3MEVA

Crystal structure of sgf29 in complex with r2ak4me3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
175
structure length
175
Chain Sequence
b'GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 29 homolog
molecule tags Transcription
source organism Homo sapiens
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
total genus 34
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mevA02
4GY5A 3L2VA 4EDUA 4CRIA 3LYIA 4BE2A 5J39A 3Q1JA 4E7LA 4ZTFA 2X4WA 3MEAA 2E5QA 5CIUA 3LX7A 1WJQA 4N4HA 3MEVA 2L8DA 3OYLA 3H6ZA 4OVAA 2WACA 3M9QA 3QBYA 4BDZA 4E7HA 3ASKA 1MHNA 3H8ZA 2HQEA 3F70A 1OI1A 4BE0A 4X34A 4A4EA 2EFIA 1OZ2A 5FROA 4A4GA 4QVZA 4B9XA 4B9WA 2GF7A 5C6SA 4FL6A 4BE1A 3S3NA 4LD6A 4II1A 5C0MA 5D6WA 2K3YA 3DLMA 1SSFA 4E7JA 3E9GA 5KH6A 2LTOA 2RJDA 4RG2A 3OYJA 3L2UA 2X4YA 3FC3A 2RI5A 2XDPA 3FDRA 4PLLA 2B8AA 3NTHA 4QW2A 3OS0A 5D6YA 4E7IA 3OMCA 4N4GA 4UC4A 2FHDA 2QQRA 5IAYA 5D6XA 2M16A 2RHIA 3FEOA 3UT1A 5KE3A 2BIVA 3QJ6A 2D9TA 3C4SA 3L42A 3PNWC 4BD3A 3DB3A 2R58A 3UWNA 3SD4A 2EQUA 4IUPA 3OY9A 2RHZA 4PL6A 3L2WA 3BDLA 2RJEA 1WJRA 2RJCA 2RI3A 2RO0A 3OYKA 2EQJA 3OB9A 2XK0A 3OS1A 3L2RA 3E9FA 2L3RA 4A4HA 3PMIA 1KHCA 4IUUA 3OYHA 3OYBA 2X4XA 3OYFA 2HQXA 3OYDA 3NTKA 2GFAA 1RI0A 4QQDA 3OS2A 4BDYA 3ME9A 3OYNA 3GOXA 2NLUA 2YRVA 4NS5A 3CEYA 2R57A 2F5KA 3P8DA 5KCOA 5M9OA 4E7KA 3FLGA 2L89A 3P8HA 4BACA 3MEWA 3QKJA 3OQ5A 4L59A 4N4IA 2DAQA 3S6WA 2E6NA 3LGLA 3ZEHA 5FRMA 2LRQA 3O8VA 3MP6A 2X35A 2O4XA 3LGFA 2M0OA 3QIIA 1WGSA 2LDMA 2BUDA 2R5AA 2G3RA 3PFSA 3OYGA 1G5VA 1OYXA 4FU6A 3S3MA 2RHUA 2CKKA 2K3XA 3MEUA 4C5IA 2DIQA 1N27A 2RHXA 3MO8A 2PQWA 4ZTJA 4IUQA 3KUFA 1WJSA 3EAEA 3OYMA 2EKOA 3DB4A 4IKFA 4QQ6A 2VYTA 1H3ZA 3OYEA 2O4XB 4Z02A 2R5MA 4Q5WA 2LVMA 5FRNA 2M1HA 2P0KA 2LCCA 3MP8A 2DIGA 3OYIA 3LLRA 1XNIA 3MP1A 5KCHA 3LH0A 2IG0A 3OMGA 5KE2A 3L2QA 3NTIA 5J26A 2RJFA 3META 4C5EA 2QQSA 1OZ3A 3PMTA 2MWOA 5IN1A 2JZ2A 2BKDN 2RI2A 4IUTA 2EQMA 4IUVA 3OA6A 4C5GA 4A4FA 2MWPA 4PLIA 3S3OA 4QQGA 2GFUA 4C5HA 2EQKA 4HCZA 3OYCA 3OYAA 2JTFA 4IURA 2RHYA
chains in the Genus database with same CATH superfamily
4GY5A 1VQ9T 1WZOA 4OGEA 4PJOF 2BZ8A 3FRNA 1UFFA 2KRMA 4N4HA 2EWNA 5IXBA 2EAYA 5KYUA 3F70A 4DEYA 1GRIA 2ROTA 4OMOA 2AZVA 5LJ3j 1M30A 1VQPT 4FL6A 3TSWA 4LD6A 3CCEQ 1GXIE 2A28A 1YJ9Q 3R6OA 2DETA 1TH7A 2FZGB 4RG2A 1M2VA 4FCYA 5GAOr 1GBRA 3VS4A 1JEGA 1SHFA 3G6EA 3OW2A 1T0HA 5LJ5j 1AHJB 4PJOA 5DLQE 2QQBA 5GAOl 2QA4T 1YHQA 2JMAA 1VQLQ 1PNJA 5LJ5e 1VQ9Q 2RPNA 4OB3B 2KT1A 1FX7A 3QZ5B 1NPPA 1KQ2A 2QI2A 2ZPIB 2P0PA 3NTKA 4NL2A 4M7AA 3REBB 1H3HA 4PK4A 1JBMA 3OQ5A 3MJXA 5IH2A 4JS4A 4C92B 2LNHB 9ATCB 2FZCB 3G4SQ 1VQ7Q 1Y0MA 3GLXA 1X6BA 1VQ8A 1WIEA 1YFNA 2EKOA 2JS0A 5KYWB 3EG3A 2QEXQ 1H3ZA 4AFQC 2BE7D 1O75A 3HKSA 2F1LA 2QA4A 2EGAA 3JCMJ 4KGXB 2DIGA 2FPDA 1XNIA 1OV3A 2RQRA 5GAN2 3HHTB 3HFOA 2J7IA 2VGMA 4XK8E 5EC7A 1MNDA 3VS5A 2G6FX 1NM7A 3THKA 3QDRB 3BY7A 2JNGA 4N0AA 2EIFA 1QCOA 3C0CA 5LJ3f 1UG1A 1W70A 4JRPA 3T9NA 4KULA 2JVVA 4MZMA 3RDVA 4ZGDB 1I5OB 2JUFA 4Z89A 1JRIA 4ORZA 1B7TA 3V8KA 4XTXA 2MCNA 1SSFA 1MMNA 5I21A 2ZGWA 5KYYA 2DXUA 2NUZA 3CCMT 1C6VX 2MF2A 5LJ5f 3CC7Q 3RMQA 2QQRA 4XTWA 2A0FB 1TOVA 3A1PA 2DYBA 2J6OA 4F7UB 3VJPA 3JCMd 1Q82R 4J9HA 4F04B 3NMZC 3ZBDA 4JJDA 2Y4YA 3I56T 4PJOE 2V1QA 4AFUC 5GMKh 3OYHA 2KNBB 2Y4XA 1TS9A 2YRVA 2O2OA 4E7KA 2YWWA 1AD5A 2L89A 1M1FA 1M90C 2NUTB 2KR3A 1QVGA 1AWJA 1N8RR 4OP0A 5CCAA 1JU5C 4QVDA 3VYHB 1O9SA 2DILA 1OYXA 3CC7T 3M58A 1ZBJA 4M7DB 2DRMA 1NLPC 2CH4W 2J6FA 4J9FA 4C92A 1VQNA 1U8RA 4EMHA 2H8HA 1M3CA 3VU3C 4O6JA 2QYZA 2CP5A 3CD6Q 3M0PA 4Y92A 2PUOB 1W2BS 1KD1U 1QW1A 4AG2C 4FM4B 2YXYA 1VQMQ 1LOJA 2ESWA 3L2ZA 3X25B 2VC8A 1OOTA 1WHKA 4M78A 2RHYA 1NJIC 4AMCA 3JB9F 1YIJQ 3PIPA 3I5RA 2GQIA 2M02A 1YJ9A 4ELYC 1TUCA 2HQEA 2PVOB 1NBEB 4Z8AA 2K5IA 3HP9A 1W1FA 2EFIA 4LDYA 4A4GA 2GF7A 5GAN8 1VQKA 1ZA1B 3CMAQ 1ARKA 4M77A 1XJWB 3ER0A 2JXBA 1X2KA 3VRYA 2D8JA 2VXEA 2EJFA 4DBFA 4M77C 3URGA 3OBYA 4R56A 4M4ZA 4RUGA 4RTVA 4HVWA 2RQTA 3C4SA 1XQHA 5GAMj 1NPRA 1SRMA 1VIFA 4BD3A 2KRSA 2COYA 3EHRA 4E7SA 1BK2A 3SD4A 3L2WA 3JCMP 4PJNA 3OB9A 2XK0A 3L1AA 3OYDA 4M78C 1RI0A 4QT7A 2EYQA 3H41A 3EGXB 2LX7A 5GMKe 1G2BA 1BIBA 2JOYA 3LWHA 1VQ7A 4C0GA 4R55A 1V1CA 3EG2A 2YDLA 5IHIA 2XICA 4E47A 2CKKA 4E7ZA 1YITQ 2DIQA 1VQPA 4M7DA 1VQ6Q 1RAAB 1OX8A 1VUBA 3UA7A 4C8QD 2O4XB 4Z02A 3GPLA 4Q5WA 4OGCA 4KRTA 3SHWA 2O88A 1YJWT 1NG2A 2RA2A 4PNOA 2CYZB 2MWOA 1RACB 4NOYA 1QQJA 3EFRA 1PSEA 2J05A 2P4RA 4RCBA 4LD9K 2DLPA 4O5VA 4LUEA 4FW1A 1YHQT 2KY9A 2QAZA 4Y28E 2VGNA 2ZZDA 4OMNA 3VS1A 2JN0A 1WJQA 3H6ZA 3M9QA 4HVUA 3I5SA 4PKCC 5DLOA 3FJPA 1R0CB 4BY6B 2KMTA 4BI4A 3QXEB 5CQYA 4E7JA 2DJQA 2E64A 2RJDA 4IIOA 2CP6A 4QW2A 3EGDA 1NEGA 3OMCA 1Y7XA 3J7AF 5KE3A 3QJ6A 4DBQA 2ZCFB 4LE9A 3PNWC 2QG9B 3G7ZA 2DKGA 1WQWA 1YHQQ 1WHJA 4F7UG 2ZPFB 1M8VA 4J9IA 4J6YA 4RTUA 4HVVA 3CCSQ 3HPWA 5L23A 1VQ4Q 2OAUA 4BDYA 3HSBA 3OYNA 1Q86C 1YI2Q 3CEYA 1G3YA 1AT1B 2GBQA 2L3SA 1VOMA 4M75G 1BI3A 2CP3A 4L59A 2DXBA 2KVQG 4C0FA 5LJ5h 4BY6C 2O4XA 2WSFE 3VRZA 2D0NA 1EFNA 3E2UA 4D6WA 4MMKA 3G6ET 1HYOA 1M90R 2HBWA 2K6DA 4GLKA 4QQ6A 2RK2A 3V7RA 1ZX6A 1K76A 5FRNA 3VS7A 3V8LA 3MP1A 5FU6C 4KT0E 4KUDK 5J26A 1D0ZA 3M4GA 3CCST 1HJDA 1PD0A 1UJ0A 1TSFA 4MZTA 2VV5A 4A4FA 1AEYA 2LT4A 1Y96B 3CCQA 5GAOp 2EPDA 1D0YA 1SPKA 1Q7YU 5GAOm 1U3OA 1N8RC 1M9SA 2LMJA 4Z88A 3NGPA 1VQKQ 2PUKB 2RB6A 4J9BA 4BUGA 1ZSZB 4M7DD 1VQ5A 4XTUA 4J9EA 4RTZA 4C8QA 2KXCA 1W6XA 2LQKA 3IQLA 2DJZA 4KUIA 1OULA 3FDRA 4C92F 3CC7A 3M0RA 1K0XA 4JRQA 2DM1A 2D9TA 2E3HA 4DOWA 1ZUKA 1JJ2S 2FG0A 1Y57A 2AK5A 4OB2B 5ECAA 4AFZC 2IIMA 3PMIA 1ABQA 1BCMA 2E10A 2A3LA 3DLLA 2HKQB 1QMCA 1RAFB 2RN8A 5KCOA 5M9OA 3SB2A 1UUEA 2OTLQ 1BI2A 3SEMA 3QKJA 4QKUA 2EYZA 3JCMb 3CC2T 3MP6A 2X35A 4M75F 3BW1A 2BUDA 3CMEA 1GL5A 1QWFA 2HL3A 3S3MA 4X9CA 1VQ9A 2M0YA 2K7AA 1PM3A 4JLGA 1TTHB 2E3IA 5GANe 3VS3A 5A0LA 4FYXB 2XD0A 2YRCA 3EH1A 3RKXA 4PFPA 2XI9A 1KC8U 2CS7A 4IIMA 2IG0A 1PRMC 2YUPA 7AT1B 4E2FB 4E6RA 1M1GA 4J6WA 1ZBXA 4QQGA 3TQ7P 5LJ3e 1MMAA 4L6V5 5GMKj 1FWZA 1VQ8Q 4CRIA 2EJ9A 1YIJA 3QO3A 4PJOB 3CC2A 4BI3A 2XHCA 3CXCA 2VXFA 3SWNA 2ROLA 3CCVT 1CKBA 1MMGA 1QVGP 4BE0A 5HY6A 1TU0B 2IVWA 1X6GA 1MGQA 4FT4A 1YWOA 1M1KC 2RNAA 4X1VA 2JM9A 3CPWS 2JTMA 4XU0A 3FC3A 2B8AA 4X9DA 4A54A 1AWWA 1M3BA 2M16A 3G1JA 3BFMA 4M78F 2NUTA 3L42A 4V2SA 4M7AB 4F16A 3EG1A 3LW5E 2GTOA 3GNGA 2VKNA 4J9GA 3OY9A 2YHTA 1BI0A 1M5Q1 1IB8A 1VQ4A 2DMOA 1R0BG 4CC2A 2RO0A 1YIJT 3M57A 1RAIB 2LJ1A 2H3EB 3HTRA 5GAN6 3GOXA 1PSFA 3EH2A 1KG1A 5HKCA 2KGTA 2F2WA 1FMWA 2DEUA 3N5BB 4N4IA 4XAXB 2DAQA 4Y91A 3ZEHA 1WXTA 3CC4T 5FRMA 3O8VA 3CCJT 1S72T 3PT9A 3EGUA 1J3TA 2RQVA 3M59A 1Y71A 4VUBA 3CCRA 3M4YA 3A8GB 