2E12A

The crystal structure of xc5848 from xanthomonas campestris adopting a novel variant of sm-like motif
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
93
structure length
93
Chain Sequence
MPKYAPHVYTEQAQIATLEHWVKLLDGQERVRIELDDGSMIAGTVAVRPTIQTYRDEQEREGSNGQLRIDHLDASQEPQWIWMDRIVAVHPMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title XC5848, an ORFan protein from Xanthomonas campestris, adopts a novel variant of Sm-like motif
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Translation
molecule keywords Hypothetical protein XCC3642
total genus 22
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11607 DUF3247 Protein of unknown function (DUF3247)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.720 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e12A00
2E12A
chains in the Genus database with same CATH superfamily
1VQPQ 2ED0A 3L2QA 2FB7A 1K76A 2OAWA 3TEEA 1W1FA 5FWCA 4N0AC 5DY9A 2EBPA 3M56A 3M53A 2QQBA 2DA9A 3I9QA 2LNVA 3G71T 2EAYA 4HKEA 4M78G 4QVCA 4K11A 2QEXQ 1WJQA 1JRIA 3CCEQ 1NLPC 2D6FA 3EFRA 1YFNA 4DOWA 1KQSA 5D6WA 4J5YA 1YJ9T 1X2QA 2GF7A 4VUBA 2X4XA 1W2BA 5DLOA 3CCQT 3EAEA 1RLQC 9ATCB 4HVUA 3PGGA 1N8RC 2W10A 3VS5A 3CMAT 1FXXA 1U3OA 1XJWB 4Z8AA 3CCUA 4PFOA 3OS0A 5HY6A 1KQSS 3VUZA 4F7UG 3S3NA 3CEYA 4ATOA 2BZXA 2J6FA 1MMDA 1G3TA 2CDTA 4DBRA 1X69A 2PVOB 1Y71A 3VS1A 4JRIA 4JS4A 1KQSP 2RHXA 2KXCA 3EH2A 1IXDA 4FYVB 2F69A 1Y7XA 1N8RU 5CQXA 2RI5A 4DA4A 4RCBA 2QQ9A 2YLCA 3OYHA 3EFOB 5FRNA 4KH1B 5GAN8 2OTJQ 4Y92A 1QLYA 4J9IA 1U1SA 3OB9A 3CC2T 4AFSC 3I55Q 1NE8A 4HCKA 5C6SA 3PFSA 1WGSA 1SKUB 2O4XB 4HCBA 4M7AD 2RQRA 4C0DB 1P92A 5KYXB 3NGPA 3FLGA 4M75D 2EJGA 4OGCA 1SEMA 2RH2A 4LDWA 2J6KA 2P4TA 4XU0A 3HSBA 4Z02A 1RAEB 2GGRA 4LDYA 4CC7A 4IUQA 1YJ9A 4ANJA 3GP8A 3P8HA 2V1RA 3EG3A 4EMGA 4D8KA 4WCIA 4F14A 2XI9A 2FRYA 1VQLQ 5IHIA 2FL7A 4XU2A 3CCVA 2LX7A 3CMAA 3NTHA 2PUOB 3GF5A 3EFSA 3QUIA 1YI2A 4XK8E 1W70A 4PJOE 2NWMA 5AYFA 3CC7Q 5I2MA 5KYYA 4HCCA 1WXUA 1YJWA 2K9GA 2ZPBB 3OW2A 1AEYA 5HKCA 4IIMA 4J9BA 4M7DD 3EG2A 2DZCA 2LJ3A 4M7AE 3EGDB 2NLUA 4NL3A 3GIBA 4M77B 4KUIA 4O5VA 2QDLA 2M16A 2RHZA 4M7AF 5LJ5f 2IG0A 4PFZA 1JB0E 1TSFA 2Y4YA 2CP6A 4Y91A 5HK3A 2YWWA 4R55A 3INZA 1ZBJA 3QJYA 2OTLA 3OYJA 2WSEE 3QIIA 2RN8A 4LN2A 4RTZA 5FU6C 2EQUA 2H3JA 2VYTA 3H41A 3ASKA 4LDUA 4BI3A 2VB6A 2P0PA 3MCAB 2C0TA 2LJ1A 1PCXA 3CCMQ 3M54A 1JEGA 5IT9E 2V8IA 2RK1A 2MOXA 4RUGA 2EYQA 4M7AC 1MNEA 3CCST 3SHWA 3JB9H 2RJEA 1ZQ1A 2LVMA 1IO6A 4BDYA 2CREA 3QDFA 4E7IA 3OYYA 2ZGWA 2DL7A 1KFZA 1G83A 2K7AA 4J6YA 5L23A 3HL8A 1AWOA 4BE1A 1LOJA 2GBQA 2HAXA 2LCSA 1EZZB 2VUBA 2K4YA 4QQDA 5GAMj 5GANf 4WF2A 2E41A 4UC4A 4LDVA 3U23A 1YI2T 2XHCA 1AOJA 1WIEA 2G6FX 1TWBA 4QVDA 2DYBA 3Q1JA 4RMOA 2D9TA 1GCQA 3G7ZA 2CP5A 1VQ4A 1B7TA 3HRTA 2ZPIB 1QVFP 1O75A 3QDRB 1I0CA 1G8XA 3H0FA 1N5ZA 4L5GA 4ZGDB 3T9NA 3OMGA 2CT4A 3M0SA 2Z0WA 1MMGA 4OMLA 1TUDA 5KYUA 3JCMX 2RHIA 3EG0A 1R77A 3KUFA 4ZN1A 3CC7A 2CZ7B 1TXQA 3CMEA 1K73R 4C8QB 5GAOm 3LLRA 1YIJT 1K8AU 2RQTA 4TVRA 3SDZA 3CCSA 1VUBA 1YJWQ 2HQXA 2RPNA 4J9GA 1HD3A 3PIOA 1ZSZC 1VQNQ 1M90U 2VGNA 2EQIA 3SWNC 3CCSQ 1C0MA 4A4FA 3CXCS 5CCAA 5A2QE 4OMPA 1FMWA 3M55A 3UF4A 3CXCA 1D0XA 4PLIA 2R57A 4F7UB 1RI0A 2YDLA 4J9CA 2DXBA 3VU3C 2YRCA 3S6WA 1H92A 4EMKC 2DVJA 2M51A 2ZPHB 3I5SA 4ZTJA 1UUEA 1N8RR 2IVWA 1KC8C 4OP0A 5GAMh 3ME9A 1JXOA 1VQ4T 3M5AA 3JB9J 4OGEA 3VUBA 1IRXA 1W6XA 2CSQA 3E9FA 3VV0A 4AG1C 3GNGA 5GAOn 4M7AB 2HNIA 5LJ5g 1H641 2E12A 5M9OA 5D6XA 1GRIA 2EFIA 3LH5A 3NHNA 2M0YA 2FRWA 2E3HA 4ELYC 3CC7T 2F2VA 3A8OB 4QVZA 1N9SA 3CMET 1QQJA 1K9AA 3RR6A 4BI4A 3J81E 1JQQA 3A1PA 2AT1B 2BE9B 1TH7A 4IKFA 1YITA 3A8HB 1I81A 2K5FA 1VQLA 5CKBA 4IUUA 3ZFJA 4AT1B 2BIVA 2LCCA 1X75C 3G6EQ 3KFVA 2EKHA 2PVDB 2YRDA 3H0IA 1M3BA 4J9DA 2KXDA 3CMEQ 4M4ZA 2EJ9A 1QVFS 1QWEA 2RHYA 2RJFA 1ARKA 1EIFA 2EQJA 2JVVA 5GANj 2E65A 2QEXA 3CCUQ 2AKLA 1BBZA 1VOMA 2CKKA 1X27A 2DYIA 2E1HA 2XU8A 1UTIA 2KRNA 3C94A 1NYGA 4A63B 4AFUC 4OMOA 1PKSA 1WQ7A 4HVVA 3OYAA 4R56A 4EDUA 3I55A 4J8OA 1ZLMA 1O9SA 3CPWS 1HYOA 3HHTB 1GFDA 1FYNA 1W2BP 3EG9A 5LJ3d 4IUTA 1NJIU 3QWYA 4C5HA 5IHKA 5GANe 3X20B 3CPWP 3HFNA 2JN0A 2LZ6B 1D0YA 1WI7A 4AG2C 3CCJT 2QAZA 1R0BG 2HBWA 1GCPA 1H3ZA 2DTHA 2KAFA 1ZSZB 4E47A 4BE2A 1KD1R 1H3HA 3KBGA 4M77C 2AKKA 4FCYA 2COYA 1VIEA 1ZA2B 4FYWB 1LJOA 2NUTB 3CBOA 2D0NA 3UDCA 3A5ZB 4J6WA 2DILA 2RQUA 4C8QF 2JUFA 3TREA 2DZ9A 4LUDA 4PLLA 3OSVA 3MPUB 4CI0C 2FVUA 4HCZA 3QXEB 1Y57A 4E7KA 2F2WA 4OVAA 2QYZA 5GJVB 3QHSA 3SEMA 5J26A 2EPDA 1NZ9A 2LT4A 1PC0A 1UGQB 1VQ8Q 3TSZA 2DPPB 1NPRA 1RADB 2YHTA 2QEXT 3MP1A 3AT1B 2HBPA 4MMLA 3G71Q 2GTOA 1UEBA 2LP5A 3OMCA 1D09B 3UPUA 4QKUA 4Y28E 5KYUB 3VRZA 4M7DE 4F7UF 3G4ST 2CT3A 2DTOA 1VQPT 3REBB 2FYKA 3SB2A 2OAUA 2QDYB 1MMAA 1FMVA 2XDBA 1JBMA 3I56T 3TU4K 4JZ4A 1H8KA 1UHFA 1LCKA 2CH4A 1WNLA 1Q81R 2E3IA 1WHKA 2BUDA 2AIRB 2EKOA 1UDLA 4C8QD 1U1TA 3HRUA 5GAN3 1W4SA 3DKMA 1NEBA 3RKYA 1BI2A 3L2ZA 8ATCB 1SSHA 4F7UE 1M5Q1 3O5ZA 1VQ7T 2ROTA 4BE0A 4JRKA 5CR2A 2QGFB 1ZBXA 2LTOA 2DVEA 2QA4Q 3CCRA 4OMFB 3CCLT 1PHTA 1X6OA 2QQRA 3A8MB 1QCOA 4X1VA 3HTRA 1IGUA 1TG0A 2FO0A 4XU1A 2I0NA 3QZ5B 1WXTA 4DBHA 3CCVQ 1D0ZA 2CH4W 1M1KC 1QP3A 5CO7A 4C92D 3M59A 1Q81U 3A8LB 4D8DA 2KDSA 3CCJQ 4C5IA 1Y96A 3OS2A 2EW3A 2KK4A 3N5BB 4XTWA 4GLKA 4B6MA 1PG5B 4M75C 3CD6T 3CC4A 3TQ7P 1HJDA 3NTKA 4RTTA 1WZOA 4J7FA 4JJNK 1UB4A 4EIKA 3LH0A 3UATA 1MHNA 2L0AA 1Y07A 1PWTA 1PSFA 3TSWA 1ZUYA 3CBMA 2H3EB 4E7SA 1G5VA 2XMFA 1VQPA 1M1KR 2E6NA 4JRQA 1U5SA 1X6BA 1G3YA 4M77D 3I56A 3FIFA 2FZCB 1Y0MA 1VQ9A 2XICA 3LWIA 1YN8A 2HDAA 2KROA 3FC3A 4N4GA 1YWPA 3OW2S 2K3BA 3BW1A 2HL3A 1WHHA 3OYEA 4E7ZA 3VS4A 5LJ3j 2QA4T 4JRPA 3G6ET 2K5LA 2JM9A 4HXJA 1VQMA 2BE7D 4KT0E 2DXTA 3CQTA 1VQ6A 2MK5A 4PJNA 4DBFA 3NPFA 2E5QA 3MP6A 4N4HA 1YCYA 2FZKB 1K4US 4M7AA 3NFCA 1SF9A 2HKQB 2HSPA 1S72A 2CP0A 3CCLA 4PJOA 1EFNA 1GBRA 4OB2B 3E2UA 1ABOA 3VYGA 4RCCA 1HXDA 4B9WA 1BCMA 2ECZA 2P84A 1I5OB 2RJDA 2ZZDA 2RNAA 1UGVA 4M75B 1M8MA 2KRMA 4IUVA 3CXCP 3HKSA 2VWFA 1Q86R 5LJ3h 2QASA 1N6AA 5KYNA 3X28B 4DBQA 1ZHIA 3M0QA 1OQKA 4ZN3A 2HL5C 1JJ2P 3QKJA 1ABQA 4C8QC 1ZUUA 4M7DG 1VQ8T 1PD1A 4LD6A 3KXTA 2WSFE 3V7RA 5CKDA 1ZSZA 2DLPA 1OPLA 1QVFA 4QQ6A 4JDSA 1OX9A 2DD4A 