA 5GAN7 1YCSB 3MP8A 4LN2A 2F2XA 4RCBA 4KT0E 4JUVA 1WXUA 3CCSA 2FYKA 2DVEA 3I9QA 4QQDA 2ZPFB 4AMCA 1SPKA 3NMZC 2DIGA 2VXEA 1N8RU 1HJDA 1M30A 2DRKA 1V76A 3IQLA 5FU7C 3M55A 1K1ZA 2KQWA 1D3BB 2E5KA 2PU9B 1NJIR 2OI3A 1JXOA 2EYZA 1VQ5T 3G71A 1MMGA 4M7AG 1MMDA 4M7DE 2P4TA 4E7ZA 4J9HA 2PZ1A 3G6ET 1HD3A 4M77A 1M2VB 2DX1A 2DYIA 4AFUC 5GAOl 3CMEA 1N5ZA 3OMCA 3FEOA 2DFUA 2L3SA 1X27A 1HXDA 3OYFA 1GBRA 1M9SA 3MCAB 5CVIA 5AYFA 2DRMA 2DBKA 1Y71A 3RIRA 4KGZB 3CCLT 2KRSA 1VYVA 2O4XB 5I21A 2M51A 3EGDA 4JS4A 2LMJA 3E2UA 4J9GA 4RUGA 2MMPA 4R0KA 5CKFA 5LJ5g 1M3BA 2EQUA 5LJ3f 2D0NA 3OSVA 3L2UA 2E3IA 3CXCA 1RLQC 2QA4Q 1X2KA 2NUTB 1CKBA 2KNBB 1IO6A 5FU6B 5GANe 3SHWA 5GAN8 1UE9A 1ZA2B 2OAWA 2W0ZA 3M53A 4FYXB 3A8HB 1NPPA 1ZUYA 3M5AA 2QG9B 2RHUA 1R8OB 4UC4A 1NE8A 2PUKB 3I35A 4OB1B 4M77D 3INZA 1B34A 1W2BS 1K9MC 3JCMV 1E6HA 2CREA 1N6AA 1S72Q 3JCMh 3UF4A 4A4GA 4J83A 3JCMb 3TEEA 2AZSA 2FL7A 5I11A 2XMFA 1ZLMA 1KHCA 2M16A 4QKUA 3OW2P 5J26A 4C0DB 5CKDA 2CP6A 5KYYB 1BKBA 5IHIA 3SFMA 5GAN4 4KGXB 1PC0A 1YI2A 2KRMA 2RF0A 2R5AA 3S6WA 3QJYA 1VQ7T 2CGHA 3ME9A 3G4SA 1BI1A 4RTVA 1VQKT 1SEMA 2AHJB 2L3QA 3VYHB 4DEYA 1NJIU 1I4K1 1WHLA 3UT1A 2PUOB 4FYVB 2CP3A 5GJVB 4ZGDB 3VS4A 2V8IA 4AT1B 5FW9A 4M75B 4F7UG 3H9NA 2COZA 4M7AD 8ATCB 3NTHA 5GAMh 4Z89A 1PD1A 2DK3A 4O5VA 2F2VA 4E7JA 5GMKe 4PFZA 2DO3A 5IHKA 3G6EA 2P0KA 2V26A 4Y91A 1M1FA 2R5MA 1NJIC 2WSFE 1UGSB 1KFZA 2HQEA 1HK9A 1GCQA 1PKTA 4RKUE 3V7RA 2EYYA 2RJDA 2H3JA 2LQKA 4CC3A 3EAEA 4HA8A 1M2VA 4M75F 1BI0A 2MI6A 4M75G 1M3AA 2CZ0B 4J9CA 4HVWA 2EQJA 5LJ5d 1BBZA 5KYWB 2ABLA 1MNEA 2AIRB 2KDSA 1OEBA 1YITT 3NHNA 1S1NA 2B86A 1M90R 3PGGA 4KUIA 2MPXC 2IVWA 1MMNA 3JSCA 4FU6A 2DETA 4KUDK 3LLRA 2QI2A 2ZPIB 4HKEA 1PRMC 2YRDA 4IIOA 5FU7B 4CRIA 2MWPA 4X1VA 3R6OA 3AHUA 1R0BG 1T0JA 2YT6A 2YHTA 2XKOC 1D0ZA 2YUNA 3NFCA 1MNDA 3VRYA 4OP0A 4DBRA 4GY5A 4JZ3A 2A0FB 3TREA 1BK2A 2NYSA 5HKCA 3P8BB 2FZKB 4J7FA 2HKQB 1GCPA 3CCSQ 2P4RA 4X9CA 2CP2A 3RKXA 1BU1A 1RL2A 3CBMA 2ROTA 1V1CA 3DB3A 2M9UA 4MZMA 3OYLA 3LW5E 2K2MA 4J5YA 1WLPB 1Z9ZA 3CMET 3PMTA 1B3QA 3I55T 3RNJA 1KSWA 1WDXA 3CC4A 1YJ9A 1ZSZA 4BI8B 2E6ZA 1HYOA 3V8JA 2BTTA 1YIJT 1GBQA 4C5EA 3G71Q 1I0CA 1VA7A 3LGLA 1UJ0A 3EGUA 4XU0A 8AT1B 1FWZA 3X20B 1U1SA 1UTIA 3OSSC 4FW2A 2EW3A 2WSCE 3OS2A 1WGSA 2ED1A 2IIMA 2CKKA 1W4SA 1BIBA 4RTZA 5GAMf 3A1PA 2HNIA 2DERA 3FRNA 4CC7A 1VQKQ 2RQRA 1VQOA 3J80E 2DJZA 2RJCA 1XOVA 1QW1A 2JT4A 2EBPA 3DKMA 3V8LA 3VS3A 3JB9D 1OULA 3M58A 2ZPEB 1N8RC 2VXFA 2VVKA 4F04B 2RPNA 1EIFA 1GRIA 1YWPA 1M3CA 3M4GA 2P0PA 2EWNA 2DXTA 3CD6T 3CD6Q 2HAXA 2BZYA 2E3HA 1BCOA 1VQ6A 2J06A 2K3XA 2R58A 3GF5A 5KYNA 2C0OA 2RQVA 2YSQA 4M75C 4PJOB 2D9TA 4N4GA 3FDRA 3V7SA 3TCJA 4RTWA 2FEIA 2QEXA 3CCJQ 4IUTA 2YLBA 4LDWA 3PMIA 3M0PA 2EIFA 2PVOB 7AT1B 3EGXB 1YFNA 5IN1A 4C8QF 4JRIA 1MGQA 4OVAA 3VS2A 5KCOA 5IXBA 3OYAA 1NYFA 2P0QA 3HPWA 1IHWA 4KH1B 3MEUA 3THKA 3NTIA 1UB4A 2A08A 2NUPB 3EHQA 2DPPB 2QGFB 1TUCA 1ZUUA 2RI3A 3QG1A 1M2OA 1RUWA 2K9GA 4C0FA 2EFIA 2DL5A 4MDXA 1UUEA 2EAYA 3JCMc 4NOYA 2BZ8A 2HBPA 1K0SA 1ZHIA 5GMKi 3LGFA 1LNXA 4MMLA 2HMAA 4PLLA 4J7IA 2DNUA 4LDXA 3VU3C 1RAAB 1VQ4A 3CCEQ 3CCLQ 1KQSS 2I2LA 1H3HA 2F69A 5A0GA 3I55Q 1CKAA 2NLUA 1YJ9T 3KBGA 3CCQA 5GANj 4HCCA 1JJ2P 4JLIA 3G71T 1IGUA 3FJ5A 3RDVA 2O88A 3ER0A 4RTUA 1M8MA 2AK5A 3OYJA 2CP7A 3A8MB 2KBTA 3MP6A 3OBYA 2CSIA 3JV3A 2D0QB 5KYUB 3L2WA 1KQSA 1TUGB 1AVZC 1M1GA 4EMGA 4PFPA 4RTXA 1QVFS 3TVTA 4XK8E 3GIBA 2A37A 1JBMA 1Y57A 3G4ST 2BIVA 1E6GA 5GAMj 4BB7A 2VV5A 1RABB 1B07A 2B8AA 2AKKA 2KXDA 4A54A 2F5TX 4PLIA 3KXTA 2K5LA 2LCCA 3CCUQ 4FSSA 3CCUT 3CQTA 4KBMB 2Z0WA 4FT4A 1EZZB 4D8DA 4FCYA 1EX4A 2LQNA 2DAQA 4C92A 4E47A 2DVJA 3QHSA 4XQ3A 2ESWA 3Q1JA 2CDTA 2E1HA 1VQ7Q 5FRMA 2EYQA 3OB9A 3OYGA 3QBYA 3O5ZA 2HBWA 2PQWA 3O8VA 4ZTFA 5KYXA 4E2FB 4WF2A 4MDWA 1RLPC 4C92E 1YWOA 3NGPA 1QP2A 3CD6A 1NLOC 1VQ8T 4PJNA 1ZX6A 2F2WA 1C1AA 4RCCA 1VQLA 4IUQA 3T9NA 1NPRA 3JB9H 2JNGA 1J3TA 2DMOA 3HP9A 4FW1A 3H0FA 2VGMA 3S3NA 1XQHA 1YITQ 4QT7A 2LJ1A 1TU0B 1VQKA 4C8QB 3RERA 2EVRA 4M78F 2DD5A
chains in the Genus database with same CATH topology
2FL7A 5FRNA 3GPLA 2QDYB 4M7DF 2ZPGB 2EJ9A 3OYCA 4EMKA 4JRKA 4M7AE 1KHCA 2M16A 3E19A 3QPHA 3WVDB 2PVGB 3V7CA 4PJOD 5J26A 4C0DB 5CKDA 2QQ9A 3JCMJ 1BKBA 2A7YA 4FIBA 2OTJA 3SFMA 5GAN4 4L59A 4C92G 4BDYA 1YI2A 3HRTA 3PIOA 4OB2B 4QQ6A 1H641 3SWNC 2R5AA 3S6WA 3KUFA 3QJYA 2QQAA 2CGHA 4ME7A 3PNWC 2WSEE 1VQ7T 3ME9A 3G4SA 1BI1A 2QA4T 4C5GA 1VQKT 4J6XA 2EQMA 4HT9A 3OW2A 1Q82U 2AHJB 3F70A 3VYHB 1O75A 4ZN3A 2XD0A 1NJIU 1KD1U 1I4K1 2K3YA 1JB0E 3UT1A 3PTAA 2PUOB 3E1SA 4BUGA 2MAMA 3VJPA 1VQ8A 4ZGDB 2LDMA 5LJ3h 2V8IA 2VYTA 5GAN6 2KSSA 5IAYA 4BI4A 3FLGA 3CC4T 2DKGA 4M75B 4ZGJB 4IKFA 4F7UG 1KD1C 3DB4A 1ZBXA 2RA2A 3CCUA 4NS5A 1Q82C 4C92D 4M7AD 2CZ6B 3BW1A 3L42A 3NTHA 5I2SA 5GAMh 5GAN3 3CC2A 2DK3A 4O5VA 2K5FA 4GLKA 2JOYA 1KHIA 3HL8A 5CQYA 4ELYC 3JB9I 2HQXA 5GMKm 5GMKe 1WJSA 4E7HA 3OYYA 2KVQG 4E7JA 3VUZA 1UGPB 4LDUA 2M1HA 5DY9A 2DO3A 1D3BA 2ZPBB 3OYHA 5J39A 3QO3A 1M5Q1 2YRVA 1I81A 1UGQB 3M54A 3G6EA 2P0KA 2DTHA 4Y91A 3HKSA 