3NMZC

Crystal structure of apc complexed with asef
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
SSHHYSHPGGGGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGEGWFPASFVRLRVNQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/cell cycle
molecule keywords APC variant protein
publication title Structural basis for the recognition of Asef by adenomatous polyposis coli
doi rcsb
source organism Homo sapiens
total genus 13
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3nmzC00
5FW9A 2LCSA 1GFCA 1UG1A 2LZ6B 2VVKA 3VS4A 4K11A 2G6FX 2DA9A 2DNUA 3PVQA 3TSZA 2F2WA 1ZLMA 2VKNA 4LUEA 1Y0MA 2E5KA 2KT1A 2YT6A 1JO8A 2DRKA 3M0PA 2DJQA 4LNPA 1N5ZA 1GL5A 3GBQA 3VS0A 2KNBB 1UJYA 4JPBW 2K2MA 1RLQC 2FO0A 4ORZA 2YUQA 1PNJA 1WXUA 1FYNA 1T3LA 5I22A 2ESWA 2KROA 1W6XA 1OV3A 2CDTA 1NLPC 3UA7A 1RLPC 5GJVB 2LJ1A 4JZ3A 1YWPA 5IHNA 1U5SA 3FJ5A 2F2VA 1TG0A 2JM8A 3I9QA 1WLPB 2FPFA 5IXBA 2EYZA 1UTIA 2J6OA 1M3AA 2KT8A 3VS3A 4A63B 2K6DA 2ROTA 2RQVA 4IIMA 3I5SA 2GBQA 2J6KA 5IHKA 2J05A 1Y57A 2O31A 4Z89A 3VRYA 2K79A 2A37A 2DM1A 1PRLC 1KFZA 2P4RA 3UA6A 4AFQC 2A36A 1BB9A 1X27A 4J9EA 4QT7A 1OEBA 3TVTA 2D8HA 4RTVA 4F14A 1T3SA 2PTKA 2JMCA 1BBZA 1GCQC 1YCSB 2KXDA 2X3WD 3I5RA 4D8KA 2DF6A 1LCKA 2B86A 1PHTA 1S1NA 1WI7A 3EHQA 2ROLA 1M30A 1UDLA 2DE0X 1M3BA 1K9AA 2H8HA 5I11A 2BZ8A 1AWJA 3REBB 2L3SA 1K0SA 2SEMA 3JV3A 4OMNA 1U06A 1NYFA 1UFFA 2YUPA 2JXBA 2YUOA 1AZEA 3NGPA 1WDXA 2EVRA 1I1JA 1AWXA 2RQTA 1M8MA 2KRMA 4OMOA 2DX1A 2FRYA 1NEGA 5FWBA 4RTZA 1QCFA 2EGCA 1I07A 2EYWA 4J9HA 2KRSA 2RQUA 2A28A 4RTWA 3VS2A 4DEXA 2MIOA 2JT4A 1MV0B 2C0OA 3NMZC 4HXJA 1G83A 1H8KA 2RMOA 2FEIA 4IIOA 2DL8A 2DYBA 3VS1A 1IO6A 1UHCA 1ZSGA 1E6HA 1SRLA 4F17A 1WXTA 2EBPA 2CH4A 3NPFA 1QWEA 2EGAA 3VS6A 3M0RA 3VRZA 2L2PA 2DLPA 1VYVA 1NLOC 1K1ZA 1ABQA 1V1CA 1NEBA 1GBQA 1ZX6A 2SRCA 4M4ZA 1NG2A 2I0NA 3PE0A 1AEYA 2EYXA 1H92A 3EHRA 1AVZC 1Z9ZA 3THKA 2JS2A 3EGUA 3IQLA 2LX7A 1G2BA 1JXMA 4AFUC 1B07A 1CSKA 1QWFA 3SHWA 2HSPA 5IH2A 1WX6A 5HCKA 2DBMA 2BZXA 1UUEA 2W10A 1JU5C 3REAB 2AZSA 2F2XA 4J9BA 2LQNA 1K4US 2RPNA 3I35A 4ESRA 2L3PA 1YNZA 1ZUUA 5EC7A 2OAWA 3PVLA 1UE9A 2AKLA 4HVUA 2VWFA 3QWYA 2NUZA 1QKWA 1X2QA 1UECA 2AK5A 1JXOA 1KSWA 1OOTA 2GTOA 4HVWA 2GTJA 1UHFA 1SSHA 2EQIA 4AFSC 2GNCA 1NM7A 2LMJA 4ZNXA 1AOJA 1HJDA 4LUDA 1YN8A 2D1XA 1OPLA 5GJWB 2L3QA 2X3XD 4J9GA 1KJWA 2CT4A 2W0ZA 2ABLA 3KFVA 4J9IA 1AD5A 4OMLA 2DL3A 2EYYA 4D8DA 3EG0A 1K0XA 2ED0A 2PZ1A 2JS0A 1KIKA 2AZVA 2CREA 1K76A 1PKTA 1J3TA 1GCPA 2DBKA 1X6BA 4HCKA 4RTYA 1VYTA 1M27C 4WCIA 1NYGA 4F16A 4JJCA 2CH4W 1GFDA 1E6GA 3H0FA 5ECAA 2DRMA 3C0CA 4RUGA 1BK2A 1HSQA 1AWWA 3O5ZA 4RTTA 3NHNA 1PRMC 1HD3A 4DEYA 4R0KA 4RTUA 2JW4A 2LJ0A 3H41A 3R6NA 4OMQA 3UF4A 2O9SA 1B3QA 3QWXX 2HBWA 1OPKA 1WIEA 5FWCA 3VS5A 1AZGB 4X1VA 4Z8AA 1MV3A 1FMKA 2KGTA 2D8JA 4E6RA 3TSWA 1GRIA 2QDLA 1XOVA 1PWTA 2CUBA 4CC2A 1SPKA 1T0JA 1CKBA 1WXBA 3EG1A 2RNAA 1ARKA 2BZYA 4KRTA 2YDLA 2MOXA 2OJ2A 3CQTA 1WFWA 2LQWA 1RUWA 2GQIA 1RI9A 1ZBJA 1ZUKA 2C0TA 1UGVA 1PKSA 1X6GA 1GCQA 4LN2A 2HEQA 1MUZA 2KEAA 2PNIA 4AG2C 2D0NA 4CC7A 2LJ3A 2CT3A 2EKHA 4HVVA 1GBRA 3U23A 3M0SA 4FSSA 3ULRB 2XMFA 3EG3A 1SRMA 2CUDA 2HDAA 1E7OA 2RF0A 2JMAA 2EW3A 1QLYA 4JJDA 3UATA 2CSQA 2K9GA 4AG1C 1QKXA 2KBTA 4JZ4A 1YP5A 2RN8A 1SHFA 2O88A 1VYUA 2GGRA 2M51A 3M0TA 2JM9A 2KYBA 2J06A 1X43A 2FG0A 2ED1A 2RQWA 1JEGA 2A08A 2LNHB 1X69A 2O2OA 3A98A 1X2KA 2DL5A 5IHIA 1SEMA 2YUNA 2C0IA 1WA7A 2FRWA 1BU1A 2JTEA 1ZUYA 3RNJA 2J6FA 1M3CA 4CC3A 3SEMA 4AFZC 2K7AA 2K3BA 2NWMA 4RTXA 4J9FA 2AKKA 1JQQA 4GBQA 3ZL7C 2EGEA 2J7IA 4Z88A 1W70A 5L23A 3LH5A 2DILA 1YWOA 1U3OA 2V1RA 3M0QA 2FPDA 2DMOA 2LP5A 4Y92A 1EFNA 2CSIA 1TUDA 3EG2A 2BTTA 2HCKA 1W1FA 2EPDA 1Z9QA 1CKAA 2M0YA 2DL7A 4J9DA 2KXCA 2MCNA 2DVJA 2L0AA 1ABOA 4CC4B 3H0HA 2KE9A 4EIKA 5IXFA 1H3HA 4GLMA 4LE9A 1A0NB 1UJ0A 1I0CA 2KRNA 4OMPA 3H0IA 1WYXA 2KR3A 2KYMA 2OI3A 4JJBA 3RBBB 2YSQA 2IIMA 2FPEA 4J9CA 1SHGA 2O9VA 2DL4A 1T0HA 2ECZA 2ENMA 1AWOA 2RQRA 2V1QA 3VS7A 3M0UA 1VA7A 1TUCA 4OMMA
chains in the Genus database with same CATH superfamily
5GAOm 4V2SA 4BY6C 5GANf 2DK3A 4NL2A 3URGA 3JCMh 4A4FA 2HKNA 3V7CA 4PJOF 2VKNA 1I5LA 1Y0MA 5GMKi 2KT1A 1XJWB 2E3IA 3LH0A 2DJQA 1RAIB 1UJYA 9ATCB 2PVGB 2ZPFB 5CKBA 2K2MA 1U8RA 2R5MA 4M77A 3M58A 1WXUA 4BE0A 2L8DA 2YRCA 5I22A 2ESWA 2CDTA 2KROA 2QQBA 3UA7A 1RLPC 4TVRA 5GJVB 3CMAQ 3OYGA 2BKDN 3OYHA 1U5SA 1WLPB 2OTLQ 3CCEQ 1P92A 3OYJA 2BIVA 2J6OA 1M3AA 2NUPA 3SFMA 3JB9H 2LTOA 2KVQG 3OW2A 2J6KA 5IN1A 2DZCA 1VQ8A 1G5VA 1UB4A 4F7UE 1BKBA 2K79A 2LVMA 2P4RA 4KGVB 3EFOB 5GAN2 1IZ6A 2MWOA 4IUVA 3JCMW 1BB9A 2AHJB 3FRNA 4J9EA 4QT7A 1FWZA 3CMAT 3INZA 3N5BB 1OX8A 1K73R 1K73C 2RHIA 4A4EA 2L89A 2DF6A 2QDYB 4LDWA 2B86A 1PHTA 1U1SA 5I11A 2BZ8A 3L42A 4AMCA 3OW2P 3OB9A 4GY5A 1D0ZA 2JTFA 1WHHA 3CC4A 1NYFA 4M75E 5FU6C 2YUOA 3NGPA 2HAXA 1WDXA 3CC2T 2RQTA 3CCVA 3OBYA 3RUXA 1N27A 1YFNA 3CCMA 1NEGA 1JRIA 4N4GA 2ZPBB 4XTZA 2JUFA 4JJNK 3CC7Q 1EIFA 4QW2A 3E9FA 4WTOB 3A8LB 2GF7A 3T9NA 3NMZC 2DAQA 3M5AA 1M1KU 4C5GA 4OB2B 2FEIA 1WJSA 2DVEA 2DYBA 1IO6A 2K3YA 1E6HA 3G1JA 1PD1A 2HSEB 3META 2RD1A 1G3TA 4C92F 2DXUA 2E70A 5KYWA 2VASA 1JJ2S 2KI7A 4P5NA 4XQ3A 3WXMB 3QPHA 4EPCA 3CC7T 4HA8A 2A0FB 1GBQA 1ZX6A 4M4ZA 1NG2A 1VQ4Q 4EMGA 2EYXA 4FL6A 2EYQA 4XTYA 3CPWP 3THKA 3QG1A 2DJZA 1KC8U 1G2BA 1JXMA 4ELZC 5HY6A 5HCKA 2DBMA 2BZXA 2YLBA 1PSFA 2XHCA 4J6XA 2AZSA 2VGNA 2WSFE 1K4US 2A3LA 3D7SB 4ESRA 3UWNA 4CI0C 1YJNA 5LJ5h 1KD1R 1KD1C 2K5IA 3OYDA 1NJIC 1UE9A 5FLXE 2X4YA 2NUZA 2A7YA 1X2QA 4XAXB 2DTOA 3RDVA 4OB0B 2QA4A 3LWIA 4XTVA 5GAN6 1IB8A 5LJ3h 2DO3A 2HL3A 3VKIA 1UHFA 3RERA 2VC8A 4M78G 4M7AF 4AFSC 3QYGB 2GNCA 1VUBA 5CKDA 4LUDA 2WSEE 1OPLA 5CIUA 3L1AA 1AT1B 2X3XD 2CT4A 2W0ZA 2CZ0B 1MNEA 2GCXA 3RESA 3X20B 1VQ5A 1Y71A 4J9IA 1YI2Q 3JCMb 2X4XA 3ASKA 5GAMg 2DL3A 3GOXA 3V7SA 1W2BS 2ED0A 3HFOA 1VQ9Q 4LD9K 1YHQT 2AZVA 5IT9E 1VQ7Q 1YCYA 3RR6A 1GFDA 3FIFA 4JJCA 2DXCA 3TREA 4C0DB 2KMTA 4C0FA 2XKOC 4RUGA 1TXQA 2CP6A 2DXTA 3O5ZA 3J80E 3CCVT 3OMGA 2HZYA 1NBEB 4DEYA 4R0KA 1OQKA 3R6NA 2RJDA 3UF4A 4HT9A 2PUKB 4Y91A 3EH2A 1OPKA 4QQDA 4OB1B 3V7RA 3P8DA 4D6WA 1RI0A 3FLGA 3J81E 1D0YA 4E6RA 3CCSQ 3CCJQ 3QZ5B 4GLKA 3CCRA 