2E12A

The crystal structure of xc5848 from xanthomonas campestris adopting a novel variant of sm-like motif
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
93
structure length
93
Chain Sequence
MPKYAPHVYTEQAQIATLEHWVKLLDGQERVRIELDDGSMIAGTVAVRPTIQTYRDEQEREGSNGQLRIDHLDASQEPQWIWMDRIVAVHPMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Hypothetical protein XCC3642
publication title XC5848, an ORFan protein from Xanthomonas campestris, adopts a novel variant of Sm-like motif
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
total genus 22
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11607 DUF3247 Protein of unknown function (DUF3247)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.720 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e12A00
2E12A
chains in the Genus database with same CATH superfamily
4KRTA 3L2WA 4HCZA 5IXFA 4C0DB 4DQ2A 4A53A 3LWHA 3CCQQ 5HY6A 3ME9A 4FYYB 4FSXA 1GL5A 3UT1A 4C8QB 4NL2A 3I35A 1VQMT 3VS7A 5GMKl 3CCET 4IIMA 5HCKA 5CCAA 1QVPA 3CCVT 4E7IA 2GQIA 4WF2A 3CMET 3QO3A 4C92B 2HDAA 3CCMQ 2SRCA 3JB9F 1NE8A 1Z9ZA 1Y7XA 1FMVA 1HJDA 2QXFA 3J80E 4IUTA 4QVZA 4BDZA 1OEBA 4QT7A 1OOTA 4A54A 1KG1A 2X3XD 1PM3A 1VUBA 3CPWP 3JCMV 2CP0A 1I07A 4R55A 1O75A 2P4RA 3A8LB 4RTYA 3UA6A 2QQSA 4LDYA 2LJ0A 4IUQA 4OMOA 1UJ0A 3H0IA 1WX6A 3H0FA 1VQLA 4JRQA 1IO6A 2CZ7B 1WJQA 2QYZA 3GOXA 1WNLA 1ZSZC 5KYUB 3EFSA 3M54A 4HT8A 4WTOB 4JZ4A 2FVUA 2LC4A 3SHWA 3UWNA 2L2PA 2P0PA 1OZ2A 1ZSGA 3VUBA 2ECZA 3REBB 3OSSC 2QQAA 1X6BA 2OTLA 1Q86R 5I21A 4EPCA 2KXCA 2WACA 1ZA1B 1SRMA 3A1PA 4MDWA 3JB9H 2GTOA 4DOWA 4M7AB 3JAME 4FIBA 5FWCA 3UF4A 1UUEA 4QQGA 3CQTA 1QLYA 5GMKe 3H0HA 2E6ZA 4ME7A 2CP7A 1R77A 1IHWA 5AT1B 3T9NA 2DERA 3M53A 2QQBA 3VRZA 2D0QB 4PNOA 1I0CA 1D1AA 2DTIA 1K76A 1M5Q1 4AFUC 3MP8A 1UHCA 2A3LA 4F7UF 1VQ9Q 3PT9A 3M0SA 2W0ZA 1D0XA 1MMDA 4Y28E 4J7FA 5J26A 3QWYA 2EQJA 2J6KA 4ELYC 5GAMf 2FHDA 1VQNT 3CD6T 1I5OB 1W1FA 4PLLA 4M7DE 2CUBA 1UGRB 2FEIA 2LQKA 1WJRA 3PE0A 4IUPA 1ABOA 1WI7A 3OYAA 2M0YA 4M77A 2K3YA 3NTKA 2CREA 1GCPA 3A8OB 3VS2A 1X6GA 1YITA 2BE9B 2K9GA 1ZHIA 3QJ6A 4M7DC 1NYGA 5GMKi 2ZAEA 1QVGS 3CC2T 2QQRA 5GJVB 1Y96A 4Z8AA 1LNXA 3H41A 1KC8R 2RHZA 4M7DF 1YCYA 3OYKA 2EKOA 4QVCA 3I55Q 1S72T 1Q7YR 1UGPB 2AZVA 1YJWT 3DB3A 2RJFA 5KCOA 2FL7A 1NEGA 3EG2A 1TTHB 5M9OA 3ZBDA 2PZ1A 4C8QD 3G4SQ 2HEQA 3R6OA 1G2BA 3E9FA 4E7HA 4RG2A 3QYHB 4C92D 5CIUA 3OY9A 1FXXA 3M0UA 3I5SA 3E9GA 4KULA 2IIMA 1HK9A 2DXUA 3A8GB 1BKBA 3PGGA 1M2VA 1NYFA 1A0NB 5J3BA 1ZSZA 3OS1A 3GIBA 2C0TA 1QMCA 4D8DA 2O01E 3CPFA 2AK5A 1WXTA 1WJSA 2KT1A 3RKXA 3V8JA 3OSVA 3LW5E 3OYCA 2DK3A 3I56T 1IB8A 1VQPT 1UHFA 2GNCA 2X4YA 4ZN1A 3OYDA 1TWBA 2DL3A 1D1BA 1MHNA 1T0HA 2EWNA 2O4XB 3F70A 2F2VA 2RQTA 1XTDA 1VQLQ 4F17A 1EIFA 4F7UA 2NUPA 3EG3A 3V8KA 2HZYA 2JMAA 3NHNA 1SKUB 3N5BB 2EGAA 2D1XA 4M78E 4GLKA 4RTWA 1QQJA 2CSQA 2KRSA 4C5GA 3CCSA 4M7AD 2JNGA 4Y91A 2DBKA 1YN8A 2DD4A 3QPHA 1K9AA 2VGMA 3PVLA 3GP8A 2DVJA 4A4KA 2OTLQ 5GMKm 4X34A 2DXCA 2BTTA 5GAOp 3HFNA 5A2QE 4BY6B 3ZFJA 3J7AF 2M16A 2JT4A 3RKWA 2ROTA 4XU3A 2CZ6B 5FRMA 2RHIA 4PJOE 1M3CA 4XTVA 2QDLA 6AT1B 1M90R 4E6RA 5KE3A 5CAIA 2X4JA 3SFMA 2DM1A 1NLOC 2I0NA 4M7DA 1OU9A 1X43A 2YSQA 3CCLT 5CKDA 5GANj 2L8DA 3HKSA 3ZL7C 5D6YA 3VS4A 2B86A 5CR2A 3CCJT 1VQ4T 1Z9QA 2DTHA 2RNAA 4PJOF 1AOJA 1M1KU 3HRTA 2A37A 3THKA 1U3OA 1EZZB 1VQ8A 1GXIE 3BFMA 1R0CB 3P8HA 1YJNT 2LQWA 1UDLA 1PNJA 3LH5A 2KNBB 5GAOq 4MMKA 3ULRB 2JZ2A 2JMCA 2VXEA 2LJ1A 1YITQ 3JCMg 4N4HA 1U8RA 1RLQC 3BW1A 3CCRT 2JOYA 2MPXC 1QW1A 4LE9A 2CP3A 2CZ1B 1QVFA 1JQQA 2ZPGB 3M0TA 1OULA 5I2SA 4BE1A 4XTXA 1VA7A 4WCIA 5GANg 1B7TA 5A0GA 2HQHA 4IIOA 1IREB 1N5ZA 2DRKA 3OMGA 1VQMA 2Y90A 5CKEA 2RJEA 5FLXE 3CCVA 3X20B 4TVRA 2FZCB 2X4XA 5LJ3h 3QKJA 2KROA 3PMIA 3CXCA 5FU6B 2PVGB 1BI1A 1K8AC 3RR6A 3RMSA 1KQSP 4Q5WA 4PK4A 5LJ5h 4E7KA 3PIPA 1ZUKA 2QA4T 2L3RA 1VQ5T 1RI9A 1ZBXA 2DIQA 3MCAB 1NLPC 5CQYA 3QDRB 1X75C 2DL7A 2GQVA 4MZPA 3HHTB 3TREA 1ZLMA 1X27A 3PNWC 2JTEA 5EG2A 5LJ3e 1VQ6T 1IGQA 1KC8C 2X35A 1TUGB 3QXEB 4OMPA 1PRMC 5LJ5e 2D8HA 3G6ET 3QIIA 1C6VX 1RAFB 2RB6A 5EC7A 1Q7YC 2KT8A 3KXTA 3UDCA 4ZGJB 2O9SA 5KYYA 2NUTA 3JB9J 2XK0A 4JJNK 3FJ5A 4V2SA 1JJ2A 1E6HA 1MNDA 4DBFA 1XQHA 3MP1A 1IGUA 2VASA 3OS5A 2RPNA 1TSFA 1CKBA 2RI3A 5IXBA 5FWBA 1N8RU 2LP5A 2KEAA 4L59A 4M77B 4DEYA 4PL6A 2XDBA 2CUDA 3CCSQ 2QAZA 2K79A 4PFPA 5GAOr 1ACMB 3OW2S 2ZPIB 4KH0B 4EMKC 1Y96B 2J6OA 1YI2T 2DILA 1MMAA 1S1NA 5HK3A 4RTVA 1M4ZA 2LMJA 3MEVA 2ED1A 4QW2A 2ZPEB 5C0MA 2KYMA 3P8DA 3CD6A 5KYWB 4O6JA 2RN8A 2EIFA 2OTJT 1GCQC 1M1GA 2E70A 4J9IA 3JCMQ 3ER0A 1NM7A 2CT4A 2K5FA 3TQ7P 4OGCA 3OMCA 1V76A 5D6XA 8ATCB 4E7SA 2DBMA 2LRQA 3RKYA 2KY9A 4E2FB 2MMPA 1YWOA 1NJIR 1HD3A 2OX7A 3PMTA 1KK7A 5GMKj 1Q81C 4KH1B 2YHTA 2HQEA 4C5EA 1YBYA 2RHYA 1JU5C 4C92G 4JZ3A 2RJDA 4HVUA 1M2VB 5I22A 2KXDA 3JCMP 1W6XA 4FSSA 2JXBA 3M59A 3OYEA 3HTRA 1YJWA 2YRDA 3TSZA 1VQ8Q 1AWOA 3JB9I 4J9CA 3MO8A 4CC4B 1I4K1 3JRZA 2KBTA 3H6ZA 1M90C 2M1HA 3L2QA 1D3BB 4KGZB 2LVMA 1E6GA 2LX7A 5GAOl 2GFUA 4J6WA 4EDUA 1B34B 1AWXA 4ZNXA 3JCMJ 1VQMQ 2IG0A 3FLGA 3CCVQ 3CC4T 2QK0A 3CMEQ 2EQUA 1LJOA 2QQ9A 1W2BS 2BIVA 2YT6A 2FG0A 3SB2A 3GPLA 4J83A 4B6MA 1AWWA 4HXJA 2V8IA 4A4HA 4KUIA 3L2VA 1QP2A 1QVFP 1Q82U 3CBPA 1VQPA 3CBOA 1ZUYA 2CDTA 4C0ZA 3RBBB 2EGCA 2FRYA 3VS3A 2HBWA 1OV3A 3JCMb 2MWOA 1WHHA 3D7SB 5GAN2 3URGA 1WPYA 3ASKA 5KH6A 3CCQT 2RI5A 2ED0A 1H92A 1XOVA 4JS4A 3CXCP 1NBEB 2C06A 4MZMA 3CMAT 1K73U 3V8LA 2DF6A 3I5RA 2KQWA 4JPBW 3CCMT 1RI0A 2AT1B 4EMKA 4IUVA 1OI1A 2X3WD 5GMKh 4KGXB 2KK4A 2RK1A 1YP5A 3GNGA 3VS0A 2DEUA 3U23A 2RI2A 3MEWA 3VKIA 3G4SA 4M77D 5I2MA 1EFNA 3OA6A 4HVWA 4M75B 1BCMA 3NTHA 2AZSA 3VRYA 1GCQA 3OYIA 2DD5A 4RTUA 1N9SA 1RLPC 3HL8A 5A0LA 2KSSA 3GNFB 1NPRA 1TXQA 3QBYA 3OBYA 1C0MA 2M02A 2X4WA 4BE2A 1BI0A 4M78G 1UE9A 2RF0A 2BZ8A 4QVDA 3EFOA 4J9HA 1SEMA 3X28B 1R0BG 1GBRA 1K9MC 4DBHA 4OMMA 5CKFA 2IPOB 3CCJA 4FT2A 1FWZA 4R56A 4C8QE 1K0XA 2QI2A 1M27C 2DFUA 3EHQA 1JJ2P 2O31A 1YIJA 3SWNC 2YUOA 4PLIA 1WYXA 2C0OA 1VQNQ 1WZOA 3CD6Q 4ZGEB 1WHJA 3AHUA 4AFQC 2FO0A 2ZPHB 4C92E 2COYA 3JCMc 5FRNA 2DVEA 1HXDA 3S6WA 3EH2A 2RHUA 4PJOG 2YUNA 5A0DA 1ZX6A 4XTYA 3EGDA 1M3BA 4C92C 4HA8A 4C8QF 1WDXA 3CCRA 3UATA 1WLPB 1XNIA 