3MEVA

Crystal structure of sgf29 in complex with r2ak4me3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
175
structure length
175
Chain Sequence
b'GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 34
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mevA02
4IKFA 1MHNA 3NTKA 3EAEA 3LYIA 2BKDN 4ZTFA 4FU6A 3OYCA 4GY5A 2L89A 2LRQA 2O4XA 3H8ZA 3NTIA 3Q1JA 5M9OA 1RI0A 3OYEA 3KUFA 4BE2A 3S3MA 3LX7A 2FHDA 3C4SA 4C5IA 2EQMA 4A4HA 2M16A 2RJDA 2K3XA 3L2VA 4C5EA 5CIUA 1WJQA 3META 5FRNA 4IUPA 2GFAA 3PFSA 2LCCA 2RHZA 3QJ6A 1WJRA 2DIQA 4BDZA 4ZTJA 4BACA 2M0OA 5KE2A 3LGLA 4A4FA 3FC3A 4IUQA 5KH6A 3ZEHA 4QQ6A 5FROA 3OS1A 3DB4A 4BD3A 3S3OA 2RHUA 3OYIA 4B9XA 2RJFA 5KCOA 4LD6A 4QQGA 1OI1A 4E7KA 3OA6A 3LLRA 4E7LA 3L2UA 1H3ZA 2BUDA 2BIVA 4BE1A 1N27A 2DIGA 4E7IA 2EKOA 1OYXA 2X35A 4B9WA 2EQJA 2DAQA 2L8DA 2XK0A 4N4HA 2O4XB 2QQRA 3S6WA 3LH0A 3OYNA 2LTOA 2D9TA 3QKJA 4E7HA 1XNIA 3UWNA 3DB3A 3OYJA 4QVZA 2RO0A 3NTHA 4IUVA 3FEOA 4N4IA 4FL6A 5D6WA 5IN1A 3ASKA 4N4GA 3F70A 3L2RA 2JTFA 3OS0A 3GOXA 5FRMA 3OYGA 4Q5WA 4A4GA 4PLLA 4OVAA 3MO8A 2YRVA 3MEVA 3L2WA 2X4YA 2R5AA 2WACA 5J39A 4HCZA 4Z02A 3OYKA 2LDMA 3ME9A 2RI5A 3M9QA 3O8VA 3PNWC 4IURA 2RJEA 4UC4A 2PQWA 3FLGA 3MP1A 4QQDA 3OB9A 3P8DA 2RI3A 2QQSA 2RHXA 4X34A 2GF7A 5C0MA 5KCHA 5KE3A 4BDYA 2EQKA 2B8AA 2RHIA 3BDLA 5IAYA 3FDRA 2F5KA 4BE0A 5J26A 5C6SA 2EQUA 2IG0A 2E6NA 3QBYA 5D6XA 2G3RA 1WGSA 3OQ5A 3OY9A 4CRIA 3OYAA 2R57A 2JZ2A 2K3YA 2VYTA 2MWOA 3MEUA 4RG2A 2GFUA 2CKKA 3PMTA 4PLIA 4QW2A 1SSFA 3L2QA 1KHCA 2NLUA 3CEYA 3QIIA 3S3NA 2LVMA 4C5HA 3OYMA 3PMIA 3OYBA 1WJSA 3OMGA 1OZ2A 4C5GA 4E7JA 1G5VA 2HQXA 3LGFA 3MP6A 5D6YA 4A4EA 3H6ZA 1OZ3A 4PL6A 2M1HA 3OMCA 4NS5A 3L42A 2RJCA 3OYDA 2RHYA 4EDUA 2X4XA 3OYFA 3UT1A 3E9FA 3MEAA 2L3RA 3DLMA 4II1A 2X4WA 3MP8A 3OYLA 2HQEA 2R5MA 3SD4A 3OS2A 2MWPA 2EFIA 2XDPA 2P0KA 4IUTA 4L59A 3OYHA 4IUUA 2E5QA 2RI2A 3P8HA 3MEWA 2R58A 3E9GA
chains in the Genus database with same CATH superfamily
4XU3A 1U3OA 2DE0X 4ZGEB 3N5BB 2ROTA 2AK5A 2RB6A 3LX7A 1W70A 4F04B 2H8HA 3L2VA 2FEIA 1AVZC 2LCCA 2RHZA 2OTLQ 1T0HA 2FRYA 1X01A 4ZGJB 4QQ6A 4WCIA 4BD3A 5IT9E 3BFMA 1OV3A 2RJFA 1ZA2B 1O75A 3ZL7C 1YITQ 5GMKj 5GANe 1YIJA 2QQAA 4HVUA 1RAAB 2C0OA 3CC2A 2AKKA 2D9TA 1V29B 1XNIA 2L0AA 2COYA 2JTFA 4LDUA 4OVAA 3EFOA 1Z9QA 2XIDA 5GAMg 4M75C 1WXBA 5IHIA 4LD9K 2KY9A 2KRMA 1NJIU 4F7UA 1GCQC 1WQWA 3O8VA 1DJ7B 1WZOA 2PQWA 1VYVA 2YLCA 1TG0A 1RAGB 2DJQA 2MCNA 2DL3A 4BI3A 1WFWA 1WHLA 2CS7A 2EQUA 1G83A 2X9HA 2W0ZA 2KK4A 2RNAA 1KC8U 1UE9A 1PKSA 1PRLC 5LJ3e 1D1CA 3BDUA 4A63B 2QASA 4M75B 3A5ZB 3KXTA 2HSEB 4FYXB 5KYWA 9ATCB 3H6ZA 3CCMQ 3G71T 2FZKB 2D0NA 1K73R 5GJWB 4EDUA 4DA4A 2RQVA 2GQVA 1WNLA 2GQIA 1QVGA 1KQ1A 2K9GA 4BB7A 3CCJT 5CQXA 1UB4A 1JJ2A 2ZPEB 1X43A 2JM9A 2LT4A 4C0GA 1Q82C 4XTZA 4C5IA 2K5FA 4JPBW 4KH1B 3GP8A 1QCOA 3SWNB 1OX8A 2H3EB 2M0OA 4KUDK 2MI6A 2BZ8A 2O9SA 5CO7A 5HCKA 5GAN5 5AT1B 2E65A 1Q81C 4ZGDB 5KCOA 2KQWA 4LXCA 2A28A 1OI1A 2E41A 2VC8A 3C94A 2OTLA 4C0ZA 1V76A 3V7SA 3M0UA 5GAOp 2CUBA 1HYOA 3OBWA 1Q7YU 3UWNA 1YITA 4N4IA 5CCAA 2F2WA 2YRVA 4JUVA 1AOJA 4KT0E 2RI5A 5GANg 2LJ1A 4OMMA 1Y96B 2L3PA 3FJPA 5LJ5j 1RAIB 1T3SA 1WYXA 2XG8D 3QDRB 4LN2A 2NUTA 2DJZA 5GAOl 3CMET 3CCUT 1RLPC 2CZ0B 3I5RA 1D09B 2JS0A 4F7UG 2R57A 1HJDA 4QW2A 3E19A 2PTKA 2CP2A 2HKQB 1WLPB 2P4RA 3G71Q 5GAOr 4EMKA 1YNZA 2ZPBB 2EGAA 2JTEA 3EGDB 3UPUA 2M1HA 4NS5A 5CKHA 1NPRA 1IHVA 5CKFA 3M4GA 1SRMA 4OGCA 2HQEA 1M1KR 1WX6A 1D1BA 3CCMA 1W2BA 1Q86U 4BY6C 3V7RA 4FU6A 4Z8AA 2DTHA 2YRDA 1NJIC 2V8IA 1LNXA 2KE9A 2M51A 4FW1A 1K9MU 2O01E 4OMFB 5DLOA 1KFZA 2FPFA 1TUDA 4XQ3A 2DYIA 2SRCA 2ATCB 5KYUA 2C0IA 4C8QE 2PNIA 4Y28E 3OYIA 3VKIA 2KEAA 2MIOA 2PVDB 2QA4T 2E5KA 2YRCA 4BY6B 2OAWA 3UDCA 3M57A 3PE0A 2SEMA 2MMPA 3HP9A 3CPWS 3J81E 2DILA 4E7HA 3DB3A 1MV0B 3F70A 1PHTA 3OYGA 3X20B 4R56A 2ECZA 2DD4A 2HSPA 1BCMA 1QW1A 2WSCE 4ME7A 2NYSA 3PVLA 3V8KA 3G7ZA 3CMEQ 3CCUQ 2VXEA 1BK2A 4C8QA 1N9RA 1K0SA 3MJXA 3M53A 1E6GA 1QKWA 4C92B 1VQ8Q 2QG9B 3A98A 2G3RA 1WGSA 3PGGA 4JRQA 1SEMA 1ZA1B 4E47A 1B34A 2AHJB 4M7AA 1PM3A 1KG1A 2LJ0A 3EFOB 3OYBA 2E10A 5KYXA 5A0DA 4JLIA 2AKLA 5KYNA 2RA2A 4PL6A 2MPXC 1W1FA 4M78A 5HK0A 1HSQA 3TU4K 4KULA 3CQTA 3G71A 5EC7A 2ENMA 5AYFA 2CH4A 1VYTA 4IKFA 1AT1B 1B07A 2VKNA 4J9IA 2BKDN 3FIFA 1VA7A 1A0NB 2VB6A 4PFZA 5GAMd 2GBQA 1BBZA 4JJDA 1U8RA 4AMCA 4RTZA 4F16A 2IVWA 2MAMA 2B86A 4IIOA 5CIUA 3TREA 2IPOB 5KYWB 2EBPA 3JCMe 3JV3A 4DBQA 3RERA 1I4K1 2C0TA 1D0ZA 3OS1A 3V8JA 1MMNA 3S3OA 1YHQT 1WHMA 1QWEA 2RQTA 1OEBA 1UFFA 1N27A 4M75E 1UJ0A 3OW2P 3FRNA 1N9SA 3NFCA 4FYWB 3M0QA 2QQRA 2JN0A 2QAZA 2LTOA 3MHXA 2VVKA 1J3TA 2OX7A 4QVZA 1JXMA 5LJ5f 1HK9A 4C8QF 2E4HA 2NUPA 2PZ1A 4OB3B 1KSWA 3QJYA 2ABLA 2HL3A 3CXCP 3CCVT 4C8QD 3MP1A 2FRWA 2DEUA 3CXCA 2LC4A 1K73C 2AIRB 2DBMA 4B6MA 3QUIA 2CSQA 2KSSA 3EFSA 3V8LA 2EVRA 1UECA 3CMEA 2VV5A 3CCUA 3OY9A 3QG1A 3J80E 2CDTA 4HKEA 5DY9A 4BUGA 1YP5A 1VQ8A 5FWCA 1KQ2A 3MP6A 3JCMJ 4EMKC 1SHGA 1CKBA 2Y4XA 3OBYA 4GLMA 2JMAA 4J5YA 2LNVA 2O9VA 3VYHB 2O88A 4ESRA 3SD4A 5GAN4 2NUTB 4M7AG 2F2XA 1TXQA 2I0NA 2XHCA 2JS2A 3RMQA 1D3BA 1OPLA 3I55Q 2FVUA 1M90R 2O4XA 4MZPA 2EW3A 1KHIA 1WHGA 4M78G 3C0CA 1QVFP 1O9SA 4PKCC 5I2MA 3SWNA 1YI2T 2A0FB 4AFUC 3VS5A 3OYYA 2NWMA 4IUPA 1RI9A 1YHQQ 5FLXE 4KH0B 1U1TA 5KE2A 1KQSS 2WSEE 3EGXA 5I21A 2LQNA 3M0PA 3HHTB 1VQKT 1B7TA 4E7LA 4QKUA 3GF5A 1IO6A 3UATA 3KBGA 1WIEA 2L8DA 3MPUB 1FYNA 2QQ9A 3JCMg 3M58A 5KYUB 1GCPA 5FRMA 5A2QE 1TUCA 3AT1B 2LX7A 1G3WA 3EGUA 1JBMA 5LJ3d 4ZN3A 4JJNK 2CT3A 1CKAA 2FO0A 1TSFA 2O31A 4QQDA 1VQMT 2K2VA 2RHXA 2K6DA 3VJPA 4M75F 4C8QC 1ABQA 5C0MA 3QZ5B 4BI8B 5IAYA 1UHCA 1M1KC 1X6BA 1Q95G 2YUOA 3GBQA 4N0AA 1LCKA 4M75D 2GTJA 1U1SA 3MEUA 3QIIA 1PNJA 4A54A 4M7AC 2VWFA 2E6ZA 1G5VA 4MMLA 2YDLA 2HD0A 4OP0A 4D6WA 1RL2A 5GMKm 2EJ9A 3VRZA 2QDYB 4PJNA 3H0HA 1U5SA 3MEAA 1YWPA 4M78C 2FL7A 1XJWB 2MWPA 1BI0A 1UGQB 1UGVA 3SB2A 3E9GA 2KR3A 5CR2A 3RR6A 3EG0A 4XTUA 1Q81U 4ZTFA 2C06A 2A37A 1YI2Q 1NM7A 1M8VA 1B34B 3VS2A 4M7AB 3JSCA 4KGVB 2E3HA 1GL5A 2E64A 4JLGA 1K8AR 3BY7A 2M16A 1LPLA 3WXMB 2DERA 3QYGB 5KYXB 4F17A 1N8RR 1TU0B 5CVIA 3I55A 1R8OB 4GLKA 1I5LA 2FPDA 4M78B 4XU2A 3HFNA 2X51A 5GMKi 2G6FX 1YHQA 1N6AA 4BE1A 2EKOA 4HT8A 4KBMB 2DVJA 3RKXA 4M77A 2E12A 3I5SA 4F7UE 1PSFA 4K11A 2V8KA 5LJ5g 3EG3A 4YTLA 1RAHB 3GOXA 1NEBA 4A4GA 1GBQA 2XI9A 5CQYA 5KYYA 4PNOA 1VQLQ 2HBPA 2WACA 5J39A 4HCZA 2RM4A 3E2UA 3A8OB 4IURA 3JCMX 3RDVA 2LJ3A 2YT6A 1Y71A 2DL7A 4DQ2A 1K9AA 2GNCA 4RTUA 1RABB 2EJFA 4C92A 2FYKA 3BDLA 3HFOA 4AFZC 2EQIA 3JCMP 2QEXQ 2GFUA 3OSVA 3L2QA 3CEYA 4KGZB 1C6VX 4C0DC 2NUPB 1M9SA 2J6OA 2DMOA 2RJCA 2XD0A 2MK5A 3OYFA 2L3RA 1AD5A 2P0KA 3CCST 3ULRB 4D8KA 