4CC2A 2RA2A 2FZKB 1CKBA 1TH7A 3EG1A 1YBYA 2CZ1B 1ARKA 1I81A 3LLRA 4KRTA 2YDLA 5GMKe 4ZGJB 2YWWA 4M7DE 4FT4A 3EH1A 4IUUA 2RHZA 2HEQA 3BDUA 1YJWA 4AG2C 3PIPA 3JB9J 1FX7A 5J39A 3DLLA 1JB0E 4HVVA 1GBRA 4RMOA 4FSSA 2XMFA 3EG3A 1BCMA 2DPPB 2Y90A 5A0GA 1ZBXA 1E7OA 4PLLA 1VQPA 5FU7B 3OYFA 2V26A 2JMAA 1QLYA 5I2MA 1Q82R 4PJOA 2KBTA 1FMVA 1YP5A 2H3JA 1Q82C 1SHFA 2O88A 1VYUA 2X51A 2M51A 3CCLQ 4EMHA 3C95A 2J06A 2O4XB 2RQWA 1MMDA 1TOVA 2FVUA 1X69A 3G71A 1TU0B 3I55T 1SG5A 2O2OA 2JZ2A 1X2KA 3EG9A 4LDUA 3H8ZA 1SEMA 1WA7A 3M4YA 2P84A 3OSVA 4EMKB 2JVVA 2ZPHB 2VYTA 1KQSA 3TEEA 4ANJA 1K73U 1D1BA 2BE7D 1D1AA 3O8VA 4YTLA 1JQQA 2KAFA 4M78B 4F7UG 2D0QB 3CCUA 2MAMA 5L23A 3EAEA 3MCAB 5GAMj 1YWOA 1U3OA 5GANg 4DOVA 2X4JA 2DMOA 2LP5A 2Y4YA 1VQMA 3EG2A 3L2RA 1X75C 3BW1A 3QYHB 2M0YA 1CKAA 2DL7A 4E7IA 5D7UA 3CD6Q 4DBQA 1H3HA 4LE9A 4XU0A 4OP0A 4M7DC 1I0CA 3JCMc 4JS5A 1WYXA 5A0LA 2YRVA 3RBBB 2OTJT 5DLQE 4O5VA 4PJNA 5CR2A 3MEAA 2O9VA 3CMEA 2ECZA 5FRMA 2QGFB 4M77E 3G6EQ 4KUIA 3M4GA 1LPLA 2QEXQ 5FW9A 2LCSA 1VQNA 1YIJT 4MMLA 2LZ6B 3CBOA 3HPWA 4K11A 4PJLA 5GAMe 4X9CA 2DA9A 3PVQA 4JLGA 3TSZA 2AT1B 4LUEA 4BI4A 4BUGA 1YITQ 2C06A 1QP2A 3OBWA 1JO8A 3NTHA 3CCRT 1D3BB 3JB9I 2MI6A 2KNBB 3A8OB 2LCLA 2X9HA 4PKCC 2WSCE 4ME7A 1QCOA 2XI9A 1OX9A 3VV0A 1LJOA 1FYNA 1VQ6Q 2M16A 4FU6A 4J7FA 1D1CA 1OV3A 2DFUA 4PJOD 1NLPC 1S72Q 4BE2A 5EG2A 2CP7A 1VQLQ 3G4SQ 3FJ5A 2F1LA 4C92A 3I9QA 2FPFA 3QJ6A 4N4IA 2JN0A 4QQGA 1UTIA 2KT8A 4E7LA 2K6DA 1BI2A 1VQPT 2XK0A 3C12A 4UC4A 4II1A 1Y57A 4MZMA 4Z89A 3OYEA 2DD5A 3UA6A 4AFQC 2A36A 3HSBA 1VQ6T 1X27A 4ZGDB 1OEBA 3TVTA 2D8HA 4F14A 3OYYA 3J7AF 3QHSA 1VQOT 1GXIE 1VQLT 1GCQC 2HQHA 5CAIA 3X26B 3I5RA 4D8KA 3FC3A 1LCKA 2IG0A 3NTKA 1IHWA 3CCEA 5GANj 1S1NA 2ZPEB 1N6AA 1WI7A 3EHQA 3TQ7P 2DE0X 2H8HA 2ZPIB 5KYUB 1AWJA 2HL5C 4FYYB 3HRTA 2SEMA 1B7TA 4BDYA 5FU7C 4JLIA 2HBPA 4F7UB 2HQEA 5DLOA 2JXBA 1MHNA 2EAYA 2EVRA 1WNLA 4M7AA 4NS5A 1QVFS 2KRMA 2FRYA 2E64A 2EQJA 1B34A 3JCMV 5GAOl 4X34A 4ELYC 4RTWA 3JB9G 1MV0B 1H8KA 2RMOA 2RJEA 3UPUA 3F70A 3JCMf 3VS1A 4M78C 4PFPA 5GANe 1SRLA 4ZGEB 4F17A 1WXTA 3QDRB 2FZGB 5CKEA 4A4KA 1UEBA 3VRZA 2QTXA 1YJ9A 2PUOB 4JUVA 3I56A 1PSEA 4HCCA 4XTXA 1IHVA 4FW2A 1C0MA 3M59A 2R58A 2FYKA 3CBPA 3A8MB 1WJQA 2NLUA 3ME9A 1K8AR 1B07A 4C92D 3M57A 1K8AC 2HSPA 5IH2A 4JRPA 1UUEA 4XU3A 4M7DG 2F2XA 3MPUB 1ZUUA 4OMFB 4B9WA 3GIBA 5EC7A 2JJ9A 2P0QA 2VWFA 4DBRA 1QKWA 5KYXA 1Q7YU 2AK5A 1JXOA 3OSSC 1D09B 3RKYA 4XU2A 1VQ4A 4BE1A 1OOTA 2GTOA 4C5EA 4FW1A 1WHJA 3CC2Q 3X24B 1NM7A 4OGEA 2RH2A 3PFSA 4EMKA 1W4SA 2ABLA 3SWNB 1BCOA 4ZN3A 1N8RU 4C8QC 4JRKA 3S6WA 2MPXC 4IUQA 3VYHB 3CCQT 3EG0A 1K0XA 1HYOA 4M7AD 2D9TA 5HK3A 2JS0A 1M8VA 1KIKA 4MZPA 2XU8A 3GNGA 4HCKA 4DBFA 1VYTA 3JB9F 1M27C 2DTHA 1QVGS 2NYSA 1QVPA 4WCIA 2CH4W 2QQAA 1E6GA 5ECAA 2DRMA 4ZTJA 3C0CA 1QMCA 1TWBA 3NHNA 1V76A 1PRMC 3CPWA 1ZA1B 2JW4A 2RJCA 2LJ0A 3GF5A 4OMQA 1WQ7A 2QI2A 2RHXA 1H3ZA 1M1GA 1F1BB 3VS5A 1IGQA 3QIIA 1AZGB 2E4HA 1FMKA 1VQ9A 1EX4A 3PNWC 5CK9A 3SB2A 2GQVA 3QBYA 2CS7A 1WPYA 2MMPA 5GAMd 4J7IA 1SPKA 1NE8A 1M90C 4PJOE 3EGXA 2RNAA 2EJ9A 2BZYA 3FJPA 2MOXA 2XDBA 2MF2A 2LQWA 2JOYA 4M77G 2NUTB 2VXFA 1UGVA 3CPFA 1YJ9T 3I56T 4M7DF 2GFUA 4KH1B 2EKOA 1X6OA 2DZ9A 4CC7A 4C5HA 5AYFA 3FDRA 5GMKl 3M0SA 1FXXA 3WVDB 3MO8A 3OS2A 2RK1A 3CCJA 2HDAA 5LJ5f 3CXCS 2G3RA 1NJIR 2O01E 3V8JA 1G3SA 2B8AA 1ZA2B 5GMKm 4AG1C 1QKXA 1RACB 2GGRA 4J6YA 5LJ3f 3M54A 4LDVA 4M75C 4RG2A 1Q81U 2VB6A 1R0BG 1X43A 4M7DB 1YHQQ 1ZSZB 1Q86U 1BIBA 1LNXA 2EQMA 2LT1A 5GAOr 3VU3C 1WJRA 1VQ8T 3EGDB 2C0IA 3QKJA 2JTEA 2J6FA 1JBMA 1OYXA 5KYYB 2E12A 4AFZC 2K57A 4KT0E 2FZCB 4M78D 3CCVQ 3ZL7C 3L2UA 3RMSA 2XIDA 3GPLA 3TU4K 2DERA 2I2LA 3LH5A 4N0AC 2DILA 3CCLA 5GMKj 2FPDA 1EFNA 2VXEA 4A53A 4BI3A 2CSIA 1TUDA 1HK9A 3LWHA 4PFOA 1BI0A 1W1FA 3CC4T 1I5OB 3HFNA 3M56A 3M55A 2KXCA 2CZ6B 2DVJA 4DBHA 1ABOA 3ZFJA 4DA4A 4CC4B 1M4ZA 2LT4A 3L2QA 3OS0A 2KSSA 2EJFA 4GLMA 3CCMT 1BYMA 1UJ0A 4OMPA 3H0IA 2ZZDA 4J9CA 1D0XA 1SHGA 3LGLA 1AWOA 3E19A 2OX7A 1RAHB 1TUCA 3JCMJ 4HKEA 3SWNC 2YXYA 4FM4B 5GANd 2VVKA 3VS4A 2G6FX 2E3HA 4FCYA 4R55A 2F2WA 4C92E 1ZLMA 4C8QG 3CD6A 4L6V5 2DRKA 1Q95G 2LQKA 3M0PA 5GAN7 1PM3A 4LNPA 4QVZA 1FMWA 1NPPA 1GL5A 3VS0A 3I55Q 5CKHA 4OB3B 5GMKh 1C1AA 1VIFA 1XNIA 3RKWA 1Y96B 2YUQA 1PNJA 4M77B 1XTDA 1BIAA 4WF2A 3L2VA 2LCCA 1M5Q1 3HL8A 3OMCA 1W6XA 2E6NA 2K5LA 1K8AU 2E41A 2LJ1A 2FB7A 3OQ5A 2CYZB 4M78F 2CP5A 2F2VA 1TG0A 1I8FA 2EYZA 3QZ9B 4MZTA 5DM7R 3PTAA 3JCMX 3OW2S 3VS3A 4A63B 1YJNT 2ROTA 2RQVA 2DIGA 3I5SA 2KY9A 2IVWA 2GBQA 3HTRA 2ZGWA 3VRYA 2QA4T 4QKUA 2PVDB 3EFOA 3UDCA 4QVCA 3CEYA 2XDDA 4M7AE 4HCBA 4MDXA 1T3SA 1SF9A 2JMCA 1UGPB 3AHUA 3G4SA 2OTJQ 3DB4A 1VQ5T 5D6WA 1OULA 2ROLA 3JCMg 1M30A 1UDLA 1M3BA 1YIJQ 3REBB 2IPOB 2L3SA 1K0SA 1QW1A 4OMNA 1U06A 5FRNA 1M1FA 2YUPA 4JRQA 2CZ7B 3P8HA 3MEUA 5C6SA 1AZEA 1I1JA 4FIBA 1AWXA 4FT2A 1M8MA 4EDUA 4C0GA 3CCRQ 4KBMB 1ZSZC 3OY9A 1QCFA 4M75G 2EGCA 4LDXA 4X9DA 1MMGA 2RQUA 2A28A 4RG8A 2PQWA 1C6VX 1TSFA 3VS2A 1M9SA 2DYIA 4DEXA 2C0OA 2YRDA 2EWNA 1G83A 3A5ZB 1SKUB 4C8QF 2QXFA 3QDFA 4E7JA 4L59A 4B9XA 1M1KR 1BI1A 1M1KC 1ZSGA 3VUBA 1VQKA 4HCZA 1YJWQ 1N9RA 3GNFB 2CH4A 1IXDA 1QQJA 1OU8A 1G3WA 2K2VA 2ZAEA 3VS6A 5GAMh 2DLPA 1VYVA 1K1ZA 1VQPQ 2X35A 4FYXB 2L3RA 1IGUA 4MDWA 1NEBA 3LGFA 2SRCA 1RAAB 3PE0A 1AEYA 4C8QB 1H92A 3EHRA 1Z9ZA 4Z02A 3G71Q 1VQOQ 3TCJA 3EGUA 3IQLA 4PJOG 2CP0A 2LX7A 4AFUC 1YJWT 1QWFA 3SHWA 1KC8R 1KC8C 2W10A 2PVOB 1JU5C 3REAB 1KD1U 4J9BA 1NJIU 2LQNA 3JRZA 5C0MA 3I35A 2RI5A 4E7SA 1WHGA 1YNZA 4FYVB 2OAWA 1H641 1WGSA 2AKLA 4HVUA 1RABB 3QWYA 2DKGA 1UECA 1JJ2P 8AT1B 1KSWA 2DTIA 4F7UF 2GTJA 4M7DA 3G71T 2RM4A 2JNGA 2QASA 2P4TA 4L5GA 5GAN5 3CMAA 3JCMQ 3JSCA 2LMJA 4XTWA 1AOJA 4RCCA 2D1XA 3H6ZA 2OTLA 5GJWB 2L3QA 4J9GA 5LL6S 1ZHIA 1ACMB 2F5KA 1KK7A 4M77C 1OZ2A 1UGSB 3CCUT 2Z0WA 4VUBA 4OMLA 4D8DA 2K3XA 4J5YA 1PC0A 5J3BA 3CMEQ 4M75F 1WHKA 5I2SA 1W2BA 1J3TA 2LRQA 4RTYA 1VQMT 1VQNQ 2HMAA 2QG9B 3OYMA 5L8RE 2QAZA 2JTMA 1NYGA 4KULA 3MP1A 2LDMA 1R8OB 3ZBDA 1KG1A 3PT9A 1DJ7B 1RAEB 3MEVA 1HD3A 4ATOA 4CRIA 2V8IA 4XTUA 8ATCB 3VJPA 3OA6A 3PIOA 1MGQA 3MP8A 5CKFA 4F04B 2M0OA 2O9SA 1B3QA 1QCNA 2HBWA 3RKXA 4M75B 1WIEA 3M53A 5FWCA 