2WSCE 3OW2S 4MDWA 1NYGA 2LZ6B 4ZGJB 3I55A 2BE9B 4OB0B 3META 5CKBA 1JJ2P 1TXQA 3GIBA 1N9SA 4C5HA 1H8KA 2BZYA 2KK4A 1VQNQ 3OSVA 3LX7A 3MPUB 2OAWA 1MMDA 4HA8A 1YJNQ 1EX4A 4C92G 1KJWA 2X3WD 4E7HA 2CSIA 1MHNA 1OI1A 3OA6A 2E1HA 3PVLA 4FSXA 1RAGB 3LH5A 2O9SA 4A4KA 3QUIA 2A08A 1JQQA 2FHDA 2KQWA 5D6XA 2K2MA 1I81A 4XTYA 4F7UF 2K79A 5I2MA 2WSEE 4C92C 1MUZA 1UHFA 4JDSA 1UGPB 2LQ8A 4ZGEB 3EFSA 3X24B 1V76A 3MHXA 2PU9B 2FRWA 2LCLA 2RI3A 2QGFB 3OS1A 1KC8C 1BB9A 1QKXA 2OTLA 1TUGB 1ZUYA 3AT1B 3HRSA 2AZSA 1YI2A 2YUOA 4M75B 3QDFA 1RADB 3MEWA 3VS0A 1ZQ1A 4JUVA 1SEMA 2LRQA 5GMKl 2HQHA 3CCUQ 3RMSA 1CKAA 4ZNXA 1G5VA 1M2VB 3I9QA 1YCYA 1OX9A 2DL4A 2QASA 1GCQC 4M75C 1RAHB 1SG5A 3VV0A 1OPLA 4PJMA 3CCET 1N8RU 1GBQA 8ATCB 1U1TA 2R5MA 3X26B 2DRKA 3MKDA 2RM4A 1D09B 1Q82C 2PVDB 5GMKi 2YUQA 4PFOA 3D7SB 2JJ9A 4AT1B 1QVPA 4EDUA 1VQ6A 2CZ0B 3Q1JA 3MEAA 2E5QA 2YT6A 3G4ST 3NHNA 3SFMA 4GLMA 2WACA 2DERA 2FO0A 3C94A 2DD4A 2FRYA 1QVFP 3JB9G 4X34A 2BZXA 3JB9H 1V29B 4M78G 4HXJA 4M75D 3X20B 4DBHA 2E12A 1W4SA 3G71A 4PLLA 2SRCA 3OS0A 1Q82U 4E7IA 1VQ7T 5J3BA 1GFCA 1PCXA 2J06A 1WXBA 1OPKA 2HNIA 1SHGA 5KYXA 3DB3A 2EQUA 4BI8B 2P84A 1YP5A 2RHZA 4PL6A 1UB4A 4C8QE 3OYKA 1WJRA 3L2RA 3E9FA 4CC4B 1KHCA 3QYHB 3G4SA 1JB0E 2DEQA 2EVRA 4MZPA 1WDXA 3A8HB 4M7AC 3CPWA 2Z0WA 1SSHA 1K4US 3EG9B 3CMEQ 3CXCP 1WGSA 3PFSA 1X43A 1IREB 4XQ3A 2QXFA 2CH4A 3MEUA 4WF2A 4DBRA 2DL5A 3VUBA 3EG9A 4IKFA 3JCMW 2KBTA 1RLQC 2EJGA 4FW2A 5I11A 2RD1A 3CCMQ 1IGUA 1WPYA 2PZ1A 3LH0A 2F5TX 2AT1B 2QGGA 1WA7A 1OZ3A 4MMLA 2MYSA 5D7UA 1U5SA 3S3OA 3CCJA 3TU4K 4IURA 5CVIA 2L3PA 5FLXE 3UF4A 1ZSZA 5GAMg 3CC2Q 2EYWA 3JSCA 1LVKA 4ZTFA 1G3WA 2XMFA 1IO6A 1WLPB 1I8FA 2V26A 2PVGB 1QKWA 2DBKA 4J8OA 2L2PA 3L2VA 1K0SA 3SWNC 4RG8A 3UATA 4B9WA 1Z9QA 5GANd 4PJOG 2K3YA 4PJOD 2KROA 1S72A 3EHQA 1YN8A 3CCQQ 5GAN7 3V8JA 2XDPA 1XTDA 2HL5C 1K9MC 2K9GA 2C0IA 4N4GA 5CQXA 2JMCA 3H0IA 2L3QA 5HCKA 2V8KA 3M0SA 2GNCA 4FYWB 3UWNA 1PKSA 1SRLA 3I35A 2LJ0A 1NE8A 2KXDA 4OMFB 4FIBA 3BDLA 1QP3A 2X51A 1TUDA 2QQAA 4OB1B 3FJ5A 3RR6A 4ELZC 4JJCA 2MAMA 1QWEA 4RTWA 3P8DA 2XU8A 3ULRB 3WXMB 3P8HA 4BACA 2EYXA 1QVFA 3LGLA 2DTOA 3QJYA 3CMAT 1PG5B 2O01E 2X3XD 2K3BA 2M51A 2HKNA 2K4YA 2P4TA 3CCQT 1K8AR 2DL3A 2LDMA 3M54A 2G3RA 4FU6A 4BB7A 3H9NA 3CCRQ 1G8XA 1YWPA 5GAMd 1I4K1 1WJSA 2EYYA 3EAEA 2KDSA 1VQMA 2LQWA 2I0NA 5GANg 2C06A 3CCLT 2XG8D 2HDAA 4OMPA 5A0DA 2M1HA 2LCCA 1ZSZC 2D1XA 1BKBA 3OYIA 1KQSP 3OMGA 2DPPB 2E4HA 1M90U 2W10A 1KC8R 5IN1A 3U23A 4NL3A 2OTJT 3M55A 2GFUA 3OYCA 3CBPA 2CREA 5KYNA 2FPEA 1ZHIA 4EMGA 4E7LA 1BYMA 2ZPHB 1VYVA 2V1RA 4C8QF 1Q86R 3MEVA 1YJNA 3OYLA 5GAN5 3QBYA 4BDZA 2MK5A 4JRIA 4JZ4A 1OU9A 3JCMV 2RF0A 3AHUA 2NUPA 5C6SA 2V8JA 2QDLA 1VA7A 2IPOB 3JCMQ 3EGDB 1ACMB 3OYJA 2LX9A 2RK1A 2DZ9A 1YITT 1AWXA 2JT4A 4XU1A 4JRKA 2VWFA 1VQ6T 2OTJQ 3CCEA 5FU7C 3JCMf 2CSQA 1QCNA 2YLBA 1TWBA 5IHNA 2CZ7B 2XDBA 2JW4A 5GAMf 2COWA 4JS5A 4A4HA 3QG1A 1RI9A 1WX6A 1BCOA 1SKUB 1E7OA 3SWNB 1VQPQ 4JLIA 2MOXA 5FU6B 1K8AC 5GANj 3VUZA 2MPXC 1KQSA 5LJ3g 4MDXA 3EGXA 1M2OA 2COZA 1PKTA 3CCUA 5CKFA 2ED1A 1YCSB 3E19A 1VIEA 3QIIA 1ZLMA 5GAMe 1D3BA 1D0XA 3A8LB 4J9CA 4EMKC 2RHUA 3NPFA 3CQTA 4C5IA 2RHXA 4IUQA 1NEBA 3OYMA 2KI7A 1ZUUA 5CK9A 2FPFA 5KYXB 3BE3A 1H641 3M0TA 1VQLT 3JB9D 1F1BB 3PIOA 3LLRA 2K5FA 1VQOA 2YUNA 3JCMX 4C5EA 3WVDB 2E41A 1BU1A 2MIOA 3OS5A 1Q7YR 2EQKA 4HCZA 3OYAA 2QA4Q 4GBQA 1IZ6A 4ZN3A 3CCUT 5KYUB 4KH1B 3VS2A 4QVCA 1K9AA 1UEBA 5A2QE 3I55Q 1IHVA 4M75A 5L8RE 3H8ZA 2KYBA 2LNVA 1GCQA 4M7DE 4QVZA 4B9XA 5FWBA 4M78D 5C0MA 5FW9A 3DLMA 1Y96A 3BDUA 3L2UA 3HRUA 1K8AU 3MCAB 2RH2A 2CT4A 2PTKA 3CCSA 2RQWA 3J80E 3JAME 4EPCA 2ABLA 2DD5A 4M77D 2ZAEA 4ANJA 1X75C 1W2BA 4C8QB 2P0QA 1EIFA 4M7DC 2X9HA 3QHSA 3JCMg 3I55T 4RCCA 3FLGA 1E6GA 4F14A 3QSUA 4OMMA 4DEXA 2E70A 4LN2A 1LNXA 4M77E 1UDLA 2FB7A 1OEBA 1N27A 4PJJA 2PQWA 2K57A 2YSQA 2LP5A 3CBOA 2XDDA 1UGQB 3GNFB 3RERA 2CUBA 4HT8A 3CCMA 1JXOA 2CP7A 5KCHA 5LL6S 3INZA 1RUWA 3OYYA 5GAN3 4CC3A 2LJ3A 1KQSS 3ZFJA 4M78E 4LDXA 2EQMA 4ME7A 4M77G 2DTIA 4M78B 1P92A 1U1SA 5KYYB 2F2XA 2DXTA 5J39A 3I56Q 2X4WA 5CIUA 2HD0A 1PWTA 1C0MA 2L8DA 5AT1B 2E6ZA 3C95A 4M7AE 2DF6A 2OTLT 2QQ9A 1XOVA 5FROA 2PNIA 4F7UE 3S3NA 4L5GA 1PHTA 4JJBA 4KGVB 4A53A 1VYTA 1BIAA 4ZN1A 3JCMc 2E65A 5D6YA 1D1BA 4DA4A 3KBGA 1WHMA 2RMOA 2RHIA 2HAXA 2A7YA 2JS2A 1VQMT 5DM7R 4FYVB 4IUPA 1VYUA 2O9VA 3CD6T 1CSKA 4FSSA 1HD3A 4J83A 1RL2A 3TREA 2CP0A 3J81E 4HT9A 3OYBA 1TG0A 3OYFA 2RQUA 3OS2A 1SF9A 3G71Q 2FZKB 2NLUA 2EW3A 4NS5A 2FEIA 4XU2A 2XIDA 3M53A 2M9UA 1AZGB 1QLYA 3JB9J 1HXDA 1AWOA 2L0AA 2LT1A 3QYGB 3A8OB 1RABB 1Q81C 2DZCA 2ZPEB 3PGGA 4XU3A 3H0HA 3H0FA 4AG1C 5GJWB 5CKHA 2OX7A 4D8DA 1M27C 4HCBA 2DTHA 3DB4A 3EFOA 2VYTA 2K2VA 4XTZA 1YNZA 1C1AA 2HBPA 3MP8A 2DFUA 1QVFS 2QQSA 2V8IA 3EFOB 2C0TA 3G71T 1M4ZA 2RI2A 5CKEA 3JB9I 2HSPA 2LCSA 1S1NA 4PLIA 2GGRA 1MNEA 2JTEA 1IGQA 4FYYB 2YLCA 2A36A 1GCPA 5CAIA 1K9MU 1WHHA 5IT9E 3CC4A 2Y90A 1M1KU 4P5NA 5IHKA 2AIRB 4A4EA 1GFDA 2X4JA 4TVRA 1B34B 3EG0A 3RKYA 3E9GA 2VUBA 3CCLA 2LTOA 3CCJQ 1B34A 2MMPA 2RI5A 3RNJA 1YJWQ 1NZ9A 4RTTA 2DA9A 4LDWA 2J6KA 5CKDA 2BIVA 3E1SA 3P8BB 1D1CA 1IRXA 1AZEA 3VYGA 1VQOT 3RBBB 2NWMA 3FIFA 2CDTA 4EIKA 4HCKA 2HQXA 5GAOq 1YJNT 1PC0A 5GANh 3ZL7C 1FYNA 1JJ2A 1D1AA 2KEAA 1HSQA 1U06A 2E6NA 2LC4A 5LJ3h 1DJ7B 4AFSC 2DVEA 2ATCB 5GAN4 3TSZA 1JXMA 4C8QC 1WQ7A 1FMKA 1NYFA 1KD1R 2ZPBB 1UGVA 3KUFA 3CCVA 2HZYA 4ATOA 3QWYA 3OYEA 2EKHA 4LDVA 3GF5A 1VQOQ 3M5AA 4F7UA 4J7IA 4C92E 3HFNA 4PJOC 1QVGS 2LQNA 2RJFA 3CBMA 4A63B 2E5KA 1X01A 1Z9ZA 2FVUA 2DX1A 1YI2T 4IUVA 8AT1B 4OMQA 2DYIA 1E6HA 2DNUA 2NUPB 4BE2A 2AHJB 3PVQA 2C0OA 3OBWA 1K73U 3PTAA 2A37A 2XKOC 1VQ4T 3ASKA 3TVTA 2CT3A 1Q86U 1PD1A 4BE1A 1I07A 4M77B 5D6WA 1QP2A 5KYWA 3HL8A 3GBQA 5KH6A 3A98A 4WTOB 4JPBW 1BBZA 1KK7A 1X69A 5LJ3d 5HK0A 4RKUE 2B86A 2DL7A 3DKMA 4DOVA 1UJYA 2ED0A 1T3LA 1KFZA 2KAFA 3G6EQ 2DK3A 3UT1A 1NLOC 1RLPC 3JRZA 1RAEB 1VQ5Q 4LXCA 1UHCA 1UECA 2QEXT 5I2SA 4JJNK 2CUDA 4KH0B 1WXUA 2EBPA 1BI1A 4R0KA 1FXXA 1I1JA 2RJCA 3OSSC 1LJOA 2EQJA 3V7SA 4IUUA 4F17A 1I5LA 2X4XA 4D8KA 2YRDA 2HEQA 1KHIA 2GFAA 1MV0B 1WYXA 1VQKT 2F5KA 2VVKA 2DL8A 4WCIA 1Y07A 1JO8A 4KGZB 2D6FA 2OTJA 1X6OA 2DBMA 1NJIR 2DVJA 1WHLA 3MO8A 1N9RA 1VQ5T 1IXDA 1H92A 4RTXA 5A0GA 1MV3A 3RUXA 2QEXA 3JCMh 3KXTA 1Q81R 2P0KA 5CO7A 1G3TA 2CGHA 3CPWP 4M7AG 3NTIA 5IXFA 4OMLA 1K73R 1Q95G 1A0NB 5FU7B 4K11A 4J7FA 3CMAA 4C5GA 3A8MB 1AOJA 1K1ZA 2ZPGB 5FWCA 4M7AF 3I56A 3LYIA 1ABOA 2GCXA 3GP8A 3QWXX 2DE0X 2L5QA 4M7DF 3R6NA 4OVAA 2CZ1B 2KSSA 1OZ2A 1YJWA 4C8QG 2I2LA 1W2BP 3PE0A 3KFVA 3CMET 4JZ3A 1ZA2B 4DQ2A 2SEMA 5HK3A 2ENMA 5IAYA 3NFCA 4M75E 1T0JA 2KYMA 3VS6A 1KSWA 2R58A 4LDUA 4PJLA 4LNPA 2NYSA 3SDZA 4M7DG 