3NMZC

Crystal structure of apc complexed with asef
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
85
structure length
85
Chain Sequence
SSHHYSHPGGGGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGEGWFPASFVRLRVNQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the recognition of Asef by adenomatous polyposis coli
doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/cell cycle
molecule keywords APC variant protein
total genus 13
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3nmzC00
1X43A 2W0ZA 2KEAA 1WXUA 2KE9A 1VYVA 2JT4A 1OV3A 1K4US 2EYZA 1KSWA 3VS5A 1M8MA 3EHQA 3GBQA 2FPEA 1NEBA 4JPBW 4JJBA 2ED1A 3NHNA 1T0HA 2FRWA 4OMOA 1UFFA 4X1VA 3EHRA 1M3BA 2BZ8A 3FJ5A 1NEGA 1H8KA 2PTKA 1Y57A 4OMNA 4IIOA 2YUNA 1AWXA 2O9SA 1TUCA 2EGCA 1JO8A 1K9AA 4J9FA 2J7IA 1YCSB 1YNZA 1Z9QA 1U06A 3QWXX 5FW9A 5IHNA 2AZVA 2A37A 1RLQC 5EC7A 2DM1A 2RNAA 1WLPB 4DEYA 4AFQC 1HSQA 1ZUKA 2RQWA 1CKBA 1N5ZA 2AKLA 4LNPA 1U5SA 1M3CA 4WCIA 2DRKA 2M51A 1AZGB 3PVLA 3IQLA 2O31A 3REAB 2NWMA 1SHGA 1E6HA 2F2WA 2KRMA 1HD3A 2K9GA 2CUDA 1OEBA 1G83A 3R6NA 2X3WD 1ABOA 2HDAA 3I5RA 1WFWA 4F14A 2V1QA 2KBTA 4J9GA 3KFVA 2KR3A 2DNUA 3VRYA 3JV3A 2EGEA 5HCKA 2PZ1A 5IXBA 3VS0A 2CT4A 2A08A 1QLYA 1X6GA 1X69A 4CC7A 1W6XA 1SEMA 1X6BA 3M0QA 1HJDA 2DILA 1RLPC 1QWFA 1NM7A 1VA7A 2DYBA 3U23A 3ZL7C 1ZSGA 2KT8A 1Z9ZA 4LE9A 1JQQA 1M27C 1JXMA 2ABLA 2JMAA 4HVWA 1QKWA 4Z8AA 5FWCA 3SHWA 2HCKA 1S1NA 2OJ2A 2J05A 2K7AA 3VS1A 4AFSC 2VWFA 2KROA 2JM8A 4Y92A 4CC2A 2YSQA 2JTEA 1YN8A 2LJ0A 1TUDA 4Z88A 2NUZA 2VKNA 2DL4A 2RN8A 1CSKA 3VRZA 2YUQA 1UHFA 2GTOA 1KIKA 3LH5A 1PKSA 1ZBJA 2DLPA 3EG1A 4EIKA 2PNIA 4OMQA 1YWOA 2DL5A 3M0RA 5IHKA 1PRLC 3UF4A 2RMOA 1WI7A 1PNJA 1RUWA 1SRMA 3H41A 2JW4A 3REBB 4ORZA 2CH4A 1WYXA 2DBKA 1JU5C 1AWJA 1WIEA 5FWBA 2FPFA 2ROLA 3ULRB 1KFZA 2DL8A 4J9IA 3M0UA 2D8JA 4KRTA 2AZSA 4RUGA 1PKTA 2J6KA 2LZ6B 2A28A 1UE9A 4IIMA 1UG1A 4F17A 1UECA 3PE0A 3THKA 1OPKA 2LCSA 4F16A 1OOTA 2EGAA 1X2KA 4R0KA 3QWYA 4HXJA 2O9VA 2LQWA 3TSZA 1E7OA 2J6OA 1UTIA 3UATA 1I1JA 3VS7A 4JJDA 2M0YA 2QDLA 2LX7A 1SHFA 1EFNA 3A98A 1M30A 4J9DA 1AOJA 4GLMA 2D1XA 1AVZC 2L3QA 2LMJA 3VS2A 3NGPA 1GFCA 2LP5A 1J3TA 2A36A 2FG0A 1T3LA 2OI3A 2KYMA 5GJVB 3VS3A 4CC4B 2LNHB 2YUPA 2GBQA 1A0NB 1FMKA 1GBRA 2F2VA 3TVTA 1UHCA 1GBQA 1CKAA 1NLOC 2EKHA 2KXDA 3O5ZA 4RTUA 1V1CA 1SRLA 2MOXA 2DJQA 1ARKA 1K0XA 2CUBA 2YUOA 2C0OA 2HSPA 2RPNA 2EVRA 2J06A 2E5KA 3NMZC 2LQNA 1TG0A 1E6GA 1Y0MA 5I22A 1M3AA 1GCQC 4HVVA 2JS2A 2KRNA 1UJYA 3RBBB 1LCKA 4RTVA 1FYNA 2FPDA 2K3BA 1H3HA 2CSQA 1PHTA 1U3OA 1NG2A 2BZXA 4AFUC 2EQIA 2JM9A 2BZYA 1WA7A 2H8HA 2DA9A 1I0CA 2CSIA 2KT1A 1BB9A 1WX6A 2KYBA 4LUEA 1WXBA 1PRMC 2LJ1A 2DF6A 2ECZA 3EGUA 2AK5A 4J9BA 5IXFA 2C0IA 4HCKA 4RTYA 2K2MA 1T0JA 2SEMA 4J9EA 3C0CA 1GCPA 4CC3A 4ZNXA 4OMMA 2OAWA 2DE0X 1UUEA 1W70A 2RF0A 5GJWB 2I0NA 2EYYA 1T3SA 5ECAA 1OPLA 2DX1A 4J9HA 2YT6A 2GGRA 2GNCA 1VYTA 4RTZA 3M0TA 3VS6A 4Z89A 2G6FX 5IH2A 3PVQA 2HBWA 4DEXA 2KXCA 1W1FA 2L2PA 2DL3A 2JMCA 3EG3A 4J9CA 2V1RA 2RQVA 2IIMA 2RQUA 1YP5A 1GL5A 2FRYA 3H0HA 1SSHA 4QT7A 4FSSA 1AD5A 3I9QA 1IO6A 2ENMA 2GQIA 2YDLA 1GFDA 2JS0A 1PWTA 3M0SA 1QCFA 1MUZA 2K6DA 2D0NA 1ZUYA 1AEYA 1ABQA 2SRCA 4LUDA 2CREA 2BTTA 4OMPA 2K79A 1K76A 1AZEA 1BU1A 2MIOA 2RQRA 1GCQA 3EG2A 1H92A 2CDTA 1AWOA 3UA7A 2HEQA 1UGVA 2ESWA 1K0SA 4RTXA 5I11A 1G2BA 1UDLA 2C0TA 2D8HA 1B07A 4LN2A 2L3SA 4E6RA 1YWPA 1WDXA 2LJ3A 4ESRA 3SEMA 1GRIA 2KRSA 2DVJA 1ZUUA 5IHIA 3I35A 1WXTA 2ROTA 2DMOA 3EG0A 1RI9A 3M0PA 3UA6A 2DRMA 2EYWA 2XMFA 1NLPC 3CQTA 1JEGA 3VS4A 2AKKA 1QKXA 2FO0A 2L3PA 1I07A 2X3XD 3RNJA 4AG1C 4M4ZA 4AFZC 4D8DA 1AWWA 1VYUA 4JZ4A 3NPFA 2DL7A 2MCNA 3I5SA 3TSWA 1ZLMA 2EW3A 2JXBA 2P4RA 4RTWA 2CH4W 1K1ZA 1XOVA 2ED0A 1B3QA 1BBZA 4AG2C 1X27A 1X2QA 1MV3A 4GBQA 3H0IA 4JJCA 1ZX6A 4JZ3A 4A63B 4K11A 2L0AA 2O88A 1QWEA 4OMLA 1JXOA 1KJWA 2EYXA 1NYGA 2CT3A 1MV0B 2VVKA 5L23A 2B86A 2GTJA 2KGTA 2DBMA 2KNBB 2FEIA 1NYFA 1UJ0A 4RTTA 1BK2A 4HVUA 2EPDA 4D8KA 2F2XA 2RQTA 2J6FA 3H0FA 2W10A 1SPKA 2EBPA 2O2OA
chains in the Genus database with same CATH superfamily
2W0ZA 1YI2A 2H3EB 1VYVA 2KE9A 2QEXA 2VV5A 5M9OA 1M8MA 1NEBA 4UC4A 2P0QA 5CKDA 3QO3A 3EHRA 2BZ8A 4EMKA 1H641 1TUCA 2E64A 3QZ5B 3C12A 3C95A 1VUBA 4A4GA 4F7UA 4IUPA 2CP7A 3CPFA 3CCJA 1YCSB 3L2UA 1W2BA 4ZTFA 2RD1A 4OB1B 2K5IA 1YITQ 5IHNA 2A37A 2RNAA 2RQWA 3ER0A 1N5ZA 3EFRA 3CCUQ 3MP6A 4JDSA 4WCIA 1VQKQ 3VKIA 5GAOm 2ZPFB 2M51A 1AZGB 1VQ8A 2EJ9A 2NWMA 3CC7T 2ATCB 2KRMA 3NFCA 1HD3A 2CUDA 1OEBA 5FRNA 1VQOQ 1ABOA 2KBTA 1DJ7B 1WHLA 1WPYA 4LDUA 3VRYA 1BIAA 2EGEA 3KUFA 2FZGB 1LOJA 3CCMT 2EJGA 2CS7A 3VU3C 2DFUA 1I5OB 4A53A 4CC7A 1NJIU 1X6BA 1RAEB 2DILA 2CYZB 3A8LB 4C92B 2KT8A 2LDMA 5LJ5f 1Z9ZA 3MHXA 1JQQA 1M27C 3CMET 2ABLA 2JMAA 1QKWA 3CCRA 5FWCA 4BE0A 2QTXA 4NOYA 3EGDB 3VUZA 1FMVA 1G8XA 2JM8A 1LNXA 1YN8A 2HL3A 2LJ0A 3OQ5A 5LJ3g 3UDCA 3KXTA 2RN8A 1W2BP 5D6XA 1VQ7Q 3CBOA 2YUQA 4Z02A 4ZN1A 5GANj 3LH5A 1PKSA 3EG1A 4C8QE 4MDWA 3CCVT 1PRLC 4XTYA 3G6ET 1G3YA 1VQ8T 2IG0A 2RMOA 1WI7A 3RR6A 4MMLA 3TEEA 1BI0A 2L3RA 1WYXA 4XU0A 1JU5C 1WIEA 1KFZA 3ZEHA 4Q5WA 4A4FA 2QQSA 1X75C 3M0UA 4KRTA 2J6KA 5FU7B 3JB9G 1M1KC 1OPKA 1VQKT 4F16A 3CCUT 2XI9A 3J81E 3OY9A 4IUTA 3SDZA 3AHUA 2J6OA 1UTIA 2RHIA 3PIOA 2YHTA 3OYGA 3RDVA 2XD0A 4QVCA 4M7AA 1W4SA 1VQ9T 1YHQQ 1RABB 2IVWA 5D7UA 4M75B 4BB7A 2OTJQ 2LP5A 2A36A 2FG0A 4CC4B 1ZSZC 8ATCB 2LNHB 4J7IA 3JB9H 3O8VA 2YUPA 1FMKA 1GBRA 4MZPA 3TVTA 1UHCA 2GF7A 1NLOC 4XK8E 3O5ZA 3G6EQ 1WJQA 3RERA 2YRCA 1V1CA 4IUUA 2JTFA 1U1TA 1GXIE 2RM4A 1QVGA 1V29B 2RK1A 5HK3A 3D7SB 1TG0A 4XU1A 1E6GA 1Y0MA 1MMAA 5I22A 2K4YA 1Q95G 1GCQC 3VYHB 2QA4T 2HL5C 2KRNA 2D6FA 3OYKA 1ZSZA 5DM7R 1SF9A 4J6XA 4RTVA 4N4GA 1FYNA 3FLGA 1H3HA 1K8AR 1I4K1 4DOWA 1BI3A 3RKWA 5L8RE 5CKFA 4M78B 1B34B 5LJ3f 2MWPA 1U3OA 1NG2A 2GCXA 4PFOA 2KK4A 3VUBA 2LCCA 1YIJT 3MKDA 2EIFA 2CSIA 3VJPA 3VYGA 5LJ3h 2KT1A 3GNGA 1WX6A 2KYBA 4LUEA 4PJOA 2RHZA 3EH1A 2XU8A 4M77A 2AK5A 5IXFA 4HCKA 4RTYA 4PFPA 2KMTA 3HPWA 5FRMA 3MJXA 1T0JA 3OYMA 2E3IA 3CCMQ 2E4HA 3P8BB 3A8HB 1VIFA 2OAWA 1W70A 2DXTA 3I56A 5GJWB 2I0NA 4KBMB 2EYYA 4P5NA 2PUKB 5CVIA 1NE8A 5KYWB 1WHGA 4J9HA 1YHQA 3QJ6A 4M77E 4M78C 1YBYA 