2RHZA

Crystal structure of the 3-mbt repeats from human l3mbtl1 with d355n point mutation
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
315
structure length
313
Chain Sequence
b'SWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVNRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
molecule tags Transcription
source organism Homo sapiens
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
total genus 72
structure length 313
sequence length 315
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhzA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhzA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhzA03
3QBYA 4E7KA 2DIGA 1WJRA 1H3ZA 3META 5D6XA 3OYNA 3LGFA 2L89A 2IG0A 5M9OA 3O8VA 3GOXA 4A4EA 2RHXA 3P8DA 3OS1A 3OY9A 2EQJA 5IAYA 5FRNA 4E7LA 3ME9A 3QJ6A 4NS5A 3UWNA 4ZTFA 4IKFA 2QQRA 2EFIA 3NTHA 4C5HA 2XK0A 4PLIA 3OYIA 2HQXA 2LTOA 1WGSA 2WACA 4L59A 3MO8A 3OMCA 3L42A 3MEVA 3E9GA 3L2WA 5FRMA 3PMTA 2BUDA 3DLMA 3DB4A 4QQ6A 3F70A 3OYFA 3LX7A 3EAEA 1N27A 3FLGA 3S6WA 1G5VA 4A4FA 4BE0A 3FEOA 5J26A 1WJSA 2P0KA 3NTIA 3Q1JA 4BDYA 3DB3A 3KUFA 5D6WA 3OYAA 3PNWC 2L8DA 5KE2A 3L2VA 3SD4A 4IUPA 4IUVA 4BE2A 4IUQA 2K3YA 1OZ3A 4C5IA 4BE1A 3FDRA 3OYLA 3OYCA 2RHIA 3P8HA 3PMIA 4IUUA 4BDZA 4HCZA 2MWOA 5KCHA 2RHUA 2EQKA 3S3OA 5KH6A 3MEAA 3ASKA 1WJQA 2O4XA 4LD6A 2RO0A 5D6YA 4EDUA 2JTFA 2PQWA 2VYTA 4E7JA 5C0MA 2RI3A 5C6SA 3CEYA 3L2QA 3LYIA 4E7IA 4X34A 5J39A 5KCOA 4CRIA 2QQSA 4QVZA 1SSFA 3LH0A 3OA6A 4C5GA 2RJCA 3M9QA 3OB9A 3E9FA 2RJDA 3OS0A 4OVAA 3H6ZA 4B9WA 2GF7A 2O4XB 4IURA 2X4YA 4E7HA 3BDLA 3OQ5A 4QQDA 1XNIA 4PLLA 4C5EA 4A4GA 4Q5WA 2F5KA 1KHCA 2G3RA 4A4HA 3QIIA 4N4IA 2R5AA 3L2UA 2DIQA 3MP1A 3OYDA 3L2RA 2EQMA 4QQGA 2YRVA 1RI0A 2RI2A 2RHYA 3LGLA 3OYKA 2HQEA 2RJFA 3OYMA 4BACA 2R5MA 2GFAA 2R58A 4GY5A 2B8AA 3ZEHA 3QKJA 4PL6A 3S3NA 2M1HA 3S3MA 3C4SA 2BKDN 5CIUA 2X4XA 2FHDA 4ZTJA 3OYGA 2M16A 4QW2A 4BD3A 2EKOA 2RJEA 5FROA 2LVMA 2R57A 4FU6A 2L3RA 2RHZA 2XDPA 2JZ2A 2LCCA 2EQUA 2M0OA 4II1A 4RG2A 4IUTA 2E5QA 3OS2A 3PFSA 2MWPA 3MEWA 2D9TA 2GFUA 1MHNA 3MEUA 3OMGA 3UT1A 3OYEA 2E6NA 2CKKA 1OI1A 1OZ2A 4UC4A 3OYJA 2NLUA 1OYXA 2X4WA 3MP8A 3NTKA 4FL6A 4N4HA 4B9XA 3OYBA 4Z02A 2X35A 2LRQA 3LLRA 4N4GA 5KE3A 2BIVA 2RI5A 2K3XA 3MP6A 3FC3A 3OYHA 2DAQA 5IN1A 2LDMA 3H8ZA
chains in the Genus database with same CATH superfamily
1FYNA 3QBYA 2NUPA 2DIGA 5GAN3 2HKQB 4M77E 2VUBA 2IG0A 1VQPT 1BB9A 1K8AR 1NLPC 5I2MA 4ZTFA 2PTKA 4M75E 3MEVA 4Z89A 4OMQA 2KBTA 3DB4A 3L1AA 4F7UA 1M3AA 5KYXB 3I55T 3LX7A 2OTJA 2NWMA 3EGXB 1M1FA 4C92F 4O6JA 2P4RA 2W10A 2CGHA 1WNLA 1YJ9A 2X9HA 3SFMA 1G3WA 3CXCS 3G71A 1OZ3A 3JB9I 4GLKA 4LDXA 5LJ5f 1WX6A 2DXUA 5GAMe 1UB4A 2O4XA 1C0MA 2PQWA 5HK0A 2XHCA 2HZYA 1QKXA 2HL3A 2O88A 4MMKA 3EGUA 8AT1B 1NG2A 4HVVA 2K4YA 2AZVA 1D09B 5FU6B 1LJOA 1PM3A 4C5EA 3CCQT 1B7TA 4JZ3A 2LJ0A 2D0QB 3PTAA 2CP3A 2V1RA 3OYDA 3L2RA 5GANj 2DXTA 4BACA 1YHQA 3G6EA 5D7UA 5A0DA 2XD0A 2V8KA 1ZSZA 4BD3A 2OI3A 4KGZB 3M59A 1QVPA 2XDPA 1SPKA 4Z8AA 3VS1A 2O2OA 3MEUA 1BU1A 1QVFP 3BDUA 3KBGA 3CCET 2BTTA 2P84A 1BI3A 4FSSA 2I0NA 2MI6A 2A08A 3BW1A 4OMNA 3VS6A 4J9DA 1I5OB 5CK9A 2QDLA 2OAUA 2EGAA 3NHNA 2ABLA 4PJNA 3P8DA 3BFMA 3J7AF 3H9NA 4C92C 2K57A 1FWZA 2YXYA 3QYHB 2GTJA 5L23A 1OQKA 4PK4A 3CC4Q 1M1KU 3FIFA 3E19A 5GAN6 3REAB 5EG2A 1YIJQ 4EIKA 5LJ3f 4AFQC 3OYAA 5D6WA 1H92A 4IUPA 3CCUT 1GBRA 2K5IA 1VQ4Q 2IVWA 4M77F 4RTWA 5CVIA 2QK0A 4J9HA 3TREA 1B07A 5DLQE 4LD6A 3V8KA 4CI0C 1IO6A 1AVZC 1NYGA 4CRIA 3LH0A 1K8AC 3OA6A 3I56A 5GAOr 1NJIU 4B9WA 1Y0MA 2DBKA 2H3EB 1XNIA 3G1JA 2AKLA 2CZ6B 4CC3A 1JU5C 5GAMj 2R5AA 2DIQA 1VIEA 5LJ5g 2ZPGB 3EHQA 2KMTA 2HQEA 5CQYA 5CQXA 3OYYA 1K73C 2YT6A 4M78B 2JS2A 2XDDA 4M7AG 2M16A 4ANJA 2EYXA 4FU6A 4M7DA 4LDVA 1KJWA 1WLPB 2DFUA 1MHNA 3CXCP 1LPLA 2PVDB 4UC4A 4ESRA 3OYJA 1D0YA 2NLUA 3RNJA 4MMLA 4B9XA 1WHGA 1JXMA 2LRQA 3EFSA 2DL3A 4JJNK 1VQ8T 3FC3A 3CMET 1ZQ1A 5C6SA 3OYHA 2J05A 3QO3A 2RQUA 2OX7A 3EGDA 1V76A 4AFZC 4J6XA 1U06A 4MZTA 2RHXA 2VGNA 4OMFB 1ZUUA 4O5VA 1E6HA 2EYYA 2PZ1A 4OMPA 4XQ3A 2RA2A 4RMOA 5FRNA 3VYHB 1WA7A 4M75D 3CMEQ 4PLIA 2NYSA 4C92E 5IXFA 1Q81U 3E9GA 2HBPA 2D0NA 4KGXB 1MUZA 1TUCA 4JS5A 4X9CA 1G8XA 2COZA 4XAXB 3HFNA 2CT4A 4HVUA 4Y92A 4KBMB 4HA8A 4BE2A 1N6AA 2V8JA 1PD0A 2XU8A 2RHUA 4LXCA 2VV5A 4FW2A 3HRTA 3QUIA 2ECZA 3IQLA 3OW2S 2HD0A 2DZ9A 2HMAA 2LT1A 4FT4A 4LNPA 3EGXA 5KYXA 1NJIR 1VQ5T 3CC2T 4ZGDB 2QASA 3LH5A 3URGA 1QVFA 2E10A 4Q5WA 1YJWA 3M57A 1E6GA 2E6ZA 2EQMA 5IH2A 1JO8A 1BI0A 3A8OB 1R77A 1I07A 2DL5A 1OV3A 2BKDN 4J9BA 2KRMA 2JN0A 2NUPB 1BI2A 1WHKA 1CKAA 2E70A 4ELYC 2AZSA 1W70A 3FJPA 5LJ3h 4DBHA 4J8OA 2E5QA 3RUXA 2CP5A 2E6NA 2MYSA 1QWFA 5GMKl 3CCQQ 1W2BP 3CCUA 1M8MA 2EGCA 4MZPA 2JS0A 3LWHA 2KYMA 1SKUB 3HP9A 3V7SA 3DLLA 2DE0X 1X2QA 3UPUA 4DEYA 4A54A 3LGFA 4C8QF 5GANf 1BIBA 5KYWB 3A8MB 1YWPA 3THKA 4C5HA 3DKMA 1W4SA 5CKEA 1VQ7Q 1D0XA 1Q95G 1R0BG 1KQSA 1CKBA 3A5ZB 4RTUA 4BE0A 1GFDA 3UA6A 4EPCA 3JCMX 4DBRA 2FRYA 4NL3A 1PG5B 3PNWC 1YNZA 1S72T 2J6KA 3QDFA 5GAN2 4M77B 1N9RA 4EMKB 2A7YA 2DF6A 4ZGJB 4XTUA 2F2XA 3L2ZA 1G2BA 2RI3A 4OB2B 1VQLT 1KQSS 1HJDA 2QQSA 1YHQT 1M5Q1 4PKCC 4C5GA 4A4KA 1VQOT 4OVAA 3H6ZA 3CMAQ 2GF7A 4IURA 5GAMf 4M7DE 4NOYA 4R56A 3CCUQ 4QKUA 3CCQA 2HSPA 2DLPA 3SWNC 2YRCA 4RTZA 3MP1A 4LDYA 4OP0A 1RI0A 2FVUA 1PKTA 2AT1B 3OYMA 1K0SA 3R6NA 3S3NA 2IPOB 3NGPA 1HK9A 3VUZA 1KK7A 1Q82C 4XTVA 2DETA 2RQRA 2RHZA 4HCBA 4J5YA 2M0OA 2VGMA 2JXBA 1XTDA 3H0FA 2D9TA 3UT1A 4KGVB 2EPDA 4GBQA 1YJWQ 1VQLA 1MGQA 2CREA 3AHUA 4PJOC 1VQ9T 2EW3A 5J3BA 4F7UE 1KFZA 2X35A 4PJLA 1PC0A 2HL5C 2E1HA 1AOJA 2OTJT 1WJRA 3CBPA 3V7RA 2LQ8A 1UECA 2VASA 2MCNA 2JJ9A 1T0JA 5FWCA 1PD1A 4IKFA 1M2OA 2XK0A 4M7AB 2WACA 4N0AA 3CPWP 2OAWA 4M75G 4CC4B 2CP0A 3HL8A 5I21A 2LQKA 1PRMC 4EMGA 1M9SA 3AT1B 2CP6A 1VQ8Q 4M75F 1TS9A 3ZFJA 2QQ9A 1PWTA 2LJ1A 4M77A 5KYNA 3OW2P 3L2VA 3QHSA 2XMFA 1D1CA 2KROA 5GMKi 3PMIA 1YJNT 2RK1A 4RTTA 4LDWA 4E6RA 2CH4W 1M90R 4WTOB 4RTVA 3CMAA 1W2BS 1LCKA 5DY9A 3I55A 1RAIB 1NEGA 2E4HA 1VQNQ 3M9QA 1K4US 5EC7A 2F2VA 3EHRA 2YDLA 1ZA1B 5KYWA 2K3BA 4MDXA 2CT3A 2CH4A 1HYOA 2QA4T 1P92A 2MIOA 3EG1A 1K76A 2Y90A 4NL2A 1WHHA 3EG3A 3JRZA 2OTLA 1NLOC 4M7AF 2R5MA 3QJYA 2MMPA 3S3MA 2X4XA 3TSZA 1MMNA 3CC2A 3JCMe 2EJFA 4J7IA 5LJ5e 2XIDA 2M51A 1VQ7A 4XK8E 1K9AA 1VA7A 2DL4A 3OYEA 1KD1R 1ZX6A 3QDRB 1YI2T 4F7UG 3TVTA 1Q86U 3RESA 4X9DA 2HEQA 2EJGA 4JRPA 1RUWA 4F7UF 5GANg 4E7KA 2C06A 1RACB 2X3WD 1YITA 2DA9A 3OYNA 2A37A 1I0CA 1PKSA 5M9OA 1EIFA 2M0YA 4ZNXA 1I4K1 3RMQA 2DYIA 2O31A 2LCSA 3ME9A 2OTLT 4PNOA 3OYIA 2QEXQ 2ROTA 3OMCA 5FWBA 2J6OA 2KYBA 2DVEA 3PMTA 1Q7YC 1YJWT 2M9UA 2KT8A 1KD1C 2GQIA 2JM8A 1BK2A 1O75A 2C0IA 5KE2A 4M7DF 3INZA 1WXBA 4FYYB 5FU6C 3EG9B 4ORZA 1YN8A 5LJ3d 