2RHZA

Crystal structure of the 3-mbt repeats from human l3mbtl1 with d355n point mutation
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
315
structure length
313
Chain Sequence
SWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVNRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 313
sequence length 315
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhzA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhzA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhzA03
3OYBA 3LLRA 3PMTA 4LD6A 1WJQA 2EQMA 1OYXA 3UT1A 2BUDA 3MEAA 4BE1A 3UWNA 4E7KA 3OYJA 4E7LA 4IUVA 2R5AA 2O4XB 2RI3A 3OMCA 4Z02A 3QJ6A 4N4IA 1WJRA 4IUPA 2CKKA 2RI5A 3QIIA 4PLLA 5J26A 3L2RA 3NTIA 1OZ2A 1G5VA 3OA6A 2RHYA 3OYKA 3L2QA 3S3OA 2DAQA 1RI0A 2LCCA 5FRNA 2RJFA 4PL6A 4BACA 2BIVA 4Q5WA 2QQSA 4C5EA 5KE2A 3OYAA 4HCZA 2RHUA 4FL6A 4GY5A 5CIUA 3DLMA 2RJDA 2M16A 2P0KA 3P8HA 4CRIA 2E6NA 3OYNA 3META 3OYEA 4IUTA 2F5KA 3LGLA 4QVZA 5C6SA 3OS0A 2R57A 3OB9A 2E5QA 3L2UA 3O8VA 2HQEA 2XDPA 3GOXA 4BDYA 1WJSA 4PLIA 5C0MA 3OYIA 2R5MA 5KCHA 2M1HA 4X34A 4OVAA 2B8AA 4NS5A 2D9TA 1KHCA 2DIQA 2RJCA 2GFUA 3MEWA 2X4WA 4UC4A 5FRMA 1WGSA 4QQGA 5D6YA 1XNIA 2X4YA 4QQ6A 5IAYA 5D6XA 3PMIA 3OYDA 1OI1A 2RO0A 3H8ZA 1MHNA 2K3YA 3E9GA 1OZ3A 2RI2A 3NTHA 4BE0A 2K3XA 3MP8A 5KCOA 2QQRA 3OY9A 3LGFA 3MEUA 3S3MA 3FC3A 4FU6A 3CEYA 2RHXA 2LTOA 3OYFA 2X4XA 3LX7A 4ZTFA 2LVMA 2RHZA 4A4HA 4C5GA 4IUUA 5FROA 2RJEA 2EQJA 2L8DA 2DIGA 3C4SA 4QQDA 3FEOA 2X35A 3H6ZA 3DB3A 3MP1A 3Q1JA 2EQUA 2YRVA 3QBYA 4N4HA 2XK0A 2VYTA 3OS1A 4C5IA 2LRQA 3MEVA 3ASKA 3S6WA 3ZEHA 3MO8A 3FDRA 3NTKA 3DB4A 2HQXA 2JZ2A 3FLGA 4N4GA 3SD4A 5KE3A 4II1A 3EAEA 2FHDA 2WACA 3OQ5A 3L2VA 2GFAA 2LDMA 4ZTJA 3OYMA 3F70A 4A4FA 2RHIA 3MP6A 4B9XA 4E7IA 2BKDN 3OMGA 4QW2A 3S3NA 2EKOA 4RG2A 3OYLA 2GF7A 3BDLA 2R58A 3LH0A 3E9FA 3LYIA 4E7HA 5J39A 2EQKA 2NLUA 2MWOA 4E7JA 5M9OA 4BDZA 1SSFA 2O4XA 4EDUA 3L42A 4IKFA 4C5HA 4IUQA 4IURA 2IG0A 3OYGA 4A4EA 3OYCA 2PQWA 3OYHA 3OS2A 4A4GA 1N27A 2MWPA 2EFIA 1H3ZA 5D6WA 3L2WA 3QKJA 3PNWC 2L89A 2M0OA 3KUFA 3M9QA 5IN1A 5KH6A 4BE2A 3P8DA 3ME9A 4L59A 2L3RA 4B9WA 4BD3A 3PFSA 2G3RA 2JTFA
chains in the Genus database with same CATH superfamily
3M0QA 2RA2A 2E64A 2HNIA 1K76A 4BE1A 3MCAB 3CMAA 1UFFA 2JT4A 2I0NA 3HHTB 2A0FB 1YJNA 5GJWB 3LWHA 2V1QA 3TSZA 2M0YA 3G71A 3OW2P 4DBQA 3L2QA 2LP5A 4X1VA 2DJQA 5DY9A 3RKWA 5I22A 3WVDB 3CXCS 1KC8C 2JNGA 2XD0A 2DTIA 3OYEA 1HK9A 3GBQA 2YUQA 1X2KA 3RR6A 2R57A 3L2ZA 3EFSA 3RESA 1FMWA 2NUPA 4X9CA 1YI2T 2B8AA 2YSQA 2FPDA 2DIQA 3R6NA 3QSUA 4KT0E 3MEWA 4FSXA 1VQOQ 3WXMB 5AYFA 5CCAA 3CPFA 1T0HA 4R0KA 3PIOA 2A36A 3MEUA 1KK7A 2CT3A 1ZSGA 1RAHB 1X2QA 5FU6B 2K6DA 2OJ2A 3CCJT 2RQWA 2ROLA 2SRCA 4LDXA 2RM4A 3M5AA 2MYSA 3BE3A 3A8LB 1YP5A 2EKOA 5IHNA 3OYLA 2XDDA 4PJOA 1AVZC 1QLYA 5FWBA 1NYFA 2ZGWA 1VQKT 4IUQA 3SDZA 2XI9A 2VASA 2PQWA 3QDRB 1KSWA 3CCRT 1H3ZA 1VOMA 2YXYA 4JZ3A 5EC7A 3ME9A 2J7IA 1YJ9A 1M8VA 5DLOA 3RUXA 2CZ0B 3CC4Q 2CYZB 2MMPA 4GLKA 2RNAA 4WCIA 2E70A 3QJYA 3VS3A 1JJ2P 3KBGA 1AD5A 3CXCA 4NL3A 4OP0A 4OB1B 1WI7A 5GMKe 2O88A 4M7AF 2ZPGB 1Y96A 4AFUC 2J6FA 2OAWA 2KY9A 2J6OA 3REBB 4N0AC 2FZKB 2C0OA 1PHTA 1Q82U 3TCJA 5IXBA 4J9DA 1S1NA 1NG2A 1YBYA 4M77C 3AT1B 1JJ2S 2PU9B 4RCCA 2ED0A 1XOVA 4M75E 2VYTA 3RDVA 2DYIA 2CP7A 2NUPB 4C5IA 3ZEHA 2IPOB 1AWJA 5C6SA 2DXTA 1GCQA 2BTTA 3PIPA 2E41A 1PC0A 2HMAA 5HCKA 2HD0A 1YWOA 2DL3A 3HRTA 2K7AA 2LZ6B 2JMCA 2E3HA 1AWWA 1M27C 5A0GA 2G6FX 1WHJA 1X75C 4JJBA 2KVQG 4LNPA 2FVUA 4EMKA 3QZ5B 1JB0E 4XTXA 2YLCA 3OYGA 1S72A 2A08A 4OB0B 3GPLA 2FL7A 3SWNC 2KYBA 1GCQC 4A4GA 1Q7YU 2XIDA 1M90R 5GAMg 3KUFA 4M75D 3QDFA 5EG2A 3N5BB 4LDYA 2P0QA 4PJOB 4OMLA 4LE9A 1WHMA 4E7KA 1CKBA 1VQPT 1WNLA 3I55A 5KYYA 3VS0A 1VQ4A 1IXDA 1VQ9T 1AWOA 1UDLA 4Z88A 3PTAA 2DTOA 1ZUYA 9ATCB 3CCVQ 2FRWA 3S3OA 1E7OA 2M51A 4LUEA 4C8QF 4L5GA 2BIVA 4J9BA 2YHTA 1QVGP 1MV0B 1YITT 2JJ9A 2RJDA 1AHJB 1KHIA 2MIOA 3EGDA 3CCQQ 2EYWA 1Y57A 1D1BA 3LGLA 3CCEA 8AT1B 2E5QA 2EYXA 4RG8A 3INZA 5GJVB 2QK0A 3L2UA 2KNBB 1UGPB 2OTLT 1M90C 2VXFA 4AFSC 2JM9A 5CAIA 2YWWA 2ROTA 2X4YA 3X24B 2X9HA 4KH1B 4DEYA 1BK2A 5IHIA 4DEXA 2DL4A 5KCOA 2QQRA 2XG8D 3CCLQ 2O9VA 1VQ7A 1QVGS 4XU0A 1OX9A 3QWYA 1JJ2A 3H0IA 3FRNA 3HPWA 1UE9A 4RTVA 2DIGA 3VJPA 4FYWB 1Y96B 2CSIA 2XK0A 3MEVA 3VKIA 5DM7R 1X43A 1PNJA 2EYYA 4M75G 2JTMA 4CC7A 3S3NA 5KYNA 1QWFA 2AT1B 3LH0A 4E7HA 5GAOl 1RLPC 1FXXA 3JCMX 4FT2A 1WHGA 1ZUKA 4KH0B 5LJ5g 2W0ZA 5ECAA 4M78F 1TWBA 3DLLA 1RLQC 2KI7A 2QGGA 1M1FA 4KUDK 2DEQA 1N6AA 3M53A 4LUDA 2GQVA 4NOYA 2LT1A 4PJMA 4XTYA 3UT1A 1IHVA 4E7LA 1ZBXA 3CMET 2VGMA 2R5AA 2RI3A 4EMKB 1VQ6T 2JXBA 3NHNA 2MPXC 3EG3A 3C0CA 1UJ0A 2KBTA 3R6OA 5HK3A 4R55A 1IB8A 2EJGA 2DXUA 3I56A 1VQ8T 3OYNA 3CC7T 2QEXA 1Q81C 5DLQE 4QVCA 2QGFB 1VQMA 4OMFB 5KYYB 2DJZA 2JMAA 1HYOA 1YJWT 3JCMg 4KGVB 2WSFE 2P84A 2K79A 1Q81U 4AG2C 1N5ZA 4FW1A 1YI2Q 1WQ7A 3VS4A 2K3YA 1M1GA 1QVFP 1SRLA 3EGDB 2P4RA 2K57A 1QVGA 4ZTFA 1BU1A 2L8DA 1N9SA 3V7CA 1KD1R 3RMSA 3J81E 1EX4A 4XQ3A 4Z8AA 2LJ3A 1OPLA 3UPUA 1RUWA 3SD4A 1KG1A 5KE3A 3CCJQ 2KT8A 1G3WA 5CVIA 4J5YA 1M3CA 2LQNA 1RL2A 1G2BA 2DFUA 4O6JA 2EQKA 2NLUA 3H0HA 3QO3A 1SSFA 2CDTA 4JRIA 2QQBA 4MDXA 4OB3B 1QVFS 1BKBA 4XU3A 5GANj 3CD6Q 2HL3A 2RH2A 2KRMA 1U1TA 3CCMA 3QKJA 1VQKQ 4BE2A 3ZFJA 1VQOA 2SEMA 2YRDA 4L59A 2BZYA 1VQ5T 2F2XA 4XU1A 3EHRA 2MK5A 3PGGA 4CC3A 4HCCA 4M7DC 5CKBA 1XQHA 1Q86U 1SHFA 2K5LA 1KD1C 1ZX6A 1VQNQ 2LNVA 4J83A 2NUZA 2D6FA 1JXMA 2RMOA 5GAMe 2KXCA 2DXBA 1RAEB 4C92C 3QZ9B 4M75F 2F69A 1UTIA 1ZHIA 5GMKh 1K8AC 4ZGJB 2X3XD 2OX7A 2VGNA 5KYWA 2ESWA 2CP3A 1SPKA 1FX7A 3G71T 4IUTA 3RKXA 5LJ3j 1BI0A 3THKA 1U8RA 3O8VA 1VYTA 3GOXA 2XDPA 1WHKA 3LW5E 4J9EA 1ZA2B 1M5Q1 1QKXA 4NS5A 2EIFA 3A8OB 3PE0A 4HCBA 1YNZA 1OULA 2E10A 1XNIA 4OB2B 3OYDA 5GAN8 3SB2A 1VQLA 4BE0A 1C6VX 1Y0MA 4ZGDB 4FU6A 4XTZA 1TUGB 4X9DA 5GAOr 2DKGA 2NYSA 2X51A 1SEMA 2LQWA 2KT1A 1ZA1B 4ZTJA 3F70A 4A4FA 5I11A 4JRKA 1PCXA 1TS9A 2QAZA 4P5NA 2V1RA 1YIJQ 5CKDA 4LDWA 3A8GB 1B7TA 3TSWA 5FU6C 2AKLA 3L42A 2JW4A 1QVFA 3U23A 2LX9A 4C8QE 4E47A 4CC2A 1ZSZA 4DA4A 1M3BA 4MZMA 3L2WA 4RTWA 1Z9QA 1NJIU 2QG9B 4F7UE 1QW1A 3A8MB 4M77E 3PFSA 3V8KA 3OYBA 3V7RA 3UF4A 1WA7A 1RAFB 5LJ5e 2EYQA 5I2SA 3CBMA 2ZPIB 4IUVA 3LWIA 1CSKA 2CKKA 5GAMj 2XMFA 1WFWA 3NTIA 1D0ZA 3MHXA 1ZSZC 5GAN6 1YJ9T 1W70A 1VQPQ 4OMNA 3PVLA 1WLPB 4FYVB 3JB9D 2ABLA 5KE2A 4XTUA 1BIBA 5CIUA 2OTJQ 3P8HA 1PRLC 4C8QD 1KFZA 3G4SA 1TOVA 1UHCA 2L3PA 1V76A 2F5KA 4QVZA 2C0IA 2QTXA 3RBBB 5GMKi 1M2VA 1YITQ 1M3AA 2RK2A 1WJSA 4M77D 3JCMb 4X34A 2BE9B 2MF2A 4QKUA 4EPCA 4MZTA 2A3LA 1U06A 3M0RA 3TVTA 4MMKA 5KYWB 1SRMA 4FIBA 4OF1A 2FO0A 5IHKA 1NM7A 2P4TA 3CBPA 2Y4YA 3JCMe 3FC3A 1Y07A 2H3JA 4M78E 3RIRA 1WYXA 3EG1A 