2XDDA

A processed non-coding rna regulates a bacterial antiviral system
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
162
structure length
162
Chain Sequence
MKFYTISSKYIEYLKEFDDKVPNSEDPTYQNPKAFIGIVLEIQGHKYLAPLTSPKKWHNNVKESSLSCFKLHENGVPENQLGLINLKFMIPIIEAEVSLLDLGNMPNTPYKRMLYKQLQFIRANSDKIASKSDTLRNLVLQGKMQGTCNFSLLEEKYRDFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXN
publication title The Phage Abortive Infection System, Toxin, Functions as a Protein-RNA Toxin-Antitoxin Pair.
pubmed doi rcsb
source organism Pectobacterium atrosepticum
molecule tags Toxin/rna
total genus 46
structure length 162
sequence length 162
chains with identical sequence B, E
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2010-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13958 ToxN_toxin Toxin ToxN, type III toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.890 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xddA00
2XD0A 2XDDA 2XDBA 4RMOA 4ATOA 4GLKA
chains in the Genus database with same CATH superfamily
2XG8D 5GAMf 3G6EA 4J9GA 4D6WA 3CPFA 1KSWA 3M0QA 3G4SQ 2OTJT 1X27A 2O31A 1VQ4T 2HCKA 4PK4A 5GAN5 2JTEA 4C92F 3C4SA 5A2QE 1BIAA 2RD1A 4F16A 1IZ6A 5HCKA 3GF5A 4ZN1A 3CQTA 4RMOA 4C0FA 2E41A 4DOWA 3OS2A 2E70A 2X3WD 1X69A 3DB4A 4C0ZA 1KG1A 4Q5WA 5LJ5e 2DFUA 3H6ZA 2DXBA 4AFUC 3ZEHA 3G71Q 1SPKA 1PKSA 3VS2A 1TU0B 4LDXA 4F7UA 3QPHA 4E6RA 4DEXA 3JB9J 1FX7A 1YHQT 2GGRA 1YITQ 5A0GA 1WI7A 1M3CA 2CH4W 4JRQA 4FSSA 2DBKA 1YIJA 1KQSP 1VQ5T 4N4IA 4OB1B 3A8MB 1PHTA 1VQPQ 4QKUA 3OYEA 3JCMc 4LXCA 2D6FA 1JJ2S 1CKBA 2L8DA 5GMKm 1FMVA 5FWBA 2OTLT 3CCEQ 1YJ9Q 3JCMX 3CC4Q 2LCCA 3ZFJA 1FMKA 3OYAA 2EQUA 5GANj 3C94A 1EX4A 3A8OB 2LVMA 4C92B 3H9NA 1QLYA 2CP5A 1KC8C 5EC7A 1G5VA 3QZ5B 3LH0A 3FRNA 3I56T 3RMSA 5IN1A 1LPLA 2YHTA 3CBMA 1ZSZC 4MZPA 5L23A 2FL7A 3OYIA 5KE3A 2NLUA 5GAMd 1NZ9A 1WX6A 3RKYA 2ROTA 3HHTB 2RM4A 3NTIA 2V8KA 4DBFA 4JJNK 2LJ0A 2O88A 2D0QB 2YSQA 2JTMA 1VQ9T 1R0CB 3CCUT 2YUNA 4EMKC 2M16A 2LX7A 3RBBB 1M8MA 1LNXA 1KD1C 1WFWA 3OMCA 3HRUA 3CCVT 4A4EA 1I8FA 1D0ZA 2QTVA 4DBHA 5FWCA 1UDLA 4HCBA 2M9UA 2RH2A 3JSCA 1O9SA 1T3SA 1VQLA 1M1FA 3FJ5A 3M56A 2KVQG 4RUGA 1BB9A 3ME9A 4F7UF 2L3RA 4ME7A 1PG5B 1AWOA 1UFFA 2H8HA 4HCCA 4M7DC 3NPFA 4IKFA 4E7ZA 3FC3A 3OSVA 2E64A 2HSEB 1VIFA 3REAB 4FT2A 4BY6B 2LCLA 1TUCA 4KT0E 1VQNT 2EFIA 4XU2A 1YJWT 4IUVA 2JUFA 1M2OA 1UJ0A 3L2WA 3JCMW 1T0HA 3CC2A 2MWPA 2ZGWA 2VC8A 4M7AE 2XHCA 1IHVA 4Z8AA 1S72A 3QO3A 1YWPA 3M54A 2DXCA 2BZXA 5CVIA 4C8QE 2KGTA 5LJ5d 4JLGA 2J6KA 1G8XA 2JTFA 1VA7A 5GANg 2K6DA 2LJ1A 3JAME 1O75A 1ZUUA 2QA4A 1YCSB 1E6HA 3RDVA 2JW4A 2L3QA 4B9XA 3J81E 4FM4B 1M90U 1B07A 4K11A 1VQKT 4QQ6A 3P8DA 3CCRT 4C0DB 4ZTJA 2DEUA 1I5OB 1U1TA 1K9MC 3DLLA 4HT8A 2A36A 3CC7A 2EYYA 5IXFA 4F7UB 4OB3B 1X01A 4R55A 3JCMJ 2CP7A 3X26B 2L89A 4PJJA 3OYNA 3CMAQ 2I0NA 1XNIA 4AG2C 4EPCA 3LLRA 4PJOA 2DMOA 4PLLA 3UWNA 4OGCA 1RL2A 3LW5E 2MAMA 1OEBA 1K73U 3ASKA 2EBPA 3QDFA 2K4YA 3I55Q 1AVZC 1KQ1A 4C5EA 1WNLA 2E1HA 4M7AG 1K4US 5CKHA 1OYXA 2MF2A 4NS5A 2CUBA 5L8RE 3TEEA 4C92E 2LNVA 2EJ9A 3EG0A 1WZOA 1N6AA 3CBOA 4C8QG 1TSFA 4J6YA 3RERA 2HQHA 4WCIA 4IIOA 5IHIA 1H3HA 4D8DA 2GF7A 2F69A 2DAQA 1RAFB 1G3YA 2KNBB 5GMKh 2VASA 2DKGA 2MI6A 1N8RU 1AOJA 4WF2A 2COYA 1RACB 1PSFA 2QYZA 3WVEB 2R57A 1YJNT 1Q81C 5GAOr 1QP2A 2DYBA 4BDYA 2AIRB 4FYYB 3CCJT 2QQAA 1J3TA 3CD6T 2HSPA 5GAN3 4AG1C 2OTJQ 1VQ4Q 3A8LB 4KGZB 1GCQA 1K8AR 4C0GA 1M27C 1OX8A 2P0QA 4M78A 3KUFA 1WGSA 1LJOA 5GAOn 4C5GA 2DJQA 2LJ3A 2LRQA 4X1VA 3LWIA 5D6WA 2X4JA 3M9QA 3OYCA 4OMPA 1QVGS 3P8HA 1VQ6T 4EDUA 2FZKB 5LJ5j 1UGVA 5GJWB 5A0LA 4MDWA 4C92G 2FHDA 1HXDA 2QQBA 3C0CA 4PJOF 1GL5A 1QCFA 1YHQQ 4RG8A 2KE9A 3KBGA 1ZBXA 1NEBA 4QVZA 4ATOA 4RCBA 4JRKA 4FT4A 1VQ5Q 3UT1A 2WACA 3OYDA 3FJPA 1G3SA 1S1NA 1K0XA 1WA7A 2LC4A 2QEXA 1OZ2A 2F5KA 5GAMg 2JM9A 1UGSB 3L2UA 3EG9A 4XTZA 2K79A 3MP1A 5KCOA 4JLIA 3VS3A 4M7AA 2OTLQ 1IGUA 5IAYA 1M3AA 2DZ9A 2ZPEB 3IQLA 2JOYA 3OYJA 5GANf 1TH7A 2LNHB 3M0UA 3GP8A 4MMKA 4RTVA 2V1RA 5CQYA 4C8QA 4A54A 2L0AA 4Y92A 4VUBA 2NUTA 4FCYA 2DXTA 2VGNA 3EGUA 3QYHB 4OVAA 1AWXA 1RI0A 5M9OA 3I56Q 1ZUYA 2DYIA 1LCKA 1BBZA 4C92C 3OS0A 1Q86U 3EH1A 3PFSA 2J7IA 3L1AA 3JCMV 1VQ8A 4HKEA 5CK9A 3M58A 1NPRA 5CIUA 3WVDB 4F7UE 4CI0C 2FYKA 2ED1A 3RKXA 1CSKA 3Q1JA 1NE8A 4JS5A 3O5ZA 2LQNA 3INZA 2NWMA 2CP2A 2ESWA 4HVVA 2EKOA 2GQVA 1QVPA 1VQMA 2R5AA 2ZPGB 4PJOB 1Y0MA 1VQ9Q 3CCUQ 2RHZA 4B6MA 2CP3A 2RI3A 2RI5A 3QSUA 3QWYA 4BE2A 2DVEA 2FPDA 3TVTA 3CCQT 3CCVQ 4DA4A 2C0TA 2RQVA 2YT6A 1KFZA 4R56A 5GMKl 1PNJA 3JCMQ 1ACMB 5CO7A 1MMGA 3CPWA 4M7AD 2BIVA 4LNPA 5LJ5g 2E6ZA 2EGEA 2KXDA 2M02A 4OB2B 3PVQA 2W10A 1N5ZA 4A63B 2RHXA 4C8QD 1VQNQ 2COZA 5J39A 2XI9A 1YJWQ 2VKNA 5GJVB 4B9WA 2EWNA 2LQ8A 2ZCFB 1JU5C 2EQMA 3BW1A 4BY6C 4M7AF 3M5AA 2P0PA 1D1CA 1SEMA 2RB6A 1BI0A 1UE9A 2VB6A 3PVLA 2XK0A 5KYUA 4C8QF 5GANd 3ER0A 1NJIR 3M0TA 1KQ2A 2FZCB 1K76A 4F14A 4M78B 1CKAA 1SKUB 3CCST 5DM7R 1YWOA 3CCMA 1PWTA 2JN0A 4A4FA 1WIEA 2CP0A 1NM7A 1VQKQ 3E9GA 4OMQA 3LYIA 4FU6A 2DL3A 1Q7YR 3REBB 4PJMA 3CCRQ 2CS7A 2RK1A 5IT9E 4PJLA 3X25B 1NEGA 1M3BA 4RTUA 1MMAA 1GCPA 3QIIA 2YDLA 3URGA 1Y07A 4C0DC 2EQJA 5J26A 2AKLA 1E7OA 2EYQA 1QVGP 4LDWA 4C92D 2KRSA 3S3NA 2ED0A 2AZSA 1EIFA 4HCKA 2CUDA 1AZGB 1PRMC 2XICA 4AMCA 3CPWP 5KYNA 1I4K1 4RTZA 1WXTA 2DVJA 5FRNA 3QHSA 3JCMh 2V26A 3EG9B 1RAEB 1GRIA 4KUDK 4M7AB 1HD3A 2HL5C 4M77E 2DBMA 3BE3A 4ANJA 4Z88A 3NTKA 1NBEB 8AT1B 5LJ3h 4X9CA 3P8BB 1ZA1B 4ESRA 3CMET 1UGPB 1K9AA 4C8QB 3CXCS 2JT4A 3GPLA 1HSQA 2NUTB 1IGQA 3RNJA 3EAEA 1UJYA 2VYTA 1JEGA 3UATA 3UPUA 1ARKA 4HCZA 1QP3A 4FW1A 2FPEA 1KIKA 3OY9A 1MV3A 2E4HA 5DY9A 3LGFA 2HAXA 4LD9K 1RAGB 3OA6A 2GQIA 2LDMA 1YJNQ 2VWFA 3VU3C 2O9VA 4EMHA 1U5SA 1UHFA 4A4HA 2DTOA 3TSZA 5GMKe 1VQOT 4PJOE 3CCJQ 2DJZA 3CD6Q 1WHGA 3PIOA 1HYOA 2PVOB 2D8JA 1QVFS 2RI2A 4AFZC 1WQWA 2COWA 2CT4A 2PUKB 1ZHIA 3F70A 2DL4A 2LX9A 1NYGA 2NYSA 3N5BB 4NOYA 3A98A 1ZSGA 3MEUA 1IO6A 4EMGA 3M4YA 1JO8A 5EG2A 3RUXA 3OW2S 4N4GA 2HBWA 4M77G 3G6ET 5HY6A 2PVDB 1VQ6Q 3GIBA 3HRSA 2PNIA 4Y28E 5LJ5f 2HBPA 2YXYA 1Y7XA 1BI1A 2Y4YA 1QWEA 1QQJA 2KT8A 5CKFA 2CYZB 4J6XA 2Y90A 4E7SA 1BCMA 3MCAB 1WJSA 4PLIA 3HKSA 1JBMA 1W2BS 1K9MU 1WHLA 1KC8R 4N0AA 2WSEE 2X4YA 3HSBA 1N9RA 4L6V5 1XTDA 