1NLOC

Structure of signal transduction protein, nmr, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (transferase/peptide)
molecule keywords C-SRC
publication title Molecular basis for the binding of SH3 ligands with non-peptide elements identified by combinatorial synthesis.
pubmed doi rcsb
source organism Gallus gallus
total genus 7
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1996-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1nloC00
3M0QA 1YWPA 1YCSB 2K6DA 5L23A 3O5ZA 4RTYA 4IIMA 1ZSGA 2LX7A 1NEGA 4J9FA 2W0ZA 4RTUA 2YUNA 1KSWA 2J6KA 1WX6A 2EGCA 4OMQA 2MCNA 1GBQA 1OEBA 1RI9A 4CC7A 2KRNA 3I5SA 1WFWA 4CC4B 2EKHA 1RLQC 1PKTA 2AKLA 5FWCA 4CC2A 1ZUKA 4RTWA 2GBQA 1WXUA 2DLPA 1NYFA 1NLPC 2DL5A 1W6XA 2O2OA 1K1ZA 2ENMA 2FEIA 3FJ5A 4J9GA 4RTXA 2KR3A 4JZ4A 1E6HA 1WIEA 4F17A 1NG2A 3SHWA 5HCKA 2ESWA 2JS2A 1UHCA 1ARKA 2BZXA 3ZL7C 4ZNXA 1PHTA 1UJYA 4JZ3A 2AZSA 4M4ZA 1M30A 2DM1A 3TSWA 3H0HA 3EG3A 2DYBA 4GBQA 2LQNA 1WXTA 4JJDA 4F14A 1AWOA 1SRMA 1ZX6A 4AFUC 1I07A 5IXBA 1A0NB 1CKBA 1TUCA 2L2PA 2KNBB 1AZGB 1M3BA 2CSIA 2PTKA 2D8JA 2LNHB 1J3TA 1QKWA 3PVLA 1WXBA 2K79A 1UHFA 4AFQC 2EYWA 2L3PA 1FMKA 1JO8A 5GJVB 3LH5A 4QT7A 1JQQA 1SPKA 3TSZA 1JU5C 2O9SA 2V1QA 3RNJA 1UFFA 2KYBA 3REAB 2DL8A 1AVZC 1OOTA 1X6GA 2F2XA 4OMPA 2V1RA 2FG0A 3H41A 1UGVA 2NUZA 1GFDA 1XOVA 1PRMC 3VS1A 2DL3A 5FWBA 2RQUA 2KROA 1SRLA 2CH4W 4AG1C 1ZUUA 2RNAA 1Y57A 4R0KA 2IIMA 2C0OA 2H8HA 4FSSA 1AWXA 1SHFA 2ROLA 2DF6A 2AK5A 2PZ1A 3EHRA 1VYTA 1JEGA 2YDLA 3REBB 4OMMA 4J9IA 1M27C 3C0CA 4JJBA 2O9VA 2DBKA 3CQTA 1SSHA 1UDLA 1PRLC 1M3CA 2DILA 1I0CA 2ED1A 1H92A 2JM8A 1M3AA 3VS0A 4GLMA 1GCPA 4HVUA 2EQIA 2DNUA 2CH4A 4F16A 4LNPA 1KFZA 5ECAA 2F2VA 5GJWB 2ECZA 1PWTA 1S1NA 2LP5A 2CUBA 3ULRB 3U23A 3M0UA 1MV0B 2DL4A 1X27A 1T3LA 4Y92A 4WCIA 1X6BA 3UA6A 2A36A 2NWMA 4DEYA 2J7IA 3NPFA 1T0HA 4JJCA 1QWEA 5IHIA 2KE9A 1V1CA 3VS4A 1AEYA 4RTVA 3VS2A 1X43A 2KXDA 2ROTA 4AG2C 3IQLA 4RTZA 2BTTA 2JM9A 1YWOA 1Z9ZA 2LJ0A 1YN8A 1G83A 2KEAA 1TG0A 1UECA 1KJWA 1I1JA 4K11A 2GNCA 1H8KA 2VVKA 3QWXX 1OPLA 3M0RA 4DEXA 1T0JA 3EGUA 1H3HA 3SEMA 4HXJA 3KFVA 1YNZA 2D0NA 3VRYA 2B86A 1OPKA 2J6FA 3JV3A 1SHGA 1WA7A 2EGAA 2KT1A 1VYUA 3I5RA 1HD3A 2JMCA 4RUGA 2O88A 2HSPA 4IIOA 3THKA 1GCQA 1RLPC 2P4RA 5IHNA 4AFSC 3VS7A 2GTJA 3VS6A 3UATA 2C0TA 2EVRA 1BU1A 1WYXA 1QCFA 1B07A 1RUWA 3VS5A 2LJ1A 2JXBA 2MIOA 2HBWA 4LE9A 1K9AA 4ORZA 3NMZC 2DJQA 1T3SA 1ZLMA 3NHNA 4D8KA 1B3QA 1HJDA 1JXOA 2XMFA 5I22A 2CDTA 2QDLA 4ESRA 2RQVA 1BK2A 2DE0X 1GBRA 1WDXA 1CSKA 2EYYA 3RBBB 4HVVA 2D8HA 1QLYA 1JXMA 3M0TA 1GRIA 2DL7A 2K7AA 1K0SA 2JMAA 2DA9A 1GL5A 2SEMA 2DMOA 1HSQA 2EYXA 3QWYA 2LZ6B 2JTEA 1Y0MA 4E6RA 2GTOA 2CT4A 2RQWA 2C0IA 3GBQA 1E6GA 1UG1A 2X3WD 3A98A 1E7OA 2OI3A 1IO6A 2LQWA 2JS0A 4J9DA 1ABOA 3R6NA 2KGTA 4J9BA 2FPEA 1FYNA 2OAWA 2M0YA 2KYMA 4AFZC 1TUDA 2HEQA 2SRCA 1UTIA 2W10A 4D8DA 2LMJA 3H0IA 1X2QA 4Z88A 1UE9A 2EBPA 5EC7A 2DVJA 4LUEA 3NGPA 5I11A 2EGEA 2PNIA 1X69A 3M0SA 2FO0A 1SEMA 2JT4A 1YP5A 2EPDA 2E5KA 2LJ3A 2J06A 3UF4A 2DX1A 5IHKA 2L3SA 4J9CA 2AZVA 1UJ0A 4HCKA 1EFNA 1G2BA 1AZEA 3PE0A 1NLOC 2RPNA 3H0FA 3EG0A 1QWFA 1AWJA 2DRKA 2FRWA 1GFCA 1W1FA 1VA7A 3EG2A 2HCKA 2A28A 1AD5A 2RN8A 4RTTA 1PKSA 1BB9A 2A37A 3VRZA 3VS3A 1GCQC 4KRTA 3EHQA 3TVTA 2FRYA 4J9HA 1U3OA 1PNJA 3PVQA 1BBZA 2K2MA 4OMNA 4JPBW 1WI7A 4LUDA 4CC3A 2I0NA 2K3BA 2KBTA 2KRSA 4A63B 2OJ2A 2RQRA 1AOJA 2O31A 2DRMA 2AKKA 4J9EA 2LCSA 1CKAA 3M0PA 1Z9QA 1NEBA 5IXFA 1K0XA 2FPFA 2EYZA 3I9QA 1MV3A 1QKXA 1ZUYA 2ED0A 1MUZA 2L3QA 2FPDA 2MOXA 1X2KA 4HVWA 2VKNA 1K76A 1ABQA 2X3XD 2A08A 2CUDA 2J6OA 1VYVA 2J05A 2YUOA 2KT8A 2VWFA 4OMOA 4Z89A 2YUQA 5FW9A 4EIKA 2D1XA 4OMLA 1NYGA 2RMOA 2GQIA 1NM7A 2DBMA 3I35A 4LN2A 1ZBJA 2JW4A 2KXCA 2KRMA 2YT6A 1LCKA 2YSQA 1K4US 2M51A 1OV3A 5IH2A 2K9GA 2HDAA 1U06A 1AWWA 1M8MA 3UA7A 2L0AA 2F2WA 4X1VA 2YUPA 1W70A 2CSQA 1U5SA 2RQTA 1WLPB 2BZ8A 1KIKA 2RF0A 2EW3A 2G6FX 2BZYA 3EG1A 2CREA 1N5ZA 4Z8AA 2GGRA 2CT3A 1UUEA 2ABLA
chains in the Genus database with same CATH superfamily
4N0AA 3UT1A 5A0LA 3M0QA 2QA4T 2FZKB 3HRSA 4M77D 1ZSGA 5GAN7 3I55A 2QTXA 4IUTA 1NEGA 5A2QE 2YHTA 2MI6A 4J6YA 3CPFA 2H3JA 1WX6A 3QKJA 4ZGDB 4E7KA 1OEBA 3A1PA 1SSFA 3G71T 3VUBA 1YJWA 4M75C 1JJ2A 2GBQA 1WXUA 3CPWA 1GXIE 3QDRB 1W6XA 2FEIA 2KK4A 4RTXA 1W2BA 4JZ4A 1VQ5A 3G6EQ 4F17A 4HT9A 1M1FA 2FYKA 2JS2A 4ZNXA 4JLGA 4ZN1A 3VKIA 4OGCA 2AZSA 4V2SA 3PNWC 1QVGP 1M30A 2DM1A 4LDYA 4F14A 1ZX6A 5IXBA 1A0NB 1CKBA 2JZ2A 1K8AR 1YI2T 1YJNT 2LNHB 1UHFA 4M7DA 3QBYA 4BE1A 2L3PA 3HRTA 2K4YA 3CCLA 1M2VB 3EAEA 3TSZA 2O9SA 3BDUA 4JLIA 4Z02A 3TU4K 2L3RA 5KH6A 2FG0A 3EGDB 2NUZA 1VQ9T 1GFDA 3HTRA 2RQUA 3M57A 1ZHIA 4BY6B 2RNAA 2ZAEA 1KHCA 5CKBA 3OBWA 3M4YA 2QQRA 2H8HA 4PK4A 4FSSA 3SD4A 2DZ9A 4E7LA 3BDLA 4DBRA 2QTVA 1VYTA 1K73R 3CCVT 4C8QA 3REBB 4J9IA 3C0CA 4WF2A 4M77C 3DLLA 3OYJA 1UDLA 1PRLC 2DILA 4KT0E 3SWNC 1H92A 2XKOC 4C5GA 4GLMA 3CCLQ 1H3ZA 1D0ZA 1ZSZC 3GPLA 4N4HA 4LNPA 3QO3A 4BI4A 1LJOA 5GJWB 3QUIA 5KE2A 1I4K1 3L2UA 4PJOG 3U23A 3TCJA 1X27A 4WCIA 3UA6A 2YRVA 1K8AU 3V7CA 4M7AF 2YLCA 1AEYA 4DBHA 3VS2A 2KXDA 1KD1C 1Q86R 4M7AE 2LJ0A 1C1AA 2V8JA 2KEAA 3OW2P 5LJ5j 1KJWA 2A0FB 4JRIA 2YWWA 2ZPGB 5LJ3j 1H8KA 3RKXA 3M0RA 5J26A 4QQ6A 2ZGWA 1PCXA 3EGUA 1H3HA 5LJ5f 1Y7XA 2XD0A 1N9RA 2Y90A 3QPHA 3VRYA 1K73U 5D6WA 1WNLA 4IUUA 1SHGA 2EGAA 4F04B 4M7DC 3ZBDA 3KXTA 1VQLQ 1KG1A 1KQSP 5GAMj 3CXCA 1FMWA 4BDZA 2E6NA 1OYXA 1KHIA 2DAQA 1YITT 2IPOB 2QDYB 3OYKA 3CPWS 2DFUA 3I56A 4BD3A 3CC4T 1RI0A 2JXBA 5FU7B 2HBWA 3KBGA 4LE9A 1W2BS 2LVMA 5L8RE 3QXEB 3A8GB 3EGXB 3G4SA 1WHGA 4PLLA 2LDMA 2CDTA 2CP0A 3CCUA 3QDFA 2B8AA 1YIJT 3CCSA 3OS1A 1Q86U 1MGQA 1WDXA 1P92A 4KBMB 2DZCA 2D8HA 2XU8A 3M59A 4RG2A 1QLYA 2QA4Q 4KH0B 2P0PA 2DL7A 5GAN3 4C0GA 4QVCA 3HP9A 2KSSA 4M78F 2DA9A 2SEMA 4M7AB 3MO8A 1EIFA 1M4ZA 2M16A 4FW1A 1MMNA 4JUVA 3UDCA 2KQWA 2EYXA 3L2ZA 5GAN4 4XU3A 3KUFA 2HZYA 5IAYA 5GANj 1WJRA 4F7UG 1UG1A 4PJLA 3M9QA 1RAAB 1G3TA 5GAN2 3G71Q 2DIQA 2RJDA 1IO6A 2XDPA 4J9DA 2CP6A 3CCRA 2MWOA 2ZZDA 5GANf 4KULA 2M0YA 2KDSA 3LWHA 2OAUA 4AFZC 1TUDA 2HEQA 3G7ZA 3V8JA 1QW1A 1UE9A 2EBPA 3ER0A 5FU6C 1NZ9A 2PNIA 2FO0A 2DX1A 2L3SA 4J9CA 3M4GA 1VQPA 5KE3A 