3MEVA

Crystal structure of sgf29 in complex with r2ak4me3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
175
structure length
175
Chain Sequence
GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mevA02
3MP6A 1H3ZA 3OS1A 4LD6A 3GOXA 2DIQA 3S3OA 2E5QA 1G5VA 3UWNA 5C0MA 1WJSA 4X34A 3CEYA 3EAEA 3P8DA 3QBYA 4IUTA 4E7HA 4E7LA 1OI1A 5KE3A 2RHUA 3LX7A 4C5HA 4NS5A 3H8ZA 3LGLA 3MO8A 3OYGA 4HCZA 4RG2A 1N27A 3DB4A 2EQUA 2L89A 2YRVA 3E9GA 2EQKA 2EKOA 3OYHA 4FU6A 3NTKA 3FDRA 3MEWA 4BE0A 4BD3A 2VYTA 5KCHA 2K3YA 2M0OA 3MP8A 3OYNA 2RO0A 2XK0A 4N4HA 5KE2A 4BACA 2DAQA 3FLGA 3OQ5A 2JTFA 4ZTFA 3LYIA 2RI5A 4IUUA 4IKFA 4BDZA 4IUQA 2GFAA 4PLLA 3E9FA 4IURA 1RI0A 3PFSA 3PMTA 4A4GA 4CRIA 2LTOA 3MP1A 5M9OA 3OY9A 2WACA 3H6ZA 3OMCA 3Q1JA 5FRNA 4A4EA 2IG0A 4QQDA 3QJ6A 3OYMA 3L2UA 2P0KA 4N4GA 3OA6A 4UC4A 3OYIA 5D6XA 3L2VA 2MWPA 2X4WA 3OYEA 2RHXA 3F70A 3LH0A 2GF7A 2QQRA 4B9XA 4ZTJA 3ME9A 3OYFA 3SD4A 4QVZA 4BE1A 5C6SA 2RI3A 2HQXA 1SSFA 5KCOA 2RHZA 4C5IA 3OYJA 3O8VA 2EFIA 3ZEHA 2XDPA 4BE2A 3LLRA 5IAYA 2HQEA 2M16A 5FRMA 4Z02A 2RJCA 3OYDA 2RI2A 2G3RA 2X4XA 4IUPA 5IN1A 2BIVA 3S3NA 3M9QA 2EQMA 3OYBA 4QW2A 2F5KA 4GY5A 1WJQA 2RJDA 2LRQA 3NTIA 4B9WA 4II1A 3OYCA 3META 3L2RA 2MWOA 4PLIA 2R58A 4OVAA 1WJRA 2CKKA 2NLUA 3P8HA 2O4XB 3PNWC 3QKJA 3ASKA 3S6WA 3OYAA 5CIUA 4QQ6A 1OYXA 2LVMA 2R5AA 3OS0A 2X35A 3OB9A 2RJEA 3MEUA 1WGSA 4Q5WA 2O4XA 3DLMA 2EQJA 2X4YA 5D6WA 3PMIA 4C5EA 2BUDA 2GFUA 1MHNA 4QQGA 3L2QA 5J26A 2E6NA 2L8DA 2PQWA 2R5MA 3LGFA 4FL6A 4IUVA 4E7IA 3FEOA 2QQSA 3KUFA 1OZ3A 3OS2A 4C5GA 4EDUA 2FHDA 2RHYA 2LDMA 3DB3A 3OMGA 3C4SA 4A4FA 4A4HA 4E7KA 4L59A 4PL6A 3OYLA 3FC3A 2D9TA 1KHCA 2RHIA 2LCCA 2M1HA 1XNIA 5FROA 3BDLA 2RJFA 5J39A 3OYKA 2JZ2A 4N4IA 2K3XA 4E7JA 2B8AA 3UT1A 3NTHA 2BKDN 2R57A 3S3MA 3MEVA 3MEAA 3L42A 4BDYA 2DIGA 2L3RA 5D6YA 5KH6A 1OZ2A 3L2WA 3QIIA
chains in the Genus database with same CATH superfamily
3HP9A 5IHIA 2H8HA 2E5QA 4ME7A 5C0MA 4Y28E 1Q7YC 3CCUA 2CZ7B 2AIRB 3NGPA 1KQSP 2QQBA 4HCZA 2H3EB 2KAFA 5GMKl 1VQMQ 1VQKT 3OYHA 3GNGA 3VS0A 1U1TA 3G6ET 2K3YA 4F14A 2EYWA 1VQMA 2FPDA 2DAQA 2YT6A 4LUDA 4RG8A 1M1KC 1NEBA 3A8OB 4PLLA 1A0NB 1KHIA 5LJ3e 4CRIA 2A7YA 3H6ZA 3Q1JA 4NOYA 2P4TA 1XQHA 3EGXA 5GANh 2J6KA 3L2UA 3RERA 2NWMA 1FXXA 1NLOC 2H3JA 3TCJA 2GTJA 4R55A 2EYYA 2D8JA 1Y57A 1JRIA 1I4K1 3JCMd 2KXCA 2PUKB 2DRKA 5CQYA 3JCMV 3AT1B 2QAZA 3QO3A 3RDVA 1IZ6A 2JVVA 4ORZA 4F17A 5HY6A 3RMQA 1V1CA 1I81A 1RAEB 3H9NA 3TVTA 3JCMe 2MPXC 1NG2A 2X4YA 3URGA 1VQPT 4TVRA 4LUEA 3EGDB 2MF2A 4LXCA 4CC3A 1KC8R 3RKYA 1TUCA 2ZPEB 1YIJQ 3VU3C 2XICA 1D1CA 1VQ4T 4AFZC 2E4HA 1YIJA 3J7AF 1WYXA 3M0UA 2DE0X 1VUBA 1VQ9T 1H3ZA 2DIQA 3VS2A 1O75A 1WJSA 4ZGEB 2COWA 2VXEA 4E7LA 4X1VA 1YITA 2EIFA 3A1PA 2DD5A 1JQQA 2EJ9A 5HK3A 3LGLA 7AT1B 1Y96A 4M78E 3DB4A 3M0TA 1V76A 1YJNQ 2QDLA 3G1JA 2EVRA 2FG0A 1ZSZC 2QG9B 1GFCA 5L23A 4M7DB 2KMTA 1YJNA 4KRTA 2DFUA 4J83A 1BIBA 5I22A 1KQSA 4CI0C 4AMCA 3A8LB 4M78A 4M77F 5FRNA 1K73U 2JM9A 2DXTA 2K2VA 2RQRA 4NL3A 2BZ8A 2YWWA 1Y71A 2QQRA 4JZ4A 1OPLA 2OTLQ 1M90C 3CBMA 4QVZA 1MV3A 2XU8A 2DL7A 4MZPA 5CKBA 4C5IA 2KXDA 2OTLA 4ZGJB 1UGSB 3ZEHA 3LLRA 1X2QA 1X01A 3J80E 2QTXA 4PJOB 2D0NA 1BI0A 2ZZDA 3PVQA 5GMKi 1UHFA 4Z89A 1OX9A 2DL3A 2GQIA 4O6JA 3ZBDA 1OX8A 3OBYA 2R5AA 4C92G 3U23A 1BYMA 3CCUT 1Z9ZA 3G4SQ 3CCSQ 2X35A 1MNEA 5KYNA 1RADB 2KE9A 3G4SA 3CCSA 2X3WD 2QI2A 3M0RA 4DA4A 4BI4A 2PNIA 3BE3A 2PU9B 2FZCB 1VQMT 3JCMP 2ENMA 3OYKA 5CCAA 1JJ2P 5KYXA 4CC7A 1M3AA 1RLPC 3MHXA 2DYBA 4JRPA 2KEAA 5KYUA 3JCMW 3T9NA 2FYKA 3CBOA 4OGEA 1Q82U 3CCEQ 3EG9A 1KQ2A 2J6FA 1M5Q1 3CCEA 3FDRA 3SWNB 2P0QA 1BI3A 2P0PA 3MP8A 4P5NA 5D7UA 4BACA 3CPFA 5FU7C 3M59A 4ZTFA 2LNVA 1MUZA 2HKNA 3RIRA 1X6GA 2QA4A 1VYVA 2AT1B 3PIPA 1RAIB 2KYMA 2JJ9A 3EHQA 4AFUC 2CZ0B 1LNXA 1SHGA 2QYZA 4N0AA 1VQ8Q 2LT1A 2P0KA 2K3BA 4WF2A 4B9XA 1T3SA 1D1AA 3HHTB 1VQ8A 4DBQA 2FZGB 2HBWA 3GNFB 2ZPIB 5IAYA 1JEGA 1YCYA 3OYDA 2K9GA 2PVGB 2HKQB 1S72Q 1QP2A 1YIJT 1NLPC 4GY5A 4C0DB 1AEYA 2XMFA 3META 1S72A 4EMKA 1QLYA 2V8IA 3GF5A 4VUBA 4M78F 3OB9A 2RJEA 3C94A 1YITT 3THKA 2EGEA 4J9HA 3PMIA 1JJ2S 2DK3A 2V8JA 4PK4A 4FYYB 1ABQA 2R5MA 4IUVA 5CAIA 4DEXA 3HRTA 4C5GA 1H92A 1PSEA 2IIMA 1WHGA 1YJNT 2CP7A 2M02A 4HVWA 3VRZA 4A54A 1UJ0A 3MEVA 4J5YA 2DIGA 3JCMQ 3DLLA 1KC8U 4OP0A 1Q7YR 4LDXA 4X34A 4L5GA 4EMHA 3QBYA 4C8QC 1JJ2A 1NM7A 4M7AA 2OTLT 3RMSA 1Y07A 2NUPA 3E9GA 1RLQC 2EKOA 3CQTA 2VYTA 2CSQA 1UGVA 2LQWA 3X20B 4Y91A 2YDLA 4C92B 4J6WA 1ZUYA 1UEBA 2LP5A 1YFNA 1KK7A 4F7UA 1I0CA 1IHVA 2F5TX 1GCQC 2HDAA 2RB6A 1NE8A 3OMCA 1KD1R 1PKSA 4N4GA 2K7AA 1K8AC 3EG1A 3REAB 2DILA 4HCKA 1H8KA 1KJWA 2L0AA 2O9SA 3CCST 1PKTA 2RI3A 4OMQA 1BCOA 5KCOA 2RHZA 5CR2A 1IB8A 3I56Q 2V1RA 2X4XA 3M0QA 1YP5A 1H3HA 2XDBA 3I56A 1WXUA 4OF1A 1EIFA 4II1A 2ZGWA 1K76A 4M75A 4MMKA 3CPWP 1MMNA 1Q95G 1I8FA 2WSCE 2X9HA 2LCSA 1SF9A 2DTIA 3VJPA 2A3LA 1TSFA 2ED0A 2KY9A 5GAOr 2L5QA 3J81E 1VIEA 5I2SA 4XU1A 4C5EA 3E19A 4D6WA 1R77A 3HL8A 2RK1A 3CCET 1K9AA 3FIFA 2YUQA 2HEQA 4RUGA 2RHYA 1UE9A 2D9TA 2FVUA 2ZPHB 2QA4T 1KSWA 5GAMg 3MEAA 2RQUA 4OMLA 2KSSA 1ZX6A 3L2WA 5LJ3g 3JB9F 4M77G 2K57A 4K11A 1VQ8T 2KRSA 2RHUA 2FRWA 1LPLA 3MKDA 2MIOA 2JW4A 3QWYA 4PJLA 4OMFB 2YSQA 4DOVA 1S1NA 3EFSA 2GTOA 2X4JA 1S72T 5GAMj 1UB4A 1EX4A 1B3QA 2KNBB 3SEMA 1TUDA 3PFSA 4LN2A 3SDZA 5LJ3j 4J9EA 1UGRB 3TEEA 2D8HA 2RA2A 5GAOp 1PM3A 2ZCFB 3VKIA 3JCMg 5AT1B 2GF7A 3SD4A 3X26B 1AZEA 3CPWS 1B07A 3QDFA 2A28A 1RABB 5LJ5e 4M7AF 4J9BA 3N5BB 3QSUA 2RJCA 1MMAA 1PWTA 4JS5A 4HVVA 4DBRA 2R58A 2ATCB 2JMCA 1QVPA 3QKJA 3PNWC 1B34A 2RN8A 2EYXA 4F7UF 4RCBA 2DBKA 4N0AC 5IHNA 2VGMA 3VUBA 2DRMA 1YWOA 2MK5A 3CPWA 1ARKA 1JXMA 1QWEA 1QMCA 2NUTB 2LCLA 2XDDA 3DB3A 3G7ZA 3OSVA 3OMGA 2YXYA 4DBFA 3M4YA 4RTXA 2RJFA 2YRCA 4JUVA 4EMKC 2K4YA 4M75F 3TSZA 1Q81C 1D1BA 3LH5A 4LDYA 3OS1A 4M77E 3S3OA 2RH2A 3QHSA 2AHJB 1UTIA 3EAEA 4OGCA 2CZ6B 3QG1A 1Y0MA 3E2UA 3RKXA 2RMOA 2JM8A 2YUNA 1Q7YU 4FU6A 4AFSC 5KYWA 4RTYA 1FMWA 2LNHB 1BIAA 3I56T 6AT1B 8ATCB 4ATOA 4BDZA 2HZYA 1G2BA 3CCVA 3PMTA 2LTOA 5M9OA 5GAMd 1IGQA 4QQDA 3V8LA 2HSEB 3L2VA 2FZKB 4M78G 5LJ3d 3OYEA 4C0FA 4LNPA 4M7AC 4IIOA 3OYJA 2M0YA 1MMDA 3BFMA 1KD1U 5GAMe 3C12A 4IIMA 4J6XA 5IN1A 1K1ZA 2O31A 4RCCA 2CZ1B 4M77B 1NPRA 4C0ZA 4KUDK 2I2LA 5J3BA 2EAYA 2LJ1A 5A0GA 4E7SA 4QQ6A 1I5LA 1NPPA 1NZ9A 2CDTA 1G3SA 3MEUA 1WGSA 3RBBB 4X9CA 3PE0A 1YNZA 2L3QA 2CP2A 1MHNA 4JJNK 1UFFA 4BY6C 1IREB 3L2ZA 3FEOA 3VS6A 2HMAA 1JO8A 2DXUA 2QDYB 4A4FA 2G6FX 3EGDA 4PL6A 3FC3A 1QQJA 2QGGA 3VV0A 4N4IA 2K3XA 2R57A 3L42A 4M75C 5I21A 2J05A 5DM7R 1VQNQ 4C8QA 3V7SA 1X75C 1CKAA 2KK4A 4JRQA 2BE9B 1VQNA 1TU0B 1U06A 2ZPGB 2VB6A 3GLXA 2VV5A 4HCCA 4KGXB 3VYHB 2YRVA 2DTOA 