3NMZC

Crystal structure of apc complexed with asef
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
SSHHYSHPGGGGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGEGWFPASFVRLRVNQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the recognition of Asef by adenomatous polyposis coli
doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/cell cycle
molecule keywords APC variant protein
total genus 13
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3nmzC00
1G2BA 1PNJA 4RTZA 4AFZC 2ESWA 4CC7A 3EG3A 2EGAA 1UFFA 4K11A 2KGTA 2EPDA 3LH5A 1ZUUA 1NM7A 4D8DA 1Y57A 1W6XA 1QKWA 1K9AA 1YP5A 2OI3A 1E7OA 1NYGA 2JMAA 1HJDA 1PKSA 2PNIA 1BB9A 2G6FX 2KROA 2O9VA 1GCQA 2KT8A 5GJVB 2CT3A 1YWPA 2O88A 3C0CA 1WXTA 3PVQA 2KR3A 4Z8AA 2RQUA 5ECAA 1UJ0A 2EKHA 2AKLA 3QWYA 2DLPA 2FG0A 2MCNA 3SHWA 1N5ZA 1BU1A 1UTIA 2HEQA 2J06A 4AG2C 1E6GA 2CDTA 4LNPA 3QWXX 1AVZC 1NYFA 2D8JA 4Z88A 2I0NA 1JEGA 1EFNA 1ZSGA 4AFSC 4CC4B 1X2QA 2GNCA 3EGUA 3UF4A 2KE9A 2NUZA 1UE9A 2FPEA 4OMMA 2DL3A 4OMQA 2KRMA 1RLPC 2DYBA 4J9EA 1B07A 2LMJA 2RQRA 3U23A 4LN2A 2JMCA 4J9HA 2HBWA 3ULRB 2A08A 2H8HA 2L0AA 1ABQA 1E6HA 2KXDA 3I5SA 2DRMA 3H41A 5HCKA 2KYBA 4ZNXA 3SEMA 4RTXA 4ORZA 1HSQA 4Z89A 3I5RA 2C0IA 2LJ1A 1K0XA 1YCSB 5IXFA 1H3HA 1VYVA 1AZGB 2BTTA 2EYXA 2ECZA 5IHNA 4AG1C 2O9SA 1VYUA 2L3QA 1S1NA 3VS3A 2KYMA 2CSIA 1MV3A 1XOVA 2CUBA 3A98A 2ROLA 4JJCA 1GBQA 2OAWA 2ENMA 1OV3A 1WIEA 1GFCA 2EQIA 4QT7A 1WI7A 1OPKA 2K2MA 5IH2A 1WYXA 3TVTA 3JV3A 4OMLA 2HCKA 2AZVA 5L23A 4RTVA 2LJ0A 2RQWA 1WLPB 1M3CA 2X3WD 4RTUA 3M0TA 2EYZA 2M51A 4JJDA 1SRLA 3VS7A 2DE0X 4DEXA 2PZ1A 1RI9A 1A0NB 2MOXA 2J05A 1H8KA 1M3BA 2LP5A 2V1RA 2A28A 2PTKA 1PHTA 4IIOA 2LNHB 4LE9A 2DMOA 2LX7A 1X43A 1WXBA 2DRKA 2J6KA 3PVLA 2KT1A 2J6FA 1I07A 1T3SA 2HSPA 2P4RA 1GRIA 1X27A 2DBMA 1MUZA 2SEMA 2FPDA 1AWWA 2LCSA 4OMNA 1BK2A 3EHRA 1UECA 1QCFA 4JZ3A 2HDAA 1JQQA 1OOTA 2JM8A 2RQTA 2YDLA 4J9IA 2E5KA 2SRCA 1K76A 2C0TA 2LQNA 2W10A 1SRMA 1H92A 1WXUA 1RUWA 1K0SA 2F2WA 2CUDA 3EG1A 1AWOA 3UA6A 4R0KA 1UUEA 1ZLMA 3H0FA 2FEIA 2YUNA 1CSKA 1ZUKA 2ED0A 1PRLC 2K7AA 1PRMC 1ZBJA 4JPBW 2FO0A 2GGRA 2ROTA 4RTYA 2DBKA 1NG2A 2DVJA 5FWBA 2GTJA 2CT4A 1CKBA 3VRYA 2EBPA 5IHKA 1QWFA 1G83A 1GCPA 4RTWA 5I11A 3M0RA 5IXBA 1OEBA 1X69A 2EW3A 3PE0A 2ED1A 2B86A 1KSWA 3H0IA 4D8KA 1ZUYA 4F16A 1TG0A 2KNBB 1JXMA 1RLQC 2KXCA 2MIOA 3IQLA 3EG0A 3VS0A 2CSQA 4IIMA 1T0HA 4HXJA 3M0UA 1K4US 1T3LA 1JXOA 3VRZA 1U5SA 3KFVA 2EGCA 2YUQA 2EGEA 2DJQA 2CH4A 1KJWA 1VA7A 2JTEA 2D1XA 2NWMA 3FJ5A 4LUDA 3CQTA 2EYWA 1Z9QA 4AFUC 4HCKA 2RMOA 3NHNA 3EG2A 4ESRA 1YNZA 2JS2A 1GCQC 3ZL7C 1X6GA 5I22A 2J7IA 1KIKA 4Y92A 2K9GA 2AZSA 2FRWA 2KBTA 1ABOA 1KFZA 4X1VA 2L2PA 5EC7A 4GLMA 4EIKA 2AK5A 2KRNA 1AEYA 4J9BA 4JZ4A 3UATA 2EYYA 4WCIA 2K79A 2F2XA 2V1QA 2LQWA 3RBBB 2BZYA 2C0OA 4HVWA 3REAB 4HVUA 3TSZA 4FSSA 1Y0MA 2DM1A 2LZ6B 3NPFA 1AWJA 1IO6A 3VS4A 2DL8A 4AFQC 2JT4A 1W1FA 3REBB 1B3QA 1SHFA 4M4ZA 1U3OA 1SHGA 5FWCA 2YSQA 1J3TA 1YN8A 1HD3A 3H0HA 2L3SA 4GBQA 2XMFA 2DILA 1I0CA 3NMZC 3I9QA 3THKA 1UDLA 4J9FA 5GJWB 1NEGA 2CH4W 1X2KA 2O2OA 2DNUA 4JJBA 3M0SA 3GBQA 3VS5A 1OPLA 3M0QA 1PWTA 2CREA 2DA9A 2LJ3A 4J9GA 1UHCA 1GBRA 2GBQA 4J9DA 2M0YA 4F14A 2A36A 1UGVA 1M27C 2O31A 1LCKA 1NEBA 2YUOA 4A63B 1FMKA 2DL5A 1YWOA 1NLOC 2JS0A 2VKNA 3TSWA 2JM9A 3EHQA 2YUPA 5FW9A 3VS6A 1QWEA 3R6NA 2L3PA 4KRTA 3UA7A 3M0PA 1PKTA 2BZ8A 1SEMA 2FPFA 2K6DA 1ARKA 4CC3A 2DF6A 1ZX6A 1CKAA 1MV0B 1NLPC 2ABLA 2RNAA 2QDLA 4CC2A 2IIMA 2KEAA 1GL5A 1AD5A 1M30A 1T0JA 2BZXA 2EVRA 4RTTA 2FRYA 4OMPA 4F17A 1WX6A 4RUGA 2K3BA 1AOJA 2RQVA 2W0ZA 3O5ZA 1UJYA 3RNJA 1SPKA 1M8MA 4E6RA 4HVVA 2J6OA 1WA7A 1VYTA 2RF0A 3VS1A 3I35A 1SSHA 1FYNA 2F2VA 2X3XD 1QKXA 4OMOA 2RN8A 2D8HA 1JU5C 2DL4A 1BBZA 1V1CA 2VWFA 4J9CA 1K1ZA 1Z9ZA 1X6BA 1WFWA 2AKKA 1U06A 1TUDA 2OJ2A 5IHIA 1AWXA 2A37A 2DL7A 1GFDA 2VVKA 2YT6A 2D0NA 1W70A 2RPNA 1I1JA 4LUEA 1UG1A 1UHFA 2GQIA 1AZEA 3NGPA 1WDXA 2JW4A 2JXBA 2GTOA 1M3AA 1QLYA 2DX1A 4DEYA 2KRSA 1JO8A 1TUCA 3VS2A
chains in the Genus database with same CATH superfamily
4LD6A 4AFZC 3QUIA 3EG3A 2E65A 4Y28E 4K11A 2KGTA 1OX9A 1RACB 1ZUUA 2COZA 1W6XA 5KYWA 2OI3A 4X34A 2PNIA 2G6FX 1VQMA 4EMHA 3A5ZB 2CZ7B 4Z8AA 3BFMA 2JZ2A 4DBFA 4JRPA 2EKHA 1YHQT 1MHNA 5GAN6 3SHWA 2X35A 3CC7Q 4AG2C 2OTJQ 3GIBA 4MMLA 2HKQB 4M7DF 4LNPA 4C8QE 1AVZC 1NYFA 2XDBA 4BY6B 1Q95G 5I2SA 2RI5A 1EFNA 2NUTA 3T9NA 3JCMh 4AFSC 4QVDA 1YJNA 2MWOA 2GNCA 3FLGA 1K73R 2KE9A 4FT2A 3JB9I 3HHTB 2QEXT 1X6OA 4OMMA 3L2ZA 5I21A 1RLPC 3L1AA 2AT1B 2LMJA 4KUIA 1YHQQ 4C0DB 4LN2A 2ZGWA 4E7SA 2JMCA 4ANJA 2WSCE 2QGFB 2QTVA 4DBQA 5GMKl 3H41A 2PQWA 5HCKA 2KYBA 4C0FA 1HSQA 2QG9B 4M7DG 1ZBXA 1H3HA 3AT1B 2B8AA 1AZGB 4L59A 3CCSQ 4OGEA 2L3QA 2O9SA 3VS3A 1ZQ1A 4FIBA 1KQSS 2JTMA 1MV3A 4M7AA 3E9GA 2MPXC 3CMET 5GAN7 3CPWS 2ROLA 4JJCA 3VV0A 4M75C 2DIGA 2ENMA 2XDPA 5LJ5e 5GAMd 2EQIA 4N4HA 2K2MA 1P92A 1WYXA 3VU3C 1VOMA 2HCKA 4B6MA 1XJWB 1YI2Q 2VGMA 1KD1R 4JJDA 1M1KR 5LJ5j 3FJPA 1K8AC 3VS7A 5CO7A 4R55A 3S3MA 3CCQA 2HL3A 2BKDN 1RI9A 1GXIE 1A0NB 2Y4YA 3G6EQ 1UGQB 2XICA 1KC8U 1H8KA 1NZ9A 2LP5A 2DERA 4NOYA 4M78A 1VQ5T 2PTKA 4IIOA 2FZGB 3CCMT 2DMOA 5GAMe 3PVLA 3OYGA 5FRNA 1T3SA 2P4RA 3CD6Q 2DBMA 4M7DB 3OYNA 3OYMA 2LT4A 2FPDA 3CCET 1RI0A 2XK0A 5CK9A 4PKCC 4M7AE 1JQQA 3SDZA 4J9IA 3A8HB 4Z02A 2C0TA 3CCRA 2X4WA 3HL8A 1RUWA 5CQYA 3QJ6A 1PCXA 3CC2A 4EPCA 3HP9A 2I2LA 5GAOn 5LJ3f 6AT1B 3G71T 1BCMA 3CMEQ 2ED0A 3GNGA 1O75A 3NTHA 4M77F 4JPBW 5GMKj 1QW1A 2QQSA 2ROTA 1YJNQ 2DBKA 2DD4A 2GTJA 2JJ9A 1GCPA 3OS5A 5I11A 5IXBA 1OEBA 1WHKA 2E64A 2QDYB 2L8DA 3VYHB 1KSWA 4PNOA 1ZUYA 1MMDA 1TG0A 2KNBB 1RLQC 2KXCA 3ZBDA 3CC4A 3VS0A 4C92C 3LW5E 1K4US 1T3LA 1TWBA 2HKNA 2RB6A 3VRZA 1U5SA 2EGCA 4PLIA 2EGEA 2QQBA 5CKBA 2D1XA 3I55Q 2QAZA 1VQLT 1QP2A 4M77C 1PM3A 5D6YA 1R0BG 1YNZA 1X6GA 2K9GA 2AZSA 4BE0A 3L2WA 1I8FA 2DXTA 3CD6T 5LJ3h 2AK5A 2LTOA 2GFAA 2FVUA 1S72A 1KQ2A 2X4JA 3X20B 2Y90A 2V1QA 4HVWA 3REAB 1LVKA 4FSSA 1SSFA 1BIBA 4E7IA 4M75E 1AWJA 4J7IA 4PJMA 3CBOA 1C1AA 5GAMh 5LJ5g 2XD0A 3WVEB 2DTIA 1SF9A 3X25B 5FWCA 1SHGA 1J3TA 3GLXA 3MHXA 5FU6C 2HQHA 2XMFA 3GF5A 2X9HA 3UWNA 2RI3A 3NMZC 4OF1A 3QZ9B 2MYSA 4C5HA 1ZSZB 5DLOA 1QVFS 1NEGA 2E1HA 