1AVZC 1T3SA 1VQ8T 4EMKA 2KT8A 2RJEA 4YTLA 3UPUA 2L3RA 2EGEA 4J5YA 4QQDA 2FL7A 4C0DC 1VQLA 1I0CA 5LJ5d 2K5LA 4RTYA 1EZZB 4J9DA 2GTJA 2DO3A 2F69A 3VKIA 5LJ5g 2JM8A 4PFZA 3RKWA 3LGFA 2M0OA 3RESA 1QCFA 2KE9A 2H3JA 3OYGA 3CCVQ 2VB6A 2K3XA 1G83A 3TEEA 2QTVA 2QK0A 2CP2A 1UTIA 2HCKA 1B07A 3CD6A 3CXCS 1K73C 1N6AA 4C92D 5GANf 3JCMe 2BKDN 4IUTA 1LCKA 3RIRA 3UA6A 2JTFA 3HRTA 5GAMh 3UDCA 1KIKA 1D3BB 3CC4Q 3QPHA 3M0QA 2QTXA 1S72Q 4CI0C 2HMAA 1IHWA 4M77F 2QDYB 4M7AD 3TCJA 2AKKA 3WVEB 2KRNA 1KD1C 4HKEA 4B6MA 5GMKm 4II1A 3CCLQ 1B3QA 2VASA 2X4YA 4J6XA 1N5ZA 1R8OB 3NTHA 2D8HA 2F2VA 1UGSB 1X2QA 4HCCA 2CZ6B 1NJIU 4UC4A 5I22A 1WNLA 3CCRT 2FYKA 3X28B 2DXCA 3FEOA 2EQIA 4RMOA 1K9MR 3O5ZA 1WI7A 3QZ9B 1M1KR 5EG2A 4XTVA 4FT2A 3JV3A 1Q81U 4C0ZA 1VQNT 1YBYA 5DY9A 4EMKB 2ECZA 2W0ZA 1M8MA 5AYFA 3ME9A 5CR2A 1WFWA 2AKLA 3C12A 2R57A 4C0DB 1WHGA 2OI3A 1UE9A 1LPLA 3OW2P 3S6WA 1G3SA 3LWIA 4LUDA 1KQ1A 2R5AA 1M3AA 3CPFA 1R77A 2O31A 1YITA 3M56A 5GAOn 4ZTJA 3FB9A 1PRLC 3V7CA 4CC7A 1YJ9T 3M0UA 1Q7YC 4ESRA 2LVMA 1HK9A 1ZSGA 4N0AC 1X27A 4KBMB 5KE2A 3L2QA 6AT1B 2D0QB 2OJ2A 1UGRB 3PMTA 2MI6A 1FMVA 4OF1A 2EGCA 1OQKA 3REAB 2JZ2A 2HSEB 1OU8A 2MWPA 5GJVB 2BTTA 2GQVA 3A5ZB
chains in the Genus database with same CATH topology
4GY5A 2YLCA 5FLXE 5CAIA 4LDXA 1K9MU 5GAMg 1VQ9T 5IT9E 1Q7YU 3JSCA 4OGEA 4ZTFA 4PJOF 1G3WA 2Y90A 5GAOm 3CC4A 1N8RC 1M9SA 3FRNA 1M1KU 4N4HA 1I8FA 2PVGB 2EWNA 4P5NA 2EAYA 2PUKB 2RB6A 3F70A 4J8OA 4BUGA 5LJ3j 4A4EA 3L2VA 3SWNC 1VQPT 4RG8A 4B9WA 4M7DD 2X4JA 4FL6A 4TVRA 4LD6A 1B34B 1VQ5A 4XTUA 1GXIE 5GANd 4PJOG 2K3YA 4PJOD 4C8QA 3R6OA 3RKYA 3E9GA 1TH7A 2VUBA 3CCLA 2LQKA 2LTOA 2DJZA 1S72A 4KUIA 4RG2A 1B34A 5GAN7 2MMPA 2RI5A 1XTDA 2XDPA 3FDRA 3V8JA 4C92F 3CC7A 5GAOr 1NZ9A 1K9MC 4N4GA 5CQXA 4JRQA 3G6EA 3OW2A 4LDWA 5CKDA 2BIVA 2D9TA 4DOWA 3E1SA 2V8KA 3P8BB 1JJ2S 5LJ5j 1AHJB 4PJOA 5DLQE 3UWNA 4OB2B 2QQBA 3VYGA 5GAOl 1NE8A 2QA4T 1YHQA 4OMFB 4FIBA 3BDLA 1VQOT 5LJ5e 1QP3A 3FIFA 4OB3B 1FX7A 3PMIA 1NPPA 3QZ5B 1KQ2A 2QI2A 2QQAA 2ZPIB 2HQXA 4OB1B 2P0PA 3NTKA 2E10A 5GAOq 4ELZC 1YJNT 2A3LA 4NL2A 3DLLA 4M7AA 2MAMA 5GANh 3P8DA 5KCOA 1JJ2A 2XU8A 5M9OA 3SB2A 3WXMB 1BI2A 3P8HA 4BACA 3QKJA 1JBMA 3OQ5A 1QVFA 4JS4A 3JCMb 2E6NA 3LGLA 2DTOA 3QJYA 3CMAT 2LC4A 2O01E 5LJ3h 4C92B 3CC2T 1DJ7B 3MP6A 2P4TA 2K4YA 2DVEA 2X35A 4M75F 5GAN4 3CCQT 2LDMA 2BUDA 3BW1A 2G3RA 1WQ7A 3M54A 4C8QC 3CMEA 4FU6A 3GLXA 4BB7A 3S3MA 4X9CA 1VQ9A 5GAMd 1I4K1 2ZPBB 4JLGA 3KUFA 1VQ8A 1WJSA 3EAEA 3CCVA 2EKOA 2KDSA 1VQMA 5GANe 4ATOA 5GANg 2C06A 5A0LA 1H3ZA 2XD0A 3OYEA 3CCLT 2XG8D 3RKXA 1O75A 5A0DA 3HKSA 4LDVA 2QA4A 2M1HA 3GF5A 2LCCA 2XI9A 3JCMJ 1BKBA 3M5AA 4F7UA 2DIGA 3OYIA 1KC8U 1XNIA 2CS7A 4J7IA 2IG0A 3OMGA 3HFNA 4C92E 4PJOC 1QVGS 2DPPB 2RJFA 3CBMA 5GAN2 3HHTB 3HFOA 1M90U 2FVUA 1X01A 5IN1A 4NL3A 1YI2T 3OA6A 1M1GA 4IUVA 2OTJT 2VGMA 4J6WA 4XK8E 1ZBXA 4QQGA 3M55A 2GFUA 5LJ3e 3OYCA 3CBPA 4L6V5 5GMKj 1FWZA 3BY7A 3QDRB 4CRIA 4BE2A 1ZHIA 2EJ9A 2AHJB 2JNGA 2EIFA 4N0AA 4EMGA 3QO3A 4E7LA 1YIJA 4PJOB 3CC2A 1BYMA 2ZPHB 2XHCA 5LJ3f 3OBWA 4BI3A 3CXCA 4JRPA 1K73U 4C8QF 2VXFA 3SWNA 3CCVT 3MEVA 3T9NA 1YJNA 3OYLA 2XKOC 4KULA 5GAN5 3PTAA 1VQ4T 2JVVA 3QBYA 4MZMA 4ZGDB 4BDZA 2JUFA 3ASKA 4JRIA 4BE0A 5HY6A 1JRIA 3JCMV 1Q86U 3AHUA 5C6SA 2IVWA 2V8JA 4BE1A 4M77B 1MGQA 3V8KA 4XTXA 5D6WA 1QP2A 3JCMQ 1SSFA 4FT4A 1M1KC 3HL8A 5I21A 2ZGWA 5KH6A 2DXUA 3CPWS 5LJ3d 5HK0A 3OYJA 3CCMT 2JTMA 4RKUE 4XU0A 3FC3A 2LX9A 2B8AA 3DKMA 2MF2A 4X9DA 4A54A 4DOVA 2RK1A 5LJ5f 2DZ9A 2KAFA 3RMQA 2QQRA 1YITT 2M16A 4XTWA 2DK3A 4M78F 3BFMA 3UT1A 4F7UB 3JCMd 4XU1A 4JRKA 3VJPA 3JRZA 3L42A 1VQ6T 3CCEA 5FU7C 4M7AB 3JCMf 2QEXT 3LW5E 4V2SA 5I2SA 3GNGA 4JJNK 3ZBDA 3OY9A 1BI0A 1M5Q1 2YLBA 1BI1A 2Y4YA 2CZ7B 1FXXA 2YHTA 1VQ4A 2XDBA 5GAMf 3I56T 2RJCA 2RO0A 3OSSC 4PJOE 1LJOA 2EQJA 3V7SA 4JS5A 1YIJT 4A4HA 5GMKh 4IUUA 3OYHA 3M57A 2X4XA 3QG1A 1I5LA 2Y4XA 1KHIA 2GFAA 5GAN6 3GOXA 1PSFA 2YRVA 1VQKT 2F5KA 4E7KA 1KG1A 5HKCA 3SWNB 2L89A 1M1FA 4JLIA 1M90C 3N5BB 5FU6B 1Y07A 4N4IA 1QVGA 4XAXB 5GANj 2DAQA 1K8AC 3VUZA 1KQSA 5LJ3g 2D6FA 4MDXA 4Y91A 2OTJA 3ZEHA 3CC4T 1X6OA 3CCUA 3O8VA 4OP0A 5CKFA 5CCAA 3CCJT 3E19A 1S72T 3PT9A 1VIEA 3QIIA 4QVDA 3VYHB 5GAMe 1O9SA 1D3BA 3CC7T 1OYXA 3A8LB 3M58A 4EMKC 2RHUA 3M59A 1Y71A 4VUBA 4C5IA 4M7DB 3CCRA 3M4YA 2RHXA 3A8GB 3MO8A 1N9RA 4IUQA 3OYMA 2WSCE 1VQ5T 3OW2S 4C92A 1VQNA 5A0GA 4EMHA 1U8RA 3RUXA 5CK9A 4MDWA 3VU3C 4O6JA 2QEXA 1H641 3JCMh 3KXTA 2P0KA 1VQLT 3JB9D 5CO7A 3PIOA 4ZGJB 3LLRA 1G3TA 2K5FA 2CGHA 2PUOB 3I55A 1VQOA 1W2BS 4M7AG 3NTIA 4OB0B 3JCMX 1KD1U 3META 5CKBA 4C5EA 3WVDB 1QW1A 5FU7B 4FM4B 2E41A 1LOJA 3GIBA 4J7FA 3CMAA 4C5GA 3A8MB 3L2ZA 3OS5A 3X25B 2VC8A 1N9SA 4C5HA 2EQKA 2ZPGB 4HCZA 3OYAA 4M78A 2RHYA 1NJIC 4M7AF 3I56A 3LYIA 2GCXA 3JB9F 2KK4A 3GP8A 1IZ6A 4ZN3A 3CCUT 3OSVA 3LX7A 2L5QA 4M7DF 4QVCA 3PIPA 1UEBA 5A2QE 4HA8A 4OVAA 4C92G 4E7HA 1YJ9A 4ELYC 4M75A 1MHNA 3H8ZA 2HQEA 2PVOB 1OI1A 2LNVA 5L8RE 2CZ1B 2K5IA 3HP9A 2EFIA 1OZ2A 2KSSA 4LDYA 4QVZA 4A4GA 4B9XA 2E1HA 2GF7A 1YJWA 4M78D 4M7DE 4C8QG 5GAN8 5C0MA 3DLMA 1VQKA 1Y96A 2I2LA 3BDUA 4M77A 4FSXA 3ER0A 3L2UA 3CMET 4DQ2A 3HRUA 2VXEA 1K8AU 2EJFA 3MCAB 4M77C 2RH2A 4A4KA 5HK3A 3URGA 3QUIA 2FHDA 3OBYA 2KQWA 5IAYA 4R56A 5D6XA 3NFCA 1I81A 3CCSA 4XTYA 4M75E 3C4SA 4F7UF 1XQHA 5GAMj 5I2MA 2WSEE 4C92C 3J80E 1NPRA 1VIFA 3JAME 4EPCA 4BD3A 2DD5A 4JDSA 2R58A 4LDUA 1UGPB 2LQ8A 3SD4A 4ZGEB 4M77D 3EFSA 3SDZA 3X24B 4M7DG 3L2WA 1VQ8T 1X75C 3MHXA 4EMKA 1W2BA 2PU9B 2LCLA 2RJEA 2RI3A 4YTLA 4C8QB 3JCMP 2P0QA 1EIFA 3OB9A 2XK0A 3OS1A 3UPUA 2L3RA 3L1AA 1KC8C 2OTLA 3OYDA 4M7DC 3HRSA 4J5YA 1RI0A 2FL7A 4M78C 4QQDA 4C0DC 3QHSA 1YI2A 5LJ5d 3JCMg 1VQLA 2K5LA 3I55T 4RCCA 3FLGA 2EYQA 4M75B 3MEWA 5GMKe 3QSUA 1BIBA 2JOYA 3LWHA 1ZQ1A 4C0GA 2DO3A 2F69A 4R55A 1VQ7A 3VKIA 5LJ5g 2E70A 4JUVA 2LRQA 5GMKl 3RKWA 3LGFA 2M0OA 3RESA 3RMSA 2H3JA 3OYGA 1G5VA 2XICA 1YCYA 1LNXA 4E47A 2CKKA 2K3XA 4M77E 3TEEA 2FB7A 2DIQA 1N27A 4M75C 2PQWA 1VQPA 2K57A 4M7DA 3CBOA 3VV0A 2XDDA 1VUBA 3CCET 1N8RU 1UGQB 4C8QD 2O4XB 4Z02A 1U1TA 3GNFB 2R5MA 5FRMA 3X26B 3GPLA 3RERA 4Q5WA 4HT8A 3CCMA 4OGCA 2RM4A 3CD6A 3CXCS 1YJWT 1K73C 5KCHA 1N6AA 4C92D 5LL6S 2RA2A 5GANf 1Q82C 2PVDB 2CYZB 4PNOA 3INZA 3OYYA 5GMKi 3JCMe 5GAN3 2MWOA 1KQSS 3ZFJA 4M78E 2BKDN 4NOYA 3EFRA 4IUTA 2EQMA 4ME7A 4M77G 2DTIA 1PSEA 4M78B 4RCBA 1P92A 1U1SA 4O5VA 4LD9K 3RIRA 1QVPA 2JTFA 2DXTA 3HRTA 5GAMh 3UDCA 1YHQT 3JB9H 1D3BB 4EDUA 1VQ6A 2KY9A 5J39A 4Y28E 2CZ0B 2VGNA 3Q1JA 3QPHA 2X4WA 2QTXA 2E5QA 2ZZDA 3MEAA 2HD0A 5CIUA 4CI0C 3G4ST 3SFMA 2JN0A 1WJQA 2L8DA 4M77F 3H6ZA 2QDYB 2WACA 3M9QA 2E6ZA 3C95A 4M7AE 3C94A 2DD4A 4M7AD 3TCJA 3JB9G 3WVEB 4PKCC 4X34A 2OTLT 2QQ9A 1XOVA 5FROA 