4EIKA 3DKMA 2E70A 2E10A 3OYNA 1KQSS 1PSFA 4HXJA 2OAUA 3SB2A 1GCQA 3VS5A 1BI2A 1YITQ 4M7DA 1I5OB 1RI0A 4ESRA 2WACA 1NJIR 2CSIA 2PTKA 1KFZA 1M3CA 1VQ5Q 4ZTJA 3JB9D 3LH0A 2DKGA 1YCSB 3ER0A 3ME9A 3EFOB 1IHWA 3X28B 1X6OA 2XHCA 1VQ5A 1M4ZA 3RNJA 2YRDA 2OAWA 2K2MA 3A5ZB 4YTLA 3S3NA 2SRCA 2KDSA 2EQMA 4BI3A 1W4SA 3OYCA 4PJOA 3V8JA 1K9MR 1D3BB 3JSCA 3UDCA 4RTUA 2LVMA 1ZUUA 1T0JA 1ZBJA 4R0KA 3UA7A 5GAN7 1YI2A 1RUWA 3V8KA 1PRLC 2RQWA 1M2VB 4QQGA 3L2QA 2PVDB 1HJDA 3H0IA 1WFWA 1Q86C 2ECZA 2E6ZA 2LQKA 5EC7A 4M7AD 1KHCA 2X51A 1N8RR 3CCVT 4XQ3A 3TSWA 1K73C 4M78B 2CUDA 2LMJA 2X3XD 2DEUA 3SHWA 4RMOA 1AZGB 2FPEA 3LX7A 1PCXA 1NYGA 3TREA 3PT9A 4A4KA 2OI3A 4FT2A 3NFCA 4BD3A 2M0OA 1C6VX 2V8KA 4ELZC 3SWNA 4X9DA 4XAXB 3MP1A 1WIEA 1N5ZA 5FWCA 4WCIA 4C8QF 1M9SA 2DL5A 4M75D 1QCNA 4BE1A 3HSBA 1UGPB 5C6SA 4F04B 3M4GA 3G71Q 2CT3A 2QA4Q 4RTVA 1RI9A 1OOTA 1NEGA 4HT8A 1VA7A 1ZLMA 2ZPBB 1XJWB 3JB9H 2E64A 3G71A 1G3TA 4MDXA 4JRKA 1BKBA 1BB9A 4WTOB 1K0SA 1TUGB 2DTHA 3GIBA 1BI1A 4BUGA 5KYYB 1G8XA 1UJYA 3P8HA 1SRLA 2O4XB 2DEQA 4CC2A 4M7DF 2J6OA 1VQNT 1Q82C 4RKUE 2LX9A 3KBGA 2P4RA 5ECAA 3RESA 2F2VA 3ZFJA 3CMAQ 1I1JA 4HCBA 1QVFP 4FL6A 1G3YA 3R6NA 4E47A 1Z9QA 1R0CB 3QDRB 3CMAA 1CSKA 2VUBA 1YHQQ 1E6HA 2FHDA 2ZAEA 2LCCA 3JV3A 1IO6A 1VQOA 2CYZB 3FRNA 1QCFA 1YHQA 3PGGA 3UA6A 1JB0E 1I07A 3S3MA 2VGNA 4BDYA 2XI9A 2JS2A 4JJDA 4RTWA 1Q81R 5HKCA 2XD0A 2QTVA 3QIIA 2CUBA 2EJGA 3FJPA 3CC7Q 1RACB 2QQAA 2HD0A 1V29B 2CP5A 3QYHB 4PJNA 3QYGB 3P8DA 4FSSA 4J9DA 3CC7A 1VQ5T 2O2OA 4FT4A 2E3IA 4PNOA 4E2FB 3CCLA 2KBTA 2HSPA 1MNDA 5LJ5g 1HXDA 2L2PA 3NTKA 4J7FA 1AWXA 1WNLA 4M7AE 1M8VA 1AWOA 4AG1C 1AT1B 4J9IA 1GBQA 1UHCA 5GMKj 2GFAA 3CC2T 4KULA 3PIOA 4C92A 3QJ6A 4MZMA 1YI2T 3INZA 4F7UE 2EQIA 4JPBW 4LD9K 1F1BB 4FYVB 3OW2A 3HTRA 4DEYA 2RM4A 5LJ5j 3CCJQ 1BCMA 1NJIU 1M1KR 2VC8A 4Z02A 2RI2A 1PG5B 3I5SA 4PJJA 3KXTA 2D0QB 1JBMA 3CCJA 1WQWA 3NTIA 3M5AA 1W1FA 2JXBA 1KC8C 1QVFS 1PNJA 1WJRA 1YN8A 4M7DC 1BU1A 1FMVA 3ASKA 4J9CA 4M75E 3AHUA 3TQ7P 4Q5WA 2D6FA 3CD6Q 2LJ3A 3QPHA 4ZNXA 3O5ZA 1K9MU 2I0NA 4ELYC 1LJOA 2AKLA 3CD6A 2XKOC 2C0TA 5LJ3f 3A8MB 5DLOA 3QJYA 4RTTA 4BB7A 5GANg 3OYLA 3X25B 3EG3A 4OMOA 1X43A 3RKWA 2MMPA 3ZL7C 3NTHA 1QVFA 2LT4A 3BY7A 2KRMA 4PJOC 3SFMA 2FB7A 2PVOB 3R6OA 2RD1A 3HRSA 1C1AA 4LDUA 1AD5A 2AZVA 2KT8A 1N8RU 3WVEB 5KE3A 3C0CA 4NS5A 4RG2A 2DF6A 4C0GA 1QKWA 1SKUB 2V26A 3G71T 2DLPA 5GANj 1ZA2B 2DX1A 2RO0A 1SPKA 4N4HA 2LQNA 3JCMf 1QVGP 4EMGA 2K5FA 5A0DA 1K0XA 4XTXA 4OMMA 2DL4A 4ZGDB 2O9VA 1WX6A 1GBRA 5FLXE 2EYZA 3CMAT 2RQVA 5A0LA 4FCYA 3O8VA 4J9GA 1UDLA 1TWBA 5GMKe 1VQOT 1YHQT 3M9QA 3OYBA 1MGQA 5LJ5d 1T0HA 2Y90A 3I5RA 3SWNC 2KRNA 1M90R 2HAXA 3OS0A 5GAN6 2VXFA 1BBZA 4C92F 2DETA 2OJ2A 3CC7T 1X2KA 2O01E 1VIFA 1ZSZB 1ZQ1A 4C8QD 5IHKA 5CKHA 3CCLT 3OYYA 2FEIA 1N9RA 5GMKm 4E7IA 1Q86R 3VS4A 2A08A 1OZ3A 4KGVB 4A4HA 3D7SB 1YJWA 5GAOm 1YWPA 2PUOB 3MJXA 2NUTA 4E7JA 2L3PA 2EGAA 4JJCA 1P92A 1RL2A 1OQKA 4C0DC 2KROA 5GAOq 4OB1B 1VQ6A 1KG1A 4M7DD 2EPDA 1QVGS 1DJ7B 3LWIA 2DBMA 1B7TA 2K6DA 4RTZA 1WHJA 1X6BA 4M4ZA 3CCJT 1WXBA 2QGFB 1M3BA 5KE2A 3OQ5A 2MOXA 1W70A 5GANd 4J6YA 3IQLA 2E1HA 4IURA 2CREA 5IXBA 2CH4W 2YUPA 2K5LA 2IG0A 3EH1A 3OA6A 3OYIA 4PJOD 3VUZA 5CQXA 1QVGA 3JB9J 3OYFA 3PVLA 3JAME 5GANe 3JCMX 4XU2A 1GXIE 3CD6T 3HFNA 2YHTA 3E1SA 4ZN1A 2FL7A 2M51A 3CCVQ 4BE2A 2M16A 1FYNA 2BIVA 4MZTA 4OB0B 5HCKA 2DJZA 1E6GA 2E12A 2MWOA 2JMAA 2A0FB 3EG0A 4XTUA 2NLUA 1MV0B 4L6V5 2EKHA 3OYAA 2QK0A 1M1KU 4C92C 2BZYA 1XOVA 1WHKA 1M2OA 4GLKA 4HA8A 1UG1A 1J3TA 4V2SA 3LWHA 1PD1A 5FU7B 3WVDB 1RAGB 1U5SA 1VYTA 3JCMJ 5KYWB 1YJ9Q 1C0MA 1MMGA 2DVJA 2WSFE 2VWFA 4J9FA 5IH2A 1ABOA 3M58A 1YJ9A 5GAOl 5KH6A 4PFPA 4A4GA 3CCQQ 2VVKA 4C8QE 3CCQA 2IPOB 4FM4B 2DM1A 3NHNA 1KD1C 4Y92A 3VYGA 3CBPA 2COZA 2JTEA 2MYSA 1IRXA 1TXQA 5KCHA 2O88A 2XK0A 4IKFA 3LYIA 4IUUA 4XU0A 3EGXB 1FWZA 2RNAA 2CH4A 2LC4A 1WPYA 4A4EA 2AZSA 3CMEQ 2EW3A 4M7DE 3NPFA 3I55Q 3TU4K 2AK5A 3CMEA 1VQLQ 5GAMh 2HQXA 1SRMA 3I55A 1K4US 1X69A 2Y4XA 1QP3A 2DMOA 5LJ3h 1VQLA 4LE9A 3EFOA 2G3RA 1YJWT 4KGZB 1WJQA 2OTJQ 1OV3A 4KUIA 4XK8E 2E41A 1Y7XA 3GP8A 1OPKA 1K8AR 3M54A 3UF4A 1SSHA 2CKKA 3JCMc 4C8QB 2NUZA 2OTJA 3VS1A 4PJOE 1VQ6T 2KQWA 1D3BA 1PHTA 4KBMB 3GPLA 4E7ZA 2DXBA 3X24B 3OBWA 1UUEA 1PD0A 2A36A 1AWJA 5J26A 2E6NA 3LGFA 1UGQB 1M90U 1OULA 1WLPB 1M2VA 3CC2Q 1W6XA 2CP6A 2RHIA 1O9SA 3JCMh 2WSEE 1GRIA 4NL2A 1YI2Q 3CC2A 2QXFA 1IXDA 4JDSA 1IGUA 4ANJA 3JB9G 1Q86U 3CCMT 5D6YA 1GL5A 5I11A 4GBQA 2IVWA 2MI6A 3MP6A 1U3OA 3HFOA 2J06A 2JUFA 2DD4A 1Y96B 3FB9A 2DNUA 3WXMB 1AOJA 1LCKA 3QZ5B 2E5KA 1EFNA 2ROLA 5CKFA 4C5HA 3MO8A 4C92D 1HK9A 2D1XA 1WXTA 3MEWA 4FW2A 3NMZC 4J8OA 1AWWA 3JCMb 1SG5A 2Y4YA 4F16A 1CKBA 1G83A 2HCKA 4QVCA 3E9FA 2EJFA 2QEXT 2K5IA 3OY9A 5DLQE 1H641 1N9SA 3L1AA 2DXCA 3OYMA 5FW9A 5D6XA 2MWPA 4FSXA 1D0YA 1T3LA 1SEMA 4M7AG 2KR3A 1VQ7Q 1TOVA 2GCXA 5FRMA 2RQTA 3M53A 1VQ7A 3OW2P 2F5KA 1YJ9T 4PFOA 4B9WA 3M0PA 9ATCB 4OVAA 1ZUKA 4F7UG 2GBQA 2DA9A 2XG8D 4HKEA 3UATA 5KYYA 4DBHA 3CCQT 2O4XA 3DLMA 4J7IA 4CC4B 2GGRA 2PQWA 2ROTA 3QWXX 3A8GB 2DL8A 2KYBA 5KYXB 3C4SA 4L59A 3OS5A 5FROA 1TS9A 3BDLA 5J39A 3JB9I 4Z88A 3PTAA 2B8AA 3UT1A 1R0BG 1UECA 4M75G 5KYUB 2L3SA 1TTHB 2KVQG 1OZ2A 1PC0A 3I35A 5LJ5f 4JS4A 1R8OB 1G5VA 3EG9B 4M77C 3UWNA 4MMLA 4OMNA 4PFZA 4XTVA 3CMET 4AG2C 4IUTA 2FO0A 5CKDA 4E7HA 3H0HA 1OI1A 1QCOA 2NYSA 5CK9A 1KQ1A 1VQOQ 3I55T 4JRIA 3OYGA 3H8ZA 4QT7A 2KT1A 1VQLT 2L89A 2P84A 3RR6A 2EQKA 2M9UA 4BE0A 4FYXB 2BZXA 4EPCA 5GAN2 1M8MA 3MCAB 2JTMA 3EHRA 5L8RE 4PJOF 3M55A 4A63B 2FPFA 4IUQA 2F69A 4AT1B 2VKNA 1NBEB 3MPUB 2OTJT 3KFVA 2VASA 1YBYA 1HYOA 2CP0A 1JU5C 3CCLQ 4QVDA 2SEMA 4FW1A 4HT9A 2K79A 3OW2S 4UC4A 3REBB 2CP3A 2RHXA 3F70A 4BI8B 4XTYA 4C92E 4QKUA 3CXCP 3M57A 1M1GA 2C0IA 4D8KA 1U1SA 4EMKB 2QASA 3HKSA 2ESWA 1FMKA 4PKCC 4QW2A 4GLMA 3M56A 5CKEA 4XTWA 1HSQA 3QZ9B 2LQ8A 5GJVB 2J7IA 1D0XA 1M1FA 2ED1A 3VS7A 5GAN8 4FYWB 4R56A 5GANf 5FU6B 1D0ZA 3ULRB 4LDVA 3VS3A 2HL3A 1QWFA 4D8DA 2EQJA 2CS7A 2GFUA 4HVUA 1K8AU 1D09B 2RF0A 2HQHA 2QQSA 4DOWA 3CC4Q 2JNGA 2CGHA 4EDUA 3JRZA 2LDMA 4E7KA 1GFDA 3RUXA 5GAOn 3CC4A 3H41A 3V7RA 1M30A 2A37A 2LX7A 1WHMA 2BKDN 2DPPB 2L3RA 2CT4A 2RPNA 2MAMA 1VYUA 3HRUA 5AYFA 4M7AB 5GAMf 2NUPB 2F2WA 4KH1B 1VOMA 1NJIC 3M0SA 1N27A 5HK0A 1ZSGA 2ABLA 3G4ST 4JLGA 3OSSC 2JS0A 1GCPA 1VQ7T 4MDWA 5GAN5 1SHFA 5CO7A 4F7UB 1WA7A 1WHLA 2JTFA 3CCRQ 3CXCS 2E3HA 4OB3B 1TG0A 3CCRA 3FJ5A 4A53A 4BY6B 1N6AA 3QXEB 1K9MC 2X4WA 2PZ1A 2HL5C 4M78C 1LOJA 1VQKQ 1SSFA 4M77D 2HBPA 2W10A 2DJQA 2EFIA 3G6EQ 2EBPA 2HQEA 4M75B 1VQKA 3HPWA 1WHHA 2XIDA 3G6EA 2RJDA 2LRQA 5FWBA 1AHJB 3CXCA 3EH2A 5GAN3 1E7OA 2B86A 2JT4A 4PLIA 5A2QE 2KGTA 2GNCA 4FIBA 