5CKHA 2DBKA 4QT7A 1D1AA 4FSXA 4IIOA 4M75E 1MV3A 1KC8R 3JCMW 1Q86C 2PZ1A 5GMKe 1K9MU 4PJOC 3HFOA 1UE9A 1YNZA 1I5LA 2ED1A 4XQ3A 4C0DC 1N27A 3HPWA 4JLGA 4OB1B 2L3RA 5HK0A 3OS5A 3L42A 2JMCA 1UG1A 3UA6A 4BDZA 1RABB 4KGXB 2VKNA 2KVQG 1K73C 3CCQQ 1YIJQ 2QQAA 4XTUA 3EGXB 3OYCA 1VQKA 4HA8A 2VASA 2EIFA 3GLXA 2PTKA 4Z88A 4RTWA 4C0GA 1AT1B 2COZA 1KD1C 2R5MA 4PJLA 1KHCA 3THKA 2DAQA 3IQLA 3I56Q 1E7OA 1OV3A 1WHLA 2LRQA 5GAN2 3QSUA 3L2RA 1YJNQ 2K2VA 1BB9A 4C8QA 1NM7A 3EHQA 1B34B 3MO8A 3EHRA 3CCUT 4E6RA 2P0KA 1DJ7B 1VQ8A 3ZL7C 5FRMA 1VQNA 2A37A 5GAOp 1RACB 2EJFA 2JS2A 3UA7A 4MZMA 1Q95G 4X9DA 3C95A 4FYYB 3OBYA 1AWXA 2RI3A 1MV0B 1M1GA 3MEVA 5ECAA 3RERA 3RMSA 2HZYA 5KYWA 2OJ2A 2VVKA 3OYDA 2EQMA 4C5GA 1CSKA 4F17A 2KE9A 1PRMC 2LC4A 4MMKA 3HP9A 3RBBB 1JXMA 3BY7A 2LMJA 2X35A 1I07A 2K79A 1K0SA 1ZSGA 4J6XA 4OF1A 2X3WD 1RL2A 1YWOA 3CC2A 3BE3A 5GAMe 1Q82C 2RQWA 2DE0X 2KNBB 3O8VA 4XTZA 1OULA 4ZTFA 2DFUA 1VQ4Q 3OA6A 3JB9D 2OTJA 2MIOA 1D3BA 2O2OA 1S1NA 1WXBA 2KMTA 5AT1B 4A53A 4FW2A 3CD6Q 1NG2A 4M75F 3MHXA 5KYXA 2ZPEB 4JJBA 2JNGA 5FU6B 2C0IA 3WVDB 3CCVT 4E7JA 3H6ZA 2L3SA 4M78C 1QVGP 5GAN6 2ROLA 1SRLA 1XQHA 3M58A 1BU1A 2SEMA 3EGDA 1N9RA 5A0DA 3BDUA 1VQNT 1YHQT 1NEGA 4GY5A 3CCLQ 2HCKA 1YJWT 1M2OA 5GJWB 2V8KA 2M1HA 4X9CA 5LJ3e 2DEQA 1Q82U 3JCMg 1I1JA 1WQWA 1K1ZA 7AT1B 2EWNA 1I8FA 3R6OA 5GAOl 4M78E 4OB3B 3M0PA 3CCMA 5I21A 1OOTA 2COWA 1FWZA 4LXCA 3MEAA 3V7CA 2LQKA 3WXMB 1A0NB 3LX7A 3TVTA 2HQEA 2A0FB 3F70A 1K0XA 1LPLA 3D7SB 4JJCA 3GOXA 1G2BA 4AMCA 1QVGS 1M8VA 2I2LA 1WFWA 3REAB 1W2BS 2EGEA 1T0HA 3G4SQ 1PRLC 2QGGA 5EG2A 5GANh 1WX6A 1YJNT 1PD0A 4AFQC 4C92E 1K73U 4KUDK 2DXUA 1KG1A 2KEAA 3VYHB 4QW2A 3OYNA 4JJDA 3OS1A 1WJSA 2GFAA 2NYSA 4N0AA 1K8AR 2O31A 3X26B 4BB7A 2OTJT 1R0CB 2MI6A 4ESRA 2MPXC 1EX4A 3JCMb 1UFFA 2X4YA 2DX1A 4ME7A 3RDVA 2YUQA 2E5KA 2ZCFB 4F16A 2CUDA 2X4WA 5DLQE 2R58A 1YI2Q 3ULRB 5KCOA 1I4K1 1AWJA 3ZEHA 1X2KA 3CCQA 5A0GA 2JTMA 1OZ3A 3I5RA 2CYZB 2DBMA 3OYLA 3M9QA 1FX7A 2E10A 5GAN4 1QCFA 3ER0A 2YT6A 3RNJA 2CGHA 2XG8D 4JLIA 2C0OA 4C5EA 1M2VB 3RESA 1Q81C 4PJMA 1YCSB 1Q7YR 3OQ5A 3X24B 1RAIB 1BIBA 2E4HA 3EH1A 1PM3A 2VXFA 2WSCE 4N4IA 4ZGEB 1Y96B 3CCMT 3L1AA 2AZVA 2QK0A 2V8JA 3PIPA 1FMKA 1AZGB 1BYMA 4MZTA 1B07A 2O9SA 1WHJA 3CCET 2F5KA 2D8JA 4X34A 4PK4A 4IURA 3JCMc 3QO3A 3JCMJ 3FJ5A 4PJOF 1GFCA 2QQSA 2C06A 1QMCA 4RG8A 5IXFA 1IREB 1SHGA 3L2WA 1KC8U 1M1FA 1ZUKA 2A08A 4ZGJB 1TTHB 4ZNXA 3JV3A 2FPDA 1YIJA 1YJNA 3OYGA 4M78D 3DLMA 3S3OA 1ACMB 1VQ6Q 4CRIA 1VQ5T 3RIRA 1QKXA 2DJQA 1KHIA 2JT4A 2NUPA 1ZA1B 5HCKA 2GQIA 2JZ2A 1UJYA 3MEUA 2DIGA 1IB8A 1BI1A 1AHJB 2NUPB 5J39A 2FG0A 2D8HA 1RI9A 5CQYA 1SG5A 1TS9A 1K8AC 4XTXA 1NLOC 2CP2A 3JCMe 2ESWA 4M77A 2L3QA 3OBWA 1B34A 1T3SA 4OB0B 2R5AA 3J7AF 2OTLQ 1TU0B 2YUNA 1VYVA 2RQVA 5D6YA 4F7UA 3FRNA 1J3TA 4NOYA 2E70A 2DO3A 4KULA 4RKUE 5KCHA 1KD1U 2BZYA 3M0UA 2MAMA 1MUZA 2CZ0B 2FHDA 2FPEA 4M78F 3OW2P 2KSSA 4PKCC 4RTUA 4FYXB 1GL5A 1KQ2A 2LX9A 3CCEA 1Q7YC 2EVRA 2DK3A 2IIMA 2OTLT 2EYXA 4CC3A 1RAHB 1MMNA 4OMMA 3SFMA 3M4GA 3FJPA 5CIUA 3VJPA 4JS5A 1U8RA 3OYKA 4HVWA 3OYMA 4YTLA 1K9MR 2O9VA 4AFZC 1WLPB 2B86A 1MGQA 2KYBA 2J05A 4RTYA 2ZPGB 2HEQA 1YITT 3P8BB 4J9FA 1RAFB 4IUPA 1Q82R 1VQ5A 3FB9A 1BIAA 3LYIA 1M9SA 3JRZA 1NPPA 4FL6A 1KSWA 5FLXE 2KBTA 1NJIC 1OEBA 4V2SA 1UGRB 2QXFA 2HKNA 4DEXA 3V8JA 3OYBA 1VQ5Q 2YUPA 5FROA 3TCJA 4XTYA 4L6V5 3E1SA 3CMAQ 4J7IA 1QCNA 1QWFA 2L3PA 5LJ5e 4OMNA 3L2VA 2LQWA 3E9GA 2D1XA 1IGQA 1V1CA 3QYHB 5KE3A 3PVQA 1QP2A 2B8AA 5I22A 1PNJA 2L89A 4P5NA 4PFPA 4O6JA 2GCXA 2DL4A 5GANg 2DXCA 1RAAB 2LT1A 2XD0A 1D3BB 2EYYA 4BY6C 1BI0A 2RMOA 3PVLA 1G3WA 2J7IA 2K6DA 3EG9B 2Y90A 2A36A 1GBQA 1GXIE 2XDPA 2F1LA 4JUVA 3BDLA 3GNFB 4A4HA 5GAMf 3JCMP 2KQWA 2RA2A 5A0LA 4PJOB 3R6NA 1AZEA 3SWNA 3L2UA 3X25B 2LQNA 3NTIA 5FW9A 4EMHA 4KGZB 4KBMB 1JJ2S 1VQKQ 4A4KA 5DM7R 3JCMf 5C0MA 2ABLA 2J06A 1VQMQ 1C1AA 4C92G 4FU6A 2G3RA 2GFUA 4ORZA 1D1BA 1SPKA 2RB6A 4E7LA 3QZ9B 2EYZA 2L2PA 1BKBA 5LL6S 4M7AG 4M75G 2RHUA 2F2XA 1OU8A 3MKDA 3OY9A 2ENMA 1QVPA 2HSEB 2BKDN 1BI3A 4HT9A 1RUWA 5FWBA 2QTXA 4C0FA 2J6OA 2QG9B 3G4SA 1M2VA 4FT2A 1YJ9Q 2X3XD 3VKIA 5GAOq 3WVEB 4CC2A 3JCMd 1KQ1A 1M4ZA 4BACA 4BY6B 3QJ6A 3OYIA 4GBQA 2JTEA 4M77G 1SSFA 1D1CA 2YXYA 2MYSA 4RTVA 2AHJB 1B3QA 5CK9A 2EQKA 1OU9A 4HT8A 1UECA 1WHGA 5LJ5j 3UWNA 1X6GA 2DL8A 1GCQC 3H0HA 4M78B 2EGCA 1WA7A 5GAMg 1PSEA 4FM4B 2RK2A 2MWPA 4E7HA 2CSIA 3EGUA 2K57A 2W0ZA 3OSSC 4J83A 4EMKA 2RF0A 4FIBA 1UJ0A 5IAYA 2MWOA 2JOYA 2XK0A 1LVKA 1U06A 4DEYA 3CCRT 5KE2A 2RJCA 4A4EA 1M3CA 1NBEB 3DLLA 3EFOA 2LJ0A 1WHMA 3LW5E 5GMKh 1VQ9Q 3JB9F 3FDRA 1VIFA 5IHNA 3GBQA 1RLPC 4D6WA 1VYUA 3CPFA 3CPWA 3PT9A 1VQLT 2JM8A 2YRVA 4JZ3A 1M30A 2Y4XA 3JSCA 3CD6A 3VS2A 4EMKB 4FT4A 4MZPA 4Q5WA 2JS0A 1OX8A 1M1KU 2BZ8A 2CUBA 4NS5A 2FEIA 3AHUA 1OZ2A 3CC4Q 2KT8A 2JTFA 3QPHA 4R0KA 2K2MA 3QYGB 3I55T 1KK7A 2A3LA 3HRSA 3QWXX 3CC2Q 2DD5A 5GMKj 2O01E 3I35A 4M75A 2GTJA 1AWWA 5GMKm 1AD5A 3RUXA 5GMKi 4WTOB 1SRMA 3C0CA 1ZX6A 1QVGA 3JCMh 1WJRA 3PTAA 1Q86U 4F04B 2VGMA 3RKWA 3JCMV 2DJZA 2QA4A 2XIDA 2YUOA 3CCJA 2DRKA 2FPFA 4RG2A 1VQMT 2L5QA 1VA7A 2PVGB 5I11A 1OPKA 4ELZC 2RM4A 2CP3A 2GQVA 4GLMA 4M7DF 2ZPFB 3JB9G 5GANd 3JAME 1E6HA 1V76A 2HD0A 1QW1A 1S72T 1T0JA 2KR3A 5EC7A 2M0OA 2DM1A 2XDDA 1M3AA 5GAMd 2QI2A 1V29B 2V26A 2LQ8A 1OYXA 3CCRQ 1UHCA 1HK9A 3G1JA 5GAN5 1XNIA 3M4YA 2RI2A 2NUZA 4LNPA 5LJ3f 2PUKB 2PNIA 3E19A 3LGLA 3BFMA 3M57A 1IHVA 4C8QE 4C92A 2ATCB 3A8GB 2HMAA 4J9HA 1Z9QA 2E64A 2LDMA 3V8KA 2XKOC 2DMOA 3MEWA 1UGSB 4PL6A 1TUCA 3DB4A 1SHFA 1C6VX 1WDXA 5L8RE 4XU3A 4PNOA 4KRTA 1M90R 4BD3A 1QKWA 1UGPB 3M0RA 2ZAEA 4PJOD 2DNUA 2X4JA 4LUEA 2D0QB 4FSSA 3NMZC 1OI1A 1M27C 5J3BA 1WYXA 1VQOQ 2M02A 4DOVA 3VS3A 3CBPA 1T3LA 2VC8A 2SRCA 1E6GA 4C92F 4A54A 2K5IA 4A4GA 2EYWA 1VQ7A 4PJOG 4RTXA 5FU7B 1VQKT 5LJ3g 2IPOB 1HSQA 3UT1A 4XAXB 3JB9I 3FEOA 3S3MA 5GMKl 5IH2A 2O4XA 1K9MC 3EGXA 4DQ2A 4J9EA 5KYWB 3PMTA 4LD9K 2DL5A 3RMQA 5KH6A 1MNDA 5FU7C 1YBYA 2M9UA 4C92C 1XOVA 2RO0A 2WACA 2YLBA 3C4SA 2O88A 4LDXA 2K3YA 1CKAA 2VV5A 3CC4T 2MMPA 2FZGB 1X01A 2DETA 1RAGB 5KYYB 2JMAA 2JXBA 1PKTA 1IHWA 2RD1A 3URGA 1CKBA 4CC4B 3M0TA 2QTVA 2PQWA 2MCNA 2JW4A 2CZ6B 2PU9B 1JU5C 1LNXA 4E2FB 4M7DA 3JCMQ 1KIKA 4MDXA 4PJJA 4BI8B 4EPCA 2DL3A 5GAN7 3H8ZA 2EGAA 1M90C 1TUGB 2KYMA 2HQHA 4M78A 3PE0A 4KGVB 2AK5A 5CAIA 1VQ9T 3C12A 2KGTA 1XTDA 3V7SA 2KT1A 4C8QG 3PMIA 5CKFA 4LE9A 1YP5A 3V8LA 1VQOA 1YHQQ 2VXEA 5GAOr 1JJ2A 4L59A 3VS6A 1S72Q 2H8HA 1JO8A 1KJWA 3G6EA 4MDWA 2OX7A 8AT1B 3RKXA 2L8DA 2DERA 2DEUA 1VQ6T 1YITQ 4QQGA 2DIQA 4M7DB 2CP7A 3QBYA 2OI3A 2BTTA 2JJ9A 2K3XA 3A98A 4C0ZA 3DB3A 3EG1A 3G71A 1BCOA 1IZ6A 2LNHB 3P8DA 1G3SA 5I2SA 1X43A 2DRMA 1NJIR 5CVIA 4OMQA 3H9NA 1AVZC 3VRYA 2KY9A 1VYTA 4M7DC 4Z89A 2A28A 4BUGA 4M77E 3MP8A 3VS0A 1BK2A 1Q7YU 5LJ5d 2YSQA 2MF2A 3VS7A 3PNWC 1WPYA 1F1BB 3SD4A 2P4RA 3MJXA 1TOVA 1NYFA 2GNCA 2X9HA 5CKEA 1Z9ZA 1YHQA 5IN1A 4B9XA 2P0QA 3OYFA 4JPBW 2E6ZA 4FW1A 2AZSA 2NUTA 3LWHA 1VQ7Q 2DKGA 4M77F 5IXBA 3QG1A 3SWNB 3ZBDA 3LGFA 2X51A 2KRSA 3J80E 4XTVA 2CZ1B 2KI7A 6AT1B 3META 1VQOT 5LJ5h 2A7YA 2DF6A 1R8OB 5D7UA 2DTIA 4KH0B 3GPLA 2V1QA 4II1A 2CS7A 4NL2A 4C92B 2F5TX 2LCLA
