3NMZC

Crystal structure of apc complexed with asef
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
SSHHYSHPGGGGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGEGWFPASFVRLRVNQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords APC variant protein
publication title Structural basis for the recognition of Asef by adenomatous polyposis coli
doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/cell cycle
total genus 13
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3nmzC00
4A63B 1M3BA 3NGPA 3EG2A 3VRZA 2GTJA 2P4RA 2X3XD 4D8KA 3VRYA 2BZXA 3CQTA 2CT3A 1QWFA 1OPLA 1YN8A 3UA7A 2KR3A 4Z89A 2HDAA 2K79A 2DX1A 1PHTA 2EYWA 1UFFA 2XMFA 4IIMA 2DLPA 2KT1A 1X2KA 1X6GA 1X43A 2LQNA 4F17A 2LMJA 2KROA 2RNAA 2H8HA 4F16A 2EYXA 1Z9ZA 1VYVA 3SHWA 2KRMA 1ZLMA 2FPEA 2VWFA 1BBZA 4J9FA 5EC7A 1AWOA 3KFVA 1JXMA 1VYUA 2C0TA 2LJ3A 4KRTA 4RTTA 3VS2A 2DMOA 2GBQA 4J9HA 1K0SA 4ORZA 1CKAA 5HCKA 2DNUA 2DYBA 3UF4A 4AFUC 1KFZA 2CH4A 1SRLA 4RTXA 3M0UA 1EFNA 4Z88A 3EG1A 1K0XA 2DRKA 2YT6A 1OPKA 5FW9A 2DILA 2L3PA 2PZ1A 4OMPA 2VVKA 4RTYA 1G83A 4AG1C 1AVZC 2HEQA 2LJ1A 4JPBW 3VS4A 4CC7A 2CSIA 4WCIA 2DF6A 1NLOC 1NEGA 1SHFA 4F14A 2F2XA 2OAWA 1FMKA 1GRIA 2FPDA 2DJQA 2L0AA 2DA9A 3TSZA 3ZL7C 2KXCA 2HBWA 1QCFA 3VS7A 4RTUA 1AWJA 2O9SA 2CT4A 1SEMA 1WXTA 4RTZA 4LNPA 2DBMA 2SEMA 2EGEA 1SPKA 2KGTA 3EHRA 1S1NA 2DL8A 4LUDA 4K11A 4FSSA 1E6GA 2EPDA 2M51A 1B07A 2J06A 3LH5A 3M0TA 2FPFA 1V1CA 2NWMA 2LX7A 3EG3A 4R0KA 1NM7A 3I5RA 1PRMC 1Y57A 1W6XA 1T0HA 1KJWA 1ZSGA 3GBQA 1UE9A 2FRYA 1XOVA 1AZGB 1JU5C 1WLPB 2DL5A 4OMQA 2C0IA 1YNZA 1BB9A 4J9GA 1CSKA 2J6FA 1AD5A 1YWPA 4DEYA 3I35A 2YDLA 2D0NA 2W0ZA 1GBQA 2DL7A 2NUZA 1BK2A 2D1XA 2CSQA 1SSHA 2ENMA 2LCSA 1KIKA 2A37A 1ABOA 1E7OA 3EGUA 2YUNA 1T3LA 3NHNA 1H3HA 3VS6A 3RBBB 1YWOA 2JS2A 2L2PA 3U23A 1IO6A 2G6FX 2JT4A 4Y92A 3THKA 2D8HA 1NYGA 1G2BA 2AZSA 2DBKA 5GJVB 2BZ8A 1K76A 2I0NA 2JS0A 2YUQA 1GCQC 1JO8A 4M4ZA 2KRNA 2FO0A 2RQUA 3VS5A 1T3SA 1UHFA 3QWXX 2GQIA 3QWYA 2LNHB 1GCPA 2FRWA 1NG2A 2EW3A 2VKNA 3A98A 2ROLA 1H92A 2GNCA 4EIKA 1M3CA 5L23A 4D8DA 1H8KA 2AKLA 1K9AA 1QKWA 1WXBA 2HCKA 1M3AA 2AZVA 1N5ZA 2RQVA 1PNJA 3FJ5A 2O9VA 1UTIA 2X3WD 2K7AA 1BU1A 2K2MA 2O31A 2DL3A 1WI7A 4OMOA 1ZUUA 3ULRB 1U5SA 4DEXA 3H41A 2V1RA 3NMZC 1ZBJA 3VS3A 4JJDA 4ZNXA 2EGAA 2PNIA 2GTOA 1ZUYA 2C0OA 2MIOA 2EBPA 2LZ6B 1OV3A 1RLQC 1TUDA 2OI3A 2RMOA 4HVUA 1QWEA 1JQQA 2ABLA 4JZ3A 2RQRA 4OMLA 1JXOA 2K9GA 2LQWA 2MCNA 1HSQA 3I5SA 4OMNA 1B3QA 1GBRA 4JJCA 3REBB 2JM8A 1UHCA 2JXBA 5I22A 3NPFA 2IIMA 2OJ2A 4RUGA 1X2QA 3UA6A 1M27C 1ARKA 4J9BA 2O88A 3H0IA 4AFQC 2LP5A 1VA7A 2J7IA 3M0SA 4JZ4A 2JTEA 2AKKA 3M0QA 4AFZC 1ZUKA 3M0PA 2DE0X 4LN2A 3O5ZA 1AOJA 1I0CA 2ESWA 2L3QA 5IH2A 5IXFA 1YP5A 1KSWA 2EGCA 1I1JA 1SRMA 5IHNA 1AEYA 2KYBA 5FWCA 4OMMA 3EG0A 2JM9A 4J9CA 1MV3A 2A28A 2L3SA 1YCSB 5GJWB 1J3TA 2A08A 1UUEA 1U3OA 2F2VA 2EQIA 1I07A 2O2OA 2SRCA 4J9EA 5IHKA 1U06A 4RTVA 4X1VA 4HVWA 3EHQA 2GGRA 4CC3A 1UDLA 4AG2C 1T0JA 2DL4A 5I11A 1X27A 4CC2A 1QKXA 2PTKA 2J6KA 1UJ0A 1UG1A 4LE9A 1RI9A 1PKTA 3R6NA 4ESRA 1MUZA 1K4US 3VS1A 2J6OA 1GFCA 4HCKA 4J9IA 2CUBA 1K1ZA 2D8JA 2ED0A 1NEBA 2E5KA 2CDTA 4IIOA 1WDXA 3C0CA 2JW4A 1OEBA 1AWWA 2DRMA 2KYMA 3TVTA 2RQTA 1E6HA 2QDLA 3I9QA 2RF0A 1LCKA 2LJ0A 4J9DA 1ABQA 3PVQA 2EYZA 2K3BA 2EYYA 1X6BA 2JMAA 3IQLA 1GCQA 2ROTA 3VS0A 1WXUA 2FEIA 1PWTA 1X69A 2CREA 1Z9QA 2F2WA 2KEAA 1QLYA 1CKBA 4Z8AA 2KRSA 1RUWA 2EKHA 1GFDA 2HSPA 2ED1A 2KNBB 3H0FA 2J05A 2RPNA 1GL5A 1WA7A 1HD3A 3SEMA 2YUOA 1OOTA 2JMCA 1W1FA 1TG0A 2MOXA 1AZEA 1HJDA 2RN8A 4RTWA 5ECAA 2EVRA 1FYNA 4QT7A 3JV3A 1A0NB 1TUCA 2DVJA 2K6DA 2M0YA 2RQWA 4GBQA 4GLMA 2B86A 1JEGA 1UGVA 1W70A 2BZYA 1WFWA 2W10A 4CC4B 1WIEA 3H0HA 5IHIA 2A36A 2CUDA 1SHGA 1UECA 1VYTA 1PRLC 1M30A 2FG0A 2YSQA 1NYFA 3PE0A 1ZX6A 2AK5A 2KXDA 3TSWA 2DM1A 1AWXA 1Y0MA 3RNJA 4AFSC 2CH4W 3REAB 2KT8A 2KE9A 1UJYA 4E6RA 3M0RA 1M8MA 1PKSA 4LUEA 4HXJA 1NLPC 2BTTA 1MV0B 3UATA 1WX6A 5FWBA 2ECZA 5IXBA 2YUPA 1WYXA 2KBTA 2V1QA 3PVLA 4JJBA 4HVVA 1RLPC
chains in the Genus database with same CATH superfamily
4CRIA 1RACB 3NGPA 4BB7A 1VQ4A 2GTJA 4D8KA 4N4HA 4OGEA 2MMPA 3MEWA 1UGRB 1X01A 3QDFA 2K4YA 2HDAA 2K79A 4MMLA 1VQKA 5GMKe 2XMFA 2DLPA 3QBYA 1U1TA 1X2KA 4AMCA 1X43A 2LQNA 5KYYB 3I56Q 2RNAA 1LPLA 4NOYA 3MCAB 4M77F 5LJ3g 2FPEA 2DO3A 4J9FA 4DOWA 1VQMT 1JRIA 3CCQT 2FZCB 5KYWA 4C0DB 2GBQA 2C06A 2OTLQ 4J9HA 4ZGDB 4M7AA 5HCKA 1N9SA 1VQ6T 2ZPHB 1WJQA 3V8LA 3HPWA 1YHQA 2DERA 3S3OA 4E7IA 3OYBA 2RD1A 2CH4A 4JRIA 1VIEA 1VQ7A 1K8AU 3EG1A 1K0XA 1KHCA 1OPKA 2DILA 5GAN6 2XIDA 4QQ6A 2PUKB 2B8AA 1D1CA 1NLOC 3JCMb 2F2XA 2VV5A 2RJCA 3GNFB 2DJQA 4KH0B 4KGVB 3ZL7C 2QTVA 2ZCFB 5D6XA 2HBWA 2P4TA 1VQLA 3C95A 1OQKA 2R58A 4RMOA 3G4ST 5LJ3f 5AYFA 2O9SA 1WXTA 4LNPA 1VQNT 5GANe 2O4XA 1SPKA 4HCCA 2RK2A 2KGTA 4LUDA 2R57A 2LCLA 1MMDA 2EPDA 4PJNA 3JB9H 1PCXA 3SWNC 2FPFA 1C1AA 1KHIA 1ZBXA 3CCJQ 2DFUA 1PRMC 5LJ3d 3D7SB 1UE9A 1KC8R 1YFNA 4N0AC 1JU5C 4PLLA 4XTZA 1WLPB 2DL5A 1Q82U 2C0IA 2EJ9A 3EG9B 1YWPA 2M1HA 4DEYA 3I35A 3CC7A 2W0ZA 2E3IA 1BK2A 3KXTA 2LCSA 1Y7XA 3RUXA 1ABOA 4C8QG 1KC8C 3RBBB 4II1A 2L2PA 3U23A 2QDYB 3CCVA 3M4YA 2ATCB 3THKA 4M7AD 1NYGA 1KQ2A 5A0LA 3S6WA 3L2WA 4C5GA 5GJVB 3CCUA 1Q86U 4FYXB 4O6JA 2YUQA 4FYVB 5LJ5e 4M4ZA 1ZA1B 2KRNA 1VQ6A 4KGXB 5LJ3h 5GAOn 4LDVA 3OBYA 1RABB 3NTIA 1BCOA 4NL3A 1U1SA 1RAGB 3QWYA 2LNHB 2DEUA 4GY5A 4JS5A 1NJIU 2DTHA 2HNIA 5I2SA 3G71A 4TVRA 3FLGA 2WSEE 4EIKA 4PJOB 3JCMQ 1EZZB 4D8DA 1H8KA 2EQUA 1WXBA 1YJ9Q 2RQVA 1DJ7B 1VQOT 2MWPA 1FMVA 3MEAA 1MNDA 3ULRB 2YLBA 4BDZA 3NMZC 2HKNA 2EGAA 2QA4Q 3PFSA 3JCMg 1BKBA 2CZ0B 1BYMA 2KI7A 1Y07A 4ZN1A 1RLQC 5GMKm 4HVUA 3SFMA 2RQRA 3L42A 1SKUB 1KQ1A 3I55T 2LQWA 2MCNA 3I5SA 1N6AA 3GPLA 4JJCA 1YITT 3QPHA 5GAOr 1UHCA 3DB4A 2Y4XA 3CD6A 1ZSZC 2IIMA 2OJ2A 1M2VB 2KMTA 4M75F 2O88A 1Q81U 4ME7A 4ELZC 5DY9A 1VA7A 1KD1R 4MMKA 1UB4A 4C8QA 3EH1A 5GAOp 3M0SA 4JZ4A 3M56A 3M0QA 3MPUB 2QA4T 2HL3A 2MAMA 2GF7A 2DPPB 1AOJA 3H6ZA 5I21A 5GAOq 5IH2A 4Q5WA 4FW2A 2EGCA 2K5IA 1WJSA 5KH6A 5FWCA 2MF2A 4OMMA 1WHLA 2JJ9A 3JB9I 2EJFA 4J9CA 1XQHA 2L3SA 1J3TA 4PJOF 3X28B 1I81A 1U06A 5HK3A 3ZEHA 1VQ9A 1VQ5Q 2E1HA 1T0JA 2DL4A 5I11A 1U8RA 2QI2A 