2JT4A 3NFCA 1KIKA 4FCYA 2FB7A 1Y07A 2E64A 3SDZA 3SB2A 1VYVA 1VQ7T 2HCKA 5GMKe 5GJWB 3VU3C 5CKDA 1AZEA 4E7ZA 2RM4A 1SSFA 4J6YA 3E9FA 1OX9A 2DYBA 2DZCA 2F2WA 3CCVT 4LUEA 2LNHB 1M3CA 4M7DD 1GCQC 2Y4XA 4TVRA 2EKHA 2G3RA 5IXBA 1Z9QA 1HXDA 3LGLA 2ATCB 1JXOA 3QKJA 5HK3A 5IHKA 4FYVB 4QW2A 2VVKA 3ZL7C 3G6EQ 2LNVA 2LVMA 4II1A 4RG2A 2JZ2A 2LCCA 2EQUA 3PFSA 3TCJA 2SEMA 2X4JA 3CMAT 1VYTA 1Y71A 3PT9A 3CMEA 2CP7A 4JLGA 1JRIA 1OYXA 1Q82R 4PJOA 1IHVA 3JCMc 8ATCB 2YWWA 2RI5A 1X01A 2QGGA 4KRTA 3JCMW 1YCSB 4PJOD 1LVKA 2VXFA 2EWNA 3O8VA 2RB6A 2MPXC 4MDWA 3OY9A 2EQJA 1U8RA 1TUGB 1LOJA 2FPDA 2DKGA 2HQXA 4M78G 2EIFA 1C6VX 2DRMA 4PJOE 3OBWA 2LP5A 3G71Q 3PVLA 1WQ7A 3DLMA 2P0PA 1HD3A 1OPKA 2JVVA 4FYWB 3WXMB 2A36A 1YJ9Q 2GQVA 2A0FB 2LJ3A 2L0AA 4PJJA 1F1BB 1MMGA 3JAME 5DLOA 1G3SA 4RCCA 3TU4K 3RMSA 3VS3A 4DOWA 4IUUA 2E12A 1H641 1D0ZA 1YJ9T 1TH7A 3OBYA 4QVDA 3CCMA 2PUKB 2EYWA 2QQBA 2DXBA 3CQTA 1XJWB 3A98A 3TEEA 1XOVA 4M75C 5GAOl 1QP3A 2DD5A 1ZUKA 2K9GA 5GAN4 2DM1A 3CD6T 1YFNA 2F5KA 2HKNA 2KRNA 1RAFB 1KC8U 3HRSA 3WVEB 1KHIA 2M1HA 2FZGB 4BI4A 5CIUA 4ZTJA 4XTYA 3M55A 4C0DB 3CC4A 3GLXA 2JMCA 2QDYB 2YLCA 2BE7D 2GFUA 4C0ZA 1FX7A 1YBYA 2D6FA 2JM9A 1UDLA 4Z02A 2BE9B 2KDSA 2I2LA 4GLMA 1T3LA 2DD4A 2XI9A 1RAAB 3UATA 4XU3A 1JQQA 5IHNA 1X75C 3H41A 2COWA 1YJNA 2HBWA 3X25B 2KEAA 1VQ9A 1NJIC 4C8QD 3G6ET 5AT1B 3EG0A 1UGQB 3GBQA 2NUZA 1LNXA 1AWOA 3JCMg 3MCAB 1M4ZA 2DXCA 2ROLA 1UUEA 5GAN7 2P0KA 1Y96A 5HCKA 5IHIA 1YHQQ 4C5IA 5FU7C 3M58A 2FPFA 1BCOA 5KCHA 1JJ2S 4DQ2A 1XQHA 1H8KA 2Y4YA 2E5KA 4F7UB 3A8LB 3CEYA 2V1QA 3M56A 4FIBA 2QTXA 4XU1A 2J7IA 2JTMA 2W0ZA 4C92G 3G71T 1E7OA 2PUOB 4CC2A 3CPWA 1PSFA 1D1BA 2K2MA 2DVJA 4D8DA 5GMKm 2X4YA 3EH2A 3JCMf 4Y91A 2ZZDA 2EVRA 1WXTA 1VQKT 4MZMA 5GMKj 3CC7T 1VQ9Q 1JBMA 3JCMQ 3LWIA 2V8IA 4K11A 2GFAA 2IIMA 2G6FX 4KULA 2YUOA 1VQPA 1Y57A 2OTJQ 2P4TA 2ZPBB 3CCJT 2F69A 5CKFA 2CDTA 4EMKA 3MP8A 2O01E 3OSVA 4FL6A 1SSHA 2L3SA 5CKBA 1X6BA 2J06A 4E47A 1ZA2B 2CZ7B 5GANh 3CCRA 3EH1A 1JJ2P 2X51A 3CCJQ 4RTYA 1VQMQ 3CXCA 1G83A 1JEGA 2BZ8A 2DRKA 1UJYA 2QQRA 1OPLA 4M78E 4XTXA 3I5SA 1X6OA 1O9SA 4WF2A 1NEBA 3CCMT 3EAEA 5GAOm 2CP2A 3FEOA 1N9SA 3Q1JA 1YITQ 1R8OB 3FB9A 2A3LA 3JV3A 3EG9A 2LC4A 5HY6A 2KSSA 3CBOA 3VYGA 1VQNT 3FDRA 3C0CA 3CCMQ 2EQKA 2FPEA 3ULRB 3C12A 3ASKA 5D6YA 1A0NB 2JTFA 3LYIA 4IIMA 3VRYA 2BZXA 2F5TX 2HDAA 3REBB 4ME7A 1X6GA 2OTLQ 4XTZA 4FW1A 1TUDA 2AHJB 3HRUA 3GIBA 1IHWA 4FM4B 3PE0A 2YRVA 2RHYA 4HXJA 1YI2Q 2RJFA 1VQNA 2FHDA 3I35A 4D6WA 1FMVA 2LQWA 1OOTA 5GAOn 5CAIA 2CKKA 2QYZA 4KUDK 3M0UA 1VQ5A 1AWXA 1RLPC 3CD6Q 1UGPB 1UE9A 3OYBA 4FSXA 4N4GA 1VQKA 3X26B 3EFOA 4C8QG 2K6DA 2DPPB 1H3ZA 1SG5A 3META 3CCST 3CCVQ 1VQ8A 2ED0A 5KYUA 2D8JA 4A4EA 3QPHA 3VV0A 3GNGA 1AWWA 5ECAA 4JZ4A 2EQIA 5FW9A 4NS5A 3ER0A 1U3OA 2GGRA 1ZBXA 3BE3A 3MHXA 2ZCFB 4OGEA 4C0FA 4J9EA 4QQ6A 4M7DC 4JJCA 2F1LA 1UHFA 3JB9G 4QVCA 6AT1B 2LX7A 2ZPHB 2DJQA 3RKYA 2QA4A 2DX1A 4F16A 4RUGA 1RAEB 1AZGB 3TQ7P 1MNDA 5I22A 1KQ2A 3JSCA 5GAOp 3S3OA 1UEBA 2KAFA 2VB6A 4J9FA 2RD1A 2JMAA 3CCLT 1TXQA 4E7IA 3HFOA 4M77G 2P0QA 3U23A 5CO7A 1U1TA 2DL8A 3WVDB 3UA7A 2O4XB 3BDLA 1YITT 1NZ9A 2D8HA 4A4GA 3EG2A 2DILA 2QEXA 4A4HA 1TU0B 2E3HA 4JDSA 2ED1A 4J9IA 1KQ1A 1GCQA 3QYGB 1JJ2A 4C0DC 4M75B 4F17A 2EGEA 3OSSC 3C4SA 1V29B 1BBZA 1RAHB 2R57A 1WPYA 2KGTA 4JPBW 2AK5A 4ZGEB 1OI1A 3RERA 2X4WA 2DK3A 4BB7A 4N4HA 1VQ6T 3RKWA 2LQNA 4OMMA 2QAZA 1IREB 2K3XA 3ZEHA 2WSCE 4JS4A 2K5LA 1M1KR 3CC2Q 3A8HB 1TOVA 3CCSA 4QT7A 4Z88A 2JOYA 2DEQA 5GAMh 3VJPA 2L89A 4AFUC 4E7SA 1D3BB 1WQWA 1ABQA 4E7LA 2DMOA 4M78D 3RIRA 2LTOA 3M0QA 3NMZC 1ZLMA 1WHLA 4IIOA 1IRXA 1CSKA 3F70A 2RMOA 3M0PA 1QCOA 3S6WA 3ZBDA 2KQWA 5J26A 4BI8B 1MV3A 4XU2A 4M78F 4PJOG 4R55A 1Q7YU 3I55Q 2YSQA 1QW1A 3VRZA 1K9MU 5AYFA 3BY7A 1BI1A 4IUQA 2PU9B 3P8HA 2PNIA 4OMLA 4OGCA 4F14A 4HT8A 2QGFB 1QWEA 4HKEA 1QCNA 5LL6S 2NUTB 1UGVA 1QVGS 1K8AU 2X3XD 1IGQA 4LUDA 3E1SA 2KR3A 2KVQG 3CCEA 4A53A 4PJMA 2CUDA 4BUGA 2JW4A 4OB1B 2B86A 4ZN1A 1S72A 1QMCA 2DTIA 2HSEB 1H3HA 4M7AE 1UJ0A 4QQGA 4OB0B 3V8JA 3JB9J 1TSFA 2M02A 1SHFA 4ATOA 1QQJA 1U5SA 3D7SB 2VKNA 2WSEE 3CCLA 4DBFA 4E2FB 2RF0A 1V1CA 1T0HA 2RJEA 3JB9H 1KC8R 1VOMA 2KRSA 3G7ZA 4XTWA 2QQAA 1G3YA 2ZAEA 2LX9A 7AT1B 2CZ1B 1ABOA 2ENMA 1VQLQ 2QG9B 1WI7A 2DTOA 3KXTA 1ZUYA 3LLRA 1M2VA 2AKKA 1VQOQ 1J3TA 3CPFA 2K79A 3H8ZA 2L3PA 2QXFA 4AFSC 3CCRT 2RQTA 3H0IA 2QEXT 2YRDA 1IZ6A 3HTRA 2DJZA 1BIAA 3UWNA 3NTHA 3SHWA 1UFFA 3MO8A 3JCMh 4DA4A 1AEYA 3X20B 4OB3B 1W1FA 1X69A 3PIOA 2EYQA 4PFZA 5DM7R 1K9MC 4N0AC 1TG0A 4HT9A 1N8RR 4XU0A 1EX4A 2J6FA 1MMAA 3PIPA 2QTVA 1YIJT 1QVFS 2RHIA 3M5AA 4C8QC 1RLQC 3VS4A 3GNFB 1Q81C 2MWOA 4LN2A 5FLXE 3E2UA 1ZBJA 3RBBB 2KNBB 1M2VB 4EDUA 1AHJB 1X43A 2C0TA 2K2VA 1WYXA 2RPNA 1SRLA 3VS2A 4X34A 1Y96B 5KCOA 1KQSP 4C8QB 2RH2A 4PFPA 3QWYA 2RJDA 2H8HA 1NPRA 9ATCB 1Q82U 1WZOA 3EGDB 4PLLA 2FRWA 1B3QA 2E41A 5LJ5d 1GBQA 1I1JA 3JCMd 3VS5A 4GY5A 4PL6A 2ZPFB 3JB9D 4C92B 3OYGA 3SWNB 1VIFA 1KG1A 3G4ST 2VWFA 4DOVA 4M7DB 4CC7A 3P8BB 1B34A 1I81A 1NE8A 2HAXA 4V2SA 3I5RA 4EMKC 2OJ2A 2FL7A 1Q86R 2JUFA 5GANd 1HSQA 3CCEQ 2DEUA 3HPWA 1PNJA 2MAMA 4HVWA 1YIJA 4HCKA 1QVGP 2VXEA 1PCXA 4RKUE 3OS1A 3M4YA 3X28B 5IAYA 5GAN8 2WSFE 1VUBA 2RK2A 4AG2C 4L59A 3J81E 3CPWS 4HCCA 1GFCA 3O5ZA 1PRLC 3OYFA 4JLIA 1WFWA 4PJOF 2ZPIB 4M4ZA 5GJVB 4AMCA 1QVGA 1GRIA 4DBQA 1KD1U 2L8DA 2HQHA 2CUBA 1N5ZA 1X2KA 3OYLA 2XDBA 1VQ4T 3GF5A 4HCZA 4A63B 1AT1B 1OULA 5LJ3e 3GPLA 1SF9A 1RAGB 2C0OA 4E7JA 2XKOC 4VUBA 1SEMA 3CCSQ 1S1NA 2GCXA 2KE9A 4R0KA 3GP8A 2LCLA 1MNEA 1OEBA 2RQWA 3J80E 3OQ5A 3PVQA 2XG8D 3OS5A 4PJOB 2D1XA 1R0CB 4B6MA 3OYKA 4PFOA 1U1SA 2CYZB 3RDVA 3HHTB 2GTOA 2YUNA 4KH0B 4M77D 1EFNA 1RADB 2FO0A 2MWPA 3MEWA 1ZSZB 2ESWA 3N5BB 5KE3A 2DBMA 5D6XA 3SEMA 1ZSGA 1VQMT 1VQOA 5IT9E 4KUIA 4RTXA 1X27A 4JRIA 2K7AA 2H3JA 4J6WA 3PGGA 4M78A 1YCYA 3L2WA 5FRMA 2SRCA 1FMWA 2QA4Q 1M90C 2KK4A 3M4GA 2NUTA 1N27A 4ELZC 4FT2A 2YHTA 4A4FA 1Q86C 3I56Q 1WJSA 2E3IA 3CCLQ 3DB3A 1UG1A 2DTHA 3FJ5A 4IUVA 3TSWA 2K3YA 2YUQA 4BE1A 2DERA 2HNIA 3UF4A 4BDZA 1S72Q 4OF1A 3CC4T 1WJQA 1BCMA 2RO0A 3RKXA 2VYTA 4F04B 1Y7XA 5C0MA 1VQ4A 1ARKA 3CCVA 3JCMP 3JCMV 3L2QA 4JUVA 2QI2A 1IGUA 3JCMJ 1NPPA 2K5FA 2MF2A 1FXXA 3OB9A 3OS0A 3JB9F 1NM7A 2PVOB 1D3BA 4WCIA 5CKHA 4QQDA 3CD6A 1M1KC 1KHCA 4JJDA 3QIIA 3V7CA 2EAYA 4C92D 4LE9A 2LZ6B 2KT1A 2YLBA 1PHTA 1M30A 3A8GB 1QLYA 1QP2A 2R58A 3QWXX 5A0LA 2EKOA 1T3SA 1UHCA 3M54A 5GAMg 1SRMA 2KXCA 3CBMA 1OZ2A 3NTKA 2EBPA 1N8RC 2EYZA 1W6XA 3X24B 4M75A 1WXUA 1NYFA 2FEIA 2VC8A 4J83A 4D8KA 1GXIE 3LW5E 3M0RA 1BKBA 2AIRB 2FYKA 2CSQA 3OW2A 4J7FA 3QJ6A 3NPFA 2EFIA 4BI3A 1IB8A 2JTEA 1D1AA 1I5LA 2EJ9A 5CR2A 3VUBA 1B34B 1YWOA 3VS7A 2FG0A 5HKCA 5I2SA 1G5VA 4C92A 1G3TA 4LD9K 1ZSZC 3HSBA 3KFVA 