1MNEA 2AZVA 1M90R 1UJ0A 2E3IA 3MP8A 3SFMA 3H0FA 1YI2Q 1QWFA 3PTAA 2FRWA 1B34A 1W1FA 1VA7A 1RAFB 3EG2A 3BE3A 2A28A 2DKGA 2RN8A 3GOXA 2DTHA 1PKSA 1BB9A 3LGFA 3MEWA 4J5YA 5FLXE 2DTIA 4LDWA 1D1CA 1PNJA 3PVQA 4KGZB 4OMNA 1IB8A 4JPBW 2MYSA 1VQ9Q 2RQRA 4KH1B 3H8ZA 2LCSA 1CKAA 4UC4A 2FPFA 2EYZA 3JCMW 1MUZA 2VKNA 1M8VA 2OTJA 2X3XD 2A08A 3MEAA 9ATCB 4PJOA 4DQ2A 4C5HA 2DO3A 2NUPB 2RJEA 2KT8A 2VWFA 4OMOA 1X75C 1O75A 1N6AA 2YUQA 2QASA 4FYWB 2MF2A 4XAXB 3X25B 2M0OA 2GQIA 3EFOB 2MWPA 1NPPA 1VQ4A 3V8LA 1ZBJA 2DXUA 2JW4A 2KRMA 1K4US 4X9DA 2M51A 1BCOA 8ATCB 1M90U 2K9GA 2C06A 3UA7A 2E64A 1FX7A 2F2WA 4X1VA 2YUPA 2A7YA 4ZGJB 3OYCA 3ME9A 4A4HA 2CSQA 1U5SA 1VOMA 4M7DG 1OZ3A 1KIKA 2O4XA 2FZGB 4EMHA 1UGPB 3EG1A 3MKDA 2OTJQ 1ZA1B 1JJ2P 3VYGA 4L6V5 1VQ6A 3LH0A 2RH2A 1YWPA 2K6DA 5DLOA 1VQ7T 4P5NA 3O5ZA 4PJMA 1C0MA 2HBPA 4QVDA 3X28B 4RTUA 1LPLA 1N8RR 1KSWA 2J6KA 1S72T 3DB3A 2EAYA 2JN0A 1GBQA 1RI9A 4CC7A 2XHCA 4CC4B 2EKHA 1RLQC 1PKTA 2AKLA 3INZA 2I2LA 2LX9A 3CCJT 2PVGB 1ZUKA 3VJPA 4RTWA 2RHIA 4CI0C 4QQDA 3JB9D 2ENMA 2OTLA 4M75A 1KQ2A 3MP1A 4XTWA 1YITQ 5GAOl 4R55A 2ESWA 2BZXA 2MK5A 3QYGB 1PHTA 2X51A 4JZ3A 4QQGA 1IGQA 4NL3A 2ZPBB 1MMAA 1M90C 2CKKA 3EG3A 1QVPA 1KC8R 3ZFJA 2PVDB 1SRMA 5KYXB 2NYSA 1I07A 2DTOA 2DETA 2YXYA 2KNBB 1AZGB 4MDWA 4Q5WA 1YIJQ 3NTIA 1M3BA 1J3TA 1WXBA 5LJ3e 2QAZA 3EGDA 1IHWA 4HCZA 4BB7A 4AFQC 3OS5A 1JO8A 2XI9A 5GJVB 3LH5A 2E3HA 3BY7A 3PIOA 1MHNA 4J8OA 5GAN5 3RNJA 2VGMA 5DLQE 4MMLA 1N8RU 4C92E 1TWBA 2F2XA 3QHSA 4OMPA 1RAHB 2JNGA 1TSFA 1PRMC 2ZPEB 5FWBA 1OI1A 1F1BB 4HT8A 1SRLA 3M58A 2G3RA 1MMDA 2C0OA 4AT1B 4IKFA 1XJWB 1AWXA 1SHFA 2DEQA 1D1AA 2CZ0B 2YDLA 2QQ9A 1PG5B 1I5OB 4N4IA 1BI0A 4JJBA 3LYIA 3G6EA 2JM8A 4M77A 1GCPA 3CC7T 3CBPA 2DNUA 3SWNA 1KC8U 4F16A 1Y96B 2P0QA 2V8IA 4L5GA 4F7UF 1ZSZA 2LP5A 2CUBA 3QYHB 1ZBXA 1D3BB 3QJYA 4AMCA 5A0GA 2A36A 2LNVA 4F7UE 1PD0A 3VU3C 5D6YA 1HK9A 5C6SA 2QG9B 3CMAT 1X43A 4MZPA 4Y28E 3CBMA 2GFUA 5KYYA 2JM9A 4OB3B 4DA4A 1XQHA 5C0MA 3CXCP 1TG0A 4PJNA 3JAME 3A8LB 3NTKA 3PGGA 2PQWA 1SKUB 4RG8A 4PKCC 1QQJA 2EQJA 4B9XA 4JRPA 2HL3A 4C92B 4XTUA 1N27A 3HPWA 3PMIA 3DB4A 1G5VA 4MZTA 4E7JA 2B86A 4PJJA 1TOVA 4HA8A 3I5RA 2JMCA 5LL6S 4RUGA 1TH7A 4IIOA 3JCMe 3E2UA 5AYFA 3EGXA 4FW2A 3VV0A 2GTJA 2E12A 3TEEA 3CMET 1UGSB 2IVWA 1BU1A 2EQMA 1WYXA 1B07A 2COZA 2EFIA 2QEXT 3JSCA 1M5Q1 3SDZA 2RA2A 3Q1JA 3O8VA 1T3SA 1ZLMA 2E65A 4ELZC 3M54A 2DJZA 1JXOA 2V26A 1UGRB 3OYIA 2RQVA 5GMKi 2ZPHB 2BIVA 4FCYA 4HCCA 4M7AD 4F7UB 1JXMA 3M55A 1GRIA 4JS5A 1K0SA 2F1LA 2JMAA 2YRDA 1OU9A 2M9UA 1GL5A 1D0XA 3RMSA 3CCQT 1RAIB 1HSQA 1QVFP 1D0YA 4N4GA 4KGXB 1S72Q 4EMKB 3OYMA 2CT4A 3P8HA 3GBQA 1E6GA 1YHQA 1ACMB 3MCAB 3J80E 4M7DF 3CCMT 2D9TA 4FYXB 3RUXA 3CCJQ 2YLBA 1Q81R 4XTVA 1U1TA 2FPEA 3ASKA 1VQLA 2FHDA 4DOVA 3EFRA 2RB6A 4MZMA 4OMFB 1UTIA 2W10A 4OB0B 3H0IA 2CP7A 2RK1A 3NGPA 5I11A 4PFPA 2LT1A 1VQNT 1Y71A 2F5TX 1LNXA 1ZA2B 4B6MA 5D7UA 2DERA 3VUZA 4C8QF 1AZEA 2JJ9A 3CCET 2RPNA 1YHQQ 3EG0A 5KYNA 4C8QE 4GLKA 2COWA 4C0DC 4L59A 2A37A 2QA4A 3FJPA 4IURA 3PT9A 2LRQA 1U3OA 1YJ9T 2K2MA 1WJQA 4JDSA 1VQKT 2CS7A 2I0NA 2K3BA 5GAN6 4A53A 4A63B 3C95A 4HCBA 2O31A 2DRMA 2AKKA 1UGQB 1XNIA 1Z9QA 1NEBA 4JJNK 1QKXA 1U8RA 1BKBA 2L3QA 2E1HA 2EWNA 3UWNA 2MOXA 1X2KA 1Q81U 2NUTB 2WSFE 3G71A 1QCNA 4ANJA 3E19A 5J3BA 2HQXA 5LJ3h 1TU0B 1K8AC 4M7AC 3E9GA 4M75G 4C5EA 3N5BB 2CUDA 2J6OA 3S3MA 3OYGA 5CVIA 2VV5A 1QP2A 3OMCA 1SG5A 5D6XA 3DKMA 5CQXA 4EIKA 1QVGA 4OMLA 2RMOA 2HMAA 3CC7Q 1EZZB 2DBMA 3UPUA 4EMGA 2DXTA 1R0CB 1D09B 2YSQA 1VQOT 2RHYA 1OV3A 2EQKA 3E9FA 3RMQA 3OYDA 3OSVA 5M9OA 4M78E 1W70A 5GAOm 3OYNA 1G3YA 1YI2A 1H641 1YJNA 1WLPB 2RF0A 3CMAQ 4ZTJA 1K73C 2OTLT 2RD1A 1N5ZA 3FEOA 3PMTA 4Z8AA 3CD6T 4XU1A 1UUEA 1VQMT 2OX7A 2JTFA 4C8QB 3AHUA 2GFAA 1Q95G 2LX7A 2LQKA 2NLUA 2X4WA 4XU0A 1G3WA 1VQ9A 3EG9B 2X4JA 4J9FA 1BI1A 4GY5A 4A4KA 5J39A 5LJ5d 2YUNA 5LJ3d 2EGCA 2DXCA 2LCLA 3FC3A 2GQVA 5GMKe 1M1KR 1WFWA 4XTZA 1Q81C 1PSEA 3OYHA 1FXXA 3CCVA 1AHJB 1NYFA 1NLPC 4CRIA 2DL5A 4RKUE 2O2OA 1YJNQ 2DEUA 3FJ5A 1BI2A 3JB9I 1Q86C 4M77G 5GMKl 1AT1B 2KR3A 2RJCA 1E6HA 3CC2T 1WIEA 3CMEQ 5CKHA 5GAMd 1ARKA 4FL6A 3C4SA 1UJYA 4RCCA 2RI5A 4M4ZA 5EG2A 2Z0WA 2QEXQ 2DYBA 1PM3A 3LLRA 5DM7R 4J83A 2HAXA 2VC8A 2RI2A 3QIIA 3JCMP 1TUCA 2L2PA 5KYWA 3T9NA 2Y4YA 4BE2A 1M1GA 2PTKA 4M78B 2K79A 3A8HB 2F5KA 1VIEA 3CCVQ 3OW2A 2EYWA 1VQ8T 4QT7A 2EKOA 1JQQA 1JU5C 4O6JA 2PVOB 5HK3A 3J7AF 2KYBA 3I55T 3CCQQ 3REAB 2DL8A 5CQYA 3H41A 3GNGA 4OVAA 1XOVA 5KYUB 2R57A 3VS1A 1M1KU 2KROA 2DIGA 2V8KA 4AG1C 1ZUUA 4E47A 2E6ZA 4R0KA 2HQEA 3OS2A 3CCMQ 2IIMA 4HKEA 2ROLA 1KQSA 3A8MB 2AK5A 5GANd 2PZ1A 2VGNA 3EHRA 4WTOB 1YJWT 1JEGA 2XK0A 1QP3A 2X4XA 4LXCA 1Y96A 1BCMA 4DBFA 2O9VA 2DBKA 3CQTA 4JS4A 1SSHA 1U1SA 2VUBA 1I0CA 3MEUA 1VQ5T 3D7SB 2EIFA 3CPWP 1YITA 3L42A 2ZPIB 4HVUA 3CC4A 1NBEB 2EQIA 3H6ZA 2F69A 1W2BP 2CH4A 3TREA 4JRQA 3MPUB 2A3LA 3CEYA 1MV0B 3M0UA 2DL4A 1QVGS 4PJOF 4Y92A 2O01E 1B7TA 2R5MA 1X6BA 2K5LA 3CCEQ 2NWMA 3LWIA 3QZ5B 3X24B 3NPFA 1YIJA 2EJ9A 4M7AG 5IHIA 3JCMd 4PJOE 3VS4A 1IZ6A 1X01A 4RTVA 4EPCA 4E7SA 2ROTA 1PSFA 4AG2C 3LW5E 3IQLA 1PC0A 2BTTA 2E4HA 1D1BA 2QQAA 8AT1B 3CCLT 1YJ9Q 3FB9A 3RESA 1VQKQ 4C92A 1UECA 2VXEA 3C94A 3MJXA 1XTDA 4C92D 3G1JA 1IGUA 2GNCA 1OX8A 2VVKA 1OPLA 3CC4Q 4DEXA 3OYEA 2KY9A 1T0JA 3RKYA 1Q82R 1JB0E 1JRIA 4XTYA 2ZPFB 2HNIA 1QMCA 3FLGA 2J6FA 2EYQA 4ELYC 1M2VA 3JV3A 2KT1A 1VYUA 1YCYA 3CBOA 5LJ5e 4BI8B 3RERA 1RLPC 3V7SA 4DBQA 2FL7A 5HKCA 4J7FA 1RABB 2C0TA 1WHJA 3L2WA 3L2QA 2QYZA 1X6OA 1VQOQ 2QI2A 4OF1A 1I5LA 4JRKA 4MMKA 2DJQA 1R0BG 3OYFA 1HJDA 5GAMe 2XMFA 5I22A 1O9SA 4M75F 2QDLA 3WVDB 2DD4A 1GBRA 2EQUA 5GAOn 4LDUA 4M75E 3RBBB 4XU2A 4LD6A 1W4SA 1HXDA 3PFSA 4PJOB 3M0TA 4EMKA 2K7AA 2RK2A 4R56A 2K5FA 2VASA 3WXMB 2DPPB 4OB1B 3QSUA 3OW2S 4BI3A 2DVEA 4FT4A 3QWYA 1Q82U 2JTEA 1Y0MA 1NPRA 4ZN3A 3HKSA 2GTOA 3M5AA 3BW1A 2X9HA 2RQWA 2X3WD 2ZCFB 2RHUA 3A98A 1E7OA 2OI3A 1ABOA 2D0QB 2LT4A 2KGTA 4J9BA 5CKEA 2OAWA 4FSXA 2VB6A 1KD1R 1WHKA 2CZ7B 3OY9A 2PUKB 2KYMA 4C0ZA 1I8FA 1Q7YR 2EJGA 5DY9A 3CC2Q 3HHTB 2O4XB 2E5QA 2LMJA 4C92C 1KQSS 2BKDN 4QW2A 2JTMA 5EC7A 3QG1A 2DVJA 1VIFA 4LUEA 5GANe 5I2MA 2PU9B 3I56T 4QVZA 1X69A 1KK7A 3JCMQ 