4J9DA 2KXCA 1B34A 1UGQB 3QYGB 4E7KA 1H8KA 2CKKA 2GTJA 5KYUB 4RCCA 6AT1B 1M1KC 2DZCA 4N4HA 5I11A 3SD4A 4M78E 4PJOG 3CCLA 2LCSA 3OYHA 2RJCA 3X24B 1M1KR 4IUTA 1V76A 2KBTA 1YIJT 1PRLC 3D7SB 2JXBA 4OMMA 2MMPA 1KD1R 2K7AA 2ROLA 1VQ7Q 2DRMA 2ENMA 2DD5A 2K57A 3FLGA 1TTHB 3O8VA 2KAFA 4BB7A 1WLPB 2KQWA 1IB8A 4J9CA 3JCMP 2VXEA 2LQKA 1AD5A 1JJ2A 1WPYA 1PSEA 1LVKA 2JVVA 1K8AU 1XJWB 4JRIA 1W70A 4C5HA 4LUDA 2O4XA 1IRXA 2GBQA 4PJOC 3CCQQ 3I5SA 3TREA 2LT4A 4PKCC 3LX7A 2BZ8A 4PFPA 5CKBA 1U8RA 3G4SA 3X28B 1RLPC 2CDTA 2DTIA 4M77A 2YLBA 3E9FA 3RIRA 3OYFA 2ABLA 2Z0WA 4OF1A 1YN8A 1EZZB 2DILA 4M78G 3THKA 3HL8A 3C12A 4LUEA 4GLKA 1F1BB 4OMFB 1X75C 2EKHA 4E2FB 2RQWA 3SWNA 2MIOA 2BUDA 1C0MA 3MP6A 2KT1A 2K3BA 5I22A 2LZ6B 4ZN3A 4XU0A 1WJQA 3G71A 1PD1A 5HK0A 5I2MA 4FW2A 3M0SA 1VQLT 4LDUA 2AT1B 1DJ7B 1K9MR 4M7DA 1YITA 5AYFA 4UC4A 2DXUA 3BFMA 3J80E 1VQPA 2LQWA 4J6WA 3L2VA 1D09B 3CCSQ 5GAOm 1M2VA 1GCQC 2E10A 4XTVA 3JRZA 1TOVA 4BI3A 3VYGA 2LTOA 4BDZA 1KHIA 2OX7A 3PNWC 3CCEA 2GFAA 1YJ9A 1QVFP 3CC2T 3CC4A 4XTXA 2CZ0B 4M75E 1OULA 2EJGA 1X2QA 2F2WA 1SSFA 1MGQA 5FROA 1JJ2P 1RABB 3VS5A 1U3OA 1S72T 1H3ZA 2MYSA 2KK4A 4M77D 4J83A 2PU9B 2QI2A 3QXEB 3OW2P 5D7UA 2CREA 4FYWB 1X6GA 1JXMA 4JRPA 4CC4B 1Q82C 1VOMA 4DEYA 2K5LA 2DPPB 3NFCA 2QA4T 2DNUA 2DK3A 1D3BA 4ZGEB 1B34B 1ZBJA 3MP8A 4II1A 2BE7D 3BY7A 2E5KA 3QDRB 4FYVB 1MMDA 4M77F 2A28A 4KH0B 1ABOA 2ECZA 4HA8A 3M59A 3CC7T 2Y4XA 4DQ2A 1Q81R 4P5NA 2OAWA 4LDVA 2GTOA 4M7AC 1I81A 4JJDA 3CMEQ 3JCMe 2PZ1A 9ATCB 4X9DA 4WTOB 4PJOD 1YI2Q 2O01E 1E6GA 3PE0A 2BE9B 2KEAA 2XIDA 5LJ3e 4C8QC 2L5QA 4MMLA 3OYGA 1MV0B 1MNDA 4EIKA 3QUIA 2M0YA 2WSCE 5CKEA 4M75G 2FVUA 2ZPFB 3HP9A 2RK2A 3SB2A 5IXBA 1AEYA 2QGFB 4X34A 5DLQE 1U1SA 4KRTA 2VVKA 5FU6B 4GBQA 1VQOQ 3TQ7P 1JXOA 1V1CA 5GMKj 5FRMA 2E65A 4ELZC 1C1AA 3HFNA 1NJIU 5HKCA 2O4XB 2AK5A 4J9FA 2V8IA 1OQKA 1YP5A 4A4GA 4ZGDB 1WHMA 1M4ZA 4M77B 3H0HA 2FZGB 3JCMb 1QKWA 2SEMA 3G6EQ 4XTYA 1K73C 3EGDA 1Q7YU 2DERA 1SF9A 1BI3A 4JUVA 4CC3A 3NMZC 1RI9A 4RTWA 3QWXX 2CP6A 2K2MA 1BI2A 4M78D 3SWNB 1QWFA 3VS1A 4BUGA 2J6OA 3RKWA 1VQ7T 3GLXA 3LGLA 2EAYA 2K9GA 3TU4K 2EW3A 5KH6A 2M1HA 1AWWA 2C0OA 2RHYA 2YUOA 2P4RA 4J9IA 4FYXB 4IIMA 1VYTA 2DX1A 2NUPA 4M7DB 3QZ9B 2AHJB 4XU3A 3CMAA 4M78F 3GNGA 3KFVA 3OYMA 3GBQA 1KQSS 2QXFA 4JJBA 3OS5A 4IUUA 1GBQA 3DLMA 2HKQB 1UECA 1GFCA 4HVUA 5LL6S 1N27A 1M2VB 2M51A 2RMOA 3I55A 1N9SA 4XK8E 2EGCA 1QVGA 1YFNA 1YIJQ 2DTHA 1H641 1VUBA 1I5LA 1MNEA 1FMWA 2VV5A 2F5TX 2HD0A 2QEXT 2JM8A 4M75A 3OS1A 2EQKA 1PM3A 2JJ9A 4E7HA 2HZYA 1QCNA 4Z02A 4R0KA 1BKBA 4J8OA 4QVDA 3TCJA 3S3OA 2G3RA 2MK5A 2JS0A 2EPDA 1WHKA 1WXUA 3OYBA 3L2RA 1X2KA 1LOJA 2A37A 1D3BB 2AKKA 1Z9QA 4HXJA 3PMIA 1X6OA 3JCMd 5FW9A 1UGRB 4MDXA 1M8VA 1NLOC 2EVRA 1VQ8T 2OTJA 1TUDA 1IREB 2KR3A 3V8LA 1VQ4A 5I2SA 4D8KA 2MPXC 3DB3A 3ULRB 4CC7A 3BDLA 5LJ3d 2E12A 2ATCB 2FO0A 1UB4A 5FLXE 4PFZA 1BCOA 2P4TA 5A0DA 3HFOA 1VQMT 2KRMA 5GAMe 2L3SA 1FWZA 2QGGA 2CH4A 3L2ZA 2RHIA 1K0SA 2SRCA 3V7RA 1BK2A 5D6XA 4BE0A 3E19A 2RNAA 3M53A 4RKUE 1I0CA 1WQ7A 3OYLA 1KC8U 3UDCA 3META 2H3EB 4LD6A 3M0RA 1OZ3A 2DLPA 1VQLQ 3FB9A 3MO8A 1Y57A 4M75D 2IG0A 1YHQA 1D1AA 1Q86C 2KYBA 2PTKA 1ZUKA 4LN2A 1Y96A 2EGAA 5GAN4 4E47A 3OBYA 1XOVA 5KE2A 1VQ5A 2X4XA 4IUQA 3L42A 1Q95G 1WDXA 4KGXB 3UA6A 2X35A 4KUIA 2X3XD 3QG1A 4GY5A 1YBYA 1H92A 2EYWA 1ABQA 4ZNXA 2DE0X 2E3IA 2KRNA 3VS6A 8ATCB 3JB9F 3OB9A 2K5FA 1M1KU 2OTLA 4M75F 1SSHA 3A8GB 3CC2Q 3EGDB 2QK0A 2P84A 3JB9H 1OX9A 2QQSA 3PT9A 3NTHA 5KYXA 1NPPA 2DM1A 3EFSA 3OQ5A 1S72Q 1KD1U 3H41A 2JZ2A 2DIQA 4OMLA 1YI2T 2KMTA 2K2VA 1B3QA 3PTAA 4RTXA 3SHWA 3I56A 5GANh 1R8OB 2DL7A 3QJYA 2B86A 1X6BA 3LWHA 2D1XA 3PIPA 3OMGA 2W0ZA 5GAOq 4XTUA 2F1LA 5CR2A 3H0FA 3CCMT 1WHJA 2QA4Q 1VYVA 5D6YA 4Y91A 2CZ7B 4M7DE 1TS9A 4ELYC 4O6JA 2NUPB 4BE1A 4N0AC 2YUPA 2FEIA 5KCHA 5ECAA 2FRYA 1RAHB 2RF0A 1KJWA 2RHUA 4JJCA 4ZTFA 3CC7Q 3UA7A 1VQ9A 3CCUA 5KYWA 2D8HA 4L59A 4C5IA 2PVGB 5GMKi 3J7AF 1QCOA 1M30A 3HRTA 1SG5A 3CCVA 4FIBA 2DL5A 2O9SA 2QTXA 2M0OA 1NLPC 2DRKA 2E6NA 2J06A 2KSSA 2LT1A 5GAOl 2E3HA 2WSFE 3FDRA 5FU7B 4M75B 5LJ3j 2OJ2A 2J05A 2QQRA 1P92A 3HPWA 2DD4A 2PUOB 2BZYA 3EFOA 3ZL7C 1IHWA 1TG0A 2R5MA 3FEOA 1VQNA 1UG1A 1RUWA 1R77A 3DKMA 1YJWA 3EHQA 2XDDA 1Z9ZA 3CEYA 1IXDA 4FL6A 2V1QA 4OP0A 1G83A 5FU6C 3V7CA 3EG1A 5CQXA 4NL3A 3E1SA 4J9HA 4E7LA 2ZZDA 3MJXA 4JDSA 2DETA 4M7DG 2XDPA 1X43A 3LH5A 1OU9A 1TXQA 3CXCA 2YRDA 2VUBA 3SEMA 2IIMA 2CSIA 1M5Q1 2RJFA 4M77C 3WXMB 4JZ4A 3RMQA 1K1ZA 4KH1B 2RJEA 1VQKA 5GAN6 2YUQA 4E7IA 2GFUA 4AFSC 3CCRA 1Y71A 2CT3A 1KHCA 5J3BA 1UEBA 2GNCA 2RN8A 5I21A 3SWNC 2A3LA 4HT9A 4IUPA 2HQXA 3OBWA 1QVFA 1PKTA 1MMNA 3EHRA 1Q82U 1Y96B 2HNIA 2EJFA 1ZSZA 3JB9I 3U23A 2DL8A 4LDYA 1ZA2B 1WYXA 2YLCA 3MHXA 1C6VX 1Q81U 4QQDA 1RLQC 3OW2A 3S6WA 2EYXA 2MWOA 4TVRA 3JCMg 3MPUB 5GAMh 4DBRA 4RTTA 2KYMA 3VYHB 2X51A 3VS7A 2QEXQ 5KYXB 2AZVA 4EMKA 4KBMB 4LE9A 4KGVB 5LJ3g 2FB7A 3SDZA 1YNZA 1MUZA 1SHFA 2HQEA 3M57A 1R0BG 1W2BA 3CCLT 3TSWA 3C95A 3PGGA 2J6FA 3CXCP 2X9HA 4NL2A 3VV0A 1NG2A 2NUZA 2QQ9A 4PFOA 5C6SA 2H3JA 3T9NA 1YJNA 5CKDA 2DEQA 4BACA 4OMNA 4OGEA 4QW2A 3CCJA 3QBYA 3CD6A 1VQ8Q 3H0IA 3OYYA 5KYWB 2K3XA 1VYUA 2HDAA 3GOXA 1G3WA 2F2XA 2RQRA 1FXXA 5CCAA 1VQMQ 1V29B 4M78C 1ZLMA 3A1PA 2BKDN 1MHNA 2YRVA 4PJNA 5GAMj 1VQ6A 1GBRA 1JQQA 3G7ZA 3SFMA 1PCXA 5CAIA 2BTTA 5AT1B 4J7IA 4BD3A 2QG9B 5GAOp 3EFOB 2CZ1B 3G4ST 3E2UA 4JPBW 4M4ZA 2OAUA 1B7TA 1W6XA 4BI4A 1BIBA 5LJ5h 5GAN7 5KYYA 2LP5A 3BDUA 2K5IA 1YCYA 3CBPA 3EG2A 3R6NA 2HMAA 1Q82R 3GNFB 4IURA 3VS4A 2R58A 3G1JA 4PL6A 1W2BP 1OOTA 1TUGB 1W4SA 3L2QA 1HK9A 2YWWA 3FIFA 3G71T 1K8AC 4XU1A 1QKXA 2RJDA 4M7DD 2DA9A 3ZBDA 4YTLA 4F04B 1YITT 3PMTA 3V7SA 2D0NA 2GCXA 3EGXA 3R6OA 1T0JA 2RO0A 1VQPT 1RADB 2JNGA 1D0XA 3JB9G 1GFDA 3EH2A 1RAAB 4MZTA 4AFQC 3CCMQ 1VQ7A 3H8ZA 7AT1B 4M7DF 4XAXB 4L5GA 1TWBA 1M90C 3A5ZB 3CCET 2RQUA 1YJ9T 5GANe 4GLMA 3CC4T 2ZPIB 2EYZA 3QKJA 2I2LA 3VUZA 1ZSZB 1M90R 3CPWS 3HTRA 2FG0A 1PD0A 3CCQA 2DO3A 3V8KA 1UTIA 3JCMf 4QT7A 2LMJA 2KI7A 3NHNA 3M0PA 2B8AA 3M55A 2C06A 1AT1B 5IHNA 5LJ3f 4EMKB 4BI8B 3MEVA 2IVWA 2KY9A 4O5VA 5FU7C 4M75C 1D0YA 1OPLA 1K73R 2QDYB 1M1GA 1I1JA 1WXBA 2FRWA 2JMAA 3I9QA 1UHCA 1G2BA 1QW1A 1A0NB 5IHKA 1SRMA 1UUEA 2RQTA 4CC2A 4RTYA 2C0IA 4J5YA 3RR6A 5GAN8 2P0KA 2A0FB 4XQ3A 