2RHZA

Crystal structure of the 3-mbt repeats from human l3mbtl1 with d355n point mutation
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
315
structure length
313
Chain Sequence
SWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVNRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 72
structure length 313
sequence length 315
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhzA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhzA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhzA03
2EKOA 3MEUA 3H8ZA 2FHDA 5D6YA 4A4HA 4QW2A 3SD4A 3OYJA 3L2QA 2E5QA 5CIUA 4ZTJA 3OMGA 3MP1A 3MEWA 2DIGA 3OS0A 4N4HA 5C0MA 4IUQA 3S3NA 3NTHA 5D6WA 4IUTA 4BE0A 3DB4A 2RHYA 3MO8A 2LVMA 4BE2A 4NS5A 3OYMA 4LD6A 1OYXA 2P0KA 3MEVA 5J26A 3ZEHA 2EQUA 4PLIA 2R57A 3OYBA 2D9TA 2L3RA 2XK0A 3DLMA 2DAQA 4BDZA 4E7KA 3OA6A 5FRNA 2RHUA 2RJFA 4RG2A 4B9XA 2X35A 3OMCA 4BE1A 2RJDA 2L8DA 2R5AA 3PMTA 4OVAA 2X4YA 4QQDA 3F70A 3FEOA 3PMIA 3S6WA 4BDYA 2RHZA 3QJ6A 3S3OA 2O4XA 3OY9A 3OYCA 1WGSA 3OYDA 4BACA 1SSFA 2YRVA 4QVZA 4A4GA 5KH6A 2RJEA 4QQGA 4BD3A 3OYHA 3L2WA 5IAYA 3OS1A 2M1HA 2QQRA 3QBYA 2PQWA 2RO0A 3OS2A 2K3XA 3FLGA 3FC3A 2F5KA 4B9WA 2DIQA 3OYLA 2EQMA 2O4XB 3C4SA 3MP8A 4N4GA 3OYNA 3OYGA 2MWPA 2M0OA 3FDRA 4IUPA 4E7LA 3CEYA 4E7IA 2E6NA 2JTFA 3BDLA 5KCOA 4FL6A 5KCHA 3L2VA 3OYEA 2LCCA 3KUFA 3E9FA 3NTIA 4QQ6A 3S3MA 4PLLA 4C5EA 3OYFA 2JZ2A 2LDMA 3QKJA 2EQKA 2LRQA 3H6ZA 1XNIA 3LYIA 4GY5A 2RJCA 4A4EA 1WJSA 2QQSA 5FRMA 4IUUA 5IN1A 4C5IA 2NLUA 2RHXA 3GOXA 4A4FA 2K3YA 5M9OA 3OB9A 4C5HA 2CKKA 3META 2HQEA 3OYAA 3MP6A 4IKFA 3DB3A 3LX7A 2RI3A 1MHNA 3P8HA 1N27A 2R5MA 5FROA 4L59A 2X4XA 3EAEA 2GFUA 4II1A 2BKDN 3PNWC 4IURA 4UC4A 3L2RA 4ZTFA 4Z02A 2M16A 3Q1JA 4C5GA 3O8VA 1OZ3A 3OYKA 1RI0A 1G5VA 2XDPA 3LLRA 3QIIA 3L2UA 3MEAA 3UWNA 1KHCA 4N4IA 5C6SA 2BUDA 4CRIA 2X4WA 3LGFA 2WACA 1WJRA 2LTOA 3M9QA 4E7HA 4FU6A 2G3RA 3PFSA 5KE3A 3ME9A 4PL6A 3OYIA 2EFIA 1OI1A 3E9GA 2GF7A 3OQ5A 1WJQA 4Q5WA 3LGLA 4E7JA 3L42A 5D6XA 1H3ZA 2BIVA 4IUVA 3P8DA 2HQXA 3ASKA 5J39A 2RHIA 2IG0A 2R58A 2RI2A 2VYTA 4EDUA 2RI5A 2L89A 4HCZA 2MWOA 2GFAA 3UT1A 2EQJA 3NTKA 5KE2A 4X34A 2B8AA 1OZ2A 3LH0A
chains in the Genus database with same CATH superfamily
5GAN4 2LX9A 3JCMW 1TOVA 4PKCC 3KBGA 1IRXA 3QG1A 3OW2S 3RERA 1SPKA 3UATA 2JS0A 3MO8A 2DXBA 5I2SA 2HBPA 2PUOB 4ELZC 1IGQA 5CQYA 5GANf 2X35A 4EMKA 1QVPA 4JLGA 2K2VA 2FO0A 1MNEA 2K5FA 3WVDB 1VQKT 2HL5C 2OJ2A 3OYCA 1WGSA 3OYDA 1SSFA 4DBRA 4J6YA 3CC2Q 1YI2A 2EVRA 2DTHA 4X9DA 8ATCB 1T3SA 2JOYA 2YUQA 3HKSA 2BZXA 3PIPA 4F04B 4E47A 2K5IA 3CEYA 1KC8U 5FU6C 1BB9A 2EW3A 5LJ5j 3CCUA 3OYFA 5FU7C 4OMNA 2YUOA 2ZPBB 4PK4A 2LRQA 1YNZA 2DXTA 3LYIA 3QO3A 4MZMA 1IXDA 2DL7A 2RHXA 2KDSA 1VQ4T 2CKKA 3CC7Q 4RTUA 3EFSA 3QYGB 3ER0A 2BZ8A 5GAOr 4M75B 4UC4A 3RUXA 2AKKA 1OX9A 1RI0A 2ZPGB 3RMQA 2QQAA 1M90C 2KVQG 3OSVA 1EFNA 4BI3A 2M51A 2PUKB 2RQRA 4FT4A 2X4JA 2MPXC 1WLPB 4C92D 2R58A 2LNVA 2PVDB 4HCZA 4X34A 1MV3A 1QVFA 2FHDA 4RTXA 3AHUA 1YI2Q 4JJDA 4AG1C 3AT1B 2DYIA 1YWPA 2JTMA 5LJ3f 1VYVA 5J26A 1PD1A 4IIOA 1WHGA 5HKCA 1Y71A 2C06A 2VUBA 2AZSA 2VKNA 4XU2A 2F5TX 1K0XA 2QDLA 5GANg 2AHJB 2HMAA 2QEXQ 2GCXA 5KYYA 1JO8A 4D6WA 3CCJT 1OULA 3SHWA 4J6WA 1IHWA 4WF2A 3URGA 1BCOA 2EQMA 3MP8A 3GPLA 1QVFP 1ZUYA 3FDRA 1ZSZC 2FZKB 1ZA1B 2AIRB 4RMOA 2GQIA 4M7AF 4FYWB 2EJFA 4FL6A 3QPHA 2QEXT 3H0IA 4Z8AA 1WXUA 3FB9A 3M5AA 4C0GA 2EYXA 1AZEA 2BE9B 1IHVA 2KMTA 3T9NA 3CCET 1YP5A 4M78D 2KXDA 2P0QA 1HYOA 5M9OA 3EHRA 3PT9A 3QZ9B 3DB3A 1TUDA 1N9RA 5GAOm 4F7UG 5GMKj 1M8VA 3VS4A 1UECA 1GBQA 3OYKA 5AT1B 4J9GA 1U8RA 4X9CA 1G3WA 3HFNA 4RKUE 3LW5E 3I56T 2RQUA 4LDVA 2KXCA 1T0JA 4C92C 2L2PA 1R8OB 2E10A 2RM4A 3VRZA 4EDUA 2RI5A 1C6VX 1Q82U 2GFAA 1VQ9T 1BI0A 1VQPA 2A37A 1OZ2A 1VQMQ 2Y4YA 2X9HA 2HD0A 3MEUA 3EGDB 4M77G 2DTIA 3OMGA 2L0AA 1QP2A 5D6WA 2HSEB 4XTUA 3CCLA 1CSKA 3A8HB 1I5OB 1UGSB 4QKUA 2CREA 1KQSA 1QVGA 1WI7A 4BDZA 4C92F 1VQMT 1OU8A 1VQNT 3FEOA 2OTJT 1X43A 4F7UE 1ZUKA 3CCVA 3L2ZA 1JQQA 3MPUB 4XQ3A 4F16A 3PTAA 3D7SB 2QQRA 2DD4A 3VUBA 5D7UA 3G6ET 3FC3A 2D1XA 2DIQA 2F69A 5I11A 1Y0MA 2HKQB 2P0PA 4RTVA 4B6MA 1UGQB 4KRTA 2JTFA 5KCHA 4O5VA 1TUGB 2DNUA 4GBQA 4XAXB 4LNPA 3M0UA 1VQOT 3SFMA 1KQSP 2DL5A 3EHQA 5GAOq 2FB7A 4CC4B 2DVJA 3CPFA 2DL3A 1NLOC 3OB9A 2MMPA 2CDTA 4ZNXA 1RI9A 2DF6A 2O31A 2EKHA 1RAEB 1LJOA 2MF2A 4DOVA 3N5BB 1W2BA 4V2SA 2D8JA 5A2QE 2DRKA 3SDZA 5CKBA 2CZ7B 2XDPA 1D3BA 2E65A 3TSZA 5EC7A 4LDYA 1ZSZB 3G6EA 2DX1A 2DILA 1KD1C 2M02A 4Q5WA 4OMLA 4IUVA 3CC7T 4BB7A 4HT9A 1TTHB 1M27C 3G4SQ 3TSWA 2V1QA 4X1VA 5D6YA 3OYJA 1JXMA 1KK7A 5FU6B 4JRQA 1M2VA 1Y96B 3VS0A 1QVGS 2RQTA 2NUPB 2C0IA 3A98A 1JRIA 1IB8A 3EFOA 1M1KC 3M57A 2YLBA 4LN2A 1OQKA 2X4YA 4JZ3A 1QCNA 1YI2T 4BACA 1MMAA 2EGEA 3SB2A 2DA9A 3VS3A 3EGXA 3OYHA 2CZ1B 3VYGA 2D0NA 2PQWA 2DETA 1X27A 3JAME 4M7AG 2IPOB 4GLKA 5CK9A 1YHQT 1M1KR 3L2VA 4Z88A 4AMCA 1IZ6A 3CC2A 2LDMA 1W70A 2A0FB 4IUUA 1M1GA 1T3LA 3A8OB 3I56A 5GAN8 1OOTA 4D8DA 1D0ZA 1TG0A 4JRKA 2RI3A 3HRTA 3M0PA 3P8HA 1K9MC 4J83A 1BIBA 5CR2A 1UHCA 1C1AA 4C5GA 1FXXA 1UFFA 2NUTA 3DLLA 2FRWA 3TVTA 2JS2A 2RQWA 2PZ1A 2XHCA 2YRDA 3MEAA 3JCMh 4GLMA 2ZPFB 3M0SA 5LJ5e 1NJIR 1BI1A 2RD1A 3ME9A 3V7RA 1FMWA 1VQLA 1YHQA 4OMOA 5CKEA 4JDSA 5GAOp 1M9SA 4JZ4A 5J39A 2QAZA 2O9SA 1GBRA 2KT8A 1XJWB 4NL2A 3UT1A 3M55A 2QTXA 3NTKA 2DRMA 1SSHA 1RAIB 2J6KA 2XIDA 1X6GA 4OMQA 4HT8A 3H8ZA 4KH0B 3L2QA 4AFQC 1TU0B 3V8LA 1GRIA 2OTJA 3OS0A 4IUQA 3CD6T 3QJYA 3QDRB 4DEYA 1K8AC 3OYMA 2CZ6B 4CC2A 2J7IA 1M3AA 4PJOB 4BE1A 3I55T 1UDLA 4OB1B 1FWZA 2RJDA 2E41A 1LPLA 4RCCA 4AFSC 2JTEA 3S6WA 3LWIA 1YJ9T 3JCMb 4M75C 2CSQA 2M1HA 3A5ZB 5GANe 2KRNA 4M7DC 1Y07A 1W1FA 2VXEA 4M78G 2QYZA 1MV0B 2K7AA 4A53A 1EIFA 5J3BA 1NG2A 2YHTA 3CC2T 2FYKA 2CYZB 5GJWB 1PNJA 4ATOA 2ZPHB 4C5EA 2DE0X 1BBZA 1QWFA 1W6XA 2EQKA 1A0NB 3CMEQ 1VQ4A 2D6FA 4MMLA 2YUPA 3I55A 2KRSA 1KIKA 1U3OA 2JT4A 1HJDA 4EMHA 2XICA 5L8RE 4M7DG 5GAOn 4L59A 4J9FA 1GL5A 3UWNA 2EYYA 1VQ9Q 2LNHB 3CPWS 2QGGA 4C92B 2H3JA 2GF7A 2NWMA 3LGLA 2HL3A 1D3BB 3UA6A 2ZAEA 3CCUT 2EQJA 1M2VB 5LJ3e 4DEXA 2CT4A 2LJ1A 2VV5A 1YIJQ 2I2LA 2DERA 3V8JA 3BW1A 2E5QA 3MP1A 4M4ZA 1GFDA 5GJVB 4J9EA 3LWHA 2V1RA 4XTWA 3EGUA 5GAMe 1WPYA 1AWOA 1ZLMA 4DOWA 4EMGA 1Q82R 4MZPA 4XTXA 2F2VA 1KQ1A 2HAXA 1RLQC 1GXIE 3C95A 3CQTA 3EGXB 2DVEA 1AT1B 2QASA 2ZZDA 3QJ6A 2OTLQ 4LXCA 3M54A 2FG0A 3OS1A 2FPDA 1WYXA 2KAFA 1BU1A 7AT1B 2F5KA 2DMOA 4DBFA 3C4SA 2F2XA 4N4GA 1JU5C 2GNCA 3CCEA 4IUPA 5KYWA 4ZGEB 4OGEA 3WVEB 4FYYB 4OMFB 2OAUA 3OSSC 1SEMA 4FYVB 2CH4W 3HPWA 4L6V5 3RIRA 1FMVA 1B34B 4J9CA 5CKDA 4C5HA 2NUPA 4HKEA 1UGPB 3UDCA 2GTOA 1D0YA 2ROTA 4JUVA 3SEMA 1WHJA 2Y4XA 2AZVA 3L1AA 2ZGWA 2LJ3A 2DD5A 5CAIA 1EZZB 2RA2A 2C0OA 4M78F 4DBHA 