chains in the Genus database with same CATH topology
3CC2A 2BKDN 1BI3A 5GAMe 3L2QA 1Q82C 4HT9A 2FB7A 1WQ7A 2QTXA 4C0FA 3O8VA 3TEEA 4R56A 3OYAA 4EDUA 3I55A 4J8OA 3G4SA 4FT2A 4XTZA 3CPWS 1O9SA 3VKIA 5GAOq 4N0AC 5DY9A 3WVEB 4ZTFA 3M56A 3HHTB 3M53A 2QQBA 2LNVA 5LJ3d 3JCMd 1KQ1A 1M4ZA 2EAYA 4HKEA 4IUTA 4M78G 3G71T 4BY6B 4QVCA 4BACA 1NJIU 4C5HA 1WJQA 3QJ6A 3OYIA 3OA6A 3JB9D 4M77G 2OTJA 1SSFA 1D3BA 1JRIA 5GANe 2KMTA 2D6FA 4A53A 3EFRA 3X20B 3HFNA 2JN0A 2AHJB 4DOWA 5CK9A 2EQKA 1KQSA 5D6WA 4J5YA 4M75F 1YJ9T 3MHXA 4HT8A 2ZPEB 5LJ5j 2GF7A 4M78B 3UWNA 3CCJT 2JNGA 4VUBA 2X4XA 5FU6B 5GAMg 1W2BA 5DLOA 3CCQT 1PSEA 3EAEA 2RK2A 4FM4B 2MWPA 3WVDB 4E7HA 3OSSC 2K57A 1H3ZA 2DTHA 3PGGA 4J83A 3CCVT 4EMKA 1N8RC 4E7JA 2KAFA 4FIBA 1FXXA 3H6ZA 3CMAT 5IAYA 4M78C 2MWOA 2JOYA 4E47A 2XK0A 4BE2A 5GAN6 3CCUA 3CCRT 5KE2A 3KBGA 1XQHA 3M58A 4M77C 3OS0A 5HY6A 1KQSS 1VIEA 3VUZA 2RJCA 4F7UG 1N9RA 1LJOA 3BDUA 4A4EA 5A0DA 3CEYA 3S3NA 3CBOA 1YHQT 1VQNT 4ATOA 3UDCA 3A5ZB 3DLLA 4GY5A 4J6WA 1YJWT 1G3TA 2V8KA 3LW5E 2M1HA 2JUFA 3TREA 2DZ9A 4C8QF 4PLLA 3OSVA 4X9CA 5GMKh 5LJ3e 2DEQA 1Q82U 2PVOB 1Y71A 4CI0C 2FVUA 3JCMg 3JB9F 4HCZA 1WQWA 3FDRA 4JRIA 1VIFA 3QXEB 2EWNA 1I8FA 3R6OA 2RHXA 5GAOl 4JS4A 4M78E 4OB3B 4D6WA 4E7KA 4OVAA 3CPFA 2F69A 1Y7XA 3PT9A 3CPWA 3CCMA 1N8RU 1VQLT 5I21A 3QHSA 5CQXA 2RI5A 5J26A 2YRVA 1FWZA 4DA4A 3MEAA 3V7CA 4RCBA 2LQKA 2QQ9A 2Y4XA 2YLCA 1NZ9A 3JSCA 3WXMB 3CD6A 2LT4A 4EMKB 3LX7A 4FT4A 4MZPA 2HQEA 4Q5WA 3OYHA 1UGQB 3F70A 5FRNA 2DPPB 5GAN8 1NPRA 1M1KU 2YHTA 3GOXA 2QEXT 3MP1A 4NS5A 2HBPA 4MMLA 1U1SA 1QVGS 3AHUA 1M8VA 1OZ2A 1UEBA 2I2LA 3OB9A 3OMCA 1W2BS 3CC2T 3UPUA 4Y28E 4M7DE 1NE8A 2JTFA 3QPHA 4F7UF 5EG2A 5GANh 3QYGB 3I55T 3G4ST 5C6SA 1YJNT 1WGSA 3PFSA 2O4XB 2DTOA 2A3LA 4C92E 2FYKA 3SB2A 3HRSA 2QDYB 2OAUA 1VQPT 2DXUA 4HCBA 2DD5A 4KUDK 4M7AD 1KG1A 5GMKj 4C0DB 2XDBA 1P92A 1JBMA 3VYHB 3I56T 2O01E 3TU4K 4QW2A 3FLGA 4M75D 4M75A 3OYNA 2EJGA 3OS1A 4OGCA 1WNLA 1WJSA 2RH2A 4LDWA 5GMKm 2GFAA 4N0AA 2OTJT 2BUDA 3X26B 4BB7A 3RUXA 2MI6A 2P4TA 4XU0A 5GMKi 3HSBA 4Z02A 3JCMb 2X4YA 2EKOA 4C8QD 1QVGA 1U1TA 1WJRA 3HRUA 4ME7A 3JCMh 3PTAA 4LDYA 2ZCFB 1Q86U 4IUQA 5GAN3 1W4SA 2VGMA 3DKMA 2X4WA 3GP8A 5DLQE 3RKYA 1BI2A 2DJZA 2R58A 2XIDA 3P8HA 3RKWA 3JCMV 2QA4A 4EMGA 3CCJA 4RG2A 2XI9A 5KCOA 1VQMT 2L5QA 1I4K1 2PVGB 3ZEHA 3L2ZA 3CCQA 5A0GA 2JTMA 1OZ3A 2CYZB 4ELZC 2RM4A 4F7UE 2FL7A 2GQVA 1M5Q1 4XU2A 2ZPFB 3CCVA 4BE0A 4JRKA 5CR2A 1VQ7T 3CMAA 4M7DF 3NTHA 3OYLA 2PUOB 3GF5A 3M9QA 1ZBXA 2LTOA 2DVEA 3JB9G 1FX7A 2E10A 5GANd 5GAN4 3EFSA 2HD0A 3QUIA 3JAME 3ER0A 3CCRA 1QW1A 4XK8E 1YI2A 1S72T 2CGHA 2XG8D 4OMFB 4JLIA 3CCLT 2M0OA 4C5EA 2XDDA 4PJOE 5GAMd 1X6OA 2QI2A 2QQRA 5AYFA 3A8MB 5I2MA 1V29B 4HCCA 1YJWA 2LQ8A 3RESA 1Q81C 1OYXA 2ZPBB 4XU1A 3OQ5A 1HK9A 3OW2A 3X24B 3QZ5B 1BIBA 5HKCA 5GAN5 4M7DD 2DZCA 2VXFA 1XNIA 2WSCE 4M7AE 1M1KC 2NLUA 4N4IA 4ZGEB 4M77B 4NL3A 1QP3A 5CO7A 3M4YA 1Y96B 4KUIA 4C92D 2RI2A 3L1AA 3M59A 3CCMT 1Q81U 4O5VA 2V8JA 3PIPA 1BYMA 3A8LB 2M16A 2RHZA 2KDSA 2PUKB 4MZTA 5LJ3f 4C5IA 1Y96A 3OS2A 4M7AF 3E19A 2KK4A 3N5BB 3LGLA 3BFMA 3M57A 4GLKA 4XTWA 5LJ5f 2IG0A 4M75C 1JB0E 3CD6T 2Y4YA 3CC4A 4C8QE 3NTKA 4Y91A 4C92A 3CCET 5HK3A 2F5KA 3GIBA 4R55A 3INZA 4J7FA 4X34A 3A8GB 4JJNK 1UB4A 3QJYA 4IURA 3JCMc 3QO3A 3JCMJ 2OTLA 4PJOF 2E64A 3OYJA 2LDMA 3V8KA 2QQSA 2XKOC 2WSEE 3QIIA 2C06A 4RG8A 1IREB 5FU6C 3LH0A 1MHNA 1UGSB 2EQUA 1M1FA 2H3JA 3MEWA 2VYTA 4PL6A 1Y07A 4ZGJB 1KC8U 3DB4A 3ASKA 1PSFA 4LDUA 5L8RE 4BI3A 3CBMA 4XU3A 2P0PA 3MCAB 4PNOA 1YIJA 1YJNA 1G5VA 3OYGA 1VQPA 2E6NA 4JRQA 4M78D 3DLMA 3M54A 3S3OA 5IT9E 2V8IA 4BD3A 1UGPB 1G3YA 4M77D 3I56A 3FIFA 2RK1A 4PJOD 4CRIA 2EYQA 1VQ9A 2XICA 3LWIA 4M7AC 3CCST 3RIRA 2X4JA 1VQ5T 2D0QB 3FC3A 4N4GA 1OI1A 3JB9H 5J3BA 2RJEA 1ZQ1A 2LVMA 3OW2S 1KHIA 3BW1A 3OYEA 4BDYA 2JZ2A 4DOVA 4E7IA 3OYYA 5LJ3j 3MEUA 3CBPA 2QA4T 2ZGWA 4JRPA 2VC8A 3G6ET 2K5LA 2DIGA 1VQMA 1BI1A 4C92F 4A54A 1AHJB 4KT0E 4J6YA 2DXTA 5J39A 2K5IA 4A4GA 3HL8A 1VQ6A 4BE1A 1LOJA 2E5QA 3MP6A 4N4HA 1VQ7A 4PJOG 2HAXA 1YCYA 2VUBA 2K4YA 4QQDA 5CQYA 5GAMj 5FU7B 5GANf 3NFCA 1K8AC 4WF2A 2E41A 1VQKT 4M7AA 4UC4A 4LDVA 5LJ3g 1YI2T 4XTXA 1S72A 3JCMe 3CCLA 2XHCA 4PJOA 4M77A 4QVDA 3UT1A 4OB2B 4XAXB 3JB9I 3Q1JA 3FEOA 4RMOA 3S3MA 3OBWA 1B34A 3VYGA 5GMKl 2D9TA 4OB0B 2R5AA 4RCCA 3J7AF 2O4XA 3G7ZA 1K9MC 1HXDA 5D6YA 4F7UA 4B9WA 1VQ4A 4DQ2A 3FRNA 4NOYA 3HRTA 3PMTA 2ZPIB 1O75A 2E70A 4LD9K 2DO3A 3QDRB 4KULA 2RJDA 2ZZDA 4RKUE 5KCHA 4M75B 1KD1U 3RMQA 2MAMA 5KH6A 2CZ0B 2FHDA 4IUVA 4L5GA 4ZGDB 4M78F 1YBYA 2M9UA 3OMGA 5FU7C 3T9NA 4C92C 1XOVA 3HKSA 2RO0A 2WACA 2YLBA 2KSSA 3C4SA 5LJ3h 4LDXA 2K3YA 1N6AA 4PKCC 2VV5A 3CC4T 3X28B 2MMPA 1X01A 1ZHIA 1KQ2A 2LX9A 3CCEA 4ZN3A 3JCMX 1Q7YC 2RHIA 3QKJA 2DK3A 4C8QC 2OTLT 2RD1A 4M7DG 3URGA 1VQ8T 4LD6A 3KUFA 4ZN1A 3CC7A 3SFMA 2PQWA 3FJPA 3M4GA 5CIUA 3VJPA 2CZ7B 4JS5A 3KXTA 1U8RA 3OYKA 3CMEA 3OYMA 2WSFE 2CZ6B 2PU9B 4YTLA 3V7RA 1LNXA 4M7DA 5CKDA 4C8QB 3JCMQ 4MDXA 1MGQA 4BI8B 4QQ6A 3LLRA 4EPCA 3H8ZA 4JDSA 5GAN7 5GAOm 1QVFA 1M90C 1YIJT 2ZPGB 1K8AU 2DD4A 5CKHA 4TVRA 1YITT 3P8BB 4FSXA 4M78A 4M75E 5CAIA 3SDZA 4IUPA 1VQ9T 3C12A 1XTDA 3V7SA 3CCSA 1VQ5A 3FB9A 1BIAA 1VUBA 3LYIA 1M9SA 3JCMW 1Q86C 4C8QG 3PMIA 5CKFA 5GMKe 3JRZA 1K9MU 3HFOA 2HQXA 4PJOC 3V8LA 1NPPA 1I5LA 4XQ3A 4FL6A 4C0DC 5FLXE 1VQOA 