1NLOC

Structure of signal transduction protein, nmr, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC
molecule tags Complex (transferase/peptide)
source organism Gallus gallus
publication title Molecular basis for the binding of SH3 ligands with non-peptide elements identified by combinatorial synthesis.
pubmed doi rcsb
total genus 7
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1996-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1nloC00
2D0NA 3UA7A 5L23A 3EG0A 2L3QA 4OMMA 1KSWA 4HXJA 2GTOA 5I22A 2G6FX 3EHQA 2DRKA 2CT3A 4F16A 1PWTA 2LNHB 1WXTA 2W10A 3IQLA 5GJWB 3NMZC 3TSZA 1UE9A 2X3WD 4QT7A 1PHTA 5I11A 1V1CA 2EYYA 1E7OA 1NLPC 1KJWA 3VRZA 1K1ZA 4Z88A 2DL4A 2GNCA 1M27C 2J05A 1OOTA 4J9EA 3KFVA 1B07A 2ENMA 3H0IA 1UJ0A 1FYNA 2L3PA 2ESWA 2JM9A 1NG2A 2DYBA 2DF6A 2LMJA 1U3OA 1JXMA 1X6GA 2B86A 1AZEA 1M3BA 1VYTA 4ESRA 4DEYA 1WI7A 4GLMA 2YUPA 1WDXA 4Y92A 1MV0B 3VRYA 2J6KA 2LJ3A 2KT1A 4OMOA 2ABLA 1GFDA 2XMFA 4EIKA 4LUEA 1YP5A 2KEAA 2EYWA 1NM7A 2EQIA 2O9SA 1VYVA 2D1XA 4J9BA 4RTTA 1U06A 2KYMA 3QWYA 5IXBA 2K3BA 1X2KA 1AWJA 1ABQA 1WXUA 3VS6A 2J06A 1HSQA 5IHIA 3SEMA 4IIMA 4JPBW 3NHNA 2FPEA 2YUOA 2L3SA 1VYUA 1M3AA 2RF0A 2GTJA 2JS2A 4ZNXA 2L0AA 2LQWA 2DMOA 2PTKA 2JW4A 2DLPA 2KRNA 4RTUA 4D8KA 1H8KA 2EVRA 3H0HA 2FG0A 1PNJA 3THKA 2EGEA 3I5RA 2I0NA 3M0SA 1YWOA 2CSQA 2HDAA 2SRCA 1PRLC 1SRLA 3C0CA 1TUDA 2HCKA 1JU5C 2LJ0A 2OJ2A 1ZLMA 1TUCA 3VS3A 2K9GA 4F14A 2EPDA 2HEQA 1MV3A 2CREA 4FSSA 4LE9A 2GBQA 4J9GA 2M51A 4J9HA 2DJQA 2MIOA 4J9FA 1I1JA 3A98A 1QWEA 2KT8A 1TG0A 1GCQA 1NLOC 2ROTA 2JM8A 1J3TA 2P4RA 2DVJA 2KXCA 2PZ1A 2IIMA 1SRMA 2W0ZA 4D8DA 2KNBB 2AKLA 2DL8A 2FEIA 2LX7A 1AWWA 2RMOA 3PE0A 