1MHNA 2D1XA 1AZEA 1T0JA 2I2LA 5M9OA 2DEQA 2F5TX 2H3JA 4J83A 2K4YA 3KUFA 2V8JA 3TCJA 3X24B 4FSXA 1V1CA 3I56T 4C0DB 3SWNC 5LJ3h 1ZUKA 2IIMA 4OB0B 1KK7A 4A4KA 4E7ZA 1YI2A 4ZTJA 2LP5A 2J05A 4A4FA 2LCSA 2WSFE 4AG2C 3EFRA 1G3SA 2OAUA 2JUFA 4RG8A 4FCYA 4OMQA 1QCFA 1FMWA 2YUNA 1VQPT 1D3BB 4ATOA 1MV3A 2O4XB 5EG2A 5HKCA 2DNUA 3SEMA 1MNDA 3OYJA 3NMZC 2BE7D 1YJNT 1I5OB 3O5ZA 2V1QA 1NLPC 4XU1A 2CZ6B 3HPWA 5IXFA 2LQKA 4J9CA 5GAN7 4AFSC 3CC4T 2V26A 4RTXA 3EGXB 4M77G 3L1AA 1TS9A 4PJJA 4C92D 1VQLA 5L8RE 2L2PA 2KI7A 2MF2A 2KMTA 2DETA 4BE0A 5J26A 1E6HA 1D0YA 5IXBA 4F7UF 4CC2A 1E7OA 2VGMA 5D6XA 3EH1A 4EMGA 2FZCB 4N0AC 2DO3A 2MWOA 4RG2A 5GJVB 4JS5A 1M30A 5J3BA 1M90C 2NLUA 4J9FA 1H3HA 4C92G 1OZ2A 2RF0A 3PT9A 3VS1A 4XK8E 1OZ3A 4FSSA 3TEEA 2QEXA 3UF4A 1ZBXA 1ABOA 4J9EA 3CCRT 1LJOA 3CCSQ 4II1A 1M3AA 4GBQA 2A08A 4L59A 3JCMd 2R58A 3EAEA 3G6ET 1Y7XA 1QVGS 2KYBA 3CPWP 3P8BB 1PKTA 3I56Q 2AZVA 2DYBA 1X6OA 3GPLA 4BE2A 2CZ7B 2E3IA 1JJ2S 3A1PA 3T9NA 2FHDA 1F1BB 3X28B 2RJDA 5FRNA 4HVVA 4OB2B 1RUWA 4J9HA 4BDZA 2PUOB 3CCJQ 1M1GA 1PSEA 2RH2A 1CSKA 4OMOA 2QXFA 1VQPQ 2K5LA 1VQNT 2XMFA 3U23A 1GXIE 1GBRA 3OA6A 3SDZA 1IHWA 2BUDA 2DLPA 5FU6C 4R55A 1SG5A 4F14A 1K73U 3QKJA 1YJNQ 4MZTA 4M77C 2EAYA 4DEYA 2JW4A 3FEOA 5I22A 4Q5WA 1KD1R 3QSUA 3CC4Q 3MO8A 2XU8A 3KFVA 1VQ6T 4PFOA 3M9QA 3PNWC 3VS0A 3VS6A 3VUZA 2P0QA 1WI7A 3JB9G 2ZPIB 4M7AE 5FU6B 4QT7A 2EIFA 4C92C 2XDBA 1H8KA 2RK2A 1EX4A 3VU3C 4M77B 2DK3A 4M78E 1X2KA 1SSFA 1KHCA 2YSQA 1S72T 5KYYB 3G1JA 4LNPA 4E7JA 3CCRQ 4RTYA 1K8AC 3LGFA 3URGA 2XICA 1G2BA 4Z88A 4AT1B 3JAME 1N8RC 3A8GB 2FG0A 1ZQ1A 3EG1A 3E9FA 2X4WA 1M2OA 3OS2A 2XDPA 3PVQA 3OYHA 3FJ5A 1MMAA 5HY6A 3VRYA 3CCSA 3LYIA 3M0SA 1W2BS 1AWWA 2L5QA 4PK4A 3S3MA 2BZXA 2DRMA 3LH5A 3EG9A 2EQMA 2OTJT 4P5NA 5GMKe 3I56A 5CKDA 2QI2A 1UGPB 1VQNQ 2EPDA 3ZEHA 4RCBA 1Y57A 1BKBA 5I2SA 4PJOA 2CP0A 1W6XA 3CPFA 3L2UA 3CCJA 1ACMB 1VQPA 1PD1A 1ARKA 2DD5A 3VV0A 1M1KU 3TVTA 1BCOA 2QA4Q 1OQKA 2ZPFB 1K4US 1YJNA 3PIOA 1TWBA 4JRPA 1VUBA 4E6RA 4JJBA 4E2FB 3VS7A 2EYXA 2RJEA 1YJ9T 3QZ9B 3CC4A 1AWOA 4LDWA 4KGXB 3OW2A 5KE3A 4MDXA 4C0FA 2DM1A 3CC7T 1M27C 3RESA 3JB9I 1N5ZA 3NGPA 4OF1A 3RBBB 3S3NA 1NG2A 1Y07A 3R6NA 2EYQA 2YXYA 2HQXA 5IH2A 2RD1A 2K57A 1KQSP 4DOWA 1VQ5T 1OULA 1KQSA 2E70A 5LJ3j 1UEBA 4M7AF 3EH2A 3H0IA 1QMCA 3FB9A 2EFIA 2COZA 2D8JA 3M4YA 3CCRA 3E1SA 4J6YA 1IRXA 4B9XA 1BU1A 1OOTA 3HRSA 2ZPGB 7AT1B 1YIJT 3V7CA 1PCXA 3OYCA 4M7AD 1M2VA 4M78F 2K79A 3CC2T 3NTIA 3TQ7P 4HT9A 1I0CA 2OTJQ 1C1AA 2QTVA 2K3XA 5FW9A 4M78D 3META 4Y91A 2Y4YA 3RUXA 1JQQA 3PFSA 1R77A 2DIQA 2K2MA 2PU9B 1JU5C 4BACA 1TTHB 3PTAA 2KROA 4OMNA 1JRIA 5GAMf 1MMGA 3LLRA 3I9QA 1AEYA 3A8LB 1VQNA 1H3ZA 2BIVA 3JCMV 2EQJA 1SKUB 5GANd 1GFDA 1EFNA 1QVFA 5LJ5e 2KBTA 4PJOG 3WVDB 3OS0A 1BIAA 2JJ9A 4QVDA 3MEVA 2DA9A 2KXCA 2F69A 2X4YA 2M02A 4JRIA 1YJ9Q 1R0CB 4HA8A 2CP3A 1NEGA 4UC4A 3GNGA 3OB9A 2QA4A 2RI3A 2DBKA 3H0FA 4X34A 4EIKA 1ZBJA 5GAN3 4BDYA 2B8AA 5GAN2 3CC7Q 1H92A 1SRLA 5GAN8 1X69A 4V2SA 2JZ2A 2Z0WA 4PLIA 3CCVQ 1WJSA 1VQ5Q 2ESWA 2CUDA 2EKHA 2D8HA 2KT1A 3JCMQ 5GAMh 3OYDA 3UT1A 1NBEB 3HTRA 1QWFA 2OI3A 4IUUA 3EHRA 2HMAA 2HKNA 2QGGA 4XTXA 3X26B 4JZ3A 4KUIA 1QKXA 2LQ8A 3H8ZA 1NJIR 4M4ZA 2CZ1B 2DZCA 2HNIA 2HBWA 1UDLA 3CCLT 2DL5A 4A4HA 4OGEA 4C5EA 1FXXA 2CP5A 4J7FA 1SPKA 4OB1B 2OTJA 1KD1C 3RIRA 4ZN1A 4M77E 2RHUA 1KC8R 2ZCFB 2RPNA 3MKDA 4XU0A 3IQLA 1VQ9T 4M7DG 4PJOC 1I1JA 1ZUYA 4PJLA 4VUBA 5GANf 1WQ7A 4B9WA 2RQRA 1PRMC 1I07A 2KAFA 2EYYA 2JOYA 3EG9B 1ZLMA 3LWHA 5FU7C 1PC0A 1QLYA 5IN1A 3JB9H 3M59A 4N4GA 3CD6T 2X3XD 3R6OA 4PLLA 3OS5A 1BI2A 4C92E 1SSHA 1VQKQ 2BZYA 1M90U 2XDDA 4LDYA 3CCET 3RNJA 4PJOB 3LWIA 1BI3A 1YJ9A 3CCMT 2KXDA 2F5KA 1W4SA 5FU7B 4FIBA 4J9DA 3PIPA 1FWZA 1NYGA 3QWXX 5LJ3f 3CC7A 2LVMA 2O2OA 3PMIA 1ZHIA 2YUPA 1X2QA 2ZPHB 3UA7A 1VQMQ 3DLLA 5D6YA 2EGEA 5I11A 4NOYA 3CBPA 2QYZA 3CCVA 1Q7YR 4XTYA 4FW2A 5CK9A 2JXBA 1VQ5A 5GANh 2GCXA 3P8HA 3MEWA 2YWWA 4J8OA 1PD0A 4OMPA 4J6XA 3CCQT 3Q1JA 3CCLQ 1Y0MA 2ED0A 4NL3A 2AT1B 1YCYA 5LL6S 4M7DC 3M56A 1RAEB 1QP3A 5GAOn 2DVEA 3AHUA 4HXJA 1VQ9Q 5A0LA 5FROA 1LOJA 1GRIA 4LD6A 4MZMA 2J06A 1JB0E 4XAXB 1OYXA 1M2VB 2XK0A 3CBOA 2DL4A 2HCKA 3LH0A 1X27A 3X25B 3OYNA 3C12A 3CD6Q 2NUZA 4ANJA 4CC3A 3QXEB 4LE9A 1H641 4M7DB 2RO0A 3ASKA 4RTTA 5FWBA 4ELYC 4ELZC 4FT2A 4LUDA 5DM7R 4IIMA 3CCEQ 2EJGA 3G4ST 1Q86R 3MCAB 4M77F 2EYZA 1NPPA 4Z02A 3OYKA 4HCCA 2FB7A 2W10A 1MMDA 1K9MR 2M0YA 2LNHB 1VQ7T 1K8AU 2CSIA 1TH7A 1AHJB 3VS3A 1VQKA 2LX9A 3D7SB 2CREA 3M0RA 1BB9A 1N8RU 4M77D 1QVGP 3C95A 4RTWA 4L5GA 4E7SA 3L2ZA 3TSWA 1KJWA 1JJ2P 3OYAA 3QHSA 2JM8A 2DTIA 4CI0C 1U06A 2CYZB 4C92F 4L6V5 1MNEA 3OMGA 2J6FA 2YHTA 2GGRA 3OMCA 2FPEA 4Y92A 1M3BA 2K7AA 2CP7A 3J7AF 2M9UA 1VQMA 1P92A 1D0XA 3CCQQ 5CAIA 1ZX6A 1VQ4T 2LRQA 1UG1A 1XTDA 2VGNA 1VIEA 2ZAEA 3JRZA 4WTOB 3C4SA 2KYMA 2F1LA 2VUBA 3HRTA 1G3YA 3RMSA 1Z9ZA 8AT1B 3CCLA 4PFPA 4LDVA 3FC3A 4IUQA 1WXTA 3M5AA 5ECAA 2ZGWA 1X6GA 5GMKl 4FT4A 1NYFA 1G3TA 1YCSB 2PVGB 2DF6A 3SHWA 3REAB 2ED1A 1VQ9A 2VASA 3CPWA 2DAQA 2DXUA 2JT4A 4N4HA 2BE9B 2DL8A 3I35A 1YJWT 2CH4W 3CMAT 3L2RA 1AWXA 1I8FA 3G4SQ 4XTWA 1OU8A 2KGTA 3HRUA 1UUEA 1VQ8T 3CD6A 1ZUUA 2R5AA 5CKEA 1VQ7Q 2JTMA 1JEGA 3JB9F 2L3QA 1QVPA 1M3CA 3P8DA 3HKSA 4DOVA 3CCEA 1R0BG 2GF7A 2DXTA 1AZGB 3QPHA 1ZSZA 3FDRA 5D7UA 1BYMA 5GAMj 3JB9D 3NHNA 1W2BP 3JCMc 3OQ5A 4RUGA 3GNFB 5LJ3g 4HCBA 2K3YA 1WDXA 2YLBA 2COWA 4FYVB 3VS4A 4C5HA 3OYMA 1M8MA 4C5GA 3SFMA 2ZZDA 3BE3A 2D0QB 4RTVA 3ZBDA 5GAOq 3DLMA 2LCLA 2E1HA 1K76A 1VQ4Q 1KC8C 4JRKA 2F2VA 3NTKA 1WHHA 4GY5A 3OYEA 1HXDA 1JO8A 3CCQA 4PJOE 1MGQA 2FZGB 1M5Q1 2QDLA 1WJQA 2DX1A 1HD3A 2GFAA 1WJRA 5GAN6 4D8DA 3JCMf 4J6WA 3LGLA 1MUZA 3G6EQ 5LJ5d 1WXUA 4O6JA 4Z89A 2L3SA 4QQGA 4JDSA 3EHQA 1RACB 4RMOA 4TVRA 1UGRB 1M1FA 2DKGA 2DTOA 1YJWQ 3CMAQ 3A8MB 1YN8A 2RQUA 1K0XA 4FL6A 1PG5B 2X4JA 2CGHA 3L2WA 5L23A 4XTVA 4QVCA 5GMKh 2MYSA 1SF9A 8ATCB 1B3QA 3G4SA 6AT1B 2A7YA 2PUKB 4F7UB 4DEXA 1NE8A 2XKOC 4ORZA 3EG2A 4X9CA 4JZ4A 1Q7YC 5KCHA 1S1NA 1AWJA 4EMHA 1VQ7A 1OX9A 2RHIA 2AZSA 2HEQA 1JXOA 2KDSA 1VQOT 2K3BA 4CRIA 5GANj 1BIBA 3QWYA 1VQ6Q 3PMTA 4BI4A 1TOVA 3QYHB 2KNBB 1NLOC 3DKMA 4J9BA 3JCMh 3INZA 3I55T 1M4ZA 2Y90A 4LUEA 1IB8A 2QGFB 4A4EA 2X3WD 1X75C 4MDWA 3RKWA 1TUGB 3GLXA 3HL8A 4ZNXA 2HAXA 1EZZB 1RADB 3UA6A 2K5IA 4IUTA 2ROLA 3ZFJA 1KD1U 4M7DE 1S72Q 3M54A 4CC7A 1RI0A 2DPPB 1VQ4A 1BI1A 1WA7A 1XOVA 2PVOB 3REBB 3LW5E 2KVQG 1WHJA 2DXBA 4HVWA 1YWOA 4MMKA 1UHFA 2J7IA 5KH6A 4OMLA 3OSSC 1XQHA 3DB4A 1ZSGA 1Q86C 2YUQA 5HK3A 3VUBA 1C0MA 3CBMA 2LZ6B 1QQJA 1K9MC 2RQWA 2DIGA 4E7IA 1IGQA 2X35A 3G6EA 1Q82R 1FMKA 4M7DA 4JJCA 1VIFA 4PJOF 2OJ2A 1UTIA 4WF2A 5D6WA 3RKYA 5IHNA 4M75A 1YJWA 1LVKA 1RAFB 