3TREA 3ASKA 3NTKA 1TXQA 1BBZA 3MO8A 4K11A 4J6XA 2A28A 2PUKB 1QCNA 4RG2A 2FEIA 2QA4A 1K9MU 3BDLA 3OW2S 4RTUA 3CCQA 5J39A 2ZCFB 2ZPBB 1DJ7B 4EDUA 4M7AA 4KGXB 1QP3A 3PT9A 2DK3A 3I35A 1NLPC 3HTRA 2CP6A 2EYZA 1G3YA 3JB9G 2JN0A 2L89A 4M78D 3X28B 5GANg 3QPHA 4BD3A 1T3SA 3FLGA 4C8QG 1S72T 3G6EQ 1D0XA 4KBMB 1OOTA 1IRXA 4FYYB 5LJ5j 3OYJA 2DXCA 4LDVA 3E1SA 4M77G 3HKSA 1WJRA 4IUPA 2XKOC 3OA6A 1N8RU 1PG5B 1ZSZB 3BFMA 2QTVA 3CMEQ 3HFNA 3I55T 1Q82R 2JVVA 3A98A 4PFPA 3OYAA 4HCZA 4GY5A 1I4K1 3I5SA 4PJOC 2K2VA 1YWPA 3OS0A 4DOWA 2OI3A 5C0MA 1VQ8Q 2M1HA 2DBKA 1WQWA 5LJ3g 4OMPA 3CCET 1UECA 2OAUA 3CCUA 2A7YA 2DL7A 3J80E 1KQSP 1W4SA 1NZ9A 2FPEA 1GFDA 2VC8A 4AT1B 4JJDA 2RHZA 2HDAA 4IUUA 1M2VB 3GP8A 3MPUB 2LMJA 1Q7YR 1YHQQ 1Q95G 1Q82C 3S6WA 4RUGA 2CP0A 2HQXA 1O9SA 5L23A 2DX1A 3HFOA 4PJJA 2WACA 4M78G 1BI3A 1FMVA 1IHWA 3MP6A 2HEQA 1ZLMA 1D3BA 2EBPA 5CQXA 3OW2A 4ESRA 1OV3A 1X6GA 4BUGA 1WXBA 4C0FA 2FG0A 1KQSS 2ATCB 4LDUA 1V1CA 5IT9E 5CKHA 3C94A 3OYHA 3OS2A 3RERA 2RQUA 3HSBA 1QWEA 3JB9J 3EG9A 3PNWC 5LL6S 2M0OA 5IN1A 3HP9A 3P8DA 4J9CA 5GAMh 3KXTA 1YI2A 4VUBA 1JRIA 4PJOF 2FZGB 2E1HA 2DILA 1PM3A 1K1ZA 5HK0A 2YT6A 1Q7YC 5CKEA 4M7AB 2KQWA 3QJ6A 3QIIA 1I5OB 1SG5A 1OZ2A 5HKCA 1WDXA 1MNEA 1WHLA 1G3SA 1ACMB 2DAQA 1H641 1MGQA 2RB6A 3I5RA 4CI0C 5L8RE 2P0KA 2CUBA 1KQ2A 5GAOq 3UA7A 3ZL7C 3J7AF 3VS1A 2KGTA 2MAMA 4LXCA 3OB9A 2D8HA 4EMKC 3O5ZA 3CD6A 4JS5A 3I56T 3G71Q 4JS4A 3JB9F 2DRMA 2RJCA 4M7DE 1YCSB 1VQMT 2DMOA 1JO8A 3M4GA 5FU7B 2CGHA 2RI2A 3IQLA 1I07A 1CKAA 2PVDB 4F7UF 1VQNA 4M77F 5GAN2 2LTOA 3CCSA 2F2WA 4C92E 2EQJA 4QQDA 1M2OA 3VYGA 3FEOA 4J9FA 3QBYA 1VYVA 3EFRA 3BW1A 4JLGA 2GQIA 2FHDA 2X4JA 2DZCA 2GFAA 2DPPB 3JSCA 4A4KA 2CZ1B 2R58A 2E65A 1A0NB 2EGEA 1UG1A 1PD0A 1GL5A 4BDZA 4M7DD 2KAFA 3V7SA 1RAGB 5FWCA 2D0QB 1R0CB 1KQSA 1RACB 1T0JA 2RN8A 1VIFA 5LJ5f 5LJ5h 2EKHA 3UDCA 2MWPA 1TU0B 3BDUA 2EFIA 2GTJA 5I21A 4JJNK 1D3BB 1UEBA 4LD6A 3VS7A 3EG2A 1C0MA 2BUDA 2J05A 3FIFA 1W2BP 3CCMT 3M58A 4N4IA 4AFZC 5A0DA 2RI5A 1UGQB 5J26A 2DEUA 1NLOC 2DLPA 1Q81R 1BCOA 3M0PA 5GANe 1ARKA 1RI0A 4CC4B 4PL6A 3EG9B 1D1CA 3TEEA 4AG1C 2E5KA 2RHUA 4O5VA 1YIJA 4JRQA 1YJ9Q 4OMMA 1LNXA 5GAOm 2KYMA 3C12A 1IGQA 4PJLA 1V29B 1JEGA 2B86A 2K9GA 3JCMf 3JCMh 2Z0WA 5A2QE 2JOYA 5GMKl 4E6RA 2FZCB 5J3BA 1OI1A 2RO0A 4EMHA 1RADB 3EHQA 3OBYA 2VXEA 4E7ZA 1WX6A 3M54A 4M7DG 3CPWP 4M4ZA 3M59A 1KQ1A 3LX7A 5LJ3e 2RJEA 5GAN7 4V2SA 2CH4A 1VQLT 4RCBA 3JV3A 3VUZA 1IO6A 4M75A 3DB4A 1G83A 2QASA 1MV3A 2KRSA 3EAEA 1Z9ZA 3OYYA 2DL5A 3OYMA 4Z89A 2RHIA 4E7IA 2BKDN 1Q86R 2OTJA 4OMQA 2MWOA 2VVKA 2CH4W 1K73U 1FMKA 4J9IA 1YITA 2O2OA 1QVPA 2QQ9A 1VUBA 3ULRB 1LOJA 4PNOA 1H3HA 2EQIA 3RKYA 2KXDA 2L3RA 2DO3A 1WJQA 2EQMA 1K8AR 2MOXA 1MNDA 4J7IA 7AT1B 4HVVA 4PKCC 1IZ6A 4OGCA 1M1KU 5A0LA 1NBEB 4J9GA 1K0XA 3REAB 1BIAA 1VYUA 1Q86C 4WF2A 2HL5C 3ER0A 4XU2A 5D7UA 3M56A 4FL6A 3A5ZB 3H0FA 4C0DC 1QP2A 2NUTA 3CCRQ 2KE9A 2KRNA 2LQ8A 3I55Q 2ZZDA 2FB7A 1X01A 4ELYC 3CC2T 1WXUA 2HBPA 1PRMC 3JCMQ 2CZ7B 3G4ST 2VB6A 1U1SA 1GFCA 1AEYA 4ZN1A 2F1LA 4F04B 3CMAT 2DRKA 5D6YA 2LJ0A 3PMIA 1YJNT 3E9GA 3G6EA 4GBQA 4E7SA 3CCEQ 1GXIE 1NPRA 2X4XA 4A4HA 4ZN3A 3JB9H 1QKWA 3Q1JA 2COYA 3OS1A 2D8JA 2JZ2A 4EMGA 4A53A 2NWMA 4PJOE 1F1BB 4QW2A 2ENMA 4D6WA 1WIEA 1UHFA 2H8HA 1RAIB 4ATOA 5GAN5 1M30A 1VIEA 1LJOA 4GLMA 2DERA 1WZOA 1ZBJA 3FB9A 1LCKA 5HY6A 2QA4T 3OYCA 1NE8A 3CC4A 4J7FA 3URGA 4M75B 4E2FB 3M55A 3M9QA 5KH6A 2E4HA 1N9RA 3PMTA 1W6XA 4M7DF 3VYHB 3X25B 2DE0X 3A1PA 4DOVA 4PJOD 3MJXA 1NJIC 1YHQA 1OU9A 4C92F 2J6KA 1QMCA 2RK1A 2QQSA 2JM8A 4C0DB 2ZAEA 4LN2A 3FJ5A 1KIKA 1PSEA 4BDYA 1GCPA 4XTWA 2RD1A 2JS0A 3MKDA 3VRZA 6AT1B 2W10A 1K9MR 1EIFA 2I2LA 3EGUA 1SKUB 3BY7A 3PVQA 3JCMV 3TU4K 1VQ9Q 3I56Q 2O31A 3NTHA 1OPKA 2EW3A 1BYMA 1OU8A 2NUTB 2HKQB 1VQMQ 3VV0A 2HKNA 1X6BA 3CCUT 4IIOA 1YN8A 2LCLA 2X35A 3H6ZA 3RMQA 5LJ5d 4J6YA 1LVKA 2CP2A 1XTDA 2YRCA 2EJ9A 2OTLQ 1PSFA 4HCKA 4A54A 2Y4XA 2K5FA 3D7SB 2FPFA 1PWTA 2F5TX 4PJOG 1YFNA 2D1XA 3C95A 3P8BB 3NPFA 1N8RR 2GBQA 1R77A 2QDYB 3NMZC 1TTHB 3ZBDA 1K9MC 4ME7A 1K0SA 4KUIA 4ANJA 3CCVA 2DNUA 2DA9A 1G3TA 2CZ6B 3G7ZA 2C0TA 2X3WD 5GANf 5GANh 3LH5A 3UWNA 4BB7A 4HKEA 2COZA 2EVRA 1KC8U 4PLLA 3L2RA 2LCSA 3X26B 3UA6A 1MMGA 3JCMd 3AHUA 4YTLA 3OYKA 4FSSA 3CCMQ 1FYNA 4MDWA 3M0SA 3EH2A 4BACA 1UGRB 4Q5WA 2HCKA 3WVEB 3META 1N8RC 1R0BG 1JQQA 1MMNA 3CCLA 3CQTA 4M7AC 2E6ZA 4F7UG 1EFNA 1VA7A 2AK5A 4OVAA 2O01E 4RTTA 1KHCA 1AZGB 4C0ZA 1H8KA 4RTYA 5LJ3f 5LJ3h 1I5LA 4QQGA 1VQ6Q 2P0PA 4QQ6A 4QVDA 1TSFA 1XJWB 1VQ4T 2HSPA 1HJDA 3CD6T 2QQAA 1I1JA 3MP8A 3JCMP 1AT1B 1AOJA 3EGXA 4RKUE 1D09B 2LVMA 4C5GA 1B34A 4OMOA 3OYIA 1NPPA 5D6WA 3DB3A 3MP1A 1TH7A 2YRVA 3M4YA 4XK8E 2KMTA 3CC7Q 1ZQ1A 1X6OA 1VQNT 3CCST 2LDMA 1Y7XA 3VU3C 4B9XA 3OMGA 1YJWQ 1VQLQ 3KFVA 2CT4A 5FU7C 3HRSA 2RQTA 2CREA 2JUFA 4WTOB 2ED1A 1WXTA 1NEGA 4F17A 2ZPHB 3RNJA 4JUVA 4FW2A 2DYBA 4BI8B 4DBHA 1AWXA 2F2VA 2KK4A 4N0AA 1VQ7T 4C8QA 4FCYA 2RQVA 1NYGA 2G3RA 2JTFA 3A8HB 2WSEE 2EGCA 4HXJA 4F7UA 4M77A 2LT4A 4ZNXA 1I8FA 1D0YA 2JTEA 2CP5A 4Z02A 2IIMA 2L0AA 2RF0A 4RMOA 5CO7A 4F14A 2XICA 1WHHA 8ATCB 1JBMA 2GCXA 5FRNA 2RJFA 2BZ8A 4C8QC 2DTHA 4JRPA 2V8KA 2A37A 5GAMf 5GAOp 2DVEA 4A63B 2DVJA 5CK9A 4KULA 2VKNA 2HQEA 1B07A 3L1AA 2R5MA 1PKTA 1VQ5Q 2DETA 3SWNA 2M9UA 1YIJT 1HD3A 1K9AA 4QT7A 1W1FA 4UC4A 3CCJA 1WGSA 2K5IA 2PVOB 1PD1A 3CC2Q 3NGPA 3SEMA 2XU8A 3QG1A 3G1JA 3V8JA 2K3XA 3G4SQ 3EG0A 2BE7D 4FT4A 3QXEB 3CMAQ 5KYXA 1LPLA 3OYFA 3GF5A 5FROA 1YJNQ 3VUBA 5CR2A 4N4HA 4M78A 2V26A 2EPDA 2YUPA 4N4GA 4II1A 2QEXT 3L2VA 1VQKA 1OQKA 4ZGEB 1U5SA 5FW9A 1GBRA 2VWFA 3E9FA 3JAME 1M8MA 3CCRA 2LJ1A 5IH2A 2ZPFB 3EGXB 1KJWA 5FLXE 1B34B 1ABOA 2OTJT 3VS6A 1J3TA 4M78C 4BY6C 4JZ4A 2L3QA 4J6WA 4KRTA 4PFOA 2QA4Q 2L3SA 2E12A 4AMCA 3LLRA 4PFZA 1M9SA 1OYXA 5GMKj 3OMCA 3JCMW 4F16A 3JRZA 1UGVA 1RAAB 1H92A 1E6GA 2AIRB 3M0TA 2YUOA 4J9HA 3JCMJ 3JCMc 4C8QB 2YLBA 2Y90A 4C92D 1M90U 4XAXB 5CQYA 2HSEB 2LC4A 4HVUA 2M16A 2AZSA 4RTZA 2L2PA 3SHWA 4F7UB 1QCOA 4M77B 1BI2A 2AZVA 4PLIA 1VQOT 2GNCA 2PZ1A 4J8OA 2QDLA 1BB9A 4HT9A 2L5QA 1IREB 5FRMA 2KEAA 5CKFA 4D8KA 1SSHA 4RTXA 2FYKA 4JPBW 3EFOA 4DBFA 3SFMA 3M57A 1OZ3A 1K73R 3QHSA 3OY9A 3LGFA 2K3BA 2XHCA 2K4YA 2CSQA 1UUEA 1UGSB 3VS2A 1EZZB 4OGEA 3G6ET 3OSVA 2LRQA 3SWNB 3FDRA 1W2BS 2KR3A 2VUBA 2V8IA 2QYZA 3GIBA 3CCUQ 1U3OA 2EGAA 3I9QA 2LQKA 5GANd 2GF7A 4LD9K 4JDSA 2AHJB 2CS7A 2DM1A 3VS5A 1M1KR 4E7JA 5M9OA 2O4XA 5KYXB 2KSSA 4B6MA 4IKFA 4MZPA 3OSSC 1OEBA 3QUIA 2RQRA 3E19A 4BI4A 2ECZA 4M78B 4BY6B 1N27A 1D1AA 1VQPA 4R56A 1K73C 5GMKm 5AT1B 4PK4A 4C92G 1WPYA 3HL8A 3GNGA 1VQ9A 1IGUA 3MEAA 3CC4T 3OBWA 3GLXA 5GAN4 4PJNA 1I81A 1OX8A 1K4US 2YDLA 3M0UA 2MCNA 1G5VA 1G8XA 3CPWS 1ABQA 4M75C 5I2MA 5LJ3d 1O75A 