1ZUUA 1OV3A 1QWFA 4CC4B 1X2QA 2FRWA 2KE9A 1Z9ZA 4JZ4A 2O31A 1AZGB 2ECZA 4HVVA 3RBBB 2KYBA 1JXOA 2J6FA 5EC7A 2DBKA 3SHWA 4Z8AA 2YT6A 1KFZA 2O88A 2O2OA 2PNIA 1ZUYA 5IH2A 3M0RA 1EFNA 3UF4A 1E6HA 2JS0A 1QCFA 2ROLA 1GFCA 1ABOA 1OPKA 2DL7A 1M3CA 1SSHA 1NYGA 1PKSA 3EG3A 1RI9A 1UTIA 1UECA 2AKKA 2RQRA 3M0TA 4OMNA 2JTEA 3M0UA 4AFZC 1HJDA 2YDLA 2JT4A 1YWPA 2L2PA 1BU1A 1IO6A 1U5SA 1PRMC 2D8HA 2RN8A 2DL5A 1GBRA 1Y57A 1AEYA 3H41A 1CKAA 4AFUC 1B3QA 5GJVB 1ZBJA 2CUBA 1K4US 1VA7A 5ECAA 1JQQA 4DEXA 3EGUA 1MUZA 3VS1A 2AK5A 3REBB 1K0XA 5IXFA 1RUWA 1AWOA 2BZYA 3U23A 3REAB 1BBZA 4LNPA 2KROA 3M0PA 4LN2A 2YSQA 3VS7A 1I0CA 2A28A 1N5ZA 3M0QA 2JMAA 2J7IA 1G83A 1K0SA 1I07A 3ULRB 2LP5A 4HCKA 4J9CA 5FWCA 2X3XD 4JJDA 2DE0X 1WX6A 4IIOA 1UDLA 4RTYA 1WA7A 2EGAA 2FRYA 1KIKA 2MCNA 3EG2A 1FMKA 1WYXA 4K11A 1SHGA 2VKNA 2M0YA 1T0HA 2KGTA 2FO0A 4WCIA 1XOVA 2ED1A 2OI3A 4OMQA 3VS2A 2GGRA 2A08A 2A36A 5FW9A 3VS5A 4F17A 4ORZA 4JZ3A 2LCSA 4J9DA 1A0NB 4HVWA 1LCKA 4RTXA 1UG1A 2ED0A 1G2BA 1YCSB 1WFWA 2QDLA 3I5SA 2SEMA 1NEBA 2KRMA 4RUGA 1JO8A 2LZ6B 5IHKA 2DRMA 2GQIA 4AG1C 1T0JA 4CC2A 1QKWA 3PVLA 1BK2A 4OMLA 2EYZA 2RPNA 2KRSA 2K2MA 2BTTA 3EG1A 2HSPA 4JJCA 2CH4A 1NYFA 1WLPB 2DNUA 3JV3A 2EW3A 2AZSA 4RTWA 1UJYA 2CUDA 5HCKA 4OMPA 4CC7A 1QLYA 2RQTA 4AG2C 2YUNA 1GCQC 1Y0MA 2A37A 4X1VA 2K6DA 2JXBA 3NPFA 2BZXA 1OEBA 3I9QA 2KBTA 1UGVA 1GL5A 1WXBA 2RQVA 1X27A 1SPKA 1CSKA 4KRTA 1SHFA 1S1NA 2KR3A 3LH5A 3UA6A 1SEMA 1AD5A 3TSWA 2RQUA 1ZX6A 1W6XA 1YN8A 2CT4A 1ZUKA 2C0TA 1H3HA 1BB9A 2F2XA 1H92A 3VS4A 2VWFA 2K7AA 1UHCA 4Z89A 2V1QA 2FPFA 1AOJA 2EBPA 3UATA 2VVKA 1X6BA 1ZSGA 1OPLA 2DA9A 3PVQA 1M8MA 4AFSC 4J9IA 1UHFA 3I35A 1W70A 4GBQA 2FPDA 2JMCA 2EGCA 