1ZQ1A 1VQOT 4OB3B 2GNCA 2HBPA 4E47A 3JCMJ 3I55A 4PJOE 3VS6A 2HKNA 1YJWA 4Z89A 1AT1B 5IH2A 3PVQA 4E7JA 4DEXA 2OAUA 1BIBA 1WJRA 1W1FA 2ZPBB 3JCMg 2DIQA 5KYXA 2V1RA 3OS2A 1IHVA 2IIMA 2RQUA 1YP5A 1GL5A 2XIDA 3M56A 2JS0A 4E7ZA 2CP6A 2DYIA 4J8OA 3L42A 1R77A 1LPLA 2SRCA 2QQ9A 3X26B 2E41A 2CREA 5LJ3d 2K79A 4FYYB 1K76A 2RQRA 4JRKA 2CZ6B 4C8QF 4PL6A 4KGXB 1AWOA 2HEQA 3RUXA 2X4XA 1VOMA 4RTXA 4A4HA 1YIJA 4E6RA 3GIBA 3J7AF 4M7DF 4JS4A 2DVJA 4RCBA 3FJPA 3I35A 3DLLA 1IGUA 1N8RR 3CQTA 3OYFA 1JEGA 5AT1B 1KD1U 2AKKA 3JB9D 2FO0A 1WHKA 2CP2A 2OTJA 3RNJA 5LJ3e 1H3ZA 1AWWA 4JZ4A 4LD6A 5GANd 2QAZA 3ASKA 4MZTA 3I55T 2COYA 3I5SA 4ZGJB 4JRIA 1WZOA 4YTLA 3MP8A 2DETA 1ZLMA 3OYNA 2EW3A 1QVFP 2DJZA 4RTWA 2CH4W 1XOVA 4MZMA 4AG2C 2G3RA 3FC3A 1TH7A 4C5GA 2HD0A 5GAOp 1X27A 1X2QA 2VGMA 4GBQA 3H0IA 4JJCA 5D6WA 4K11A 3FB9A 4OMLA 1KJWA 1XTDA 1MMNA 1NYGA 3CC7A 3RESA 2LT4A 4C5EA 1MV0B 2VVKA 1I81A 2GTJA 4E7KA 2KNBB 5GANe 3L2ZA 2EPDA 4C0ZA 4D8KA 4M7AC 2RQTA 4M75G 4PKCC 3QHSA 3H0FA 2W10A 3SFMA 4DBRA 1R0CB 2CZ1B 1RAHB 1D1CA 4RG2A 2LVMA 1D0XA 4XTUA 3NTIA 3RKYA 1OV3A 1Q86R 1K4US 3VS5A 2O4XA 4ZGDB 1S72Q 4RG8A 5CAIA 1T0HA 2E3HA 1EIFA 1UFFA 5GAN5 4X1VA 3CCRQ 2GQVA 3PT9A 3Q1JA 4OP0A 1M3BA 4FSXA 4N4IA 1OQKA 1QVPA 1OU8A 2EFIA 1KK7A 2RB6A 4IIOA 4OB2B 4O6JA 2KQWA 1UGQB 1K9AA 4FL6A 2RI2A 1LJOA 2AT1B 4NS5A 2DXUA 2XDDA 3QWXX 1N8RC 5GANg 1WQWA 4BI3A 4JRPA 1YJ9Q 2FYKA 2DM1A 1X6OA 2FZKB 3C94A 4DEYA 2M9UA 2DPPB 4XTZA 1BCMA 3MPUB 2OTLQ 2FVUA 3CCST 3MEUA 3G6EA 2DRKA 3L2RA 1BI2A 4PJOC 3IQLA 2O31A 2V8JA 1SHGA 4HT9A 2F2WA 1Y96A 4XU3A 2DTHA 4KUDK 2HDAA 2KSSA 1WFWA 1YITT 2EAYA 3PGGA 4J5YA 1WHMA 3X25B 1VQNA 4XAXB 3JCMd 2JNGA 3OS0A 1XQHA 4A54A 1SG5A 4E7LA 4CRIA 1HJDA 2VC8A 3NTKA 1UEBA 3U23A 2C06A 2NUTA 3S3MA 1YJNT 4C92F 4LE9A 1Q86U 1JXMA 4HVWA 3EFSA 2OJ2A 5I2MA 5LJ5e 1K9MR 3HHTB 3CMEA 1FMWA 2QK0A 4PJNA 3NTHA 4AMCA 5KYXB 2JTEA 1PG5B 2NUZA 2NUPA 3GNFB 4RKUE 4C92C 1LVKA 2RJCA 3M57A 2DL4A 4M7DB 2COZA 2P84A 3LX7A 1UHFA 5J39A 4X34A 3S3OA 2QDYB 2DLPA 5EG2A 5LJ5g 1ZSZB 4OMQA 3QDFA 2VGNA 1D0ZA 2LQKA 3QUIA 3UF4A 1Q82R 1M1KR 2JW4A 3CCVA 1K73U 2E6NA 4ORZA 1N27A 3OBWA 1OZ3A 1MHNA 2DBKA 2FPFA 1TUGB 1D1BA 4J9IA 2D8JA 1M90R 2ZAEA 5A0LA 2RA2A 2DERA 4RUGA 3I56Q 4IIMA 1UG1A 1UECA 3THKA 5CKBA 3CCSQ 2FZCB 1MMDA 4KT0E 1VQ5Q 5KYUB 1IGQA 4M78E 2QYZA 1VQNT 1OX9A 1VQ5T 1VQKA 3TSZA 3FDRA 1E7OA 3VS7A 3JRZA 4JJDA 2M0YA 2QDLA 3GPLA 2LX7A 1SHFA 3OSVA 2DD4A 1IB8A 3I56T 2NUPB 3V7SA 5GAN8 4E7HA 2F69A 2MPXC 3VS2A 4XTWA 4FW1A 1T3LA 2KYMA 4CI0C 4PLLA 1M9SA 2GBQA 4F7UG 1JB0E 2F2VA 3CPWS 3CC2T 5CK9A 3V8LA 3BDLA 1CKAA 1Q82C 2KXDA 2V26A 1SRLA 3OMCA 1PD1A 2CUBA 4M77B 1VQLT 4HCBA 2RPNA 1RAAB 2DO3A 1M90C 2LQNA 5I2SA 1HXDA 4M7AB 1K73R 1I5LA 1S72A 3G7ZA 4OMFB 5DLQE 3SD4A 2X9HA 1M8VA 1LCKA 3QZ9B 2FPDA 2DXCA 4M78F 1U1SA 1PHTA 1JJ2P 4F04B 4F7UE 3F70A 3J80E 1P92A 2EQIA 2JM9A 3CBMA 3M55A 3OW2P 1FX7A 1G3WA 2LJ1A 3SWNA 1G5VA 3L1AA 1VQPT 2K2MA 1VQ5A 1KD1R 4N0AA 1O75A 3BY7A 5IAYA 4CC3A 3VV0A 4C0GA 1QVGP 1WQ7A 1U8RA 1T3SA 5ECAA 2DX1A 1V76A 3GF5A 2GGRA 3JCMV 1VYTA 1VQPQ 4L6V5 2QXFA 4XU2A 3ZFJA 3E1SA 5KYYB 1Q82U 3CBPA 4FM4B 2NLUA 2KXCA 3OS1A 2VB6A 5KYYA 3TCJA 4J9CA 2OTLT 1QVFA 3MEAA 3L2WA 1NJIC 2FRYA 1M4ZA 3H0HA 1AD5A 1PM3A 1GFDA 5HKCA 4KGZB 4B9WA 1TU0B 4X9CA 3CCVQ 3V7CA 1KG1A 3JCMb 1ABQA 2ZPGB 3CCLA 3OMGA 1VQ4T 3CMAA 1VQ7T 3L2VA 4BY6B 1BU1A 2MIOA 2DTIA 3EG2A 2CDTA 4M7DG 1QVGS 1OULA 1UGVA 3CCQQ 4JS5A 1K0SA 2HQXA 1K8AU 1G2BA 4LN2A 1RADB 1YWPA 3X24B 2LJ3A 1N9SA 1ACMB 3LLRA 1GRIA 5IHIA 5GAMh 5GAOq 2XK0A 1RI0A 3V8JA 3RIRA 3CCEA 2CZ7B 2Y4XA 3EG0A 5CR2A 1VQPA 3MO8A 2PVGB 3UWNA 3QXEB 2L8DA 2NUTB 5GAN3 1VQ6T 3LH0A 2JJ9A 5AYFA 5GMKi 4LDYA 5IT9E 5A0GA 1Q7YU 1IREB 4AG1C 4AFZC 1VYUA 5GAN4 4Y28E 3NPFA 3M4YA 3QKJA 3TSWA 3G71A 3JB9F 4HKEA 4BD3A 1OI1A 3JB9I 2OTLA 2RJDA 4M75F 4C92D 2CKKA 3INZA 4JZ3A 4A63B 5GAMe 2O88A 1B34A 5LL6S 4C8QB 3CC7Q 5LJ5d 2CT3A 1UGPB 2D0QB 3G4ST 2FHDA 2B86A 3WXMB 3I55Q 1Y96B 2KGTA 2DBMA 3QPHA 2YLBA 4RTTA 4HVUA 1VQ4A 4QVZA 2LT1A 2DK3A 4HT8A 3CCJQ 1KC8R 2HSEB 3M53A 2F2XA 2J6FA 4M7AG 5CQYA 2I2LA 2QEXT 2EBPA 1X43A 2KEAA 3GOXA 2DZCA 1KSWA 3EHQA 2P0PA 1G3SA 4JPBW 4JJBA 2ED1A 1PSEA 5C6SA 1JJ2A 2MI6A 2E5QA 2PUOB 4BUGA 5FU6C 1NEGA 4M75E 2MF2A 1H8KA 1Y57A 4OMNA 3OYBA 1AWXA 5A2QE 2O9SA 3LWIA 2EGCA 4EMKB 2MYSA 4BE2A 2J7IA 1YNZA 1Z9QA 4C0FA 1PSFA 2DZ9A 3CCJT 5LJ5j 5GAN2 3BDUA 1RLQC 1WLPB 1FWZA 4C0DB 1QVFS 4AFQC 1HSQA 1ZUKA 4ELYC 1CKBA 2AKLA 1PD0A 4LNPA 1U5SA 3REAB 1K8AC 3EH2A 1RL2A 4XTXA 2XICA 1E6HA 3CC4A 1D09B 3CCSA 1BCOA 2QQBA 2K9GA 4M7DE 1G83A 2CP3A 2X3WD 2CP5A 3I5RA 4MMKA 4F14A 3CCMA 4M7AF 3JV3A 5HCKA 2PZ1A 5IXBA 3E2UA 4XQ3A 1G3TA 4F7UF 2QGGA 5DLOA 2CT4A 1QLYA 1X6GA 5GAMj 1RACB 1D1AA 1W6XA 3SWNC 1SEMA 5CCAA 4L59A 2HKQB 1VQ6Q 3HL8A 1NM7A 1VA7A 3TREA 2DYBA 3CCRT 3A5ZB 1ZSGA 3HFNA 3TQ7P 4BDZA 5GMKh 1M90U 2KAFA 3M59A 1KQSA 3OYHA 2RO0A 3E9FA 4B6MA 1NPPA 1S1NA 2NYSA 4NL3A 3CC2A 3CMEQ 4PJOB 2J05A 2K7AA 1VQMA 4AFSC 1M1KU 2KROA 2AIRB 4Y92A 2M0OA 3CCQT 2E70A 1TUDA 3V7RA 4KGVB 4Z88A 3OB9A 2LRQA 3H9NA 3UPUA 3OYAA 1CSKA 1OZ2A 2KVQG 3VRZA 3EAEA 1KIKA 3BE3A 1ZBJA 2R5MA 4QKUA 4OB0B 3RMQA 3JB9J 2XG8D 2DL5A 3M0RA 3UT1A 2A3LA 4PJOF 4J83A 1PNJA 2V8KA 1RUWA 1SRMA 2DVEA 3H41A 3CC4T 1TS9A 5GANf 1I8FA 2ZPIB 3R6OA 3EFOA 4QQGA 5KYWA 5FWBA 2HZYA 3HRUA 3ULRB 4IKFA 2DL8A 2M02A 3OYIA 2AZSA 3SWNB 1VQ9Q 2LZ6B 2A28A 1UE9A 3ME9A 4F17A 2YLCA 3PE0A 2LCSA 1OOTA 3LYIA 1JRIA 5FU7C 1X2KA 4R0KA 3QWYA 2CZ0B 2Y90A 2LQWA 1VQ9A 1BYMA 2HQEA 2QG9B 3UATA 1I1JA 2Y4YA 3FIFA 4FIBA 1EFNA 2XHCA 4GLMA 1AVZC 2LMJA 2EQUA 3CD6A 1HK9A 1GFCA 4GLKA 4QQ6A 4J6WA 4FYWB 2COWA 1D3BA 4PJJA 2PVDB 1GBQA 1VQMT 3HRSA 3QG1A 3QSUA 4XTVA 3JCMc 2MOXA 2R5AA 1KQ1A 2DJQA 3OYJA 1C0MA 2RJFA 2C0OA 4C5IA 2EVRA 2PQWA 2J06A 3QYGB 3GP8A 1MNDA 3OA6A 3PFSA 4HVVA 3M54A 2JS2A 2QEXQ 1EX4A 5FROA 3RBBB 3QDRB 1TWBA 4DOVA 2QA4A 3JCMe 2F1LA 2LCLA 2MAMA 1RAIB 2JZ2A 2EJFA 3PNWC 2BZXA 4C8QD 4AFUC 2X4WA 3QBYA 3P8HA 4ATOA 1WA7A 1N9RA 3PIPA 2DA9A 1I0CA 3G4SQ 1YJWQ 3HP9A 2PVOB 2EQMA 3LGLA 1C6VX 2RHXA 1WXBA 4PJMA 2DKGA 3EGUA 3JCMf 4PLIA 4BI4A 1KC8C 1C1AA 2JVVA 2BUDA 4J9EA 4HA8A 1VQ6A 4B9XA 1VQOA 4OMMA 4DQ2A 3DB3A 1PC0A 2RF0A 2YRDA 3MP1A 