1TWBA 5FU7B 3MJXA 3RR6A 2O9SA 3A1PA 5KYYA 1MV0B 4OMOA 1VYUA 1M27C 3OYCA 4C8QE 1UGRB 4L6V5 5GANe 4M7AA 1OU9A 1BYMA 2GBQA 1Z9ZA 3MEAA 5LJ5h 1K9MR 1VQMA 2FZKB 3EFRA 3I9QA 1AWJA 3FRNA 3QZ5B 2CSIA 1Q7YR 3CCRQ 5J39A 3V8LA 4M7AD 1ACMB 3QG1A 3QXEB 4BY6B 4J9GA 4E7HA 2L5QA 1UTIA 2ZGWA 3MPUB 1PSEA 5KYUB 1GL5A 1YP5A 3M0SA 5CCAA 4N4IA 2XICA 4X1VA 3EFOB 1UGSB 3M53A 4KT0E 3M0TA 2E65A 3R6OA 1VQPQ 3QZ9B 4LDUA 5FROA 4FYXB 4Y28E 5LJ3j 2L3RA 4IUTA 5A0GA 1N8RU 1FMKA 2MK5A 4J9CA 5LJ5j 4L5GA 1KC8C 1VQ6Q 2YUPA 2FZCB 1M90U 1JB0E 4DEXA 2BIVA 2DO3A 4ZN3A 3MP6A 1KSWA 1NBEB 2RN8A 1IXDA 1M3BA 2DNUA 5LJ3g 3H0HA 1WHMA 1OX8A 1RL2A 1WHJA 2L3QA 2Z0WA 3C95A 1TTHB 2LMJA 3GOXA 1VQKQ 1GCPA 2KXDA 1AD5A 3JCMb 4JRKA 2COYA 3CC7Q 3C94A 5GMKh 1SHGA 1EZZB 1OU8A 2L2PA 1VQ5Q 2KI7A 1K0XA 3VKIA 1WGSA 4P5NA 5GAOq 4YTLA 5GAN5 4AT1B 5L8RE 3L42A 2BUDA 3G4SA 1MMDA 3FLGA 1WDXA 3UDCA 3NTIA 2ZPEB 4BDYA 3KUFA 4RG8A 1K73U 3SD4A 1YI2A 5KYYB 4C0GA 4BY6C 2CS7A 2LT4A 2DL7A 4M7AC 5KH6A 1C1AA 2JNGA 1YJNQ 3VS0A 1RABB 1M8VA 2CZ0B 2RQVA 5GAMd 1I8FA 3HKSA 3SWNA 2RNAA 4QVZA 4AG1C 2O9VA 3I56T 2RJCA 2V26A 4M7DG 3G4SQ 1DJ7B 1QCFA 5A2QE 2A28A 2MOXA 2GNCA 3L2UA 3CC7A 1WIEA 2RI2A 4RCBA 4JRQA 1W2BA 1M1GA 1RI9A 2B8AA 4JJBA 4KH1B 1ZHIA 4C8QA 4M78C 5I11A 3T9NA 1Q81R 3MKDA 4EMHA 3OS2A 2KY9A 2BZYA 3OMGA 4M77C 3QSUA 1K73R 1VQ6A 2PVGB 1QKWA 1K1ZA 2DAQA 3CCJA 2LDMA 5IN1A
chains in the Genus database with same CATH topology
2CZ7B 3HPWA 3QBYA 5GANh 2DIGA 2E1HA 2OTJT 3CCRA 1WJRA 2MAMA 3CBPA 5GAN3 1YIJA 4M77E 2LQ8A 2VUBA 3V7RA 2VXEA 2IG0A 3CXCA 4RKUE 3OS1A 1VQPT 3M4YA 3X28B 5IAYA 5GAN8 5I2MA 4IKFA 4ZTFA 2QQRA 2WSFE 2XK0A 1VUBA 4M7AB 4M78E 4XTXA 2RK2A 2WACA 4N0AA 4L59A 4M75E 3J81E 3CPWS 4M75G 4HCCA 1X6OA 3MEVA 1O9SA 3HL8A 5I21A 3DB4A 3L1AA 4F7UA 3I55T 4WF2A 3OYFA 3LX7A 2LQKA 3EAEA 4JLIA 4PJOF 2ZPIB 3CCMT 4EMGA 5GAOm 1M9SA 1M1FA 3FEOA 1N9SA 4C92F 4M75F 3ZFJA 1QVGA 2QQ9A 4O6JA 3Q1JA 2CGHA 4M77A 1R8OB 1WNLA 3FB9A 2A3LA 1YJ9A 1KD1U 2L8DA 3SFMA 1G3WA 2LC4A 5HY6A 3L2VA 2KSSA 3QHSA 3CXCS 3CBOA 3G71A 3VYGA 1VQNT 1OZ3A 3JB9I 3FDRA 4GLKA 4LDXA 3OYLA 5LJ5f 5GMKi 1VQ4T 2XDBA 3PMIA 3GF5A 4HCZA 2DXUA 1YJNT 2RK1A 2EQKA 4LDWA 5GAMe 3C12A 1UB4A 3ASKA 2O4XA 5LJ3e 3GPLA 5D6YA 3CMAA 2JTFA 2PQWA 5HK0A 4E7JA 2XKOC 1W2BS 2XHCA 4VUBA 3LYIA 5DY9A 2F5TX 3I55A 2GCXA 4MMKA 3GP8A 2LCLA 3M9QA 2K4YA 4ME7A 3J80E 4XTZA 5FU6B 1LJOA 3OQ5A 4MDXA 4C5EA 2XG8D 2AHJB 3HRUA 3CCQT 1P92A 2QA4T 3OS5A 3GIBA 4PJOB 3PTAA 2D0QB 2Y90A 4FM4B 4NL2A 3OYDA 3L2RA 5GANj 2DXTA 2YRVA 2RHYA 3OYKA 4BACA 2RJFA 3JRZA 1YHQA 2OTLA 4M7AF 2R5MA 3G6EA 3QJYA 1U1SA 2MMPA 5A0DA 3S3MA 1VQNA 2CYZB 2V8KA 2XD0A 2X4XA 2FHDA 3HHTB 4BD3A 3CC2A 3JCMe 4M77D 2EJFA 4D6WA 4J7IA 5LJ5e 3M59A 1QVPA 2XIDA 2XDPA 2MWPA 1VQ7A 4XK8E 3MEWA 3MEUA 3OYEA 5GAOn 5CAIA 2CKKA 4KUDK 1VQ5A 3QDRB 1UGPB 3N5BB 1YI2T 3BDUA 3KBGA 4F7UG 3OYBA 4FSXA 3CCET 5KE3A 4N4GA 1Q86U 3RESA 1BI3A 4X9DA 1VQKA 2EJGA 2MI6A 3X26B 4JRPA 4F7UF 5GANg 3BW1A 4C8QG 4E7KA 2C06A 5CK9A 2DPPB 1YITA 1H3ZA 3META 5D6XA 3OYNA 3CCST 1VQMT 2OAUA 1VQ8A 1VQOA 5IT9E 4KUIA 5M9OA 1EIFA 4A4EA 3P8DA 1I4K1 3QPHA 3RMQA 3GNGA 3VV0A 3BFMA 4JRIA 3J7AF 2OTLT 3ME9A 4NS5A 2H3JA 4PNOA 4J6WA 3ER0A 3OYIA 1ZBXA 3MHXA 2ZCFB 4OGEA 4C92C 2K57A 3OMCA 1FWZA 3PGGA 3QYHB 4M78A 1YCYA 3L2WA 4C0FA 2DVEA 3PMTA 5FRMA 1M1KU 4QQ6A 1Q7YC 2KK4A 1M90C 3M4GA 4M7DC 1YJWT 1N27A 3FIFA 4ELZC 3E19A 4FT2A 2YHTA 4A4FA 5GAN6 2M9UA 1Q86C 1WJSA 5EG2A 1KD1C 3JB9G 5LJ3f 4QVCA 3DB3A 3OYAA 5D6WA 1O75A 2ZPHB 2DTHA 5KE2A 3RKYA 4IUPA 4IUVA 3CCUT 2QA4A 4M7DF 2K5IA 3INZA 5FU6C 2K3YA 2IVWA 4BE1A 4M77F 5CVIA 5LJ3d 2HNIA 4BDZA 3NFCA 1KQ2A 2FB7A 3JSCA 4OF1A 1Y07A 1UEBA 2E64A 3TREA 2KAFA 3SDZA 5GAOp 5DLQE 3CC4T 3OW2A 1WJQA 4LD6A 3SB2A 3V8KA 2RD1A 2RO0A 3RKXA 1VQ7T 2VYTA 1Y7XA 5C0MA 4CI0C 3CCLT 1VQ4A 3CCVA 5GMKe 3JCMP 3JCMV 3L2QA 4JUVA 4E7IA 3VU3C 5CKDA 3HFOA 4M77G 2QI2A 2RM4A 2P0QA 4CRIA 1NPPA 3JCMJ 2K5FA 1SSFA 3LH0A 2MF2A 3OA6A 1K8AC 1FXXA 3I56A 4J6YA 3OB9A 3E9FA 5CO7A 3OS0A 1U1TA 5GAOr 1NJIU 3JB9F 3WVDB 2DZCA 2PVOB 4B9WA 3CCVT 2O4XB 1D3BA 5CKHA 3BDLA 1YITT 4QQDA 1XNIA 3CD6A 4M7DD 2Y4XA 1NZ9A 4A4GA 4TVRA 1M1KC 2CZ6B 1KHCA 2G3RA 2QEXA 4A4HA 5GAMj 3QIIA 2R5AA 2DIQA 3V7CA 1VIEA 2EAYA 5LJ5g 4C92D 2ZPGB 1HXDA 2YLBA 4JDSA 3A8GB 2KMTA 3LGLA 2HQEA 5CQYA 1KQ1A 5CQXA 3OYYA 1K73C 3QYGB 1QP2A 2R58A 4M75B 4C0DC 3QKJA 5A0LA 5HK3A 1JJ2A 4M78B 3OSSC 3C4SA 2XDDA 1V29B 4M7AG 2M16A 4QW2A 2EKOA 2LNVA 2LVMA 3M54A 2R57A 1WPYA 4FU6A 4M7DA 4II1A 4RG2A 2JZ2A 2LCCA 2EQUA 4LDVA 5GAMg 3PFSA 3TCJA 4ZGEB 2X4JA 3CBMA 3CMAT 1MHNA 2PVDB 1Y71A 1OI1A 1OZ2A 3PT9A 4UC4A 3OYJA 3CMEA 2NLUA 1JRIA 1OYXA 2X4WA 3NTKA 2DK3A 4JLGA 4N4HA 4BB7A 1N8RC 1VQ6T 3RKWA 4PJOA 4MMLA 3JCMc 4B9XA 3X24B 4M75A 2LRQA 3EFSA 1IREB 4JJNK 2RI5A 2K3XA 1VQ8T 3FC3A 3CMET 2VC8A 1ZQ1A 1X01A 3ZEHA 5C6SA 3OYHA 4J83A 2WSCE 4JS4A 2K5LA 3QO3A 3JCMW 3A8HB 3CCSA 4PJOD 1GXIE 2JOYA 2DEQA 3LW5E 5GAMh 2VXFA 2EWNA 1BKBA 3VJPA 2L89A 2FYKA 4J6XA 3O8VA 4MZTA 2RB6A 2RHXA 2VGNA 1D3BB 4MDWA 1WQWA 2EQJA 4O5VA 4OMFB 3OY9A 4J7FA 4XQ3A 1LOJA 2RA2A 4RMOA 1U8RA 3VYHB 4E7LA 5FRNA 3QJ6A 2EFIA 4M75D 4BI3A 4PLIA 2DKGA 2HQXA 2LTOA 4M78D 4M78G 3RIRA 1I5LA 2EJ9A 4C92E 3VUBA 1B34B 5CR2A 2EIFA 1Q81U 4PJOE 3E9GA 3OBWA 5HKCA 2HBPA 1WQ7A 3DLMA 2P0PA 3F70A 2JVVA 3WXMB 3ZBDA 3S6WA 1YHQT 5I2SA 2GQVA 1G5VA 2KQWA 4JS5A 5J26A 4BI8B 4C92A 4X9CA 1G3TA 4XU2A 4M78F 4LD9K 4XAXB 4PJOG 4R55A 1Q7YU 3HSBA 3RERA 3HFNA 5FU7B 1QW1A 4KBMB 3JAME 4HA8A 5DLOA 4BE2A 1K9MU 1G3SA 5AYFA 4RCCA 3BY7A 1BI1A 4IUQA 1N6AA 3TU4K 2V8JA 2PU9B 3RMSA 4C8QE 3OYCA 1UGRB 3P8HA 4IUUA 4L6V5 4DOWA 2E12A 4OGCA 1H641 5GANe 4HT8A 2XU8A 1YJ9T 1TH7A 2RHUA 3OBYA 4HKEA 4QVDA 2VV5A 4M7AA 3CCMA 2PUKB 1BYMA 3MEAA 5LJ5h 3HRTA 2QQBA 2DXBA 5LL6S 3QUIA 3EFRA 1VQMA 3OW2S 2HD0A 2DZ9A 3FRNA 3QZ5B 1QVGS 1K8AU 5J39A 2LT1A 4FT4A 3E1SA 3TEEA 3V8LA 4M7AD 1XOVA 2KVQG 4M75C 3QG1A 5GAOl 3CCEA 3QXEB 1QP3A 4A53A 4BY6B 1VQ5T 4BUGA 2L5QA 4ZGDB 2DD5A 2ZGWA 4E7HA 1PSEA 4OB1B 3CC2T 5GAN4 2OTJA 3URGA 4ZN1A 1S72A 3CD6T 1QVFA 2E10A 2DTIA 2F5KA 4Q5WA 1YJWA 5CCAA 3M57A 4N4IA 2XICA 4M7AE 2E6ZA 2EQMA 4QQGA 1KC8U 1UGSB 4OB0B 3HRSA 3M53A 3V8JA 3JB9J 4KT0E 1BI0A 3WVEB 3A8OB 2E65A 1KHIA 4ATOA 3R6OA 2M1HA 3QZ9B 4BI4A 4ZTJA 2BKDN 2WSEE 5CIUA 2JN0A 3CCLA 1BI2A 4XTYA 2E70A 4ELYC 2RJEA 3JB9H 3M55A 4LDUA 5FROA 4C0DB 3FJPA 4Y28E 5LJ3h 3CC4A 5LJ3j 2L3RA 3GLXA 4J8OA 3G7ZA 4XTWA 2QQAA 4IUTA 2E5QA 5A0GA 1N8RU 2QDYB 2YLCA 3RUXA 1G3YA 2GFUA 4C0ZA 1FX7A 5LJ5j 2E6NA 2LX9A 4L5GA 1KC8C 1YBYA 2CZ1B 5GMKl 2D6FA 1M90U 3CCUA 2DTOA 3KXTA 4Z02A 1JB0E 3LLRA 4MZPA 3LWHA 2BIVA 2DO3A 2KDSA 4ZN3A 3MP6A 3HP9A 3V7SA 2I2LA 3CPFA 3DLLA 2DD4A 3H8ZA 3UPUA 2QXFA 2XI9A 5LJ3g 4A54A 4XU3A 3CCRT 1X75C 1RL2A 