4HKEA 4F7UE 1V29B 5DLOA 1KD1C 4M78G 5GMKm 3S3NA 3FJPA 4L5GA 2KMTA 4II1A 3QXEB 4BI4A 5CQYA 4BY6B 4A53A 4E7JA 1BIAA 4ZN1A 3JCMc 4M75D 2E64A 2RJDA 3X20B 2E65A 2E12A 1W4SA 2X4YA 4J6XA 4PLLA 4QW2A 3G71A 1R8OB 3NTHA 3OS0A 1Q82U 5D6YA 4E7IA 4DA4A 3OMCA 1VQ7T 1UGSB 5J3BA 4HCCA 3KBGA 1Y7XA 2CZ6B 1NJIU 4UC4A 1WNLA 3CCRT 3J7AF 2RHIA 2FYKA 3X28B 2DXCA 3FEOA 4RMOA 2HAXA 5KE3A 3QJ6A 2A7YA 2ZCFB 1VQMT 2HNIA 3PNWC 3QZ9B 3G7ZA 3DB3A 5DM7R 2DKGA 5EG2A 1WQWA 2EQUA 4BI8B 4IUPA 3CD6T 4F7UG 2ZPFB 2RHZA 4PL6A 4XTVA 1M8VA 1UB4A 4FT2A 4C8QE 3OYKA 1WJRA 1Q81U 4J83A 4C0ZA 4J6YA 1RL2A 3TREA 3L2RA 1VQNT 1YBYA 3E9FA 5DY9A 4EMKB 3J81E 1KHCA 3QYHB 4HT9A 3OYBA 3OYFA 3HPWA 3G4SA 3HSBA 3OS2A 2OAUA 4BDYA 5AYFA 3ME9A 3OYNA 1JB0E 2NLUA 5CR2A 2DEQA 3C12A 3CEYA 2R57A 4NS5A 1Q86C 4XU2A 1G3YA 4MZPA 2XIDA 3M53A 4C0DB 4M75G 2M9UA 1BI3A 4L59A 3JB9J 2DXBA 2KVQG 1HXDA 3A8HB 3S6WA 1G3SA 4C0FA 3CPWA 5LJ5h 4M7AC 2LT1A 3QYGB 4BY6C 3A8OB 3LWIA 2O4XA 2WSFE 1WGSA 3PFSA 1KQ1A 2R5AA 1IREB 2DZCA 1Q81C 2ZPEB 3CPFA 2QXFA 3PGGA 4XQ3A 4XU3A 4D6WA 3MEUA 4MMKA 3G6ET 4WF2A 1YITA 3M56A 5GAOn 5CKHA 4ZTJA 3FB9A 3VUBA 4GLKA 4HCBA 2DTHA 3DB4A 4IKFA 4QQ6A 2VYTA 2RK2A 2K2VA 3V7RA 3V7CA 1YJ9T 4XTZA 3JCMW 1Q7YC 2EJGA 2LVMA 5FRNA 1HK9A 2RD1A 4N0AC 2HBPA 1WPYA 3MP8A 3V8LA 4KBMB 3MP1A 5KE2A 3LH0A 5FU6C 3L2QA 1QVFS 4KT0E 4KUDK 2F5TX 5J26A 3M4GA 3CCST 2D0QB 2QQSA 2V8IA 1OZ3A 1UGRB 4MMLA 3PMTA 2MI6A 4OF1A 3G71T 4MZTA 2JZ2A 1M4ZA 2RI2A 5CKEA 3JB9I 2VV5A 4A4FA 2MWPA 2LT4A 4PLIA 1Y96B 3CCJA 3S3OA 2GQVA 3CCQA 5GAOp 3A5ZB 3TU4K 4IURA 5CVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GY5 A;  3L2V A;  4EDU A;  4CRI A;  3LYI A;  4BE2 A;  5J39 A;  3Q1J A;  4E7L A;  4ZTF A;  2X4W A;  3MEA A;  2E5Q A;  5CIU A;  3LX7 A;  1WJQ A;  4N4H A;  3MEV A;  2L8D A;  3OYL A;  3H6Z A;  4OVA A;  2WAC A;  3M9Q A;  3QBY A;  4BDZ A;  4E7H A;  3ASK A;  1MHN A;  3H8Z A;  2HQE A;  3F70 A;  1OI1 A;  4BE0 A;  4X34 A;  4A4E A;  2EFI A;  1OZ2 A;  5FRO A;  4A4G A;  4QVZ A;  4B9X A;  4B9W A;  2GF7 A;  5C6S A;  4FL6 A;  4BE1 A;  3S3N A;  4LD6 A;  4II1 A;  5C0M A;  5D6W A;  2K3Y A;  3DLM A;  1SSF A;  4E7J A;  3E9G A;  5KH6 A;  2LTO A;  2RJD A;  4RG2 A;  3OYJ A;  3L2U A;  2X4Y A;  3FC3 A;  2RI5 A;  2XDP A;  3FDR A;  4PLL A;  2B8A A;  3NTH A;  4QW2 A;  3OS0 A;  5D6Y A;  4E7I A;  3OMC A;  4N4G A;  4UC4 A;  2FHD A;  2QQR A;  5IAY A;  5D6X A;  2M16 A;  2RHI A;  3FEO A;  3UT1 A;  5KE3 A;  2BIV A;  3QJ6 A;  2D9T A;  3C4S A;  3L42 A;  3PNW C;  4BD3 A;  3DB3 A;  2R58 A;  3UWN A;  3SD4 A;  2EQU A;  4IUP A;  3OY9 A;  2RHZ A;  4PL6 A;  3L2W A;  3BDL A;  2RJE A;  1WJR A;  2RJC A;  2RI3 A;  2RO0 A;  3OYK A;  2EQJ A;  3OB9 A;  2XK0 A;  3OS1 A;  3L2R A;  3E9F A;  2L3R A;  4A4H A;  3PMI A;  1KHC A;  4IUU A;  3OYH A;  3OYB A;  2X4X A;  3OYF A;  2HQX A;  3OYD A;  3NTK A;  2GFA A;  1RI0 A;  4QQD A;  3OS2 A;  4BDY A;  3ME9 A;  3OYN A;  3GOX A;  2NLU A;  2YRV A;  4NS5 A;  3CEY A;  2R57 A;  2F5K A;  3P8D A;  5KCO A;  5M9O A;  4E7K A;  3FLG A;  2L89 A;  3P8H A;  4BAC A;  3MEW A;  3QKJ A;  3OQ5 A;  4L59 A;  4N4I A;  2DAQ A;  3S6W A;  2E6N A;  3LGL A;  3ZEH A;  5FRM A;  2LRQ A;  3O8V A;  3MP6 A;  2X35 A;  2O4X A;  3LGF A;  2M0O A;  3QII A;  1WGS A;  2LDM A;  2BUD A;  2R5A A;  2G3R A;  3PFS A;  3OYG A;  1G5V A;  1OYX A;  4FU6 A;  3S3M A;  2RHU A;  2CKK A;  2K3X A;  3MEU A;  4C5I A;  2DIQ A;  1N27 A;  2RHX A;  3MO8 A;  2PQW A;  4ZTJ A;  4IUQ A;  3KUF A;  1WJS A;  3EAE A;  3OYM A;  2EKO A;  3DB4 A;  4IKF A;  4QQ6 A;  2VYT A;  1H3Z A;  3OYE A;  2O4X B;  4Z02 A;  2R5M A;  4Q5W A;  2LVM A;  5FRN A;  2M1H A;  2P0K A;  2LCC A;  3MP8 A;  2DIG A;  3OYI A;  3LLR A;  1XNI A;  3MP1 A;  5KCH A;  3LH0 A;  2IG0 A;  3OMG A;  5KE2 A;  3L2Q A;  3NTI A;  5J26 A;  2RJF A;  3MET A;  4C5E A;  2QQS A;  1OZ3 A;  3PMT A;  2MWO A;  5IN1 A;  2JZ2 A;  2BKD N;  2RI2 A;  4IUT A;  2EQM A;  4IUV A;  3OA6 A;  4C5G A;  4A4F A;  2MWP A;  4PLI A;  3S3O A;  4QQG A;  2GFU A;  4C5H A;  2EQK A;  4HCZ A;  3OYC A;  3OYA A;  2JTF A;  4IUR A;  2RHY A; 
#chains in the Genus database with same CATH topology
 4GY5 A;  1VQ9 T;  1WZO A;  4OGE A;  4PJO F;  2BZ8 A;  3FRN A;  1UFF A;  2KRM A;  4N4H A;  2EWN A;  5IXB A;  2EAY A;  5KYU A;  3F70 A;  4DEY A;  1GRI A;  2ROT A;  4OMO A;  2AZV A;  5LJ3 j;  1M30 A;  1VQP T;  4FL6 A;  3TSW A;  4LD6 A;  3CCE Q;  1GXI E;  2A28 A;  1YJ9 Q;  3R6O A;  2DET A;  1TH7 A;  2FZG B;  4RG2 A;  1M2V A;  4FCY A;  5GAO r;  1GBR A;  3VS4 A;  1JEG A;  1SHF A;  3G6E A;  3OW2 A;  1T0H A;  5LJ5 j;  1AHJ B;  4PJO A;  5DLQ E;  2QQB A;  5GAO l;  2QA4 T;  1YHQ A;  2JMA A;  1VQL Q;  1PNJ A;  5LJ5 e;  1VQ9 Q;  2RPN A;  4OB3 B;  2KT1 A;  1FX7 A;  3QZ5 B;  1NPP A;  1KQ2 A;  2QI2 A;  2ZPI B;  2P0P A;  3NTK A;  4NL2 A;  4M7A A;  3REB B;  1H3H A;  4PK4 A;  1JBM A;  3OQ5 A;  3MJX A;  5IH2 A;  4JS4 A;  4C92 B;  2LNH B;  9ATC B;  2FZC B;  3G4S Q;  1VQ7 Q;  1Y0M A;  3GLX A;  1X6B A;  1VQ8 A;  1WIE A;  1YFN A;  2EKO A;  2JS0 A;  5KYW B;  3EG3 A;  2QEX Q;  1H3Z A;  4AFQ C;  2BE7 D;  1O75 A;  3HKS A;  2F1L A;  2QA4 A;  2EGA A;  3JCM J;  4KGX B;  2DIG A;  2FPD A;  1XNI A;  1OV3 A;  2RQR A;  5GAN 2;  3HHT B;  3HFO A;  2J7I A;  2VGM A;  4XK8 E;  5EC7 A;  1MND A;  3VS5 A;  2G6F X;  1NM7 A;  3THK A;  3QDR B;  3BY7 A;  2JNG A;  4N0A A;  2EIF A;  1QCO A;  3C0C A;  5LJ3 f;  1UG1 A;  1W70 A;  4JRP A;  3T9N A;  4KUL A;  2JVV A;  4MZM A;  3RDV A;  4ZGD B;  1I5O B;  2JUF A;  4Z89 A;  1JRI A;  4ORZ A;  1B7T A;  3V8K A;  4XTX A;  2MCN A;  1SSF A;  1MMN A;  5I21 A;  2ZGW A;  5KYY A;  2DXU A;  2NUZ A;  3CCM T;  1C6V X;  2MF2 A;  5LJ5 f;  3CC7 Q;  3RMQ A;  2QQR A;  4XTW A;  2A0F B;  1TOV A;  3A1P A;  2DYB A;  2J6O A;  4F7U B;  3VJP A;  3JCM d;  1Q82 R;  4J9H A;  4F04 B;  3NMZ C;  3ZBD A;  4JJD A;  2Y4Y A;  3I56 T;  4PJO E;  2V1Q A;  4AFU C;  5GMK h;  3OYH A;  2KNB B;  2Y4X A;  1TS9 A;  2YRV A;  2O2O A;  4E7K A;  2YWW A;  1AD5 A;  2L89 A;  1M1F A;  1M90 C;  2NUT B;  2KR3 A;  1QVG A;  1AWJ A;  1N8R R;  4OP0 A;  5CCA A;  1JU5 C;  4QVD A;  3VYH B;  1O9S A;  2DIL A;  1OYX A;  3CC7 T;  3M58 A;  1ZBJ A;  4M7D B;  2DRM A;  1NLP C;  2CH4 W;  2J6F A;  4J9F A;  4C92 A;  1VQN A;  1U8R A;  4EMH A;  2H8H A;  1M3C A;  3VU3 C;  4O6J A;  2QYZ A;  2CP5 A;  3CD6 Q;  3M0P A;  4Y92 A;  2PUO B;  1W2B S;  1KD1 U;  1QW1 A;  4AG2 C;  4FM4 B;  2YXY A;  1VQM Q;  1LOJ A;  2ESW A;  3L2Z A;  3X25 B;  2VC8 A;  1OOT A;  1WHK A;  4M78 A;  2RHY A;  1NJI C;  4AMC A;  3JB9 F;  1YIJ Q;  3PIP A;  3I5R A;  2GQI A;  2M02 A;  1YJ9 A;  4ELY C;  1TUC A;  2HQE A;  2PVO B;  1NBE B;  4Z8A A;  2K5I A;  3HP9 A;  1W1F