1YP5A 2EPDA 2JT4A 2E5KA 4J6WA 1N8RC 4LDVA 1TUGB 4Y91A 5GMKh 1RAGB 1QCOA 3V8KA 3G4ST 1EFNA 1M2OA 4BDYA 1BYMA 3OYLA 3CCUT 3CCST 4M77F 1AD5A 2E70A 1VQ8Q 3VRZA 1LOJA 1LVKA 3HL8A 3TVTA 1VQ7A 4ME7A 4M77E 3P8BB 4C0FA 3I55Q 2FVUA 1WI7A 4LUDA 4BY6C 3JRZA 2NUTA 4M75B 3GP8A 4IUVA 4FIBA 2OJ2A 2K3YA 4J9EA 1Q82C 2KI7A 1S72A 2RO0A 5IXFA 1K0XA 1KC8C 1WHMA 3A8OB 4X9CA 1MV3A 4MDXA 2ED0A 3GF5A 4PNOA 2FPDA 4HVWA 1IXDA 4A54A 3CCJA 4ZTFA 1K76A 1YJWQ 2FZCB 1KD1U 4FT2A 3CCRT 4M7DD 5CAIA 1Q7YU 3MHXA 1VYVA 1JBMA 3ZEHA 4M7AA 4EMKC 4Z89A 2XICA 2ATCB 1VQ5Q 2XIDA 5A0DA 2D1XA 1NYGA 4YTLA 4LDXA 2K5IA 4OGEA 1NM7A 1VQ7Q 5IT9E 3MEVA 2KXCA 2YT6A 1V76A 2HDAA 1U06A 3RKWA 2XDBA 2L0AA 2P0KA 1WZOA 5HY6A 1VQPT 3GIBA 5GMKm 2FB7A 1NE8A 4FU6A 3OSSC 2RHXA 2RQTA 4C8QD 2BZ8A 4N0AC 2G6FX 4DOWA 1WHHA 5LJ5g 2CREA 1TS9A 4ZGEB 3EG9A 4C5IA 2GGRA 1WQWA 2CT3A 4E7ZA 5LJ3g 2ABLA 1WPYA 2X4YA 4M7DE 1YCSB 4KUDK 5GAOp 2HSEB 5L23A 4QKUA 4RTYA 4IIMA 4XTXA 1KQ1A 3GNFB 1EX4A 5CR2A 2KVQG 2W0ZA 2QGFB 1K9MR 4M77B 1G8XA 3SWNB 3A5ZB 4OMQA 2MCNA 2KRNA 3I5SA 4FYYB 5GAMg 2BUDA 3JCMV 3JCMc 1IHVA 5FWCA 1ZSZB 3WVEB 2OTJT 2WSEE 4CC2A 2CP3A 2DLPA 1Q7YC 1K1ZA 4EDUA 4J9GA 3C12A 5FU7C 2RHZA 1NG2A 3VYHB 3SHWA 5HCKA 3X20B 1UHCA 3CC7A 2CP2A 3ZL7C 5KYYB 5KCOA 3M53A 1VQ4T 4J7IA 1BIBA 1TXQA 4M78A 3TSWA 3H0HA 1UEBA 4GBQA 5LJ3f 3RR6A 2LQNA 4PLIA 1WXTA 4M78D 5CCAA 2X35A 4JJDA 1AWOA 1YFNA 4AFUC 2NUPA 3JB9H 2CSIA 1NJIR 2D8JA 5LJ5h 1QKWA 3LGLA 3CMAA 3PVLA 3JB9G 3OYBA 3EFOA 1FMKA 2L8DA 5KYUA 2L89A 4C92G 1JJ2S 1VQ6T 1SPKA 2V1QA 5GAMf 6AT1B 5GANg 1UFFA 1TTHB 4IUQA 4C0DB 5FRMA 3HRUA 1K9MU 3LX7A 2MMPA 1AVZC 1OOTA 1X6GA 2V1RA 4M7DB 1UGVA 5I2SA 2DL3A 1M9SA 2CH4W 1Y57A 3SB2A 2PUOB 5GAMh 3JB9J 4C8QC 2IG0A 4BE0A 2WACA 2DF6A 1WQ7A 4XK8E 3FDRA 3URGA 4NL2A 1UB4A 2CGHA 4OMMA 2CP5A 1M27C 3OA6A 1G3SA 2DXBA 1M3CA 2ED1A 3PIPA 3CMEA 2EJFA 3VS0A 1M3AA 3JCMg 3OYYA 5GAOr 3I56Q 3BFMA 1KFZA 5ECAA 2CZ1B 2F2VA 2QEXA 2ECZA 1PWTA 3OBYA 1S1NA 3ULRB 1MMGA 1FWZA 1T3LA 4FYVB 3G4SQ 3R6OA 3OQ5A 1SF9A 2MPXC 3NTHA 1NJIU 4DEYA 2J7IA 4BACA 1VUBA 4JJCA 1T0HA 1QWEA 2KE9A 1V1CA 4VUBA 3CCUQ 3CCSQ 5GAN8 2HQHA 4LD9K 3RDVA 4D6WA 4O5VA 1OZ2A 3H9NA 4RTZA 1YWOA 3JCMb 1Z9ZA 1QVFA 3E1SA 1YN8A 5GANh 1G83A 2D6FA 1OU8A 3CCQA 1I1JA 4K11A 1K9MC 2L5QA 5KYXA 3QWXX 2JVVA 3OB9A 4M78C 2YRCA 3X26B 1I81A 2E41A 3S6WA 3SEMA 4HXJA 3CCMA 3KFVA 1YNZA 2D0NA 5FU6B 3JCMf 4FM4B 1OPKA 3CCRQ 2E10A 3JCMJ 1C6VX 1WA7A 1Y07A 1HD3A 2QK0A 2O88A 2HSPA 4A4EA 3THKA 1GCQA 2P4RA 5IHNA 4AFSC 2QQSA 3VS7A 3G6ET 3JCMh 4II1A 3L2VA 3VS6A 3UATA 2EVRA 1QCFA 1RUWA 1VQNA 3VS5A 2LJ1A 3MP6A 2MIOA 5AT1B 2LC4A 1K9AA 4ORZA 1VQPQ 5FROA 3RIRA 3NMZC 2HD0A 3CCEA 2QXFA 2JOYA 3NHNA 2DYIA 2VXFA 1NJIC 4D8KA 1B3QA 4PJOD 2P84A 4ESRA 4OB2B 2JUFA 4TVRA 1BK2A 2DE0X 2K3XA 1CSKA 2EYYA 3HFNA 4HVVA 1YJ9A 1VQKA 5IN1A 5CIUA 2R58A 3QZ9B 1D3BA 2DMOA 3CXCS 2P4TA 2RJFA 3QJ6A 2LZ6B 1VQNQ 4E6RA 3FRNA 4B9WA 1ZQ1A 1OULA 2M02A 2C0IA 1RACB 2GF7A 4A4FA 1YBYA 2K57A 3L1AA 2LQWA 2JS0A 4NS5A 3R6NA 5KCHA 3J81E 1FYNA 3HSBA 5CK9A 1RADB 4OP0A 2H3EB 1BI3A 2CZ6B 2SRCA 4D8DA 3OS0A 1R8OB 2QGGA 2LQ8A 4KGVB 1X2QA 2XG8D 4E2FB 4PL6A 4Z88A 4E7HA 4RCBA 3FIFA 1VQ4Q 1IRXA 2AHJB 2EGEA 5CO7A 2HKQB 3M0SA 1VQOA 2WSCE 2XDDA 1WGSA 1SEMA 2AT1B 2J06A 2LJ3A 3UF4A 5IHKA 2VYTA 2K2VA 4C8QG 2GCXA 4HCKA 3META 3S3NA 1G2BA 4IUPA 3DLMA 1N9SA 3PE0A 4BUGA 1M1KC 1NLOC 1RAEB 3M56A 1RL2A 5HK0A 1AWJA 3GLXA 3TQ7P 2DRKA 3AT1B 5CKFA 1GFCA 1FMVA 1PD1A 2DD5A 4PFOA 2HCKA 3CD6A 4M75D 1VQMA 4RTTA 3VS3A 1VQ6Q 1GCQC 4KRTA 2KMTA 2R5AA 3EHQA 2FRYA 4J9HA 1V29B 3EH2A 2DK3A 1BBZA 1WJSA 4A4GA 3HFOA 4CC3A 2KBTA 1B34B 2KRSA 2HL5C 3EFSA 4X34A 1AOJA 2BE7D 4ATOA 1BIAA 3M0PA 1QVFS 3I9QA 5I21A 1ZUYA 3S3OA 4PJOC 2RM4A 1YHQT 1IREB 3L2RA 4F7UA 3JB9F 1ABQA 2Y4XA 2BE9B 3OMGA 2HKNA 4C92F 2AIRB 5GAOq 2J05A 2COYA 2YUOA 5KYWB 2OTLQ 2M1HA 1VQLT 2RI3A 3CC2A 3CD6Q 1DJ7B 4NOYA 4XQ3A 5FW9A 1VQMQ 3F70A 4KUIA 5CKDA 1OQKA 1R77A 1MNDA 1OX9A 3I35A 3NFCA 4LN2A 4M78G 4J6XA 1LCKA 7AT1B 5IH2A 3P8DA 1AWWA 1M8MA 2QQBA 3V7RA 4E7IA 2KAFA 5FRNA 1HYOA 4RMOA 3OYAA 2CYZB 1WHLA 2EW3A 2LTOA 2BZYA 4PFZA 3JCMX 3EH1A 5GMKj 1VQ8A 2MAMA 2LCCA
chains in the Genus database with same CATH topology
3M0QA 1YWPA 1YCSB 2K6DA 5L23A 3O5ZA 4RTYA 4IIMA 1ZSGA 2LX7A 1NEGA 4J9FA 2W0ZA 4RTUA 2YUNA 1KSWA 2J6KA 1WX6A 2EGCA 4OMQA 2MCNA 1GBQA 1OEBA 1RI9A 4CC7A 2KRNA 3I5SA 1WFWA 4CC4B 2EKHA 1RLQC 1PKTA 2AKLA 5FWCA 4CC2A 1ZUKA 4RTWA 2GBQA 1WXUA 2DLPA 1NYFA 1NLPC 2DL5A 1W6XA 2O2OA 1K1ZA 2ENMA 2FEIA 3FJ5A 4J9GA 4RTXA 2KR3A 4JZ4A 1E6HA 1WIEA 4F17A 1NG2A 3SHWA 5HCKA 2ESWA 2JS2A 1UHCA 1ARKA 2BZXA 3ZL7C 4ZNXA 1PHTA 1UJYA 4JZ3A 2AZSA 4M4ZA 1M30A 2DM1A 3TSWA 3H0HA 3EG3A 2DYBA 4GBQA 2LQNA 1WXTA 4JJDA 4F14A 1AWOA 1SRMA 1ZX6A 4AFUC 1I07A 5IXBA 1A0NB 1CKBA 1TUCA 2L2PA 2KNBB 1AZGB 1M3BA 2CSIA 2PTKA 2D8JA 2LNHB 1J3TA 1QKWA 3PVLA 1WXBA 2K79A 1UHFA 4AFQC 2EYWA 2L3PA 1FMKA 1JO8A 5GJVB 3LH5A 4QT7A 1JQQA 1SPKA 3TSZA 1JU5C 2O9SA 2V1QA 3RNJA 1UFFA 2KYBA 3REAB 2DL8A 1AVZC 1OOTA 1X6GA 2F2XA 4OMPA 2V1RA 2FG0A 3H41A 1UGVA 2NUZA 1GFDA 1XOVA 1PRMC 3VS1A 2DL3A 5FWBA 2RQUA 2KROA 1SRLA 2CH4W 4AG1C 1ZUUA 2RNAA 1Y57A 4R0KA 2IIMA 2C0OA 2H8HA 4FSSA 1AWXA 1SHFA 2ROLA 2DF6A 2AK5A 2PZ1A 3EHRA 1VYTA 1JEGA 2YDLA 3REBB 4OMMA 4J9IA 1M27C 3C0CA 4JJBA 2O9VA 2DBKA 3CQTA 1SSHA 1UDLA 1PRLC 1M3CA 2DILA 1I0CA 2ED1A 1H92A 2JM8A 1M3AA 3VS0A 4GLMA 1GCPA 4HVUA 2EQIA 2DNUA 2CH4A 4F16A 4LNPA 1KFZA 5ECAA 2F2VA 5GJWB 2ECZA 1PWTA 1S1NA 2LP5A 2CUBA 3ULRB 3U23A 3M0UA 1MV0B 2DL4A 1X27A 1T3LA 4Y92A 4WCIA 1X6BA 3UA6A 2A36A 2NWMA 4DEYA 2J7IA 3NPFA 1T0HA 4JJCA 1QWEA 5IHIA 2KE9A 1V1CA 3VS4A 1AEYA 4RTVA 3VS2A 1X43A 2KXDA 2ROTA 4AG2C 3IQLA 4RTZA 2BTTA 2JM9A 1YWOA 1Z9ZA 2LJ0A 1YN8A 1G83A 2KEAA 1TG0A 1UECA 1KJWA 1I1JA 4K11A 2GNCA 1H8KA 2VVKA 3QWXX 1OPLA 3M0RA 4DEXA 1T0JA 3EGUA 1H3HA 3SEMA 4HXJA 3KFVA 1YNZA 2D0NA 3VRYA 2B86A 1OPKA 2J6FA 3JV3A 1SHGA 1WA7A 2EGAA 2KT1A 1VYUA 3I5RA 1HD3A 2JMCA 4RUGA 2O88A 2HSPA 4IIOA 3THKA 1GCQA 1RLPC 2P4RA 5IHNA 4AFSC 3VS7A 2GTJA 3VS6A 3UATA 2C0TA 2EVRA 1BU1A 1WYXA 1QCFA 1B07A 1RUWA 3VS5A 2LJ1A 2JXBA 2MIOA 2HBWA 4LE9A 1K9AA 4ORZA 3NMZC 2DJQA 1T3SA 1ZLMA 3NHNA 4D8KA 1B3QA 1HJDA 