4C5HA 5GAOr 1M1FA 2R5MA 3FIFA 1NJIC 1N9SA 2RHYA 2BUDA 2WSFE 1UGSB 4IURA 5A0LA 2HQEA 1HK9A 4FSXA 4RKUE 3V7RA 1YBYA 4BACA 1RI0A 3HHTB 4HCZA 2RJDA 2E41A 2H3JA 4A4HA 2LQKA 5FLXE 1BI3A 3GP8A 3EAEA 1VQPA 4HA8A 4M75F 3CBPA 4EMHA 4F7UB 1BI0A 2MI6A 2X35A 4M75G 4M77C 2CZ0B 4PJOA 5LJ3d 2E6NA 2EQJA 5LJ5d 4N4IA 4ELZC 4B9WA 3JCMP 2DZ9A 2XDPA 4IUVA 3OQ5A 4C8QE 4XTWA 1OYXA 2KDSA 1KG1A 3X28B 3GOXA 2X4JA 3ASKA 1YITT 3ZEHA 2K4YA 1YIJA 1FXXA 4M78C 3PGGA 4KUIA 1S72T 2IVWA 4PKCC 4BY6C 2QQSA 4QVDA 4A53A 3UPUA 3JSCA 5GANh 3CMAA 4FU6A 4MMKA 1S72A 4C5IA 4Z02A 2PVDB 3RKWA 3I55A 3LLRA 3CC7T 4KUDK 2QI2A 2ZPIB 3E9FA 1X75C 3GLXA 4HKEA 4M78E 5DM7R 3H6ZA 3OS5A 3FB9A 3DLLA 4PJOG 5FU7B 4CRIA 2A3LA 4DA4A 2OTLA 2MWPA 1Y7XA 1KQ1A 4YTLA 2OAUA 1K73C 4M7AF 3TU4K 3V8KA 3R6OA 3AHUA 3RMSA 3CCRA 3X24B 3JB9F 1QVPA 4F7UF 4M7DB 4OB0B 5CK9A 4XTYA 3OYBA 4VUBA 1G3SA 1AHJB 4MZTA 2YHTA 2XKOC 2ZZDA 2X4XA 3NFCA 3H8ZA 5J3BA 4OP0A 3J81E 3VV0A 3M56A 1U1TA 4GY5A 4C0GA 4BD3A 1H3ZA 1K8AC 2Y4XA 3TREA 2DEQA 2EJGA 5D6YA 5HKCA 3P8BB 5C6SA 2DTIA 3P8DA 4J7FA 5LJ5f 1M4ZA 2XIDA 1QVGA 1WPYA 2JTFA 3QIIA 2YLCA 4X9CA 3JCMe 1Q86U 3P8HA 2RD1A 4Y28E 3RKXA 4KULA 1N9RA 4IUUA 1RL2A 3CBMA 4ZTJA 3QJ6A 2DIQA 2RHIA 5GMKl 2CZ1B 4RG2A 4TVRA 3DB3A 3CCJA 4C92F 5GAOq 5HY6A 5FROA 2M9UA 1VQ9T 1VQ6T 2FB7A 4MZMA 3QSUA 1PSFA 3OYLA 2OTLT 3C12A 2GCXA 3HFOA 3EFRA 3LW5E 4M75D 4NL2A 1OI1A 2DXCA 4J5YA 4QVCA 2EJFA 2JZ2A 1VQ4T 2X4YA 4M7AB 3CMET 3L2QA 3SWNB 2DXBA 3PMTA 3QXEB 3I55T 1QVFA 4M7DG 3QZ5B 1G3YA 3CC4A 1VIEA 5HK0A 1YJ9A 1Y96B 2GF7A 4JLGA 4JS5A 4BI8B 2E6ZA 2RJFA 4M78G 1VQNA 1JJ2A 3V8JA 4C0DC 3A8OB 1YIJT 4PJOE 4C5EA 5GAOp 3QYGB 1OZ2A 4EPCA 2QTXA 1G5VA 4II1A 3LGLA 1KC8C 4E7IA 3JRZA 3JCMd 2XDBA 4XU0A 4PL6A 5GAN5 3N5BB 1FWZA 3M57A 3X20B 4M7DC 1V29B 2V8KA 4EMKC 2KK4A 1U1SA 2WACA 2KY9A 5KE2A 1VQMT 5I2MA 3OSSC 4XTVA 4ZN1A 1YHQT 1G3WA 1XTDA 2WSCE 3LYIA 4XU2A 3OS2A 1WGSA 4X9DA 5CCAA 3C95A 4OMFB 2RM4A 4A4FA 1Q7YC 2EKOA 2CKKA 1W4SA 2MF2A 5LJ3e 3A8LB 2XDDA 1BIBA 3WXMB 1M8VA 2BKDN 2RJEA 2LQ8A 3A5ZB 2C06A 1YI2T 3CC2T 1B34B 3QDRB 4BY6B 5GAMf 5EG2A 1Q81C 4C92B 2FVUA 4M78B 1WQWA 1W2BA 3MP1A 2VC8A 3LWHA 2CZ7B 2HNIA 3FRNA 2E64A 4M7AC 2CS7A 4C92C 1WNLA 1IREB 5CO7A 1VQOA 1P92A 2M0OA 3L1AA 3QYHB 2E12A 2CYZB 4LD6A 4QQGA 4RG8A 3J80E 5KH6A 3J7AF 2DJZA 1JRIA 3GNFB 4BDZA 3QZ9B 2RJCA 1XOVA 2EQKA 1QW1A 4M77B 3DKMA 3V8LA 5GANd 1U8RA 3SB2A 2ZPHB 3JB9D 3M9QA 3M58A 2ZPEB 2XG8D 2LNVA 5IT9E 1N8RC 3LX7A 2VXFA 3JCMf 3HSBA 1PSEA 2QEXT 4EMKB 4PJOC 1MHNA 5DLQE 5GAOn 3LH0A 2QQBA 2XICA 3G7ZA 3GNGA 4A4KA 4F7UE 3CCVA 1IZ6A 3OBWA 1EIFA 1UGRB 4R55A 1VQLT 2IG0A 3M4GA 1M1KC 2P0PA 2EWNA 2DXTA 2XU8A 3OYNA 3CD6T 2JVVA 3I56A 5GAMg 4R56A 2HAXA 2QXFA 2JUFA 2O4XA 4LD9K 4DOVA 3CCST 5CKHA 3VUBA 3UWNA 1YCYA 3HRUA 3CMAT 4N0AA 2GFAA 1NZ9A 3PIPA 1VQOT 1VQ6A 2K3XA 2FHDA 2R58A 3S3MA 3GF5A 2K57A 4M77F 3OMGA 2E5QA 3BDUA 4M75C 2D9TA 5CKEA 2L89A 2V8JA 1KQ2A 4PJOB 3CCVT 4N4GA 3CBOA 3FDRA 3V7SA 4L6V5 1DJ7B 4M75A 4C8QA 2JTMA 3CCET 3TCJA 1KC8U 2RI5A 5CAIA 2XI9A 3UDCA 2QEXA 3C94A 3CPWA 4IUTA 3I56T 2Y4YA 4OF1A 2YLBA 1YJWT 4LDWA 2X4WA 2L3RA 2GFUA 3META 3PMIA 1VQ9A 1YHQA 2DXUA 3L2RA 3E9GA 3OYKA 2EIFA 2PVOB 3JCMW 2KAFA 5IN1A 4C8QF 4JRIA 1MGQA 2MWOA 5LJ3g 1M90C 3CCLA 3MEWA 4OVAA 5KCOA 3OYAA 2P0QA 3HPWA 1YJNA 4XAXB 3CCMT 4RMOA 3MEUA 4FL6A 1WJRA 2LX9A 3EFSA 2VUBA 3NTIA 1UB4A 4E7LA 4C8QC 4XTUA 1SSFA 5D6XA 4J6YA 3JCMQ 1I5LA 4BI3A 2DPPB 3M59A 4C8QG 2LTOA 3MO8A 4JRQA 3HRSA 4F7UA 2ZGWA 2RI3A 2LT4A 5LJ5h 3QG1A 2XHCA 4LDVA 5A0DA 3BY7A 4C0FA 1ZQ1A 3M4YA 4ZGEB 5GAOm 2EFIA 3CPWS 4X34A 3CCQT 5LJ5j 1K8AU 5CQXA 4J6WA 3CCMA 3X25B 1M90U 2DTOA 4HT8A 4HCBA 3BDLA 1YJNT 4M78D 4MDXA 2EAYA 1JJ2S 3JCMc 3OS1A 4NOYA 1VQPT 2HBPA 3OY9A 4M7DD 2Y90A 4D6WA 3LWIA 3CXCS 1ZHIA 4Q5WA 1VQ5A 4JRPA 1VQMA 1K73U 3RMQA 5GMKi 2JN0A 3LGFA 1LNXA 5C0MA 5GMKh 4P5NA 3RESA 4MMLA 3L2VA 4XTXA 4PLLA 3PT9A 4M77E 2K5IA 4E7KA 2LVMA 1VUBA 4J7IA 1I8FA 4J8OA 4N0AC 2HD0A 4PNOA 5GAN2 4BE1A 3VU3C 4LDXA 3BFMA 5GAN7 1UEBA 3NTKA 1GXIE 4OGEA 1VQ4A 1OZ3A 4CI0C 2OTJT 3MP8A 4DQ2A 2LT1A 5GAMd 4RCBA 1KQSS 2I2LA 2F69A 5A0GA 4A4EA 4KT0E 2RI2A 3RKYA 2NLUA 4JUVA 4XTZA 5FU6C 1YJ9T 1O9SA 3KBGA 3CCQA 3CCSA 5GANj 4HCCA 2L5QA 2FYKA 1M1KU 2DVEA 1YITA 4JLIA 2RHZA 1Y07A 3G71T 3CC7A 2LCLA 4QQDA 2ZPFB 2RO0A 4QVZA 1WQ7A 5GANf 3CPFA 2QQRA 3ER0A 2G3RA 3X26B 4B9XA 1Q81U 3VKIA 1TH7A 4BE0A 4O6JA 2R57A 2DIGA 2VXEA 1N8RU 3OYJA 3FC3A 3A8MB 2KMTA 5FU7C 3OA6A 3M55A 2VGNA 3MP6A 1BIAA 5CKBA 5A2QE 2KQWA 1D3BB 1X6OA 3OBYA 2PU9B 3ZFJA 4C8QD 2QA4A 4BE2A 4ATOA 1N27A 5GAMe 2D0QB 3JB9G 4FT2A 2GQVA 3L2WA 1KQSA 3MEAA 3G71A 1VQ5T 2D6FA 1M1GA 2P4TA 4EMGA 4M7AG 4M7DE 1QVFS 4FM4B 5CR2A 4XK8E 1VQNT 3GIBA 1JBMA 2K2VA 3HFNA 3G4ST 2BIVA 3G6ET 4M77A 4BB7A 2VV5A 4C0ZA 5GAMj 3OYDA 3CCEA 1WJQA 1Q7YU 5GAOl 2B8AA 3CMEA 3OW2S 3SD4A 3OMCA 3FEOA 2ZCFB 4OGCA 2LRQA 4A54A 3JCMX 2F5TX 3C4SA 1HXDA 3OYFA 3QUIA 4MZPA 4PLIA 4XU1A 3JAME 3KXTA 1M9SA 3JCMg 3MCAB 5CVIA 3OYEA 3JB9J 5AYFA 2K5LA 4DOWA 2LCCA 4JJNK 3DLMA 1Y71A 2DZCA 2RB6A 3RIRA 3CCLT 3CCUT 5M9OA 3CEYA 3L2ZA 4LDYA 4KBMB 