2PTKA 2J06A 4Y91A 2D0NA 3V8LA 2M02A 2JS2A 2YUNA 2OTLA 1M1KC 1YHQT 4DQ2A 1X27A 4FYXB 1X69A 5IXFA 4FM4B 5GAOn 2DD5A 3NFCA 1S72Q 3DKMA 2KDSA 1TUCA 2GFUA 3TQ7P 3EH1A 1UJYA 2X4WA 3E2UA 5IAYA 5D6XA 4M7DA 4HA8A 2GGRA 1T3LA 1PKSA 3CEYA 2RHXA 1NEBA 1VQ4Q 4C0GA 1SF9A 3JB9I 1FWZA 3S3MA 2EQUA 3GNFB 3UATA 2E3IA 1RI9A 2RPNA 4C92A 4HT8A 3HRUA 4Y28E 1W2BA 1R8OB 3OQ5A 1GBQA 5KYUA 2XDBA 1YCYA 2BZXA 4XTVA 2DL8A 1QQJA 3EFOB 2V8JA 4M7AE 3LYIA 2LX7A 3T9NA 3CCSQ 3H41A 3FJPA 4ELZC 1SHGA 2IG0A 4A4EA 1MMDA 2AKKA 1ZUUA 1KD1U 1NJIR 1BCMA 3CMEA 2LNHB 2VV5A 1M4ZA 2FRYA 1AZEA 1TG0A 1VQ6A 1MMAA 2DBMA 5GAMd 4L6V5 1P92A 4TVRA 4JJCA 1VQ7Q 3CCVT 1K8AU 2O4XB 2DF6A 2KROA 2QI2A 4M7AD 1VQ8A 2CUDA 2RHYA 3CC7A 3CCQT 3CPWA 2HAXA 2LCCA 4EIKA 2K2MA 3CBOA 2ZPEB 4C5EA 1YJWA 4DBRA 3DLMA 3H9NA 4D8DA 1HSQA 1TUDA 4CRIA 2E6NA 1I0CA 2QXFA 1BI1A 2O9SA 1UB4A 2PUOB 3X20B 1MUZA 5KCHA 4BI3A 2EAYA 2D9TA 2DZ9A 1JXOA 1QCFA 2PNIA 3CCLT 4HVWA 1HXDA 2H3EB 2WSCE 3H8ZA 1MHNA 1C1AA 4MMLA 5GAN3 4AFQC 1E6HA 3VRYA 3C4SA 4ORZA 2EWNA 3OS5A 1JU5C 1Y71A 1GRIA 2EJFA 2PVGB 2COWA 2IVWA 4JLIA 4Y92A 1B3QA 4M7DB 2HZYA 2C06A 4NL2A 2HQHA 1KC8R 2DD4A 2QEXQ 4C5HA 4IURA 1VQ5A 4M7AG 3QWXX 1RABB 3QYHB 3CXCP 4IIMA 4C92B 2GTOA 3QYGB 2MI6A 2HBWA 3CC2A 5KYUB 4B9WA 4KGZB
chains in the Genus database with same CATH topology
1D3BB 1UEBA 3A8HB 2RA2A 2E64A 4LD6A 2WSEE 4XU1A 2HNIA 3PGGA 2BUDA 4BE1A 4HCCA 3MCAB 1XQHA 5CKBA 4F7UA 1Q86U 2K5LA 3FIFA 3CMAA 4M77A 2LT4A 1KD1C 3CCMT 3HHTB 2LNVA 1I8FA 4J83A 1YJNA 2D6FA 3M58A 4Z02A 4N4IA 5A0DA 3LWHA 2RI5A 1UGQB 5J26A 5GAMe 2DXBA 4RMOA 5GANe 3G71A 5CO7A 4C92C 3QZ9B 3L2QA 2XICA 2F69A 4M75F 1JBMA 1RI0A 2GCXA 5FRNA 1ZHIA 5GMKh 2RJFA 4PL6A 5DY9A 4C8QC 1K8AC 2DTHA 4ZGJB 3TEEA 4JRPA 2VGNA 2V8KA 3RKWA 3WVDB 2RHUA 3CXCS 5GAMf 1KC8C 1FX7A 2JNGA 5GAOp 4O5VA 1YIJA 2DVEA 4JRQA 5CK9A 3G71T 2DTIA 3OYEA 2XD0A 4IUTA 1LNXA 1HK9A 3RKXA 4KULA 5GAOm 3C12A 2R57A 5LJ3j 1BI0A 3L2ZA 3EFSA 1U8RA 3O8VA 2HQEA 2XDPA 3GOXA 1V29B 3L1AA 3RESA 3LW5E 2R5MA 1M5Q1 3SWNA 4X9CA 1YI2T 2M9UA 2B8AA 4NS5A 1YIJT 2EIFA 3JCMf 3A8OB 3JCMh 2DIQA 5A2QE 3QSUA 2JOYA 4KT0E 5GMKl 3MEWA 4HCBA 4UC4A 3CCJA 2E10A 1WGSA 2K5IA 5J3BA 2PVOB 4FSXA 1XNIA 4OB2B 3OYDA 5GAN8 3SB2A 3WXMB 5AYFA 1VQLA 1OI1A 2RO0A 4EMHA 2XU8A 3CPFA 5CCAA 4BE0A 3QG1A 3V8JA 2K3XA 3OBYA 2VXEA 3PIOA 4ZGDB 3MEUA 4FT4A 3M54A 3QXEB 4FU6A 4XTZA 4M7DG 5FU6B 3OYFA 3GF5A 3M59A 4X9DA 1KQ1A 3LX7A 3CCJT 5GAOr 5LJ3e 5FROA 2DKGA 2RJEA 5GAN7 3VUBA 4V2SA 5CR2A 1VQLT 4N4HA 4RCBA 3VUZA 4LDXA 4M78A 4M75A 3DB4A 2RM4A 4N4GA 3M5AA 4II1A 3EAEA 2QEXT 3L2VA 3OYYA 4ZTJA 3OYMA 3F70A 3A8LB 2RHIA 4A4FA 4E7IA 1VQKA 2BKDN 4JRKA 4ZGEB 2EKOA 3OYLA 2XDDA 2OTJA 4M7DC 4P5NA 4PJOA 3E9FA 3JAME 5CKDA 4LDWA 3CCRA 2MWOA 3A8GB 1K73U 5FU6C 3L42A 2ZPFB 5FLXE 1YITA 2ZGWA 1VQKT 4IUQA 3SDZA 1B34B 1QVFA 2XI9A 1QVPA 2OTJT 2QQ9A 2LX9A 2PQWA 4C8QE 4M78C 4BY6C 1VUBA 4E47A 1LOJA 4DA4A 3QDRB 4MZMA 3CCRT 1H3ZA 3L2WA 4J6WA 4PNOA 1NJIU 3RKYA 4F7UE 1QW1A 3ME9A 2L3RA 3A8MB 4M77E 2DO3A 3PFSA 3V8KA 2E12A 3OYBA 3LLRA 3V7RA 1WJQA 2EQMA 1M9SA 1OYXA 1YJ9A 5LJ5e 2EYQA 1M8VA 4J7IA 5DLOA 3RUXA 2CZ0B 5I2SA 5GMKj 4PKCC 1IZ6A 3CBMA 2ZPIB 3OMCA 4IUVA 3JCMW 3LWIA 4OGCA 3JRZA 1M1KU 5A0LA 2CKKA 5GAMj 1BIAA 3NTIA 3MHXA 1YJ9T 5GAN6 2CYZB 2MMPA 1Q86C 4GLKA 4WF2A 3ER0A 3JCMJ 3JB9D 4XU2A 3JCMc 2E70A 4C8QB 3QJYA 5KE2A 4XTUA 2YLBA 2Y90A 4C92D 1M90U 3KBGA 1BIBA 3M56A 4FL6A 2LC4A 4XAXB 5CIUA 5CQYA 2M16A 3CXCA 3A5ZB 3P8HA 4C8QD 4C0DC 1QP2A 3G4SA 4NL3A 4F7UB 4OP0A 2F5KA 4OB1B 4QVZA 4M77B 2LQ8A 2QTXA 2ZZDA 2FB7A 5GMKi 5GMKe 4M7AF 1BI2A 2ZPGB 1X01A 4ELYC 2RK2A 1WJSA 4PLIA 3CC2T 1Y96A 4M77D 1VQOT 3JCMb 4J8OA 4X34A 2HBPA 4HT9A 3JCMQ 2MF2A 2CZ7B 3G4ST 2L5QA 2KY9A 4EPCA 4MZTA 1U1SA 2A3LA 4ZN1A 1IREB 3CMAT 5FRMA 5CKFA 4N0AC 5D6YA 4MMKA 2FYKA 3PMIA 1YJNT 4FIBA 1Q82U 4OF1A 3E9GA 3M57A 1OZ3A 3SFMA 3TCJA 3QHSA 3G6EA 2P4TA 3OY9A 3CBPA 3LGFA 2Y4YA 3JCMe 3FC3A 1GXIE 1Y07A 2H3JA 1NPRA 1YBYA 2XHCA 4M77C 2K4YA 2X4XA 2PU9B 1JJ2S 4M78E 4RCCA 4A4HA 1XOVA 1UGSB 4M75E 3RIRA 4ZN3A 3JB9H 3Q1JA 4OGEA 3OS1A 2VYTA 3G6ET 3OSVA 4C5IA 2LRQA 3SWNB 3TREA 3ASKA 3ZEHA 5C6SA 3MO8A 3FDRA 3NTKA 2DXTA 1W2BS 2JZ2A 3PIPA 2E41A 4EMGA 2VUBA 4A53A 2HD0A 2V8IA 3GIBA 4J6XA 4PJOE 2PUKB 3HRTA 4QW2A 2LQKA 4D6WA 4RG2A 2QA4A 1K9MU 5GANd 2GF7A 3VYGA 3BDLA 4JDSA 5A0GA 3OW2S 4LD9K 1X75C 2AHJB 2CS7A 2KVQG 3CCQA 5J39A 4ATOA 2ZCFB 2ZPBB 2FVUA 4E7JA 5M9OA 5GAN5 1DJ7B 2O4XA 4EDUA 1VIEA 3QZ5B 4EMKA 1LJOA 4M7AA 1JB0E 1QP3A 2KSSA 4IKFA 3PT9A 4XTXA 2DK3A 4MZPA 3FB9A 2YLCA 3OSSC 3QUIA 5HY6A 2QA4T 3E19A 3OYGA 1S72A 4OB0B 1NE8A 3OYCA 4BI4A 2FL7A 3SWNC 3GPLA 3CC4A 4M78B 4BY6B 4J7FA 3URGA 4A4GA 1N27A 2XIDA 4M75B 1Q7YU 1VQPA 1G3YA 3JB9G 2JN0A 5GAMg 4R56A 1K73C 2L89A 5GMKm 3M55A 4M78D 4C92G 3X28B 3KUFA 3M9QA 1WPYA 5GANg 3QPHA 4M75D 5KH6A 3HL8A 5EG2A 3GNGA 4BD3A 1VQ9A 3FLGA 1N9RA 3N5BB 4C8QG 3PMTA 1S72T 4LDYA 2P0QA 4KBMB 5LJ5j 4M7DF 3MEAA 3CC4T 4PJOB 4E7KA 3OBWA 3VYHB 3OYJA 3GLXA 5GAN4 1VQPT 2DXCA 3X25B 1I81A 1WNLA 4LDVA 4DOVA 3I55A 4PJOD 3E1SA 1VQ4A 4M77G 1NJIC 3HKSA 1WJRA 4IUPA 1VQ9T 1YHQA 3PTAA 2XKOC 1G5VA 3OA6A 1N8RU 2DTOA 3CPWS 4C92F 4M75C 5I2MA 3BFMA 3S3OA 5LJ3d 1O75A 3HFNA 4Y91A 3V8LA 4C8QF 3I55T 2JVVA 4L5GA 2BIVA 2RK1A 2QQSA 2YHTA 1YITT 3OYAA 4HCZA 1M1KC 2OTLA 4GY5A 1I4K1 4DQ2A 2RJDA 1YHQT 1AHJB 1KHIA 4PJOC 4C0DB 2K2VA 3LGLA 3CCEA 3OS0A 4DOWA 2E5QA 4RG8A 1PSEA 3INZA 3L2UA 4BDYA 4FM4B 5GAOn 5C0MA 1UGPB 2DD5A 4XTWA 3OYIA 1M90C 2RD1A 2OTLT 2VXFA 2M1HA 3NFCA 3DKMA 1WQWA 5LJ3g 2KDSA 3CCET 5CAIA 2GFUA 2OAUA 2X4WA 1EIFA 2I2LA 3BY7A 3CCUA 2X4YA 2A7YA 3X24B 5IAYA 5D6XA 3J80E 3JCMV 3TU4K 1W4SA 1NZ9A 4M7DA 3NTHA 5KCOA 1BYMA 2QQRA 2VC8A 2XG8D 4HA8A 1VQ7A 1QVGS 3CEYA 4XU0A 2RHXA 3VV0A 2RHZA 3CCUT 1JJ2A 4IUUA 3GP8A 3FRNA 3HPWA 3VJPA 4C0GA 2DIGA 2LCLA 2X35A 3H6ZA 1FWZA 3JB9I 3RMQA 1Y96B 2EQUA 3GNFB 3S3MA 2XK0A 5LJ5d 3MEVA 3VKIA 5DM7R 3S6WA 1Q82C 4C92A 4J6YA 4HT8A 2HQXA 1O9SA 3HRUA 3HFOA 4Y28E 1W2BA 1R8OB 2WACA 4M78G 3OQ5A 4M75G 1BI3A 2JTMA 2XDBA 1XTDA 1YCYA 3MP6A 4XTVA 3S3NA 2EJ9A 1D3BA 1PSFA 2V8JA 4M7AE 3LH0A 5CQXA 4A54A 2Y4XA 3LYIA 2K5FA 5GAOl 3T9NA 3OW2A 4E7HA 1FXXA 2F5TX 4PJOG 4BUGA 3JCMX 3C95A 4FT2A 4C0FA 3P8BB 1KQSS 3FJPA 4LDUA 4ELZC 5LJ5g 5IT9E 2IG0A 2QDYB 5CKHA 4A4EA 3ZBDA 1K9MC 3C94A 4ME7A 3OS2A 4M78F 3OYHA 3RERA 4KUIA 1KD1U 3DLLA 4KUDK 1M1FA 3CCVA 3HSBA 3JB9J 2DEQA 3CMEA 2VV5A 1M4ZA 1N6AA 3PNWC 3M53A 5LL6S 2GQVA 1VQ6A 2M0OA 5IN1A 3HP9A 3P8DA 4NOYA 1G3TA 5GAMd 5GAMh 4L6V5 2LT1A 2CZ6B 3G7ZA 3KXTA 4VUBA 1YI2A 1JRIA 1P92A 4XTYA 4PJOF 5GANf 5GANh 3UT1A 2E1HA 4TVRA 3UWNA 4BB7A 4E7LA 4HKEA 5HK0A 1Q7YC 3CCVT 1K8AU 1ZBXA 3CMET 2VGMA 2R5AA 2O4XB 2RI3A 5CKEA 4M7AB 4EMKB 1VQ6T 2KQWA 