1KG1A 2QI2A 1BCMA 4TVRA 1OI1A 2DYBA 3E9GA 4E7JA 2YUNA 5D6XA 2ROLA 2HBWA 4O6JA 3GBQA 2L89A 3J7AF 1H8KA 3CMET 4J9BA 4M78A 1XTDA 2E3IA 3LH0A 2HEQA 2XU8A 1M30A 2ECZA 1VQ8A 3FRNA 1Q81C 3JCMX 1KHIA 4F14A 1K9AA 3MEWA 3IQLA 3EG1A 1K8AU 2YDLA 1VQNQ 3CXCS 3NTHA 4P5NA 1G83A 4KH1B 4LDUA 1H641 3OYBA 2R57A 3NPFA 5I21A 3CCMQ 1AD5A 2SRCA 3V7SA 4DA4A 3VJPA 3RMSA 2OTLA 1X6BA 2A08A 1SRLA 3PMIA 4KULA 4C8QF 1QVFS 2JNGA 4RCBA 1Q7YC 4A4KA 4CC7A 5A0DA 2BTTA 1YCSB 3C12A 2K3XA 3VS6A 2AK5A 4C92E 3OBYA 4NOYA 2L3PA 4AFUC 2XI9A 4M7DF 1E7OA 1GCPA 2EQIA 4M77F 2P84A 3E9FA 3NTIA 1R0BG 3BDUA 2CP2A 4KGXB 1K73U 3HHTB 1M8MA 3H6ZA 2EYZA 3H0HA 5LJ5f 4C5IA 1NYGA 2DJQA 3ZBDA 4PJNA 3CMAT 3SWNB 3M0TA 3JCMf 1M1KU 2I0NA 5GAMg 3LH5A 4BUGA 3CBMA 3LX7A 1O75A 1OPLA 3NHNA 4J9DA 2RK2A 8AT1B 4OF1A 3CC7A 3JB9J 2K79A 4J8OA 1B7TA 4FM4B 2CT3A 5C6SA 4FIBA 5LJ3g 3M9QA 2G3RA 2XD0A 4M7DE 3C0CA 4AG2C 1N8RC 1C0MA 2IG0A 2COZA 3FIFA 1W2BP 3SD4A 3H9NA 3R6NA 3BY7A 1QKWA 2ZCFB 2GBQA 2P4RA 1VQ5T 5HY6A 3CCVT 2AKLA 1U5SA 2CS7A 2HCKA 3DB4A 3VS5A 1PWTA 1GCQA 1VQ7A 1YFNA 2P0KA 4M7DB 2W10A 2DTOA 3INZA 1I5LA 4RG2A 2DO3A 2X3WD 2L8DA 3VS7A 2KY9A 3JV3A 2F1LA 1S72T 2OAWA 1VQ5Q 1V76A 1WQWA 2GGRA 5IAYA 4C92A 3CCEQ 2RO0A 2LJ0A 3THKA 4EIKA 4FSSA 3OW2P 3E2UA 2LQWA 2KSSA 1QVGP 2BE7D 4M7DD 3CCMA 3KUFA 2MYSA 4M75G 4BY6C 2W0ZA 2VASA 1KQ2A 3DKMA 4GY5A 2RJCA 3I56Q 5IN1A 1WDXA 4HA8A 2Z0WA 2HQEA 3OYAA 3M4GA 3KXTA 1K73R 3JCMg 3EAEA 5GAMf 4J6XA 3NMZC 3JB9H 1S72A 1VQ9A 1OPKA 4LUEA 1MGQA 1PSEA 5IXBA 2MIOA 2NUTB 1M3BA 4R0KA 2K5LA 3A8GB 3CCVQ 3QWYA 1AVZC 1N5ZA 2EGAA 4HCKA 1VQOQ 3O5ZA 2P4TA 4M78C 4IIMA 3MHXA 5FLXE 3QWXX 1VQ8Q 1X01A 2MWOA 2H8HA 3CXCA 2VC8A 5GMKe 2CP5A 3CC4Q 3JCMV 2EYQA 1PKTA 3TEEA 2DXCA 1TWBA 1WA7A 2CZ0B 1PHTA 1D1AA 2K4YA 1ZSGA 2KEAA 2OX7A 1I0CA 5CIUA 1H92A 1G3TA 4XK8E 4N4HA 3PIOA 2CP0A 3J81E 1YJ9Q 5CO7A 2O01E 3VS2A 1LNXA 3I9QA 1JJ2A 4E7KA 5FRNA 2MCNA 4B9XA 2YXYA 1PRMC 4N0AA 1W4SA 4QQDA 4C8QG 2CUDA 2DPPB 5DLQE 3M0QA 3BE3A 2YRVA 4A4GA 2G6FX 3CMAQ 3EG9A 3JCMP 3E19A 1B07A 3OS2A 5KYNA 3X28B 2O4XB 4PJMA 4M78E 1RL2A 4E7IA 3M58A 2PVGB 2JUFA 5CQXA 1Q82C 1NBEB 4PJLA 4MMKA 3EGDA 2RQVA 3G71Q 5CCAA 2JM8A 2K6DA 1WJSA 3PVQA 2NLUA 4QT7A 1CKBA 1I07A 3META 4KGVB 1YJNT 3G6EQ 3JCMQ 1NEBA 2DFUA 3V8KA 1YJWT 2X4XA 4KGZB 4E7SA 3A8LB 4C0ZA 4LUDA 1G5VA 3RKXA 4RTWA 2DL4A 5GAN6 1M4ZA 4PJOF 1S1NA 2CUBA 3CCQA 4N4IA 2X4WA 4J7FA 5IT9E 3GNGA 4BI8B 4C8QE 2J6FA 4PJOC 3PFSA 2YWWA 2FPEA 3WXMB 1M2OA 2KYMA 1YJWQ 1D1CA 1MMNA 4JJNK 2QG9B 4M7AD 2L5QA 2XKOC 2KROA 2RH2A 5GAN3 1YIJA 5KE2A 1HD3A 2LMJA 1WHLA 4JS5A 1QW1A 1WIEA 2J06A 2DBKA 1MUZA 4PNOA 4R55A 1YJNA 5KYXA 1UGVA 5GAN2 1D09B 1X69A 4IUTA 3PVLA 3A8MB 1VYTA 1JJ2S 1UHFA 2RF0A 3RNJA 1HSQA 1ZBXA 1QWEA 2L3RA 2DAQA 3CPWA 2CP7A 4JPBW 1VQPT 4RTYA 1VUBA 3OY9A 2K9GA 4M7DA 2CP3A 3CCLT 4F7UA 4BD3A 3I55Q 4A63B 2AT1B 4AT1B 1ZSZA 3M4YA 3CMEA 3VRYA 1VQ4Q 5KYUA 3OYNA 1I8FA 5LJ5d 2MWPA 4RG8A 1Z9ZA 3VS1A 3CD6Q 4A54A 1NEGA 4M75F 5KYWB 1QLYA 3HFOA 1TS9A 3CCRQ 1OV3A 2FZGB 4E7ZA 1AZGB 2IIMA 1YWOA 1RAAB 3EH1A 5ECAA 3RBBB 4XTVA 3SWNC 1MNDA 1BI3A 1QCFA 3EH2A 1F1BB 4IKFA 3M56A 4M75E 1XQHA 1XOVA 1N27A 3OBWA 4IURA 4ZTFA 2FZCB 3Q1JA 3O8VA 3REBB 1IGUA 1EX4A 5GANd 4C8QB 2RK1A 4M77B 1AWXA 4KUDK 2QQBA 2WSFE 2KI7A 4JJCA 2M0YA 4FU6A 1G3SA 3NGPA 2LZ6B 2HKNA 1KQSS 4ZGDB 1KC8C 3CCSA 2HQXA 2XMFA 4JLIA 5CVIA 1S72Q 2A28A 2DZ9A 3G7ZA 3I5RA 2QA4T 4JS4A 5KYYB 2PTKA 3EG2A 1X2QA 4M7AE 2JVVA 4QW2A 2QXFA 1WXBA 3OS5A 1RLPC 1YHQQ 1M90R 1G8XA 1WFWA 1U1TA 1PC0A 3QXEB 4C8QD 3ZL7C 3MEVA 2EQUA 3A1PA 2QQ9A 2RJFA 1KFZA 4PJOG 1YITQ 2QEXA 3X24B 2COWA 4RTTA 3G71A 2RHZA 2XG8D 4J9HA 1UUEA 4ESRA 1QP3A 1UTIA 3JB9I 1WQ7A 3FLGA 2PU9B 1RUWA 2VB6A 3CD6A 1U1SA 2JMAA 1QKXA 2KK4A 3BFMA 3JB9F 2E3HA 1WHHA 2V26A 1WZOA 5CKHA 3HRSA 4QQ6A 4Y92A 4PLLA 3QKJA 2E5KA 4HCBA 1XNIA 1GFCA 3RR6A 4A4EA 1KD1R 4JRIA 5FRMA 5GAN7 3CCRA 4XU3A 4A4FA 5IHNA 4R56A 1RACB 5GMKi 3X26B 3CCUQ 1FMKA 4LD9K 2CGHA 2BKDN 4Z02A 4CI0C 1PCXA 1YIJT 1M5Q1 2GTJA 3LLRA 4XU0A 3QIIA 3L2UA 1KHCA 2E70A 1VQ8T 4BI4A 2DBMA 2JXBA 5KE3A 4J5YA 2DK3A 2M9UA 2EFIA 4PFZA 1X6OA 3CCQQ 4F17A 2QGFB 2ENMA 3L42A 1ACMB 1YJNQ 1H3ZA 3ASKA 1KD1U 5FWCA 2CP6A 2K2MA 4ORZA 5KYXB 4LDXA 3QZ5B 3QHSA 1YJWA 3G1JA 4M7AB 1PM3A 3G4SA 4M7AC 4A4HA 3QSUA 2FEIA 3PGGA 4FW1A 4K11A 3X25B 1G2BA 1BI2A 1Z9QA 2RHYA 2LVMA 4BE2A 5IXFA 4PFPA 2XDBA 1OYXA 3ZEHA 1NZ9A 2XK0A 5FWBA 3OA6A 3HSBA 1NM7A 2R5AA 3PMTA 4NL3A 3HTRA 5GMKh 2ED1A 2X3XD 3REAB 1YN8A 4C0FA 1AEYA 1D1BA 4EMKB 1NE8A 1ZQ1A 2YRCA 3GLXA 1W2BS 3M0RA 3OYLA 1YCYA 3OYGA 3NFCA 1GCQC 3ZFJA 3VYHB 5L23A 3JB9G 4F7UB 2DXUA 3BDLA 1RAFB 1OX8A 5LJ5g 2ESWA 1ZX6A 2EBPA 1YJ9A 2EWNA 4ZGJB 2O88A 1YITT 3RESA 3GOXA 1N6AA 2DKGA 2MOXA 1JB0E 3MJXA 3HRUA 1OEBA 1ZHIA 2HZYA 4YTLA 1UE9A 2JW4A 2GFUA 4DBQA 1QQJA 1VQ6A 1UJYA 1G3YA 1OZ3A 2PNIA 4KBMB 1PRLC 5HK0A 4D8KA 4MDWA 3JSCA 1K0SA 1AHJB 1PD0A 1TUCA 1VQOA 4CRIA 1TXQA 1DJ7B 2WACA 1JEGA 5LL6S 2LCLA 5IHIA 2KGTA 4M75A 4PL6A 5HK3A 4KT0E 1R0CB 5I2MA 2D0QB 4WTOB 1MMDA 1VOMA 2BIVA 1CKAA 2J6OA 2QK0A 2JN0A 5FU7B 4Y91A 5IH2A 2FL7A 1V1CA 1UEBA 2EKOA 1NYFA 2YT6A 4ZTJA 3VUZA 2DIGA 5C0MA 3HP9A 1Q81R 4NS5A 1Q86U 1X75C 4PLIA 4PJJA 2D9TA 1J3TA 4XTZA 3OYYA 4C8QC 4PJOE 3CCSQ 2ZPEB 3PE0A 4HVWA 4L5GA 4E6RA 3S3OA 2V8JA 4XU1A 2LQNA 4QVDA 3I5SA 2A7YA 2NUZA 4QQGA 5DLOA 3QBYA 1VQ5A 1PG5B 2SEMA 2VWFA 1B3QA 3CCRT 3CCST 2KQWA 4XTYA 1VQLT 2GQVA 3CCMT 4OGCA 2E6ZA 2LCCA 1ABQA 4ZN1A 2YSQA 5GAN5 3E1SA 2HSPA 2A36A 2WSEE 2PVOB 2XDDA 9ATCB 5GMKl 2MAMA 3UA7A 3GNFB 2QQSA 1Y96A 2B86A 5I22A 1E6GA 2V8IA 4OMMA 1AWJA 3C94A 3TU4K 2R5MA 1QMCA 5FROA 1ABOA 3PNWC 1P92A 1UG1A 1IREB 4C0DC 4OB3B 1WX6A 4VUBA 3TREA 5A0GA 1BK2A 5LJ3j 1M3CA 1I4K1 1K8AR 4RUGA 3MCAB 2BUDA 2ABLA 1AWWA 2QA4Q 1BIAA 2K57A 3EG0A 5FW9A 4MDXA 1T0HA 3M59A 3CMAA 4MZTA 2CH4A 5GAMj 2RI2A 1WHMA 5A0LA 3J80E 2FVUA 1K76A 1K9MR 1NLPC 1AOJA 2B8AA 5GAMh 1Q95G 2LC4A 4HXJA 2E12A 4OB0B 1NJIC 3CBOA 4M77D 1K9MU 4PJOA 2LT4A 2OTJQ 3VKIA 2DLPA 5LJ3h 4C92G 2ATCB 2V8KA 3OW2A 1V29B 4OVAA 4BDYA 4FSXA 2O4XA 1VIEA 2YLCA 4HVUA 4QVZA 2RJEA 3CC4T 4HCCA 2LX7A 2FPFA 1M90U 5CKFA 3M53A 1U06A 2EPDA 3VV0A 2COYA 2KE9A 4HVVA 1JJ2P 3FJ5A 2OTLT 2F2WA 1D0XA 3CPWP 3CCQT 3UF4A 4LE9A 4E2FB 3R6OA 2ZPIB 4M75D 2DM1A 3G71T 1B34A 2DL8A 1OU9A 4EMKC 1YBYA 2KT1A 1VQKA 1Y7XA 2OI3A 1VQNA 1SHGA 2LTOA 3VU3C 1ZA2B 3G4ST 1O9SA 4OP0A 3TCJA 1TH7A 4M77A 1RABB 2LCSA 1WJQA 5DM7R 2EJGA 3V7CA 1IO6A 2FRYA 1SF9A 1Q81U 1SG5A 3JCMc 3RDVA 1HK9A 1HXDA 1MMGA 5GANj 2K3BA 2EJ9A 1VQ7T 2HQHA 4FT2A 1RADB 1SRMA 3KFVA 5GMKm 1Y57A 5GAOl 3DLMA 2HDAA 5DY9A 3OMCA 1PKSA 4QVCA 1R77A 1WXTA 2LT1A 2HNIA 4J7IA 1Q7YU 1KC8R 4WCIA 3CC4A 2X51A 3HL8A 1RAGB 1VA7A 4KUIA 4CC3A 2Y90A 2O9VA 3GP8A 4FCYA 2ED0A 