4V2SA 1KC8U 3CPWP 1YCYA 2YT6A 3WVDB 4FCYA 3M0TA 2G6FX 4M7DA 2A0FB 4EPCA 1WHHA 4JJNK 2EWNA 1YJWT 2RHYA 1YIJQ 2RQVA 4IUQA 4Y91A 3X20B 4IURA 1MGQA 4QT7A 4FSSA 4BACA 4EMGA 1KD1C 1PWTA 2QTVA 4FW2A 5J3BA 2K5LA 3M0SA 3M5AA 2D0NA 4OGEA 2K2VA 1ZUYA 2R57A 3CPWA 3A8GB 3CCLQ 1ZA2B 4LDXA 3FEOA 1YJ9A 1GCQA 1QW1A 3TU4K 2LTOA 3UA7A 1KHCA 2HQHA 1VQ7A 3E19A 5I11A 1UDLA 2CP0A 2F5KA 4ESRA 3SEMA 4ME7A 3WVEB 4M75C 4RMOA 3LWHA 1N6AA 3OS5A 2DMOA 2E12A 2E65A 4FU6A 2DRMA 1YJNQ 2OTJT 1B7TA 1JJ2S 2XDPA 3CD6Q 3JSCA 3VS4A 2L3PA 1I07A 5GAOl 4EDUA 1M5Q1 4KH1B 4M4ZA 1YFNA 4D8DA 2WSEE 1M2VA 5GAN6 2X4JA 2DL7A 4E7SA 2MK5A 2MCNA 2LC4A 2X35A 3S6WA 2P4RA 1IHWA 1AHJB 2IPOB 2ED0A 4QVDA 1UB4A 3G71T 5LJ5h 1JBMA 1ZX6A 1Y7XA 3CC4Q 4PJLA 5CKHA 1TSFA 2VASA 2GFUA 4FYVB 5J26A 5L23A 3DLMA 2FEIA 2PU9B 1NYFA 1BK2A 3T9NA 3G4SA 3EFOB 1YJ9T 4M7AD 5GAMg 2E10A 5GAOr 2MMPA 7AT1B 3MCAB 4O5VA 5GMKj 4C92A 1SPKA 3CXCA 2O2OA 4RCCA 1M2VB 4LDWA 3ZBDA 3MEVA 1ZHIA 1WXUA 2JT4A 2DTOA 2EYZA 2DD5A 3GBQA 4DBQA 1VQLQ 2FPEA 4M78G 5C0MA 1IXDA 3NHNA 1QP3A 2FRWA 4C8QA 4OMOA 3BFMA 1WNLA 3OYLA 4M75A 5DY9A 4ANJA 5KE2A 3OYEA 3CMAQ 3EGXB 3FJ5A 2PTKA 2YUNA 2ZPHB 5KH6A 3RMSA 1JO8A 3EGXA 4EMHA 3OBYA 5KYNA 4J9FA 2XDBA 2GFAA 4J6YA 1U06A 5FW9A 3G1JA 4C5HA 2AZVA 4M77F 1RAFB 3EG9B 3OYCA 5EC7A 1RAGB 1D0YA 2RHUA 4LD9K 1VQNQ 3M9QA 4J7FA 1Y07A 1M3CA 2QASA 4PJOD 3CEYA 2QI2A 3PVLA 4M7DD 3M4GA 2DIGA 1BKBA 4M77D 3HFOA 3HKSA 4M77C 4DBFA 1KHIA 1YITA 2JOYA 1HYOA 4F7UB 3R6NA 4II1A 1OX8A 3G71Q 2V1QA 4J9GA 4KH0B 4ZGEB 5GMKl 1Q81C 3KFVA 2KR3A 2DNUA 1BI1A 1KQ2A 2DXBA 2V8IA 1WGSA 1W2BS 3PMIA 3VS0A 4MDXA 3JCMh 2A08A 3RKXA 2CGHA 1X69A 5I21A 1YI2T 1R8OB 2B8AA 3OW2S 1YJNA 3M0QA 1RLPC 1QWFA 1UGRB 8AT1B 2RH2A 2P4TA 1D3BB 3ZL7C 3CD6T 3HSBA 5GAOn 2JN0A 2X51A 4ELZC 4Z8AA 3SHWA 2HCKA 5GMKm 2BE9B 4A4KA 3VS1A 4WF2A 2VWFA 1R0BG 4PK4A 3S3NA 4JLIA 4HCCA 4CC2A 2YSQA 1IZ6A 2ZGWA 2VKNA 2FL7A 3CCQA 1SKUB 2GTOA 1K9MC 3E9GA 1WHJA 4EIKA 2PNIA 4KULA 1YWOA 5IHKA 3SB2A 4JRQA 3LGFA 1K9MU 3REBB 2CH4A 1Q81U 1ZA1B 1AWJA 1M2OA 5HY6A 2ROLA 2A7YA 6AT1B 4WTOB 3CCUA 3FRNA 5IN1A 1PKTA 1QCOA 4IUVA 4C92E 4C8QG 4OGCA 5GAMf 2EGAA 2BKDN 2P0KA 4HXJA 2O9VA 2L89A 2DEQA 2KDSA 4A4EA 4PFZA 4HCZA 1TOVA 3A8OB 2QGFB 4C0DC 2HMAA 1M30A 3A98A 4J9DA 2HNIA 1AOJA 4QQDA 2D1XA 2L3QA 3JAME 3M58A 3BW1A 5KCHA 3NGPA 3MEWA 1J3TA 3DKMA 2OI3A 5GJVB 3VS3A 3H8ZA 1A0NB 4BE1A 1K73C 5CKEA 2Z0WA 2VXEA 3CCEQ 2K57A 2EKHA 2XKOC 4RTUA 3EGDA 1FXXA 1NPRA 4M75D 2YWWA 1ARKA 2K3XA 1K0XA 4E2FB 2YUOA 1S72T 2K5FA 3OYDA 2VYTA 2HSPA 5GMKe 3QYHB 4ZTJA 1VQ4Q 2E5KA 3NMZC 5LJ3j 4X9DA 1NBEB 4TVRA 1M3AA 4BDYA 1KQSS 1VQLA 1O9SA 3AT1B 1EZZB 1UGSB 2KY9A 2ZPEB 1UJYA 2QA4Q 2AHJB 2M1HA 2EYQA 2K3BA 5KYUA 2CSQA 3N5BB 3OW2A 2FB7A 4VUBA 1Y71A 5GAN7 1QCNA 4C8QC 2BZYA 3JCMX 2RI3A 2H8HA 1Q7YC 3L2QA 3OYYA 2YXYA 1VQMQ 1BB9A 2D9TA 2MWOA 3X28B 4M7DC 3KBGA 1PRMC 2DF6A 2ECZA 2H3JA 2LQ8A 2M16A 1YI2Q 4J9BA 1M1FA 2C0IA 2JUFA 2RJEA 2QQAA 1XNIA 2SEMA 1Q7YR 2WACA 4OF1A 2HAXA 3C0CA 1GCPA 1YHQT 4ZNXA 2DE0X 1UUEA 1SSFA 1WJSA 1OPLA 1MMGA 4RTZA 1NJIR 4E7IA 2WSFE 4NL2A 3PTAA 2K3YA 2ZCFB 3QIIA 5D6YA 1OU9A 4GY5A 2WSCE 4R55A 2HBWA 2BIVA 2L2PA 2DL3A 2JMCA 4KUIA 3EG3A 3META 4LXCA 2F5TX 2EKOA 5GANh 2DAQA 3LW5E 4LDVA 1SSHA 2EQJA 5KE3A 3I9QA 1Q81R 4JLGA 1IO6A 2ENMA 4FT4A 2GQIA 2YDLA 1VQ8Q 1QCFA 1MUZA 2K6DA 2ZZDA 3JCMP 3P8DA 1Q86C 1AEYA 4LUDA 4QW2A 1MNEA 3H6ZA 1IRXA 3V8KA 2BTTA 4OMPA 5FU6B 3URGA 1AZEA 3CXCP 1QMCA 1H92A 2BE7D 4ZN3A 3CCLT 3CMAT 2ESWA 4BY6C 1VIEA 5A0DA 3PMTA 2C0TA 2D8HA 3JCMW 2L5QA 1TTHB 1B07A 2L3SA 1WDXA 2VUBA 4BI8B 3GLXA 3CCET 2YRVA 3CC2Q 2KRSA 4M78A 1ZUUA 4FT2A 1F1BB 2JTMA 1ZBXA 1M1GA 1WXTA 2O4XB 2QQRA 3JCMQ 2KI7A 2ROTA 2LX9A 2O01E 2R58A 1RI9A 5CQXA 3M0PA 3UA6A 2EYWA 2XMFA 2RI5A 5CO7A 5GAMd 1NLPC 3A1PA 4DA4A 3C4SA 1PCXA 1QKXA 4OVAA 4N4HA 2X3XD 4PNOA 2OX7A 2LNVA 3HTRA 1NZ9A 3DB4A 3EG9A 2JXBA 3HRTA 4AT1B 4D6WA 4M78D 1K1ZA 2E1HA 1KQSP 3CXCS 1XJWB 1B3QA 1BBZA 1N8RU 1MV3A 3QJYA 1OYXA 1QP2A 2RK2A 2E6ZA 2X4YA 4DBHA 9ATCB 5KCOA 4M7AE 2L0AA 2EQKA 1QWEA 4R56A 1JXOA 2EYXA 2VXFA 4C92G 4N0AC 5CIUA 2DEUA 4PJOG 5HK0A 1UJ0A 4M77G 4JUVA 4EMKC 4L5GA 5FLXE 1QQJA 3OSSC 3A8MB 1X01A 1TXQA 4FYXB
chains in the Genus database with same CATH topology
1X43A 2W0ZA 2KEAA 1WXUA 2KE9A 1VYVA 2JT4A 1OV3A 1K4US 2EYZA 1KSWA 3VS5A 1M8MA 3EHQA 3GBQA 2FPEA 1NEBA 4JPBW 4JJBA 2ED1A 3NHNA 1T0HA 2FRWA 4OMOA 1UFFA 4X1VA 3EHRA 1M3BA 2BZ8A 3FJ5A 1NEGA 1H8KA 2PTKA 1Y57A 4OMNA 4IIOA 2YUNA 1AWXA 2O9SA 1TUCA 2EGCA 1JO8A 1K9AA 4J9FA 2J7IA 1YCSB 1YNZA 1Z9QA 1U06A 3QWXX 5FW9A 5IHNA 2AZVA 2A37A 1RLQC 5EC7A 2DM1A 2RNAA 1WLPB 4DEYA 4AFQC 1HSQA 1ZUKA 2RQWA 1CKBA 1N5ZA 2AKLA 4LNPA 1U5SA 1M3CA 4WCIA 2DRKA 2M51A 1AZGB 3PVLA 3IQLA 2O31A 3REAB 2NWMA 1SHGA 1E6HA 2F2WA 2KRMA 1HD3A 2K9GA 2CUDA 1OEBA 1G83A 3R6NA 2X3WD 1ABOA 2HDAA 3I5RA 1WFWA 4F14A 2V1QA 2KBTA 4J9GA 3KFVA 2KR3A 2DNUA 3VRYA 3JV3A 2EGEA 5HCKA 2PZ1A 5IXBA 3VS0A 2CT4A 2A08A 1QLYA 1X6GA 1X69A 4CC7A 1W6XA 1SEMA 1X6BA 3M0QA 1HJDA 2DILA 1RLPC 1QWFA 1NM7A 1VA7A 2DYBA 3U23A 3ZL7C 1ZSGA 2KT8A 1Z9ZA 4LE9A 1JQQA 1M27C 1JXMA 2ABLA 2JMAA 4HVWA 1QKWA 4Z8AA 5FWCA 3SHWA 2HCKA 1S1NA 2OJ2A 2J05A 2K7AA 3VS1A 4AFSC 2VWFA 2KROA 2JM8A 4Y92A 4CC2A 2YSQA 2JTEA 1YN8A 2LJ0A 1TUDA 4Z88A 2NUZA 2VKNA 2DL4A 2RN8A 1CSKA 3VRZA 2YUQA 1UHFA 2GTOA 1KIKA 3LH5A 1PKSA 1ZBJA 2DLPA 3EG1A 4EIKA 2PNIA 4OMQA 1YWOA 2DL5A 3M0RA 5IHKA 1PRLC 3UF4A 2RMOA 1WI7A 1PNJA 1RUWA 1SRMA 3H41A 2JW4A 3REBB 4ORZA 2CH4A 1WYXA 2DBKA 1JU5C 1AWJA 1WIEA 5FWBA 2FPFA 2ROLA 3ULRB 1KFZA 2DL8A 4J9IA 3M0UA 2D8JA 4KRTA 2AZSA 4RUGA 1PKTA 2J6KA 2LZ6B 2A28A 1UE9A 4IIMA 1UG1A 4F17A 1UECA 3PE0A 3THKA 1OPKA 2LCSA 4F16A 1OOTA 2EGAA 1X2KA 4R0KA 3QWYA 4HXJA 2O9VA 2LQWA 3TSZA 1E7OA 2J6OA 1UTIA 3UATA 1I1JA 3VS7A 4JJDA 2M0YA 2QDLA 2LX7A 1SHFA 1EFNA 3A98A 1M30A 4J9DA 1AOJA 4GLMA 2D1XA 1AVZC 2L3QA 2LMJA 3VS2A 3NGPA 1GFCA 2LP5A 1J3TA 2A36A 2FG0A 1T3LA 2OI3A 2KYMA 5GJVB 3VS3A 4CC4B 2LNHB 2YUPA 2GBQA 1A0NB 1FMKA 1GBRA 2F2VA 3TVTA 1UHCA 1GBQA 1CKAA 1NLOC 2EKHA 2KXDA 3O5ZA 4RTUA 1V1CA 1SRLA 2MOXA 2DJQA 1ARKA 1K0XA 2CUBA 2YUOA 2C0OA 2HSPA 2RPNA 2EVRA 2J06A 2E5KA 3NMZC 2LQNA 1TG0A 1E6GA 1Y0MA 5I22A 1M3AA 1GCQC 