2HL5C 4DBFA 3CMAA 2KT8A 3VYGA 4C8QG 1Q81R 4PJOD 1GCQA 1K1ZA 2LDMA 2KRNA 1FMVA 2HZYA 3QO3A 1OU9A 3ER0A 2QQSA 1VYUA 2HDAA 1VQOQ 3TSZA 2EQKA 1G8XA 5CKBA 4FYYB 3HSBA 2DXCA 2JMCA 1ZSZC 4KRTA 3OW2S 2E6NA 2P0PA 4EPCA 3QDFA 5A0GA 3THKA 2RN8A 4J9GA 5LJ5h 1VOMA 3M55A 1PWTA 4DBRA 2JVVA 4A53A 4EMKB 1VQ6A 3L42A 2EWNA 2X4XA 1WPYA 2LMJA 3CXCS 3OYLA 2R5MA 2LQWA 2E5QA 1ZSZB 2RI2A 1QCNA 4AG1C 2BTTA 1WHKA 2KRSA 3JCMb 1UGSB 4RKUE 2L89A 1OPKA 2QK0A 4JS4A 2EGCA 3BW1A 4HCKA 1S72A 1SHFA 2CT4A 2DZ9A 2RK1A 1EIFA 1FX7A 4O5VA 2A3LA 3QJ6A 2D6FA 1D1AA 2VXFA 1YIJQ 3JCMW 2J6KA 2OTLT 3CC2Q 1NZ9A 2GTOA 5GAMe 1Y96A 2MOXA 4M7DF 3JB9J 4NL2A 2P84A 4E7KA 1GFCA 1IZ6A 1VQLT 3WVEB 3H41A 2JNGA 1YFNA 1YITT 4M7DD 3S6WA 2V1RA 2LT1A 3NPFA 4R0KA 2EYWA 3NTHA 4IUVA 4DBHA 1QVFS 2QTXA 2P4TA 4J7IA 1QP2A 3H9NA 5GAOm 2QEXT 3EGDA 5DLQE 3ME9A 4FM4B 1T3LA 2DFUA 1Q82U 4X1VA 3FLGA 2HQHA 1IREB 3M0TA 4AFQC 4M75G 4C8QB 3GIBA 3A8HB 5C6SA 2IG0A 4RCCA 3QBYA 4PJMA 2VYTA 1KIKA 2CKKA 1VQOA 2CP6A 4LDXA 2A36A 1YBYA 5IHKA 2DRKA 1IXDA 2QQBA 4X9DA 2RHYA 3MP8A 1RLQC 4CC4B 1UJYA 2RMOA 1IGUA 1I81A
chains in the Genus database with same CATH topology
3RMQA 5HY6A 4XU3A 1D3BA 3CCSA 3LYIA 4ZGEB 1VQ4T 2FVUA 2LRQA 2O4XA 4MZPA 3N5BB 1KHIA 1W2BS 4M78G 2L5QA 1XTDA 2RB6A 3S3MA 2VGNA 1VIEA 3JRZA 3LX7A 1O9SA 4PKCC 5I2MA 3SWNA 1YI2T 3C4SA 2EQMA 3L2VA 2VUBA 2OTJT 4P5NA 3HRTA 1G3YA 3RMSA 3OYYA 5GMKe 3CCLA 4IUPA 3I56A 5CKDA 2LCCA 2QI2A 2RHZA 1UGPB 4LDVA 5FLXE 1U1TA 3FC3A 5KE2A 1X01A 4IUQA 3M5AA 3ZEHA 4QQ6A 4RCBA 4ZGJB 1KQSS 2WSEE 4BD3A 2ZGWA 1BKBA 5GMKl 5IT9E 4FT4A 3BFMA 5I21A 2RJFA 5I2SA 1G3TA 4PJOA 2PVGB 3CPFA 1O75A 3HHTB 1VQKT 4E7LA 3L2UA 3GF5A 5GMKj 5GANe 3KBGA 3CCJA 1YIJA 1VQ9A 3CPWA 2QQAA 2DAQA 2DXUA 2L8DA 4N4HA 1VQPA 3CC2A 2D9TA 1V29B 2DD5A 1XNIA 2QQ9A 3VV0A 3JCMg 1YJWT 3M58A 1M1KU 3CMAT 3L2RA 2JTFA 5FRMA 1I8FA 4LDUA 4XTWA 5A2QE 4OVAA 3HRUA 1VQ8T 2ZPFB 2XIDA 5GAMg 4M75C 3CD6A 1YJNA 1G3WA 3PIOA 2R5AA 5CKEA 4LD9K 1JBMA 4JRPA 2KY9A 1VUBA 2JTMA 5LJ3d 4ZN3A 4JJNK 1NJIU 4F7UA 1WQWA 3O8VA 1DJ7B 3JB9F 2RJEA 2PQWA 1YJ9T 1QVPA 3QZ9B 2YLCA 4QQDA 3CC4A 3P8DA 1VQMT 3HKSA 2K2VA 2RHXA 4LDWA 3VJPA 4DOVA 3CCEA 4M75F 2GF7A 4C8QC 5C0MA 2DXTA 4BI3A 3QPHA 3QZ5B 3OW2A 5KE3A 4BI8B 5IAYA 3FDRA 1M1KC 1BYMA 5GAMj 3JB9D 4MDXA 2CS7A 2EQUA 4C0FA 3JCMc 3OQ5A 2KK4A 4N0AA 3CC7T 3GNFB 5LJ3g 4HCBA 4M75D 2K3YA 1KC8U 2YLBA 1U1SA 3MEUA 3RESA 5LJ3e 4OF1A 3JB9I 3BDUA 3QIIA 3S3NA 4M75B 4A54A 4C5HA 3OYMA 3A5ZB 3KXTA 1Y07A 4M7AC 2EYQA 4C5GA 2E6ZA 1G5VA 4MMLA 2HQXA 2ZZDA 3SFMA 2RD1A 2K57A 3H6ZA 2HD0A 4OP0A 4DOWA 4D6WA 1RL2A 3G71T 2D0QB 1VQ5T 5GMKm 2EJ9A 2QDYB 1KQSA 2E70A 4EDUA 3ZBDA 5LJ3j 4DA4A 5GAOq 1UEBA 3MEAA 2GQVA 3DLMA 4M78C 4M7AF 1WNLA 2FL7A 2LCLA 2MWPA 2EFIA 3FB9A 3M4YA 3CCRA 1BI0A 2E1HA 3E1SA 4J6YA 1QVGA 1UGQB 1KQ1A 3SB2A 1KC8C 4BB7A 3E9GA 4JRKA 3HRSA 4B9XA 2ZPGB 5CR2A 3CCJT 3V7CA 1YIJT 3NTKA 4XTUA 5CQXA 1Q81U 1UB4A 4ZTFA 2C06A 3OYCA 4M7AD 4GY5A 2ZPEB 4M78F 1JJ2A 3CC2T 3NTIA 1M8VA 3OYEA 1B34B 2LT4A 4HT9A 4C0GA 1HXDA 1Q82C 4M7AB 3JSCA 3CCQA 2E64A 4JLGA 4XTZA 3BY7A 4C5IA 4PJOE 1MGQA 2M16A 1M5Q1 2K3XA 2K5FA 3GP8A 3WXMB 3QYGB 4M78D 1WJQA 3META 5CVIA 3SWNB 4Y91A 3I55A 1R8OB 4GLKA 2Y4YA 3RUXA 2GFAA 3PFSA 1WJRA 2DIQA 5GAN6 1I5LA 2PU9B 4BACA 3JCMf 2M0OA 4J6WA 3LGLA 4M78B 4KUDK 2MI6A 5CO7A 5LJ5d 3PTAA 5GAN5 4XU2A 1JRIA 2E65A 1Q81C 4ZGDB 5KCOA 4O6JA 2KQWA 5GAMf 4QQGA 3HFNA 1OI1A 2E41A 2VC8A 3C94A 2OTLA 3LLRA 4C0ZA 3A8LB 4JDSA 5GMKi 1YHQA 1N6AA 2BIVA 1VQNA 4BE1A 4RMOA 1H3ZA 4TVRA 3V7SA 1UGRB 1M1FA 2EKOA 3JCMV 2DKGA 2EQJA 5GAOp 2DTOA 4KBMB 4HT8A 5GANd 3RKXA 4M77A 3A8MB 2E12A 3OBWA 4F7UE 1Q7YU 1PSFA 3UWNA 2V8KA 5LJ5g 1QVFA 4YTLA 1YITA 4N4IA 5LJ5e 4FL6A 4PJOG 3WVDB 5CCAA 3GOXA 3OS0A 1BIAA 4A4GA 2X4JA 4QVDA 2CGHA 2XI9A 5CQYA 2YRVA 3MEVA 4PNOA 3L2WA 4XTVA 2F69A 4QVCA 2X4YA 4JUVA 2HBPA 4JRIA 2WACA 5GMKh 5J39A 4HCZA 2RM4A 4HA8A 4KT0E 3A8OB 2RI5A 4IURA 3JCMX 5GANg 1Y96B 4UC4A 3FJPA 3G4SA 3GNGA 2A7YA 2PUKB 5LJ5j 4F7UB 3OB9A 2QA4A 1NE8A 2RI3A 1Y71A 2XKOC 4DQ2A 4X9CA 4X34A 2XG8D 3QDRB 4C92A 2EJFA 2DJZA 5GAOl 5GAN3 3CMET 5KCHA 3CCUT 1Q7YC 4EMHA 1VQ7A 4BDYA 2CZ0B 2B8AA 2FYKA 2RHIA 3BDLA 5GAN2 3HFOA 5GAN8 2KDSA 3JCMP 1VQOT 4CRIA 4F7UG 4V2SA 2R57A 2JZ2A 5GANj 1BIBA 2GFUA 3OSVA 3PMTA 4PLIA 3E19A 4QW2A 4BI4A 3L2QA 3CEYA 3QYHB 1WJSA 3DKMA 3JCMh 5GAOr 3INZA 3I55T 1M4ZA 4C0DC 4EMKA 2Y90A 2ZPBB 4A4EA 1M9SA 1X75C 3UPUA 2M1HA 4MDWA 3RKWA 4NS5A 5CKHA 1NPRA 2RJCA 2XD0A 3GLXA 3JCMQ 5GAMh 3HL8A 3OYDA 5CKFA 3OYFA 3UT1A 3M4GA 2HAXA 2L3RA 4OGCA 2HQEA 2K5IA 2P0KA 4IUTA 3ZFJA 3CCST 1KD1U 4M7DE 4IUUA 3CCMA 3M54A 1MHNA 1W2BA 1Q86U 4BY6C 3V7RA 4FU6A 4XTXA 2DTHA 3X26B 2I2LA 2LQ8A 3H8ZA 4KUIA 5M9OA 2DEQA 4J83A 1NJIC 2F5TX 1RI0A 1LNXA 2H3JA 2CZ1B 2K4YA 2V8IA 2DZCA 3KUFA 2DPPB 2HNIA 2V8JA 2O01E 4OMFB 5DLOA 3TCJA 1K9MU 3X24B 1VQ4A 4FSXA 4XQ3A 1BI1A 3I56T 3CCLT 1XOVA 4A4HA 4OGEA 4C0DB 3SWNC 5LJ3h 2PVOB 4C5EA 3LW5E 2KVQG 4OB0B 1FXXA 4A4KA 1YI2A 4J7FA 2DXBA 4OB1B 4ZTJA 4C8QE 2OTJA 4MMKA 1KD1C 4A4FA 3RIRA 5KH6A 2WSFE 3EFRA 4Y28E 4ZN1A 1G3SA 2OAUA 3OSSC 2JUFA 1XQHA 4M77E 3DB4A 4RG8A 2RHUA 3VKIA 2ZCFB 3OYIA 1Q86C 5HK3A 4XU0A 3VUBA 1VQ9T 3CBMA 2PVDB 2QA4T 4M7DG 1VQPT 4PJOC 4BY6B 3UDCA 1D3BB 3M57A 4VUBA 1K9MC 4E7IA 2DIGA 2X35A 3G6EA 5GANf 1WQ7A 4B9WA 4ATOA 2MMPA 2O4XB 3HP9A 4M7DA 2KAFA 5EG2A 5HKCA 2JOYA 3J81E 3CPWS 4E7HA 1VIFA 3DB3A 4PJOF 3OYJA 3LWHA 4WF2A 5D6WA 5FU7C 5IN1A 3JB9H 3M59A 4N4GA 3F70A 3CD6T 3RKYA 1YJNT 3OYGA 3X20B 3R6OA 4PLLA 3OS5A 1BI2A 4C92E 4M75A 4R56A 1YJWA 2DD4A 4XU1A 3CMAA 2CZ6B 1QW1A 3HPWA 3VYGA 4C8QG 2LQKA 2WSCE 4ME7A 4PJOD 5GAN7 1M90U 3CC4T 2LDMA 2XDDA 4LDYA 4M77G 3V8KA 3CCET 3G7ZA 3QO3A 4PJOB 3L1AA 2VXEA 3ER0A 4C8QA 2QQSA 3LWIA 4C92D 1BI3A 1N9RA 5L8RE 1VQLA 1YJ9A 2EQKA 2MF2A 2KMTA 3M53A 5CKBA 3CCMT 3HSBA 2DXCA 2F5KA 4BE0A 4C92B 5J26A 1W4SA 3OW2S 4F7UF 2E6NA 2P0PA 2VGMA 4EPCA 5D6XA 2G3RA 1WGSA 3PGGA 5FU7B 4JRQA 4FIBA 4EMGA 5A0GA 4N0AC 3PIPA 2DO3A 2MWOA 4RG2A 4E47A 1B34A 4JS5A 1FWZA 5LJ3f 2AHJB 5J3BA 1M90C 2NLUA 4M7AA 3CC7A 2LVMA 1KG1A 3PMIA 1ZHIA 4C92G 3OYBA 5LJ5h 2ZPHB 3M55A 1OZ2A 3DLLA 3PT9A 2E10A 5A0DA 4JLIA 5D6YA 2RA2A 2JVVA 1OZ3A 4PL6A 4XK8E 3TEEA 2QEXA 4A53A 4EMKB 1ZBXA 1VQ6A 3L42A 3CCRT 2EWNA 1LJOA 3CBPA 4M78A 4NOYA 5HK0A 3TU4K 3CCVA 2X4XA 4XTYA 1WPYA 4II1A 4KULA 5CK9A 3OYLA 2R5MA 3CXCS 3G71A 1VQ5A 4L59A 5GANh 2GCXA 2E5QA 2RI2A 3P8HA 3MEWA 5AYFA 3JCMd 4J8OA 2R58A 4IKFA 3EAEA 3JCMb 3G6ET 1Y7XA 1UGSB 2BKDN 3FIFA 1QVGS 4J6XA 3CCQT 3P8BB 2L89A 4RKUE 3Q1JA 5GAMd 1X6OA 4NL3A 3GPLA 4BE2A 2CZ7B 1U8RA 4JS4A 1JJ2S 3T9NA 3BW1A 2FHDA 1S72A 2IVWA 2MAMA 1YCYA 3X28B 2RJDA 5LL6S 4M7DC 3M56A 5CIUA 3TREA 5FRNA 2DZ9A 2RK1A 