4DQ2A 4E7LA 3CCJQ 5KCOA 3QUIA 3JCMJ 1KJWA 2E64A 3P8BB 3RKYA 1FX7A 3OYEA 3GIBA 1WNLA 3S3MA 1PSFA 2JZ2A 1YITA 4OB2B 1VQKQ 1I1JA 1X2KA 2D8HA 5HCKA 4JRPA 2K3YA 4JJBA 3MP6A 4C8QA 1MHNA 2KBTA 3SWNA 1VQLQ 4ANJA 1LVKA 3TQ7P 2E1HA 3JRZA 3JCMd 2M16A 3CXCP 2RPNA 2IVWA 5IHKA 2VVKA 1H3HA 4M77E 1RAHB 4E7HA 3EG9B 2A3LA 1BKBA 3EFOB 2L3QA 5GANh 2BZYA 1WHKA 2H3EB 2JJ9A 2RB6A 4M78B 2DEUA 5EG2A 2VYTA 1N8RU 2QDYB 2RMOA 3FJPA 1UGRB 2DZCA 2EAYA 2KNBB 6AT1B 3H41A 3CBPA 4J9IA 1NJIU 2EIFA 3UPUA 3H0FA 2C0TA 2VGMA 1K4US 3CCLQ 1ZUUA 2JM9A 3S3NA 4BE0A 4BY6B 3QDFA 1M1FA 4PJOD 2MK5A 4LD6A 4M77C 2RHUA 1NPRA 4FW2A 2RNAA 4RTZA 1K1ZA 4EPCA 3F70A 2WSCE 3GF5A 2LQ8A 2DJZA 1QCOA 5KH6A 3L2WA 4ZN3A 5AYFA 4B9WA 2O2OA 2NYSA 1KSWA 5LJ5h 3JCMe 1LCKA 2KYBA 2M0OA 4PFOA 2E6NA 1VQ7Q 3JB9D 2KRMA 2E4HA 3CCJA 3U23A 1ARKA 1VQPQ 1VYUA 2EYWA 3MKDA 1SHFA 1Q86R 1Q86C 3EFRA 3RKWA 1E6HA 2KR3A 2MI6A 1Q7YR 5GAMd 1LOJA 2CSIA 4AFZC 2LP5A 1VQMA 4OMPA 3I35A 2EGCA 4II1A 3L2RA 3QYHB 2QTVA 2L3SA 4C0DB 4FYXB 1BYMA 2QA4A 4N0AC 4ELYC 3X20B 1VQ6Q 4ME7A 1N8RR 3EG3A 2DEQA 1TSFA 5LJ3d 3LGFA 1UJ0A 2J05A 1WJRA 4LDWA 4Y28E 4Z89A 3OYIA 4M7AA 3OQ5A 1N9SA 1VIFA 1JBMA 2VGNA 5KYUB 3P8DA 2JMCA 2RHIA 4F7UF 3ULRB 2RN8A 2VXFA 1SKUB 1NPPA 1JXOA 1FYNA 1UB4A 1ZBJA 1K73C 1VQ6T 1I81A 2LQKA
chains in the Genus database with same CATH topology
2EKOA 5GAN4 3JCMV 4HT8A 2EYQA 2LX9A 3H8ZA 3JCMW 3TEEA 2DXCA 3L2QA 2CZ0B 4PKCC 2K4YA 5CIUA 3KBGA 3V8LA 4ZTJA 3QG1A 1G3TA 3VUZA 2DIGA 4XK8E 4N4HA 3PIOA 3OS0A 3OW2S 5C0MA 4IUQA 3J81E 3RERA 3HP9A 3CD6T 3QJYA 3QDRB 3MO8A 5CO7A 1K8AC 2DXBA 4NS5A 5I2SA 2HBPA 3OYMA 1Q86U 2O01E 2PUOB 1LNXA 1X75C 2CZ6B 4PLIA 4ELZC 5CQYA 2D9TA 1JJ2A 4XTZA 3OYYA 4C8QC 5GANf 4E7KA 5FRNA 4BE1A 4PJOB 4B9XA 4PJOE 2X35A 4EMKA 3I55T 4OB1B 1QVPA 2ZPEB 4JLGA 1FWZA 2K2VA 2RJDA 2E41A 4N0AA 1W4SA 4QQDA 4RCCA 4L5GA 4C8QG 2K5FA 3S6WA 2DPPB 3WVDB 1VQKT 5DLQE 3S3OA 2V8JA 4XU1A 3LWIA 1YJ9T 4QVDA 3OYCA 1WGSA 3OYDA 1SSFA 2A7YA 4M75C 2YRVA 3JCMb 4A4GA 4J6YA 4QQGA 5DLOA 2M1HA 3A5ZB 3JCMP 3E19A 1YI2A 5GANe 2DTHA 3QBYA 4X9DA 4M7DC 1VQ5A 1Y07A 3OS2A 2JOYA 3X28B 2VXEA 3HKSA 3PIPA 4M78G 2O4XB 4E47A 3CCRT 3CCST 2KQWA 4M78E 1EIFA 5J3BA 1RL2A 4XTYA 4A53A 2K5IA 2YHTA 3CEYA 4E7IA 1VQLT 2GQVA 3CCMT 1KC8U 3M58A 2PVGB 4OGCA 5FU6C 2E6ZA 2JUFA 2LCCA 3CC2T 2FYKA 2CYZB 5CQXA 1Q82C 4ATOA 5LJ5j 4ZN1A 3CCUA 5GAN5 2ZPHB 4MMKA 4C5EA 3OYFA 5FU7C 2ZPBB 3E1SA 2WSEE 2PVOB 5CCAA 2XDDA 2EQKA 2LRQA 5GMKl 2DXTA 3LYIA 3QO3A 1VQ4A 2MAMA 1WJSA 3GNFB 2QQSA 1Y96A 4MZMA 2D6FA 2NLUA 4MMLA 2RHXA 2KDSA 2V8IA 3I55A 1VQ4T 2CKKA 3META 1YJNT 3C94A 3JCMQ 4EMHA 3EFSA 2XICA 3TU4K 3V8KA 1YJWT 3QYGB 5L8RE 4M7DG 2R5MA 3ER0A 5GAOn 5GAOr 5FROA 4L59A 2X4XA 4M75B 4UC4A 3RUXA 3A8LB 3PNWC 1P92A 4C0ZA 1IREB 4C0DC 4OB3B 4VUBA 3TREA 5A0GA 5LJ3j 1RI0A 1G5VA 3RKXA 5GAN6 1I4K1 1M4ZA 4PJOF 2ZPGB 3UWNA 3MCAB 3CCQA 4N4IA 2BUDA 2X4WA 4J7FA 3RMQA 5IT9E 2QQAA 3GNGA 1M90C 4BI8B 2KVQG 3OSVA 4C8QE 3PFSA 4PJOC 3CPWS 1BIAA 2K57A 4BI3A 4C92B 2H3JA 2PUKB 3WXMB 2GF7A 4MDXA 3LGLA 3M59A 4JJNK 4FT4A 2X4JA 3CMAA 4MZTA 1D3BB 4M7AD 2L5QA 2XKOC 4C92D 2R58A 5GAMj 2LNVA 2RI2A 3CCUT 2PVDB 4HCZA 2RH2A 5GAN3 1YIJA 2EQJA 5LJ3e 2OTJA 5A0LA 3J80E 5KE2A 2FVUA 4X34A 2B8AA 2VV5A 5GAMh 4JS5A 1QW1A 2I2LA 1QVFA 2LC4A 2FHDA 3V8JA 3BW1A 3AHUA 2E5QA 4PNOA 2E12A 4R55A 4OB0B 3MP1A 1YJNA 5GAN2 1NJIC 3CBOA 4IUTA 3LWHA 2JTMA 5LJ3f 3A8MB 4M77D 4XTWA 1K9MU 1JJ2S 5GAMe 4PJOA 1WPYA 2LT4A 5J26A 4DOWA 4EMGA 4MZPA 3VKIA 5LJ3h 4XTXA 1ZBXA 1KQ1A 2L3RA 4C92G 5HKCA 2HAXA 2DAQA 1GXIE 1Y71A 2C06A 2VUBA 3C95A 3CPWA 2V8KA 2DVEA 3OW2A 1V29B 4OVAA 1VQPT 4XU2A 1VUBA 2F5TX 4BDYA 2ZZDA 3QJ6A 4FSXA 5GANg 2O4XA 2AHJB 3OY9A 2GCXA 1VIEA 4M7DA 2YLCA 4D6WA 4QVZA 3CCLT 4F7UA 2RJEA 4BD3A 3CCJT 3M54A 3CC4T 3OS1A 4HCCA 4J6WA 4WF2A 3URGA 3M4YA 2KAFA 3CMEA 1M90U 2F5KA 5CKFA 2EQMA 1I8FA 3C4SA 3MP8A 4N4GA 3M53A 5LJ5d 3OYNA 3GPLA 2MWPA 4RG8A 3FDRA 4IUPA 3VV0A 3CCEA 4ZGEB 4RMOA 4OGEA 4M7AF 2EJFA 4FL6A 4A54A 3QPHA 3WVEB 2QEXT 4M75F 2OTLT 3HFOA 3FB9A 3M5AA 4OMFB 4C0GA 3CCQT 2OAUA 3OSSC 3HPWA 4L6V5 2KMTA 3RIRA 3T9NA 3CCET 4XTVA 1B34B 4M78D 3SWNC 2P0QA 5CKDA 5M9OA 1BI3A 4C5HA 4HKEA 3PT9A 2ZPIB 1UGPB 3QZ9B 3R6OA 3DB3A 3M56A 4M75D 3UDCA 3G71T 1B34A 4IKFA 4M75E 1N9RA 5GAOm 4F7UG 1XQHA 1XOVA 5GMKj 1N27A 1M8VA 4JUVA 3OBWA 4IURA 4ZTFA 2Y4XA 4EMKC 3Q1JA 1YBYA 3O8VA 1VQKA 1Y7XA 3L1AA 3OYKA 1VQNA 2ZGWA 5GANd 4C8QB 1U8RA 2RK1A 2DD5A 5CAIA 4X9CA 2RA2A 1G3WA 3HFNA 4M77B 4RKUE 4KUDK 2QQBA 2LTOA 2WSFE 3LW5E 3VU3C 4FU6A 4LDVA 4M78F 3I56T 3G4ST 1KG1A 1G3SA 1O9SA 2QI2A 4OP0A 3TCJA 4TVRA 1TH7A 4M77A 4C92C 1OI1A 3E9GA 4E7JA 1WJQA 5DM7R 1KQSS 5D6XA 4ZGDB 1R8OB 2E10A 2EJGA 2RM4A 3CCSA 2HQXA 1KC8C 1K73C 3V7CA 4JLIA 4O6JA 5CVIA 4EDUA 2RI5A 2L89A 3J7AF 1Q82U 2GFAA 2DZ9A 3G7ZA 2QA4T 1BI0A 3CMET 4JS4A 1VQ9T 1VQPA 4M78A 1Q81U 1OZ2A 1XTDA 3LH0A 2Y4YA 2XU8A 2HD0A 3JCMc 3MEUA 1VQ8A 3FRNA 4M7AE 2JVVA 4QW2A 1HK9A 1HXDA 1Q81C 4M77G 3JCMX 1KHIA 2DTIA 2QXFA 5GANj 3OMGA 3MEWA 3OS5A 1QP2A 1K8AU 2EJ9A 1VQ7T 3CXCS 3NTHA 5D6WA 1U1TA 3QXEB 4P5NA 4C8QD 4FT2A 4LDUA 4XTUA 3CCLA 3A8HB 3MEVA 1H641 1UGSB 2EQUA 5GMKm 2R57A 5I21A 3OYBA 1KQSA 1QVGA 5GAOl 3DLMA 3V7SA 4DA4A 5DY9A 4BDZA 2QQ9A 4C92F 2RJFA 3VJPA 3RMSA 1VQMT 3OMCA 4PJOG 4QVCA 2QEXA 2OTLA 3X24B 2LT1A 3G71A 2HNIA 1VQNT 3FEOA 3PMIA 4KULA 2OTJT 4J7IA 2RHZA 4C8QF 4F7UE 1Q7YU 1QVFS 2XG8D 3CCVA 3CC4A 2JNGA 3L2ZA 4RCBA 3HL8A 1QP3A 1Q7YC 3PTAA 4XQ3A 4A4KA 5A0DA 2QQRA 2DD4A 3VUBA 3G6ET 3JB9I 3C12A 1WQ7A 2K3XA 4KUIA 3FLGA 2PU9B 3FC3A 2Y90A 2DIQA 3GP8A 3CD6A 4C92E 1U1SA 3OBYA 2F69A 4NOYA 2KK4A 4DQ2A 3BFMA 3JB9F 2P0PA 2XI9A 4E7LA 4M7DF 1UGQB 2JTFA 5KCOA 3QUIA 4M77F 5KCHA 4O5VA 3JCMJ 2E64A 3P8BB 1FX7A 3HRSA 5CKHA 3RKYA 3OYEA 4QQ6A 3E9FA 3NTIA 1WNLA 3GIBA 3BDUA 4XAXB 3S3MA 1PSFA 1VQOT 4PLLA 2JZ2A 1YITA 1K73U 3QKJA 3SFMA 4OB2B 3HHTB 4HCBA 3H6ZA 1XNIA 4A4EA 5LJ5f 4JRIA 5FRMA 4C5IA 5GAN7 5GAOq 4JRPA 2FB7A 3CCRA 3ZBDA 3CMAT 3SWNB 4XU3A 4A4FA 3CPFA 2K3YA 3JCMf 3OB9A 1M1KU 4R56A 2MMPA 5GAMg 3MP6A 4BUGA 3CBMA 3LX7A 4C8QA 1O75A 5GMKi 1MHNA 3SWNA 1LJOA 2MF2A 3X26B 2RK2A 4DOVA 3N5BB 1W2BA 2CGHA 4LD9K 4V2SA 2BKDN 4OF1A 2E1HA 3JRZA 3JCMd 5A2QE 4Z02A 2M16A 3CC7A 3JB9J 4CI0C 3SDZA 1YIJT 5CKBA 1M5Q1 2CZ7B 2XDPA 3LLRA 4J8OA 4XU0A 4FM4B 3QIIA 3L2UA 1D3BA 2E65A 2IVWA 1KHCA 2E70A 4FIBA 5C6SA 4M77E 5LJ3g 3M9QA 1VQ8T 4E7HA 4BI4A 2A3LA 2G3RA 4LDYA 1BKBA 2DK3A 4J5YA 2M9UA 5KE3A 2EFIA 3G6EA 2XD0A 1KD1C 4M7DE 1X6OA 5GANh 4Q5WA 1N8RC 3L42A 1H3ZA 4IUVA 3CC7T 4BB7A 3ASKA 2RB6A 1KD1U 4M78B 2IG0A 4HT9A 5EG2A 2VYTA 1N8RU 4LDXA 2QDYB 3QZ5B 3QHSA 1YJWA 3FIFA 4M7AB 3FJPA 1UGRB 2DZCA 3G4SA 4M7AC 2EAYA 4A4HA 5D6YA 3QSUA 3CBPA 3SD4A 1NJIU 3OYJA 2EIFA 3UPUA 3BY7A 3PGGA 