3VUZA 4CC2A 3HTRA 2X4WA 2EWNA 3F70A 2J6KA 3JCMd 5IT9E 2QG9B 3HRTA 4EMKC 3OSVA 2LTOA 4ESRA 1MUZA 4BY6C 3VS1A 3ASKA 1RL2A 4HT9A 3LWIA 1PSEA 3N5BB 1K1ZA 1C6VX 1VQOA 2D8JA 2RHZA 3HP9A 2CDTA 3JB9J 1BI1A 2EQMA 2NUPB 2L89A 4E47A 3E2UA 2BKDN 1AWWA 1OEBA 3M59A 4BI4A 2RQTA 3RIRA 3I9QA 3SWNB 1D0ZA 3CMAQ 1LCKA 5A0DA 4D6WA 4M78G 2EYZA 2K3BA 1V76A 3VS0A 1PWTA 2E4HA 5A0GA 4Z02A 2KEAA 1D0XA 2RO0A 2LCCA 1YITA 3H0FA 2E64A 2EJGA 1HD3A 1ZA2B 1Q86R 3SEMA 4C8QD 2JMCA 3OS2A 2OTJA 1YJWQ 2RN8A 4GLKA 5ECAA 5GMKi 1FYNA 3CMEQ 1ACMB 2CGHA 2RQWA 3QYGB 4GBQA 1WJRA 3X26B 3EH2A 4C0FA 1UGVA 5KYUA 4DOVA 3GF5A 4J6WA 1Q86C 1N9RA 3X20B 3OW2S 2Z0WA 1VYTA 3A5ZB 1JB0E 3BDUA 2OAUA 3PE0A 1ZX6A 3OYAA 2AK5A 1VQ4Q 1AWXA 3G6ET 3CC4Q 4AFSC 3ME9A 5C6SA 4F7UG 3JCMJ 1Q95G 1UJYA 2PVOB 5KYYA 4XAXB 1BI0A 1PKSA 2LVMA 7AT1B 1FX7A 1RAEB 1VQKQ 2ECZA 2ZZDA 3URGA 1WYXA 1D09B 3PVLA 4JJBA 5J26A 2XHCA 4RCCA 1M3BA 2RH2A 5GAMj 3EG2A 4XTUA 3MP1A 2X3XD 1YCYA 4M75G 2NUTB 4X34A 3M54A 1H641 5CCAA 3BFMA 4A4GA 3HRUA 4Z89A 4M78A 3TQ7P 2DX1A 1PHTA 1RI0A 3CCET 4IIMA 1PM3A 3QXEB 2FZGB 2LT4A 2KROA 5DM7R 2DXUA 5I2MA 3SHWA 4E7ZA 2KRMA 1VQKT 1F1BB 2VWFA 1BBZA 1BIAA 2D6FA 5J39A 1AWOA 3KFVA 2XU8A 3J7AF 2LJ3A 1K0SA 1CKAA 4EMHA 1MMAA 3C94A 4LD9K 3M55A 3RKYA 1VQ8T 3UF4A 4AFUC 4A54A 2DD4A 1KC8U 4RTXA 3M0UA 1VQLQ 4Z88A 5GAN2 2DRKA 2DK3A 2JTFA 1YHQT 4JLIA 3CC2A 1R0CB 1M1GA 4RCBA 2CP5A 3SB2A 2VVKA 1G83A 3OYYA 2FZKB 1AVZC 3TU4K 1VQ7T 4XTVA 4JPBW 1G8XA 4WCIA 2DF6A 2X51A 1VOMA 1M9SA 1SHFA 1FMKA 4QW2A 2FPDA 3EG9A 1OX9A 4HCZA 3RDVA 3OSSC 3JAME 3M4GA 3G6EA 2DA9A 1QCFA 4RTZA 4PFZA 1QVFS 3GP8A 4FSSA 4Y28E 1B07A 2EQKA 1IZ6A 1MMNA 4M7DE 1NPPA 4M75A 4R56A 4OB1B 2CZ7B 4F04B 1BI3A 3RMQA 3I5RA 1YBYA 2WACA 1Y57A 3LX7A 1KJWA 3CCVQ 2DTOA 5HKCA 1XOVA 4QVZA 1AZGB 1VQMQ 4R55A 4PL6A 2XD0A 3OW2P 1BB9A 1CSKA 3NFCA 3CCUQ 1AD5A 3JB9F 1I5LA 3JCMW 3UWNA 3CCEA 2DL7A 1SSHA 1VQ6Q 1KIKA 1XTDA 4BUGA 3CPFA 4PJOA 3SD4A 1YJNA 3NHNA 3LGLA 3OQ5A 3CC7T 3EFOB 1QP2A 2RHUA 1IO6A 4HA8A 3QJYA 2DXCA 4Y92A 2DIQA 4M7DC 3JCMc 4JJNK 4A4FA 1M4ZA 5GAOm 4KH1B 2JS0A 1GCQC 1WHHA 3CCVT 3OYFA 1IB8A 1GXIE 4C92E 3VS5A 4MZMA 2F5KA 2V8JA 1HK9A 1VQ8A 2NLUA 3QWXX 2A7YA 1BI2A 4XU2A 3CCUT 2YWWA 2ZPEB 2FRWA 1G3TA 3L2RA 3G4SQ 2VKNA 3QZ9B 2RI2A 5CKHA 1P92A 1M3CA 1KD1U 1VQNQ 1K9AA 1QKWA 2HCKA 1M3AA 4EPCA 1N5ZA 3EGXA 5GANg 4KGZB 1Y96B 1KQSA 2XDPA 1M2VA 2X3WD 3G71T 2O31A 1G3YA 2AHJB 4PKCC 4DEXA 2YRVA 3CXCS 4PJLA 1OX8A 1ZBJA 3AT1B 3TEEA 3VS3A 4ZTFA 3CD6Q 1M1KU 3A8MB 3OS0A 5LL6S 4JS4A 2QEXT 1Q7YR 2EBPA 1OV3A 1TUDA 2OI3A 4X9DA 4C92C 3OYEA 4M75D 3OYDA 1QWEA 2YRCA 4VUBA 3CBOA 4OMNA 1B3QA 3V8KA 2KVQG 4PFPA 3REBB 2F5TX 1Q7YC 3KUFA 2FYKA 3RKWA 3NPFA 4RUGA 1M27C 1NBEB 3PIPA 4E2FB 1ARKA 4J9BA 3H0IA 4IUQA 2LP5A 5GMKh 3MEUA 4PJOD 2DEQA 2JNGA 3CD6T 3WXMB 1ZUKA 1OULA 8AT1B 5M9OA 5GANf 5LJ5g 4JRPA 2ESWA 9ATCB 2DZ9A 3V7CA 3T9NA 1I1JA 3META 4RKUE 1SRMA 3EG0A 2E65A 1YI2A 1QVFP 5D6WA 3RMSA 2NUPA 5KE2A 3RERA 1K9MU 2A08A 2I2LA 1U3OA 4ZGEB 2EQIA 5GANd 1I07A 2O2OA 3HHTB 3OYKA 3BE3A 3EFSA 1VQOQ 4X1VA 4HVWA 4CC3A 1ZHIA 1UDLA 4AG2C 3JSCA 3SDZA 4IKFA 2V8KA 2LNVA 1XJWB 3JCMV 2PTKA 1RAIB 1G3WA 5AT1B 4N0AA 1QVGS 1UJ0A 4O5VA 2EQJA 2QYZA 1VQ9T 1RI9A 1NE8A 1K4US 3RESA 3UPUA 2GQVA 2J6OA 3C12A 1UEBA 1TSFA 1GFCA 2PU9B 3QKJA 1JJ2A 2XI9A 4RG2A 3I55Q 2DVEA 4MZTA 4IIOA 2WSFE 1RAAB 1YITQ 1PC0A 3VV0A 5LJ5f 2KYMA 4C5IA 3OW2A 3CEYA 2ZGWA 2QEXA 4J9DA 5KYNA 2JZ2A 2IG0A 2X35A 5GANh 2K5FA 2KY9A 3P8HA 4KUDK 3IQLA 1WHJA 1SG5A 1WXUA 3I56A 5LJ5d 2F2WA 2CP2A 1QLYA 1CKBA 2QQSA 3AHUA 2KRSA 3OYLA 2EKHA 1GFDA 2HSPA 3OY9A 2D9TA 4M77G 2KNBB 1D3BA 2J05A 1WA7A 2JTMA 5CQYA 1BCMA 1TG0A 3GOXA 5FRNA 4RTWA 3EGDA 4QT7A 3JV3A 1A0NB 2LQ8A 5KCHA 1YIJA 2DVJA 2OTLA 4JRKA 3CXCP 4M7DB 3QHSA 4FU6A 2OTJT 3FEOA 5KYWB 3FIFA 3UDCA 3QO3A 4M7AB 1OYXA 1WIEA 2A36A 2CUDA 3X24B 4NS5A 1KQSS 5LJ3j 5IAYA 1PG5B 3M58A 3TSWA 3E9GA 3L2QA 3PMIA 2CH4W 5GAMe 5LJ5h 3REAB 2KT8A 2KE9A 4OVAA 1M1KR 1M8MA 3A8OB 1TS9A 4J8OA 1KD1C 3JCMe 4HXJA 2BTTA 1ZSZA 1MV0B 3OYIA 5FWBA 5IXBA 4PJJA 2CKKA 3P8DA 2RB6A 3CCST 1NZ9A 2CP6A 4AT1B 4HVVA 4A63B 1QQJA 4LDWA 1M1KC 2DETA 3VRZA 5CR2A 2X4JA 3VRYA 1QCOA 3CPWS 4C92B 1QWFA 1YN8A 4NL2A 3UA7A 3CCJA 4J5YA 2HBPA 2KR3A 2HMAA 3CCMA 2AT1B 2X4XA 2EYWA 3VYHB 1KG1A 3DKMA 2KQWA 2LMJA 2H8HA 3QJ6A 2EYXA 1D0YA 1D1AA 5KYXB 3OYHA 3O8VA 4WTOB 1ZLMA 4M77A 1PD0A 4M7DF 2P0QA 4B6MA 3CC2Q 1QVGP 3MKDA 3PT9A 2DD5A 1QVFA 2C0TA 4KRTA 3VS2A 2DMOA 1K9MR 4EMKA 3QYHB 2PQWA 4BD3A 1G5VA 3RKXA 2GFAA 3VUBA 4DBHA 1VIFA 5CVIA 2GFUA 3MHXA 2DYBA 2BUDA 5LJ5j 1SRLA 3OB9A 3G6EQ 6AT1B 2DAQA 2P0KA 3V7SA 3A8HB 1PSFA 3HFNA 2YT6A 1UGPB 1K9MC 3V7RA 4C5HA 3OYNA 3LW5E 4AG1C 2LJ1A 1JJ2S 1FMWA 2QGGA 2RJDA 3CC2T 2OAWA 3M53A 4M78E 4BDYA 2FB7A 1YJ9A 1WQ7A 2E5QA 2Y4YA 2KXCA 2VASA 4OB2B 4RTUA 5GAN4 4C92F 1AWJA 2CT4A 1SEMA 3BDLA 3FB9A 4E7HA 1V29B 2DBMA 3OA6A 3UT1A 3CCEQ 4K11A 1W4SA 3JB9D 2E6NA 1E6GA 1C0MA 1OU8A 2M51A 2ZPFB 4N4GA 4QVCA 3CCSA 3M0TA 1V1CA 1YJNQ 4R0KA 1X75C 2JN0A 1M90U 1IXDA 1W6XA 1ZSGA 3GBQA 2K2VA 2FRYA 1FXXA 4OMQA 2FVUA 2D0QB 3G1JA 4J9GA 1KQSP 2D0NA 1QMCA 4M78C 1GBQA 2CYZB 2NUZA 4IURA 5CKFA 2D1XA 4KULA 2ENMA 4M77D 3CXCA 1VQ8Q 3EGUA 3X25B 4HCBA 1T3LA 3QDRB 1H3HA 3CCLT 2JS2A 2VXEA 1Y96A 3VJPA 4DQ2A 2JT4A 1Q7YU 4F7UE 1YHQQ 2AZSA 2BE7D 4IUTA 4XU1A 3FDRA 4C8QB 4FYWB 1YJNT 2BZ8A 1OZ2A 1K76A 4XU0A 1VQ7Q 2O01E 1MMGA 1WNLA 3VU3C 3OMCA 1JO8A 4LDUA 2FO0A 2VB6A 4PJOG 3FRNA 3CPWP 3ZBDA 4A4HA 2GQIA 2HL5C 2QQAA 1VQ5A 4XK8E 2L5QA 2ROLA 1H92A 2LT1A 1K73U 2E70A 3DLMA 1PNJA 4XTXA 2A3LA 1UTIA 3CCRA 3VKIA 2K7AA 2K2MA 4C5EA 3PTAA 2X9HA 1U5SA 5HY6A 4EMGA 2XKOC 1M2OA 2HZYA 4JJDA 2PNIA 3RR6A 1ZUYA 1IHVA 2C0OA 2GCXA 2QGFB 1WGSA 2LZ6B 4OB0B 3E1SA 1W2BP 1HYOA 4KBMB 1JQQA 2RHIA 1LNXA 4OMLA 1S72A 1HSQA 2QQ9A 4M75C 2QK0A 4B9XA 2JM8A 2VGMA 1QVGA 3CC7Q 5DLQE 2JXBA 2RJEA 3OYCA 5I22A 1YI2Q 2E41A 3LH0A 2MPXC 3UA6A 4MDWA 2RA2A 4ZTJA 1JJ2P 2M0OA 1BIBA 2J7IA 4A4EA 2M16A 4X9CA 2RM4A 2JTEA 4DBRA 2AKKA 4M7AE 1MNEA 2HQEA 2DE0X 4XU3A 1YJWA 3O5ZA 1I0CA 3FJPA 4HKEA 1OZ3A 3S3MA 4J7FA 5A2QE 1KSWA 4BE2A 3CCLA 2M02A 2JM9A 2A28A 1YCSB 3JCMX 3GLXA 1UUEA 2RI3A 2XK0A 2SRCA 4J9EA 4C92G 5KYUB 4OB3B 3G71Q 4MDXA 4N4IA 1YI2T 