1EIFA 4OB2B 1QP3A 1FX7A 4O5VA 2A3LA 3QJ6A 3JCMe 4BDZA 2D6FA 2PUOB 2VXFA 2DVEA 5GAOn 3AHUA 1M1GA 1I4K1 1PSEA 3JCMW 3RERA 2RH2A 5A0LA 5FROA 2OTLT 2QXFA 3OS1A 1LOJA 3V8JA 2K5LA 3S3OA 1YHQT 1NZ9A 1VQNT 5GAMe 1Y96A 4M7DF 3JB9J 4NL2A 4LD6A 1GXIE 4E7KA 4MZMA 1IZ6A 3OA6A 3SDZA 3WVEB 1VQLT 1JB0E 2BUDA 1N27A 4M75E 4XAXB 1OYXA 3FRNA 1N9SA 3NFCA 2XK0A 5FU6C 4R55A 2JNGA 2QQRA 1YITT 4M7DD 2JN0A 3CBOA 3S6WA 3LH0A 3X25B 3OYNA 3C12A 2LTOA 3MHXA 1K73U 3QKJA 3QXEB 2LT1A 4MZTA 4M77C 2EAYA 4QVZA 1H641 4M7DB 2RO0A 3NTHA 4IUVA 3FEOA 3ASKA 5LJ5f 1QVFS 4ELYC 1HK9A 2QTXA 4Q5WA 4ELZC 4FT2A 3QSUA 2P4TA 4C8QF 3MO8A 5DM7R 4J7IA 1QP2A 2EJGA 2XU8A 3G4ST 3MCAB 4M77F 4OB3B 5GAOm 1NPPA 3QJYA 4Z02A 3OYKA 5DLQE 3ME9A 2QEXT 2FB7A 4HCCA 3M9QA 3PNWC 1VQ6T 3VUZA 4FM4B 1Q82U 3CCVT 2P0QA 3FLGA 4C8QD 1IREB 3MP1A 1K8AU 3JB9G 1VQ7T 2ZPIB 3CXCA 2LC4A 1AHJB 1TH7A 1VQKA 4M7AE 2LX9A 1K73C 5FU6B 4M77D 1N8RU 2EIFA 3QUIA 4M75G 4C8QB 2KSSA 3C95A 3EFSA 3V8LA 2RK2A 4C92C 2XDBA 3A8HB 3GIBA 5C6SA 3VU3C 4L5GA 2IG0A 4M77B 4RCCA 3CMEA 3QBYA 2VV5A 3L2ZA 3CCUA 3OY9A 2DK3A 3OYAA 3QHSA 4M78E 2VYTA 3QG1A 2DTIA 3J80E 2CKKA 4CI0C 1VQOA 1SSFA 2CYZB 1KHCA 4HKEA 4C92F 5DY9A 1S72T 4L6V5 4BUGA 4LDXA 1VQ8A 3OMGA 4E7JA 1K8AC 1KQ2A 3LGFA 3MP6A 2XICA 3URGA 3JCMJ 4EMKC 2YHTA 3OMCA 1YBYA 2Y4XA 3OBYA 3A8GB 3JAME 1N8RC 2QQBA 1ZQ1A 4X9DA 2RHYA 2LNVA 4J5YA 3J7AF 3E9FA 2M9UA 3VYHB 2X4WA 3MP8A 1VQMA 3SD4A 5GAN4 3OS2A 1P92A 2XDPA 4M7AG 3OYHA 5CAIA 2XHCA 1I81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKF A;  1MHN A;  3NTK A;  3EAE A;  3LYI A;  2BKD N;  4ZTF A;  4FU6 A;  3OYC A;  4GY5 A;  2L89 A;  2LRQ A;  2O4X A;  3H8Z A;  3NTI A;  3Q1J A;  5M9O A;  1RI0 A;  3OYE A;  3KUF A;  4BE2 A;  3S3M A;  3LX7 A;  2FHD A;  3C4S A;  4C5I A;  2EQM A;  4A4H A;  2M16 A;  2RJD A;  2K3X A;  3L2V A;  4C5E A;  5CIU A;  1WJQ A;  3MET A;  5FRN A;  4IUP A;  2GFA A;  3PFS A;  2LCC A;  2RHZ A;  3QJ6 A;  1WJR A;  2DIQ A;  4BDZ A;  4ZTJ A;  4BAC A;  2M0O A;  5KE2 A;  3LGL A;  4A4F A;  3FC3 A;  4IUQ A;  5KH6 A;  3ZEH A;  4QQ6 A;  5FRO A;  3OS1 A;  3DB4 A;  4BD3 A;  3S3O A;  2RHU A;  3OYI A;  4B9X A;  2RJF A;  5KCO A;  4LD6 A;  4QQG A;  1OI1 A;  4E7K A;  3OA6 A;  3LLR A;  4E7L A;  3L2U A;  1H3Z A;  2BUD A;  2BIV A;  4BE1 A;  1N27 A;  2DIG A;  4E7I A;  2EKO A;  1OYX A;  2X35 A;  4B9W A;  2EQJ A;  2DAQ A;  2L8D A;  2XK0 A;  4N4H A;  2O4X B;  2QQR A;  3S6W A;  3LH0 A;  3OYN A;  2LTO A;  2D9T A;  3QKJ A;  4E7H A;  1XNI A;  3UWN A;  3DB3 A;  3OYJ A;  4QVZ A;  2RO0 A;  3NTH A;  4IUV A;  3FEO A;  4N4I A;  4FL6 A;  5D6W A;  5IN1 A;  3ASK A;  4N4G A;  3F70 A;  3L2R A;  2JTF A;  3OS0 A;  3GOX A;  5FRM A;  3OYG A;  4Q5W A;  4A4G A;  4PLL A;  4OVA A;  3MO8 A;  2YRV A;  3MEV A;  3L2W A;  2X4Y A;  2R5A A;  2WAC A;  5J39 A;  4HCZ A;  4Z02 A;  3OYK A;  2LDM A;  3ME9 A;  2RI5 A;  3M9Q A;  3O8V A;  3PNW C;  4IUR A;  2RJE A;  4UC4 A;  2PQW A;  3FLG A;  3MP1 A;  4QQD A;  3OB9 A;  3P8D A;  2RI3 A;  2QQS A;  2RHX A;  4X34 A;  2GF7 A;  5C0M A;  5KCH A;  5KE3 A;  4BDY A;  2EQK A;  2B8A A;  2RHI A;  3BDL A;  5IAY A;  3FDR A;  2F5K A;  4BE0 A;  5J26 A;  5C6S A;  2EQU A;  2IG0 A;  2E6N A;  3QBY A;  5D6X A;  2G3R A;  1WGS A;  3OQ5 A;  3OY9 A;  4CRI A;  3OYA A;  2R57 A;  2JZ2 A;  2K3Y A;  2VYT A;  2MWO A;  3MEU A;  4RG2 A;  2GFU A;  2CKK A;  3PMT A;  4PLI A;  4QW2 A;  1SSF A;  3L2Q A;  1KHC A;  2NLU A;  3CEY A;  3QII A;  3S3N A;  2LVM A;  4C5H A;  3OYM A;  3PMI A;  3OYB A;  1WJS A;  3OMG A;  1OZ2 A;  4C5G A;  4E7J A;  1G5V A;  2HQX A;  3LGF A;  3MP6 A;  5D6Y A;  4A4E A;  3H6Z A;  1OZ3 A;  4PL6 A;  2M1H A;  3OMC A;  4NS5 A;  3L42 A;  2RJC A;  3OYD A;  2RHY A;  4EDU A;  2X4X A;  3OYF A;  3UT1 A;  3E9F A;  3MEA A;  2L3R A;  3DLM A;  4II1 A;  2X4W A;  3MP8 A;  3OYL A;  2HQE A;  2R5M A;  3SD4 A;  3OS2 A;  2MWP A;  2EFI A;  2XDP A;  2P0K A;  4IUT A;  4L59 A;  3OYH A;  4IUU A;  2E5Q A;  2RI2 A;  3P8H A;  3MEW A;  2R58 A;  3E9G A; 
#chains in the Genus database with same CATH topology
 4XU3 A;  1U3O A;  2DE0 X;  4ZGE B;  3N5B B;  2ROT A;  2AK5 A;  2RB6 A;  3LX7 A;  1W70 A;  4F04 B;  2H8H A;  3L2V A;  2FEI A;  1AVZ C;  2LCC A;  2RHZ A;  2OTL Q;  1T0H A;  2FRY A;  1X01 A;  4ZGJ B;  4QQ6 A;  4WCI A;  4BD3 A;  5IT9 E;  3BFM A;  1OV3 A;  2RJF A;  1ZA2 B;  1O75 A;  3ZL7 C;  1YIT Q;  5GMK j;  5GAN e;  1YIJ A;  2QQA A;  4HVU A;  1RAA B;  2C0O A;  3CC2 A;  2AKK A;  2D9T A;  1V29 B;  1XNI A;  2L0A A;  2COY A;  2JTF A;  4LDU A;  4OVA A;  3EFO A;  1Z9Q A;  2XID A;  5GAM g;  4M75 C;  1WXB A;  5IHI A;  4LD9 K;  2KY9 A;  2KRM A;  1NJI U;  4F7U A;  1GCQ C;  1WQW A;  3O8V A;  1DJ7 B;  1WZO A;  2PQW A;  1VYV A;  2YLC A;  1TG0 A;  1RAG B;  2DJQ A;  2MCN A;  2DL3 A;  4BI3 A;  1WFW A;  1WHL A;  2CS7 A;  2EQU A;  1G83 A;  2X9H A;  2W0Z A;  2KK4 A;  2RNA A;  1KC8 U;  1UE9 A;  1PKS A;  1PRL C;  5LJ3 e;  1D1C A;  3BDU A;  4A63 B;  2QAS A;  4M75 B;  3A5Z B;  3KXT A;  2HSE B;  4FYX B;  5KYW A;  9ATC B;  3H6Z A;  3CCM Q;  3G71 T;  2FZK B;  2D0N A;  1K73 R;  5GJW B;  4EDU A;  4DA4 A;  2RQV A;  2GQV A;  1WNL A;  2GQI A;  1QVG A;  1KQ1 A;  2K9G A;  4BB7 A;  3CCJ T;  5CQX A;  1UB4 A;  1JJ2 A;  2ZPE B;  1X43 A;  2JM9 A;  2LT4 A;  4C0G A;  1Q82 C;  4XTZ A;  4C5I A;  2K5F A;  4JPB W;  4KH1 B;  3GP8 A;  1QCO A;  3SWN B;  1OX8 A;  2H3E B;  2M0O A;  4KUD K;  2MI6 A;  2BZ8 A;  2O9S A;  5CO7 A;  5HCK A;  5GAN 5;  5AT1 B;  2E65 A;  1Q81 C;  4ZGD B;  5KCO A;  2KQW A;  4LXC A;  2A28 A;  1OI1 A;  2E41 A;  2VC8 A;  3C94 A;  2OTL A;  4C0Z A;  1V76 A;  3V7S A;  3M0U A;  5GAO p;  2CUB A;  1HYO A;  3OBW A;  1Q7Y U;  3UWN A;  1YIT A;  4N4I A;  5CCA A;  2F2W A;  2YRV A;  4JUV A;  1AOJ A;  4KT0 E;  2RI5 A;  5GAN g;  2LJ1 A;  4OMM A;  1Y96 B;  2L3P A;  3FJP A;  5LJ5 j;  1RAI B;  1T3S A;  1WYX A;  2XG8 D;  3QDR B;  4LN2 A;  2NUT A;  2DJZ A;  5GAO l;  3CME T;  3CCU T;  1RLP C;  2CZ0 B;  3I5R A;  1D09 B;  2JS0 A;  4F7U G;  2R57 A;  1HJD A;  4QW2 A;  3E19 A;  2PTK A;  2CP2 A;  2HKQ B;  1WLP B;  2P4R A;  3G71 Q;  5GAO r;  4EMK A;  1YNZ A;  2ZPB B;  2EGA A;  2JTE A;  3EGD B;  3UPU A;  2M1H A;  4NS5 A;  5CKH A;  1NPR A;  1IHV A;  5CKF A;  3M4G A;  1SRM A;  4OGC A;  2HQE A;  1M1K R;  1WX6 A;  1D1B A;  3CCM A;  1W2B A;  1Q86 U;  4BY6 C;  3V7R A;  4FU6 A;  4Z8A A;  2DTH A;  2YRD A;  1NJI C;  2V8I A;  1LNX A;  2KE9 A;  2M51 A;  4FW1 A;  1K9M U;  2O01 E;  4OMF B;  5DLO A;  1KFZ A;  2FPF A;  1TUD A;  4XQ3 A;  2DYI A;  2SRC A;  2ATC B;  5KYU A;  2C0I A;  4C8Q E;  2PNI A;  4Y28 E;  3OYI A;  3VKI A;  2KEA A;  2MIO A;  2PVD B;  2QA4 T;  2E5K A;  2YRC A;  4BY6 B;  