4HVVA 2JS2A 2KRNA 1UJYA 3RBBB 1LCKA 4RTVA 1FYNA 2FPDA 2K3BA 1H3HA 2CSQA 1PHTA 1U3OA 1NG2A 2BZXA 4AFUC 2EQIA 2JM9A 2BZYA 1WA7A 2H8HA 2DA9A 1I0CA 2CSIA 2KT1A 1BB9A 1WX6A 2KYBA 4LUEA 1WXBA 1PRMC 2LJ1A 2DF6A 2ECZA 3EGUA 2AK5A 4J9BA 5IXFA 2C0IA 4HCKA 4RTYA 2K2MA 1T0JA 2SEMA 4J9EA 3C0CA 1GCPA 4CC3A 4ZNXA 4OMMA 2OAWA 2DE0X 1UUEA 1W70A 2RF0A 5GJWB 2I0NA 2EYYA 1T3SA 5ECAA 1OPLA 2DX1A 4J9HA 2YT6A 2GGRA 2GNCA 1VYTA 4RTZA 3M0TA 3VS6A 4Z89A 2G6FX 5IH2A 3PVQA 2HBWA 4DEXA 2KXCA 1W1FA 2L2PA 2DL3A 2JMCA 3EG3A 4J9CA 2V1RA 2RQVA 2IIMA 2RQUA 1YP5A 1GL5A 2FRYA 3H0HA 1SSHA 4QT7A 4FSSA 1AD5A 3I9QA 1IO6A 2ENMA 2GQIA 2YDLA 1GFDA 2JS0A 1PWTA 3M0SA 1QCFA 1MUZA 2K6DA 2D0NA 1ZUYA 1AEYA 1ABQA 2SRCA 4LUDA 2CREA 2BTTA 4OMPA 2K79A 1K76A 1AZEA 1BU1A 2MIOA 2RQRA 1GCQA 3EG2A 1H92A 2CDTA 1AWOA 3UA7A 2HEQA 1UGVA 2ESWA 1K0SA 4RTXA 5I11A 1G2BA 1UDLA 2C0TA 2D8HA 1B07A 4LN2A 2L3SA 4E6RA 1YWPA 1WDXA 2LJ3A 4ESRA 3SEMA 1GRIA 2KRSA 2DVJA 1ZUUA 5IHIA 3I35A 1WXTA 2ROTA 2DMOA 3EG0A 1RI9A 3M0PA 3UA6A 2DRMA 2EYWA 2XMFA 1NLPC 3CQTA 1JEGA 3VS4A 2AKKA 1QKXA 2FO0A 2L3PA 1I07A 2X3XD 3RNJA 4AG1C 4M4ZA 4AFZC 4D8DA 1AWWA 1VYUA 4JZ4A 3NPFA 2DL7A 2MCNA 3I5SA 3TSWA 1ZLMA 2EW3A 2JXBA 2P4RA 4RTWA 2CH4W 1K1ZA 1XOVA 2ED0A 1B3QA 1BBZA 4AG2C 1X27A 1X2QA 1MV3A 4GBQA 3H0IA 4JJCA 1ZX6A 4JZ3A 4A63B 4K11A 2L0AA 2O88A 1QWEA 4OMLA 1JXOA 1KJWA 2EYXA 1NYGA 2CT3A 1MV0B 2VVKA 5L23A 2B86A 2GTJA 2KGTA 2DBMA 2KNBB 2FEIA 1NYFA 1UJ0A 4RTTA 1BK2A 4HVUA 2EPDA 4D8KA 2F2XA 2RQTA 2J6FA 3H0FA 2W10A 1SPKA 2EBPA 2O2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X43 A;  2W0Z A;  2KEA A;  1WXU A;  2KE9 A;  1VYV A;  2JT4 A;  1OV3 A;  1K4U S;  2EYZ A;  1KSW A;  3VS5 A;  1M8M A;  3EHQ A;  3GBQ A;  2FPE A;  1NEB A;  4JPB W;  4JJB A;  2ED1 A;  3NHN A;  1T0H A;  2FRW A;  4OMO A;  1UFF A;  4X1V A;  3EHR A;  1M3B A;  2BZ8 A;  3FJ5 A;  1NEG A;  1H8K A;  2PTK A;  1Y57 A;  4OMN A;  4IIO A;  2YUN A;  1AWX A;  2O9S A;  1TUC A;  2EGC A;  1JO8 A;  1K9A A;  4J9F A;  2J7I A;  1YCS B;  1YNZ A;  1Z9Q A;  1U06 A;  3QWX X;  5FW9 A;  5IHN A;  2AZV A;  2A37 A;  1RLQ C;  5EC7 A;  2DM1 A;  2RNA A;  1WLP B;  4DEY A;  4AFQ C;  1HSQ A;  1ZUK A;  2RQW A;  1CKB A;  1N5Z A;  2AKL A;  4LNP A;  1U5S A;  1M3C A;  4WCI A;  2DRK A;  2M51 A;  1AZG B;  3PVL A;  3IQL A;  2O31 A;  3REA B;  2NWM A;  1SHG A;  1E6H A;  2F2W A;  2KRM A;  1HD3 A;  2K9G A;  2CUD A;  1OEB A;  1G83 A;  3R6N A;  2X3W D;  1ABO A;  2HDA A;  3I5R A;  1WFW A;  4F14 A;  2V1Q A;  2KBT A;  4J9G A;  3KFV A;  2KR3 A;  2DNU A;  3VRY A;  3JV3 A;  2EGE A;  5HCK A;  2PZ1 A;  5IXB A;  3VS0 A;  2CT4 A;  2A08 A;  1QLY A;  1X6G A;  1X69 A;  4CC7 A;  1W6X A;  1SEM A;  1X6B A;  3M0Q A;  1HJD A;  2DIL A;  1RLP C;  1QWF A;  1NM7 A;  1VA7 A;  2DYB A;  3U23 A;  3ZL7 C;  1ZSG A;  2KT8 A;  1Z9Z A;  4LE9 A;  1JQQ A;  1M27 C;  1JXM A;  2ABL A;  2JMA A;  4HVW A;  1QKW A;  4Z8A A;  5FWC A;  3SHW A;  2HCK A;  1S1N A;  2OJ2 A;  2J05 A;  2K7A A;  3VS1 A;  4AFS C;  2VWF A;  2KRO A;  2JM8 A;  4Y92 A;  4CC2 A;  2YSQ A;  2JTE A;  1YN8 A;  2LJ0 A;  1TUD A;  4Z88 A;  2NUZ A;  2VKN A;  2DL4 A;  2RN8 A;  1CSK A;  3VRZ A;  2YUQ A;  1UHF A;  2GTO A;  1KIK A;  3LH5 A;  1PKS A;  1ZBJ A;  2DLP A;  3EG1 A;  4EIK A;  2PNI A;  4OMQ A;  1YWO A;  2DL5 A;  3M0R A;  5IHK A;  1PRL C;  3UF4 A;  2RMO A;  1WI7 A;  1PNJ A;  1RUW A;  1SRM A;  3H41 A;  2JW4 A;  3REB B;  4ORZ A;  2CH4 A;  1WYX A;  2DBK A;  1JU5 C;  1AWJ A;  1WIE A;  5FWB A;  2FPF A;  2ROL A;  3ULR B;  1KFZ A;  2DL8 A;  4J9I A;  3M0U A;  2D8J A;  4KRT A;  2AZS A;  4RUG A;  1PKT A;  2J6K A;  2LZ6 B;  2A28 A;  1UE9 A;  4IIM A;  1UG1 A;  4F17 A;  1UEC A;  3PE0 A;  3THK A;  1OPK A;  2LCS A;  4F16 A;  1OOT A;  2EGA A;  1X2K A;  4R0K A;  3QWY A;  4HXJ A;  2O9V A;  2LQW A;  3TSZ A;  1E7O A;  2J6O A;  1UTI A;  3UAT A;  1I1J A;  3VS7 A;  4JJD A;  2M0Y A;  2QDL A;  2LX7 A;  1SHF A;  1EFN A;  3A98 A;  1M30 A;  4J9D A;  1AOJ A;  4GLM A;  2D1X A;  1AVZ C;  2L3Q A;  2LMJ A;  3VS2 A;  3NGP A;  1GFC A;  2LP5 A;  1J3T A;  2A36 A;  2FG0 A;  1T3L A;  2OI3 A;  2KYM A;  5GJV B;  3VS3 A;  4CC4 B;  2LNH B;  2YUP A;  2GBQ A;  1A0N B;  1FMK A;  1GBR A;  2F2V A;  3TVT A;  1UHC A;  1GBQ A;  1CKA A;  1NLO C;  2EKH A;  2KXD A;  3O5Z A;  4RTU A;  1V1C A;  1SRL A;  2MOX A;  2DJQ A;  1ARK A;  1K0X A;  2CUB A;  2YUO A;  2C0O A;  2HSP A;  2RPN A;  2EVR A;  2J06 A;  2E5K A;  3NMZ C;  2LQN A;  1TG0 A;  1E6G A;  1Y0M A;  5I22 A;  1M3A A;  1GCQ C;  4HVV A;  2JS2 A;  2KRN A;  1UJY A;  3RBB B;  1LCK A;  4RTV A;  1FYN A;  2FPD A;  2K3B A;  1H3H A;  2CSQ A;  1PHT A;  1U3O A;  1NG2 A;  2BZX A;  4AFU C;  2EQI A;  2JM9 A;  2BZY A;  1WA7 A;  2H8H A;  2DA9 A;  1I0C A;  2CSI A;  2KT1 A;  1BB9 A;  1WX6 A;  2KYB A;  4LUE A;  1WXB A;  1PRM C;  2LJ1 A;  2DF6 A;  2ECZ A;  3EGU A;  2AK5 A;  4J9B A;  5IXF A;  2C0I A;  4HCK A;  4RTY A;  2K2M A;  1T0J A;  2SEM A;  4J9E A;  3C0C A;  1GCP A;  4CC3 A;  4ZNX A;  4OMM A;  2OAW A;  2DE0 X;  1UUE A;  1W70 A;  2RF0 A;  5GJW B;  2I0N A;  2EYY A;  1T3S A;  5ECA A;  1OPL A;  2DX1 A;  4J9H A;  2YT6 A;  2GGR A;  2GNC A;  1VYT A;  4RTZ A;  3M0T A;  3VS6 A;  4Z89 A;  2G6F X;  5IH2 A;  3PVQ A;  2HBW A;  4DEX A;  2KXC A;  1W1F A;  2L2P A;  2DL3 A;  2JMC A;  3EG3 A;  4J9C A;  2V1R A;  2RQV A;  2IIM A;  2RQU A;  1YP5 A;  1GL5 A;  2FRY A;  3H0H A;  1SSH A;  4QT7 A;  4FSS A;  1AD5 A;  3I9Q A;  1IO6 A;  2ENM A;  2GQI A;  2YDL A;  1GFD A;  2JS0 A;  1PWT A;  3M0S A;  1QCF A;  1MUZ A;  2K6D A;  2D0N A;  1ZUY A;  1AEY A;  1ABQ A;  2SRC A;  4LUD A;  2CRE A;  2BTT A;  4OMP A;  2K79 A;  1K76 A;  1AZE A;  1BU1 A;  2MIO A;  2RQR A;  1GCQ A;  3EG2 A;  1H92 A;  2CDT A;  1AWO A;  3UA7 A;  2HEQ A;  1UGV A;  2ESW A;  1K0S A;  4RTX A;  5I11 A;  1G2B A;  1UDL A;  2C0T A;  2D8H A;  1B07 A;  4LN2 A;  2L3S A;  4E6R A;  1YWP A;  1WDX A;  2LJ3 A;  4ESR A;  3SEM A;  1GRI A;  2KRS A;  2DVJ A;  1ZUU A;  5IHI A;  3I35 A;  1WXT A;  2ROT A;  2DMO A;  3EG0 A;  1RI9 A;  3M0P A;  3UA6 A;  2DRM A;  2EYW A;  2XMF A;  1NLP C;  3CQT A;  1JEG A;  3VS4 A;  2AKK A;  1QKX A;  2FO0 A;  2L3P A;  1I07 A;  2X3X D;  3RNJ A;  4AG1 C;  4M4Z A;  4AFZ C;  4D8D A;  1AWW A;  1VYU A;  4JZ4 A;  3NPF A;  2DL7 A;  2MCN A;  3I5S A;  3TSW A;  1ZLM A;  2EW3 A;  2JXB A;  2P4R A;  4RTW A;  2CH4 W;  1K1Z A;  1XOV A;  2ED0 A;  1B3Q A;  1BBZ A;  4AG2 C;  1X27 A;  1X2Q A;  1MV3 A;  4GBQ A;  3H0I A;  4JJC A;  1ZX6 A;  4JZ3 A;  4A63 B;  4K11 A;  2L0A A;  2O88 A;  1QWE A;  4OML A;  1JXO A;  1KJW A;  2EYX A;  1NYG A;  2CT3 A;  1MV0 B;  2VVK A;  5L23 A;  2B86 A;  2GTJ A;  2KGT A;  2DBM A;  2KNB B;  2FEI A;  1NYF A;  1UJ0 A;  4RTT A;  1BK2 A;  4HVU A;  2EPD A;  4D8K A;  2F2X A;  2RQT A;  2J6F A;  3H0F A;  2W10 A;  1SPK A;  2EBP A;  2O2O A; 