5IHNA 3RNJA 4E6RA 4M4ZA 4RTZA 1RLPC 1K9AA 1X43A 4CC3A 1YNZA 1UFFA 4A63B 4RTVA 3R6NA 2NUZA 2CSIA 2OAWA 2EKHA 2CDTA 3GBQA 1W1FA 1AWXA 1WIEA 1GRIA 2H8HA 3ZL7C 1E6GA 2J6OA 1GBQA 1M30A 2DILA 2DL3A 2F2VA 3QWXX 1ARKA 3NGPA 1QKXA 2DM1A 2NWMA 2K79A 2C0IA 2LQNA 2HBWA 2C0OA 2F2WA 3EHRA 3O5ZA 2LJ1A 5FWBA 4HVUA 2RQWA 1PKTA 1X69A 2CH4W 1JEGA 1Z9QA 3FJ5A 2YUQA 2D8JA 1AVZC 2E5KA 4JJBA 2BZ8A 1HD3A 3VS0A 2DBMA 2EYXA 2V1RA 1RLQC 4AFQC 3TVTA 1UUEA 1T3LA 1K76A 2MOXA 2KXDA 2AZVA 2O9VA 3CQTA 1GCPA 1T3SA 4LUDA 3H0FA 1NEGA 2DX1A 2RNAA 4R0KA 1CKBA
chains in the Genus database with same CATH superfamily
1VQ8Q 3UA7A 5L23A 2RH2A 2E10A 2CP7A 2RI2A 1KSWA 3EHQA 1NJIU 2K2VA 2CP0A 2CT3A 5CQYA 1YBYA 1ZA1B 2X3WD 1JBMA 4QT7A 3A8OB 2QA4A 2EYYA 1W2BS 2XICA 1W2BP 1E7OA 3CCVT 3SWNA 2NYSA 2E41A 1X6OA 5GAOn 3G7ZA 1WZOA 3UWNA 1OOTA 5LJ5g 3KFVA 5IAYA 2ENMA 3BY7A 1FYNA 1QMCA 1JJ2P 1VIFA 2L3PA 4QKUA 2HZYA 3H6ZA 2ZPGB 1NG2A 5GAN5 4BACA 1JJ2A 5GAMe 1X6GA 4LD6A 2GFAA 3MP1A 2F5KA 3MP6A 4PLIA 3FLGA 1OZ2A 3UDCA 4GLMA 3TU4K 5FU7B 2YUPA 2GQVA 4Y92A 1JB0E 5HK3A 4EDUA 1VQMA 2XMFA 4EIKA 1H641 3R6OA 2XK0A 2KEAA 3GP8A 1OQKA 2EQIA 5GANe 2D1XA 2KYMA 2IG0A 2WACA 3QWYA 5IT9E 3OYAA 2LQKA 2Y90A 1AWJA 1ABQA 2O01E 2J06A 4XK8E 1HSQA 2EYQA 1P92A 4IIMA 1Y96A 2OTJT 3M4YA 4E7IA 1IB8A 3NHNA 2FPEA 2L3SA 3P8HA 1VYUA 1M3AA 2RHXA 1PC0A 4WF2A 1YJ9A 3BDLA 2LQWA 2PTKA 2QEXQ 2LT4A 3PMIA 3LW5E 4FIBA 3CC2T 4D8KA 4E7SA 4II1A 3CCVA 1KHIA 3OMGA 3THKA 2EGEA 4IUPA 1WJQA 4M75E 2I2LA 3C0CA 1WJSA 2XHCA 2GCXA 2OJ2A 3FB9A 4HA8A 4C5HA 3UPUA 1FWZA 1FMVA 5KYYA 2EPDA 5CVIA 2CREA 2K4YA 3OQ5A 4J9GA 2DJQA 1VQ4A 3A98A 1VQLA 2HKQB 2XIDA 3DKMA 2DVJA 3ZFJA 2YRVA 4IUUA 2DTHA 2W0ZA 