1KC8U 3QJ6A 3QIIA 4PLLA 3L2RA 2QI2A 1OZ2A 3X26B 1VQ8A 4M7AD 3JCMd 3AHUA 5HKCA 2RHYA 4YTLA 3CC7A 3OYKA 1G3SA 3CCQT 3CPWA 2HAXA 2DAQA 2LCCA 4MDWA 1H641 1MGQA 3CBOA 2ZPEB 3R6OA 4BACA 1UGRB 4Q5WA 2RB6A 4C5EA 5HK3A 4R55A 1YJWA 3WVEB 2EJGA 4CI0C 2DXUA 3DLMA 2P0KA 5L8RE 3I56A 4CRIA 1VQ8T 2E6NA 3OYNA 3META 5GAOq 3CC7T 1N8RC 1KQ2A 3J7AF 2QXFA 2MAMA 1BI1A 2QEXA 5DLQE 1Q81C 3CCLA 3OB9A 4QVCA 1UB4A 2PUOB 1VQMA 4EMKC 4M7AC 2E6ZA 4OMFB 3X20B 4F7UG 2DJZA 1YJWT 3JCMg 3CD6A 5KCHA 4BI3A 3I56T 4JS5A 4OVAA 2O01E 2EAYA 2D9TA 2DZ9A 2WSFE 4JS4A 3JB9F 1KHCA 2RJCA 1Q81U 4C0ZA 3CCLT 5LJ3f 4M7DE 5LJ3h 1HXDA 1VQMT 4QQGA 1I5LA 2P0PA 4QQ6A 4QVDA 1VQ4T 2WSCE 3H8ZA 3CD6T 1WQ7A 1MHNA 2K3YA 2QQAA 3M4GA 1M1GA 2CGHA 2RI2A 4MMLA 5FU7B 3MP8A 3JCMP 5GAN3 2PVDB 4F7UF 2K57A 1VQNA 4M77F 5GAN2 2LTOA 3CCSA 1QVGA 4ZTFA 4RKUE 2LVMA 4C5GA 4C92E 1B34A 3C4SA 2EQJA 2L8DA 1NPPA 4QQDA 1N9SA 3FEOA 3V7CA 5D6WA 3DB3A 3MP1A 2EWNA 1TH7A 2YRVA 3M4YA 3OS5A 3QBYA 3EFRA 4XQ3A 3RMSA 3J81E 1Y71A 3UPUA 4XK8E 2KMTA 3SD4A 1KG1A 2EJFA 5KE3A 2PVGB 3BW1A 2IVWA 4JLGA 1ZQ1A 2FHDA 1X6OA 1VQNT 2X4JA 2DZCA 3CCST 2GFAA 2LDMA 4JLIA 1G3WA 1Y7XA 2DPPB 3JSCA 5CVIA 4J5YA 3VU3C 4A4KA 4B9XA 3OMGA 2CZ1B 2R58A 2E65A 5FU7C 1RL2A 3HRSA 4M7DB 2JUFA 2C06A 2EQKA 2NLUA 4NL2A 4O6JA 3QO3A 2DD4A 4BDZA 1SSFA 4M7DD 4JRIA 2KAFA 2QQBA 3V7SA 4C5HA 2D0QB 4MDXA 4OB3B 1KQSA 2ZPHB 1QVFS 4IURA 4JUVA 1VQ5A 4M7AG 1BKBA 4XU3A 1VIFA 5GANj 3QYHB 5LJ5f 4BI8B 5LJ5h 2RH2A 3UDCA 4C92B 2MWPA 3BDUA 2EFIA 2KK4A 1U1TA 3CCMA 3QYGB 4N0AA 1VQ7T 2MI6A 3QKJA 4C8QA 4BE2A 3ZFJA 3CC2A 5I21A 1VQOA 4L59A 4B9WA 4JJNK 1VQ5T 2G3RA 2JTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYB A;  3LLR A;  3PMT A;  4LD6 A;  1WJQ A;  2EQM A;  1OYX A;  3UT1 A;  2BUD A;  3MEA A;  4BE1 A;  3UWN A;  4E7K A;  3OYJ A;  4E7L A;  4IUV A;  2R5A A;  2O4X B;  2RI3 A;  3OMC A;  4Z02 A;  3QJ6 A;  4N4I A;  1WJR A;  4IUP A;  2CKK A;  2RI5 A;  3QII A;  4PLL A;  5J26 A;  3L2R A;  3NTI A;  1OZ2 A;  1G5V A;  3OA6 A;  2RHY A;  3OYK A;  3L2Q A;  3S3O A;  2DAQ A;  1RI0 A;  2LCC A;  5FRN A;  2RJF A;  4PL6 A;  4BAC A;  2BIV A;  4Q5W A;  2QQS A;  4C5E A;  5KE2 A;  3OYA A;  4HCZ A;  2RHU A;  4FL6 A;  4GY5 A;  5CIU A;  3DLM A;  2RJD A;  2M16 A;  2P0K A;  3P8H A;  4CRI A;  2E6N A;  3OYN A;  3MET A;  3OYE A;  4IUT A;  2F5K A;  3LGL A;  4QVZ A;  5C6S A;  3OS0 A;  2R57 A;  3OB9 A;  2E5Q A;  3L2U A;  3O8V A;  2HQE A;  2XDP A;  3GOX A;  4BDY A;  1WJS A;  4PLI A;  5C0M A;  3OYI A;  2R5M A;  5KCH A;  2M1H A;  4X34 A;  4OVA A;  2B8A A;  4NS5 A;  2D9T A;  1KHC A;  2DIQ A;  2RJC A;  2GFU A;  3MEW A;  2X4W A;  4UC4 A;  5FRM A;  1WGS A;  4QQG A;  5D6Y A;  1XNI A;  2X4Y A;  4QQ6 A;  5IAY A;  5D6X A;  3PMI A;  3OYD A;  1OI1 A;  2RO0 A;  3H8Z A;  1MHN A;  2K3Y A;  3E9G A;  1OZ3 A;  2RI2 A;  3NTH A;  4BE0 A;  2K3X A;  3MP8 A;  5KCO A;  2QQR A;  3OY9 A;  3LGF A;  3MEU A;  3S3M A;  3FC3 A;  4FU6 A;  3CEY A;  2RHX A;  2LTO A;  3OYF A;  2X4X A;  3LX7 A;  4ZTF A;  2LVM A;  2RHZ A;  4A4H A;  4C5G A;  4IUU A;  5FRO A;  2RJE A;  2EQJ A;  2L8D A;  2DIG A;  3C4S A;  4QQD A;  3FEO A;  2X35 A;  3H6Z A;  3DB3 A;  3MP1 A;  3Q1J A;  2EQU A;  2YRV A;  3QBY A;  4N4H A;  2XK0 A;  2VYT A;  3OS1 A;  4C5I A;  2LRQ A;  3MEV A;  3ASK A;  3S6W A;  3ZEH A;  3MO8 A;  3FDR A;  3NTK A;  3DB4 A;  2HQX A;  2JZ2 A;  3FLG A;  4N4G A;  3SD4 A;  5KE3 A;  4II1 A;  3EAE A;  2FHD A;  2WAC A;  3OQ5 A;  3L2V A;  2GFA A;  2LDM A;  4ZTJ A;  3OYM A;  3F70 A;  4A4F A;  2RHI A;  3MP6 A;  4B9X A;  4E7I A;  2BKD N;  3OMG A;  4QW2 A;  3S3N A;  2EKO A;  4RG2 A;  3OYL A;  2GF7 A;  3BDL A;  2R58 A;  3LH0 A;  3E9F A;  3LYI A;  4E7H A;  5J39 A;  2EQK A;  2NLU A;  2MWO A;  4E7J A;  5M9O A;  4BDZ A;  1SSF A;  2O4X A;  4EDU A;  3L42 A;  4IKF A;  4C5H A;  4IUQ A;  4IUR A;  2IG0 A;  3OYG A;  4A4E A;  3OYC A;  2PQW A;  3OYH A;  3OS2 A;  4A4G A;  1N27 A;  2MWP A;  2EFI A;  1H3Z A;  5D6W A;  3L2W A;  3QKJ A;  3PNW C;  2L89 A;  2M0O A;  3KUF A;  3M9Q A;  5IN1 A;  5KH6 A;  4BE2 A;  3P8D A;  3ME9 A;  4L59 A;  2L3R A;  4B9W A;  4BD3 A;  3PFS A;  2G3R A;  2JTF A; 
#chains in the Genus database with same CATH topology
 3M0Q A;  2RA2 A;  2E64 A;  2HNI A;  1K76 A;  4BE1 A;  3MCA B;  3CMA A;  1UFF A;  2JT4 A;  2I0N A;  3HHT B;  2A0F B;  1YJN A;  5GJW B;  3LWH A;  2V1Q A;  3TSZ A;  2M0Y A;  3G71 A;  3OW2 P;  4DBQ A;  3L2Q A;  2LP5 A;  4X1V A;  2DJQ A;  5DY9 A;  3RKW A;  5I22 A;  3WVD B;  3CXC S;  1KC8 C;  2JNG A;  2XD0 A;  2DTI A;  3OYE A;  1HK9 A;  3GBQ A;  2YUQ A;  1X2K A;  3RR6 A;  2R57 A;  3L2Z A;  3EFS A;  3RES A;  1FMW A;  2NUP A;  4X9C A;  1YI2 T;  2B8A A;  2YSQ A;  2FPD A;  2DIQ A;  3R6N A;  3QSU A;  4KT0 E;  3MEW A;  4FSX A;  1VQO Q;  3WXM B;  5AYF A;  5CCA A;  3CPF A;  1T0H A;  4R0K A;  3PIO A;  2A36 A;  3MEU A;  1KK7 A;  2CT3 A;  1ZSG A;  1RAH B;  1X2Q A;  5FU6 B;  2K6D A;  2OJ2 A;  3CCJ T;  2RQW A;  2ROL A;  2SRC A;  4LDX A;  2RM4 A;  3M5A A;  2MYS A;  3BE3 A;  3A8L B;  1YP5 A;  2EKO A;  5IHN A;  3OYL A;  2XDD A;  4PJO A;  1AVZ C;  1QLY A;  5FWB A;  1NYF A;  2ZGW A;  1VQK T;  4IUQ A;  3SDZ A;  2XI9 A;  2VAS A;  2PQW A;  3QDR B;  1KSW A;  3CCR T;  1H3Z A;  1VOM A;  2YXY A;  4JZ3 A;  5EC7 A;  3ME9 A;  2J7I A;  1YJ9 A;  1M8V A;  5DLO A;  3RUX A;  2CZ0 B;  3CC4 Q;  2CYZ B;  2MMP A;  4GLK A;  2RNA A;  4WCI A;  2E70 A;  3QJY A;  3VS3 A;  1JJ2 P;  3KBG A;  1AD5 A;  3CXC A;  4NL3 A;  4OP0 A;  4OB1 B;  1WI7 A;  5GMK e;  2O88 A;  4M7A F;  2ZPG B;  1Y96 A;  4AFU C;  2J6F A;  2OAW A;  2KY9 A;  2J6O A;  3REB B;  4N0A C;  2FZK B;  2C0O A;  1PHT A;  1Q82 U;  3TCJ A;  5IXB A;  4J9D A;  1S1N A;  1NG2 A;  1YBY A;  4M77 C;  3AT1 B;  1JJ2 S;  2PU9 B;  4RCC A;  2ED0 A;  1XOV A;  4M75 E;  2VYT A;  3RDV A;  2DYI A;  2CP7 A;  2NUP B;  4C5I A;  3ZEH A;  2IPO B;  1AWJ A;  5C6S A;  2DXT A;  1GCQ A;  2BTT A;  3PIP A;  2E41 A;  1PC0 A;  2HMA A;  5HCK A;  2HD0 A;  1YWO A;  2DL3 A;  3HRT A;  2K7A A;  2LZ6 B;  2JMC A;  2E3H A;  1AWW A;  1M27 C;  5A0G A;  2G6F X;  1WHJ A;  1X75 C;  4JJB A;  2KVQ G;  4LNP A;  2FVU A;  4EMK A;  3QZ5 B;  1JB0 E;  4XTX A;  2YLC A;  3OYG A;  1S72 A;  2A08 A;  4OB0 B;  3GPL A;  2FL7 A;  3SWN C;  2KYB A;  1GCQ C;  4A4G A;  1Q7Y U;  2XID A;  1M90 R;  5GAM g;  3KUF A;  4M75 D;  3QDF A;  5EG2 A;  3N5B B;  4LDY A;  2P0Q A;  4PJO B;  4OML A;  4LE9 A;  1WHM A;  4E7K A;  1CKB A;  1VQP T;  1WNL A;  3I55 A;  5KYY A;  3VS0 A;  1VQ4 A;  1IXD A;  1VQ9 T;  1AWO A;  1UDL A;  4Z88 A;  3PTA A;  2DTO A;  1ZUY A;  9ATC B;  3CCV Q;  2FRW A;  3S3O A;  1E7O A;  2M51 A;  4LUE A;  4C8Q F;  4L5G A;  2BIV A;  4J9B A;  2YHT A;  1QVG P;  1MV0 B;  1YIT T;  2JJ9 A;  2RJD A;  1AHJ B;  1KHI A;  2MIO A;  3EGD A;  3CCQ Q;  2EYW A;  1Y57 A;  1D1B A;  3LGL A;  3CCE A;  8AT1 B;  2E5Q A;  2EYX A;  4RG8 A;  3INZ A;  5GJV B;  2QK0 A;  3L2U A;  2KNB B;  1UGP B;  2OTL T;  1M90 C;  2VXF A;  4AFS C;  2JM9 A;  5CAI A;  2YWW A;  2ROT A;  2X4Y A;  3X24 B;  2X9H A;  4KH1 B;  4DEY A;  1BK2 A;  5IHI A;  4DEX A;  2DL4 A;  5KCO A;  2QQR A;  2XG8 D;  3CCL Q;  2O9V A;  1VQ7 A;  1QVG S;  4XU0 A;  1OX9 A;  3QWY A;  1JJ2 A;  3H0I A;  3FRN A;  3HPW A;  1UE9 A;  4RTV A;  2DIG A;  3VJP A;  4FYW B;  1Y96 B;  2CSI A;  2XK0 A;  3MEV A;  3VKI A;  5DM7 R;  1X43 A;  1PNJ A;  2EYY A;  4M75 G;  2JTM A;  4CC7 A;  3S3N A;  5KYN A;  1QWF A;  2AT1 B;  3LH0 A;  4E7H A;  5GAO l;  1RLP C;  1FXX A;  3JCM X;  4FT2 A;  1WHG A;  1ZUK A;  4KH0 B;  5LJ5 g;  2W0Z A;  5ECA A;  4M78 F;  1TWB A;  3DLL A;  1RLQ C;  2KI7 A;  2QGG A;  1M1F A;  4KUD K;  2DEQ A;  1N6A A;  3M53 A;  4LUD A;  2GQV A;  4NOY A;  2LT1 A;  4PJM A;  4XTY A;  3UT1 A;  1IHV A;  4E7L A;  1ZBX A;  3CME T;  2VGM A;  2R5A A;  2RI3 A;  4EMK B;  1VQ6 T;  2JXB A;  3NHN A;  2MPX C;  3EG3 A;  3C0C A;  1UJ0 A;  2KBT A;  3R6O A;  5HK3 A;  4R55 A;  1IB8 A;  2EJG A;  2DXU A;  3I56 A;  1VQ8 T;  3OYN A;  3CC7 T;  2QEX A;  1Q81 C;  5DLQ E;  4QVC A;  2QGF B;  1VQM A;  4OMF B;  5KYY B;  2DJZ A;  2JMA A;  1HYO A;  1YJW T;  3JCM g;  4KGV B;  2WSF E;  2P84 A;  2K79 A;  1Q81 U;  4AG2 C;  1N5Z A;  4FW1 A;  1YI2 Q;  1WQ7 A;  3VS4 A;  2K3Y A;  1M1G A;  1QVF P;  1SRL A;  3EGD B;  2P4R A;  2K57 A;  1QVG A;  4ZTF A;  1BU1 A;  2L8D A;  1N9S A;  3V7C A;  1KD1 R;  3RMS A;  3J81 E;  1EX4 A;  4XQ3 A;  4Z8A A;  2LJ3 A;  1OPL A;  3UPU A;  1RUW A;  3SD4 A;  1KG1 A;  5KE3 A;  3CCJ Q;  2KT8 A;  1G3W A;  5CVI A;  4J5Y A;  1M3C A;  2LQN A;  1RL2 A;  1G2B A;  2DFU A;  4O6J A;  2EQK A;  2NLU A;  3H0H A;  3QO3 A;  1SSF A;  2CDT A;  4JRI A;  2QQB A;  4MDX A;  4OB3 B;  1QVF S;  1BKB A;  4XU3 A;  5GAN j;  3CD6 Q;  2HL3 A;  2RH2 A;  2KRM A;  1U1T A;  3CCM A;  3QKJ A;  1VQK Q;  4BE2 A;  3ZFJ A;  1VQO A;  2SEM A;  2YRD A;  4L59 A;  2BZY A;  1VQ5 T;  2F2X A;  4XU1 A;  3EHR A;  2MK5 A;  3PGG A;  4CC3 A;  4HCC A;  4M7D C;  5CKB A;  1XQH A;  1Q86 U;  1SHF A;  2K5L A;  1KD1 C;  1ZX6 A;  1VQN Q;  2LNV A;  4J83 A;  2NUZ A;  2D6F A;  1JXM A;  2RMO A;  5GAM e;  2KXC A;  2DXB A;  1RAE B;  4C92 C;  3QZ9 B;  4M75 F;  2F69 A;  1UTI A;  1ZHI A;  5GMK h;  1K8A C;  4ZGJ B;  2X3X D;  2OX7 A;  2VGN A;  5KYW A;  2ESW A;  2CP3 A;  1SPK A;  1FX7 A;  3G71 T;  4IUT A;  3RKX A;  5LJ3 j;  1BI0 A;  3THK A;  1U8R A;  3O8V A;  1VYT A;  3GOX A;  2XDP A;  1WHK A;  3LW5 E;  4J9E A;  1ZA2 B;  1M5Q 1;  1QKX A;  4NS5 A;  2EIF A;  3A8O B;  3PE0 A;  4HCB A;  1YNZ A;  1OUL A;  2E10 A;  1XNI A;  4OB2 B;  3OYD A;  5GAN 8;  3SB2 A;  1VQL A;  4BE0 A;  1C6V X;  1Y0M A;  4ZGD B;  4FU6 A;  4XTZ A;  1TUG B;  4X9D A;  5GAO r;  2DKG A;  2NYS A;  2X51 A;  1SEM A;  2LQW A;  2KT1 A;  1ZA1 B;  4ZTJ A;  3F70 A;  4A4F A;  5I11 A;  4JRK A;  1PCX A;  1TS9 A;  2QAZ A;  4P5N A;  2V1R A;  1YIJ Q;  5CKD A;  4LDW A;  3A8G B;  1B7T A;  3TSW A;  5FU6 C;  2AKL A;  3L42 A;  2JW4 A;  1QVF A;  3U23 A;  2LX9 A;  4C8Q E;  4E47 A;  4CC2 A;  1ZSZ A;  4DA4 A;  1M3B A;  4MZM A;  3L2W A;  4RTW A;  1Z9Q A;  1NJI U;  2QG9 B;  4F7U E;  1QW1 A;  3A8M B;  4M77 E;  3PFS A;  3V8K A;  3OYB A;  3V7R A;  3UF4 A;  1WA7 A;  1RAF B;  5LJ5 e;  2EYQ A;  5I2S A;  3CBM A;  2ZPI B;  4IUV A;  3LWI A;  1CSK A;  2CKK A;  5GAM j;  2XMF A;  1WFW A;  3NTI A;  1D0Z A;  3MHX A;  1ZSZ C;  5GAN 6;  1YJ9 T;  1W70 A;  1VQP Q;  4OMN A;  3PVL A;  1WLP B;  4FYV B;  3JB9 D;  2ABL A;  5KE2 A;  4XTU A;  1BIB A;  5CIU A;  2OTJ Q;  3P8H A;  1PRL C;  4C8Q D;  1KFZ A;  3G4S A;  1TOV A;  1UHC A;  2L3P A;  1V76 A;  2F5K A;  4QVZ A;  2C0I A;  2QTX A;  3RBB B;  5GMK i;  1M2V A;  1YIT Q;  1M3A A;  2RK2 A;  1WJS A;  4M77 D;  3JCM b;  4X34 A;  2BE9 B;  2MF2 A;  4QKU A;  4EPC A;  4MZT A;  2A3L A;  1U06 A;  3M0R A;  3TVT A;  4MMK A;  5KYW B;  1SRM A;  4FIB A;  4OF1 A;  2FO0 A;  5IHK A;  1NM7 A;  2P4T A;  3CBP A;  2Y4Y A;  3JCM e;  3FC3 A;  1Y07 A;  2H3J A;  4M78 E;  3RIR A;  1WYX A;  3EG1 A;  3TRE A;  3ASK A;  3NTK A;  1TXQ A;  1BBZ A;  3MO8 A;  4K11 A;  4J6X A;  2A28 A;  2PUK B;  1QCN A;  4RG2 A;  2FEI A;  2QA4 A;  1K9M U;  3BDL A;  3OW2 S;  4RTU A;  3CCQ A;  5J39 A;  2ZCF B;  2ZPB B;  1DJ7 B;  4EDU A;  4M7A A;  4KGX B;  1QP3 A;  3PT9 A;  2DK3 A;  3I35 A;  1NLP C;  3HTR A;  2CP6 A;  2EYZ A;  1G3Y A;  3JB9 G;  2JN0 A;  2L89 A;  4M78 D;  3X28 B;  5GAN g;  3QPH A;  4BD3 A;  1T3S A;  3FLG A;  4C8Q G;  1S72 T;  3G6E Q;  1D0X A;  4KBM B;  1OOT A;  1IRX A;  4FYY B;  5LJ5 j;  3OYJ A;  2DXC A;  4LDV A;  3E1S A;  4M77 G;  3HKS A;  1WJR A;  4IUP A;  2XKO C;  3OA6 A;  1N8R U;  1PG5 B;  1ZSZ B;  3BFM A;  2QTV A;  3CME Q;  3HFN A;  3I55 T;  1Q82 R;  2JVV A;  3A98 A;  4PFP A;  3OYA A;  4HCZ A;  4GY5 A;  1I4K 1;  3I5S A;  4PJO C;  2K2V A;  1YWP A;  3OS0 A;  4DOW A;  2OI3 A;  5C0M A;  1VQ8 Q;  2M1H A;  2DBK A;  1WQW A;  5LJ3 g;  4OMP A;  3CCE T;  1UEC A;  2OAU A;  3CCU A;  2A7Y A;  2DL7 A;  3J80 E;  1KQS P;  1W4S A;  1NZ9 A;  2FPE A;  1GFD A;  2VC8 A;  4AT1 B;  4JJD A;  2RHZ A;  2HDA A;  4IUU A;  1M2V B;  3GP8 A;  3MPU B;  2LMJ A;  1Q7Y R;  1YHQ Q;  1Q95 G;  1Q82 C;  3S6W A;  4RUG A;  2CP0 A;  2HQX A;  1O9S A;  5L23 A;  2DX1 A;  3HFO A;  4PJJ A;  2WAC A;  4M78 G;  1BI3 A;  1FMV A;  1IHW A;  3MP6 A;  2HEQ A;  1ZLM A;  1D3B A;  2EBP A;  5CQX A;  3OW2 A;  4ESR A;  1OV3 A;  1X6G A;  4BUG A;  1WXB A;  4C0F A;  2FG0 A;  1KQS S;  2ATC B;  4LDU A;  1V1C A;  5IT9 E;  5CKH A;  3C94 A;  3OYH A;  3OS2 A;  3RER A;  2RQU A;  3HSB A;  1QWE A;  3JB9 J;  3EG9 A;  3PNW C;  5LL6 S;  2M0O A;  5IN1 A;  3HP9 A;  3P8D A;  4J9C A;  5GAM h;  3KXT A;  1YI2 A;  4VUB A;  1JRI A;  4PJO F;  2FZG B;  2E1H A;  2DIL A;  1PM3 A;  1K1Z A;  5HK0 A;  2YT6 A;  1Q7Y C;  5CKE A;  4M7A B;  2KQW A;  3QJ6 A;  3QII A;  1I5O B;  1SG5 A;  1OZ2 A;  5HKC A;  1WDX A;  1MNE A;  1WHL A;  1G3S A;  1ACM B;  2DAQ A;  1H64 1;  1MGQ A;  2RB6 A;  3I5R A;  4CI0 C;  5L8R E;  2P0K A;  2CUB A;  1KQ2 A;  5GAO q;  3UA7 A;  3ZL7 C;  3J7A F;  3VS1 A;  2KGT A;  2MAM A;  4LXC A;  3OB9 A;  2D8H A;  4EMK C;  3O5Z A;  3CD6 A;  4JS5 A;  3I56 T;  3G71 Q;  4JS4 A;  3JB9 F;  2DRM A;  2RJC A;  4M7D E;  1YCS B;  1VQM T;  2DMO A;  1JO8 A;  3M4G A;  5FU7 B;  2CGH A;  2RI2 A;  3IQL A;  1I07 A;  1CKA A;  2PVD B;  4F7U F;  1VQN A;  4M77 F;  5GAN 2;  2LTO A;  3CCS A;  2F2W A;  4C92 E;  2EQJ A;  4QQD A;  1M2O A;  3VYG A;  3FEO A;  4J9F A;  3QBY A;  1VYV A;  3EFR A;  3BW1 