1JXOA 2XMFA 5I22A 2CDTA 2QDLA 4ESRA 2RQVA 1BK2A 2DE0X 1GBRA 1WDXA 1CSKA 2EYYA 3RBBB 4HVVA 2D8HA 1QLYA 1JXMA 3M0TA 1GRIA 2DL7A 2K7AA 1K0SA 2JMAA 2DA9A 1GL5A 2SEMA 2DMOA 1HSQA 2EYXA 3QWYA 2LZ6B 2JTEA 1Y0MA 4E6RA 2GTOA 2CT4A 2RQWA 2C0IA 3GBQA 1E6GA 1UG1A 2X3WD 3A98A 1E7OA 2OI3A 1IO6A 2LQWA 2JS0A 4J9DA 1ABOA 3R6NA 2KGTA 4J9BA 2FPEA 1FYNA 2OAWA 2M0YA 2KYMA 4AFZC 1TUDA 2HEQA 2SRCA 1UTIA 2W10A 4D8DA 2LMJA 3H0IA 1X2QA 4Z88A 1UE9A 2EBPA 5EC7A 2DVJA 4LUEA 3NGPA 5I11A 2EGEA 2PNIA 1X69A 3M0SA 2FO0A 1SEMA 2JT4A 1YP5A 2EPDA 2E5KA 2LJ3A 2J06A 3UF4A 2DX1A 5IHKA 2L3SA 4J9CA 2AZVA 1UJ0A 4HCKA 1EFNA 1G2BA 1AZEA 3PE0A 1NLOC 2RPNA 3H0FA 3EG0A 1QWFA 1AWJA 2DRKA 2FRWA 1GFCA 1W1FA 1VA7A 3EG2A 2HCKA 2A28A 1AD5A 2RN8A 4RTTA 1PKSA 1BB9A 2A37A 3VRZA 3VS3A 1GCQC 4KRTA 3EHQA 3TVTA 2FRYA 4J9HA 1U3OA 1PNJA 3PVQA 1BBZA 2K2MA 4OMNA 4JPBW 1WI7A 4LUDA 4CC3A 2I0NA 2K3BA 2KBTA 2KRSA 4A63B 2OJ2A 2RQRA 1AOJA 2O31A 2DRMA 2AKKA 4J9EA 2LCSA 1CKAA 3M0PA 1Z9QA 1NEBA 5IXFA 1K0XA 2FPFA 2EYZA 3I9QA 1MV3A 1QKXA 1ZUYA 2ED0A 1MUZA 2L3QA 2FPDA 2MOXA 1X2KA 4HVWA 2VKNA 1K76A 1ABQA 2X3XD 2A08A 2CUDA 2J6OA 1VYVA 2J05A 2YUOA 2KT8A 2VWFA 4OMOA 4Z89A 2YUQA 5FW9A 4EIKA 2D1XA 4OMLA 1NYGA 2RMOA 2GQIA 1NM7A 2DBMA 3I35A 4LN2A 1ZBJA 2JW4A 2KXCA 2KRMA 2YT6A 1LCKA 2YSQA 1K4US 2M51A 1OV3A 5IH2A 2K9GA 2HDAA 1U06A 1AWWA 1M8MA 3UA7A 2L0AA 2F2WA 4X1VA 2YUPA 1W70A 2CSQA 1U5SA 2RQTA 1WLPB 2BZ8A 1KIKA 2RF0A 2EW3A 2G6FX 2BZYA 3EG1A 2CREA 1N5ZA 4Z8AA 2GGRA 2CT3A 1UUEA 2ABLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0Q A;  1YWP A;  1YCS B;  2K6D A;  5L23 A;  3O5Z A;  4RTY A;  4IIM A;  1ZSG A;  2LX7 A;  1NEG A;  4J9F A;  2W0Z A;  4RTU A;  2YUN A;  1KSW A;  2J6K A;  1WX6 A;  2EGC A;  4OMQ A;  2MCN A;  1GBQ A;  1OEB A;  1RI9 A;  4CC7 A;  2KRN A;  3I5S A;  1WFW A;  4CC4 B;  2EKH A;  1RLQ C;  1PKT A;  2AKL A;  5FWC A;  4CC2 A;  1ZUK A;  4RTW A;  2GBQ A;  1WXU A;  2DLP A;  1NYF A;  1NLP C;  2DL5 A;  1W6X A;  2O2O A;  1K1Z A;  2ENM A;  2FEI A;  3FJ5 A;  4J9G A;  4RTX A;  2KR3 A;  4JZ4 A;  1E6H A;  1WIE A;  4F17 A;  1NG2 A;  3SHW A;  5HCK A;  2ESW A;  2JS2 A;  1UHC A;  1ARK A;  2BZX A;  3ZL7 C;  4ZNX A;  1PHT A;  1UJY A;  4JZ3 A;  2AZS A;  4M4Z A;  1M30 A;  2DM1 A;  3TSW A;  3H0H A;  3EG3 A;  2DYB A;  4GBQ A;  2LQN A;  1WXT A;  4JJD A;  4F14 A;  1AWO A;  1SRM A;  1ZX6 A;  4AFU C;  1I07 A;  5IXB A;  1A0N B;  1CKB A;  1TUC A;  2L2P A;  2KNB B;  1AZG B;  1M3B A;  2CSI A;  2PTK A;  2D8J A;  2LNH B;  1J3T A;  1QKW A;  3PVL A;  1WXB A;  2K79 A;  1UHF A;  4AFQ C;  2EYW A;  2L3P A;  1FMK A;  1JO8 A;  5GJV B;  3LH5 A;  4QT7 A;  1JQQ A;  1SPK A;  3TSZ A;  1JU5 C;  2O9S A;  2V1Q A;  3RNJ A;  1UFF A;  2KYB A;  3REA B;  2DL8 A;  1AVZ C;  1OOT A;  1X6G A;  2F2X A;  4OMP A;  2V1R A;  2FG0 A;  3H41 A;  1UGV A;  2NUZ A;  1GFD A;  1XOV A;  1PRM C;  3VS1 A;  2DL3 A;  5FWB A;  2RQU A;  2KRO A;  1SRL A;  2CH4 W;  4AG1 C;  1ZUU A;  2RNA A;  1Y57 A;  4R0K A;  2IIM A;  2C0O A;  2H8H A;  4FSS A;  1AWX A;  1SHF A;  2ROL A;  2DF6 A;  2AK5 A;  2PZ1 A;  3EHR A;  1VYT A;  1JEG A;  2YDL A;  3REB B;  4OMM A;  4J9I A;  1M27 C;  3C0C A;  4JJB A;  2O9V A;  2DBK A;  3CQT A;  1SSH A;  1UDL A;  1PRL C;  1M3C A;  2DIL A;  1I0C A;  2ED1 A;  1H92 A;  2JM8 A;  1M3A A;  3VS0 A;  4GLM A;  1GCP A;  4HVU A;  2EQI A;  2DNU A;  2CH4 A;  4F16 A;  4LNP A;  1KFZ A;  5ECA A;  2F2V A;  5GJW B;  2ECZ A;  1PWT A;  1S1N A;  2LP5 A;  2CUB A;  3ULR B;  3U23 A;  3M0U A;  1MV0 B;  2DL4 A;  1X27 A;  1T3L A;  4Y92 A;  4WCI A;  1X6B A;  3UA6 A;  2A36 A;  2NWM A;  4DEY A;  2J7I A;  3NPF A;  1T0H A;  4JJC A;  1QWE A;  5IHI A;  2KE9 A;  1V1C A;  3VS4 A;  1AEY A;  4RTV A;  3VS2 A;  1X43 A;  2KXD A;  2ROT A;  4AG2 C;  3IQL A;  4RTZ A;  2BTT A;  2JM9 A;  1YWO A;  1Z9Z A;  2LJ0 A;  1YN8 A;  1G83 A;  2KEA A;  1TG0 A;  1UEC A;  1KJW A;  1I1J A;  4K11 A;  2GNC A;  1H8K A;  2VVK A;  3QWX X;  1OPL A;  3M0R A;  4DEX A;  1T0J A;  3EGU A;  1H3H A;  3SEM A;  4HXJ A;  3KFV A;  1YNZ A;  2D0N A;  3VRY A;  2B86 A;  1OPK A;  2J6F A;  3JV3 A;  1SHG A;  1WA7 A;  2EGA A;  2KT1 A;  1VYU A;  3I5R A;  1HD3 A;  2JMC A;  4RUG A;  2O88 A;  2HSP A;  4IIO A;  3THK A;  1GCQ A;  1RLP C;  2P4R A;  5IHN A;  4AFS C;  3VS7 A;  2GTJ A;  3VS6 A;  3UAT A;  2C0T A;  2EVR A;  1BU1 A;  1WYX A;  1QCF A;  1B07 A;  1RUW A;  3VS5 A;  2LJ1 A;  2JXB A;  2MIO A;  2HBW A;  4LE9 A;  1K9A A;  4ORZ A;  3NMZ C;  2DJQ A;  1T3S A;  1ZLM A;  3NHN A;  4D8K A;  1B3Q A;  1HJD A;  1JXO A;  2XMF A;  5I22 A;  2CDT A;  2QDL A;  4ESR A;  2RQV A;  1BK2 A;  2DE0 X;  1GBR A;  1WDX A;  1CSK A;  2EYY A;  3RBB B;  4HVV A;  2D8H A;  1QLY A;  1JXM A;  3M0T A;  1GRI A;  2DL7 A;  2K7A A;  1K0S A;  2JMA A;  2DA9 A;  1GL5 A;  2SEM A;  2DMO A;  1HSQ A;  2EYX A;  3QWY A;  2LZ6 B;  2JTE A;  1Y0M A;  4E6R A;  2GTO A;  2CT4 A;  2RQW A;  2C0I A;  3GBQ A;  1E6G A;  1UG1 A;  2X3W D;  3A98 A;  1E7O A;  2OI3 A;  1IO6 A;  2LQW A;  2JS0 A;  4J9D A;  1ABO A;  3R6N A;  2KGT A;  4J9B A;  2FPE A;  1FYN A;  2OAW A;  2M0Y A;  2KYM A;  4AFZ C;  1TUD A;  2HEQ A;  2SRC A;  1UTI A;  2W10 A;  4D8D A;  2LMJ A;  3H0I A;  1X2Q A;  4Z88 A;  1UE9 A;  2EBP A;  5EC7 A;  2DVJ A;  4LUE A;  3NGP A;  5I11 A;  2EGE A;  2PNI A;  1X69 A;  3M0S A;  2FO0 A;  1SEM A;  2JT4 A;  1YP5 A;  2EPD A;  2E5K A;  2LJ3 A;  2J06 A;  3UF4 A;  2DX1 A;  5IHK A;  2L3S A;  4J9C A;  2AZV A;  1UJ0 A;  4HCK A;  1EFN A;  1G2B A;  1AZE A;  3PE0 A;  1NLO C;  2RPN A;  3H0F A;  3EG0 A;  1QWF A;  1AWJ A;  2DRK A;  2FRW A;  1GFC A;  1W1F A;  1VA7 A;  3EG2 A;  2HCK A;  2A28 A;  1AD5 A;  2RN8 A;  4RTT A;  1PKS A;  1BB9 A;  2A37 A;  3VRZ A;  3VS3 A;  1GCQ C;  4KRT A;  3EHQ A;  3TVT A;  2FRY A;  4J9H A;  1U3O A;  1PNJ A;  3PVQ A;  1BBZ A;  2K2M A;  4OMN A;  4JPB W;  1WI7 A;  4LUD A;  4CC3 A;  2I0N A;  2K3B A;  2KBT A;  2KRS A;  4A63 B;  2OJ2 A;  2RQR A;  1AOJ A;  2O31 A;  2DRM A;  2AKK A;  4J9E A;  2LCS A;  1CKA A;  3M0P A;  1Z9Q A;  1NEB A;  5IXF A;  1K0X A;  2FPF A;  2EYZ A;  3I9Q A;  1MV3 A;  1QKX A;  1ZUY A;  2ED0 A;  1MUZ A;  2L3Q A;  2FPD A;  2MOX A;  1X2K A;  4HVW A;  2VKN A;  1K76 A;  1ABQ A;  2X3X D;  2A08 A;  2CUD A;  2J6O A;  1VYV A;  2J05 A;  2YUO A;  2KT8 A;  2VWF A;  4OMO A;  4Z89 A;  2YUQ A;  5FW9 A;  4EIK A;  2D1X A;  4OML A;  1NYG A;  2RMO A;  2GQI A;  1NM7 A;  2DBM A;  3I35 A;  4LN2 A;  1ZBJ A;  2JW4 A;  2KXC A;  2KRM A;  2YT6 A;  1LCK A;  2YSQ A;  1K4U S;  2M51 A;  1OV3 A;  5IH2 A;  2K9G A;  2HDA A;  1U06 A;  1AWW A;  1M8M A;  3UA7 A;  2L0A A;  2F2W A;  4X1V A;  2YUP A;  1W70 A;  2CSQ A;  1U5S A;  2RQT A;  1WLP B;  2BZ8 A;  1KIK A;  2RF0 A;  2EW3 A;  2G6F X;  2BZY A;  3EG1 A;  2CRE A;  1N5Z A;  4Z8A A;  2GGR A;  2CT3 A;  1UUE A;  2ABL A; 