3S6WA 5CIUA 1ZHIA 3VRYA 8AT1B 1OYXA 1BK2A 1N8RC 3BW1A 5CVIA 4PJMA 3EG2A 1W2BP 1HD3A 5GAN4 2L8DA 2Z0WA 4Z8AA 3EFRA 4JLIA 3OS2A 2BTTA 4JZ3A 2DZCA 1ZSZA 1PRMC 2DZ9A 2JZ2A 1G3WA 2EGCA 1WZOA 2C06A 3I9QA 4OB2B 2ZPFB 3QUIA 4E6RA 4LD6A 3GOXA 3UPUA 2RK2A 3A8HB 3CEYA 1VQPQ 3BDUA 2LZ6B 1YJWQ 2LJ0A 4B6MA 1ACMB 3GBQA 1VQPA 2EQUA 3P8BB 2DERA 1VQ4Q 1WI7A 2W0ZA 1ZA1B 4O5VA 1K73R 1OU8A 3FLGA 1VQ4A 1VQ6Q 2RI5A 3H0FA 1VQ9Q 4LDWA 1RAAB 1QKXA 4C8QG 5IT9E 1M27C 1RAFB 1VQ9A 2KI7A 1WQ7A 1Q81U 1RAHB 4KT0E 1WDXA 2AKKA 1QW1A 2FRYA 1U8RA 5GMKh 2DO3A 2MCNA 2DYIA 2QQ9A 3V7CA 2XDPA 1X27A 3C95A 2COYA 5LL6S 4IUPA 3CC4T 1AVZC 5DY9A 3CCMQ 1OU9A 4JJBA 2V1QA 1B34B 4KH0B 2EWNA 2OX7A 5GJWB 3CCMA 4XU3A 1W2BS 3L2RA 1LVKA 4M7DG 2DVEA 1EZZB 4ZN3A 2YUOA 5LJ5h 2JN0A 3A98A 4OMPA 1OEBA 3LW5E 2JOYA 5I2MA 5D6WA 2F2XA 1NYFA 2BUDA 4AFQC 2YLBA 3KUFA 2GQVA 2F1LA 4XTZA 4M78D 1FX7A 2BE7D 2QEXQ 2C0OA 5EG2A 2M1HA 5FU6C 1XNIA 1ZBXA 1TH7A 2YLCA 1JXOA 1Q82R 1XTDA 2HNIA 3EGUA 2QEXA 1W2BA 4PJOG 4M77A 2EYQA 1KIKA 2E65A 3CCRT 3CCUQ 4DQ2A 5IXFA
chains in the Genus database with same CATH topology
3JB9F 2IVWA 2MI6A 2EJGA 3FJPA 3HP9A 3MP6A 2QQAA 3HFOA 4M77G 2HD0A 2E5QA 2JUFA 4ME7A 2DD4A 1V29B 2K57A 1Y96B 3QYHB 4Y28E 5C0MA 3FB9A 1Q7YC 3QYGB 3CCUA 2CZ7B 3WXMB 3P8DA 1VQ8T 3CC7A 2RHUA 3QZ5B 1VQ5T 5CKFA 5LJ3g 4C5HA 3MO8A 2QQBA 4FT4A 4PNOA 4HCZA 4C92D 2KAFA 5GMKl 3CCLA 1HK9A 4OMFB 1N8RU 5LJ5g 1VQKT 3OYHA 1HXDA 4J7FA 3GNGA 3NTKA 4M7AE 1WNLA 3MEWA 4DOVA 1M8VA 3EFSA 1U1TA 3G6ET 2K3YA 2X4JA 4J8OA 1VQMA 2DAQA 1S72T 3JCMb 2Y4YA 5GAMj 1UB4A 4RG8A 5GMKj 1M1KC 2GFAA 3A8OB 4QVCA 4PLLA 1KHIA 2EJFA 3E9FA 3CC2T 4KULA 2QEXT 3PFSA 5LJ3e 3PIOA 4CRIA 5LJ3j 2K5IA 3SDZA 3OY9A 5DLQE 1UGRB 2A7YA 3H6ZA 3Q1JA 4NOYA 2P4TA 1H641 1N9SA 3L1AA 2DXCA 2RA2A 3TEEA 4C92A 5GAOp 3QJ6A 1XQHA 4MZMA 3OYMA 2ZCFB 3INZA 3VKIA 5GANh 3L2UA 4F7UE 1YI2T 5D6XA 3JCMg 2MWPA 3RERA 4FSXA 4LD9K 2GF7A 3SD4A 1FXXA 3X26B 3OW2A 4M7AG 3CPWS 2H3JA 3TCJA 4R55A 5LJ5e 2RM4A 4M7AF 5LJ5j 1JRIA 1NJIU 1I4K1 2GCXA 2VC8A 2RJCA 3N5BB 2RI2A 4Z02A 5FRMA 3QSUA 3M53A 3JCMd 3KXTA 2D0QB 1VQ7A 2PUKB 1JBMA 3CCJA 2F5KA 4JS5A 1WQWA 1YJ9T 3NTIA 3M5AA 5CQYA 3JCMV 4B9WA 1KC8C 3QO3A 1QVFS 1IZ6A 2JVVA 2R58A 4OVAA 1WJRA 3PNWC 3QKJA 1QVPA 4F7UG 4M7DC 3ASKA 1B34A 5HY6A 2XG8D 4HKEA 3RMQA 4F7UF 4M75E 1I81A 3AHUA 4RCBA 3JCMe 4N0AC 3CCQT 4Q5WA 2O4XA 2D6FA 2VGMA 3VUBA 3DLMA 2X4YA 4J7IA 3URGA 3QPHA 1VQPT 4TVRA 3CPWA 1K9MU 2PQWA 4ELYC 2MF2A 1LJOA 3A8GB 3CD6A 2XKOC 2LCLA 5LJ3f 3RKYA 2XDDA 3A8MB 2ZPEB 3DB3A 3G7ZA 3OSVA 3OMGA 5DLOA 3C4SA 3QJYA 3VU3C 2XICA 3M4YA 4L59A 4BB7A 3X25B 5GANg 3OYLA 3OS5A 1VQ4T 3RKWA 5FROA 3BDLA 2RJFA 5J39A 2MMPA 3JB9I 3PTAA 1YIJA 2B8AA 3UT1A 3NTHA 1QVFA 2LT4A 3BY7A 3J7AF 4M75G 4JUVA 4EMKC 2K4YA 4PJOC 3SFMA 1VUBA 4M75F 2KVQG 1OZ2A 1VQ9T 1Q81C 5LJ5f 2FB7A 2PVOB 3R6OA 4JS4A 4LDYA 1R8OB 2RD1A 4M77E 3HRSA 2DIQA 4LDUA 3OS1A 2RH2A 4M77C 3UWNA 3S3OA 3QHSA 4MMLA 1O75A 1WJSA 2AHJB 4ZGEB 4XTVA 3CMET 3EAEA 2VXEA 4IUTA 4OGCA 2CZ6B 5CKDA 4E7HA 1OI1A 5CK9A 3QG1A 4E7LA 1KQ1A 2EIFA 3WVEB 2DD5A 5KE3A 3I55T 1YITA 2EJ9A 4JRIA 5HK3A 4NS5A 3H8ZA 3LGLA 3OYGA 4RG2A 1Y96A 4M78E 3DB4A 3RKXA 4C0GA 2L89A 1VQLT 2EQKA 1Q7YU 4FU6A 3G71T 2M9UA 4BE0A 5GANj 1BIAA 3I56T 4M7DB 4EPCA 2KMTA 5GAN2 1YJNA 2RO0A 4N4HA 3JCMf 3MCAB 2JTMA 5L8RE 4J83A 1BIBA 3M55A 4PJOF 4EMGA 1KQSA 4ATOA 4CI0C 4BDZA 2K5FA 2F69A 4IUQA 3CCVA 5A0DA 2OTJT 3A8LB 4XTXA 3PMTA 1YBYA 4M78A 2LTOA 4M77F 5M9OA 5GAMd 5FRNA 4QVDA 4QQDA 3V8LA 1K73U 4HT9A 2DXTA 2K2VA 3OW2S 4UC4A 4ZGDB 3L2VA 4NL3A 4M78G 2RHXA 3F70A 5LJ3d 4BI8B 1Y71A 2QQRA 3OYEA 4C0FA 4XTYA 4C92E 3CBMA 4QVZA 1M90C 2XU8A 5FLXE 4MZPA 5CKBA 3M57A 4M7AC 1M1GA 3CMAT 4C5IA 5A0LA 3OYJA 2OTLA 4ZGJB 1UGSB 3O8VA 3ZEHA 3LLRA 1X01A 3BFMA 1KD1U 5GAMe 3J80E 3C12A 2QTXA 4J6XA 1U1SA 5IN1A 4EMKB 5GMKe 1VQOT 4PJOB 3HKSA 1YHQT 3M9QA 3OYBA 1BI0A 1MGQA 4PKCC 4QW2A 5LJ5d 3M56A 5CKEA 4XTWA 4RCCA 2ZZDA 5GMKi 2CZ1B 3QZ9B 1NPRA 4M77B 2LQ8A 2Y90A 4C0ZA 3SWNC 4KUDK 2I2LA 1H3ZA 5J3BA 1M1FA 2EAYA 4O6JA 3ZBDA 5A0GA 3OBYA 4QQ6A 5GAN8 2HAXA 2R5AA 4C92G 1BYMA 1I5LA 1NPPA 3OS0A 1VQOA 1NZ9A 4R56A 3CCUT 5GAN6 2X35A 5GANf 1G3SA 3MEUA 2VXFA 5FU6B 1WGSA 4C92F 4LDVA 4X9CA 3CC7T 2EQJA 2O01E 2CS7A 1VIFA 4C8QD 1ZQ1A 2GFUA 1MHNA 3G4SA 3CCSA 5CKHA 2QI2A 4JJNK 4DA4A 3CCLT 4BY6C 3OYYA 1K8AU 1N9RA 1IREB 3L2ZA 3FEOA 2QQSA 4BI4A 4DOWA 5GMKm 4E7IA 1OZ3A 2JNGA 2DXUA 2CGHA 2PU9B 2QDYB 4EDUA 3JRZA 4A4FA 2LDMA 4A4HA 4E7KA 4PL6A 3RUXA 5GAOn 3FC3A 1VQMT 5GAOm 1YJWA 3CC4A 3V7RA 3JCMP 3VV0A 3OYKA 2PUOB 4N4IA 2K3XA 5CCAA 4E7JA 2BKDN 2R57A 3L42A 4M75C 5I21A 2DPPB 3MHXA 5DM7R 2L3RA 2MAMA 4C8QA 3V7SA 1P92A 1RL2A 1X75C 3HRUA 5AYFA 2KK4A 4C0DC 5GAOq 4JRQA 4M7AB 4JRPA 5GAMf 1VQNA 3JCMW 4OB1B 3T9NA 1VQ6A 1KG1A 2FYKA 4M7DD 2ZPGB 3CBOA 4OGEA 1Q82U 1QVGS 1DJ7B 3LWIA 3GLXA 1NJIC 2VV5A 1N27A 5HK0A 4HCCA 1KQ2A 3VYHB 2YRVA 3G4ST 1M5Q1 2DTOA 4JLGA 3OSSC 3CCEA 1VQ7T 3FDRA 3DKMA 2E70A 4MDWA 2P0QA 3SWNB 1BI3A 3CCJT 2P0PA 2E10A 5GAN5 3MP8A 3OYNA 5CO7A 1KQSS 1PSFA 4F7UB 4P5NA 2OAUA 5KE2A 4BACA 3CPFA 3SB2A 5FU7C 3M59A 3OQ5A 2JTFA 2LNVA 4ZTFA 1BI2A 5GANd 4J6YA 3RIRA 3CXCS 2QA4A 4M7DA 3PIPA 2E1HA 4IURA 1RI0A 4OB3B 2WACA 2CZ0B 1LNXA 3CCRA 2K5LA 2IG0A 4A53A 4BY6B 4N0AA 2LT1A 1N6AA 2P0KA 3QXEB 3OA6A 3OYIA 1K9MC 4PJOD 4WF2A 3VUZA 5CQXA 2X4WA 4ZTJA 4B9XA 3JB9D 3LH0A 2DKGA 1QVGA 3ER0A 4M78C 1LOJA 3JB9J 3ME9A 3OYFA 3HHTB 1VQ8A 3JAME 5GANe 3X28B 1X6OA 2XHCA 4XU2A 1SSFA 3JCMX 1M4ZA 4M77D 1VQ5A 2HBPA 3HFNA 3CD6T 1GXIE 2YHTA 3E1SA 4ZN1A 2FL7A 2EFIA 4BE2A 3GNFB 2ZPIB 5IAYA 2HQEA 2M16A 3A5ZB 1YCYA 3OYDA 4YTLA 4M75B 1VQKA 2BIVA 3HPWA 2PVGB 2XIDA 3S3NA 1QP2A 1G5VA 2KDSA 2EQMA 4BI3A 4MZTA 4OB0B 3G6EA 2DJZA 4GY5A 1YIJT 2RJDA 4C0DB 2E12A 2LRQA 1W4SA 1AHJB 3OYCA 3CXCA 3META 1S72A 5GAN3 4EMKA 3V8JA 4PJOA 2MWOA 1D3BB 4PLIA 4XTUA 2NLUA 2V8IA 3JSCA 4L6V5 5A2QE 3S6WA 4FIBA 3OYAA 5CIUA 1ZHIA 3UDCA 1M1KU 3GF5A 1OYXA 2LVMA 4VUBA 1N8RC 4C92C 4M78F 3BW1A 5CVIA 3OB9A 2RJEA 5GAN7 1XOVA 3C94A 1YI2A 1YITT 3V8KA 4GLKA 3PMIA 1JJ2S 2DK3A 2V8JA 4HA8A 4QQGA 3L2QA 5GAN4 2L8DA 2PVDB 2R5MA 4IUVA 4V2SA 3LWHA 5FU7B 5CAIA 3WVDB 3EFRA 4JLIA 3OS2A 3JCMJ 1Q86C 3HRTA 2DZCA 4C5GA 1PSEA 2E6ZA 2LQKA 1YJNT 2WSFE 4M7AD 1KHCA 2DZ9A 2JZ2A 1G3WA 3M58A 1YJ9A 4A54A 3CCVT 3MEVA 5GAOl 4J5YA 4XQ3A 2C06A 2DIGA 1K73C 4M78B 4OB2B 2ZPFB 3JCMQ 5KH6A 3DLLA 3QUIA 4A4GA 1KC8U 4OP0A 4LD6A 3GOXA 4LDXA 4RMOA 3UPUA 4X34A 2RK2A 3A8HB 3CEYA 4L5GA 4C8QE 3BDUA 4EMHA 3QBYA 4C8QC 3CCQA 1JJ2A 4FM4B 3LX7A 4M7AA 1KD1C 2OTLT 1VQPA 3RMSA 1Y07A 2EQUA 3VYGA 3E9GA 3P8BB 3TREA 3CBPA 2EKOA 3PT9A 4A4KA 4FT2A 3NFCA 4O5VA 4BD3A 2VYTA 5KCHA 2M0OA 2XK0A 3X20B 4Y91A 2V8KA 3FLGA 