1YI2T 3S6WA 2QXFA 2LX7A 2XI9A 1VQ9A 4JDSA 4XTYA 3BW1A 2IVWA 4DOWA 1ZUUA 1M2VA 1S72Q 2FRWA 2KE9A 1WQWA 4JZ4A 2PUKB 2ECZA 2L89A 2WSEE 2DBKA 2YT6A 4F7UB 4OMFB 2RJCA 2O2OA 1IREB 1EFNA 1M9SA 4C8QB 2JS0A 1KC8R 1OPKA 4M75F 1WQ7A 4LDUA 4AT1B 8AT1B 1WNLA 5CKDA 3QYHB 4D6WA 2Y4YA 3FDRA 3M0UA 1VQLT 4AFZC 1HJDA 3PMTA 3X25B 4C8QC 3QUIA 1RABB 3VU3C 1U5SA 1PRMC 4ZGDB 5CCAA 3JB9F 2LC4A 4OB0B 3CCUQ 1YJNT 2E3IA 1K73C 5GJVB 2DXBA 4MZTA 1M5Q1 5LJ3d 5ECAA 1JQQA 2O4XA 4FYVB 2HQEA 3RESA 5GAN2 4R55A 4XTWA 1PG5B 2AK5A 2R57A 3CXCS 1YHQQ 1K0XA 4J7IA 1AWOA 1BBZA 4LNPA 2MAMA 3WXMB 1O9SA 2HD0A 2YSQA 3EG9A 3OYNA 3G6EQ 1N5ZA 2MI6A 3M0QA 3RMSA 1MNDA 2P0PA 3L2ZA 4HCKA 2OTJQ 2X3XD 4NOYA 1WX6A 2FRYA 3RDVA 3L42A 1YITA 3T9NA 1WYXA 5KE2A 1NBEB 4EMKA 5J39A 4PK4A 3FC3A 3ZEHA 1KC8U 2FO0A 2MF2A 2V8KA 4C8QD 1VQPA 2KDSA 4ZTFA 3G4ST 5CKEA 2GGRA 3CCRT 1ZQ1A 3S3MA 4IUVA 3CC7A 2A36A 3VS5A 5LJ5d 8ATCB 2FHDA 3PNWC 1DJ7B 1A0NB 2X4XA 2ED0A 1YCSB 4PJOG 3F70A 2X9HA 3I5SA 3X20B 2CKKA 3PIOA 3VYGA 4RUGA 5GAOr 2LZ6B 3I56T 1KC8C 2DRMA 2ZCFB 2GQIA 4B9WA 4FT2A 4CC2A 3X28B 1MMGA 1ZA2B 1BK2A 1BI1A 4F7UA 1YIJA 2RJDA 2OX7A 1NYFA 3SWNB 1WLPB 3PT9A 1C1AA 3LLRA 2EQUA 1N9SA 5CKHA 2JTMA 3VYHB 2CUDA 4M78D 2KMTA 4AG2C 1RAFB 2YHTA 2K6DA 3CBPA 1B7TA 5GMKe 1OEBA 3EGXB 3LWHA 1I5LA 3RKWA 1VQ5A 2ZPIB 2NUTA 3SWNC 3QDFA 1X27A 2CP5A 2LTOA 1SHFA 1VUBA 3G71A 1N6AA 3LH5A 4O6JA 4R56A 2ZPHB 1PSFA 2RQUA 1W6XA 2CT4A 3A1PA 4HCBA 2QAZA 3GIBA 2VWFA 1QVFS 5D7UA 5HKCA 3C12A 1M8MA 5LJ5h 3CC2A 1W70A 4GBQA 1IGUA 4KUIA 4UC4A 3RNJA 4E6RA 3NFCA 1QCNA 2D6FA 2DJZA 3G6EA 3CCLA 4QVDA 3QXEB 3TQ7P 4CC3A 2HQHA 4OGEA 4A63B 3JCMW 2QTXA 2VGMA 1AT1B 4M7AG 4PJLA 1Y7XA 1E6GA 1TH7A 4M78C 2HBPA 