2DNUA 1RAAB 3URGA 3M0QA 1PWTA 2H3JA 2LJ3A 2H3EB 4ZGDB 4PFZA 1UGVA 3MEWA 5DY9A 4IUTA 1IGUA 2YUOA 1Q86C 5KYYA 4LXCA 1VQPA 1N9SA 4C0DC 3CCJA 2F5TX 2YLCA 2F69A 2L3PA 2DVEA 3DB4A 2CKKA 1KHIA 1M9SA 3M0PA 5CQXA 2RJCA 4MZTA 1PKTA 4QKUA 4CC3A 1CKAA 4FW1A 2QASA 1NLPC 4ELZC 2ZPHB 4C8QD 3GNFB 1TH7A 3CXCP 3JCMJ 2IIMA 1GL5A 2CS7A 7AT1B 4DOVA 2RI2A 4RCBA 2D6FA 3E9FA 3M4YA 1WX6A 3M59A 5GMKi 4ZTFA 1K73U 3O5ZA 3EGDB 1PC0A 2AHJB 1M8MA 1VQ4T 4F7UE 1WJQA 4ME7A 4RCCA 1M8VA 2L5QA 3VS1A 3FB9A 2D0QB 1QKXA 2RN8A 4PLLA 2L89A 1JU5C 2DL4A 1LOJA 2M02A 1X6BA 3CCMQ 1WFWA 3WXMB 1BI0A 5GAOl 1BIAA 1EIFA 2OJ2A 3OYEA 4XU3A 4WTOB 3RUXA 3OYCA 1GFDA 4OB2B 5DLQE 4UC4A 2YT6A 3FDRA 4N0AC 1I1JA 2XU8A 2P84A 1W4SA 2NUPB 2BUDA 1WDXA 2LQKA 4R56A 4C8QG 1M3AA 3GP8A 5KE3A 2DX1A 1JO8A 1TUCA 3PGGA 1QCOA 1PNJA 4RTZA 4V2SA 1B34B 2EPDA 3JCMP 2DZ9A 4D8DA 1Y57A 1N9RA 3QO3A 1YP5A 4F7UB 2JMAA 1HJDA 1M1FA 3CC7T 1BB9A 4PJOG 2KT8A 5CKHA 5GJVB 3JB9D 2CT3A 1WXTA 5GAMj 1FX7A 5GAMf 5ECAA 3G4SA 3LGFA 3RKXA 4KH1B 2J06A 1E6GA 5HK3A 2CDTA 1D0YA 2D8JA 1V76A 4Z88A 1JEGA 4J6XA 2M16A 5FLXE 2DZCA 1ZSGA 2LQ8A 2CGHA 3UF4A 1RAFB 2E3IA 2RK2A 5AT1B 2FPEA 1VQMQ 4FYWB 2KRMA 1S72Q 4C92G 3SWNA 1N8RR 4O5VA 4N4IA 1N6AA 3EG9A 1JJ2P 3EGXA 2LRQA 1Q82R 3ULRB 2H8HA 3CC2T 1ABQA 3OYJA 3LWHA 3HRUA 3CCQT 2DRMA 1C6VX 3SEMA 5LJ5d 4RTXA 4RG2A 3I5RA 5GAN5 2CYZB 3X26B 5IXFA 4PFOA 1Q86U 2V26A 2EYXA 4AG1C 3CCVT 1HXDA 1M4ZA 3KBGA 2KYMA 1S72T 4RG8A 2D9TA 4XAXB 2VUBA 3I56Q 2CUBA 2RD1A 3A98A 3G7ZA 4J7FA 1D1AA 1GBQA 4OGCA 2LDMA 1YCYA 1EZZB 2NLUA 5KYNA 1GFCA 2ATCB 1RAIB 4C5GA 3CCVQ 2NUPA 5LJ3e 2EQMA 5IAYA 2V8KA 3J81E 3JCMd 4A4HA 2LJ0A 2VGNA 1WZOA 3OYYA 2M51A 3G71A 1SRLA 1OZ2A 2GFUA 5HKCA 4DEXA 3CXCS 2O01E 3LGLA 2QXFA 2J05A 3DLMA 3MEUA 2K5LA 3VUZA 2A28A 4M78C 3RDVA 3JCMg 3S3OA 3JB9H 2LX7A 1VQNQ 2KT1A 3V8KA 2A7YA 2RK1A 3JCMe 1QVGS 2HSPA 5FU7B 1GRIA 4LDWA 4ELYC 2YHTA 1MUZA 4M77D 4PFPA 3QPHA 2LCSA 4OMNA 1UECA 4JZ3A 4FM4B 1TU0B 1WGSA 2QA4Q 1VQ8T 1H641 1M2VA 1OOTA 3RR6A 4KGZB 3MP1A 1K76A 2LQNA 9ATCB 1H92A 1WXUA 1K0SA 1U8RA 2CP7A 2P0QA 3UA6A 4R0KA 4FYXB 1UUEA 5KYUA 4PJNA 3TU4K 3H0FA 2FEIA 2QQRA 1C0MA 1ZUKA 2FO0A 2GGRA 2QEXA 4PJOC 3X24B 1PD1A 2CT4A 4OB1B 1CKBA 5GANh 1Y96A 4QQDA 3OW2P 2R5MA 2ED1A 3H0IA 4Y91A 4D8KA 2DTOA 2IVWA 2KQWA 1JXMA 3IQLA 2OTJA 2OTJT 5GAN4 3SFMA 4DBRA 4M7DE 2YUQA 1YBYA 2DJQA 2E5QA 2DD5A 4XTVA 2CH4A 3HRSA 1VA7A 3FJ5A 3CQTA 2EYWA 4KUDK 1KC8R 4AFUC 4PJLA 4FYVB 2HL5C 1VQ6Q 1U1SA 1PD0A 3MO8A 1R8OB 3ZL7C 1KD1U 5I22A 4Y92A 2G3RA 1VQOA 2RHIA 2KBTA 1KK7A 3MCAB 1WHGA 1IRXA 3OYIA 4GLMA 1N27A 5CVIA 4JRQA 4F7UG 2KRNA 1VQ4A 5I2MA 3S3NA 5DM7R 1LJOA 4PJJA 2F2XA 2LQWA 3RBBB 2BZYA 2K57A 1BI3A 4HVUA 4E2FB 2YRDA 4HA8A 1ZA2B 4VUBA 3NPFA 3UT1A 4E47A 1VIFA 3SWNC 3UPUA 1IO6A 4N0AA 3VS4A 3CC4Q 4BDZA 3I56A 1U1TA 3VYGA 4JUVA 1KD1C 1Q81R 3CD6A 1W1FA 3D7SB 1Q7YR 4YTLA 2IG0A 2YSQA 1VQMT 4C92B 2VXFA 2L3SA 4M7DC 1MGQA 1I0CA 5A0DA 4JRIA 2M9UA 2O4XB 4J9FA 5FRMA 3G4SQ 2O2OA 4JJBA 1WPYA 1VQ6T 4FU6A 5KE2A 1OPLA 4C92D 2F1LA 3QXEB 1Q82U 2NUTB 4JLGA 3OYAA 1LCKA 2GF7A 1KG1A 4A63B 1OU9A 5GAN8 3JCMb 2VV5A 3EH2A 2RJFA 1PSFA 2YRCA 3TSWA 4PJOF 3A1PA 2QA4A 2YUPA 2KMTA 1WHLA 1QWEA 3OS0A 3CMAQ 1VQ9T 3EFOA 4OVAA 2BZ8A 5A0LA 2DIQA 1VQ7Q 4N4GA 2GQVA 2DF6A 5GAOr 4QW2A 5HY6A 1MV0B 3CMEA 4XU0A 1QQJA 2QDLA 3M55A 4KGXB 3RESA 1AD5A 2R57A 4TVRA 2OTLT 2DO3A 5J39A 3MP6A 2Z0WA 2FB7A 1FMVA 2RHYA 5FU6B 1YJWT 4C8QF 2W0ZA 3QG1A 4KT0E 4M7AB 3CBMA 1VQ5Q 1SPKA 1M90R 1KC8C 4E7JA 2J6OA 3CPWA 2FZKB 4X9DA 5LJ5h 3E1SA 2QEXQ 4EMGA 4LDXA 1VQKT 3JSCA 4OMOA 3NTKA 1BBZA 1V1CA 1K1ZA 2BIVA 4GY5A 1I5OB 4XTWA 2AKKA 3LX7A 1UGPB 4EMKA 4LD9K 4PJOD 1QCNA 1N8RU 1TUDA 2COWA 2XIDA 4M75A 2A37A 2RHZA 2VVKA 1W70A 5FU7C 3CCJQ 3MPUB 3CCQQ 1W2BP 4LUEA 1UG1A 3PIOA 3QSUA 1UHFA 3I55T 1AZEA 4QVCA 1VQ7A 4KULA 2EJGA 2YRVA 2E10A 2JXBA 2QGGA 2LC4A 5LJ5f 5CR2A 3VS2A 4FYYB 3DB3A 1G2BA 2DETA 3BY7A 1YITA 4FT4A 3RMSA 3LH5A 3CCLQ 4ATOA 3QDFA 3JCMf 8AT1B 4RMOA 1D1BA 1QKWA 1K9AA 1OI1A 3N5BB 1E7OA 1PSEA 2VC8A 2ZPFB 1JRIA 5KYWB 2RJDA 1YJWQ 1VQNT 2KROA 4M78D 1YWPA 5CKEA 3C0CA 2O88A 3SWNB 1VQ4Q 3CCSA 3PVQA 5GAN2 2RQUA 1Q81U 4E7ZA 3JCMQ 2M0OA 4BE2A 3JB9J 2AKLA 3MKDA 4RKUE 2K3XA 2FG0A 2MCNA 3M5AA 1BU1A 1IREB 1UTIA 2HEQA 3CC4T 3JRZA 1M5Q1 4MDWA 5KYYB 3A8MB 3QWXX 4M77B 1MNEA 2E3HA 1VQOQ 2OX7A 2KAFA 1NJIU 4CC4B 1H3ZA 5LJ3d 1IXDA 2NUZA 2ZAEA 3HFNA 5C0MA 4L5GA 3SB2A 2VB6A 1UE9A 1KHCA 2DL3A 1WJSA 4HT9A 4JS4A 1NE8A 2DYBA 3OS2A 2K2VA 2DAQA 3TREA 4C0ZA 2KI7A 3U23A 2K4YA 4BDYA 1B7TA 3OW2S 2HBWA 2A08A 1FWZA 4IUUA 4XTYA 2KXDA 2E6NA 4OB0B 4J6WA 5LJ3g 4ORZA 4M7DA 1JJ2A 4IKFA 1R77A 2C0IA 1K0XA 1LNXA 2YLBA 2JN0A 1Q82C 3OYDA 4JLIA 1RAGB 2DEQA 3V7SA 2DKGA 2BTTA 4KH0B 1NJIC 2ECZA 3V7RA 1RABB 3HRTA 1PG5B 5GANd 4DQ2A 2XI9A 1XOVA 4M78F 1JBMA 1OU8A 5EG2A 4BD3A 2F5KA 2JNGA 2E41A 1WI7A 1OPKA 1G5VA 1VQOT 3CCST 2V8JA 4M78B 4M77G 3TVTA 3OYFA 5IT9E 4OMLA 5L23A 1RADB 1I81A 4BI8B 2OAUA 1N8RC 2X3WD 4HCBA 3M0TA 2EYZA 1G3SA 3ASKA 5FROA 1YJ9T 2AIRB 4IUVA 2PZ1A 3L2VA 2MOXA 5A2QE 2OTLQ 1YITT 1M3BA 2CP2A 2HAXA 2E70A 2JVVA 4XU2A 2V1RA 2RH2A 3RMQA 3S6WA 3CCUA 4J5YA 4M77A 4LE9A 5GMKh 2CZ1B 1WXBA 2J6KA 1ZSZA 3RKWA 3M4GA 2QQAA 4FL6A 3I55A 5GANj 1X27A 1LPLA 1YJNT 1VQ9Q 4GLKA 4ZTJA 2XKOC 1YIJQ 2K5IA 2SEMA 1AWWA 1QCFA 2DXUA 2A3LA 2WSFE 2HDAA 5D6WA 2KSSA 2JM8A 2QK0A 3A8OB 2E5KA 2SRCA 2W10A 1D1CA 3CCLA 5HK0A 2KVQG 1I4K1 2CUDA 2F2WA 3EG1A 3JCMV 1ZLMA 2HMAA 3G6EA 3H6ZA 1XTDA 3OYKA 2MF2A 1CSKA 1I5LA 2RJEA 1VQNA 4F7UF 1K8AR 3MEVA 5FWBA 1FMWA 1EX4A 2PU9B 2EBPA 5IHKA 4BY6C 1QWFA 5GANe 1G83A 5CKFA 2JTFA 3M0RA 1M2OA 2MWPA 3E19A 4XTUA 3PE0A 3ZEHA 2B86A 5LJ3j 4E7KA 4HT8A 4A4FA 3HPWA 3X28B 3EG0A 4IIMA 5C6SA 1IZ6A 2QQ9A 4HXJA 3CXCA 4ZN1A 3R6OA 2BE9B 2KDSA 3KFVA 1WHHA 3PFSA 2MMPA 4LUDA 2JTEA 3LLRA 3M9QA 3LWIA 1Z9QA 2CP6A 3L42A 2RMOA 1QVFA 3CCJT 3NHNA 4CI0C 3OYBA 3EG2A 2FYKA 1QVPA 2EFIA 1GCQC 3PMIA 3E2UA 2CZ6B 4BB7A 2J7IA 1KIKA 2HSEB 2FRWA 1ABOA 2JUFA 4X1VA 3L2UA 2ZPIB 4B9WA 5EC7A 2M1HA 2GCXA 5J3BA 4E7HA 1AEYA 4J9BA 4IUQA 3UATA 3INZA 3JB9G 2EYYA 5CKDA 2K79A 1Q7YC 1YFNA 3TSZA 1MMGA 1Y07A 2IPOB 2P0KA 4EMKC 1JB0E 2LZ6B 3PNWC 1YJ9Q 2A0FB 3VJPA 5GAMg 3JCMc 2EQJA 3CEYA 3QDRB 