2COZA 5D7UA 4MZPA 3LWHA 2DXTA 1HXDA 3TCJA 3CC4A 2E10A 3INZA 2QEXQ 2XDDA 2H3JA 1UG1A 4LE9A 1VQPA 4M7AC 2OX7A 1PKTA 2VC8A 4QVDA 3R6NA 1XNIA 2HQHA 2HSEB 2EFIA 3A8LB 3PNWC 2CUBA 1M90R 2K3YA 1NEBA 2E5KA 3HRSA 3VYGA 3MEVA 4XTWA 3C0CA 2HKQB 2DRMA 3TVTA 1EX4A 2NYSA 4M7DA 3OS5A 2RF0A 5DLOA 2LJ0A 3M9QA 1X6OA 2L8DA 4OF1A 1M8VA 1ABQA 1M90C 1YIJQ 1GCQA 2ROTA 1IGQA 2FL7A 1X69A 3QZ5B 4IUUA 4M78B 8ATCB 3NTHA 2RPNA 4FSXA 1LVKA 2YUOA 1W1FA 3I56T 5D6YA 2COWA 1HJDA 5GAN7 2DXBA 2EVRA 5LJ3e 4FCYA 2F1LA 5GAOl 2M0YA 3CPWA 4GLMA 1B34B 4PJMA 1AHJB 2VXFA 1W70A 2BZYA 2W10A 1YIJT 4CC4B 3H0HA 2OTLT 1VQ9Q 1K73R 3OBWA 4FIBA 1PD1A 1M30A 4C92A 2QQRA 3J81E 1R0BG 2FG0A 2P0PA 1NYFA 4DBFA 4FT2A 3V8JA 4B9WA 2DJZA 2RJFA 3RNJA 1I8FA 5KCOA 2BIVA 4E6RA 1O9SA 4PNOA 4JDSA 3BW1A 1M1FA 1SSFA 3HKSA 4P5NA 1ZQ1A 5KYXA 3CCMQ 4LUEA 1NLPC 2HQXA 1K73C 3JRZA 2DKGA 3L1AA 4F7UB 4ANJA 1W2BA 2V1QA 3QSUA 3SWNA 2LQKA 1RLPC 2EYQA 5CAIA 4E7LA 1WHMA 1RAHB 3DB3A 1G3SA 4V2SA 2QASA 2P4RA 1SF9A 2CP7A 2VUBA 2BZXA 3CQTA 2ZPIB 2CT3A 2DYIA 1WHGA 1OPLA 2KDSA 4M7DD 4M78F 5CKDA 1UFFA 2IPOB 4M75B 2KT1A 1X6GA 1WZOA 4F17A 3JCMP 2JUFA 2DIGA 1VQMA 4L59A 4F16A 1Z9ZA 1OI1A 3CCQA 1VYVA 4JRQA 3JB9G 3CCJT 3BY7A 3CCMT 3LGFA 4C8QE 1RADB 2Y90A 3LYIA 2YLCA 2KK4A 2XDBA 2OTJQ 5IN1A 2QQBA 1TH7A 5EC7A 1JXMA 3WVEB 3QUIA 2ZAEA 1N8RR 3QIIA 1VYUA 2G3RA 5GMKj 2KSSA 4RTTA 2PVGB 1IREB 4ORZA 4J83A 1LJOA 2DZCA 2DNUA 2F69A 4L6V5 3DLLA 1EIFA 5L8RE 1KFZA 3E9FA 2V26A 2KAFA 2MWOA 4FL6A 1EFNA 5GAMg 1N8RC 4BE1A 4E7JA 2MYSA 5FW9A 3QG1A 2L3PA 2X4YA 4J6XA 4C92D 1I5OB 2PZ1A 4OMPA 5J3BA 3LLRA 4RTYA 1NPRA 2LDMA 3OYGA 4PFOA 2HEQA 4C8QC 3VS4A 4F7UF 3CCSQ 4CC7A 3G4SA 2CSIA 2IVWA 2YHTA 1NEGA 4LXCA 4CI0C 1VQNA 4F14A 1GRIA 4YTLA 4J6YA 2E12A 2L0AA 3TSZA 1TXQA 4DBQA 3VS7A 4LDXA 2NUTA 5FU6C 1IRXA 3EFRA 2SEMA 3EGXB 2EGEA 4OMFB 1M5Q1 3EHRA 1YJ9T 1S1NA 2DL8A 1MGQA 4M77E 4XTYA 2YXYA 2J06A 3LH5A 2NWMA 2LX7A 3L2VA 3HSBA 2AIRB 1O75A 3EG3A 4QQDA 1NM7A 1TTHB 1B7TA 4LDYA 2QXFA 1T0HA 2JOYA 4KT0E 5KE3A 2LRQA 3Q1JA 1K8AR 1JBMA 3KBGA 1YNZA 5GANj 2QAZA 5GAMf 2J6FA 2CS7A 5GMKl 2YDLA 4L5GA 2CSQA 3JCMf 1H3ZA 2A37A 2CZ6B 1E7OA 4BI8B 3PIOA 2O4XB 2E6ZA 2YUNA 4LD6A 3VS6A 1K8AC 3CBPA 1YWOA 2EKOA 4XQ3A 5GAMd 4IUVA 2G6FX 4M77C 2MK5A 2D8HA 1G2BA 2DBKA 1AT1B 5EG2A 1OU9A 4WF2A 2I0NA 2RHXA 3ZFJA 3CCRQ 2QTXA 3HL8A 2RQUA 5CO7A 5GAN5 1T3SA 3G7ZA 1UHFA 3M5AA 3ER0A 2DTIA 2COYA 5CKBA 1GCPA 4M7AF 2CP3A 4KUIA 1NG2A 2EW3A 3NTKA 4PK4A 3A98A 2CZ1B 1W2BS 4JUVA 1Q82R 2GNCA 3J80E 2YRDA 5L23A 2AKLA 2AZVA 2K5LA 1S72Q 1LOJA 3FJ5A 1VQ5T 2O9VA 2VYTA 1BU1A 5FU7C 2DL3A 1WI7A 4OMOA 2P84A 1ZUUA 2HD0A 3H41A 2V1RA 5GAMh 4A53A 4HT8A 4ZNXA 3OYJA 1Q82C 2GTOA 3I55A 2MIOA 5CK9A 3MP6A 3CCRT 3MP8A 3GNGA 3JCMh 1WPYA 2RMOA 4ZN3A 5FROA 4JZ3A 2ABLA 2PUOB 5FLXE 1MHNA 1JXOA 2K9GA 4RG8A 4Y91A 4OP0A 1GBRA 4IUPA 3CCLQ 2EIFA 2JVVA 3L2UA 4BACA 2QA4A 3EFOA 1NJIR 1X2QA 1WQWA 3EAEA 1S72T 3CMAT 3MJXA 3WVDB 2V8IA 4UC4A 4ATOA 5GAN3 4AFQC 3L2ZA 4AFZC 4C0DC 3M0PA 4LN2A 3HFOA 3PMTA 1IGUA 2K3XA 1D3BB 2L3QA 5IXFA 1NJIC 1YP5A 4FYYB 3FC3A 4FT4A 1VQPQ 5IHNA 5GAN8 2KYBA 1AEYA 1TWBA 4EDUA 2HAXA 3EGDB 1MV3A 4QQGA 1YJWT 4OGCA 5GJWB 2MI6A 1QP3A 4FW1A 3OYMA 2F2VA 3CMET 4ZGJB 5IHKA 3A1PA 4RTVA 2LC4A 3EHQA 2GGRA 2XG8D 3OMGA 1X27A 1QKXA 3E19A 2FHDA 2A0FB 2R5AA 5CQXA 1WHKA 2K57A 1VUBA 2R5MA 1Q81R 2RK1A 4HCKA 3GIBA 1VQ4T 4J9IA 3CC4T 2ED0A 5FU6B 3OS1A 1VQPT 1QW1A 2PVDB 4E7KA 4M75E 1ZSZB 1WDXA 1QVPA 2JW4A 2RHYA 1E6HA 2QDLA 1Q81C 2LX9A 4JLGA 2VGNA 4FM4B 2M9UA 3C4SA 1B34A 4ELYC 3PVQA 1IHWA 4C0ZA 2ZPBB 1N27A 2EYYA 5HK0A 1X6BA 2JMAA 4PLIA 3MO8A 2FEIA 3H8ZA 2CREA 1Z9QA 3R6OA 1QCNA 4Z8AA 3P8BB 1RUWA 1UGSB 1I4K1 4PJOE 2ED1A 1RAFB 5C0MA 1GL5A 1KK7A 4M7DG 4QKUA 1TU0B 1OOTA 3CBMA 2ZPGB 3CMAA 2MOXA 1AZEA 1D1BA 2BE9B 2EAYA 3A8GB 4M7AG 2XICA 4BE0A 4M77B 1TUCA 2E3HA 1Y71A 2K6DA 1TOVA 4F7UA 3PGGA 1R8OB 2B86A 1JEGA 2RI5A 1UGQB 3S3NA 4EMKB 1FWZA 1WFWA 4C8QF 3TREA 4BY6B 5IHIA 1SHGA 1UECA 4C0GA 1PRLC 2WSCE 2CP0A 2YSQA 5FRMA 3H9NA 2KXDA 2DM1A 1Y0MA 4J7IA 5CKEA 4A4KA 1TUGB 3CMEA 4PJOC 1VQLT 3M0RA 1R77A 2L3RA 2H3EB 4DA4A 1N8RU 3M57A 3UATA 1WX6A 4M78D 4BI3A 5CIUA 5FU7B 2YUPA 2KBTA 3CCQQ 4E7SA
chains in the Genus database with same CATH topology
4A63B 1M3BA 3NGPA 3EG2A 3VRZA 2GTJA 2P4RA 2X3XD 4D8KA 3VRYA 2BZXA 3CQTA 2CT3A 1QWFA 1OPLA 1YN8A 3UA7A 2KR3A 4Z89A 2HDAA 2K79A 2DX1A 1PHTA 2EYWA 1UFFA 2XMFA 4IIMA 2DLPA 2KT1A 1X2KA 1X6GA 1X43A 2LQNA 4F17A 2LMJA 2KROA 2RNAA 2H8HA 4F16A 2EYXA 1Z9ZA 1VYVA 3SHWA 2KRMA 1ZLMA 2FPEA 2VWFA 1BBZA 4J9FA 5EC7A 1AWOA 3KFVA 1JXMA 1VYUA 2C0TA 2LJ3A 4KRTA 4RTTA 3VS2A 2DMOA 2GBQA 4J9HA 1K0SA 4ORZA 1CKAA 5HCKA 2DNUA 2DYBA 3UF4A 4AFUC 1KFZA 2CH4A 1SRLA 4RTXA 3M0UA 1EFNA 4Z88A 3EG1A 1K0XA 2DRKA 2YT6A 1OPKA 5FW9A 2DILA 2L3PA 2PZ1A 4OMPA 2VVKA 4RTYA 1G83A 4AG1C 1AVZC 2HEQA 2LJ1A 4JPBW 3VS4A 4CC7A 2CSIA 4WCIA 2DF6A 1NLOC 1NEGA 1SHFA 4F14A 2F2XA 2OAWA 1FMKA 1GRIA 2FPDA 2DJQA 2L0AA 2DA9A 3TSZA 3ZL7C 2KXCA 2HBWA 1QCFA 3VS7A 4RTUA 1AWJA 2O9SA 2CT4A 1SEMA 1WXTA 4RTZA 4LNPA 2DBMA 2SEMA 2EGEA 1SPKA 2KGTA 3EHRA 1S1NA 2DL8A 4LUDA 4K11A 4FSSA 1E6GA 2EPDA 2M51A 1B07A 2J06A 3LH5A 3M0TA 2FPFA 1V1CA 2NWMA 2LX7A 3EG3A 4R0KA 1NM7A 3I5RA 1PRMC 1Y57A 1W6XA 1T0HA 1KJWA 1ZSGA 3GBQA 1UE9A 2FRYA 1XOVA 1AZGB 1JU5C 1WLPB 2DL5A 4OMQA 2C0IA 1YNZA 1BB9A 4J9GA 1CSKA 2J6FA 1AD5A 1YWPA 4DEYA 3I35A 2YDLA 2D0NA 2W0ZA 1GBQA 2DL7A 2NUZA 1BK2A 2D1XA 2CSQA 1SSHA 2ENMA 2LCSA 1KIKA 2A37A 1ABOA 1E7OA 3EGUA 2YUNA 1T3LA 3NHNA 1H3HA 3VS6A 3RBBB 1YWOA 2JS2A 2L2PA 3U23A 1IO6A 2G6FX 2JT4A 4Y92A 3THKA 2D8HA 1NYGA 1G2BA 2AZSA 2DBKA 5GJVB 2BZ8A 1K76A 2I0NA 2JS0A 2YUQA 1GCQC 1JO8A 4M4ZA 2KRNA 2FO0A 2RQUA 3VS5A 1T3SA 1UHFA 3QWXX 2GQIA 3QWYA 2LNHB 1GCPA 2FRWA 1NG2A 2EW3A 2VKNA 3A98A 2ROLA 1H92A 2GNCA 4EIKA 1M3CA 5L23A 4D8DA 1H8KA 2AKLA 1K9AA 1QKWA 1WXBA 2HCKA 1M3AA 2AZVA 1N5ZA 2RQVA 1PNJA 3FJ5A 2O9VA 1UTIA 2X3WD 2K7AA 1BU1A 2K2MA 2O31A 2DL3A 1WI7A 4OMOA 1ZUUA 3ULRB 1U5SA 4DEXA 3H41A 2V1RA 3NMZC 1ZBJA 3VS3A 4JJDA 4ZNXA 2EGAA 2PNIA 2GTOA 1ZUYA 2C0OA 2MIOA 2EBPA 2LZ6B 1OV3A 1RLQC 1TUDA 2OI3A 2RMOA 4HVUA 1QWEA 1JQQA 2ABLA 4JZ3A 2RQRA 4OMLA 1JXOA 2K9GA 2LQWA 2MCNA 1HSQA 3I5SA 4OMNA 