2E41A 4OP0A 5FU7C 1BIBA 1U1TA 2LCLA 4DOVA 1KQSA 2GBQA 4RKUE 4C92F 4J9DA 2JS0A 4C5IA 3BE3A 3NPFA 3KFVA 1MGQA 3EG9A 1YJ9T 2NYSA 2RA2A 2Y4XA 1M2OA 4E47A 2J05A 2Z0WA 1S72Q 1YJWQ 1TG0A 2EBPA 5CKHA 2HBPA 1GBQA 2G6FX 2HKQB 1RAEB 1Y57A 3M5AA 5CK9A 4LUDA 2AHJB 4JJCA 2HL5C 3JCMW 1SSHA 3V7SA 4PJLA 5DLOA 3JCMf 1E7OA 2RMOA 3EGXA 4M7AE 3BY7A 1NJIC 3FRNA 3OB9A 5ECAA 1WHLA 4AG1C 3M56A 1PWTA 2JJ9A 5GANf 4FYXB 2LX9A 4JLGA 2QTXA 5KYXB 4CRIA 1M30A 2CT3A 1WXUA 3HRSA 2FB7A 3OW2P 3I55T 3G6EA 4JRKA 5FROA 2PVDB 5GAOn 2VYTA 4Y92A 1Q82R 4LN2A 4FW2A 4LNPA 4M7AF 2DAQA 3J81E 2A28A 1YNZA 2JUFA 3I56Q 1QVGA 1VQPQ 2WSEE 3R6NA 2EVRA 4GY5A 5DY9A 5KCHA 2ZPBB 2RQVA 1K73R 1KD1C 3RMQA 2E10A 1WHMA 1Y07A 2AKLA 2LCCA 1UGVA 3P8BB 4RCCA 5DM7R 2HD0A 4M75D 5LJ3d 2DL5A 4OMQA 5GAOm 2V8KA 3A98A 1BI2A 2OAUA 5LJ3j 1JXMA 1AT1B 5LJ5d 2PUOB 4EIKA 2HSPA 3CC7T 4PJNA 1SHFA 3GF5A 2JN0A 4A4FA 3SWNA 4QKUA 4RTZA 4XK8E 5LJ5j 1G5VA 4BE0A 4N4GA 3PVQA 2OTJA 4M78C 2E3IA 4PKCC 3WVDB 4A63B 3QWXX 2FRWA 1M1FA 4F14A 4M78F 2K5IA 3M9QA 4C92A 1F1BB 4E7ZA 1OX8A 4L5GA 3V7RA 3TCJA 3G1JA 2XMFA 2KYBA 1FX7A 3JSCA 3OYMA 1NEBA 3E1SA 3CCJQ 3O5ZA 1HYOA 2OTLT 5D7UA 4OB1B 3MHXA 2CS7A 1AVZC 4PJOC 3O8VA 1BU1A 1MV0B 4RTTA 4A4GA 2O2OA 1YIJQ 5LJ3g 2HQXA 1NZ9A 1I81A 2GFAA 4E7LA 5IH2A 2EGEA 3CPWS 1TS9A 1X2KA 3L42A 2X9HA 1W4SA 5LJ5g 3LLRA 2V26A 2KR3A 1YJNQ 5GAN3 2E65A 4IUUA 2PQWA 1Q86C 3IQLA 4XU2A 3HSBA 1RAHB 1FMWA 5KYUA 1GFCA 1QKXA 4OF1A 1WFWA 3CCRQ 4J9EA 3HPWA 1NG2A 2J06A 3H8ZA 3RESA 3AT1B 2LDMA 3GBQA 4ZTJA 2HKNA 3NGPA 4F16A 4BD3A 3C12A 5HKCA 3G71T 2AKKA 1QCNA 3CC4A 5IHNA 3C0CA 3FC3A 3L2ZA 2QASA 3CCEA 3UA7A 2MF2A 2K3XA 2QEXT 1VQOT 3CMEA 3GLXA 4EMKB 2K3BA 1B3QA 1VYTA 1VQ5Q 2PNIA 4OB3B 3OQ5A 2VVKA 3S3MA 3RERA 4BI8B 4OVAA 2NLUA 3TVTA 4RMOA 2MYSA 1H641 4J9FA 3OS2A 2COWA 1WXBA 2DJZA 1MMNA 1YHQT 2DRMA 3CMAA 2RD1A 4J7IA 1SPKA 1KHCA 2K57A 4XAXB 5GAMe 2YWWA 1PKSA 1OX9A 1PSFA 2MAMA 2F69A 3G6EQ 3LGFA 2LCSA 1I8FA 2P4TA 4KBMB 2WSCE 1KFZA 1JO8A 2MOXA 2JVVA 4JS5A 5IN1A 1T0JA 1Y71A 3S3OA 3H9NA 1LPLA 3SDZA 2J7IA 4M78A 1SHGA 2MIOA 3E2UA 5GAN6 4BACA 2JTFA 1AZEA 4XU1A 1BCOA 5GAN4 1WQ7A 5GAN7 2DZCA 2LNHB 4AMCA 2MWPA 3M0RA 1Q95G 2RK2A 1WHGA 2D0NA 2EKHA 2JM8A 2KRMA 2LZ6B 2FPDA 4JJDA 2ROLA 3EGDB 3BDLA 2RH2A 2CSIA 2RQWA 1JRIA 4RUGA 1QVGP 2M51A 4OGEA 1QCOA 3X26B 2CZ0B 1VQ7T 3MP6A 2K6DA 2K4YA 4PJOA 1JB0E 2XKOC 4JRIA 2E5QA 2F5KA 4J6XA 4Z89A 3QUIA 2MK5A 1H8KA 3JCMX 1U1SA 2OTJQ 3DLMA 2E5KA 1VQNA 1X2QA 1OYXA 1RADB 2DPPB 1FMKA 2CP5A 4BI3A 2YRCA 1JXOA 4HVVA 2P0QA 2BZYA 3A5ZB 1RL2A 4FT4A 3UPUA 1VIEA 2NWMA 1OU8A 2CP2A 4B9WA 2EW3A 3CC2A 2CKKA 4ESRA 1QWEA 1UG1A 1YJ9A 4ORZA 1TOVA 4RCBA 4C8QG 1D0ZA 5KE2A 4KGVB 1M1KR 3LWIA 1W70A 5L23A 2DO3A 1HSQA 1IXDA 3LX7A 1KQ2A 1AHJB 4J9GA 5AYFA 1K8AU 4CC3A 3Q1JA 1BK2A 1S72A 3FB9A 4N4IA 1ZSZB 2DMOA 2FPEA 1VQKT 1QCFA 1MMGA 2VKNA 4LDXA 1KIKA 3V7CA 2RM4A 3HRUA 3BDUA 3OW2A 3NFCA 2XU8A 4RG8A 2YLBA 1SSFA 2HNIA 4HT9A 2HCKA 2DXBA 1FYNA 2BZXA 1X01A 3C95A 4Z88A 4J5YA 1BB9A 1AEYA 2DTOA 1V29B 3VYGA 2D8JA 1KC8U 3CC4Q 3M58A 4M77E 2EPDA 4LDVA 4EMHA 3CCEQ 2VXFA 4F7UB 2NUPB 3NTIA 2DA9A 2WSFE 5CQXA 4M75G 2JM9A 3CCUT 4HCBA 3OBWA 4LUEA 3X25B 3REAB 3SWNB 3HP9A 4OMLA 2AIRB 4M77F 4M7AG 2HSEB 2XI9A 3I56A 1M9SA 4FL6A 1P92A 1G3WA 3CMAQ 3VV0A 5KYNA 4JLIA 1I5LA 4UC4A 2KDSA 2CP6A 3M55A 3OYHA 2DZ9A 4Z02A 1IRXA 4AG2C 1X6OA 2V1QA 2EYZA 2L0AA 1N9RA 5FU7B 1I1JA 2H3JA 1C1AA 2EYWA 2VUBA 2DLPA 1UJYA 4MZTA 1M3AA 1G3SA 4M7DB 4AT1B 3CC7A 1H3ZA 3L1AA 2F2WA 2ABLA 1SG5A 5I11A 1OPLA 1EX4A 3OYJA 1VOMA 1KSWA 1TUDA 2YLCA 4PFOA 2KAFA 3M0PA 1N8RR 3FIFA 2LQ8A 1W2BA 5IAYA 3HFOA 1K0SA 1PD1A 4C0FA 2CH4A 4LDUA 3QG1A 2KGTA 3JB9D 2XD0A 1D1CA 1WGSA 1KQSS 3CCLA 1Q81U 1UFFA 1MUZA 2W10A 8AT1B 3QZ5B 4F7UE 2H8HA 2A36A 1VQ4A 3A8MB 1XJWB 4X9CA 4QQ6A 2NUZA 1QKWA 4OB2B 2B8AA 2VGNA 1ZQ1A 4C0DC 3EFRA 1ZUUA 3PTAA 1YJNA 4B9XA 4C8QC 1YWPA 1M90U 5CVIA 4BI4A 1BYMA 3JV3A 1NPPA 1QP3A 2GF7A 2XICA 2DE0X 3CEYA 3CC2Q 5J39A 1YJ9Q 4CC2A 2EJFA 1VQ9T 2DEQA 3G71A 4K11A 4OMNA 2R57A 2MI6A 1K8AR 5FW9A 2EYQA 4E7JA 3M4YA 5LJ3f 2G3RA 4BDYA 3SD4A 2XHCA 2L3QA 2KE9A 2KMTA 3I9QA 3EHRA 2QEXA 3M4GA 1VQOA 5LJ5f 4J6YA 1DJ7B 2BKDN 2QGFB 2MCNA 4J9BA 3LH0A 1T3LA 2O88A 4VUBA 2QA4A 1IZ6A 2OJ2A 2YDLA 4CI0C 4M75E 2COZA 1VQ5A 1PHTA 1LCKA 5KYYB 4ATOA 4M78B 2BE7D 3L2RA 2KI7A 3TSWA 2NUTB 4XTWA 4DEXA 3EH1A 1JBMA 1YHQA 4QQDA 3DB4A 2J6FA 5KYWA 4J8OA 4MDXA 3NMZC 4M75C 3OYFA 1UEBA 3MKDA 1UGQB 2V8JA 3ZEHA 4BUGA 1VQ6A 4NS5A 1PRLC 2EJ9A 2JS2A 1M1KC 1SRLA 2EJGA 4M7AC 4M75F 3QJYA 2L89A 4DA4A 1CSKA 2EAYA 2PVOB 5IT9E 1O9SA 2CGHA 2K5LA 1G83A 4PJOB 3M0QA 2XG8D 4LD6A 4D8KA 5GJWB 2EYXA 2PTKA 3G4ST 2CYZB 2C0IA 3LYIA 4HKEA 3EGUA 4XU0A 1RACB 3M57A 4M7DD 2F1LA 2K7AA 2RJCA 2PU9B 3OYGA 4JUVA 3EG0A 2GTJA 3WXMB 4HCKA 2QDYB 1BI3A 2VV5A 4X1VA 4FCYA 2DL4A 2OI3A 2ZGWA 3TEEA 3RIRA 4OMFB 3C4SA 1VQ7A 2YRVA 1Y0MA 1UECA 5GAMd 1K9MU 1TUCA 4DBQA 2DIGA 1V1CA 4ZGDB 3CC7Q 1UGSB 5DLQE 2FPFA 1YI2A 1ZA2B 5GAMj 1H3HA 1OQKA 2HMAA 2R5AA 1D3BA 4P5NA 3VU3C 1U5SA 1OZ3A 2XDDA 2FZKB 2PUKB 2L5QA 3TU4K 2R58A 1B34A 2V1RA 2YUQA 1X69A 4M4ZA 1N6AA 4BB7A 2R5MA 1B07A 1K1ZA 2KRNA 2LT1A 1R8OB 1QWFA 1TU0B 3VJPA 4C8QA 2IVWA 1VQLT 4FYWB 2JTMA 2F2XA 1Q81R 3OYNA 1BBZA 4JRPA 4A4EA 1OPKA 3CCLQ 1PCXA 2ZCFB 1PC0A 2E3HA 2LQNA 4PJJA 5GAN5 1QVFS 3OYLA 4XTZA 4F04B 1VQ4Q 3QZ9B 5GAMg 3JCMd 4GBQA 1RAAB 1W2BP 4XQ3A 3G7ZA 1K4US 1VQKA 5GANd 1UTIA 3CXCS 2QGGA 3PFSA 1N8RC 4N0AC 5IHKA 1NJIU 1T3SA 2VC8A 3G71Q 3CBMA 1TH7A 2XIDA 1YIJT 4M75A 1GFDA 1KQ1A 4GLMA 1D09B 1SF9A 2VWFA 3QDFA 5CO7A 3LGLA 1JEGA 4HCCA 5L8RE 2QEXQ 3DLLA 4M7AA 4M78D 1VQOQ 2DJQA 4IURA 3EG1A 3KBGA 4ZN3A 9ATCB 3CCUA 4ZTFA 5GAMh 1BIAA 2YUPA 2E6NA 4PFZA 2QA4Q 4R0KA 1YCSB 1YITT 1VYVA 1KD1U 4MMLA 3QHSA 1VYUA 2P0KA 1YHQQ 4PJMA 2A08A 1ABQA 1AD5A 2BUDA 2EQIA 1PKTA 2M0OA 4DBRA 3CPWA 2D6FA 3CCQA 1G3YA 4PJOD 5HK0A 4M77G 1JJ2S 2LNVA 4LD9K 1VQ6Q 1IHVA 4L6V5 2RO0A 2HAXA 1WQWA 4BY6C 2LJ3A 3CCMA 2DYBA 2A0FB 2ESWA 3SEMA 3JB9G 3EFOB 4FM4B 4ELZC 3VS1A 2F5TX 1KJWA 4NOYA 4FU6A 1AWJA 4EMGA 1N27A 1G3TA 3FJPA 3L2UA 2HL3A 3JCMh 2OAWA 2DXTA 2P84A 5LL6S 2E12A 2RQRA 1WIEA 1RUWA 4CC7A 3MEAA 1ZBJA 4IKFA 1YFNA 2DKGA 1LVKA 5GANh 1VIFA 3META 1K9MR 1PD0A 3RUXA 4JDSA 2EFIA 2GGRA 1KHIA 1RAGB 1VQ7Q 3MEUA 5GAN8 2Y4YA 1YI2Q 2RQUA 3FDRA 2DETA 2EQMA 2GCXA 2RHXA 4C0GA 3JCMe 1Q82C 5IHIA 3X24B 2A7YA 2M9UA 1ARKA 3EG9B 3E19A 2ZZDA 2DNUA 2ATCB 3S3NA 1Q86U 5GANe 5KYXA 3MPUB 4RTXA 5D6WA 2E64A 1D0YA 2K2VA 2FZGB 4N0AA 4YTLA 1K73C 4KUDK 2ENMA 3OYYA 3VYHB 3VUZA 1RAIB 5CKBA 3QYGB 2X51A 2DL8A 5FU6C 2DYIA 3CCST 4FW1A 3KUFA 1VQ9A 2ZPFB 2YXYA 3INZA 1MNEA 3PIOA 4XTUA 4ANJA 3EGXB 3FEOA 4F7UG 2K2MA 1MV3A 4LXCA 3A8HB 2QG9B 4FYVB 2VB6A 1J3TA 3EAEA 1M8VA 3VS5A 2KVQG 4O5VA 4X9DA 7AT1B 2O4XA 1VQKQ 2XDPA 2E1HA 3OYBA 1RABB 4LDWA 4KT0E 2L3SA 2JW4A 3DKMA 1WHKA 2I2LA 4NL3A 1UB4A 2E4HA 2CH4W 2EQKA 2LTOA 2LT4A 3QSUA 1PSEA 2O9VA 2SEMA 2EYYA 1PG5B 1WA7A 2QTVA 2H3EB 1CKAA 4II1A 4M7DG 3C94A 1M8MA 2D9TA 3RNJA 1G8XA 5C6SA 3VS6A 4D6WA 4JJBA 3I55A 3OS0A 3CCUQ 3MJXA 4OB0B 4AFSC 2FYKA 4C5HA 3WVEB 1VQ8T 1AZGB 1KD1R 4AFZC 1Q7YU 1LOJA 2L3PA 1U06A 1GRIA 4M77C 3RDVA 2DX1A