1JB0E 4F17A 4JS4A 4OB0B 1VIEA 2KROA 1N8RC 3EFRA 2PQWA 2XDBA 2FPFA 1QMCA 3S3MA 2JS2A 1W1FA 2VGMA 1OPKA 3KXTA 4J9BA 1T3LA 2E5QA 3CCSA 1OU8A 1JRIA 1N8RR 2ZPHB 5C0MA 4Z89A 1OV3A 1AHJB 2F2VA 1AZEA 1HJDA 3NGPA 4KULA 3MEWA 3RESA 1AWJA 3VKIA 4AT1B 3AHUA 2OI3A 2JMCA 1WJRA 2XU8A 3UF4A 1ZQ1A 1FYNA 4E7JA 2CZ6B 2EQIA 2L2PA 5HK3A 1M9SA 2HKNA 4XTWA 2MOXA 4JZ3A 4ZGJB 1BYMA 3I5RA 1SRLA 5KYYB 4HVWA 4C92A 2DF6A 3AT1B 5DLOA 3VS0A 3MEAA 4OMOA 4ORZA 3VUBA 1OI1A 3A8HB 1NYFA 4QVCA 1G3TA 2CSQA 2MCNA 2V8JA 2A7YA 2O2OA 3QJ6A 1NJIC 2HL3A 3CMEA 4F7UG 1D1BA 2YRCA 1XQHA 3CMAT 1YI2A 1ZX6A 3MKDA 1WHHA 4FSXA 3OYKA 2CGHA 3EG3A 3X20B 2QASA 3EGXB 3CCLQ 2IPOB 3M4GA 3VJPA 1U06A 2L3PA 5IH2A 1Q7YC 3I55T 2X4WA 4QQGA 4DOVA 2RPNA 3V8JA 4PNOA 3I35A 2G6FX 2QAZA 3JB9D 3VRYA 2A08A 2KDSA 4RG2A 1KQSA 4V2SA 1VQOA 3VRZA 2HEQA 2DIGA 4MZMA 4CRIA 4A4KA 2EIFA 4DBQA 2QDLA 1KK7A 4A53A 3OSSC 2ZAEA 1RAIB 1EFNA 1BU1A 2ZPBB 5GAN2 1SHGA 1Q86R 2RA2A 2XKOC 3JV3A 1GXIE 1PC0A 2K3YA 2VXFA 4J9EA 2XD0A 4J7FA 2D9TA 1I07A 2XMFA
chains in the Genus database with same CATH topology
2XG8D 5GAMf 4E7IA 2GFUA 3INZA 3G6EA 3CCRA 4JRPA 1Q82C 1Y71A 4D6WA 3CPFA 1KHCA 2K5LA 2DPPB 3NFCA 5J3BA 2EKOA 2GQVA 1QVPA 1UEBA 2R5AA 2ZPGB 5I21A 2QA4T 1VQMA 3SWNC 4PJOB 1VQ4T 2OTJT 2A3LA 4HT9A 4IUPA 2DK3A 5GAN5 1D3BA 4C92F 2HQXA 2RHZA 1B34B 3C4SA 4ZGEB 5A2QE 2RI3A 3MP8A 4II1A 3BY7A 2RI5A 3OBWA 3QSUA 3QDRB 4BE2A 1BIAA 1QVFA 4M77F 2DVEA 1Q82U 1Y96B 3CCQT 2RD1A 1IZ6A 2HNIA 4HA8A 2EJFA 4DA4A 3M59A 3GF5A 3CC7T 4ZN1A 3JB9I 4LDYA 2Y4XA 4RMOA 4C0FA 2E41A 2YLCA 4DOWA 4DQ2A 2E70A 4P5NA 4R56A 5GMKl 3OS2A 3MHXA 4LDVA 1Q81U 3DB4A 4QQDA 4C0ZA 4M7AC 4Q5WA 1I81A 3JCMQ 5CO7A 1KG1A 5LJ5e 3JCMe 4X9DA 3H6ZA 2DXBA 3CPWA 3OW2A 4M7AD 2BIVA 3S6WA 4PJOD 2O01E 2MWOA 3ZEHA 4TVRA 3JCMg 5LJ5g 5GAMh 2E6ZA 4LDXA 2XIDA 4F7UA 3QPHA 4C8QC 4OB2B 3VYHB 2L5QA 4MMLA 5LJ3e 3JB9J 1FX7A 3OYGA 2RHXA 4C8QD 1YHQT 4EMKA 4KBMB 5J39A 2XI9A 5A0GA 5LJ3g 2FB7A 3QUIA 4JRQA 2WSCE 5CKEA 3SDZA 4M75G 4B9WA 2FVUA 2ZPFB 3HP9A 2EWNA 2RK2A 2LQ8A 1YIJA 3SB2A 1VQ5T 2HQEA 2ZCFB 3M57A 2EQMA 3BW1A 4N4IA 1W2BA 4BY6C 4OB1B 3A8MB 4M7AF 4X34A 3M5AA 5DLQE 3CCLT 2P0PA 1U1SA 3OYEA 5FU6B 3C95A 2RB6A 1BI0A 3PGGA 3JCMc 2D6FA 1JJ2S 2L8DA 5GMKm 4NL2A 2XK0A 3VV0A 5GMKj 2OTLT 5FRMA 2QQ9A 4C8QF 2E65A 3ER0A 5GANd 5C6SA 2H3JA 3T9NA 4ELZC 3HFNA 3JCMX 1NJIU 5HKCA 2LCCA 3ZFJA 1YJNA 2O4XB 1KQ2A 2V8IA 2DEQA 5CKDA 4BACA 3OYAA 4M78B 4OGEA 2EQUA 5GANj 4A4GA 4QW2A 3C94A 4ZGDB 3A8OB 5DM7R 3CCJA 3QBYA 2LVMA 3CCST 4C92B 3CCMA 3CD6A 2JN0A 1M4ZA 4A4FA 3OYYA 2K3XA 4M77B 1KC8C 1G5VA 3JCMb 3QZ5B 3LH0A 3E9GA 3FRNA 3RMSA 5IN1A 3I56T 3LYIA 4FU6A 3GOXA 1G3WA 4XTYA 2YHTA 1K73C 3CBMA 1Q7YU 2RK1A 2CS7A 5IT9E 4MZPA 3X25B 2FL7A 3OYIA 1BI3A 1FXXA 5KE3A 5CCAA 4JUVA 2NLUA 5GAMd 1NZ9A 1V29B 4M78C 2BKDN 1MHNA 2YRVA 3QIIA 3URGA 4C0DC 1Y07A 3RKYA 2EQJA 5J26A 1BI2A 4M78D 3SWNB 3HHTB 2RM4A 4BUGA 5GAMj 1VQ6A 3NTIA 2V8KA 2EYQA 4LDWA 4C92D 4JJNK 3G7ZA 3RKWA 3SFMA 5CAIA 3S3NA 1VQ7T 2D0QB 3GLXA 4J7IA 3LGLA 4BD3A 1EIFA 5GAOp 2EAYA 3TU4K 2CZ1B 5KH6A 3G4ST 2JTMA 2M1HA 1VQ9T 3CCUT 2OAUA 2XICA 2RHYA 4EMKC 2M16A 1I4K1 5FRNA 4BI4A 3QHSA 4M7DB 1BIBA 3JCMh 5LJ5h 3QZ9B 1LNXA 2AHJB 5GAN7 1KD1C 4KUDK 4XU3A 3OMCA 3HRUA 4M7AB 4A4EA 3CMAA 3CCVT 1I8FA 4M78F 3GNGA 3BDUA 4M77E 3OYMA 2K5IA 4HCBA 2M9UA 1KQSS 1YCYA 2RH2A 2QXFA 3CBPA 3JSCA 3NTKA 3OS5A 1O9SA 4IUUA 1VQLA 1M1FA 3DLMA 3M56A 5LJ3h 2KVQG 4X9CA 3P8BB 3GNFB 4IURA 5LL6S 3CMET 1N27A 1UGPB 3I55A 4C8QB 2R58A 3ME9A 4F7UF 2L3RA 4PL6A 3CXCS 4ME7A 3GPLA 1W4SA 1N9SA 4XK8E 3L2QA 1HK9A 3EAEA 1QVGA 3FIFA 3G71T 4HCCA 4M7DC 2DTHA 1H641 4IKFA 2VYTA 1VUBA 1I5LA 3FC3A 3UPUA 1K8AC 3OSVA 4XU1A 2RJDA 4M7DD 2VV5A 2E64A 2F5TX 1VIFA 2HD0A 2QEXT 4FT2A 4HCZA 4YTLA 3ZBDA 2LCLA 4BY6B 4M75A 1QP3A 4KT0E 3OS1A 1VQNT 2EQKA 3OY9A 1YITT 2EFIA 4XU2A 1YJWT 4IUVA 2JUFA 3LGFA 3PMTA 5DY9A 2HAXA 4E7HA 3V7SA 4LD9K 3L2WA 3JCMW 3OA6A 4Z02A 3CC2A 1BKBA 4J8OA 2GCXA 4QVDA 3TCJA 2LDMA 3S3OA 2MWPA 3R6OA 2G3RA 3VU3C 4EMHA 2RO0A 1VQPT 2ZGWA 4A4HA 2VC8A 2DTOA 2JNGA 5GMKe 4M7AE 2XHCA 3JB9G 1VQOT 1S72A 4PJOE 4MZTA 2DJZA 3QO3A 1VQ7A 3PIOA 3H8ZA 3M54A 2PVOB 3OYBA 2DXCA 3L2RA 4XAXB 4M7DF 1LOJA 4L5GA 1QVFS 2RI2A 5CVIA 1D3BB 1M90C 3A5ZB 3CCET 1YJ9T 5GANe 1WQWA 3CC4T 3PMIA 2PUKB 2ZPIB 4C8QE 1X6OA 1ZHIA 3F70A 4JLGA 5LJ5d 2LX9A 3JCMd 4NOYA 2JTFA 3N5BB 1UGRB 4MDXA 3QKJA 1M8VA 5GANg 2I2LA 3VUZA 3MEUA 3JAME 4EMGA 1VQ8T 1O75A 2QA4A 2OTJA 1IREB 3M4YA 3V8LA 1VQ4A 5I2SA 5EG2A 3RUXA 4B9XA 3DB3A 3J81E 3BDLA 4FM4B 1M90U 5LJ3d 3CPWS 1VQKT 3OW2S 2E12A 4N4GA 4QQ6A 1UB4A 4M77G 3P8DA 5HY6A 2PVDB 5FLXE 3G6ET 3CCRT 4C0DB 4ZTJA 3GIBA 1U1TA 1K9MC 3CCQA 2DO3A 2P4TA 3HRSA 4Y28E 3V8KA 3JCMf 5LJ5f 5A0DA 3DLLA 2HBPA 4HT8A 1Y7XA 1BI1A 2Y4YA 3HFOA 3CC7A 2B8AA 1VQMT 5GAMe 4F7UB 4OB3B 1FWZA 1X01A 3M55A 5CKFA 2C06A 2CYZB 3L2ZA 4J6XA 4R55A 2Y90A 3JCMJ 3X26B 2RHIA 5LJ3f 3MCAB 1WJSA 4EMKB 2L89A 4PLIA 3V7RA 4BI8B 3MEVA 2IVWA 1JBMA 3HKSA 3OYNA 5D6XA 1W2BS 2KY9A 1K9MU 4BE0A 3E19A 3M53A 4O5VA 4RKUE 1XNIA 4N0AA 2WSEE 1WQ7A 2X4YA 5FU7C 4EPCA 3LLRA 3OYLA 3HSBA 1KC8U 4PJOA 3UDCA 3META 1N9RA 4LD6A 4PLLA 4M75C 4OGCA 4L6V5 1XTDA 3UWNA 1RL2A 3LW5E 1OZ3A 2MAMA 3FB9A 1B34A 3MO8A 1UGQB 2QDYB 1M1GA 3QYGB 4M75D 1K73U 2IG0A 3ASKA 4E7KA 1YHQA 1Q86C 2K4YA 2CKKA 1KQ1A 1Y96A 4RCCA 5GAN4 1QW1A 1M1KC 4E47A 3OBYA 2DZCA 1XOVA 5KE2A 4C5EA 1WNLA 1VQ5A 2X4XA 4IUQA 4N4HA 3L42A 2E1HA 4M7AG 3SD4A 4M78E 4PJOG 3CCLA 5CKHA 1OYXA 4J5YA 2X35A 2P0KA 5GAN8 4KUIA 2MF2A 4NS5A 3QG1A 4XQ3A 5L8RE 1JB0E 3TEEA 4C92E 4JS4A 1YITA 4GY5A 2LNVA 4OB0B 1YBYA 3OYHA 2RJCA 3X24B 2EJ9A 1VIEA 1N8RC 1N6AA 3CBOA 3JB9F 3EFRA 4IUTA 3OB9A 2K5FA 1M1KU 2OTLA 2PQWA 4M75F 4C8QG 2XDBA 4J6YA 1YIJT 3RERA 3A8GB 3S3MA 2VGMA 3KXTA 2GF7A 2F69A 2DAQA 2MMPA 3JB9H 1G3YA 2QQSA 2E5QA 3PT9A 3CCSA 3NTHA 5GMKh 1NPPA 3EFSA 3OQ5A 1KD1U 1JRIA 2DKGA 2JZ2A 2DIQA 2MI6A 2ZPHB 2KMTA 5C0MA 1YI2T 1N8RU 1AHJB 4WF2A 2K2VA 4KULA 3MEWA 3PTAA 3RESA 3VKIA 1PSFA 3I56A 3WVEB 2DD5A 2R57A 1R8OB 2K57A 3FLGA 3QJYA 5GANh 1YJNT 1Q81C 3AHUA 3LWHA 5GAOr 3PIPA 1WJRA 2XU8A 1QP2A 3OMGA 1ZQ1A 3O8VA 5GAOq 4BDYA 4XTUA 3CCJT 4E7JA 2KAFA 2CZ6B 2QQAA 4BB7A 5HK3A 5CR2A 3CCMT 3CD6T 5GAN3 1M9SA 4XTWA 2KQWA 3JCMP 5D6YA 2VXEA 2LQKA 3A8LB 4Y91A 1JJ2A 1WPYA 1PSEA 