#chains in the Genus database with same CATH topology
 2W0Z A;  1YI2 A;  2H3E B;  1VYV A;  2KE9 A;  2QEX A;  2VV5 A;  5M9O A;  1M8M A;  1NEB A;  4UC4 A;  2P0Q A;  5CKD A;  3QO3 A;  3EHR A;  2BZ8 A;  4EMK A;  1H64 1;  1TUC A;  2E64 A;  3QZ5 B;  3C12 A;  3C95 A;  1VUB A;  4A4G A;  4F7U A;  4IUP A;  2CP7 A;  3CPF A;  3CCJ A;  1YCS B;  3L2U A;  1W2B A;  4ZTF A;  2RD1 A;  4OB1 B;  2K5I A;  1YIT Q;  5IHN A;  2A37 A;  2RNA A;  2RQW A;  3ER0 A;  1N5Z A;  3EFR A;  3CCU Q;  3MP6 A;  4JDS A;  4WCI A;  1VQK Q;  3VKI A;  5GAO m;  2ZPF B;  2M51 A;  1AZG B;  1VQ8 A;  2EJ9 A;  2NWM A;  3CC7 T;  2ATC B;  2KRM A;  3NFC A;  1HD3 A;  2CUD A;  1OEB A;  5FRN A;  1VQO Q;  1ABO A;  2KBT A;  1DJ7 B;  1WHL A;  1WPY A;  4LDU A;  3VRY A;  1BIA A;  2EGE A;  3KUF A;  2FZG B;  1LOJ A;  3CCM T;  2EJG A;  2CS7 A;  3VU3 C;  2DFU A;  1I5O B;  4A53 A;  4CC7 A;  1NJI U;  1X6B A;  1RAE B;  2DIL A;  2CYZ B;  3A8L B;  4C92 B;  2KT8 A;  2LDM A;  5LJ5 f;  1Z9Z A;  3MHX A;  1JQQ A;  1M27 C;  3CME T;  2ABL A;  2JMA A;  1QKW A;  3CCR A;  5FWC A;  4BE0 A;  2QTX A;  4NOY A;  3EGD B;  3VUZ A;  1FMV A;  1G8X A;  2JM8 A;  1LNX A;  1YN8 A;  2HL3 A;  2LJ0 A;  3OQ5 A;  5LJ3 g;  3UDC A;  3KXT A;  2RN8 A;  1W2B P;  5D6X A;  1VQ7 Q;  3CBO A;  2YUQ A;  4Z02 A;  4ZN1 A;  5GAN j;  3LH5 A;  1PKS A;  3EG1 A;  4C8Q E;  4MDW A;  3CCV T;  1PRL C;  4XTY A;  3G6E T;  1G3Y A;  1VQ8 T;  2IG0 A;  2RMO A;  1WI7 A;  3RR6 A;  4MML A;  3TEE A;  1BI0 A;  2L3R A;  1WYX A;  4XU0 A;  1JU5 C;  1WIE A;  1KFZ A;  3ZEH A;  4Q5W A;  4A4F A;  2QQS A;  1X75 C;  3M0U A;  4KRT A;  2J6K A;  5FU7 B;  3JB9 G;  1M1K C;  1OPK A;  1VQK T;  4F16 A;  3CCU T;  2XI9 A;  3J81 E;  3OY9 A;  4IUT A;  3SDZ A;  3AHU A;  2J6O A;  1UTI A;  2RHI A;  3PIO A;  2YHT A;  3OYG A;  3RDV A;  2XD0 A;  4QVC A;  4M7A A;  1W4S A;  1VQ9 T;  1YHQ Q;  1RAB B;  2IVW A;  5D7U A;  4M75 B;  4BB7 A;  2OTJ Q;  2LP5 A;  2A36 A;  2FG0 A;  4CC4 B;  1ZSZ C;  8ATC B;  2LNH B;  4J7I A;  3JB9 H;  3O8V A;  2YUP A;  1FMK A;  1GBR A;  4MZP A;  3TVT A;  1UHC A;  2GF7 A;  1NLO C;  4XK8 E;  3O5Z A;  3G6E Q;  1WJQ A;  3RER A;  2YRC A;  1V1C A;  4IUU A;  2JTF A;  1U1T A;  1GXI E;  2RM4 A;  1QVG A;  1V29 B;  2RK1 A;  5HK3 A;  3D7S B;  1TG0 A;  4XU1 A;  1E6G A;  1Y0M A;  1MMA A;  5I22 A;  2K4Y A;  1Q95 G;  1GCQ C;  3VYH B;  2QA4 T;  2HL5 C;  2KRN A;  2D6F A;  3OYK A;  1ZSZ A;  5DM7 R;  1SF9 A;  4J6X A;  4RTV A;  4N4G A;  1FYN A;  3FLG A;  1H3H A;  1K8A R;  1I4K 1;  4DOW A;  1BI3 A;  3RKW A;  5L8R E;  5CKF A;  4M78 B;  1B34 B;  5LJ3 f;  2MWP A;  1U3O A;  1NG2 A;  2GCX A;  4PFO A;  2KK4 A;  3VUB A;  2LCC A;  1YIJ T;  3MKD A;  2EIF A;  2CSI A;  3VJP A;  3VYG A;  5LJ3 h;  2KT1 A;  3GNG A;  1WX6 A;  2KYB A;  4LUE A;  4PJO A;  2RHZ A;  3EH1 A;  2XU8 A;  4M77 A;  2AK5 A;  5IXF A;  4HCK A;  4RTY A;  4PFP A;  2KMT A;  3HPW A;  5FRM A;  3MJX A;  1T0J A;  3OYM A;  2E3I A;  3CCM Q;  2E4H A;  3P8B B;  3A8H B;  1VIF A;  2OAW A;  1W70 A;  2DXT A;  3I56 A;  5GJW B;  2I0N A;  4KBM B;  2EYY A;  4P5N A;  2PUK B;  5CVI A;  1NE8 A;  5KYW B;  1WHG A;  4J9H A;  1YHQ A;  3QJ6 A;  4M77 E;  4M78 C;  1YBY A;  1ZQ1 A;  1VQO T;  4OB3 B;  2GNC A;  2HBP A;  4E47 A;  3JCM J;  3I55 A;  4PJO E;  3VS6 A;  2HKN A;  1YJW A;  4Z89 A;  1AT1 B;  5IH2 A;  3PVQ A;  4E7J A;  4DEX A;  2OAU A;  1BIB A;  1WJR A;  1W1F A;  2ZPB B;  3JCM g;  2DIQ A;  5KYX A;  2V1R A;  3OS2 A;  1IHV A;  2IIM A;  2RQU A;  1YP5 A;  1GL5 A;  2XID A;  3M56 A;  2JS0 A;  4E7Z A;  2CP6 A;  2DYI A;  4J8O A;  3L42 A;  1R77 A;  1LPL A;  2SRC A;  2QQ9 A;  3X26 B;  2E41 A;  2CRE A;  5LJ3 d;  2K79 A;  4FYY B;  1K76 A;  2RQR A;  4JRK A;  2CZ6 B;  4C8Q F;  4PL6 A;  4KGX B;  1AWO A;  2HEQ A;  3RUX A;  2X4X A;  1VOM A;  4RTX A;  4A4H A;  1YIJ A;  4E6R A;  3GIB A;  3J7A F;  4M7D F;  4JS4 A;  2DVJ A;  4RCB A;  3FJP A;  3I35 A;  3DLL A;  1IGU A;  1N8R R;  3CQT A;  3OYF A;  1JEG A;  5AT1 B;  1KD1 U;  2AKK A;  3JB9 D;  2FO0 A;  1WHK A;  2CP2 A;  2OTJ A;  3RNJ A;  5LJ3 e;  1H3Z A;  1AWW A;  4JZ4 A;  4LD6 A;  5GAN d;  2QAZ A;  3ASK A;  4MZT A;  3I55 T;  2COY A;  3I5S A;  4ZGJ B;  4JRI A;  1WZO A;  4YTL A;  3MP8 A;  2DET A;  1ZLM A;  3OYN A;  2EW3 A;  1QVF P;  2DJZ A;  4RTW A;  2CH4 W;  1XOV A;  4MZM A;  4AG2 C;  2G3R A;  3FC3 A;  1TH7 A;  4C5G A;  2HD0 A;  5GAO p;  1X27 A;  1X2Q A;  2VGM A;  4GBQ A;  3H0I A;  4JJC A;  5D6W A;  4K11 A;  3FB9 A;  4OML A;  1KJW A;  1XTD A;  1MMN A;  1NYG A;  3CC7 A;  3RES A;  2LT4 A;  4C5E A;  1MV0 B;  2VVK A;  1I81 A;  2GTJ A;  4E7K A;  2KNB B;  5GAN e;  3L2Z A;  2EPD A;  4C0Z A;  4D8K A;  4M7A C;  2RQT A;  4M75 G;  4PKC C;  3QHS A;  3H0F A;  2W10 A;  3SFM A;  4DBR A;  1R0C B;  2CZ1 B;  1RAH B;  1D1C A;  4RG2 A;  2LVM A;  1D0X A;  4XTU A;  3NTI A;  3RKY A;  1OV3 A;  1Q86 R;  1K4U S;  3VS5 A;  2O4X A;  4ZGD B;  1S72 Q;  4RG8 A;  5CAI A;  1T0H A;  2E3H A;  1EIF A;  1UFF A;  5GAN 5;  4X1V A;  3CCR Q;  2GQV A;  3PT9 A;  3Q1J A;  4OP0 A;  1M3B A;  4FSX A;  4N4I A;  1OQK A;  1QVP A;  1OU8 A;  2EFI A;  1KK7 A;  2RB6 A;  4IIO A;  4OB2 B;  4O6J A;  2KQW A;  1UGQ B;  1K9A A;  4FL6 A;  2RI2 A;  1LJO A;  2AT1 B;  4NS5 A;  2DXU A;  2XDD A;  3QWX X;  1N8R C;  5GAN g;  1WQW A;  4BI3 A;  4JRP A;  1YJ9 Q;  2FYK A;  2DM1 A;  1X6O A;  2FZK B;  3C94 A;  4DEY A;  2M9U A;  2DPP B;  4XTZ A;  1BCM A;  3MPU B;  2OTL Q;  2FVU A;  3CCS T;  3MEU A;  3G6E A;  2DRK A;  3L2R A;  1BI2 A;  4PJO C;  3IQL A;  2O31 A;  2V8J A;  1SHG A;  4HT9 