2MWPA 5LJ5g 3H9NA 3CMET 3JB9D 3GLXA 4Z8AA 3JCMe 3PMIA 2MYSA 2D8JA 1W2BP 1VQNT 1XOVA 1PWTA 3A8GB 4OGCA 5LJ3g 5GANh 1T0JA 1WXBA 4OVAA 3CC7A 1VQKT 3CQTA 4E47A 4AT1B 1MMAA 1RUWA 1RI9A 2LX9A 1ZBJA 3QUIA 2C0TA 3OYLA 4Y28E 1PKSA 1LVKA 1GCQA 4C0ZA 3WVEB 1MUZA 2QYZA 4C92G 1BI3A 2KEAA 1PCXA 2D0NA 3HRSA 5CQXA 2EKHA 2QK0A 1Y96A 5KE3A 3M9QA 1SRMA 2CUDA 1Q82U 2WACA 2RF0A 2EW3A 3UATA 4PJOB 4JZ4A 2X4WA 2RN8A 2QQSA 5KE2A 4M7DD 3CCQQ 2K4YA 3M0TA 2KYBA 3OYAA 2O4XA 1Y7XA 2FG0A 2ED1A 2M02A 3A1PA 2A08A 2LNHB 5KYNA 3HRUA 3S3NA 2RO0A 2EQKA 4E7HA 3EG9B 3E9GA 1M2VB 3BFMA 2FRWA 1BU1A 1KQSS 2DETA 1ZUYA 3RNJA 1G3YA 1M3CA 4CC3A 3SEMA 4R56A 2NWMA 3EFRA 4RTXA 4DQ2A 3UT1A 1UGQB 5KCHA 2KK4A 4GBQA 3ER0A 5CQYA 4M78A 2EGEA 4PFZA 4Z88A 2E6ZA 1N9SA 2OTLT 3CCET 2V1RA 3M0QA 3KBGA 2P0PA 3HP9A 2LQ8A 4M7AG 2HNIA 4LXCA 4J83A 4Y92A 1YHQA 3OYBA 1WQWA 2EFIA 2F69A 4J8OA 1I4K1 2RB6A 2M1HA 2MCNA 2E65A 3H0HA 4EIKA 3V8LA 2YHTA 1A0NB 1YI2A 1IREB 1YJ9Q 3I56Q 3QJYA 3L2ZA 4PJMA 2KQWA 2CKKA 2IIMA 3BY7A 5LJ5j 5KH6A 2RHUA 2DL4A 1T0HA 1K9MR 1K9MC 3KXTA 1VQ7A 1VA7A 4OMMA 1GFCA 1UG1A 2OAUA 1M90R 2COYA 1U1TA 5LJ3j 2BUDA 1WZOA 2DNUA 2LC4A 3DB3A 2E5KA 2YT6A 4QQ6A 4BI8B 2VUBA 3DKMA 1N5ZA 3GBQA 1D3BA 5M9OA 4PJJA 1VQ8Q 4JPBW 4M77D 1RLQC 1MNDA 2FO0A 4BACA 4ORZA 3CBMA 1T3LA 4C8QA 3CCSA 2RHYA 2RI2A 2HKQB 4PLIA 4JZ3A 5LJ5e 1YWPA 1WHMA 5IHNA 2COZA 2CP3A 4C92B 2JM8A 1NPRA 1NZ9A 5IXBA 5GAN8 5LJ3e 4IIMA 3I55A 1MMNA 5IHKA 2COWA 2J05A 2E5QA 3PGGA 2O31A 3CC4Q 2A37A 2DM1A 1PRLC 1KFZA 1VQ4T 4DOWA 2VGMA 5A0DA 3AT1B 5HK0A 4RTVA 2YLCA 2CP2A 4E7KA 2PTKA 2FHDA 1X01A 2QGGA 4IKFA 3CCMQ 1RADB 1BBZA 1PD0A 1YCSB 2DD4A 2KXDA 2X3WD 4A54A 3ZEHA 2R57A 3L2WA 4JS4A 4LD6A 4Q5WA 5A2QE 3C94A 1K9AA 5KYUA 3HHTB 4FYWB 3JV3A 4F7UA 1UFFA 4PJOC 1OU9A 1O9SA 4M7AB 4OMOA 2DX1A 5KCOA 5FWBA 4RTZA 1B34B 1QVFA 2M9UA 1I07A 1LOJA 2EYWA 2OTJA 2VV5A 3NTIA 4J9HA 2KRSA 5J26A 2XD0A 2MK5A 2MIOA 2JT4A 4HXJA 5HKCA 2LNVA 4MMKA 2D6FA 1YI2T 4M77F 2QQRA 1YIJA 4IIOA 2GFAA 2DL8A 3R6OA 3JCMd 1UHCA 3OYKA 4M75A 4KGZB 4FSXA 1VQ9T 4IUPA 2EBPA 1SSFA 3NPFA 1QWEA 2EGAA 1VQ7T 3P8BB 4BB7A 1RAFB 1VOMA 3M0RA 2L2PA 1YJNQ 3LW5E 4ZTFA 1NLOC 4E2FB 1ABQA 1V1CA 1QVFP 2P0KA 2DEUA 2QA4Q 3BDLA 2I0NA 4C8QD 5FROA 1KHIA 3G6EA 5GAN4 4PL6A 2QEXA 1AVZC 5I21A 1KHCA 1OI1A 2JS2A 4KH0B 2ATCB 1CSKA 4N0AA 2HD0A 3FB9A 2EJGA 1WX6A 2DXBA 1TUGB 3OYNA 1YITA 2PU9B 2HQXA 1Y07A 2NUPB 5GAOq 1VQ5Q 3CCST 3CCJT 2RPNA 2DEQA 2L3PA 3MHXA 2L5QA 3PVLA 3EFSA 3VUZA 5KYXB 2E10A 2QQ9A 2XG8D 4O6JA 1Q7YR 1Q7YC 1VQ6A 4HVWA 4N4HA 3E1SA 1SSHA 1O75A 4RKUE 4HT8A 2EQIA 1S72A 1VQOA 3QO3A 5DY9A 3SD4A 3OYIA 1VQLA 3MP6A 2EQUA 4ZNXA 1M2VA 1HJDA 5CCAA 3OYCA 1YN8A 4XK8E 2CGHA 3DLMA 3A8HB 2AIRB 1QP3A 1KJWA 2ZCFB 3SWNA 3KFVA 4BY6B 2KDSA 5GAN3 1R0CB 1AD5A 2ZPGB 1N8RR 1N8RC 4ZN1A 3S3OA 1AHJB 3CCLT 2EYYA 3OS1A 2BE9B 2PZ1A 4C92C 2V8JA 1WHLA 2CREA 1K76A 1PKTA 1GCPA 2DBKA 1X6BA 4F16A 3MKDA 5D6YA 4J6WA 3H0FA 4BD3A 1QVGA 3CPWS 2EIFA 3BE3A 1BK2A 1HSQA 1AWWA 1KQSP 4RTTA 4C5IA 3QSUA 6AT1B 5GAOn 4E7ZA 4RTUA 3H41A 4M75D 4RCBA 3QWXX 1K9MU 4A4GA 3V8KA 4X1VA 1MV3A 2KGTA 3S3MA 1ZQ1A 5KYWB 4OF1A 1HXDA 3TSWA 1M90U 1V29B 4IURA 1GRIA 2RK2A 2QDLA 5GAMf 2CUBA 2V8KA 3Q1JA 3JCMP 3RIRA 3QXEB 3EGXB 1JJ2A 2E1HA 1QVGP 2OJ2A 1M2OA 1WFWA 3X25B 3CD6T 3PMTA 5AT1B 2GQIA 2NUTA 1ZUKA 1VIEA 2F5TX 1R77A 3G7ZA 1X6GA 1RAGB 2H3EB 4M7AC 4A4HA 4LN2A 2PNIA 2RJFA 2LJ3A 2CT3A 3G6ET 4C0DC 1RL2A 4JDSA 3U23A 3ULRB 2DIQA 2QEXT 2R5AA 3KUFA 1XQHA 4KGXB 4QVDA 5LJ5d 4M78E 1UGRB 3GP8A 4JJDA 5FU6B 2CSQA 3CXCA 2K9GA 3CCUQ 3LX7A 3FEOA 3OS5A 5IAYA 1YITT 5LJ3d 2JM9A 2XDPA 1JEGA 1Q81R 1ZSZA 3MEWA 1TTHB 1Q81C 5CVIA 4JRIA 3A98A 1VQMQ 2QTVA 2DL5A 5IHIA 4PK4A 1Q86R 1Q86C 2YUNA 3EGDA 1KQ1A 3VYGA 5KYYA 5CO7A 3RMQA 2K7AA 4NOYA 2K3BA 3E2UA 1S72T 4J9FA 2AKKA 2Y4XA 3LYIA 3G4ST 3CXCP 2J7IA 1W70A 2XICA 3HKSA 3NFCA 3CCQA 1KQ2A 4BDZA 7AT1B 4KUDK 3CC2A 1PG5B 4PNOA 1OZ3A 1TS9A 3MJXA 2BTTA 2HCKA 2EPDA 1Z9QA 1EZZB 3C4SA 4J9DA 1VQKQ 2L0AA 5GAOp 2KE9A 3X28B 5IXFA 4IUTA 2RI3A 4B6MA 2KRNA 2KR3A 2KYMA 4XU1A 2OI3A 1G8XA 4JJBA 5D6XA 4NL3A 2YSQA 3SDZA 2FPEA 2K5FA 2FL7A 2ENMA 1IRXA 2RQRA 2V1QA 3VS7A 3JAME 4LDYA 4C8QE 4EMKC 3M0UA
chains in the Genus database with same CATH topology
5FW9A 2LCSA 1GFCA 1UG1A 2LZ6B 2VVKA 3VS4A 4K11A 2G6FX 2DA9A 2DNUA 3PVQA 3TSZA 2F2WA 1ZLMA 2VKNA 4LUEA 1Y0MA 2E5KA 2KT1A 2YT6A 1JO8A 2DRKA 3M0PA 2DJQA 4LNPA 1N5ZA 1GL5A 3GBQA 3VS0A 2KNBB 1UJYA 4JPBW 2K2MA 1RLQC 2FO0A 4ORZA 2YUQA 1PNJA 1WXUA 1FYNA 1T3LA 5I22A 2ESWA 2KROA 1W6XA 1OV3A 2CDTA 1NLPC 3UA7A 1RLPC 5GJVB 2LJ1A 4JZ3A 1YWPA 5IHNA 1U5SA 3FJ5A 2F2VA 1TG0A 2JM8A 3I9QA 1WLPB 2FPFA 5IXBA 2EYZA 1UTIA 2J6OA 1M3AA 2KT8A 3VS3A 4A63B 2K6DA 2ROTA 2RQVA 4IIMA 3I5SA 2GBQA 2J6KA 5IHKA 2J05A 1Y57A 2O31A 4Z89A 3VRYA 2K79A 2A37A 2DM1A 1PRLC 1KFZA 2P4RA 3UA6A 4AFQC 2A36A 1BB9A 1X27A 4J9EA 4QT7A 1OEBA 3TVTA 2D8HA 4RTVA 4F14A 1T3SA 2PTKA 2JMCA 1BBZA 1GCQC 1YCSB 2KXDA 2X3WD 3I5RA 4D8KA 2DF6A 1LCKA 2B86A 1PHTA 1S1NA 1WI7A 3EHQA 2ROLA 1M30A 1UDLA 2DE0X 1M3BA 1K9AA 2H8HA 5I11A 2BZ8A 1AWJA 3REBB 2L3SA 1K0SA 2SEMA 3JV3A 4OMNA 1U06A 1NYFA 1UFFA 2YUPA 2JXBA 2YUOA 1AZEA 3NGPA 1WDXA 2EVRA 1I1JA 1AWXA 2RQTA 1M8MA 2KRMA 4OMOA 2DX1A 2FRYA 1NEGA 5FWBA 4RTZA 1QCFA 2EGCA 1I07A 2EYWA 4J9HA 2KRSA 2RQUA 2A28A 4RTWA 3VS2A 4DEXA 2MIOA 2JT4A 1MV0B 2C0OA 3NMZC 4HXJA 1G83A 1H8KA 2RMOA 2FEIA 4IIOA 2DL8A 2DYBA 3VS1A 1IO6A 1UHCA 1ZSGA 1E6HA 1SRLA 4F17A 1WXTA 2EBPA 2CH4A 3NPFA 1QWEA 2EGAA 3VS6A 3M0RA 3VRZA 2L2PA 2DLPA 1VYVA 1NLOC 1K1ZA 1ABQA 1V1CA 1NEBA 1GBQA 1ZX6A 2SRCA 4M4ZA 1NG2A 2I0NA 3PE0A 1AEYA 2EYXA 1H92A 3EHRA 1AVZC 1Z9ZA 3THKA 2JS2A 3EGUA 3IQLA 2LX7A 1G2BA 1JXMA 4AFUC 1B07A 1CSKA 1QWFA 3SHWA 2HSPA 5IH2A 1WX6A 5HCKA 2DBMA 2BZXA 1UUEA 2W10A 1JU5C 3REAB 2AZSA 2F2XA 4J9BA 2LQNA 1K4US 2RPNA 3I35A 4ESRA 2L3PA 1YNZA 1ZUUA 5EC7A 2OAWA 3PVLA 1UE9A 2AKLA 4HVUA 2VWFA 3QWYA 2NUZA 1QKWA 1X2QA 1UECA 2AK5A 1JXOA 1KSWA 1OOTA 2GTOA 4HVWA 2GTJA 1UHFA 1SSHA 2EQIA 4AFSC 2GNCA 1NM7A 2LMJA 4ZNXA 1AOJA 1HJDA 4LUDA 1YN8A 2D1XA 1OPLA 5GJWB 2L3QA 2X3XD 4J9GA 1KJWA 2CT4A 2W0ZA 2ABLA 3KFVA 4J9IA 1AD5A 4OMLA 2DL3A 2EYYA 4D8DA 3EG0A 1K0XA 2ED0A 2PZ1A 2JS0A 1KIKA 2AZVA 2CREA 