3OYIA 2O4XB 4FT4A 5I21A 3OYMA 1YJWA 1Q86C 4OB3B 4M7AA 5DLOA 2DAQA 4C92A 4M78A 5HK3A 3SWNA 3VYGA 4JS4A 4E47A 2MMPA 5LL6S 5LJ3j 5CKFA 5LJ5g 3QHSA 1Y96A 4N4HA 2EQUA 4XQ3A 3RUXA 3Q1JA 5LJ3f 4M7DA 3OSVA 3L2UA 4V2SA 2E1HA 3CCRT 5CIUA 3CXCA 5FRMA 2EYQA 3OB9A 2E65A 3PFSA 3SDZA 3OYGA 3QBYA 3QKJA 4M77G 1G3TA 5FU6B 2RK2A 1QP3A 4JDSA 5GANe 2PQWA 3O8VA 5L8RE 5GAN8 4ZTFA 5KCHA 3M53A 2F5KA 3A8HB 4WF2A 4MDWA 1LJOA 4C92E 1NPPA 3M5AA 1QP2A 2RHXA 3WVEB 3CCJT 3CD6A 2RHUA 1R8OB 1VQ8T 4L5GA 1FX7A 3ZBDA 4M75E 4UC4A 3S3OA 1NE8A 1K9MU 5LJ5e 1BYMA 4NL3A 2PUKB 2XK0A 3FJPA 4PJOF 4OB1B 4M77D 1VIFA 2RK1A 3INZA 4RCCA 1BI2A 1B34A 1XNIA 1W2BS 1VQLA 2O01E 4IUQA 1NPRA 3T9NA 2JNGA 3URGA 3OS0A 5GMKj 1K9MC 3JB9H 4IUPA 3HP9A 3JCMV 1VQ7A 5GANg 2VGMA 3S3NA 1XQHA 1QVGS 2L8DA 1LOJA 4EDUA 3A8GB 1N6AA 2E10A 2LC4A 3MHXA 3JCMh 3MEVA 1X01A 2RH2A 5KE3A 2E70A 4QW2A 5D6WA 1VQKA 4XU3A 4C8QB 3RERA 4M78F 4A4GA 2DD5A 4J83A 3JCMb 3TEEA 2DD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RMO A;  2XDD A;  2XD0 A;  4GLK A;  2XDB A;  4ATO A; 
#chains in the Genus database with same CATH topology
 5FRN A;  4OMN A;  1AT1 B;  2ZPG B;  3OYC A;  1WFW A;  1VQN Q;  3CC2 Q;  2FRY A;  2OTJ A;  2BZX A;  1WXT A;  3PIO A;  4OB2 B;  4HVU A;  3SWN C;  2QQA A;  2WSE E;  2ZAE A;  1QMC A;  2QA4 T;  1RAI B;  1ZBJ A;  2VAS A;  4AFS C;  5IHN A;  4HT9 A;  2NUZ A;  3F70 A;  5AT1 B;  2DL8 A;  4E7S A;  2O9S A;  3E1S A;  1VQ8 A;  1VQ6 Q;  2VYT A;  2KSS A;  1VOM A;  3CC4 T;  2DKG A;  4IKF A;  1X6B A;  2HEQ A;  4NS5 A;  4C92 D;  2CZ6 B;  3L42 A;  1WHH A;  2FO0 A;  3NPF A;  3I5R A;  3CC2 A;  2O31 A;  4GLK A;  1KHI A;  2D1X A;  3JB9 I;  2DL7 A;  5GMK m;  1WJS A;  2KVQ G;  1UJY A;  1UGP B;  4LDU A;  5J39 A;  3QO3 A;  3G1J A;  2SEM A;  2YRV A;  3CMA Q;  1UGQ B;  1RAC B;  2L0A A;  1XJW B;  5A0L A;  4FSX A;  2F1L A;  4BAC A;  3HHT B;  3GP8 A;  2EYW A;  1TWB A;  4A4H A;  4J9I A;  2XDP A;  4XTW A;  3GOX A;  2AZV A;  2K4Y A;  2KT8 A;  4M78 C;  2GNC A;  4MMK A;  4KGV B;  3U23 A;  3GBQ A;  3CC7 Q;  3CC7 T;  4Z02 A;  2PVD B;  5DM7 R;  4M78 E;  3H6Z A;  3FB9 A;  2OAU A;  3TU4 K;  3V8K A;  3CCR A;  3JB9 F;  4F14 A;  5CK9 A;  6AT1 B;  1AHJ B;  2ZZD A;  1JXM A;  1FMK A;  3RR6 A;  2X4X A;  4B6M A;  3M56 A;  2DEQ A;  5D6Y A;  1VQP Q;  3P8D A;  3D7S B;  3QII A;  1W6X A;  4KUL A;  4ZTJ A;  2CZ1 B;  2FZC B;  5GAO q;  3CPW P;  5FRO A;  2P84 A;  3C12 A;  2GCX A;  2MYS A;  3EFR A;  3HFO A;  4M75 D;  4NL2 A;  1OI1 A;  4QVC A;  1VQ4 T;  2DYB A;  3SWN B;  2DXB A;  2GTJ A;  1UFF A;  1G3Y A;  5HK0 A;  2RJF A;  4M78 G;  1JJ2 A;  2GQI A;  2CP5 A;  4JJD A;  2XDB A;  2H3E B;  5GAN 5;  3N5B B;  3M0U A;  1V29 B;  1WHK A;  2K3B A;  2V8K A;  4EMK C;  2KK4 A;  2WAC A;  2H8H A;  2KY9 A;  2M0Y A;  1YHQ T;  1G3W A;  1XTD A;  1QQJ A;  5CCA A;  5L23 A;  3C95 A;  1VYT A;  2MF2 A;  2XDD A;  3EG1 A;  1NEB A;  2A36 A;  2C06 A;  4BY6 B;  3QDR B;  1M27 C;  3EH1 A;  3MP1 A;  4M7A C;  1WNL A;  4ORZ A;  1P92 A;  4QQG A;  3L1A A;  2LQW A;  4LD6 A;  2CYZ B;  3J7A F;  2FRW A;  3GNF B;  4BDZ A;  1KK7 A;  1TG0 A;  4M77 B;  2LZ6 B;  1U8R A;  1FMV A;  4DBQ A;  3EG2 A;  1PNJ A;  1PCX A;  2EGA A;  2XG8 D;  1OPL A;  5KYX B;  3HSB A;  3JCM f;  1PSE A;  2QEX T;  2RQU A;  4EMK B;  1H8K A;  4A4K A;  3G7Z A;  1IZ6 A;  3OBW A;  1VQL T;  1M1K C;  3I56 A;  5GAM g;  3EHR A;  1YIJ Q;  2DEU A;  4CC4 B;  1ZA1 B;  1T3S A;  3CCS T;  3VUB A;  3UWN A;  2G6F X;  3CMA T;  1PWT A;  4WCI A;  1NBE B;  4FYW B;  2K57 A;  2RN8 A;  4M77 F;  1I5O B;  2E5Q A;  2CUB A;  3BDU A;  5CKE A;  1KQ2 A;  1UHC A;  2C0I A;  3M0T A;  4L6V 5;  4M75 A;  4C8Q A;  1ZSZ C;  3CCE T;  3C94 A;  1IRX A;  2X4W A;  2GFU A;  2JS2 A;  2HKN A;  3KFV A;  3CCL A;  2BE7 D;  3ULR B;  1OU8 A;  4LUD A;  1YJN A;  3H41 A;  3CCM Q;  2JM8 A;  4FL6 A;  4E7L A;  1Q7Y R;  4J9B A;  4XTU A;  2COY A;  5D6X A;  2MIO A;  1ABQ A;  1AWO A;  3M59 A;  2LTO A;  3MO8 A;  3HRS A;  4PFO A;  4F7U A;  3BE3 A;  5LJ5 h;  3BY7 A;  4ZGE B;  4X34 A;  5LJ5 j;  2KE9 A;  2GBQ A;  3CCM A;  3X25 B;  1M90 U;  3MJX A;  2ED0 A;  1YJN Q;  2IPO B;  1SSH A;  2VWF A;  2ATC B;  1JJ2 S;  3VS6 A;  4M7D D;  3LWI A;  2JN0 A;  5KYY A;  4HXJ A;  5GMK h;  4P5N A;  3RES A;  3EG3 A;  4LE9 A;  3VS7 A;  3REB B;  2K5I A;  1Q81 R;  2LVM A;  2RMO A;  1I8F A;  1JU5 C;  4N0A C;  2HD0 A;  4PNO A;  5GAN 2;  3NTK A;  4OGE A;  4CI0 C;  2QDL A;  4OML A;  4RTT A;  2D8J A;  2RI2 A;  3RKY A;  4XTZ A;  5FU6 C;  2HL3 A;  1O9S A;  3HTR A;  2L5Q A;  4F16 A;  2RO0 A;  1WQ7 A;  5GAN f;  2A28 A;  2V1R A;  3CPF A;  2G3R A;  4PJJ A;  4B9X A;  1Q81 U;  3VKI A;  1F1B B;  2R57 A;  2EGC A;  2L2P A;  4E6R A;  2KMT A;  1RAH B;  3OA6 A;  3AT1 B;  2VGN A;  5A2Q E;  1X6O A;  3ZFJ A;  4C8Q D;  2QA4 A;  4BE2 A;  1N27 A;  4GBQ A;  3JB9 G;  2JTE A;  4FT2 A;  2GQV A;  2W10 A;  4AG2 C;  4FM4 B;  5CR2 A;  1VQN T;  3CCE A;  4C0Z A;  2VB6 A;  1AD5 A;  4KRT A;  1WJQ A;  1Q7Y U;  2JMC A;  3OW2 S;  2LNH B;  3SD4 A;  1QCN A;  1IXD A;  1TTH B;  4OGC A;  3JCM X;  3QUI A;  