2CZ0B 2DL8A 1K8AU 3G71Q 4MMKA 1OQKA 3META 3OA6A 2XHCA 1B3QA 1QP3A 3EFOB 4M4ZA 4DOWA 4L6V5 3GOXA 3C12A 1HK9A 1VQ8A 4FSXA 5IN1A 1HD3A 1ZHIA 4GBQA 3H8ZA 1YJWA 3THKA 1O9SA 1BCOA 5GJWB 1M2VB 4IUPA 5KCHA 2OTLA 1X2KA 1VQKQ 3ZFJA 1D0XA 4XTXA 5LL6S 5AYFA 3GBQA 3VS5A 1K9MU 4DBHA 1G3WA 2DA9A 4M7AF 4J9GA 1GBRA 2GBQA 4J9DA 4F14A 1G3TA 1M27C 2O31A 1NEBA 4XQ3A 3M53A 2EIFA 3J80E 1FMKA 3BW1A 3OSSC 1NLOC 1TXQA 2JS0A 2VKNA 4WF2A 2DYIA 2JOYA 1UB4A 4OMFB 2PUKB 4LDYA 4M75B 1AT1B 4PL6A 2DTHA 3L2QA 4KRTA 3UA7A 1MMAA 1VUBA 1ARKA 1SEMA 2FPFA 2HNIA 2K6DA 3EH1A 2ZZDA 3PTAA 3PT9A 1VQ8Q 4XK8E 2RNAA 4CC2A 2DFUA 2KEAA 3FC3A 4HCCA 2FRYA 2MK5A 2LX9A 4PK4A 4RUGA 2VYTA 3EFSA 1AOJA 3C4SA 1UJYA 3M54A 2EQKA 1D3BB 4HVVA 3UDCA 3VUBA 1WA7A 1D09B 3OY9A 3QBYA 3PIPA 1XNIA 2E12A 3G4ST 1FYNA 2K3YA 2DPPB 4C0GA 5D6XA 2P4TA 3QJYA 3J7AF 5IHIA 1AWXA 3C95A 2EKOA 3WVDB 4XU1A 2FL7A 3KXTA 4LDVA 2C06A 2GQIA 4C5EA 3NGPA 2FZCB 1F1BB 1K73C 3LH0A 3NFCA 4DEYA 2KRSA 1BYMA 4M7DD 4QQGA 1QMCA 2ESWA 4CC7A 2ZPBB 2EGAA 1UFFA 3FEOA 3V7CA 2DEUA 2NYSA 1NM7A 2R5AA 4A54A 1YIJA 5GAOm 1NYGA 1PKSA 2O9VA 1GCQA 3LYIA 1VQPT 1D3BA 3P8DA 2KR3A 1M1KC 1NPPA 1IB8A 1B34A 4BACA 1VQKA 1UJ0A 4Q5WA 3GPLA 3CCLT 3MP8A 4MDXA 3QWYA 2DLPA 4M75F 3HTRA 1N5ZA 2LT1A 5KCOA 2HZYA 2ZCFB 3BE3A 3P8BB 2I0NA 2WACA 1YI2T 3ME9A 2FHDA 3EAEA 1X2QA 3EGUA 2LVMA 3V8JA 5L8RE 1VQPQ 4C92F 1YI2A 2KY9A 2COYA 2YXYA 4OMQA 3CMAT 4M75D 4J9EA 1B07A 2RQRA 5M9OA 3M57A 4BE1A 1X01A 4J9HA 5KH6A 1R0CB 4C8QA 3EGXB 1UGRB 2DXBA 2WSEE 2DJZA 2L0AA 1ACMB 1E6HA 3I5SA 3VKIA 4J83A 3OYLA 3ER0A 3OBWA 4ZNXA 1QVFP 3CCEQ 4Z89A 1NPRA 5GAOp 2LJ1A 5CCAA 1VQLQ 1YCSB 1YIJT 8ATCB 3KUFA 1VYVA 2XDDA 3OSVA 5IHNA 1TSFA 2EJ9A 3QIIA 4JDSA 2CP3A 2K5FA 1VYUA 4QQ6A 1S1NA 2CSIA 1D0ZA 3QHSA 3CCUQ 1VQ5A 1M90C 3JB9F 3CCRQ 4A4KA 1OYXA 3Q1JA 4BI4A 2OAWA 1OV3A 1WIEA 4QT7A 1VQ7T 1KQSA 5IH2A 3JV3A 4M77E 2AZVA 3C94A 4RTVA 3OBYA 2DXCA 4B9XA 3EG9B 5GAN3 2RQWA 1WLPB 1M3CA 4RTUA 2MAMA 1TOVA 4AT1B 1KQSP 3RERA 2DE0X 5KYUB 3OYHA 2HQEA 3CC2Q 4NL2A 5CAIA 1IHVA 2RA2A 2XG8D 1PHTA 3QKJA 2LNHB 2RM4A 1X43A 2DRKA 2J6FA 1I07A 1NJIR 2Y4XA 3OMCA 4J8OA 1Y71A 2RHXA 3SD4A 2EQUA 1BK2A 3EHRA 4A53A 4BUGA 3FRNA 1SKUB 1RL2A 2HD0A 2RQTA 2YDLA 2LCCA 1SRMA 4M78E 1UEBA 1Q86R 1AWOA 1WHJA 1X75C 1V29B 1SG5A 5GMKm 4PJOE 4X9CA 3NTIA 2R58A 2YUNA 3I56T 2QYZA 1PRLC 2K7AA 1PRMC 3O8VA 1K9MR 1ZBJA 1BI1A 4RTYA 2P0PA 3TEEA 3A8GB 1NG2A 2DVJA 2X4YA 2DK3A 4P5NA 3VRYA 2HQXA 1JJ2S 4RTWA 3JCMW 2E6ZA 3JAME 1G3YA 1VIEA 1X69A 2EW3A 4E7LA 4F16A 2LNVA 2CP5A 3EGDA 2MIOA 3TQ7P 2CSQA 4ZN3A 1T0HA 1BI2A 3JCMX 3MEAA 3M0UA 1VQ6A 4JRKA 2VASA 2EWNA 1JXOA 1M1GA 1QVGP 3BDLA 1OZ3A 1KJWA 2NWMA 5D7UA 1VQ9A 3OMGA 2CP0A 3V8LA 4MZPA 4ZGEB 4HCKA 1WNLA 4C8QB 3L2RA 4FCYA 3RKYA 2PVDB 4ESRA 3CPWP 3BDUA 1QVGA 2JS2A 1VQLA 4J6YA 4C5IA 3CBPA 1KFZA 2X4XA 3PMTA 2L2PA 3OB9A 3CCRT 2VXEA 4EIKA 4NS5A 4EDUA 4F7UA 3HSBA 4CRIA 1FXXA 2KK4A 1M90U 1IGQA 3DLLA 4PJOB 4JZ4A 3FIFA 3TCJA 5KYXA 5CIUA 4M78G 1RAHB 2EAYA 4KGVB 1Y96B 4WCIA 4DA4A 1W2BA 1WQ7A 4AMCA 2C0OA 1Y0MA 1ZA1B 4OP0A 2DM1A 4OB3B 4O6JA 1DJ7B 3CCMA 3RIRA 4C92E 4PJOA 3A8LB 4AFQC 4M7AD 2HBPA 4JJNK 2JT4A 3M58A 2ZPGB 3REBB 2RO0A 4F04B 1SHFA 1U3OA 1YN8A 3MJXA 4A4EA 3H0HA 1WHMA 2X51A 2QA4T 2DILA 4II1A 4M7AG 1OULA 3I9QA 4XTZA 1UDLA 4LDUA 3OQ5A 2EJFA 1TTHB 2CH4W 2PUOB 1W2BS 1KQ1A 3M0SA 1Y7XA 5GANf 1TUGB 4M7AC 2EYQA 4M75G 3QYHB 2CREA 1YHQA 5A0GA 1UHCA 2M0YA 2A36A 2V8IA 3AHUA 1TS9A 5KYXB 1HYOA 2DL5A 1YWOA 4QVZA 4JS5A 2JM9A 3EHQA 2RHUA 1WQWA 4ZGJB 3F70A 2QI2A 5FW9A 4C92A 3VS6A 3R6NA 2LCLA 1RAEB 4NL3A 3CPFA 3DKMA 3OW2A 4HCZA 1MMNA 3HKSA 1ZX6A 4HKEA 1XQHA 4FW2A 3QZ5B 4A4GA 2ABLA 3CCEA 3CMAA 4KBMB 3QYGB 5GANg 1M30A 4C8QC 1T0JA 1ZSZC 2BZXA 2EVRA 3CCVA 5GAOq 4RTTA 3G1JA 4F17A 4OMPA 4D6WA 1Q7YU 1WJRA 2K3BA 4BI3A 2RQVA 1BKBA 1OX8A 2PVOB 2YWWA 2ZPEB 3RNJA 1IHWA 4IURA 4E6RA 2L3RA 5GMKe 1VYTA 3CCUT 1M1KU 3EFRA 1YITQ 1G8XA 2O4XA 2RF0A 3G6ET 2E4HA 3I35A 1SSHA 2F2VA 2X3XD 1AHJB 2BE7D 1Q81C 2D8HA 2VWFA 2QTXA 4J9CA 1Z9ZA 4EMKB 1YJ9A 1NBEB 3M56A 1U06A 1MNDA 3CC7A 1UGSB 2DL7A 2D0NA 2RPNA 2PVGB 4MZMA 3HFOA 3P8HA 2JW4A 3OS1A 3H9NA 2GTOA 1QLYA 5J26A 2MI6A 1K9MC
chains in the Genus database with same CATH topology
1G2BA 1PNJA 4RTZA 4AFZC 2ESWA 4CC7A 3EG3A 2EGAA 1UFFA 4K11A 2KGTA 2EPDA 3LH5A 1ZUUA 1NM7A 4D8DA 1Y57A 1W6XA 1QKWA 1K9AA 1YP5A 2OI3A 1E7OA 1NYGA 2JMAA 1HJDA 1PKSA 2PNIA 1BB9A 2G6FX 2KROA 2O9VA 1GCQA 2KT8A 5GJVB 2CT3A 1YWPA 2O88A 3C0CA 1WXTA 3PVQA 2KR3A 4Z8AA 2RQUA 5ECAA 1UJ0A 2EKHA 2AKLA 3QWYA 2DLPA 2FG0A 2MCNA 3SHWA 1N5ZA 1BU1A 1UTIA 2HEQA 2J06A 4AG2C 1E6GA 2CDTA 4LNPA 3QWXX 1AVZC 1NYFA 2D8JA 4Z88A 2I0NA 1JEGA 1EFNA 1ZSGA 4AFSC 4CC4B 1X2QA 2GNCA 3EGUA 3UF4A 2KE9A 2NUZA 1UE9A 2FPEA 4OMMA 2DL3A 4OMQA 2KRMA 1RLPC 2DYBA 4J9EA 1B07A 2LMJA 2RQRA 3U23A 4LN2A 2JMCA 4J9HA 2HBWA 3ULRB 2A08A 2H8HA 2L0AA 1ABQA 1E6HA 2KXDA 3I5SA 2DRMA 3H41A 5HCKA 2KYBA 4ZNXA 3SEMA 4RTXA 4ORZA 1HSQA 4Z89A 3I5RA 2C0IA 2LJ1A 1K0XA 1YCSB 5IXFA 1H3HA 1VYVA 1AZGB 2BTTA 2EYXA 2ECZA 5IHNA 4AG1C 2O9SA 1VYUA 2L3QA 1S1NA 3VS3A 2KYMA 2CSIA 1MV3A 1XOVA 2CUBA 3A98A 2ROLA 4JJCA 1GBQA 2OAWA 2ENMA 1OV3A 1WIEA 1GFCA 2EQIA 4QT7A 1WI7A 1OPKA 2K2MA 5IH2A 1WYXA 3TVTA 3JV3A 4OMLA 2HCKA 2AZVA 5L23A 4RTVA 2LJ0A 2RQWA 1WLPB 1M3CA 2X3WD 4RTUA 3M0TA 2EYZA 2M51A 4JJDA 1SRLA 3VS7A 2DE0X 4DEXA 2PZ1A 1RI9A 1A0NB 2MOXA 2J05A 1H8KA 1M3BA 2LP5A 2V1RA 2A28A 2PTKA 1PHTA 4IIOA 2LNHB 4LE9A 2DMOA 2LX7A 1X43A 1WXBA 2DRKA 2J6KA 3PVLA 2KT1A 2J6FA 1I07A 1T3SA 2HSPA 2P4RA 1GRIA 1X27A 2DBMA 1MUZA 2SEMA 2FPDA 1AWWA 2LCSA 4OMNA 1BK2A 3EHRA 1UECA 1QCFA 4JZ3A 2HDAA 1JQQA 1OOTA 2JM8A 2RQTA 2YDLA 4J9IA 2E5KA 2SRCA 1K76A 2C0TA 2LQNA 2W10A 1SRMA 1H92A 1WXUA 1RUWA 1K0SA 2F2WA 2CUDA 3EG1A 1AWOA 3UA6A 4R0KA 1UUEA 1ZLMA 3H0FA 2FEIA 2YUNA 1CSKA 1ZUKA 2ED0A 1PRLC 2K7AA 1PRMC 1ZBJA 4JPBW 2FO0A 2GGRA 2ROTA 4RTYA 2DBKA 1NG2A 2DVJA 5FWBA 2GTJA 2CT4A 1CKBA 3VRYA 2EBPA 5IHKA 1QWFA 1G83A 1GCPA 4RTWA 5I11A 3M0RA 5IXBA 1OEBA 1X69A 2EW3A 3PE0A 2ED1A 2B86A 1KSWA 3H0IA 4D8KA 1ZUYA 4F16A 1TG0A 2KNBB 1JXMA 1RLQC 2KXCA 2MIOA 3IQLA 3EG0A 3VS0A 2CSQA 4IIMA 1T0HA 4HXJA 3M0UA 1K4US 1T3LA 1JXOA 3VRZA 1U5SA 3KFVA 2EGCA 2YUQA 2EGEA 