1VQ4A 4IKFA 3LYIA 2RI5A 4IUUA 4ELZC 4C92B 4J6WA 3SWNA 4XU0A 1UEBA 4X9DA 4LDWA 1FWZA 4XAXB 4F7UA 2F5TX 3MP1A 4C8QG 2LC4A 2RB6A 3OMCA 1NE8A 5IT9E 1WPYA 4A4EA 1VQ9A 4C8QF 4M7DE 4N4GA 1WQ7A 1M9SA 4M75D 1Q81U 1K8AC 3TU4K 4KT0E 3CCST 3CMEA 4BE1A 3HSBA 1QW1A 1UGPB 1U8RA 5C6SA 5GAMh 2RI3A 2HQXA 3M4GA 5GMKh 3I55A 5KCOA 2RHZA 2Y4XA 5CR2A 2DO3A 2QQ9A 3V7CA 1QP3A 2XDPA 5LJ3h 1VQLA 4HT8A 3C95A 2ZPBB 2X4XA 2G3RA 4IUPA 5LL6S 3CC4T 1YJWT 5DY9A 3JB9H 2E64A 3G71A 1G3TA 4MDXA 4JRKA 2XDBA 1BKBA 3I56A 1WJQA 1B34B 4OF1A 2DTHA 1EIFA 2EWNA 4II1A 4KUIA 2ZGWA 4XK8E 3GIBA 3CCMA 4M75A 2E41A 4MMKA 4XU3A 3L2RA 1Y7XA 1W2BS 1BI1A 4BUGA 3GP8A 3M54A 4M7DG 1I8FA 2DVEA 2CKKA 3JCMc 3P8HA 2O4XB 4C8QB 2WSCE 4ZN3A 2DEQA 5LJ5h 2OTJA 4M7DF 2JN0A 1VQNT 4PJOE 2DTIA 3VJPA 1Q82C 2A3LA 1VQ6T 2KQWA 1D3BA 4KBMB 4RKUE 3GPLA 2KY9A 5GAOr 2L5QA 2LX9A 3KBGA 3J81E 1VIEA 3RESA 2DXBA 3LW5E 3ZFJA 2JOYA 5I2MA 3X24B 3OBWA 5D6WA 5I2SA 4XU1A 4C5EA 2BUDA 4HCBA 3E19A 5J26A 2E6NA 3LGFA 4D6WA 1UGQB 2YLBA 1G3YA 3HL8A 2RK1A 4FL6A 4E47A 1M90U 3QDRB 3KUFA 2GQVA 3CCET 3CMAA 4XTZA 2VUBA 4M78D 3FIFA 1FX7A 2FHDA 2RHYA 2D9TA 5EG2A 2M1HA 1O9SA 2LCCA 2FVUA 2RHIA 1XNIA 2CYZB 1ZBXA 1TH7A 2WSEE 3FRNA 5FU6C 3JCMh 2YLCA 3PGGA 1YHQA 2ZPHB 4NL2A 2QA4T 1JB0E 1XTDA 2HNIA 2QXFA 5GAMg 2QEXA 1W2BA 3CC2A 3S3MA 4JDSA 4PJOG 3MEAA 2EYQA 4M77A 2VGNA 4BDYA 3JB9G 2XI9A 1Q86U 2XD0A 2E65A 2KSSA 5HKCA 5D6YA 3CCMT 3CCRT 3L2WA 3QIIA 4DQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP6 A;  1H3Z A;  3OS1 A;  4LD6 A;  3GOX A;  2DIQ A;  3S3O A;  2E5Q A;  1G5V A;  3UWN A;  5C0M A;  1WJS A;  4X34 A;  3CEY A;  3EAE A;  3P8D A;  3QBY A;  4IUT A;  4E7H A;  4E7L A;  1OI1 A;  5KE3 A;  2RHU A;  3LX7 A;  4C5H A;  4NS5 A;  3H8Z A;  3LGL A;  3MO8 A;  3OYG A;  4HCZ A;  4RG2 A;  1N27 A;  3DB4 A;  2EQU A;  2L89 A;  2YRV A;  3E9G A;  2EQK A;  2EKO A;  3OYH A;  4FU6 A;  3NTK A;  3FDR A;  3MEW A;  4BE0 A;  4BD3 A;  2VYT A;  5KCH A;  2K3Y A;  2M0O A;  3MP8 A;  3OYN A;  2RO0 A;  2XK0 A;  4N4H A;  5KE2 A;  4BAC A;  2DAQ A;  3FLG A;  3OQ5 A;  2JTF A;  4ZTF A;  3LYI A;  2RI5 A;  4IUU A;  4IKF A;  4BDZ A;  4IUQ A;  2GFA A;  4PLL A;  3E9F A;  4IUR A;  1RI0 A;  3PFS A;  3PMT A;  4A4G A;  4CRI A;  2LTO A;  3MP1 A;  5M9O A;  3OY9 A;  2WAC A;  3H6Z A;  3OMC A;  3Q1J A;  5FRN A;  4A4E A;  2IG0 A;  4QQD A;  3QJ6 A;  3OYM A;  3L2U A;  2P0K A;  4N4G A;  3OA6 A;  4UC4 A;  3OYI A;  5D6X A;  3L2V A;  2MWP A;  2X4W A;  3OYE A;  2RHX A;  3F70 A;  3LH0 A;  2GF7 A;  2QQR A;  4B9X A;  4ZTJ A;  3ME9 A;  3OYF A;  3SD4 A;  4QVZ A;  4BE1 A;  5C6S A;  2RI3 A;  2HQX A;  1SSF A;  5KCO A;  2RHZ A;  4C5I A;  3OYJ A;  3O8V A;  2EFI A;  3ZEH A;  2XDP A;  4BE2 A;  3LLR A;  5IAY A;  2HQE A;  2M16 A;  5FRM A;  4Z02 A;  2RJC A;  3OYD A;  2RI2 A;  2G3R A;  2X4X A;  4IUP A;  5IN1 A;  2BIV A;  3S3N A;  3M9Q A;  2EQM A;  3OYB A;  4QW2 A;  2F5K A;  4GY5 A;  1WJQ A;  2RJD A;  2LRQ A;  3NTI A;  4B9W A;  4II1 A;  3OYC A;  3MET A;  3L2R A;  2MWO A;  4PLI A;  2R58 A;  4OVA A;  1WJR A;  2CKK A;  2NLU A;  3P8H A;  2O4X B;  3PNW C;  3QKJ A;  3ASK A;  3S6W A;  3OYA A;  5CIU A;  4QQ6 A;  1OYX A;  2LVM A;  2R5A A;  3OS0 A;  2X35 A;  3OB9 A;  2RJE A;  3MEU A;  1WGS A;  4Q5W A;  2O4X A;  3DLM A;  2EQJ A;  2X4Y A;  5D6W A;  3PMI A;  4C5E A;  2BUD A;  2GFU A;  1MHN A;  4QQG A;  3L2Q A;  5J26 A;  2E6N A;  2L8D A;  2PQW A;  2R5M A;  3LGF A;  4FL6 A;  4IUV A;  4E7I A;  3FEO A;  2QQS A;  3KUF A;  1OZ3 A;  3OS2 A;  4C5G A;  4EDU A;  2FHD A;  2RHY A;  2LDM A;  3DB3 A;  3OMG A;  3C4S A;  4A4F A;  4A4H A;  4E7K A;  4L59 A;  4PL6 A;  3OYL A;  3FC3 A;  2D9T A;  1KHC A;  2RHI A;  2LCC A;  2M1H A;  1XNI A;  5FRO A;  3BDL A;  2RJF A;  5J39 A;  3OYK A;  2JZ2 A;  4N4I A;  2K3X A;  4E7J A;  2B8A A;  3UT1 A;  3NTH A;  2BKD N;  2R57 A;  3S3M A;  3MEV A;  3MEA A;  3L42 A;  4BDY A;  2DIG A;  2L3R A;  5D6Y A;  5KH6 A;  1OZ2 A;  3L2W A;  3QII A; 
#chains in the Genus database with same CATH topology
 3HP9 A;  5IHI A;  2H8H A;  2E5Q A;  4ME7 A;  5C0M A;  4Y28 E;  1Q7Y C;  3CCU A;  2CZ7 B;  2AIR B;  3NGP A;  1KQS P;  2QQB A;  4HCZ A;  2H3E B;  2KAF A;  5GMK l;  1VQM Q;  1VQK T;  3OYH A;  3GNG A;  3VS0 A;  1U1T A;  3G6E T;  2K3Y A;  4F14 A;  2EYW A;  1VQM A;  2FPD A;  2DAQ A;  2YT6 A;  4LUD A;  4RG8 A;  1M1K C;  1NEB A;  3A8O B;  4PLL A;  1A0N B;  1KHI A;  5LJ3 e;  4CRI A;  2A7Y A;  3H6Z A;  3Q1J A;  4NOY A;  2P4T A;  1XQH A;  3EGX A;  5GAN h;  2J6K A;  3L2U A;  3RER A;  2NWM A;  1FXX A;  1NLO C;  2H3J A;  3TCJ A;  2GTJ A;  4R55 A;  2EYY A;  2D8J A;  1Y57 A;  1JRI A;  1I4K 1;  3JCM d;  2KXC A;  2PUK B;  2DRK A;  5CQY A;  3JCM V;  3AT1 B;  2QAZ A;  3QO3 A;  3RDV A;  1IZ6 A;  2JVV A;  4ORZ A;  4F17 A;  5HY6 A;  3RMQ A;  1V1C A;  1I81 A;  1RAE B;  3H9N A;  3TVT A;  3JCM e;  2MPX C;  1NG2 A;  2X4Y A;  3URG A;  1VQP T;  4TVR A;  4LUE A;  3EGD B;  2MF2 A;  4LXC A;  4CC3 A;  1KC8 R;  3RKY A;  1TUC A;  2ZPE B;  1YIJ Q;  3VU3 C;  2XIC A;  1D1C A;  1VQ4 T;  4AFZ C;  2E4H A;  1YIJ A;  3J7A F;  1WYX A;  3M0U A;  2DE0 X;  1VUB A;  1VQ9 T;  1H3Z A;  2DIQ A;  3VS2 A;  1O75 A;  1WJS A;  4ZGE B;  2COW A;  2VXE A;  4E7L A;  4X1V A;  1YIT A;  2EIF A;  3A1P A;  2DD5 A;  1JQQ A;  2EJ9 A;  5HK3 A;  3LGL A;  7AT1 B;  1Y96 A;  4M78 E;  3DB4 A;  3M0T A;  1V76 A;  1YJN Q;  2QDL A;  3G1J A;  2EVR A;  2FG0 A;  1ZSZ C;  2QG9 B;  1GFC A;  5L23 A;  4M7D B;  2KMT A;  1YJN A;  4KRT A;  2DFU A;  4J83 A;  1BIB A;  5I22 A;  1KQS A;  4CI0 C;  4AMC A;  3A8L B;  4M78 A;  4M77 F;  5FRN A;  1K73 U;  2JM9 A;  2DXT A;  2K2V A;  2RQR A;  4NL3 A;  2BZ8 A;  2YWW A;  1Y71 A;  2QQR A;  4JZ4 A;  1OPL A;  2OTL Q;  1M90 C;  3CBM A;  4QVZ A;  1MV3 A;  2XU8 A;  2DL7 A;  4MZP A;  5CKB A;  4C5I A;  2KXD A;  2OTL A;  4ZGJ B;  1UGS B;  3ZEH A;  3LLR A;  1X2Q A;  1X01 A;  3J80 E;  2QTX A;  4PJO B;  2D0N A;  1BI0 A;  2ZZD A;  3PVQ A;  5GMK i;  1UHF A;  4Z89 A;  1OX9 A;  2DL3 A;  2GQI A;  4O6J A;  3ZBD A;  1OX8 A;  3OBY A;  2R5A A;  4C92 G;  3U23 A;  1BYM A;  3CCU T;  1Z9Z A;  3G4S Q;  3CCS Q;  2X35 A;  1MNE A;  5KYN A;  1RAD B;  2KE9 A;  3G4S A;  3CCS A;  2X3W D;  2QI2 A;  3M0R A;  4DA4 A;  4BI4 A;  2PNI A;  3BE3 A;  2PU9 B;  2FZC B;  1VQM T;  3JCM P;  2ENM A;  3OYK A;  5CCA A;  1JJ2 P;  5KYX A;  4CC7 A;  1M3A A;  1RLP C;  3MHX A;  2DYB A;  4JRP A;  2KEA A;  5KYU A;  3JCM W;  3T9N A;  2FYK A;  3CBO A;  4OGE A;  1Q82 U;  3CCE Q;  3EG9 A;  1KQ2 A;  2J6F A;  1M5Q 1;  3CCE A;  3FDR A;  3SWN B;  2P0Q A;  1BI3 A;  2P0P A;  3MP8 A;  4P5N A;  5D7U A;  4BAC A;  3CPF A;  5FU7 C;  3M59 A;  4ZTF A;  2LNV A;  