2OAW A;  3UDC A;  3M57 A;  3PE0 A;  2SEM A;  2MMP A;  3HP9 A;  3CPW S;  3J81 E;  2DIL A;  4E7H A;  3DB3 A;  1MV0 B;  3F70 A;  1PHT A;  3OYG A;  3X20 B;  4R56 A;  2ECZ A;  2DD4 A;  2HSP A;  1BCM A;  1QW1 A;  2WSC E;  4ME7 A;  2NYS A;  3PVL A;  3V8K A;  3G7Z A;  3CME Q;  3CCU Q;  2VXE A;  1BK2 A;  4C8Q A;  1N9R A;  1K0S A;  3MJX A;  3M53 A;  1E6G A;  1QKW A;  4C92 B;  1VQ8 Q;  2QG9 B;  3A98 A;  2G3R A;  1WGS A;  3PGG A;  4JRQ A;  1SEM A;  1ZA1 B;  4E47 A;  1B34 A;  2AHJ B;  4M7A A;  1PM3 A;  1KG1 A;  2LJ0 A;  3EFO B;  3OYB A;  2E10 A;  5KYX A;  5A0D A;  4JLI A;  2AKL A;  5KYN A;  2RA2 A;  4PL6 A;  2MPX C;  1W1F A;  4M78 A;  5HK0 A;  1HSQ A;  3TU4 K;  4KUL A;  3CQT A;  3G71 A;  5EC7 A;  2ENM A;  5AYF A;  2CH4 A;  1VYT A;  4IKF A;  1AT1 B;  1B07 A;  2VKN A;  4J9I A;  2BKD N;  3FIF A;  1VA7 A;  1A0N B;  2VB6 A;  4PFZ A;  5GAM d;  2GBQ A;  1BBZ A;  4JJD A;  1U8R A;  4AMC A;  4RTZ A;  4F16 A;  2IVW A;  2MAM A;  2B86 A;  4IIO A;  5CIU A;  3TRE A;  2IPO B;  5KYW B;  2EBP A;  3JCM e;  3JV3 A;  4DBQ A;  3RER A;  1I4K 1;  2C0T A;  1D0Z A;  3OS1 A;  3V8J A;  1MMN A;  3S3O A;  1YHQ T;  1WHM A;  1QWE A;  2RQT A;  1OEB A;  1UFF A;  1N27 A;  4M75 E;  1UJ0 A;  3OW2 P;  3FRN A;  1N9S A;  3NFC A;  4FYW B;  3M0Q A;  2QQR A;  2JN0 A;  2QAZ A;  2LTO A;  3MHX A;  2VVK A;  1J3T A;  2OX7 A;  4QVZ A;  1JXM A;  5LJ5 f;  1HK9 A;  4C8Q F;  2E4H A;  2NUP A;  2PZ1 A;  4OB3 B;  1KSW A;  3QJY A;  2ABL A;  2HL3 A;  3CXC P;  3CCV T;  4C8Q D;  3MP1 A;  2FRW A;  2DEU A;  3CXC A;  2LC4 A;  1K73 C;  2AIR B;  2DBM A;  4B6M A;  3QUI A;  2CSQ A;  2KSS A;  3EFS A;  3V8L A;  2EVR A;  1UEC A;  3CME A;  2VV5 A;  3CCU A;  3OY9 A;  3QG1 A;  3J80 E;  2CDT A;  4HKE A;  5DY9 A;  4BUG A;  1YP5 A;  1VQ8 A;  5FWC A;  1KQ2 A;  3MP6 A;  3JCM J;  4EMK C;  1SHG A;  1CKB A;  2Y4X A;  3OBY A;  4GLM A;  2JMA A;  4J5Y A;  2LNV A;  2O9V A;  3VYH B;  2O88 A;  4ESR A;  3SD4 A;  5GAN 4;  2NUT B;  4M7A G;  2F2X A;  1TXQ A;  2I0N A;  2XHC A;  2JS2 A;  3RMQ A;  1D3B A;  1OPL A;  3I55 Q;  2FVU A;  1M90 R;  2O4X A;  4MZP A;  2EW3 A;  1KHI A;  1WHG A;  4M78 G;  3C0C A;  1QVF P;  1O9S A;  4PKC C;  5I2M A;  3SWN A;  1YI2 T;  2A0F B;  4AFU C;  3VS5 A;  3OYY A;  2NWM A;  4IUP A;  1RI9 A;  1YHQ Q;  5FLX E;  4KH0 B;  1U1T A;  5KE2 A;  1KQS S;  2WSE E;  3EGX A;  5I21 A;  2LQN A;  3M0P A;  3HHT B;  1VQK T;  1B7T A;  4E7L A;  4QKU A;  3GF5 A;  1IO6 A;  3UAT A;  3KBG A;  1WIE A;  2L8D A;  3MPU B;  1FYN A;  2QQ9 A;  3JCM g;  3M58 A;  5KYU B;  1GCP A;  5FRM A;  5A2Q E;  1TUC A;  3AT1 B;  2LX7 A;  1G3W A;  3EGU A;  1JBM A;  5LJ3 d;  4ZN3 A;  4JJN K;  2CT3 A;  1CKA A;  2FO0 A;  1TSF A;  2O31 A;  4QQD A;  1VQM T;  2K2V A;  2RHX A;  2K6D A;  3VJP A;  4M75 F;  4C8Q C;  1ABQ A;  5C0M A;  3QZ5 B;  4BI8 B;  5IAY A;  1UHC A;  1M1K C;  1X6B A;  1Q95 G;  2YUO A;  3GBQ A;  4N0A A;  1LCK A;  4M75 D;  2GTJ A;  1U1S A;  3MEU A;  3QII A;  1PNJ A;  4A54 A;  4M7A C;  2VWF A;  2E6Z A;  1G5V A;  4MML A;  2YDL A;  2HD0 A;  4OP0 A;  4D6W A;  1RL2 A;  5GMK m;  2EJ9 A;  3VRZ A;  2QDY B;  4PJN A;  3H0H A;  1U5S A;  3MEA A;  1YWP A;  4M78 C;  2FL7 A;  1XJW B;  2MWP A;  1BI0 A;  1UGQ B;  1UGV A;  3SB2 A;  3E9G A;  2KR3 A;  5CR2 A;  3RR6 A;  3EG0 A;  4XTU A;  1Q81 U;  4ZTF A;  2C06 A;  2A37 A;  1YI2 Q;  1NM7 A;  1M8V A;  1B34 B;  3VS2 A;  4M7A B;  3JSC A;  4KGV B;  2E3H A;  1GL5 A;  2E64 A;  4JLG A;  1K8A R;  3BY7 A;  2M16 A;  1LPL A;  3WXM B;  2DER A;  3QYG B;  5KYX B;  4F17 A;  1N8R R;  1TU0 B;  5CVI A;  3I55 A;  1R8O B;  4GLK A;  1I5L A;  2FPD A;  4M78 B;  4XU2 A;  3HFN A;  2X51 A;  5GMK i;  2G6F X;  1YHQ A;  1N6A A;  4BE1 A;  2EKO A;  4HT8 A;  4KBM B;  2DVJ A;  3RKX A;  4M77 A;  2E12 A;  3I5S A;  4F7U E;  1PSF A;  4K11 A;  2V8K A;  5LJ5 g;  3EG3 A;  4YTL A;  1RAH B;  3GOX A;  1NEB A;  4A4G A;  1GBQ A;  2XI9 A;  5CQY A;  5KYY A;  4PNO A;  1VQL Q;  2HBP A;  2WAC A;  5J39 A;  4HCZ A;  2RM4 A;  3E2U A;  3A8O B;  4IUR A;  3JCM X;  3RDV A;  2LJ3 A;  2YT6 A;  1Y71 A;  2DL7 A;  4DQ2 A;  1K9A A;  2GNC A;  4RTU A;  1RAB B;  2EJF A;  4C92 A;  2FYK A;  3BDL A;  3HFO A;  4AFZ C;  2EQI A;  3JCM P;  2QEX Q;  2GFU A;  3OSV A;  3L2Q A;  3CEY A;  4KGZ B;  1C6V X;  4C0D C;  2NUP B;  1M9S A;  2J6O A;  2DMO A;  2RJC A;  2XD0 A;  2MK5 A;  3OYF A;  2L3R A;  1AD5 A;  2P0K A;  3CCS T;  3ULR B;  4D8K A;  1MHN A;  2D1X A;  1AZE A;  1T0J A;  2I2L A;  5M9O A;  2DEQ A;  2F5T X;  2H3J A;  4J83 A;  2K4Y A;  3KUF A;  2V8J A;  3TCJ A;  3X24 B;  4FSX A;  1V1C A;  3I56 T;  4C0D B;  3SWN C;  5LJ3 h;  1ZUK A;  2IIM A;  4OB0 B;  1KK7 A;  4A4K A;  4E7Z A;  1YI2 A;  4ZTJ A;  2LP5 A;  2J05 A;  4A4F A;  2LCS A;  2WSF E;  4AG2 C;  3EFR A;  1G3S A;  2OAU A;  2JUF A;  4RG8 A;  4FCY A;  4OMQ A;  1QCF A;  1FMW A;  2YUN A;  1VQP T;  1D3B B;  4ATO A;  1MV3 A;  2O4X B;  5EG2 A;  5HKC A;  2DNU A;  3SEM A;  1MND A;  3OYJ A;  3NMZ C;  2BE7 D;  1YJN T;  1I5O B;  3O5Z A;  2V1Q A;  1NLP C;  4XU1 A;  2CZ6 B;  3HPW A;  5IXF A;  2LQK A;  4J9C A;  5GAN 7;  4AFS C;  3CC4 T;  2V26 A;  4RTX A;  3EGX B;  4M77 G;  3L1A A;  1TS9 A;  4PJJ A;  4C92 D;  1VQL A;  5L8R E;  2L2P A;  2KI7 A;  2MF2 A;  2KMT A;  2DET A;  4BE0 A;  5J26 A;  1E6H A;  1D0Y A;  5IXB A;  4F7U F;  4CC2 A;  1E7O A;  2VGM A;  5D6X A;  3EH1 A;  4EMG A;  2FZC B;  4N0A C;  2DO3 A;  2MWO A;  4RG2 A;  5GJV B;  4JS5 A;  1M30 A;  5J3B A;  1M90 C;  2NLU A;  4J9F A;  1H3H A;  4C92 G;  1OZ2 A;  2RF0 A;  3PT9 A;  3VS1 A;  4XK8 E;  1OZ3 A;  4FSS A;  3TEE A;  2QEX A;  3UF4 A;  1ZBX A;  1ABO A;  4J9E A;  3CCR T;  1LJO A;  3CCS Q;  4II1 A;  1M3A A;  4GBQ A;  2A08 A;  4L59 A;  3JCM d;  2R58 A;  3EAE A;  3G6E T;  1Y7X A;  1QVG S;  2KYB A;  3CPW P;  3P8B B;  1PKT A;  3I56 Q;  2AZV A;  2DYB A;  1X6O A;  3GPL A;  4BE2 A;  2CZ7 B;  2E3I A;  1JJ2 S;  3A1P A;  3T9N A;  2FHD A;  1F1B B;  3X28 B;  2RJD A;  5FRN A;  4HVV A;  4OB2 B;  1RUW A;  4J9H A;  4BDZ A;  2PUO B;  3CCJ Q;  1M1G A;  1PSE A;  2RH2 A;  1CSK A;  4OMO A;  2QXF A;  1VQP Q;  2K5L A;  1VQN T;  2XMF A;  3U23 A;  1GXI E;  1GBR A;  3OA6 A;  3SDZ A;  1IHW A;  2BUD A;  2DLP A;  5FU6 C;  4R55 A;  1SG5 A;  4F14 A;  1K73 U;  3QKJ A;  1YJN Q;  4MZT A;  4M77 C;  2EAY A;  4DEY A;  2JW4 A;  3FEO A;  5I22 A;  4Q5W A;  1KD1 R;  3QSU A;  3CC4 Q;  3MO8 A;  2XU8 A;  3KFV A;  1VQ6 T;  4PFO A;  3M9Q A;  3PNW C;  3VS0 A;  3VS6 A;  3VUZ A;  2P0Q A;  1WI7 A;  3JB9 G;  2ZPI B;  4M7A E;  5FU6 B;  4QT7 A;  2EIF A;  4C92 C;  2XDB A;  1H8K A;  2RK2 A;  1EX4 A;  3VU3 C;  4M77 B;  2DK3 A;  4M78 E;  1X2K A;  1SSF A;  1KHC A;  2YSQ A;  1S72 T;  5KYY B;  