2DJQA 2CH4A 1KJWA 1VA7A 2JTEA 2D1XA 2NWMA 3FJ5A 4LUDA 3CQTA 2EYWA 1Z9QA 4AFUC 4HCKA 2RMOA 3NHNA 3EG2A 4ESRA 1YNZA 2JS2A 1GCQC 3ZL7C 1X6GA 5I22A 2J7IA 1KIKA 4Y92A 2K9GA 2AZSA 2FRWA 2KBTA 1ABOA 1KFZA 4X1VA 2L2PA 5EC7A 4GLMA 4EIKA 2AK5A 2KRNA 1AEYA 4J9BA 4JZ4A 3UATA 2EYYA 4WCIA 2K79A 2F2XA 2V1QA 2LQWA 3RBBB 2BZYA 2C0OA 4HVWA 3REAB 4HVUA 3TSZA 4FSSA 1Y0MA 2DM1A 2LZ6B 3NPFA 1AWJA 1IO6A 3VS4A 2DL8A 4AFQC 2JT4A 1W1FA 3REBB 1B3QA 1SHFA 4M4ZA 1U3OA 1SHGA 5FWCA 2YSQA 1J3TA 1YN8A 1HD3A 3H0HA 2L3SA 4GBQA 2XMFA 2DILA 1I0CA 3NMZC 3I9QA 3THKA 1UDLA 4J9FA 5GJWB 1NEGA 2CH4W 1X2KA 2O2OA 2DNUA 4JJBA 3M0SA 3GBQA 3VS5A 1OPLA 3M0QA 1PWTA 2CREA 2DA9A 2LJ3A 4J9GA 1UHCA 1GBRA 2GBQA 4J9DA 2M0YA 4F14A 2A36A 1UGVA 1M27C 2O31A 1LCKA 1NEBA 2YUOA 4A63B 1FMKA 2DL5A 1YWOA 1NLOC 2JS0A 2VKNA 3TSWA 2JM9A 3EHQA 2YUPA 5FW9A 3VS6A 1QWEA 3R6NA 2L3PA 4KRTA 3UA7A 3M0PA 1PKTA 2BZ8A 1SEMA 2FPFA 2K6DA 1ARKA 4CC3A 2DF6A 1ZX6A 1CKAA 1MV0B 1NLPC 2ABLA 2RNAA 2QDLA 4CC2A 2IIMA 2KEAA 1GL5A 1AD5A 1M30A 1T0JA 2BZXA 2EVRA 4RTTA 2FRYA 4OMPA 4F17A 1WX6A 4RUGA 2K3BA 1AOJA 2RQVA 2W0ZA 3O5ZA 1UJYA 3RNJA 1SPKA 1M8MA 4E6RA 4HVVA 2J6OA 1WA7A 1VYTA 2RF0A 3VS1A 3I35A 1SSHA 1FYNA 2F2VA 2X3XD 1QKXA 4OMOA 2RN8A 2D8HA 1JU5C 2DL4A 1BBZA 1V1CA 2VWFA 4J9CA 1K1ZA 1Z9ZA 1X6BA 1WFWA 2AKKA 1U06A 1TUDA 2OJ2A 5IHIA 1AWXA 2A37A 2DL7A 1GFDA 2VVKA 2YT6A 2D0NA 1W70A 2RPNA 1I1JA 4LUEA 1UG1A 1UHFA 2GQIA 1AZEA 3NGPA 1WDXA 2JW4A 2JXBA 2GTOA 1M3AA 1QLYA 2DX1A 4DEYA 2KRSA 1JO8A 1TUCA 3VS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2B A;  1PNJ A;  4RTZ A;  4AFZ C;  2ESW A;  4CC7 A;  3EG3 A;  2EGA A;  1UFF A;  4K11 A;  2KGT A;  2EPD A;  3LH5 A;  1ZUU A;  1NM7 A;  4D8D A;  1Y57 A;  1W6X A;  1QKW A;  1K9A A;  1YP5 A;  2OI3 A;  1E7O A;  1NYG A;  2JMA A;  1HJD A;  1PKS A;  2PNI A;  1BB9 A;  2G6F X;  2KRO A;  2O9V A;  1GCQ A;  2KT8 A;  5GJV B;  2CT3 A;  1YWP A;  2O88 A;  3C0C A;  1WXT A;  3PVQ A;  2KR3 A;  4Z8A A;  2RQU A;  5ECA A;  1UJ0 A;  2EKH A;  2AKL A;  3QWY A;  2DLP A;  2FG0 A;  2MCN A;  3SHW A;  1N5Z A;  1BU1 A;  1UTI A;  2HEQ A;  2J06 A;  4AG2 C;  1E6G A;  2CDT A;  4LNP A;  3QWX X;  1AVZ C;  1NYF A;  2D8J A;  4Z88 A;  2I0N A;  1JEG A;  1EFN A;  1ZSG A;  4AFS C;  4CC4 B;  1X2Q A;  2GNC A;  3EGU A;  3UF4 A;  2KE9 A;  2NUZ A;  1UE9 A;  2FPE A;  4OMM A;  2DL3 A;  4OMQ A;  2KRM A;  1RLP C;  2DYB A;  4J9E A;  1B07 A;  2LMJ A;  2RQR A;  3U23 A;  4LN2 A;  2JMC A;  4J9H A;  2HBW A;  3ULR B;  2A08 A;  2H8H A;  2L0A A;  1ABQ A;  1E6H A;  2KXD A;  3I5S A;  2DRM A;  3H41 A;  5HCK A;  2KYB A;  4ZNX A;  3SEM A;  4RTX A;  4ORZ A;  1HSQ A;  4Z89 A;  3I5R A;  2C0I A;  2LJ1 A;  1K0X A;  1YCS B;  5IXF A;  1H3H A;  1VYV A;  1AZG B;  2BTT A;  2EYX A;  2ECZ A;  5IHN A;  4AG1 C;  2O9S A;  1VYU A;  2L3Q A;  1S1N A;  3VS3 A;  2KYM A;  2CSI A;  1MV3 A;  1XOV A;  2CUB A;  3A98 A;  2ROL A;  4JJC A;  1GBQ A;  2OAW A;  2ENM A;  1OV3 A;  1WIE A;  1GFC A;  2EQI A;  4QT7 A;  1WI7 A;  1OPK A;  2K2M A;  5IH2 A;  1WYX A;  3TVT A;  3JV3 A;  4OML A;  2HCK A;  2AZV A;  5L23 A;  4RTV A;  2LJ0 A;  2RQW A;  1WLP B;  1M3C A;  2X3W D;  4RTU A;  3M0T A;  2EYZ A;  2M51 A;  4JJD A;  1SRL A;  3VS7 A;  2DE0 X;  4DEX A;  2PZ1 A;  1RI9 A;  1A0N B;  2MOX A;  2J05 A;  1H8K A;  1M3B A;  2LP5 A;  2V1R A;  2A28 A;  2PTK A;  1PHT A;  4IIO A;  2LNH B;  4LE9 A;  2DMO A;  2LX7 A;  1X43 A;  1WXB A;  2DRK A;  2J6K A;  3PVL A;  2KT1 A;  2J6F A;  1I07 A;  1T3S A;  2HSP A;  2P4R A;  1GRI A;  1X27 A;  2DBM A;  1MUZ A;  2SEM A;  2FPD A;  1AWW A;  2LCS A;  4OMN A;  1BK2 A;  3EHR A;  1UEC A;  1QCF A;  4JZ3 A;  2HDA A;  1JQQ A;  1OOT A;  2JM8 A;  2RQT A;  2YDL A;  4J9I A;  2E5K A;  2SRC A;  1K76 A;  2C0T A;  2LQN A;  2W10 A;  1SRM A;  1H92 A;  1WXU A;  1RUW A;  1K0S A;  2F2W A;  2CUD A;  3EG1 A;  1AWO A;  3UA6 A;  4R0K A;  1UUE A;  1ZLM A;  3H0F A;  2FEI A;  2YUN A;  1CSK A;  1ZUK A;  2ED0 A;  1PRL C;  2K7A A;  1PRM C;  1ZBJ A;  4JPB W;  2FO0 A;  2GGR A;  2ROT A;  4RTY A;  2DBK A;  1NG2 A;  2DVJ A;  5FWB A;  2GTJ A;  2CT4 A;  1CKB A;  3VRY A;  2EBP A;  5IHK A;  1QWF A;  1G83 A;  1GCP A;  4RTW A;  5I11 A;  3M0R A;  5IXB A;  1OEB A;  1X69 A;  2EW3 A;  3PE0 A;  2ED1 A;  2B86 A;  1KSW A;  3H0I A;  4D8K A;  1ZUY A;  4F16 A;  1TG0 A;  2KNB B;  1JXM A;  1RLQ C;  2KXC A;  2MIO A;  3IQL A;  3EG0 A;  3VS0 A;  2CSQ A;  4IIM A;  1T0H A;  4HXJ A;  3M0U A;  1K4U S;  1T3L A;  1JXO A;  3VRZ A;  1U5S A;  3KFV A;  2EGC A;  2YUQ A;  2EGE A;  2DJQ A;  2CH4 A;  1KJW A;  1VA7 A;  2JTE A;  2D1X A;  2NWM A;  3FJ5 A;  4LUD A;  3CQT A;  2EYW A;  1Z9Q A;  4AFU C;  4HCK A;  2RMO A;  3NHN A;  3EG2 A;  4ESR A;  1YNZ A;  2JS2 A;  1GCQ C;  3ZL7 C;  1X6G A;  5I22 A;  2J7I A;  1KIK A;  4Y92 A;  2K9G A;  2AZS A;  2FRW A;  2KBT A;  1ABO A;  1KFZ A;  4X1V A;  2L2P A;  5EC7 A;  4GLM A;  4EIK A;  2AK5 A;  2KRN A;  1AEY A;  4J9B A;  4JZ4 A;  3UAT A;  2EYY A;  4WCI A;  2K79 A;  2F2X A;  2V1Q A;  2LQW A;  3RBB B;  2BZY A;  2C0O A;  4HVW A;  3REA B;  4HVU A;  3TSZ A;  4FSS A;  1Y0M A;  2DM1 A;  2LZ6 B;  3NPF A;  1AWJ A;  1IO6 A;  3VS4 A;  2DL8 A;  4AFQ C;  2JT4 A;  1W1F A;  3REB B;  1B3Q A;  1SHF A;  4M4Z A;  1U3O A;  1SHG A;  5FWC A;  2YSQ A;  1J3T A;  1YN8 A;  1HD3 A;  3H0H A;  2L3S A;  4GBQ A;  2XMF A;  2DIL A;  1I0C A;  3NMZ C;  3I9Q A;  3THK A;  1UDL A;  4J9F A;  5GJW B;  1NEG A;  2CH4 W;  1X2K A;  2O2O A;  2DNU A;  4JJB A;  3M0S A;  3GBQ A;  3VS5 A;  1OPL A;  3M0Q A;  1PWT A;  2CRE A;  2DA9 A;  2LJ3 A;  4J9G A;  1UHC A;  1GBR A;  2GBQ A;  4J9D A;  2M0Y A;  4F14 A;  2A36 A;  1UGV A;  1M27 C;  2O31 A;  1LCK A;  1NEB A;  2YUO A;  4A63 B;  1FMK A;  2DL5 A;  1YWO A;  1NLO C;  2JS0 A;  2VKN A;  3TSW A;  2JM9 A;  3EHQ A;  2YUP A;  5FW9 A;  3VS6 A;  1QWE A;  3R6N A;  2L3P A;  4KRT A;  3UA7 A;  3M0P A;  1PKT A;  2BZ8 A;  1SEM A;  2FPF A;  2K6D A;  1ARK A;  4CC3 A;  2DF6 A;  1ZX6 A;  1CKA A;  1MV0 B;  1NLP C;  2ABL A;  2RNA A;  2QDL A;  4CC2 A;  2IIM A;  2KEA A;  1GL5 A;  1AD5 A;  1M30 A;  1T0J A;  2BZX A;  2EVR A;  4RTT A;  2FRY A;  4OMP A;  4F17 A;  1WX6 A;  4RUG A;  2K3B A;  1AOJ A;  2RQV A;  2W0Z A;  3O5Z A;  1UJY A;  3RNJ A;  1SPK A;  1M8M A;  4E6R A;  4HVV A;  2J6O A;  1WA7 A;  1VYT A;  2RF0 A;  3VS1 A;  3I35 A;  1SSH A;  1FYN A;  2F2V A;  2X3X D;  1QKX A;  4OMO A;  2RN8 A;  2D8H A;  1JU5 C;  2DL4 A;  1BBZ A;  1V1C A;  2VWF A;  4J9C A;  1K1Z A;  1Z9Z A;  1X6B A;  1WFW A;  2AKK A;  1U06 A;  1TUD A;  2OJ2 A;  5IHI A;  1AWX A;  2A37 A;  2DL7 A;  1GFD A;  2VVK A;  2YT6 A;  2D0N A;  1W70 A;  2RPN A;  1I1J A;  4LUE A;  1UG1 A;  1UHF A;  2GQI A;  1AZE A;  3NGP A;  1WDX A;  2JW4 A;  2JXB A;  2GTO A;  1M3A A;  1QLY A;  2DX1 A;  4DEY A;  2KRS A;  1JO8 A;  1TUC A;  3VS2 A; 