3LGFA 4C8QF 5GANf 3C95A 2QEXT 3GOXA 1BIBA 3JCMb 4JRKA 1YJNA 1IZ6A 3X25B 1VQ9A 2DJZA 3A8MB 1BIAA 3C94A 5GMKh 4C8QD 3UWNA 1NJIC 3G6ET 3NTHA 4C5HA 3DKMA 3VKIA 1WGSA 1UGQB 4P5NA 1W4SA 5GAOq 5CKEA 4YTLA 3MO8A 3JCMh 5L8RE 5GAN5 4DA4A 1LNXA 3X20B 3L42A 4OB3B 3JCMg 2BUDA 3MCAB 3G4SA 1M4ZA 3FLGA 2DXCA 3PIOA 1KQSA 2EYQA 3A5ZB 4BE0A 5DM7R 5GAN7 4N0AC 1K9MC 3UDCA 2P0KA 4EPCA 3JCMX 1Y96A 3NTIA 4HT9A 4XU0A 2ZPEB 4BDYA 3KUFA 4RG8A 4NL3A 1K73U 3PNWC 3SD4A 1YI2A 1S72T 3PIPA 4C0GA 1YIJT 4C5IA 4BY6C 2CS7A 2LT4A 5FU7C 2RHIA 3M5AA 3M58A 4C8QC 1QVFS 5GAN2 3GNFB 1Q81C 2MWOA 4M7AC 4M77B 5KCHA 1N9RA 4EMKB 1JJ2S 5FLXE 5KH6A 4DQ2A 1XQHA 2JNGA 2A7YA 4ZGJB 4XTUA 4EDUA 1AHJB 2Y4YA 3L2ZA 1M8VA 2CZ0B 2K2VA 2RI3A 4F7UB 4OB2B 5GAMd 3A8LB 3CEYA 1VQLT 3M56A 4X34A 1I8FA 1Y96B 4FIBA 5KCOA 3HKSA 1KQSS 2QQSA 2QTXA 2JTMA 4QVZA 4XU1A 3SWNA 4C92G 4C8QB 3G71T 2PUOB 1M5Q1 4PKCC 1PSFA 3I56T 4C5GA 2RH2A 2RJCA 3CPWA 2RJDA 4A4KA 4OVAA 1VQOT 1NPRA 3H6ZA 2GF7A 4IURA 5GAMf 5GMKm 2X4YA 4M7DG 4M7DE 1DJ7B 1Q82U 4NOYA 4R56A 3CCQA 4PLLA 5A2QE 3SWNC 3JCMf 4Y91A 2ZZDA 1VQKT 4MZMA 3L2UA 3MP1A 4LDYA 2E41A 5GMKj 4OP0A 3CC7T 1JBMA 1RI0A 2FVUA 2RI2A 4RCBA 3JCMQ 3CC7A 4JRQA 1W2BA 5LJ5d 3LWIA 3OYMA 1M1GA 2V8IA 3JCMd 2GFAA 3S3NA 4GY5A 2B8AA 4PL6A 2ZPFB 3JB9D 1HK9A 3VUZA 4C92B 1ZHIA 4KULA 4C8QA 3OYGA 4M78C 1VQPA 3SWNB 1Q82C 4XTVA 1VIFA 3T9NA 1KG1A 3G4ST 2RHZA 2P4TA 4J5YA 2ZPBB 2M0OA 4DOVA 4HCBA 4M7DB 2VGMA 4EMHA 3OS2A 3P8BB 1XTDA 2KY9A 1B34A 1I81A 1NE8A 2HAXA 4V2SA 2D9TA 3OMGA 3UT1A 3CCJT 2F69A 4M77C 3QSUA 5CKFA 4EMKC 3S3OA 1MGQA 1VQLA 4EMKA 3AHUA 4PJOC 3MP8A 2O01E 3OSVA 4FL6A 1VQ9T 1VQ6A 2FL7A 5J3BA 4F7UE 2X35A 5CKBA 2JUFA 5GANd 2PVGB 2DAQA 3CCJA 4E47A 2LDMA 5IN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QBY A;  4E7K A;  2DIG A;  1WJR A;  1H3Z A;  3MET A;  5D6X A;  3OYN A;  3LGF A;  2L89 A;  2IG0 A;  5M9O A;  3O8V A;  3GOX A;  4A4E A;  2RHX A;  3P8D A;  3OS1 A;  3OY9 A;  2EQJ A;  5IAY A;  5FRN A;  4E7L A;  3ME9 A;  3QJ6 A;  4NS5 A;  3UWN A;  4ZTF A;  4IKF A;  2QQR A;  2EFI A;  3NTH A;  4C5H A;  2XK0 A;  4PLI A;  3OYI A;  2HQX A;  2LTO A;  1WGS A;  2WAC A;  4L59 A;  3MO8 A;  3OMC A;  3L42 A;  3MEV A;  3E9G A;  3L2W A;  5FRM A;  3PMT A;  2BUD A;  3DLM A;  3DB4 A;  4QQ6 A;  3F70 A;  3OYF A;  3LX7 A;  3EAE A;  1N27 A;  3FLG A;  3S6W A;  1G5V A;  4A4F A;  4BE0 A;  3FEO A;  5J26 A;  1WJS A;  2P0K A;  3NTI A;  3Q1J A;  4BDY A;  3DB3 A;  3KUF A;  5D6W A;  3OYA A;  3PNW C;  2L8D A;  5KE2 A;  3L2V A;  3SD4 A;  4IUP A;  4IUV A;  4BE2 A;  4IUQ A;  2K3Y A;  1OZ3 A;  4C5I A;  4BE1 A;  3FDR A;  3OYL A;  3OYC A;  2RHI A;  3P8H A;  3PMI A;  4IUU A;  4BDZ A;  4HCZ A;  2MWO A;  5KCH A;  2RHU A;  2EQK A;  3S3O A;  5KH6 A;  3MEA A;  3ASK A;  1WJQ A;  2O4X A;  4LD6 A;  2RO0 A;  5D6Y A;  4EDU A;  2JTF A;  2PQW A;  2VYT A;  4E7J A;  5C0M A;  2RI3 A;  5C6S A;  3CEY A;  3L2Q A;  3LYI A;  4E7I A;  4X34 A;  5J39 A;  5KCO A;  4CRI A;  2QQS A;  4QVZ A;  1SSF A;  3LH0 A;  3OA6 A;  4C5G A;  2RJC A;  3M9Q A;  3OB9 A;  3E9F A;  2RJD A;  3OS0 A;  4OVA A;  3H6Z A;  4B9W A;  2GF7 A;  2O4X B;  4IUR A;  2X4Y A;  4E7H A;  3BDL A;  3OQ5 A;  4QQD A;  1XNI A;  4PLL A;  4C5E A;  4A4G A;  4Q5W A;  2F5K A;  1KHC A;  2G3R A;  4A4H A;  3QII A;  4N4I A;  2R5A A;  3L2U A;  2DIQ A;  3MP1 A;  3OYD A;  3L2R A;  2EQM A;  4QQG A;  2YRV A;  1RI0 A;  2RI2 A;  2RHY A;  3LGL A;  3OYK A;  2HQE A;  2RJF A;  3OYM A;  4BAC A;  2R5M A;  2GFA A;  2R58 A;  4GY5 A;  2B8A A;  3ZEH A;  3QKJ A;  4PL6 A;  3S3N A;  2M1H A;  3S3M A;  3C4S A;  2BKD N;  5CIU A;  2X4X A;  2FHD A;  4ZTJ A;  3OYG A;  2M16 A;  4QW2 A;  4BD3 A;  2EKO A;  2RJE A;  5FRO A;  2LVM A;  2R57 A;  4FU6 A;  2L3R A;  2RHZ A;  2XDP A;  2JZ2 A;  2LCC A;  2EQU A;  2M0O A;  4II1 A;  4RG2 A;  4IUT A;  2E5Q A;  3OS2 A;  3PFS A;  2MWP A;  3MEW A;  2D9T A;  2GFU A;  1MHN A;  3MEU A;  3OMG A;  3UT1 A;  3OYE A;  2E6N A;  2CKK A;  1OI1 A;  1OZ2 A;  4UC4 A;  3OYJ A;  2NLU A;  1OYX A;  2X4W A;  3MP8 A;  3NTK A;  4FL6 A;  4N4H A;  4B9X A;  3OYB A;  4Z02 A;  2X35 A;  2LRQ A;  3LLR A;  4N4G A;  5KE3 A;  2BIV A;  2RI5 A;  2K3X A;  3MP6 A;  3FC3 A;  3OYH A;  2DAQ A;  5IN1 A;  2LDM A;  3H8Z A; 
#chains in the Genus database with same CATH topology
 1FYN A;  3QBY A;  2NUP A;  2DIG A;  5GAN 3;  2HKQ B;  4M77 E;  2VUB A;  2IG0 A;  1VQP T;  1BB9 A;  1K8A R;  1NLP C;  5I2M A;  4ZTF A;  2PTK A;  4M75 E;  3MEV A;  4Z89 A;  4OMQ A;  2KBT A;  3DB4 A;  3L1A A;  4F7U A;  1M3A A;  5KYX B;  3I55 T;  3LX7 A;  2OTJ A;  2NWM A;  3EGX B;  1M1F A;  4C92 F;  4O6J A;  2P4R A;  2W10 A;  2CGH A;  1WNL A;  1YJ9 A;  2X9H A;  3SFM A;  1G3W A;  3CXC S;  3G71 A;  1OZ3 A;  3JB9 I;  4GLK A;  4LDX A;  5LJ5 f;  1WX6 A;  2DXU A;  5GAM e;  1UB4 A;  2O4X A;  1C0M A;  2PQW A;  5HK0 A;  2XHC A;  2HZY A;  1QKX A;  2HL3 A;  2O88 A;  4MMK A;  3EGU A;  8AT1 B;  1NG2 A;  4HVV A;  2K4Y A;  2AZV A;  1D09 B;  5FU6 B;  1LJO A;  1PM3 A;  4C5E A;  3CCQ T;  1B7T A;  4JZ3 A;  2LJ0 A;  2D0Q B;  3PTA A;  2CP3 A;  2V1R A;  3OYD A;  3L2R A;  5GAN j;  2DXT A;  4BAC A;  1YHQ A;  3G6E A;  5D7U A;  5A0D A;  2XD0 A;  2V8K A;  1ZSZ A;  4BD3 A;  2OI3 A;  4KGZ B;  3M59 A;  1QVP A;  2XDP A;  1SPK A;  4Z8A A;  3VS1 A;  2O2O A;  3MEU A;  1BU1 A;  1QVF P;  3BDU A;  3KBG A;  3CCE T;  2BTT A;  2P84 A;  1BI3 A;  4FSS A;  2I0N A;  2MI6 A;  2A08 A;  3BW1 A;  4OMN A;  3VS6 A;  4J9D A;  1I5O B;  5CK9 A;  2QDL A;  2OAU A;  2EGA A;  3NHN A;  2ABL A;  4PJN A;  3P8D A;  3BFM A;  3J7A F;  3H9N A;  4C92 C;  2K57 A;  1FWZ A;  2YXY A;  3QYH B;  2GTJ A;  5L23 A;  1OQK A;  4PK4 A;  3CC4 Q;  1M1K U;  3FIF A;  3E19 A;  5GAN 6;  3REA B;  5EG2 A;  1YIJ Q;  4EIK A;  5LJ3 f;  4AFQ C;  3OYA A;  5D6W A;  1H92 A;  4IUP A;  3CCU T;  1GBR A;  2K5I A;  1VQ4 Q;  2IVW A;  4M77 F;  4RTW A;  5CVI A;  2QK0 A;  4J9H A;  3TRE A;  1B07 A;  5DLQ E;  4LD6 A;  3V8K A;  4CI0 C;  1IO6 A;  1AVZ C;  1NYG A;  4CRI A;  3LH0 A;  1K8A C;  3OA6 A;  3I56 A;  5GAO r;  1NJI U;  4B9W A;  1Y0M A;  2DBK A;  2H3E B;  1XNI A;  3G1J A;  2AKL A;  2CZ6 B;  4CC3 A;  1JU5 C;  5GAM j;  2R5A A;  2DIQ A;  1VIE A;  5LJ5 g;  2ZPG B;  3EHQ A;  2KMT A;  2HQE A;  5CQY A;  5CQX A;  3OYY A;  1K73 C;  2YT6 A;  4M78 B;  2JS2 A;  2XDD A;  4M7A G;  2M16 A;  4ANJ A;  2EYX A;  4FU6 A;  4M7D A;  4LDV A;  1KJW A;  1WLP B;  2DFU A;  1MHN A;  3CXC P;  1LPL A;  2PVD B;  4UC4 A;  4ESR A;  3OYJ A;  1D0Y A;  2NLU A;  3RNJ A;  4MML A;  4B9X A;  1WHG A;  1JXM A;  2LRQ A;  3EFS A;  2DL3 A;  4JJN K;  1VQ8 T;  3FC3 A;  3CME T;  1ZQ1 A;  5C6S A;  3OYH A;  2J05 A;  3QO3 A;  2RQU A;  2OX7 A;  3EGD A;  1V76 A;  4AFZ C;  4J6X A;  1U06 