1NJIC 2VXEA 1N27A 3HPWA 3PIOA 5GAOr 4L59A 4JLGA 1JJ2A 4V2SA 1M90U 1UGRB 2VGNA 2QXFA 4OB1B 2L3RA 5HK0A 3V8JA 3SWNC 3OYBA 3OS5A 3L42A 4A4FA 3CXCS 5FROA 3G6EA 4MDWA 3TCJA 5CCAA 4XTYA 4L6V5 5A2QE 4BDZA 3E1SA 3RKXA 2L8DA 4J7IA 1VQ6T 3M55A 2KVQG 1K73C 4QQGA 3CXCA 2DIQA 4M7DB 5LJ5e 3QBYA 2QQAA 4PLIA 3L2VA 2R57A 4XTUA 4F7UB 3OYCA 1RI0A 1VQKA 4HA8A 3E9GA 2DXBA 2EIFA 3GLXA 3VU3C 2K3XA 3QYHB 5KE3A 4C0ZA 3DB3A 3S6WA 4EMKC 1QP2A 2ZPHB 2B8AA 4ZTJA 3G71A 4C0GA 2IVWA 1KC8C 2L89A 4P5NA 1IZ6A 4O6JA 4OP0A 2GCXA 3P8DA 5GAMh 1G3SA 3ME9A 5I2SA 5GANg 1KD1C 2DXCA 2R5MA 1VQ4T 3M5AA 2LT1A 1KHCA 5CVIA 1D3BB 2DAQA 3JB9J 4OGEA 2XD0A 3VUBA 5GAN2 2LRQA 4BY6C 3QSUA 3E9FA 1BI0A 2KY9A 3VV0A 3L2RA 3GNGA 1G3WA 4M7DC 2Y90A 4BUGA 4M77E 5GAOn 2K2VA 3MP8A 4M7AB 2HNIA 1Q7YU 5LJ5g 5LJ5d 1H641 1GXIE 2XDPA 4JUVA 2E12A 4C8QA 2MF2A 3BDLA 5M9OA 3GNFB 5D6XA 4A4HA 2EFIA 5GAMf 1B34B 3MO8A 3PNWC 3CCUT 1WPYA 3JCMP 2KQWA 3SD4A 2RA2A 5A0LA 4PJOB 2P0KA 1DJ7B 1VQ8A 4ELYC 5FRMA 3CC7T 1VQNA 5CKEA 4QVZA 3A8OB 1YHQA 3SWNA 5IN1A 5GAOp 3L2UA 1N9SA 3CMET 4B9XA 2P0QA 3X25B 3NTIA 3J81E 4BI4A 3OYFA 2EJFA 4EMHA 4KBMB 1JJ2S 2E6ZA 4MZMA 4A4KA 5DM7R 1K73U 4X9DA 3JCMf 3LWHA 1TH7A 4IKFA 2DKGA 1YITA 5C0MA 3A8HB 3C95A 4M77F 3QG1A 1I81A 3SWNB 3ZBDA 2K5FA 3LGFA 1VQLA 5CKBA 4IUUA 3OBYA 3ZFJA 2BIVA 2LCCA 1X75C 2RI3A 1M1GA 3MEVA 3RERA 4C92G 4FU6A 3RMSA 2G3RA 2PVDB 3J80E 2GFUA 2RB6A 4XTVA 3OYDA 2CZ1B 2EQMA 4E7LA 3QZ9B 3META 2EJ9A 4C5GA 1VQOT 1QVFS 1BKBA 5LL6S 5LJ5h 4M7AG 2A7YA 2RHYA 2RJFA 3L2WA 2LC4A 1EIFA 1R8OB 4MMKA 3HP9A 2EQJA 2JVVA 5GANj 2E65A 4M75G 3BY7A 2DTIA 2X35A 2QEXA 2RHUA 3GPLA 2CKKA 4J6XA 4OF1A 1RL2A 4II1A 2CS7A 4NL2A 2E1HA 4C92B 3OY9A 1YJ9A 2XU8A 1QVPA 2F5TX 3C94A 2LCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E12 A; 
#chains in the Genus database with same CATH topology
 1VQP Q;  2ED0 A;  3L2Q A;  2FB7 A;  1K76 A;  2OAW A;  3TEE A;  1W1F A;  5FWC A;  4N0A C;  5DY9 A;  2EBP A;  3M56 A;  3M53 A;  2QQB A;  2DA9 A;  3I9Q A;  2LNV A;  3G71 T;  2EAY A;  4HKE A;  4M78 G;  4QVC A;  4K11 A;  2QEX Q;  1WJQ A;  1JRI A;  3CCE Q;  1NLP C;  2D6F A;  3EFR A;  1YFN A;  4DOW A;  1KQS A;  5D6W A;  4J5Y A;  1YJ9 T;  1X2Q A;  2GF7 A;  4VUB A;  2X4X A;  1W2B A;  5DLO A;  3CCQ T;  3EAE A;  1RLQ C;  9ATC B;  4HVU A;  3PGG A;  1N8R C;  2W10 A;  3VS5 A;  3CMA T;  1FXX A;  1U3O A;  1XJW B;  4Z8A A;  3CCU A;  4PFO A;  3OS0 A;  5HY6 A;  1KQS S;  3VUZ A;  4F7U G;  3S3N A;  3CEY A;  4ATO A;  2BZX A;  2J6F A;  1MMD A;  1G3T A;  2CDT A;  4DBR A;  1X69 A;  2PVO B;  1Y71 A;  3VS1 A;  4JRI A;  4JS4 A;  1KQS P;  2RHX A;  2KXC A;  3EH2 A;  1IXD A;  4FYV B;  2F69 A;  1Y7X A;  1N8R U;  5CQX A;  2RI5 A;  4DA4 A;  4RCB A;  2QQ9 A;  2YLC A;  3OYH A;  3EFO B;  5FRN A;  4KH1 B;  5GAN 8;  2OTJ Q;  4Y92 A;  1QLY A;  4J9I A;  1U1S A;  3OB9 A;  3CC2 T;  4AFS C;  3I55 Q;  1NE8 A;  4HCK A;  5C6S A;  3PFS A;  1WGS A;  1SKU B;  2O4X B;  4HCB A;  4M7A D;  2RQR A;  4C0D B;  1P92 A;  5KYX B;  3NGP A;  3FLG A;  4M75 D;  2EJG A;  4OGC A;  1SEM A;  2RH2 A;  4LDW A;  2J6K A;  2P4T A;  4XU0 A;  3HSB A;  4Z02 A;  1RAE B;  2GGR A;  4LDY A;  4CC7 A;  4IUQ A;  1YJ9 A;  4ANJ A;  3GP8 A;  3P8H A;  2V1R A;  3EG3 A;  4EMG A;  4D8K A;  4WCI A;  4F14 A;  2XI9 A;  2FRY A;  1VQL Q;  5IHI A;  2FL7 A;  4XU2 A;  3CCV A;  2LX7 A;  3CMA A;  3NTH A;  2PUO B;  3GF5 A;  3EFS A;  3QUI A;  1YI2 A;  4XK8 E;  1W70 A;  4PJO E;  2NWM A;  5AYF A;  3CC7 Q;  5I2M A;  5KYY A;  4HCC A;  1WXU A;  1YJW A;  2K9G A;  2ZPB B;  3OW2 A;  1AEY A;  5HKC A;  4IIM A;  4J9B A;  4M7D D;  3EG2 A;  2DZC A;  2LJ3 A;  4M7A E;  3EGD B;  2NLU A;  4NL3 A;  3GIB A;  4M77 B;  4KUI A;  4O5V A;  2QDL A;  2M16 A;  2RHZ A;  4M7A F;  5LJ5 f;  2IG0 A;  4PFZ A;  1JB0 E;  1TSF A;  2Y4Y A;  2CP6 A;  4Y91 A;  5HK3 A;  2YWW A;  4R55 A;  3INZ A;  1ZBJ A;  3QJY A;  2OTL A;  3OYJ A;  2WSE E;  3QII A;  2RN8 A;  4LN2 A;  4RTZ A;  5FU6 C;  2EQU A;  2H3J A;  2VYT A;  3H41 A;  3ASK A;  4LDU A;  4BI3 A;  2VB6 A;  2P0P A;  3MCA B;  2C0T A;  2LJ1 A;  1PCX A;  3CCM Q;  3M54 A;  1JEG A;  5IT9 E;  2V8I A;  2RK1 A;  2MOX A;  4RUG A;  2EYQ A;  4M7A C;  1MNE A;  3CCS T;  3SHW A;  3JB9 H;  2RJE A;  1ZQ1 A;  2LVM A;  1IO6 A;  4BDY A;  2CRE A;  3QDF A;  4E7I A;  3OYY A;  2ZGW A;  2DL7 A;  1KFZ A;  1G83 A;  2K7A A;  4J6Y A;  5L23 A;  3HL8 A;  1AWO A;  4BE1 A;  1LOJ A;  2GBQ A;  2HAX A;  2LCS A;  1EZZ B;  2VUB A;  2K4Y A;  4QQD A;  5GAM j;  5GAN f;  4WF2 A;  2E41 A;  4UC4 A;  4LDV A;  3U23 A;  1YI2 T;  2XHC A;  1AOJ A;  1WIE A;  2G6F X;  1TWB A;  4QVD A;  2DYB A;  3Q1J A;  4RMO A;  2D9T A;  1GCQ A;  3G7Z A;  2CP5 A;  1VQ4 A;  1B7T A;  3HRT A;  2ZPI B;  1QVF P;  1O75 A;  3QDR B;  1I0C A;  1G8X A;  3H0F A;  1N5Z A;  4L5G A;  4ZGD B;  3T9N A;  3OMG A;  2CT4 A;  3M0S A;  2Z0W A;  1MMG A;  4OML A;  1TUD A;  5KYU A;  3JCM X;  2RHI A;  3EG0 A;  1R77 A;  3KUF A;  4ZN1 A;  3CC7 A;  2CZ7 B;  1TXQ A;  3CME A;  1K73 R;  4C8Q B;  5GAO m;  3LLR A;  1YIJ T;  1K8A U;  2RQT A;  4TVR A;  3SDZ A;  3CCS A;  1VUB A;  1YJW Q;  2HQX A;  2RPN A;  4J9G A;  1HD3 A;  3PIO A;  1ZSZ C;  1VQN Q;  1M90 U;  2VGN A;  2EQI A;  3SWN C;  3CCS Q;  1C0M A;  4A4F A;  3CXC S;  5CCA A;  5A2Q E;  4OMP A;  1FMW A;  3M55 A;  3UF4 A;  3CXC A;  1D0X A;  4PLI A;  2R57 A;  4F7U B;  1RI0 A;  2YDL A;  4J9C A;  2DXB A;  3VU3 C;  2YRC A;  3S6W A;  1H92 A;  4EMK C;  2DVJ A;  2M51 A;  2ZPH B;  3I5S A;  4ZTJ A;  1UUE A;  1N8R R;  2IVW A;  1KC8 C;  4OP0 A;  5GAM h;  3ME9 A;  1JXO A;  1VQ4 T;  3M5A A;  3JB9 J;  4OGE A;  3VUB A;  1IRX A;  1W6X A;  2CSQ A;  3E9F A;  3VV0 A;  4AG1 C;  3GNG A;  5GAO n;  4M7A B;  2HNI A;  5LJ5 g;  1H64 1;  2E12 A;  5M9O A;  5D6X A;  1GRI A;  2EFI A;  3LH5 A;  3NHN A;  2M0Y A;  2FRW A;  2E3H A;  4ELY C;  3CC7 T;  2F2V A;  3A8O B;  4QVZ A;  1N9S A;  3CME T;  1QQJ A;  1K9A A;  3RR6 A;  4BI4 A;  3J81 E;  1JQQ A;  3A1P A;  2AT1 B;  2BE9 B;  1TH7 A;  4IKF A;  1YIT A;  3A8H B;  1I81 A;  2K5F A;  1VQL A;  5CKB A;  4IUU A;  3ZFJ A;  4AT1 B;  2BIV A;  2LCC A;  1X75 C;  3G6E Q;  3KFV A;  2EKH A;  2PVD B;  2YRD A;  3H0I A;  1M3B A;  4J9D A;  2KXD A;  3CME Q;  4M4Z A;  2EJ9 A;  1QVF S;  