1MUZ A;  2HKN A;  3RIR A;  1X6G A;  2QA4 A;  1VYV A;  2AT1 B;  3PIP A;  1RAI B;  2KYM A;  2JJ9 A;  3EHQ A;  4AFU C;  2CZ0 B;  1LNX A;  1SHG A;  2QYZ A;  4N0A A;  1VQ8 Q;  2LT1 A;  2P0K A;  2K3B A;  4WF2 A;  4B9X A;  1T3S A;  1D1A A;  3HHT B;  1VQ8 A;  4DBQ A;  2FZG B;  2HBW A;  3GNF B;  2ZPI B;  5IAY A;  1JEG A;  1YCY A;  3OYD A;  2K9G A;  2PVG B;  2HKQ B;  1S72 Q;  1QP2 A;  1YIJ T;  1NLP C;  4GY5 A;  4C0D B;  1AEY A;  2XMF A;  3MET A;  1S72 A;  4EMK A;  1QLY A;  2V8I A;  3GF5 A;  4VUB A;  4M78 F;  3OB9 A;  2RJE A;  3C94 A;  1YIT T;  3THK A;  2EGE A;  4J9H A;  3PMI A;  1JJ2 S;  2DK3 A;  2V8J A;  4PK4 A;  4FYY B;  1ABQ A;  2R5M A;  4IUV A;  5CAI A;  4DEX A;  3HRT A;  4C5G A;  1H92 A;  1PSE A;  2IIM A;  1WHG A;  1YJN T;  2CP7 A;  2M02 A;  4HVW A;  3VRZ A;  4A54 A;  1UJ0 A;  3MEV A;  4J5Y A;  2DIG A;  3JCM Q;  3DLL A;  1KC8 U;  4OP0 A;  1Q7Y R;  4LDX A;  4X34 A;  4L5G A;  4EMH A;  3QBY A;  4C8Q C;  1JJ2 A;  1NM7 A;  4M7A A;  2OTL T;  3RMS A;  1Y07 A;  2NUP A;  3E9G A;  1RLQ C;  2EKO A;  3CQT A;  2VYT A;  2CSQ A;  1UGV A;  2LQW A;  3X20 B;  4Y91 A;  2YDL A;  4C92 B;  4J6W A;  1ZUY A;  1UEB A;  2LP5 A;  1YFN A;  1KK7 A;  4F7U A;  1I0C A;  1IHV A;  2F5T X;  1GCQ C;  2HDA A;  2RB6 A;  1NE8 A;  3OMC A;  1KD1 R;  1PKS A;  4N4G A;  2K7A A;  1K8A C;  3EG1 A;  3REA B;  2DIL A;  4HCK A;  1H8K A;  1KJW A;  2L0A A;  2O9S A;  3CCS T;  1PKT A;  2RI3 A;  4OMQ A;  1BCO A;  5KCO A;  2RHZ A;  5CR2 A;  1IB8 A;  3I56 Q;  2V1R A;  2X4X A;  3M0Q A;  1YP5 A;  1H3H A;  2XDB A;  3I56 A;  1WXU A;  4OF1 A;  1EIF A;  4II1 A;  2ZGW A;  1K76 A;  4M75 A;  4MMK A;  3CPW P;  1MMN A;  1Q95 G;  1I8F A;  2WSC E;  2X9H A;  2LCS A;  1SF9 A;  2DTI A;  3VJP A;  2A3L A;  1TSF A;  2ED0 A;  2KY9 A;  5GAO r;  2L5Q A;  3J81 E;  1VIE A;  5I2S A;  4XU1 A;  4C5E A;  3E19 A;  4D6W A;  1R77 A;  3HL8 A;  2RK1 A;  3CCE T;  1K9A A;  3FIF A;  2YUQ A;  2HEQ A;  4RUG A;  2RHY A;  1UE9 A;  2D9T A;  2FVU A;  2ZPH B;  2QA4 T;  1KSW A;  5GAM g;  3MEA A;  2RQU A;  4OML A;  2KSS A;  1ZX6 A;  3L2W A;  5LJ3 g;  3JB9 F;  4M77 G;  2K57 A;  4K11 A;  1VQ8 T;  2KRS A;  2RHU A;  2FRW A;  1LPL A;  3MKD A;  2MIO A;  2JW4 A;  3QWY A;  4PJL A;  4OMF B;  2YSQ A;  4DOV A;  1S1N A;  3EFS A;  2GTO A;  2X4J A;  1S72 T;  5GAM j;  1UB4 A;  1EX4 A;  1B3Q A;  2KNB B;  3SEM A;  1TUD A;  3PFS A;  4LN2 A;  3SDZ A;  5LJ3 j;  4J9E A;  1UGR B;  3TEE A;  2D8H A;  2RA2 A;  5GAO p;  1PM3 A;  2ZCF B;  3VKI A;  3JCM g;  5AT1 B;  2GF7 A;  3SD4 A;  3X26 B;  1AZE A;  3CPW S;  1B07 A;  3QDF A;  2A28 A;  1RAB B;  5LJ5 e;  4M7A F;  4J9B A;  3N5B B;  3QSU A;  2RJC A;  1MMA A;  1PWT A;  4JS5 A;  4HVV A;  4DBR A;  2R58 A;  2ATC B;  2JMC A;  1QVP A;  3QKJ A;  3PNW C;  1B34 A;  2RN8 A;  2EYX A;  4F7U F;  4RCB A;  2DBK A;  4N0A C;  5IHN A;  2VGM A;  3VUB A;  2DRM A;  1YWO A;  2MK5 A;  3CPW A;  1ARK A;  1JXM A;  1QWE A;  1QMC A;  2NUT B;  2LCL A;  2XDD A;  3DB3 A;  3G7Z A;  3OSV A;  3OMG A;  2YXY A;  4DBF A;  3M4Y A;  4RTX A;  2RJF A;  2YRC A;  4JUV A;  4EMK C;  2K4Y A;  4M75 F;  3TSZ A;  1Q81 C;  1D1B A;  3LH5 A;  4LDY A;  3OS1 A;  4M77 E;  3S3O A;  2RH2 A;  3QHS A;  2AHJ B;  1UTI A;  3EAE A;  4OGC A;  2CZ6 B;  3QG1 A;  1Y0M A;  3E2U A;  3RKX A;  2RMO A;  2JM8 A;  2YUN A;  1Q7Y U;  4FU6 A;  4AFS C;  5KYW A;  4RTY A;  1FMW A;  2LNH B;  1BIA A;  3I56 T;  6AT1 B;  8ATC B;  4ATO A;  4BDZ A;  2HZY A;  1G2B A;  3CCV A;  3PMT A;  2LTO A;  5M9O A;  5GAM d;  1IGQ A;  4QQD A;  3V8L A;  2HSE B;  3L2V A;  2FZK B;  4M78 G;  5LJ3 d;  3OYE A;  4C0F A;  4LNP A;  4M7A C;  4IIO A;  3OYJ A;  2M0Y A;  1MMD A;  3BFM A;  1KD1 U;  5GAM e;  3C12 A;  4IIM A;  4J6X A;  5IN1 A;  1K1Z A;  2O31 A;  4RCC A;  2CZ1 B;  4M77 B;  1NPR A;  4C0Z A;  4KUD K;  2I2L A;  5J3B A;  2EAY A;  2LJ1 A;  5A0G A;  4E7S A;  4QQ6 A;  1I5L A;  1NPP A;  1NZ9 A;  2CDT A;  1G3S A;  3MEU A;  1WGS A;  3RBB B;  4X9C A;  3PE0 A;  1YNZ A;  2L3Q A;  2CP2 A;  1MHN A;  4JJN K;  1UFF A;  4BY6 C;  1IRE B;  3L2Z A;  3FEO A;  3VS6 A;  2HMA A;  1JO8 A;  2DXU A;  2QDY B;  4A4F A;  2G6F X;  3EGD A;  4PL6 A;  3FC3 A;  1QQJ A;  2QGG A;  3VV0 A;  4N4I A;  2K3X A;  2R57 A;  3L42 A;  4M75 C;  5I21 A;  2J05 A;  5DM7 R;  1VQN Q;  4C8Q A;  3V7S A;  1X75 C;  1CKA A;  2KK4 A;  4JRQ A;  2BE9 B;  1VQN A;  1TU0 B;  1U06 A;  2ZPG B;  2VB6 A;  3GLX A;  2VV5 A;  4HCC A;  4KGX B;  3VYH B;  2YRV A;  2DTO A;  4EIK A;  3DKM A;  2E70 A;  2E10 A;  3OYN A;  1KQS S;  1PSF A;  4HXJ A;  2OAU A;  3SB2 A;  1GCQ A;  3VS5 A;  1BI2 A;  1YIT Q;  4M7D A;  1I5O B;  1RI0 A;  4ESR A;  2WAC A;  1NJI R;  2CSI A;  2PTK A;  1KFZ A;  1M3C A;  1VQ5 Q;  4ZTJ A;  3JB9 D;  3LH0 A;  2DKG A;  1YCS B;  3ER0 A;  3ME9 A;  3EFO B;  1IHW A;  3X28 B;  1X6O A;  2XHC A;  1VQ5 A;  1M4Z A;  3RNJ A;  2YRD A;  2OAW A;  2K2M A;  3A5Z B;  4YTL A;  3S3N A;  2SRC A;  2KDS A;  2EQM A;  4BI3 A;  1W4S A;  3OYC A;  4PJO A;  3V8J A;  1K9M R;  1D3B B;  3JSC A;  3UDC A;  4RTU A;  2LVM A;  1ZUU A;  1T0J A;  1ZBJ A;  4R0K A;  3UA7 A;  5GAN 7;  1YI2 A;  1RUW A;  3V8K A;  1PRL C;  2RQW A;  1M2V B;  4QQG A;  3L2Q A;  2PVD B;  1HJD A;  3H0I A;  1WFW A;  1Q86 C;  2ECZ A;  2E6Z A;  2LQK A;  5EC7 A;  4M7A D;  1KHC A;  2X51 A;  1N8R R;  3CCV T;  4XQ3 A;  3TSW A;  1K73 C;  4M78 B;  2CUD A;  2LMJ A;  2X3X D;  2DEU A;  3SHW A;  4RMO A;  1AZG B;  2FPE A;  3LX7 A;  1PCX A;  1NYG A;  3TRE A;  3PT9 A;  4A4K A;  2OI3 A;  4FT2 A;  3NFC A;  4BD3 A;  2M0O A;  1C6V X;  2V8K A;  4ELZ C;  3SWN A;  4X9D A;  4XAX B;  3MP1 A;  1WIE A;  1N5Z A;  5FWC A;  4WCI A;  4C8Q F;  1M9S A;  2DL5 A;  4M75 D;  1QCN A;  4BE1 A;  3HSB A;  1UGP B;  5C6S A;  4F04 B;  3M4G A;  3G71 Q;  2CT3 A;  2QA4 Q;  4RTV A;  1RI9 A;  1OOT A;  1NEG A;  4HT8 A;  1VA7 A;  1ZLM A;  2ZPB B;  1XJW B;  3JB9 H;  2E64 A;  3G71 A;  1G3T A;  4MDX A;  4JRK A;  1BKB A;  1BB9 A;  4WTO B;  1K0S A;  1TUG B;  2DTH A;  3GIB A;  1BI1 A;  4BUG A;  5KYY B;  1G8X A;  1UJY A;  3P8H A;  1SRL A;  2O4X B;  2DEQ A;  4CC2 A;  4M7D F;  2J6O A;  1VQN T;  1Q82 C;  4RKU E;  2LX9 A;  3KBG A;  2P4R A;  5ECA A;  3RES A;  2F2V A;  3ZFJ A;  3CMA Q;  1I1J A;  4HCB A;  1QVF P;  4FL6 A;  1G3Y A;  3R6N A;  4E47 A;  1Z9Q A;  1R0C B;  3QDR B;  3CMA A;  1CSK A;  2VUB A;  1YHQ Q;  1E6H A;  2FHD A;  2ZAE A;  2LCC A;  3JV3 A;  1IO6 A;  1VQO A;  2CYZ B;  3FRN A;  1QCF A;  1YHQ A;  3PGG A;  3UA6 A;  1JB0 E;  1I07 A;  3S3M A;  2VGN A;  4BDY A;  2XI9 A;  2JS2 A;  4JJD A;  4RTW A;  1Q81 R;  5HKC A;  2XD0 A;  2QTV A;  3QII A;  2CUB A;  2EJG A;  3FJP A;  3CC7 Q;  1RAC B;  2QQA A;  2HD0 A;  1V29 B;  2CP5 