1K76A 1PKTA 1J3TA 1GCPA 2DBKA 1X6BA 4HCKA 4RTYA 1VYTA 1M27C 4WCIA 1NYGA 4F16A 4JJCA 2CH4W 1GFDA 1E6GA 3H0FA 5ECAA 2DRMA 3C0CA 4RUGA 1BK2A 1HSQA 1AWWA 3O5ZA 4RTTA 3NHNA 1PRMC 1HD3A 4DEYA 4R0KA 4RTUA 2JW4A 2LJ0A 3H41A 3R6NA 4OMQA 3UF4A 2O9SA 1B3QA 3QWXX 2HBWA 1OPKA 1WIEA 5FWCA 3VS5A 1AZGB 4X1VA 4Z8AA 1MV3A 1FMKA 2KGTA 2D8JA 4E6RA 3TSWA 1GRIA 2QDLA 1XOVA 1PWTA 2CUBA 4CC2A 1SPKA 1T0JA 1CKBA 1WXBA 3EG1A 2RNAA 1ARKA 2BZYA 4KRTA 2YDLA 2MOXA 2OJ2A 3CQTA 1WFWA 2LQWA 1RUWA 2GQIA 1RI9A 1ZBJA 1ZUKA 2C0TA 1UGVA 1PKSA 1X6GA 1GCQA 4LN2A 2HEQA 1MUZA 2KEAA 2PNIA 4AG2C 2D0NA 4CC7A 2LJ3A 2CT3A 2EKHA 4HVVA 1GBRA 3U23A 3M0SA 4FSSA 3ULRB 2XMFA 3EG3A 1SRMA 2CUDA 2HDAA 1E7OA 2RF0A 2JMAA 2EW3A 1QLYA 4JJDA 3UATA 2CSQA 2K9GA 4AG1C 1QKXA 2KBTA 4JZ4A 1YP5A 2RN8A 1SHFA 2O88A 1VYUA 2GGRA 2M51A 3M0TA 2JM9A 2KYBA 2J06A 1X43A 2FG0A 2ED1A 2RQWA 1JEGA 2A08A 2LNHB 1X69A 2O2OA 3A98A 1X2KA 2DL5A 5IHIA 1SEMA 2YUNA 2C0IA 1WA7A 2FRWA 1BU1A 2JTEA 1ZUYA 3RNJA 2J6FA 1M3CA 4CC3A 3SEMA 4AFZC 2K7AA 2K3BA 2NWMA 4RTXA 4J9FA 2AKKA 1JQQA 4GBQA 3ZL7C 2EGEA 2J7IA 4Z88A 1W70A 5L23A 3LH5A 2DILA 1YWOA 1U3OA 2V1RA 3M0QA 2FPDA 2DMOA 2LP5A 4Y92A 1EFNA 2CSIA 1TUDA 3EG2A 2BTTA 2HCKA 1W1FA 2EPDA 1Z9QA 1CKAA 2M0YA 2DL7A 4J9DA 2KXCA 2MCNA 2DVJA 2L0AA 1ABOA 4CC4B 3H0HA 2KE9A 4EIKA 5IXFA 1H3HA 4GLMA 4LE9A 1A0NB 1UJ0A 1I0CA 2KRNA 4OMPA 3H0IA 1WYXA 2KR3A 2KYMA 2OI3A 4JJBA 3RBBB 2YSQA 2IIMA 2FPEA 4J9CA 1SHGA 2O9VA 2DL4A 1T0HA 2ECZA 2ENMA 1AWOA 2RQRA 2V1QA 3VS7A 3M0UA 1VA7A 1TUCA 4OMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FW9 A;  2LCS A;  1GFC A;  1UG1 A;  2LZ6 B;  2VVK A;  3VS4 A;  4K11 A;  2G6F X;  2DA9 A;  2DNU A;  3PVQ A;  3TSZ A;  2F2W A;  1ZLM A;  2VKN A;  4LUE A;  1Y0M A;  2E5K A;  2KT1 A;  2YT6 A;  1JO8 A;  2DRK A;  3M0P A;  2DJQ A;  4LNP A;  1N5Z A;  1GL5 A;  3GBQ A;  3VS0 A;  2KNB B;  1UJY A;  4JPB W;  2K2M A;  1RLQ C;  2FO0 A;  4ORZ A;  2YUQ A;  1PNJ A;  1WXU A;  1FYN A;  1T3L A;  5I22 A;  2ESW A;  2KRO A;  1W6X A;  1OV3 A;  2CDT A;  1NLP C;  3UA7 A;  1RLP C;  5GJV B;  2LJ1 A;  4JZ3 A;  1YWP A;  5IHN A;  1U5S A;  3FJ5 A;  2F2V A;  1TG0 A;  2JM8 A;  3I9Q A;  1WLP B;  2FPF A;  5IXB A;  2EYZ A;  1UTI A;  2J6O A;  1M3A A;  2KT8 A;  3VS3 A;  4A63 B;  2K6D A;  2ROT A;  2RQV A;  4IIM A;  3I5S A;  2GBQ A;  2J6K A;  5IHK A;  2J05 A;  1Y57 A;  2O31 A;  4Z89 A;  3VRY A;  2K79 A;  2A37 A;  2DM1 A;  1PRL C;  1KFZ A;  2P4R A;  3UA6 A;  4AFQ C;  2A36 A;  1BB9 A;  1X27 A;  4J9E A;  4QT7 A;  1OEB A;  3TVT A;  2D8H A;  4RTV A;  4F14 A;  1T3S A;  2PTK A;  2JMC A;  1BBZ A;  1GCQ C;  1YCS B;  2KXD A;  2X3W D;  3I5R A;  4D8K A;  2DF6 A;  1LCK A;  2B86 A;  1PHT A;  1S1N A;  1WI7 A;  3EHQ A;  2ROL A;  1M30 A;  1UDL A;  2DE0 X;  1M3B A;  1K9A A;  2H8H A;  5I11 A;  2BZ8 A;  1AWJ A;  3REB B;  2L3S A;  1K0S A;  2SEM A;  3JV3 A;  4OMN A;  1U06 A;  1NYF A;  1UFF A;  2YUP A;  2JXB A;  2YUO A;  1AZE A;  3NGP A;  1WDX A;  2EVR A;  1I1J A;  1AWX A;  2RQT A;  1M8M A;  2KRM A;  4OMO A;  2DX1 A;  2FRY A;  1NEG A;  5FWB A;  4RTZ A;  1QCF A;  2EGC A;  1I07 A;  2EYW A;  4J9H A;  2KRS A;  2RQU A;  2A28 A;  4RTW A;  3VS2 A;  4DEX A;  2MIO A;  2JT4 A;  1MV0 B;  2C0O A;  3NMZ C;  4HXJ A;  1G83 A;  1H8K A;  2RMO A;  2FEI A;  4IIO A;  2DL8 A;  2DYB A;  3VS1 A;  1IO6 A;  1UHC A;  1ZSG A;  1E6H A;  1SRL A;  4F17 A;  1WXT A;  2EBP A;  2CH4 A;  3NPF A;  1QWE A;  2EGA A;  3VS6 A;  3M0R A;  3VRZ A;  2L2P A;  2DLP A;  1VYV A;  1NLO C;  1K1Z A;  1ABQ A;  1V1C A;  1NEB A;  1GBQ A;  1ZX6 A;  2SRC A;  4M4Z A;  1NG2 A;  2I0N A;  3PE0 A;  1AEY A;  2EYX A;  1H92 A;  3EHR A;  1AVZ C;  1Z9Z A;  3THK A;  2JS2 A;  3EGU A;  3IQL A;  2LX7 A;  1G2B A;  1JXM A;  4AFU C;  1B07 A;  1CSK A;  1QWF A;  3SHW A;  2HSP A;  5IH2 A;  1WX6 A;  5HCK A;  2DBM A;  2BZX A;  1UUE A;  2W10 A;  1JU5 C;  3REA B;  2AZS A;  2F2X A;  4J9B A;  2LQN A;  1K4U S;  2RPN A;  3I35 A;  4ESR A;  2L3P A;  1YNZ A;  1ZUU A;  5EC7 A;  2OAW A;  3PVL A;  1UE9 A;  2AKL A;  4HVU A;  2VWF A;  3QWY A;  2NUZ A;  1QKW A;  1X2Q A;  1UEC A;  2AK5 A;  1JXO A;  1KSW A;  1OOT A;  2GTO A;  4HVW A;  2GTJ A;  1UHF A;  1SSH A;  2EQI A;  4AFS C;  2GNC A;  1NM7 A;  2LMJ A;  4ZNX A;  1AOJ A;  1HJD A;  4LUD A;  1YN8 A;  2D1X A;  1OPL A;  5GJW B;  2L3Q A;  2X3X D;  4J9G A;  1KJW A;  2CT4 A;  2W0Z A;  2ABL A;  3KFV A;  4J9I A;  1AD5 A;  4OML A;  2DL3 A;  2EYY A;  4D8D A;  3EG0 A;  1K0X A;  2ED0 A;  2PZ1 A;  2JS0 A;  1KIK A;  2AZV A;  2CRE A;  1K76 A;  1PKT A;  1J3T A;  1GCP A;  2DBK A;  1X6B A;  4HCK A;  4RTY A;  1VYT A;  1M27 C;  4WCI A;  1NYG A;  4F16 A;  4JJC A;  2CH4 W;  1GFD A;  1E6G A;  3H0F A;  5ECA A;  2DRM A;  3C0C A;  4RUG A;  1BK2 A;  1HSQ A;  1AWW A;  3O5Z A;  4RTT A;  3NHN A;  1PRM C;  1HD3 A;  4DEY A;  4R0K A;  4RTU A;  2JW4 A;  2LJ0 A;  3H41 A;  3R6N A;  4OMQ A;  3UF4 A;  2O9S A;  1B3Q A;  3QWX X;  2HBW A;  1OPK A;  1WIE A;  5FWC A;  3VS5 A;  1AZG B;  4X1V A;  4Z8A A;  1MV3 A;  1FMK A;  2KGT A;  2D8J A;  4E6R A;  3TSW A;  1GRI A;  2QDL A;  1XOV A;  1PWT A;  2CUB A;  4CC2 A;  1SPK A;  1T0J A;  1CKB A;  1WXB A;  3EG1 A;  2RNA A;  1ARK A;  2BZY A;  4KRT A;  2YDL A;  2MOX A;  2OJ2 A;  3CQT A;  1WFW A;  2LQW A;  1RUW A;  2GQI A;  1RI9 A;  1ZBJ A;  1ZUK A;  2C0T A;  1UGV A;  1PKS A;  1X6G A;  1GCQ A;  4LN2 A;  2HEQ A;  1MUZ A;  2KEA A;  2PNI A;  4AG2 C;  2D0N A;  4CC7 A;  2LJ3 A;  2CT3 A;  2EKH A;  4HVV A;  1GBR A;  3U23 A;  3M0S A;  4FSS A;  3ULR B;  2XMF A;  3EG3 A;  1SRM A;  2CUD A;  2HDA A;  1E7O A;  2RF0 A;  2JMA A;  2EW3 A;  1QLY A;  4JJD A;  3UAT A;  2CSQ A;  2K9G A;  4AG1 C;  1QKX A;  2KBT A;  4JZ4 A;  1YP5 A;  2RN8 A;  1SHF A;  2O88 A;  1VYU A;  2GGR A;  2M51 A;  3M0T A;  2JM9 A;  2KYB A;  2J06 A;  1X43 A;  2FG0 A;  2ED1 A;  2RQW A;  1JEG A;  2A08 A;  2LNH B;  1X69 A;  2O2O A;  3A98 A;  1X2K A;  2DL5 A;  5IHI A;  1SEM A;  2YUN A;  2C0I A;  1WA7 A;  2FRW A;  1BU1 A;  2JTE A;  1ZUY A;  3RNJ A;  2J6F A;  1M3C A;  4CC3 A;  3SEM A;  4AFZ C;  2K7A A;  2K3B A;  2NWM A;  4RTX A;  4J9F A;  2AKK A;  1JQQ A;  4GBQ A;  3ZL7 C;  2EGE A;  2J7I A;  4Z88 A;  1W70 A;  5L23 A;  3LH5 A;  2DIL A;  1YWO A;  1U3O A;  2V1R A;  3M0Q A;  2FPD A;  2DMO A;  2LP5 A;  4Y92 A;  1EFN A;  2CSI A;  1TUD A;  3EG2 A;  2BTT A;  2HCK A;  1W1F A;  2EPD A;  1Z9Q A;  1CKA A;  2M0Y A;  2DL7 A;  4J9D A;  2KXC A;  2MCN A;  2DVJ A;  2L0A A;  1ABO A;  4CC4 B;  3H0H A;  2KE9 A;  4EIK A;  5IXF A;  1H3H A;  4GLM A;  4LE9 A;  1A0N B;  1UJ0 A;  1I0C A;  2KRN A;  4OMP A;  3H0I A;  1WYX A;  2KR3 A;  2KYM A;  2OI3 A;  4JJB A;  3RBB B;  2YSQ A;  2IIM A;  2FPE A;  4J9C A;  1SHG A;  2O9V A;  2DL4 A;  1T0H A;  2ECZ A;  2ENM A;  1AWO A;  2RQR A;  2V1Q A;  3VS7 A;  3M0U A;  1VA7 A;  1TUC A;  4OMM A; 