A;  2EFI A;  4LDY A;  4A4G A;  2GF7 A;  5GAN 8;  1VQK A;  1ZA1 B;  3CMA Q;  1ARK A;  4M77 A;  1XJW B;  3ER0 A;  2JXB A;  1X2K A;  3VRY A;  2D8J A;  2VXE A;  2EJF A;  4DBF A;  4M77 C;  3URG A;  3OBY A;  4R56 A;  4M4Z A;  4RUG A;  4RTV A;  4HVW A;  2RQT A;  3C4S A;  1XQH A;  5GAM j;  1NPR A;  1SRM A;  1VIF A;  4BD3 A;  2KRS A;  2COY A;  3EHR A;  4E7S A;  1BK2 A;  3SD4 A;  3L2W A;  3JCM P;  4PJN A;  3OB9 A;  2XK0 A;  3L1A A;  3OYD A;  4M78 C;  1RI0 A;  4QT7 A;  2EYQ A;  3H41 A;  3EGX B;  2LX7 A;  5GMK e;  1G2B A;  1BIB A;  2JOY A;  3LWH A;  1VQ7 A;  4C0G A;  4R55 A;  1V1C A;  3EG2 A;  2YDL A;  5IHI A;  2XIC A;  4E47 A;  2CKK A;  4E7Z A;  1YIT Q;  2DIQ A;  1VQP A;  4M7D A;  1VQ6 Q;  1RAA B;  1OX8 A;  1VUB A;  3UA7 A;  4C8Q D;  2O4X B;  4Z02 A;  3GPL A;  4Q5W A;  4OGC A;  4KRT A;  3SHW A;  2O88 A;  1YJW T;  1NG2 A;  2RA2 A;  4PNO A;  2CYZ B;  2MWO A;  1RAC B;  4NOY A;  1QQJ A;  3EFR A;  1PSE A;  2J05 A;  2P4R A;  4RCB A;  4LD9 K;  2DLP A;  4O5V A;  4LUE A;  4FW1 A;  1YHQ T;  2KY9 A;  2QAZ A;  4Y28 E;  2VGN A;  2ZZD A;  4OMN A;  3VS1 A;  2JN0 A;  1WJQ A;  3H6Z A;  3M9Q A;  4HVU A;  3I5S A;  4PKC C;  5DLO A;  3FJP A;  1R0C B;  4BY6 B;  2KMT A;  4BI4 A;  3QXE B;  5CQY A;  4E7J A;  2DJQ A;  2E64 A;  2RJD A;  4IIO A;  2CP6 A;  4QW2 A;  3EGD A;  1NEG A;  3OMC A;  1Y7X A;  3J7A F;  5KE3 A;  3QJ6 A;  4DBQ A;  2ZCF B;  4LE9 A;  3PNW C;  2QG9 B;  3G7Z A;  2DKG A;  1WQW A;  1YHQ Q;  1WHJ A;  4F7U G;  2ZPF B;  1M8V A;  4J9I A;  4J6Y A;  4RTU A;  4HVV A;  3CCS Q;  3HPW A;  5L23 A;  1VQ4 Q;  2OAU A;  4BDY A;  3HSB A;  3OYN A;  1Q86 C;  1YI2 Q;  3CEY A;  1G3Y A;  1AT1 B;  2GBQ A;  2L3S A;  1VOM A;  4M75 G;  1BI3 A;  2CP3 A;  4L59 A;  2DXB A;  2KVQ G;  4C0F A;  5LJ5 h;  4BY6 C;  2O4X A;  2WSF E;  3VRZ A;  2D0N A;  1EFN A;  3E2U A;  4D6W A;  4MMK A;  3G6E T;  1HYO A;  1M90 R;  2HBW A;  2K6D A;  4GLK A;  4QQ6 A;  2RK2 A;  3V7R A;  1ZX6 A;  1K76 A;  5FRN A;  3VS7 A;  3V8L A;  3MP1 A;  5FU6 C;  4KT0 E;  4KUD K;  5J26 A;  1D0Z A;  3M4G A;  3CCS T;  1HJD A;  1PD0 A;  1UJ0 A;  1TSF A;  4MZT A;  2VV5 A;  4A4F A;  1AEY A;  2LT4 A;  1Y96 B;  3CCQ A;  5GAO p;  2EPD A;  1D0Y A;  1SPK A;  1Q7Y U;  5GAO m;  1U3O A;  1N8R C;  1M9S A;  2LMJ A;  4Z88 A;  3NGP A;  1VQK Q;  2PUK B;  2RB6 A;  4J9B A;  4BUG A;  1ZSZ B;  4M7D D;  1VQ5 A;  4XTU A;  4J9E A;  4RTZ A;  4C8Q A;  2KXC A;  1W6X A;  2LQK A;  3IQL A;  2DJZ A;  4KUI A;  1OUL A;  3FDR A;  4C92 F;  3CC7 A;  3M0R A;  1K0X A;  4JRQ A;  2DM1 A;  2D9T A;  2E3H A;  4DOW A;  1ZUK A;  1JJ2 S;  2FG0 A;  1Y57 A;  2AK5 A;  4OB2 B;  5ECA A;  4AFZ C;  2IIM A;  3PMI A;  1ABQ A;  1BCM A;  2E10 A;  2A3L A;  3DLL A;  2HKQ B;  1QMC A;  1RAF B;  2RN8 A;  5KCO A;  5M9O A;  3SB2 A;  1UUE A;  2OTL Q;  1BI2 A;  3SEM A;  3QKJ A;  4QKU A;  2EYZ A;  3JCM b;  3CC2 T;  3MP6 A;  2X35 A;  4M75 F;  3BW1 A;  2BUD A;  3CME A;  1GL5 A;  1QWF A;  2HL3 A;  3S3M A;  4X9C A;  1VQ9 A;  2M0Y A;  2K7A A;  1PM3 A;  4JLG A;  1TTH B;  2E3I A;  5GAN e;  3VS3 A;  5A0L A;  4FYX B;  2XD0 A;  2YRC A;  3EH1 A;  3RKX A;  4PFP A;  2XI9 A;  1KC8 U;  2CS7 A;  4IIM A;  2IG0 A;  1PRM C;  2YUP A;  7AT1 B;  4E2F B;  4E6R A;  1M1G A;  4J6W A;  1ZBX A;  4QQG A;  3TQ7 P;  5LJ3 e;  1MMA A;  4L6V 5;  5GMK j;  1FWZ A;  1VQ8 Q;  4CRI A;  2EJ9 A;  1YIJ A;  3QO3 A;  4PJO B;  3CC2 A;  4BI3 A;  2XHC A;  3CXC A;  2VXF A;  3SWN A;  2ROL A;  3CCV T;  1CKB A;  1MMG A;  1QVG P;  4BE0 A;  5HY6 A;  1TU0 B;  2IVW A;  1X6G A;  1MGQ A;  4FT4 A;  1YWO A;  1M1K C;  2RNA A;  4X1V A;  2JM9 A;  3CPW S;  2JTM A;  4XU0 A;  3FC3 A;  2B8A A;  4X9D A;  4A54 A;  1AWW A;  1M3B A;  2M16 A;  3G1J A;  3BFM A;  4M78 F;  2NUT A;  3L42 A;  4V2S A;  4M7A B;  4F16 A;  3EG1 A;  3LW5 E;  2GTO A;  3GNG A;  2VKN A;  4J9G A;  3OY9 A;  2YHT A;  1BI0 A;  1M5Q 1;  1IB8 A;  1VQ4 A;  2DMO A;  1R0B G;  4CC2 A;  2RO0 A;  1YIJ T;  3M57 A;  1RAI B;  2LJ1 A;  2H3E B;  3HTR A;  5GAN 6;  3GOX A;  1PSF A;  3EH2 A;  1KG1 A;  5HKC A;  2KGT A;  2F2W A;  1FMW A;  2DEU A;  3N5B B;  4N4I A;  4XAX B;  2DAQ A;  4Y91 A;  3ZEH A;  1WXT A;  3CC4 T;  5FRM A;  3O8V A;  3CCJ T;  1S72 T;  3PT9 A;  3EGU A;  1J3T A;  2RQV A;  3M59 A;  1Y71 A;  4VUB A;  3CCR A;  3M4Y A;  3A8G B;  2WSC E;  3OW2 S;  4MDW A;  1NYG A;  2LZ6 B;  4ZGJ B;  3I55 A;  2BE9 B;  4OB0 B;  3MET A;  5CKB A;  1JJ2 P;  1TXQ A;  3GIB A;  1N9S A;  4C5H A;  1H8K A;  2BZY A;  2KK4 A;  1VQN Q;  3OSV A;  3LX7 A;  3MPU B;  2OAW A;  1MMD A;  4HA8 A;  1YJN Q;  1EX4 A;  4C92 G;  1KJW A;  2X3W D;  4E7H A;  2CSI A;  1MHN A;  1OI1 A;  3OA6 A;  2E1H A;  3PVL A;  4FSX A;  1RAG B;  3LH5 A;  2O9S A;  4A4K A;  3QUI A;  2A08 A;  1JQQ A;  2FHD A;  2KQW A;  5D6X A;  2K2M A;  1I81 A;  4XTY A;  4F7U F;  2K79 A;  5I2M A;  2WSE E;  4C92 C;  1MUZ A;  1UHF A;  4JDS A;  1UGP B;  2LQ8 A;  4ZGE B;  3EFS A;  3X24 B;  1V76 A;  3MHX A;  2PU9 B;  2FRW A;  2LCL A;  2RI3 A;  2QGF B;  3OS1 A;  1KC8 C;  1BB9 A;  1QKX A;  2OTL A;  1TUG B;  1ZUY A;  3AT1 B;  3HRS A;  2AZS A;  1YI2 A;  2YUO A;  4M75 B;  3QDF A;  1RAD B;  3MEW A;  3VS0 A;  1ZQ1 A;  4JUV A;  1SEM A;  2LRQ A;  5GMK l;  2HQH A;  3CCU Q;  3RMS A;  1CKA A;  4ZNX A;  1G5V A;  1M2V B;  3I9Q A;  1YCY A;  1OX9 A;  2DL4 A;  2QAS A;  1GCQ C;  4M75 C;  1RAH B;  1SG5 A;  3VV0 A;  1OPL A;  4PJM A;  3CCE T;  1N8R U;  1GBQ A;  8ATC B;  1U1T A;  2R5M A;  3X26 B;  2DRK A;  3MKD A;  2RM4 A;  1D09 B;  1Q82 C;  2PVD B;  5GMK i;  2YUQ A;  4PFO A;  3D7S B;  2JJ9 A;  4AT1 B;  1QVP A;  4EDU A;  1VQ6 A;  2CZ0 B;  3Q1J A;  3MEA A;  2E5Q A;  2YT6 A;  3G4S T;  3NHN A;  3SFM A;  4GLM A;  2WAC A;  2DER A;  2FO0 A;  3C94 A;  2DD4 A;  2FRY A;  1QVF P;  3JB9 G;  4X34 A;  2BZX A;  3JB9 H;  1V29 B;  4M78 G;  4HXJ A;  4M75 D;  3X20 B;  4DBH A;  2E12 A;  1W4S A;  3G71 A;  4PLL A;  2SRC A;  3OS0 A;  1Q82 U;  4E7I A;  1VQ7 T;  5J3B A;  1GFC A;  1PCX A;  2J06 A;  1WXB A;  1OPK A;  2HNI A;  1SHG A;  5KYX A;  3DB3 A;  2EQU A;  4BI8 B;  2P84 A;  1YP5 A;  2RHZ A;  4PL6 A;  1UB4 A;  4C8Q E;  3OYK A;  1WJR A;  3L2R A;  3E9F A;  4CC4 B;  1KHC A;  3QYH B;  3G4S A;  1JB0 E;  2DEQ A;  2EVR A;  4MZP A;  1WDX A;  3A8H B;  4M7A C;  3CPW A;  2Z0W A;  1SSH A;  1K4U S;  3EG9 B;  3CME Q;  3CXC P;  1WGS A;  3PFS A;  1X43 A;  1IRE B;  4XQ3 A;  2QXF A;  2CH4 A;  3MEU A;  4WF2 A;  4DBR A;  2DL5 A;  3VUB A;  3EG9 A;  4IKF A;  3JCM W;  2KBT A;  1RLQ C;  2EJG A;  4FW2 A;  5I11 A;  2RD1 A;  3CCM Q;  1IGU A;  1WPY A;  2PZ1 A;  3LH0 A;  2F5T X;  2AT1 B;  2QGG A;  1WA7 A;  1OZ3 A;  4MML A;  2MYS A;  5D7U A;  1U5S A;  3S3O A;  3CCJ A;  3TU4 K;  4IUR A;  5CVI A;  