2ZCFB 5FU6B 2VGMA 4JRQA 1VQ5T 5HY6A 3S3NA 3X25B 3CCVT 1BI2A 1Y96B 4BY6B 3DB4A 2CS7A 4BE0A 2RHYA 1M1FA 1QVGS 2LVMA 4BE2A 4PJOD 1VQ7A 2XDBA 4LD6A 1OYXA 2P0KA 3ZEHA 4M7DB 1JRIA 4M77C 1NZ9A 2DTOA 2XK0A 3INZA 1M1KC 3OA6A 1I5LA 2RHUA 2DO3A 3M57A 1NPRA 4RG2A 3HSBA 2L8DA 2YLBA 2R5AA 3PMTA 4NL3A 2X4YA 5GMKh 4EPCA 3F70A 2KY9A 2WSCE 3GF5A 2LQ8A 1S72T 1YI2T 2DJZA 4BACA 4C0FA 3SB2A 1WQWA 5KH6A 3OYHA 3L2WA 4EMKB 5IAYA 1NE8A 1ZQ1A 2CZ1B 3GLXA 3VYGA 4C92A 4ZN3A 1W2BS 2PQWA 2RO0A 5AYFA 4B9WA 3OYLA 1YCYA 3OYGA 5LJ5h 3JCMe 3JAME 2M0OA 3NFCA 4M7AG 3ZFJA 3VYHB 4GLKA 3JB9G 4F7UB 5CK9A 2E6NA 2DXUA 2KSSA 3BDLA 3JB9D 1YHQT 3L2VA 4M7DD 3CCMA 3KUFA 4M75G 1IZ6A 4BY6C 5LJ5g 3CCJA 1KQ2A 3CC2A 1YJ9A 2LDMA 2EWNA 3DKMA 4GY5A 4ZGJB 2RJCA 1Q86C 3EFRA 3RKWA 4IUUA 5IN1A 3RESA 1YITT 4HA8A 2MI6A 1M1GA 3GOXA 1N6AA 2DKGA 3A8OB 5GAMd 5GAN8 3I56A 1JB0E 2HQEA 3OYAA 3HRUA 1LOJA 2RI3A 3HRTA 4JRKA 1ZHIA 3M4GA 3P8HA 3KXTA 1K9MC 4J83A 4YTLA 1BIBA 5CR2A 1VQMA 3JCMg 4II1A 3EAEA 2GFUA 3L2RA 5GAMf 4J6XA 1VQ6A 3QYHB 4C5GA 1G3YA 1FXXA 4C0DB 3DLLA 1OZ3A 3JB9H 1BYMA 1S72A 4KBMB 2QA4A 4N0AC 1VQ9A 4ELYC 3X20B 5HK0A 1MGQA 4ME7A 3JSCA 4MDWA 2XHCA 2DEQA 3MEAA 1AHJB 1PSEA 5LJ3d 1VQOA 4CRIA 3LGFA 1DJ7B 2WACA 2ZPFB 1WJRA 4LDWA 2LCLA 5LL6S 3JCMh 5LJ5e 2K5LA 4Y28E 3A8GB 4M75A 1BI1A 2RD1A 3ME9A 4PL6A 5HK3A 4KT0E 3OYIA 4M7AA 5I2MA 3V7RA 1VQLA 3OQ5A 2D0QB 1YHQA 1N9SA 1VIFA 5CKEA 1JBMA 2P4TA 2BIVA 2VGNA 4JDSA 3P8DA 4M78C 5GAOp 1M9SA 2RHIA 3MHXA 5J39A 5FLXE 4F7UF 2JN0A 2VXFA 4NL2A 1X01A 5FU7B 2MWOA 1NPPA 4Y91A 3M55A 2QTXA 3NTKA 3UT1A 3CXCA 1UB4A 2VC8A 2FL7A 5GMKe 1VQ6T 1I81A 2XIDA 1UEBA 2LQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKO A;  3MEU A;  3H8Z A;  2FHD A;  5D6Y A;  4A4H A;  4QW2 A;  3SD4 A;  3OYJ A;  3L2Q A;  2E5Q A;  5CIU A;  4ZTJ A;  3OMG A;  3MP1 A;  3MEW A;  2DIG A;  3OS0 A;  4N4H A;  5C0M A;  4IUQ A;  3S3N A;  3NTH A;  5D6W A;  4IUT A;  4BE0 A;  3DB4 A;  2RHY A;  3MO8 A;  2LVM A;  4BE2 A;  4NS5 A;  3OYM A;  4LD6 A;  1OYX A;  2P0K A;  3MEV A;  5J26 A;  3ZEH A;  2EQU A;  4PLI A;  2R57 A;  3OYB A;  2D9T A;  2L3R A;  2XK0 A;  3DLM A;  2DAQ A;  4BDZ A;  4E7K A;  3OA6 A;  5FRN A;  2RHU A;  2RJF A;  4RG2 A;  4B9X A;  2X35 A;  3OMC A;  4BE1 A;  2RJD A;  2L8D A;  2R5A A;  3PMT A;  4OVA A;  2X4Y A;  4QQD A;  3F70 A;  3FEO A;  3PMI A;  3S6W A;  4BDY A;  2RHZ A;  3QJ6 A;  3S3O A;  2O4X A;  3OY9 A;  3OYC A;  1WGS A;  3OYD A;  4BAC A;  1SSF A;  2YRV A;  4QVZ A;  4A4G A;  5KH6 A;  2RJE A;  4QQG A;  4BD3 A;  3OYH A;  3L2W A;  5IAY A;  3OS1 A;  2M1H A;  2QQR A;  3QBY A;  2PQW A;  2RO0 A;  3OS2 A;  2K3X A;  3FLG A;  3FC3 A;  2F5K A;  4B9W A;  2DIQ A;  3OYL A;  2EQM A;  2O4X B;  3C4S A;  3MP8 A;  4N4G A;  3OYN A;  3OYG A;  2MWP A;  2M0O A;  3FDR A;  4IUP A;  4E7L A;  3CEY A;  4E7I A;  2E6N A;  2JTF A;  3BDL A;  5KCO A;  4FL6 A;  5KCH A;  3L2V A;  3OYE A;  2LCC A;  3KUF A;  3E9F A;  3NTI A;  4QQ6 A;  3S3M A;  4PLL A;  4C5E A;  3OYF A;  2JZ2 A;  2LDM A;  3QKJ A;  2EQK A;  2LRQ A;  3H6Z A;  1XNI A;  3LYI A;  4GY5 A;  2RJC A;  4A4E A;  1WJS A;  2QQS A;  5FRM A;  4IUU A;  5IN1 A;  4C5I A;  2NLU A;  2RHX A;  3GOX A;  4A4F A;  2K3Y A;  5M9O A;  3OB9 A;  4C5H A;  2CKK A;  3MET A;  2HQE A;  3OYA A;  3MP6 A;  4IKF A;  3DB3 A;  3LX7 A;  2RI3 A;  1MHN A;  3P8H A;  1N27 A;  2R5M A;  5FRO A;  4L59 A;  2X4X A;  3EAE A;  2GFU A;  4II1 A;  2BKD N;  3PNW C;  4IUR A;  4UC4 A;  3L2R A;  4ZTF A;  4Z02 A;  2M16 A;  3Q1J A;  4C5G A;  3O8V A;  1OZ3 A;  3OYK A;  1RI0 A;  1G5V A;  2XDP A;  3LLR A;  3QII A;  3L2U A;  3MEA A;  3UWN A;  1KHC A;  4N4I A;  5C6S A;  2BUD A;  4CRI A;  2X4W A;  3LGF A;  2WAC A;  1WJR A;  2LTO A;  3M9Q A;  4E7H A;  4FU6 A;  2G3R A;  3PFS A;  5KE3 A;  3ME9 A;  4PL6 A;  3OYI A;  2EFI A;  1OI1 A;  3E9G A;  2GF7 A;  3OQ5 A;  1WJQ A;  4Q5W A;  3LGL A;  4E7J A;  3L42 A;  5D6X A;  1H3Z A;  2BIV A;  4IUV A;  3P8D A;  2HQX A;  3ASK A;  5J39 A;  2RHI A;  2IG0 A;  2R58 A;  2RI2 A;  2VYT A;  4EDU A;  2RI5 A;  2L89 A;  4HCZ A;  2MWO A;  2GFA A;  3UT1 A;  2EQJ A;  3NTK A;  5KE2 A;  4X34 A;  2B8A A;  1OZ2 A;  3LH0 A; 
#chains in the Genus database with same CATH topology
 5GAN 4;  2LX9 A;  3JCM W;  1TOV A;  4PKC C;  3KBG A;  1IRX A;  3QG1 A;  3OW2 S;  3RER A;  1SPK A;  3UAT A;  2JS0 A;  3MO8 A;  2DXB A;  5I2S A;  2HBP A;  2PUO B;  4ELZ C;  1IGQ A;  5CQY A;  5GAN f;  2X35 A;  4EMK A;  1QVP A;  4JLG A;  2K2V A;  2FO0 A;  1MNE A;  2K5F A;  3WVD B;  1VQK T;  2HL5 C;  2OJ2 A;  3OYC A;  1WGS A;  3OYD A;  1SSF A;  4DBR A;  4J6Y A;  3CC2 Q;  1YI2 A;  2EVR A;  2DTH A;  4X9D A;  8ATC B;  1T3S A;  2JOY A;  2YUQ A;  3HKS A;  2BZX A;  3PIP A;  4F04 B;  4E47 A;  2K5I A;  3CEY A;  1KC8 U;  5FU6 C;  1BB9 A;  2EW3 A;  5LJ5 j;  3CCU A;  3OYF A;  5FU7 C;  4OMN A;  2YUO A;  2ZPB B;  4PK4 A;  2LRQ A;  1YNZ A;  2DXT A;  3LYI A;  3QO3 A;  4MZM A;  1IXD A;  2DL7 A;  2RHX A;  2KDS A;  1VQ4 T;  2CKK A;  3CC7 Q;  4RTU A;  3EFS A;  3QYG B;  3ER0 A;  2BZ8 A;  5GAO r;  4M75 B;  4UC4 A;  3RUX A;  2AKK A;  1OX9 A;  1RI0 A;  2ZPG B;  3RMQ A;  2QQA A;  1M90 C;  2KVQ G;  3OSV A;  1EFN A;  4BI3 A;  2M51 A;  2PUK B;  2RQR A;  4FT4 A;  2X4J A;  2MPX C;  1WLP B;  4C92 D;  2R58 A;  2LNV A;  2PVD B;  4HCZ A;  4X34 A;  1MV3 A;  1QVF A;  2FHD A;  4RTX A;  3AHU A;  1YI2 Q;  4JJD A;  4AG1 C;  3AT1 B;  2DYI A;  1YWP A;  2JTM A;  5LJ3 f;  1VYV A;  5J26 A;  1PD1 A;  4IIO A;  1WHG A;  5HKC A;  1Y71 A;  2C06 A;  2VUB A;  2AZS A;  2VKN A;  4XU2 A;  2F5T X;  1K0X A;  2QDL A;  5GAN g;  2AHJ B;  2HMA A;  2QEX Q;  2GCX A;  5KYY A;  1JO8 A;  4D6W A;  3CCJ T;  1OUL A;  3SHW A;  4J6W A;  1IHW A;  4WF2 A;  3URG A;  1BCO A;  2EQM A;  3MP8 A;  3GPL A;  1QVF P;  1ZUY A;  3FDR A;  1ZSZ C;  2FZK B;  1ZA1 B;  2AIR B;  4RMO A;  2GQI A;  4M7A F;  4FYW B;  2EJF A;  4FL6 A;  3QPH A;  2QEX T;  3H0I A;  4Z8A A;  1WXU A;  3FB9 A;  3M5A A;  4C0G A;  2EYX A;  1AZE A;  2BE9 B;  1IHV A;  2KMT A;  3T9N A;  3CCE T;  1YP5 A;  4M78 D;  2KXD A;  2P0Q A;  1HYO A;  5M9O A;  3EHR A;  3PT9 A;  3QZ9 B;  3DB3 A;  1TUD A;  1N9R A;  5GAO m;  4F7U G;  5GMK j;  1M8V A;  3VS4 A;  1UEC A;  1GBQ A;  3OYK A;  5AT1 B;  4J9G A;  1U8R A;  4X9C A;  1G3W A;  3HFN A;  4RKU E;  3LW5 E;  3I56 T;  2RQU A;  4LDV A;  2KXC A;  1T0J A;  4C92 C;  2L2P A;  1R8O B;  2E10 A;  2RM4 A;  3VRZ A;  4EDU A;  2RI5 A;  1C6V X;  1Q82 U;  2GFA A;  1VQ9 T;  1BI0 A;  1VQP A;  2A37 A;  1OZ2 A;  1VQM Q;  2Y4Y A;  2X9H A;  2HD0 A;  3MEU A;  3EGD B;  4M77 G;  2DTI A;  3OMG A;  2L0A A;  1QP2 A;  5D6W A;  2HSE B;  4XTU A;  3CCL A;  1CSK A;  3A8H B;  1I5O B;  1UGS B;  4QKU A;  2CRE A;  1KQS