chains in the Genus database with same CATH topology
2R57A 3G6ET 2MI6A 3QIIA 3L2WA 2EYQA 1M1FA 2RB6A 3M4YA 5LJ3f 2G3RA 4M78F 2K5IA 4BDYA 4E7JA 3SD4A 1Q7YC 3M9QA 4C92A 3KXTA 2XHCA 3UDCA 4ZGJB 2KMTA 4HCZA 2QEXA 3M4GA 4C0DB 4DQ2A 4A53A 3LWHA 1VQOA 5HY6A 3ME9A 4L5GA 5LJ5f 4J6YA 1DJ7B 4FSXA 3TCJA 3V7RA 3JB9J 2BKDN 1FX7A 2XK0A 3JSCA 4NL2A 3UT1A 4C8QB 4JJNK 1VQMT 3OYMA 3LH0A 3E1SA 5GMKl 3CCET 4V2SA 4VUBA 1JJ2A 4E7IA 5CCAA 1QVPA 3CCVT 2OTLT 2QA4A 3MHXA 4OB1B 1XQHA 2CS7A 3MP1A 4WF2A 1IZ6A 3O8VA 3CMET 4PJOC 3QO3A 4A4GA 4C92B 3OS5A 4M75E 4CI0C 3JB9F 5LJ3g 1VQ5A 2HQXA 1NE8A 2RI3A 1NZ9A 1I81A 1Y7XA 2GFAA 4ATOA 4M78B 4E7LA 3CPWS 1N8RU 3L2RA 3L42A 4L59A 4M77B 4XTWA 2QXFA 3J80E 4PL6A 1JBMA 1W4SA 5LJ5g 1YHQA 3LLRA 4QQDA 2XDBA 4IUTA 4QVZA 4BDZA 5GAN3 3DB4A 2E65A 4IUUA 4J8OA 2PQWA 4A54A 5GAOr 1Q86C 4MDXA 1KG1A 4M75C 3OYFA 4XU2A 1VUBA 3OW2S 3JCMV 1UEBA 2ZPIB 1UGQB 2V8JA 3ZEHA 4EMKC 1Y96B 4R55A 3HSBA 1O75A 3A8LB 4BUGA 1VQ6A 1YI2T 4NS5A 2EJ9A 4OF1A 5HK3A 1M1KC 2EJGA 2QQSA 4LDYA 1M4ZA 4M7AC 4M75F 3HPWA 3QJYA 2L89A 3H8ZA 4IUQA 4DA4A 2EAYA 2PVOB 3MEVA 5IT9E 3RESA 4QW2A 1O9SA 2ZPEB 1VQLA 5C0MA 4JRQA 2CGHA 3P8DA 3CD6A 2LDMA 2CZ7B 2K5LA 4ZTJA 4O6JA 4PJOB 1WJQA 2EIFA 2OTJT 2XG8D 1M1GA 1WNLA 2E70A 3C12A 4BD3A 4LD6A 5HKCA 3ER0A 3JCMQ 2K5FA 3EFSA 3G71T 3M54A 4HT8A 4OGCA 3OMCA 3G4ST 3CC4A 2FVUA 2LC4A 5D6XA 1BYMA 3UWNA 2CYZB 3LYIA 3FC3A 4HKEA 2LRQA 2P0PA 1OZ2A 3VUBA 4XU0A 3RKYA 3L2ZA 2KY9A 3M57A 2QQAA 3OSSC 4M7DD 3CCEA 2MF2A 2MMPA 2OTLA 2K3XA 2RJCA 2QEXT 2PU9B 3PMTA 3OYGA 4JUVA 3GLXA 4EMKB 4EPCA 5I21A 3CMEA 1VQOT 2WACA 3WXMB 2QDYB 1BI3A 2VV5A 4MDWA 3JB9H 5GMKj 2ZGWA 4M7AB 3TEEA 4OB3B 2YHTA 4DOWA 3JAME 3OQ5A 4FIBA 3RIRA 2HQEA 4C5EA 1YBYA 2RHYA 4OMFB 4C92G 3S3MA 3RERA 4BI8B 4OVAA 3C4SA 4QQGA 2NLUA 2RJDA 2YRVA 1VQ7A 5GMKe 5GAMd 2E6ZA 1K9MU 4ME7A 3JCMP 4RMOA 3M59A 2DIGA 1H641 4ZGDB 3T9NA 1UGSB 3OS2A 5DLQE 3M53A 3OYEA 2QQBA 1YI2A 1YJWA 5GAMj 2DJZA 2D0QB 2R5AA 4PNOA 1YHQT 2DTIA 1D3BA 3CMAA 2RD1A 4J7IA 4P5NA 3JB9I 1M5Q1 3VU3C 3MP8A 1KHCA 2K57A 1OZ3A 2A3LA 3MO8A 4F7UF 4XAXB 5GAMe 2PUKB 2L5QA 3PT9A 2R58A 2XDDA 3TU4K 1B34A 1Q81C 1PSFA 2MAMA 2F69A 4Y28E 1I4K1 3LGFA 4J7FA 5J26A 3JRZA 1N6AA 4BB7A 1I8FA 3H6ZA 2R5MA 2LT1A 1M90C 2P4TA 1R8OB 2M1HA 2EQJA 4KBMB 4C8QA 3VJPA 3L2QA 2WSCE 2IVWA 1VQLT 1D3BB 2JTMA 2LVMA 4ELYC 5GAMf 2FHDA 1VQNT 3CD6T 2JVVA 5GAOl 4JS5A 2GFUA 5IN1A 4J6WA 3OYNA 4PLLA 4EDUA 1Y71A 1B34B 4M7DE 3JCMJ 2IG0A 1UGRB 4JRPA 2LQKA 3S3OA 1WJRA 3SDZA 4A4EA 3FLGA 4IUPA 4M78A 3CC4T 5GAN6 2EQUA 2ZCFB 3OYAA 4M77A 2K3YA 1LJOA 2JTFA 2QQ9A 3A8OB 3NTKA 4BACA 1W2BS 2BIVA 5GAN5 4XU1A 1YITA 5GAN4 3OYLA 1QVFS 1WQ7A 1ZHIA 5GAN7 2DZCA 4XTZA 2MWPA 3QJ6A 3SB2A 5GMKi 4J83A 3GPLA 4M7DC 2RK2A 3QZ9B 1QVGS 3CC2T 2QQRA 2V8IA 4A4HA 3JCMd 4KUIA 1Y96A 5GAMg 3L2VA 1QP2A 3BDLA 1LNXA 1Q82U 2RH2A 4XQ3A 2RHZA 3CBPA 1VQPA 3CBOA 4M7DF 1YCYA 3G7ZA 1JRIA 4C0ZA 1VQKA 5GANd 3OYKA 4OGEA 1VQ7T 2EKOA 2CZ0B 3X26B 3CXCS 3MP6A 3JCMb 2K4YA 2MWOA 3PFSA 4N0AC 1N8RC 5GAN2 4PJOA 1JB0E 1WPYA 3ASKA 2XKOC 3URGA 5KH6A 4JRIA 3CCQT 4QVCA 1S72T 2RI5A 1UGPB 1XOVA 1YJWT 2E5QA 3DB3A 2F5KA 2RJFA 4J6XA 5KCOA 2FL7A 4JS4A 1NJIU 3QUIA 3JCMX 2C06A 4MZMA 3CMAT 1K73U 1U1SA 3V8LA 4M7AD 3DLMA 5M9OA 3ZBDA 2VC8A 4C8QD 3CBMA 1TH7A 1VQNA 1OYXA 2KQWA 2XIDA 3CCMT 1YIJT 4M75A 1KQ1A 1RI0A 3R6OA 2DPPB 3E9FA 4EMKA 5CO7A 4E7HA 3LGLA 4IUVA 1OI1A 4RG2A 5GMKh 3QYHB 5L8RE 5CIUA 4C92D 3CCLT 4HCCA 2KK4A 2RK1A 3GNGA 3OY9A 1FXXA 2RI2A 4BI3A 3MEWA 3DLLA 4M7AA 4M78D 3VKIA 3G4SA 3E9GA 2P0QA 3A5ZB 4KULA 4IURA 3KBGA 4M77D 5I2MA 1RL2A 1HK9A 2DXUA 3A8GB 4FT4A 1BKBA 4ZN3A 3CCUA 3PGGA 1VIEA 3OA6A 3UPUA 4ZTFA 5GAMh 4M75B 1BIAA 3NTHA 4B9WA 5J3BA 3CC2A 2CKKA 3OYIA 2E6NA 1YJ9A 3OS1A 4C8QG 4RCBA 2DD5A 3GIBA 1N9SA 5KE2A 2O01E 3CPFA 1YITT 3HL8A 3LWIA 5A0LA 1WJSA 2KSSA 3RKXA 3GNFB 1NPRA 4MMLA 3V8JA 2DO3A 3OSVA 1KD1U 3LW5E 3QHSA 3LX7A 2P0KA 1KQ2A 3QBYA 3OBYA 2X4WA 3OYCA 4BE2A 1BI0A 2BUDA 2M0OA 1AHJB 4M78G 5AYFA 3CPWA 2D6FA 1K8AU 2DK3A 3CCQA 1G3YA 3Q1JA 3I56T 4PJOD 5HK0A 4M77G 1S72A 3FB9A 4N4IA 4QVDA 1VQPT 1JJ2S 3X28B 2X4YA 2LNVA 4LD9K 1VQKT 4L6V5 2RO0A 4ZN1A 2HAXA 3OYDA 1K9MC 4LDXA 3V7CA 2RM4A 3HRUA 3BDUA 5CKFA 3CCJA 3OW2A 2EWNA 3NFCA 1MHNA 1WQWA 4FT2A 1FWZA 4BY6C 4C8QE 4R56A 2QI2A 2XU8A 2O4XB 3F70A 4RG8A 2YLBA 1SSFA 2HNIA 1XTDA 4HT9A 3CCMA 1YIJA 3SWNC 4PLIA 1EIFA 4F7UA 2DXBA 4ZGEB 3AHUA 2ZPHB 1X01A 3JB9G 4C92E 3V8KA 4ELZC 4FM4B 3C95A 3N5BB 4J5YA 3JCMc 5FRNA 2DTOA 2DVEA 1V29B 1HXDA 2F5TX 4GLKA 4M78E 3VYGA 3S6WA 4NOYA 4C5GA 3CCSA 4FU6A 1KC8U 2JNGA 2RHUA 4PJOG 3M58A 4Y91A 4M77E 1N27A 4EMGA 4LDVA 1G3TA 5A0DA 3FJPA 4EMHA 3L2UA 4XTYA 3JCMh 2DD4A 2DXTA 3QPHA 4C92C 4HA8A 2VGMA 2VXFA 5LL6S 3GP8A 2E12A 4C8QF 4F7UB 3CCRA 4A4KA 5GMKm 1XNIA 4X34A 3MEAA 2DXCA 2E41A 4OP0A 5FU7C 1BIBA 1U1TA 3NTIA 4IKFA 5GAOp 2DKGA 2LCLA 4DOVA 2WSFE 3HFNA 1KQSA 5CQXA 1VIFA 3META 4M75G 5GANh 5A2QE 3CCUT 4RKUE 4C92F 1G5VA 4BY6B 3ZFJA 3GOXA 3J7AF 4C5IA 2M16A 4HCBA 3OBWA 3RKWA 3X25B 1MGQA 4JDSA 3RUXA 1YJ9T 2EFIA 1KHIA 3SWNB 2RA2A 3HP9A 3MEUA 4XU3A 2CZ6B 4M77F 2RHIA 5GAN8 5FRMA 4M7AG 2Y4XA 3I56A 2XI9A 4E47A 4PJOE 4XTVA 2Y4YA 5CAIA 5KE3A 1M9SA 2X4JA 5CKHA 3SFMA 3FDRA 4FL6A 2EQMA 1P92A 1G3WA 2HBPA 2GCXA 2RHXA 3VV0A 4C0GA 3JCMe 1Q82C 4M7DA 4JLIA 1I5LA 3X24B 4UC4A 2KDSA 2A7YA 2M9UA 3M55A 2DZ9A 3M5AA 5CKDA 