1M30A 4XTZA 1RI0A 2RHZA 2DM1A 3CD6Q 2BE9B 1VQPT 4F7UE 2LQNA 1WPYA 2C0OA 3CCRA 1VQNT 1SG5A 4A4HA 4PJOD 1PKTA 2NUPB 4ZN1A 3J7AF 1K9MU 4EMGA 3FJ5A 5FRNA 4KGXB 1HD3A 3VS0A 3I55A 1EX4A 2V1RA 5GAOm 3OA6A 1RLQC 4FCYA 3RR6A 4M77D 4BB7A 2DZCA 4JS5A 4C8QA 1BKBA 3CQTA 2WSCE 2RNAA 3ASKA 2QGGA 2JTFA 1M2VB 2D0NA 2OTLA 2FYKA 2BKDN 3EG0A 4OMMA 1QVGA 4HXJA 5A2QE 3SD4A 1VQOT 5J26A 3SFMA 2DRKA 2KI7A 3OYGA 1D0ZA 4Z02A 3LYIA 5GMKj 3JCMX 3OS5A 3IQLA 5GJWB 3NMZC 2RB6A 5C0MA 1Y96B 5LJ3g 4L6V5 1IHVA 5GAN4 4L5GA 1QP2A 1QQJA 5HK0A 4BDYA 4NL3A 1K1ZA 5HY6A 4EMHA 1D1BA 1D3BA 4Y91A 2LRQA 1VQ6A 3DLLA 4BI4A 2D9TA 3FRNA 2B86A 2QYZA 4F04B 1M3BA 3H9NA 4E7KA 3OYYA 5IN1A 1N8RC 2E6ZA 3VRYA 2E64A 3JB9I 1M90C 4OB2B 3CEYA 2ABLA 1GFDA 4M7DG 1HYOA 3OYEA 3KUFA 4C8QF 1X01A 4FYWB 1NM7A 2O9SA 3EH2A 2EKOA 2Z0WA 2RK2A 2R5AA 4JRQA 3OSVA 2E5QA 1X2KA 4WTOB 1QVFP 2CZ0B 4HT8A 5IHIA 4M77B 4KUDK 4J6XA 2GTJA 2JS2A 4ZNXA 5D6WA 2DMOA 2JW4A 2KRNA 4J6YA 1RAAB 4RTUA 3JCMg 1H8KA 1BI2A 2FG0A 1R8OB 3JAME 3I5RA 2EIFA 3O8VA 5CQXA 5DM7R 1I8FA 2I0NA 2G3RA 1SSFA 1YWOA 3M0SA 1YJWQ 2CP6A 2HDAA 2SRCA 4A4FA 1PRLC 1SRLA 1R77A 2HCKA 2DXTA 2RJFA 3M59A 3E19A 2DIQA 3MPUB 3E1SA 2K9GA 1LJOA 1MV3A 2QQSA 2YWWA 3PFSA 3HRTA 4LE9A 3Q1JA 2GBQA 4J9HA 3CCRQ 4J9FA 3VJPA 3CXCA 2QEXA 1GCQA 1LOJA 1NLOC 4N4HA 4BD3A 3A5ZB 1Q7YC 1J3TA 3CCLQ 2LX9A 1SRMA 4XU2A 2KNBB 3D7SB 1F1BB 3VUBA 1O75A 1AWWA 2DD5A 2RMOA 4N0AA 4BE0A 1Z9ZA 1IZ6A 2O31A 1EIFA 4HVVA 3RBBB 1JXOA 1UB4A 1VQ8A 2CZ1B 4C92A 3SHWA 2DK3A 1KFZA 5KCHA 1PD1A 3CD6T 2XDBA 4XU1A 1ZUYA 3UF4A 3CC2Q 4BDZA 3SDZA 2PU9B 1QCFA 2E70A 2ROLA 1GFCA 5D6YA 3QPHA 1VQ6Q 3MHXA 2DL7A 1M1KU 4M7DB 1SSHA 1NYGA 1U1SA 1YITQ 5FRMA 1YITT 5KH6A 