2CZ7B 2JVVA 4M7DE 1K8AU 4JRIA 4C0GA 4ELYC 4ZGJB 4O6JA 4C5HA 1BYMA 2O4XA 4BE1A 2P0QA 4N0AC 4M78A 3KUFA 4PJOC 1WGSA 5KCHA 2RHUA 2LT4A 3TREA 1LJOA 3LX7A 4PKCC 4C92A 5GAOn 5CKBA 4C5GA 4ZTFA 1U8RA 3G4SA 3X28B 1VQ9A 3CCUA 5DLOA 2DTIA 3MEAA 4M77A 2LRQA 3VUBA 2YLBA 4L59A 5D6WA 3LWIA 4C5IA 3E9FA 3RIRA 2X4JA 3OYFA 2PVGB 3M9QA 3OYCA 1OI1A 5GMKi 1QVGS 3J7AF 3A8HB 3P8HA 1VQ6T 4OF1A 4QVCA 3HRTA 4EDUA 3CCVA 4FIBA 1G3TA 2QTXA 4M78G 3HL8A 5LJ5j 2M0OA 3C12A 5A0LA 4MDWA 4GLKA 2E6NA 2KSSA 4OMFB 2V8JA 2FHDA 4C92G 1X75C 2LT1A 5GAOl 2A7YA 2WSFE 3FDRA 3QJ6A 1HXDA 1NJIC 2QQBA 5FU7B 4PJOF 3CMEA 3SWNA 4M75B 4F7UG 4RG8A 2BUDA 3KBGA 5LJ3j 1ZBXA 3MP6A 2QQRA 1P92A 1XQHA 4QVZA 3HPWA 4ATOA 4RCBA 4JRKA 3CMAT 2DD4A 4ZN3A 1YI2A 4XU0A 4FT4A 1WJQA 2PUOB 3G71A 4FSXA 5HK0A 3OYKA 3UT1A 2WACA 5I2MA 2CGHA 3X20B 3FJPA 3OYDA 1G3SA 1VQLT 4LDUA 2LC4A 2R5MA 3M4GA 3VJPA 2QEXA 1DJ7B 1OZ2A 2F5KA 5GAMg 3FEOA 1Q7YC 1VQNA 4M7DA 3I55T 1UGSB 2X4WA 4QQGA 3DKMA 4XTZA 3MP1A 4DOVA 5AYFA 5KCOA 3L2UA 1YJWA 4JLIA 2XDDA 4M7AA 4UC4A 3V8JA 2DXUA 5IAYA 4PNOA 3CEYA 3BFMA 4FL6A 4OP0A 3V7CA 5FU6C 2DZ9A 2ZPEB 3JB9D 3J80E 5CQXA 2JOYA 1VQPA 3OYJA 2KDSA 1TH7A 4RG2A 5GANf 4J6WA 3L2VA 4NL3A 3GP8A 3E1SA 4MMKA 1KQSA 4V2SA 1VQOA 5CQYA 5GAOm 4E7LA 4C8QA 2E10A 4XTVA 2ZZDA 4A54A 4JDSA 4M7DG 2DIGA 2XDPA 3JRZA 4MZMA 4VUBA 3VYGA 4A4KA 4BI3A 2EIFA 4CRIA 2LTOA 4BDZA 1KHIA 2DXTA 2VGNA 3PNWC 3QYHB 4OVAA 4A53A 1RI0A 2GFAA 3OSSC 5M9OA 3CCEA 1YJ9A 3CXCA 3CC2T 2VUBA 3CC4A 4XTXA 2ZPBB 2CZ0B 4M75E 4C92C 5GAN2 2EJGA 3OS0A 2RA2A 2XKOC 1SSFA 1MGQA 3PFSA 1M5Q1 5FROA 2RJFA 1Q86U 3L1AA 1GXIE 4M77C 1S72T 3JCMV 1VQ8A 4HKEA 3WXMB 2K3YA 2VXFA 1NPRA 3M58A 5CIUA 3WVDB 4F7UE 3RMQA 2FYKA 5CK9A 4CI0C 1H3ZA 2XD0A 2KK4A 4M77D 4J83A 3Q1JA 3RKXA 1NE8A 4J7FA 2RJEA 1VQKA 4JS5A 2D9TA 2PU9B 5GAN6 2QI2A 3QXEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XD0 A;  2XDD A;  2XDB A;  4RMO A;  4ATO A;  4GLK A; 
#chains in the Genus database with same CATH topology
 2XG8 D;  5GAM f;  3G6E A;  4J9G A;  4D6W A;  3CPF A;  1KSW A;  3M0Q A;  3G4S Q;  2OTJ T;  1X27 A;  2O31 A;  1VQ4 T;  2HCK A;  4PK4 A;  5GAN 5;  2JTE A;  4C92 F;  3C4S A;  5A2Q E;  1BIA A;  2RD1 A;  4F16 A;  1IZ6 A;  5HCK A;  3GF5 A;  4ZN1 A;  3CQT A;  4RMO A;  4C0F A;  2E41 A;  4DOW A;  3OS2 A;  2E70 A;  2X3W D;  1X69 A;  3DB4 A;  4C0Z A;  1KG1 A;  4Q5W A;  5LJ5 e;  2DFU A;  3H6Z A;  2DXB A;  4AFU C;  3ZEH A;  3G71 Q;  1SPK A;  1PKS A;  3VS2 A;  1TU0 B;  4LDX A;  4F7U A;  3QPH A;  4E6R A;  4DEX A;  3JB9 J;  1FX7 A;  1YHQ T;  2GGR A;  1YIT Q;  5A0G A;  1WI7 A;  1M3C A;  2CH4 W;  4JRQ A;  4FSS A;  2DBK A;  1YIJ A;  1KQS P;  1VQ5 T;  4N4I A;  4OB1 B;  3A8M B;  1PHT A;  1VQP Q;  4QKU A;  3OYE A;  3JCM c;  4LXC A;  2D6F A;  1JJ2 S;  1CKB A;  2L8D A;  5GMK m;  1FMV A;  5FWB A;  2OTL T;  3CCE Q;  1YJ9 Q;  3JCM X;  3CC4 Q;  2LCC A;  3ZFJ A;  1FMK A;  3OYA A;  2EQU A;  5GAN j;  3C94 A;  1EX4 A;  3A8O B;  2LVM A;  4C92 B;  3H9N A;  1QLY A;  2CP5 A;  1KC8 C;  5EC7 A;  1G5V A;  3QZ5 B;  3LH0 A;  3FRN A;  3I56 T;  3RMS A;  5IN1 A;  1LPL A;  2YHT A;  3CBM A;  1ZSZ C;  4MZP A;  5L23 A;  2FL7 A;  3OYI A;  5KE3 A;  2NLU A;  5GAM d;  1NZ9 A;  1WX6 A;  3RKY A;  2ROT A;  3HHT B;  2RM4 A;  3NTI A;  2V8K A;  4DBF A;  4JJN K;  2LJ0 A;  2O88 A;  2D0Q B;  2YSQ A;  2JTM A;  1VQ9 T;  1R0C B;  3CCU T;  2YUN A;  4EMK C;  2M16 A;  2LX7 A;  3RBB B;  1M8M A;  1LNX A;  1KD1 C;  1WFW A;  3OMC A;  3HRU A;  3CCV T;  4A4E A;  1I8F A;  1D0Z A;  2QTV A;  4DBH A;  5FWC A;  1UDL A;  4HCB A;  2M9U A;  2RH2 A;  3JSC A;  1O9S A;  1T3S A;  1VQL A;  1M1F A;  3FJ5 A;  3M56 A;  2KVQ G;  4RUG A;  1BB9 A;  3ME9 A;  4F7U F;  2L3R A;  4ME7 A;  1PG5 B;  1AWO A;  1UFF A;  2H8H A;  4HCC A;  4M7D C;  3NPF A;  4IKF A;  4E7Z A;  3FC3 A;  3OSV A;  2E64 A;  2HSE B;  1VIF A;  3REA B;  4FT2 A;  4BY6 B;  2LCL A;  1TUC A;  4KT0 E;  1VQN T;  2EFI A;  4XU2 A;  1YJW T;  4IUV A;  2JUF A;  1M2O A;  1UJ0 A;  3L2W A;  3JCM W;  1T0H A;  3CC2 A;  2MWP A;  2ZGW A;  2VC8 A;  4M7A E;  2XHC A;  1IHV A;  4Z8A A;  1S72 A;  3QO3 A;  1YWP A;  3M54 A;  2DXC A;  2BZX A;  5CVI A;  4C8Q E;  2KGT A;  5LJ5 d;  4JLG A;  2J6K A;  1G8X A;  2JTF A;  1VA7 A;  5GAN g;  2K6D A;  2LJ1 A;  3JAM E;  1O75 A;  1ZUU A;  2QA4 A;  1YCS B;  1E6H A;  3RDV A;  2JW4 A;  2L3Q A;  4B9X A;  3J81 E;  4FM4 B;  1M90 U;  1B07 A;  4K11 A;  1VQK T;  4QQ6 A;  3P8D A;  3CCR T;  4C0D B;  4ZTJ A;  2DEU A;  1I5O B;  1U1T A;  1K9M C;  3DLL A;  4HT8 A;  2A36 A;  3CC7 A;  2EYY A;  5IXF A;  4F7U B;  4OB3 B;  1X01 A;  4R55 A;  3JCM J;  2CP7 A;  3X26 B;  2L89 A;  4PJJ A;  3OYN A;  3CMA Q;  2I0N A;  1XNI A;  4AG2 C;  4EPC A;  3LLR A;  4PJO A;  2DMO A;  4PLL A;  3UWN A;  4OGC A;  1RL2 A;  3LW5 E;  2MAM A;  1OEB A;  1K73 U;  3ASK A;  2EBP A;  3QDF A;  2K4Y A;  3I55 Q;  1AVZ C;  1KQ1 A;  4C5E A;  1WNL A;  2E1H A;  4M7A G;  1K4U S;  5CKH A;  1OYX A;  2MF2 A;  4NS5 A;  2CUB A;  5L8R E;  3TEE A;  4C92 E;  2LNV A;  2EJ9 A;  3EG0 A;  1WZO A;  1N6A A;  3CBO A;  4C8Q G;  1TSF A;  4J6Y A;  3RER A;  2HQH A;  4WCI A;  4IIO A;  5IHI A;  1H3H A;  4D8D A;  2GF7 A;  2F69 A;  2DAQ A;  1RAF B;  1G3Y A;  2KNB B;  5GMK h;  2VAS A;  2DKG A;  2MI6 A;  1N8R U;  1AOJ A;  4WF2 A;  2COY A;  1RAC B;  1PSF A;  2QYZ A;  3WVE B;  2R57 A;  1YJN T;  1Q81 C;  5GAO r;  1QP2 A;  2DYB A;  4BDY A;  2AIR B;  4FYY B;  3CCJ T;  2QQA A;  1J3T A;  3CD6 T;  2HSP A;  5GAN 3;  4AG1 C;  2OTJ Q;  1VQ4 Q;  3A8L B;  4KGZ B;  1GCQ A;  1K8A R;  4C0G A;  1M27 C;  1OX8 A;  2P0Q A;  4M78 A;  3KUF A;  1WGS A;  1LJO A;  5GAO n;  4C5G A;  2DJQ A;  2LJ3 A;  2LRQ A;  4X1V A;  3LWI A;  5D6W A;  2X4J A;  3M9Q A;  3OYC A;  4OMP A;  1QVG S;  3P8H A;  1VQ6 T;  4EDU A;  2FZK B;  5LJ5 j;  1UGV A;  5GJW B;  5A0L A;  4MDW A;  4C92 G;  2FHD A;  1HXD A;  2QQB A;  3C0C A;  4PJO F;  1GL5 A;  1QCF A;  1YHQ Q;  4RG8 A;  2KE9 A;  3KBG A;  1ZBX A;  1NEB A;  4QVZ A;  4ATO A;  4RCB A;  4JRK A;  4FT4 A;  1VQ5 Q;  3UT1 A;  2WAC A;  3OYD A;  3FJP A;  1G3S A;  1S1N A;  1K0X A;  1WA7 A;  2LC4 A;  2QEX A;  1OZ2 A;  2F5K A;  5GAM g;  2JM9 A;  1UGS B;  3L2U A;  3EG9 A;  4XTZ A;  2K79 A;  3MP1 A;  5KCO A;  4JLI A;  3VS3 A;  4M7A A;  2OTL Q;  