1B3QA 1GBRA 4JJCA 3REBB 2JM8A 1UHCA 2JXBA 5I22A 3NPFA 2IIMA 2OJ2A 4RUGA 1X2QA 3UA6A 1M27C 1ARKA 4J9BA 2O88A 3H0IA 4AFQC 2LP5A 1VA7A 2J7IA 3M0SA 4JZ4A 2JTEA 2AKKA 3M0QA 4AFZC 1ZUKA 3M0PA 2DE0X 4LN2A 3O5ZA 1AOJA 1I0CA 2ESWA 2L3QA 5IH2A 5IXFA 1YP5A 1KSWA 2EGCA 1I1JA 1SRMA 5IHNA 1AEYA 2KYBA 5FWCA 4OMMA 3EG0A 2JM9A 4J9CA 1MV3A 2A28A 2L3SA 1YCSB 5GJWB 1J3TA 2A08A 1UUEA 1U3OA 2F2VA 2EQIA 1I07A 2O2OA 2SRCA 4J9EA 5IHKA 1U06A 4RTVA 4X1VA 4HVWA 3EHQA 2GGRA 4CC3A 1UDLA 4AG2C 1T0JA 2DL4A 5I11A 1X27A 4CC2A 1QKXA 2PTKA 2J6KA 1UJ0A 1UG1A 4LE9A 1RI9A 1PKTA 3R6NA 4ESRA 1MUZA 1K4US 3VS1A 2J6OA 1GFCA 4HCKA 4J9IA 2CUBA 1K1ZA 2D8JA 2ED0A 1NEBA 2E5KA 2CDTA 4IIOA 1WDXA 3C0CA 2JW4A 1OEBA 1AWWA 2DRMA 2KYMA 3TVTA 2RQTA 1E6HA 2QDLA 3I9QA 2RF0A 1LCKA 2LJ0A 4J9DA 1ABQA 3PVQA 2EYZA 2K3BA 2EYYA 1X6BA 2JMAA 3IQLA 1GCQA 2ROTA 3VS0A 1WXUA 2FEIA 1PWTA 1X69A 2CREA 1Z9QA 2F2WA 2KEAA 1QLYA 1CKBA 4Z8AA 2KRSA 1RUWA 2EKHA 1GFDA 2HSPA 2ED1A 2KNBB 3H0FA 2J05A 2RPNA 1GL5A 1WA7A 1HD3A 3SEMA 2YUOA 1OOTA 2JMCA 1W1FA 1TG0A 2MOXA 1AZEA 1HJDA 2RN8A 4RTWA 5ECAA 2EVRA 1FYNA 4QT7A 3JV3A 1A0NB 1TUCA 2DVJA 2K6DA 2M0YA 2RQWA 4GBQA 4GLMA 2B86A 1JEGA 1UGVA 1W70A 2BZYA 1WFWA 2W10A 4CC4B 1WIEA 3H0HA 5IHIA 2A36A 2CUDA 1SHGA 1UECA 1VYTA 1PRLC 1M30A 2FG0A 2YSQA 1NYFA 3PE0A 1ZX6A 2AK5A 2KXDA 3TSWA 2DM1A 1AWXA 1Y0MA 3RNJA 4AFSC 2CH4W 3REAB 2KT8A 2KE9A 1UJYA 4E6RA 3M0RA 1M8MA 1PKSA 4LUEA 4HXJA 1NLPC 2BTTA 1MV0B 3UATA 1WX6A 5FWBA 2ECZA 5IXBA 2YUPA 1WYXA 2KBTA 2V1QA 3PVLA 4JJBA 4HVVA 1RLPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A63 B;  1M3B A;  3NGP A;  3EG2 A;  3VRZ A;  2GTJ A;  2P4R A;  2X3X D;  4D8K A;  3VRY A;  2BZX A;  3CQT A;  2CT3 A;  1QWF A;  1OPL A;  1YN8 A;  3UA7 A;  2KR3 A;  4Z89 A;  2HDA A;  2K79 A;  2DX1 A;  1PHT A;  2EYW A;  1UFF A;  2XMF A;  4IIM A;  2DLP A;  2KT1 A;  1X2K A;  1X6G A;  1X43 A;  2LQN A;  4F17 A;  2LMJ A;  2KRO A;  2RNA A;  2H8H A;  4F16 A;  2EYX A;  1Z9Z A;  1VYV A;  3SHW A;  2KRM A;  1ZLM A;  2FPE A;  2VWF A;  1BBZ A;  4J9F A;  5EC7 A;  1AWO A;  3KFV A;  1JXM A;  1VYU A;  2C0T A;  2LJ3 A;  4KRT A;  4RTT A;  3VS2 A;  2DMO A;  2GBQ A;  4J9H A;  1K0S A;  4ORZ A;  1CKA A;  5HCK A;  2DNU A;  2DYB A;  3UF4 A;  4AFU C;  1KFZ A;  2CH4 A;  1SRL A;  4RTX A;  3M0U A;  1EFN A;  4Z88 A;  3EG1 A;  1K0X A;  2DRK A;  2YT6 A;  1OPK A;  5FW9 A;  2DIL A;  2L3P A;  2PZ1 A;  4OMP A;  2VVK A;  4RTY A;  1G83 A;  4AG1 C;  1AVZ C;  2HEQ A;  2LJ1 A;  4JPB W;  3VS4 A;  4CC7 A;  2CSI A;  4WCI A;  2DF6 A;  1NLO C;  1NEG A;  1SHF A;  4F14 A;  2F2X A;  2OAW A;  1FMK A;  1GRI A;  2FPD A;  2DJQ A;  2L0A A;  2DA9 A;  3TSZ A;  3ZL7 C;  2KXC A;  2HBW A;  1QCF A;  3VS7 A;  4RTU A;  1AWJ A;  2O9S A;  2CT4 A;  1SEM A;  1WXT A;  4RTZ A;  4LNP A;  2DBM A;  2SEM A;  2EGE A;  1SPK A;  2KGT A;  3EHR A;  1S1N A;  2DL8 A;  4LUD A;  4K11 A;  4FSS A;  1E6G A;  2EPD A;  2M51 A;  1B07 A;  2J06 A;  3LH5 A;  3M0T A;  2FPF A;  1V1C A;  2NWM A;  2LX7 A;  3EG3 A;  4R0K A;  1NM7 A;  3I5R A;  1PRM C;  1Y57 A;  1W6X A;  1T0H A;  1KJW A;  1ZSG A;  3GBQ A;  1UE9 A;  2FRY A;  1XOV A;  1AZG B;  1JU5 C;  1WLP B;  2DL5 A;  4OMQ A;  2C0I A;  1YNZ A;  1BB9 A;  4J9G A;  1CSK A;  2J6F A;  1AD5 A;  1YWP A;  4DEY A;  3I35 A;  2YDL A;  2D0N A;  2W0Z A;  1GBQ A;  2DL7 A;  2NUZ A;  1BK2 A;  2D1X A;  2CSQ A;  1SSH A;  2ENM A;  2LCS A;  1KIK A;  2A37 A;  1ABO A;  1E7O A;  3EGU A;  2YUN A;  1T3L A;  3NHN A;  1H3H A;  3VS6 A;  3RBB B;  1YWO A;  2JS2 A;  2L2P A;  3U23 A;  1IO6 A;  2G6F X;  2JT4 A;  4Y92 A;  3THK A;  2D8H A;  1NYG A;  1G2B A;  2AZS A;  2DBK A;  5GJV B;  2BZ8 A;  1K76 A;  2I0N A;  2JS0 A;  2YUQ A;  1GCQ C;  1JO8 A;  4M4Z A;  2KRN A;  2FO0 A;  2RQU A;  3VS5 A;  1T3S A;  1UHF A;  3QWX X;  2GQI A;  3QWY A;  2LNH B;  1GCP A;  2FRW A;  1NG2 A;  2EW3 A;  2VKN A;  3A98 A;  2ROL A;  1H92 A;  2GNC A;  4EIK A;  1M3C A;  5L23 A;  4D8D A;  1H8K A;  2AKL A;  1K9A A;  1QKW A;  1WXB A;  2HCK A;  1M3A A;  2AZV A;  1N5Z A;  2RQV A;  1PNJ A;  3FJ5 A;  2O9V A;  1UTI A;  2X3W D;  2K7A A;  1BU1 A;  2K2M A;  2O31 A;  2DL3 A;  1WI7 A;  4OMO A;  1ZUU A;  3ULR B;  1U5S A;  4DEX A;  3H41 A;  2V1R A;  3NMZ C;  1ZBJ A;  3VS3 A;  4JJD A;  4ZNX A;  2EGA A;  2PNI A;  2GTO A;  1ZUY A;  2C0O A;  2MIO A;  2EBP A;  2LZ6 B;  1OV3 A;  1RLQ C;  1TUD A;  2OI3 A;  2RMO A;  4HVU A;  1QWE A;  1JQQ A;  2ABL A;  4JZ3 A;  2RQR A;  4OML A;  1JXO A;  2K9G A;  2LQW A;  2MCN A;  1HSQ A;  3I5S A;  4OMN A;  1B3Q A;  1GBR A;  4JJC A;  3REB B;  2JM8 A;  1UHC A;  2JXB A;  5I22 A;  3NPF A;  2IIM A;  2OJ2 A;  4RUG A;  1X2Q A;  3UA6 A;  1M27 C;  1ARK A;  4J9B A;  2O88 A;  3H0I A;  4AFQ C;  2LP5 A;  1VA7 A;  2J7I A;  3M0S A;  4JZ4 A;  2JTE A;  2AKK A;  3M0Q A;  4AFZ C;  1ZUK A;  3M0P A;  2DE0 X;  4LN2 A;  3O5Z A;  1AOJ A;  1I0C A;  2ESW A;  2L3Q A;  5IH2 A;  5IXF A;  1YP5 A;  1KSW A;  2EGC A;  1I1J A;  1SRM A;  5IHN A;  1AEY A;  2KYB A;  5FWC A;  4OMM A;  3EG0 A;  2JM9 A;  4J9C A;  1MV3 A;  2A28 A;  2L3S A;  1YCS B;  5GJW B;  1J3T A;  2A08 A;  1UUE A;  1U3O A;  2F2V A;  2EQI A;  1I07 A;  2O2O A;  2SRC A;  4J9E A;  5IHK A;  1U06 A;  4RTV A;  4X1V A;  4HVW A;  3EHQ A;  2GGR A;  4CC3 A;  1UDL A;  4AG2 C;  1T0J A;  2DL4 A;  5I11 A;  1X27 A;  4CC2 A;  1QKX A;  2PTK A;  2J6K A;  1UJ0 A;  1UG1 A;  4LE9 A;  1RI9 A;  1PKT A;  3R6N A;  4ESR A;  1MUZ A;  1K4U S;  3VS1 A;  2J6O A;  1GFC A;  4HCK A;  4J9I A;  2CUB A;  1K1Z A;  2D8J A;  2ED0 A;  1NEB A;  2E5K A;  2CDT A;  4IIO A;  1WDX A;  3C0C A;  2JW4 A;  1OEB A;  1AWW A;  2DRM A;  2KYM A;  3TVT A;  2RQT A;  1E6H A;  2QDL A;  3I9Q A;  2RF0 A;  1LCK A;  2LJ0 A;  4J9D A;  1ABQ A;  3PVQ A;  2EYZ A;  2K3B A;  2EYY A;  1X6B A;  2JMA A;  3IQL A;  1GCQ A;  2ROT A;  3VS0 A;  1WXU A;  2FEI A;  1PWT A;  1X69 A;  2CRE A;  1Z9Q A;  2F2W A;  2KEA A;  1QLY A;  1CKB A;  4Z8A A;  2KRS A;  1RUW A;  2EKH A;  1GFD A;  2HSP A;  2ED1 A;  2KNB B;  3H0F A;  2J05 A;  2RPN A;  1GL5 A;  1WA7 A;  1HD3 A;  3SEM A;  2YUO A;  1OOT A;  2JMC A;  1W1F A;  1TG0 A;  2MOX A;  1AZE A;  1HJD A;  2RN8 A;  4RTW A;  5ECA A;  2EVR A;  1FYN A;  4QT7 A;  3JV3 A;  1A0N B;  1TUC A;  2DVJ A;  2K6D A;  2M0Y A;  2RQW A;  4GBQ A;  4GLM A;  2B86 A;  1JEG A;  1UGV A;  1W70 A;  2BZY A;  1WFW A;  2W10 A;  4CC4 B;  1WIE A;  3H0H A;  5IHI A;  2A36 A;  2CUD A;  1SHG A;  1UEC A;  1VYT A;  1PRL C;  1M30 A;  2FG0 A;  2YSQ A;  1NYF A;  3PE0 A;  1ZX6 A;  2AK5 A;  2KXD A;  3TSW A;  2DM1 A;  1AWX A;  1Y0M A;  3RNJ A;  4AFS C;  2CH4 W;  3REA B;  2KT8 A;  2KE9 A;  1UJY A;  4E6R A;  3M0R A;  1M8M A;  1PKS A;  4LUE A;  4HXJ A;  1NLP C;  2BTT A;  1MV0 B;  3UAT A;  1WX6 A;  5FWB A;  2ECZ A;  5IXB A;  2YUP A;  1WYX A;  2KBT A;  2V1Q A;  3PVL A;  4JJB A;  4HVV A;  1RLP C; 