1QWE A;  2RHY A;  2RJF A;  1ARK A;  1EIF A;  2EQJ A;  2JVV A;  5GAN j;  2E65 A;  2QEX A;  3CCU Q;  2AKL A;  1BBZ A;  1VOM A;  2CKK A;  1X27 A;  2DYI A;  2E1H A;  2XU8 A;  1UTI A;  2KRN A;  3C94 A;  1NYG A;  4A63 B;  4AFU C;  4OMO A;  1PKS A;  1WQ7 A;  4HVV A;  3OYA A;  4R56 A;  4EDU A;  3I55 A;  4J8O A;  1ZLM A;  1O9S A;  3CPW S;  1HYO A;  3HHT B;  1GFD A;  1FYN A;  1W2B P;  3EG9 A;  5LJ3 d;  4IUT A;  1NJI U;  3QWY A;  4C5H A;  5IHK A;  5GAN e;  3X20 B;  3CPW P;  3HFN A;  2JN0 A;  2LZ6 B;  1D0Y A;  1WI7 A;  4AG2 C;  3CCJ T;  2QAZ A;  1R0B G;  2HBW A;  1GCP A;  1H3Z A;  2DTH A;  2KAF A;  1ZSZ B;  4E47 A;  4BE2 A;  1KD1 R;  1H3H A;  3KBG A;  4M77 C;  2AKK A;  4FCY A;  2COY A;  1VIE A;  1ZA2 B;  4FYW B;  1LJO A;  2NUT B;  3CBO A;  2D0N A;  3UDC A;  3A5Z B;  4J6W A;  2DIL A;  2RQU A;  4C8Q F;  2JUF A;  3TRE A;  2DZ9 A;  4LUD A;  4PLL A;  3OSV A;  3MPU B;  4CI0 C;  2FVU A;  4HCZ A;  3QXE B;  1Y57 A;  4E7K A;  2F2W A;  4OVA A;  2QYZ A;  5GJV B;  3QHS A;  3SEM A;  5J26 A;  2EPD A;  1NZ9 A;  2LT4 A;  1PC0 A;  1UGQ B;  1VQ8 Q;  3TSZ A;  2DPP B;  1NPR A;  1RAD B;  2YHT A;  2QEX T;  3MP1 A;  3AT1 B;  2HBP A;  4MML A;  3G71 Q;  2GTO A;  1UEB A;  2LP5 A;  3OMC A;  1D09 B;  3UPU A;  4QKU A;  4Y28 E;  5KYU B;  3VRZ A;  4M7D E;  4F7U F;  3G4S T;  2CT3 A;  2DTO A;  1VQP T;  3REB B;  2FYK A;  3SB2 A;  2OAU A;  2QDY B;  1MMA A;  1FMV A;  2XDB A;  1JBM A;  3I56 T;  3TU4 K;  4JZ4 A;  1H8K A;  1UHF A;  1LCK A;  2CH4 A;  1WNL A;  1Q81 R;  2E3I A;  1WHK A;  2BUD A;  2AIR B;  2EKO A;  1UDL A;  4C8Q D;  1U1T A;  3HRU A;  5GAN 3;  1W4S A;  3DKM A;  1NEB A;  3RKY A;  1BI2 A;  3L2Z A;  8ATC B;  1SSH A;  4F7U E;  1M5Q 1;  3O5Z A;  1VQ7 T;  2ROT A;  4BE0 A;  4JRK A;  5CR2 A;  2QGF B;  1ZBX A;  2LTO A;  2DVE A;  2QA4 Q;  3CCR A;  4OMF B;  3CCL T;  1PHT A;  1X6O A;  2QQR A;  3A8M B;  1QCO A;  4X1V A;  3HTR A;  1IGU A;  1TG0 A;  2FO0 A;  4XU1 A;  2I0N A;  3QZ5 B;  1WXT A;  4DBH A;  3CCV Q;  1D0Z A;  2CH4 W;  1M1K C;  1QP3 A;  5CO7 A;  4C92 D;  3M59 A;  1Q81 U;  3A8L B;  4D8D A;  2KDS A;  3CCJ Q;  4C5I A;  1Y96 A;  3OS2 A;  2EW3 A;  2KK4 A;  3N5B B;  4XTW A;  4GLK A;  4B6M A;  1PG5 B;  4M75 C;  3CD6 T;  3CC4 A;  3TQ7 P;  1HJD A;  3NTK A;  4RTT A;  1WZO A;  4J7F A;  4JJN K;  1UB4 A;  4EIK A;  3LH0 A;  3UAT A;  1MHN A;  2L0A A;  1Y07 A;  1PWT A;  1PSF A;  3TSW A;  1ZUY A;  3CBM A;  2H3E B;  4E7S A;  1G5V A;  2XMF A;  1VQP A;  1M1K R;  2E6N A;  4JRQ A;  1U5S A;  1X6B A;  1G3Y A;  4M77 D;  3I56 A;  3FIF A;  2FZC B;  1Y0M A;  1VQ9 A;  2XIC A;  3LWI A;  1YN8 A;  2HDA A;  2KRO A;  3FC3 A;  4N4G A;  1YWP A;  3OW2 S;  2K3B A;  3BW1 A;  2HL3 A;  1WHH A;  3OYE A;  4E7Z A;  3VS4 A;  5LJ3 j;  2QA4 T;  4JRP A;  3G6E T;  2K5L A;  2JM9 A;  4HXJ A;  1VQM A;  2BE7 D;  4KT0 E;  2DXT A;  3CQT A;  1VQ6 A;  2MK5 A;  4PJN A;  4DBF A;  3NPF A;  2E5Q A;  3MP6 A;  4N4H A;  1YCY A;  2FZK B;  1K4U S;  4M7A A;  3NFC A;  1SF9 A;  2HKQ B;  2HSP A;  1S72 A;  2CP0 A;  3CCL A;  4PJO A;  1EFN A;  1GBR A;  4OB2 B;  3E2U A;  1ABO A;  3VYG A;  4RCC A;  1HXD A;  4B9W A;  1BCM A;  2ECZ A;  2P84 A;  1I5O B;  2RJD A;  2ZZD A;  2RNA A;  1UGV A;  4M75 B;  1M8M A;  2KRM A;  4IUV A;  3CXC P;  3HKS A;  2VWF A;  1Q86 R;  5LJ3 h;  2QAS A;  1N6A A;  5KYN A;  3X28 B;  4DBQ A;  1ZHI A;  3M0Q A;  1OQK A;  4ZN3 A;  2HL5 C;  1JJ2 P;  3QKJ A;  1ABQ A;  4C8Q C;  1ZUU A;  4M7D G;  1VQ8 T;  1PD1 A;  4LD6 A;  3KXT A;  2WSF E;  3V7R A;  5CKD A;  1ZSZ A;  2DLP A;  1OPL A;  1QVF A;  4QQ6 A;  4JDS A;  1OX9 A;  2DD4 A;  5CKH A;  2DBK A;  4QT7 A;  1D1A A;  4FSX A;  4IIO A;  4M75 E;  1MV3 A;  1KC8 R;  3JCM W;  1Q86 C;  2PZ1 A;  5GMK e;  1K9M U;  4PJO C;  3HFO A;  1UE9 A;  1YNZ A;  1I5L A;  2ED1 A;  4XQ3 A;  4C0D C;  1N27 A;  3HPW A;  4JLG A;  4OB1 B;  2L3R A;  5HK0 A;  3OS5 A;  3L42 A;  2JMC A;  1UG1 A;  3UA6 A;  4BDZ A;  1RAB B;  4KGX B;  2VKN A;  2KVQ G;  1K73 C;  3CCQ Q;  1YIJ Q;  2QQA A;  4XTU A;  3EGX B;  3OYC A;  1VQK A;  4HA8 A;  2VAS A;  2EIF A;  3GLX A;  2PTK A;  4Z88 A;  4RTW A;  4C0G A;  1AT1 B;  2COZ A;  1KD1 C;  2R5M A;  4PJL A;  1KHC A;  3THK A;  2DAQ A;  3IQL A;  3I56 Q;  1E7O A;  1OV3 A;  1WHL A;  2LRQ A;  5GAN 2;  3QSU A;  3L2R A;  1YJN Q;  2K2V A;  1BB9 A;  4C8Q A;  1NM7 A;  3EHQ A;  1B34 B;  3MO8 A;  3EHR A;  3CCU T;  4E6R A;  2P0K A;  1DJ7 B;  1VQ8 A;  3ZL7 C;  5FRM A;  1VQN A;  2A37 A;  5GAO p;  1RAC B;  2EJF A;  2JS2 A;  3UA7 A;  4MZM A;  1Q95 G;  4X9D A;  3C95 A;  4FYY B;  3OBY A;  1AWX A;  2RI3 A;  1MV0 B;  1M1G A;  3MEV A;  5ECA A;  3RER A;  3RMS A;  2HZY A;  5KYW A;  2OJ2 A;  2VVK A;  3OYD A;  2EQM A;  4C5G A;  1CSK A;  4F17 A;  2KE9 A;  1PRM C;  2LC4 A;  4MMK A;  3HP9 A;  3RBB B;  1JXM A;  3BY7 A;  2LMJ A;  2X35 A;  1I07 A;  2K79 A;  1K0S A;  1ZSG A;  4J6X A;  4OF1 A;  2X3W D;  1RL2 A;  1YWO A;  3CC2 A;  3BE3 A;  5GAM e;  1Q82 C;  2RQW A;  2DE0 X;  2KNB B;  3O8V A;  4XTZ A;  1OUL A;  4ZTF A;  2DFU A;  1VQ4 Q;  3OA6 A;  3JB9 D;  2OTJ A;  2MIO A;  1D3B A;  2O2O A;  1S1N A;  1WXB A;  2KMT A;  5AT1 B;  4A53 A;  4FW2 A;  3CD6 Q;  1NG2 A;  4M75 F;  3MHX A;  5KYX A;  2ZPE B;  4JJB A;  2JNG A;  5FU6 B;  2C0I A;  3WVD B;  3CCV T;  4E7J A;  3H6Z A;  2L3S A;  4M78 C;  1QVG P;  5GAN 6;  2ROL A;  1SRL A;  1XQH A;  3M58 A;  1BU1 A;  2SEM A;  3EGD A;  1N9R A;  5A0D A;  3BDU A;  1VQN T;  1YHQ T;  1NEG A;  4GY5 A;  3CCL Q;  2HCK A;  1YJW T;  1M2O A;  5GJW B;  2V8K A;  2M1H A;  4X9C A;  5LJ3 e;  2DEQ A;  1Q82 U;  3JCM g;  1I1J A;  1WQW A;  1K1Z A;  7AT1 B;  2EWN A;  1I8F A;  3R6O A;  5GAO l;  4M78 E;  4OB3 B;  3M0P A;  3CCM A;  5I21 A;  1OOT A;  2COW A;  1FWZ A;  4LXC A;  3MEA A;  3V7C A;  2LQK A;  3WXM B;  1A0N B;  3LX7 A;  3TVT A;  2HQE A;  2A0F B;  3F70 A;  1K0X A;  1LPL A;  3D7S B;  4JJC A;  3GOX A;  1G2B A;  4AMC A;  1QVG S;  1M8V A;  2I2L A;  1WFW A;  3REA B;  1W2B S;  2EGE A;  1T0H A;  3G4S Q;  1PRL C;  2QGG A;  5EG2 A;  5GAN h;  1WX6 A;  1YJN T;  1PD0 A;  4AFQ C;  4C92 E;  1K73 U;  4KUD K;  2DXU A;  1KG1 A;  2KEA A;  3VYH B;  4QW2 A;  3OYN A;  4JJD A;  3OS1 A;  1WJS A;  2GFA A;  2NYS A;  4N0A A;  1K8A R;  2O31 A;  3X26 B;  4BB7 A;  