1IGU A;  5IAY A;  1M3A A;  2DZ9 A;  2ZPE B;  3IQL A;  2JOY A;  3OYJ A;  5GAN f;  1TH7 A;  2LNH B;  3M0U A;  3GP8 A;  4MMK A;  4RTV A;  2V1R A;  5CQY A;  4C8Q A;  4A54 A;  2L0A A;  4Y92 A;  4VUB A;  2NUT A;  4FCY A;  2DXT A;  2VGN A;  3EGU A;  3QYH B;  4OVA A;  1AWX A;  1RI0 A;  5M9O A;  3I56 Q;  1ZUY A;  2DYI A;  1LCK A;  1BBZ A;  4C92 C;  3OS0 A;  1Q86 U;  3EH1 A;  3PFS A;  2J7I A;  3L1A A;  3JCM V;  1VQ8 A;  4HKE A;  5CK9 A;  3M58 A;  1NPR A;  5CIU A;  3WVD B;  4F7U E;  4CI0 C;  2FYK A;  2ED1 A;  3RKX A;  1CSK A;  3Q1J A;  1NE8 A;  4JS5 A;  3O5Z A;  2LQN A;  3INZ A;  2NWM A;  2CP2 A;  2ESW A;  4HVV A;  2EKO A;  2GQV A;  1QVP A;  1VQM A;  2R5A A;  2ZPG B;  4PJO B;  1Y0M A;  1VQ9 Q;  3CCU Q;  2RHZ A;  4B6M A;  2CP3 A;  2RI3 A;  2RI5 A;  3QSU A;  3QWY A;  4BE2 A;  2DVE A;  2FPD A;  3TVT A;  3CCQ T;  3CCV Q;  4DA4 A;  2C0T A;  2RQV A;  2YT6 A;  1KFZ A;  4R56 A;  5GMK l;  1PNJ A;  3JCM Q;  1ACM B;  5CO7 A;  1MMG A;  3CPW A;  4M7A D;  2BIV A;  4LNP A;  5LJ5 g;  2E6Z A;  2EGE A;  2KXD A;  2M02 A;  4OB2 B;  3PVQ A;  2W10 A;  1N5Z A;  4A63 B;  2RHX A;  4C8Q D;  1VQN Q;  2COZ A;  5J39 A;  2XI9 A;  1YJW Q;  2VKN A;  5GJV B;  4B9W A;  2EWN A;  2LQ8 A;  2ZCF B;  1JU5 C;  2EQM A;  3BW1 A;  4BY6 C;  4M7A F;  3M5A A;  2P0P A;  1D1C A;  1SEM A;  2RB6 A;  1BI0 A;  1UE9 A;  2VB6 A;  3PVL A;  2XK0 A;  5KYU A;  4C8Q F;  5GAN d;  3ER0 A;  1NJI R;  3M0T A;  1KQ2 A;  2FZC B;  1K76 A;  4F14 A;  4M78 B;  1CKA A;  1SKU B;  3CCS T;  5DM7 R;  1YWO A;  3CCM A;  1PWT A;  2JN0 A;  4A4F A;  1WIE A;  2CP0 A;  1NM7 A;  1VQK Q;  3E9G A;  4OMQ A;  3LYI A;  4FU6 A;  2DL3 A;  1Q7Y R;  3REB B;  4PJM A;  3CCR Q;  2CS7 A;  2RK1 A;  5IT9 E;  4PJL A;  3X25 B;  1NEG A;  1M3B A;  4RTU A;  1MMA A;  1GCP A;  3QII A;  2YDL A;  3URG A;  1Y07 A;  4C0D C;  2EQJ A;  5J26 A;  2AKL A;  1E7O A;  2EYQ A;  1QVG P;  4LDW A;  4C92 D;  2KRS A;  3S3N A;  2ED0 A;  2AZS A;  1EIF A;  4HCK A;  2CUD A;  1AZG B;  1PRM C;  2XIC A;  4AMC A;  3CPW P;  5KYN A;  1I4K 1;  4RTZ A;  1WXT A;  2DVJ A;  5FRN A;  3QHS A;  3JCM h;  2V26 A;  3EG9 B;  1RAE B;  1GRI A;  4KUD K;  4M7A B;  1HD3 A;  2HL5 C;  4M77 E;  2DBM A;  3BE3 A;  4ANJ A;  4Z88 A;  3NTK A;  1NBE B;  8AT1 B;  5LJ3 h;  4X9C A;  3P8B B;  1ZA1 B;  4ESR A;  3CME T;  1UGP B;  1K9A A;  4C8Q B;  3CXC S;  2JT4 A;  3GPL A;  1HSQ A;  2NUT B;  1IGQ A;  3RNJ A;  3EAE A;  1UJY A;  2VYT A;  1JEG A;  3UAT A;  3UPU A;  1ARK A;  4HCZ A;  1QP3 A;  4FW1 A;  2FPE A;  1KIK A;  3OY9 A;  1MV3 A;  2E4H A;  5DY9 A;  3LGF A;  2HAX A;  4LD9 K;  1RAG B;  3OA6 A;  2GQI A;  2LDM A;  1YJN Q;  2VWF A;  3VU3 C;  2O9V A;  4EMH A;  1U5S A;  1UHF A;  4A4H A;  2DTO A;  3TSZ A;  5GMK e;  1VQO T;  4PJO E;  3CCJ Q;  2DJZ A;  3CD6 Q;  1WHG A;  3PIO A;  1HYO A;  2PVO B;  2D8J A;  1QVF S;  2RI2 A;  4AFZ C;  1WQW A;  2COW A;  2CT4 A;  2PUK B;  1ZHI A;  3F70 A;  2DL4 A;  2LX9 A;  1NYG A;  2NYS A;  3N5B B;  4NOY A;  3A98 A;  1ZSG A;  3MEU A;  1IO6 A;  4EMG A;  3M4Y A;  1JO8 A;  5EG2 A;  3RUX A;  3OW2 S;  4N4G A;  2HBW A;  4M77 G;  3G6E T;  5HY6 A;  2PVD B;  1VQ6 Q;  3GIB A;  3HRS A;  2PNI A;  4Y28 E;  5LJ5 f;  2HBP A;  2YXY A;  1Y7X A;  1BI1 A;  2Y4Y A;  1QWE A;  1QQJ A;  2KT8 A;  5CKF A;  2CYZ B;  4J6X A;  2Y90 A;  4E7S A;  1BCM A;  3MCA B;  1WJS A;  4PLI A;  3HKS A;  1JBM A;  1W2B S;  1K9M U;  1WHL A;  1KC8 R;  4N0A A;  2WSE E;  2X4Y A;  3HSB A;  1N9R A;  4L6V 5;  1XTD A;  4J9D A;  2KXC A;  1B34 A;  1UGQ B;  3QYG B;  4E7K A;  1H8K A;  2CKK A;  2GTJ A;  5KYU B;  4RCC A;  6AT1 B;  1M1K C;  2DZC A;  4N4H A;  5I11 A;  3SD4 A;  4M78 E;  4PJO G;  3CCL A;  2LCS A;  3OYH A;  2RJC A;  3X24 B;  1M1K R;  4IUT A;  1V76 A;  2KBT A;  1YIJ T;  1PRL C;  3D7S B;  2JXB A;  4OMM A;  2MMP A;  1KD1 R;  2K7A A;  2ROL A;  1VQ7 Q;  2DRM A;  2ENM A;  2DD5 A;  2K57 A;  3FLG A;  1TTH B;  3O8V A;  2KAF A;  4BB7 A;  1WLP B;  2KQW A;  1IB8 A;  4J9C A;  3JCM P;  2VXE A;  2LQK A;  1AD5 A;  1JJ2 A;  1WPY A;  1PSE A;  1LVK A;  2JVV A;  1K8A U;  1XJW B;  4JRI A;  1W70 A;  4C5H A;  4LUD A;  2O4X A;  1IRX A;  2GBQ A;  4PJO C;  3CCQ Q;  3I5S A;  3TRE A;  2LT4 A;  4PKC C;  3LX7 A;  2BZ8 A;  4PFP A;  5CKB A;  1U8R A;  3G4S A;  3X28 B;  1RLP C;  2CDT A;  2DTI A;  4M77 A;  2YLB A;  3E9F A;  3RIR A;  3OYF A;  2ABL A;  2Z0W A;  4OF1 A;  1YN8 A;  1EZZ B;  2DIL A;  4M78 G;  3THK A;  3HL8 A;  3C12 A;  4LUE A;  4GLK A;  1F1B B;  4OMF B;  1X75 C;  2EKH A;  4E2F B;  2RQW A;  3SWN A;  2MIO A;  2BUD A;  1C0M A;  3MP6 A;  2KT1 A;  2K3B A;  5I22 A;  2LZ6 B;  4ZN3 A;  4XU0 A;  1WJQ A;  3G71 A;  1PD1 A;  5HK0 A;  5I2M A;  4FW2 A;  3M0S A;  1VQL T;  4LDU A;  2AT1 B;  1DJ7 B;  1K9M R;  4M7D A;  1YIT A;  5AYF A;  4UC4 A;  2DXU A;  3BFM A;  3J80 E;  1VQP A;  2LQW A;  4J6W A;  3L2V A;  1D09 B;  3CCS Q;  5GAO m;  1M2V A;  1GCQ C;  2E10 A;  4XTV A;  3JRZ A;  1TOV A;  4BI3 A;  3VYG A;  2LTO A;  4BDZ A;  1KHI A;  2OX7 A;  3PNW C;  3CCE A;  2GFA A;  1YJ9 A;  1QVF P;  3CC2 T;  3CC4 A;  4XTX A;  2CZ0 B;  4M75 E;  1OUL A;  2EJG A;  1X2Q A;  2F2W A;  1SSF A;  1MGQ A;  5FRO A;  1JJ2 P;  1RAB B;  3VS5 A;  1U3O A;  1S72 T;  1H3Z A;  2MYS A;  2KK4 A;  4M77 D;  4J83 A;  2PU9 B;  2QI2 A;  3QXE B;  3OW2 P;  5D7U A;  2CRE A;  4FYW B;  1X6G A;  1JXM A;  4JRP A;  4CC4 B;  1Q82 C;  1VOM A;  4DEY A;  2K5L A;  2DPP B;  3NFC A;  2QA4 T;  2DNU A;  2DK3 A;  1D3B A;  4ZGE B;  1B34 B;  1ZBJ A;  3MP8 A;  4II1 A;  2BE7 D;  3BY7 A;  2E5K A;  3QDR B;  4FYV B;  1MMD A;  4M77 F;  2A28 A;  4KH0 B;  1ABO A;  2ECZ A;  4HA8 A;  3M59 A;  3CC7 T;  2Y4X A;  4DQ2 A;  1Q81 R;  4P5N A;  2OAW A;  4LDV A;  2GTO A;  4M7A C;  1I81 A;  4JJD A;  3CME Q;  3JCM e;  2PZ1 A;  9ATC B;  4X9D A;  4WTO B;  4PJO D;  1YI2 Q;  2O01 E;  1E6G A;  3PE0 A;  2BE9 B;  2KEA A;  2XID A;  5LJ3 e;  4C8Q C;  2L5Q A;  4MML A;  3OYG A;  1MV0 B;  1MND A;  4EIK A;  3QUI A;  2M0Y A;  2WSC E;  5CKE A;  4M75 G;  2FVU A;  2ZPF B;  3HP9 A;  2RK2 A;  3SB2 A;  5IXB A;  1AEY A;  2QGF B;  4X34 A;  5DLQ E;  1U1S A;  4KRT A;  2VVK A;  5FU6 B;  4GBQ A;  1VQO Q;  3TQ7 P;  1JXO A;  1V1C A;  5GMK j;  5FRM A;  2E65 A;  4ELZ C;  1C1A A;  3HFN A;  1NJI U;  5HKC A;  2O4X B;  2AK5 A;  