#chains in the Genus database with same CATH topology
 4CRI A;  1RAC B;  3NGP A;  4BB7 A;  1VQ4 A;  2GTJ A;  4D8K A;  4N4H A;  4OGE A;  2MMP A;  3MEW A;  1UGR B;  1X01 A;  3QDF A;  2K4Y A;  2HDA A;  2K79 A;  4MML A;  1VQK A;  5GMK e;  2XMF A;  2DLP A;  3QBY A;  1U1T A;  1X2K A;  4AMC A;  1X43 A;  2LQN A;  5KYY B;  3I56 Q;  2RNA A;  1LPL A;  4NOY A;  3MCA B;  4M77 F;  5LJ3 g;  2FPE A;  2DO3 A;  4J9F A;  4DOW A;  1VQM T;  1JRI A;  3CCQ T;  2FZC B;  5KYW A;  4C0D B;  2GBQ A;  2C06 A;  2OTL Q;  4J9H A;  4ZGD B;  4M7A A;  5HCK A;  1N9S A;  1VQ6 T;  2ZPH B;  1WJQ A;  3V8L A;  3HPW A;  1YHQ A;  2DER A;  3S3O A;  4E7I A;  3OYB A;  2RD1 A;  2CH4 A;  4JRI A;  1VIE A;  1VQ7 A;  1K8A U;  3EG1 A;  1K0X A;  1KHC A;  1OPK A;  2DIL A;  5GAN 6;  2XID A;  4QQ6 A;  2PUK B;  2B8A A;  1D1C A;  1NLO C;  3JCM b;  2F2X A;  2VV5 A;  2RJC A;  3GNF B;  2DJQ A;  4KH0 B;  4KGV B;  3ZL7 C;  2QTV A;  2ZCF B;  5D6X A;  2HBW A;  2P4T A;  1VQL A;  3C95 A;  1OQK A;  2R58 A;  4RMO A;  3G4S T;  5LJ3 f;  5AYF A;  2O9S A;  1WXT A;  4LNP A;  1VQN T;  5GAN e;  2O4X A;  1SPK A;  4HCC A;  2RK2 A;  2KGT A;  4LUD A;  2R57 A;  2LCL A;  1MMD A;  2EPD A;  4PJN A;  3JB9 H;  1PCX A;  3SWN C;  2FPF A;  1C1A A;  1KHI A;  1ZBX A;  3CCJ Q;  2DFU A;  1PRM C;  5LJ3 d;  3D7S B;  1UE9 A;  1KC8 R;  1YFN A;  4N0A C;  1JU5 C;  4PLL A;  4XTZ A;  1WLP B;  2DL5 A;  1Q82 U;  2C0I A;  2EJ9 A;  3EG9 B;  1YWP A;  2M1H A;  4DEY A;  3I35 A;  3CC7 A;  2W0Z A;  2E3I A;  1BK2 A;  3KXT A;  2LCS A;  1Y7X A;  3RUX A;  1ABO A;  4C8Q G;  1KC8 C;  3RBB B;  4II1 A;  2L2P A;  3U23 A;  2QDY B;  3CCV A;  3M4Y A;  2ATC B;  3THK A;  4M7A D;  1NYG A;  1KQ2 A;  5A0L A;  3S6W A;  3L2W A;  4C5G A;  5GJV B;  3CCU A;  1Q86 U;  4FYX B;  4O6J A;  2YUQ A;  4FYV B;  5LJ5 e;  4M4Z A;  1ZA1 B;  2KRN A;  1VQ6 A;  4KGX B;  5LJ3 h;  5GAO n;  4LDV A;  3OBY A;  1RAB B;  3NTI A;  1BCO A;  4NL3 A;  1U1S A;  1RAG B;  3QWY A;  2LNH B;  2DEU A;  4GY5 A;  4JS5 A;  1NJI U;  2DTH A;  2HNI A;  5I2S A;  3G71 A;  4TVR A;  3FLG A;  2WSE E;  4EIK A;  4PJO B;  3JCM Q;  1EZZ B;  4D8D A;  1H8K A;  2EQU A;  1WXB A;  1YJ9 Q;  2RQV A;  1DJ7 B;  1VQO T;  2MWP A;  1FMV A;  3MEA A;  1MND A;  3ULR B;  2YLB A;  4BDZ A;  3NMZ C;  2HKN A;  2EGA A;  2QA4 Q;  3PFS A;  3JCM g;  1BKB A;  2CZ0 B;  1BYM A;  2KI7 A;  1Y07 A;  4ZN1 A;  1RLQ C;  5GMK m;  4HVU A;  3SFM A;  2RQR A;  3L42 A;  1SKU B;  1KQ1 A;  3I55 T;  2LQW A;  2MCN A;  3I5S A;  1N6A A;  3GPL A;  4JJC A;  1YIT T;  3QPH A;  5GAO r;  1UHC A;  3DB4 A;  2Y4X A;  3CD6 A;  1ZSZ C;  2IIM A;  2OJ2 A;  1M2V B;  2KMT A;  4M75 F;  2O88 A;  1Q81 U;  4ME7 A;  4ELZ C;  5DY9 A;  1VA7 A;  1KD1 R;  4MMK A;  1UB4 A;  4C8Q A;  3EH1 A;  5GAO p;  3M0S A;  4JZ4 A;  3M56 A;  3M0Q A;  3MPU B;  2QA4 T;  2HL3 A;  2MAM A;  2GF7 A;  2DPP B;  1AOJ A;  3H6Z A;  5I21 A;  5GAO q;  5IH2 A;  4Q5W A;  4FW2 A;  2EGC A;  2K5I A;  1WJS A;  5KH6 A;  5FWC A;  2MF2 A;  4OMM A;  1WHL A;  2JJ9 A;  3JB9 I;  2EJF A;  4J9C A;  1XQH A;  2L3S A;  1J3T A;  4PJO F;  3X28 B;  1I81 A;  1U06 A;  5HK3 A;  3ZEH A;  1VQ9 A;  1VQ5 Q;  2E1H A;  1T0J A;  2DL4 A;  5I11 A;  1U8R A;  2QI2 A;  3VUZ A;  4CC2 A;  3HTR A;  2X4W A;  2EWN A;  3F70 A;  2J6K A;  3JCM d;  5IT9 E;  2QG9 B;  3HRT A;  4EMK C;  3OSV A;  2LTO A;  4ESR A;  1MUZ A;  4BY6 C;  3VS1 A;  3ASK A;  1RL2 A;  4HT9 A;  3LWI A;  1PSE A;  3N5B B;  1K1Z A;  1C6V X;  1VQO A;  2D8J A;  2RHZ A;  3HP9 A;  2CDT A;  3JB9 J;  1BI1 A;  2EQM A;  2NUP B;  2L89 A;  4E47 A;  3E2U A;  2BKD N;  1AWW A;  1OEB A;  3M59 A;  4BI4 A;  2RQT A;  3RIR A;  3I9Q A;  3SWN B;  1D0Z A;  3CMA Q;  1LCK A;  5A0D A;  4D6W A;  4M78 G;  2EYZ A;  2K3B A;  1V76 A;  3VS0 A;  1PWT A;  2E4H A;  5A0G A;  4Z02 A;  2KEA A;  1D0X A;  2RO0 A;  2LCC A;  1YIT A;  3H0F A;  2E64 A;  2EJG A;  1HD3 A;  1ZA2 B;  1Q86 R;  3SEM A;  4C8Q D;  2JMC A;  3OS2 A;  2OTJ A;  1YJW Q;  2RN8 A;  4GLK A;  5ECA A;  5GMK i;  1FYN A;  3CME Q;  1ACM B;  2CGH A;  2RQW A;  3QYG B;  4GBQ A;  1WJR A;  3X26 B;  3EH2 A;  4C0F A;  1UGV A;  5KYU A;  4DOV A;  3GF5 A;  4J6W A;  1Q86 C;  1N9R A;  3X20 B;  3OW2 S;  2Z0W A;  1VYT A;  3A5Z B;  1JB0 E;  3BDU A;  2OAU A;  3PE0 A;  1ZX6 A;  3OYA A;  2AK5 A;  1VQ4 Q;  1AWX A;  3G6E T;  3CC4 Q;  4AFS C;  3ME9 A;  5C6S A;  4F7U G;  3JCM J;  1Q95 G;  1UJY A;  2PVO B;  5KYY A;  4XAX B;  1BI0 A;  1PKS A;  2LVM A;  7AT1 B;  1FX7 A;  1RAE B;  1VQK Q;  2ECZ A;  2ZZD A;  3URG A;  1WYX A;  1D09 B;  3PVL A;  4JJB A;  5J26 A;  2XHC A;  4RCC A;  1M3B A;  2RH2 A;  5GAM j;  3EG2 A;  4XTU A;  3MP1 A;  2X3X D;  1YCY A;  4M75 G;  2NUT B;  4X34 A;  3M54 A;  1H64 1;  5CCA A;  3BFM A;  4A4G A;  3HRU A;  4Z89 A;  4M78 A;  3TQ7 P;  2DX1 A;  1PHT A;  1RI0 A;  3CCE T;  4IIM A;  1PM3 A;  3QXE B;  2FZG B;  2LT4 A;  2KRO A;  5DM7 R;  2DXU A;  5I2M A;  3SHW A;  4E7Z A;  2KRM A;  1VQK T;  1F1B B;  2VWF A;  1BBZ A;  1BIA A;  2D6F A;  5J39 A;  1AWO A;  3KFV A;  2XU8 A;  3J7A F;  2LJ3 A;  1K0S A;  1CKA A;  4EMH A;  1MMA A;  3C94 A;  4LD9 K;  3M55 A;  3RKY A;  1VQ8 T;  3UF4 A;  4AFU C;  4A54 A;  2DD4 A;  1KC8 U;  4RTX A;  3M0U A;  1VQL Q;  4Z88 A;  5GAN 2;  2DRK A;  2DK3 A;  2JTF A;  1YHQ T;  4JLI A;  3CC2 A;  1R0C B;  1M1G A;  4RCB A;  2CP5 A;  3SB2 A;  2VVK A;  1G83 A;  3OYY A;  2FZK B;  1AVZ C;  3TU4 K;  1VQ7 T;  4XTV A;  4JPB W;  1G8X A;  4WCI A;  2DF6 A;  2X51 A;  1VOM A;  1M9S A;  1SHF A;  1FMK A;  4QW2 A;  2FPD A;  3EG9 A;  1OX9 A;  4HCZ A;  3RDV A;  