2L3P A;  5FLX E;  3UF4 A;  1ZSZ A;  5GAM g;  3CC2 Q;  2EYW A;  3JSC A;  1LVK A;  4ZTF A;  1G3W A;  2XMF A;  1IO6 A;  1WLP B;  1I8F A;  2V26 A;  2PVG B;  1QKW A;  2DBK A;  4J8O A;  2L2P A;  3L2V A;  1K0S A;  3SWN C;  4RG8 A;  3UAT A;  4B9W A;  1Z9Q A;  5GAN d;  4PJO G;  2K3Y A;  4PJO D;  2KRO A;  1S72 A;  3EHQ A;  1YN8 A;  3CCQ Q;  5GAN 7;  3V8J A;  2XDP A;  1XTD A;  2HL5 C;  1K9M C;  2K9G A;  2C0I A;  4N4G A;  5CQX A;  2JMC A;  3H0I A;  2L3Q A;  5HCK A;  2V8K A;  3M0S A;  2GNC A;  4FYW B;  3UWN A;  1PKS A;  1SRL A;  3I35 A;  2LJ0 A;  1NE8 A;  2KXD A;  4OMF B;  4FIB A;  3BDL A;  1QP3 A;  2X51 A;  1TUD A;  2QQA A;  4OB1 B;  3FJ5 A;  3RR6 A;  4ELZ C;  4JJC A;  2MAM A;  1QWE A;  4RTW A;  3P8D A;  2XU8 A;  3ULR B;  3WXM B;  3P8H A;  4BAC A;  2EYX A;  1QVF A;  3LGL A;  2DTO A;  3QJY A;  3CMA T;  1PG5 B;  2O01 E;  2X3X D;  2K3B A;  2M51 A;  2HKN A;  2K4Y A;  2P4T A;  3CCQ T;  1K8A R;  2DL3 A;  2LDM A;  3M54 A;  2G3R A;  4FU6 A;  4BB7 A;  3H9N A;  3CCR Q;  1G8X A;  1YWP A;  5GAM d;  1I4K 1;  1WJS A;  2EYY A;  3EAE A;  2KDS A;  1VQM A;  2LQW A;  2I0N A;  5GAN g;  2C06 A;  3CCL T;  2XG8 D;  2HDA A;  4OMP A;  5A0D A;  2M1H A;  2LCC A;  1ZSZ C;  2D1X A;  1BKB A;  3OYI A;  1KQS P;  3OMG A;  2DPP B;  2E4H A;  1M90 U;  2W10 A;  1KC8 R;  5IN1 A;  3U23 A;  4NL3 A;  2OTJ T;  3M55 A;  2GFU A;  3OYC A;  3CBP A;  2CRE A;  5KYN A;  2FPE A;  1ZHI A;  4EMG A;  4E7L A;  1BYM A;  2ZPH B;  1VYV A;  2V1R A;  4C8Q F;  1Q86 R;  3MEV A;  1YJN A;  3OYL A;  5GAN 5;  3QBY A;  4BDZ A;  2MK5 A;  4JRI A;  4JZ4 A;  1OU9 A;  3JCM V;  2RF0 A;  3AHU A;  2NUP A;  5C6S A;  2V8J A;  2QDL A;  1VA7 A;  2IPO B;  3JCM Q;  3EGD B;  1ACM B;  3OYJ A;  2LX9 A;  2RK1 A;  2DZ9 A;  1YIT T;  1AWX A;  2JT4 A;  4XU1 A;  4JRK A;  2VWF A;  1VQ6 T;  2OTJ Q;  3CCE A;  5FU7 C;  3JCM f;  2CSQ A;  1QCN A;  2YLB A;  1TWB A;  5IHN A;  2CZ7 B;  2XDB A;  2JW4 A;  5GAM f;  2COW A;  4JS5 A;  4A4H A;  3QG1 A;  1RI9 A;  1WX6 A;  1BCO A;  1SKU B;  1E7O A;  3SWN B;  1VQP Q;  4JLI A;  2MOX A;  5FU6 B;  1K8A C;  5GAN j;  3VUZ A;  2MPX C;  1KQS A;  5LJ3 g;  4MDX A;  3EGX A;  1M2O A;  2COZ A;  1PKT A;  3CCU A;  5CKF A;  2ED1 A;  1YCS B;  3E19 A;  1VIE A;  3QII A;  1ZLM A;  5GAM e;  1D3B A;  1D0X A;  3A8L B;  4J9C A;  4EMK C;  2RHU A;  3NPF A;  3CQT A;  4C5I A;  2RHX A;  4IUQ A;  1NEB A;  3OYM A;  2KI7 A;  1ZUU A;  5CK9 A;  2FPF A;  5KYX B;  3BE3 A;  1H64 1;  3M0T A;  1VQL T;  3JB9 D;  1F1B B;  3PIO A;  3LLR A;  2K5F A;  1VQO A;  2YUN A;  3JCM X;  4C5E A;  3WVD B;  2E41 A;  1BU1 A;  2MIO A;  3OS5 A;  1Q7Y R;  2EQK A;  4HCZ A;  3OYA A;  2QA4 Q;  4GBQ A;  1IZ6 A;  4ZN3 A;  3CCU T;  5KYU B;  4KH1 B;  3VS2 A;  4QVC A;  1K9A A;  1UEB A;  5A2Q E;  3I55 Q;  1IHV A;  4M75 A;  5L8R E;  3H8Z A;  2KYB A;  2LNV A;  1GCQ A;  4M7D E;  4QVZ A;  4B9X A;  5FWB A;  4M78 D;  5C0M A;  5FW9 A;  3DLM A;  1Y96 A;  3BDU A;  3L2U A;  3HRU A;  1K8A U;  3MCA B;  2RH2 A;  2CT4 A;  2PTK A;  3CCS A;  2RQW A;  3J80 E;  3JAM E;  4EPC A;  2ABL A;  2DD5 A;  4M77 D;  2ZAE A;  4ANJ A;  1X75 C;  1W2B A;  4C8Q B;  2P0Q A;  1EIF A;  4M7D C;  2X9H A;  3QHS A;  3JCM g;  3I55 T;  4RCC A;  3FLG A;  1E6G A;  4F14 A;  3QSU A;  4OMM A;  4DEX A;  2E70 A;  4LN2 A;  1LNX A;  4M77 E;  1UDL A;  2FB7 A;  1OEB A;  1N27 A;  4PJJ A;  2PQW A;  2K57 A;  2YSQ A;  2LP5 A;  3CBO A;  2XDD A;  1UGQ B;  3GNF B;  3RER A;  2CUB A;  4HT8 A;  3CCM A;  1JXO A;  2CP7 A;  5KCH A;  5LL6 S;  3INZ A;  1RUW A;  3OYY A;  5GAN 3;  4CC3 A;  2LJ3 A;  1KQS S;  3ZFJ A;  4M78 E;  4LDX A;  2EQM A;  4ME7 A;  4M77 G;  2DTI A;  4M78 B;  1P92 A;  1U1S A;  5KYY B;  2F2X A;  2DXT A;  5J39 A;  3I56 Q;  2X4W A;  5CIU A;  2HD0 A;  1PWT A;  1C0M A;  2L8D A;  5AT1 B;  2E6Z A;  3C95 A;  4M7A E;  2DF6 A;  2OTL T;  2QQ9 A;  1XOV A;  5FRO A;  2PNI A;  4F7U E;  3S3N A;  4L5G A;  1PHT A;  4JJB A;  4KGV B;  4A53 A;  1VYT A;  1BIA A;  4ZN1 A;  3JCM c;  2E65 A;  5D6Y A;  1D1B A;  4DA4 A;  3KBG A;  1WHM A;  2RMO A;  2RHI A;  2HAX A;  2A7Y A;  2JS2 A;  1VQM T;  5DM7 R;  4FYV B;  4IUP A;  1VYU A;  2O9V A;  3CD6 T;  1CSK A;  4FSS A;  1HD3 A;  4J83 A;  1RL2 A;  3TRE A;  2CP0 A;  3J81 E;  4HT9 A;  3OYB A;  1TG0 A;  3OYF A;  2RQU A;  3OS2 A;  1SF9 A;  3G71 Q;  2FZK B;  2NLU A;  2EW3 A;  4NS5 A;  2FEI A;  4XU2 A;  2XID A;  3M53 A;  2M9U A;  1AZG B;  1QLY A;  3JB9 J;  1HXD A;  1AWO A;  2L0A A;  2LT1 A;  3QYG B;  3A8O B;  1RAB B;  1Q81 C;  2DZC A;  2ZPE B;  3PGG A;  4XU3 A;  3H0H A;  3H0F A;  4AG1 C;  5GJW B;  5CKH A;  2OX7 A;  4D8D A;  1M27 C;  4HCB A;  2DTH A;  3DB4 A;  3EFO A;  2VYT A;  2K2V A;  4XTZ A;  1YNZ A;  1C1A A;  2HBP A;  3MP8 A;  2DFU A;  1QVF S;  2QQS A;  2V8I A;  3EFO B;  2C0T A;  3G71 T;  1M4Z A;  2RI2 A;  5CKE A;  3JB9 I;  2HSP A;  2LCS A;  1S1N A;  4PLI A;  2GGR A;  1MNE A;  2JTE A;  1IGQ A;  4FYY B;  2YLC A;  2A36 A;  1GCP A;  5CAI A;  1K9M U;  1WHH A;  5IT9 E;  3CC4 A;  2Y90 A;  1M1K U;  4P5N A;  5IHK A;  2AIR B;  4A4E A;  1GFD A;  2X4J A;  4TVR A;  1B34 B;  3EG0 A;  3RKY A;  3E9G A;  2VUB A;  3CCL A;  2LTO A;  3CCJ Q;  1B34 A;  2MMP A;  2RI5 A;  3RNJ A;  1YJW Q;  1NZ9 A;  4RTT A;  2DA9 A;  4LDW A;  2J6K A;  5CKD A;  2BIV A;  3E1S A;  3P8B B;  1D1C A;  1IRX A;  1AZE A;  3VYG A;  1VQO T;  3RBB B;  2NWM A;  3FIF A;  2CDT A;  4EIK A;  4HCK A;  2HQX A;  5GAO q;  1YJN T;  1PC0 A;  5GAN h;  3ZL7 C;  1FYN A;  1JJ2 A;  1D1A A;  2KEA A;  1HSQ A;  1U06 A;  2E6N A;  2LC4 A;  5LJ3 h;  1DJ7 B;  4AFS C;  2DVE A;  2ATC B;  5GAN 4;  3TSZ A;  1JXM A;  4C8Q C;  1WQ7 A;  1FMK A;  1NYF A;  1KD1 R;  2ZPB B;  1UGV A;  3KUF A;  3CCV A;  2HZY A;  4ATO A;  3QWY A;  3OYE A;  2EKH A;  4LDV A;  3GF5 A;  1VQO Q;  3M5A A;  4F7U A;  4J7I A;  4C92 E;  3HFN A;  4PJO C;  1QVG S;  2LQN A;  2RJF A;  3CBM A;  4A63 B;  2E5K A;  1X01 A;  1Z9Z A;  2FVU A;  2DX1 A;  1YI2 T;  4IUV A;  8AT1 B;  4OMQ A;  2DYI A;  1E6H A;  2DNU A;  2NUP B;  4BE2 A;  2AHJ B;  3PVQ A;  2C0O A;  3OBW A;  1K73 U;  3PTA A;  2A37 A;  2XKO C;  1VQ4 T;  3ASK A;  3TVT A;  2CT3 A;  1Q86 U;  1PD1 A;  4BE1 A;  1I07 A;  4M77 B;  5D6W A;  1QP2 A;  5KYW A;  3HL8 A;  3GBQ A;  5KH6 A;  3A98 A;  4WTO B;  4JPB W;  1BBZ A;  1KK7 A;  1X69 A;  5LJ3 d;  5HK0 A;  4RKU E;  2B86 A;  2DL7 A;  3DKM A;  4DOV A;  1UJY A;  2ED0 A;  1T3L A;  1KFZ A;  2KAF A;  3G6E Q;  2DK3 A;  3UT1 A;  1NLO C;  1RLP C;  3JRZ A;  1RAE B;  1VQ5 Q;  4LXC A;  1UHC A;  1UEC A;  2QEX T;  5I2S A;  4JJN K;  2CUD A;  4KH0 B;  1WXU A;  2EBP A;  1BI1 A;  4R0K A;  1FXX A;  1I1J A;  2RJC A;  3OSS C;  1LJO A;  2EQJ A;  3V7S A;  4IUU A;  4F17 A;  1I5L A;  2X4X A;  