4MZP A;  1VQ9 A;  3JCM g;  3OYE A;  3JB9 J;  1Q82 R;  4JJN K;  2DZC A;  1FMW A;  1I07 A;  2EPD A;  4LDY A;  2PNI A;  3CCQ Q;  1D0X A;  1IGQ A;  3UAT A;  1WA7 A;  2COW A;  3PVL A;  5DLO A;  5HK3 A;  3SWN A;  3VYG A;  1OX8 A;  4N4H A;  4M7D A;  4V2S A;  1D1B A;  1AZE A;  1AOJ A;  3SDZ A;  1YP5 A;  4M77 G;  2O2O A;  2RK2 A;  1QP3 A;  5KCH A;  2F5K A;  1WZO A;  2RHX A;  1D0Y A;  3WVE B;  3I56 Q;  2JM9 A;  1QWF A;  1UGV A;  5HCK A;  3ZBD A;  4M75 E;  1K9M U;  2CSQ A;  3PE0 A;  2XK0 A;  3FJP A;  1XNI A;  2FZG B;  3QDF A;  3OS0 A;  1VQ7 A;  5GAN g;  2L8D A;  1LOJ A;  3ZL7 C;  4EDU A;  1SKU B;  1OV3 A;  1ZSZ B;  1WX6 A;  2E10 A;  1W70 A;  3MEV A;  2J6F A;  1KC8 R;  1X01 A;  2RH2 A;  5KE3 A;  2E70 A;  1SRM A;  2MOX A;  4XU3 A;  4OMQ A;  3PIP A;  2DD4 A;  1B7T A;  4M7D F;  4J9F A;  4EMK A;  1PRL C;  4JRK A;  3QPH A;  2MCN A;  1W1F A;  3WVD B;  4PJO D;  1ARK A;  2A7Y A;  3EH2 A;  4L59 A;  4C92 G;  4BDY A;  3HRT A;  2X3W D;  4QQ6 A;  1H64 1;  1U3O A;  1KIK A;  4C5G A;  4AFZ C;  1Q82 U;  1QLY A;  1O75 A;  4JJC A;  1KD1 U;  2DF6 A;  2K3Y A;  2DIL A;  3PTA A;  2K79 A;  4BUG A;  2LDM A;  5IAY A;  4BI4 A;  2KRN A;  5IXF A;  3M0R A;  3DB4 A;  4AFQ C;  1ZBX A;  5I2S A;  3BW1 A;  1RAG B;  2JJ9 A;  1AWX A;  2VKN A;  2JOY A;  5ECA A;  5I22 A;  5CQY A;  2HQX A;  3CCR Q;  3VUZ A;  2M1H A;  5DY9 A;  4KH0 B;  1D3B A;  2ZPB B;  1Y0M A;  1M5Q 1;  1H92 A;  1I81 A;  4EIK A;  3M54 A;  1UHF A;  1C0M A;  4PJL A;  2DTH A;  1UEC A;  3HKS A;  1N9S A;  4IUR A;  4M4Z A;  2FG0 A;  5FLX E;  4HCZ A;  2E41 A;  1VQ5 Q;  1BI3 A;  2QGG A;  3CBP A;  4F7U B;  1BCM A;  2X35 A;  4PJO A;  1WXB A;  5LJ3 d;  4RTY A;  1RAF B;  1YJW Q;  3CXC P;  3JCM P;  2DZ9 A;  1T3L A;  1OYX A;  1N8R R;  4OMP A;  1K8A R;  3ASK A;  3ZEH A;  1YIJ A;  1FXX A;  1OQK A;  3H0I A;  1QVG P;  4IIM A;  4A53 A;  3UPU A;  5GAN h;  1QKW A;  3CMA A;  1MUZ A;  1S72 A;  4C5I A;  3I55 A;  3RKW A;  3E9F A;  3GLX A;  4WTO B;  3EGD B;  2KRO A;  1K9M R;  3OS5 A;  3DLL A;  3I5S A;  4PJO G;  2A3L A;  1WYX A;  4DA4 A;  5KYU A;  1KQ1 A;  1SF9 A;  4M7D B;  3RMS A;  3X24 B;  4F7U F;  2YUP A;  3OYB A;  3MKD A;  4VUB A;  1G3S A;  3PVQ A;  3J81 E;  3VV0 A;  1AEY A;  1K8A C;  5LJ5 f;  5C6S A;  2DTI A;  1M4Z A;  1WPY A;  2JTF A;  2KT1 A;  9ATC B;  2YLC A;  1AWW A;  1Q86 U;  2V1Q A;  4Y28 E;  3TSW A;  4DBH A;  1N9R A;  1KQS P;  3QJ6 A;  2RHI A;  4RG2 A;  3CCJ A;  4TVR A;  1VQ9 T;  1K0X A;  4C92 F;  5HY6 A;  1VQ6 T;  1ZSG A;  2FB7 A;  3QSU A;  1LVK A;  2QEX Q;  1TS9 A;  2DXC A;  3CME Q;  4M7A B;  1Q95 G;  3L2Q A;  4M7D G;  1Y96 B;  1VQN A;  4C0D C;  3A8O B;  4PJO E;  5GAO p;  3QYG B;  4EPC A;  2QTX A;  1G5V A;  4II1 A;  1KC8 C;  4E7I A;  3JRZ A;  1NM7 A;  1TXQ A;  2QYZ A;  1YN8 A;  4M7D C;  4AG1 C;  1OU9 A;  1HSQ A;  5KE2 A;  2HQH A;  1VQM T;  2KGT A;  4XTV A;  4J9E A;  4OMF B;  2RM4 A;  1Q7Y C;  2EKO A;  3RBB B;  2L3P A;  4HCK A;  3A8L B;  1FYN A;  1M8V A;  3A5Z B;  1YI2 T;  5EG2 A;  1SHG A;  1SG5 A;  1WQW A;  1W2B A;  2VC8 A;  3UA6 A;  2KYB A;  2LP5 A;  1TUD A;  1IRE B;  2M0O A;  3QYH B;  2E12 A;  2PTK A;  1BB9 A;  5KH6 A;  1JRI A;  2EQK A;  2KEA A;  2ZPH B;  3M9Q A;  1JO8 A;  2FPF A;  3M0Q A;  3LX7 A;  3VS1 A;  5GAO n;  2QQB A;  4F7U E;  1UGR B;  4R55 A;  2XU8 A;  3OYN A;  2J6O A;  1JEG A;  2JUF A;  4Y92 A;  4Z88 A;  5CKH A;  3HRU A;  4N0A A;  1NZ9 A;  1RI9 A;  3S3M A;  3OMG A;  2JXB A;  2L89 A;  2OTL Q;  3CCV T;  4JZ4 A;  2DLP A;  3CCV Q;  3CBO A;  2O9V A;  5KYW A;  1DJ7 B;  1QCO A;  4D8K A;  2RI5 A;  2I0N A;  3UDC A;  2Y4Y A;  4OF1 A;  1YJW T;  2L3R A;  1YHQ A;  2AKL A;  5EC7 A;  3JCM W;  2KAF A;  2ENM A;  2MWO A;  5LJ3 g;  1M90 C;  1Q86 R;  1IB8 A;  4XAX B;  4RMO A;  1WJR A;  2QAS A;  3EFS A;  4C8Q C;  2HZY A;  1SSF A;  1K73 R;  2LJ3 A;  4J6Y A;  1I5L A;  1YHQ Q;  2RNA A;  3UA7 A;  5A0D A;  3CCQ T;  1GL5 A;  2JS0 A;  1MV0 B;  4J6W A;  4HT8 A;  2DTO A;  2EYX A;  4M78 D;  2CP0 A;  2SRC A;  3R6N A;  2CH4 W;  3OS1 A;  2Y90 A;  4D6W A;  4Q5W A;  1VQ5 A;  1VQM A;  1M1K R;  1K73 U;  1VQO Q;  1YNZ A;  5C0M A;  4XTX A;  3PT9 A;  1WIE A;  1NLP C;  4BE1 A;  4ZNX A;  2EKH A;  1UEB A;  1GXI E;  1OZ3 A;  2OTJ T;  2C0T A;  4DQ2 A;  2LT1 A;  5GAM d;  1D1C A;  4A4E A;  5GJW B;  2DE0 X;  2DJQ A;  3CC4 Q;  1VQL Q;  4ESR A;  1M1K U;  1YIT A;  2RHZ A;  1Y07 A;  3CC7 A;  2LCL A;  4QVZ A;  1A0N B;  1QVF P;  2QQR A;  3X26 B;  1TH7 A;  4BE0 A;  4O6J A;  1X6G A;  3FC3 A;  2KXC A;  5CKB A;  1BIA A;  1I1J A;  1MV3 A;  4ATO A;  1NG2 A;  5GAM e;  1UG1 A;  2QK0 A;  4PK4 A;  3MEA A;  2D6F A;  1YI2 Q;  2OX7 A;  1U5S A;  1T0H A;  1OPK A;  3G4S Q;  2K2V A;  3HFN A;  3TSZ A;  3OYD A;  1Z9Q A;  1R0C B;  2ZCF B;  2LRQ A;  1TSF A;  3C4S A;  3JAM E;  4XU1 A;  4DOW A;  2X51 A;  3DLM A;  2RB6 A;  2MK5 A;  1CSK A;  2EQI A;  5M9O A;  1PD0 A;  3CEY A;  3L2Z A;  3OYI A;  3OYM A;  1U06 A;  1YJW A;  4J9D A;  1Q86 C;  4OB3 B;  4M7A A;  4M78 A;  3REA B;  2J05 A;  5LL6 S;  5LJ3 j;  4LNP A;  1Y96 A;  3RUX A;  3CCR T;  4GLM A;  