3OSS C;  3JAM E;  3M4G A;  3G6E A;  2DA9 A;  1QCF A;  4RTZ A;  4PFZ A;  1QVF S;  3GP8 A;  4FSS A;  4Y28 E;  1B07 A;  2EQK A;  1IZ6 A;  1MMN A;  4M7D E;  1NPP A;  4M75 A;  4R56 A;  4OB1 B;  2CZ7 B;  4F04 B;  1BI3 A;  3RMQ A;  3I5R A;  1YBY A;  2WAC A;  1Y57 A;  3LX7 A;  1KJW A;  3CCV Q;  2DTO A;  5HKC A;  1XOV A;  4QVZ A;  1AZG B;  1VQM Q;  4R55 A;  4PL6 A;  2XD0 A;  3OW2 P;  1BB9 A;  1CSK A;  3NFC A;  3CCU Q;  1AD5 A;  3JB9 F;  1I5L A;  3JCM W;  3UWN A;  3CCE A;  2DL7 A;  1SSH A;  1VQ6 Q;  1KIK A;  1XTD A;  4BUG A;  3CPF A;  4PJO A;  3SD4 A;  1YJN A;  3NHN A;  3LGL A;  3OQ5 A;  3CC7 T;  3EFO B;  1QP2 A;  2RHU A;  1IO6 A;  4HA8 A;  3QJY A;  2DXC A;  4Y92 A;  2DIQ A;  4M7D C;  3JCM c;  4JJN K;  4A4F A;  1M4Z A;  5GAO m;  4KH1 B;  2JS0 A;  1GCQ C;  1WHH A;  3CCV T;  3OYF A;  1IB8 A;  1GXI E;  4C92 E;  3VS5 A;  4MZM A;  2F5K A;  2V8J A;  1HK9 A;  1VQ8 A;  2NLU A;  3QWX X;  2A7Y A;  1BI2 A;  4XU2 A;  3CCU T;  2YWW A;  2ZPE B;  2FRW A;  1G3T A;  3L2R A;  3G4S Q;  2VKN A;  3QZ9 B;  2RI2 A;  5CKH A;  1P92 A;  1M3C A;  1KD1 U;  1VQN Q;  1K9A A;  1QKW A;  2HCK A;  1M3A A;  4EPC A;  1N5Z A;  3EGX A;  5GAN g;  4KGZ B;  1Y96 B;  1KQS A;  2XDP A;  1M2V A;  2X3W D;  3G71 T;  2O31 A;  1G3Y A;  2AHJ B;  4PKC C;  4DEX A;  2YRV A;  3CXC S;  4PJL A;  1OX8 A;  1ZBJ A;  3AT1 B;  3TEE A;  3VS3 A;  4ZTF A;  3CD6 Q;  1M1K U;  3A8M B;  3OS0 A;  5LL6 S;  4JS4 A;  2QEX T;  1Q7Y R;  2EBP A;  1OV3 A;  1TUD A;  2OI3 A;  4X9D A;  4C92 C;  3OYE A;  4M75 D;  3OYD A;  1QWE A;  2YRC A;  4VUB A;  3CBO A;  4OMN A;  1B3Q A;  3V8K A;  2KVQ G;  4PFP A;  3REB B;  2F5T X;  1Q7Y C;  3KUF A;  2FYK A;  3RKW A;  3NPF A;  4RUG A;  1M27 C;  1NBE B;  3PIP A;  4E2F B;  1ARK A;  4J9B A;  3H0I A;  4IUQ A;  2LP5 A;  5GMK h;  3MEU A;  4PJO D;  2DEQ A;  2JNG A;  3CD6 T;  3WXM B;  1ZUK A;  1OUL A;  8AT1 B;  5M9O A;  5GAN f;  5LJ5 g;  4JRP A;  2ESW A;  9ATC B;  2DZ9 A;  3V7C A;  3T9N A;  1I1J A;  3MET A;  4RKU E;  1SRM A;  3EG0 A;  2E65 A;  1YI2 A;  1QVF P;  5D6W A;  3RMS A;  2NUP A;  5KE2 A;  3RER A;  1K9M U;  2A08 A;  2I2L A;  1U3O A;  4ZGE B;  2EQI A;  5GAN d;  1I07 A;  2O2O A;  3HHT B;  3OYK A;  3BE3 A;  3EFS A;  1VQO Q;  4X1V A;  4HVW A;  4CC3 A;  1ZHI A;  1UDL A;  4AG2 C;  3JSC A;  3SDZ A;  4IKF A;  2V8K A;  2LNV A;  1XJW B;  3JCM V;  2PTK A;  1RAI B;  1G3W A;  5AT1 B;  4N0A A;  1QVG S;  1UJ0 A;  4O5V A;  2EQJ A;  2QYZ A;  1VQ9 T;  1RI9 A;  1NE8 A;  1K4U S;  3RES A;  3UPU A;  2GQV A;  2J6O A;  3C12 A;  1UEB A;  1TSF A;  1GFC A;  2PU9 B;  3QKJ A;  1JJ2 A;  2XI9 A;  4RG2 A;  3I55 Q;  2DVE A;  4MZT A;  4IIO A;  2WSF E;  1RAA B;  1YIT Q;  1PC0 A;  3VV0 A;  5LJ5 f;  2KYM A;  4C5I A;  3OW2 A;  3CEY A;  2ZGW A;  2QEX A;  4J9D A;  5KYN A;  2JZ2 A;  2IG0 A;  2X35 A;  5GAN h;  2K5F A;  2KY9 A;  3P8H A;  4KUD K;  3IQL A;  1WHJ A;  1SG5 A;  1WXU A;  3I56 A;  5LJ5 d;  2F2W A;  2CP2 A;  1QLY A;  1CKB A;  2QQS A;  3AHU A;  2KRS A;  3OYL A;  2EKH A;  1GFD A;  2HSP A;  3OY9 A;  2D9T A;  4M77 G;  2KNB B;  1D3B A;  2J05 A;  1WA7 A;  2JTM A;  5CQY A;  1BCM A;  1TG0 A;  3GOX A;  5FRN A;  4RTW A;  3EGD A;  4QT7 A;  3JV3 A;  1A0N B;  2LQ8 A;  5KCH A;  1YIJ A;  2DVJ A;  2OTL A;  4JRK A;  3CXC P;  4M7D B;  3QHS A;  4FU6 A;  2OTJ T;  3FEO A;  5KYW B;  3FIF A;  3UDC A;  3QO3 A;  4M7A B;  1OYX A;  1WIE A;  2A36 A;  2CUD A;  3X24 B;  4NS5 A;  1KQS S;  5LJ3 j;  5IAY A;  1PG5 B;  3M58 A;  3TSW A;  3E9G A;  3L2Q A;  3PMI A;  2CH4 W;  5GAM e;  5LJ5 h;  3REA B;  2KT8 A;  2KE9 A;  4OVA A;  1M1K R;  1M8M A;  3A8O B;  1TS9 A;  4J8O A;  1KD1 C;  3JCM e;  4HXJ A;  2BTT A;  1ZSZ A;  1MV0 B;  3OYI A;  5FWB A;  5IXB A;  4PJJ A;  2CKK A;  3P8D A;  2RB6 A;  3CCS T;  1NZ9 A;  2CP6 A;  4AT1 B;  4HVV A;  4A63 B;  1QQJ A;  4LDW A;  1M1K C;  2DET A;  3VRZ A;  5CR2 A;  2X4J A;  3VRY A;  1QCO A;  3CPW S;  4C92 B;  1QWF A;  1YN8 A;  4NL2 A;  3UA7 A;  3CCJ A;  4J5Y A;  2HBP A;  2KR3 A;  2HMA A;  3CCM A;  2AT1 B;  2X4X A;  2EYW A;  3VYH B;  1KG1 A;  3DKM A;  2KQW A;  2LMJ A;  2H8H A;  3QJ6 A;  2EYX A;  1D0Y A;  1D1A A;  5KYX B;  3OYH A;  3O8V A;  4WTO B;  1ZLM A;  4M77 A;  1PD0 A;  4M7D F;  2P0Q A;  4B6M A;  3CC2 Q;  1QVG P;  3MKD A;  3PT9 A;  2DD5 A;  1QVF A;  2C0T A;  4KRT A;  3VS2 A;  2DMO A;  1K9M R;  4EMK A;  3QYH B;  2PQW A;  4BD3 A;  1G5V A;  3RKX A;  2GFA A;  3VUB A;  4DBH A;  1VIF A;  5CVI A;  2GFU A;  3MHX A;  2DYB A;  2BUD A;  5LJ5 j;  1SRL A;  3OB9 A;  3G6E Q;  6AT1 B;  2DAQ A;  2P0K A;  3V7S A;  3A8H B;  1PSF A;  3HFN A;  2YT6 A;  1UGP B;  1K9M C;  3V7R A;  4C5H A;  3OYN A;  3LW5 E;  4AG1 C;  2LJ1 A;  1JJ2 S;  1FMW A;  2QGG A;  2RJD A;  3CC2 T;  2OAW A;  3M53 A;  4M78 E;  4BDY A;  2FB7 A;  1YJ9 A;  1WQ7 A;  2E5Q A;  2Y4Y A;  2KXC A;  2VAS A;  4OB2 B;  4RTU A;  5GAN 4;  4C92 F;  1AWJ A;  2CT4 A;  1SEM A;  3BDL A;  3FB9 A;  4E7H A;  1V29 B;  2DBM A;  3OA6 A;  3UT1 A;  3CCE Q;  4K11 A;  1W4S A;  3JB9 D;  2E6N A;  1E6G A;  1C0M A;  1OU8 A;  2M51 A;  2ZPF B;  4N4G A;  4QVC A;  3CCS A;  3M0T A;  1V1C A;  1YJN Q;  4R0K A;  1X75 C;  2JN0 A;  1M90 U;  1IXD A;  1W6X A;  1ZSG A;  3GBQ A;  2K2V A;  2FRY A;  1FXX A;  4OMQ A;  2FVU A;  2D0Q B;  3G1J A;  4J9G A;  1KQS P;  2D0N A;  1QMC A;  4M78 C;  1GBQ A;  2CYZ B;  2NUZ A;  4IUR A;  5CKF A;  2D1X A;  4KUL A;  2ENM A;  4M77 D;  3CXC A;  1VQ8 Q;  3EGU A;  3X25 B;  4HCB A;  1T3L A;  3QDR B;  1H3H A;  3CCL T;  2JS2 A;  2VXE A;  1Y96 A;  3VJP A;  4DQ2 A;  2JT4 A;  1Q7Y U;  4F7U E;  1YHQ Q;  2AZS A;  2BE7 D;  4IUT A;  4XU1 A;  3FDR A;  4C8Q B;  4FYW B;  1YJN T;  2BZ8 A;  1OZ2 A;  1K76 A;  4XU0 A;  1VQ7 Q;  2O01 E;  1MMG A;  1WNL A;  3VU3 C;  3OMC A;  1JO8 A;  4LDU A;  2FO0 A;  2VB6 A;  4PJO G;  3FRN A;  3CPW P;  3ZBD A;  4A4H A;  2GQI A;  2HL5 C;  2QQA A;  1VQ5 A;  4XK8 E;  2L5Q A;  2ROL A;  1H92 A;  2LT1 A;  1K73 U;  2E70 A;  3DLM A;  1PNJ A;  4XTX A;  2A3L A;  1UTI A;  3CCR A;  3VKI A;  2K7A A;  2K2M A;  4C5E A;  3PTA A;  2X9H A;  1U5S A;  5HY6 A;  4EMG A;  2XKO C;  1M2O A;  2HZY A;  4JJD A;  2PNI A;  3RR6 A;  1ZUY A;  1IHV A;  2C0O A;  2GCX A;  2QGF B;  1WGS A;  