2OTJ T;  1R0C B;  2MI6 A;  4ESR A;  2MPX C;  1EX4 A;  3JCM b;  1UFF A;  2X4Y A;  2DX1 A;  4ME7 A;  3RDV A;  2YUQ A;  2E5K A;  2ZCF B;  4F16 A;  2CUD A;  2X4W A;  5DLQ E;  2R58 A;  1YI2 Q;  3ULR B;  5KCO A;  1I4K 1;  1AWJ A;  3ZEH A;  1X2K A;  3CCQ A;  5A0G A;  2JTM A;  1OZ3 A;  3I5R A;  2CYZ B;  2DBM A;  3OYL A;  3M9Q A;  1FX7 A;  2E10 A;  5GAN 4;  1QCF A;  3ER0 A;  2YT6 A;  3RNJ A;  2CGH A;  2XG8 D;  4JLI A;  2C0O A;  4C5E A;  1M2V B;  3RES A;  1Q81 C;  4PJM A;  1YCS B;  1Q7Y R;  3OQ5 A;  3X24 B;  1RAI B;  1BIB A;  2E4H A;  3EH1 A;  1PM3 A;  2VXF A;  2WSC E;  4N4I A;  4ZGE B;  1Y96 B;  3CCM T;  3L1A A;  2AZV A;  2QK0 A;  2V8J A;  3PIP A;  1FMK A;  1AZG B;  1BYM A;  4MZT A;  1B07 A;  2O9S A;  1WHJ A;  3CCE T;  2F5K A;  2D8J A;  4X34 A;  4PK4 A;  4IUR A;  3JCM c;  3QO3 A;  3JCM J;  3FJ5 A;  4PJO F;  1GFC A;  2QQS A;  2C06 A;  1QMC A;  4RG8 A;  5IXF A;  1IRE B;  1SHG A;  3L2W A;  1KC8 U;  1M1F A;  1ZUK A;  2A08 A;  4ZGJ B;  1TTH B;  4ZNX A;  3JV3 A;  2FPD A;  1YIJ A;  1YJN A;  3OYG A;  4M78 D;  3DLM A;  3S3O A;  1ACM B;  1VQ6 Q;  4CRI A;  1VQ5 T;  3RIR A;  1QKX A;  2DJQ A;  1KHI A;  2JT4 A;  2NUP A;  1ZA1 B;  5HCK A;  2GQI A;  2JZ2 A;  1UJY A;  3MEU A;  2DIG A;  1IB8 A;  1BI1 A;  1AHJ B;  2NUP B;  5J39 A;  2FG0 A;  2D8H A;  1RI9 A;  5CQY A;  1SG5 A;  1TS9 A;  1K8A C;  4XTX A;  1NLO C;  2CP2 A;  3JCM e;  2ESW A;  4M77 A;  2L3Q A;  3OBW A;  1B34 A;  1T3S A;  4OB0 B;  2R5A A;  3J7A F;  2OTL Q;  1TU0 B;  2YUN A;  1VYV A;  2RQV A;  5D6Y A;  4F7U A;  3FRN A;  1J3T A;  4NOY A;  2E70 A;  2DO3 A;  4KUL A;  4RKU E;  5KCH A;  1KD1 U;  2BZY A;  3M0U A;  2MAM A;  1MUZ A;  2CZ0 B;  2FHD A;  2FPE A;  4M78 F;  3OW2 P;  2KSS A;  4PKC C;  4RTU A;  4FYX B;  1GL5 A;  1KQ2 A;  2LX9 A;  3CCE A;  1Q7Y C;  2EVR A;  2DK3 A;  2IIM A;  2OTL T;  2EYX A;  4CC3 A;  1RAH B;  1MMN A;  4OMM A;  3SFM A;  3M4G A;  3FJP A;  5CIU A;  3VJP A;  4JS5 A;  1U8R A;  3OYK A;  4HVW A;  3OYM A;  4YTL A;  1K9M R;  2O9V A;  4AFZ C;  1WLP B;  2B86 A;  1MGQ A;  2KYB A;  2J05 A;  4RTY A;  2ZPG B;  2HEQ A;  1YIT T;  3P8B B;  4J9F A;  1RAF B;  4IUP A;  1Q82 R;  1VQ5 A;  3FB9 A;  1BIA A;  3LYI A;  1M9S A;  3JRZ A;  1NPP A;  4FL6 A;  1KSW A;  5FLX E;  2KBT A;  1NJI C;  1OEB A;  4V2S A;  1UGR B;  2QXF A;  2HKN A;  4DEX A;  3V8J A;  3OYB A;  1VQ5 Q;  2YUP A;  5FRO A;  3TCJ A;  4XTY A;  4L6V 5;  3E1S A;  3CMA Q;  4J7I A;  1QCN A;  1QWF A;  2L3P A;  5LJ5 e;  4OMN A;  3L2V A;  2LQW A;  3E9G A;  2D1X A;  1IGQ A;  1V1C A;  3QYH B;  5KE3 A;  3PVQ A;  1QP2 A;  2B8A A;  5I22 A;  1PNJ A;  2L89 A;  4P5N A;  4PFP A;  4O6J A;  2GCX A;  2DL4 A;  5GAN g;  2DXC A;  1RAA B;  2LT1 A;  2XD0 A;  1D3B B;  2EYY A;  4BY6 C;  1BI0 A;  2RMO A;  3PVL A;  1G3W A;  2J7I A;  2K6D A;  3EG9 B;  2Y90 A;  2A36 A;  1GBQ A;  1GXI E;  2XDP A;  2F1L A;  4JUV A;  3BDL A;  3GNF B;  4A4H A;  5GAM f;  3JCM P;  2KQW A;  2RA2 A;  5A0L A;  4PJO B;  3R6N A;  1AZE A;  3SWN A;  3L2U A;  3X25 B;  2LQN A;  3NTI A;  5FW9 A;  4EMH A;  4KGZ B;  4KBM B;  1JJ2 S;  1VQK Q;  4A4K A;  5DM7 R;  3JCM f;  5C0M A;  2ABL A;  2J06 A;  1VQM Q;  1C1A A;  4C92 G;  4FU6 A;  2G3R A;  2GFU A;  4ORZ A;  1D1B A;  1SPK A;  2RB6 A;  4E7L A;  3QZ9 B;  2EYZ A;  2L2P A;  1BKB A;  5LL6 S;  4M7A G;  4M75 G;  2RHU A;  2F2X A;  1OU8 A;  3MKD A;  3OY9 A;  2ENM A;  1QVP A;  2HSE B;  2BKD N;  1BI3 A;  4HT9 A;  1RUW A;  5FWB A;  2QTX A;  4C0F A;  2J6O A;  2QG9 B;  3G4S A;  1M2V A;  4FT2 A;  1YJ9 Q;  2X3X D;  3VKI A;  5GAO q;  3WVE B;  4CC2 A;  3JCM d;  1KQ1 A;  1M4Z A;  4BAC A;  4BY6 B;  3QJ6 A;  3OYI A;  4GBQ A;  2JTE A;  4M77 G;  1SSF A;  1D1C A;  2YXY A;  2MYS A;  4RTV A;  2AHJ B;  1B3Q A;  5CK9 A;  2EQK A;  1OU9 A;  4HT8 A;  1UEC A;  1WHG A;  5LJ5 j;  3UWN A;  1X6G A;  2DL8 A;  1GCQ C;  3H0H A;  4M78 B;  2EGC A;  1WA7 A;  5GAM g;  1PSE A;  4FM4 B;  2RK2 A;  2MWP A;  4E7H A;  2CSI A;  3EGU A;  2K57 A;  2W0Z A;  3OSS C;  4J83 A;  4EMK A;  2RF0 A;  4FIB A;  1UJ0 A;  5IAY A;  2MWO A;  2JOY A;  2XK0 A;  1LVK A;  1U06 A;  4DEY A;  3CCR T;  5KE2 A;  2RJC A;  4A4E A;  1M3C A;  1NBE B;  3DLL A;  3EFO A;  2LJ0 A;  1WHM A;  3LW5 E;  5GMK h;  1VQ9 Q;  3JB9 F;  3FDR A;  1VIF A;  5IHN A;  3GBQ A;  1RLP C;  4D6W A;  1VYU A;  3CPF A;  3CPW A;  3PT9 A;  1VQL T;  2JM8 A;  2YRV A;  4JZ3 A;  1M30 A;  2Y4X A;  3JSC A;  3CD6 A;  3VS2 A;  4EMK B;  4FT4 A;  4MZP A;  4Q5W A;  2JS0 A;  1OX8 A;  1M1K U;  2BZ8 A;  2CUB A;  4NS5 A;  2FEI A;  3AHU A;  1OZ2 A;  3CC4 Q;  2KT8 A;  2JTF A;  3QPH A;  4R0K A;  2K2M A;  3QYG B;  3I55 T;  1KK7 A;  2A3L A;  3HRS A;  3QWX X;  3CC2 Q;  2DD5 A;  5GMK j;  2O01 E;  3I35 A;  4M75 A;  2GTJ A;  1AWW A;  5GMK m;  1AD5 A;  3RUX A;  5GMK i;  4WTO B;  1SRM A;  3C0C A;  1ZX6 A;  1QVG A;  3JCM h;  1WJR A;  3PTA A;  1Q86 U;  4F04 B;  2VGM A;  3RKW A;  3JCM V;  2DJZ A;  2QA4 A;  2XID A;  2YUO A;  3CCJ A;  2DRK A;  2FPF A;  4RG2 A;  1VQM T;  2L5Q A;  1VA7 A;  2PVG B;  5I11 A;  1OPK A;  4ELZ C;  2RM4 A;  2CP3 A;  2GQV A;  4GLM A;  4M7D F;  2ZPF B;  3JB9 G;  5GAN d;  3JAM E;  1E6H A;  1V76 A;  2HD0 A;  1QW1 A;  1S72 T;  1T0J A;  2KR3 A;  5EC7 A;  2M0O A;  2DM1 A;  2XDD A;  1M3A A;  5GAM d;  2QI2 A;  1V29 B;  2V26 A;  2LQ8 A;  1OYX A;  3CCR Q;  1UHC A;  1HK9 A;  3G1J A;  5GAN 5;  1XNI A;  3M4Y A;  2RI2 A;  2NUZ A;  4LNP A;  5LJ3 f;  2PUK B;  2PNI A;  3E19 A;  3LGL A;  3BFM A;  3M57 A;  1IHV A;  4C8Q E;  4C92 A;  2ATC B;  3A8G B;  2HMA A;  4J9H A;  1Z9Q A;  2E64 A;  2LDM A;  3V8K A;  2XKO C;  2DMO A;  3MEW A;  1UGS B;  4PL6 A;  1TUC A;  3DB4 A;  1SHF A;  1C6V X;  1WDX A;  5L8R E;  4XU3 A;  4PNO A;  4KRT A;  1M90 R;  4BD3 A;  1QKW A;  1UGP B;  3M0R A;  2ZAE A;  4PJO D;  2DNU A;  2X4J A;  4LUE A;  2D0Q B;  4FSS A;  3NMZ C;  1OI1 A;  1M27 C;  5J3B A;  1WYX A;  1VQO Q;  2M02 A;  4DOV A;  3VS3 A;  3CBP A;  1T3L A;  2VC8 A;  2SRC A;  1E6G A;  4C92 F;  4A54 A;  2K5I A;  4A4G A;  2EYW A;  1VQ7 A;  4PJO G;  4RTX A;  5FU7 B;  1VQK T;  5LJ3 g;  2IPO B;  1HSQ A;  3UT1 A;  4XAX B;  3JB9 I;  3FEO A;  3S3M A;  5GMK l;  5IH2 A;  2O4X A;  1K9M C;  3EGX A;  4DQ2 A;  4J9E A;  5KYW B;  3PMT A;  4LD9 K;  2DL5 A;  