5CIU A;  3PFS A;  2E65 A;  3QKJ A;  1G3T A;  1G2B A;  4JDS A;  5L8R E;  2FPD A;  1LJO A;  3CCJ T;  5IH2 A;  3VS0 A;  2E4H A;  4L5G A;  1VQ8 Q;  1FX7 A;  2CUD A;  1VQ4 Q;  3S3O A;  5LJ5 e;  1BYM A;  4NL3 A;  2K7A A;  4PJO F;  1VIF A;  2RK1 A;  3EG9 A;  2HL5 C;  1BI2 A;  2ECZ A;  2O01 E;  3URG A;  1SHF A;  2DA9 A;  5GMK j;  4IUP A;  1QVG S;  2LJ0 A;  1ACM B;  3A8G B;  2LC4 A;  3MHX A;  1TOV A;  2FPE A;  5D6W A;  4QW2 A;  1LPL A;  4CC2 A;  4JPB W;  3EFO A;  3GPL A;  2QDY B;  3MPU B;  2EJ9 A;  4M7A E;  1D1A A;  3E19 A;  1RAD B;  2PVG B;  3V7C A;  2CT3 A;  2QQ9 A;  3JCM J;  4FIB A;  3G6E Q;  3A98 A;  2HSP A;  3VS5 A;  3KUF A;  4ME7 A;  3PNW C;  3QWX X;  2EQM A;  4J6X A;  3OW2 A;  2ROL A;  4ZN3 A;  2XD0 A;  1OOT A;  1JB0 E;  2MAM A;  3VJP A;  5LJ3 h;  5D7U A;  4K11 A;  3VRZ A;  5GAN 6;  1WHG A;  3FLG A;  1YJ9 Q;  4ZGJ B;  1KD1 C;  1RAE B;  2RA2 A;  3CCU A;  1Q82 C;  1QWE A;  5GAN 3;  2YXY A;  2K5F A;  3EGX A;  3HL8 A;  4ELY C;  1QCF A;  4E7H A;  2LCS A;  3OYY A;  1OX9 A;  2JW4 A;  3OYH A;  1JQQ A;  1SRL A;  2M02 A;  1K9A A;  2YUO A;  4C5H A;  5GAO r;  3FIF A;  2NUP A;  2RHY A;  2BUD A;  1ABO A;  1YBY A;  1RI0 A;  2X3X D;  1VQP A;  4ANJ A;  4EMH A;  2CT4 A;  4M77 C;  2E6N A;  4N4I A;  4ELZ C;  4B9W A;  4DBF A;  4IUV A;  3OQ5 A;  1PKS A;  4C8Q E;  1EFN A;  2J7I A;  1KG1 A;  3X28 B;  1ZUK A;  2X4J A;  2AT1 B;  2GTO A;  2K6D A;  2QTV A;  1UDL A;  5FWB A;  1S72 T;  4PKC C;  4BY6 C;  2QQS A;  4QVD A;  1E7O A;  3SEM A;  1X75 C;  1GFC A;  2CH4 A;  2LX7 A;  1D09 B;  2EGE A;  2OTL A;  1Y7X A;  4YTL A;  1K73 C;  4M7A F;  4LXC A;  1QVP A;  4OB0 B;  4XTY A;  4MZT A;  1G83 A;  1WHJ A;  5J3B A;  3H8Z A;  3EG0 A;  1U1T A;  4C0G A;  1H3Z A;  4BD3 A;  2Y4X A;  2EJG A;  1NYG A;  2XID A;  1QVG A;  3JCM e;  3P8H A;  2RD1 A;  4IUU A;  2DIQ A;  5GMK l;  2RQW A;  1PSF A;  2OTL T;  3EG9 B;  3C0C A;  2EJF A;  2JZ2 A;  1W2B P;  2X4Y A;  2HSE B;  2BE9 B;  3QXE B;  1GCQ C;  1R77 A;  1QVF A;  3QZ5 B;  4A63 B;  2KYM A;  1LCK A;  1VIE A;  2GF7 A;  4JLG A;  4JS5 A;  4HVV A;  4Z8A A;  1OZ2 A;  2NUT A;  4F17 A;  1MMA A;  4OMM A;  3JCM d;  4PJM A;  4DEX A;  4PL6 A;  1WHM A;  3M57 A;  5I2M A;  4ZN1 A;  1X69 A;  3LYI A;  4XU2 A;  2X9H A;  4X9D A;  1C6V X;  4A4F A;  5FWC A;  5LJ3 e;  3WXM B;  2BKD N;  2RJE A;  2LQ8 A;  3CC2 T;  1B34 B;  1Q81 C;  4C92 B;  2FVU A;  4M78 B;  3LWH A;  2CZ7 B;  2E64 A;  2CS7 A;  4C92 C;  5CO7 A;  4RG8 A;  3TQ7 P;  2DL3 A;  2DL4 A;  3QZ9 B;  5GAN d;  3SB2 A;  1KJW A;  1WI7 A;  3H0H A;  1IHV A;  2LNV A;  5IT9 E;  1GFD A;  2DM1 A;  4PJO C;  1MHN A;  1NEG A;  5DLQ E;  3LH0 A;  2XIC A;  3GNG A;  3CCV A;  1K4U S;  2IG0 A;  2HCK A;  2YUQ A;  2JVV A;  4R56 A;  2QXF A;  4OMO A;  2O4X A;  4LD9 K;  4DOV A;  2HDA A;  1K76 A;  1YCY A;  2J6K A;  1X43 A;  2GFA A;  1VQO T;  2YDL A;  2FHD A;  4JJB A;  1VQ9 Q;  1PHT A;  2YRC A;  2V8J A;  1VQM Q;  2D8H A;  2JTM A;  2OTJ Q;  1KC8 U;  2KR3 A;  2KI7 A;  2GGR A;  5CAI A;  2XI9 A;  3M0S A;  3CPW A;  3EFO B;  3I56 T;  3MET A;  1PG5 B;  2DXU A;  1X2Q A;  3E9G A;  3OYK A;  3L2R A;  1G8X A;  3MEW A;  3LH5 A;  3CCM T;  1QKX A;  2QAZ A;  2NWM A;  2LX9 A;  2VUB A;  3JCM Q;  4FYY B;  4BI3 A;  4C8Q G;  4JRQ A;  2DBM A;  2ZGW A;  2JMA A;  2LT4 A;  1KD1 R;  2XHC A;  4LDV A;  1AWJ A;  1ZQ1 A;  3M4Y A;  5GAO m;  3CPW S;  1K8A U;  5CQX A;  4HCB A;  3BDL A;  1YJN T;  3QWY A;  1VYU A;  1VQP T;  3OY9 A;  1PM3 A;  3CXC S;  4JRP A;  4LUE A;  3RMQ A;  2RQT A;  2YWW A;  3L2V A;  4M77 E;  2OJ2 A;  1AZG B;  4E7K A;  1VUB A;  4J8O A;  3BFM A;  5GAN 7;  1YCS B;  3MP8 A;  4LN2 A;  2F2X A;  4RCB A;  4KT0 E;  4JUV A;  1WXU A;  3CCS A;  2FYK A;  2DVE A;  3I9Q A;  4QQD A;  2ZPF B;  4AMC A;  1SPK A;  3NMZ C;  2DIG A;  2VXE A;  1N8R U;  1HJD A;  1M30 A;  2DRK A;  1V76 A;  3IQL A;  5FU7 C;  3M55 A;  1K1Z A;  2KQW A;  1D3B B;  2E5K A;  2PU9 B;  1NJI R;  2OI3 A;  1JXO A;  2EYZ A;  1VQ5 T;  3G71 A;  1MMG A;  4M7A G;  1MMD A;  4M7D E;  2P4T A;  4E7Z A;  4J9H A;  2PZ1 A;  3G6E T;  1HD3 A;  4M77 A;  1M2V B;  2DX1 A;  2DYI A;  4AFU C;  5GAO l;  3CME A;  1N5Z A;  3OMC A;  3FEO A;  2DFU A;  2L3S A;  1X27 A;  1HXD A;  3OYF A;  1GBR A;  1M9S A;  3MCA B;  5CVI A;  5AYF A;  2DRM A;  2DBK A;  1Y71 A;  3RIR A;  4KGZ B;  3CCL T;  2KRS A;  1VYV A;  2O4X B;  5I21 A;  2M51 A;  3EGD A;  4JS4 A;  2LMJ A;  3E2U A;  4J9G A;  4RUG A;  2MMP A;  4R0K A;  5CKF A;  5LJ5 g;  1M3B A;  2EQU A;  5LJ3 f;  2D0N A;  3OSV A;  3L2U A;  2E3I A;  3CXC A;  1RLQ C;  2QA4 Q;  1X2K A;  2NUT B;  1CKB A;  2KNB B;  1IO6 A;  5FU6 B;  5GAN e;  3SHW A;  5GAN 8;  1UE9 A;  1ZA2 B;  2OAW A;  2W0Z A;  3M53 A;  4FYX B;  3A8H B;  1NPP A;  1ZUY A;  3M5A A;  2QG9 B;  2RHU A;  1R8O B;  4UC4 A;  1NE8 A;  2PUK B;  3I35 A;  4OB1 B;  4M77 D;  3INZ A;  1B34 A;  1W2B S;  1K9M C;  3JCM V;  1E6H A;  2CRE A;  1N6A A;  1S72 Q;  3JCM h;  3UF4 A;  4A4G A;  4J83 A;  3JCM b;  3TEE A;  2AZS A;  2FL7 A;  5I11 A;  2XMF A;  1ZLM A;  1KHC A;  2M16 A;  4QKU A;  3OW2 P;  5J26 