A;  4JLG A;  2GQI A;  2FHD A;  2X4J A;  2DZC A;  2GFA A;  2DPP B;  3JSC A;  4A4K A;  2CZ1 B;  2R58 A;  2E65 A;  1A0N B;  2EGE A;  1UG1 A;  1PD0 A;  1GL5 A;  4BDZ A;  4M7D D;  2KAF A;  3V7S A;  1RAG B;  5FWC A;  2D0Q B;  1R0C B;  1KQS A;  1RAC B;  1T0J A;  2RN8 A;  1VIF A;  5LJ5 f;  5LJ5 h;  2EKH A;  3UDC A;  2MWP A;  1TU0 B;  3BDU A;  2EFI A;  2GTJ A;  5I21 A;  4JJN K;  1D3B B;  1UEB A;  4LD6 A;  3VS7 A;  3EG2 A;  1C0M A;  2BUD A;  2J05 A;  3FIF A;  1W2B P;  3CCM T;  3M58 A;  4N4I A;  4AFZ C;  5A0D A;  2RI5 A;  1UGQ B;  5J26 A;  2DEU A;  1NLO C;  2DLP A;  1Q81 R;  1BCO A;  3M0P A;  5GAN e;  1ARK A;  1RI0 A;  4CC4 B;  4PL6 A;  3EG9 B;  1D1C A;  3TEE A;  4AG1 C;  2E5K A;  2RHU A;  4O5V A;  1YIJ A;  4JRQ A;  1YJ9 Q;  4OMM A;  1LNX A;  5GAO m;  2KYM A;  3C12 A;  1IGQ A;  4PJL A;  1V29 B;  1JEG A;  2B86 A;  2K9G A;  3JCM f;  3JCM h;  2Z0W A;  5A2Q E;  2JOY A;  5GMK l;  4E6R A;  2FZC B;  5J3B A;  1OI1 A;  2RO0 A;  4EMH A;  1RAD B;  3EHQ A;  3OBY A;  2VXE A;  4E7Z A;  1WX6 A;  3M54 A;  4M7D G;  3CPW P;  4M4Z A;  3M59 A;  1KQ1 A;  3LX7 A;  5LJ3 e;  2RJE A;  5GAN 7;  4V2S A;  2CH4 A;  1VQL T;  4RCB A;  3JV3 A;  3VUZ A;  1IO6 A;  4M75 A;  3DB4 A;  1G83 A;  2QAS A;  1MV3 A;  2KRS A;  3EAE A;  1Z9Z A;  3OYY A;  2DL5 A;  3OYM A;  4Z89 A;  2RHI A;  4E7I A;  2BKD N;  1Q86 R;  2OTJ A;  4OMQ A;  2MWO A;  2VVK A;  2CH4 W;  1K73 U;  1FMK A;  4J9I A;  1YIT A;  2O2O A;  1QVP A;  2QQ9 A;  1VUB A;  3ULR B;  1LOJ A;  4PNO A;  1H3H A;  2EQI A;  3RKY A;  2KXD A;  2L3R A;  2DO3 A;  1WJQ A;  2EQM A;  1K8A R;  2MOX A;  1MND A;  4J7I A;  7AT1 B;  4HVV A;  4PKC C;  1IZ6 A;  4OGC A;  1M1K U;  5A0L A;  1NBE B;  4J9G A;  1K0X A;  3REA B;  1BIA A;  1VYU A;  1Q86 C;  4WF2 A;  2HL5 C;  3ER0 A;  4XU2 A;  5D7U A;  3M56 A;  4FL6 A;  3A5Z B;  3H0F A;  4C0D C;  1QP2 A;  2NUT A;  3CCR Q;  2KE9 A;  2KRN A;  2LQ8 A;  3I55 Q;  2ZZD A;  2FB7 A;  1X01 A;  4ELY C;  3CC2 T;  1WXU A;  2HBP A;  1PRM C;  3JCM Q;  2CZ7 B;  3G4S T;  2VB6 A;  1U1S A;  1GFC A;  1AEY A;  4ZN1 A;  2F1L A;  4F04 B;  3CMA T;  2DRK A;  5D6Y A;  2LJ0 A;  3PMI A;  1YJN T;  3E9G A;  3G6E A;  4GBQ A;  4E7S A;  3CCE Q;  1GXI E;  1NPR A;  2X4X A;  4A4H A;  4ZN3 A;  3JB9 H;  1QKW A;  3Q1J A;  2COY A;  3OS1 A;  2D8J A;  2JZ2 A;  4EMG A;  4A53 A;  2NWM A;  4PJO E;  1F1B B;  4QW2 A;  2ENM A;  4D6W A;  1WIE A;  1UHF A;  2H8H A;  1RAI B;  4ATO A;  5GAN 5;  1M30 A;  1VIE A;  1LJO A;  4GLM A;  2DER A;  1WZO A;  1ZBJ A;  3FB9 A;  1LCK A;  5HY6 A;  2QA4 T;  3OYC A;  1NE8 A;  3CC4 A;  4J7F A;  3URG A;  4M75 B;  4E2F B;  3M55 A;  3M9Q A;  5KH6 A;  2E4H A;  1N9R A;  3PMT A;  1W6X A;  4M7D F;  3VYH B;  3X25 B;  2DE0 X;  3A1P A;  4DOV A;  4PJO D;  3MJX A;  1NJI C;  1YHQ A;  1OU9 A;  4C92 F;  2J6K A;  1QMC A;  2RK1 A;  2QQS A;  2JM8 A;  4C0D B;  2ZAE A;  4LN2 A;  3FJ5 A;  1KIK A;  1PSE A;  4BDY A;  1GCP A;  4XTW A;  2RD1 A;  2JS0 A;  3MKD A;  3VRZ A;  6AT1 B;  2W10 A;  1K9M R;  1EIF A;  2I2L A;  3EGU A;  1SKU B;  3BY7 A;  3PVQ A;  3JCM V;  3TU4 K;  1VQ9 Q;  3I56 Q;  2O31 A;  3NTH A;  1OPK A;  2EW3 A;  1BYM A;  1OU8 A;  2NUT B;  2HKQ B;  1VQM Q;  3VV0 A;  2HKN A;  1X6B A;  3CCU T;  4IIO A;  1YN8 A;  2LCL A;  2X35 A;  3H6Z A;  3RMQ A;  5LJ5 d;  4J6Y A;  1LVK A;  2CP2 A;  1XTD A;  2YRC A;  2EJ9 A;  2OTL Q;  1PSF A;  4HCK A;  4A54 A;  2Y4X A;  2K5F A;  3D7S B;  2FPF A;  1PWT A;  2F5T X;  4PJO G;  1YFN A;  2D1X A;  3C95 A;  3P8B B;  3NPF A;  1N8R R;  2GBQ A;  1R77 A;  2QDY B;  3NMZ C;  1TTH B;  3ZBD A;  1K9M C;  4ME7 A;  1K0S A;  4KUI A;  4ANJ A;  3CCV A;  2DNU A;  2DA9 A;  1G3T A;  2CZ6 B;  3G7Z A;  2C0T A;  2X3W D;  5GAN f;  5GAN h;  3LH5 A;  3UWN A;  4BB7 A;  4HKE A;  2COZ A;  2EVR A;  1KC8 U;  4PLL A;  3L2R A;  2LCS A;  3X26 B;  3UA6 A;  1MMG A;  3JCM d;  3AHU A;  4YTL A;  3OYK A;  4FSS A;  3CCM Q;  1FYN A;  4MDW A;  3M0S A;  3EH2 A;  4BAC A;  1UGR B;  4Q5W A;  2HCK A;  3WVE B;  3MET A;  1N8R C;  1R0B G;  1JQQ A;  1MMN A;  3CCL A;  3CQT A;  4M7A C;  2E6Z A;  4F7U G;  1EFN A;  1VA7 A;  2AK5 A;  4OVA A;  2O01 E;  4RTT A;  1KHC A;  1AZG B;  4C0Z A;  1H8K A;  4RTY A;  5LJ3 f;  5LJ3 h;  1I5L A;  4QQG A;  1VQ6 Q;  2P0P A;  4QQ6 A;  4QVD A;  1TSF A;  1XJW B;  1VQ4 T;  2HSP A;  1HJD A;  3CD6 T;  2QQA A;  1I1J A;  3MP8 A;  3JCM P;  1AT1 B;  1AOJ A;  3EGX A;  4RKU E;  1D09 B;  2LVM A;  4C5G A;  1B34 A;  4OMO A;  3OYI A;  1NPP A;  5D6W A;  3DB3 A;  3MP1 A;  1TH7 A;  2YRV A;  3M4Y A;  4XK8 E;  2KMT A;  3CC7 Q;  1ZQ1 A;  1X6O A;  1VQN T;  3CCS T;  2LDM A;  1Y7X A;  3VU3 C;  4B9X A;  3OMG A;  1YJW Q;  1VQL Q;  3KFV A;  2CT4 A;  5FU7 C;  3HRS A;  2RQT A;  2CRE A;  2JUF A;  4WTO B;  2ED1 A;  1WXT A;  1NEG A;  4F17 A;  2ZPH B;  3RNJ A;  4JUV A;  4FW2 A;  2DYB A;  4BI8 B;  4DBH A;  1AWX A;  2F2V A;  2KK4 A;  4N0A A;  1VQ7 T;  4C8Q A;  4FCY A;  2RQV A;  1NYG A;  2G3R A;  2JTF A;  3A8H B;  2WSE E;  2EGC A;  4HXJ A;  4F7U A;  4M77 A;  2LT4 A;  4ZNX A;  1I8F A;  1D0Y A;  2JTE A;  2CP5 A;  4Z02 A;  2IIM A;  2L0A A;  2RF0 A;  4RMO A;  5CO7 A;  4F14 A;  2XIC A;  1WHH A;  8ATC B;  1JBM A;  2GCX A;  5FRN A;  2RJF A;  2BZ8 A;  4C8Q C;  2DTH A;  4JRP A;  2V8K A;  2A37 A;  5GAM f;  5GAO p;  2DVE A;  4A63 B;  2DVJ A;  5CK9 A;  4KUL A;  2VKN A;  2HQE A;  1B07 A;  3L1A A;  2R5M A;  1PKT A;  1VQ5 Q;  2DET A;  3SWN A;  2M9U A;  1YIJ T;  1HD3 A;  1K9A A;  4QT7 A;  1W1F A;  4UC4 A;  3CCJ A;  1WGS A;  2K5I A;  2PVO B;  1PD1 A;  3CC2 Q;  3NGP A;  3SEM A;  2XU8 A;  3QG1 A;  3G1J A;  3V8J A;  2K3X A;  3G4S Q;  3EG0 A;  2BE7 D;  4FT4 A;  3QXE B;  3CMA Q;  5KYX A;  1LPL A;  3OYF A;  3GF5 A;  5FRO A;  1YJN Q;  3VUB A;  5CR2 A;  4N4H A;  4M78 A;  2V26 A;  2EPD A;  2YUP A;  4N4G A;  4II1 A;  2QEX T;  3L2V A;  1VQK A;  1OQK A;  4ZGE B;  1U5S A;  5FW9 A;  1GBR A;  2VWF A;  3E9F A;  3JAM E;  1M8M A;  3CCR A;  2LJ1 A;  5IH2 A;  2ZPF B;  3EGX B;  1KJW A;  5FLX E;  1B34 B;  1ABO A;  2OTJ T;  3VS6 A;  1J3T A;  4M78 C;  4BY6 C;  4JZ4 A;  2L3Q A;  4J6W A;  4KRT A;  4PFO A;  2QA4 Q;  2L3S A;  2E12 A;  4AMC A;  3LLR A;  4PFZ A;  1M9S A;  1OYX A;  5GMK j;  3OMC A;  3JCM W;  4F16 A;  3JRZ A;  1UGV A;  1RAA B;  1H92 A;  1E6G A;  2AIR B;  3M0T A;  2YUO A;  4J9H A;  3JCM J;  3JCM c;  4C8Q B;  2YLB A;  2Y90 A;  4C92 D;  1M90 U;  4XAX B;  5CQY A;  2HSE B;  2LC4 A;  4HVU A;  2M16 A;  2AZS A;  4RTZ A;  2L2P A;  3SHW A;  4F7U B;  1QCO A;  4M77 B;  1BI2 A;  2AZV A;  4PLI A;  1VQO T;  2GNC A;  2PZ1 A;  4J8O A;  2QDL A;  1BB9 A;  4HT9 A;  2L5Q A;  1IRE B;  5FRM A;  2KEA A;  5CKF A;  4D8K A;  1SSH A;  4RTX A;  2FYK A;  4JPB W;  3EFO A;  4DBF A;  3SFM