2AKKA 4M7DD 1LPLA 2RQRA 2JTEA 1VQ7Q 5I21A 1IHWA 2B8AA 1VOMA 3OYLA 1YWPA 1QVGS 3L1AA 4RG8A 3META 4PL6A 5LJ3h 1IO6A 3MEWA 2D8HA 2RN8A 4M77G 2MK5A 1GBRA 2E65A 1R0CB 3H41A 1CKAA 4PNOA 4AFUC 1B3QA 1BIAA 2CUBA 1MNEA 1K4US 4X9CA 3FIFA 3JCMh 2YRDA 2COYA 4DEXA 3EAEA 1BYMA 3VS1A 3HRSA 5KYUA 3REBB 2K5FA 3CCJT 4XTXA 1VQMQ 1YCYA 2BZYA 5FROA 4EPCA 5LJ3j 3VV0A 4ZGJB 4C0GA 3AHUA 5LJ5j 1I0CA 3LGLA 2A28A 4XAXB 3OS1A 2DYIA 3G71T 1G83A 3GF5A 2BE7D 2WSFE 3ULRB 1YJNQ 4J9CA 5FWCA 2E12A 4RTYA 1Q86C 1VQ7T 2EGAA 5FU6B 5GAN6 3CCJA 4C92G 3CCJQ 4A53A 1D0XA 3INZA 2M0YA 1T0HA 2X51A 3JSCA 3L2VA 2XD0A 4WCIA 1K8AU 1XOVA 4HT9A 2FZKB 1ZBXA 2OI3A 4OMQA 4ZTJA 2A08A 1W2BA 2PQWA 3P8DA 2EJGA 2NLUA 2OTJA 2RA2A 5GAMh 4ORZA 2LVMA 4BI8B 5DLQE 4J9DA 3RIRA 3RMQA 2RHIA 1VQKA 1N8RR 4MZPA 1G2BA 5FLXE 2NUPA 2QASA 1OU9A 4FSXA 2H3EB 1Q81R 2KRMA 2O4XB 1X75C 3OBYA 3JCMd 5GAOp 1FXXA 5M9OA 2EWNA 3CC4Q 5CKBA 3JCMJ 1QKWA 4BUGA 2E1HA 1PSEA 4MDWA 3C95A 2QQ9A 4JJCA 2M0OA 3JV3A 2DNUA 3HHTB 4HCCA 2LCLA 3OYDA 2V26A 1EZZB 5HCKA 1VQKT 1VIEA 2RQTA 2YUNA 2AHJB 3QHSA 4AMCA 3NPFA 4JS4A 2D0QB 3L2UA 1OU8A 2KBTA 3OYFA 1UGVA 4BI3A 4C5GA 3RKXA 2KR3A 2QA4T 2DIGA 1RAGB 3TSWA 2P4TA 4M77E 5CO7A 4OF1A 1NPPA 2F2XA 3MEVA 1H92A 1UHCA 4YTLA 4Z89A 2EBPA 3RUXA 2XDDA 1B34A 1ZSGA 1OPLA 2RI5A 1H3ZA 3PVQA 3QBYA 2HL5C 1YJNA 1UHFA 2VB6A 4DA4A 3I35A 5GAMg 2FPDA 4KH1B 4Q5WA 1RAEB 5IHNA 4RKUE 4RTZA 1QP3A 1K9AA 1VQMT 3QO3A 2NUZA 4DOVA 2CSIA 2CDTA 3GBQA 4C0FA 4QW2A 7AT1B 4PFZA 1NPRA 5D6XA 2EQMA 3CMAQ 2H8HA 3ZL7C 2DPPB 2RI3A 2J6OA 5GANf 1RACB 4M77C 1IXDA 1GBQA 2DILA 2F2VA 2H3JA 3QWXX 2X4JA 3QYGB 1QKXA 4OP0A 1ZHIA 1UGSB 2K79A 1BCMA 5GANh 1U1TA 2E3HA 3O5ZA 4J7FA 3S3NA 3LGFA 3DB4A 