A;  4C0D B;  5CKD A;  2CP6 A;  5KYY B;  1BKB A;  5IHI A;  3SFM A;  5GAN 4;  4KGX B;  1PC0 A;  1YI2 A;  2KRM A;  2RF0 A;  2R5A A;  3S6W A;  3QJY A;  1VQ7 T;  2CGH A;  3ME9 A;  3G4S A;  1BI1 A;  4RTV A;  1VQK T;  1SEM A;  2AHJ B;  2L3Q A;  3VYH B;  4DEY A;  1NJI U;  1I4K 1;  1WHL A;  3UT1 A;  2PUO B;  4FYV B;  2CP3 A;  5GJV B;  4ZGD B;  3VS4 A;  2V8I A;  4AT1 B;  5FW9 A;  4M75 B;  4F7U G;  3H9N A;  2COZ A;  4M7A D;  8ATC B;  3NTH A;  5GAM h;  4Z89 A;  1PD1 A;  2DK3 A;  4O5V A;  2F2V A;  4E7J A;  5GMK e;  4PFZ A;  2DO3 A;  5IHK A;  3G6E A;  2P0K A;  2V26 A;  4Y91 A;  1M1F A;  2R5M A;  1NJI C;  2WSF E;  1UGS B;  1KFZ A;  2HQE A;  1HK9 A;  1GCQ A;  1PKT A;  4RKU E;  3V7R A;  2EYY A;  2RJD A;  2H3J A;  2LQK A;  4CC3 A;  3EAE A;  4HA8 A;  1M2V A;  4M75 F;  1BI0 A;  2MI6 A;  4M75 G;  1M3A A;  2CZ0 B;  4J9C A;  4HVW A;  2EQJ A;  5LJ5 d;  1BBZ A;  5KYW B;  2ABL A;  1MNE A;  2AIR B;  2KDS A;  1OEB A;  1YIT T;  3NHN A;  1S1N A;  2B86 A;  1M90 R;  3PGG A;  4KUI A;  2MPX C;  2IVW A;  1MMN A;  3JSC A;  4FU6 A;  2DET A;  4KUD K;  3LLR A;  2QI2 A;  2ZPI B;  4HKE A;  1PRM C;  2YRD A;  4IIO A;  5FU7 B;  4CRI A;  2MWP A;  4X1V A;  3R6O A;  3AHU A;  1R0B G;  1T0J A;  2YT6 A;  2YHT A;  2XKO C;  1D0Z A;  2YUN A;  3NFC A;  1MND A;  3VRY A;  4OP0 A;  4DBR A;  4GY5 A;  4JZ3 A;  2A0F B;  3TRE A;  1BK2 A;  2NYS A;  5HKC A;  3P8B B;  2FZK B;  4J7F A;  2HKQ B;  1GCP A;  3CCS Q;  2P4R A;  4X9C A;  2CP2 A;  3RKX A;  1BU1 A;  1RL2 A;  3CBM A;  2ROT A;  1V1C A;  3DB3 A;  2M9U A;  4MZM A;  3OYL A;  3LW5 E;  2K2M A;  4J5Y A;  1WLP B;  1Z9Z A;  3CME T;  3PMT A;  1B3Q A;  3I55 T;  3RNJ A;  1KSW A;  1WDX A;  3CC4 A;  1YJ9 A;  1ZSZ A;  4BI8 B;  2E6Z A;  1HYO A;  3V8J A;  2BTT A;  1YIJ T;  1GBQ A;  4C5E A;  3G71 Q;  1I0C A;  1VA7 A;  3LGL A;  1UJ0 A;  3EGU A;  4XU0 A;  8AT1 B;  1FWZ A;  3X20 B;  1U1S A;  1UTI A;  3OSS C;  4FW2 A;  2EW3 A;  2WSC E;  3OS2 A;  1WGS A;  2ED1 A;  2IIM A;  2CKK A;  1W4S A;  1BIB A;  4RTZ A;  5GAM f;  3A1P A;  2HNI A;  2DER A;  3FRN A;  4CC7 A;  1VQK Q;  2RQR A;  1VQO A;  3J80 E;  2DJZ A;  2RJC A;  1XOV A;  1QW1 A;  2JT4 A;  2EBP A;  3DKM A;  3V8L A;  3VS3 A;  3JB9 D;  1OUL A;  3M58 A;  2ZPE B;  1N8R C;  2VXF A;  2VVK A;  4F04 B;  2RPN A;  1EIF A;  1GRI A;  1YWP A;  1M3C A;  3M4G A;  2P0P A;  2EWN A;  2DXT A;  3CD6 T;  3CD6 Q;  2HAX A;  2BZY A;  2E3H A;  1BCO A;  1VQ6 A;  2J06 A;  2K3X A;  2R58 A;  3GF5 A;  5KYN A;  2C0O A;  2RQV A;  2YSQ A;  4M75 C;  4PJO B;  2D9T A;  4N4G A;  3FDR A;  3V7S A;  3TCJ A;  4RTW A;  2FEI A;  2QEX A;  3CCJ Q;  4IUT A;  2YLB A;  4LDW A;  3PMI A;  3M0P A;  2EIF A;  2PVO B;  7AT1 B;  3EGX B;  1YFN A;  5IN1 A;  4C8Q F;  4JRI A;  1MGQ A;  4OVA A;  3VS2 A;  5KCO A;  5IXB A;  3OYA A;  1NYF A;  2P0Q A;  3HPW A;  1IHW A;  4KH1 B;  3MEU A;  3THK A;  3NTI A;  1UB4 A;  2A08 A;  2NUP B;  3EHQ A;  2DPP B;  2QGF B;  1TUC A;  1ZUU A;  2RI3 A;  3QG1 A;  1M2O A;  1RUW A;  2K9G A;  4C0F A;  2EFI A;  2DL5 A;  4MDX A;  1UUE A;  2EAY A;  3JCM c;  4NOY A;  2BZ8 A;  2HBP A;  1K0S A;  1ZHI A;  5GMK i;  3LGF A;  1LNX A;  4MML A;  2HMA A;  4PLL A;  4J7I A;  2DNU A;  4LDX A;  3VU3 C;  1RAA B;  1VQ4 A;  3CCE Q;  3CCL Q;  1KQS S;  2I2L A;  1H3H A;  2F69 A;  5A0G A;  3I55 Q;  1CKA A;  2NLU A;  1YJ9 T;  3KBG A;  3CCQ A;  5GAN j;  4HCC A;  1JJ2 P;  4JLI A;  3G71 T;  1IGU A;  3FJ5 A;  3RDV A;  2O88 A;  3ER0 A;  4RTU A;  1M8M A;  2AK5 A;  3OYJ A;  2CP7 A;  3A8M B;  2KBT A;  3MP6 A;  3OBY A;  2CSI A;  3JV3 A;  2D0Q B;  5KYU B;  3L2W A;  1KQS A;  1TUG B;  1AVZ C;  1M1G A;  4EMG A;  4PFP A;  4RTX A;  1QVF S;  3TVT A;  4XK8 E;  3GIB A;  2A37 A;  1JBM A;  1Y57 A;  3G4S T;  2BIV A;  1E6G A;  5GAM j;  4BB7 A;  2VV5 A;  1RAB B;  1B07 A;  2B8A A;  2AKK A;  2KXD A;  4A54 A;  2F5T X;  4PLI A;  3KXT A;  2K5L A;  2LCC A;  3CCU Q;  4FSS A;  3CCU T;  3CQT A;  4KBM B;  2Z0W A;  4FT4 A;  1EZZ B;  4D8D A;  4FCY A;  1EX4 A;  2LQN A;  2DAQ A;  4C92 A;  4E47 A;  2DVJ A;  3QHS A;  4XQ3 A;  2ESW A;  3Q1J A;  2CDT A;  2E1H A;  1VQ7 Q;  5FRM A;  2EYQ A;  3OB9 A;  3OYG A;  3QBY A;  3O5Z A;  2HBW A;  2PQW A;  3O8V A;  4ZTF A;  5KYX A;  4E2F B;  4WF2 A;  4MDW A;  1RLP C;  4C92 E;  1YWO A;  3NGP A;  1QP2 A;  3CD6 A;  1NLO C;  1VQ8 T;  4PJN A;  1ZX6 A;  2F2W A;  1C1A A;  4RCC A;  1VQL A;  4IUQ A;  3T9N A;  1NPR A;  3JB9 H;  2JNG A;  1J3T A;  2DMO A;  3HP9 A;  4FW1 A;  3H0F A;  2VGM A;  3S3N A;  1XQH A;  1YIT Q;  4QT7 A;  2LJ1 A;  1TU0 B;  1VQK A;  4C8Q B;  3RER A;  2EVR A;  4M78 F;  2DD5 A; 
#chains in the Genus database with same CATH homology