A;  2F2W A;  1Y96 A;  4XU3 A;  2DTH A;  4KUD K;  2HDA A;  2KSS A;  1WFW A;  1YIT T;  2EAY A;  3PGG A;  4J5Y A;  1WHM A;  3X25 B;  1VQN A;  4XAX B;  3JCM d;  2JNG A;  3OS0 A;  1XQH A;  4A54 A;  1SG5 A;  4E7L A;  4CRI A;  1HJD A;  2VC8 A;  3NTK A;  1UEB A;  3U23 A;  2C06 A;  2NUT A;  3S3M A;  1YJN T;  4C92 F;  4LE9 A;  1Q86 U;  1JXM A;  4HVW A;  3EFS A;  2OJ2 A;  5I2M A;  5LJ5 e;  1K9M R;  3HHT B;  3CME A;  1FMW A;  2QK0 A;  4PJN A;  3NTH A;  4AMC A;  5KYX B;  2JTE A;  1PG5 B;  2NUZ A;  2NUP A;  3GNF B;  4RKU E;  4C92 C;  1LVK A;  2RJC A;  3M57 A;  2DL4 A;  4M7D B;  2COZ A;  2P84 A;  3LX7 A;  1UHF A;  5J39 A;  4X34 A;  3S3O A;  2QDY B;  2DLP A;  5EG2 A;  5LJ5 g;  1ZSZ B;  4OMQ A;  3QDF A;  2VGN A;  1D0Z A;  2LQK A;  3QUI A;  3UF4 A;  1Q82 R;  1M1K R;  2JW4 A;  3CCV A;  1K73 U;  2E6N A;  4ORZ A;  1N27 A;  3OBW A;  1OZ3 A;  1MHN A;  2DBK A;  2FPF A;  1TUG B;  1D1B A;  4J9I A;  2D8J A;  1M90 R;  2ZAE A;  5A0L A;  2RA2 A;  2DER A;  4RUG A;  3I56 Q;  4IIM A;  1UG1 A;  1UEC A;  3THK A;  5CKB A;  3CCS Q;  2FZC B;  1MMD A;  4KT0 E;  1VQ5 Q;  5KYU B;  1IGQ A;  4M78 E;  2QYZ A;  1VQN T;  1OX9 A;  1VQ5 T;  1VQK A;  3TSZ A;  3FDR A;  1E7O A;  3VS7 A;  3JRZ A;  4JJD A;  2M0Y A;  2QDL A;  3GPL A;  2LX7 A;  1SHF A;  3OSV A;  2DD4 A;  1IB8 A;  3I56 T;  2NUP B;  3V7S A;  5GAN 8;  4E7H A;  2F69 A;  2MPX C;  3VS2 A;  4XTW A;  4FW1 A;  1T3L A;  2KYM A;  4CI0 C;  4PLL A;  1M9S A;  2GBQ A;  4F7U G;  1JB0 E;  2F2V A;  3CPW S;  3CC2 T;  5CK9 A;  3V8L A;  3BDL A;  1CKA A;  1Q82 C;  2KXD A;  2V26 A;  1SRL A;  3OMC A;  1PD1 A;  2CUB A;  4M77 B;  1VQL T;  4HCB A;  2RPN A;  1RAA B;  2DO3 A;  1M90 C;  2LQN A;  5I2S A;  1HXD A;  4M7A B;  1K73 R;  1I5L A;  1S72 A;  3G7Z A;  4OMF B;  5DLQ E;  3SD4 A;  2X9H A;  1M8V A;  1LCK A;  3QZ9 B;  2FPD A;  2DXC A;  4M78 F;  1U1S A;  1PHT A;  1JJ2 P;  4F04 B;  4F7U E;  3F70 A;  3J80 E;  1P92 A;  2EQI A;  2JM9 A;  3CBM A;  3M55 A;  3OW2 P;  1FX7 A;  1G3W A;  2LJ1 A;  3SWN A;  1G5V A;  3L1A A;  1VQP T;  2K2M A;  1VQ5 A;  1KD1 R;  4N0A A;  1O75 A;  3BY7 A;  5IAY A;  4CC3 A;  3VV0 A;  4C0G A;  1QVG P;  1WQ7 A;  1U8R A;  1T3S A;  5ECA A;  2DX1 A;  1V76 A;  3GF5 A;  2GGR A;  3JCM V;  1VYT A;  1VQP Q;  4L6V 5;  2QXF A;  4XU2 A;  3ZFJ A;  3E1S A;  5KYY B;  1Q82 U;  3CBP A;  4FM4 B;  2NLU A;  2KXC A;  3OS1 A;  2VB6 A;  5KYY A;  3TCJ A;  4J9C A;  2OTL T;  1QVF A;  3MEA A;  3L2W A;  1NJI C;  2FRY A;  1M4Z A;  3H0H A;  1AD5 A;  1PM3 A;  1GFD A;  5HKC A;  4KGZ B;  4B9W A;  1TU0 B;  4X9C A;  3CCV Q;  3V7C A;  1KG1 A;  3JCM b;  1ABQ A;  2ZPG B;  3CCL A;  3OMG A;  1VQ4 T;  3CMA A;  1VQ7 T;  3L2V A;  4BY6 B;  1BU1 A;  2MIO A;  2DTI A;  3EG2 A;  2CDT A;  4M7D G;  1QVG S;  1OUL A;  1UGV A;  3CCQ Q;  4JS5 A;  1K0S A;  2HQX A;  1K8A U;  1G2B A;  4LN2 A;  1RAD B;  1YWP A;  3X24 B;  2LJ3 A;  1N9S A;  1ACM B;  3LLR A;  1GRI A;  5IHI A;  5GAM h;  5GAO q;  2XK0 A;  1RI0 A;  3V8J A;  3RIR A;  3CCE A;  2CZ7 B;  2Y4X A;  3EG0 A;  5CR2 A;  1VQP A;  3MO8 A;  2PVG B;  3UWN A;  3QXE B;  2L8D A;  2NUT B;  5GAN 3;  1VQ6 T;  3LH0 A;  2JJ9 A;  5AYF A;  5GMK i;  4LDY A;  5IT9 E;  5A0G A;  1Q7Y U;  1IRE B;  4AG1 C;  4AFZ C;  1VYU A;  5GAN 4;  4Y28 E;  3NPF A;  3M4Y A;  3QKJ A;  3TSW A;  3G71 A;  3JB9 F;  4HKE A;  4BD3 A;  1OI1 A;  3JB9 I;  2OTL A;  2RJD A;  4M75 F;  4C92 D;  2CKK A;  3INZ A;  4JZ3 A;  4A63 B;  5GAM e;  2O88 A;  1B34 A;  5LL6 S;  4C8Q B;  3CC7 Q;  5LJ5 d;  2CT3 A;  1UGP B;  2D0Q B;  3G4S T;  2FHD A;  2B86 A;  3WXM B;  3I55 Q;  1Y96 B;  2KGT A;  2DBM A;  3QPH A;  2YLB A;  4RTT A;  4HVU A;  1VQ4 A;  4QVZ A;  2LT1 A;  2DK3 A;  4HT8 A;  3CCJ Q;  1KC8 R;  2HSE B;  3M53 A;  2F2X A;  2J6F A;  4M7A G;  5CQY A;  2I2L A;  2QEX T;  2EBP A;  1X43 A;  2KEA A;  3GOX A;  2DZC A;  1KSW A;  3EHQ A;  2P0P A;  1G3S A;  4JPB W;  4JJB A;  2ED1 A;  1PSE A;  5C6S A;  1JJ2 A;  2MI6 A;  2E5Q A;  2PUO B;  4BUG A;  5FU6 C;  1NEG A;  4M75 E;  2MF2 A;  1H8K A;  1Y57 A;  4OMN A;  3OYB A;  1AWX A;  5A2Q E;  2O9S A;  3LWI A;  2EGC A;  4EMK B;  2MYS A;  4BE2 A;  2J7I A;  1YNZ A;  1Z9Q A;  4C0F A;  1PSF A;  2DZ9 A;  3CCJ T;  5LJ5 j;  5GAN 2;  3BDU A;  1RLQ C;  1WLP B;  1FWZ A;  4C0D B;  1QVF S;  4AFQ C;  1HSQ A;  1ZUK A;  4ELY C;  1CKB A;  2AKL A;  1PD0 A;  4LNP A;  1U5S A;  3REA B;  1K8A C;  3EH2 A;  1RL2 A;  4XTX A;  2XIC A;  1E6H A;  3CC4 A;  1D09 B;  3CCS A;  1BCO A;  2QQB A;  2K9G A;  4M7D E;  1G83 A;  2CP3 A;  2X3W D;  2CP5 A;  3I5R A;  4MMK A;  4F14 A;  3CCM A;  4M7A F;  3JV3 A;  5HCK A;  2PZ1 A;  5IXB A;  3E2U A;  4XQ3 A;  1G3T A;  4F7U F;  2QGG A;  5DLO A;  2CT4 A;  1QLY A;  1X6G A;  5GAM j;  1RAC B;  1D1A A;  1W6X A;  3SWN C;  1SEM A;  5CCA A;  4L59 A;  2HKQ B;  1VQ6 Q;  3HL8 A;  1NM7 A;  1VA7 A;  3TRE A;  2DYB A;  3CCR T;  3A5Z B;  1ZSG A;  3HFN A;  3TQ7 P;  4BDZ A;  5GMK h;  1M90 U;  2KAF A;  3M59 A;  1KQS A;  3OYH A;  2RO0 A;  3E9F A;  4B6M A;  1NPP A;  1S1N A;  2NYS A;  4NL3 A;  3CC2 A;  3CME Q;  4PJO B;  2J05 A;  2K7A A;  1VQM A;  4AFS C;  1M1K U;  2KRO A;  2AIR B;  4Y92 A;  2M0O A;  3CCQ T;  2E70 A;  1TUD A;  3V7R A;  4KGV B;  4Z88 A;  3OB9 A;  2LRQ A;  3H9N A;  3UPU A;  3OYA A;  1CSK A;  1OZ2 A;  2KVQ G;  3VRZ A;  3EAE A;  1KIK A;  3BE3 A;  1ZBJ A;  2R5M A;  4QKU A;  4OB0 B;  3RMQ A;  3JB9 J;  2XG8 D;  2DL5 A;  3M0R A;  3UT1 A;  2A3L A;  4PJO F;  4J83 A;  1PNJ A;  2V8K A;  1RUW A;  1SRM A;  2DVE A;  3H41 A;  3CC4 T;  1TS9 A;  5GAN f;  1I8F A;  2ZPI B;  3R6O A;  3EFO A;  4QQG A;  5KYW A;  5FWB A;  2HZY A;  3HRU A;  3ULR B;  4IKF A;  2DL8 A;  2M02 A;  3OYI A;  2AZS A;  3SWN B;  1VQ9 Q;  2LZ6 B;  2A28 A;  1UE9 A;  3ME9 A;  4F17 A;  2YLC A;  3PE0 A;  2LCS A;  1OOT A;  3LYI A;  1JRI A;  5FU7 C;  1X2K A;  4R0K A;  3QWY A;  2CZ0 B;  2Y90 A;  2LQW A;  1VQ9 A;  1BYM A;  2HQE A;  2QG9 B;  3UAT A;  1I1J A;  2Y4Y A;  3FIF A;  4FIB A;  1EFN A;  2XHC A;  4GLM A;  1AVZ C;  2LMJ A;  2EQU A;  3CD6 A;  1HK9 A;  1GFC A;  4GLK A;  4QQ6 A;  4J6W A;  4FYW B;  2COW A;  1D3B A;  4PJJ A;  2PVD B;  1GBQ A;  1VQM T;  3HRS A;  3QG1 A;  3QSU A;  4XTV A;  3JCM c;  2MOX