2LZ6 B;  4OB0 B;  3E1S A;  1W2B P;  1HYO A;  4KBM B;  1JQQ A;  2RHI A;  1LNX A;  4OML A;  1S72 A;  1HSQ A;  2QQ9 A;  4M75 C;  2QK0 A;  4B9X A;  2JM8 A;  2VGM A;  1QVG A;  3CC7 Q;  5DLQ E;  2JXB A;  2RJE A;  3OYC A;  5I22 A;  1YI2 Q;  2E41 A;  3LH0 A;  2MPX C;  3UA6 A;  4MDW A;  2RA2 A;  4ZTJ A;  1JJ2 P;  2M0O A;  1BIB A;  2J7I A;  4A4E A;  2M16 A;  4X9C A;  2RM4 A;  2JTE A;  4DBR A;  2AKK A;  4M7A E;  1MNE A;  2HQE A;  2DE0 X;  4XU3 A;  1YJW A;  3O5Z A;  1I0C A;  3FJP A;  4HKE A;  1OZ3 A;  3S3M A;  4J7F A;  5A2Q E;  1KSW A;  4BE2 A;  3CCL A;  2M02 A;  2JM9 A;  2A28 A;  1YCS B;  3JCM X;  3GLX A;  1UUE A;  2RI3 A;  2XK0 A;  2SRC A;  4J9E A;  4C92 G;  5KYU B;  4OB3 B;  3G71 Q;  4MDX A;  4N4I A;  1YI2 T;  2COZ A;  5D7U A;  4MZP A;  3LWH A;  2DXT A;  1HXD A;  3TCJ A;  3CC4 A;  2E10 A;  3INZ A;  2QEX Q;  2XDD A;  2H3J A;  1UG1 A;  4LE9 A;  1VQP A;  4M7A C;  2OX7 A;  1PKT A;  2VC8 A;  4QVD A;  3R6N A;  1XNI A;  2HQH A;  2HSE B;  2EFI A;  3A8L B;  3PNW C;  2CUB A;  1M90 R;  2K3Y A;  1NEB A;  2E5K A;  3HRS A;  3VYG A;  3MEV A;  4XTW A;  3C0C A;  2HKQ B;  2DRM A;  3TVT A;  1EX4 A;  2NYS A;  4M7D A;  3OS5 A;  2RF0 A;  5DLO A;  2LJ0 A;  3M9Q A;  1X6O A;  2L8D A;  4OF1 A;  1M8V A;  1ABQ A;  1M90 C;  1YIJ Q;  1GCQ A;  2ROT A;  1IGQ A;  2FL7 A;  1X69 A;  3QZ5 B;  4IUU A;  4M78 B;  8ATC B;  3NTH A;  2RPN A;  4FSX A;  1LVK A;  2YUO A;  1W1F A;  3I56 T;  5D6Y A;  2COW A;  1HJD A;  5GAN 7;  2DXB A;  2EVR A;  5LJ3 e;  4FCY A;  2F1L A;  5GAO l;  2M0Y A;  3CPW A;  4GLM A;  1B34 B;  4PJM A;  1AHJ B;  2VXF A;  1W70 A;  2BZY A;  2W10 A;  1YIJ T;  4CC4 B;  3H0H A;  2OTL T;  1VQ9 Q;  1K73 R;  3OBW A;  4FIB A;  1PD1 A;  1M30 A;  4C92 A;  2QQR A;  3J81 E;  1R0B G;  2FG0 A;  2P0P A;  1NYF A;  4DBF A;  4FT2 A;  3V8J A;  4B9W A;  2DJZ A;  2RJF A;  3RNJ A;  1I8F A;  5KCO A;  2BIV A;  4E6R A;  1O9S A;  4PNO A;  4JDS A;  3BW1 A;  1M1F A;  1SSF A;  3HKS A;  4P5N A;  1ZQ1 A;  5KYX A;  3CCM Q;  4LUE A;  1NLP C;  2HQX A;  1K73 C;  3JRZ A;  2DKG A;  3L1A A;  4F7U B;  4ANJ A;  1W2B A;  2V1Q A;  3QSU A;  3SWN A;  2LQK A;  1RLP C;  2EYQ A;  5CAI A;  4E7L A;  1WHM A;  1RAH B;  3DB3 A;  1G3S A;  4V2S A;  2QAS A;  2P4R A;  1SF9 A;  2CP7 A;  2VUB A;  2BZX A;  3CQT A;  2ZPI B;  2CT3 A;  2DYI A;  1WHG A;  1OPL A;  2KDS A;  4M7D D;  4M78 F;  5CKD A;  1UFF A;  2IPO B;  4M75 B;  2KT1 A;  1X6G A;  1WZO A;  4F17 A;  3JCM P;  2JUF A;  2DIG A;  1VQM A;  4L59 A;  4F16 A;  1Z9Z A;  1OI1 A;  3CCQ A;  1VYV A;  4JRQ A;  3JB9 G;  3CCJ T;  3BY7 A;  3CCM T;  3LGF A;  4C8Q E;  1RAD B;  2Y90 A;  3LYI A;  2YLC A;  2KK4 A;  2XDB A;  2OTJ Q;  5IN1 A;  2QQB A;  1TH7 A;  5EC7 A;  1JXM A;  3WVE B;  3QUI A;  2ZAE A;  1N8R R;  3QII A;  1VYU A;  2G3R A;  5GMK j;  2KSS A;  4RTT A;  2PVG B;  1IRE B;  4ORZ A;  4J83 A;  1LJO A;  2DZC A;  2DNU A;  2F69 A;  4L6V 5;  3DLL A;  1EIF A;  5L8R E;  1KFZ A;  3E9F A;  2V26 A;  2KAF A;  2MWO A;  4FL6 A;  1EFN A;  5GAM g;  1N8R C;  4BE1 A;  4E7J A;  2MYS A;  5FW9 A;  3QG1 A;  2L3P A;  2X4Y A;  4J6X A;  4C92 D;  1I5O B;  2PZ1 A;  4OMP A;  5J3B A;  3LLR A;  4RTY A;  1NPR A;  2LDM A;  3OYG A;  4PFO A;  2HEQ A;  4C8Q C;  3VS4 A;  4F7U F;  3CCS Q;  4CC7 A;  3G4S A;  2CSI A;  2IVW A;  2YHT A;  1NEG A;  4LXC A;  4CI0 C;  1VQN A;  4F14 A;  1GRI A;  4YTL A;  4J6Y A;  2E12 A;  2L0A A;  3TSZ A;  1TXQ A;  4DBQ A;  3VS7 A;  4LDX A;  2NUT A;  5FU6 C;  1IRX A;  3EFR A;  2SEM A;  3EGX B;  2EGE A;  4OMF B;  1M5Q 1;  3EHR A;  1YJ9 T;  1S1N A;  2DL8 A;  1MGQ A;  4M77 E;  4XTY A;  2YXY A;  2J06 A;  3LH5 A;  2NWM A;  2LX7 A;  3L2V A;  3HSB A;  2AIR B;  1O75 A;  3EG3 A;  4QQD A;  1NM7 A;  1TTH B;  1B7T A;  4LDY A;  2QXF A;  1T0H A;  2JOY A;  4KT0 E;  5KE3 A;  2LRQ A;  3Q1J A;  1K8A R;  1JBM A;  3KBG A;  1YNZ A;  5GAN j;  2QAZ A;  5GAM f;  2J6F A;  2CS7 A;  5GMK l;  2YDL A;  4L5G A;  2CSQ A;  3JCM f;  1H3Z A;  2A37 A;  2CZ6 B;  1E7O A;  4BI8 B;  3PIO A;  2O4X B;  2E6Z A;  2YUN A;  4LD6 A;  3VS6 A;  1K8A C;  3CBP A;  1YWO A;  2EKO A;  4XQ3 A;  5GAM d;  4IUV A;  2G6F X;  4M77 C;  2MK5 A;  2D8H A;  1G2B A;  2DBK A;  1AT1 B;  5EG2 A;  1OU9 A;  4WF2 A;  2I0N A;  2RHX A;  3ZFJ A;  3CCR Q;  2QTX A;  3HL8 A;  2RQU A;  5CO7 A;  5GAN 5;  1T3S A;  3G7Z A;  1UHF A;  3M5A A;  3ER0 A;  2DTI A;  2COY A;  5CKB A;  1GCP A;  4M7A F;  2CP3 A;  4KUI A;  1NG2 A;  2EW3 A;  3NTK A;  4PK4 A;  3A98 A;  2CZ1 B;  1W2B S;  4JUV A;  1Q82 R;  2GNC A;  3J80 E;  2YRD A;  5L23 A;  2AKL A;  2AZV A;  2K5L A;  1S72 Q;  1LOJ A;  3FJ5 A;  1VQ5 T;  2O9V A;  2VYT A;  1BU1 A;  5FU7 C;  2DL3 A;  1WI7 A;  4OMO A;  2P84 A;  1ZUU A;  2HD0 A;  3H41 A;  2V1R A;  5GAM h;  4A53 A;  4HT8 A;  4ZNX A;  3OYJ A;  1Q82 C;  2GTO A;  3I55 A;  2MIO A;  5CK9 A;  3MP6 A;  3CCR T;  3MP8 A;  3GNG A;  3JCM h;  1WPY A;  2RMO A;  4ZN3 A;  5FRO A;  4JZ3 A;  2ABL A;  2PUO B;  5FLX E;  1MHN A;  1JXO A;  2K9G A;  4RG8 A;  4Y91 A;  4OP0 A;  1GBR A;  4IUP A;  3CCL Q;  2EIF A;  2JVV A;  3L2U A;  4BAC A;  2QA4 A;  3EFO A;  1NJI R;  1X2Q A;  1WQW A;  3EAE A;  1S72 T;  3CMA T;  3MJX A;  3WVD B;  2V8I A;  4UC4 A;  4ATO A;  5GAN 3;  4AFQ C;  3L2Z A;  4AFZ C;  4C0D C;  3M0P A;  4LN2 A;  3HFO A;  3PMT A;  1IGU A;  2K3X A;  1D3B B;  2L3Q A;  5IXF A;  1NJI C;  1YP5 A;  4FYY B;  3FC3 A;  4FT4 A;  1VQP Q;  5IHN A;  5GAN 8;  2KYB A;  1AEY A;  1TWB A;  4EDU A;  2HAX A;  3EGD B;  1MV3 A;  4QQG A;  1YJW T;  4OGC A;  5GJW B;  2MI6 A;  1QP3 A;  4FW1 A;  3OYM A;  2F2V A;  3CME T;  4ZGJ B;  5IHK A;  3A1P A;  4RTV A;  2LC4 A;  3EHQ A;  2GGR A;  2XG8 D;  3OMG A;  1X27 A;  1QKX A;  3E19 A;  2FHD A;  2A0F B;  2R5A A;  5CQX A;  1WHK A;  2K57 A;  1VUB A;  2R5M A;  1Q81 R;  2RK1 A;  4HCK A;  3GIB A;  1VQ4 T;  4J9I A;  3CC4 T;  2ED0 A;  5FU6 B;  3OS1 A;  1VQP T;  1QW1 A;  2PVD B;  4E7K A;  4M75 E;  1ZSZ B;  1WDX A;  1QVP A;  2JW4 A;  2RHY A;  1E6H A;  2QDL A;  1Q81 C;  2LX9 A;  4JLG A;  2VGN A;  4FM4 B;  2M9U A;  3C4S A;  1B34 A;  4ELY C;  3PVQ A;  1IHW A;  4C0Z A;  2ZPB B;  1N27 A;  2EYY A;  5HK0 A;  1X6B A;  2JMA A;  4PLI A;  3MO8 A;  2FEI A;  3H8Z A;  2CRE A;  1Z9Q A;  3R6O A;  1QCN A;  4Z8A A;  3P8B B;  1RUW A;  1UGS B;  1I4K 1;  4PJO E;  2ED1 A;  1RAF B;  5C0M A;  1GL5 A;  1KK7 A;  4M7D G;  4QKU A;  1TU0 B;  1OOT A;  3CBM A;  2ZPG B;  3CMA A;  2MOX A;  1AZE A;  1D1B A;  2BE9 B;  2EAY A;  3A8G B;  4M7A G;  2XIC A;  4BE0 A;  4M77 B;  1TUC A;  2E3H A;  1Y71 A;  2K6D A;  1TOV A;  4F7U A;  3PGG A;  1R8O B;  2B86 A;  1JEG A;  2RI5 A;  1UGQ B;  3S3N A;  4EMK B;  1FWZ A;  1WFW A;  4C8Q F;  3TRE A;  4BY6 B;  5IHI A;  1SHG A;  1UEC A;  4C0G A;  1PRL C;  2WSC E;  2CP0 A;  2YSQ A;  5FRM A;  3H9N A;  2KXD A;  2DM1 A;  1Y0M A;  4J7I A;  5CKE A;  4A4K A;  1TUG B;  3CME A;  4PJO C;  1VQL T;  3M0R A;  1R77 A;  2L3R A;  2H3E B;  4DA4 A;  1N8R U;  3M57 A;  3UAT A;  1WX6 A;  4M78 D;  4BI3 A;  5CIU A;  5FU7 B;  2YUP A;  2KBT A;  3CCQ Q;  4E7S A; 