#chains in the Genus database with same CATH topology
 4LD6 A;  4AFZ C;  3QUI A;  3EG3 A;  2E65 A;  4Y28 E;  4K11 A;  2KGT A;  1OX9 A;  1RAC B;  1ZUU A;  2COZ A;  1W6X A;  5KYW A;  2OI3 A;  4X34 A;  2PNI A;  2G6F X;  1VQM A;  4EMH A;  3A5Z B;  2CZ7 B;  4Z8A A;  3BFM A;  2JZ2 A;  4DBF A;  4JRP A;  2EKH A;  1YHQ T;  1MHN A;  5GAN 6;  3SHW A;  2X35 A;  3CC7 Q;  4AG2 C;  2OTJ Q;  3GIB A;  4MML A;  2HKQ B;  4M7D F;  4LNP A;  4C8Q E;  1AVZ C;  1NYF A;  2XDB A;  4BY6 B;  1Q95 G;  5I2S A;  2RI5 A;  1EFN A;  2NUT A;  3T9N A;  3JCM h;  4AFS C;  4QVD A;  1YJN A;  2MWO A;  2GNC A;  3FLG A;  1K73 R;  2KE9 A;  4FT2 A;  3JB9 I;  3HHT B;  2QEX T;  1X6O A;  4OMM A;  3L2Z A;  5I21 A;  1RLP C;  3L1A A;  2AT1 B;  2LMJ A;  4KUI A;  1YHQ Q;  4C0D B;  4LN2 A;  2ZGW A;  4E7S A;  2JMC A;  4ANJ A;  2WSC E;  2QGF B;  2QTV A;  4DBQ A;  5GMK l;  3H41 A;  2PQW A;  5HCK A;  2KYB A;  4C0F A;  1HSQ A;  2QG9 B;  4M7D G;  1ZBX A;  1H3H A;  3AT1 B;  2B8A A;  1AZG B;  4L59 A;  3CCS Q;  4OGE A;  2L3Q A;  2O9S A;  3VS3 A;  1ZQ1 A;  4FIB A;  1KQS S;  2JTM A;  1MV3 A;  4M7A A;  3E9G A;  2MPX C;  3CME T;  5GAN 7;  3CPW S;  2ROL A;  4JJC A;  3VV0 A;  4M75 C;  2DIG A;  2ENM A;  2XDP A;  5LJ5 e;  5GAM d;  2EQI A;  4N4H A;  2K2M A;  1P92 A;  1WYX A;  3VU3 C;  1VOM A;  2HCK A;  4B6M A;  1XJW B;  1YI2 Q;  2VGM A;  1KD1 R;  4JJD A;  1M1K R;  5LJ5 j;  3FJP A;  1K8A C;  3VS7 A;  5CO7 A;  4R55 A;  3S3M A;  3CCQ A;  2HL3 A;  2BKD N;  1RI9 A;  1GXI E;  1A0N B;  2Y4Y A;  3G6E Q;  1UGQ B;  2XIC A;  1KC8 U;  1H8K A;  1NZ9 A;  2LP5 A;  2DER A;  4NOY A;  4M78 A;  1VQ5 T;  2PTK A;  4IIO A;  2FZG B;  3CCM T;  2DMO A;  5GAM e;  3PVL A;  3OYG A;  5FRN A;  1T3S A;  2P4R A;  3CD6 Q;  2DBM A;  4M7D B;  3OYN A;  3OYM A;  2LT4 A;  2FPD A;  3CCE T;  1RI0 A;  2XK0 A;  5CK9 A;  4PKC C;  4M7A E;  1JQQ A;  3SDZ A;  4J9I A;  3A8H B;  4Z02 A;  2C0T A;  3CCR A;  2X4W A;  3HL8 A;  1RUW A;  5CQY A;  3QJ6 A;  1PCX A;  3CC2 A;  4EPC A;  3HP9 A;  2I2L A;  5GAO n;  5LJ3 f;  6AT1 B;  3G71 T;  1BCM A;  3CME Q;  2ED0 A;  3GNG A;  1O75 A;  3NTH A;  4M77 F;  4JPB W;  5GMK j;  1QW1 A;  2QQS A;  2ROT A;  1YJN Q;  2DBK A;  2DD4 A;  2GTJ A;  2JJ9 A;  1GCP A;  3OS5 A;  5I11 A;  5IXB A;  1OEB A;  1WHK A;  2E64 A;  2QDY B;  2L8D A;  3VYH B;  1KSW A;  4PNO A;  1ZUY A;  1MMD A;  1TG0 A;  2KNB B;  1RLQ C;  2KXC A;  3ZBD A;  3CC4 A;  3VS0 A;  4C92 C;  3LW5 E;  1K4U S;  1T3L A;  1TWB A;  2HKN A;  2RB6 A;  3VRZ A;  1U5S A;  2EGC A;  4PLI A;  2EGE A;  2QQB A;  5CKB A;  2D1X A;  3I55 Q;  2QAZ A;  1VQL T;  1QP2 A;  4M77 C;  1PM3 A;  5D6Y A;  1R0B G;  1YNZ A;  1X6G A;  2K9G A;  2AZS A;  4BE0 A;  3L2W A;  1I8F A;  2DXT A;  3CD6 T;  5LJ3 h;  2AK5 A;  2LTO A;  2GFA A;  2FVU A;  1S72 A;  1KQ2 A;  2X4J A;  3X20 B;  2Y90 A;  2V1Q A;  4HVW A;  3REA B;  1LVK A;  4FSS A;  1SSF A;  1BIB A;  4E7I A;  4M75 E;  1AWJ A;  4J7I A;  4PJM A;  3CBO A;  1C1A A;  5GAM h;  5LJ5 g;  2XD0 A;  3WVE B;  2DTI A;  1SF9 A;  3X25 B;  5FWC A;  1SHG A;  1J3T A;  3GLX A;  3MHX A;  5FU6 C;  2HQH A;  2XMF A;  3GF5 A;  2X9H A;  3UWN A;  2RI3 A;  3NMZ C;  4OF1 A;  3QZ9 B;  2MYS A;  4C5H A;  1ZSZ B;  5DLO A;  1QVF S;  1NEG A;  2E1H A;  2DNU A;  1RAA B;  3URG A;  3M0Q A;  1PWT A;  2H3J A;  2LJ3 A;  2H3E B;  4ZGD B;  4PFZ A;  1UGV A;  3MEW A;  5DY9 A;  4IUT A;  1IGU A;  2YUO A;  1Q86 C;  5KYY A;  4LXC A;  1VQP A;  1N9S A;  4C0D C;  3CCJ A;  2F5T X;  2YLC A;  2F69 A;  2L3P A;  2DVE A;  3DB4 A;  2CKK A;  1KHI A;  1M9S A;  3M0P A;  5CQX A;  2RJC A;  4MZT A;  1PKT A;  4QKU A;  4CC3 A;  1CKA A;  4FW1 A;  2QAS A;  1NLP C;  4ELZ C;  2ZPH B;  4C8Q D;  3GNF B;  1TH7 A;  3CXC P;  3JCM J;  2IIM A;  1GL5 A;  2CS7 A;  7AT1 B;  4DOV A;  2RI2 A;  4RCB A;  2D6F A;  3E9F A;  3M4Y A;  1WX6 A;  3M59 A;  5GMK i;  4ZTF A;  1K73 U;  3O5Z A;  3EGD B;  1PC0 A;  2AHJ B;  1M8M A;  1VQ4 T;  4F7U E;  1WJQ A;  4ME7 A;  4RCC A;  1M8V A;  2L5Q A;  3VS1 A;  3FB9 A;  2D0Q B;  1QKX A;  2RN8 A;  4PLL A;  2L89 A;  1JU5 C;  2DL4 A;  1LOJ A;  2M02 A;  1X6B A;  3CCM Q;  1WFW A;  3WXM B;  1BI0 A;  5GAO l;  1BIA A;  1EIF A;  2OJ2 A;  3OYE A;  4XU3 A;  4WTO B;  3RUX A;  3OYC A;  1GFD A;  4OB2 B;  5DLQ E;  4UC4 A;  2YT6 A;  3FDR A;  4N0A C;  1I1J A;  2XU8 A;  2P84 A;  1W4S A;  2NUP B;  2BUD A;  1WDX A;  2LQK A;  4R56 A;  4C8Q G;  1M3A A;  3GP8 A;  5KE3 A;  2DX1 A;  1JO8 A;  1TUC A;  3PGG A;  1QCO A;  1PNJ A;  4RTZ A;  4V2S A;  1B34 B;  2EPD A;  3JCM P;  2DZ9 A;  4D8D A;  1Y57 A;  1N9R A;  3QO3 A;  1YP5 A;  4F7U B;  2JMA A;  1HJD A;  1M1F A;  3CC7 T;  1BB9 A;  4PJO G;  2KT8 A;  5CKH A;  5GJV B;  3JB9 D;  2CT3 A;  1WXT A;  5GAM j;  1FX7 A;  5GAM f;  5ECA A;  3G4S A;  3LGF A;  3RKX A;  4KH1 B;  2J06 A;  1E6G A;  5HK3 A;  2CDT A;  1D0Y A;  2D8J A;  1V76 A;  4Z88 A;  1JEG A;  4J6X A;  2M16 A;  5FLX E;  2DZC A;  1ZSG A;  2LQ8 A;  2CGH A;  3UF4 A;  1RAF B;  2E3I A;  2RK2 A;  5AT1 B;  2FPE A;  1VQM Q;  4FYW B;  2KRM A;  1S72 Q;  4C92 G;  3SWN A;  1N8R R;  4O5V A;  4N4I A;  1N6A A;  3EG9 A;  1JJ2 P;  3EGX A;  2LRQ A;  1Q82 R;  3ULR B;  2H8H A;  3CC2 T;  1ABQ A;  3OYJ A;  3LWH A;  3HRU A;  3CCQ T;  2DRM A;  1C6V X;  3SEM A;  5LJ5 d;  4RTX A;  4RG2 A;  3I5R A;  5GAN 5;  2CYZ B;  3X26 B;  5IXF A;  4PFO A;  1Q86 U;  2V26 A;  2EYX A;  4AG1 C;  3CCV T;  1HXD A;  1M4Z A;  3KBG A;  2KYM A;  1S72 T;  4RG8 A;  2D9T A;  4XAX B;  2VUB A;  3I56 Q;  2CUB A;  2RD1 A;  3A98 A;  3G7Z A;  4J7F A;  1D1A A;  1GBQ A;  4OGC A;  2LDM A;  