4J9F A;  2V8I A;  1OQK A;  1YP5 A;  4A4G A;  4ZGD B;  1WHM A;  1M4Z A;  4M77 B;  3H0H A;  2FZG B;  3JCM b;  1QKW A;  2SEM A;  3G6E Q;  4XTY A;  1K73 C;  3EGD A;  1Q7Y U;  2DER A;  1SF9 A;  1BI3 A;  4JUV A;  4CC3 A;  3NMZ C;  1RI9 A;  4RTW A;  3QWX X;  2CP6 A;  2K2M A;  1BI2 A;  4M78 D;  3SWN B;  1QWF A;  3VS1 A;  4BUG A;  2J6O A;  3RKW A;  1VQ7 T;  3GLX A;  3LGL A;  2EAY A;  2K9G A;  3TU4 K;  2EW3 A;  5KH6 A;  2M1H A;  1AWW A;  2C0O A;  2RHY A;  2YUO A;  2P4R A;  4J9I A;  4FYX B;  4IIM A;  1VYT A;  2DX1 A;  2NUP A;  4M7D B;  3QZ9 B;  2AHJ B;  4XU3 A;  3CMA A;  4M78 F;  3GNG A;  3KFV A;  3OYM A;  3GBQ A;  1KQS S;  2QXF A;  4JJB A;  3OS5 A;  4IUU A;  1GBQ A;  3DLM A;  2HKQ B;  1UEC A;  1GFC A;  4HVU A;  5LL6 S;  1N27 A;  1M2V B;  2M51 A;  2RMO A;  3I55 A;  1N9S A;  4XK8 E;  2EGC A;  1QVG A;  1YFN A;  1YIJ Q;  2DTH A;  1H64 1;  1VUB A;  1I5L A;  1MNE A;  1FMW A;  2VV5 A;  2F5T X;  2HD0 A;  2QEX T;  2JM8 A;  4M75 A;  3OS1 A;  2EQK A;  1PM3 A;  2JJ9 A;  4E7H A;  2HZY A;  1QCN A;  4Z02 A;  4R0K A;  1BKB A;  4J8O A;  4QVD A;  3TCJ A;  3S3O A;  2G3R A;  2MK5 A;  2JS0 A;  2EPD A;  1WHK A;  1WXU A;  3OYB A;  3L2R A;  1X2K A;  1LOJ A;  2A37 A;  1D3B B;  2AKK A;  1Z9Q A;  4HXJ A;  3PMI A;  1X6O A;  3JCM d;  5FW9 A;  1UGR B;  4MDX A;  1M8V A;  1NLO C;  2EVR A;  1VQ8 T;  2OTJ A;  1TUD A;  1IRE B;  2KR3 A;  3V8L A;  1VQ4 A;  5I2S A;  4D8K A;  2MPX C;  3DB3 A;  3ULR B;  4CC7 A;  3BDL A;  5LJ3 d;  2E12 A;  2ATC B;  2FO0 A;  1UB4 A;  5FLX E;  4PFZ A;  1BCO A;  2P4T A;  5A0D A;  3HFO A;  1VQM T;  2KRM A;  5GAM e;  2L3S A;  1FWZ A;  2QGG A;  2CH4 A;  3L2Z A;  2RHI A;  1K0S A;  2SRC A;  3V7R A;  1BK2 A;  5D6X A;  4BE0 A;  3E19 A;  2RNA A;  3M53 A;  4RKU E;  1I0C A;  1WQ7 A;  3OYL A;  1KC8 U;  3UDC A;  3MET A;  2H3E B;  4LD6 A;  3M0R A;  1OZ3 A;  2DLP A;  1VQL Q;  3FB9 A;  3MO8 A;  1Y57 A;  4M75 D;  2IG0 A;  1YHQ A;  1D1A A;  1Q86 C;  2KYB A;  2PTK A;  1ZUK A;  4LN2 A;  1Y96 A;  2EGA A;  5GAN 4;  4E47 A;  3OBY A;  1XOV A;  5KE2 A;  1VQ5 A;  2X4X A;  4IUQ A;  3L42 A;  1Q95 G;  1WDX A;  4KGX B;  3UA6 A;  2X35 A;  4KUI A;  2X3X D;  3QG1 A;  4GY5 A;  1YBY A;  1H92 A;  2EYW A;  1ABQ A;  4ZNX A;  2DE0 X;  2E3I A;  2KRN A;  3VS6 A;  8ATC B;  3JB9 F;  3OB9 A;  2K5F A;  1M1K U;  2OTL A;  4M75 F;  1SSH A;  3A8G B;  3CC2 Q;  3EGD B;  2QK0 A;  2P84 A;  3JB9 H;  1OX9 A;  2QQS A;  3PT9 A;  3NTH A;  5KYX A;  1NPP A;  2DM1 A;  3EFS A;  3OQ5 A;  1S72 Q;  1KD1 U;  3H41 A;  2JZ2 A;  2DIQ A;  4OML A;  1YI2 T;  2KMT A;  2K2V A;  1B3Q A;  3PTA A;  4RTX A;  3SHW A;  3I56 A;  5GAN h;  1R8O B;  2DL7 A;  3QJY A;  2B86 A;  1X6B A;  3LWH A;  2D1X A;  3PIP A;  3OMG A;  2W0Z A;  5GAO q;  4XTU A;  2F1L A;  5CR2 A;  3H0F A;  3CCM T;  1WHJ A;  2QA4 Q;  1VYV A;  5D6Y A;  4Y91 A;  2CZ7 B;  4M7D E;  1TS9 A;  4ELY C;  4O6J A;  2NUP B;  4BE1 A;  4N0A C;  2YUP A;  2FEI A;  5KCH A;  5ECA A;  2FRY A;  1RAH B;  2RF0 A;  1KJW A;  2RHU A;  4JJC A;  4ZTF A;  3CC7 Q;  3UA7 A;  1VQ9 A;  3CCU A;  5KYW A;  2D8H A;  4L59 A;  4C5I A;  2PVG B;  5GMK i;  3J7A F;  1QCO A;  1M30 A;  3HRT A;  1SG5 A;  3CCV A;  4FIB A;  2DL5 A;  2O9S A;  2QTX A;  2M0O A;  1NLP C;  2DRK A;  2E6N A;  2J06 A;  2KSS A;  2LT1 A;  5GAO l;  2E3H A;  2WSF E;  3FDR A;  5FU7 B;  4M75 B;  5LJ3 j;  2OJ2 A;  2J05 A;  2QQR A;  1P92 A;  3HPW A;  2DD4 A;  2PUO B;  2BZY A;  3EFO A;  3ZL7 C;  1IHW A;  1TG0 A;  2R5M A;  3FEO A;  1VQN A;  1UG1 A;  1RUW A;  1R77 A;  3DKM A;  1YJW A;  3EHQ A;  2XDD A;  1Z9Z A;  3CEY A;  1IXD A;  4FL6 A;  2V1Q A;  4OP0 A;  1G83 A;  5FU6 C;  3V7C A;  3EG1 A;  5CQX A;  4NL3 A;  3E1S A;  4J9H A;  4E7L A;  2ZZD A;  3MJX A;  4JDS A;  2DET A;  4M7D G;  2XDP A;  1X43 A;  3LH5 A;  1OU9 A;  1TXQ A;  3CXC A;  2YRD A;  2VUB A;  3SEM A;  2IIM A;  2CSI A;  1M5Q 1;  2RJF A;  4M77 C;  3WXM B;  4JZ4 A;  3RMQ A;  1K1Z A;  4KH1 B;  2RJE A;  1VQK A;  5GAN 6;  2YUQ A;  4E7I A;  2GFU A;  4AFS C;  3CCR A;  1Y71 A;  2CT3 A;  1KHC A;  5J3B A;  1UEB A;  2GNC A;  2RN8 A;  5I21 A;  3SWN C;  2A3L A;  4HT9 A;  4IUP A;  2HQX A;  3OBW A;  1QVF A;  1PKT A;  1MMN A;  3EHR A;  1Q82 U;  1Y96 B;  2HNI A;  2EJF A;  1ZSZ A;  3JB9 I;  3U23 A;  2DL8 A;  4LDY A;  1ZA2 B;  1WYX A;  2YLC A;  3MHX A;  1C6V X;  1Q81 U;  4QQD A;  1RLQ C;  3OW2 A;  3S6W A;  2EYX A;  2MWO A;  4TVR A;  3JCM g;  3MPU B;  5GAM h;  4DBR A;  4RTT A;  2KYM A;  3VYH B;  2X51 A;  3VS7 A;  2QEX Q;  5KYX B;  2AZV A;  4EMK A;  4KBM B;  4LE9 A;  4KGV B;  5LJ3 g;  2FB7 A;  3SDZ A;  1YNZ A;  1MUZ A;  1SHF A;  2HQE A;  3M57 A;  1R0B G;  1W2B A;  3CCL T;  3TSW A;  3C95 A;  3PGG A;  2J6F A;  3CXC P;  2X9H A;  4NL2 A;  3VV0 A;  1NG2 A;  2NUZ A;  2QQ9 A;  4PFO A;  5C6S A;  2H3J A;  3T9N A;  1YJN A;  5CKD A;  2DEQ A;  4BAC A;  4OMN A;  4OGE A;  4QW2 A;  3CCJ A;  3QBY A;  3CD6 A;  1VQ8 Q;  3H0I A;  3OYY A;  5KYW B;  2K3X A;  1VYU A;  2HDA A;  3GOX A;  1G3W A;  2F2X A;  2RQR A;  1FXX A;  5CCA A;  1VQM Q;  1V29 B;  4M78 C;  1ZLM A;  3A1P A;  2BKD N;  1MHN A;  2YRV A;  4PJN A;  5GAM j;  1VQ6 A;  1GBR A;  1JQQ A;  3G7Z A;  3SFM A;  1PCX A;  5CAI A;  2BTT A;  5AT1 B;  4J7I A;  4BD3 A;  2QG9 B;  5GAO p;  3EFO B;  2CZ1 B;  3G4S T;  3E2U A;  4JPB W;  4M4Z A;  2OAU A;  1B7T A;  1W6X A;  4BI4 A;  1BIB A;  5LJ5 h;  5GAN 7;  5KYY A;  2LP5 A;  3BDU A;  2K5I A;  1YCY A;  3CBP A;  3EG2 A;  3R6N A;  2HMA A;  1Q82 R;  3GNF B;  4IUR A;  3VS4 A;  2R58 A;  3G1J A;  4PL6 A;  1W2B P;  1OOT A;  1TUG B;  1W4S A;  3L2Q A;  1HK9 A;  2YWW A;  3FIF A;  3G71 T;  1K8A C;  4XU1 A;  1QKX A;  2RJD A;  4M7D D;  2DA9 A;  3ZBD A;  4YTL A;  4F04 B;  1YIT T;  3PMT A;  3V7S A;  2D0N A;  2GCX A;  3EGX A;  3R6O A;  1T0J A;  2RO0 A;  1VQP T;  1RAD B;  2JNG A;  1D0X A;  3JB9 G;  1GFD A;  3EH2 A;  1RAA B;  4MZT A;  4AFQ C;  3CCM Q;  1VQ7 A;  3H8Z A;  7AT1 B;  4M7D F;  4XAX B;  4L5G A;  1TWB A;  1M90 C;  3A5Z B;  3CCE T;  2RQU A;  1YJ9 T;  5GAN e;  4GLM A;  3CC4 T;  2ZPI B;  2EYZ A;  3QKJ A;  2I2L A;  3VUZ A;  1ZSZ B;  1M90 R;  3CPW S;  3HTR A;  2FG0 A;  1PD0 A;  3CCQ A;  2DO3 A;  3V8K A;  1UTI A;  3JCM f;  4QT7 A;  2LMJ A;  2KI7 A;  3NHN A;  3M0P A;  2B8A A;  3M55 A;  2C06 A;  1AT1 B;  