2V8JA 2RO0A 5FWBA 5GMKh 3CCEA 1N9RA 3S3OA 1JEGA 5GAMj 1Z9QA 1C0MA 2FL7A 3DB3A 2XG8D 2OAUA 3JCMe 3CC4A 1OI1A 3MEAA 2QG9B 3E2UA 3BE3A 3OBWA 3UT1A 4BE1A 1KG1A 1T3LA 2NUTB 2AZVA 2O9VA 3G4SA 1WHLA 2L3RA 1GCPA 2DX1A 4R0KA 1CKBA 5A0LA 4M7AF 4C5IA 5LJ5f 1BCOA 2KQWA 2L3QA 3EFOA 2GTOA 2YXYA 2HKNA 1TSFA 2LNHB 1AHJB 1WXTA 3TSZA 3HTRA 3CPFA 3MP8A 1FMWA 1PHTA 4A4KA 3JCMP 2C06A 1XTDA 4IKFA 1WHGA 4JUVA 4Z88A 3EGDB 3CCMA 2M9UA 1XQHA 2DL4A 2QEXT 2QK0A 2J05A 1GXIE 1QVFA 1B07A 1YIJT 3H0IA 1UGPB 2K5IA 2XKOC 2QGFB 2P0KA 1VQNQ 3OS0A 3HL8A 4IUQA 5KYWA 4MMLA 3EGDA 2ESWA 2JM9A 4PFPA 1I5OB 2DYBA 2LMJA 4LDWA 1U3OA 4IURA 1VYTA 3ER0A 2HL3A 4DBQA 1QVPA 1WDXA 4HCZA 2HSEB 2J6KA 2LCCA 2KT1A 2LJ3A 2ZPFB 2QI2A 1PM3A 3LX7A 4OMOA 3AT1B 1VQNA 2CP3A 4LXCA 4LUEA 1D1AA 3L2WA 5I2MA 4PJOB 2EYWA 2VUBA 4M78A 1VYVA 2K3BA 1WXUA 2QQBA 1G3WA 4QQDA 2MYSA 3RKYA 1Q82U 4JPBW 2HQXA 5FU7C 6AT1B 2QQRA 2DETA 2F69A 2YUOA 3HFNA 5I2SA 2A7YA 4MZMA 4N0AC 3NTIA 3CMET 1HXDA 4OB3B 3X24B 4RG2A 3OY9A 2EVRA 3H0HA 1PNJA 4C92E 2DD4A 3JB9D 2QTVA 4ME7A 4LDVA 3HFOA 3CCMT 4RMOA 1JU5C 1OULA 2DAQA 2LJ0A 3OB9A 1ZLMA 3VS3A 5GAMd 2AT1B 1YJWT 2BIVA 1TUGB 3CCUT 4F14A 3WVEB 1VQ7A 4FSSA 1K73U 2DO3A 4X9DA 1I1JA 1TG0A 3M9QA 1Q95G 4E7HA 3EGXA 2CZ6B 2E6NA 2ZAEA 2ROTA 3EFSA 2P4RA 1BIBA 3NTKA 4X34A 3ME9A 3LWIA 3CPWS 3QSUA 3CPWP 4D8DA 3JB9G 1BI3A 2AKLA 3J81E 3L2RA 1TS9A 4M75C 3CPWA 3PE0A 1XJWB 2EJFA 1QWFA 1X2QA 5LL6S 1MMDA 1AZGB 2DTIA 3OYKA 3C94A 1G5VA 4DBRA 5FU6C 1UGRB 5EC7A 2HAXA 4HKEA 3CMEA 1FX7A 1ACMB 2O88A 5KYXB 5KE3A 5IH2A 3HKSA 3I56A 2K5LA 3M57A 5CK9A 2VASA 1PKSA 2L8DA 3EG3A 1RI9A 1UECA 2M16A 3M0TA 3CC7T 1VQ6T 3OYCA 4M78B 2YDLA 1WHMA 2MPXC 1R0BG 2L2PA 4JLIA 1BU1A 