2L8DA 3HKSA 5CK9A 3OYHA 5GANj 2AHJB 3E19A 1X6OA 2ZZDA 5D6YA 3JCMW 3S3NA 1N9RA 1Q86U 5GANe 5FU7B 5CR2A 2H3JA 3V7SA 3CCJT 1VQ4T 2DTHA 2VUBA 5D6WA 5DLOA 4MZTA 4PJOF 2E64A 3JCMf 1G3SA 2K2VA 4M7AE 3BY7A 4M7DB 4N0AA 1NJIC 1M1KU 3HRTA 3FRNA 4YTLA 3CC7A 1K73C 3L1AA 4KUDK 1H3ZA 3OYYA 3VYHB 3VUZA 3OB9A 5CKBA 3M56A 3QYGB 1VQ8A 5GANf 1GXIE 3BFMA 3P8HA 5FU6C 3OYJA 1YJNT 2LX9A 4JLGA 2QTXA 3CCST 4CRIA 3KUFA 2YLCA 1VQ9A 3HRSA 2ZPFB 5GAOq 2FB7A 4MMKA 3INZA 3PIOA 4XTUA 3I55T 2JZ2A 3G6EA 4JRKA 3FEOA 2PVDB 5FROA 4F7UG 2VXEA 5GAOn 2VYTA 2KAFA 4N4HA 3JCMg 1U8RA 3BW1A 3A8HB 3CCRT 2JOYA 3FIFA 2LQ8A 1QW1A 1W2BA 4M7AF 2DAQA 3J81E 5IAYA 2CZ1B 1QVFA 3HFOA 2JUFA 4C0FA 3EAEA 2ZPGB 1M8VA 5I2SA 4BE1A 4LDUA 4XTXA 3QG1A 1QVGA 2KVQG 2WSEE 5GANg 5A0GA 4O5VA 4X9DA 3JB9D 2O4XA 2XD0A 4GY5A 1IREB 1WGSA 2XDPA 5DY9A 2E1HA 3OMGA 3OYBA 1VQMA 5KCHA 2Y90A 2ZPBB 5CKEA 4LDWA 2RJEA 1KQSS 3CCLA 5FLXE 1Q81U 3CCVA 4KT0E 3X20B 4TVRA 2X4XA 1KD1C 5LJ3h 3RMQA 2E10A 3DKMA 3QKJA 2I2LA 3PMIA 3CXCA 1Y07A 3QZ5B 5FU6B 4F7UE 4NL3A 2PVGB 1BI1A 1K8AC 1VQ4A 3A8MB 3RMSA 1UB4A 4Q5WA 5LJ5h 2LCCA 4X9CA 4E7KA 3PIPA 3P8BB 2EQKA 2LTOA 2LT4A 4QQ6A 2QA4T 4OB2B 4RCCA 2B8AA 5DM7R 2VGNA 1ZQ1A 2HD0A 4M75D 2L3RA 3QSUA 1PSEA 1VQ5T 5LJ3d 4C0DC 5GAOm 1ZBXA 2V8KA 3EFRA 2DIQA 3PTAA 1BI2A 4II1A 2OAUA 4M7DG 1YJNA 4B9XA 4C8QC 5LJ3j 3I55A 3C94A 3MCAB 5LJ5d 2PUOB 1M90U 2D9TA 5CVIA 5C6SA 4BI4A 3CC7T 5CQYA 4D6WA 3GF5A 1X75C 2GQVA 2JN0A 3QDRB 3HHTB 4MZPA 3TREA 3PNWC 3SWNA 1NPPA 5EG2A 1QP3A 4A4FA 5LJ3e 3OS0A 2GF7A 4OB0B 4XK8E 5LJ5j 2FYKA 2XICA 3WVEB 4C5HA 4BE0A 1KC8C 1VQ8T 1VQ6T 4N4GA 3CEYA 2OTJA 5J39A 2X35A 4M78C 2EJFA 3QXEB 1Q7YU 1LOJA 4PKCC 3WVDB 1VQ9T 5LJ5e 2DEQA 4M77C 3G71A 4Z02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E12 A; 
#chains in the Genus database with same CATH topology
 4KRT A;  3L2W A;  4HCZ A;  5IXF A;  4C0D B;  4DQ2 A;  4A53 A;  3LWH A;  3CCQ Q;  5HY6 A;  3ME9 A;  4FYY B;  4FSX A;  1GL5 A;  3UT1 A;  4C8Q B;  4NL2 A;  3I35 A;  1VQM T;  3VS7 A;  5GMK l;  3CCE T;  4IIM A;  5HCK A;  5CCA A;  1QVP A;  3CCV T;  4E7I A;  2GQI A;  4WF2 A;  3CME T;  3QO3 A;  4C92 B;  2HDA A;  3CCM Q;  2SRC A;  3JB9 F;  1NE8 A;  1Z9Z A;  1Y7X A;  1FMV A;  1HJD A;  2QXF A;  3J80 E;  4IUT A;  4QVZ A;  4BDZ A;  1OEB A;  4QT7 A;  1OOT A;  4A54 A;  1KG1 A;  2X3X D;  1PM3 A;  1VUB A;  3CPW P;  3JCM V;  2CP0 A;  1I07 A;  4R55 A;  1O75 A;  2P4R A;  3A8L B;  4RTY A;  3UA6 A;  2QQS A;  4LDY A;  2LJ0 A;  4IUQ A;  4OMO A;  1UJ0 A;  3H0I A;  1WX6 A;  3H0F A;  1VQL A;  4JRQ A;  1IO6 A;  2CZ7 B;  1WJQ A;  2QYZ A;  3GOX A;  1WNL A;  1ZSZ C;  5KYU B;  3EFS A;  3M54 A;  4HT8 A;  4WTO B;  4JZ4 A;  2FVU A;  2LC4 A;  3SHW A;  3UWN A;  2L2P A;  2P0P A;  1OZ2 A;  1ZSG A;  3VUB A;  2ECZ A;  3REB B;  3OSS C;  2QQA A;  1X6B A;  2OTL A;  1Q86 R;  5I21 A;  4EPC A;  2KXC A;  2WAC A;  1ZA1 B;  1SRM A;  3A1P A;  4MDW A;  3JB9 H;  2GTO A;  4DOW A;  4M7A B;  3JAM E;  4FIB A;  5FWC A;  3UF4 A;  1UUE A;  4QQG A;  3CQT A;  1QLY A;  5GMK e;  3H0H A;  2E6Z A;  4ME7 A;  2CP7 A;  1R77 A;  1IHW A;  5AT1 B;  3T9N A;  2DER A;  3M53 A;  2QQB A;  3VRZ A;  2D0Q B;  4PNO A;  1I0C A;  1D1A A;  2DTI A;  1K76 A;  1M5Q 1;  4AFU C;  3MP8 A;  1UHC A;  2A3L A;  4F7U F;  1VQ9 Q;  3PT9 A;  3M0S A;  2W0Z A;  1D0X A;  1MMD A;  4Y28 E;  4J7F A;  5J26 A;  3QWY A;  2EQJ A;  2J6K A;  4ELY C;  5GAM f;  2FHD A;  1VQN T;  3CD6 T;  1I5O B;  1W1F A;  4PLL A;  4M7D E;  2CUB A;  1UGR B;  2FEI A;  2LQK A;  1WJR A;  3PE0 A;  4IUP A;  1ABO A;  1WI7 A;  3OYA A;  2M0Y A;  4M77 A;  2K3Y A;  3NTK A;  2CRE A;  1GCP A;  3A8O B;  3VS2 A;  1X6G A;  1YIT A;  2BE9 B;  2K9G A;  1ZHI A;  3QJ6 A;  4M7D C;  1NYG A;  5GMK i;  2ZAE A;  1QVG S;  3CC2 T;  2QQR A;  5GJV B;  1Y96 A;  4Z8A A;  1LNX A;  3H41 A;  1KC8 R;  2RHZ A;  4M7D F;  1YCY A;  3OYK A;  2EKO A;  4QVC A;  3I55 Q;  1S72 T;  1Q7Y R;  1UGP B;  2AZV A;  1YJW T;  3DB3 A;  2RJF A;  5KCO A;  2FL7 A;  1NEG A;  3EG2 A;  1TTH B;  5M9O A;  3ZBD A;  2PZ1 A;  4C8Q D;  3G4S Q;  2HEQ A;  3R6O A;  1G2B A;  3E9F A;  4E7H A;  4RG2 A;  3QYH B;  4C92 D;  5CIU A;  3OY9 A;  1FXX A;  3M0U A;  3I5S A;  3E9G A;  4KUL A;  2IIM A;  1HK9 A;  2DXU A;  3A8G B;  1BKB A;  3PGG A;  1M2V A;  1NYF A;  1A0N B;  5J3B A;  1ZSZ A;  3OS1 A;  3GIB A;  2C0T A;  1QMC A;  4D8D A;  2O01 E;  3CPF A;  2AK5 A;  1WXT A;  1WJS A;  2KT1 A;  3RKX A;  3V8J A;  3OSV A;  3LW5 E;  3OYC A;  2DK3 A;  3I56 T;  1IB8 A;  1VQP T;  1UHF A;  2GNC A;  2X4Y A;  4ZN1 A;  3OYD A;  1TWB A;  2DL3 A;  1D1B A;  1MHN A;  1T0H A;  2EWN A;  2O4X B;  3F70 A;  2F2V A;  2RQT A;  1XTD A;  1VQL Q;  4F17 A;  1EIF A;  4F7U A;  2NUP A;  3EG3 A;  3V8K A;  2HZY A;  2JMA A;  3NHN A;  1SKU B;  3N5B B;  2EGA A;  2D1X A;  4M78 E;  4GLK A;  4RTW A;  1QQJ A;  2CSQ A;  2KRS A;  4C5G A;  3CCS A;  4M7A D;  2JNG A;  4Y91 A;  2DBK A;  1YN8 A;  2DD4 A;  3QPH A;  1K9A A;  2VGM A;  3PVL A;  3GP8 A;  2DVJ A;  4A4K A;  2OTL Q;  5GMK m;  4X34 A;  2DXC A;  2BTT A;  5GAO p;  3HFN A;  5A2Q E;  4BY6 B;  3ZFJ A;  3J7A F;  2M16 A;  2JT4 A;  3RKW A;  2ROT A;  4XU3 A;  2CZ6 B;  5FRM A;  2RHI A;  4PJO E;  1M3C A;  4XTV A;  2QDL A;  6AT1 B;  1M90 R;  4E6R A;  5KE3 A;  5CAI A;  2X4J A;  3SFM A;  2DM1 A;  1NLO C;  2I0N A;  4M7D A;  1OU9 A;  1X43 A;  2YSQ A;  3CCL T;  5CKD A;  5GAN j;  2L8D A;  3HKS A;  3ZL7 C;  5D6Y A;  3VS4 A;  2B86 A;  5CR2 A;  3CCJ T;  1VQ4 T;  1Z9Q A;  2DTH A;  2RNA A;  4PJO F;  1AOJ A;  1M1K U;  3HRT A;  2A37 A;  3THK A;  1U3O A;  1EZZ B;  1VQ8 A;  1GXI E;  3BFM A;  1R0C B;  3P8H A;  1YJN T;  2LQW A;  1UDL A;  1PNJ A;  3LH5 A;  2KNB B;  5GAO q;  4MMK A;  3ULR B;  2JZ2 A;  2JMC A;  2VXE A;  2LJ1 A;  1YIT Q;  3JCM g;  4N4H A;  1U8R A;  1RLQ C;  3BW1 A;  3CCR T;  2JOY A;  2MPX C;  1QW1 A;  4LE9 A;  2CP3 A;  2CZ1 B;  1QVF A;  1JQQ A;  2ZPG B;  3M0T A;  1OUL A;  5I2S A;  4BE1 A;  4XTX A;  1VA7 A;  4WCI A;  5GAN g;  1B7T A;  5A0G A;  2HQH A;  4IIO A;  1IRE B;  1N5Z A;  2DRK A;  3OMG A;  1VQM A;  2Y90 A;  5CKE A;  2RJE A;  5FLX E;  3CCV A;  3X20 B;  4TVR A;  2FZC B;  2X4X A;  5LJ3 h;  3QKJ A;  2KRO A;  3PMI A;  3CXC A;  5FU6 B;  2PVG B;  1BI1 A;  1K8A C;  