5IHN A;  5LJ3 f;  4EMK B;  4BI8 B;  3MEV A;  2IVW A;  2KY9 A;  4O5V A;  5FU7 C;  4M75 C;  1D0Y A;  1OPL A;  1K73 R;  2QDY B;  1M1G A;  1I1J A;  1WXB A;  2FRW A;  2JMA A;  3I9Q A;  1UHC A;  1G2B A;  1QW1 A;  1A0N B;  5IHK A;  1SRM A;  1UUE A;  2RQT A;  4CC2 A;  4RTY A;  2C0I A;  4J5Y A;  3RR6 A;  5GAN 8;  2P0K A;  2A0F B;  4XQ3 A;  1JB0 E;  4F17 A;  4JS4 A;  4OB0 B;  1VIE A;  2KRO A;  1N8R C;  3EFR A;  2PQW A;  2XDB A;  2FPF A;  1QMC A;  3S3M A;  2JS2 A;  1W1F A;  2VGM A;  1OPK A;  3KXT A;  4J9B A;  1T3L A;  2E5Q A;  3CCS A;  1OU8 A;  1JRI A;  1N8R R;  2ZPH B;  5C0M A;  4Z89 A;  1OV3 A;  1AHJ B;  2F2V A;  1AZE A;  1HJD A;  3NGP A;  4KUL A;  3MEW A;  3RES A;  1AWJ A;  3VKI A;  4AT1 B;  3AHU A;  2OI3 A;  2JMC A;  1WJR A;  2XU8 A;  3UF4 A;  1ZQ1 A;  1FYN A;  4E7J A;  2CZ6 B;  2EQI A;  2L2P A;  5HK3 A;  1M9S A;  2HKN A;  4XTW A;  2MOX A;  4JZ3 A;  4ZGJ B;  1BYM A;  3I5R A;  1SRL A;  5KYY B;  4HVW A;  4C92 A;  2DF6 A;  3AT1 B;  5DLO A;  3VS0 A;  3MEA A;  4OMO A;  4ORZ A;  3VUB A;  1OI1 A;  3A8H B;  1NYF A;  4QVC A;  1G3T A;  2CSQ A;  2MCN A;  2V8J A;  2A7Y A;  2O2O A;  3QJ6 A;  1NJI C;  2HL3 A;  3CME A;  4F7U G;  1D1B A;  2YRC A;  1XQH A;  3CMA T;  1YI2 A;  1ZX6 A;  3MKD A;  1WHH A;  4FSX A;  3OYK A;  2CGH A;  3EG3 A;  3X20 B;  2QAS A;  3EGX B;  3CCL Q;  2IPO B;  3M4G A;  3VJP A;  1U06 A;  2L3P A;  5IH2 A;  1Q7Y C;  3I55 T;  2X4W A;  4QQG A;  4DOV A;  2RPN A;  3V8J A;  4PNO A;  3I35 A;  2G6F X;  2QAZ A;  3JB9 D;  3VRY A;  2A08 A;  2KDS A;  4RG2 A;  1KQS A;  4V2S A;  1VQO A;  3VRZ A;  2HEQ A;  2DIG A;  4MZM A;  4CRI A;  4A4K A;  2EIF A;  4DBQ A;  2QDL A;  1KK7 A;  4A53 A;  3OSS C;  2ZAE A;  1RAI B;  1EFN A;  1BU1 A;  2ZPB B;  5GAN 2;  1SHG A;  1Q86 R;  2RA2 A;  2XKO C;  3JV3 A;  1GXI E;  1PC0 A;  2K3Y A;  2VXF A;  4J9E A;  2XD0 A;  4J7F A;  2D9T A;  1I07 A;  2XMF A; 
#chains in the Genus database with same CATH homology
 2XG8 D;  5GAM f;  4E7I A;  2GFU A;  3INZ A;  3G6E A;  3CCR A;  4JRP A;  1Q82 C;  1Y71 A;  4D6W A;  3CPF A;  1KHC A;  2K5L A;  2DPP B;  3NFC A;  5J3B A;  2EKO A;  2GQV A;  1QVP A;  1UEB A;  2R5A A;  2ZPG B;  5I21 A;  2QA4 T;  1VQM A;  3SWN C;  4PJO B;  1VQ4 T;  2OTJ T;  2A3L A;  4HT9 A;  4IUP A;  2DK3 A;  5GAN 5;  1D3B A;  4C92 F;  2HQX A;  2RHZ A;  1B34 B;  3C4S A;  4ZGE B;  5A2Q E;  2RI3 A;  3MP8 A;  4II1 A;  3BY7 A;  2RI5 A;  3OBW A;  3QSU A;  3QDR B;  4BE2 A;  1BIA A;  1QVF A;  4M77 F;  2DVE A;  1Q82 U;  1Y96 B;  3CCQ T;  2RD1 A;  1IZ6 A;  2HNI A;  4HA8 A;  2EJF A;  4DA4 A;  3M59 A;  3GF5 A;  3CC7 T;  4ZN1 A;  3JB9 I;  4LDY A;  2Y4X A;  4RMO A;  4C0F A;  2E41 A;  2YLC A;  4DOW A;  4DQ2 A;  2E70 A;  4P5N A;  4R56 A;  5GMK l;  3OS2 A;  3MHX A;  4LDV A;  1Q81 U;  3DB4 A;  4QQD A;  4C0Z A;  4M7A C;  4Q5W A;  1I81 A;  3JCM Q;  5CO7 A;  1KG1 A;  5LJ5 e;  3JCM e;  4X9D A;  3H6Z A;  2DXB A;  3CPW A;  3OW2 A;  4M7A D;  2BIV A;  3S6W A;  4PJO D;  2O01 E;  2MWO A;  3ZEH A;  4TVR A;  3JCM g;  5LJ5 g;  5GAM h;  2E6Z A;  4LDX A;  2XID A;  4F7U A;  3QPH A;  4C8Q C;  4OB2 B;  3VYH B;  2L5Q A;  4MML A;  5LJ3 e;  3JB9 J;  1FX7 A;  3OYG A;  2RHX A;  4C8Q D;  1YHQ T;  4EMK A;  4KBM B;  5J39 A;  2XI9 A;  5A0G A;  5LJ3 g;  2FB7 A;  3QUI A;  4JRQ A;  2WSC E;  5CKE A;  3SDZ A;  4M75 G;  4B9W A;  2FVU A;  2ZPF B;  3HP9 A;  2EWN A;  2RK2 A;  2LQ8 A;  1YIJ A;  3SB2 A;  1VQ5 T;  2HQE A;  2ZCF B;  3M57 A;  2EQM A;  3BW1 A;  4N4I A;  1W2B A;  4BY6 C;  4OB1 B;  3A8M B;  4M7A F;  4X34 A;  3M5A A;  5DLQ E;  3CCL T;  2P0P A;  1U1S A;  3OYE A;  5FU6 B;  3C95 A;  2RB6 A;  1BI0 A;  3PGG A;  3JCM c;  2D6F A;  1JJ2 S;  2L8D A;  5GMK m;  4NL2 A;  2XK0 A;  3VV0 A;  5GMK j;  2OTL T;  5FRM A;  2QQ9 A;  4C8Q F;  2E65 A;  3ER0 A;  5GAN d;  5C6S A;  2H3J A;  3T9N A;  4ELZ C;  3HFN A;  3JCM X;  1NJI U;  5HKC A;  2LCC A;  3ZFJ A;  1YJN A;  2O4X B;  1KQ2 A;  2V8I A;  2DEQ A;  5CKD A;  4BAC A;  3OYA A;  4M78 B;  4OGE A;  2EQU A;  5GAN j;  4A4G A;  4QW2 A;  3C94 A;  4ZGD B;  3A8O B;  5DM7 R;  3CCJ A;  3QBY A;  2LVM A;  3CCS T;  4C92 B;  3CCM A;  3CD6 A;  2JN0 A;  1M4Z A;  4A4F A;  3OYY A;  2K3X A;  4M77 B;  1KC8 C;  1G5V A;  3JCM b;  3QZ5 B;  3LH0 A;  3E9G A;  3FRN A;  3RMS A;  5IN1 A;  3I56 T;  3LYI A;  4FU6 A;  3GOX A;  1G3W A;  4XTY A;  2YHT A;  1K73 C;  3CBM A;  1Q7Y U;  2RK1 A;  2CS7 A;  5IT9 E;  4MZP A;  3X25 B;  2FL7 A;  3OYI A;  1BI3 A;  1FXX A;  5KE3 A;  5CCA A;  4JUV A;  2NLU A;  5GAM d;  1NZ9 A;  1V29 B;  4M78 C;  2BKD N;  1MHN A;  2YRV A;  3QII A;  3URG A;  4C0D C;  1Y07 A;  3RKY A;  2EQJ A;  5J26 A;  1BI2 A;  4M78 D;  3SWN B;  3HHT B;  2RM4 A;  4BUG A;  5GAM j;  1VQ6 A;  3NTI A;  2V8K A;  2EYQ A;  4LDW A;  4C92 D;  4JJN K;  3G7Z A;  3RKW A;  3SFM A;  5CAI A;  3S3N A;  1VQ7 T;  2D0Q B;  3GLX A;  4J7I A;  3LGL A;  4BD3 A;  1EIF A;  5GAO p;  2EAY A;  3TU4 K;  2CZ1 B;  5KH6 A;  3G4S T;  2JTM A;  2M1H A;  1VQ9 T;  3CCU T;  2OAU A;  2XIC A;  2RHY A;  4EMK C;  2M16 A;  1I4K 1;  5FRN A;  4BI4 A;  3QHS A;  4M7D B;  1BIB A;  3JCM h;  5LJ5 h;  3QZ9 B;  1LNX A;  2AHJ B;  5GAN 7;  1KD1 C;  4KUD K;  4XU3 A;  3OMC A;  3HRU A;  4M7A B;  4A4E A;  3CMA A;  3CCV T;  1I8F A;  4M78 F;  3GNG A;  3BDU A;  4M77 E;  3OYM A;  2K5I A;  4HCB A;  2M9U A;  1KQS S;  1YCY A;  2RH2 A;  2QXF A;  3CBP A;  3JSC A;  3NTK A;  3OS5 A;  1O9S A;  4IUU A;  1VQL A;  1M1F A;  3DLM A;  3M56 A;  5LJ3 h;  2KVQ G;  4X9C A;  3P8B B;  3GNF B;  4IUR A;  5LL6 S;  3CME T;  1N27 A;  1UGP B;  3I55 A;  4C8Q B;  2R58 A;  3ME9 A;  4F7U F;  2L3R A;  4PL6 A;  3CXC S;  4ME7 A;  3GPL A;  1W4S A;  1N9S A;  4XK8 E;  3L2Q A;  1HK9 A;  3EAE A;  1QVG A;  3FIF A;  3G71 T;  4HCC A;  4M7D C;  2DTH A;  1H64 1;  4IKF A;  2VYT A;  1VUB A;  1I5L A;  3FC3 A;  3UPU A;  1K8A C;  3OSV A;  4XU1 A;  2RJD A;  4M7D D;  2VV5 A;  2E64 A;  2F5T X;  1VIF A;  2HD0 A;  2QEX T;  4FT2 A;  4HCZ A;  4YTL A;  3ZBD A;  2LCL A;  4BY6 B;  4M75 A;  1QP3 A;  4KT0 E;  3OS1 A;  1VQN T;  2EQK A;  3OY9 A;  1YIT T;  2EFI A;  4XU2 A;  1YJW T;  4IUV A;  2JUF A;  3LGF A;  3PMT A;  5DY9 A;  2HAX A;  4E7H A;  3V7S A;  4LD9 K;  3L2W A;  3JCM W;  3OA6 A;  4Z02 A;  3CC2 A;  1BKB A;  4J8O A;  2GCX A;  4QVD