#chains in the Genus database with same CATH topology
 5GAO m;  4V2S A;  4BY6 C;  5GAN f;  2DK3 A;  4NL2 A;  3URG A;  3JCM h;  4A4F A;  2HKN A;  3V7C A;  4PJO F;  2VKN A;  1I5L A;  1Y0M A;  5GMK i;  2KT1 A;  1XJW B;  2E3I A;  3LH0 A;  2DJQ A;  1RAI B;  1UJY A;  9ATC B;  2PVG B;  2ZPF B;  5CKB A;  2K2M A;  1U8R A;  2R5M A;  4M77 A;  3M58 A;  1WXU A;  4BE0 A;  2L8D A;  2YRC A;  5I22 A;  2ESW A;  2CDT A;  2KRO A;  2QQB A;  3UA7 A;  1RLP C;  4TVR A;  5GJV B;  3CMA Q;  3OYG A;  2BKD N;  3OYH A;  1U5S A;  1WLP B;  2OTL Q;  3CCE Q;  1P92 A;  3OYJ A;  2BIV A;  2J6O A;  1M3A A;  2NUP A;  3SFM A;  3JB9 H;  2LTO A;  2KVQ G;  3OW2 A;  2J6K A;  5IN1 A;  2DZC A;  1VQ8 A;  1G5V A;  1UB4 A;  4F7U E;  1BKB A;  2K79 A;  2LVM A;  2P4R A;  4KGV B;  3EFO B;  5GAN 2;  1IZ6 A;  2MWO A;  4IUV A;  3JCM W;  1BB9 A;  2AHJ B;  3FRN A;  4J9E A;  4QT7 A;  1FWZ A;  3CMA T;  3INZ A;  3N5B B;  1OX8 A;  1K73 R;  1K73 C;  2RHI A;  4A4E A;  2L89 A;  2DF6 A;  2QDY B;  4LDW A;  2B86 A;  1PHT A;  1U1S A;  5I11 A;  2BZ8 A;  3L42 A;  4AMC A;  3OW2 P;  3OB9 A;  4GY5 A;  1D0Z A;  2JTF A;  1WHH A;  3CC4 A;  1NYF A;  4M75 E;  5FU6 C;  2YUO A;  3NGP A;  2HAX A;  1WDX A;  3CC2 T;  2RQT A;  3CCV A;  3OBY A;  3RUX A;  1N27 A;  1YFN A;  3CCM A;  1NEG A;  1JRI A;  4N4G A;  2ZPB B;  4XTZ A;  2JUF A;  4JJN K;  3CC7 Q;  1EIF A;  4QW2 A;  3E9F A;  4WTO B;  3A8L B;  2GF7 A;  3T9N A;  3NMZ C;  2DAQ A;  3M5A A;  1M1K U;  4C5G A;  4OB2 B;  2FEI A;  1WJS A;  2DVE A;  2DYB A;  1IO6 A;  2K3Y A;  1E6H A;  3G1J A;  1PD1 A;  2HSE B;  3MET A;  2RD1 A;  1G3T A;  4C92 F;  2DXU A;  2E70 A;  5KYW A;  2VAS A;  1JJ2 S;  2KI7 A;  4P5N A;  4XQ3 A;  3WXM B;  3QPH A;  4EPC A;  3CC7 T;  4HA8 A;  2A0F B;  1GBQ A;  1ZX6 A;  4M4Z A;  1NG2 A;  1VQ4 Q;  4EMG A;  2EYX A;  4FL6 A;  2EYQ A;  4XTY A;  3CPW P;  3THK A;  3QG1 A;  2DJZ A;  1KC8 U;  1G2B A;  1JXM A;  4ELZ C;  5HY6 A;  5HCK A;  2DBM A;  2BZX A;  2YLB A;  1PSF A;  2XHC A;  4J6X A;  2AZS A;  2VGN A;  2WSF E;  1K4U S;  2A3L A;  3D7S B;  4ESR A;  3UWN A;  4CI0 C;  1YJN A;  5LJ5 h;  1KD1 R;  1KD1 C;  2K5I A;  3OYD A;  1NJI C;  1UE9 A;  5FLX E;  2X4Y A;  2NUZ A;  2A7Y A;  1X2Q A;  4XAX B;  2DTO A;  3RDV A;  4OB0 B;  2QA4 A;  3LWI A;  4XTV A;  5GAN 6;  1IB8 A;  5LJ3 h;  2DO3 A;  2HL3 A;  3VKI A;  1UHF A;  3RER A;  2VC8 A;  4M78 G;  4M7A F;  4AFS C;  3QYG B;  2GNC A;  1VUB A;  5CKD A;  4LUD A;  2WSE E;  1OPL A;  5CIU A;  3L1A A;  1AT1 B;  2X3X D;  2CT4 A;  2W0Z A;  2CZ0 B;  1MNE A;  2GCX A;  3RES A;  3X20 B;  1VQ5 A;  1Y71 A;  4J9I A;  1YI2 Q;  3JCM b;  2X4X A;  3ASK A;  5GAM g;  2DL3 A;  3GOX A;  3V7S A;  1W2B S;  2ED0 A;  3HFO A;  1VQ9 Q;  4LD9 K;  1YHQ T;  2AZV A;  5IT9 E;  1VQ7 Q;  1YCY A;  3RR6 A;  1GFD A;  3FIF A;  4JJC A;  2DXC A;  3TRE A;  4C0D B;  2KMT A;  4C0F A;  2XKO C;  4RUG A;  1TXQ A;  2CP6 A;  2DXT A;  3O5Z A;  3J80 E;  3CCV T;  3OMG A;  2HZY A;  1NBE B;  4DEY A;  4R0K A;  1OQK A;  3R6N A;  2RJD A;  3UF4 A;  4HT9 A;  2PUK B;  4Y91 A;  3EH2 A;  1OPK A;  4QQD A;  4OB1 B;  3V7R A;  3P8D A;  4D6W A;  1RI0 A;  3FLG A;  3J81 E;  1D0Y A;  4E6R A;  3CCS Q;  3CCJ Q;  3QZ5 B;  4GLK A;  3CCR A;  4CC2 A;  2RA2 A;  2FZK B;  1CKB A;  1TH7 A;  3EG1 A;  1YBY A;  2CZ1 B;  1ARK A;  1I81 A;  3LLR A;  4KRT A;  2YDL A;  5GMK e;  4ZGJ B;  2YWW A;  4M7D E;  4FT4 A;  3EH1 A;  4IUU A;  2RHZ A;  2HEQ A;  3BDU A;  1YJW A;  4AG2 C;  3PIP A;  3JB9 J;  1FX7 A;  5J39 A;  3DLL A;  1JB0 E;  4HVV A;  1GBR A;  4RMO A;  4FSS A;  2XMF A;  3EG3 A;  1BCM A;  2DPP B;  2Y90 A;  5A0G A;  1ZBX A;  1E7O A;  4PLL A;  1VQP A;  5FU7 B;  3OYF A;  2V26 A;  2JMA A;  1QLY A;  5I2M A;  1Q82 R;  4PJO A;  2KBT A;  1FMV A;  1YP5 A;  2H3J A;  1Q82 C;  1SHF A;  2O88 A;  1VYU A;  2X51 A;  2M51 A;  3CCL Q;  4EMH A;  3C95 A;  2J06 A;  2O4X B;  2RQW A;  1MMD A;  1TOV A;  2FVU A;  1X69 A;  3G71 A;  1TU0 B;  3I55 T;  1SG5 A;  2O2O A;  2JZ2 A;  1X2K A;  3EG9 A;  4LDU A;  3H8Z A;  1SEM A;  1WA7 A;  3M4Y A;  2P84 A;  3OSV A;  4EMK B;  2JVV A;  2ZPH B;  2VYT A;  1KQS A;  3TEE A;  4ANJ A;  1K73 U;  1D1B A;  2BE7 D;  1D1A A;  3O8V A;  4YTL A;  1JQQ A;  2KAF A;  4M78 B;  4F7U G;  2D0Q B;  3CCU A;  2MAM A;  5L23 A;  3EAE A;  3MCA B;  5GAM j;  1YWO A;  1U3O A;  5GAN g;  4DOV A;  2X4J A;  2DMO A;  2LP5 A;  2Y4Y A;  1VQM A;  3EG2 A;  3L2R A;  1X75 C;  3BW1 A;  3QYH B;  2M0Y A;  1CKA A;  2DL7 A;  4E7I A;  5D7U A;  3CD6 Q;  4DBQ A;  1H3H A;  4LE9 A;  4XU0 A;  4OP0 A;  4M7D C;  1I0C A;  3JCM c;  4JS5 A;  1WYX A;  5A0L A;  2YRV A;  3RBB B;  2OTJ T;  5DLQ E;  4O5V A;  4PJN A;  5CR2 A;  3MEA A;  2O9V A;  3CME A;  2ECZ A;  5FRM A;  2QGF B;  4M77 E;  3G6E Q;  4KUI A;  3M4G A;  1LPL A;  2QEX Q;  5FW9 A;  2LCS A;  1VQN A;  1YIJ T;  4MML A;  2LZ6 B;  3CBO A;  3HPW A;  4K11 A;  4PJL A;  5GAM e;  4X9C A;  2DA9 A;  3PVQ A;  4JLG A;  3TSZ A;  2AT1 B;  4LUE A;  4BI4 A;  4BUG A;  1YIT Q;  2C06 A;  1QP2 A;  3OBW A;  1JO8 A;  3NTH A;  3CCR T;  1D3B B;  3JB9 I;  2MI6 A;  2KNB B;  3A8O B;  2LCL A;  2X9H A;  4PKC C;  2WSC E;  4ME7 A;  1QCO A;  2XI9 A;  1OX9 A;  3VV0 A;  1LJO A;  1FYN A;  1VQ6 Q;  2M16 A;  4FU6 A;  4J7F A;  1D1C A;  1OV3 A;  2DFU A;  4PJO D;  1NLP C;  1S72 Q;  4BE2 A;  5EG2 A;  2CP7 A;  1VQL Q;  3G4S Q;  3FJ5 A;  2F1L A;  4C92 A;  3I9Q A;  2FPF A;  3QJ6 A;  4N4I A;  2JN0 A;  4QQG A;  1UTI A;  2KT8 A;  4E7L A;  2K6D A;  1BI2 A;  1VQP T;  2XK0 A;  3C12 A;  4UC4 A;  4II1 A;  1Y57 A;  4MZM A;  4Z89 A;  3OYE A;  