A;  1QVG A;  1WI7 A;  4BDZ A;  4C92 F;  1VQM T;  1OU8 A;  1VQN T;  3FEO A;  2OTJ T;  1X43 A;  4F7U E;  1ZUK A;  3CCV A;  3L2Z A;  1JQQ A;  3MPU B;  4XQ3 A;  4F16 A;  3PTA A;  3D7S B;  2QQR A;  2DD4 A;  3VUB A;  5D7U A;  3G6E T;  3FC3 A;  2D1X A;  2DIQ A;  2F69 A;  5I11 A;  1Y0M A;  2HKQ B;  2P0P A;  4RTV A;  4B6M A;  1UGQ B;  4KRT A;  2JTF A;  5KCH A;  4O5V A;  1TUG B;  2DNU A;  4GBQ A;  4XAX B;  4LNP A;  3M0U A;  1VQO T;  3SFM A;  1KQS P;  2DL5 A;  3EHQ A;  5GAO q;  2FB7 A;  4CC4 B;  2DVJ A;  3CPF A;  2DL3 A;  1NLO C;  3OB9 A;  2MMP A;  2CDT A;  4ZNX A;  1RI9 A;  2DF6 A;  2O31 A;  2EKH A;  1RAE B;  1LJO A;  2MF2 A;  4DOV A;  3N5B B;  1W2B A;  4V2S A;  2D8J A;  5A2Q E;  2DRK A;  3SDZ A;  5CKB A;  2CZ7 B;  2XDP A;  1D3B A;  2E65 A;  3TSZ A;  5EC7 A;  4LDY A;  1ZSZ B;  3G6E A;  2DX1 A;  2DIL A;  1KD1 C;  2M02 A;  4Q5W A;  4OML A;  4IUV A;  3CC7 T;  4BB7 A;  4HT9 A;  1TTH B;  1M27 C;  3G4S Q;  3TSW A;  2V1Q A;  4X1V A;  5D6Y A;  3OYJ A;  1JXM A;  1KK7 A;  5FU6 B;  4JRQ A;  1M2V A;  1Y96 B;  3VS0 A;  1QVG S;  2RQT A;  2NUP B;  2C0I A;  3A98 A;  1JRI A;  1IB8 A;  3EFO A;  1M1K C;  3M57 A;  2YLB A;  4LN2 A;  1OQK A;  2X4Y A;  4JZ3 A;  1QCN A;  1YI2 T;  4BAC A;  1MMA A;  2EGE A;  3SB2 A;  2DA9 A;  3VS3 A;  3EGX A;  3OYH A;  2CZ1 B;  3VYG A;  2D0N A;  2PQW A;  2DET A;  1X27 A;  3JAM E;  4M7A G;  2IPO B;  4GLK A;  5CK9 A;  1YHQ T;  1M1K R;  3L2V A;  4Z88 A;  4AMC A;  1IZ6 A;  3CC2 A;  2LDM A;  1W70 A;  2A0F B;  4IUU A;  1M1G A;  1T3L A;  3A8O B;  3I56 A;  5GAN 8;  1OOT A;  4D8D A;  1D0Z A;  1TG0 A;  4JRK A;  2RI3 A;  3HRT A;  3M0P A;  3P8H A;  1K9M C;  4J83 A;  1BIB A;  5CR2 A;  1UHC A;  1C1A A;  4C5G A;  1FXX A;  1UFF A;  2NUT A;  3DLL A;  2FRW A;  3TVT A;  2JS2 A;  2RQW A;  2PZ1 A;  2XHC A;  2YRD A;  3MEA A;  3JCM h;  4GLM A;  2ZPF B;  3M0S A;  5LJ5 e;  1NJI R;  1BI1 A;  2RD1 A;  3ME9 A;  3V7R A;  1FMW A;  1VQL A;  1YHQ A;  4OMO A;  5CKE A;  4JDS A;  5GAO p;  1M9S A;  4JZ4 A;  5J39 A;  2QAZ A;  2O9S A;  1GBR A;  2KT8 A;  1XJW B;  4NL2 A;  3UT1 A;  3M55 A;  2QTX A;  3NTK A;  2DRM A;  1SSH A;  1RAI B;  2J6K A;  2XID A;  1X6G A;  4OMQ A;  4HT8 A;  3H8Z A;  4KH0 B;  3L2Q A;  4AFQ C;  1TU0 B;  3V8L A;  1GRI A;  2OTJ A;  3OS0 A;  4IUQ A;  3CD6 T;  3QJY A;  3QDR B;  4DEY A;  1K8A C;  3OYM A;  2CZ6 B;  4CC2 A;  2J7I A;  1M3A A;  4PJO B;  4BE1 A;  3I55 T;  1UDL A;  4OB1 B;  1FWZ A;  2RJD A;  2E41 A;  1LPL A;  4RCC A;  4AFS C;  2JTE A;  3S6W A;  3LWI A;  1YJ9 T;  3JCM b;  4M75 C;  2CSQ A;  2M1H A;  3A5Z B;  5GAN e;  2KRN A;  4M7D C;  1Y07 A;  1W1F A;  2VXE A;  4M78 G;  2QYZ A;  1MV0 B;  2K7A A;  4A53 A;  1EIF A;  5J3B A;  1NG2 A;  2YHT A;  3CC2 T;  2FYK A;  2CYZ B;  5GJW B;  1PNJ A;  4ATO A;  2ZPH B;  4C5E A;  2DE0 X;  1BBZ A;  1QWF A;  1W6X A;  2EQK A;  1A0N B;  3CME Q;  1VQ4 A;  2D6F A;  4MML A;  2YUP A;  3I55 A;  2KRS A;  1KIK A;  1U3O A;  2JT4 A;  1HJD A;  4EMH A;  2XIC A;  5L8R E;  4M7D G;  5GAO n;  4L59 A;  4J9F A;  1GL5 A;  3UWN A;  2EYY A;  1VQ9 Q;  2LNH B;  3CPW S;  2QGG A;  4C92 B;  2H3J A;  2GF7 A;  2NWM A;  3LGL A;  2HL3 A;  1D3B B;  3UA6 A;  2ZAE A;  3CCU T;  2EQJ A;  1M2V B;  5LJ3 e;  4DEX A;  2CT4 A;  2LJ1 A;  2VV5 A;  1YIJ Q;  2I2L A;  2DER A;  3V8J A;  3BW1 A;  2E5Q A;  3MP1 A;  4M4Z A;  1GFD A;  5GJV B;  4J9E A;  3LWH A;  2V1R A;  4XTW A;  3EGU A;  5GAM e;  1WPY A;  1AWO A;  1ZLM A;  4DOW A;  4EMG A;  1Q82 R;  4MZP A;  4XTX A;  2F2V A;  1KQ1 A;  2HAX A;  1RLQ C;  1GXI E;  3C95 A;  3CQT A;  3EGX B;  2DVE A;  1AT1 B;  2QAS A;  2ZZD A;  3QJ6 A;  2OTL Q;  4LXC A;  3M54 A;  2FG0 A;  3OS1 A;  2FPD A;  1WYX A;  2KAF A;  1BU1 A;  7AT1 B;  2F5K A;  2DMO A;  4DBF A;  3C4S A;  2F2X A;  4N4G A;  1JU5 C;  2GNC A;  3CCE A;  4IUP A;  5KYW A;  4ZGE B;  4OGE A;  3WVE B;  4FYY B;  4OMF B;  2OAU A;  3OSS C;  1SEM A;  4FYV B;  2CH4 W;  3HPW A;  4L6V 5;  3RIR A;  1FMV A;  1B34 B;  4J9C A;  5CKD A;  4C5H A;  2NUP A;  4HKE A;  1UGP B;  3UDC A;  2GTO A;  1D0Y A;  2ROT A;  4JUV A;  3SEM A;  1WHJ A;  2Y4X A;  2AZV A;  3L1A A;  2ZGW A;  2LJ3 A;  2DD5 A;  5CAI A;  1EZZ B;  2RA2 A;  2C0O A;  4M78 F;  4DBH A;  1KG1 A;  2QI2 A;  1BCM A;  4TVR A;  1OI1 A;  2DYB A;  3E9G A;  4E7J A;  2YUN A;  5D6X A;  2ROL A;  2HBW A;  4O6J A;  3GBQ A;  2L89 A;  3J7A F;  1H8K A;  3CME T;  4J9B A;  4M78 A;  1XTD A;  2E3I A;  3LH0 A;  2HEQ A;  2XU8 A;  1M30 A;  2ECZ A;  1VQ8 A;  3FRN A;  1Q81 C;  3JCM X;  1KHI A;  4F14 A;  1K9A A;  3MEW A;  3IQL A;  3EG1 A;  1K8A U;  2YDL A;  1VQN Q;  3CXC S;  3NTH A;  4P5N A;  1G83 A;  4KH1 B;  4LDU A;  1H64 1;  3OYB A;  2R57 A;  3NPF A;  5I21 A;  3CCM Q;  1AD5 A;  2SRC A;  3V7S A;  4DA4 A;  3VJP A;  3RMS A;  2OTL A;  1X6B A;  2A08 A;  1SRL A;  3PMI A;  4KUL A;  4C8Q F;  1QVF S;  2JNG A;  4RCB A;  1Q7Y C;  4A4K A;  4CC7 A;  5A0D A;  2BTT A;  1YCS B;  3C12 A;  2K3X A;  3VS6 A;  2AK5 A;  4C92 E;  3OBY A;  4NOY A;  2L3P A;  4AFU C;  2XI9 A;  4M7D F;  1E7O A;  1GCP A;  2EQI A;  4M77 F;  2P84 A;  3E9F A;  3NTI A;  1R0B G;  3BDU A;  2CP2 A;  4KGX B;  1K73 U;  3HHT B;  1M8M A;  3H6Z A;  2EYZ A;  3H0H A;  5LJ5 f;  4C5I A;  1NYG A;  2DJQ A;  3ZBD A;  4PJN A;  3CMA T;  3SWN B;  3M0T A;  3JCM f;  1M1K U;  2I0N A;  5GAM g;  3LH5 A;  4BUG A;  3CBM A;  3LX7 A;  1O75 A;  1OPL A;  3NHN A;  4J9D A;  2RK2 A;  8AT1 B;  4OF1 A;  3CC7 A;  3JB9 J;  2K79 A;  4J8O A;  1B7T A;  4FM4 B;  2CT3 A;  5C6S A;  4FIB A;  5LJ3 g;  3M9Q A;  2G3R A;  2XD0 A;  4M7D E;  3C0C A;  4AG2 C;  1N8R C;  1C0M A;  2IG0 A;  2COZ A;  3FIF A;  1W2B P;  3SD4 A;  3H9N A;  3R6N A;  3BY7 A;  1QKW A;  2ZCF B;  2GBQ A;  2P4R A;  1VQ5 T;  5HY6 A;  3CCV T;  2AKL A;  1U5S A;  2CS7 A;  2HCK A;  3DB4 A;  3VS5 A;  1PWT A;  1GCQ A;  1VQ7 A;  1YFN A;  2P0K A;  4M7D B;  2W10 A;  2DTO A;  3INZ A;  1I5L A;  4RG2 A;  2DO3 A;  2X3W D;  2L8D A;  3VS7 A;  2KY9 A;  3JV3 A;  2F1L A;  1S72 T;  2OAW A;  1VQ5 Q;  1V76 A;  1WQW A;  2GGR A;  5IAY A;  4C92 A;  3CCE Q;  2RO0 A;  2LJ0 A;  3THK A;  4EIK A;  4FSS A;  3OW2 P;  3E2U A;  2LQW A;  2KSS A;  1QVG P;  2BE7 D;  4M7D D;  3CCM A;  3KUF A;  2MYS A;  4M75 G;  4BY6 C;  2W0Z A;  2VAS A;  1KQ2 A;  3DKM A;  4GY5 A;  2RJC A;  3I56 Q;  5IN1 A;  1WDX A;  4HA8 A;  2Z0W A;  2HQE A;  3OYA A;  3M4G A;  3KXT A;  1K73 R;  3JCM g;  3EAE A;  5GAM f;  4J6X A;  3NMZ C;  3JB9 H;  1S72 A;  1VQ9 A;  1OPK A;  4LUE A;  1MGQ A;  1PSE A;  5IXB A;  2MIO A;  2NUT B;  1M3B A;  4R0K A;  2K5L A;  3A8G B;  3CCV Q;  3QWY A;  1AVZ C;  1N5Z A;  2EGA A;  4HCK A;  1VQO Q;  3O5Z A;  2P4T A;  4M78 C;  4IIM A;  3MHX A;  5FLX E;  3QWX X;  1VQ8 Q;  1X01 A;  2MWO A;  