#chains in the Genus database with same CATH homology
 4A63 B;  1M3B A;  3NGP A;  3EG2 A;  3VRZ A;  2GTJ A;  2P4R A;  2X3X D;  4D8K A;  3VRY A;  2BZX A;  3CQT A;  2CT3 A;  1QWF A;  1OPL A;  1YN8 A;  3UA7 A;  2KR3 A;  4Z89 A;  2HDA A;  2K79 A;  2DX1 A;  1PHT A;  2EYW A;  1UFF A;  2XMF A;  4IIM A;  2DLP A;  2KT1 A;  1X2K A;  1X6G A;  1X43 A;  2LQN A;  4F17 A;  2LMJ A;  2KRO A;  2RNA A;  2H8H A;  4F16 A;  2EYX A;  1Z9Z A;  1VYV A;  3SHW A;  2KRM A;  1ZLM A;  2FPE A;  2VWF A;  1BBZ A;  4J9F A;  5EC7 A;  1AWO A;  3KFV A;  1JXM A;  1VYU A;  2C0T A;  2LJ3 A;  4KRT A;  4RTT A;  3VS2 A;  2DMO A;  2GBQ A;  4J9H A;  1K0S A;  4ORZ A;  1CKA A;  5HCK A;  2DNU A;  2DYB A;  3UF4 A;  4AFU C;  1KFZ A;  2CH4 A;  1SRL A;  4RTX A;  3M0U A;  1EFN A;  4Z88 A;  3EG1 A;  1K0X A;  2DRK A;  2YT6 A;  1OPK A;  5FW9 A;  2DIL A;  2L3P A;  2PZ1 A;  4OMP A;  2VVK A;  4RTY A;  1G83 A;  4AG1 C;  1AVZ C;  2HEQ A;  2LJ1 A;  4JPB W;  3VS4 A;  4CC7 A;  2CSI A;  4WCI A;  2DF6 A;  1NLO C;  1NEG A;  1SHF A;  4F14 A;  2F2X A;  2OAW A;  1FMK A;  1GRI A;  2FPD A;  2DJQ A;  2L0A A;  2DA9 A;  3TSZ A;  3ZL7 C;  2KXC A;  2HBW A;  1QCF A;  3VS7 A;  4RTU A;  1AWJ A;  2O9S A;  2CT4 A;  1SEM A;  1WXT A;  4RTZ A;  4LNP A;  2DBM A;  2SEM A;  2EGE A;  1SPK A;  2KGT A;  3EHR A;  1S1N A;  2DL8 A;  4LUD A;  4K11 A;  4FSS A;  1E6G A;  2EPD A;  2M51 A;  1B07 A;  2J06 A;  3LH5 A;  3M0T A;  2FPF A;  1V1C A;  2NWM A;  2LX7 A;  3EG3 A;  4R0K A;  1NM7 A;  3I5R A;  1PRM C;  1Y57 A;  1W6X A;  1T0H A;  1KJW A;  1ZSG A;  3GBQ A;  1UE9 A;  2FRY A;  1XOV A;  1AZG B;  1JU5 C;  1WLP B;  2DL5 A;  4OMQ A;  2C0I A;  1YNZ A;  1BB9 A;  4J9G A;  1CSK A;  2J6F A;  1AD5 A;  1YWP A;  4DEY A;  3I35 A;  2YDL A;  2D0N A;  2W0Z A;  1GBQ A;  2DL7 A;  2NUZ A;  1BK2 A;  2D1X A;  2CSQ A;  1SSH A;  2ENM A;  2LCS A;  1KIK A;  2A37 A;  1ABO A;  1E7O A;  3EGU A;  2YUN A;  1T3L A;  3NHN A;  1H3H A;  3VS6 A;  3RBB B;  1YWO A;  2JS2 A;  2L2P A;  3U23 A;  1IO6 A;  2G6F X;  2JT4 A;  4Y92 A;  3THK A;  2D8H A;  1NYG A;  1G2B A;  2AZS A;  2DBK A;  5GJV B;  2BZ8 A;  1K76 A;  2I0N A;  2JS0 A;  2YUQ A;  1GCQ C;  1JO8 A;  4M4Z A;  2KRN A;  2FO0 A;  2RQU A;  3VS5 A;  1T3S A;  1UHF A;  3QWX X;  2GQI A;  3QWY A;  2LNH B;  1GCP A;  2FRW A;  1NG2 A;  2EW3 A;  2VKN A;  3A98 A;  2ROL A;  1H92 A;  2GNC A;  4EIK A;  1M3C A;  5L23 A;  4D8D A;  1H8K A;  2AKL A;  1K9A A;  1QKW A;  1WXB A;  2HCK A;  1M3A A;  2AZV A;  1N5Z A;  2RQV A;  1PNJ A;  3FJ5 A;  2O9V A;  1UTI A;  2X3W D;  2K7A A;  1BU1 A;  2K2M A;  2O31 A;  2DL3 A;  1WI7 A;  4OMO A;  1ZUU A;  3ULR B;  1U5S A;  4DEX A;  3H41 A;  2V1R A;  3NMZ C;  1ZBJ A;  3VS3 A;  4JJD A;  4ZNX A;  2EGA A;  2PNI A;  2GTO A;  1ZUY A;  2C0O A;  2MIO A;  2EBP A;  2LZ6 B;  1OV3 A;  1RLQ C;  1TUD A;  2OI3 A;  2RMO A;  4HVU A;  1QWE A;  1JQQ A;  2ABL A;  4JZ3 A;  2RQR A;  4OML A;  1JXO A;  2K9G A;  2LQW A;  2MCN A;  1HSQ A;  3I5S A;  4OMN A;  1B3Q A;  1GBR A;  4JJC A;  3REB B;  2JM8 A;  1UHC A;  2JXB A;  5I22 A;  3NPF A;  2IIM A;  2OJ2 A;  4RUG A;  1X2Q A;  3UA6 A;  1M27 C;  1ARK A;  4J9B A;  2O88 A;  3H0I A;  4AFQ C;  2LP5 A;  1VA7 A;  2J7I A;  3M0S A;  4JZ4 A;  2JTE A;  2AKK A;  3M0Q A;  4AFZ C;  1ZUK A;  3M0P A;  2DE0 X;  4LN2 A;  3O5Z A;  1AOJ A;  1I0C A;  2ESW A;  2L3Q A;  5IH2 A;  5IXF A;  1YP5 A;  1KSW A;  2EGC A;  1I1J A;  1SRM A;  5IHN A;  1AEY A;  2KYB A;  5FWC A;  4OMM A;  3EG0 A;  2JM9 A;  4J9C A;  1MV3 A;  2A28 A;  2L3S A;  1YCS B;  5GJW B;  1J3T A;  2A08 A;  1UUE A;  1U3O A;  2F2V A;  2EQI A;  1I07 A;  2O2O A;  2SRC A;  4J9E A;  5IHK A;  1U06 A;  4RTV A;  4X1V A;  4HVW A;  3EHQ A;  2GGR A;  4CC3 A;  1UDL A;  4AG2 C;  1T0J A;  2DL4 A;  5I11 A;  1X27 A;  4CC2 A;  1QKX A;  2PTK A;  2J6K A;  1UJ0 A;  1UG1 A;  4LE9 A;  1RI9 A;  1PKT A;  3R6N A;  4ESR A;  1MUZ A;  1K4U S;  3VS1 A;  2J6O A;  1GFC A;  4HCK A;  4J9I A;  2CUB A;  1K1Z A;  2D8J A;  2ED0 A;  1NEB A;  2E5K A;  2CDT A;  4IIO A;  1WDX A;  3C0C A;  2JW4 A;  1OEB A;  1AWW A;  2DRM A;  2KYM A;  3TVT A;  2RQT A;  1E6H A;  2QDL A;  3I9Q A;  2RF0 A;  1LCK A;  2LJ0 A;  4J9D A;  1ABQ A;  3PVQ A;  2EYZ A;  2K3B A;  2EYY A;  1X6B A;  2JMA A;  3IQL A;  1GCQ A;  2ROT A;  3VS0 A;  1WXU A;  2FEI A;  1PWT A;  1X69 A;  2CRE A;  1Z9Q A;  2F2W A;  2KEA A;  1QLY A;  1CKB A;  4Z8A A;  2KRS A;  1RUW A;  2EKH A;  1GFD A;  2HSP A;  2ED1 A;  2KNB B;  3H0F A;  2J05 A;  2RPN A;  1GL5 A;  1WA7 A;  1HD3 A;  3SEM A;  2YUO A;  1OOT A;  2JMC A;  1W1F A;  1TG0 A;  2MOX A;  1AZE A;  1HJD A;  2RN8 A;  4RTW A;  5ECA A;  2EVR A;  1FYN A;  4QT7 A;  3JV3 A;  1A0N B;  1TUC A;  2DVJ A;  2K6D A;  2M0Y A;  2RQW A;  4GBQ A;  4GLM A;  2B86 A;  1JEG A;  1UGV A;  1W70 A;  2BZY A;  1WFW A;  2W10 A;  4CC4 B;  1WIE A;  3H0H A;  5IHI A;  2A36 A;  2CUD A;  1SHG A;  1UEC A;  1VYT A;  1PRL C;  1M30 A;  2FG0 A;  2YSQ A;  1NYF A;  3PE0 A;  1ZX6 A;  2AK5 A;  2KXD A;  3TSW A;  2DM1 A;  1AWX A;  1Y0M A;  3RNJ A;  4AFS C;  2CH4 W;  3REA B;  2KT8 A;  2KE9 A;  1UJY A;  4E6R A;  3M0R A;  1M8M A;  1PKS A;  4LUE A;  4HXJ A;  1NLP C;  2BTT A;  1MV0 B;  3UAT A;  1WX6 A;  5FWB A;  2ECZ A;  5IXB A;  2YUP A;  1WYX A;  2KBT A;  2V1Q A;  3PVL A;  4JJB A;  4HVV A;  1RLP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...