A;  4MZT A;  2RHX A;  2VGN A;  4OMF B;  1ZUU A;  4O5V A;  1E6H A;  2EYY A;  2PZ1 A;  4OMP A;  4XQ3 A;  2RA2 A;  4RMO A;  5FRN A;  3VYH B;  1WA7 A;  4M75 D;  3CME Q;  4PLI A;  2NYS A;  4C92 E;  5IXF A;  1Q81 U;  3E9G A;  2HBP A;  2D0N A;  4KGX B;  1MUZ A;  1TUC A;  4JS5 A;  4X9C A;  1G8X A;  2COZ A;  4XAX B;  3HFN A;  2CT4 A;  4HVU A;  4Y92 A;  4KBM B;  4HA8 A;  4BE2 A;  1N6A A;  2V8J A;  1PD0 A;  2XU8 A;  2RHU A;  4LXC A;  2VV5 A;  4FW2 A;  3HRT A;  3QUI A;  2ECZ A;  3IQL A;  3OW2 S;  2HD0 A;  2DZ9 A;  2HMA A;  2LT1 A;  4FT4 A;  4LNP A;  3EGX A;  5KYX A;  1NJI R;  1VQ5 T;  3CC2 T;  4ZGD B;  2QAS A;  3LH5 A;  3URG A;  1QVF A;  2E10 A;  4Q5W A;  1YJW A;  3M57 A;  1E6G A;  2E6Z A;  2EQM A;  5IH2 A;  1JO8 A;  1BI0 A;  3A8O B;  1R77 A;  1I07 A;  2DL5 A;  1OV3 A;  2BKD N;  4J9B A;  2KRM A;  2JN0 A;  2NUP B;  1BI2 A;  1WHK A;  1CKA A;  2E70 A;  4ELY C;  2AZS A;  1W70 A;  3FJP A;  5LJ3 h;  4DBH A;  4J8O A;  2E5Q A;  3RUX A;  2CP5 A;  2E6N A;  2MYS A;  1QWF A;  5GMK l;  3CCQ Q;  1W2B P;  3CCU A;  1M8M A;  2EGC A;  4MZP A;  2JS0 A;  3LWH A;  2KYM A;  1SKU B;  3HP9 A;  3V7S A;  3DLL A;  2DE0 X;  1X2Q A;  3UPU A;  4DEY A;  4A54 A;  3LGF A;  4C8Q F;  5GAN f;  1BIB A;  5KYW B;  3A8M B;  1YWP A;  3THK A;  4C5H A;  3DKM A;  1W4S A;  5CKE A;  1VQ7 Q;  1D0X A;  1Q95 G;  1R0B G;  1KQS A;  1CKB A;  3A5Z B;  4RTU A;  4BE0 A;  1GFD A;  3UA6 A;  4EPC A;  3JCM X;  4DBR A;  2FRY A;  4NL3 A;  1PG5 B;  3PNW C;  1YNZ A;  1S72 T;  2J6K A;  3QDF A;  5GAN 2;  4M77 B;  1N9R A;  4EMK B;  2A7Y A;  2DF6 A;  4ZGJ B;  4XTU A;  2F2X A;  3L2Z A;  1G2B A;  2RI3 A;  4OB2 B;  1VQL T;  1KQS S;  1HJD A;  2QQS A;  1YHQ T;  1M5Q 1;  4PKC C;  4C5G A;  4A4K A;  1VQO T;  4OVA A;  3H6Z A;  3CMA Q;  2GF7 A;  4IUR A;  5GAM f;  4M7D E;  4NOY A;  4R56 A;  3CCU Q;  4QKU A;  3CCQ A;  2HSP A;  2DLP A;  3SWN C;  2YRC A;  4RTZ A;  3MP1 A;  4LDY A;  4OP0 A;  1RI0 A;  2FVU A;  1PKT A;  2AT1 B;  3OYM A;  1K0S A;  3R6N A;  3S3N A;  2IPO B;  3NGP A;  1HK9 A;  3VUZ A;  1KK7 A;  1Q82 C;  4XTV A;  2DET A;  2RQR A;  2RHZ A;  4HCB A;  4J5Y A;  2M0O A;  2VGM A;  2JXB A;  1XTD A;  3H0F A;  2D9T A;  3UT1 A;  4KGV B;  2EPD A;  4GBQ A;  1YJW Q;  1VQL A;  1MGQ A;  2CRE A;  3AHU A;  4PJO C;  1VQ9 T;  2EW3 A;  5J3B A;  4F7U E;  1KFZ A;  2X35 A;  4PJL A;  1PC0 A;  2HL5 C;  2E1H A;  1AOJ A;  2OTJ T;  1WJR A;  3CBP A;  3V7R A;  2LQ8 A;  1UEC A;  2VAS A;  2MCN A;  2JJ9 A;  1T0J A;  5FWC A;  1PD1 A;  4IKF A;  1M2O A;  2XK0 A;  4M7A B;  2WAC A;  4N0A A;  3CPW P;  2OAW A;  4M75 G;  4CC4 B;  2CP0 A;  3HL8 A;  5I21 A;  2LQK A;  1PRM C;  4EMG A;  1M9S A;  3AT1 B;  2CP6 A;  1VQ8 Q;  4M75 F;  1TS9 A;  3ZFJ A;  2QQ9 A;  1PWT A;  2LJ1 A;  4M77 A;  5KYN A;  3OW2 P;  3L2V A;  3QHS A;  2XMF A;  1D1C A;  2KRO A;  5GMK i;  3PMI A;  1YJN T;  2RK1 A;  4RTT A;  4LDW A;  4E6R A;  2CH4 W;  1M90 R;  4WTO B;  4RTV A;  3CMA A;  1W2B S;  1LCK A;  5DY9 A;  3I55 A;  1RAI B;  1NEG A;  2E4H A;  1VQN Q;  3M9Q A;  1K4U S;  5EC7 A;  2F2V A;  3EHR A;  2YDL A;  1ZA1 B;  5KYW A;  2K3B A;  4MDX A;  2CT3 A;  2CH4 A;  1HYO A;  2QA4 T;  1P92 A;  2MIO A;  3EG1 A;  1K76 A;  2Y90 A;  4NL2 A;  1WHH A;  3EG3 A;  3JRZ A;  2OTL A;  1NLO C;  4M7A F;  2R5M A;  3QJY A;  2MMP A;  3S3M A;  2X4X A;  3TSZ A;  1MMN A;  3CC2 A;  3JCM e;  2EJF A;  4J7I A;  5LJ5 e;  2XID A;  2M51 A;  1VQ7 A;  4XK8 E;  1K9A A;  1VA7 A;  2DL4 A;  3OYE A;  1KD1 R;  1ZX6 A;  3QDR B;  1YI2 T;  4F7U G;  3TVT A;  1Q86 U;  3RES A;  4X9D A;  2HEQ A;  2EJG A;  4JRP A;  1RUW A;  4F7U F;  5GAN g;  4E7K A;  2C06 A;  1RAC B;  2X3W D;  1YIT A;  2DA9 A;  3OYN A;  2A37 A;  1I0C A;  1PKS A;  5M9O A;  1EIF A;  2M0Y A;  4ZNX A;  1I4K 1;  3RMQ A;  2DYI A;  2O31 A;  2LCS A;  3ME9 A;  2OTL T;  4PNO A;  3OYI A;  2QEX Q;  2ROT A;  3OMC A;  5FWB A;  2J6O A;  2KYB A;  2DVE A;  3PMT A;  1Q7Y C;  1YJW T;  2M9U A;  2KT8 A;  1KD1 C;  2GQI A;  2JM8 A;  1BK2 A;  1O75 A;  2C0I A;  5KE2 A;  4M7D F;  3INZ A;  1WXB A;  4FYY B;  5FU6 C;  3EG9 B;  4ORZ A;  1YN8 A;  5LJ3 d;  2JT4 A;  3NFC A;  1KIK A;  4FCY A;  2FB7 A;  1Y07 A;  2E64 A;  3SDZ A;  3SB2 A;  1VYV A;  1VQ7 T;  2HCK A;  5GMK e;  5GJW B;  3VU3 C;  5CKD A;  1AZE A;  4E7Z A;  2RM4 A;  1SSF A;  4J6Y A;  3E9F A;  1OX9 A;  2DYB A;  2DZC A;  2F2W A;  3CCV T;  4LUE A;  2LNH B;  1M3C A;  4M7D D;  1GCQ C;  2Y4X A;  4TVR A;  2EKH A;  2G3R A;  5IXB A;  1Z9Q A;  1HXD A;  3LGL A;  2ATC B;  1JXO A;  3QKJ A;  5HK3 A;  5IHK A;  4FYV B;  4QW2 A;  2VVK A;  3ZL7 C;  3G6E Q;  2LNV A;  2LVM A;  4II1 A;  4RG2 A;  2JZ2 A;  2LCC A;  2EQU A;  3PFS A;  3TCJ A;  2SEM A;  2X4J A;  3CMA T;  1VYT A;  1Y71 A;  3PT9 A;  3CME A;  2CP7 A;  4JLG A;  1JRI A;  1OYX A;  1Q82 R;  4PJO A;  1IHV A;  3JCM c;  8ATC B;  2YWW A;  2RI5 A;  1X01 A;  2QGG A;  4KRT A;  3JCM W;  1YCS B;  4PJO D;  1LVK A;  2VXF A;  2EWN A;  3O8V A;  2RB6 A;  2MPX C;  4MDW A;  3OY9 A;  2EQJ A;  1U8R A;  1TUG B;  1LOJ A;  2FPD A;  2DKG A;  2HQX A;  4M78 G;  2EIF A;  1C6V X;  2DRM A;  4PJO E;  3OBW A;  2LP5 A;  3G71 Q;  3PVL A;  1WQ7 A;  3DLM A;  2P0P A;  1HD3 A;  1OPK A;  2JVV A;  4FYW B;  3WXM B;  2A36 A;  1YJ9 Q;  2GQV A;  2A0F B;  2LJ3 A;  2L0A A;  4PJJ A;  1F1B B;  1MMG A;  3JAM E;  5DLO A;  1G3S A;  4RCC A;  3TU4 K;  3RMS A;  3VS3 A;  4DOW A;  4IUU A;  2E12 A;  1H64 1;  1D0Z A;  1YJ9 T;  1TH7 A;  3OBY A;  4QVD A;  3CCM A;  2PUK B;  2EYW A;  2QQB A;  2DXB A;  3CQT A;  1XJW B;  3A98 A;  3TEE A;  1XOV A;  4M75 C;  5GAO l;  1QP3 A;  2DD5 A;  1ZUK A;  2K9G A;  5GAN 4;  2DM1 A;  3CD6 T;  1YFN A;  2F5K A;  2HKN A;  2KRN A;  1RAF B;  1KC8 U;  3HRS A;  3WVE B;  1KHI A;  2M1H A;  2FZG B;  4BI4 A;  5CIU A;  4ZTJ A;  4XTY A;  3M55 A;  4C0D B;  3CC4 A;  3GLX A;  2JMC A;  2QDY B;  2YLC A;  2BE7 D;  2GFU A;  4C0Z A;  1FX7 A;  1YBY A;  2D6F A;  2JM9 A;  1UDL A;  4Z02 A;  2BE9 B;  2KDS A;  2I2L A;  4GLM A;  1T3L A;  2DD4 A;  2XI9 A;  1RAA B;  3UAT A;  4XU3 A;  1JQQ A;  5IHN A;  1X75 C;  3H41 A;  2COW A;  1YJN A;  2HBW A;  3X25 B;  2KEA A;  1VQ9 A;  1NJI C;  4C8Q D;  3G6E T;  5AT1 B;  3EG0 A;  1UGQ B;  3GBQ A;  2NUZ A;  1LNX A;  1AWO A;  3JCM g;  3MCA B;  1M4Z A;  2DXC A;  2ROL A;  1UUE A;  5GAN 7;  2P0K A;  1Y96 A;  5HCK A;  5IHI A;  1YHQ Q;  4C5I A;  5FU7 C;  3M58 A;  2FPF A;  1BCO A;  5KCH A;  1JJ2 S;  4DQ2 A;  1XQH A;  1H8K A;  2Y4Y A;  2E5K A;  4F7U B;  3A8L B;  3CEY A;  2V1Q A;  3M56 A;  4FIB A;  2QTX A;  4XU1 A;  2J7I A;  2JTM A;  2W0Z A;  4C92 G;  3G71 T;  1E7O A;  2PUO B;  4CC2 A;  3CPW A;  1PSF A;  1D1B A;  2K2M A;  2DVJ A;  4D8D A;  5GMK m;  2X4Y A;  3EH2 A;  3JCM f;  4Y91 A;  2ZZD A;  2EVR A;  1WXT