3G1J A;  4LNP A;  4E7J A;  3CCR Q;  4RTY A;  1K8A C;  3LGF A;  3URG A;  2XIC A;  1G2B A;  4Z88 A;  4AT1 B;  3JAM E;  1N8R C;  3A8G B;  2FG0 A;  1ZQ1 A;  3EG1 A;  3E9F A;  2X4W A;  1M2O A;  3OS2 A;  2XDP A;  3PVQ A;  3OYH A;  3FJ5 A;  1MMA A;  5HY6 A;  3VRY A;  3CCS A;  3LYI A;  3M0S A;  1W2B S;  1AWW A;  2L5Q A;  4PK4 A;  3S3M A;  2BZX A;  2DRM A;  3LH5 A;  3EG9 A;  2EQM A;  2OTJ T;  4P5N A;  5GMK e;  3I56 A;  5CKD A;  2QI2 A;  1UGP B;  1VQN Q;  2EPD A;  3ZEH A;  4RCB A;  1Y57 A;  1BKB A;  5I2S A;  4PJO A;  2CP0 A;  1W6X A;  3CPF A;  3L2U A;  3CCJ A;  1ACM B;  1VQP A;  1PD1 A;  1ARK A;  2DD5 A;  3VV0 A;  1M1K U;  3TVT A;  1BCO A;  2QA4 Q;  1OQK A;  2ZPF B;  1K4U S;  1YJN A;  3PIO A;  1TWB A;  4JRP A;  1VUB A;  4E6R A;  4JJB A;  4E2F B;  3VS7 A;  2EYX A;  2RJE A;  1YJ9 T;  3QZ9 B;  3CC4 A;  1AWO A;  4LDW A;  4KGX B;  3OW2 A;  5KE3 A;  4MDX A;  4C0F A;  2DM1 A;  3CC7 T;  1M27 C;  3RES A;  3JB9 I;  1N5Z A;  3NGP A;  4OF1 A;  3RBB B;  3S3N A;  1NG2 A;  1Y07 A;  3R6N A;  2EYQ A;  2YXY A;  2HQX A;  5IH2 A;  2RD1 A;  2K57 A;  1KQS P;  4DOW A;  1VQ5 T;  1OUL A;  1KQS A;  2E70 A;  5LJ3 j;  1UEB A;  4M7A F;  3EH2 A;  3H0I A;  1QMC A;  3FB9 A;  2EFI A;  2COZ A;  2D8J A;  3M4Y A;  3CCR A;  3E1S A;  4J6Y A;  1IRX A;  4B9X A;  1BU1 A;  1OOT A;  3HRS A;  2ZPG B;  7AT1 B;  1YIJ T;  3V7C A;  1PCX A;  3OYC A;  4M7A D;  1M2V A;  4M78 F;  2K79 A;  3CC2 T;  3NTI A;  3TQ7 P;  4HT9 A;  1I0C A;  2OTJ Q;  1C1A A;  2QTV A;  2K3X A;  5FW9 A;  4M78 D;  3MET A;  4Y91 A;  2Y4Y A;  3RUX A;  1JQQ A;  3PFS A;  1R77 A;  2DIQ A;  2K2M A;  2PU9 B;  1JU5 C;  4BAC A;  1TTH B;  3PTA A;  2KRO A;  4OMN A;  1JRI A;  5GAM f;  1MMG A;  3LLR A;  3I9Q A;  1AEY A;  3A8L B;  1VQN A;  1H3Z A;  2BIV A;  3JCM V;  2EQJ A;  1SKU B;  5GAN d;  1GFD A;  1EFN A;  1QVF A;  5LJ5 e;  2KBT A;  4PJO G;  3WVD B;  3OS0 A;  1BIA A;  2JJ9 A;  4QVD A;  3MEV A;  2DA9 A;  2KXC A;  2F69 A;  2X4Y A;  2M02 A;  4JRI A;  1YJ9 Q;  1R0C B;  4HA8 A;  2CP3 A;  1NEG A;  4UC4 A;  3GNG A;  3OB9 A;  2QA4 A;  2RI3 A;  2DBK A;  3H0F A;  4X34 A;  4EIK A;  1ZBJ A;  5GAN 3;  4BDY A;  2B8A A;  5GAN 2;  3CC7 Q;  1H92 A;  1SRL A;  5GAN 8;  1X69 A;  4V2S A;  2JZ2 A;  2Z0W A;  4PLI A;  3CCV Q;  1WJS A;  1VQ5 Q;  2ESW A;  2CUD A;  2EKH A;  2D8H A;  2KT1 A;  3JCM Q;  5GAM h;  3OYD A;  3UT1 A;  1NBE B;  3HTR A;  1QWF A;  2OI3 A;  4IUU A;  3EHR A;  2HMA A;  2HKN A;  2QGG A;  4XTX A;  3X26 B;  4JZ3 A;  4KUI A;  1QKX A;  2LQ8 A;  3H8Z A;  1NJI R;  4M4Z A;  2CZ1 B;  2DZC A;  2HNI A;  2HBW A;  1UDL A;  3CCL T;  2DL5 A;  4A4H A;  4OGE A;  4C5E A;  1FXX A;  2CP5 A;  4J7F A;  1SPK A;  4OB1 B;  2OTJ A;  1KD1 C;  3RIR A;  4ZN1 A;  4M77 E;  2RHU A;  1KC8 R;  2ZCF B;  2RPN A;  3MKD A;  4XU0 A;  3IQL A;  1VQ9 T;  4M7D G;  4PJO C;  1I1J A;  1ZUY A;  4PJL A;  4VUB A;  5GAN f;  1WQ7 A;  4B9W A;  2RQR A;  1PRM C;  1I07 A;  2KAF A;  2EYY A;  2JOY A;  3EG9 B;  1ZLM A;  3LWH A;  5FU7 C;  1PC0 A;  1QLY A;  5IN1 A;  3JB9 H;  3M59 A;  4N4G A;  3CD6 T;  2X3X D;  3R6O A;  4PLL A;  3OS5 A;  1BI2 A;  4C92 E;  1SSH A;  1VQK Q;  2BZY A;  1M90 U;  2XDD A;  4LDY A;  3CCE T;  3RNJ A;  4PJO B;  3LWI A;  1BI3 A;  1YJ9 A;  3CCM T;  2KXD A;  2F5K A;  1W4S A;  5FU7 B;  4FIB A;  4J9D A;  3PIP A;  1FWZ A;  1NYG A;  3QWX X;  5LJ3 f;  3CC7 A;  2LVM A;  2O2O A;  3PMI A;  1ZHI A;  2YUP A;  1X2Q A;  2ZPH B;  3UA7 A;  1VQM Q;  3DLL A;  5D6Y A;  2EGE A;  5I11 A;  4NOY A;  3CBP A;  2QYZ A;  3CCV A;  1Q7Y R;  4XTY A;  4FW2 A;  5CK9 A;  2JXB A;  1VQ5 A;  5GAN h;  2GCX A;  3P8H A;  3MEW A;  2YWW A;  4J8O A;  1PD0 A;  4OMP A;  4J6X A;  3CCQ T;  3Q1J A;  3CCL Q;  1Y0M A;  2ED0 A;  4NL3 A;  2AT1 B;  1YCY A;  5LL6 S;  4M7D C;  3M56 A;  1RAE B;  1QP3 A;  5GAO n;  2DVE A;  3AHU A;  4HXJ A;  1VQ9 Q;  5A0L A;  5FRO A;  1LOJ A;  1GRI A;  4LD6 A;  4MZM A;  2J06 A;  1JB0 E;  4XAX B;  1OYX A;  1M2V B;  2XK0 A;  3CBO A;  2DL4 A;  2HCK A;  3LH0 A;  1X27 A;  3X25 B;  3OYN A;  3C12 A;  3CD6 Q;  2NUZ A;  4ANJ A;  4CC3 A;  3QXE B;  4LE9 A;  1H64 1;  4M7D B;  2RO0 A;  3ASK A;  4RTT A;  5FWB A;  4ELY C;  4ELZ C;  4FT2 A;  4LUD A;  5DM7 R;  4IIM A;  3CCE Q;  2EJG A;  3G4S T;  1Q86 R;  3MCA B;  4M77 F;  2EYZ A;  1NPP A;  4Z02 A;  3OYK A;  4HCC A;  2FB7 A;  2W10 A;  1MMD A;  1K9M R;  2M0Y A;  2LNH B;  1VQ7 T;  1K8A U;  2CSI A;  1TH7 A;  1AHJ B;  3VS3 A;  1VQK A;  2LX9 A;  3D7S B;  2CRE A;  3M0R A;  1BB9 A;  1N8R U;  4M77 D;  1QVG P;  3C95 A;  4RTW A;  4L5G A;  4E7S A;  3L2Z A;  3TSW A;  1KJW A;  1JJ2 P;  3OYA A;  3QHS A;  2JM8 A;  2DTI A;  4CI0 C;  1U06 A;  2CYZ B;  4C92 F;  4L6V 5;  1MNE A;  3OMG A;  2J6F A;  2YHT A;  2GGR A;  3OMC A;  2FPE A;  4Y92 A;  1M3B A;  2K7A A;  2CP7 A;  3J7A F;  2M9U A;  1VQM A;  1P92 A;  1D0X A;  3CCQ Q;  5CAI A;  1ZX6 A;  1VQ4 T;  2LRQ A;  1UG1 A;  1XTD A;  2VGN A;  1VIE A;  2ZAE A;  3JRZ A;  4WTO B;  3C4S A;  2KYM A;  2F1L A;  2VUB A;  3HRT A;  1G3Y A;  3RMS A;  1Z9Z A;  8AT1 B;  3CCL A;  4PFP A;  4LDV A;  3FC3 A;  4IUQ A;  1WXT A;  3M5A A;  5ECA A;  2ZGW A;  1X6G A;  5GMK l;  4FT4 A;  1NYF A;  1G3T A;  1YCS B;  2PVG B;  2DF6 A;  3SHW A;  3REA B;  2ED1 A;  1VQ9 A;  2VAS A;  3CPW A;  2DAQ A;  2DXU A;  2JT4 A;  4N4H A;  2BE9 B;  2DL8 A;  3I35 A;  1YJW T;  2CH4 W;  3CMA T;  3L2R A;  1AWX A;  1I8F A;  3G4S Q;  4XTW A;  1OU8 A;  2KGT A;  3HRU A;  1UUE A;  1VQ8 T;  3CD6 A;  1ZUU A;  2R5A A;  5CKE A;  1VQ7 Q;  2JTM A;  1JEG A;  3JB9 F;  2L3Q A;  1QVP A;  1M3C A;  3P8D A;  3HKS A;  4DOV A;  3CCE A;  1R0B G;  2GF7 A;  2DXT A;  1AZG B;  3QPH A;  1ZSZ A;  3FDR A;  5D7U A;  1BYM A;  5GAM j;  3JB9 D;  3NHN A;  1W2B P;  3JCM c;  3OQ5 A;  4RUG A;  3GNF B;  5LJ3 g;  4HCB A;  2K3Y A;  1WDX A;  2YLB A;  2COW A;  4FYV B;  3VS4 A;  4C5H A;  3OYM A;  1M8M A;  4C5G A;  3SFM A;  2ZZD A;  3BE3 A;  2D0Q B;  4RTV A;  3ZBD A;  5GAO q;  3DLM A;  2LCL A;  2E1H A;  1K76 A;  1VQ4 Q;  1KC8 C;  4JRK A;  2F2V A;  3NTK A;  1WHH A;  4GY5 A;  3OYE A;  1HXD A;  1JO8 A;  3CCQ A;  4PJO E;  1MGQ A;  2FZG B;  1M5Q 1;  2QDL A;  1WJQ A;  2DX1 A;  1HD3 A;  2GFA A;  1WJR A;  5GAN 6;  4D8D A;  3JCM f;  4J6W A;  3LGL A;  1MUZ A;  3G6E Q;  5LJ5 d;  1WXU A;  4O6J A;  4Z89 A;  2L3S A;  4QQG A;  4JDS A;  3EHQ A;  1RAC B;  4RMO A;  4TVR A;  1UGR B;  1M1F A;  2DKG A;  2DTO A;  1YJW Q;  3CMA Q;  3A8M B;  1YN8 A;  2RQU A;  1K0X A;  4FL6 A;  1PG5 B;  2X4J A;  2CGH A;  3L2W A;  5L23 A;  4XTV A;  4QVC A;  5GMK h;  2MYS A;  1SF9 A;  8ATC B;  1B3Q A;  3G4S A;  6AT1 B;  2A7Y A;  2PUK B;  4F7U B;  4DEX A;  1NE8 A;  2XKO C;  4ORZ A;  3EG2 A;  4X9C A;  