A;  3QYH B;  4PJN A;  3QYG B;  3P8D A;  4FSS A;  4J9D A;  3CC7 A;  1VQ5 T;  2O2O A;  4FT4 A;  2E3I A;  4PNO A;  4E2F B;  3CCL A;  2KBT A;  2HSP A;  1MND A;  5LJ5 g;  1HXD A;  2L2P A;  3NTK A;  4J7F A;  1AWX A;  1WNL A;  4M7A E;  1M8V A;  1AWO A;  4AG1 C;  1AT1 B;  4J9I A;  1GBQ A;  1UHC A;  5GMK j;  2GFA A;  3CC2 T;  4KUL A;  3PIO A;  4C92 A;  3QJ6 A;  4MZM A;  1YI2 T;  3INZ A;  4F7U E;  2EQI A;  4JPB W;  4LD9 K;  1F1B B;  4FYV B;  3OW2 A;  3HTR A;  4DEY A;  2RM4 A;  5LJ5 j;  3CCJ Q;  1BCM A;  1NJI U;  1M1K R;  2VC8 A;  4Z02 A;  2RI2 A;  1PG5 B;  3I5S A;  4PJJ A;  3KXT A;  2D0Q B;  1JBM A;  3CCJ A;  1WQW A;  3NTI A;  3M5A A;  1W1F A;  2JXB A;  1KC8 C;  1QVF S;  1PNJ A;  1WJR A;  1YN8 A;  4M7D C;  1BU1 A;  1FMV A;  3ASK A;  4J9C A;  4M75 E;  3AHU A;  3TQ7 P;  4Q5W A;  2D6F A;  3CD6 Q;  2LJ3 A;  3QPH A;  4ZNX A;  3O5Z A;  1K9M U;  2I0N A;  4ELY C;  1LJO A;  2AKL A;  3CD6 A;  2XKO C;  2C0T A;  5LJ3 f;  3A8M B;  5DLO A;  3QJY A;  4RTT A;  4BB7 A;  5GAN g;  3OYL A;  3X25 B;  3EG3 A;  4OMO A;  1X43 A;  3RKW A;  2MMP A;  3ZL7 C;  3NTH A;  1QVF A;  2LT4 A;  3BY7 A;  2KRM A;  4PJO C;  3SFM A;  2FB7 A;  2PVO B;  3R6O A;  2RD1 A;  3HRS A;  1C1A A;  4LDU A;  1AD5 A;  2AZV A;  2KT8 A;  1N8R U;  3WVE B;  5KE3 A;  3C0C A;  4NS5 A;  4RG2 A;  2DF6 A;  4C0G A;  1QKW A;  1SKU B;  2V26 A;  3G71 T;  2DLP A;  5GAN j;  1ZA2 B;  2DX1 A;  2RO0 A;  1SPK A;  4N4H A;  2LQN A;  3JCM f;  1QVG P;  4EMG A;  2K5F A;  5A0D A;  1K0X A;  4XTX A;  4OMM A;  2DL4 A;  4ZGD B;  2O9V A;  1WX6 A;  1GBR A;  5FLX E;  2EYZ A;  3CMA T;  2RQV A;  5A0L A;  4FCY A;  3O8V A;  4J9G A;  1UDL A;  1TWB A;  5GMK e;  1VQO T;  1YHQ T;  3M9Q A;  3OYB A;  1MGQ A;  5LJ5 d;  1T0H A;  2Y90 A;  3I5R A;  3SWN C;  2KRN A;  1M90 R;  2HAX A;  3OS0 A;  5GAN 6;  2VXF A;  1BBZ A;  4C92 F;  2DET A;  2OJ2 A;  3CC7 T;  1X2K A;  2O01 E;  1VIF A;  1ZSZ B;  1ZQ1 A;  4C8Q D;  5IHK A;  5CKH A;  3CCL T;  3OYY A;  2FEI A;  1N9R A;  5GMK m;  4E7I A;  1Q86 R;  3VS4 A;  2A08 A;  1OZ3 A;  4KGV B;  4A4H A;  3D7S B;  1YJW A;  5GAO m;  1YWP A;  2PUO B;  3MJX A;  2NUT A;  4E7J A;  2L3P A;  2EGA A;  4JJC A;  1P92 A;  1RL2 A;  1OQK A;  4C0D C;  2KRO A;  5GAO q;  4OB1 B;  1VQ6 A;  1KG1 A;  4M7D D;  2EPD A;  1QVG S;  1DJ7 B;  3LWI A;  2DBM A;  1B7T A;  2K6D A;  4RTZ A;  1WHJ A;  1X6B A;  4M4Z A;  3CCJ T;  1WXB A;  2QGF B;  1M3B A;  5KE2 A;  3OQ5 A;  2MOX A;  1W70 A;  5GAN d;  4J6Y A;  3IQL A;  2E1H A;  4IUR A;  2CRE A;  5IXB A;  2CH4 W;  2YUP A;  2K5L A;  2IG0 A;  3EH1 A;  3OA6 A;  3OYI A;  4PJO D;  3VUZ A;  5CQX A;  1QVG A;  3JB9 J;  3OYF A;  3PVL A;  3JAM E;  5GAN e;  3JCM X;  4XU2 A;  1GXI E;  3CD6 T;  3HFN A;  2YHT A;  3E1S A;  4ZN1 A;  2FL7 A;  2M51 A;  3CCV Q;  4BE2 A;  2M16 A;  1FYN A;  2BIV A;  4MZT A;  4OB0 B;  5HCK A;  2DJZ A;  1E6G A;  2E12 A;  2MWO A;  2JMA A;  2A0F B;  3EG0 A;  4XTU A;  2NLU A;  1MV0 B;  4L6V 5;  2EKH A;  3OYA A;  2QK0 A;  1M1K U;  4C92 C;  2BZY A;  1XOV A;  1WHK A;  1M2O A;  4GLK A;  4HA8 A;  1UG1 A;  1J3T A;  4V2S A;  3LWH A;  1PD1 A;  5FU7 B;  3WVD B;  1RAG B;  1U5S A;  1VYT A;  3JCM J;  5KYW B;  1YJ9 Q;  1C0M A;  1MMG A;  2DVJ A;  2WSF E;  2VWF A;  4J9F A;  5IH2 A;  1ABO A;  3M58 A;  1YJ9 A;  5GAO l;  5KH6 A;  4PFP A;  4A4G A;  3CCQ Q;  2VVK A;  4C8Q E;  3CCQ A;  2IPO B;  4FM4 B;  2DM1 A;  3NHN A;  1KD1 C;  4Y92 A;  3VYG A;  3CBP A;  2COZ A;  2JTE A;  2MYS A;  1IRX A;  1TXQ A;  5KCH A;  2O88 A;  2XK0 A;  4IKF A;  3LYI A;  4IUU A;  4XU0 A;  3EGX B;  1FWZ A;  2RNA A;  2CH4 A;  2LC4 A;  1WPY A;  4A4E A;  2AZS A;  3CME Q;  2EW3 A;  4M7D E;  3NPF A;  3I55 Q;  3TU4 K;  2AK5 A;  3CME A;  1VQL Q;  5GAM h;  2HQX A;  1SRM A;  3I55 A;  1K4U S;  1X69 A;  2Y4X A;  1QP3 A;  2DMO A;  5LJ3 h;  1VQL A;  4LE9 A;  3EFO A;  2G3R A;  1YJW T;  4KGZ B;  1WJQ A;  2OTJ Q;  1OV3 A;  4KUI A;  4XK8 E;  2E41 A;  1Y7X A;  3GP8 A;  1OPK A;  1K8A R;  3M54 A;  3UF4 A;  1SSH A;  2CKK A;  3JCM c;  4C8Q B;  2NUZ A;  2OTJ A;  3VS1 A;  4PJO E;  1VQ6 T;  2KQW A;  1D3B A;  1PHT A;  4KBM B;  3GPL A;  4E7Z A;  2DXB A;  3X24 B;  3OBW A;  1UUE A;  1PD0 A;  2A36 A;  1AWJ A;  5J26 A;  2E6N A;  3LGF A;  1UGQ B;  1M90 U;  1OUL A;  1WLP B;  1M2V A;  3CC2 Q;  1W6X A;  2CP6 A;  2RHI A;  1O9S A;  3JCM h;  2WSE E;  1GRI A;  4NL2 A;  1YI2 Q;  3CC2 A;  2QXF A;  1IXD A;  4JDS A;  1IGU A;  4ANJ A;  3JB9 G;  1Q86 U;  3CCM T;  5D6Y A;  1GL5 A;  5I11 A;  4GBQ A;  2IVW A;  2MI6 A;  3MP6 A;  1U3O A;  3HFO A;  2J06 A;  2JUF A;  2DD4 A;  1Y96 B;  3FB9 A;  2DNU A;  3WXM B;  1AOJ A;  1LCK A;  3QZ5 B;  2E5K A;  1EFN A;  2ROL A;  5CKF A;  4C5H A;  3MO8 A;  4C92 D;  1HK9 A;  2D1X A;  1WXT A;  3MEW A;  4FW2 A;  3NMZ C;  4J8O A;  1AWW A;  3JCM b;  1SG5 A;  2Y4Y A;  4F16 A;  1CKB A;  1G83 A;  2HCK A;  4QVC A;  3E9F A;  2EJF A;  2QEX T;  2K5I A;  3OY9 A;  5DLQ E;  1H64 1;  1N9S A;  3L1A A;  2DXC A;  3OYM A;  5FW9 A;  5D6X A;  2MWP A;  4FSX A;  1D0Y A;  1T3L A;  1SEM A;  4M7A G;  2KR3 A;  1VQ7 Q;  1TOV A;  2GCX A;  5FRM A;  2RQT A;  3M53 A;  1VQ7 A;  3OW2 P;  2F5K A;  1YJ9 T;  4PFO A;  4B9W A;  3M0P A;  9ATC B;  4OVA A;  1ZUK A;  4F7U G;  2GBQ A;  2DA9 A;  2XG8 D;  4HKE A;  3UAT A;  5KYY A;  4DBH A;  3CCQ T;  2O4X A;  3DLM A;  4J7I A;  4CC4 B;  2GGR A;  2PQW A;  2ROT A;  3QWX X;  3A8G B;  2DL8 A;  2KYB A;  5KYX B;  3C4S A;  4L59 A;  3OS5 A;  5FRO A;  1TS9 A;  3BDL A;  5J39 A;  3JB9 I;  4Z88 A;  3PTA A;  2B8A A;  3UT1 A;  1R0B G;  1UEC A;  4M75 G;  5KYU B;  2L3S A;  1TTH B;  2KVQ G;  1OZ2 A;  1PC0 A;  3I35 A;  5LJ5 f;  4JS4 A;  1R8O B;  1G5V A;  3EG9 B;  4M77 C;  3UWN A;  4MML A;  4OMN A;  4PFZ A;  4XTV A;  3CME T;  4AG2 C;  4IUT A;  2FO0 A;  5CKD A;  4E7H A;  3H0H A;  1OI1 A;  1QCO A;  2NYS A;  5CK9 A;  1KQ1 A;  1VQO Q;  3I55 T;  4JRI A;  3OYG A;  3H8Z A;  4QT7 A;  2KT1 A;  1VQL T;  2L89 A;  2P84 A;  3RR6 A;  2EQK A;  2M9U A;  4BE0 A;  4FYX B;  2BZX A;  4EPC A;  5GAN 2;  1M8M A;  3MCA B;  2JTM A;  3EHR A;  5L8R E;  4PJO F;  3M55 A;  4A63 B;  2FPF A;  4IUQ A;  2F69 A;  4AT1 B;  2VKN A;  1NBE B;  3MPU B;  2OTJ T;  3KFV A;  2VAS A;  1YBY A;  1HYO A;  2CP0 A;  1JU5 C;  3CCL Q;  4QVD A;  2SEM A;  4FW1 A;  4HT9 A;  2K79 A;  3OW2 S;  4UC4 A;  3REB B;  2CP3 A;  2RHX A;  3F70 A;  4BI8 B;  4XTY A;  4C92 E;  4QKU A;  3CXC P;  3M57 A;  1M1G A;  2C0I A;  4D8K A;  1U1S A;  4EMK B;  2QAS A;  3HKS A;  2ESW A;  1FMK A;  4PKC C;  4QW2 A;  4GLM A;  3M56 A;  5CKE A;  4XTW A;  1HSQ A;  3QZ9 B;  2LQ8 A;  5GJV B;  2J7I A;  1D0X A;  1M1F A;  2ED1 A;  3VS7 A;  5GAN 8;  4FYW B;  4R56 A;  5GAN f;  5FU6 