A;  2R5A A;  1KQ1 A;  2DJQ A;  3OYJ A;  1C0M A;  2RJF A;  2C0O A;  4C5I A;  2EVR A;  2PQW A;  2J06 A;  3QYG B;  3GP8 A;  1MND A;  3OA6 A;  3PFS A;  4HVV A;  3M54 A;  2JS2 A;  2QEX Q;  1EX4 A;  5FRO A;  3RBB B;  3QDR B;  1TWB A;  4DOV A;  2QA4 A;  3JCM e;  2F1L A;  2LCL A;  2MAM A;  1RAI B;  2JZ2 A;  2EJF A;  3PNW C;  2BZX A;  4C8Q D;  4AFU C;  2X4W A;  3QBY A;  3P8H A;  4ATO A;  1WA7 A;  1N9R A;  3PIP A;  2DA9 A;  1I0C A;  3G4S Q;  1YJW Q;  3HP9 A;  2PVO B;  2EQM A;  3LGL A;  1C6V X;  2RHX A;  1WXB A;  4PJM A;  2DKG A;  3EGU A;  3JCM f;  4PLI A;  4BI4 A;  1KC8 C;  1C1A A;  2JVV A;  2BUD A;  4J9E A;  4HA8 A;  1VQ6 A;  4B9X A;  1VQO A;  4OMM A;  4DQ2 A;  3DB3 A;  1PC0 A;  2RF0 A;  2YRD A;  3MP1 A;  4V2S A;  1KC8 U;  3CPW P;  1YCY A;  2YT6 A;  3WVD B;  4FCY A;  3M0T A;  2G6F X;  4M7D A;  2A0F B;  4EPC A;  1WHH A;  4JJN K;  2EWN A;  1YJW T;  2RHY A;  1YIJ Q;  2RQV A;  4IUQ A;  4Y91 A;  3X20 B;  4IUR A;  1MGQ A;  4QT7 A;  4FSS A;  4BAC A;  4EMG A;  1KD1 C;  1PWT A;  2QTV A;  4FW2 A;  5J3B A;  2K5L A;  3M0S A;  3M5A A;  2D0N A;  4OGE A;  2K2V A;  1ZUY A;  2R57 A;  3CPW A;  3A8G B;  3CCL Q;  1ZA2 B;  4LDX A;  3FEO A;  1YJ9 A;  1GCQ A;  1QW1 A;  3TU4 K;  2LTO A;  3UA7 A;  1KHC A;  2HQH A;  1VQ7 A;  3E19 A;  5I11 A;  1UDL A;  2CP0 A;  2F5K A;  4ESR A;  3SEM A;  4ME7 A;  3WVE B;  4M75 C;  4RMO A;  3LWH A;  1N6A A;  3OS5 A;  2DMO A;  2E12 A;  2E65 A;  4FU6 A;  2DRM A;  1YJN Q;  2OTJ T;  1B7T A;  1JJ2 S;  2XDP A;  3CD6 Q;  3JSC A;  3VS4 A;  2L3P A;  1I07 A;  5GAO l;  4EDU A;  1M5Q 1;  4KH1 B;  4M4Z A;  1YFN A;  4D8D A;  2WSE E;  1M2V A;  5GAN 6;  2X4J A;  2DL7 A;  4E7S A;  2MK5 A;  2MCN A;  2LC4 A;  2X35 A;  3S6W A;  2P4R A;  1IHW A;  1AHJ B;  2IPO B;  2ED0 A;  4QVD A;  1UB4 A;  3G71 T;  5LJ5 h;  1JBM A;  1ZX6 A;  1Y7X A;  3CC4 Q;  4PJL A;  5CKH A;  1TSF A;  2VAS A;  2GFU A;  4FYV B;  5J26 A;  5L23 A;  3DLM A;  2FEI A;  2PU9 B;  1NYF A;  1BK2 A;  3T9N A;  3G4S A;  3EFO B;  1YJ9 T;  4M7A D;  5GAM g;  2E10 A;  5GAO r;  2MMP A;  7AT1 B;  3MCA B;  4O5V A;  5GMK j;  4C92 A;  1SPK A;  3CXC A;  2O2O A;  4RCC A;  1M2V B;  4LDW A;  3ZBD A;  3MEV A;  1ZHI A;  1WXU A;  2JT4 A;  2DTO A;  2EYZ A;  2DD5 A;  3GBQ A;  4DBQ A;  1VQL Q;  2FPE A;  4M78 G;  5C0M A;  1IXD A;  3NHN A;  1QP3 A;  2FRW A;  4C8Q A;  4OMO A;  3BFM A;  1WNL A;  3OYL A;  4M75 A;  5DY9 A;  4ANJ A;  5KE2 A;  3OYE A;  3CMA Q;  3EGX B;  3FJ5 A;  2PTK A;  2YUN A;  2ZPH B;  5KH6 A;  3RMS A;  1JO8 A;  3EGX A;  4EMH A;  3OBY A;  5KYN A;  4J9F A;  2XDB A;  2GFA A;  4J6Y A;  1U06 A;  5FW9 A;  3G1J A;  4C5H A;  2AZV A;  4M77 F;  1RAF B;  3EG9 B;  3OYC A;  5EC7 A;  1RAG B;  1D0Y A;  2RHU A;  4LD9 K;  1VQN Q;  3M9Q A;  4J7F A;  1Y07 A;  1M3C A;  2QAS A;  4PJO D;  3CEY A;  2QI2 A;  3PVL A;  4M7D D;  3M4G A;  2DIG A;  1BKB A;  4M77 D;  3HFO A;  3HKS A;  4M77 C;  4DBF A;  1KHI A;  1YIT A;  2JOY A;  1HYO A;  4F7U B;  3R6N A;  4II1 A;  1OX8 A;  3G71 Q;  2V1Q A;  4J9G A;  4KH0 B;  4ZGE B;  5GMK l;  1Q81 C;  3KFV A;  2KR3 A;  2DNU A;  1BI1 A;  1KQ2 A;  2DXB A;  2V8I A;  1WGS A;  1W2B S;  3PMI A;  3VS0 A;  4MDX A;  3JCM h;  2A08 A;  3RKX A;  2CGH A;  1X69 A;  5I21 A;  1YI2 T;  1R8O B;  2B8A A;  3OW2 S;  1YJN A;  3M0Q A;  1RLP C;  1QWF A;  1UGR B;  8AT1 B;  2RH2 A;  2P4T A;  1D3B B;  3ZL7 C;  3CD6 T;  3HSB A;  5GAO n;  2JN0 A;  2X51 A;  4ELZ C;  4Z8A A;  3SHW A;  2HCK A;  5GMK m;  2BE9 B;  4A4K A;  3VS1 A;  4WF2 A;  2VWF A;  1R0B G;  4PK4 A;  3S3N A;  4JLI A;  4HCC A;  4CC2 A;  2YSQ A;  1IZ6 A;  2ZGW A;  2VKN A;  2FL7 A;  3CCQ A;  1SKU B;  2GTO A;  1K9M C;  3E9G A;  1WHJ A;  4EIK A;  2PNI A;  4KUL A;  1YWO A;  5IHK A;  3SB2 A;  4JRQ A;  3LGF A;  1K9M U;  3REB B;  2CH4 A;  1Q81 U;  1ZA1 B;  1AWJ A;  1M2O A;  5HY6 A;  2ROL A;  2A7Y A;  6AT1 B;  4WTO B;  3CCU A;  3FRN A;  5IN1 A;  1PKT A;  1QCO A;  4IUV A;  4C92 E;  4C8Q G;  4OGC A;  5GAM f;  2EGA A;  2BKD N;  2P0K A;  4HXJ A;  2O9V A;  2L89 A;  2DEQ A;  2KDS A;  4A4E A;  4PFZ A;  4HCZ A;  1TOV A;  3A8O B;  2QGF B;  4C0D C;  2HMA A;  1M30 A;  3A98 A;  4J9D A;  2HNI A;  1AOJ A;  4QQD A;  2D1X A;  2L3Q A;  3JAM E;  3M58 A;  3BW1 A;  5KCH A;  3NGP A;  3MEW A;  1J3T A;  3DKM A;  2OI3 A;  5GJV B;  3VS3 A;  3H8Z A;  1A0N B;  4BE1 A;  1K73 C;  5CKE A;  2Z0W A;  2VXE A;  3CCE Q;  2K57 A;  2EKH A;  2XKO C;  4RTU A;  3EGD A;  1FXX A;  1NPR A;  4M75 D;  2YWW A;  1ARK A;  2K3X A;  1K0X A;  4E2F B;  2YUO A;  1S72 T;  2K5F A;  3OYD A;  2VYT A;  2HSP A;  5GMK e;  3QYH B;  4ZTJ A;  1VQ4 Q;  2E5K A;  3NMZ C;  5LJ3 j;  4X9D A;  1NBE B;  4TVR A;  1M3A A;  4BDY A;  1KQS S;  1VQL A;  1O9S A;  3AT1 B;  1EZZ B;  1UGS B;  2KY9 A;  2ZPE B;  1UJY A;  2QA4 Q;  2AHJ B;  2M1H A;  2EYQ A;  2K3B A;  5KYU A;  2CSQ A;  3N5B B;  3OW2 A;  2FB7 A;  4VUB A;  1Y71 A;  5GAN 7;  1QCN A;  4C8Q C;  2BZY A;  3JCM X;  2RI3 A;  2H8H A;  1Q7Y C;  3L2Q A;  3OYY A;  2YXY A;  1VQM Q;  1BB9 A;  2D9T A;  2MWO A;  3X28 B;  4M7D C;  3KBG A;  1PRM C;  2DF6 A;  2ECZ A;  2H3J A;  2LQ8 A;  2M16 A;  1YI2 Q;  4J9B A;  1M1F A;  2C0I A;  2JUF A;  2RJE A;  2QQA A;  1XNI A;  2SEM A;  1Q7Y R;  2WAC A;  4OF1 A;  2HAX A;  3C0C A;  1GCP A;  1YHQ T;  4ZNX A;  2DE0 X;  1UUE A;  1SSF A;  1WJS A;  1OPL A;  1MMG A;  4RTZ A;  1NJI R;  4E7I A;  2WSF E;  4NL2 A;  3PTA A;  2K3Y A;  2ZCF B;  3QII A;  5D6Y A;  1OU9 A;  4GY5 A;  2WSC E;  4R55 A;  2HBW A;  2BIV A;  2L2P A;  2DL3 A;  2JMC A;  4KUI A;  3EG3 A;  3MET A;  4LXC A;  2F5T X;  2EKO A;  5GAN h;  2DAQ A;  3LW5 E;  4LDV A;  1SSH A;  2EQJ A;  5KE3 A;  3I9Q A;  1Q81 R;  4JLG A;  1IO6 A;  2ENM A;  4FT4 A;  2GQI A;  2YDL A;  1VQ8 Q;  1QCF A;  1MUZ A;  2K6D A;  2ZZD A;  3JCM P;  3P8D A;  1Q86 C;  1AEY A;  4LUD A;  4QW2 A;  1MNE A;  3H6Z A;  1IRX A;  3V8K A;  2BTT A;  4OMP A;  5FU6 B;  3URG A;  1AZE A;  3CXC P;  1QMC A;  1H92 A;  2BE7 D;  4ZN3 A;  3CCL T;  3CMA T;  2ESW A;  4BY6 C;  1VIE A;  5A0D A;  3PMT A;  2C0T A;  2D8H A;  3JCM W;  2L5Q A;  1TTH B;  1B07 A;  2L3S A;  1WDX A;  2VUB A;  4BI8 B;  3GLX A;  3CCE T;  2YRV A;  3CC2 Q;  2KRS A;  4M78 A;  1ZUU A;  4FT2 A;  1F1B B;  2JTM A;  1ZBX A;  1M1G A;  1WXT A;  2O4X B;  2QQR A;  3JCM Q;  2KI7 A;  2ROT A;  2LX9 A;  2O01 E;  2R58 A;  1RI9 A;  5CQX A;  3M0P A;  3UA6 A;  2EYW A;  2XMF A;  2RI5 A;  5CO7 A;  5GAM d;  1NLP C;  3A1P A;  4DA4 A;  3C4S A;  1PCX A;  1QKX A;  4OVA A;  4N4H A;  2X3X D;  4PNO A;  2OX7 A;  2LNV A;  3HTR A;  1NZ9 A;  3DB4 A;  3EG9 A;  2JXB A;  3HRT A;  4AT1 B;  4D6W A;  4M78 D;  1K1Z A;  2E1H A;  1KQS P;  3CXC S;  1XJW B;  1B3Q A;  1BBZ A;  1N8R U;  1MV3 A;  3QJY A;  1OYX A;  1QP2 A;  2RK2 A;  2E6Z A;  2X4Y A;  4DBH A;  9ATC B;  5KCO A;  4M7A E;  2L0A A;  2EQK A;  1QWE A;  4R56 A;  1JXO A;  2EYX A;  2VXF A;  4C92 G;  4N0A C;  5CIU A;  2DEU A;  4PJO G;  5HK0 A;  1UJ0 A;  4M77 G;  4JUV A;  4EMK C;  4L5G A;  5FLX E;  1QQJ A;  3OSS C;  3A8M B;  1X01 A;  1TXQ A;  4FYX B; 