#chains in the Genus database with same CATH topology
 4N0A A;  3UT1 A;  5A0L A;  3M0Q A;  2QA4 T;  2FZK B;  3HRS A;  4M77 D;  1ZSG A;  5GAN 7;  3I55 A;  2QTX A;  4IUT A;  1NEG A;  5A2Q E;  2YHT A;  2MI6 A;  4J6Y A;  3CPF A;  2H3J A;  1WX6 A;  3QKJ A;  4ZGD B;  4E7K A;  1OEB A;  3A1P A;  1SSF A;  3G71 T;  3VUB A;  1YJW A;  4M75 C;  1JJ2 A;  2GBQ A;  1WXU A;  3CPW A;  1GXI E;  3QDR B;  1W6X A;  2FEI A;  2KK4 A;  4RTX A;  1W2B A;  4JZ4 A;  1VQ5 A;  3G6E Q;  4F17 A;  4HT9 A;  1M1F A;  2FYK A;  2JS2 A;  4ZNX A;  4JLG A;  4ZN1 A;  3VKI A;  4OGC A;  2AZS A;  4V2S A;  3PNW C;  1QVG P;  1M30 A;  2DM1 A;  4LDY A;  4F14 A;  1ZX6 A;  5IXB A;  1A0N B;  1CKB A;  2JZ2 A;  1K8A R;  1YI2 T;  1YJN T;  2LNH B;  1UHF A;  4M7D A;  3QBY A;  4BE1 A;  2L3P A;  3HRT A;  2K4Y A;  3CCL A;  1M2V B;  3EAE A;  3TSZ A;  2O9S A;  3BDU A;  4JLI A;  4Z02 A;  3TU4 K;  2L3R A;  5KH6 A;  2FG0 A;  3EGD B;  2NUZ A;  1VQ9 T;  1GFD A;  3HTR A;  2RQU A;  3M57 A;  1ZHI A;  4BY6 B;  2RNA A;  2ZAE A;  1KHC A;  5CKB A;  3OBW A;  3M4Y A;  2QQR A;  2H8H A;  4PK4 A;  4FSS A;  3SD4 A;  2DZ9 A;  4E7L A;  3BDL A;  4DBR A;  2QTV A;  1VYT A;  1K73 R;  3CCV T;  4C8Q A;  3REB B;  4J9I A;  3C0C A;  4WF2 A;  4M77 C;  3DLL A;  3OYJ A;  1UDL A;  1PRL C;  2DIL A;  4KT0 E;  3SWN C;  1H92 A;  2XKO C;  4C5G A;  4GLM A;  3CCL Q;  1H3Z A;  1D0Z A;  1ZSZ C;  3GPL A;  4N4H A;  4LNP A;  3QO3 A;  4BI4 A;  1LJO A;  5GJW B;  3QUI A;  5KE2 A;  1I4K 1;  3L2U A;  4PJO G;  3U23 A;  3TCJ A;  1X27 A;  4WCI A;  3UA6 A;  2YRV A;  1K8A U;  3V7C A;  4M7A F;  2YLC A;  1AEY A;  4DBH A;  3VS2 A;  2KXD A;  1KD1 C;  1Q86 R;  4M7A E;  2LJ0 A;  1C1A A;  2V8J A;  2KEA A;  3OW2 P;  5LJ5 j;  1KJW A;  2A0F B;  4JRI A;  2YWW A;  2ZPG B;  5LJ3 j;  1H8K A;  3RKX A;  3M0R A;  5J26 A;  4QQ6 A;  2ZGW A;  1PCX A;  3EGU A;  1H3H A;  5LJ5 f;  1Y7X A;  2XD0 A;  1N9R A;  2Y90 A;  3QPH A;  3VRY A;  1K73 U;  5D6W A;  1WNL A;  4IUU A;  1SHG A;  2EGA A;  4F04 B;  4M7D C;  3ZBD A;  3KXT A;  1VQL Q;  1KG1 A;  1KQS P;  5GAM j;  3CXC A;  1FMW A;  4BDZ A;  2E6N A;  1OYX A;  1KHI A;  2DAQ A;  1YIT T;  2IPO B;  2QDY B;  3OYK A;  3CPW S;  2DFU A;  3I56 A;  4BD3 A;  3CC4 T;  1RI0 A;  2JXB A;  5FU7 B;  2HBW A;  3KBG A;  4LE9 A;  1W2B S;  2LVM A;  5L8R E;  3QXE B;  3A8G B;  3EGX B;  3G4S A;  1WHG A;  4PLL A;  2LDM A;  2CDT A;  2CP0 A;  3CCU A;  3QDF A;  2B8A A;  1YIJ T;  3CCS A;  3OS1 A;  1Q86 U;  1MGQ A;  1WDX A;  1P92 A;  4KBM B;  2DZC A;  2D8H A;  2XU8 A;  3M59 A;  4RG2 A;  1QLY A;  2QA4 Q;  4KH0 B;  2P0P A;  2DL7 A;  5GAN 3;  4C0G A;  4QVC A;  3HP9 A;  2KSS A;  4M78 F;  2DA9 A;  2SEM A;  4M7A B;  3MO8 A;  1EIF A;  1M4Z A;  2M16 A;  4FW1 A;  1MMN A;  4JUV A;  3UDC A;  2KQW A;  2EYX A;  3L2Z A;  5GAN 4;  4XU3 A;  3KUF A;  2HZY A;  5IAY A;  5GAN j;  1WJR A;  4F7U G;  1UG1 A;  4PJL A;  3M9Q A;  1RAA B;  1G3T A;  5GAN 2;  3G71 Q;  2DIQ A;  2RJD A;  1IO6 A;  2XDP A;  4J9D A;  2CP6 A;  3CCR A;  2MWO A;  2ZZD A;  5GAN f;  4KUL A;  2M0Y A;  2KDS A;  3LWH A;  2OAU A;  4AFZ C;  1TUD A;  2HEQ A;  3G7Z A;  3V8J A;  1QW1 A;  1UE9 A;  2EBP A;  3ER0 A;  5FU6 C;  1NZ9 A;  2PNI A;  2FO0 A;  2DX1 A;  2L3S A;  4J9C A;  3M4G A;  1VQP A;  5KE3 A;  1MNE A;  2AZV A;  1M90 R;  1UJ0 A;  2E3I A;  3MP8 A;  3SFM A;  3H0F A;  1YI2 Q;  1QWF A;  3PTA A;  2FRW A;  1B34 A;  1W1F A;  1VA7 A;  1RAF B;  3EG2 A;  3BE3 A;  2A28 A;  2DKG A;  2RN8 A;  3GOX A;  2DTH A;  1PKS A;  1BB9 A;  3LGF A;  3MEW A;  4J5Y A;  5FLX E;  2DTI A;  4LDW A;  1D1C A;  1PNJ A;  3PVQ A;  4KGZ B;  4OMN A;  1IB8 A;  4JPB W;  2MYS A;  1VQ9 Q;  2RQR A;  4KH1 B;  3H8Z A;  2LCS A;  1CKA A;  4UC4 A;  2FPF A;  2EYZ A;  3JCM W;  1MUZ A;  2VKN A;  1M8V A;  2OTJ A;  2X3X D;  2A08 A;  3MEA A;  9ATC B;  4PJO A;  4DQ2 A;  4C5H A;  2DO3 A;  2NUP B;  2RJE A;  2KT8 A;  2VWF A;  4OMO A;  1X75 C;  1O75 A;  1N6A A;  2YUQ A;  2QAS A;  4FYW B;  2MF2 A;  4XAX B;  3X25 B;  2M0O A;  2GQI A;  3EFO B;  2MWP A;  1NPP A;  1VQ4 A;  3V8L A;  1ZBJ A;  2DXU A;  2JW4 A;  2KRM A;  1K4U S;  4X9D A;  2M51 A;  1BCO A;  8ATC B;  1M90 U;  2K9G A;  2C06 A;  3UA7 A;  2E64 A;  1FX7 A;  2F2W A;  4X1V A;  2YUP A;  2A7Y A;  4ZGJ B;  3OYC A;  3ME9 A;  4A4H A;  2CSQ A;  1U5S A;  1VOM A;  4M7D G;  1OZ3 A;  1KIK A;  2O4X A;  2FZG B;  4EMH A;  1UGP B;  3EG1 A;  3MKD A;  2OTJ Q;  1ZA1 B;  1JJ2 P;  3VYG A;  4L6V 5;  1VQ6 A;  3LH0 A;  2RH2 A;  1YWP A;  2K6D A;  5DLO A;  1VQ7 T;  4P5N A;  3O5Z A;  4PJM A;  1C0M A;  2HBP A;  4QVD A;  3X28 B;  4RTU A;  1LPL A;  1N8R R;  1KSW A;  2J6K A;  1S72 T;  3DB3 A;  2EAY A;  2JN0 A;  1GBQ A;  1RI9 A;  4CC7 A;  2XHC A;  4CC4 B;  2EKH A;  1RLQ C;  1PKT A;  2AKL A;  3INZ A;  2I2L A;  2LX9 A;  3CCJ T;  2PVG B;  1ZUK A;  3VJP A;  4RTW A;  2RHI A;  4CI0 C;  4QQD A;  3JB9 D;  2ENM A;  2OTL A;  4M75 A;  1KQ2 A;  3MP1 A;  4XTW A;  1YIT Q;  5GAO l;  4R55 A;  2ESW A;  2BZX A;  2MK5 A;  3QYG B;  1PHT A;  2X51 A;  4JZ3 A;  4QQG A;  1IGQ A;  4NL3 A;  2ZPB B;  1MMA A;  1M90 C;  2CKK A;  3EG3 A;  1QVP A;  1KC8 R;  3ZFJ A;  2PVD B;  1SRM A;  5KYX B;  2NYS A;  1I07 A;  2DTO A;  2DET A;  2YXY A;  2KNB B;  1AZG B;  4MDW A;  4Q5W A;  1YIJ Q;  3NTI A;  1M3B A;  1J3T A;  1WXB A;  5LJ3 e;  2QAZ A;  3EGD A;  1IHW A;  4HCZ A;  4BB7 A;  4AFQ C;  3OS5 A;  1JO8 A;  2XI9 A;  5GJV B;  3LH5 A;  2E3H A;  3BY7 A;  3PIO A;  1MHN A;  4J8O A;  5GAN 5;  3RNJ A;  2VGM A;  5DLQ E;  4MML A;  1N8R U;  4C92 E;  1TWB A;  2F2X A;  3QHS A;  4OMP A;  1RAH B;  2JNG