2H8H A;  3CXC A;  2VC8 A;  5GMK e;  2CP5 A;  3CC4 Q;  3JCM V;  2EYQ A;  1PKT A;  3TEE A;  2DXC A;  1TWB A;  1WA7 A;  2CZ0 B;  1PHT A;  1D1A A;  2K4Y A;  1ZSG A;  2KEA A;  2OX7 A;  1I0C A;  5CIU A;  1H92 A;  1G3T A;  4XK8 E;  4N4H A;  3PIO A;  2CP0 A;  3J81 E;  1YJ9 Q;  5CO7 A;  2O01 E;  3VS2 A;  1LNX A;  3I9Q A;  1JJ2 A;  4E7K A;  5FRN A;  2MCN A;  4B9X A;  2YXY A;  1PRM C;  4N0A A;  1W4S A;  4QQD A;  4C8Q G;  2CUD A;  2DPP B;  5DLQ E;  3M0Q A;  3BE3 A;  2YRV A;  4A4G A;  2G6F X;  3CMA Q;  3EG9 A;  3JCM P;  3E19 A;  1B07 A;  3OS2 A;  5KYN A;  3X28 B;  2O4X B;  4PJM A;  4M78 E;  1RL2 A;  4E7I A;  3M58 A;  2PVG B;  2JUF A;  5CQX A;  1Q82 C;  1NBE B;  4PJL A;  4MMK A;  3EGD A;  2RQV A;  3G71 Q;  5CCA A;  2JM8 A;  2K6D A;  1WJS A;  3PVQ A;  2NLU A;  4QT7 A;  1CKB A;  1I07 A;  3MET A;  4KGV B;  1YJN T;  3G6E Q;  3JCM Q;  1NEB A;  2DFU A;  3V8K A;  1YJW T;  2X4X A;  4KGZ B;  4E7S A;  3A8L B;  4C0Z A;  4LUD A;  1G5V A;  3RKX A;  4RTW A;  2DL4 A;  5GAN 6;  1M4Z A;  4PJO F;  1S1N A;  2CUB A;  3CCQ A;  4N4I A;  2X4W A;  4J7F A;  5IT9 E;  3GNG A;  4BI8 B;  4C8Q E;  2J6F A;  4PJO C;  3PFS A;  2YWW A;  2FPE A;  3WXM B;  1M2O A;  2KYM A;  1YJW Q;  1D1C A;  1MMN A;  4JJN K;  2QG9 B;  4M7A D;  2L5Q A;  2XKO C;  2KRO A;  2RH2 A;  5GAN 3;  1YIJ A;  5KE2 A;  1HD3 A;  2LMJ A;  1WHL A;  4JS5 A;  1QW1 A;  1WIE A;  2J06 A;  2DBK A;  1MUZ A;  4PNO A;  4R55 A;  1YJN A;  5KYX A;  1UGV A;  5GAN 2;  1D09 B;  1X69 A;  4IUT A;  3PVL A;  3A8M B;  1VYT A;  1JJ2 S;  1UHF A;  2RF0 A;  3RNJ A;  1HSQ A;  1ZBX A;  1QWE A;  2L3R A;  2DAQ A;  3CPW A;  2CP7 A;  4JPB W;  1VQP T;  4RTY A;  1VUB A;  3OY9 A;  2K9G A;  4M7D A;  2CP3 A;  3CCL T;  4F7U A;  4BD3 A;  3I55 Q;  4A63 B;  2AT1 B;  4AT1 B;  1ZSZ A;  3M4Y A;  3CME A;  3VRY A;  1VQ4 Q;  5KYU A;  3OYN A;  1I8F A;  5LJ5 d;  2MWP A;  4RG8 A;  1Z9Z A;  3VS1 A;  3CD6 Q;  4A54 A;  1NEG A;  4M75 F;  5KYW B;  1QLY A;  3HFO A;  1TS9 A;  3CCR Q;  1OV3 A;  2FZG B;  4E7Z A;  1AZG B;  2IIM A;  1YWO A;  1RAA B;  3EH1 A;  5ECA A;  3RBB B;  4XTV A;  3SWN C;  1MND A;  1BI3 A;  1QCF A;  3EH2 A;  1F1B B;  4IKF A;  3M56 A;  4M75 E;  1XQH A;  1XOV A;  1N27 A;  3OBW A;  4IUR A;  4ZTF A;  2FZC B;  3Q1J A;  3O8V A;  3REB B;  1IGU A;  1EX4 A;  5GAN d;  4C8Q B;  2RK1 A;  4M77 B;  1AWX A;  4KUD K;  2QQB A;  2WSF E;  2KI7 A;  4JJC A;  2M0Y A;  4FU6 A;  1G3S A;  3NGP A;  2LZ6 B;  2HKN A;  1KQS S;  4ZGD B;  1KC8 C;  3CCS A;  2HQX A;  2XMF A;  4JLI A;  5CVI A;  1S72 Q;  2A28 A;  2DZ9 A;  3G7Z A;  3I5R A;  2QA4 T;  4JS4 A;  5KYY B;  2PTK A;  3EG2 A;  1X2Q A;  4M7A E;  2JVV A;  4QW2 A;  2QXF A;  1WXB A;  3OS5 A;  1RLP C;  1YHQ Q;  1M90 R;  1G8X A;  1WFW A;  1U1T A;  1PC0 A;  3QXE B;  4C8Q D;  3ZL7 C;  3MEV A;  2EQU A;  3A1P A;  2QQ9 A;  2RJF A;  1KFZ A;  4PJO G;  1YIT Q;  2QEX A;  3X24 B;  2COW A;  4RTT A;  3G71 A;  2RHZ A;  2XG8 D;  4J9H A;  1UUE A;  4ESR A;  1QP3 A;  1UTI A;  3JB9 I;  1WQ7 A;  3FLG A;  2PU9 B;  1RUW A;  2VB6 A;  3CD6 A;  1U1S A;  2JMA A;  1QKX A;  2KK4 A;  3BFM A;  3JB9 F;  2E3H A;  1WHH A;  2V26 A;  1WZO A;  5CKH A;  3HRS A;  4QQ6 A;  4Y92 A;  4PLL A;  3QKJ A;  2E5K A;  4HCB A;  1XNI A;  1GFC A;  3RR6 A;  4A4E A;  1KD1 R;  4JRI A;  5FRM A;  5GAN 7;  3CCR A;  4XU3 A;  4A4F A;  5IHN A;  4R56 A;  1RAC B;  5GMK i;  3X26 B;  3CCU Q;  1FMK A;  4LD9 K;  2CGH A;  2BKD N;  4Z02 A;  4CI0 C;  1PCX A;  1YIJ T;  1M5Q 1;  2GTJ A;  3LLR A;  4XU0 A;  3QII A;  3L2U A;  1KHC A;  2E70 A;  1VQ8 T;  4BI4 A;  2DBM A;  2JXB A;  5KE3 A;  4J5Y A;  2DK3 A;  2M9U A;  2EFI A;  4PFZ A;  1X6O A;  3CCQ Q;  4F17 A;  2QGF B;  2ENM A;  3L42 A;  1ACM B;  1YJN Q;  1H3Z A;  3ASK A;  1KD1 U;  5FWC A;  2CP6 A;  2K2M A;  4ORZ A;  5KYX B;  4LDX A;  3QZ5 B;  3QHS A;  1YJW A;  3G1J A;  4M7A B;  1PM3 A;  3G4S A;  4M7A C;  4A4H A;  3QSU A;  2FEI A;  3PGG A;  4FW1 A;  4K11 A;  3X25 B;  1G2B A;  1BI2 A;  1Z9Q A;  2RHY A;  2LVM A;  4BE2 A;  5IXF A;  4PFP A;  2XDB A;  1OYX A;  3ZEH A;  1NZ9 A;  2XK0 A;  5FWB A;  3OA6 A;  3HSB A;  1NM7 A;  2R5A A;  3PMT A;  4NL3 A;  3HTR A;  5GMK h;  2ED1 A;  2X3X D;  3REA B;  1YN8 A;  4C0F A;  1AEY A;  1D1B A;  4EMK B;  1NE8 A;  1ZQ1 A;  2YRC A;  3GLX A;  1W2B S;  3M0R A;  3OYL A;  1YCY A;  3OYG A;  3NFC A;  1GCQ C;  3ZFJ A;  3VYH B;  5L23 A;  3JB9 G;  4F7U B;  2DXU A;  3BDL A;  1RAF B;  1OX8 A;  5LJ5 g;  2ESW A;  1ZX6 A;  2EBP A;  1YJ9 A;  2EWN A;  4ZGJ B;  2O88 A;  1YIT T;  3RES A;  3GOX A;  1N6A A;  2DKG A;  2MOX A;  1JB0 E;  3MJX A;  3HRU A;  1OEB A;  1ZHI A;  2HZY A;  4YTL A;  1UE9 A;  2JW4 A;  2GFU A;  4DBQ A;  1QQJ A;  1VQ6 A;  1UJY A;  1G3Y A;  1OZ3 A;  2PNI A;  4KBM B;  1PRL C;  5HK0 A;  4D8K A;  4MDW A;  3JSC A;  1K0S A;  1AHJ B;  1PD0 A;  1TUC A;  1VQO A;  4CRI A;  1TXQ A;  1DJ7 B;  2WAC A;  1JEG A;  5LL6 S;  2LCL A;  5IHI A;  2KGT A;  4M75 A;  4PL6 A;  5HK3 A;  4KT0 E;  1R0C B;  5I2M A;  2D0Q B;  4WTO B;  1MMD A;  1VOM A;  2BIV A;  1CKA A;  2J6O A;  2QK0 A;  2JN0 A;  5FU7 B;  4Y91 A;  5IH2 A;  2FL7 A;  1V1C A;  1UEB A;  2EKO A;  1NYF A;  2YT6 A;  4ZTJ A;  3VUZ A;  2DIG A;  5C0M A;  3HP9 A;  1Q81 R;  4NS5 A;  1Q86 U;  1X75 C;  4PLI A;  4PJJ A;  2D9T A;  1J3T A;  4XTZ A;  3OYY A;  4C8Q C;  4PJO E;  3CCS Q;  2ZPE B;  3PE0 A;  4HVW A;  4L5G A;  4E6R A;  3S3O A;  2V8J A;  4XU1 A;  2LQN A;  4QVD A;  3I5S A;  2A7Y A;  2NUZ A;  4QQG A;  5DLO A;  3QBY A;  1VQ5 A;  1PG5 B;  2SEM A;  2VWF A;  1B3Q A;  3CCR T;  3CCS T;  2KQW A;  4XTY A;  1VQL T;  2GQV A;  3CCM T;  4OGC A;  2E6Z A;  2LCC A;  1ABQ A;  4ZN1 A;  2YSQ A;  5GAN 5;  3E1S A;  2HSP A;  2A36 A;  2WSE E;  2PVO B;  2XDD A;  9ATC B;  5GMK l;  2MAM A;  3UA7 A;  3GNF B;  2QQS A;  1Y96 A;  2B86 A;  5I22 A;  1E6G A;  2V8I A;  4OMM A;  1AWJ A;  3C94 A;  3TU4 K;  2R5M A;  1QMC A;  5FRO A;  1ABO A;  3PNW C;  1P92 A;  1UG1 A;  1IRE B;  4C0D C;  4OB3 B;  1WX6 A;  4VUB A;  3TRE A;  5A0G A;  1BK2 A;  5LJ3 j;  1M3C A;  1I4K 1;  1K8A R;  4RUG A;  3MCA B;  2BUD A;  2ABL A;  1AWW A;  2QA4 Q;  1BIA A;  2K57 A;  3EG0 A;  5FW9 A;  4MDX A;  1T0H A;  3M59 A;  3CMA A;  4MZT A;  2CH4 A;  5GAM j;  2RI2 A;  1WHM A;  5A0L A;  3J80 E;  2FVU A;  1K76 A;  1K9M R;  1NLP C;  1AOJ A;  2B8A A;  5GAM h;  1Q95 G;  2LC4 A;  4HXJ A;  2E12 A;  4OB0 B;  1NJI C;  3CBO A;  4M77 D;  1K9M U;  4PJO A;  2LT4 A;  2OTJ Q;  3VKI A;  2DLP A;  5LJ3 h;  4C92 G;  2ATC B;  2V8K A;  3OW2 A;  1V29 B;  4OVA A;  4BDY A;  4FSX A;  2O4X A;  1VIE A;  2YLC A;  4HVU A;  4QVZ A;  2RJE A;  3CC4 T;  4HCC A;  2LX7 A;  2FPF A;  1M90 U;  5CKF A;  3M53 A;  1U06 A;  2EPD A;  3VV0 A;  2COY A;  2KE9 A;  4HVV A;  