 2FL7 A;  5FRN A;  3GPL A;  2QDY B;  4M7D F;  2ZPG B;  2EJ9 A;  3OYC A;  4EMK A;  4JRK A;  4M7A E;  1KHC A;  2M16 A;  3E19 A;  3QPH A;  3WVD B;  2PVG B;  3V7C A;  4PJO D;  5J26 A;  4C0D B;  5CKD A;  2QQ9 A;  3JCM J;  1BKB A;  2A7Y A;  4FIB A;  2OTJ A;  3SFM A;  5GAN 4;  4L59 A;  4C92 G;  4BDY A;  1YI2 A;  3HRT A;  3PIO A;  4OB2 B;  4QQ6 A;  1H64 1;  3SWN C;  2R5A A;  3S6W A;  3KUF A;  3QJY A;  2QQA A;  2CGH A;  4ME7 A;  3PNW C;  2WSE E;  1VQ7 T;  3ME9 A;  3G4S A;  1BI1 A;  2QA4 T;  4C5G A;  1VQK T;  4J6X A;  2EQM A;  4HT9 A;  3OW2 A;  1Q82 U;  2AHJ B;  3F70 A;  3VYH B;  1O75 A;  4ZN3 A;  2XD0 A;  1NJI U;  1KD1 U;  1I4K 1;  2K3Y A;  1JB0 E;  3UT1 A;  3PTA A;  2PUO B;  3E1S A;  4BUG A;  2MAM A;  3VJP A;  1VQ8 A;  4ZGD B;  2LDM A;  5LJ3 h;  2V8I A;  2VYT A;  5GAN 6;  2KSS A;  5IAY A;  4BI4 A;  3FLG A;  3CC4 T;  2DKG A;  4M75 B;  4ZGJ B;  4IKF A;  4F7U G;  1KD1 C;  3DB4 A;  1ZBX A;  2RA2 A;  3CCU A;  4NS5 A;  1Q82 C;  4C92 D;  4M7A D;  2CZ6 B;  3BW1 A;  3L42 A;  3NTH A;  5I2S A;  5GAM h;  5GAN 3;  3CC2 A;  2DK3 A;  4O5V A;  2K5F A;  4GLK A;  2JOY A;  1KHI A;  3HL8 A;  5CQY A;  4ELY C;  3JB9 I;  2HQX A;  5GMK m;  5GMK e;  1WJS A;  4E7H A;  3OYY A;  2KVQ G;  4E7J A;  3VUZ A;  1UGP B;  4LDU A;  2M1H A;  5DY9 A;  2DO3 A;  1D3B A;  2ZPB B;  3OYH A;  5J39 A;  3QO3 A;  1M5Q 1;  2YRV A;  1I81 A;  1UGQ B;  3M54 A;  3G6E A;  2P0K A;  2DTH A;  4Y91 A;  3HKS A;  4C5H A;  5GAO r;  1M1F A;  2R5M A;  3FIF A;  1NJI C;  1N9S A;  2RHY A;  2BUD A;  2WSF E;  1UGS B;  4IUR A;  5A0L A;  2HQE A;  1HK9 A;  4FSX A;  4RKU E;  3V7R A;  1YBY A;  4BAC A;  1RI0 A;  3HHT B;  4HCZ A;  2RJD A;  2E41 A;  2H3J A;  4A4H A;  2LQK A;  5FLX E;  1BI3 A;  3GP8 A;  3EAE A;  1VQP A;  4HA8 A;  4M75 F;  3CBP A;  4EMH A;  4F7U B;  1BI0 A;  2MI6 A;  2X35 A;  4M75 G;  4M77 C;  2CZ0 B;  4PJO A;  5LJ3 d;  2E6N A;  2EQJ A;  5LJ5 d;  4N4I A;  4ELZ C;  4B9W A;  3JCM P;  2DZ9 A;  2XDP A;  4IUV A;  3OQ5 A;  4C8Q E;  4XTW A;  1OYX A;  2KDS A;  1KG1 A;  3X28 B;  3GOX A;  2X4J A;  3ASK A;  1YIT T;  3ZEH A;  2K4Y A;  1YIJ A;  1FXX A;  4M78 C;  3PGG A;  4KUI A;  1S72 T;  2IVW A;  4PKC C;  4BY6 C;  2QQS A;  4QVD A;  4A53 A;  3UPU A;  3JSC A;  5GAN h;  3CMA A;  4FU6 A;  4MMK A;  1S72 A;  4C5I A;  4Z02 A;  2PVD B;  3RKW A;  3I55 A;  3LLR A;  3CC7 T;  4KUD K;  2QI2 A;  2ZPI B;  3E9F A;  1X75 C;  3GLX A;  4HKE A;  4M78 E;  5DM7 R;  3H6Z A;  3OS5 A;  3FB9 A;  3DLL A;  4PJO G;  5FU7 B;  4CRI A;  2A3L A;  4DA4 A;  2OTL A;  2MWP A;  1Y7X A;  1KQ1 A;  4YTL A;  2OAU A;  1K73 C;  4M7A F;  3TU4 K;  3V8K A;  3R6O A;  3AHU A;  3RMS A;  3CCR A;  3X24 B;  3JB9 F;  1QVP A;  4F7U F;  4M7D B;  4OB0 B;  5CK9 A;  4XTY A;  3OYB A;  4VUB A;  1G3S A;  1AHJ B;  4MZT A;  2YHT A;  2XKO C;  2ZZD A;  2X4X A;  3NFC A;  3H8Z A;  5J3B A;  4OP0 A;  3J81 E;  3VV0 A;  3M56 A;  1U1T A;  4GY5 A;  4C0G A;  4BD3 A;  1H3Z A;  1K8A C;  2Y4X A;  3TRE A;  2DEQ A;  2EJG A;  5D6Y A;  5HKC A;  3P8B B;  5C6S A;  2DTI A;  3P8D A;  4J7F A;  5LJ5 f;  1M4Z A;  2XID A;  1QVG A;  1WPY A;  2JTF A;  3QII A;  2YLC A;  4X9C A;  3JCM e;  1Q86 U;  3P8H A;  2RD1 A;  4Y28 E;  3RKX A;  4KUL A;  1N9R A;  4IUU A;  1RL2 A;  3CBM A;  4ZTJ A;  3QJ6 A;  2DIQ A;  2RHI A;  5GMK l;  2CZ1 B;  4RG2 A;  4TVR A;  3DB3 A;  3CCJ A;  4C92 F;  5GAO q;  5HY6 A;  5FRO A;  2M9U A;  1VQ9 T;  1VQ6 T;  2FB7 A;  4MZM A;  3QSU A;  1PSF A;  3OYL A;  2OTL T;  3C12 A;  2GCX A;  3HFO A;  3EFR A;  3LW5 E;  4M75 D;  4NL2 A;  1OI1 A;  2DXC A;  4J5Y A;  4QVC A;  2EJF A;  2JZ2 A;  1VQ4 T;  2X4Y A;  4M7A B;  3CME T;  3L2Q A;  3SWN B;  2DXB A;  3PMT A;  3QXE B;  3I55 T;  1QVF A;  4M7D G;  3QZ5 B;  1G3Y A;  3CC4 A;  1VIE A;  5HK0 A;  1YJ9 A;  1Y96 B;  2GF7 A;  4JLG A;  4JS5 A;  4BI8 B;  2E6Z A;  2RJF A;  4M78 G;  1VQN A;  1JJ2 A;  3V8J A;  4C0D C;  3A8O B;  1YIJ T;  4PJO E;  4C5E A;  5GAO p;  3QYG B;  1OZ2 A;  4EPC A;  2QTX A;  1G5V A;  4II1 A;  3LGL A;  1KC8 C;  4E7I A;  3JRZ A;  3JCM d;  2XDB A;  4XU0 A;  4PL6 A;  5GAN 5;  3N5B B;  1FWZ A;  3M57 A;  3X20 B;  4M7D C;  1V29 B;  2V8K A;  4EMK C;  2KK4 A;  1U1S A;  2WAC A;  2KY9 A;  5KE2 A;  1VQM T;  5I2M A;  3OSS C;  4XTV A;  4ZN1 A;  1YHQ T;  1G3W A;  1XTD A;  2WSC E;  3LYI A;  4XU2 A;  3OS2 A;  1WGS A;  4X9D A;  5CCA A;  3C95 A;  4OMF B;  2RM4 A;  4A4F A;  1Q7Y C;  2EKO A;  2CKK A;  1W4S A;  2MF2 A;  5LJ3 e;  3A8L B;  2XDD A;  1BIB A;  3WXM B;  1M8V A;  2BKD N;  2RJE A;  2LQ8 A;  3A5Z B;  2C06 A;  1YI2 T;  3CC2 T;  1B34 B;  3QDR B;  4BY6 B;  5GAM f;  5EG2 A;  1Q81 C;  4C92 B;  2FVU A;  4M78 B;  1WQW A;  1W2B A;  3MP1 A;  2VC8 A;  3LWH A;  2CZ7 B;  2HNI A;  3FRN A;  2E64 A;  4M7A C;  2CS7 A;  4C92 C;  1WNL A;  1IRE B;  5CO7 A;  1VQO A;  1P92 A;  2M0O A;  3L1A A;  3QYH B;  2E12 A;  2CYZ B;  4LD6 A;  4QQG A;  4RG8 A;  3J80 E;  5KH6 A;  3J7A F;  2DJZ A;  1JRI A;  3GNF B;  4BDZ A;  3QZ9 B;  2RJC A;  1XOV A;  2EQK A;  1QW1 A;  4M77 B;  3DKM A;  3V8L A;  5GAN d;  1U8R A;  3SB2 A;  2ZPH B;  3JB9 D;  3M9Q A;  3M58 A;  2ZPE B;  2XG8 D;  2LNV A;  5IT9 E;  1N8R C;  3LX7 A;  2VXF A;  3JCM f;  3HSB A;  1PSE A;  2QEX T;  4EMK B;  4PJO C;  1MHN A;  5DLQ E;  5GAO n;  3LH0 A;  2QQB A;  2XIC A;  3G7Z A;  3GNG A;  4A4K A;  4F7U E;  3CCV A;  1IZ6 A;  3OBW A;  1EIF A;  1UGR B;  4R55 A;  1VQL T;  2IG0 A;  3M4G A;  1M1K C;  2P0P A;  2EWN A;  2DXT A;  2XU8 A;  3OYN A;  3CD6 T;  2JVV A;  3I56 A;  