A;  1TSF A;  1PRM C;  2ZPE B;  5FWB A;  1OI1 A;  1F1B B;  4HT8 A;  1SRL A;  3M58 A;  2G3R A;  1MMD A;  2C0O A;  4AT1 B;  4IKF A;  1XJW B;  1AWX A;  1SHF A;  2DEQ A;  1D1A A;  2CZ0 B;  2YDL A;  2QQ9 A;  1PG5 B;  1I5O B;  4N4I A;  1BI0 A;  4JJB A;  3LYI A;  3G6E A;  2JM8 A;  4M77 A;  1GCP A;  3CC7 T;  3CBP A;  2DNU A;  3SWN A;  1KC8 U;  4F16 A;  1Y96 B;  2P0Q A;  2V8I A;  4L5G A;  4F7U F;  1ZSZ A;  2LP5 A;  2CUB A;  3QYH B;  1ZBX A;  1D3B B;  3QJY A;  4AMC A;  5A0G A;  2A36 A;  2LNV A;  4F7U E;  1PD0 A;  3VU3 C;  5D6Y A;  1HK9 A;  5C6S A;  2QG9 B;  3CMA T;  1X43 A;  4MZP A;  4Y28 E;  3CBM A;  2GFU A;  5KYY A;  2JM9 A;  4OB3 B;  4DA4 A;  1XQH A;  5C0M A;  3CXC P;  1TG0 A;  4PJN A;  3JAM E;  3A8L B;  3NTK A;  3PGG A;  2PQW A;  1SKU B;  4RG8 A;  4PKC C;  1QQJ A;  2EQJ A;  4B9X A;  4JRP A;  2HL3 A;  4C92 B;  4XTU A;  1N27 A;  3HPW A;  3PMI A;  3DB4 A;  1G5V A;  4MZT A;  4E7J A;  2B86 A;  4PJJ A;  1TOV A;  4HA8 A;  3I5R A;  2JMC A;  5LL6 S;  4RUG A;  1TH7 A;  4IIO A;  3JCM e;  3E2U A;  5AYF A;  3EGX A;  4FW2 A;  3VV0 A;  2GTJ A;  2E12 A;  3TEE A;  3CME T;  1UGS B;  2IVW A;  1BU1 A;  2EQM A;  1WYX A;  1B07 A;  2COZ A;  2EFI A;  2QEX T;  3JSC A;  1M5Q 1;  3SDZ A;  2RA2 A;  3Q1J A;  3O8V A;  1T3S A;  1ZLM A;  2E65 A;  4ELZ C;  3M54 A;  2DJZ A;  1JXO A;  2V26 A;  1UGR B;  3OYI A;  2RQV A;  5GMK i;  2ZPH B;  2BIV A;  4FCY A;  4HCC A;  4M7A D;  4F7U B;  1JXM A;  3M55 A;  1GRI A;  4JS5 A;  1K0S A;  2F1L A;  2JMA A;  2YRD A;  1OU9 A;  2M9U A;  1GL5 A;  1D0X A;  3RMS A;  3CCQ T;  1RAI B;  1HSQ A;  1QVF P;  1D0Y A;  4N4G A;  4KGX B;  1S72 Q;  4EMK B;  3OYM A;  2CT4 A;  3P8H A;  3GBQ A;  1E6G A;  1YHQ A;  1ACM B;  3MCA B;  3J80 E;  4M7D F;  3CCM T;  2D9T A;  4FYX B;  3RUX A;  3CCJ Q;  2YLB A;  1Q81 R;  4XTV A;  1U1T A;  2FPE A;  3ASK A;  1VQL A;  2FHD A;  4DOV A;  3EFR A;  2RB6 A;  4MZM A;  4OMF B;  1UTI A;  2W10 A;  4OB0 B;  3H0I A;  2CP7 A;  2RK1 A;  3NGP A;  5I11 A;  4PFP A;  2LT1 A;  1VQN T;  1Y71 A;  2F5T X;  1LNX A;  1ZA2 B;  4B6M A;  5D7U A;  2DER A;  3VUZ A;  4C8Q F;  1AZE A;  2JJ9 A;  3CCE T;  2RPN A;  1YHQ Q;  3EG0 A;  5KYN A;  4C8Q E;  4GLK A;  2COW A;  4C0D C;  4L59 A;  2A37 A;  2QA4 A;  3FJP A;  4IUR A;  3PT9 A;  2LRQ A;  1U3O A;  1YJ9 T;  2K2M A;  1WJQ A;  4JDS A;  1VQK T;  2CS7 A;  2I0N A;  2K3B A;  5GAN 6;  4A53 A;  4A63 B;  3C95 A;  4HCB A;  2O31 A;  2DRM A;  2AKK A;  1UGQ B;  1XNI A;  1Z9Q A;  1NEB A;  4JJN K;  1QKX A;  1U8R A;  1BKB A;  2L3Q A;  2E1H A;  2EWN A;  3UWN A;  2MOX A;  1X2K A;  1Q81 U;  2NUT B;  2WSF E;  3G71 A;  1QCN A;  4ANJ A;  3E19 A;  5J3B A;  2HQX A;  5LJ3 h;  1TU0 B;  1K8A C;  4M7A C;  3E9G A;  4M75 G;  4C5E A;  3N5B B;  2CUD A;  2J6O A;  3S3M A;  3OYG A;  5CVI A;  2VV5 A;  1QP2 A;  3OMC A;  1SG5 A;  5D6X A;  3DKM A;  5CQX A;  4EIK A;  1QVG A;  4OML A;  2RMO A;  2HMA A;  3CC7 Q;  1EZZ B;  2DBM A;  3UPU A;  4EMG A;  2DXT A;  1R0C B;  1D09 B;  2YSQ A;  1VQO T;  2RHY A;  1OV3 A;  2EQK A;  3E9F A;  3RMQ A;  3OYD A;  3OSV A;  5M9O A;  4M78 E;  1W70 A;  5GAO m;  3OYN A;  1G3Y A;  1YI2 A;  1H64 1;  1YJN A;  1WLP B;  2RF0 A;  3CMA Q;  4ZTJ A;  1K73 C;  2OTL T;  2RD1 A;  1N5Z A;  3FEO A;  3PMT A;  4Z8A A;  3CD6 T;  4XU1 A;  1UUE A;  1VQM T;  2OX7 A;  2JTF A;  4C8Q B;  3AHU A;  2GFA A;  1Q95 G;  2LX7 A;  2LQK A;  2NLU A;  2X4W A;  4XU0 A;  1G3W A;  1VQ9 A;  3EG9 B;  2X4J A;  4J9F A;  1BI1 A;  4GY5 A;  4A4K A;  5J39 A;  5LJ5 d;  2YUN A;  5LJ3 d;  2EGC A;  2DXC A;  2LCL A;  3FC3 A;  2GQV A;  5GMK e;  1M1K R;  1WFW A;  4XTZ A;  1Q81 C;  1PSE A;  3OYH A;  1FXX A;  3CCV A;  1AHJ B;  1NYF A;  1NLP C;  4CRI A;  2DL5 A;  4RKU E;  2O2O A;  1YJN Q;  2DEU A;  3FJ5 A;  1BI2 A;  3JB9 I;  1Q86 C;  4M77 G;  5GMK l;  1AT1 B;  2KR3 A;  2RJC A;  1E6H A;  3CC2 T;  1WIE A;  3CME Q;  5CKH A;  5GAM d;  1ARK A;  4FL6 A;  3C4S A;  1UJY A;  4RCC A;  2RI5 A;  4M4Z A;  5EG2 A;  2Z0W A;  2QEX Q;  2DYB A;  1PM3 A;  3LLR A;  5DM7 R;  4J83 A;  2HAX A;  2VC8 A;  2RI2 A;  3QII A;  3JCM P;  1TUC A;  2L2P A;  5KYW A;  3T9N A;  2Y4Y A;  4BE2 A;  1M1G A;  2PTK A;  4M78 B;  2K79 A;  3A8H B;  2F5K A;  1VIE A;  3CCV Q;  3OW2 A;  2EYW A;  1VQ8 T;  4QT7 A;  2EKO A;  1JQQ A;  1JU5 C;  4O6J A;  2PVO B;  5HK3 A;  3J7A F;  2KYB A;  3I55 T;  3CCQ Q;  3REA B;  2DL8 A;  5CQY A;  3H41 A;  3GNG A;  4OVA A;  1XOV A;  5KYU B;  2R57 A;  3VS1 A;  1M1K U;  2KRO A;  2DIG A;  2V8K A;  4AG1 C;  1ZUU A;  4E47 A;  2E6Z A;  4R0K A;  2HQE A;  3OS2 A;  3CCM Q;  2IIM A;  4HKE A;  2ROL A;  1KQS A;  3A8M B;  2AK5 A;  5GAN d;  2PZ1 A;  2VGN A;  3EHR A;  4WTO B;  1YJW T;  1JEG A;  2XK0 A;  1QP3 A;  2X4X A;  4LXC A;  1Y96 A;  1BCM A;  4DBF A;  2O9V A;  2DBK A;  3CQT A;  4JS4 A;  1SSH A;  1U1S A;  2VUB A;  1I0C A;  3MEU A;  1VQ5 T;  3D7S B;  2EIF A;  3CPW P;  1YIT A;  3L42 A;  2ZPI B;  4HVU A;  3CC4 A;  1NBE B;  2EQI A;  3H6Z A;  2F69 A;  1W2B P;  2CH4 A;  3TRE A;  4JRQ A;  3MPU B;  2A3L A;  3CEY A;  1MV0 B;  3M0U A;  2DL4 A;  1QVG S;  4PJO F;  4Y92 A;  2O01 E;  1B7T A;  2R5M A;  1X6B A;  2K5L A;  3CCE Q;  2NWM A;  3LWI A;  3QZ5 B;  3X24 B;  3NPF A;  1YIJ A;  2EJ9 A;  4M7A G;  5IHI A;  3JCM d;  4PJO E;  3VS4 A;  1IZ6 A;  1X01 A;  4RTV A;  4EPC A;  4E7S A;  2ROT A;  1PSF A;  4AG2 C;  3LW5 E;  3IQL A;  1PC0 A;  2BTT A;  2E4H A;  1D1B A;  2QQA A;  8AT1 B;  3CCL T;  1YJ9 Q;  3FB9 A;  3RES A;  1VQK Q;  4C92 A;  1UEC A;  2VXE A;  3C94 A;  3MJX A;  1XTD A;  4C92 D;  3G1J A;  1IGU A;  2GNC A;  1OX8 A;  2VVK A;  1OPL A;  3CC4 Q;  4DEX A;  3OYE A;  2KY9 A;  1T0J A;  3RKY A;  1Q82 R;  1JB0 E;  1JRI A;  4XTY A;  2ZPF B;  2HNI A;  1QMC A;  3FLG A;  2J6F A;  2EYQ A;  4ELY C;  1M2V A;  3JV3 A;  2KT1 A;  1VYU A;  1YCY A;  3CBO A;  5LJ5 e;  4BI8 B;  3RER A;  1RLP C;  3V7S A;  4DBQ A;  2FL7 A;  5HKC A;  4J7F A;  1RAB B;  2C0T A;  1WHJ A;  3L2W A;  3L2Q A;  2QYZ A;  1X6O A;  1VQO Q;  2QI2 A;  4OF1 A;  1I5L A;  4JRK A;  4MMK A;  2DJQ A;  1R0B G;  3OYF A;  1HJD A;  5GAM e;  2XMF A;  5I22 A;  1O9S A;  4M75 F;  2QDL A;  3WVD B;  2DD4 A;  1GBR A;  2EQU A;  5GAO n;  4LDU A;  4M75 E;  