2DD5 A;  3UA6 A;  4AFQ C;  2A36 A;  3HSB A;  1VQ6 T;  1X27 A;  4ZGD B;  1OEB A;  3TVT A;  2D8H A;  4F14 A;  3OYY A;  3J7A F;  3QHS A;  1VQO T;  1GXI E;  1VQL T;  1GCQ C;  2HQH A;  5CAI A;  3X26 B;  3I5R A;  4D8K A;  3FC3 A;  1LCK A;  2IG0 A;  3NTK A;  1IHW A;  3CCE A;  5GAN j;  1S1N A;  2ZPE B;  1N6A A;  1WI7 A;  3EHQ A;  3TQ7 P;  2DE0 X;  2H8H A;  2ZPI B;  5KYU B;  1AWJ A;  2HL5 C;  4FYY B;  3HRT A;  2SEM A;  1B7T A;  4BDY A;  5FU7 C;  4JLI A;  2HBP A;  4F7U B;  2HQE A;  5DLO A;  2JXB A;  1MHN A;  2EAY A;  2EVR A;  1WNL A;  4M7A A;  4NS5 A;  1QVF S;  2KRM A;  2FRY A;  2E64 A;  2EQJ A;  1B34 A;  3JCM V;  5GAO l;  4X34 A;  4ELY C;  4RTW A;  3JB9 G;  1MV0 B;  1H8K A;  2RMO A;  2RJE A;  3UPU A;  3F70 A;  3JCM f;  3VS1 A;  4M78 C;  4PFP A;  5GAN e;  1SRL A;  4ZGE B;  4F17 A;  1WXT A;  3QDR B;  2FZG B;  5CKE A;  4A4K A;  1UEB A;  3VRZ A;  2QTX A;  1YJ9 A;  2PUO B;  4JUV A;  3I56 A;  1PSE A;  4HCC A;  4XTX A;  1IHV A;  4FW2 A;  1C0M A;  3M59 A;  2R58 A;  2FYK A;  3CBP A;  3A8M B;  1WJQ A;  2NLU A;  3ME9 A;  1K8A R;  1B07 A;  4C92 D;  3M57 A;  1K8A C;  2HSP A;  5IH2 A;  4JRP A;  1UUE A;  4XU3 A;  4M7D G;  2F2X A;  3MPU B;  1ZUU A;  4OMF B;  4B9W A;  3GIB A;  5EC7 A;  2JJ9 A;  2P0Q A;  2VWF A;  4DBR A;  1QKW A;  5KYX A;  1Q7Y U;  2AK5 A;  1JXO A;  3OSS C;  1D09 B;  3RKY A;  4XU2 A;  1VQ4 A;  4BE1 A;  1OOT A;  2GTO A;  4C5E A;  4FW1 A;  1WHJ A;  3CC2 Q;  3X24 B;  1NM7 A;  4OGE A;  2RH2 A;  3PFS A;  4EMK A;  1W4S A;  2ABL A;  3SWN B;  1BCO A;  4ZN3 A;  1N8R U;  4C8Q C;  4JRK A;  3S6W A;  2MPX C;  4IUQ A;  3VYH B;  3CCQ T;  3EG0 A;  1K0X A;  1HYO A;  4M7A D;  2D9T A;  5HK3 A;  2JS0 A;  1M8V A;  1KIK A;  4MZP A;  2XU8 A;  3GNG A;  4HCK A;  4DBF A;  1VYT A;  3JB9 F;  1M27 C;  2DTH A;  1QVG S;  2NYS A;  1QVP A;  4WCI A;  2CH4 W;  2QQA A;  1E6G A;  5ECA A;  2DRM A;  4ZTJ A;  3C0C A;  1QMC A;  1TWB A;  3NHN A;  1V76 A;  1PRM C;  3CPW A;  1ZA1 B;  2JW4 A;  2RJC A;  2LJ0 A;  3GF5 A;  4OMQ A;  1WQ7 A;  2QI2 A;  2RHX A;  1H3Z A;  1M1G A;  1F1B B;  3VS5 A;  1IGQ A;  3QII A;  1AZG B;  2E4H A;  1FMK A;  1VQ9 A;  1EX4 A;  3PNW C;  5CK9 A;  3SB2 A;  2GQV A;  3QBY A;  2CS7 A;  1WPY A;  2MMP A;  5GAM d;  4J7I A;  1SPK A;  1NE8 A;  1M90 C;  4PJO E;  3EGX A;  2RNA A;  2EJ9 A;  2BZY A;  3FJP A;  2MOX A;  2XDB A;  2MF2 A;  2LQW A;  2JOY A;  4M77 G;  2NUT B;  2VXF A;  1UGV A;  3CPF A;  1YJ9 T;  3I56 T;  4M7D F;  2GFU A;  4KH1 B;  2EKO A;  1X6O A;  2DZ9 A;  4CC7 A;  4C5H A;  5AYF A;  3FDR A;  5GMK l;  3M0S A;  1FXX A;  3WVD B;  3MO8 A;  3OS2 A;  2RK1 A;  3CCJ A;  2HDA A;  5LJ5 f;  3CXC S;  2G3R A;  1NJI R;  2O01 E;  3V8J A;  1G3S A;  2B8A A;  1ZA2 B;  5GMK m;  4AG1 C;  1QKX A;  1RAC B;  2GGR A;  4J6Y A;  5LJ3 f;  3M54 A;  4LDV A;  4M75 C;  4RG2 A;  1Q81 U;  2VB6 A;  1R0B G;  1X43 A;  4M7D B;  1YHQ Q;  1ZSZ B;  1Q86 U;  1BIB A;  1LNX A;  2EQM A;  2LT1 A;  5GAO r;  3VU3 C;  1WJR A;  1VQ8 T;  3EGD B;  2C0I A;  3QKJ A;  2JTE A;  2J6F A;  1JBM A;  1OYX A;  5KYY B;  2E12 A;  4AFZ C;  2K57 A;  4KT0 E;  2FZC B;  4M78 D;  3CCV Q;  3ZL7 C;  3L2U A;  3RMS A;  2XID A;  3GPL A;  3TU4 K;  2DER A;  2I2L A;  3LH5 A;  4N0A C;  2DIL A;  3CCL A;  5GMK j;  2FPD A;  1EFN A;  2VXE A;  4A53 A;  4BI3 A;  2CSI A;  1TUD A;  1HK9 A;  3LWH A;  4PFO A;  1BI0 A;  1W1F A;  3CC4 T;  1I5O B;  3HFN A;  3M56 A;  3M55 A;  2KXC A;  2CZ6 B;  2DVJ A;  4DBH A;  1ABO A;  3ZFJ A;  4DA4 A;  4CC4 B;  1M4Z A;  2LT4 A;  3L2Q A;  3OS0 A;  2KSS A;  2EJF A;  4GLM A;  3CCM T;  1BYM A;  1UJ0 A;  4OMP A;  3H0I A;  2ZZD A;  4J9C A;  1D0X A;  1SHG A;  3LGL A;  1AWO A;  3E19 A;  2OX7 A;  1RAH B;  1TUC A;  3JCM J;  4HKE A;  3SWN C;  2YXY A;  4FM4 B;  5GAN d;  2VVK A;  3VS4 A;  2G6F X;  2E3H A;  4FCY A;  4R55 A;  2F2W A;  4C92 E;  1ZLM A;  4C8Q G;  3CD6 A;  4L6V 5;  2DRK A;  1Q95 G;  2LQK A;  3M0P A;  5GAN 7;  1PM3 A;  4LNP A;  4QVZ A;  1FMW A;  1NPP A;  1GL5 A;  3VS0 A;  3I55 Q;  5CKH A;  4OB3 B;  5GMK h;  1C1A A;  1VIF A;  1XNI A;  3RKW A;  1Y96 B;  2YUQ A;  1PNJ A;  4M77 B;  1XTD A;  1BIA A;  4WF2 A;  3L2V A;  2LCC A;  1M5Q 1;  3HL8 A;  3OMC A;  1W6X A;  2E6N A;  2K5L A;  1K8A U;  2E41 A;  2LJ1 A;  2FB7 A;  3OQ5 A;  2CYZ B;  4M78 F;  2CP5 A;  2F2V A;  1TG0 A;  1I8F A;  2EYZ A;  3QZ9 B;  4MZT A;  5DM7 R;  3PTA A;  3JCM X;  3OW2 S;  3VS3 A;  4A63 B;  1YJN T;  2ROT A;  2RQV A;  2DIG A;  3I5S A;  2KY9 A;  2IVW A;  2GBQ A;  3HTR A;  2ZGW A;  3VRY A;  2QA4 T;  4QKU A;  2PVD B;  3EFO A;  3UDC A;  4QVC A;  3CEY A;  2XDD A;  4M7A E;  4HCB A;  4MDX A;  1T3S A;  1SF9 A;  2JMC A;  1UGP B;  3AHU A;  3G4S A;  2OTJ Q;  3DB4 A;  1VQ5 T;  5D6W A;  1OUL A;  2ROL A;  3JCM g;  1M30 A;  1UDL A;  1M3B A;  1YIJ Q;  3REB B;  2IPO B;  2L3S A;  1K0S A;  1QW1 A;  4OMN A;  1U06 A;  5FRN A;  1M1F A;  2YUP A;  4JRQ A;  2CZ7 B;  3P8H A;  3MEU A;  5C6S A;  1AZE A;  1I1J A;  4FIB A;  1AWX A;  4FT2 A;  1M8M A;  4EDU A;  4C0G A;  3CCR Q;  4KBM B;  1ZSZ C;  3OY9 A;  1QCF A;  4M75 G;  2EGC A;  4LDX A;  4X9D A;  1MMG A;  2RQU A;  2A28 A;  4RG8 A;  2PQW A;  1C6V X;  1TSF A;  3VS2 A;  1M9S A;  2DYI A;  4DEX A;  2C0O A;  2YRD A;  2EWN A;  1G83 A;  3A5Z B;  1SKU B;  4C8Q F;  2QXF A;  3QDF A;  4E7J A;  4L59 A;  4B9X A;  1M1K R;  1BI1 A;  1M1K C;  1ZSG A;  3VUB A;  1VQK A;  4HCZ A;  1YJW Q;  1N9R A;  3GNF B;  2CH4 A;  1IXD A;  1QQJ A;  1OU8 A;  1G3W A;  2K2V A;  2ZAE A;  3VS6 A;  5GAM h;  2DLP A;  1VYV A;  1K1Z A;  1VQP Q;  2X35 A;  4FYX B;  2L3R A;  1IGU A;  4MDW A;  1NEB A;  3LGF A;  2SRC A;  1RAA B;  3PE0 A;  1AEY A;  4C8Q B;  1H92 A;  3EHR A;  1Z9Z A;  4Z02 A;  3G71 Q;  1VQO Q;  3TCJ A;  3EGU A;  3IQL A;  4PJO G;  2CP0 A;  2LX7 A;  4AFU C;  1YJW T;  1QWF A;  3SHW A;  1KC8 R;  1KC8 C;  2W10 A;  2PVO B;  1JU5 C;  3REA B;  1KD1 U;  4J9B A;  1NJI U;  2LQN A;  3JRZ A;  5C0M A;  3I35 A;  2RI5 A;  4E7S A;  1WHG A;  1YNZ A;  4FYV B;  2OAW A;  1H64 1;  1WGS A;  2AKL A;  4HVU A;  1RAB B;  3QWY A;  2DKG A;  1UEC A;  1JJ2 P;  8AT1 B;  1KSW A;  2DTI A;  4F7U F;  2GTJ A;  4M7D A;  3G71 T;  2RM4 A;  2JNG A;  2QAS A;  2P4T A;  4L5G A;  5GAN 5;  