1YCY A;  1EZZ B;  2NLU A;  5KYN A;  1GFC A;  2ATC B;  1RAI B;  4C5G A;  3CCV Q;  2NUP A;  5LJ3 e;  2EQM A;  5IAY A;  2V8K A;  3J81 E;  3JCM d;  4A4H A;  2LJ0 A;  2VGN A;  1WZO A;  3OYY A;  2M51 A;  3G71 A;  1SRL A;  1OZ2 A;  2GFU A;  5HKC A;  4DEX A;  3CXC S;  2O01 E;  3LGL A;  2QXF A;  2J05 A;  3DLM A;  3MEU A;  2K5L A;  3VUZ A;  2A28 A;  4M78 C;  3RDV A;  3JCM g;  3S3O A;  3JB9 H;  2LX7 A;  1VQN Q;  2KT1 A;  3V8K A;  2A7Y A;  2RK1 A;  3JCM e;  1QVG S;  2HSP A;  5FU7 B;  1GRI A;  4LDW A;  4ELY C;  2YHT A;  1MUZ A;  4M77 D;  4PFP A;  3QPH A;  2LCS A;  4OMN A;  1UEC A;  4JZ3 A;  4FM4 B;  1TU0 B;  1WGS A;  2QA4 Q;  1VQ8 T;  1H64 1;  1M2V A;  1OOT A;  3RR6 A;  4KGZ B;  3MP1 A;  1K76 A;  2LQN A;  9ATC B;  1H92 A;  1WXU A;  1K0S A;  1U8R A;  2CP7 A;  2P0Q A;  3UA6 A;  4R0K A;  4FYX B;  1UUE A;  5KYU A;  4PJN A;  3TU4 K;  3H0F A;  2FEI A;  2QQR A;  1C0M A;  1ZUK A;  2FO0 A;  2GGR A;  2QEX A;  4PJO C;  3X24 B;  1PD1 A;  2CT4 A;  4OB1 B;  1CKB A;  5GAN h;  1Y96 A;  4QQD A;  3OW2 P;  2R5M A;  2ED1 A;  3H0I A;  4Y91 A;  4D8K A;  2DTO A;  2IVW A;  2KQW A;  1JXM A;  3IQL A;  2OTJ A;  2OTJ T;  5GAN 4;  3SFM A;  4DBR A;  4M7D E;  2YUQ A;  1YBY A;  2DJQ A;  2E5Q A;  2DD5 A;  4XTV A;  2CH4 A;  3HRS A;  1VA7 A;  3FJ5 A;  3CQT A;  2EYW A;  4KUD K;  1KC8 R;  4AFU C;  4PJL A;  4FYV B;  2HL5 C;  1VQ6 Q;  1U1S A;  1PD0 A;  3MO8 A;  1R8O B;  3ZL7 C;  1KD1 U;  5I22 A;  4Y92 A;  2G3R A;  1VQO A;  2RHI A;  2KBT A;  1KK7 A;  3MCA B;  1WHG A;  1IRX A;  3OYI A;  4GLM A;  1N27 A;  5CVI A;  4JRQ A;  4F7U G;  2KRN A;  1VQ4 A;  5I2M A;  3S3N A;  5DM7 R;  1LJO A;  4PJJ A;  2F2X A;  2LQW A;  3RBB B;  2BZY A;  2K57 A;  1BI3 A;  4HVU A;  4E2F B;  2YRD A;  4HA8 A;  1ZA2 B;  4VUB A;  3NPF A;  3UT1 A;  4E47 A;  1VIF A;  3SWN C;  3UPU A;  1IO6 A;  4N0A A;  3VS4 A;  3CC4 Q;  4BDZ A;  3I56 A;  1U1T A;  3VYG A;  4JUV A;  1KD1 C;  1Q81 R;  3CD6 A;  1W1F A;  3D7S B;  1Q7Y R;  4YTL A;  2IG0 A;  2YSQ A;  1VQM T;  4C92 B;  2VXF A;  2L3S A;  4M7D C;  1MGQ A;  1I0C A;  5A0D A;  4JRI A;  2M9U A;  2O4X B;  4J9F A;  5FRM A;  3G4S Q;  2O2O A;  4JJB A;  1WPY A;  1VQ6 T;  4FU6 A;  5KE2 A;  1OPL A;  4C92 D;  2F1L A;  3QXE B;  1Q82 U;  2NUT B;  4JLG A;  3OYA A;  1LCK A;  2GF7 A;  1KG1 A;  4A63 B;  1OU9 A;  5GAN 8;  3JCM b;  2VV5 A;  3EH2 A;  2RJF A;  1PSF A;  2YRC A;  3TSW A;  4PJO F;  3A1P A;  2QA4 A;  2YUP A;  2KMT A;  1WHL A;  1QWE A;  3OS0 A;  3CMA Q;  1VQ9 T;  3EFO A;  4OVA A;  2BZ8 A;  5A0L A;  2DIQ A;  1VQ7 Q;  4N4G A;  2GQV A;  2DF6 A;  5GAO r;  4QW2 A;  5HY6 A;  1MV0 B;  3CME A;  4XU0 A;  1QQJ A;  2QDL A;  3M55 A;  4KGX B;  3RES A;  1AD5 A;  2R57 A;  4TVR A;  2OTL T;  2DO3 A;  5J39 A;  3MP6 A;  2Z0W A;  2FB7 A;  1FMV A;  2RHY A;  5FU6 B;  1YJW T;  4C8Q F;  2W0Z A;  3QG1 A;  4KT0 E;  4M7A B;  3CBM A;  1VQ5 Q;  1SPK A;  1M90 R;  1KC8 C;  4E7J A;  2J6O A;  3CPW A;  2FZK B;  4X9D A;  5LJ5 h;  3E1S A;  2QEX Q;  4EMG A;  4LDX A;  1VQK T;  3JSC A;  4OMO A;  3NTK A;  1BBZ A;  1V1C A;  1K1Z A;  2BIV A;  4GY5 A;  1I5O B;  4XTW A;  2AKK A;  3LX7 A;  1UGP B;  4EMK A;  4LD9 K;  4PJO D;  1QCN A;  1N8R U;  1TUD A;  2COW A;  2XID A;  4M75 A;  2A37 A;  2RHZ A;  2VVK A;  1W70 A;  5FU7 C;  3CCJ Q;  3MPU B;  3CCQ Q;  1W2B P;  4LUE A;  1UG1 A;  3PIO A;  3QSU A;  1UHF A;  3I55 T;  1AZE A;  4QVC A;  1VQ7 A;  4KUL A;  2EJG A;  2YRV A;  2E10 A;  2JXB A;  2QGG A;  2LC4 A;  5LJ5 f;  5CR2 A;  3VS2 A;  4FYY B;  3DB3 A;  1G2B A;  2DET A;  3BY7 A;  1YIT A;  4FT4 A;  3RMS A;  3LH5 A;  3CCL Q;  4ATO A;  3QDF A;  3JCM f;  8AT1 B;  4RMO A;  1D1B A;  1QKW A;  1K9A A;  1OI1 A;  3N5B B;  1E7O A;  1PSE A;  2VC8 A;  2ZPF B;  1JRI A;  5KYW B;  2RJD A;  1YJW Q;  1VQN T;  2KRO A;  4M78 D;  1YWP A;  5CKE A;  3C0C A;  2O88 A;  3SWN B;  1VQ4 Q;  3CCS A;  3PVQ A;  5GAN 2;  2RQU A;  1Q81 U;  4E7Z A;  3JCM Q;  2M0O A;  4BE2 A;  3JB9 J;  2AKL A;  3MKD A;  4RKU E;  2K3X A;  2FG0 A;  2MCN A;  3M5A A;  1BU1 A;  1IRE B;  1UTI A;  2HEQ A;  3CC4 T;  3JRZ A;  1M5Q 1;  4MDW A;  5KYY B;  3A8M B;  3QWX X;  4M77 B;  1MNE A;  2E3H A;  1VQO Q;  2OX7 A;  2KAF A;  1NJI U;  4CC4 B;  1H3Z A;  5LJ3 d;  1IXD A;  2NUZ A;  2ZAE A;  3HFN A;  5C0M A;  4L5G A;  3SB2 A;  2VB6 A;  1UE9 A;  1KHC A;  2DL3 A;  1WJS A;  4HT9 A;  4JS4 A;  1NE8 A;  2DYB A;  3OS2 A;  2K2V A;  2DAQ A;  3TRE A;  4C0Z A;  2KI7 A;  3U23 A;  2K4Y A;  4BDY A;  1B7T A;  3OW2 S;  2HBW A;  2A08 A;  1FWZ A;  4IUU A;  4XTY A;  2KXD A;  2E6N A;  4OB0 B;  4J6W A;  5LJ3 g;  4ORZ A;  4M7D A;  1JJ2 A;  4IKF A;  1R77 A;  2C0I A;  1K0X A;  1LNX A;  2YLB A;  2JN0 A;  1Q82 C;  3OYD A;  4JLI A;  1RAG B;  2DEQ A;  3V7S A;  2DKG A;  2BTT A;  4KH0 B;  1NJI C;  2ECZ A;  3V7R A;  1RAB B;  3HRT A;  1PG5 B;  5GAN d;  4DQ2 A;  2XI9 A;  1XOV A;  4M78 F;  1JBM A;  1OU8 A;  5EG2 A;  4BD3 A;  2F5K A;  2JNG A;  2E41 A;  1WI7 A;  1OPK A;  1G5V A;  1VQO T;  3CCS T;  2V8J A;  4M78 B;  4M77 G;  3TVT A;  3OYF A;  5IT9 E;  4OML A;  5L23 A;  1RAD B;  1I81 A;  4BI8 B;  2OAU A;  1N8R C;  2X3W D;  4HCB A;  3M0T A;  2EYZ A;  1G3S A;  3ASK A;  5FRO A;  1YJ9 T;  2AIR B;  4IUV A;  2PZ1 A;  3L2V A;  2MOX A;  5A2Q E;  2OTL Q;  1YIT T;  1M3B A;  2CP2 A;  2HAX A;  2E70 A;  2JVV A;  4XU2 A;  2V1R A;  2RH2 A;  3RMQ A;  3S6W A;  3CCU A;  4J5Y A;  4M77 A;  4LE9 A;  5GMK h;  2CZ1 B;  1WXB A;  2J6K A;  1ZSZ A;  3RKW A;  3M4G A;  2QQA A;  4FL6 A;  3I55 A;  5GAN j;  1X27 A;  1LPL A;  1YJN T;  1VQ9 Q;  4GLK A;  4ZTJ A;  2XKO C;  1YIJ Q;  2K5I A;  2SEM A;  1AWW A;  1QCF A;  2DXU A;  2A3L A;  2WSF E;  2HDA A;  5D6W A;  2KSS A;  2JM8 A;  2QK0 A;  3A8O B;  2E5K A;  2SRC A;  2W10 A;  1D1C A;  3CCL A;  5HK0 A;  2KVQ G;  1I4K 1;  2CUD A;  2F2W A;  3EG1 A;  3JCM V;  1ZLM A;  2HMA A;  3G6E A;  3H6Z A;  1XTD A;  3OYK A;  2MF2 A;  1CSK A;  1I5L A;  2RJE A;  1VQN A;  4F7U F;  1K8A R;  3MEV A;  5FWB A;  1FMW A;  1EX4 A;  2PU9 B;  2EBP A;  5IHK A;  4BY6 C;  1QWF A;  5GAN e;  1G83 A;  5CKF A;  2JTF A;  3M0R A;  1M2O A;  2MWP A;  3E19 A;  4XTU A;  3PE0 A;  3ZEH A;  2B86 A;  5LJ3 j;  4E7K A;  4HT8 A;  4A4F A;  3HPW A;  3X28 