1JJ2 P;  3FJ5 A;  2OTL T;  2F2W A;  1D0X A;  3CPW P;  3CCQ T;  3UF4 A;  4LE9 A;  4E2F B;  3R6O A;  2ZPI B;  4M75 D;  2DM1 A;  3G71 T;  1B34 A;  2DL8 A;  1OU9 A;  4EMK C;  1YBY A;  2KT1 A;  1VQK A;  1Y7X A;  2OI3 A;  1VQN A;  1SHG A;  2LTO A;  3VU3 C;  1ZA2 B;  3G4S T;  1O9S A;  4OP0 A;  3TCJ A;  1TH7 A;  4M77 A;  1RAB B;  2LCS A;  1WJQ A;  5DM7 R;  2EJG A;  3V7C A;  1IO6 A;  2FRY A;  1SF9 A;  1Q81 U;  1SG5 A;  3JCM c;  3RDV A;  1HK9 A;  1HXD A;  1MMG A;  5GAN j;  2K3B A;  2EJ9 A;  1VQ7 T;  2HQH A;  4FT2 A;  1RAD B;  1SRM A;  3KFV A;  5GMK m;  1Y57 A;  5GAO l;  3DLM A;  2HDA A;  5DY9 A;  3OMC A;  1PKS A;  4QVC A;  1R77 A;  1WXT A;  2LT1 A;  2HNI A;  4J7I A;  1Q7Y U;  1KC8 R;  4WCI A;  3CC4 A;  2X51 A;  3HL8 A;  1RAG B;  1VA7 A;  4KUI A;  4CC3 A;  2Y90 A;  2O9V A;  3GP8 A;  4FCY A;  2ED0 A;  4DQ2 A;  4E7L A;  3CCJ Q;  5KCO A;  3QUI A;  3JCM J;  1KJW A;  2E64 A;  3P8B B;  3RKY A;  1FX7 A;  3OYE A;  3GIB A;  1WNL A;  3S3M A;  1PSF A;  2JZ2 A;  1YIT A;  4OB2 B;  1VQK Q;  1I1J A;  1X2K A;  2D8H A;  5HCK A;  4JRP A;  2K3Y A;  4JJB A;  3MP6 A;  4C8Q A;  1MHN A;  2KBT A;  3SWN A;  1VQL Q;  4ANJ A;  1LVK A;  3TQ7 P;  2E1H A;  3JRZ A;  3JCM d;  2M16 A;  3CXC P;  2RPN A;  2IVW A;  5IHK A;  2VVK A;  1H3H A;  4M77 E;  1RAH B;  4E7H A;  3EG9 B;  2A3L A;  1BKB A;  3EFO B;  2L3Q A;  5GAN h;  2BZY A;  1WHK A;  2H3E B;  2JJ9 A;  2RB6 A;  4M78 B;  2DEU A;  5EG2 A;  2VYT A;  1N8R U;  2QDY B;  2RMO A;  3FJP A;  1UGR B;  2DZC A;  2EAY A;  2KNB B;  6AT1 B;  3H41 A;  3CBP A;  4J9I A;  1NJI U;  2EIF A;  3UPU A;  3H0F A;  2C0T A;  2VGM A;  1K4U S;  3CCL Q;  1ZUU A;  2JM9 A;  3S3N A;  4BE0 A;  4BY6 B;  3QDF A;  1M1F A;  4PJO D;  2MK5 A;  4LD6 A;  4M77 C;  2RHU A;  1NPR A;  4FW2 A;  2RNA A;  4RTZ A;  1K1Z A;  4EPC A;  3F70 A;  2WSC E;  3GF5 A;  2LQ8 A;  2DJZ A;  1QCO A;  5KH6 A;  3L2W A;  4ZN3 A;  5AYF A;  4B9W A;  2O2O A;  2NYS A;  1KSW A;  5LJ5 h;  3JCM e;  1LCK A;  2KYB A;  2M0O A;  4PFO A;  2E6N A;  1VQ7 Q;  3JB9 D;  2KRM A;  2E4H A;  3CCJ A;  3U23 A;  1ARK A;  1VQP Q;  1VYU A;  2EYW A;  3MKD A;  1SHF A;  1Q86 R;  1Q86 C;  3EFR A;  3RKW A;  1E6H A;  2KR3 A;  2MI6 A;  1Q7Y R;  5GAM d;  1LOJ A;  2CSI A;  4AFZ C;  2LP5 A;  1VQM A;  4OMP A;  3I35 A;  2EGC A;  4II1 A;  3L2R A;  3QYH B;  2QTV A;  2L3S A;  4C0D B;  4FYX B;  1BYM A;  2QA4 A;  4N0A C;  4ELY C;  3X20 B;  1VQ6 Q;  4ME7 A;  1N8R R;  3EG3 A;  2DEQ A;  1TSF A;  5LJ3 d;  3LGF A;  1UJ0 A;  2J05 A;  1WJR A;  4LDW A;  4Y28 E;  4Z89 A;  3OYI A;  4M7A A;  3OQ5 A;  1N9S A;  1VIF A;  1JBM A;  2VGN A;  5KYU B;  3P8D A;  2JMC A;  2RHI A;  4F7U F;  3ULR B;  2RN8 A;  2VXF A;  1SKU B;  1NPP A;  1JXO A;  1FYN A;  1UB4 A;  1ZBJ A;  1K73 C;  1VQ6 T;  1I81 A;  2LQK A; 
#chains in the Genus database with same CATH homology
 2EKO A;  5GAN 4;  3JCM V;  4HT8 A;  2EYQ A;  2LX9 A;  3H8Z A;  3JCM W;  3TEE A;  2DXC A;  3L2Q A;  2CZ0 B;  4PKC C;  2K4Y A;  5CIU A;  3KBG A;  3V8L A;  4ZTJ A;  3QG1 A;  1G3T A;  3VUZ A;  2DIG A;  4XK8 E;  4N4H A;  3PIO A;  3OS0 A;  3OW2 S;  5C0M A;  4IUQ A;  3J81 E;  3RER A;  3HP9 A;  3CD6 T;  3QJY A;  3QDR B;  3MO8 A;  5CO7 A;  1K8A C;  2DXB A;  4NS5 A;  5I2S A;  2HBP A;  3OYM A;  1Q86 U;  2O01 E;  2PUO B;  1LNX A;  1X75 C;  2CZ6 B;  4PLI A;  4ELZ C;  5CQY A;  2D9T A;  1JJ2 A;  4XTZ A;  3OYY A;  4C8Q C;  5GAN f;  4E7K A;  5FRN A;  4BE1 A;  4PJO B;  4B9X A;  4PJO E;  2X35 A;  4EMK A;  3I55 T;  4OB1 B;  1QVP A;  2ZPE B;  4JLG A;  1FWZ A;  2K2V A;  2RJD A;  2E41 A;  4N0A A;  1W4S A;  4QQD A;  4RCC A;  4L5G A;  4C8Q G;  2K5F A;  3S6W A;  2DPP B;  3WVD B;  1VQK T;  5DLQ E;  3S3O A;  2V8J A;  4XU1 A;  3LWI A;  1YJ9 T;  4QVD A;  3OYC A;  1WGS A;  3OYD A;  1SSF A;  2A7Y A;  4M75 C;  2YRV A;  3JCM b;  4A4G A;  4J6Y A;  4QQG A;  5DLO A;  2M1H A;  3A5Z B;  3JCM P;  3E19 A;  1YI2 A;  5GAN e;  2DTH A;  3QBY A;  4X9D A;  4M7D C;  1VQ5 A;  1Y07 A;  3OS2 A;  2JOY A;  3X28 B;  2VXE A;  3HKS A;  3PIP A;  4M78 G;  2O4X B;  4E47 A;  3CCR T;  3CCS T;  2KQW A;  4M78 E;  1EIF A;  5J3B A;  1RL2 A;  4XTY A;  4A53 A;  2K5I A;  2YHT A;  3CEY A;  4E7I A;  1VQL T;  2GQV A;  3CCM T;  1KC8 U;  3M58 A;  2PVG B;  4OGC A;  5FU6 C;  2E6Z A;  2JUF A;  2LCC A;  3CC2 T;  2FYK A;  2CYZ B;  5CQX A;  1Q82 C;  4ATO A;  5LJ5 j;  4ZN1 A;  3CCU A;  5GAN 5;  2ZPH B;  4MMK A;  4C5E A;  3OYF A;  5FU7 C;  2ZPB B;  3E1S A;  2WSE E;  2PVO B;  5CCA A;  2XDD A;  2EQK A;  2LRQ A;  5GMK l;  2DXT A;  3LYI A;  3QO3 A;  1VQ4 A;  2MAM A;  1WJS A;  3GNF B;  2QQS A;  1Y96 A;  4MZM A;  2D6F A;  2NLU A;  4MML A;  2RHX A;  2KDS A;  2V8I A;  3I55 A;  1VQ4 T;  2CKK A;  3MET A;  1YJN T;  3C94 A;  3JCM Q;  4EMH A;  3EFS A;  2XIC A;  3TU4 K;  3V8K A;  1YJW T;  3QYG B;  5L8R E;  4M7D G;  2R5M A;  3ER0 A;  5GAO n;  5GAO r;  5FRO A;  4L59 A;  2X4X A;  4M75 B;  4UC4 A;  3RUX A;  3A8L B;  3PNW C;  1P92 A;  4C0Z A;  1IRE B;  4C0D C;  4OB3 B;  4VUB A;  3TRE A;  5A0G A;  5LJ3 j;  1RI0 A;  1G5V A;  3RKX A;  5GAN 6;  1I4K 1;  1M4Z A;  4PJO F;  2ZPG B;  3UWN A;  3MCA B;  3CCQ A;  4N4I A;  2BUD A;  2X4W A;  4J7F A;  3RMQ A;  5IT9 E;  2QQA A;  3GNG A;  1M90 C;  4BI8 B;  2KVQ G;  3OSV A;  4C8Q E;  3PFS A;  4PJO C;  3CPW S;  1BIA A;  2K57 A;  4BI3 A;  4C92 B;  2H3J A;  2PUK B;  3WXM B;  2GF7 A;  4MDX A;  3LGL A;  3M59 A;  4JJN K;  4FT4 A;  2X4J A;  3CMA A;  4MZT A;  1D3B B;  4M7A D;  2L5Q A;  2XKO C;  4C92 D;  2R58 A;  5GAM j;  2LNV A;  2RI2 A;  3CCU T;  2PVD B;  4HCZ A;  2RH2 A;  5GAN 3;  1YIJ A;  2EQJ A;  5LJ3 e;  2OTJ A;  5A0L A;  3J80 E;  5KE2 A;  2FVU A;  4X34 A;  2B8A A;  2VV5 A;  5GAM h;  4JS5 A;  1QW1 A;  2I2L A;  1QVF A;  2LC4 A;  2FHD A;  3V8J A;  3BW1 A;  3AHU A;  2E5Q A;  4PNO A;  2E12 A;  4R55 A;  4OB0 B;  3MP1 A;  1YJN A;  5GAN 2;  1NJI C;  3CBO A;  4IUT A;  3LWH A;  2JTM A;  5LJ3 f;  3A8M B;  4M77 D;  4XTW A;  1K9M U;  1JJ2 S;  5GAM e;  4PJO A;  1WPY A;  2LT4 A;  5J26 A;  4DOW A;  4EMG A;  4MZP A;  3VKI A;  5LJ3 h;  4XTX A;  1ZBX A;  1KQ1 A;  2L3R A;  4C92 G;  5HKC A;  2HAX A;  2DAQ A;  1GXI E;  1Y71 A;  2C06 A;  2VUB A;  3C95 A;  3CPW A;  2V8K A;  2DVE A;  3OW2 A;  1V29 B;  4OVA A;  1VQP T;  4XU2 A;  1VUB A;  2F5T X;  4BDY A;  2ZZD A;  3QJ6 A;  4FSX A;  5GAN g;  2O4X A;  2AHJ B;  3OY9 A;  2GCX A;  1VIE A;  4M7D A;  2YLC A;  4D6W A;  4QVZ A;  3CCL T;  4F7U A;  2RJE A;  4BD3 A;  3CCJ T;  3M54 A;  3CC4 T;  3OS1 A;  4HCC A;  4J6W A;  4WF2 A;  3URG A;  3M4Y A;  2KAF A;  3CME A;  1M90 U;  2F5K A;  5CKF A;  2EQM A;  1I8F A;  3C4S A;  3MP8 A;  4N4G A;  3M53 A;  5LJ5 d;  3OYN A;  3GPL A;  2MWP A;  4RG8 A;  3FDR A;  4IUP A;  3VV0 