5GAM g;  4R56 A;  2HAX A;  2QXF A;  2JUF A;  2O4X A;  4LD9 K;  4DOV A;  3CCS T;  5CKH A;  3VUB A;  3UWN A;  1YCY A;  3HRU A;  3CMA T;  4N0A A;  2GFA A;  1NZ9 A;  3PIP A;  1VQO T;  1VQ6 A;  2K3X A;  2FHD A;  2R58 A;  3S3M A;  3GF5 A;  2K57 A;  4M77 F;  3OMG A;  2E5Q A;  3BDU A;  4M75 C;  2D9T A;  5CKE A;  2L89 A;  2V8J A;  1KQ2 A;  4PJO B;  3CCV T;  4N4G A;  3CBO A;  3FDR A;  3V7S A;  4L6V 5;  1DJ7 B;  4M75 A;  4C8Q A;  2JTM A;  3CCE T;  3TCJ A;  1KC8 U;  2RI5 A;  5CAI A;  2XI9 A;  3UDC A;  2QEX A;  3C94 A;  3CPW A;  4IUT A;  3I56 T;  2Y4Y A;  4OF1 A;  2YLB A;  1YJW T;  4LDW A;  2X4W A;  2L3R A;  2GFU A;  3MET A;  3PMI A;  1VQ9 A;  1YHQ A;  2DXU A;  3L2R A;  3E9G A;  3OYK A;  2EIF A;  2PVO B;  3JCM W;  2KAF A;  5IN1 A;  4C8Q F;  4JRI A;  1MGQ A;  2MWO A;  5LJ3 g;  1M90 C;  3CCL A;  3MEW A;  4OVA A;  5KCO A;  3OYA A;  2P0Q A;  3HPW A;  1YJN A;  4XAX B;  3CCM T;  4RMO A;  3MEU A;  4FL6 A;  1WJR A;  2LX9 A;  3EFS A;  2VUB A;  3NTI A;  1UB4 A;  4E7L A;  4C8Q C;  4XTU A;  1SSF A;  5D6X A;  4J6Y A;  3JCM Q;  1I5L A;  4BI3 A;  2DPP B;  3M59 A;  4C8Q G;  2LTO A;  3MO8 A;  4JRQ A;  3HRS A;  4F7U A;  2ZGW A;  2RI3 A;  2LT4 A;  5LJ5 h;  3QG1 A;  2XHC A;  4LDV A;  5A0D A;  3BY7 A;  4C0F A;  1ZQ1 A;  3M4Y A;  4ZGE B;  5GAO m;  2EFI A;  3CPW S;  4X34 A;  3CCQ T;  5LJ5 j;  1K8A U;  5CQX A;  4J6W A;  3CCM A;  3X25 B;  1M90 U;  2DTO A;  4HT8 A;  4HCB A;  3BDL A;  1YJN T;  4M78 D;  4MDX A;  2EAY A;  1JJ2 S;  3JCM c;  3OS1 A;  4NOY A;  1VQP T;  2HBP A;  3OY9 A;  4M7D D;  2Y90 A;  4D6W A;  3LWI A;  3CXC S;  1ZHI A;  4Q5W A;  1VQ5 A;  4JRP A;  1VQM A;  1K73 U;  3RMQ A;  5GMK i;  2JN0 A;  3LGF A;  1LNX A;  5C0M A;  5GMK h;  4P5N A;  3RES A;  4MML A;  3L2V A;  4XTX A;  4PLL A;  3PT9 A;  4M77 E;  2K5I A;  4E7K A;  2LVM A;  1VUB A;  4J7I A;  1I8F A;  4J8O A;  4N0A C;  2HD0 A;  4PNO A;  5GAN 2;  4BE1 A;  3VU3 C;  4LDX A;  3BFM A;  5GAN 7;  1UEB A;  3NTK A;  1GXI E;  4OGE A;  1VQ4 A;  1OZ3 A;  4CI0 C;  2OTJ T;  3MP8 A;  4DQ2 A;  2LT1 A;  5GAM d;  4RCB A;  1KQS S;  2I2L A;  2F69 A;  5A0G A;  4A4E A;  4KT0 E;  2RI2 A;  3RKY A;  2NLU A;  4JUV A;  4XTZ A;  5FU6 C;  1YJ9 T;  1O9S A;  3KBG A;  3CCQ A;  3CCS A;  5GAN j;  4HCC A;  2L5Q A;  2FYK A;  1M1K U;  2DVE A;  1YIT A;  4JLI A;  2RHZ A;  1Y07 A;  3G71 T;  3CC7 A;  2LCL A;  4QQD A;  2ZPF B;  2RO0 A;  4QVZ A;  1WQ7 A;  5GAN f;  3CPF A;  2QQR A;  3ER0 A;  2G3R A;  3X26 B;  4B9X A;  1Q81 U;  3VKI A;  1TH7 A;  4BE0 A;  4O6J A;  2R57 A;  2DIG A;  2VXE A;  1N8R U;  3OYJ A;  3FC3 A;  3A8M B;  2KMT A;  5FU7 C;  3OA6 A;  3M55 A;  2VGN A;  3MP6 A;  1BIA A;  5CKB A;  5A2Q E;  2KQW A;  1D3B B;  1X6O A;  3OBY A;  2PU9 B;  3ZFJ A;  4C8Q D;  2QA4 A;  4BE2 A;  4ATO A;  1N27 A;  5GAM e;  2D0Q B;  3JB9 G;  4FT2 A;  2GQV A;  3L2W A;  1KQS A;  3MEA A;  3G71 A;  1VQ5 T;  2D6F A;  1M1G A;  2P4T A;  4EMG A;  4M7A G;  4M7D E;  1QVF S;  4FM4 B;  5CR2 A;  4XK8 E;  1VQN T;  3GIB A;  1JBM A;  2K2V A;  3HFN A;  3G4S T;  2BIV A;  3G6E T;  4M77 A;  4BB7 A;  2VV5 A;  4C0Z A;  5GAM j;  3OYD A;  3CCE A;  1WJQ A;  1Q7Y U;  5GAO l;  2B8A A;  3CME A;  3OW2 S;  3SD4 A;  3OMC A;  3FEO A;  2ZCF B;  4OGC A;  2LRQ A;  4A54 A;  3JCM X;  2F5T X;  3C4S A;  1HXD A;  3OYF A;  3QUI A;  4MZP A;  4PLI A;  4XU1 A;  3JAM E;  3KXT A;  1M9S A;  3JCM g;  3MCA B;  5CVI A;  3OYE A;  3JB9 J;  5AYF A;  2K5L A;  4DOW A;  2LCC A;  4JJN K;  3DLM A;  1Y71 A;  2DZC A;  2RB6 A;  3RIR A;  3CCL T;  3CCU T;  5M9O A;  3CEY A;  3L2Z A;  4LDY A;  4KBM B;  3OYI A;  2O4X B;  4FT4 A;  5I21 A;  3OYM A;  1YJW A;  1Q86 C;  4OB3 B;  4M7A A;  5DLO A;  2DAQ A;  4C92 A;  4M78 A;  5HK3 A;  3SWN A;  3VYG A;  4JS4 A;  4E47 A;  2MMP A;  5LL6 S;  5LJ3 j;  5CKF A;  5LJ5 g;  3QHS A;  1Y96 A;  4N4H A;  2EQU A;  4XQ3 A;  3RUX A;  3Q1J A;  5LJ3 f;  4M7D A;  3OSV A;  3L2U A;  4V2S A;  2E1H A;  3CCR T;  5CIU A;  3CXC A;  5FRM A;  2EYQ A;  3OB9 A;  2E65 A;  3PFS A;  3SDZ A;  3OYG A;  3QBY A;  3QKJ A;  4M77 G;  1G3T A;  5FU6 B;  2RK2 A;  1QP3 A;  4JDS A;  5GAN e;  2PQW A;  3O8V A;  5L8R E;  5GAN 8;  4ZTF A;  5KCH A;  3M53 A;  2F5K A;  3A8H B;  4WF2 A;  4MDW A;  1LJO A;  4C92 E;  1NPP A;  3M5A A;  1QP2 A;  2RHX A;  3WVE B;  3CCJ T;  3CD6 A;  2RHU A;  1R8O B;  1VQ8 T;  4L5G A;  1FX7 A;  3ZBD A;  4M75 E;  4UC4 A;  3S3O A;  1NE8 A;  1K9M U;  5LJ5 e;  1BYM A;  4NL3 A;  2PUK B;  2XK0 A;  3FJP A;  4PJO F;  4OB1 B;  4M77 D;  1VIF A;  2RK1 A;  3INZ A;  4RCC A;  1BI2 A;  1B34 A;  1XNI A;  1W2B S;  1VQL A;  2O01 E;  4IUQ A;  1NPR A;  3T9N A;  2JNG A;  3URG A;  3OS0 A;  5GMK j;  1K9M C;  3JB9 H;  4IUP A;  3HP9 A;  3JCM V;  1VQ7 A;  5GAN g;  2VGM A;  3S3N A;  1XQH A;  1QVG S;  2L8D A;  1LOJ A;  4EDU A;  3A8G B;  1N6A A;  2E10 A;  2LC4 A;  3MHX A;  3JCM h;  3MEV A;  1X01 A;  2RH2 A;  5KE3 A;  2E70 A;  4QW2 A;  5D6W A;  1VQK A;  4XU3 A;  4C8Q B;  3RER A;  4M78 F;  4A4G A;  2DD5 A;  4J83 A;  3JCM b;  3TEE A;  2DD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...