3RMQ A;  5KH6 A;  1MND A;  5FU7 C;  1YBY A;  2M9U A;  4C92 C;  1XOV A;  2RO0 A;  2WAC A;  2YLB A;  3C4S A;  2O88 A;  4LDX A;  2K3Y A;  1CKA A;  2VV5 A;  3CC4 T;  2MMP A;  2FZG B;  1X01 A;  2DET A;  1RAG B;  5KYY B;  2JMA A;  2JXB A;  1PKT A;  1IHW A;  2RD1 A;  3URG A;  1CKB A;  4CC4 B;  3M0T A;  2QTV A;  2PQW A;  2MCN A;  2JW4 A;  2CZ6 B;  2PU9 B;  1JU5 C;  1LNX A;  4E2F B;  4M7D A;  3JCM Q;  1KIK A;  4MDX A;  4PJJ A;  4BI8 B;  4EPC A;  2DL3 A;  5GAN 7;  3H8Z A;  2EGA A;  1M90 C;  1TUG B;  2KYM A;  2HQH A;  4M78 A;  3PE0 A;  4KGV B;  2AK5 A;  5CAI A;  1VQ9 T;  3C12 A;  2KGT A;  1XTD A;  3V7S A;  2KT1 A;  4C8Q G;  3PMI A;  5CKF A;  4LE9 A;  1YP5 A;  3V8L A;  1VQO A;  1YHQ Q;  2VXE A;  5GAO r;  1JJ2 A;  4L59 A;  3VS6 A;  1S72 Q;  2H8H A;  1JO8 A;  1KJW A;  3G6E A;  4MDW A;  2OX7 A;  8AT1 B;  3RKX A;  2L8D A;  2DER A;  2DEU A;  1VQ6 T;  1YIT Q;  4QQG A;  2DIQ A;  4M7D B;  2CP7 A;  3QBY A;  2OI3 A;  2BTT A;  2JJ9 A;  2K3X A;  3A98 A;  4C0Z A;  3DB3 A;  3EG1 A;  3G71 A;  1BCO A;  1IZ6 A;  2LNH B;  3P8D A;  1G3S A;  5I2S A;  1X43 A;  2DRM A;  1NJI R;  5CVI A;  4OMQ A;  3H9N A;  1AVZ C;  3VRY A;  2KY9 A;  1VYT A;  4M7D C;  4Z89 A;  2A28 A;  4BUG A;  4M77 E;  3MP8 A;  3VS0 A;  1BK2 A;  1Q7Y U;  5LJ5 d;  2YSQ A;  2MF2 A;  3VS7 A;  3PNW C;  1WPY A;  1F1B B;  3SD4 A;  2P4R A;  3MJX A;  1TOV A;  1NYF A;  2GNC A;  2X9H A;  5CKE A;  1Z9Z A;  1YHQ A;  5IN1 A;  4B9X A;  2P0Q A;  3OYF A;  4JPB W;  2E6Z A;  4FW1 A;  2AZS A;  2NUT A;  3LWH A;  1VQ7 Q;  2DKG A;  4M77 F;  5IXB A;  3QG1 A;  3SWN B;  3ZBD A;  3LGF A;  2X51 A;  2KRS A;  3J80 E;  4XTV A;  2CZ1 B;  2KI7 A;  6AT1 B;  3MET A;  1VQO T;  5LJ5 h;  2A7Y A;  2DF6 A;  1R8O B;  5D7U A;  2DTI A;  4KH0 B;  3GPL A;  2V1Q A;  4II1 A;  2CS7 A;  4NL2 A;  4C92 B;  2F5T X;  2LCL A; 
#chains in the Genus database with same CATH homology
 3CC2 A;  2BKD N;  1BI3 A;  5GAM e;  3L2Q A;  1Q82 C;  4HT9 A;  2FB7 A;  1WQ7 A;  2QTX A;  4C0F A;  3O8V A;  3TEE A;  4R56 A;  3OYA A;  4EDU A;  3I55 A;  4J8O A;  3G4S A;  4FT2 A;  4XTZ A;  3CPW S;  1O9S A;  3VKI A;  5GAO q;  4N0A C;  5DY9 A;  3WVE B;  4ZTF A;  3M56 A;  3HHT B;  3M53 A;  2QQB A;  2LNV A;  5LJ3 d;  3JCM d;  1KQ1 A;  1M4Z A;  2EAY A;  4HKE A;  4IUT A;  4M78 G;  3G71 T;  4BY6 B;  4QVC A;  4BAC A;  1NJI U;  4C5H A;  1WJQ A;  3QJ6 A;  3OYI A;  3OA6 A;  3JB9 D;  4M77 G;  2OTJ A;  1SSF A;  1D3B A;  1JRI A;  5GAN e;  2KMT A;  2D6F A;  4A53 A;  3EFR A;  3X20 B;  3HFN A;  2JN0 A;  2AHJ B;  4DOW A;  5CK9 A;  2EQK A;  1KQS A;  5D6W A;  4J5Y A;  4M75 F;  1YJ9 T;  3MHX A;  4HT8 A;  2ZPE B;  5LJ5 j;  2GF7 A;  4M78 B;  3UWN A;  3CCJ T;  2JNG A;  4VUB A;  2X4X A;  5FU6 B;  5GAM g;  1W2B A;  5DLO A;  3CCQ T;  1PSE A;  3EAE A;  2RK2 A;  4FM4 B;  2MWP A;  3WVD B;  4E7H A;  3OSS C;  2K57 A;  1H3Z A;  2DTH A;  3PGG A;  4J83 A;  3CCV T;  4EMK A;  1N8R C;  4E7J A;  2KAF A;  4FIB A;  1FXX A;  3H6Z A;  3CMA T;  5IAY A;  4M78 C;  2MWO A;  2JOY A;  4E47 A;  2XK0 A;  4BE2 A;  5GAN 6;  3CCU A;  3CCR T;  5KE2 A;  3KBG A;  1XQH A;  3M58 A;  4M77 C;  3OS0 A;  5HY6 A;  1KQS S;  1VIE A;  3VUZ A;  2RJC A;  4F7U G;  1N9R A;  1LJO A;  3BDU A;  4A4E A;  5A0D A;  3CEY A;  3S3N A;  3CBO A;  1YHQ T;  1VQN T;  4ATO A;  3UDC A;  3A5Z B;  3DLL A;  4GY5 A;  4J6W A;  1YJW T;  1G3T A;  2V8K A;  3LW5 E;  2M1H A;  2JUF A;  3TRE A;  2DZ9 A;  4C8Q F;  4PLL A;  3OSV A;  4X9C A;  5GMK h;  5LJ3 e;  2DEQ A;  1Q82 U;  2PVO B;  1Y71 A;  4CI0 C;  2FVU A;  3JCM g;  3JB9 F;  4HCZ A;  1WQW A;  3FDR A;  4JRI A;  1VIF A;  3QXE B;  2EWN A;  1I8F A;  3R6O A;  2RHX A;  5GAO l;  4JS4 A;  4M78 E;  4OB3 B;  4D6W A;  4E7K A;  4OVA A;  3CPF A;  2F69 A;  1Y7X A;  3PT9 A;  3CPW A;  3CCM A;  1N8R U;  1VQL T;  5I21 A;  3QHS A;  5CQX A;  2RI5 A;  5J26 A;  2YRV A;  1FWZ A;  4DA4 A;  3MEA A;  3V7C A;  4RCB A;  2LQK A;  2QQ9 A;  2Y4X A;  2YLC A;  1NZ9 A;  3JSC A;  3WXM B;  3CD6 A;  2LT4 A;  4EMK B;  3LX7 A;  4FT4 A;  4MZP A;  2HQE A;  4Q5W A;  3OYH A;  1UGQ B;  3F70 A;  5FRN A;  2DPP B;  5GAN 8;  1NPR A;  1M1K U;  2YHT A;  3GOX A;  2QEX T;  3MP1 A;  4NS5 A;  2HBP A;  4MML A;  1U1S A;  1QVG S;  3AHU A;  1M8V A;  1OZ2 A;  1UEB A;  2I2L A;  3OB9 A;  3OMC A;  1W2B S;  3CC2 T;  3UPU A;  4Y28 E;  4M7D E;  1NE8 A;  2JTF A;  3QPH A;  4F7U F;  5EG2 A;  5GAN h;  3QYG B;  3I55 T;  3G4S T;  5C6S A;  1YJN T;  1WGS A;  3PFS A;  2O4X B;  2DTO A;  2A3L A;  4C92 E;  2FYK A;  3SB2 A;  3HRS A;  2QDY B;  2OAU A;  1VQP T;  2DXU A;  4HCB A;  2DD5 A;  4KUD K;  4M7A D;  1KG1 A;  5GMK j;  4C0D B;  2XDB A;  1P92 A;  1JBM A;  3VYH B;  3I56 T;  2O01 E;  3TU4 K;  4QW2 A;  3FLG A;  4M75 D;  4M75 A;  3OYN A;  2EJG A;  3OS1 A;  4OGC A;  1WNL A;  1WJS A;  2RH2 A;  4LDW A;  5GMK m;  2GFA A;  4N0A A;  2OTJ T;  2BUD A;  3X26 B;  4BB7 A;  3RUX A;  2MI6 A;  2P4T A;  4XU0 A;  5GMK i;  3HSB A;  4Z02 A;  3JCM b;  2X4Y A;  2EKO A;  4C8Q D;  1QVG A;  1U1T A;  1WJR A;  3HRU A;  4ME7 A;  3JCM h;  3PTA A;  4LDY A;  2ZCF B;  1Q86 U;  4IUQ A;  5GAN 3;  1W4S A;  2VGM A;  3DKM A;  2X4W A;  3GP8 A;  5DLQ E;  3RKY A;  1BI2 A;  2DJZ A;  2R58 A;  2XID A;  3P8H A;  3RKW A;  3JCM V;  2QA4 A;  4EMG A;  3CCJ A;  4RG2 A;  2XI9 A;  5KCO A;  1VQM T;  2L5Q A;  1I4K 1;  2PVG B;  3ZEH A;  3L2Z A;  3CCQ A;  5A0G A;  2JTM A;  1OZ3 A;  2CYZ B;  4ELZ C;  2RM4 A;  4F7U E;  2FL7 A;  2GQV A;  1M5Q 1;  4XU2 A;  2ZPF B;  3CCV A;  4BE0 A;  4JRK A;  5CR2 A;  1VQ7 T;  3CMA A;  4M7D F;  3NTH A;  3OYL A;  2PUO B;  3GF5 A;  3M9Q A;  1ZBX A;  2LTO A;  2DVE A;  3JB9 G;  1FX7 A;  2E10 A;  5GAN d;  5GAN 4;  3EFS A;  2HD0 A;  3QUI A;  3JAM E;  3ER0 A;  3CCR A;  1QW1 A;  4XK8 E;  1YI2 A;  1S72 T;  2CGH A;  2XG8 D;  4OMF B;  4JLI A;  3CCL T;  2M0O A;  4C5E A;  2XDD A;  4PJO E;  5GAM d;  1X6O A;  2QI2 A;  2QQR A;  5AYF A;  3A8M B;  5I2M A;  1V29 B;  4HCC A;  1YJW A;  2LQ8 A;  3RES A;  1Q81 C;  1OYX A;  2ZPB B;  4XU1 A;  3OQ5 A;  1HK9 A;  3OW2 A;  3X24 B;  3QZ5 B;  1BIB A;  5HKC A;  5GAN 5;  4M7D D;  2DZC A;  2VXF A;  1XNI A;  2WSC E;  4M7A E;  1M1K C;  2NLU A;  4N4I A;  4ZGE B;  4M77 B;  4NL3 A;  1QP3 A;  5CO7 A;  3M4Y A;  1Y96 B;  4KUI