4JZ4 A;  1Q7Y C;  5KCH A;  1S1N A;  1AWJ A;  4EMH A;  1VQ7 A;  1OX9 A;  2RHI A;  2AZS A;  2HEQ A;  1JXO A;  2KDS A;  1VQO T;  2K3B A;  4CRI A;  5GAN j;  1BIB A;  3QWY A;  1VQ6 Q;  3PMT A;  4BI4 A;  1TOV A;  3QYH B;  2KNB B;  1NLO C;  3DKM A;  4J9B A;  3JCM h;  3INZ A;  3I55 T;  1M4Z A;  2Y90 A;  4LUE A;  1IB8 A;  2QGF B;  4A4E A;  2X3W D;  1X75 C;  4MDW A;  3RKW A;  1TUG B;  3GLX A;  3HL8 A;  4ZNX A;  2HAX A;  1EZZ B;  1RAD B;  3UA6 A;  2K5I A;  4IUT A;  2ROL A;  3ZFJ A;  1KD1 U;  4M7D E;  1S72 Q;  3M54 A;  4CC7 A;  1RI0 A;  2DPP B;  1VQ4 A;  1BI1 A;  1WA7 A;  1XOV A;  2PVO B;  3REB B;  3LW5 E;  2KVQ G;  1WHJ A;  2DXB A;  4HVW A;  1YWO A;  4MMK A;  1UHF A;  2J7I A;  5KH6 A;  4OML A;  3OSS C;  1XQH A;  3DB4 A;  1ZSG A;  1Q86 C;  2YUQ A;  5HK3 A;  3VUB A;  1C0M A;  3CBM A;  2LZ6 B;  1QQJ A;  1K9M C;  2RQW A;  2DIG A;  4E7I A;  1IGQ A;  2X35 A;  3G6E A;  1Q82 R;  1FMK A;  4M7D A;  4JJC A;  1VIF A;  4PJO F;  2OJ2 A;  1UTI A;  4WF2 A;  5D6W A;  3RKY A;  5IHN A;  4M75 A;  1YJW A;  1LVK A;  1RAF B;  2HL5 C;  4DBF A;  3CMA A;  2KT8 A;  3VYG A;  4C8Q G;  1Q81 R;  4PJO D;  1GCQ A;  1K1Z A;  2LDM A;  2KRN A;  1FMV A;  2HZY A;  3QO3 A;  1OU9 A;  3ER0 A;  2QQS A;  1VYU A;  2HDA A;  1VQO Q;  3TSZ A;  2EQK A;  1G8X A;  5CKB A;  4FYY B;  3HSB A;  2DXC A;  2JMC A;  1ZSZ C;  4KRT A;  3OW2 S;  2E6N A;  2P0P A;  4EPC A;  3QDF A;  5A0G A;  3THK A;  2RN8 A;  4J9G A;  5LJ5 h;  1VOM A;  3M55 A;  1PWT A;  4DBR A;  2JVV A;  4A53 A;  4EMK B;  1VQ6 A;  3L42 A;  2EWN A;  2X4X A;  1WPY A;  2LMJ A;  3CXC S;  3OYL A;  2R5M A;  2LQW A;  2E5Q A;  1ZSZ B;  2RI2 A;  1QCN A;  4AG1 C;  2BTT A;  1WHK A;  2KRS A;  3JCM b;  1UGS B;  4RKU E;  2L89 A;  1OPK A;  2QK0 A;  4JS4 A;  2EGC A;  3BW1 A;  4HCK A;  1S72 A;  1SHF A;  2CT4 A;  2DZ9 A;  2RK1 A;  1EIF A;  1FX7 A;  4O5V A;  2A3L A;  3QJ6 A;  2D6F A;  1D1A A;  2VXF A;  1YIJ Q;  3JCM W;  2J6K A;  2OTL T;  3CC2 Q;  1NZ9 A;  2GTO A;  5GAM e;  1Y96 A;  2MOX A;  4M7D F;  3JB9 J;  4NL2 A;  2P84 A;  4E7K A;  1GFC A;  1IZ6 A;  1VQL T;  3WVE B;  3H41 A;  2JNG A;  1YFN A;  1YIT T;  4M7D D;  3S6W A;  2V1R A;  2LT1 A;  3NPF A;  4R0K A;  2EYW A;  3NTH A;  4IUV A;  4DBH A;  1QVF S;  2QTX A;  2P4T A;  4J7I A;  1QP2 A;  3H9N A;  5GAO m;  2QEX T;  3EGD A;  5DLQ E;  3ME9 A;  4FM4 B;  1T3L A;  2DFU A;  1Q82 U;  4X1V A;  3FLG A;  2HQH A;  1IRE B;  3M0T A;  4AFQ C;  4M75 G;  4C8Q B;  3GIB A;  3A8H B;  5C6S A;  2IG0 A;  4RCC A;  3QBY A;  4PJM A;  2VYT A;  1KIK A;  2CKK A;  1VQO A;  2CP6 A;  4LDX A;  2A36 A;  1YBY A;  5IHK A;  2DRK A;  1IXD A;  2QQB A;  4X9D A;  2RHY A;  3MP8 A;  1RLQ C;  4CC4 B;  1UJY A;  2RMO A;  1IGU A;  1I81 A; 
#chains in the Genus database with same CATH homology
 3RMQ A;  5HY6 A;  4XU3 A;  1D3B A;  3CCS A;  3LYI A;  4ZGE B;  1VQ4 T;  2FVU A;  2LRQ A;  2O4X A;  4MZP A;  3N5B B;  1KHI A;  1W2B S;  4M78 G;  2L5Q A;  1XTD A;  2RB6 A;  3S3M A;  2VGN A;  1VIE A;  3JRZ A;  3LX7 A;  1O9S A;  4PKC C;  5I2M A;  3SWN A;  1YI2 T;  3C4S A;  2EQM A;  3L2V A;  2VUB A;  2OTJ T;  4P5N A;  3HRT A;  1G3Y A;  3RMS A;  3OYY A;  5GMK e;  3CCL A;  4IUP A;  3I56 A;  5CKD A;  2LCC A;  2QI2 A;  2RHZ A;  1UGP B;  4LDV A;  5FLX E;  1U1T A;  3FC3 A;  5KE2 A;  1X01 A;  4IUQ A;  3M5A A;  3ZEH A;  4QQ6 A;  4RCB A;  4ZGJ B;  1KQS S;  2WSE E;  4BD3 A;  2ZGW A;  1BKB A;  5GMK l;  5IT9 E;  4FT4 A;  3BFM A;  5I21 A;  2RJF A;  5I2S A;  1G3T A;  4PJO A;  2PVG B;  3CPF A;  1O75 A;  3HHT B;  1VQK T;  4E7L A;  3L2U A;  3GF5 A;  5GMK j;  5GAN e;  3KBG A;  3CCJ A;  1YIJ A;  1VQ9 A;  3CPW A;  2QQA A;  2DAQ A;  2DXU A;  2L8D A;  4N4H A;  1VQP A;  3CC2 A;  2D9T A;  1V29 B;  2DD5 A;  1XNI A;  2QQ9 A;  3VV0 A;  3JCM g;  1YJW T;  3M58 A;  1M1K U;  3CMA T;  3L2R A;  2JTF A;  5FRM A;  1I8F A;  4LDU A;  4XTW A;  5A2Q E;  4OVA A;  3HRU A;  1VQ8 T;  2ZPF B;  2XID A;  5GAM g;  4M75 C;  3CD6 A;  1YJN A;  1G3W A;  3PIO A;  2R5A A;  5CKE A;  4LD9 K;  1JBM A;  4JRP A;  2KY9 A;  1VUB A;  2JTM A;  5LJ3 d;  4ZN3 A;  4JJN K;  1NJI U;  4F7U A;  1WQW A;  3O8V A;  1DJ7 B;  3JB9 F;  2RJE A;  2PQW A;  1YJ9 T;  1QVP A;  3QZ9 B;  2YLC A;  4QQD A;  3CC4 A;  3P8D A;  1VQM T;  3HKS A;  2K2V A;  2RHX A;  4LDW A;  3VJP A;  4DOV A;  3CCE A;  4M75 F;  2GF7 A;  4C8Q C;  5C0M A;  2DXT A;  4BI3 A;  3QPH A;  3QZ5 B;  3OW2 A;  5KE3 A;  4BI8 B;  5IAY A;  3FDR A;  1M1K C;  1BYM A;  5GAM j;  3JB9 D;  4MDX A;  2CS7 A;  2EQU A;  4C0F A;  3JCM c;  3OQ5 A;  2KK4 A;  4N0A A;  3CC7 T;  3GNF B;  5LJ3 g;  4HCB A;  4M75 D;  2K3Y A;  1KC8 U;  2YLB A;  1U1S A;  3MEU A;  3RES A;  5LJ3 e;  4OF1 A;  3JB9 I;  3BDU A;  3QII A;  3S3N A;  4M75 B;  4A54 A;  4C5H A;  3OYM A;  3A5Z B;  3KXT A;  1Y07 A;  4M7A C;  2EYQ A;  4C5G A;  2E6Z A;  1G5V A;  4MML A;  2HQX A;  2ZZD A;  3SFM A;  2RD1 A;  2K57 A;  3H6Z A;  2HD0 A;  4OP0 A;  4DOW A;  4D6W A;  1RL2 A;  3G71 T;  2D0Q B;  1VQ5 T;  5GMK m;  2EJ9 A;  2QDY B;  1KQS A;  2E70 A;  4EDU A;  3ZBD A;  5LJ3 j;  4DA4 A;  5GAO q;  1UEB A;  3MEA A;  2GQV A;  3DLM A;  4M78 C;  4M7A F;  1WNL A;  2FL7 A;  2LCL A;  2MWP A;  2EFI A;  3FB9 A;  3M4Y A;  3CCR A;  1BI0 A;  2E1H A;  3E1S A;  4J6Y A;  1QVG A;  1UGQ B;  1KQ1 A;  3SB2 A;  1KC8 C;  4BB7 A;  3E9G A;  4JRK A;  3HRS A;  4B9X A;  2ZPG B;  5CR2 A;  3CCJ T;  3V7C A;  1YIJ T;  3NTK A;  4XTU A;  5CQX A;  1Q81 U;  1UB4 A;  4ZTF A;  2C06 A;  3OYC A;  4M7A D;  4GY5 A;  2ZPE B;  4M78 F;  1JJ2 A;  3CC2 T;  3NTI A;  1M8V A;  3OYE A;  1B34 B;  2LT4 A;  4HT9 A;  4C0G A;  1HXD A;  1Q82 C;  4M7A B;  3JSC A;  3CCQ A;  2E64 A;  4JLG A;  4XTZ A;  3BY7 A;  4C5I A;  4PJO E;  1MGQ A;  2M16 A;  1M5Q 1;  2K3X A;  2K5F A;  3GP8 A;  3WXM B;  3QYG B;  4M78 D;  1WJQ A;  3MET A;  5CVI A;  3SWN B;  4Y91 A;  3I55 A;  1R8O B;  4GLK A;  2Y4Y A;  3RUX A;  2GFA A;  3PFS A;  1WJR A;  2DIQ A;  5GAN 6;  1I5L A;  2PU9 B;  4BAC A;  3JCM f;  2M0O A;  4J6W A;  3LGL A;  4M78 B;  4KUD K;  2MI6 A;  5CO7 A;  5LJ5 d;  3PTA A;  5GAN 5;  4XU2 A;  1JRI A;  2E65 A;  1Q81 C;  4ZGD B;  5KCO A;  4O6J A;  2KQW A;  5GAM f;  4QQG A;  3HFN A;  1OI1 A;  2E41 A;  2VC8 A;  3C94 A;  2OTL A;  3LLR A;  4C0Z A;  3A8L B;  4JDS A;  5GMK i;  1YHQ A;  1N6A A;  2BIV A;  1VQN A;  4BE1 A;  4RMO A;  1H3Z A;  4TVR A;  3V7S A;  1UGR B;  1M1F A;  2EKO A;  3JCM V;  2DKG A;  2EQJ A;  5GAO p;  2DTO A;  4KBM B;  4HT8 A;  5GAN d;  3RKX A;  4M77 A;  3A8M B;  2E12 A;  3OBW A;  4F7U E;  1Q7Y U;  1PSF A;  3UWN A;  2V8K A;  5LJ5 g;  1QVF A;  4YTL A;  1YIT A;  4N4I A;  5LJ5 e;  4FL6 A;  4PJO G;  3WVD B;  5CCA A;  3GOX A;  3OS0 A;  1BIA A;  4A4G