A;  3CCE A;  4ZGE B;  4RMO A;  4OGE A;  4M7A F;  2EJF A;  4FL6 A;  4A54 A;  3QPH A;  3WVE B;  2QEX T;  4M75 F;  2OTL T;  3HFO A;  3FB9 A;  3M5A A;  4OMF B;  4C0G A;  3CCQ T;  2OAU A;  3OSS C;  3HPW A;  4L6V 5;  2KMT A;  3RIR A;  3T9N A;  3CCE T;  4XTV A;  1B34 B;  4M78 D;  3SWN C;  2P0Q A;  5CKD A;  5M9O A;  1BI3 A;  4C5H A;  4HKE A;  3PT9 A;  2ZPI B;  1UGP B;  3QZ9 B;  3R6O A;  3DB3 A;  3M56 A;  4M75 D;  3UDC A;  3G71 T;  1B34 A;  4IKF A;  4M75 E;  1N9R A;  5GAO m;  4F7U G;  1XQH A;  1XOV A;  5GMK j;  1N27 A;  1M8V A;  4JUV A;  3OBW A;  4IUR A;  4ZTF A;  2Y4X A;  4EMK C;  3Q1J A;  1YBY A;  3O8V A;  1VQK A;  1Y7X A;  3L1A A;  3OYK A;  1VQN A;  2ZGW A;  5GAN d;  4C8Q B;  1U8R A;  2RK1 A;  2DD5 A;  5CAI A;  4X9C A;  2RA2 A;  1G3W A;  3HFN A;  4M77 B;  4RKU E;  4KUD K;  2QQB A;  2LTO A;  2WSF E;  3LW5 E;  3VU3 C;  4FU6 A;  4LDV A;  4M78 F;  3I56 T;  3G4S T;  1KG1 A;  1G3S A;  1O9S A;  2QI2 A;  4OP0 A;  3TCJ A;  4TVR A;  1TH7 A;  4M77 A;  4C92 C;  1OI1 A;  3E9G A;  4E7J A;  1WJQ A;  5DM7 R;  1KQS S;  5D6X A;  4ZGD B;  1R8O B;  2E10 A;  2EJG A;  2RM4 A;  3CCS A;  2HQX A;  1KC8 C;  1K73 C;  3V7C A;  4JLI A;  4O6J A;  5CVI A;  4EDU A;  2RI5 A;  2L89 A;  3J7A F;  1Q82 U;  2GFA A;  2DZ9 A;  3G7Z A;  2QA4 T;  1BI0 A;  3CME T;  4JS4 A;  1VQ9 T;  1VQP A;  4M78 A;  1Q81 U;  1OZ2 A;  1XTD A;  3LH0 A;  2Y4Y A;  2XU8 A;  2HD0 A;  3JCM c;  3MEU A;  1VQ8 A;  3FRN A;  4M7A E;  2JVV A;  4QW2 A;  1HK9 A;  1HXD A;  1Q81 C;  4M77 G;  3JCM X;  1KHI A;  2DTI A;  2QXF A;  5GAN j;  3OMG A;  3MEW A;  3OS5 A;  1QP2 A;  1K8A U;  2EJ9 A;  1VQ7 T;  3CXC S;  3NTH A;  5D6W A;  1U1T A;  3QXE B;  4P5N A;  4C8Q D;  4FT2 A;  4LDU A;  4XTU A;  3CCL A;  3A8H B;  3MEV A;  1H64 1;  1UGS B;  2EQU A;  5GMK m;  2R57 A;  5I21 A;  3OYB A;  1KQS A;  1QVG A;  5GAO l;  3DLM A;  3V7S A;  4DA4 A;  5DY9 A;  4BDZ A;  2QQ9 A;  4C92 F;  2RJF A;  3VJP A;  3RMS A;  1VQM T;  3OMC A;  4PJO G;  4QVC A;  2QEX A;  2OTL A;  3X24 B;  2LT1 A;  3G71 A;  2HNI A;  1VQN T;  3FEO A;  3PMI A;  4KUL A;  2OTJ T;  4J7I A;  2RHZ A;  4C8Q F;  4F7U E;  1Q7Y U;  1QVF S;  2XG8 D;  3CCV A;  3CC4 A;  2JNG A;  3L2Z A;  4RCB A;  3HL8 A;  1QP3 A;  1Q7Y C;  3PTA A;  4XQ3 A;  4A4K A;  5A0D A;  2QQR A;  2DD4 A;  3VUB A;  3G6E T;  3JB9 I;  3C12 A;  1WQ7 A;  2K3X A;  4KUI A;  3FLG A;  2PU9 B;  3FC3 A;  2Y90 A;  2DIQ A;  3GP8 A;  3CD6 A;  4C92 E;  1U1S A;  3OBY A;  2F69 A;  4NOY A;  2KK4 A;  4DQ2 A;  3BFM A;  3JB9 F;  2P0P A;  2XI9 A;  4E7L A;  4M7D F;  1UGQ B;  2JTF A;  5KCO A;  3QUI A;  4M77 F;  5KCH A;  4O5V A;  3JCM J;  2E64 A;  3P8B B;  1FX7 A;  3HRS A;  5CKH A;  3RKY A;  3OYE A;  4QQ6 A;  3E9F A;  3NTI A;  1WNL A;  3GIB A;  3BDU A;  4XAX B;  3S3M A;  1PSF A;  1VQO T;  4PLL A;  2JZ2 A;  1YIT A;  1K73 U;  3QKJ A;  3SFM A;  4OB2 B;  3HHT B;  4HCB A;  3H6Z A;  1XNI A;  4A4E A;  5LJ5 f;  4JRI A;  5FRM A;  4C5I A;  5GAN 7;  5GAO q;  4JRP A;  2FB7 A;  3CCR A;  3ZBD A;  3CMA T;  3SWN B;  4XU3 A;  4A4F A;  3CPF A;  2K3Y A;  3JCM f;  3OB9 A;  1M1K U;  4R56 A;  2MMP A;  5GAM g;  3MP6 A;  4BUG A;  3CBM A;  3LX7 A;  4C8Q A;  1O75 A;  5GMK i;  1MHN A;  3SWN A;  1LJO A;  2MF2 A;  3X26 B;  2RK2 A;  4DOV A;  3N5B B;  1W2B A;  2CGH A;  4LD9 K;  4V2S A;  2BKD N;  4OF1 A;  2E1H A;  3JRZ A;  3JCM d;  5A2Q E;  4Z02 A;  2M16 A;  3CC7 A;  3JB9 J;  4CI0 C;  3SDZ A;  1YIJ T;  5CKB A;  1M5Q 1;  2CZ7 B;  2XDP A;  3LLR A;  4J8O A;  4XU0 A;  4FM4 B;  3QII A;  3L2U A;  1D3B A;  2E65 A;  2IVW A;  1KHC A;  2E70 A;  4FIB A;  5C6S A;  4M77 E;  5LJ3 g;  3M9Q A;  1VQ8 T;  4E7H A;  4BI4 A;  2A3L A;  2G3R A;  4LDY A;  1BKB A;  2DK3 A;  4J5Y A;  2M9U A;  5KE3 A;  2EFI A;  3G6E A;  2XD0 A;  1KD1 C;  4M7D E;  1X6O A;  5GAN h;  4Q5W A;  1N8R C;  3L42 A;  1H3Z A;  4IUV A;  3CC7 T;  4BB7 A;  3ASK A;  2RB6 A;  1KD1 U;  4M78 B;  2IG0 A;  4HT9 A;  5EG2 A;  2VYT A;  1N8R U;  4LDX A;  2QDY B;  3QZ5 B;  3QHS A;  1YJW A;  3FIF A;  4M7A B;  3FJP A;  1UGR B;  2DZC A;  3G4S A;  4M7A C;  2EAY A;  4A4H A;  5D6Y A;  3QSU A;  3CBP A;  3SD4 A;  1NJI U;  3OYJ A;  2EIF A;  3UPU A;  3BY7 A;  3PGG A;  2ZCF B;  5FU6 B;  2VGM A;  4JRQ A;  1VQ5 T;  5HY6 A;  3S3N A;  3X25 B;  3CCV T;  1BI2 A;  1Y96 B;  4BY6 B;  3DB4 A;  2CS7 A;  4BE0 A;  2RHY A;  1M1F A;  1QVG S;  2LVM A;  4BE2 A;  4PJO D;  1VQ7 A;  2XDB A;  4LD6 A;  1OYX A;  2P0K A;  3ZEH A;  4M7D B;  1JRI A;  4M77 C;  1NZ9 A;  2DTO A;  2XK0 A;  3INZ A;  1M1K C;  3OA6 A;  1I5L A;  2RHU A;  2DO3 A;  3M57 A;  1NPR A;  4RG2 A;  3HSB A;  2L8D A;  2YLB A;  2R5A A;  3PMT A;  4NL3 A;  2X4Y A;  5GMK h;  4EPC A;  3F70 A;  2KY9 A;  2WSC E;  3GF5 A;  2LQ8 A;  1S72 T;  1YI2 T;  2DJZ A;  4BAC A;  4C0F A;  3SB2 A;  1WQW A;  5KH6 A;  3OYH A;  3L2W A;  4EMK B;  5IAY A;  1NE8 A;  1ZQ1 A;  2CZ1 B;  3GLX A;  3VYG A;  4C92 A;  4ZN3 A;  1W2B S;  2PQW A;  2RO0 A;  5AYF A;  4B9W A;  3OYL A;  1YCY A;  3OYG A;  5LJ5 h;  3JCM e;  3JAM E;  2M0O A;  3NFC A;  4M7A G;  3ZFJ A;  3VYH B;  4GLK A;  3JB9 G;  4F7U B;  5CK9 A;  2E6N A;  2DXU A;  2KSS A;  3BDL A;  3JB9 D;  1YHQ T;  3L2V A;  4M7D D;  3CCM A;  3KUF A;  4M75 G;  1IZ6 A;  4BY6 C;  5LJ5 g;  3CCJ A;  1KQ2 A;  3CC2 A;  1YJ9 A;  2LDM A;  2EWN A;  3DKM A;  4GY5 A;  4ZGJ B;  2RJC A;  1Q86 C;  3EFR A;  3RKW A;  4IUU A;  5IN1 A;  3RES A;  1YIT T;  4HA8 A;  2MI6 A;  1M1G A;  3GOX A;  1N6A A;  2DKG A;  3A8O B;  5GAM d;  5GAN 8;  3I56 A;  1JB0 E;  2HQE A;  3OYA A;  3HRU A;  1LOJ A;  2RI3 A;  3HRT A;  4JRK A;  1ZHI A;  3M4G A;  3P8H A;  3KXT A;  1K9M C;  4J83 A;  4YTL A;  1BIB A;  5CR2 A;  1VQM A;  3JCM g;  4II1 A;  3EAE A;  2GFU A;  3L2R A;  5GAM f;  4J6X A;  1VQ6 A;  3QYH B;  4C5G A;  1G3Y A;  1FXX A;  4C0D B;  3DLL A;  1OZ3 A;  3JB9 H;  1BYM A;  1S72 A;  4KBM B;  2QA4 A;  4N0A C;  1VQ9 A;  4ELY C;  3X20 B;  5HK0 A;  1MGQ A;  4ME7 A;  3JSC A;  4MDW A;  2XHC A;  2DEQ A;  3MEA A;  1AHJ B;  1PSE A;  5LJ3 d;  1VQO A;  4CRI A;  3LGF A;  1DJ7 B;  2WAC A;  2ZPF B;  1WJR A;  4LDW A;  2LCL A;  5LL6 S;  3JCM h;  5LJ5 e;  2K5L A;  4Y28 E;  3A8G B;  4M75 A;  1BI1 A;  2RD1 A;  3ME9 A;  4PL6 A;  5HK3 A;  4KT0 E;  3OYI A;  4M7A A;  5I2M A;  3V7R A;  1VQL A;  3OQ5 A;  2D0Q B;  1YHQ A;  1N9S A;  1VIF A;  5CKE A;  1JBM A;  2P4T A;  2BIV A;  2VGN A;  4JDS A;  3P8D A;  4M78 C;  5GAO p;  1M9S A;  2RHI A;  3MHX A;  5J39 A;  5FLX E;  4F7U F;  2JN0 A;  2VXF A;  4NL2 A;  1X01 A;  5FU7 B;  2MWO A;  1NPP A;  4Y91 A;  3M55 A;  2QTX A;  3NTK A;  3UT1 A;  3CXC A;  1UB4 A;  2VC8 A;  2FL7 A;  5GMK e;  1VQ6 T;  1I81 A;  2XID A;  1UEB A;  2LQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...