A;  4C92 D;  2RI2 A;  3L1A A;  3M59 A;  3CCM T;  1Q81 U;  4O5V A;  2V8J A;  3PIP A;  1BYM A;  3A8L B;  2M16 A;  2RHZ A;  2KDS A;  2PUK B;  4MZT A;  5LJ3 f;  4C5I A;  1Y96 A;  3OS2 A;  4M7A F;  3E19 A;  2KK4 A;  3N5B B;  3LGL A;  3BFM A;  3M57 A;  4GLK A;  4XTW A;  5LJ5 f;  2IG0 A;  4M75 C;  1JB0 E;  3CD6 T;  2Y4Y A;  3CC4 A;  4C8Q E;  3NTK A;  4Y91 A;  4C92 A;  3CCE T;  5HK3 A;  2F5K A;  3GIB A;  4R55 A;  3INZ A;  4J7F A;  4X34 A;  3A8G B;  4JJN K;  1UB4 A;  3QJY A;  4IUR A;  3JCM c;  3QO3 A;  3JCM J;  2OTL A;  4PJO F;  2E64 A;  3OYJ A;  2LDM A;  3V8K A;  2QQS A;  2XKO C;  2WSE E;  3QII A;  2C06 A;  4RG8 A;  1IRE B;  5FU6 C;  3LH0 A;  1MHN A;  1UGS B;  2EQU A;  1M1F A;  2H3J A;  3MEW A;  2VYT A;  4PL6 A;  1Y07 A;  4ZGJ B;  1KC8 U;  3DB4 A;  3ASK A;  1PSF A;  4LDU A;  5L8R E;  4BI3 A;  3CBM A;  4XU3 A;  2P0P A;  3MCA B;  4PNO A;  1YIJ A;  1YJN A;  1G5V A;  3OYG A;  1VQP A;  2E6N A;  4JRQ A;  4M78 D;  3DLM A;  3M54 A;  3S3O A;  5IT9 E;  2V8I A;  4BD3 A;  1UGP B;  1G3Y A;  4M77 D;  3I56 A;  3FIF A;  2RK1 A;  4PJO D;  4CRI A;  2EYQ A;  1VQ9 A;  2XIC A;  3LWI A;  4M7A C;  3CCS T;  3RIR A;  2X4J A;  1VQ5 T;  2D0Q B;  3FC3 A;  4N4G A;  1OI1 A;  3JB9 H;  5J3B A;  2RJE A;  1ZQ1 A;  2LVM A;  3OW2 S;  1KHI A;  3BW1 A;  3OYE A;  4BDY A;  2JZ2 A;  4DOV A;  4E7I A;  3OYY A;  5LJ3 j;  3MEU A;  3CBP A;  2QA4 T;  2ZGW A;  4JRP A;  2VC8 A;  3G6E T;  2K5L A;  2DIG A;  1VQM A;  1BI1 A;  4C92 F;  4A54 A;  1AHJ B;  4KT0 E;  4J6Y A;  2DXT A;  5J39 A;  2K5I A;  4A4G A;  3HL8 A;  1VQ6 A;  4BE1 A;  1LOJ A;  2E5Q A;  3MP6 A;  4N4H A;  1VQ7 A;  4PJO G;  2HAX A;  1YCY A;  2VUB A;  2K4Y A;  4QQD A;  5CQY A;  5GAM j;  5FU7 B;  5GAN f;  3NFC A;  1K8A C;  4WF2 A;  2E41 A;  1VQK T;  4M7A A;  4UC4 A;  4LDV A;  5LJ3 g;  1YI2 T;  4XTX A;  1S72 A;  3JCM e;  3CCL A;  2XHC A;  4PJO A;  4M77 A;  4QVD A;  3UT1 A;  4OB2 B;  4XAX B;  3JB9 I;  3Q1J A;  3FEO A;  4RMO A;  3S3M A;  3OBW A;  1B34 A;  3VYG A;  5GMK l;  2D9T A;  4OB0 B;  2R5A A;  4RCC A;  3J7A F;  2O4X A;  3G7Z A;  1K9M C;  1HXD A;  5D6Y A;  4F7U A;  4B9W A;  1VQ4 A;  4DQ2 A;  3FRN A;  4NOY A;  3HRT A;  3PMT A;  2ZPI B;  1O75 A;  2E70 A;  4LD9 K;  2DO3 A;  3QDR B;  4KUL A;  2RJD A;  2ZZD A;  4RKU E;  5KCH A;  4M75 B;  1KD1 U;  3RMQ A;  2MAM A;  5KH6 A;  2CZ0 B;  2FHD A;  4IUV A;  4L5G A;  4ZGD B;  4M78 F;  1YBY A;  2M9U A;  3OMG A;  5FU7 C;  3T9N A;  4C92 C;  1XOV A;  3HKS A;  2RO0 A;  2WAC A;  2YLB A;  2KSS A;  3C4S A;  5LJ3 h;  4LDX A;  2K3Y A;  1N6A A;  4PKC C;  2VV5 A;  3CC4 T;  3X28 B;  2MMP A;  1X01 A;  1ZHI A;  1KQ2 A;  2LX9 A;  3CCE A;  4ZN3 A;  3JCM X;  1Q7Y C;  2RHI A;  3QKJ A;  2DK3 A;  4C8Q C;  2OTL T;  2RD1 A;  4M7D G;  3URG A;  1VQ8 T;  4LD6 A;  3KUF A;  4ZN1 A;  3CC7 A;  3SFM A;  2PQW A;  3FJP A;  3M4G A;  5CIU A;  3VJP A;  2CZ7 B;  4JS5 A;  3KXT A;  1U8R A;  3OYK A;  3CME A;  3OYM A;  2WSF E;  2CZ6 B;  2PU9 B;  4YTL A;  3V7R A;  1LNX A;  4M7D A;  5CKD A;  4C8Q B;  3JCM Q;  4MDX A;  1MGQ A;  4BI8 B;  4QQ6 A;  3LLR A;  4EPC A;  3H8Z A;  4JDS A;  5GAN 7;  5GAO m;  1QVF A;  1M90 C;  1YIJ T;  2ZPG B;  1K8A U;  2DD4 A;  5CKH A;  4TVR A;  1YIT T;  3P8B B;  4FSX A;  4M78 A;  4M75 E;  5CAI A;  3SDZ A;  4IUP A;  1VQ9 T;  3C12 A;  1XTD A;  3V7S A;  3CCS A;  1VQ5 A;  3FB9 A;  1BIA A;  1VUB A;  3LYI A;  1M9S A;  3JCM W;  1Q86 C;  4C8Q G;  3PMI A;  5CKF A;  5GMK e;  3JRZ A;  1K9M U;  3HFO A;  2HQX A;  4PJO C;  3V8L A;  1NPP A;  1I5L A;  4XQ3 A;  4FL6 A;  4C0D C;  5FLX E;  1VQO A;  1NJI C;  2VXE A;  1N27 A;  3HPW A;  3PIO A;  5GAO r;  4L59 A;  4JLG A;  1JJ2 A;  4V2S A;  1M90 U;  1UGR B;  2VGN A;  2QXF A;  4OB1 B;  2L3R A;  5HK0 A;  3V8J A;  3SWN C;  3OYB A;  3OS5 A;  3L42 A;  4A4F A;  3CXC S;  5FRO A;  3G6E A;  4MDW A;  3TCJ A;  5CCA A;  4XTY A;  4L6V 5;  5A2Q E;  4BDZ A;  3E1S A;  3RKX A;  2L8D A;  4J7I A;  1VQ6 T;  3M55 A;  2KVQ G;  1K73 C;  4QQG A;  3CXC A;  2DIQ A;  4M7D B;  5LJ5 e;  3QBY A;  2QQA A;  4PLI A;  3L2V A;  2R57 A;  4XTU A;  4F7U B;  3OYC A;  1RI0 A;  1VQK A;  4HA8 A;  3E9G A;  2DXB A;  2EIF A;  3GLX A;  3VU3 C;  2K3X A;  3QYH B;  5KE3 A;  4C0Z A;  3DB3 A;  3S6W A;  4EMK C;  1QP2 A;  2ZPH B;  2B8A A;  4ZTJ A;  3G71 A;  4C0G A;  2IVW A;  1KC8 C;  2L89 A;  4P5N A;  1IZ6 A;  4O6J A;  4OP0 A;  2GCX A;  3P8D A;  5GAM h;  1G3S A;  3ME9 A;  5I2S A;  5GAN g;  1KD1 C;  2DXC A;  2R5M A;  1VQ4 T;  3M5A A;  2LT1 A;  1KHC A;  5CVI A;  1D3B B;  2DAQ A;  3JB9 J;  4OGE A;  2XD0 A;  3VUB A;  5GAN 2;  2LRQ A;  4BY6 C;  3QSU A;  3E9F A;  1BI0 A;  2KY9 A;  3VV0 A;  3L2R A;  3GNG A;  1G3W A;  4M7D C;  2Y90 A;  4BUG A;  4M77 E;  5GAO n;  2K2V A;  3MP8 A;  4M7A B;  2HNI A;  1Q7Y U;  5LJ5 g;  5LJ5 d;  1H64 1;  1GXI E;  2XDP A;  4JUV A;  2E12 A;  4C8Q A;  2MF2 A;  3BDL A;  5M9O A;  3GNF B;  5D6X A;  4A4H A;  2EFI A;  5GAM f;  1B34 B;  3MO8 A;  3PNW C;  3CCU T;  1WPY A;  3JCM P;  2KQW A;  3SD4 A;  2RA2 A;  5A0L A;  4PJO B;  2P0K A;  1DJ7 B;  1VQ8 A;  4ELY C;  5FRM A;  3CC7 T;  1VQN A;  5CKE A;  4QVZ A;  3A8O B;  1YHQ A;  3SWN A;  5IN1 A;  5GAO p;  3L2U A;  1N9S A;  3CME T;  4B9X A;  2P0Q A;  3X25 B;  3NTI A;  3J81 E;  4BI4 A;  3OYF A;  2EJF A;  4EMH A;  4KBM B;  1JJ2 S;  2E6Z A;  4MZM A;  4A4K A;  5DM7 R;  1K73 U;  4X9D A;  3JCM f;  3LWH A;  1TH7 A;  4IKF A;  2DKG A;  1YIT A;  5C0M A;  3A8H B;  3C95 A;  4M77 F;  3QG1 A;  1I81 A;  3SWN B;  3ZBD A;  2K5F A;  3LGF A;  1VQL A;  5CKB A;  4IUU A;  3OBY A;  3ZFJ A;  2BIV A;  2LCC A;  1X75 C;  2RI3 A;  1M1G A;  3MEV A;  3RER A;  4C92 G;  4FU6 A;  3RMS A;  2G3R A;  2PVD B;  3J80 E;  2GFU A;  2RB6 A;  4XTV A;  3OYD A;  2CZ1 B;  2EQM A;  4E7L A;  3QZ9 B;  3MET A;  2EJ9 A;  4C5G A;  1VQO T;  1QVF S;  1BKB A;  5LL6 S;  5LJ5 h;  4M7A G;  2A7Y A;  2RHY A;  2RJF A;  3L2W A;  2LC4 A;  1EIF A;  1R8O B;  4MMK A;  3HP9 A;  2EQJ A;  2JVV A;  5GAN j;  2E65 A;  4M75 G;  3BY7 A;  2DTI A;  2X35 A;  2QEX A;  2RHU A;  3GPL A;  2CKK A;  4J6X A;  4OF1 A;  1RL2 A;  4II1 A;  2CS7 A;  4NL2 A;  2E1H A;  4C92 B;  3OY9 A;  1YJ9 A;  2XU8 A;  1QVP A;  2F5T X;  3C94 A;  2LCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...