A;  1VQK T;  4MZM A;  5GMK j;  3CC7 T;  1VQ9 Q;  1JBM A;  3JCM Q;  3LWI A;  2V8I A;  4K11 A;  2GFA A;  2IIM A;  2G6F X;  4KUL A;  2YUO A;  1VQP A;  1Y57 A;  2OTJ Q;  2P4T A;  2ZPB B;  3CCJ T;  2F69 A;  5CKF A;  2CDT A;  4EMK A;  3MP8 A;  2O01 E;  3OSV A;  4FL6 A;  1SSH A;  2L3S A;  5CKB A;  1X6B A;  2J06 A;  4E47 A;  1ZA2 B;  2CZ7 B;  5GAN h;  3CCR A;  3EH1 A;  1JJ2 P;  2X51 A;  3CCJ Q;  4RTY A;  1VQM Q;  3CXC A;  1G83 A;  1JEG A;  2BZ8 A;  2DRK A;  1UJY A;  2QQR A;  1OPL A;  4M78 E;  4XTX A;  3I5S A;  1X6O A;  1O9S A;  4WF2 A;  1NEB A;  3CCM T;  3EAE A;  5GAO m;  2CP2 A;  3FEO A;  1N9S A;  3Q1J A;  1YIT Q;  1R8O B;  3FB9 A;  2A3L A;  3JV3 A;  3EG9 A;  2LC4 A;  5HY6 A;  2KSS A;  3CBO A;  3VYG A;  1VQN T;  3FDR A;  3C0C A;  3CCM Q;  2EQK A;  2FPE A;  3ULR B;  3C12 A;  3ASK A;  5D6Y A;  1A0N B;  2JTF A;  3LYI A;  4IIM A;  3VRY A;  2BZX A;  2F5T X;  2HDA A;  3REB B;  4ME7 A;  1X6G A;  2OTL Q;  4XTZ A;  4FW1 A;  1TUD A;  2AHJ B;  3HRU A;  3GIB A;  1IHW A;  4FM4 B;  3PE0 A;  2YRV A;  2RHY A;  4HXJ A;  1YI2 Q;  2RJF A;  1VQN A;  2FHD A;  3I35 A;  4D6W A;  1FMV A;  2LQW A;  1OOT A;  5GAO n;  5CAI A;  2CKK A;  2QYZ A;  4KUD K;  3M0U A;  1VQ5 A;  1AWX A;  1RLP C;  3CD6 Q;  1UGP B;  1UE9 A;  3OYB A;  4FSX A;  4N4G A;  1VQK A;  3X26 B;  3EFO A;  4C8Q G;  2K6D A;  2DPP B;  1H3Z A;  1SG5 A;  3MET A;  3CCS T;  3CCV Q;  1VQ8 A;  2ED0 A;  5KYU A;  2D8J A;  4A4E A;  3QPH A;  3VV0 A;  3GNG A;  1AWW A;  5ECA A;  4JZ4 A;  2EQI A;  5FW9 A;  4NS5 A;  3ER0 A;  1U3O A;  2GGR A;  1ZBX A;  3BE3 A;  3MHX A;  2ZCF B;  4OGE A;  4C0F A;  4J9E A;  4QQ6 A;  4M7D C;  4JJC A;  2F1L A;  1UHF A;  3JB9 G;  4QVC A;  6AT1 B;  2LX7 A;  2ZPH B;  2DJQ A;  3RKY A;  2QA4 A;  2DX1 A;  4F16 A;  4RUG A;  1RAE B;  1AZG B;  3TQ7 P;  1MND A;  5I22 A;  1KQ2 A;  3JSC A;  5GAO p;  3S3O A;  1UEB A;  2KAF A;  2VB6 A;  4J9F A;  2RD1 A;  2JMA A;  3CCL T;  1TXQ A;  4E7I A;  3HFO A;  4M77 G;  2P0Q A;  3U23 A;  5CO7 A;  1U1T A;  2DL8 A;  3WVD B;  3UA7 A;  2O4X B;  3BDL A;  1YIT T;  1NZ9 A;  2D8H A;  4A4G A;  3EG2 A;  2DIL A;  2QEX A;  4A4H A;  1TU0 B;  2E3H A;  4JDS A;  2ED1 A;  4J9I A;  1KQ1 A;  1GCQ A;  3QYG B;  1JJ2 A;  4C0D C;  4M75 B;  4F17 A;  2EGE A;  3OSS C;  3C4S A;  1V29 B;  1BBZ A;  1RAH B;  2R57 A;  1WPY A;  2KGT A;  4JPB W;  2AK5 A;  4ZGE B;  1OI1 A;  3RER A;  2X4W A;  2DK3 A;  4BB7 A;  4N4H A;  1VQ6 T;  3RKW A;  2LQN A;  4OMM A;  2QAZ A;  1IRE B;  2K3X A;  3ZEH A;  2WSC E;  4JS4 A;  2K5L A;  1M1K R;  3CC2 Q;  3A8H B;  1TOV A;  3CCS A;  4QT7 A;  4Z88 A;  2JOY A;  2DEQ A;  5GAM h;  3VJP A;  2L89 A;  4AFU C;  4E7S A;  1D3B B;  1WQW A;  1ABQ A;  4E7L A;  2DMO A;  4M78 D;  3RIR A;  2LTO A;  3M0Q A;  3NMZ C;  1ZLM A;  1WHL A;  4IIO A;  1IRX A;  1CSK A;  3F70 A;  2RMO A;  3M0P A;  1QCO A;  3S6W A;  3ZBD A;  2KQW A;  5J26 A;  4BI8 B;  1MV3 A;  4XU2 A;  4M78 F;  4PJO G;  4R55 A;  1Q7Y U;  3I55 Q;  2YSQ A;  1QW1 A;  3VRZ A;  1K9M U;  5AYF A;  3BY7 A;  1BI1 A;  4IUQ A;  2PU9 B;  3P8H A;  2PNI A;  4OML A;  4OGC A;  4F14 A;  4HT8 A;  2QGF B;  1QWE A;  4HKE A;  1QCN A;  5LL6 S;  2NUT B;  1UGV A;  1QVG S;  1K8A U;  2X3X D;  1IGQ A;  4LUD A;  3E1S A;  2KR3 A;  2KVQ G;  3CCE A;  4A53 A;  4PJM A;  2CUD A;  4BUG A;  2JW4 A;  4OB1 B;  2B86 A;  4ZN1 A;  1S72 A;  1QMC A;  2DTI A;  2HSE B;  1H3H A;  4M7A E;  1UJ0 A;  4QQG A;  4OB0 B;  3V8J A;  3JB9 J;  1TSF A;  2M02 A;  1SHF A;  4ATO A;  1QQJ A;  1U5S A;  3D7S B;  2VKN A;  2WSE E;  3CCL A;  4DBF A;  4E2F B;  2RF0 A;  1V1C A;  1T0H A;  2RJE A;  3JB9 H;  1KC8 R;  1VOM A;  2KRS A;  3G7Z A;  4XTW A;  2QQA A;  1G3Y A;  2ZAE A;  2LX9 A;  7AT1 B;  2CZ1 B;  1ABO A;  2ENM A;  1VQL Q;  2QG9 B;  1WI7 A;  2DTO A;  3KXT A;  1ZUY A;  3LLR A;  1M2V A;  2AKK A;  1VQO Q;  1J3T A;  3CPF A;  2K79 A;  3H8Z A;  2L3P A;  2QXF A;  4AFS C;  3CCR T;  2RQT A;  3H0I A;  2QEX T;  2YRD A;  1IZ6 A;  3HTR A;  2DJZ A;  1BIA A;  3UWN A;  3NTH A;  3SHW A;  1UFF A;  3MO8 A;  3JCM h;  4DA4 A;  1AEY A;  3X20 B;  4OB3 B;  1W1F A;  1X69 A;  3PIO A;  2EYQ A;  4PFZ A;  5DM7 R;  1K9M C;  4N0A C;  1TG0 A;  4HT9 A;  1N8R R;  4XU0 A;  1EX4 A;  2J6F A;  1MMA A;  3PIP A;  2QTV A;  1YIJ T;  1QVF S;  2RHI A;  3M5A A;  4C8Q C;  1RLQ C;  3VS4 A;  3GNF B;  1Q81 C;  2MWO A;  4LN2 A;  5FLX E;  3E2U A;  1ZBJ A;  3RBB B;  2KNB B;  1M2V B;  4EDU A;  1AHJ B;  1X43 A;  2C0T A;  2K2V A;  1WYX A;  2RPN A;  1SRL A;  3VS2 A;  4X34 A;  1Y96 B;  5KCO A;  1KQS P;  4C8Q B;  2RH2 A;  4PFP A;  3QWY A;  2RJD A;  2H8H A;  1NPR A;  9ATC B;  1Q82 U;  1WZO A;  3EGD B;  4PLL A;  2FRW A;  1B3Q A;  2E41 A;  5LJ5 d;  1GBQ A;  1I1J A;  3JCM d;  3VS5 A;  4GY5 A;  4PL6 A;  2ZPF B;  3JB9 D;  4C92 B;  3OYG A;  3SWN B;  1VIF A;  1KG1 A;  3G4S T;  2VWF A;  4DOV A;  4M7D B;  4CC7 A;  3P8B B;  1B34 A;  1I81 A;  1NE8 A;  2HAX A;  4V2S A;  3I5R A;  4EMK C;  2OJ2 A;  2FL7 A;  1Q86 R;  2JUF A;  5GAN d;  1HSQ A;  3CCE Q;  2DEU A;  3HPW A;  1PNJ A;  2MAM A;  4HVW A;  1YIJ A;  4HCK A;  1QVG P;  2VXE A;  1PCX A;  4RKU E;  3OS1 A;  3M4Y A;  3X28 B;  5IAY A;  5GAN 8;  2WSF E;  1VUB A;  2RK2 A;  4AG2 C;  4L59 A;  3J81 E;  3CPW S;  4HCC A;  1GFC A;  3O5Z A;  1PRL C;  3OYF A;  4JLI A;  1WFW A;  4PJO F;  2ZPI B;  4M4Z A;  5GJV B;  4AMC A;  1QVG A;  1GRI A;  4DBQ A;  1KD1 U;  2L8D A;  2HQH A;  2CUB A;  1N5Z A;  1X2K A;  3OYL A;  2XDB A;  1VQ4 T;  3GF5 A;  4HCZ A;  4A63 B;  1AT1 B;  1OUL A;  5LJ3 e;  3GPL A;  1SF9 A;  1RAG B;  2C0O A;  4E7J A;  2XKO C;  4VUB A;  1SEM A;  3CCS Q;  1S1N A;  2GCX A;  2KE9 A;  4R0K A;  3GP8 A;  2LCL A;  1MNE A;  1OEB A;  2RQW A;  3J80 E;  3OQ5 A;  3PVQ A;  2XG8 D;  3OS5 A;  4PJO B;  2D1X A;  1R0C B;  4B6M A;  3OYK A;  4PFO A;  1U1S A;  2CYZ B;  3RDV A;  3HHT B;  2GTO A;  2YUN A;  4KH0 B;  4M77 D;  1EFN A;  1RAD B;  2FO0 A;  2MWP A;  3MEW A;  1ZSZ B;  2ESW A;  3N5B B;  5KE3 A;  2DBM A;  5D6X A;  3SEM A;  1ZSG A;  1VQM T;  1VQO A;  5IT9 E;  4KUI A;  4RTX A;  1X27 A;  4JRI A;  2K7A A;  2H3J A;  4J6W A;  3PGG A;  4M78 A;  1YCY A;  3L2W A;  5FRM A;  2SRC A;  1FMW A;  2QA4 Q;  1M90 C;  2KK4 A;  3M4G A;  2NUT A;  1N27 A;  4ELZ C;  4FT2 A;  2YHT A;  4A4F A;  1Q86 C;  3I56 Q;  1WJS A;  2E3I A;  3CCL Q;  3DB3 A;  1UG1 A;  2DTH A;  3FJ5 A;  4IUV A;  3TSW A;  2K3Y A;  2YUQ A;  4BE1 A;  2DER A;  2HNI A;  3UF4 A;  4BDZ A;  1S72 Q;  4OF1 A;  3CC4 T;  1WJQ A;  1BCM A;  2RO0 A;  3RKX A;  2VYT A;  4F04 B;  1Y7X A;  5C0M A;  1VQ4 A;  1ARK A;  3CCV A;  3JCM P;  3JCM V;  3L2Q A;  4JUV A;  2QI2 A;  1IGU A;  3JCM J;  1NPP A;  2K5F A;  2MF2 A;  1FXX A;  3OB9 A;  3OS0 A;  3JB9 F;  1NM7 A;  2PVO B;  1D3B A;  4WCI