3CMA A;  3JCM Q;  3JSC A;  2LMJ A;  4XTW A;  1AOJ A;  4RCC A;  2D1X A;  3H6Z A;  2OTL A;  5GJW B;  2L3Q A;  4J9G A;  5LL6 S;  1ZHI A;  1ACM B;  2F5K A;  1KK7 A;  4M77 C;  1OZ2 A;  1UGS B;  3CCU T;  2Z0W A;  4VUB A;  4OML A;  4D8D A;  2K3X A;  4J5Y A;  1PC0 A;  5J3B A;  3CME Q;  4M75 F;  1WHK A;  5I2S A;  1W2B A;  1J3T A;  2LRQ A;  4RTY A;  1VQM T;  1VQN Q;  2HMA A;  2QG9 B;  3OYM A;  5L8R E;  2QAZ A;  2JTM A;  1NYG A;  4KUL A;  3MP1 A;  2LDM A;  1R8O B;  3ZBD A;  1KG1 A;  3PT9 A;  1DJ7 B;  1RAE B;  3MEV A;  1HD3 A;  4ATO A;  4CRI A;  2V8I A;  4XTU A;  8ATC B;  3VJP A;  3OA6 A;  3PIO A;  1MGQ A;  3MP8 A;  5CKF A;  4F04 B;  2M0O A;  2O9S A;  1B3Q A;  1QCN A;  2HBW A;  3RKX A;  4M75 B;  1WIE A;  3M53 A;  5FWC A;  2MWP A;  5LJ5 g;  3H9N A;  3CME T;  3JB9 D;  3GLX A;  4Z8A A;  3JCM e;  3PMI A;  2MYS A;  2D8J A;  1W2B P;  1VQN T;  1XOV A;  1PWT A;  3A8G B;  4OGC A;  5LJ3 g;  5GAN h;  1T0J A;  1WXB A;  4OVA A;  3CC7 A;  1VQK T;  3CQT A;  4E47 A;  4AT1 B;  1MMA A;  1RUW A;  1RI9 A;  2LX9 A;  1ZBJ A;  3QUI A;  2C0T A;  3OYL A;  4Y28 E;  1PKS A;  1LVK A;  1GCQ A;  4C0Z A;  3WVE B;  1MUZ A;  2QYZ A;  4C92 G;  1BI3 A;  2KEA A;  1PCX A;  2D0N A;  3HRS A;  5CQX A;  2EKH A;  2QK0 A;  1Y96 A;  5KE3 A;  3M9Q A;  1SRM A;  2CUD A;  1Q82 U;  2WAC A;  2RF0 A;  2EW3 A;  3UAT A;  4PJO B;  4JZ4 A;  2X4W A;  2RN8 A;  2QQS A;  5KE2 A;  4M7D D;  3CCQ Q;  2K4Y A;  3M0T A;  2KYB A;  3OYA A;  2O4X A;  1Y7X A;  2FG0 A;  2ED1 A;  2M02 A;  3A1P A;  2A08 A;  2LNH B;  5KYN A;  3HRU A;  3S3N A;  2RO0 A;  2EQK A;  4E7H A;  3EG9 B;  3E9G A;  1M2V B;  3BFM A;  2FRW A;  1BU1 A;  1KQS S;  2DET A;  1ZUY A;  3RNJ A;  1G3Y A;  1M3C A;  4CC3 A;  3SEM A;  4R56 A;  2NWM A;  3EFR A;  4RTX A;  4DQ2 A;  3UT1 A;  1UGQ B;  5KCH A;  2KK4 A;  4GBQ A;  3ER0 A;  5CQY A;  4M78 A;  2EGE A;  4PFZ A;  4Z88 A;  2E6Z A;  1N9S A;  2OTL T;  3CCE T;  2V1R A;  3M0Q A;  3KBG A;  2P0P A;  3HP9 A;  2LQ8 A;  4M7A G;  2HNI A;  4LXC A;  4J83 A;  4Y92 A;  1YHQ A;  3OYB A;  1WQW A;  2EFI A;  2F69 A;  4J8O A;  1I4K 1;  2RB6 A;  2M1H A;  2MCN A;  2E65 A;  3H0H A;  4EIK A;  3V8L A;  2YHT A;  1A0N B;  1YI2 A;  1IRE B;  1YJ9 Q;  3I56 Q;  3QJY A;  3L2Z A;  4PJM A;  2KQW A;  2CKK A;  2IIM A;  3BY7 A;  5LJ5 j;  5KH6 A;  2RHU A;  2DL4 A;  1T0H A;  1K9M R;  1K9M C;  3KXT A;  1VQ7 A;  1VA7 A;  4OMM A;  1GFC A;  1UG1 A;  2OAU A;  1M90 R;  2COY A;  1U1T A;  5LJ3 j;  2BUD A;  1WZO A;  2DNU A;  2LC4 A;  3DB3 A;  2E5K A;  2YT6 A;  4QQ6 A;  4BI8 B;  2VUB A;  3DKM A;  1N5Z A;  3GBQ A;  1D3B A;  5M9O A;  4PJJ A;  1VQ8 Q;  4JPB W;  4M77 D;  1RLQ C;  1MND A;  2FO0 A;  4BAC A;  4ORZ A;  3CBM A;  1T3L A;  4C8Q A;  3CCS A;  2RHY A;  2RI2 A;  2HKQ B;  4PLI A;  4JZ3 A;  5LJ5 e;  1YWP A;  1WHM A;  5IHN A;  2COZ A;  2CP3 A;  4C92 B;  2JM8 A;  1NPR A;  1NZ9 A;  5IXB A;  5GAN 8;  5LJ3 e;  4IIM A;  3I55 A;  1MMN A;  5IHK A;  2COW A;  2J05 A;  2E5Q A;  3PGG A;  2O31 A;  3CC4 Q;  2A37 A;  2DM1 A;  1PRL C;  1KFZ A;  1VQ4 T;  4DOW A;  2VGM A;  5A0D A;  3AT1 B;  5HK0 A;  4RTV A;  2YLC A;  2CP2 A;  4E7K A;  2PTK A;  2FHD A;  1X01 A;  2QGG A;  4IKF A;  3CCM Q;  1RAD B;  1BBZ A;  1PD0 A;  1YCS B;  2DD4 A;  2KXD A;  2X3W D;  4A54 A;  3ZEH A;  2R57 A;  3L2W A;  4JS4 A;  4LD6 A;  4Q5W A;  5A2Q E;  3C94 A;  1K9A A;  5KYU A;  3HHT B;  4FYW B;  3JV3 A;  4F7U A;  1UFF A;  4PJO C;  1OU9 A;  1O9S A;  4M7A B;  4OMO A;  2DX1 A;  5KCO A;  5FWB A;  4RTZ A;  1B34 B;  1QVF A;  2M9U A;  1I07 A;  1LOJ A;  2EYW A;  2OTJ A;  2VV5 A;  3NTI A;  4J9H A;  2KRS A;  5J26 A;  2XD0 A;  2MK5 A;  2MIO A;  2JT4 A;  4HXJ A;  5HKC A;  2LNV A;  4MMK A;  2D6F A;  1YI2 T;  4M77 F;  2QQR A;  1YIJ A;  4IIO A;  2GFA A;  2DL8 A;  3R6O A;  3JCM d;  1UHC A;  3OYK A;  4M75 A;  4KGZ B;  4FSX A;  1VQ9 T;  4IUP A;  2EBP A;  1SSF A;  3NPF A;  1QWE A;  2EGA A;  1VQ7 T;  3P8B B;  4BB7 A;  1RAF B;  1VOM A;  3M0R A;  2L2P A;  1YJN Q;  3LW5 E;  4ZTF A;  1NLO C;  4E2F B;  1ABQ A;  1V1C A;  1QVF P;  2P0K A;  2DEU A;  2QA4 Q;  3BDL A;  2I0N A;  4C8Q D;  5FRO A;  1KHI A;  3G6E A;  5GAN 4;  4PL6 A;  2QEX A;  1AVZ C;  5I21 A;  1KHC A;  1OI1 A;  2JS2 A;  4KH0 B;  2ATC B;  1CSK A;  4N0A A;  2HD0 A;  3FB9 A;  2EJG A;  1WX6 A;  2DXB A;  1TUG B;  3OYN A;  1YIT A;  2PU9 B;  2HQX A;  1Y07 A;  2NUP B;  5GAO q;  1VQ5 Q;  3CCS T;  3CCJ T;  2RPN A;  2DEQ A;  2L3P A;  3MHX A;  2L5Q A;  3PVL A;  3EFS A;  3VUZ A;  5KYX B;  2E10 A;  2QQ9 A;  2XG8 D;  4O6J A;  1Q7Y R;  1Q7Y C;  1VQ6 A;  4HVW A;  4N4H A;  3E1S A;  1SSH A;  1O75 A;  4RKU E;  4HT8 A;  2EQI A;  1S72 A;  1VQO A;  3QO3 A;  5DY9 A;  3SD4 A;  3OYI A;  1VQL A;  3MP6 A;  2EQU A;  4ZNX A;  1M2V A;  1HJD A;  5CCA A;  3OYC A;  1YN8 A;  4XK8 E;  2CGH A;  3DLM A;  3A8H B;  2AIR B;  1QP3 A;  1KJW A;  2ZCF B;  3SWN A;  3KFV A;  4BY6 B;  2KDS A;  5GAN 3;  1R0C B;  1AD5 A;  2ZPG B;  1N8R R;  1N8R C;  4ZN1 A;  3S3O A;  1AHJ B;  3CCL T;  2EYY A;  3OS1 A;  2BE9 B;  2PZ1 A;  4C92 C;  2V8J A;  1WHL A;  2CRE A;  1K76 A;  1PKT A;  1GCP A;  2DBK A;  1X6B A;  4F16 A;  3MKD A;  5D6Y A;  4J6W A;  3H0F A;  4BD3 A;  1QVG A;  3CPW S;  2EIF A;  3BE3 A;  1BK2 A;  1HSQ A;  1AWW A;  1KQS P;  4RTT A;  4C5I A;  3QSU A;  6AT1 B;  5GAO n;  4E7Z A;  4RTU A;  3H41 A;  4M75 D;  4RCB A;  3QWX X;  1K9M U;  4A4G A;  3V8K A;  4X1V A;  1MV3 A;  2KGT A;  3S3M A;  1ZQ1 A;  5KYW B;  4OF1 A;  1HXD A;  3TSW A;  1M90 U;  1V29 B;  4IUR A;  1GRI A;  2RK2 A;  2QDL A;  5GAM f;  2CUB A;  2V8K A;  3Q1J A;  3JCM P;  3RIR A;  3QXE B;  3EGX B;  1JJ2 A;  2E1H A;  1QVG P;  2OJ2 A;  1M2O A;  1WFW A;  3X25 B;  3CD6 T;  3PMT A;  5AT1 B;  2GQI A;  2NUT A;  1ZUK A;  1VIE A;  2F5T X;  1R77 A;  3G7Z A;  1X6G A;  1RAG B;  2H3E B;  4M7A C;  4A4H A;  4LN2 A;  2PNI A;  2RJF A;  2LJ3 A;  2CT3 A;  3G6E T;  4C0D C;  1RL2 A;  4JDS A;  3U23 A;  3ULR B;  2DIQ A;  2QEX T;  2R5A A;  3KUF A;  1XQH A;  4KGX B;  4QVD A;  5LJ5 d;  4M78 E;  1UGR B;  3GP8 A;  4JJD A;  5FU6 B;  2CSQ A;  3CXC A;  2K9G A;  3CCU Q;  3LX7 A;  3FEO A;  3OS5 A;  5IAY A;  1YIT T;  5LJ3 d;  2JM9 A;  2XDP A;  1JEG A;  1Q81 R;  1ZSZ A;  3MEW A;  1TTH B;  1Q81 C;  5CVI A;  4JRI A;  3A98 A;  1VQM Q;  2QTV A;  2DL5 A;  5IHI A;  4PK4 A;  1Q86 R;  1Q86 C;  2YUN A;  3EGD A;  1KQ1 A;  3VYG A;  5KYY A;  5CO7 A;  3RMQ A;  2K7A A;  4NOY A;  2K3B A;  3E2U A;  1S72 T;  4J9F A;  2AKK A;  2Y4X A;  3LYI A;  3G4S T;  3CXC P;  2J7I A;  1W70 A;  2XIC A;  3HKS A;  3NFC A;  3CCQ A;  1KQ2 A;  4BDZ A;  7AT1 B;  4KUD K;  3CC2 A;  1PG5 B;  4PNO A;  1OZ3 A;  1TS9 A;  3MJX A;  2BTT A;  2HCK A;  2EPD A;  1Z9Q A;  1EZZ B;  3C4S A;  4J9D A;  1VQK Q;  2L0A A;  5GAO p;  2KE9 A;  3X28 B;  5IXF A;  4IUT A;  2RI3 A;  4B6M A;  2KRN A;  2KR3 A;  2KYM A;  4XU1 A;  2OI3 A;  1G8X A;  4JJB A;  5D6X A;  4NL3 A;  2YSQ A;  3SDZ A;  2FPE A;  2K5F A;  2FL7 A;  2ENM A;  1IRX A;  2RQR A;  2V1Q A;  3VS7 A;  3JAM E;  4LDY A;  4C8Q E;  4EMK C;  3M0U A; 