3RBB B;  4XU2 A;  4LD6 A;  1W4S A;  1HXD A;  3PFS A;  4PJO B;  3M0T A;  4EMK A;  2K7A A;  2RK2 A;  4R56 A;  2K5F A;  2VAS A;  3WXM B;  2DPP B;  4OB1 B;  3QSU A;  3OW2 S;  4BI3 A;  2DVE A;  4FT4 A;  3QWY A;  1Q82 U;  2JTE A;  1Y0M A;  1NPR A;  4ZN3 A;  3HKS A;  2GTO A;  3M5A A;  3BW1 A;  2X9H A;  2RQW A;  2X3W D;  2ZCF B;  2RHU A;  3A98 A;  1E7O A;  2OI3 A;  1ABO A;  2D0Q B;  2LT4 A;  2KGT A;  4J9B A;  5CKE A;  2OAW A;  4FSX A;  2VB6 A;  1KD1 R;  1WHK A;  2CZ7 B;  3OY9 A;  2PUK B;  2KYM A;  4C0Z A;  1I8F A;  1Q7Y R;  2EJG A;  5DY9 A;  3CC2 Q;  3HHT B;  2O4X B;  2E5Q A;  2LMJ A;  4C92 C;  1KQS S;  2BKD N;  4QW2 A;  2JTM A;  5EC7 A;  3QG1 A;  2DVJ A;  1VIF A;  4LUE A;  5GAN e;  5I2M A;  2PU9 B;  3I56 T;  4QVZ A;  1X69 A;  1KK7 A;  3JCM Q;  1YP5 A;  2EPD A;  2JT4 A;  2E5K A;  4J6W A;  1N8R C;  4LDV A;  1TUG B;  4Y91 A;  5GMK h;  1RAG B;  1QCO A;  3V8K A;  3G4S T;  1EFN A;  1M2O A;  4BDY A;  1BYM A;  3OYL A;  3CCU T;  3CCS T;  4M77 F;  1AD5 A;  2E70 A;  1VQ8 Q;  3VRZ A;  1LOJ A;  1LVK A;  3HL8 A;  3TVT A;  1VQ7 A;  4ME7 A;  4M77 E;  3P8B B;  4C0F A;  3I55 Q;  2FVU A;  1WI7 A;  4LUD A;  4BY6 C;  3JRZ A;  2NUT A;  4M75 B;  3GP8 A;  4IUV A;  4FIB A;  2OJ2 A;  2K3Y A;  4J9E A;  1Q82 C;  2KI7 A;  1S72 A;  2RO0 A;  5IXF A;  1K0X A;  1KC8 C;  1WHM A;  3A8O B;  4X9C A;  1MV3 A;  4MDX A;  2ED0 A;  3GF5 A;  4PNO A;  2FPD A;  4HVW A;  1IXD A;  4A54 A;  3CCJ A;  4ZTF A;  1K76 A;  1YJW Q;  2FZC B;  1KD1 U;  4FT2 A;  3CCR T;  4M7D D;  5CAI A;  1Q7Y U;  3MHX A;  1VYV A;  1JBM A;  3ZEH A;  4M7A A;  4EMK C;  4Z89 A;  2XIC A;  2ATC B;  1VQ5 Q;  2XID A;  5A0D A;  2D1X A;  1NYG A;  4YTL A;  4LDX A;  2K5I A;  4OGE A;  1NM7 A;  1VQ7 Q;  5IT9 E;  3MEV A;  2KXC A;  2YT6 A;  1V76 A;  2HDA A;  1U06 A;  3RKW A;  2XDB A;  2L0A A;  2P0K A;  1WZO A;  5HY6 A;  1VQP T;  3GIB A;  5GMK m;  2FB7 A;  1NE8 A;  4FU6 A;  3OSS C;  2RHX A;  2RQT A;  4C8Q D;  2BZ8 A;  4N0A C;  2G6F X;  4DOW A;  1WHH A;  5LJ5 g;  2CRE A;  1TS9 A;  4ZGE B;  3EG9 A;  4C5I A;  2GGR A;  1WQW A;  2CT3 A;  4E7Z A;  5LJ3 g;  2ABL A;  1WPY A;  2X4Y A;  4M7D E;  1YCS B;  4KUD K;  5GAO p;  2HSE B;  5L23 A;  4QKU A;  4RTY A;  4IIM A;  4XTX A;  1KQ1 A;  3GNF B;  1EX4 A;  5CR2 A;  2KVQ G;  2W0Z A;  2QGF B;  1K9M R;  4M77 B;  1G8X A;  3SWN B;  3A5Z B;  4OMQ A;  2MCN A;  2KRN A;  3I5S A;  4FYY B;  5GAM g;  2BUD A;  3JCM V;  3JCM c;  1IHV A;  5FWC A;  1ZSZ B;  3WVE B;  2OTJ T;  2WSE E;  4CC2 A;  2CP3 A;  2DLP A;  1Q7Y C;  1K1Z A;  4EDU A;  4J9G A;  3C12 A;  5FU7 C;  2RHZ A;  1NG2 A;  3VYH B;  3SHW A;  5HCK A;  3X20 B;  1UHC A;  3CC7 A;  2CP2 A;  3ZL7 C;  5KYY B;  5KCO A;  3M53 A;  1VQ4 T;  4J7I A;  1BIB A;  1TXQ A;  4M78 A;  3TSW A;  3H0H A;  1UEB A;  4GBQ A;  5LJ3 f;  3RR6 A;  2LQN A;  4PLI A;  1WXT A;  4M78 D;  5CCA A;  2X35 A;  4JJD A;  1AWO A;  1YFN A;  4AFU C;  2NUP A;  3JB9 H;  2CSI A;  1NJI R;  2D8J A;  5LJ5 h;  1QKW A;  3LGL A;  3CMA A;  3PVL A;  3JB9 G;  3OYB A;  3EFO A;  1FMK A;  2L8D A;  5KYU A;  2L89 A;  4C92 G;  1JJ2 S;  1VQ6 T;  1SPK A;  2V1Q A;  5GAM f;  6AT1 B;  5GAN g;  1UFF A;  1TTH B;  4IUQ A;  4C0D B;  5FRM A;  3HRU A;  1K9M U;  3LX7 A;  2MMP A;  1AVZ C;  1OOT A;  1X6G A;  2V1R A;  4M7D B;  1UGV A;  5I2S A;  2DL3 A;  1M9S A;  2CH4 W;  1Y57 A;  3SB2 A;  2PUO B;  5GAM h;  3JB9 J;  4C8Q C;  2IG0 A;  4BE0 A;  2WAC A;  2DF6 A;  1WQ7 A;  4XK8 E;  3FDR A;  3URG A;  4NL2 A;  1UB4 A;  2CGH A;  4OMM A;  2CP5 A;  1M27 C;  3OA6 A;  1G3S A;  2DXB A;  1M3C A;  2ED1 A;  3PIP A;  3CME A;  2EJF A;  3VS0 A;  1M3A A;  3JCM g;  3OYY A;  5GAO r;  3I56 Q;  3BFM A;  1KFZ A;  5ECA A;  2CZ1 B;  2F2V A;  2QEX A;  2ECZ A;  1PWT A;  3OBY A;  1S1N A;  3ULR B;  1MMG A;  1FWZ A;  1T3L A;  4FYV B;  3G4S Q;  3R6O A;  3OQ5 A;  1SF9 A;  2MPX C;  3NTH A;  1NJI U;  4DEY A;  2J7I A;  4BAC A;  1VUB A;  4JJC A;  1T0H A;  1QWE A;  2KE9 A;  1V1C A;  4VUB A;  3CCU Q;  3CCS Q;  5GAN 8;  2HQH A;  4LD9 K;  3RDV A;  4D6W A;  4O5V A;  1OZ2 A;  3H9N A;  4RTZ A;  1YWO A;  3JCM b;  1Z9Z A;  1QVF A;  3E1S A;  1YN8 A;  5GAN h;  1G83 A;  2D6F A;  1OU8 A;  3CCQ A;  1I1J A;  4K11 A;  1K9M C;  2L5Q A;  5KYX A;  3QWX X;  2JVV A;  3OB9 A;  4M78 C;  2YRC A;  3X26 B;  1I81 A;  2E41 A;  3S6W A;  3SEM A;  4HXJ A;  3CCM A;  3KFV A;  1YNZ A;  2D0N A;  5FU6 B;  3JCM f;  4FM4 B;  1OPK A;  3CCR Q;  2E10 A;  3JCM J;  1C6V X;  1WA7 A;  1Y07 A;  1HD3 A;  2QK0 A;  2O88 A;  2HSP A;  4A4E A;  3THK A;  1GCQ A;  2P4R A;  5IHN A;  4AFS C;  2QQS A;  3VS7 A;  3G6E T;  3JCM h;  4II1 A;  3L2V A;  3VS6 A;  3UAT A;  2EVR A;  1QCF A;  1RUW A;  1VQN A;  3VS5 A;  2LJ1 A;  3MP6 A;  2MIO A;  5AT1 B;  2LC4 A;  1K9A A;  4ORZ A;  1VQP Q;  5FRO A;  3RIR A;  3NMZ C;  2HD0 A;  3CCE A;  2QXF A;  2JOY A;  3NHN A;  2DYI A;  2VXF A;  1NJI C;  4D8K A;  1B3Q A;  4PJO D;  2P84 A;  4ESR A;  4OB2 B;  2JUF A;  4TVR A;  1BK2 A;  2DE0 X;  2K3X A;  1CSK A;  2EYY A;  3HFN A;  4HVV A;  1YJ9 A;  1VQK A;  5IN1 A;  5CIU A;  2R58 A;  3QZ9 B;  1D3B A;  2DMO A;  3CXC S;  2P4T A;  2RJF A;  3QJ6 A;  2LZ6 B;  1VQN Q;  4E6R A;  3FRN A;  4B9W A;  1ZQ1 A;  1OUL A;  2M02 A;  2C0I A;  1RAC B;  2GF7 A;  4A4F A;  1YBY A;  2K57 A;  3L1A A;  2LQW A;  2JS0 A;  4NS5 A;  3R6N A;  5KCH A;  3J81 E;  1FYN A;  3HSB A;  5CK9 A;  1RAD B;  4OP0 A;  2H3E B;  1BI3 A;  2CZ6 B;  2SRC A;  4D8D A;  3OS0 A;  1R8O B;  2QGG A;  2LQ8 A;  4KGV B;  1X2Q A;  2XG8 D;  4E2F B;  4PL6 A;  4Z88 A;  4E7H A;  4RCB A;  3FIF A;  1VQ4 Q;  1IRX A;  2AHJ B;  2EGE A;  5CO7 A;  2HKQ B;  3M0S A;  1VQO A;  2WSC E;  2XDD A;  1WGS A;  1SEM A;  2AT1 B;  2J06 A;  2LJ3 A;  3UF4 A;  5IHK A;  2VYT A;  2K2V A;  4C8Q G;  2GCX A;  4HCK A;  3MET A;  3S3N A;  1G2B A;  4IUP A;  3DLM A;  1N9S A;  3PE0 A;  4BUG A;  1M1K C;  1NLO C;  1RAE B;  3M56 A;  1RL2 A;  5HK0 A;  1AWJ A;  3GLX A;  3TQ7 P;  2DRK A;  3AT1 B;  5CKF A;  1GFC A;  1FMV A;  1PD1 A;  2DD5 A;  4PFO A;  2HCK A;  3CD6 A;  4M75 D;  1VQM A;  4RTT A;  3VS3 A;  1VQ6 Q;  1GCQ C;  4KRT A;  2KMT A;  2R5A A;  3EHQ A;  2FRY A;  4J9H A;  1V29 B;  3EH2 A;  2DK3 A;  1BBZ A;  1WJS A;  4A4G A;  3HFO A;  4CC3 A;  2KBT A;  1B34 B;  2KRS A;  2HL5 C;  3EFS A;  4X34 A;  1AOJ A;  2BE7 D;  4ATO A;  1BIA A;  3M0P A;  1QVF S;  3I9Q A;  5I21 A;  1ZUY A;  3S3O A;  4PJO C;  2RM4 A;  1YHQ T;  1IRE B;  3L2R A;  4F7U A;  3JB9 F;  1ABQ A;  2Y4X A;  2BE9 B;  3OMG A;  2HKN A;  4C92 F;  2AIR B;  5GAO q;  2J05 A;  2COY A;  2YUO A;  5KYW B;  2OTL Q;  2M1H A;  1VQL T;  2RI3 A;  3CC2 A;  3CD6 Q;  1DJ7 B;  4NOY A;  4XQ3 A;  5FW9 A;  1VQM Q;  3F70 A;  4KUI A;  5CKD A;  1OQK A;  1R77 A;  1MND A;  1OX9 A;  3I35 A;  3NFC A;  4LN2 A;  4M78 G;  4J6X A;  1LCK A;  7AT1 B;  5IH2 A;  3P8D A;  1AWW A;  1M8M A;  2QQB A;  3V7R A;  4E7I A;  2KAF A;  5FRN A;  1HYO A;  4RMO A;  3OYA A;  2CYZ B;  1WHL A;  2EW3 A;  2LTO A;  2BZY A;  4PFZ A;  3JCM X;  3EH1 A;  5GMK j;  1VQ8 A;  2MAM A;  2LCC A; 