3RR6 A;  3RMS A;  1KQS P;  4Q5W A;  4PK4 A;  5LJ5 h;  4E7K A;  3PIP A;  1ZUK A;  2QA4 T;  2L3R A;  1VQ5 T;  1RI9 A;  1ZBX A;  2DIQ A;  3MCA B;  1NLP C;  5CQY A;  3QDR B;  1X75 C;  2DL7 A;  2GQV A;  4MZP A;  3HHT B;  3TRE A;  1ZLM A;  1X27 A;  3PNW C;  2JTE A;  5EG2 A;  5LJ3 e;  1VQ6 T;  1IGQ A;  1KC8 C;  2X35 A;  1TUG B;  3QXE B;  4OMP A;  1PRM C;  5LJ5 e;  2D8H A;  3G6E T;  3QII A;  1C6V X;  1RAF B;  2RB6 A;  5EC7 A;  1Q7Y C;  2KT8 A;  3KXT A;  3UDC A;  4ZGJ B;  2O9S A;  5KYY A;  2NUT A;  3JB9 J;  2XK0 A;  4JJN K;  3FJ5 A;  4V2S A;  1JJ2 A;  1E6H A;  1MND A;  4DBF A;  1XQH A;  3MP1 A;  1IGU A;  2VAS A;  3OS5 A;  2RPN A;  1TSF A;  1CKB A;  2RI3 A;  5IXB A;  5FWB A;  1N8R U;  2LP5 A;  2KEA A;  4L59 A;  4M77 B;  4DEY A;  4PL6 A;  2XDB A;  2CUD A;  3CCS Q;  2QAZ A;  2K79 A;  4PFP A;  5GAO r;  1ACM B;  3OW2 S;  2ZPI B;  4KH0 B;  4EMK C;  1Y96 B;  2J6O A;  1YI2 T;  2DIL A;  1MMA A;  1S1N A;  5HK3 A;  4RTV A;  1M4Z A;  2LMJ A;  3MEV A;  2ED1 A;  4QW2 A;  2ZPE B;  5C0M A;  2KYM A;  3P8D A;  3CD6 A;  5KYW B;  4O6J A;  2RN8 A;  2EIF A;  2OTJ T;  1GCQ C;  1M1G A;  2E70 A;  4J9I A;  3JCM Q;  3ER0 A;  1NM7 A;  2CT4 A;  2K5F A;  3TQ7 P;  4OGC A;  3OMC A;  1V76 A;  5D6X A;  8ATC B;  4E7S A;  2DBM A;  2LRQ A;  3RKY A;  2KY9 A;  4E2F B;  2MMP A;  1YWO A;  1NJI R;  1HD3 A;  2OX7 A;  3PMT A;  1KK7 A;  5GMK j;  1Q81 C;  4KH1 B;  2YHT A;  2HQE A;  4C5E A;  1YBY A;  2RHY A;  1JU5 C;  4C92 G;  4JZ3 A;  2RJD A;  4HVU A;  1M2V B;  5I22 A;  2KXD A;  3JCM P;  1W6X A;  4FSS A;  2JXB A;  3M59 A;  3OYE A;  3HTR A;  1YJW A;  2YRD A;  3TSZ A;  1VQ8 Q;  1AWO A;  3JB9 I;  4J9C A;  3MO8 A;  4CC4 B;  1I4K 1;  3JRZ A;  2KBT A;  3H6Z A;  1M90 C;  2M1H A;  3L2Q A;  1D3B B;  4KGZ B;  2LVM A;  1E6G A;  2LX7 A;  5GAO l;  2GFU A;  4J6W A;  4EDU A;  1B34 B;  1AWX A;  4ZNX A;  3JCM J;  1VQM Q;  2IG0 A;  3FLG A;  3CCV Q;  3CC4 T;  2QK0 A;  3CME Q;  2EQU A;  1LJO A;  2QQ9 A;  1W2B S;  2BIV A;  2YT6 A;  2FG0 A;  3SB2 A;  3GPL A;  4J83 A;  4B6M A;  1AWW A;  4HXJ A;  2V8I A;  4A4H A;  4KUI A;  3L2V A;  1QP2 A;  1QVF P;  1Q82 U;  3CBP A;  1VQP A;  3CBO A;  1ZUY A;  2CDT A;  4C0Z A;  3RBB B;  2EGC A;  2FRY A;  3VS3 A;  2HBW A;  1OV3 A;  3JCM b;  2MWO A;  1WHH A;  3D7S B;  5GAN 2;  3URG A;  1WPY A;  3ASK A;  5KH6 A;  3CCQ T;  2RI5 A;  2ED0 A;  1H92 A;  1XOV A;  4JS4 A;  3CXC P;  1NBE B;  2C06 A;  4MZM A;  3CMA T;  1K73 U;  3V8L A;  2DF6 A;  3I5R A;  2KQW A;  4JPB W;  3CCM T;  1RI0 A;  2AT1 B;  4EMK A;  4IUV A;  1OI1 A;  2X3W D;  5GMK h;  4KGX B;  2KK4 A;  2RK1 A;  1YP5 A;  3GNG A;  3VS0 A;  2DEU A;  3U23 A;  2RI2 A;  3MEW A;  3VKI A;  3G4S A;  4M77 D;  5I2M A;  1EFN A;  3OA6 A;  4HVW A;  4M75 B;  1BCM A;  3NTH A;  2AZS A;  3VRY A;  1GCQ A;  3OYI A;  2DD5 A;  4RTU A;  1N9S A;  1RLP C;  3HL8 A;  5A0L A;  2KSS A;  3GNF B;  1NPR A;  1TXQ A;  3QBY A;  3OBY A;  1C0M A;  2M02 A;  2X4W A;  4BE2 A;  1BI0 A;  4M78 G;  1UE9 A;  2RF0 A;  2BZ8 A;  4QVD A;  3EFO A;  4J9H A;  1SEM A;  3X28 B;  1R0B G;  1GBR A;  1K9M C;  4DBH A;  4OMM A;  5CKF A;  2IPO B;  3CCJ A;  4FT2 A;  1FWZ A;  4R56 A;  4C8Q E;  1K0X A;  2QI2 A;  1M27 C;  2DFU A;  3EHQ A;  1JJ2 P;  2O31 A;  1YIJ A;  3SWN C;  2YUO A;  4PLI A;  1WYX A;  2C0O A;  1VQN Q;  1WZO A;  3CD6 Q;  4ZGE B;  1WHJ A;  3AHU A;  4AFQ C;  2FO0 A;  2ZPH B;  4C92 E;  2COY A;  3JCM c;  5FRN A;  2DVE A;  1HXD A;  3S6W A;  3EH2 A;  2RHU A;  4PJO G;  2YUN A;  5A0D A;  1ZX6 A;  4XTY A;  3EGD A;  1M3B A;  4C92 C;  4HA8 A;  4C8Q F;  1WDX A;  3CCR A;  3UAT A;  1WLP B;  1XNI A;  2E41 A;  4OP0 A;  5FU7 C;  1BIB A;  1U1T A;  2LCL A;  4DOV A;  1KQS A;  2GBQ A;  4RKU E;  4C92 F;  4J9D A;  2JS0 A;  4C5I A;  3BE3 A;  3NPF A;  3KFV A;  1MGQ A;  3EG9 A;  1YJ9 T;  2NYS A;  2RA2 A;  2Y4X A;  1M2O A;  4E47 A;  2J05 A;  2Z0W A;  1S72 Q;  1YJW Q;  1TG0 A;  2EBP A;  5CKH A;  2HBP A;  1GBQ A;  2G6F X;  2HKQ B;  1RAE B;  1Y57 A;  3M5A A;  5CK9 A;  4LUD A;  2AHJ B;  4JJC A;  2HL5 C;  3JCM W;  1SSH A;  3V7S A;  4PJL A;  5DLO A;  3JCM f;  1E7O A;  2RMO A;  3EGX A;  4M7A E;  3BY7 A;  1NJI C;  3FRN A;  3OB9 A;  5ECA A;  1WHL A;  4AG1 C;  3M56 A;  1PWT A;  2JJ9 A;  5GAN f;  4FYX B;  2LX9 A;  4JLG A;  2QTX A;  5KYX B;  4CRI A;  1M30 A;  2CT3 A;  1WXU A;  3HRS A;  2FB7 A;  3OW2 P;  3I55 T;  3G6E A;  4JRK A;  5FRO A;  2PVD B;  5GAO n;  2VYT A;  4Y92 A;  1Q82 R;  4LN2 A;  4FW2 A;  4LNP A;  4M7A F;  2DAQ A;  3J81 E;  2A28 A;  1YNZ A;  2JUF A;  3I56 Q;  1QVG A;  1VQP Q;  2WSE E;  3R6N A;  2EVR A;  4GY5 A;  5DY9 A;  5KCH A;  2ZPB B;  2RQV A;  1K73 R;  1KD1 C;  3RMQ A;  2E10 A;  1WHM A;  1Y07 A;  2AKL A;  2LCC A;  1UGV A;  3P8B B;  4RCC A;  5DM7 R;  2HD0 A;  4M75 D;  5LJ3 d;  2DL5 A;  4OMQ A;  5GAO m;  2V8K A;  3A98 A;  1BI2 A;  2OAU A;  5LJ3 j;  1JXM A;  1AT1 B;  5LJ5 d;  2PUO B;  4EIK A;  2HSP A;  3CC7 T;  4PJN A;  1SHF A;  3GF5 A;  2JN0 A;  4A4F A;  3SWN A;  4QKU A;  4RTZ A;  4XK8 E;  5LJ5 j;  1G5V A;  4BE0 A;  4N4G A;  3PVQ A;  2OTJ A;  4M78 C;  2E3I A;  4PKC C;  3WVD B;  4A63 B;  3QWX X;  2FRW A;  1M1F A;  4F14 A;  4M78 F;  2K5I A;  3M9Q A;  4C92 A;  1F1B B;  4E7Z A;  1OX8 A;  4L5G A;  3V7R A;  3TCJ A;  3G1J A;  2XMF A;  2KYB A;  1FX7 A;  3JSC A;  3OYM A;  1NEB A;  3E1S A;  3CCJ Q;  3O5Z A;  1HYO A;  2OTL T;  5D7U A;  4OB1 B;  3MHX A;  2CS7 A;  1AVZ C;  4PJO C;  3O8V A;  1BU1 A;  1MV0 B;  4RTT A;  4A4G A;  2O2O A;  1YIJ Q;  5LJ3 g;  2HQX A;  1NZ9 A;  1I81 A;  2GFA A;  4E7L A;  5IH2 A;  2EGE A;  3CPW S;  1TS9 A;  1X2K A;  3L42 A;  2X9H A;  1W4S A;  5LJ5 g;  3LLR A;  2V26 A;  2KR3 A;  1YJN Q;  5GAN 3;  2E65 A;  4IUU A;  2PQW A;  1Q86 C;  3IQL A;  4XU2 A;  3HSB A;  1RAH B;  1FMW A;  5KYU A;  1GFC A;  1QKX A;  4OF1 A;  1WFW A;  3CCR Q;  4J9E A;  3HPW A;  1NG2 A;  2J06 A;  3H8Z A;  3RES A;  3AT1 B;  2LDM A;  3GBQ A;  4ZTJ A;  2HKN A;  3NGP A;  4F16 A;  4BD3 A;  3C12 A;  5HKC A;  3G71 T;  2AKK A;  1QCN A;  3CC4 A;  5IHN A;  3C0C A;  3FC3 A;  3L2Z A;  2QAS A;  3CCE A;  3UA7 A;  2MF2 A;  2K3X A;  2QEX T;  1VQO T;  3CME A;  3GLX A;  4EMK B;  2K3B A;  1B3Q A;  1VYT A;  1VQ5 Q;  2PNI A;  4OB3 B;  3OQ5 A;  2VVK A;  3S3M