B;  3EG0 A;  4IIM A;  5C6S A;  1IZ6 A;  2QQ9 A;  4HXJ A;  3CXC A;  4ZN1 A;  3R6O A;  2BE9 B;  2KDS A;  3KFV A;  1WHH A;  3PFS A;  2MMP A;  4LUD A;  2JTE A;  3LLR A;  3M9Q A;  3LWI A;  1Z9Q A;  2CP6 A;  3L42 A;  2RMO A;  1QVF A;  3CCJ T;  3NHN A;  4CI0 C;  3OYB A;  3EG2 A;  2FYK A;  1QVP A;  2EFI A;  1GCQ C;  3PMI A;  3E2U A;  2CZ6 B;  4BB7 A;  2J7I A;  1KIK A;  2HSE B;  2FRW A;  1ABO A;  2JUF A;  4X1V A;  3L2U A;  2ZPI B;  4B9W A;  5EC7 A;  2M1H A;  2GCX A;  5J3B A;  4E7H A;  1AEY A;  4J9B A;  4IUQ A;  3UAT A;  3INZ A;  3JB9 G;  2EYY A;  5CKD A;  2K79 A;  1Q7Y C;  1YFN A;  3TSZ A;  1MMG A;  1Y07 A;  2IPO B;  2P0K A;  4EMK C;  1JB0 E;  2LZ6 B;  3PNW C;  1YJ9 Q;  2A0F B;  3VJP A;  5GAM g;  3JCM c;  2EQJ A;  3CEY A;  3QDR B;  2CZ0 B;  2DL8 A;  1K8A U;  3G71 Q;  4MMK A;  1OQK A;  3MET A;  3OA6 A;  2XHC A;  1B3Q A;  1QP3 A;  3EFO B;  4M4Z A;  4DOW A;  4L6V 5;  3GOX A;  3C12 A;  1HK9 A;  1VQ8 A;  4FSX A;  5IN1 A;  1HD3 A;  1ZHI A;  4GBQ A;  3H8Z A;  1YJW A;  3THK A;  1O9S A;  1BCO A;  5GJW B;  1M2V B;  4IUP A;  5KCH A;  2OTL A;  1X2K A;  1VQK Q;  3ZFJ A;  1D0X A;  4XTX A;  5LL6 S;  5AYF A;  3GBQ A;  3VS5 A;  1K9M U;  4DBH A;  1G3W A;  2DA9 A;  4M7A F;  4J9G A;  1GBR A;  2GBQ A;  4J9D A;  4F14 A;  1G3T A;  1M27 C;  2O31 A;  1NEB A;  4XQ3 A;  3M53 A;  2EIF A;  3J80 E;  1FMK A;  3BW1 A;  3OSS C;  1NLO C;  1TXQ A;  2JS0 A;  2VKN A;  4WF2 A;  2DYI A;  2JOY A;  1UB4 A;  4OMF B;  2PUK B;  4LDY A;  4M75 B;  1AT1 B;  4PL6 A;  2DTH A;  3L2Q A;  4KRT A;  3UA7 A;  1MMA A;  1VUB A;  1ARK A;  1SEM A;  2FPF A;  2HNI A;  2K6D A;  3EH1 A;  2ZZD A;  3PTA A;  3PT9 A;  1VQ8 Q;  4XK8 E;  2RNA A;  4CC2 A;  2DFU A;  2KEA A;  3FC3 A;  4HCC A;  2FRY A;  2MK5 A;  2LX9 A;  4PK4 A;  4RUG A;  2VYT A;  3EFS A;  1AOJ A;  3C4S A;  1UJY A;  3M54 A;  2EQK A;  1D3B B;  4HVV A;  3UDC A;  3VUB A;  1WA7 A;  1D09 B;  3OY9 A;  3QBY A;  3PIP A;  1XNI A;  2E12 A;  3G4S T;  1FYN A;  2K3Y A;  2DPP B;  4C0G A;  5D6X A;  2P4T A;  3QJY A;  3J7A F;  5IHI A;  1AWX A;  3C95 A;  2EKO A;  3WVD B;  4XU1 A;  2FL7 A;  3KXT A;  4LDV A;  2C06 A;  2GQI A;  4C5E A;  3NGP A;  2FZC B;  1F1B B;  1K73 C;  3LH0 A;  3NFC A;  4DEY A;  2KRS A;  1BYM A;  4M7D D;  4QQG A;  1QMC A;  2ESW A;  4CC7 A;  2ZPB B;  2EGA A;  1UFF A;  3FEO A;  3V7C A;  2DEU A;  2NYS A;  1NM7 A;  2R5A A;  4A54 A;  1YIJ A;  5GAO m;  1NYG A;  1PKS A;  2O9V A;  1GCQ A;  3LYI A;  1VQP T;  1D3B A;  3P8D A;  2KR3 A;  1M1K C;  1NPP A;  1IB8 A;  1B34 A;  4BAC A;  1VQK A;  1UJ0 A;  4Q5W A;  3GPL A;  3CCL T;  3MP8 A;  4MDX A;  3QWY A;  2DLP A;  4M75 F;  3HTR A;  1N5Z A;  2LT1 A;  5KCO A;  2HZY A;  2ZCF B;  3BE3 A;  3P8B B;  2I0N A;  2WAC A;  1YI2 T;  3ME9 A;  2FHD A;  3EAE A;  1X2Q A;  3EGU A;  2LVM A;  3V8J A;  5L8R E;  1VQP Q;  4C92 F;  1YI2 A;  2KY9 A;  2COY A;  2YXY A;  4OMQ A;  3CMA T;  4M75 D;  4J9E A;  1B07 A;  2RQR A;  5M9O A;  3M57 A;  4BE1 A;  1X01 A;  4J9H A;  5KH6 A;  1R0C B;  4C8Q A;  3EGX B;  1UGR B;  2DXB A;  2WSE E;  2DJZ A;  2L0A A;  1ACM B;  1E6H A;  3I5S A;  3VKI A;  4J83 A;  3OYL A;  3ER0 A;  3OBW A;  4ZNX A;  1QVF P;  3CCE Q;  4Z89 A;  1NPR A;  5GAO p;  2LJ1 A;  5CCA A;  1VQL Q;  1YCS B;  1YIJ T;  8ATC B;  3KUF A;  1VYV A;  2XDD A;  3OSV A;  5IHN A;  1TSF A;  2EJ9 A;  3QII A;  4JDS A;  2CP3 A;  2K5F A;  1VYU A;  4QQ6 A;  1S1N A;  2CSI A;  1D0Z A;  3QHS A;  3CCU Q;  1VQ5 A;  1M90 C;  3JB9 F;  3CCR Q;  4A4K A;  1OYX A;  3Q1J A;  4BI4 A;  2OAW A;  1OV3 A;  1WIE A;  4QT7 A;  1VQ7 T;  1KQS A;  5IH2 A;  3JV3 A;  4M77 E;  2AZV A;  3C94 A;  4RTV A;  3OBY A;  2DXC A;  4B9X A;  3EG9 B;  5GAN 3;  2RQW A;  1WLP B;  1M3C A;  4RTU A;  2MAM A;  1TOV A;  4AT1 B;  1KQS P;  3RER A;  2DE0 X;  5KYU B;  3OYH A;  2HQE A;  3CC2 Q;  4NL2 A;  5CAI A;  1IHV A;  2RA2 A;  2XG8 D;  1PHT A;  3QKJ A;  2LNH B;  2RM4 A;  1X43 A;  2DRK A;  2J6F A;  1I07 A;  1NJI R;  2Y4X A;  3OMC A;  4J8O A;  1Y71 A;  2RHX A;  3SD4 A;  2EQU A;  1BK2 A;  3EHR A;  4A53 A;  4BUG A;  3FRN A;  1SKU B;  1RL2 A;  2HD0 A;  2RQT A;  2YDL A;  2LCC A;  1SRM A;  4M78 E;  1UEB A;  1Q86 R;  1AWO A;  1WHJ A;  1X75 C;  1V29 B;  1SG5 A;  5GMK m;  4PJO E;  4X9C A;  3NTI A;  2R58 A;  2YUN A;  3I56 T;  2QYZ A;  1PRL C;  2K7A A;  1PRM C;  3O8V A;  1K9M R;  1ZBJ A;  1BI1 A;  4RTY A;  2P0P A;  3TEE A;  3A8G B;  1NG2 A;  2DVJ A;  2X4Y A;  2DK3 A;  4P5N A;  3VRY A;  2HQX A;  1JJ2 S;  4RTW A;  3JCM W;  2E6Z A;  3JAM E;  1G3Y A;  1VIE A;  1X69 A;  2EW3 A;  4E7L A;  4F16 A;  2LNV A;  2CP5 A;  3EGD A;  2MIO A;  3TQ7 P;  2CSQ A;  4ZN3 A;  1T0H A;  1BI2 A;  3JCM X;  3MEA A;  3M0U A;  1VQ6 A;  4JRK A;  2VAS A;  2EWN A;  1JXO A;  1M1G A;  1QVG P;  3BDL A;  1OZ3 A;  1KJW A;  2NWM A;  5D7U A;  1VQ9 A;  3OMG A;  2CP0 A;  3V8L A;  4MZP A;  4ZGE B;  4HCK A;  1WNL A;  4C8Q B;  3L2R A;  4FCY A;  3RKY A;  2PVD B;  4ESR A;  3CPW P;  3BDU A;  1QVG A;  2JS2 A;  1VQL A;  4J6Y A;  4C5I A;  3CBP A;  1KFZ A;  2X4X A;  3PMT A;  2L2P A;  3OB9 A;  3CCR T;  2VXE A;  4EIK A;  4NS5 A;  4EDU A;  4F7U A;  3HSB A;  4CRI A;  1FXX A;  2KK4 A;  1M90 U;  1IGQ A;  3DLL A;  4PJO B;  4JZ4 A;  3FIF A;  3TCJ A;  5KYX A;  5CIU A;  4M78 G;  1RAH B;  2EAY A;  4KGV B;  1Y96 B;  4WCI A;  4DA4 A;  1W2B A;  1WQ7 A;  4AMC A;  2C0O A;  1Y0M A;  1ZA1 B;  4OP0 A;  2DM1 A;  4OB3 B;  4O6J A;  1DJ7 B;  3CCM A;  3RIR A;  4C92 E;  4PJO A;  3A8L B;  4AFQ C;  4M7A D;  2HBP A;  4JJN K;  2JT4 A;  3M58 A;  2ZPG B;  3REB B;  2RO0 A;  4F04 B;  1SHF A;  1U3O A;  1YN8 A;  3MJX A;  4A4E A;  3H0H A;  1WHM A;  2X51 A;  2QA4 T;  2DIL A;  4II1 A;  4M7A G;  1OUL A;  3I9Q A;  4XTZ A;  1UDL A;  4LDU A;  3OQ5 A;  2EJF A;  1TTH B;  2CH4 W;  2PUO B;  1W2B S;  1KQ1 A;  3M0S A;  1Y7X A;  5GAN f;  1TUG B;  4M7A C;  2EYQ A;  4M75 G;  3QYH B;  2CRE A;  1YHQ A;  5A0G A;  1UHC A;  2M0Y A;  2A36 A;  2V8I A;  3AHU A;  1TS9 A;  5KYX B;  1HYO A;  2DL5 A;  1YWO A;  4QVZ A;  4JS5 A;  2JM9 A;  3EHQ A;  2RHU A;  1WQW A;  4ZGJ B;  3F70 A;  2QI2 A;  5FW9 A;  4C92 A;  3VS6 A;  3R6N A;  2LCL A;  1RAE B;  4NL3 A;  3CPF A;  3DKM A;  3OW2 A;  4HCZ A;  1MMN A;  3HKS A;  1ZX6 A;  4HKE A;  1XQH A;  4FW2 A;  3QZ5 B;  4A4G A;  2ABL A;  3CCE A;  3CMA A;  4KBM B;  3QYG B;  5GAN g;  1M30 A;  4C8Q C;  1T0J A;  1ZSZ C;  2BZX A;  2EVR A;  3CCV A;  5GAO q;  4RTT A;  3G1J A;  4F17 A;  4OMP A;  4D6W A;  1Q7Y U;  1WJR A;  2K3B A;  4BI3 A;  2RQV A;  1BKB A;  1OX8 A;  2PVO B;  2YWW A;  2ZPE B;  3RNJ A;  1IHW A;  4IUR A;  4E6R A;  2L3R A;  5GMK e;  1VYT A;  3CCU T;  1M1K U;  3EFR A;  1YIT Q;  1G8X A;  2O4X A;  2RF0 A;  3G6E T;  2E4H A;  3I35 A;  1SSH A;  2F2V A;  2X3X D;  1AHJ B;  2BE7 D;  1Q81 C;  2D8H A;  2VWF A;  2QTX A;  4J9C A;  1Z9Z A;  4EMK B;  1YJ9 A;  1NBE B;  3M56 A;  1U06 A;  1MND A;  3CC7 A;  1UGS B;  2DL7 A;  2D0N A;  2RPN A;  2PVG B;  4MZM A;  3HFO A;  3P8H A;  2JW4 A;  3OS1 A;  3H9N A;  2GTO A;  1QLY A;  5J26 A;  2MI6 A;  1K9M C; 