A;  3M57 A;  1OZ3 A;  1K73 R;  3QHS A;  3OY9 A;  3LGF A;  2K3B A;  2XHC A;  2K4Y A;  2CSQ A;  1UUE A;  1UGS B;  3VS2 A;  1EZZ B;  4OGE A;  3G6E T;  3OSV A;  2LRQ A;  3SWN B;  3FDR A;  1W2B S;  2KR3 A;  2VUB A;  2V8I A;  2QYZ A;  3GIB A;  3CCU Q;  1U3O A;  2EGA A;  3I9Q A;  2LQK A;  5GAN d;  2GF7 A;  4LD9 K;  4JDS A;  2AHJ B;  2CS7 A;  2DM1 A;  3VS5 A;  1M1K R;  4E7J A;  5M9O A;  2O4X A;  5KYX B;  2KSS A;  4B6M A;  4IKF A;  4MZP A;  3OSS C;  1OEB A;  3QUI A;  2RQR A;  3E19 A;  4BI4 A;  2ECZ A;  4M78 B;  4BY6 B;  1N27 A;  1D1A A;  1VQP A;  4R56 A;  1K73 C;  5GMK m;  5AT1 B;  4PK4 A;  4C92 G;  1WPY A;  3HL8 A;  3GNG A;  1VQ9 A;  1IGU A;  3MEA A;  3CC4 T;  3OBW A;  3GLX A;  5GAN 4;  4PJN A;  1I81 A;  1OX8 A;  1K4U S;  2YDL A;  3M0U A;  2MCN A;  1G5V A;  1G8X A;  3CPW S;  1ABQ A;  4M75 C;  5I2M A;  5LJ3 d;  1O75 A;  2PTK A;  2J06 A;  4Y91 A;  2D0N A;  3V8L A;  2M02 A;  2JS2 A;  2YUN A;  2OTL A;  1M1K C;  1YHQ T;  4DQ2 A;  1X27 A;  4FYX B;  1X69 A;  5IXF A;  4FM4 B;  5GAO n;  2DD5 A;  3NFC A;  1S72 Q;  3DKM A;  2KDS A;  1TUC A;  2GFU A;  3TQ7 P;  3EH1 A;  1UJY A;  2X4W A;  3E2U A;  5IAY A;  5D6X A;  4M7D A;  4HA8 A;  2GGR A;  1T3L A;  1PKS A;  3CEY A;  2RHX A;  1NEB A;  1VQ4 Q;  4C0G A;  1SF9 A;  3JB9 I;  1FWZ A;  3S3M A;  2EQU A;  3GNF B;  3UAT A;  2E3I A;  1RI9 A;  2RPN A;  4C92 A;  4HT8 A;  3HRU A;  4Y28 E;  1W2B A;  1R8O B;  3OQ5 A;  1GBQ A;  5KYU A;  2XDB A;  1YCY A;  2BZX A;  4XTV A;  2DL8 A;  1QQJ A;  3EFO B;  2V8J A;  4M7A E;  3LYI A;  2LX7 A;  3T9N A;  3CCS Q;  3H41 A;  3FJP A;  4ELZ C;  1SHG A;  2IG0 A;  4A4E A;  1MMD A;  2AKK A;  1ZUU A;  1KD1 U;  1NJI R;  1BCM A;  3CME A;  2LNH B;  2VV5 A;  1M4Z A;  2FRY A;  1AZE A;  1TG0 A;  1VQ6 A;  1MMA A;  2DBM A;  5GAM d;  4L6V 5;  1P92 A;  4TVR A;  4JJC A;  1VQ7 Q;  3CCV T;  1K8A U;  2O4X B;  2DF6 A;  2KRO A;  2QI2 A;  4M7A D;  1VQ8 A;  2CUD A;  2RHY A;  3CC7 A;  3CCQ T;  3CPW A;  2HAX A;  2LCC A;  4EIK A;  2K2M A;  3CBO A;  2ZPE B;  4C5E A;  1YJW A;  4DBR A;  3DLM A;  3H9N A;  4D8D A;  1HSQ A;  1TUD A;  4CRI A;  2E6N A;  1I0C A;  2QXF A;  1BI1 A;  2O9S A;  1UB4 A;  2PUO B;  3X20 B;  1MUZ A;  5KCH A;  4BI3 A;  2EAY A;  2D9T A;  2DZ9 A;  1JXO A;  1QCF A;  2PNI A;  3CCL T;  4HVW A;  1HXD A;  2H3E B;  2WSC E;  3H8Z A;  1MHN A;  1C1A A;  4MML A;  5GAN 3;  4AFQ C;  1E6H A;  3VRY A;  3C4S A;  4ORZ A;  2EWN A;  3OS5 A;  1JU5 C;  1Y71 A;  1GRI A;  2EJF A;  2PVG B;  2COW A;  2IVW A;  4JLI A;  4Y92 A;  1B3Q A;  4M7D B;  2HZY A;  2C06 A;  4NL2 A;  2HQH A;  1KC8 R;  2DD4 A;  2QEX Q;  4C5H A;  4IUR A;  1VQ5 A;  4M7A G;  3QWX X;  1RAB B;  3QYH B;  3CXC P;  4IIM A;  4C92 B;  2GTO A;  3QYG B;  2MI6 A;  2HBW A;  3CC2 A;  5KYU B;  4B9W A;  4KGZ B; 
#chains in the Genus database with same CATH homology
 1D3B B;  1UEB A;  3A8H B;  2RA2 A;  2E64 A;  4LD6 A;  2WSE E;  4XU1 A;  2HNI A;  3PGG A;  2BUD A;  4BE1 A;  4HCC A;  3MCA B;  1XQH A;  5CKB A;  4F7U A;  1Q86 U;  2K5L A;  3FIF A;  3CMA A;  4M77 A;  2LT4 A;  1KD1 C;  3CCM T;  3HHT B;  2LNV A;  1I8F A;  4J83 A;  1YJN A;  2D6F A;  3M58 A;  4Z02 A;  4N4I A;  5A0D A;  3LWH A;  2RI5 A;  1UGQ B;  5J26 A;  5GAM e;  2DXB A;  4RMO A;  5GAN e;  3G71 A;  5CO7 A;  4C92 C;  3QZ9 B;  3L2Q A;  2XIC A;  2F69 A;  4M75 F;  1JBM A;  1RI0 A;  2GCX A;  5FRN A;  1ZHI A;  5GMK h;  2RJF A;  4PL6 A;  5DY9 A;  4C8Q C;  1K8A C;  2DTH A;  4ZGJ B;  3TEE A;  4JRP A;  2VGN A;  2V8K A;  3RKW A;  3WVD B;  2RHU A;  3CXC S;  5GAM f;  1KC8 C;  1FX7 A;  2JNG A;  5GAO p;  4O5V A;  1YIJ A;  2DVE A;  4JRQ A;  5CK9 A;  3G71 T;  2DTI A;  3OYE A;  2XD0 A;  4IUT A;  1LNX A;  1HK9 A;  3RKX A;  4KUL A;  5GAO m;  3C12 A;  2R57 A;  5LJ3 j;  1BI0 A;  3L2Z A;  3EFS A;  1U8R A;  3O8V A;  2HQE A;  2XDP A;  3GOX A;  1V29 B;  3L1A A;  3RES A;  3LW5 E;  2R5M A;  1M5Q 1;  3SWN A;  4X9C A;  1YI2 T;  2M9U A;  2B8A A;  4NS5 A;  1YIJ T;  2EIF A;  3JCM f;  3A8O B;  3JCM h;  2DIQ A;  5A2Q E;  3QSU A;  2JOY A;  4KT0 E;  5GMK l;  3MEW A;  4HCB A;  4UC4 A;  3CCJ A;  2E10 A;  1WGS A;  2K5I A;  5J3B A;  2PVO B;  4FSX A;  1XNI A;  4OB2 B;  3OYD A;  5GAN 8;  3SB2 A;  3WXM B;  5AYF A;  1VQL A;  1OI1 A;  2RO0 A;  4EMH A;  2XU8 A;  3CPF A;  5CCA A;  4BE0 A;  3QG1 A;  3V8J A;  2K3X A;  3OBY A;  2VXE A;  3PIO A;  4ZGD B;  3MEU A;  4FT4 A;  3M54 A;  3QXE B;  4FU6 A;  4XTZ A;  4M7D G;  5FU6 B;  3OYF A;  3GF5 A;  3M59 A;  4X9D A;  1KQ1 A;  3LX7 A;  3CCJ T;  5GAO r;  5LJ3 e;  5FRO A;  2DKG A;  2RJE A;  5GAN 7;  3VUB A;  4V2S A;  5CR2 A;  1VQL T;  4N4H A;  4RCB A;  3VUZ A;  4LDX A;  4M78 A;  4M75 A;  3DB4 A;  2RM4 A;  4N4G A;  3M5A A;  4II1 A;  3EAE A;  2QEX T;  3L2V A;  3OYY A;  4ZTJ A;  3OYM A;  3F70 A;  3A8L B;  2RHI A;  4A4F A;  4E7I A;  1VQK A;  2BKD N;  4JRK A;  4ZGE B;  2EKO A;  3OYL A;  2XDD A;  2OTJ A;  4M7D C;  4P5N A;  4PJO A;  3E9F A;  3JAM E;  5CKD A;  4LDW A;  3CCR A;  2MWO A;  3A8G B;  1K73 U;  5FU6 C;  3L42 A;  2ZPF B;  5FLX E;  1YIT A;  2ZGW A;  1VQK T;  4IUQ A;  3SDZ A;  1B34 B;  1QVF A;  2XI9 A;  1QVP A;  2OTJ T;  2QQ9 A;  2LX9 A;  2PQW A;  4C8Q E;  4M78 C;  4BY6 C;  1VUB A;  4E47 A;  1LOJ A;  4DA4 A;  3QDR B;  4MZM A;  3CCR T;  1H3Z A;  3L2W A;  4J6W A;  4PNO A;  1NJI U;  3RKY A;  4F7U E;  1QW1 A;  3ME9 A;  2L3R A;  3A8M B;  4M77 E;  2DO3 A;  3PFS A;  3V8K A;  2E12 A;  3OYB A;  3LLR A;  3V7R A;  1WJQ A;  2EQM A;  1M9S A;  1OYX A;  1YJ9 A;  5LJ5 e;  2EYQ A;  1M8V A;  4J7I A;  5DLO A;  3RUX A;  2CZ0 B;  5I2S A;  5GMK j;  4PKC C;  1IZ6 A;  3CBM A;  2ZPI B;  3OMC A;  4IUV A;  3JCM W;  3LWI A;  4OGC A;  3JRZ A;  1M1K U;  5A0L A;  2CKK A;  5GAM j;  1BIA A;  3NTI A;  3MHX A;  1YJ9 T;  5GAN 6;  2CYZ B;  2MMP A;  1Q86 C;  4GLK A;  4WF2 A;  3ER0 A;  3JCM J;  3JB9 D;  4XU2 A;  3JCM c;  2E70 A;  4C8Q B;  3QJY A;  5KE2 A;  4XTU A;  2YLB A;  2Y90 A;  4C92 D;  1M90 U;  3KBG A;  1BIB A;  3M56 A;  4FL6 A;  2LC4 A;  4XAX B;  5CIU A;  5CQY A;  2M16 A;  3CXC A;  3A5Z B;  3P8H A;  4C8Q D;  4C0D C;  1QP2 A;  3G4S A;  4NL3 A;  4F7U B;  4OP0 A;  2F5K A;  4OB1 B;  4QVZ A;  4M77 B;  2LQ8 A;  2QTX A;  2ZZD A;  2FB7 A;  5GMK i;  5GMK e;  4M7A F;  1BI2 A;  2ZPG B;  1X01 A;  4ELY C;  2RK2 A;  1WJS A;  4PLI A;  3CC2 T;  1Y96 A;  4M77 D;  1VQO T;  3JCM b;  4J8O A;  4X34 A;  2HBP A;  4HT9 A;  3JCM Q;  2MF2 A;  2CZ7 B;  3G4S T;  2L5Q A;  2KY9 A;  4EPC A;  4MZT A;  1U1S A;  2A3L A;  4ZN1 A;  1IRE B;  3CMA T;  5FRM A;  5CKF A;  4N0A C;  5D6Y A;  4MMK A;  2FYK A;  3PMI A;  1YJN T;  4FIB A;  1Q82 U;  4OF1 A;  3E9G A;  3M57 A;  1OZ3 A;  3SFM A;  3TCJ A;  3QHS A;  3G6E A;  2P4T A;  3OY9 A;  3CBP A;  3LGF