A;  3RER A;  4BI8 B;  4OVA A;  2NLU A;  3TVT A;  4RMO A;  2MYS A;  1H64 1;  4J9F A;  3OS2 A;  2COW A;  1WXB A;  2DJZ A;  1MMN A;  1YHQ T;  2DRM A;  3CMA A;  2RD1 A;  4J7I A;  1SPK A;  1KHC A;  2K57 A;  4XAX B;  5GAM e;  2YWW A;  1PKS A;  1OX9 A;  1PSF A;  2MAM A;  2F69 A;  3G6E Q;  3LGF A;  2LCS A;  1I8F A;  2P4T A;  4KBM B;  2WSC E;  1KFZ A;  1JO8 A;  2MOX A;  2JVV A;  4JS5 A;  5IN1 A;  1T0J A;  1Y71 A;  3S3O A;  3H9N A;  1LPL A;  3SDZ A;  2J7I A;  4M78 A;  1SHG A;  2MIO A;  3E2U A;  5GAN 6;  4BAC A;  2JTF A;  1AZE A;  4XU1 A;  1BCO A;  5GAN 4;  1WQ7 A;  5GAN 7;  2DZC A;  2LNH B;  4AMC A;  2MWP A;  3M0R A;  1Q95 G;  2RK2 A;  1WHG A;  2D0N A;  2EKH A;  2JM8 A;  2KRM A;  2LZ6 B;  2FPD A;  4JJD A;  2ROL A;  3EGD B;  3BDL A;  2RH2 A;  2CSI A;  2RQW A;  1JRI A;  4RUG A;  1QVG P;  2M51 A;  4OGE A;  1QCO A;  3X26 B;  2CZ0 B;  1VQ7 T;  3MP6 A;  2K6D A;  2K4Y A;  4PJO A;  1JB0 E;  2XKO C;  4JRI A;  2E5Q A;  2F5K A;  4J6X A;  4Z89 A;  3QUI A;  2MK5 A;  1H8K A;  3JCM X;  1U1S A;  2OTJ Q;  3DLM A;  2E5K A;  1VQN A;  1X2Q A;  1OYX A;  1RAD B;  2DPP B;  1FMK A;  2CP5 A;  4BI3 A;  2YRC A;  1JXO A;  4HVV A;  2P0Q A;  2BZY A;  3A5Z B;  1RL2 A;  4FT4 A;  3UPU A;  1VIE A;  2NWM A;  1OU8 A;  2CP2 A;  4B9W A;  2EW3 A;  3CC2 A;  2CKK A;  4ESR A;  1QWE A;  1UG1 A;  1YJ9 A;  4ORZ A;  1TOV A;  4RCB A;  4C8Q G;  1D0Z A;  5KE2 A;  4KGV B;  1M1K R;  3LWI A;  1W70 A;  5L23 A;  2DO3 A;  1HSQ A;  1IXD A;  3LX7 A;  1KQ2 A;  1AHJ B;  4J9G A;  5AYF A;  1K8A U;  4CC3 A;  3Q1J A;  1BK2 A;  1S72 A;  3FB9 A;  4N4I A;  1ZSZ B;  2DMO A;  2FPE A;  1VQK T;  1QCF A;  1MMG A;  2VKN A;  4LDX A;  1KIK A;  3V7C A;  2RM4 A;  3HRU A;  3BDU A;  3OW2 A;  3NFC A;  2XU8 A;  4RG8 A;  2YLB A;  1SSF A;  2HNI A;  4HT9 A;  2HCK A;  2DXB A;  1FYN A;  2BZX A;  1X01 A;  3C95 A;  4Z88 A;  4J5Y A;  1BB9 A;  1AEY A;  2DTO A;  1V29 B;  3VYG A;  2D8J A;  1KC8 U;  3CC4 Q;  3M58 A;  4M77 E;  2EPD A;  4LDV A;  4EMH A;  3CCE Q;  2VXF A;  4F7U B;  2NUP B;  3NTI A;  2DA9 A;  2WSF E;  5CQX A;  4M75 G;  2JM9 A;  3CCU T;  4HCB A;  3OBW A;  4LUE A;  3X25 B;  3REA B;  3SWN B;  3HP9 A;  4OML A;  2AIR B;  4M77 F;  4M7A G;  2HSE B;  2XI9 A;  3I56 A;  1M9S A;  4FL6 A;  1P92 A;  1G3W A;  3CMA Q;  3VV0 A;  5KYN A;  4JLI A;  1I5L A;  4UC4 A;  2KDS A;  2CP6 A;  3M55 A;  3OYH A;  2DZ9 A;  4Z02 A;  1IRX A;  4AG2 C;  1X6O A;  2V1Q A;  2EYZ A;  2L0A A;  1N9R A;  5FU7 B;  1I1J A;  2H3J A;  1C1A A;  2EYW A;  2VUB A;  2DLP A;  1UJY A;  4MZT A;  1M3A A;  1G3S A;  4M7D B;  4AT1 B;  3CC7 A;  1H3Z A;  3L1A A;  2F2W A;  2ABL A;  1SG5 A;  5I11 A;  1OPL A;  1EX4 A;  3OYJ A;  1VOM A;  1KSW A;  1TUD A;  2YLC A;  4PFO A;  2KAF A;  3M0P A;  1N8R R;  3FIF A;  2LQ8 A;  1W2B A;  5IAY A;  3HFO A;  1K0S A;  1PD1 A;  4C0F A;  2CH4 A;  4LDU A;  3QG1 A;  2KGT A;  3JB9 D;  2XD0 A;  1D1C A;  1WGS A;  1KQS S;  3CCL A;  1Q81 U;  1UFF A;  1MUZ A;  2W10 A;  8AT1 B;  3QZ5 B;  4F7U E;  2H8H A;  2A36 A;  1VQ4 A;  3A8M B;  1XJW B;  4X9C A;  4QQ6 A;  2NUZ A;  1QKW A;  4OB2 B;  2B8A A;  2VGN A;  1ZQ1 A;  4C0D C;  3EFR A;  1ZUU A;  3PTA A;  1YJN A;  4B9X A;  4C8Q C;  1YWP A;  1M90 U;  5CVI A;  4BI4 A;  1BYM A;  3JV3 A;  1NPP A;  1QP3 A;  2GF7 A;  2XIC A;  2DE0 X;  3CEY A;  3CC2 Q;  5J39 A;  1YJ9 Q;  4CC2 A;  2EJF A;  1VQ9 T;  2DEQ A;  3G71 A;  4K11 A;  4OMN A;  2R57 A;  2MI6 A;  1K8A R;  5FW9 A;  2EYQ A;  4E7J A;  3M4Y A;  5LJ3 f;  2G3R A;  4BDY A;  3SD4 A;  2XHC A;  2L3Q A;  2KE9 A;  2KMT A;  3I9Q A;  3EHR A;  2QEX A;  3M4G A;  1VQO A;  5LJ5 f;  4J6Y A;  1DJ7 B;  2BKD N;  2QGF B;  2MCN A;  4J9B A;  3LH0 A;  1T3L A;  2O88 A;  4VUB A;  2QA4 A;  1IZ6 A;  2OJ2 A;  2YDL A;  4CI0 C;  4M75 E;  2COZ A;  1VQ5 A;  1PHT A;  1LCK A;  5KYY B;  4ATO A;  4M78 B;  2BE7 D;  3L2R A;  2KI7 A;  3TSW A;  2NUT B;  4XTW A;  4DEX A;  3EH1 A;  1JBM A;  1YHQ A;  4QQD A;  3DB4 A;  2J6F A;  5KYW A;  4J8O A;  4MDX A;  3NMZ C;  4M75 C;  3OYF A;  1UEB A;  3MKD A;  1UGQ B;  2V8J A;  3ZEH A;  4BUG A;  1VQ6 A;  4NS5 A;  1PRL C;  2EJ9 A;  2JS2 A;  1M1K C;  1SRL A;  2EJG A;  4M7A C;  4M75 F;  3QJY A;  2L89 A;  4DA4 A;  1CSK A;  2EAY A;  2PVO B;  5IT9 E;  1O9S A;  2CGH A;  2K5L A;  1G83 A;  4PJO B;  3M0Q A;  2XG8 D;  4LD6 A;  4D8K A;  5GJW B;  2EYX A;  2PTK A;  3G4S T;  2CYZ B;  2C0I A;  3LYI A;  4HKE A;  3EGU A;  4XU0 A;  1RAC B;  3M57 A;  4M7D D;  2F1L A;  2K7A A;  2RJC A;  2PU9 B;  3OYG A;  4JUV A;  3EG0 A;  2GTJ A;  3WXM B;  4HCK A;  2QDY B;  1BI3 A;  2VV5 A;  4X1V A;  4FCY A;  2DL4 A;  2OI3 A;  2ZGW A;  3TEE A;  3RIR A;  4OMF B;  3C4S A;  1VQ7 A;  2YRV A;  1Y0M A;  1UEC A;  5GAM d;  1K9M U;  1TUC A;  4DBQ A;  2DIG A;  1V1C A;  4ZGD B;  3CC7 Q;  1UGS B;  5DLQ E;  2FPF A;  1YI2 A;  1ZA2 B;  5GAM j;  1H3H A;  1OQK A;  2HMA A;  2R5A A;  1D3B A;  4P5N A;  3VU3 C;  1U5S A;  1OZ3 A;  2XDD A;  2FZK B;  2PUK B;  2L5Q A;  3TU4 K;  2R58 A;  1B34 A;  2V1R A;  2YUQ A;  1X69 A;  4M4Z A;  1N6A A;  4BB7 A;  2R5M A;  1B07 A;  1K1Z A;  2KRN A;  2LT1 A;  1R8O B;  1QWF A;  1TU0 B;  3VJP A;  4C8Q A;  2IVW A;  1VQL T;  4FYW B;  2JTM A;  2F2X A;  1Q81 R;  3OYN A;  1BBZ A;  4JRP A;  4A4E A;  1OPK A;  3CCL Q;  1PCX A;  2ZCF B;  1PC0 A;  2E3H A;  2LQN A;  4PJJ A;  5GAN 5;  1QVF S;  3OYL A;  4XTZ A;  4F04 B;  1VQ4 Q;  3QZ9 B;  5GAM g;  3JCM d;  4GBQ A;  1RAA B;  1W2B P;  4XQ3 A;  3G7Z A;  1K4U S;  1VQK A;  5GAN d;  1UTI A;  3CXC S;  2QGG A;  3PFS A;  1N8R C;  4N0A C;  5IHK A;  1NJI U;  1T3S A;  2VC8 A;  3G71 Q;  3CBM A;  1TH7 A;  2XID A;  1YIJ T;  4M75 A;  1GFD A;  1KQ1 A;  4GLM A;  1D09 B;  1SF9 A;  2VWF A;  3QDF A;  5CO7 A;  3LGL A;  1JEG A;  4HCC A;  5L8R E;  2QEX Q;  3DLL A;  4M7A A;  4M78 D;  1VQO Q;  2DJQ A;  4IUR A;  3EG1 A;  3KBG A;  4ZN3 A;  9ATC B;  3CCU A;  4ZTF A;  5GAM h;  1BIA A;  2YUP A;  2E6N A;  4PFZ A;  2QA4 Q;  4R0K A;  1YCS B;  1YIT T;  1VYV A;  1KD1 U;  4MML A;  3QHS A;  1VYU A;  2P0K A;  1YHQ Q;  4PJM A;  2A08 A;  1ABQ A;  1AD5 A;  2BUD A;  2EQI A;  1PKT A;  2M0O A;  4DBR A;  3CPW A;  2D6F A;  3CCQ A;  1G3Y A;  4PJO D;  5HK0 A;  4M77 G;  1JJ2 S;  2LNV A;  4LD9 K;  1VQ6 Q;  1IHV A;  4L6V 5;  2RO0 A;  2HAX