#chains in the Genus database with same CATH homology
 5FW9 A;  2LCS A;  1GFC A;  1UG1 A;  2LZ6 B;  2VVK A;  3VS4 A;  4K11 A;  2G6F X;  2DA9 A;  2DNU A;  3PVQ A;  3TSZ A;  2F2W A;  1ZLM A;  2VKN A;  4LUE A;  1Y0M A;  2E5K A;  2KT1 A;  2YT6 A;  1JO8 A;  2DRK A;  3M0P A;  2DJQ A;  4LNP A;  1N5Z A;  1GL5 A;  3GBQ A;  3VS0 A;  2KNB B;  1UJY A;  4JPB W;  2K2M A;  1RLQ C;  2FO0 A;  4ORZ A;  2YUQ A;  1PNJ A;  1WXU A;  1FYN A;  1T3L A;  5I22 A;  2ESW A;  2KRO A;  1W6X A;  1OV3 A;  2CDT A;  1NLP C;  3UA7 A;  1RLP C;  5GJV B;  2LJ1 A;  4JZ3 A;  1YWP A;  5IHN A;  1U5S A;  3FJ5 A;  2F2V A;  1TG0 A;  2JM8 A;  3I9Q A;  1WLP B;  2FPF A;  5IXB A;  2EYZ A;  1UTI A;  2J6O A;  1M3A A;  2KT8 A;  3VS3 A;  4A63 B;  2K6D A;  2ROT A;  2RQV A;  4IIM A;  3I5S A;  2GBQ A;  2J6K A;  5IHK A;  2J05 A;  1Y57 A;  2O31 A;  4Z89 A;  3VRY A;  2K79 A;  2A37 A;  2DM1 A;  1PRL C;  1KFZ A;  2P4R A;  3UA6 A;  4AFQ C;  2A36 A;  1BB9 A;  1X27 A;  4J9E A;  4QT7 A;  1OEB A;  3TVT A;  2D8H A;  4RTV A;  4F14 A;  1T3S A;  2PTK A;  2JMC A;  1BBZ A;  1GCQ C;  1YCS B;  2KXD A;  2X3W D;  3I5R A;  4D8K A;  2DF6 A;  1LCK A;  2B86 A;  1PHT A;  1S1N A;  1WI7 A;  3EHQ A;  2ROL A;  1M30 A;  1UDL A;  2DE0 X;  1M3B A;  1K9A A;  2H8H A;  5I11 A;  2BZ8 A;  1AWJ A;  3REB B;  2L3S A;  1K0S A;  2SEM A;  3JV3 A;  4OMN A;  1U06 A;  1NYF A;  1UFF A;  2YUP A;  2JXB A;  2YUO A;  1AZE A;  3NGP A;  1WDX A;  2EVR A;  1I1J A;  1AWX A;  2RQT A;  1M8M A;  2KRM A;  4OMO A;  2DX1 A;  2FRY A;  1NEG A;  5FWB A;  4RTZ A;  1QCF A;  2EGC A;  1I07 A;  2EYW A;  4J9H A;  2KRS A;  2RQU A;  2A28 A;  4RTW A;  3VS2 A;  4DEX A;  2MIO A;  2JT4 A;  1MV0 B;  2C0O A;  3NMZ C;  4HXJ A;  1G83 A;  1H8K A;  2RMO A;  2FEI A;  4IIO A;  2DL8 A;  2DYB A;  3VS1 A;  1IO6 A;  1UHC A;  1ZSG A;  1E6H A;  1SRL A;  4F17 A;  1WXT A;  2EBP A;  2CH4 A;  3NPF A;  1QWE A;  2EGA A;  3VS6 A;  3M0R A;  3VRZ A;  2L2P A;  2DLP A;  1VYV A;  1NLO C;  1K1Z A;  1ABQ A;  1V1C A;  1NEB A;  1GBQ A;  1ZX6 A;  2SRC A;  4M4Z A;  1NG2 A;  2I0N A;  3PE0 A;  1AEY A;  2EYX A;  1H92 A;  3EHR A;  1AVZ C;  1Z9Z A;  3THK A;  2JS2 A;  3EGU A;  3IQL A;  2LX7 A;  1G2B A;  1JXM A;  4AFU C;  1B07 A;  1CSK A;  1QWF A;  3SHW A;  2HSP A;  5IH2 A;  1WX6 A;  5HCK A;  2DBM A;  2BZX A;  1UUE A;  2W10 A;  1JU5 C;  3REA B;  2AZS A;  2F2X A;  4J9B A;  2LQN A;  1K4U S;  2RPN A;  3I35 A;  4ESR A;  2L3P A;  1YNZ A;  1ZUU A;  5EC7 A;  2OAW A;  3PVL A;  1UE9 A;  2AKL A;  4HVU A;  2VWF A;  3QWY A;  2NUZ A;  1QKW A;  1X2Q A;  1UEC A;  2AK5 A;  1JXO A;  1KSW A;  1OOT A;  2GTO A;  4HVW A;  2GTJ A;  1UHF A;  1SSH A;  2EQI A;  4AFS C;  2GNC A;  1NM7 A;  2LMJ A;  4ZNX A;  1AOJ A;  1HJD A;  4LUD A;  1YN8 A;  2D1X A;  1OPL A;  5GJW B;  2L3Q A;  2X3X D;  4J9G A;  1KJW A;  2CT4 A;  2W0Z A;  2ABL A;  3KFV A;  4J9I A;  1AD5 A;  4OML A;  2DL3 A;  2EYY A;  4D8D A;  3EG0 A;  1K0X A;  2ED0 A;  2PZ1 A;  2JS0 A;  1KIK A;  2AZV A;  2CRE A;  1K76 A;  1PKT A;  1J3T A;  1GCP A;  2DBK A;  1X6B A;  4HCK A;  4RTY A;  1VYT A;  1M27 C;  4WCI A;  1NYG A;  4F16 A;  4JJC A;  2CH4 W;  1GFD A;  1E6G A;  3H0F A;  5ECA A;  2DRM A;  3C0C A;  4RUG A;  1BK2 A;  1HSQ A;  1AWW A;  3O5Z A;  4RTT A;  3NHN A;  1PRM C;  1HD3 A;  4DEY A;  4R0K A;  4RTU A;  2JW4 A;  2LJ0 A;  3H41 A;  3R6N A;  4OMQ A;  3UF4 A;  2O9S A;  1B3Q A;  3QWX X;  2HBW A;  1OPK A;  1WIE A;  5FWC A;  3VS5 A;  1AZG B;  4X1V A;  4Z8A A;  1MV3 A;  1FMK A;  2KGT A;  2D8J A;  4E6R A;  3TSW A;  1GRI A;  2QDL A;  1XOV A;  1PWT A;  2CUB A;  4CC2 A;  1SPK A;  1T0J A;  1CKB A;  1WXB A;  3EG1 A;  2RNA A;  1ARK A;  2BZY A;  4KRT A;  2YDL A;  2MOX A;  2OJ2 A;  3CQT A;  1WFW A;  2LQW A;  1RUW A;  2GQI A;  1RI9 A;  1ZBJ A;  1ZUK A;  2C0T A;  1UGV A;  1PKS A;  1X6G A;  1GCQ A;  4LN2 A;  2HEQ A;  1MUZ A;  2KEA A;  2PNI A;  4AG2 C;  2D0N A;  4CC7 A;  2LJ3 A;  2CT3 A;  2EKH A;  4HVV A;  1GBR A;  3U23 A;  3M0S A;  4FSS A;  3ULR B;  2XMF A;  3EG3 A;  1SRM A;  2CUD A;  2HDA A;  1E7O A;  2RF0 A;  2JMA A;  2EW3 A;  1QLY A;  4JJD A;  3UAT A;  2CSQ A;  2K9G A;  4AG1 C;  1QKX A;  2KBT A;  4JZ4 A;  1YP5 A;  2RN8 A;  1SHF A;  2O88 A;  1VYU A;  2GGR A;  2M51 A;  3M0T A;  2JM9 A;  2KYB A;  2J06 A;  1X43 A;  2FG0 A;  2ED1 A;  2RQW A;  1JEG A;  2A08 A;  2LNH B;  1X69 A;  2O2O A;  3A98 A;  1X2K A;  2DL5 A;  5IHI A;  1SEM A;  2YUN A;  2C0I A;  1WA7 A;  2FRW A;  1BU1 A;  2JTE A;  1ZUY A;  3RNJ A;  2J6F A;  1M3C A;  4CC3 A;  3SEM A;  4AFZ C;  2K7A A;  2K3B A;  2NWM A;  4RTX A;  4J9F A;  2AKK A;  1JQQ A;  4GBQ A;  3ZL7 C;  2EGE A;  2J7I A;  4Z88 A;  1W70 A;  5L23 A;  3LH5 A;  2DIL A;  1YWO A;  1U3O A;  2V1R A;  3M0Q A;  2FPD A;  2DMO A;  2LP5 A;  4Y92 A;  1EFN A;  2CSI A;  1TUD A;  3EG2 A;  2BTT A;  2HCK A;  1W1F A;  2EPD A;  1Z9Q A;  1CKA A;  2M0Y A;  2DL7 A;  4J9D A;  2KXC A;  2MCN A;  2DVJ A;  2L0A A;  1ABO A;  4CC4 B;  3H0H A;  2KE9 A;  4EIK A;  5IXF A;  1H3H A;  4GLM A;  4LE9 A;  1A0N B;  1UJ0 A;  1I0C A;  2KRN A;  4OMP A;  3H0I A;  1WYX A;  2KR3 A;  2KYM A;  2OI3 A;  4JJB A;  3RBB B;  2YSQ A;  2IIM A;  2FPE A;  4J9C A;  1SHG A;  2O9V A;  2DL4 A;  1T0H A;  2ECZ A;  2ENM A;  1AWO A;  2RQR A;  2V1Q A;  3VS7 A;  3M0U A;  1VA7 A;  1TUC A;  4OMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...