4D8K A;  2YRD A;  2HEQ A;  1KHI A;  2GFA A;  1MV0 B;  1WYX A;  1VQK T;  2F5K A;  2VVK A;  2DL8 A;  4WCI A;  1Y07 A;  1JO8 A;  4KGZ B;  2D6F A;  2OTJ A;  1X6O A;  2DBM A;  1NJI R;  2DVJ A;  1WHL A;  3MO8 A;  1N9R A;  1VQ5 T;  1IXD A;  1H92 A;  4RTX A;  5A0G A;  1MV3 A;  3RUX A;  2QEX A;  3JCM h;  3KXT A;  1Q81 R;  2P0K A;  5CO7 A;  1G3T A;  2CGH A;  3CPW P;  4M7A G;  3NTI A;  5IXF A;  4OML A;  1K73 R;  1Q95 G;  1A0N B;  5FU7 B;  4K11 A;  4J7F A;  3CMA A;  4C5G A;  3A8M B;  1AOJ A;  1K1Z A;  2ZPG B;  5FWC A;  4M7A F;  3I56 A;  3LYI A;  1ABO A;  2GCX A;  3GP8 A;  3QWX X;  2DE0 X;  2L5Q A;  4M7D F;  3R6N A;  4OVA A;  2CZ1 B;  2KSS A;  1OZ2 A;  1YJW A;  4C8Q G;  2I2L A;  1W2B P;  3PE0 A;  3KFV A;  3CME T;  4JZ3 A;  1ZA2 B;  4DQ2 A;  2SEM A;  5HK3 A;  2ENM A;  5IAY A;  3NFC A;  4M75 E;  1T0J A;  2KYM A;  3VS6 A;  1KSW A;  2R58 A;  4LDU A;  4PJL A;  4LNP A;  2NYS A;  3SDZ A;  4M7D G;  1AVZ C;  1T3S A;  1VQ8 T;  4EMK A;  2KT8 A;  2RJE A;  4YTL A;  3UPU A;  2L3R A;  2EGE A;  4J5Y A;  4QQD A;  2FL7 A;  4C0D C;  1VQL A;  1I0C A;  5LJ5 d;  2K5L A;  4RTY A;  1EZZ B;  4J9D A;  2GTJ A;  2DO3 A;  2F69 A;  3VKI A;  5LJ5 g;  2JM8 A;  4PFZ A;  3RKW A;  3LGF A;  2M0O A;  3RES A;  1QCF A;  2KE9 A;  2H3J A;  3OYG A;  3CCV Q;  2VB6 A;  2K3X A;  1G83 A;  3TEE A;  2QTV A;  2QK0 A;  2CP2 A;  1UTI A;  2HCK A;  1B07 A;  3CD6 A;  3CXC S;  1K73 C;  1N6A A;  4C92 D;  5GAN f;  3JCM e;  2BKD N;  4IUT A;  1LCK A;  3RIR A;  3UA6 A;  2JTF A;  3HRT A;  5GAM h;  3UDC A;  1KIK A;  1D3B B;  3CC4 Q;  3QPH A;  3M0Q A;  2QTX A;  1S72 Q;  4CI0 C;  2HMA A;  1IHW A;  4M77 F;  2QDY B;  4M7A D;  3TCJ A;  2AKK A;  3WVE B;  2KRN A;  1KD1 C;  4HKE A;  4B6M A;  5GMK m;  4II1 A;  3CCL Q;  1B3Q A;  2VAS A;  2X4Y A;  4J6X A;  1N5Z A;  1R8O B;  3NTH A;  2D8H A;  2F2V A;  1UGS B;  1X2Q A;  4HCC A;  2CZ6 B;  1NJI U;  4UC4 A;  5I22 A;  1WNL A;  3CCR T;  2FYK A;  3X28 B;  2DXC A;  3FEO A;  2EQI A;  4RMO A;  1K9M R;  3O5Z A;  1WI7 A;  3QZ9 B;  1M1K R;  5EG2 A;  4XTV A;  4FT2 A;  3JV3 A;  1Q81 U;  4C0Z A;  1VQN T;  1YBY A;  5DY9 A;  4EMK B;  2ECZ A;  2W0Z A;  1M8M A;  5AYF A;  3ME9 A;  5CR2 A;  1WFW A;  2AKL A;  3C12 A;  2R57 A;  4C0D B;  1WHG A;  2OI3 A;  1UE9 A;  1LPL A;  3OW2 P;  3S6W A;  1G3S A;  3LWI A;  4LUD A;  1KQ1 A;  2R5A A;  1M3A A;  3CPF A;  1R77 A;  2O31 A;  1YIT A;  3M56 A;  5GAO n;  4ZTJ A;  3FB9 A;  1PRL C;  3V7C A;  4CC7 A;  1YJ9 T;  3M0U A;  1Q7Y C;  4ESR A;  2LVM A;  1HK9 A;  1ZSG A;  4N0A C;  1X27 A;  4KBM B;  5KE2 A;  3L2Q A;  6AT1 B;  2D0Q B;  2OJ2 A;  1UGR B;  3PMT A;  2MI6 A;  1FMV A;  4OF1 A;  2EGC A;  1OQK A;  3REA B;  2JZ2 A;  2HSE B;  1OU8 A;  2MWP A;  5GJV B;  2BTT A;  2GQV A;  3A5Z B; 
#chains in the Genus database with same CATH homology
 4GY5 A;  2YLC A;  5FLX E;  5CAI A;  4LDX A;  1K9M U;  5GAM g;  1VQ9 T;  5IT9 E;  1Q7Y U;  3JSC A;  4OGE A;  4ZTF A;  4PJO F;  1G3W A;  2Y90 A;  5GAO m;  3CC4 A;  1N8R C;  1M9S A;  3FRN A;  1M1K U;  4N4H A;  1I8F A;  2PVG B;  2EWN A;  4P5N A;  2EAY A;  2PUK B;  2RB6 A;  3F70 A;  4J8O A;  4BUG A;  5LJ3 j;  4A4E A;  3L2V A;  3SWN C;  1VQP T;  4RG8 A;  4B9W A;  4M7D D;  2X4J A;  4FL6 A;  4TVR A;  4LD6 A;  1B34 B;  1VQ5 A;  4XTU A;  1GXI E;  5GAN d;  4PJO G;  2K3Y A;  4PJO D;  4C8Q A;  3R6O A;  3RKY A;  3E9G A;  1TH7 A;  2VUB A;  3CCL A;  2LQK A;  2LTO A;  2DJZ A;  1S72 A;  4KUI A;  4RG2 A;  1B34 A;  5GAN 7;  2MMP A;  2RI5 A;  1XTD A;  2XDP A;  3FDR A;  3V8J A;  4C92 F;  3CC7 A;  5GAO r;  1NZ9 A;  1K9M C;  4N4G A;  5CQX A;  4JRQ A;  3G6E A;  3OW2 A;  4LDW A;  5CKD A;  2BIV A;  2D9T A;  4DOW A;  3E1S A;  2V8K A;  3P8B B;  1JJ2 S;  5LJ5 j;  1AHJ B;  4PJO A;  5DLQ E;  3UWN A;  4OB2 B;  2QQB A;  3VYG A;  5GAO l;  1NE8 A;  2QA4 T;  1YHQ A;  4OMF B;  4FIB A;  3BDL A;  1VQO T;  5LJ5 e;  1QP3 A;  3FIF A;  4OB3 B;  1FX7 A;  3PMI A;  1NPP A;  3QZ5 B;  1KQ2 A;  2QI2 A;  2QQA A;  2ZPI B;  2HQX A;  4OB1 B;  2P0P A;  3NTK A;  2E10 A;  5GAO q;  4ELZ C;  1YJN T;  2A3L A;  4NL2 A;  3DLL A;  4M7A A;  2MAM A;  5GAN h;  3P8D A;  5KCO A;  1JJ2 A;  2XU8 A;  5M9O A;  3SB2 A;  3WXM B;  1BI2 A;  3P8H A;  4BAC A;  3QKJ A;  1JBM A;  3OQ5 A;  1QVF A;  4JS4 A;  3JCM b;  2E6N A;  3LGL A;  2DTO A;  3QJY A;  3CMA T;  2LC4 A;  2O01 E;  5LJ3 h;  4C92 B;  3CC2 T;  1DJ7 B;  3MP6 A;  2P4T A;  2K4Y A;  2DVE A;  2X35 A;  4M75 F;  5GAN 4;  3CCQ T;  2LDM A;  2BUD A;  3BW1 A;  2G3R A;  1WQ7 A;  3M54 A;  4C8Q C;  3CME A;  4FU6 A;  3GLX A;  4BB7 A;  3S3M A;  4X9C A;  1VQ9 A;  5GAM d;  1I4K 1;  2ZPB B;  4JLG A;  3KUF A;  1VQ8 A;  1WJS A;  3EAE A;  3CCV A;  2EKO A;  2KDS A;  1VQM A;  5GAN e;  4ATO A;  5GAN g;  2C06 A;  5A0L A;  1H3Z A;  2XD0 A;  3OYE A;  3CCL T;  2XG8 D;  3RKX A;  1O75 A;  5A0D A;  3HKS A;  4LDV A;  2QA4 A;  2M1H A;  3GF5 A;  2LCC A;  2XI9 A;  3JCM J;  1BKB A;  3M5A A;  4F7U A;  2DIG A;  3OYI A;  1KC8 U;  1XNI A;  2CS7 A;  4J7I A;  2IG0 A;  3OMG A;  3HFN A;  4C92 E;  4PJO C;  1QVG S;  2DPP B;  2RJF A;  3CBM A;  5GAN 2;  3HHT B;  3HFO A;  1M90 U;  2FVU A;  1X01 A;  5IN1 A;  4NL3 A;  1YI2 T;  3OA6 A;  1M1G A;  4IUV A;  2OTJ T;  2VGM A;  4J6W A;  4XK8 E;  1ZBX A;  4QQG A;  3M55 A;  2GFU A;  5LJ3 e;  3OYC A;  3CBP A;  4L6V 5;  5GMK j;  1FWZ A;  3BY7 A;  3QDR B;  4CRI A;  4BE2 A;  1ZHI A;  2EJ9 A;  2AHJ B;  2JNG A;  2EIF A;  4N0A A;  4EMG A;  3QO3 A;  4E7L A;  1YIJ A;  4PJO B;  3CC2 A;  1BYM A;  2ZPH B;  2XHC A;  5LJ3 f;  3OBW A;  4BI3 A;  3CXC A;  4JRP A;  1K73 U;  4C8Q F;  2VXF A;  3SWN A;  3CCV T;  3MEV A;  3T9N A;  1YJN A;  3OYL A;  2XKO C;  4KUL A;  5GAN 5;  3PTA A;  1VQ4 T;  2JVV A;  3QBY A;  4MZM A;  4ZGD B;  4BDZ A;  2JUF A;  3ASK A;  4JRI A;  4BE0 A;  5HY6 A;  1JRI A;  3JCM V;  1Q86 U;  3AHU A;  5C6S A;  2IVW A;  2V8J A;  4BE1 A;  4M77 B;  1MGQ A;  3V8K A;  4XTX A;  5D6W A;  1QP2 A;  3JCM Q;  1SSF A;  4FT4 A;  1M1K C;  3HL8 A;  5I21 A;  2ZGW A;  5KH6 A;  2DXU A;  3CPW S;  5LJ3 d;  5HK0 A;  3OYJ A;  3CCM T;  2JTM A;  4RKU E;  4XU0 A;  3FC3 A;  2LX9 A;  2B8A A;  3DKM A;  2MF2 A;  4X9D A;  4A54 A;  4DOV A;  2RK1 A;  5LJ5 f;  2DZ9 A;  2KAF A;  3RMQ A;  2QQR A;  1YIT T;  2M16 A;  4XTW A;  2DK3 A;  4M78 F;  3BFM A;  3UT1 A;  4F7U B;  3JCM d;  4XU1 A;  4JRK A;  3VJP A;  3JRZ A;  3L42 A;  1VQ6 T;  3CCE A;  5FU7 C;  4M7A B;  3JCM f;  2QEX T;  3LW5 E;  4V2S A;  5I2S A;  3GNG A;  4JJN K;  3ZBD A;  3OY9 A;  1BI0 A;  1M5Q 1;  2YLB A;  1BI1 A;  2Y4Y A;  2CZ7 B;  1FXX A;  2YHT A;  1VQ4 A;  2XDB A;  5GAM f;  3I56 T;  2RJC A;  2RO0 A;  3OSS C;  4PJO E;  1LJO A;  2EQJ A;  3V7S A;  4JS5 A;  1YIJ T;  4A4H A;  5GMK