#chains in the Genus database with same CATH homology
 1X43 A;  2W0Z A;  2KEA A;  1WXU A;  2KE9 A;  1VYV A;  2JT4 A;  1OV3 A;  1K4U S;  2EYZ A;  1KSW A;  3VS5 A;  1M8M A;  3EHQ A;  3GBQ A;  2FPE A;  1NEB A;  4JPB W;  4JJB A;  2ED1 A;  3NHN A;  1T0H A;  2FRW A;  4OMO A;  1UFF A;  4X1V A;  3EHR A;  1M3B A;  2BZ8 A;  3FJ5 A;  1NEG A;  1H8K A;  2PTK A;  1Y57 A;  4OMN A;  4IIO A;  2YUN A;  1AWX A;  2O9S A;  1TUC A;  2EGC A;  1JO8 A;  1K9A A;  4J9F A;  2J7I A;  1YCS B;  1YNZ A;  1Z9Q A;  1U06 A;  3QWX X;  5FW9 A;  5IHN A;  2AZV A;  2A37 A;  1RLQ C;  5EC7 A;  2DM1 A;  2RNA A;  1WLP B;  4DEY A;  4AFQ C;  1HSQ A;  1ZUK A;  2RQW A;  1CKB A;  1N5Z A;  2AKL A;  4LNP A;  1U5S A;  1M3C A;  4WCI A;  2DRK A;  2M51 A;  1AZG B;  3PVL A;  3IQL A;  2O31 A;  3REA B;  2NWM A;  1SHG A;  1E6H A;  2F2W A;  2KRM A;  1HD3 A;  2K9G A;  2CUD A;  1OEB A;  1G83 A;  3R6N A;  2X3W D;  1ABO A;  2HDA A;  3I5R A;  1WFW A;  4F14 A;  2V1Q A;  2KBT A;  4J9G A;  3KFV A;  2KR3 A;  2DNU A;  3VRY A;  3JV3 A;  2EGE A;  5HCK A;  2PZ1 A;  5IXB A;  3VS0 A;  2CT4 A;  2A08 A;  1QLY A;  1X6G A;  1X69 A;  4CC7 A;  1W6X A;  1SEM A;  1X6B A;  3M0Q A;  1HJD A;  2DIL A;  1RLP C;  1QWF A;  1NM7 A;  1VA7 A;  2DYB A;  3U23 A;  3ZL7 C;  1ZSG A;  2KT8 A;  1Z9Z A;  4LE9 A;  1JQQ A;  1M27 C;  1JXM A;  2ABL A;  2JMA A;  4HVW A;  1QKW A;  4Z8A A;  5FWC A;  3SHW A;  2HCK A;  1S1N A;  2OJ2 A;  2J05 A;  2K7A A;  3VS1 A;  4AFS C;  2VWF A;  2KRO A;  2JM8 A;  4Y92 A;  4CC2 A;  2YSQ A;  2JTE A;  1YN8 A;  2LJ0 A;  1TUD A;  4Z88 A;  2NUZ A;  2VKN A;  2DL4 A;  2RN8 A;  1CSK A;  3VRZ A;  2YUQ A;  1UHF A;  2GTO A;  1KIK A;  3LH5 A;  1PKS A;  1ZBJ A;  2DLP A;  3EG1 A;  4EIK A;  2PNI A;  4OMQ A;  1YWO A;  2DL5 A;  3M0R A;  5IHK A;  1PRL C;  3UF4 A;  2RMO A;  1WI7 A;  1PNJ A;  1RUW A;  1SRM A;  3H41 A;  2JW4 A;  3REB B;  4ORZ A;  2CH4 A;  1WYX A;  2DBK A;  1JU5 C;  1AWJ A;  1WIE A;  5FWB A;  2FPF A;  2ROL A;  3ULR B;  1KFZ A;  2DL8 A;  4J9I A;  3M0U A;  2D8J A;  4KRT A;  2AZS A;  4RUG A;  1PKT A;  2J6K A;  2LZ6 B;  2A28 A;  1UE9 A;  4IIM A;  1UG1 A;  4F17 A;  1UEC A;  3PE0 A;  3THK A;  1OPK A;  2LCS A;  4F16 A;  1OOT A;  2EGA A;  1X2K A;  4R0K A;  3QWY A;  4HXJ A;  2O9V A;  2LQW A;  3TSZ A;  1E7O A;  2J6O A;  1UTI A;  3UAT A;  1I1J A;  3VS7 A;  4JJD A;  2M0Y A;  2QDL A;  2LX7 A;  1SHF A;  1EFN A;  3A98 A;  1M30 A;  4J9D A;  1AOJ A;  4GLM A;  2D1X A;  1AVZ C;  2L3Q A;  2LMJ A;  3VS2 A;  3NGP A;  1GFC A;  2LP5 A;  1J3T A;  2A36 A;  2FG0 A;  1T3L A;  2OI3 A;  2KYM A;  5GJV B;  3VS3 A;  4CC4 B;  2LNH B;  2YUP A;  2GBQ A;  1A0N B;  1FMK A;  1GBR A;  2F2V A;  3TVT A;  1UHC A;  1GBQ A;  1CKA A;  1NLO C;  2EKH A;  2KXD A;  3O5Z A;  4RTU A;  1V1C A;  1SRL A;  2MOX A;  2DJQ A;  1ARK A;  1K0X A;  2CUB A;  2YUO A;  2C0O A;  2HSP A;  2RPN A;  2EVR A;  2J06 A;  2E5K A;  3NMZ C;  2LQN A;  1TG0 A;  1E6G A;  1Y0M A;  5I22 A;  1M3A A;  1GCQ C;  4HVV A;  2JS2 A;  2KRN A;  1UJY A;  3RBB B;  1LCK A;  4RTV A;  1FYN A;  2FPD A;  2K3B A;  1H3H A;  2CSQ A;  1PHT A;  1U3O A;  1NG2 A;  2BZX A;  4AFU C;  2EQI A;  2JM9 A;  2BZY A;  1WA7 A;  2H8H A;  2DA9 A;  1I0C A;  2CSI A;  2KT1 A;  1BB9 A;  1WX6 A;  2KYB A;  4LUE A;  1WXB A;  1PRM C;  2LJ1 A;  2DF6 A;  2ECZ A;  3EGU A;  2AK5 A;  4J9B A;  5IXF A;  2C0I A;  4HCK A;  4RTY A;  2K2M A;  1T0J A;  2SEM A;  4J9E A;  3C0C A;  1GCP A;  4CC3 A;  4ZNX A;  4OMM A;  2OAW A;  2DE0 X;  1UUE A;  1W70 A;  2RF0 A;  5GJW B;  2I0N A;  2EYY A;  1T3S A;  5ECA A;  1OPL A;  2DX1 A;  4J9H A;  2YT6 A;  2GGR A;  2GNC A;  1VYT A;  4RTZ A;  3M0T A;  3VS6 A;  4Z89 A;  2G6F X;  5IH2 A;  3PVQ A;  2HBW A;  4DEX A;  2KXC A;  1W1F A;  2L2P A;  2DL3 A;  2JMC A;  3EG3 A;  4J9C A;  2V1R A;  2RQV A;  2IIM A;  2RQU A;  1YP5 A;  1GL5 A;  2FRY A;  3H0H A;  1SSH A;  4QT7 A;  4FSS A;  1AD5 A;  3I9Q A;  1IO6 A;  2ENM A;  2GQI A;  2YDL A;  1GFD A;  2JS0 A;  1PWT A;  3M0S A;  1QCF A;  1MUZ A;  2K6D A;  2D0N A;  1ZUY A;  1AEY A;  1ABQ A;  2SRC A;  4LUD A;  2CRE A;  2BTT A;  4OMP A;  2K79 A;  1K76 A;  1AZE A;  1BU1 A;  2MIO A;  2RQR A;  1GCQ A;  3EG2 A;  1H92 A;  2CDT A;  1AWO A;  3UA7 A;  2HEQ A;  1UGV A;  2ESW A;  1K0S A;  4RTX A;  5I11 A;  1G2B A;  1UDL A;  2C0T A;  2D8H A;  1B07 A;  4LN2 A;  2L3S A;  4E6R A;  1YWP A;  1WDX A;  2LJ3 A;  4ESR A;  3SEM A;  1GRI A;  2KRS A;  2DVJ A;  1ZUU A;  5IHI A;  3I35 A;  1WXT A;  2ROT A;  2DMO A;  3EG0 A;  1RI9 A;  3M0P A;  3UA6 A;  2DRM A;  2EYW A;  2XMF A;  1NLP C;  3CQT A;  1JEG A;  3VS4 A;  2AKK A;  1QKX A;  2FO0 A;  2L3P A;  1I07 A;  2X3X D;  3RNJ A;  4AG1 C;  4M4Z A;  4AFZ C;  4D8D A;  1AWW A;  1VYU A;  4JZ4 A;  3NPF A;  2DL7 A;  2MCN A;  3I5S A;  3TSW A;  1ZLM A;  2EW3 A;  2JXB A;  2P4R A;  4RTW A;  2CH4 W;  1K1Z A;  1XOV A;  2ED0 A;  1B3Q A;  1BBZ A;  4AG2 C;  1X27 A;  1X2Q A;  1MV3 A;  4GBQ A;  3H0I A;  4JJC A;  1ZX6 A;  4JZ3 A;  4A63 B;  4K11 A;  2L0A A;  2O88 A;  1QWE A;  4OML A;  1JXO A;  1KJW A;  2EYX A;  1NYG A;  2CT3 A;  1MV0 B;  2VVK A;  5L23 A;  2B86 A;  2GTJ A;  2KGT A;  2DBM A;  2KNB B;  2FEI A;  1NYF A;  1UJ0 A;  4RTT A;  1BK2 A;  4HVU A;  2EPD A;  4D8K A;  2F2X A;  2RQT A;  2J6F A;  3H0F A;  2W10 A;  1SPK A;  2EBP A;  2O2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...