A;  2Y4Y A;  3JCM e;  3FC3 A;  1GXI E;  1Y07 A;  2H3J A;  1NPR A;  1YBY A;  2XHC A;  4M77 C;  2K4Y A;  2X4X A;  2PU9 B;  1JJ2 S;  4M78 E;  4RCC A;  4A4H A;  1XOV A;  1UGS B;  4M75 E;  3RIR A;  4ZN3 A;  3JB9 H;  3Q1J A;  4OGE A;  3OS1 A;  2VYT A;  3G6E T;  3OSV A;  4C5I A;  2LRQ A;  3SWN B;  3TRE A;  3ASK A;  3ZEH A;  5C6S A;  3MO8 A;  3FDR A;  3NTK A;  2DXT A;  1W2B S;  2JZ2 A;  3PIP A;  2E41 A;  4EMG A;  2VUB A;  4A53 A;  2HD0 A;  2V8I A;  3GIB A;  4J6X A;  4PJO E;  2PUK B;  3HRT A;  4QW2 A;  2LQK A;  4D6W A;  4RG2 A;  2QA4 A;  1K9M U;  5GAN d;  2GF7 A;  3VYG A;  3BDL A;  4JDS A;  5A0G A;  3OW2 S;  4LD9 K;  1X75 C;  2AHJ B;  2CS7 A;  2KVQ G;  3CCQ A;  5J39 A;  4ATO A;  2ZCF B;  2ZPB B;  2FVU A;  4E7J A;  5M9O A;  5GAN 5;  1DJ7 B;  2O4X A;  4EDU A;  1VIE A;  3QZ5 B;  4EMK A;  1LJO A;  4M7A A;  1JB0 E;  1QP3 A;  2KSS A;  4IKF A;  3PT9 A;  4XTX A;  2DK3 A;  4MZP A;  3FB9 A;  2YLC A;  3OSS C;  3QUI A;  5HY6 A;  2QA4 T;  3E19 A;  3OYG A;  1S72 A;  4OB0 B;  1NE8 A;  3OYC A;  4BI4 A;  2FL7 A;  3SWN C;  3GPL A;  3CC4 A;  4M78 B;  4BY6 B;  4J7F A;  3URG A;  4A4G A;  1N27 A;  2XID A;  4M75 B;  1Q7Y U;  1VQP A;  1G3Y A;  3JB9 G;  2JN0 A;  5GAM g;  4R56 A;  1K73 C;  2L89 A;  5GMK m;  3M55 A;  4M78 D;  4C92 G;  3X28 B;  3KUF A;  3M9Q A;  1WPY A;  5GAN g;  3QPH A;  4M75 D;  5KH6 A;  3HL8 A;  5EG2 A;  3GNG A;  4BD3 A;  1VQ9 A;  3FLG A;  1N9R A;  3N5B B;  4C8Q G;  3PMT A;  1S72 T;  4LDY A;  2P0Q A;  4KBM B;  5LJ5 j;  4M7D F;  3MEA A;  3CC4 T;  4PJO B;  4E7K A;  3OBW A;  3VYH B;  3OYJ A;  3GLX A;  5GAN 4;  1VQP T;  2DXC A;  3X25 B;  1I81 A;  1WNL A;  4LDV A;  4DOV A;  3I55 A;  4PJO D;  3E1S A;  1VQ4 A;  4M77 G;  1NJI C;  3HKS A;  1WJR A;  4IUP A;  1VQ9 T;  1YHQ A;  3PTA A;  2XKO C;  1G5V A;  3OA6 A;  1N8R U;  2DTO A;  3CPW S;  4C92 F;  4M75 C;  5I2M A;  3BFM A;  3S3O A;  5LJ3 d;  1O75 A;  3HFN A;  4Y91 A;  3V8L A;  4C8Q F;  3I55 T;  2JVV A;  4L5G A;  2BIV A;  2RK1 A;  2QQS A;  2YHT A;  1YIT T;  3OYA A;  4HCZ A;  1M1K C;  2OTL A;  4GY5 A;  1I4K 1;  4DQ2 A;  2RJD A;  1YHQ T;  1AHJ B;  1KHI A;  4PJO C;  4C0D B;  2K2V A;  3LGL A;  3CCE A;  3OS0 A;  4DOW A;  2E5Q A;  4RG8 A;  1PSE A;  3INZ A;  3L2U A;  4BDY A;  4FM4 B;  5GAO n;  5C0M A;  1UGP B;  2DD5 A;  4XTW A;  3OYI A;  1M90 C;  2RD1 A;  2OTL T;  2VXF A;  2M1H A;  3NFC A;  3DKM A;  1WQW A;  5LJ3 g;  2KDS A;  3CCE T;  5CAI A;  2GFU A;  2OAU A;  2X4W A;  1EIF A;  2I2L A;  3BY7 A;  3CCU A;  2X4Y A;  2A7Y A;  3X24 B;  5IAY A;  5D6X A;  3J80 E;  3JCM V;  3TU4 K;  1W4S A;  1NZ9 A;  4M7D A;  3NTH A;  5KCO A;  1BYM A;  2QQR A;  2VC8 A;  2XG8 D;  4HA8 A;  1VQ7 A;  1QVG S;  3CEY A;  4XU0 A;  2RHX A;  3VV0 A;  2RHZ A;  3CCU T;  1JJ2 A;  4IUU A;  3GP8 A;  3FRN A;  3HPW A;  3VJP A;  4C0G A;  2DIG A;  2LCL A;  2X35 A;  3H6Z A;  1FWZ A;  3JB9 I;  3RMQ A;  1Y96 B;  2EQU A;  3GNF B;  3S3M A;  2XK0 A;  5LJ5 d;  3MEV A;  3VKI A;  5DM7 R;  3S6W A;  1Q82 C;  4C92 A;  4J6Y A;  4HT8 A;  2HQX A;  1O9S A;  3HRU A;  3HFO A;  4Y28 E;  1W2B A;  1R8O B;  2WAC A;  4M78 G;  3OQ5 A;  4M75 G;  1BI3 A;  2JTM A;  2XDB A;  1XTD A;  1YCY A;  3MP6 A;  4XTV A;  3S3N A;  2EJ9 A;  1D3B A;  1PSF A;  2V8J A;  4M7A E;  3LH0 A;  5CQX A;  4A54 A;  2Y4X A;  3LYI A;  2K5F A;  5GAO l;  3T9N A;  3OW2 A;  4E7H A;  1FXX A;  2F5T X;  4PJO G;  4BUG A;  3JCM X;  3C95 A;  4FT2 A;  4C0F A;  3P8B B;  1KQS S;  3FJP A;  4LDU A;  4ELZ C;  5LJ5 g;  5IT9 E;  2IG0 A;  2QDY B;  5CKH A;  4A4E A;  3ZBD A;  1K9M C;  3C94 A;  4ME7 A;  3OS2 A;  4M78 F;  3OYH A;  3RER A;  4KUI A;  1KD1 U;  3DLL A;  4KUD K;  1M1F A;  3CCV A;  3HSB A;  3JB9 J;  2DEQ A;  3CME A;  2VV5 A;  1M4Z A;  1N6A A;  3PNW C;  3M53 A;  5LL6 S;  2GQV A;  1VQ6 A;  2M0O A;  5IN1 A;  3HP9 A;  3P8D A;  4NOY A;  1G3T A;  5GAM d;  5GAM h;  4L6V 5;  2LT1 A;  2CZ6 B;  3G7Z A;  3KXT A;  4VUB A;  1YI2 A;  1JRI A;  1P92 A;  4XTY A;  4PJO F;  5GAN f;  5GAN h;  3UT1 A;  2E1H A;  4TVR A;  3UWN A;  4BB7 A;  4E7L A;  4HKE A;  5HK0 A;  1Q7Y C;  3CCV T;  1K8A U;  1ZBX A;  3CME T;  2VGM A;  2R5A A;  2O4X B;  2RI3 A;  5CKE A;  4M7A B;  4EMK B;  1VQ6 T;  2KQW A;  1KC8 U;  3QJ6 A;  3QII A;  4PLL A;  3L2R A;  2QI2 A;  1OZ2 A;  3X26 B;  1VQ8 A;  4M7A D;  3JCM d;  3AHU A;  5HKC A;  2RHY A;  4YTL A;  3CC7 A;  3OYK A;  1G3S A;  3CCQ T;  3CPW A;  2HAX A;  2DAQ A;  2LCC A;  4MDW A;  1H64 1;  1MGQ A;  3CBO A;  2ZPE B;  3R6O A;  4BAC A;  1UGR B;  4Q5W A;  2RB6 A;  4C5E A;  5HK3 A;  4R55 A;  1YJW A;  3WVE B;  2EJG A;  4CI0 C;  2DXU A;  3DLM A;  2P0K A;  5L8R E;  3I56 A;  4CRI A;  1VQ8 T;  2E6N A;  3OYN A;  3MET A;  5GAO q;  3CC7 T;  1N8R C;  1KQ2 A;  3J7A F;  2QXF A;  2MAM A;  1BI1 A;  2QEX A;  5DLQ E;  1Q81 C;  3CCL A;  3OB9 A;  4QVC A;  1UB4 A;  2PUO B;  1VQM A;  4EMK C;  4M7A C;  2E6Z A;  4OMF B;  3X20 B;  4F7U G;  2DJZ A;  1YJW T;  3JCM g;  3CD6 A;  5KCH A;  4BI3 A;  3I56 T;  4JS5 A;  4OVA A;  2O01 E;  2EAY A;  2D9T A;  2DZ9 A;  2WSF E;  4JS4 A;  3JB9 F;  1KHC A;  2RJC A;  1Q81 U;  4C0Z A;  3CCL T;  5LJ3 f;  4M7D E;  5LJ3 h;  1HXD A;  1VQM T;  4QQG A;  1I5L A;  2P0P A;  4QQ6 A;  4QVD A;  1VQ4 T;  2WSC E;  3H8Z A;  3CD6 T;  1WQ7 A;  1MHN A;  2K3Y A;  2QQA A;  3M4G A;  1M1G A;  2CGH A;  2RI2 A;  4MML A;  5FU7 B;  3MP8 A;  3JCM P;  5GAN 3;  2PVD B;  4F7U F;  2K57 A;  1VQN A;  4M77 F;  5GAN 2;  2LTO A;  3CCS A;  1QVG A;  4ZTF A;  4RKU E;  2LVM A;  4C5G A;  4C92 E;  1B34 A;  3C4S A;  2EQJ A;  2L8D A;  1NPP A;  4QQD A;  1N9S A;  3FEO A;  3V7C A;  5D6W A;  3DB3 A;  3MP1 A;  2EWN A;  1TH7 A;  2YRV A;  3M4Y A;  3OS5 A;  3QBY A;  3EFR A;  4XQ3 A;  3RMS A;  3J81 E;  1Y71 A;  3UPU A;  4XK8 E;  2KMT A;  3SD4 A;  1KG1 A;  2EJF A;  5KE3 A;  2PVG B;  3BW1 A;  2IVW A;  4JLG A;  1ZQ1 A;  2FHD A;  1X6O A;  1VQN T;  2X4J A;  2DZC A;  3CCS T;  2GFA A;  2LDM A;  4JLI A;  1G3W A;  1Y7X A;  2DPP B;  3JSC A;  5CVI A;  4J5Y A;  3VU3 C;  4A4K A;  4B9X A;  3OMG A;  2CZ1 B;  2R58 A;  2E65 A;  5FU7 C;  1RL2 A;  3HRS A;  4M7D B;  2JUF A;  2C06 A;  2EQK A;  2NLU A;  4NL2 A;  4O6J A;  3QO3 A;  2DD4 A;  4BDZ A;  1SSF A;  4M7D D;  4JRI A;  2KAF A;  2QQB A;  3V7S A;  4C5H A;  2D0Q B;  4MDX A;  4OB3 B;  1KQS A;  2ZPH B;  1QVF S;  4IUR A;  4JUV A;  1VQ5 A;  4M7A G;  1BKB A;  4XU3 A;  1VIF A;  5GAN j;  3QYH B;  5LJ5 f;  4BI8 B;  5LJ5 h;  2RH2 A;  3UDC A;  4C92 B;  2MWP A;  3BDU A;  2EFI A;  2KK4 A;  1U1T A;  3CCM A;  3QYG B;  4N0A A;  1VQ7 T;  2MI6 A;  3QKJ A;  4C8Q A;  4BE2 A;  3ZFJ A;  3CC2 A;  5I21 A;  1VQO A;  4L59 A;  4B9W A;  4JJN K;  1VQ5 T;  2G3R A;  2JTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...