A;  5CKH A;  4QQD A;  3CD6 A;  1M1K C;  1KHC A;  4JJD A;  3QII A;  3V7C A;  2EAY A;  4C92 D;  4LE9 A;  2LZ6 B;  2KT1 A;  2YLB A;  1PHT A;  1M30 A;  3A8G B;  1QLY A;  1QP2 A;  2R58 A;  3QWX X;  5A0L A;  2EKO A;  1T3S A;  1UHC A;  3M54 A;  5GAM g;  1SRM A;  2KXC A;  3CBM A;  1OZ2 A;  3NTK A;  2EBP A;  1N8R C;  2EYZ A;  1W6X A;  3X24 B;  4M75 A;  1WXU A;  1NYF A;  2FEI A;  2VC8 A;  4J83 A;  4D8K A;  1GXI E;  3LW5 E;  3M0R A;  1BKB A;  2AIR B;  2FYK A;  2CSQ A;  3OW2 A;  4J7F A;  3QJ6 A;  3NPF A;  2EFI A;  4BI3 A;  1IB8 A;  2JTE A;  1D1A A;  1I5L A;  2EJ9 A;  5CR2 A;  3VUB A;  1B34 B;  1YWO A;  3VS7 A;  2FG0 A;  5HKC A;  5I2S A;  1G5V A;  4C92 A;  1G3T A;  4LD9 K;  1ZSZ C;  3HSB A;  3KFV A;  1TWB A;  5FU7 B;  3MJX A;  3RR6 A;  2O9S A;  3A1P A;  5KYY A;  1MV0 B;  4OMO A;  1VYU A;  1M27 C;  3OYC A;  4C8Q E;  1UGR B;  4L6V 5;  5GAN e;  4M7A A;  1OU9 A;  1BYM A;  2GBQ A;  1Z9Z A;  3MEA A;  5LJ5 h;  1K9M R;  1VQM A;  2FZK B;  3EFR A;  3I9Q A;  1AWJ A;  3FRN A;  3QZ5 B;  2CSI A;  1Q7Y R;  3CCR Q;  5J39 A;  3V8L A;  4M7A D;  1ACM B;  3QG1 A;  3QXE B;  4BY6 B;  4J9G A;  4E7H A;  2L5Q A;  1UTI A;  2ZGW A;  3MPU B;  1PSE A;  5KYU B;  1GL5 A;  1YP5 A;  3M0S A;  5CCA A;  4N4I A;  2XIC A;  4X1V A;  3EFO B;  1UGS B;  3M53 A;  4KT0 E;  3M0T A;  2E65 A;  3R6O A;  1VQP Q;  3QZ9 B;  4LDU A;  5FRO A;  4FYX B;  4Y28 E;  5LJ3 j;  2L3R A;  4IUT A;  5A0G A;  1N8R U;  1FMK A;  2MK5 A;  4J9C A;  5LJ5 j;  4L5G A;  1KC8 C;  1VQ6 Q;  2YUP A;  2FZC B;  1M90 U;  1JB0 E;  4DEX A;  2BIV A;  2DO3 A;  4ZN3 A;  3MP6 A;  1KSW A;  1NBE B;  2RN8 A;  1IXD A;  1M3B A;  2DNU A;  5LJ3 g;  3H0H A;  1WHM A;  1OX8 A;  1RL2 A;  1WHJ A;  2L3Q A;  2Z0W A;  3C95 A;  1TTH B;  2LMJ A;  3GOX A;  1VQK Q;  1GCP A;  2KXD A;  1AD5 A;  3JCM b;  4JRK A;  2COY A;  3CC7 Q;  3C94 A;  5GMK h;  1SHG A;  1EZZ B;  1OU8 A;  2L2P A;  1VQ5 Q;  2KI7 A;  1K0X A;  3VKI A;  1WGS A;  4P5N A;  5GAO q;  4YTL A;  5GAN 5;  4AT1 B;  5L8R E;  3L42 A;  2BUD A;  3G4S A;  1MMD A;  3FLG A;  1WDX A;  3UDC A;  3NTI A;  2ZPE B;  4BDY A;  3KUF A;  4RG8 A;  1K73 U;  3SD4 A;  1YI2 A;  5KYY B;  4C0G A;  4BY6 C;  2CS7 A;  2LT4 A;  2DL7 A;  4M7A C;  5KH6 A;  1C1A A;  2JNG A;  1YJN Q;  3VS0 A;  1RAB B;  1M8V A;  2CZ0 B;  2RQV A;  5GAM d;  1I8F A;  3HKS A;  3SWN A;  2RNA A;  4QVZ A;  4AG1 C;  2O9V A;  3I56 T;  2RJC A;  2V26 A;  4M7D G;  3G4S Q;  1DJ7 B;  1QCF A;  5A2Q E;  2A28 A;  2MOX A;  2GNC A;  3L2U A;  3CC7 A;  1WIE A;  2RI2 A;  4RCB A;  4JRQ A;  1W2B A;  1M1G A;  1RI9 A;  2B8A A;  4JJB A;  4KH1 B;  1ZHI A;  4C8Q A;  4M78 C;  5I11 A;  3T9N A;  1Q81 R;  3MKD A;  4EMH A;  3OS2 A;  2KY9 A;  2BZY A;  3OMG A;  4M77 C;  3QSU A;  1K73 R;  1VQ6 A;  2PVG B;  1QKW A;  1K1Z A;  2DAQ A;  3CCJ A;  2LDM A;  5IN1 A; 
#chains in the Genus database with same CATH homology
 2CZ7 B;  3HPW A;  3QBY A;  5GAN h;  2DIG A;  2E1H A;  2OTJ T;  3CCR A;  1WJR A;  2MAM A;  3CBP A;  5GAN 3;  1YIJ A;  4M77 E;  2LQ8 A;  2VUB A;  3V7R A;  2VXE A;  2IG0 A;  3CXC A;  4RKU E;  3OS1 A;  1VQP T;  3M4Y A;  3X28 B;  5IAY A;  5GAN 8;  5I2M A;  4IKF A;  4ZTF A;  2QQR A;  2WSF E;  2XK0 A;  1VUB A;  4M7A B;  4M78 E;  4XTX A;  2RK2 A;  2WAC A;  4N0A A;  4L59 A;  4M75 E;  3J81 E;  3CPW S;  4M75 G;  4HCC A;  1X6O A;  3MEV A;  1O9S A;  3HL8 A;  5I21 A;  3DB4 A;  3L1A A;  4F7U A;  3I55 T;  4WF2 A;  3OYF A;  3LX7 A;  2LQK A;  3EAE A;  4JLI A;  4PJO F;  2ZPI B;  3CCM T;  4EMG A;  5GAO m;  1M9S A;  1M1F A;  3FEO A;  1N9S A;  4C92 F;  4M75 F;  3ZFJ A;  1QVG A;  2QQ9 A;  4O6J A;  3Q1J A;  2CGH A;  4M77 A;  1R8O B;  1WNL A;  3FB9 A;  2A3L A;  1YJ9 A;  1KD1 U;  2L8D A;  3SFM A;  1G3W A;  2LC4 A;  5HY6 A;  3L2V A;  2KSS A;  3QHS A;  3CXC S;  3CBO A;  3G71 A;  3VYG A;  1VQN T;  1OZ3 A;  3JB9 I;  3FDR A;  4GLK A;  4LDX A;  3OYL A;  5LJ5 f;  5GMK i;  1VQ4 T;  2XDB A;  3PMI A;  3GF5 A;  4HCZ A;  2DXU A;  1YJN T;  2RK1 A;  2EQK A;  4LDW A;  5GAM e;  3C12 A;  1UB4 A;  3ASK A;  2O4X A;  5LJ3 e;  3GPL A;  5D6Y A;  3CMA A;  2JTF A;  2PQW A;  5HK0 A;  4E7J A;  2XKO C;  1W2B S;  2XHC A;  4VUB A;  3LYI A;  5DY9 A;  2F5T X;  3I55 A;  2GCX A;  4MMK A;  3GP8 A;  2LCL A;  3M9Q A;  2K4Y A;  4ME7 A;  3J80 E;  4XTZ A;  5FU6 B;  1LJO A;  3OQ5 A;  4MDX A;  4C5E A;  2XG8 D;  2AHJ B;  3HRU A;  3CCQ T;  1P92 A;  2QA4 T;  3OS5 A;  3GIB A;  4PJO B;  3PTA A;  2D0Q B;  2Y90 A;  4FM4 B;  4NL2 A;  3OYD A;  3L2R A;  5GAN j;  2DXT A;  2YRV A;  2RHY A;  3OYK A;  4BAC A;  2RJF A;  3JRZ A;  1YHQ A;  2OTL A;  4M7A F;  2R5M A;  3G6E A;  3QJY A;  1U1S A;  2MMP A;  5A0D A;  3S3M A;  1VQN A;  2CYZ B;  2V8K A;  2XD0 A;  2X4X A;  2FHD A;  3HHT B;  4BD3 A;  3CC2 A;  3JCM e;  4M77 D;  2EJF A;  4D6W A;  4J7I A;  5LJ5 e;  3M59 A;  1QVP A;  2XID A;  2XDP A;  2MWP A;  1VQ7 A;  4XK8 E;  3MEW A;  3MEU A;  3OYE A;  5GAO n;  5CAI A;  2CKK A;  4KUD K;  1VQ5 A;  3QDR B;  1UGP B;  3N5B B;  1YI2 T;  3BDU A;  3KBG A;  4F7U G;  3OYB A;  4FSX A;  3CCE T;  5KE3 A;  4N4G A;  1Q86 U;  3RES A;  1BI3 A;  4X9D A;  1VQK A;  2EJG A;  2MI6 A;  3X26 B;  4JRP A;  4F7U F;  5GAN g;  3BW1 A;  4C8Q G;  4E7K A;  2C06 A;  5CK9 A;  2DPP B;  1YIT A;  1H3Z A;  3MET A;  5D6X A;  3OYN A;  3CCS T;  1VQM T;  2OAU A;  1VQ8 A;  1VQO A;  5IT9 E;  4KUI A;  5M9O A;  1EIF A;  4A4E A;  3P8D A;  1I4K 1;  3QPH A;  3RMQ A;  3GNG A;  3VV0 A;  3BFM A;  4JRI A;  3J7A F;  2OTL T;  3ME9 A;  4NS5 A;  2H3J A;  4PNO A;  4J6W A;  3ER0 A;  3OYI A;  1ZBX A;  3MHX A;  2ZCF B;  4OGE A;  4C92 C;  2K57 A;  3OMC A;  1FWZ A;  3PGG A;  3QYH B;  4M78 A;  1YCY A;  3L2W A;  4C0F A;  2DVE A;  3PMT A;  5FRM A;  1M1K U;  4QQ6 A;  1Q7Y C;  2KK4 A;  1M90 C;  3M4G A;  4M7D C;  1YJW T;  1N27 A;  3FIF A;  4ELZ C;  3E19 A;  4FT2 A;  2YHT A;  4A4F A;  5GAN 6;  2M9U A;  1Q86 C;  1WJS A;  5EG2 A;  1KD1 C;  3JB9 G;  5LJ3 f;  4QVC A;  3DB3 A;  3OYA A;  5D6W A;  1O75 A;  2ZPH B;  2DTH A;  5KE2 A;  3RKY A;  4IUP A;  4IUV A;  3CCU T;  2QA4 A;  4M7D F;  2K5I A;  3INZ A;  5FU6 C;  2K3Y A;  2IVW A;  4BE1 A;  4M77 F;  5CVI A;  5LJ3 d;  2HNI A;  4BDZ A;  3NFC A;  1KQ2 A;  2FB7 A;  3JSC A;  4OF1 A;  1Y07 A;  1UEB A;  2E64 A;  3TRE A;  2KAF A;  3SDZ A;  5GAO p;  5DLQ E;  3CC4 T;  3OW2 A;  1WJQ A;  4LD6 A;  3SB2 A;  3V8K A;  2RD1 A;  2RO0 A;  3RKX A;  1VQ7 T;  2VYT A;  1Y7X A;  5C0M A;  4CI0 C;  3CCL T;  1VQ4 A;  3CCV A;  5GMK e;  3JCM P;  3JCM V;  3L2Q A;  4JUV A;  4E7I A;  3VU3 C;  5CKD A;  3HFO A;  4M77 G;  2QI2 A;  2RM4 A;  2P0Q A;  4CRI A;  1NPP A;  3JCM J;  2K5F A;  1SSF A;  3LH0 A;  2MF2 A;  3OA6 A;  1K8A C;  1FXX A;  3I56 A;  4J6Y A;  3OB9 A;  3E9F A;  5CO7 A;  3OS0 A;  1U1T