A;  3TCJ A;  2LDM A;  3S3O A;  2MWP A;  3R6O A;  2G3R A;  3VU3 C;  4EMH A;  2RO0 A;  1VQP T;  2ZGW A;  4A4H A;  2VC8 A;  2DTO A;  2JNG A;  5GMK e;  4M7A E;  2XHC A;  3JB9 G;  1VQO T;  1S72 A;  4PJO E;  4MZT A;  2DJZ A;  3QO3 A;  1VQ7 A;  3PIO A;  3H8Z A;  3M54 A;  2PVO B;  3OYB A;  2DXC A;  3L2R A;  4XAX B;  4M7D F;  1LOJ A;  4L5G A;  1QVF S;  2RI2 A;  5CVI A;  1D3B B;  1M90 C;  3A5Z B;  3CCE T;  1YJ9 T;  5GAN e;  1WQW A;  3CC4 T;  3PMI A;  2PUK B;  2ZPI B;  4C8Q E;  1X6O A;  1ZHI A;  3F70 A;  4JLG A;  5LJ5 d;  2LX9 A;  3JCM d;  4NOY A;  2JTF A;  3N5B B;  1UGR B;  4MDX A;  3QKJ A;  1M8V A;  5GAN g;  2I2L A;  3VUZ A;  3MEU A;  3JAM E;  4EMG A;  1VQ8 T;  1O75 A;  2QA4 A;  2OTJ A;  1IRE B;  3M4Y A;  3V8L A;  1VQ4 A;  5I2S A;  5EG2 A;  3RUX A;  4B9X A;  3DB3 A;  3J81 E;  3BDL A;  4FM4 B;  1M90 U;  5LJ3 d;  3CPW S;  1VQK T;  3OW2 S;  2E12 A;  4N4G A;  4QQ6 A;  1UB4 A;  4M77 G;  3P8D A;  5HY6 A;  2PVD B;  5FLX E;  3G6E T;  3CCR T;  4C0D B;  4ZTJ A;  3GIB A;  1U1T A;  1K9M C;  3CCQ A;  2DO3 A;  2P4T A;  3HRS A;  4Y28 E;  3V8K A;  3JCM f;  5LJ5 f;  5A0D A;  3DLL A;  2HBP A;  4HT8 A;  1Y7X A;  1BI1 A;  2Y4Y A;  3HFO A;  3CC7 A;  2B8A A;  1VQM T;  5GAM e;  4F7U B;  4OB3 B;  1FWZ A;  1X01 A;  3M55 A;  5CKF A;  2C06 A;  2CYZ B;  3L2Z A;  4J6X A;  4R55 A;  2Y90 A;  3JCM J;  3X26 B;  2RHI A;  5LJ3 f;  3MCA B;  1WJS A;  4EMK B;  2L89 A;  4PLI A;  3V7R A;  4BI8 B;  3MEV A;  2IVW A;  1JBM A;  3HKS A;  3OYN A;  5D6X A;  1W2B S;  2KY9 A;  1K9M U;  4BE0 A;  3E19 A;  3M53 A;  4O5V A;  4RKU E;  1XNI A;  4N0A A;  2WSE E;  1WQ7 A;  2X4Y A;  5FU7 C;  4EPC A;  3LLR A;  3OYL A;  3HSB A;  1KC8 U;  4PJO A;  3UDC A;  3MET A;  1N9R A;  4LD6 A;  4PLL A;  4M75 C;  4OGC A;  4L6V 5;  1XTD A;  3UWN A;  1RL2 A;  3LW5 E;  1OZ3 A;  2MAM A;  3FB9 A;  1B34 A;  3MO8 A;  1UGQ B;  2QDY B;  1M1G A;  3QYG B;  4M75 D;  1K73 U;  2IG0 A;  3ASK A;  4E7K A;  1YHQ A;  1Q86 C;  2K4Y A;  2CKK A;  1KQ1 A;  1Y96 A;  4RCC A;  5GAN 4;  1QW1 A;  1M1K C;  4E47 A;  3OBY A;  2DZC A;  1XOV A;  5KE2 A;  4C5E A;  1WNL A;  1VQ5 A;  2X4X A;  4IUQ A;  4N4H A;  3L42 A;  2E1H A;  4M7A G;  3SD4 A;  4M78 E;  4PJO G;  3CCL A;  5CKH A;  1OYX A;  4J5Y A;  2X35 A;  2P0K A;  5GAN 8;  4KUI A;  2MF2 A;  4NS5 A;  3QG1 A;  4XQ3 A;  5L8R E;  1JB0 E;  3TEE A;  4C92 E;  4JS4 A;  1YIT A;  4GY5 A;  2LNV A;  4OB0 B;  1YBY A;  3OYH A;  2RJC A;  3X24 B;  2EJ9 A;  1VIE A;  1N8R C;  1N6A A;  3CBO A;  3JB9 F;  3EFR A;  4IUT A;  3OB9 A;  2K5F A;  1M1K U;  2OTL A;  2PQW A;  4M75 F;  4C8Q G;  2XDB A;  4J6Y A;  1YIJ T;  3RER A;  3A8G B;  3S3M A;  2VGM A;  3KXT A;  2GF7 A;  2F69 A;  2DAQ A;  2MMP A;  3JB9 H;  1G3Y A;  2QQS A;  2E5Q A;  3PT9 A;  3CCS A;  3NTH A;  5GMK h;  1NPP A;  3EFS A;  3OQ5 A;  1KD1 U;  1JRI A;  2DKG A;  2JZ2 A;  2DIQ A;  2MI6 A;  2ZPH B;  2KMT A;  5C0M A;  1YI2 T;  1N8R U;  1AHJ B;  4WF2 A;  2K2V A;  4KUL A;  3MEW A;  3PTA A;  3RES A;  3VKI A;  1PSF A;  3I56 A;  3WVE B;  2DD5 A;  2R57 A;  1R8O B;  2K57 A;  3FLG A;  3QJY A;  5GAN h;  1YJN T;  1Q81 C;  3AHU A;  3LWH A;  5GAO r;  3PIP A;  1WJR A;  2XU8 A;  1QP2 A;  3OMG A;  1ZQ1 A;  3O8V A;  5GAO q;  4BDY A;  4XTU A;  3CCJ T;  4E7J A;  2KAF A;  2CZ6 B;  2QQA A;  4BB7 A;  5HK3 A;  5CR2 A;  3CCM T;  3CD6 T;  5GAN 3;  1M9S A;  4XTW A;  2KQW A;  3JCM P;  5D6Y A;  2VXE A;  2LQK A;  3A8L B;  4Y91 A;  1JJ2 A;  1WPY A;  1PSE A;  2CZ7 B;  2JVV A;  4M7D E;  1K8A U;  4JRI A;  4C0G A;  4ELY C;  4ZGJ B;  4O6J A;  4C5H A;  1BYM A;  2O4X A;  4BE1 A;  2P0Q A;  4N0A C;  4M78 A;  3KUF A;  4PJO C;  1WGS A;  5KCH A;  2RHU A;  2LT4 A;  3TRE A;  1LJO A;  3LX7 A;  4PKC C;  4C92 A;  5GAO n;  5CKB A;  4C5G A;  4ZTF A;  1U8R A;  3G4S A;  3X28 B;  1VQ9 A;  3CCU A;  5DLO A;  2DTI A;  3MEA A;  4M77 A;  2LRQ A;  3VUB A;  2YLB A;  4L59 A;  5D6W A;  3LWI A;  4C5I A;  3E9F A;  3RIR A;  2X4J A;  3OYF A;  2PVG B;  3M9Q A;  3OYC A;  1OI1 A;  5GMK i;  1QVG S;  3J7A F;  3A8H B;  3P8H A;  1VQ6 T;  4OF1 A;  4QVC A;  3HRT A;  4EDU A;  3CCV A;  4FIB A;  1G3T A;  2QTX A;  4M78 G;  3HL8 A;  5LJ5 j;  2M0O A;  3C12 A;  5A0L A;  4MDW A;  4GLK A;  2E6N A;  2KSS A;  4OMF B;  2V8J A;  2FHD A;  4C92 G;  1X75 C;  2LT1 A;  5GAO l;  2A7Y A;  2WSF E;  3FDR A;  3QJ6 A;  1HXD A;  1NJI C;  2QQB A;  5FU7 B;  4PJO F;  3CME A;  3SWN A;  4M75 B;  4F7U G;  4RG8 A;  2BUD A;  3KBG A;  5LJ3 j;  1ZBX A;  3MP6 A;  2QQR A;  1P92 A;  1XQH A;  4QVZ A;  3HPW A;  4ATO A;  4RCB A;  4JRK A;  3CMA T;  2DD4 A;  4ZN3 A;  1YI2 A;  4XU0 A;  4FT4 A;  1WJQ A;  2PUO B;  3G71 A;  4FSX A;  5HK0 A;  3OYK A;  3UT1 A;  2WAC A;  5I2M A;  2CGH A;  3X20 B;  3FJP A;  3OYD A;  1G3S A;  1VQL T;  4LDU A;  2LC4 A;  2R5M A;  3M4G A;  3VJP A;  2QEX A;  1DJ7 B;  1OZ2 A;  2F5K A;  5GAM g;  3FEO A;  1Q7Y C;  1VQN A;  4M7D A;  3I55 T;  1UGS B;  2X4W A;  4QQG A;  3DKM A;  4XTZ A;  3MP1 A;  4DOV A;  5AYF A;  5KCO A;  3L2U A;  1YJW A;  4JLI A;  2XDD A;  4M7A A;  4UC4 A;  3V8J A;  2DXU A;  5IAY A;  4PNO A;  3CEY A;  3BFM A;  4FL6 A;  4OP0 A;  3V7C A;  5FU6 C;  2DZ9 A;  2ZPE B;  3JB9 D;  3J80 E;  5CQX A;  2JOY A;  1VQP A;  3OYJ A;  2KDS A;  1TH7 A;  4RG2 A;  5GAN f;  4J6W A;  3L2V A;  4NL3 A;  3GP8 A;  3E1S A;  4MMK A;  1KQS A;  4V2S A;  1VQO A;  5CQY A;  5GAO m;  4E7L A;  4C8Q A;  2E10 A;  4XTV A;  2ZZD A;  4A54 A;  4JDS A;  4M7D G;  2DIG A;  2XDP A;  3JRZ A;  4MZM A;  4VUB A;  3VYG A;  4A4K A;  4BI3 A;  2EIF A;  4CRI A;  2LTO A;  4BDZ A;  1KHI A;  2DXT A;  2VGN A;  3PNW C;  3QYH B;  4OVA A;  4A53 A;  1RI0 A;  2GFA A;  3OSS C;  5M9O A;  3CCE A;  1YJ9 A;  3CXC A;  3CC2 T;  2VUB A;  3CC4 A;  4XTX A;  2ZPB B;  2CZ0 B;  4M75 E;  4C92 C;  5GAN 2;  2EJG A;  3OS0 A;  2RA2 A;  2XKO C;  1SSF A;  1MGQ A;  3PFS A;  1M5Q 1;  5FRO A;  2RJF A;  1Q86 U;  3L1A A;  1GXI E;  4M77 C;  1S72 T;  3JCM V;  1VQ8 A;  4HKE A;  3WXM B;  2K3Y A;  2VXF A;  1NPR A;  3M58 A;  5CIU A;  3WVD B;  4F7U E;  3RMQ A;  2FYK A;  5CK9 A;  4CI0 C;  1H3Z A;  2XD0 A;  2KK4 A;  4M77 D;  4J83 A;  3Q1J A;  3RKX A;  1NE8 A;  4J7F A;  2RJE A;  1VQK A;  4JS5 A;  2D9T A;  2PU9 B;  5GAN 6;  2QI2 A;  3QXE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...