B;  1D0Z A;  3ULR B;  4LDV A;  3VS3 A;  2HL3 A;  1QWF A;  4D8D A;  2EQJ A;  2CS7 A;  2GFU A;  4HVU A;  1K8A U;  1D09 B;  2RF0 A;  2HQH A;  2QQS A;  4DOW A;  3CC4 Q;  2JNG A;  2CGH A;  4EDU A;  3JRZ A;  2LDM A;  4E7K A;  1GFD A;  3RUX A;  5GAO n;  3CC4 A;  3H41 A;  3V7R A;  1M30 A;  2A37 A;  2LX7 A;  1WHM A;  2BKD N;  2DPP B;  2L3R A;  2CT4 A;  2RPN A;  2MAM A;  1VYU A;  3HRU A;  5AYF A;  4M7A B;  5GAM f;  2NUP B;  2F2W A;  4KH1 B;  1VOM A;  1NJI C;  3M0S A;  1N27 A;  5HK0 A;  1ZSG A;  2ABL A;  3G4S T;  4JLG A;  3OSS C;  2JS0 A;  1GCP A;  1VQ7 T;  4MDW A;  5GAN 5;  1SHF A;  5CO7 A;  4F7U B;  1WA7 A;  1WHL A;  2JTF A;  3CCR Q;  3CXC S;  2E3H A;  4OB3 B;  1TG0 A;  3CCR A;  3FJ5 A;  4A53 A;  4BY6 B;  1N6A A;  3QXE B;  1K9M C;  2X4W A;  2PZ1 A;  2HL5 C;  4M78 C;  1LOJ A;  1VQK Q;  1SSF A;  4M77 D;  2HBP A;  2W10 A;  2DJQ A;  2EFI A;  3G6E Q;  2EBP A;  2HQE A;  4M75 B;  1VQK A;  3HPW A;  1WHH A;  2XID A;  3G6E A;  2RJD A;  2LRQ A;  5FWB A;  1AHJ B;  3CXC A;  3EH2 A;  5GAN 3;  1E7O A;  2B86 A;  2JT4 A;  4PLI A;  5A2Q E;  2KGT A;  2GNC A;  4FIB A;  3S6W A;  5CIU A;  1ZHI A;  3VRY A;  8AT1 B;  1OYX A;  1BK2 A;  1N8R C;  3BW1 A;  5CVI A;  4PJM A;  3EG2 A;  1W2B P;  1HD3 A;  5GAN 4;  2L8D A;  2Z0W A;  4Z8A A;  3EFR A;  4JLI A;  3OS2 A;  2BTT A;  4JZ3 A;  2DZC A;  1ZSZ A;  1PRM C;  2DZ9 A;  2JZ2 A;  1G3W A;  2EGC A;  1WZO A;  2C06 A;  3I9Q A;  4OB2 B;  2ZPF B;  3QUI A;  4E6R A;  4LD6 A;  3GOX A;  3UPU A;  2RK2 A;  3A8H B;  3CEY A;  1VQP Q;  3BDU A;  2LZ6 B;  1YJW Q;  2LJ0 A;  4B6M A;  1ACM B;  3GBQ A;  1VQP A;  2EQU A;  3P8B B;  2DER A;  1VQ4 Q;  1WI7 A;  2W0Z A;  1ZA1 B;  4O5V A;  1K73 R;  1OU8 A;  3FLG A;  1VQ4 A;  1VQ6 Q;  2RI5 A;  3H0F A;  1VQ9 Q;  4LDW A;  1RAA B;  1QKX A;  4C8Q G;  5IT9 E;  1M27 C;  1RAF B;  1VQ9 A;  2KI7 A;  1WQ7 A;  1Q81 U;  1RAH B;  4KT0 E;  1WDX A;  2AKK A;  1QW1 A;  2FRY A;  1U8R A;  5GMK h;  2DO3 A;  2MCN A;  2DYI A;  2QQ9 A;  3V7C A;  2XDP A;  1X27 A;  3C95 A;  2COY A;  5LL6 S;  4IUP A;  3CC4 T;  1AVZ C;  5DY9 A;  3CCM Q;  1OU9 A;  4JJB A;  2V1Q A;  1B34 B;  4KH0 B;  2EWN A;  2OX7 A;  5GJW B;  3CCM A;  4XU3 A;  1W2B S;  3L2R A;  1LVK A;  4M7D G;  2DVE A;  1EZZ B;  4ZN3 A;  2YUO A;  5LJ5 h;  2JN0 A;  3A98 A;  4OMP A;  1OEB A;  3LW5 E;  2JOY A;  5I2M A;  5D6W A;  2F2X A;  1NYF A;  2BUD A;  4AFQ C;  2YLB A;  3KUF A;  2GQV A;  2F1L A;  4XTZ A;  4M78 D;  1FX7 A;  2BE7 D;  2QEX Q;  2C0O A;  5EG2 A;  2M1H A;  5FU6 C;  1XNI A;  1ZBX A;  1TH7 A;  2YLC A;  1JXO A;  1Q82 R;  1XTD A;  2HNI A;  3EGU A;  2QEX A;  1W2B A;  4PJO G;  4M77 A;  2EYQ A;  1KIK A;  2E65 A;  3CCR T;  3CCU Q;  4DQ2 A;  5IXF A; 
#chains in the Genus database with same CATH homology
 3JB9 F;  2IVW A;  2MI6 A;  2EJG A;  3FJP A;  3HP9 A;  3MP6 A;  2QQA A;  3HFO A;  4M77 G;  2HD0 A;  2E5Q A;  2JUF A;  4ME7 A;  2DD4 A;  1V29 B;  2K57 A;  1Y96 B;  3QYH B;  4Y28 E;  5C0M A;  3FB9 A;  1Q7Y C;  3QYG B;  3CCU A;  2CZ7 B;  3WXM B;  3P8D A;  1VQ8 T;  3CC7 A;  2RHU A;  3QZ5 B;  1VQ5 T;  5CKF A;  5LJ3 g;  4C5H A;  3MO8 A;  2QQB A;  4FT4 A;  4PNO A;  4HCZ A;  4C92 D;  2KAF A;  5GMK l;  3CCL A;  1HK9 A;  4OMF B;  1N8R U;  5LJ5 g;  1VQK T;  3OYH A;  1HXD A;  4J7F A;  3GNG A;  3NTK A;  4M7A E;  1WNL A;  3MEW A;  4DOV A;  1M8V A;  3EFS A;  1U1T A;  3G6E T;  2K3Y A;  2X4J A;  4J8O A;  1VQM A;  2DAQ A;  1S72 T;  3JCM b;  2Y4Y A;  5GAM j;  1UB4 A;  4RG8 A;  5GMK j;  1M1K C;  2GFA A;  3A8O B;  4QVC A;  4PLL A;  1KHI A;  2EJF A;  3E9F A;  3CC2 T;  4KUL A;  2QEX T;  3PFS A;  5LJ3 e;  3PIO A;  4CRI A;  5LJ3 j;  2K5I A;  3SDZ A;  3OY9 A;  5DLQ E;  1UGR B;  2A7Y A;  3H6Z A;  3Q1J A;  4NOY A;  2P4T A;  1H64 1;  1N9S A;  3L1A A;  2DXC A;  2RA2 A;  3TEE A;  4C92 A;  5GAO p;  3QJ6 A;  1XQH A;  4MZM A;  3OYM A;  2ZCF B;  3INZ A;  3VKI A;  5GAN h;  3L2U A;  4F7U E;  1YI2 T;  5D6X A;  3JCM g;  2MWP A;  3RER A;  4FSX A;  4LD9 K;  2GF7 A;  3SD4 A;  1FXX A;  3X26 B;  3OW2 A;  4M7A G;  3CPW S;  2H3J A;  3TCJ A;  4R55 A;  5LJ5 e;  2RM4 A;  4M7A F;  5LJ5 j;  1JRI A;  1NJI U;  1I4K 1;  2GCX A;  2VC8 A;  2RJC A;  3N5B B;  2RI2 A;  4Z02 A;  5FRM A;  3QSU A;  3M53 A;  3JCM d;  3KXT A;  2D0Q B;  1VQ7 A;  2PUK B;  1JBM A;  3CCJ A;  2F5K A;  4JS5 A;  1WQW A;  1YJ9 T;  3NTI A;  3M5A A;  5CQY A;  3JCM V;  4B9W A;  1KC8 C;  3QO3 A;  1QVF S;  1IZ6 A;  2JVV A;  2R58 A;  4OVA A;  1WJR A;  3PNW C;  3QKJ A;  1QVP A;  4F7U G;  4M7D C;  3ASK A;  1B34 A;  5HY6 A;  2XG8 D;  4HKE A;  3RMQ A;  4F7U F;  4M75 E;  1I81 A;  3AHU A;  4RCB A;  3JCM e;  4N0A C;  3CCQ T;  4Q5W A;  2O4X A;  2D6F A;  2VGM A;  3VUB A;  3DLM A;  2X4Y A;  4J7I A;  3URG A;  3QPH A;  1VQP T;  4TVR A;  3CPW A;  1K9M U;  2PQW A;  4ELY C;  2MF2 A;  1LJO A;  3A8G B;  3CD6 A;  2XKO C;  2LCL A;  5LJ3 f;  3RKY A;  2XDD A;  3A8M B;  2ZPE B;  3DB3 A;  3G7Z A;  3OSV A;  3OMG A;  5DLO A;  3C4S A;  3QJY A;  3VU3 C;  2XIC A;  3M4Y A;  4L59 A;  4BB7 A;  3X25 B;  5GAN g;  3OYL A;  3OS5 A;  1VQ4 T;  3RKW A;  5FRO A;  3BDL A;  2RJF A;  5J39 A;  2MMP A;  3JB9 I;  3PTA A;  1YIJ A;  2B8A A;  3UT1 A;  3NTH A;  1QVF A;  2LT4 A;  3BY7 A;  3J7A F;  4M75 G;  4JUV A;  4EMK C;  2K4Y A;  4PJO C;  3SFM A;  1VUB A;  4M75 F;  2KVQ G;  1OZ2 A;  1VQ9 T;  1Q81 C;  5LJ5 f;  2FB7 A;  2PVO B;  3R6O A;  4JS4 A;  4LDY A;  1R8O B;  2RD1 A;  4M77 E;  3HRS A;  2DIQ A;  4LDU A;  3OS1 A;  2RH2 A;  4M77 C;  3UWN A;  3S3O A;  3QHS A;  4MML A;  1O75 A;  1WJS A;  2AHJ B;  4ZGE B;  4XTV A;  3CME T;  3EAE A;  2VXE A;  4IUT A;  4OGC A;  2CZ6 B;  5CKD A;  4E7H A;  1OI1 A;  5CK9 A;  3QG1 A;  4E7L A;  1KQ1 A;  2EIF A;  3WVE B;  2DD5 A;  5KE3 A;  3I55 T;  1YIT A;  2EJ9 A;  4JRI A;  5HK3 A;  4NS5 A;  3H8Z A;  3LGL A;  3OYG A;  4RG2 A;  1Y96 A;  4M78 E;  3DB4 A;  3RKX A;  4C0G A;  2L89 A;  1VQL T;  2EQK A;  1Q7Y U;  4FU6 A;  3G71 T;  2M9U A;  4BE0 A;  5GAN j;  1BIA A;  3I56 T;  4M7D B;  4EPC A;  2KMT A;  5GAN 2;  1YJN A;  2RO0 A;  4N4H A;  3JCM f;  3MCA B;  2JTM A;  5L8R E;  4J83 A;  1BIB A;  3M55 A;  4PJO F;  4EMG A;  1KQS A;  4ATO A;  4CI0 C;  4BDZ A;  2K5F A;  2F69 A;  4IUQ A;  3CCV A;  5A0D A;  2OTJ T;  3A8L B;  4XTX A;  3PMT A;  1YBY A;  4M78 A;  2LTO A;  4M77 F;  5M9O A;  5GAM d;  5FRN A;  4QVD A;  4QQD A;  3V8L A;  1K73 U;  4HT9 A;  2DXT A;  2K2V A;  3OW2 S;  4UC4 A;  4ZGD B;  3L2V A;  4NL3 A;  4M78 G;  2RHX A;  3F70 A;  5LJ3 d;  4BI8 B;  1Y71 A;  2QQR A;  3OYE A;  4C0F A;  4XTY A;  4C92 E;  3CBM A;  4QVZ A;  1M90 C;  2XU8 A;  5FLX E;  4MZP A;  5CKB A;  3M57 A;  4M7A C;  1M1G A;  3CMA T;  4C5I A;  5A0L A;  3OYJ A;  2OTL A;  4ZGJ B;  1UGS B;  3O8V A;  3ZEH A;  3LLR A;  1X01 A;  3BFM A;  1KD1 U;  5GAM e;  3J80 E;  3C12 A;  2QTX A;  4J6X A;  1U1S A;  5IN1 A;  4EMK B;  5GMK e;  1VQO T;  4PJO B;  3HKS A;  1YHQ T;  3M9Q A;  3OYB A;  1BI0 A;  1MGQ A;  4PKC C;  4QW2 A;  5LJ5 d;  3M56 A;  5CKE A;  4XTW A;  4RCC A;  2ZZD A;  5GMK i;  2CZ1 B;  3QZ9 B;  1NPR A;  4M77 B;  2LQ8 A;  2Y90 A;  4C0Z A;  3SWN C;  4KUD K;  2I2L A;  1H3Z A;  5J3B A;  1M1F A;  2EAY A;  4O6J A;  3ZBD A;  5A0G A;  3OBY A;  4QQ6 A;  5GAN 8;  2HAX A;  2R5A A;  4C92 G;  1BYM A;  1I5L A;  1NPP A;  3OS0 A;  1VQO A;  1NZ9 A;  4R56 A;  3CCU T;  5GAN 6;  2X35 A;  5GAN f;  1G3S A;  3MEU A;  2VXF A;  5FU6 B;  1WGS A;  4C92 F;  4LDV A;  4X9C A;  3CC7 T;  2EQJ A;  2O01 E;  2CS7 A;  1VIF A;  4C8Q D;  1ZQ1 A;  2GFU A;  1MHN A;  3G4S A;  3CCS A;  5CKH A;  2QI2 A;  4JJN K;  4DA4 A;  3CCL T;  4BY6 C;  3OYY A;  1K8A U;  1N9R A;  1IRE B;  3L2Z A;  3FEO A;  2QQS A;  4BI4 A;  4DOW A;  5GMK m;  4E7I A;  1OZ3 A;  2JNG A;  2DXU A;  2CGH A;  2PU9 B;  2QDY B;  4EDU A;  3JRZ A;  4A4F A;  2LDM A;  4A4H A;  4E7K A;  4PL6 A;  3RUX A;  5GAO n;  3FC3 A;  1VQM T;  5GAO m;  1YJW A;  3CC4 A;  3V7R A;  3JCM P;  3VV0 A;  3OYK A;  2PUO B;  4N4I A;  2K3X A;  5CCA A;  4E7J A;  2BKD N;  2R57 A;  3L42 A;  4M75 C;  5I21 A;  2DPP B;  3MHX A;  5DM7 R;  2L3R A;  2MAM A;  4C8Q A;  3V7S A;  1P92 A;  1RL2 A;  1X75 C;  3HRU A;  5AYF A;  2KK4 A;  4C0D C;  5GAO q;  4JRQ A;  4M7A B;  4JRP A;  5GAM f;  1VQN A;  3JCM W;  4OB1 B;  3T9N A;  1VQ6 A;  1KG1 A;  2FYK A;  4M7D D;  2ZPG B;  3CBO A;  4OGE A;  1Q82 U;  1QVG S;  1DJ7 B;  3LWI A;  3GLX A;  1NJI C;  2VV5 A;  1N27 A;  5HK0 A;  4HCC A;  1KQ2 A;  3VYH B;  2YRV A;  3G4S T;  1M5Q 1;  2DTO A;  4JLG A;  3OSS C;  3CCE A;  1VQ7 T;  3FDR A;  3DKM A;  2E70 A;  4MDW A;  2P0Q A;  3SWN B;  1BI3 A;  3CCJ T;  2P0P A;  2E10 A;  5GAN 5;  3MP8 A;  3OYN A;  5CO7 A;  1KQS S;  1PSF A;  4F7U B;  4P5N A;  2OAU A;  5KE2 A;  4BAC A;  3CPF A;  3SB2 A;  5FU7 C;  3M59 A;  3OQ5 A;  2JTF A;  2LNV A;  4ZTF A;  1BI2 A;  5GAN d;  4J6Y A;  3RIR A;  3CXC S;  2QA4 A;  4M7D A;  3PIP A;  2E1H A;  4IUR A;  1RI0 A;  4OB3 B;  2WAC A;  2CZ0 B;  1LNX A;  3CCR A;  2K5L A;  2IG0 A;  4A53 A;  4BY6 B;  4N0A A;  2LT1 A;  1N6A A;  2P0K A;  3QXE B;  3OA6 A;  3OYI A;  1K9M C;  4PJO D;  4WF2 A;  3VUZ A;  5CQX A;  2X4W A;  4ZTJ A;  4B9X A;  3JB9 D;  3LH0 A;  2DKG A;  1QVG A;  3ER0 A;  4M78 C;  1LOJ A;  3JB9 J;  3ME9 A;  3OYF A;  3HHT B;  1VQ8 A;  3JAM E;  5GAN e;  3X28 B;  1X6O A;  2XHC A;  4XU2 A;  1SSF A;  3JCM X;  1M4Z A;  4M77 D;  1VQ5 A;  2HBP A;  3HFN A;  3CD6 T;  1GXI E;  2YHT A;  3E1S A;  4ZN1 A;  2FL7 A;  2EFI A;  4BE2 A;  3GNF B;  2ZPI B;  5IAY A;  2HQE A;  2M16 A;  3A5Z B;  1YCY A;  3OYD A;  4YTL A;  4M75 B;  1VQK A;  2BIV A;  3HPW A;  2PVG B;  2XID A;  3S3N A;  1QP2 A;  1G5V A;  2KDS A;  2EQM A;  4BI3 A;  4MZT A;  4OB0 B;  3G6E A;  2DJZ A;  4GY5 A;  1YIJ T;  2RJD A;  4C0D B;  2E12 A;  2LRQ A;  1W4S A;  1AHJ B;  3OYC A;  3CXC A;  3MET A;  1S72 A;  5GAN 3;  4EMK A;  3V8J A;  4PJO A;  2MWO A;  1D3B B;  4PLI A;  4XTU A;  2NLU A;  2V8I A;  3JSC A;  4L6V 5;  5A2Q E;  3S6W A;  4FIB A;  3OYA A;  5CIU A;  1ZHI A;  3UDC A;  1M1K U;  3GF5 A;  1OYX A;  2LVM A;  4VUB A;  1N8R C;  4C92 C;  4M78 F;  3BW1 A;  5CVI A;  3OB9 A;  2RJE A;  5GAN 7;  1XOV A;  3C94 A;  1YI2 A;  1YIT T;  3V8K A;  4GLK A;  3PMI A;  1JJ2 S;  2DK3 A;  2V8J A;  4HA8 A;  4QQG A;  3L2Q A;  5GAN 4;  2L8D A;  2PVD B;  2R5M A;  4IUV A;  4V2S A;  3LWH A;  5FU7 B;  5CAI A;  3WVD B;  3EFR A;  4JLI A;  3OS2 A;  3JCM J;  1Q86 C;  3HRT A;  2DZC A;  4C5G A;  1PSE A;  2E6Z A;  2LQK A;  1YJN T;  2WSF E;  4M7A D;  1KHC A;  2DZ9 A;  2JZ2 A;  1G3W A;  3M58 A;  1YJ9 A;  4A54 A;  3CCV T;  3MEV A;  5GAO l;  4J5Y A;  4XQ3 A;  2C06 A;  2DIG A;  1K73 C;  4M78 B;  4OB2 B;  2ZPF B;  3JCM Q;  5KH6 A;  3DLL A;  3QUI A;  4A4G A;  1KC8 U;  4OP0 A;  4LD6 A;  3GOX A;  4LDX A;  4RMO A;  3UPU A;  4X34 A;  2RK2 A;  3A8H B;  3CEY A;  4L5G A;  4C8Q E;  3BDU A;  4EMH A;  3QBY A;  4C8Q C;  3CCQ A;  1JJ2 A;  4FM4 B;  3LX7 A;  4M7A A;  1KD1 C;  2OTL T;  1VQP A;  3RMS A;  1Y07 A;  2EQU A;  3VYG A;  3E9G A;  3P8B B;  3TRE A;  3CBP A;  2EKO A;  3PT9 A;  4A4K A;  4FT2 A;  3NFC A;  4O5V A;  4BD3 A;  2VYT A;  5KCH A;  2M0O A;  2XK0 A;  3X20 B;  4Y91 A;  2V8K A;  3FLG A;  1VQ4 A;  4IKF A;  3LYI A;  2RI5 A;  4IUU A;  4ELZ C;  4C92 B;  4J6W A;  3SWN A;  4XU0 A;  1UEB A;  4X9D A;  4LDW A;  1FWZ A;  4XAX B;  4F7U A;  2F5T X;  3MP1 A;  4C8Q G;  2LC4 A;  2RB6 A;  3OMC A;  1NE8 A;  5IT9 E;  1WPY A;  4A4E A;  1VQ9 A;  4C8Q F;  4M7D E;  4N4G A;  1WQ7 A;  1M9S A;  4M75 D;  1Q81 U;  1K8A C;  3TU4 K;  4KT0 E;  3CCS T;  3CME A;  4BE1 A;  3HSB A;  1QW1 A;  1UGP B;  1U8R A;  5C6S A;  5GAM h;  2RI3 A;  2HQX A;  3M4G A;  5GMK h;  3I55 A;  5KCO A;  2RHZ A;  2Y4X A;  5CR2 A;  2DO3 A;  2QQ9 A;  3V7C A;  1QP3 A;  2XDP A;  5LJ3 h;  1VQL A;  4HT8 A;  3C95 A;  2ZPB B;  2X4X A;  2G3R A;  4IUP A;  5LL6 S;  3CC4 T;  1YJW T;  5DY9 A;  3JB9 H;  2E64 A;  3G71 A;  1G3T A;  4MDX A;  4JRK A;  2XDB A;  1BKB A;  3I56 A;  1WJQ A;  1B34 B;  4OF1 A;  2DTH A;  1EIF A;  2EWN A;  4II1 A;  4KUI A;  2ZGW A;  4XK8 E;  3GIB A;  3CCM A;  4M75 A;  2E41 A;  4MMK A;  4XU3 A;  3L2R A;  1Y7X A;  1W2B S;  1BI1 A;  4BUG A;  3GP8 A;  3M54 A;  4M7D G;  1I8F A;  2DVE A;  2CKK A;  3JCM c;  3P8H A;  2O4X B;  4C8Q B;  2WSC E;  4ZN3 A;  2DEQ A;  5LJ5 h;  2OTJ A;  4M7D F;  2JN0 A;  1VQN T;  4PJO E;  2DTI A;  3VJP A;  1Q82 C;  2A3L A;  1VQ6 T;  2KQW A;  1D3B A;  4KBM B;  4RKU E;  3GPL A;  2KY9 A;  5GAO r;  2L5Q A;  2LX9 A;  3KBG A;  3J81 E;  1VIE A;  3RES A;  2DXB A;  3LW5 E;  3ZFJ A;  2JOY A;  5I2M A;  3X24 B;  3OBW A;  5D6W A;  5I2S A;  4XU1 A;  4C5E A;  2BUD A;  4HCB A;  3E19 A;  5J26 A;  2E6N A;  3LGF A;  4D6W A;  1UGQ B;  2YLB A;  1G3Y A;  3HL8 A;  2RK1 A;  4FL6 A;  4E47 A;  1M90 U;  3QDR B;  3KUF A;  2GQV A;  3CCE T;  3CMA A;  4XTZ A;  2VUB A;  4M78 D;  3FIF A;  1FX7 A;  2FHD A;  2RHY A;  2D9T A;  5EG2 A;  2M1H A;  1O9S A;  2LCC A;  2FVU A;  2RHI A;  1XNI A;  2CYZ B;  1ZBX A;  1TH7 A;  2WSE E;  3FRN A;  5FU6 C;  3JCM h;  2YLC A;  3PGG A;  1YHQ A;  2ZPH B;  4NL2 A;  2QA4 T;  1JB0 E;  1XTD A;  2HNI A;  2QXF A;  5GAM g;  2QEX A;  1W2B A;  3CC2 A;  3S3M A;  4JDS A;  4PJO G;  3MEA A;  2EYQ A;  4M77 A;  2VGN A;  4BDY A;  3JB9 G;  2XI9 A;  1Q86 U;  2XD0 A;  2E65 A;  2KSS A;  5HKC A;  5D6Y A;  3CCM T;  3CCR T;  3L2W A;  3QII A;  4DQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...