A;  5GAO r;  1NJI U;  3JB9 F;  3WVD B;  2DZC A;  2PVO B;  4B9W A;  3CCV T;  2O4X B;  1D3B A;  5CKH A;  3BDL A;  1YIT T;  4QQD A;  1XNI A;  3CD6 A;  4M7D D;  2Y4X A;  1NZ9 A;  4A4G A;  4TVR A;  1M1K C;  2CZ6 B;  1KHC A;  2G3R A;  2QEX A;  4A4H A;  5GAM j;  3QII A;  2R5A A;  2DIQ A;  3V7C A;  1VIE A;  2EAY A;  5LJ5 g;  4C92 D;  2ZPG B;  1HXD A;  2YLB A;  4JDS A;  3A8G B;  2KMT A;  3LGL A;  2HQE A;  5CQY A;  1KQ1 A;  5CQX A;  3OYY A;  1K73 C;  3QYG B;  1QP2 A;  2R58 A;  4M75 B;  4C0D C;  3QKJ A;  5A0L A;  5HK3 A;  1JJ2 A;  4M78 B;  3OSS C;  3C4S A;  2XDD A;  1V29 B;  4M7A G;  2M16 A;  4QW2 A;  2EKO A;  2LNV A;  2LVM A;  3M54 A;  2R57 A;  1WPY A;  4FU6 A;  4M7D A;  4II1 A;  4RG2 A;  2JZ2 A;  2LCC A;  2EQU A;  4LDV A;  5GAM g;  3PFS A;  3TCJ A;  4ZGE B;  2X4J A;  3CBM A;  3CMA T;  1MHN A;  2PVD B;  1Y71 A;  1OI1 A;  1OZ2 A;  3PT9 A;  4UC4 A;  3OYJ A;  3CME A;  2NLU A;  1JRI A;  1OYX A;  2X4W A;  3NTK A;  2DK3 A;  4JLG A;  4N4H A;  4BB7 A;  1N8R C;  1VQ6 T;  3RKW A;  4PJO A;  4MML A;  3JCM c;  4B9X A;  3X24 B;  4M75 A;  2LRQ A;  3EFS A;  1IRE B;  4JJN K;  2RI5 A;  2K3X A;  1VQ8 T;  3FC3 A;  3CME T;  2VC8 A;  1ZQ1 A;  1X01 A;  3ZEH A;  5C6S A;  3OYH A;  4J83 A;  2WSC E;  4JS4 A;  2K5L A;  3QO3 A;  3JCM W;  3A8H B;  3CCS A;  4PJO D;  1GXI E;  2JOY A;  2DEQ A;  3LW5 E;  5GAM h;  2VXF A;  2EWN A;  1BKB A;  3VJP A;  2L89 A;  2FYK A;  4J6X A;  3O8V A;  4MZT A;  2RB6 A;  2RHX A;  2VGN A;  1D3B B;  4MDW A;  1WQW A;  2EQJ A;  4O5V A;  4OMF B;  3OY9 A;  4J7F A;  4XQ3 A;  1LOJ A;  2RA2 A;  4RMO A;  1U8R A;  3VYH B;  4E7L A;  5FRN A;  3QJ6 A;  2EFI A;  4M75 D;  4BI3 A;  4PLI A;  2DKG A;  2HQX A;  2LTO A;  4M78 D;  4M78 G;  3RIR A;  1I5L A;  2EJ9 A;  4C92 E;  3VUB A;  1B34 B;  5CR2 A;  2EIF A;  1Q81 U;  4PJO E;  3E9G A;  3OBW A;  5HKC A;  2HBP A;  1WQ7 A;  3DLM A;  2P0P A;  3F70 A;  2JVV A;  3WXM B;  3ZBD A;  3S6W A;  1YHQ T;  5I2S A;  2GQV A;  1G5V A;  2KQW A;  4JS5 A;  5J26 A;  4BI8 B;  4C92 A;  4X9C A;  1G3T A;  4XU2 A;  4M78 F;  4LD9 K;  4XAX B;  4PJO G;  4R55 A;  1Q7Y U;  3HSB A;  3RER A;  3HFN A;  5FU7 B;  1QW1 A;  4KBM B;  3JAM E;  4HA8 A;  5DLO A;  4BE2 A;  1K9M U;  1G3S A;  5AYF A;  4RCC A;  3BY7 A;  1BI1 A;  4IUQ A;  1N6A A;  3TU4 K;  2V8J A;  2PU9 B;  3RMS A;  4C8Q E;  3OYC A;  1UGR B;  3P8H A;  4IUU A;  4L6V 5;  4DOW A;  2E12 A;  4OGC A;  1H64 1;  5GAN e;  4HT8 A;  2XU8 A;  1YJ9 T;  1TH7 A;  2RHU A;  3OBY A;  4HKE A;  4QVD A;  2VV5 A;  4M7A A;  3CCM A;  2PUK B;  1BYM A;  3MEA A;  5LJ5 h;  3HRT A;  2QQB A;  2DXB A;  5LL6 S;  3QUI A;  3EFR A;  1VQM A;  3OW2 S;  2HD0 A;  2DZ9 A;  3FRN A;  3QZ5 B;  1QVG S;  1K8A U;  5J39 A;  2LT1 A;  4FT4 A;  3E1S A;  3TEE A;  3V8L A;  4M7A D;  1XOV A;  2KVQ G;  4M75 C;  3QG1 A;  5GAO l;  3CCE A;  3QXE B;  1QP3 A;  4A53 A;  4BY6 B;  1VQ5 T;  4BUG A;  2L5Q A;  4ZGD B;  2DD5 A;  2ZGW A;  4E7H A;  1PSE A;  4OB1 B;  3CC2 T;  5GAN 4;  2OTJ A;  3URG A;  4ZN1 A;  1S72 A;  3CD6 T;  1QVF A;  2E10 A;  2DTI A;  2F5K A;  4Q5W A;  1YJW A;  5CCA A;  3M57 A;  4N4I A;  2XIC A;  4M7A E;  2E6Z A;  2EQM A;  4QQG A;  1KC8 U;  1UGS B;  4OB0 B;  3HRS A;  3M53 A;  3V8J A;  3JB9 J;  4KT0 E;  1BI0 A;  3WVE B;  3A8O B;  2E65 A;  1KHI A;  4ATO A;  3R6O A;  2M1H A;  3QZ9 B;  4BI4 A;  4ZTJ A;  2BKD N;  2WSE E;  5CIU A;  2JN0 A;  3CCL A;  1BI2 A;  4XTY A;  2E70 A;  4ELY C;  2RJE A;  3JB9 H;  3M55 A;  4LDU A;  5FRO A;  4C0D B;  3FJP A;  4Y28 E;  5LJ3 h;  3CC4 A;  5LJ3 j;  2L3R A;  3GLX A;  4J8O A;  3G7Z A;  4XTW A;  2QQA A;  4IUT A;  2E5Q A;  5A0G A;  1N8R U;  2QDY B;  2YLC A;  3RUX A;  1G3Y A;  2GFU A;  4C0Z A;  1FX7 A;  5LJ5 j;  2E6N A;  2LX9 A;  4L5G A;  1KC8 C;  1YBY A;  2CZ1 B;  5GMK l;  2D6F A;  1M90 U;  3CCU A;  2DTO A;  3KXT A;  4Z02 A;  1JB0 E;  3LLR A;  4MZP A;  3LWH A;  2BIV A;  2DO3 A;  2KDS A;  4ZN3 A;  3MP6 A;  3HP9 A;  3V7S A;  2I2L A;  3CPF A;  3DLL A;  2DD4 A;  3H8Z A;  3UPU A;  2QXF A;  2XI9 A;  5LJ3 g;  4A54 A;  4XU3 A;  3CCR T;  1X75 C;  1RL2 A;  3LGF A;  4C8Q F;  5GAN f;  3C95 A;  2QEX T;  3GOX A;  1BIB A;  3JCM b;  4JRK A;  1YJN A;  1IZ6 A;  3X25 B;  1VQ9 A;  2DJZ A;  3A8M B;  1BIA A;  3C94 A;  5GMK h;  4C8Q D;  3UWN A;  1NJI C;  3G6E T;  3NTH A;  4C5H A;  3DKM A;  3VKI A;  1WGS A;  1UGQ B;  4P5N A;  1W4S A;  5GAO q;  5CKE A;  4YTL A;  3MO8 A;  3JCM h;  5L8R E;  5GAN 5;  4DA4 A;  1LNX A;  3X20 B;  3L42 A;  4OB3 B;  3JCM g;  2BUD A;  3MCA B;  3G4S A;  1M4Z A;  3FLG A;  2DXC A;  3PIO A;  1KQS A;  2EYQ A;  3A5Z B;  4BE0 A;  5DM7 R;  5GAN 7;  4N0A C;  1K9M C;  3UDC A;  2P0K A;  4EPC A;  3JCM X;  1Y96 A;  3NTI A;  4HT9 A;  4XU0 A;  2ZPE B;  4BDY A;  3KUF A;  4RG8 A;  4NL3 A;  1K73 U;  3PNW C;  3SD4 A;  1YI2 A;  1S72 T;  3PIP A;  4C0G A;  1YIJ T;  4C5I A;  4BY6 C;  2CS7 A;  2LT4 A;  5FU7 C;  2RHI A;  3M5A A;  3M58 A;  4C8Q C;  1QVF S;  5GAN 2;  3GNF B;  1Q81 C;  2MWO A;  4M7A C;  4M77 B;  5KCH A;  1N9R A;  4EMK B;  1JJ2 S;  5FLX E;  5KH6 A;  4DQ2 A;  1XQH A;  2JNG A;  2A7Y A;  4ZGJ B;  4XTU A;  4EDU A;  1AHJ B;  2Y4Y A;  3L2Z A;  1M8V A;  2CZ0 B;  2K2V A;  2RI3 A;  4F7U B;  4OB2 B;  5GAM d;  3A8L B;  3CEY A;  1VQL T;  3M56 A;  4X34 A;  1I8F A;  1Y96 B;  4FIB A;  5KCO A;  3HKS A;  1KQS S;  2QQS A;  2QTX A;  2JTM A;  4QVZ A;  4XU1 A;  3SWN A;  4C92 G;  4C8Q B;  3G71 T;  2PUO B;  1M5Q 1;  4PKC C;  1PSF A;  3I56 T;  4C5G A;  2RH2 A;  2RJC A;  3CPW A;  2RJD A;  4A4K A;  4OVA A;  1VQO T;  1NPR A;  3H6Z A;  2GF7 A;  4IUR A;  5GAM f;  5GMK m;  2X4Y A;  4M7D G;  4M7D E;  1DJ7 B;  1Q82 U;  4NOY A;  4R56 A;  3CCQ A;  4PLL A;  5A2Q E;  3SWN C;  3JCM f;  4Y91 A;  2ZZD A;  1VQK T;  4MZM A;  3L2U A;  3MP1 A;  4LDY A;  2E41 A;  5GMK j;  4OP0 A;  3CC7 T;  1JBM A;  1RI0 A;  2FVU A;  2RI2 A;  4RCB A;  3JCM Q;  3CC7 A;  4JRQ A;  1W2B A;  5LJ5 d;  3LWI A;  3OYM A;  1M1G A;  2V8I A;  3JCM d;  2GFA A;  3S3N A;  4GY5 A;  2B8A A;  4PL6 A;  2ZPF B;  3JB9 D;  1HK9 A;  3VUZ A;  4C92 B;  1ZHI A;  4KUL A;  4C8Q A;  3OYG A;  4M78 C;  1VQP A;  3SWN B;  1Q82 C;  4XTV A;  1VIF A;  3T9N A;  1KG1 A;  3G4S T;  2RHZ A;  2P4T A;  4J5Y A;  2ZPB B;  2M0O A;  4DOV A;  4HCB A;  4M7D B;  2VGM A;  4EMH A;  3OS2 A;  3P8B B;  1XTD A;  2KY9 A;  1B34 A;  1I81 A;  1NE8 A;  2HAX A;  4V2S A;  2D9T A;  3OMG A;  3UT1 A;  3CCJ T;  2F69 A;  4M77 C;  3QSU A;  5CKF A;  4EMK C;  3S3O A;  1MGQ A;  1VQL A;  4EMK A;  3AHU A;  4PJO C;  3MP8 A;  2O01 E;  3OSV A;  4FL6 A;  1VQ9 T;  1VQ6 A;  2FL7 A;  5J3B A;  4F7U E;  2X35 A;  5CKB A;  2JUF A;  5GAN d;  2PVG B;  2DAQ A;  3CCJ A;  4E47 A;  2LDM A;  5IN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...