A;  2X4J A;  4QVD A;  2CGH A;  2XI9 A;  5CQY A;  2YRV A;  3MEV A;  4PNO A;  3L2W A;  4XTV A;  2F69 A;  4QVC A;  2X4Y A;  4JUV A;  2HBP A;  4JRI A;  2WAC A;  5GMK h;  5J39 A;  4HCZ A;  2RM4 A;  4HA8 A;  4KT0 E;  3A8O B;  2RI5 A;  4IUR A;  3JCM X;  5GAN g;  1Y96 B;  4UC4 A;  3FJP A;  3G4S A;  3GNG A;  2A7Y A;  2PUK B;  5LJ5 j;  4F7U B;  3OB9 A;  2QA4 A;  1NE8 A;  2RI3 A;  1Y71 A;  2XKO C;  4DQ2 A;  4X9C A;  4X34 A;  2XG8 D;  3QDR B;  4C92 A;  2EJF A;  2DJZ A;  5GAO l;  5GAN 3;  3CME T;  5KCH A;  3CCU T;  1Q7Y C;  4EMH A;  1VQ7 A;  4BDY A;  2CZ0 B;  2B8A A;  2FYK A;  2RHI A;  3BDL A;  5GAN 2;  3HFO A;  5GAN 8;  2KDS A;  3JCM P;  1VQO T;  4CRI A;  4F7U G;  4V2S A;  2R57 A;  2JZ2 A;  5GAN j;  1BIB A;  2GFU A;  3OSV A;  3PMT A;  4PLI A;  3E19 A;  4QW2 A;  4BI4 A;  3L2Q A;  3CEY A;  3QYH B;  1WJS A;  3DKM A;  3JCM h;  5GAO r;  3INZ A;  3I55 T;  1M4Z A;  4C0D C;  4EMK A;  2Y90 A;  2ZPB B;  4A4E A;  1M9S A;  1X75 C;  3UPU A;  2M1H A;  4MDW A;  3RKW A;  4NS5 A;  5CKH A;  1NPR A;  2RJC A;  2XD0 A;  3GLX A;  3JCM Q;  5GAM h;  3HL8 A;  3OYD A;  5CKF A;  3OYF A;  3UT1 A;  3M4G A;  2HAX A;  2L3R A;  4OGC A;  2HQE A;  2K5I A;  2P0K A;  4IUT A;  3ZFJ A;  3CCS T;  1KD1 U;  4M7D E;  4IUU A;  3CCM A;  3M54 A;  1MHN A;  1W2B A;  1Q86 U;  4BY6 C;  3V7R A;  4FU6 A;  4XTX A;  2DTH A;  3X26 B;  2I2L A;  2LQ8 A;  3H8Z A;  4KUI A;  5M9O A;  2DEQ A;  4J83 A;  1NJI C;  2F5T X;  1RI0 A;  1LNX A;  2H3J A;  2CZ1 B;  2K4Y A;  2V8I A;  2DZC A;  3KUF A;  2DPP B;  2HNI A;  2V8J A;  2O01 E;  4OMF B;  5DLO A;  3TCJ A;  1K9M U;  3X24 B;  1VQ4 A;  4FSX A;  4XQ3 A;  1BI1 A;  3I56 T;  3CCL T;  1XOV A;  4A4H A;  4OGE A;  4C0D B;  3SWN C;  5LJ3 h;  2PVO B;  4C5E A;  3LW5 E;  2KVQ G;  4OB0 B;  1FXX A;  4A4K A;  1YI2 A;  4J7F A;  2DXB A;  4OB1 B;  4ZTJ A;  4C8Q E;  2OTJ A;  4MMK A;  1KD1 C;  4A4F A;  3RIR A;  5KH6 A;  2WSF E;  3EFR A;  4Y28 E;  4ZN1 A;  1G3S A;  2OAU A;  3OSS C;  2JUF A;  1XQH A;  4M77 E;  3DB4 A;  4RG8 A;  2RHU A;  3VKI A;  2ZCF B;  3OYI A;  1Q86 C;  5HK3 A;  4XU0 A;  3VUB A;  1VQ9 T;  3CBM A;  2PVD B;  2QA4 T;  4M7D G;  1VQP T;  4PJO C;  4BY6 B;  3UDC A;  1D3B B;  3M57 A;  4VUB A;  1K9M C;  4E7I A;  2DIG A;  2X35 A;  3G6E A;  5GAN f;  1WQ7 A;  4B9W A;  4ATO A;  2MMP A;  2O4X B;  3HP9 A;  4M7D A;  2KAF A;  5EG2 A;  5HKC A;  2JOY A;  3J81 E;  3CPW S;  4E7H A;  1VIF A;  3DB3 A;  4PJO F;  3OYJ A;  3LWH A;  4WF2 A;  5D6W A;  5FU7 C;  5IN1 A;  3JB9 H;  3M59 A;  4N4G A;  3F70 A;  3CD6 T;  3RKY A;  1YJN T;  3OYG A;  3X20 B;  3R6O A;  4PLL A;  3OS5 A;  1BI2 A;  4C92 E;  4M75 A;  4R56 A;  1YJW A;  2DD4 A;  4XU1 A;  3CMA A;  2CZ6 B;  1QW1 A;  3HPW A;  3VYG A;  4C8Q G;  2LQK A;  2WSC E;  4ME7 A;  4PJO D;  5GAN 7;  1M90 U;  3CC4 T;  2LDM A;  2XDD A;  4LDY A;  4M77 G;  3V8K A;  3CCE T;  3G7Z A;  3QO3 A;  4PJO B;  3L1A A;  2VXE A;  3ER0 A;  4C8Q A;  2QQS A;  3LWI A;  4C92 D;  1BI3 A;  1N9R A;  5L8R E;  1VQL A;  1YJ9 A;  2EQK A;  2MF2 A;  2KMT A;  3M53 A;  5CKB A;  3CCM T;  3HSB A;  2DXC A;  2F5K A;  4BE0 A;  4C92 B;  5J26 A;  1W4S A;  3OW2 S;  4F7U F;  2E6N A;  2P0P A;  2VGM A;  4EPC A;  5D6X A;  2G3R A;  1WGS A;  3PGG A;  5FU7 B;  4JRQ A;  4FIB A;  4EMG A;  5A0G A;  4N0A C;  3PIP A;  2DO3 A;  2MWO A;  4RG2 A;  4E47 A;  1B34 A;  4JS5 A;  1FWZ A;  5LJ3 f;  2AHJ B;  5J3B A;  1M90 C;  2NLU A;  4M7A A;  3CC7 A;  2LVM A;  1KG1 A;  3PMI A;  1ZHI A;  4C92 G;  3OYB A;  5LJ5 h;  2ZPH B;  3M55 A;  1OZ2 A;  3DLL A;  3PT9 A;  2E10 A;  5A0D A;  4JLI A;  5D6Y A;  2RA2 A;  2JVV A;  1OZ3 A;  4PL6 A;  4XK8 E;  3TEE A;  2QEX A;  4A53 A;  4EMK B;  1ZBX A;  1VQ6 A;  3L42 A;  3CCR T;  2EWN A;  1LJO A;  3CBP A;  4M78 A;  4NOY A;  5HK0 A;  3TU4 K;  3CCV A;  2X4X A;  4XTY A;  1WPY A;  4II1 A;  4KUL A;  5CK9 A;  3OYL A;  2R5M A;  3CXC S;  3G71 A;  1VQ5 A;  4L59 A;  5GAN h;  2GCX A;  2E5Q A;  2RI2 A;  3P8H A;  3MEW A;  5AYF A;  3JCM d;  4J8O A;  2R58 A;  4IKF A;  3EAE A;  3JCM b;  3G6E T;  1Y7X A;  1UGS B;  2BKD N;  3FIF A;  1QVG S;  4J6X A;  3CCQ T;  3P8B B;  2L89 A;  4RKU E;  3Q1J A;  5GAM d;  1X6O A;  4NL3 A;  3GPL A;  4BE2 A;  2CZ7 B;  1U8R A;  4JS4 A;  1JJ2 S;  3T9N A;  3BW1 A;  2FHD A;  1S72 A;  2IVW A;  2MAM A;  1YCY A;  3X28 B;  2RJD A;  5LL6 S;  4M7D C;  3M56 A;  5CIU A;  3TRE A;  5FRN A;  2DZ9 A;  2RK1 A;  1EIF A;  4OB2 B;  1QP3 A;  1FX7 A;  4O5V A;  2A3L A;  3QJ6 A;  3JCM e;  4BDZ A;  2D6F A;  2PUO B;  2VXF A;  2DVE A;  5GAO n;  3AHU A;  1M1G A;  1I4K 1;  1PSE A;  3JCM W;  3RER A;  2RH2 A;  5A0L A;  5FRO A;  2OTL T;  2QXF A;  3OS1 A;  1LOJ A;  3V8J A;  2K5L A;  3S3O A;  1YHQ T;  1NZ9 A;  1VQN T;  5GAM e;  1Y96 A;  4M7D F;  3JB9 J;  4NL2 A;  4LD6 A;  1GXI E;  4E7K A;  4MZM A;  1IZ6 A;  3OA6 A;  3SDZ A;  3WVE B;  1VQL T;  1JB0 E;  2BUD A;  1N27 A;  4M75 E;  4XAX B;  1OYX A;  3FRN A;  1N9S A;  3NFC A;  2XK0 A;  5FU6 C;  4R55 A;  2JNG A;  2QQR A;  1YIT T;  4M7D D;  2JN0 A;  3CBO A;  3S6W A;  3LH0 A;  3X25 B;  3OYN A;  3C12 A;  2LTO A;  3MHX A;  1K73 U;  3QKJ A;  3QXE B;  2LT1 A;  4MZT A;  4M77 C;  2EAY A;  4QVZ A;  1H64 1;  4M7D B;  2RO0 A;  3NTH A;  4IUV A;  3FEO A;  3ASK A;  5LJ5 f;  1QVF S;  4ELY C;  1HK9 A;  2QTX A;  4Q5W A;  4ELZ C;  4FT2 A;  3QSU A;  2P4T A;  4C8Q F;  3MO8 A;  5DM7 R;  4J7I A;  1QP2 A;  2EJG A;  2XU8 A;  3G4S T;  3MCA B;  4M77 F;  4OB3 B;  5GAO m;  1NPP A;  3QJY A;  4Z02 A;  3OYK A;  5DLQ E;  3ME9 A;  2QEX T;  2FB7 A;  4HCC A;  3M9Q A;  3PNW C;  1VQ6 T;  3VUZ A;  4FM4 B;  1Q82 U;  3CCV T;  2P0Q A;  3FLG A;  4C8Q D;  1IRE B;  3MP1 A;  1K8A U;  3JB9 G;  1VQ7 T;  2ZPI B;  3CXC A;  2LC4 A;  1AHJ B;  1TH7 A;  1VQK A;  4M7A E;  2LX9 A;  1K73 C;  5FU6 B;  4M77 D;  1N8R U;  2EIF A;  3QUI A;  4M75 G;  4C8Q B;  2KSS A;  3C95 A;  3EFS A;  3V8L A;  2RK2 A;  4C92 C;  2XDB A;  3A8H B;  3GIB A;  5C6S A;  3VU3 C;  4L5G A;  2IG0 A;  4M77 B;  4RCC A;  3CME A;  3QBY A;  2VV5 A;  3L2Z A;  3CCU A;  3OY9 A;  2DK3 A;  3OYA A;  3QHS A;  4M78 E;  2VYT A;  3QG1 A;  2DTI A;  3J80 E;  2CKK A;  4CI0 C;  1VQO A;  1SSF A;  2CYZ B;  1KHC A;  4HKE A;  4C92 F;  5DY9 A;  1S72 T;  4L6V 5;  4BUG A;  4LDX A;  1VQ8 A;  3OMG A;  4E7J A;  1K8A C;  1KQ2 A;  3LGF A;  3MP6 A;  2XIC A;  3URG A;  3JCM J;  4EMK C;  2YHT A;  3OMC A;  1YBY A;  2Y4X A;  3OBY A;  3A8G B;  3JAM E;  1N8R C;  2QQB A;  1ZQ1 A;  4X9D A;  2RHY A;  2LNV A;  4J5Y A;  3J7A F;  3E9F A;  2M9U A;  3VYH B;  2X4W A;  3MP8 A;  1VQM A;  3SD4 A;  5GAN 4;  3OS2 A;  1P92 A;  2XDP A;  4M7A G;  3OYH A;  5CAI A;  2XHC A;  1I81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...