h;  4IUU A;  3OYH A;  3M57 A;  2X4X A;  3QG1 A;  1I5L A;  2Y4X A;  1KHI A;  2GFA A;  5GAN 6;  3GOX A;  1PSF A;  2YRV A;  1VQK T;  2F5K A;  4E7K A;  1KG1 A;  5HKC A;  3SWN B;  2L89 A;  1M1F A;  4JLI A;  1M90 C;  3N5B B;  5FU6 B;  1Y07 A;  4N4I A;  1QVG A;  4XAX B;  5GAN j;  2DAQ A;  1K8A C;  3VUZ A;  1KQS A;  5LJ3 g;  2D6F A;  4MDX A;  4Y91 A;  2OTJ A;  3ZEH A;  3CC4 T;  1X6O A;  3CCU A;  3O8V A;  4OP0 A;  5CKF A;  5CCA A;  3CCJ T;  3E19 A;  1S72 T;  3PT9 A;  1VIE A;  3QII A;  4QVD A;  3VYH B;  5GAM e;  1O9S A;  1D3B A;  3CC7 T;  1OYX A;  3A8L B;  3M58 A;  4EMK C;  2RHU A;  3M59 A;  1Y71 A;  4VUB A;  4C5I A;  4M7D B;  3CCR A;  3M4Y A;  2RHX A;  3A8G B;  3MO8 A;  1N9R A;  4IUQ A;  3OYM A;  2WSC E;  1VQ5 T;  3OW2 S;  4C92 A;  1VQN A;  5A0G A;  4EMH A;  1U8R A;  3RUX A;  5CK9 A;  4MDW A;  3VU3 C;  4O6J A;  2QEX A;  1H64 1;  3JCM h;  3KXT A;  2P0K A;  1VQL T;  3JB9 D;  5CO7 A;  3PIO A;  4ZGJ B;  3LLR A;  1G3T A;  2K5F A;  2CGH A;  2PUO B;  3I55 A;  1VQO A;  1W2B S;  4M7A G;  3NTI A;  4OB0 B;  3JCM X;  1KD1 U;  3MET A;  5CKB A;  4C5E A;  3WVD B;  1QW1 A;  5FU7 B;  4FM4 B;  2E41 A;  1LOJ A;  3GIB A;  4J7F A;  3CMA A;  4C5G A;  3A8M B;  3L2Z A;  3OS5 A;  3X25 B;  2VC8 A;  1N9S A;  4C5H A;  2EQK A;  2ZPG B;  4HCZ A;  3OYA A;  4M78 A;  2RHY A;  1NJI C;  4M7A F;  3I56 A;  3LYI A;  2GCX A;  3JB9 F;  2KK4 A;  3GP8 A;  1IZ6 A;  4ZN3 A;  3CCU T;  3OSV A;  3LX7 A;  2L5Q A;  4M7D F;  4QVC A;  3PIP A;  1UEB A;  5A2Q E;  4HA8 A;  4OVA A;  4C92 G;  4E7H A;  1YJ9 A;  4ELY C;  4M75 A;  1MHN A;  3H8Z A;  2HQE A;  2PVO B;  1OI1 A;  2LNV A;  5L8R E;  2CZ1 B;  2K5I A;  3HP9 A;  2EFI A;  1OZ2 A;  2KSS A;  4LDY A;  4QVZ A;  4A4G A;  4B9X A;  2E1H A;  2GF7 A;  1YJW A;  4M78 D;  4M7D E;  4C8Q G;  5GAN 8;  5C0M A;  3DLM A;  1VQK A;  1Y96 A;  2I2L A;  3BDU A;  4M77 A;  4FSX A;  3ER0 A;  3L2U A;  3CME T;  4DQ2 A;  3HRU A;  2VXE A;  1K8A U;  2EJF A;  3MCA B;  4M77 C;  2RH2 A;  4A4K A;  5HK3 A;  3URG A;  3QUI A;  2FHD A;  3OBY A;  2KQW A;  5IAY A;  4R56 A;  5D6X A;  3NFC A;  1I81 A;  3CCS A;  4XTY A;  4M75 E;  3C4S A;  4F7U F;  1XQH A;  5GAM j;  5I2M A;  2WSE E;  4C92 C;  3J80 E;  1NPR A;  1VIF A;  3JAM E;  4EPC A;  4BD3 A;  2DD5 A;  4JDS A;  2R58 A;  4LDU A;  1UGP B;  2LQ8 A;  3SD4 A;  4ZGE B;  4M77 D;  3EFS A;  3SDZ A;  3X24 B;  4M7D G;  3L2W A;  1VQ8 T;  1X75 C;  3MHX A;  4EMK A;  1W2B A;  2PU9 B;  2LCL A;  2RJE A;  2RI3 A;  4YTL A;  4C8Q B;  3JCM P;  2P0Q A;  1EIF A;  3OB9 A;  2XK0 A;  3OS1 A;  3UPU A;  2L3R A;  3L1A A;  1KC8 C;  2OTL A;  3OYD A;  4M7D C;  3HRS A;  4J5Y A;  1RI0 A;  2FL7 A;  4M78 C;  4QQD A;  4C0D C;  3QHS A;  1YI2 A;  5LJ5 d;  3JCM g;  1VQL A;  2K5L A;  3I55 T;  4RCC A;  3FLG A;  2EYQ A;  4M75 B;  3MEW A;  5GMK e;  3QSU A;  1BIB A;  2JOY A;  3LWH A;  1ZQ1 A;  4C0G A;  2DO3 A;  2F69 A;  4R55 A;  1VQ7 A;  3VKI A;  5LJ5 g;  2E70 A;  4JUV A;  2LRQ A;  5GMK l;  3RKW A;  3LGF A;  2M0O A;  3RES A;  3RMS A;  2H3J A;  3OYG A;  1G5V A;  2XIC A;  1YCY A;  1LNX A;  4E47 A;  2CKK A;  2K3X A;  4M77 E;  3TEE A;  2FB7 A;  2DIQ A;  1N27 A;  4M75 C;  2PQW A;  1VQP A;  2K57 A;  4M7D A;  3CBO A;  3VV0 A;  2XDD A;  1VUB A;  3CCE T;  1N8R U;  1UGQ B;  4C8Q D;  2O4X B;  4Z02 A;  1U1T A;  3GNF B;  2R5M A;  5FRM A;  3X26 B;  3GPL A;  3RER A;  4Q5W A;  4HT8 A;  3CCM A;  4OGC A;  2RM4 A;  3CD6 A;  3CXC S;  1YJW T;  1K73 C;  5KCH A;  1N6A A;  4C92 D;  5LL6 S;  2RA2 A;  5GAN f;  1Q82 C;  2PVD B;  2CYZ B;  4PNO A;  3INZ A;  3OYY A;  5GMK i;  3JCM e;  5GAN 3;  2MWO A;  1KQS S;  3ZFJ A;  4M78 E;  2BKD N;  4NOY A;  3EFR A;  4IUT A;  2EQM A;  4ME7 A;  4M77 G;  2DTI A;  1PSE A;  4M78 B;  4RCB A;  1P92 A;  1U1S A;  4O5V A;  4LD9 K;  3RIR A;  1QVP A;  2JTF A;  2DXT A;  3HRT A;  5GAM h;  3UDC A;  1YHQ T;  3JB9 H;  1D3B B;  4EDU A;  1VQ6 A;  2KY9 A;  5J39 A;  4Y28 E;  2CZ0 B;  2VGN A;  3Q1J A;  3QPH A;  2X4W A;  2QTX A;  2E5Q A;  2ZZD A;  3MEA A;  2HD0 A;  5CIU A;  4CI0 C;  3G4S T;  3SFM A;  2JN0 A;  1WJQ A;  2L8D A;  4M77 F;  3H6Z A;  2QDY B;  2WAC A;  3M9Q A;  2E6Z A;  3C95 A;  4M7A E;  3C94 A;  2DD4 A;  4M7A D;  3TCJ A;  3JB9 G;  3WVE B;  4PKC C;  4X34 A;  2OTL T;  2QQ9 A;  1XOV A;  5FRO A;  4HKE A;  4F7U E;  1V29 B;  5DLO A;  1KD1 C;  4M78 G;  5GMK m;  3S3N A;  3FJP A;  4L5G A;  2KMT A;  4II1 A;  3QXE B;  4BI4 A;  5CQY A;  4BY6 B;  4A53 A;  4E7J A;  1BIA A;  4ZN1 A;  3JCM c;  4M75 D;  2E64 A;  2RJD A;  3X20 B;  2E65 A;  2E12 A;  1W4S A;  2X4Y A;  4J6X A;  4PLL A;  4QW2 A;  3G71 A;  1R8O B;  3NTH A;  3OS0 A;  1Q82 U;  5D6Y A;  4E7I A;  4DA4 A;  3OMC A;  1VQ7 T;  1UGS B;  5J3B A;  4HCC A;  3KBG A;  1Y7X A;  2CZ6 B;  1NJI U;  4UC4 A;  1WNL A;  3CCR T;  3J7A F;  2RHI A;  2FYK A;  3X28 B;  2DXC A;  3FEO A;  4RMO A;  2HAX A;  5KE3 A;  3QJ6 A;  2A7Y A;  2ZCF B;  1VQM T;  2HNI A;  3PNW C;  3QZ9 B;  3G7Z A;  3DB3 A;  5DM7 R;  2DKG A;  5EG2 A;  1WQW A;  2EQU A;  4BI8 B;  4IUP A;  3CD6 T;  4F7U G;  2ZPF B;  2RHZ A;  4PL6 A;  4XTV A;  1M8V A;  1UB4 A;  4FT2 A;  4C8Q E;  3OYK A;  1WJR A;  1Q81 U;  4J83 A;  4C0Z A;  4J6Y A;  1RL2 A;  3TRE A;  3L2R A;  1VQN T;  1YBY A;  3E9F A;  5DY9 A;  4EMK B;  3J81 E;  1KHC A;  3QYH B;  4HT9 A;  3OYB A;  3OYF A;  3HPW A;  3G4S A;  3HSB A;  3OS2 A;  2OAU A;  4BDY A;  5AYF A;  3ME9 A;  3OYN A;  1JB0 E;  2NLU A;  5CR2 A;  2DEQ A;  3C12 A;  3CEY A;  2R57 A;  4NS5 A;  1Q86 C;  4XU2 A;  1G3Y A;  4MZP A;  2XID A;  3M53 A;  4C0D B;  4M75 G;  2M9U A;  1BI3 A;  4L59 A;  3JB9 J;  2DXB A;  2KVQ G;  1HXD A;  3A8H B;  3S6W A;  1G3S A;  4C0F A;  3CPW A;  5LJ5 h;  4M7A C;  2LT1 A;  3QYG B;  4BY6 C;  3A8O B;  3LWI A;  2O4X A;  2WSF E;  1WGS A;  3PFS A;  1KQ1 A;  2R5A A;  1IRE B;  2DZC A;  1Q81 C;  2ZPE B;  3CPF A;  2QXF A;  3PGG A;  4XQ3 A;  4XU3 A;  4D6W A;  3MEU A;  4MMK A;  3G6E T;  4WF2 A;  1YIT A;  3M56 A;  5GAO n;  5CKH A;  4ZTJ A;  3FB9 A;  3VUB A;  4GLK A;  4HCB A;  2DTH A;  3DB4 A;  4IKF A;  4QQ6 A;  2VYT A;  2RK2 A;  2K2V A;  3V7R A;  3V7C A;  1YJ9 T;  4XTZ A;  3JCM W;  1Q7Y C;  2EJG A;  2LVM A;  5FRN A;  1HK9 A;  2RD1 A;  4N0A C;  2HBP A;  1WPY A;  3MP8 A;  3V8L A;  4KBM B;  3MP1 A;  5KE2 A;  3LH0 A;  5FU6 C;  3L2Q A;  1QVF S;  4KT0 E;  4KUD K;  2F5T X;  5J26 A;  3M4G A;  3CCS T;  2D0Q B;  2QQS A;  2V8I A;  1OZ3 A;  1UGR B;  4MML A;  3PMT A;  2MI6 A;  4OF1 A;  3G71 T;  4MZT A;  2JZ2 A;  1M4Z A;  2RI2 A;  5CKE A;  3JB9 I;  2VV5 A;  4A4F A;  2MWP A;  2LT4 A;  4PLI A;  1Y96 B;  3CCJ A;  3S3O A;  2GQV A;  3CCQ A;  5GAO p;  3A5Z B;  3TU4 K;  4IUR A;  5CVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...