A;  1WQW A;  4BY6 C;  2LJ3 A;  3CCM A;  2DYB A;  2A0F B;  2ESW A;  3SEM A;  3JB9 G;  3EFO B;  4FM4 B;  4ELZ C;  3VS1 A;  2F5T X;  1KJW A;  4NOY A;  4FU6 A;  1AWJ A;  4EMG A;  1N27 A;  1G3T A;  3FJP A;  3L2U A;  2HL3 A;  3JCM h;  2OAW A;  2DXT A;  2P84 A;  5LL6 S;  2E12 A;  2RQR A;  1WIE A;  1RUW A;  4CC7 A;  3MEA A;  1ZBJ A;  4IKF A;  1YFN A;  2DKG A;  1LVK A;  5GAN h;  1VIF A;  3MET A;  1K9M R;  1PD0 A;  3RUX A;  4JDS A;  2EFI A;  2GGR A;  1KHI A;  1RAG B;  1VQ7 Q;  3MEU A;  5GAN 8;  2Y4Y A;  1YI2 Q;  2RQU A;  3FDR A;  2DET A;  2EQM A;  2GCX A;  2RHX A;  4C0G A;  3JCM e;  1Q82 C;  5IHI A;  3X24 B;  2A7Y A;  2M9U A;  1ARK A;  3EG9 B;  3E19 A;  2ZZD A;  2DNU A;  2ATC B;  3S3N A;  1Q86 U;  5GAN e;  5KYX A;  3MPU B;  4RTX A;  5D6W A;  2E64 A;  1D0Y A;  2K2V A;  2FZG B;  4N0A A;  4YTL A;  1K73 C;  4KUD K;  2ENM A;  3OYY A;  3VYH B;  3VUZ A;  1RAI B;  5CKB A;  3QYG B;  2X51 A;  2DL8 A;  5FU6 C;  2DYI A;  3CCS T;  4FW1 A;  3KUF A;  1VQ9 A;  2ZPF B;  2YXY A;  3INZ A;  1MNE A;  3PIO A;  4XTU A;  4ANJ A;  3EGX B;  3FEO A;  4F7U G;  2K2M A;  1MV3 A;  4LXC A;  3A8H B;  2QG9 B;  4FYV B;  2VB6 A;  1J3T A;  3EAE A;  1M8V A;  3VS5 A;  2KVQ G;  4O5V A;  4X9D A;  7AT1 B;  2O4X A;  1VQK Q;  2XDP A;  2E1H A;  3OYB A;  1RAB B;  4LDW A;  4KT0 E;  2L3S A;  2JW4 A;  3DKM A;  1WHK A;  2I2L A;  4NL3 A;  1UB4 A;  2E4H A;  2CH4 W;  2EQK A;  2LTO A;  2LT4 A;  3QSU A;  1PSE A;  2O9V A;  2SEM A;  2EYY A;  1PG5 B;  1WA7 A;  2QTV A;  2H3E B;  1CKA A;  4II1 A;  4M7D G;  3C94 A;  1M8M A;  2D9T A;  3RNJ A;  1G8X A;  5C6S A;  3VS6 A;  4D6W A;  4JJB A;  3I55 A;  3OS0 A;  3CCU Q;  3MJX A;  4OB0 B;  4AFS C;  2FYK A;  4C5H A;  3WVE B;  1VQ8 T;  1AZG B;  1KD1 R;  4AFZ C;  1Q7Y U;  1LOJ A;  2L3P A;  1U06 A;  1GRI A;  4M77 C;  3RDV A;  2DX1 A; 
#chains in the Genus database with same CATH homology
 2R57 A;  3G6E T;  2MI6 A;  3QII A;  3L2W A;  2EYQ A;  1M1F A;  2RB6 A;  3M4Y A;  5LJ3 f;  2G3R A;  4M78 F;  2K5I A;  4BDY A;  4E7J A;  3SD4 A;  1Q7Y C;  3M9Q A;  4C92 A;  3KXT A;  2XHC A;  3UDC A;  4ZGJ B;  2KMT A;  4HCZ A;  2QEX A;  3M4G A;  4C0D B;  4DQ2 A;  4A53 A;  3LWH A;  1VQO A;  5HY6 A;  3ME9 A;  4L5G A;  5LJ5 f;  4J6Y A;  1DJ7 B;  4FSX A;  3TCJ A;  3V7R A;  3JB9 J;  2BKD N;  1FX7 A;  2XK0 A;  3JSC A;  4NL2 A;  3UT1 A;  4C8Q B;  4JJN K;  1VQM T;  3OYM A;  3LH0 A;  3E1S A;  5GMK l;  3CCE T;  4V2S A;  4VUB A;  1JJ2 A;  4E7I A;  5CCA A;  1QVP A;  3CCV T;  2OTL T;  2QA4 A;  3MHX A;  4OB1 B;  1XQH A;  2CS7 A;  3MP1 A;  4WF2 A;  1IZ6 A;  3O8V A;  3CME T;  4PJO C;  3QO3 A;  4A4G A;  4C92 B;  3OS5 A;  4M75 E;  4CI0 C;  3JB9 F;  5LJ3 g;  1VQ5 A;  2HQX A;  1NE8 A;  2RI3 A;  1NZ9 A;  1I81 A;  1Y7X A;  2GFA A;  4ATO A;  4M78 B;  4E7L A;  3CPW S;  1N8R U;  3L2R A;  3L42 A;  4L59 A;  4M77 B;  4XTW A;  2QXF A;  3J80 E;  4PL6 A;  1JBM A;  1W4S A;  5LJ5 g;  1YHQ A;  3LLR A;  4QQD A;  2XDB A;  4IUT A;  4QVZ A;  4BDZ A;  5GAN 3;  3DB4 A;  2E65 A;  4IUU A;  4J8O A;  2PQW A;  4A54 A;  5GAO r;  1Q86 C;  4MDX A;  1KG1 A;  4M75 C;  3OYF A;  4XU2 A;  1VUB A;  3OW2 S;  3JCM V;  1UEB A;  2ZPI B;  1UGQ B;  2V8J A;  3ZEH A;  4EMK C;  1Y96 B;  4R55 A;  3HSB A;  1O75 A;  3A8L B;  4BUG A;  1VQ6 A;  1YI2 T;  4NS5 A;  2EJ9 A;  4OF1 A;  5HK3 A;  1M1K C;  2EJG A;  2QQS A;  4LDY A;  1M4Z A;  4M7A C;  4M75 F;  3HPW A;  3QJY A;  2L89 A;  3H8Z A;  4IUQ A;  4DA4 A;  2EAY A;  2PVO B;  3MEV A;  5IT9 E;  3RES A;  4QW2 A;  1O9S A;  2ZPE B;  1VQL A;  5C0M A;  4JRQ A;  2CGH A;  3P8D A;  3CD6 A;  2LDM A;  2CZ7 B;  2K5L A;  4ZTJ A;  4O6J A;  4PJO B;  1WJQ A;  2EIF A;  2OTJ T;  2XG8 D;  1M1G A;  1WNL A;  2E70 A;  3C12 A;  4BD3 A;  4LD6 A;  5HKC A;  3ER0 A;  3JCM Q;  2K5F A;  3EFS A;  3G71 T;  3M54 A;  4HT8 A;  4OGC A;  3OMC A;  3G4S T;  3CC4 A;  2FVU A;  2LC4 A;  5D6X A;  1BYM A;  3UWN A;  2CYZ B;  3LYI A;  3FC3 A;  4HKE A;  2LRQ A;  2P0P A;  1OZ2 A;  3VUB A;  4XU0 A;  3RKY A;  3L2Z A;  2KY9 A;  3M57 A;  2QQA A;  3OSS C;  4M7D D;  3CCE A;  2MF2 A;  2MMP A;  2OTL A;  2K3X A;  2RJC A;  2QEX T;  2PU9 B;  3PMT A;  3OYG A;  4JUV A;  3GLX A;  4EMK B;  4EPC A;  5I21 A;  3CME A;  1VQO T;  2WAC A;  3WXM B;  2QDY B;  1BI3 A;  2VV5 A;  4MDW A;  3JB9 H;  5GMK j;  2ZGW A;  4M7A B;  3TEE A;  4OB3 B;  2YHT A;  4DOW A;  3JAM E;  3OQ5 A;  4FIB A;  3RIR A;  2HQE A;  4C5E A;  1YBY A;  2RHY A;  4OMF B;  4C92 G;  3S3M A;  3RER A;  4BI8 B;  4OVA A;  3C4S A;  4QQG A;  2NLU A;  2RJD A;  2YRV A;  1VQ7 A;  5GMK e;  5GAM d;  2E6Z A;  1K9M U;  4ME7 A;  3JCM P;  4RMO A;  3M59 A;  2DIG A;  1H64 1;  4ZGD B;  3T9N A;  1UGS B;  3OS2 A;  5DLQ E;  3M53 A;  3OYE A;  2QQB A;  1YI2 A;  1YJW A;  5GAM j;  2DJZ A;  2D0Q B;  2R5A A;  4PNO A;  1YHQ T;  2DTI A;  1D3B A;  3CMA A;  2RD1 A;  4J7I A;  4P5N A;  3JB9 I;  1M5Q 1;  3VU3 C;  3MP8 A;  1KHC A;  2K57 A;  1OZ3 A;  2A3L A;  3MO8 A;  4F7U F;  4XAX B;  5GAM e;  2PUK B;  2L5Q A;  3PT9 A;  2R58 A;  2XDD A;  3TU4 K;  1B34 A;  1Q81 C;  1PSF A;  2MAM A;  2F69 A;  4Y28 E;  1I4K 1;  3LGF A;  4J7F A;  5J26 A;  3JRZ A;  1N6A A;  4BB7 A;  1I8F A;  3H6Z A;  2R5M A;  2LT1 A;  1M90 C;  2P4T A;  1R8O B;  2M1H A;  2EQJ A;  4KBM B;  4C8Q A;  3VJP A;  3L2Q A;  2WSC E;  2IVW A;  1VQL T;  1D3B B;  2JTM A;  2LVM A;  4ELY C;  5GAM f;  2FHD A;  1VQN T;  3CD6 T;  2JVV A;  5GAO l;  4JS5 A;  2GFU A;  5IN1 A;  4J6W A;  3OYN A;  4PLL A;  4EDU A;  1Y71 A;  1B34 B;  4M7D E;  3JCM J;  2IG0 A;  1UGR B;  4JRP A;  2LQK A;  3S3O A;  1WJR A;  3SDZ A;  4A4E A;  3FLG A;  4IUP A;  4M78 A;  3CC4 T;  5GAN 6;  2EQU A;  2ZCF B;  3OYA A;  4M77 A;  2K3Y A;  1LJO A;  2JTF A;  2QQ9 A;  3A8O B;  3NTK A;  4BAC A;  1W2B S;  2BIV A;  5GAN 5;  4XU1 A;  1YIT A;  5GAN 4;  3OYL A;  1QVF S;  1WQ7 A;  1ZHI A;  5GAN 7;  2DZC A;  4XTZ A;  2MWP A;  3QJ6 A;  3SB2 A;  5GMK i;  4J83 A;  3GPL A;  4M7D C;  2RK2 A;  3QZ9 B;  1QVG S;  3CC2 T;  2QQR A;  2V8I A;  4A4H A;  3JCM d;  4KUI A;  1Y96 A;  5GAM g;  3L2V A;  1QP2 A;  3BDL A;  1LNX A;  1Q82 U;  2RH2 A;  4XQ3 A;  2RHZ A;  3CBP A;  1VQP A;  3CBO A;  4M7D F;  1YCY A;  3G7Z A;  1JRI A;  4C0Z A;  1VQK A;  5GAN d;  3OYK A;  4OGE A;  1VQ7 T;  