#chains in the Genus database with same CATH homology
 1G2B A;  1PNJ A;  4RTZ A;  4AFZ C;  2ESW A;  4CC7 A;  3EG3 A;  2EGA A;  1UFF A;  4K11 A;  2KGT A;  2EPD A;  3LH5 A;  1ZUU A;  1NM7 A;  4D8D A;  1Y57 A;  1W6X A;  1QKW A;  1K9A A;  1YP5 A;  2OI3 A;  1E7O A;  1NYG A;  2JMA A;  1HJD A;  1PKS A;  2PNI A;  1BB9 A;  2G6F X;  2KRO A;  2O9V A;  1GCQ A;  2KT8 A;  5GJV B;  2CT3 A;  1YWP A;  2O88 A;  3C0C A;  1WXT A;  3PVQ A;  2KR3 A;  4Z8A A;  2RQU A;  5ECA A;  1UJ0 A;  2EKH A;  2AKL A;  3QWY A;  2DLP A;  2FG0 A;  2MCN A;  3SHW A;  1N5Z A;  1BU1 A;  1UTI A;  2HEQ A;  2J06 A;  4AG2 C;  1E6G A;  2CDT A;  4LNP A;  3QWX X;  1AVZ C;  1NYF A;  2D8J A;  4Z88 A;  2I0N A;  1JEG A;  1EFN A;  1ZSG A;  4AFS C;  4CC4 B;  1X2Q A;  2GNC A;  3EGU A;  3UF4 A;  2KE9 A;  2NUZ A;  1UE9 A;  2FPE A;  4OMM A;  2DL3 A;  4OMQ A;  2KRM A;  1RLP C;  2DYB A;  4J9E A;  1B07 A;  2LMJ A;  2RQR A;  3U23 A;  4LN2 A;  2JMC A;  4J9H A;  2HBW A;  3ULR B;  2A08 A;  2H8H A;  2L0A A;  1ABQ A;  1E6H A;  2KXD A;  3I5S A;  2DRM A;  3H41 A;  5HCK A;  2KYB A;  4ZNX A;  3SEM A;  4RTX A;  4ORZ A;  1HSQ A;  4Z89 A;  3I5R A;  2C0I A;  2LJ1 A;  1K0X A;  1YCS B;  5IXF A;  1H3H A;  1VYV A;  1AZG B;  2BTT A;  2EYX A;  2ECZ A;  5IHN A;  4AG1 C;  2O9S A;  1VYU A;  2L3Q A;  1S1N A;  3VS3 A;  2KYM A;  2CSI A;  1MV3 A;  1XOV A;  2CUB A;  3A98 A;  2ROL A;  4JJC A;  1GBQ A;  2OAW A;  2ENM A;  1OV3 A;  1WIE A;  1GFC A;  2EQI A;  4QT7 A;  1WI7 A;  1OPK A;  2K2M A;  5IH2 A;  1WYX A;  3TVT A;  3JV3 A;  4OML A;  2HCK A;  2AZV A;  5L23 A;  4RTV A;  2LJ0 A;  2RQW A;  1WLP B;  1M3C A;  2X3W D;  4RTU A;  3M0T A;  2EYZ A;  2M51 A;  4JJD A;  1SRL A;  3VS7 A;  2DE0 X;  4DEX A;  2PZ1 A;  1RI9 A;  1A0N B;  2MOX A;  2J05 A;  1H8K A;  1M3B A;  2LP5 A;  2V1R A;  2A28 A;  2PTK A;  1PHT A;  4IIO A;  2LNH B;  4LE9 A;  2DMO A;  2LX7 A;  1X43 A;  1WXB A;  2DRK A;  2J6K A;  3PVL A;  2KT1 A;  2J6F A;  1I07 A;  1T3S A;  2HSP A;  2P4R A;  1GRI A;  1X27 A;  2DBM A;  1MUZ A;  2SEM A;  2FPD A;  1AWW A;  2LCS A;  4OMN A;  1BK2 A;  3EHR A;  1UEC A;  1QCF A;  4JZ3 A;  2HDA A;  1JQQ A;  1OOT A;  2JM8 A;  2RQT A;  2YDL A;  4J9I A;  2E5K A;  2SRC A;  1K76 A;  2C0T A;  2LQN A;  2W10 A;  1SRM A;  1H92 A;  1WXU A;  1RUW A;  1K0S A;  2F2W A;  2CUD A;  3EG1 A;  1AWO A;  3UA6 A;  4R0K A;  1UUE A;  1ZLM A;  3H0F A;  2FEI A;  2YUN A;  1CSK A;  1ZUK A;  2ED0 A;  1PRL C;  2K7A A;  1PRM C;  1ZBJ A;  4JPB W;  2FO0 A;  2GGR A;  2ROT A;  4RTY A;  2DBK A;  1NG2 A;  2DVJ A;  5FWB A;  2GTJ A;  2CT4 A;  1CKB A;  3VRY A;  2EBP A;  5IHK A;  1QWF A;  1G83 A;  1GCP A;  4RTW A;  5I11 A;  3M0R A;  5IXB A;  1OEB A;  1X69 A;  2EW3 A;  3PE0 A;  2ED1 A;  2B86 A;  1KSW A;  3H0I A;  4D8K A;  1ZUY A;  4F16 A;  1TG0 A;  2KNB B;  1JXM A;  1RLQ C;  2KXC A;  2MIO A;  3IQL A;  3EG0 A;  3VS0 A;  2CSQ A;  4IIM A;  1T0H A;  4HXJ A;  3M0U A;  1K4U S;  1T3L A;  1JXO A;  3VRZ A;  1U5S A;  3KFV A;  2EGC A;  2YUQ A;  2EGE A;  2DJQ A;  2CH4 A;  1KJW A;  1VA7 A;  2JTE A;  2D1X A;  2NWM A;  3FJ5 A;  4LUD A;  3CQT A;  2EYW A;  1Z9Q A;  4AFU C;  4HCK A;  2RMO A;  3NHN A;  3EG2 A;  4ESR A;  1YNZ A;  2JS2 A;  1GCQ C;  3ZL7 C;  1X6G A;  5I22 A;  2J7I A;  1KIK A;  4Y92 A;  2K9G A;  2AZS A;  2FRW A;  2KBT A;  1ABO A;  1KFZ A;  4X1V A;  2L2P A;  5EC7 A;  4GLM A;  4EIK A;  2AK5 A;  2KRN A;  1AEY A;  4J9B A;  4JZ4 A;  3UAT A;  2EYY A;  4WCI A;  2K79 A;  2F2X A;  2V1Q A;  2LQW A;  3RBB B;  2BZY A;  2C0O A;  4HVW A;  3REA B;  4HVU A;  3TSZ A;  4FSS A;  1Y0M A;  2DM1 A;  2LZ6 B;  3NPF A;  1AWJ A;  1IO6 A;  3VS4 A;  2DL8 A;  4AFQ C;  2JT4 A;  1W1F A;  3REB B;  1B3Q A;  1SHF A;  4M4Z A;  1U3O A;  1SHG A;  5FWC A;  2YSQ A;  1J3T A;  1YN8 A;  1HD3 A;  3H0H A;  2L3S A;  4GBQ A;  2XMF A;  2DIL A;  1I0C A;  3NMZ C;  3I9Q A;  3THK A;  1UDL A;  4J9F A;  5GJW B;  1NEG A;  2CH4 W;  1X2K A;  2O2O A;  2DNU A;  4JJB A;  3M0S A;  3GBQ A;  3VS5 A;  1OPL A;  3M0Q A;  1PWT A;  2CRE A;  2DA9 A;  2LJ3 A;  4J9G A;  1UHC A;  1GBR A;  2GBQ A;  4J9D A;  2M0Y A;  4F14 A;  2A36 A;  1UGV A;  1M27 C;  2O31 A;  1LCK A;  1NEB A;  2YUO A;  4A63 B;  1FMK A;  2DL5 A;  1YWO A;  1NLO C;  2JS0 A;  2VKN A;  3TSW A;  2JM9 A;  3EHQ A;  2YUP A;  5FW9 A;  3VS6 A;  1QWE A;  3R6N A;  2L3P A;  4KRT A;  3UA7 A;  3M0P A;  1PKT A;  2BZ8 A;  1SEM A;  2FPF A;  2K6D A;  1ARK A;  4CC3 A;  2DF6 A;  1ZX6 A;  1CKA A;  1MV0 B;  1NLP C;  2ABL A;  2RNA A;  2QDL A;  4CC2 A;  2IIM A;  2KEA A;  1GL5 A;  1AD5 A;  1M30 A;  1T0J A;  2BZX A;  2EVR A;  4RTT A;  2FRY A;  4OMP A;  4F17 A;  1WX6 A;  4RUG A;  2K3B A;  1AOJ A;  2RQV A;  2W0Z A;  3O5Z A;  1UJY A;  3RNJ A;  1SPK A;  1M8M A;  4E6R A;  4HVV A;  2J6O A;  1WA7 A;  1VYT A;  2RF0 A;  3VS1 A;  3I35 A;  1SSH A;  1FYN A;  2F2V A;  2X3X D;  1QKX A;  4OMO A;  2RN8 A;  2D8H A;  1JU5 C;  2DL4 A;  1BBZ A;  1V1C A;  2VWF A;  4J9C A;  1K1Z A;  1Z9Z A;  1X6B A;  1WFW A;  2AKK A;  1U06 A;  1TUD A;  2OJ2 A;  5IHI A;  1AWX A;  2A37 A;  2DL7 A;  1GFD A;  2VVK A;  2YT6 A;  2D0N A;  1W70 A;  2RPN A;  1I1J A;  4LUE A;  1UG1 A;  1UHF A;  2GQI A;  1AZE A;  3NGP A;  1WDX A;  2JW4 A;  2JXB A;  2GTO A;  1M3A A;  1QLY A;  2DX1 A;  4DEY A;  2KRS A;  1JO8 A;  1TUC A;  3VS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...