#chains in the Genus database with same CATH homology
 3M0Q A;  1YWP A;  1YCS B;  2K6D A;  5L23 A;  3O5Z A;  4RTY A;  4IIM A;  1ZSG A;  2LX7 A;  1NEG A;  4J9F A;  2W0Z A;  4RTU A;  2YUN A;  1KSW A;  2J6K A;  1WX6 A;  2EGC A;  4OMQ A;  2MCN A;  1GBQ A;  1OEB A;  1RI9 A;  4CC7 A;  2KRN A;  3I5S A;  1WFW A;  4CC4 B;  2EKH A;  1RLQ C;  1PKT A;  2AKL A;  5FWC A;  4CC2 A;  1ZUK A;  4RTW A;  2GBQ A;  1WXU A;  2DLP A;  1NYF A;  1NLP C;  2DL5 A;  1W6X A;  2O2O A;  1K1Z A;  2ENM A;  2FEI A;  3FJ5 A;  4J9G A;  4RTX A;  2KR3 A;  4JZ4 A;  1E6H A;  1WIE A;  4F17 A;  1NG2 A;  3SHW A;  5HCK A;  2ESW A;  2JS2 A;  1UHC A;  1ARK A;  2BZX A;  3ZL7 C;  4ZNX A;  1PHT A;  1UJY A;  4JZ3 A;  2AZS A;  4M4Z A;  1M30 A;  2DM1 A;  3TSW A;  3H0H A;  3EG3 A;  2DYB A;  4GBQ A;  2LQN A;  1WXT A;  4JJD A;  4F14 A;  1AWO A;  1SRM A;  1ZX6 A;  4AFU C;  1I07 A;  5IXB A;  1A0N B;  1CKB A;  1TUC A;  2L2P A;  2KNB B;  1AZG B;  1M3B A;  2CSI A;  2PTK A;  2D8J A;  2LNH B;  1J3T A;  1QKW A;  3PVL A;  1WXB A;  2K79 A;  1UHF A;  4AFQ C;  2EYW A;  2L3P A;  1FMK A;  1JO8 A;  5GJV B;  3LH5 A;  4QT7 A;  1JQQ A;  1SPK A;  3TSZ A;  1JU5 C;  2O9S A;  2V1Q A;  3RNJ A;  1UFF A;  2KYB A;  3REA B;  2DL8 A;  1AVZ C;  1OOT A;  1X6G A;  2F2X A;  4OMP A;  2V1R A;  2FG0 A;  3H41 A;  1UGV A;  2NUZ A;  1GFD A;  1XOV A;  1PRM C;  3VS1 A;  2DL3 A;  5FWB A;  2RQU A;  2KRO A;  1SRL A;  2CH4 W;  4AG1 C;  1ZUU A;  2RNA A;  1Y57 A;  4R0K A;  2IIM A;  2C0O A;  2H8H A;  4FSS A;  1AWX A;  1SHF A;  2ROL A;  2DF6 A;  2AK5 A;  2PZ1 A;  3EHR A;  1VYT A;  1JEG A;  2YDL A;  3REB B;  4OMM A;  4J9I A;  1M27 C;  3C0C A;  4JJB A;  2O9V A;  2DBK A;  3CQT A;  1SSH A;  1UDL A;  1PRL C;  1M3C A;  2DIL A;  1I0C A;  2ED1 A;  1H92 A;  2JM8 A;  1M3A A;  3VS0 A;  4GLM A;  1GCP A;  4HVU A;  2EQI A;  2DNU A;  2CH4 A;  4F16 A;  4LNP A;  1KFZ A;  5ECA A;  2F2V A;  5GJW B;  2ECZ A;  1PWT A;  1S1N A;  2LP5 A;  2CUB A;  3ULR B;  3U23 A;  3M0U A;  1MV0 B;  2DL4 A;  1X27 A;  1T3L A;  4Y92 A;  4WCI A;  1X6B A;  3UA6 A;  2A36 A;  2NWM A;  4DEY A;  2J7I A;  3NPF A;  1T0H A;  4JJC A;  1QWE A;  5IHI A;  2KE9 A;  1V1C A;  3VS4 A;  1AEY A;  4RTV A;  3VS2 A;  1X43 A;  2KXD A;  2ROT A;  4AG2 C;  3IQL A;  4RTZ A;  2BTT A;  2JM9 A;  1YWO A;  1Z9Z A;  2LJ0 A;  1YN8 A;  1G83 A;  2KEA A;  1TG0 A;  1UEC A;  1KJW A;  1I1J A;  4K11 A;  2GNC A;  1H8K A;  2VVK A;  3QWX X;  1OPL A;  3M0R A;  4DEX A;  1T0J A;  3EGU A;  1H3H A;  3SEM A;  4HXJ A;  3KFV A;  1YNZ A;  2D0N A;  3VRY A;  2B86 A;  1OPK A;  2J6F A;  3JV3 A;  1SHG A;  1WA7 A;  2EGA A;  2KT1 A;  1VYU A;  3I5R A;  1HD3 A;  2JMC A;  4RUG A;  2O88 A;  2HSP A;  4IIO A;  3THK A;  1GCQ A;  1RLP C;  2P4R A;  5IHN A;  4AFS C;  3VS7 A;  2GTJ A;  3VS6 A;  3UAT A;  2C0T A;  2EVR A;  1BU1 A;  1WYX A;  1QCF A;  1B07 A;  1RUW A;  3VS5 A;  2LJ1 A;  2JXB A;  2MIO A;  2HBW A;  4LE9 A;  1K9A A;  4ORZ A;  3NMZ C;  2DJQ A;  1T3S A;  1ZLM A;  3NHN A;  4D8K A;  1B3Q A;  1HJD A;  1JXO A;  2XMF A;  5I22 A;  2CDT A;  2QDL A;  4ESR A;  2RQV A;  1BK2 A;  2DE0 X;  1GBR A;  1WDX A;  1CSK A;  2EYY A;  3RBB B;  4HVV A;  2D8H A;  1QLY A;  1JXM A;  3M0T A;  1GRI A;  2DL7 A;  2K7A A;  1K0S A;  2JMA A;  2DA9 A;  1GL5 A;  2SEM A;  2DMO A;  1HSQ A;  2EYX A;  3QWY A;  2LZ6 B;  2JTE A;  1Y0M A;  4E6R A;  2GTO A;  2CT4 A;  2RQW A;  2C0I A;  3GBQ A;  1E6G A;  1UG1 A;  2X3W D;  3A98 A;  1E7O A;  2OI3 A;  1IO6 A;  2LQW A;  2JS0 A;  4J9D A;  1ABO A;  3R6N A;  2KGT A;  4J9B A;  2FPE A;  1FYN A;  2OAW A;  2M0Y A;  2KYM A;  4AFZ C;  1TUD A;  2HEQ A;  2SRC A;  1UTI A;  2W10 A;  4D8D A;  2LMJ A;  3H0I A;  1X2Q A;  4Z88 A;  1UE9 A;  2EBP A;  5EC7 A;  2DVJ A;  4LUE A;  3NGP A;  5I11 A;  2EGE A;  2PNI A;  1X69 A;  3M0S A;  2FO0 A;  1SEM A;  2JT4 A;  1YP5 A;  2EPD A;  2E5K A;  2LJ3 A;  2J06 A;  3UF4 A;  2DX1 A;  5IHK A;  2L3S A;  4J9C A;  2AZV A;  1UJ0 A;  4HCK A;  1EFN A;  1G2B A;  1AZE A;  3PE0 A;  1NLO C;  2RPN A;  3H0F A;  3EG0 A;  1QWF A;  1AWJ A;  2DRK A;  2FRW A;  1GFC A;  1W1F A;  1VA7 A;  3EG2 A;  2HCK A;  2A28 A;  1AD5 A;  2RN8 A;  4RTT A;  1PKS A;  1BB9 A;  2A37 A;  3VRZ A;  3VS3 A;  1GCQ C;  4KRT A;  3EHQ A;  3TVT A;  2FRY A;  4J9H A;  1U3O A;  1PNJ A;  3PVQ A;  1BBZ A;  2K2M A;  4OMN A;  4JPB W;  1WI7 A;  4LUD A;  4CC3 A;  2I0N A;  2K3B A;  2KBT A;  2KRS A;  4A63 B;  2OJ2 A;  2RQR A;  1AOJ A;  2O31 A;  2DRM A;  2AKK A;  4J9E A;  2LCS A;  1CKA A;  3M0P A;  1Z9Q A;  1NEB A;  5IXF A;  1K0X A;  2FPF A;  2EYZ A;  3I9Q A;  1MV3 A;  1QKX A;  1ZUY A;  2ED0 A;  1MUZ A;  2L3Q A;  2FPD A;  2MOX A;  1X2K A;  4HVW A;  2VKN A;  1K76 A;  1ABQ A;  2X3X D;  2A08 A;  2CUD A;  2J6O A;  1VYV A;  2J05 A;  2YUO A;  2KT8 A;  2VWF A;  4OMO A;  4Z89 A;  2YUQ A;  5FW9 A;  4EIK A;  2D1X A;  4OML A;  1NYG A;  2RMO A;  2GQI A;  1NM7 A;  2DBM A;  3I35 A;  4LN2 A;  1ZBJ A;  2JW4 A;  2KXC A;  2KRM A;  2YT6 A;  1LCK A;  2YSQ A;  1K4U S;  2M51 A;  1OV3 A;  5IH2 A;  2K9G A;  2HDA A;  1U06 A;  1AWW A;  1M8M A;  3UA7 A;  2L0A A;  2F2W A;  4X1V A;  2YUP A;  1W70 A;  2CSQ A;  1U5S A;  2RQT A;  1WLP B;  2BZ8 A;  1KIK A;  2RF0 A;  2EW3 A;  2G6F X;  2BZY A;  3EG1 A;  2CRE A;  1N5Z A;  4Z8A A;  2GGR A;  2CT3 A;  1UUE A;  2ABL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...