2EKO A;  2CZ0 B;  3X26 B;  3CXC S;  3MP6 A;  3JCM b;  2K4Y A;  2MWO A;  3PFS A;  4N0A C;  1N8R C;  5GAN 2;  4PJO A;  1JB0 E;  1WPY A;  3ASK A;  2XKO C;  3URG A;  5KH6 A;  4JRI A;  3CCQ T;  4QVC A;  1S72 T;  2RI5 A;  1UGP B;  1XOV A;  1YJW T;  2E5Q A;  3DB3 A;  2F5K A;  2RJF A;  4J6X A;  5KCO A;  2FL7 A;  4JS4 A;  1NJI U;  3QUI A;  3JCM X;  2C06 A;  4MZM A;  3CMA T;  1K73 U;  1U1S A;  3V8L A;  4M7A D;  3DLM A;  5M9O A;  3ZBD A;  2VC8 A;  4C8Q D;  3CBM A;  1TH7 A;  1VQN A;  1OYX A;  2KQW A;  2XID A;  3CCM T;  1YIJ T;  4M75 A;  1KQ1 A;  1RI0 A;  3R6O A;  2DPP B;  3E9F A;  4EMK A;  5CO7 A;  4E7H A;  3LGL A;  4IUV A;  1OI1 A;  4RG2 A;  5GMK h;  3QYH B;  5L8R E;  5CIU A;  4C92 D;  3CCL T;  4HCC A;  2KK4 A;  2RK1 A;  3GNG A;  3OY9 A;  1FXX A;  2RI2 A;  4BI3 A;  3MEW A;  3DLL A;  4M7A A;  4M78 D;  3VKI A;  3G4S A;  3E9G A;  2P0Q A;  3A5Z B;  4KUL A;  4IUR A;  3KBG A;  4M77 D;  5I2M A;  1RL2 A;  1HK9 A;  2DXU A;  3A8G B;  4FT4 A;  1BKB A;  4ZN3 A;  3CCU A;  3PGG A;  1VIE A;  3OA6 A;  3UPU A;  4ZTF A;  5GAM h;  4M75 B;  1BIA A;  3NTH A;  4B9W A;  5J3B A;  3CC2 A;  2CKK A;  3OYI A;  2E6N A;  1YJ9 A;  3OS1 A;  4C8Q G;  4RCB A;  2DD5 A;  3GIB A;  1N9S A;  5KE2 A;  2O01 E;  3CPF A;  1YIT T;  3HL8 A;  3LWI A;  5A0L A;  1WJS A;  2KSS A;  3RKX A;  3GNF B;  1NPR A;  4MML A;  3V8J A;  2DO3 A;  3OSV A;  1KD1 U;  3LW5 E;  3QHS A;  3LX7 A;  2P0K A;  1KQ2 A;  3QBY A;  3OBY A;  2X4W A;  3OYC A;  4BE2 A;  1BI0 A;  2BUD A;  2M0O A;  1AHJ B;  4M78 G;  5AYF A;  3CPW A;  2D6F A;  1K8A U;  2DK3 A;  3CCQ A;  1G3Y A;  3Q1J A;  3I56 T;  4PJO D;  5HK0 A;  4M77 G;  1S72 A;  3FB9 A;  4N4I A;  4QVD A;  1VQP T;  1JJ2 S;  3X28 B;  2X4Y A;  2LNV A;  4LD9 K;  1VQK T;  4L6V 5;  2RO0 A;  4ZN1 A;  2HAX A;  3OYD A;  1K9M C;  4LDX A;  3V7C A;  2RM4 A;  3HRU A;  3BDU A;  5CKF A;  3CCJ A;  3OW2 A;  2EWN A;  3NFC A;  1MHN A;  1WQW A;  4FT2 A;  1FWZ A;  4BY6 C;  4C8Q E;  4R56 A;  2QI2 A;  2XU8 A;  2O4X B;  3F70 A;  4RG8 A;  2YLB A;  1SSF A;  2HNI A;  1XTD A;  4HT9 A;  3CCM A;  1YIJ A;  3SWN C;  4PLI A;  1EIF A;  4F7U A;  2DXB A;  4ZGE B;  3AHU A;  2ZPH B;  1X01 A;  3JB9 G;  4C92 E;  3V8K A;  4ELZ C;  4FM4 B;  3C95 A;  3N5B B;  4J5Y A;  3JCM c;  5FRN A;  2DTO A;  2DVE A;  1V29 B;  1HXD A;  2F5T X;  4GLK A;  4M78 E;  3VYG A;  3S6W A;  4NOY A;  4C5G A;  3CCS A;  4FU6 A;  1KC8 U;  2JNG A;  2RHU A;  4PJO G;  3M58 A;  4Y91 A;  4M77 E;  1N27 A;  4EMG A;  4LDV A;  1G3T A;  5A0D A;  3FJP A;  4EMH A;  3L2U A;  4XTY A;  3JCM h;  2DD4 A;  2DXT A;  3QPH A;  4C92 C;  4HA8 A;  2VGM A;  2VXF A;  5LL6 S;  3GP8 A;  2E12 A;  4C8Q F;  4F7U B;  3CCR A;  4A4K A;  5GMK m;  1XNI A;  4X34 A;  3MEA A;  2DXC A;  2E41 A;  4OP0 A;  5FU7 C;  1BIB A;  1U1T A;  3NTI A;  4IKF A;  5GAO p;  2DKG A;  2LCL A;  4DOV A;  2WSF E;  3HFN A;  1KQS A;  5CQX A;  1VIF A;  3MET A;  4M75 G;  5GAN h;  5A2Q E;  3CCU T;  4RKU E;  4C92 F;  1G5V A;  4BY6 B;  3ZFJ A;  3GOX A;  3J7A F;  4C5I A;  2M16 A;  4HCB A;  3OBW A;  3RKW A;  3X25 B;  1MGQ A;  4JDS A;  3RUX A;  1YJ9 T;  2EFI A;  1KHI A;  3SWN B;  2RA2 A;  3HP9 A;  3MEU A;  4XU3 A;  2CZ6 B;  4M77 F;  2RHI A;  5GAN 8;  5FRM A;  4M7A G;  2Y4X A;  3I56 A;  2XI9 A;  4E47 A;  4PJO E;  4XTV A;  2Y4Y A;  5CAI A;  5KE3 A;  1M9S A;  2X4J A;  5CKH A;  3SFM A;  3FDR A;  4FL6 A;  2EQM A;  1P92 A;  1G3W A;  2HBP A;  2GCX A;  2RHX A;  3VV0 A;  4C0G A;  3JCM e;  1Q82 C;  4M7D A;  4JLI A;  1I5L A;  3X24 B;  4UC4 A;  2KDS A;  2A7Y A;  2M9U A;  3M55 A;  2DZ9 A;  3M5A A;  5CKD A;  2L8D A;  3HKS A;  5CK9 A;  3OYH A;  5GAN j;  2AHJ B;  3E19 A;  1X6O A;  2ZZD A;  5D6Y A;  3JCM W;  3S3N A;  1N9R A;  1Q86 U;  5GAN e;  5FU7 B;  5CR2 A;  2H3J A;  3V7S A;  3CCJ T;  1VQ4 T;  2DTH A;  2VUB A;  5D6W A;  5DLO A;  4MZT A;  4PJO F;  2E64 A;  3JCM f;  1G3S A;  2K2V A;  4M7A E;  3BY7 A;  4M7D B;  4N0A A;  1NJI C;  1M1K U;  3HRT A;  3FRN A;  4YTL A;  3CC7 A;  1K73 C;  3L1A A;  4KUD K;  1H3Z A;  3OYY A;  3VYH B;  3VUZ A;  3OB9 A;  5CKB A;  3M56 A;  3QYG B;  1VQ8 A;  5GAN f;  1GXI E;  3BFM A;  3P8H A;  5FU6 C;  3OYJ A;  1YJN T;  2LX9 A;  4JLG A;  2QTX A;  3CCS T;  4CRI A;  3KUF A;  2YLC A;  1VQ9 A;  3HRS A;  2ZPF B;  5GAO q;  2FB7 A;  4MMK A;  3INZ A;  3PIO A;  4XTU A;  3I55 T;  2JZ2 A;  3G6E A;  4JRK A;  3FEO A;  2PVD B;  5FRO A;  4F7U G;  2VXE A;  5GAO n;  2VYT A;  2KAF A;  4N4H A;  3JCM g;  1U8R A;  3BW1 A;  3A8H B;  3CCR T;  2JOY A;  3FIF A;  2LQ8 A;  1QW1 A;  1W2B A;  4M7A F;  2DAQ A;  3J81 E;  5IAY A;  2CZ1 B;  1QVF A;  3HFO A;  2JUF A;  4C0F A;  3EAE A;  2ZPG B;  1M8V A;  5I2S A;  4BE1 A;  4LDU A;  4XTX A;  3QG1 A;  1QVG A;  2KVQ G;  2WSE E;  5GAN g;  5A0G A;  4O5V A;  4X9D A;  3JB9 D;  2O4X A;  2XD0 A;  4GY5 A;  1IRE B;  1WGS A;  2XDP A;  5DY9 A;  2E1H A;  3OMG A;  3OYB A;  1VQM A;  5KCH A;  2Y90 A;  2ZPB B;  5CKE A;  4LDW A;  2RJE A;  1KQS S;  3CCL A;  5FLX E;  1Q81 U;  3CCV A;  4KT0 E;  3X20 B;  4TVR A;  2X4X A;  1KD1 C;  5LJ3 h;  3RMQ A;  2E10 A;  3DKM A;  3QKJ A;  2I2L A;  3PMI A;  3CXC A;  1Y07 A;  3QZ5 B;  5FU6 B;  4F7U E;  4NL3 A;  2PVG B;  1BI1 A;  1K8A C;  1VQ4 A;  3A8M B;  3RMS A;  1UB4 A;  4Q5W A;  5LJ5 h;  2LCC A;  4X9C A;  4E7K A;  3PIP A;  3P8B B;  2EQK A;  2LTO A;  2LT4 A;  4QQ6 A;  2QA4 T;  4OB2 B;  4RCC A;  2B8A A;  5DM7 R;  2VGN A;  1ZQ1 A;  2HD0 A;  4M75 D;  2L3R A;  3QSU A;  1PSE A;  1VQ5 T;  5LJ3 d;  4C0D C;  5GAO m;  1ZBX A;  2V8K A;  3EFR A;  2DIQ A;  3PTA A;  1BI2 A;  4II1 A;  2OAU A;  4M7D G;  1YJN A;  4B9X A;  4C8Q C;  5LJ3 j;  3I55 A;  3C94 A;  3MCA B;  5LJ5 d;  2PUO B;  1M90 U;  2D9T A;  5CVI A;  5C6S A;  4BI4 A;  3CC7 T;  5CQY A;  4D6W A;  3GF5 A;  1X75 C;  2GQV A;  2JN0 A;  3QDR B;  3HHT B;  4MZP A;  3TRE A;  3PNW C;  3SWN A;  1NPP A;  5EG2 A;  1QP3 A;  4A4F A;  5LJ3 e;  3OS0 A;  2GF7 A;  4OB0 B;  4XK8 E;  5LJ5 j;  2FYK A;  2XIC A;  3WVE B;  4C5H A;  4BE0 A;  1KC8 C;  1VQ8 T;  1VQ6 T;  4N4G A;  3CEY A;  2OTJ A;  5J39 A;  2X35 A;  4M78 C;  2EJF A;  3QXE B;  1Q7Y U;  1LOJ A;  4PKC C;  3WVD B;  1VQ9 T;  5LJ5 e;  2DEQ A;  4M77 C;  3G71 A;  4Z02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...