1JJ2S 2DL5A 2ZPEB 2DTOA 1KQ1A 1AEYA 1Y57A 3CD6A 3QKJA 4PJOC 1TTHB 4GLKA 1ZBJA 4M75A 1VA7A 3N5BB 4F7UG 2RK1A 3EGUA 4FW1A 3OS2A 2COZA 1KD1U 3JCMc 5IXFA 1RUWA 3U23A 4DQ2A 4PFOA 5GAN3 2DXUA 2KROA 3M0PA 4FU6A 3QG1A 4KULA 5GAN8 1Q86U 1VQPQ 1I07A 3BFMA 2LP5A 1QW1A 1MHNA 1UEBA 4FYYB 3JRZA 4JJDA 2JVVA 1YJ9T 2DE0X 4IIOA 2EQJA 1WA7A 2K57A 3DLMA 4LD9K 1WHHA 1KIKA 3EG2A 1FMKA 3I55Q 5GMKl 2PUOB 1M1KR 2MWPA 2MWOA 4TVRA 3M56A 2EAYA 4M7DA 4ELZC 3EFOB 4OVAA 1Q86R 1M1GA 1K8AR 2IPOB 3CCSA 2LCSA 2DVEA 2EFIA 5KCOA 2CP2A 4HVWA 4RTXA 4E7LA 1WFWA 4A4GA 3GLXA 4M77A 2SEMA 3CCQQ 4M7DE 3G1JA 3OW2P 5IHKA 4AG1C 1T0JA 2QQAA 2CS7A 2FVUA 2KAFA 4OMLA 2RPNA 1YFNA 3OW2A 2KRSA 2F1LA 2BTTA 4F7UF 1TXQA 4M78G 2CZ7B 3EG1A 2CH4A 1VQ9T 1SKUB 1G8XA 4MDXA 4FL6A 1NZ9A 3QZ9B 2AZSA 1UJYA 4OMPA 1LVKA 2JXBA 4ANJA 3M54A 3V8JA 3MEUA 3KBGA 4BE2A 1GL5A 2YLCA 1WXBA 2RQVA 4M7AB 1CSKA 4KRTA 4M75G 1HK9A 4QVCA 3UA6A 1SEMA 3CC4T 1AD5A 4KH0B 1YJWA 1B34B 3CCQT 3EFRA 1ZUKA 4EMKB 1D1CA 4RCBA 5KYWB 2FPFA 1AOJA 2M02A 3UATA 3JCMV 2VVKA 1X6BA 4AFSC 4J9IA 3HP9A 4PJOE 1VQ4Q 2EGCA 4V2SA 2JUFA 4BY6B 1RAIB 2XDPA 4EMKC 3RERA 3TEEA 1KQSS 1X43A 3MKDA 1YNZA 1UFFA 4RTVA 3PGGA 2OAWA 2EKHA 1W1FA 1KQSA 1YHQT 4JRPA 2DL3A 1G3YA 4C8QE 3V7CA 4BY6C 2VV5A 1Y71A 3NGPA 4M77F 5GAMf 3CCSQ 2C0IA 1Q81C 4LDYA 4KBMB 2F2WA 3EHRA 5LJ3e 1V29B 1OX9A 2LJ1A 2FZGB 2RHUA 1S72T 5AYFA 9ATCB 3CXCP 3CCVQ 3V8KA 2ZZDA 2BZ8A 4XTVA 4M7DC 2YLBA 3V8LA 1QVGP 4CI0C 3OW2S 4AFQC 3TVTA 1UUEA 1K76A 1TU0B 1T3SA 3HRUA 4LUDA 2KY9A 3GNGA 3SB2A 5I22A 2G6FX 3CC7Q 3EG9B 1VQLQ 1Q82R 3OYBA 2DKGA 1PD0A 2DERA 4F16A 2JJ9A 1PWTA 2W10A 2EQKA 1KHCA 2VC8A 1UE9A 4M75B 5I11A 1V1CA 2FB7A 2KSSA 1NE8A 3JCMf 1NLPC 4KT0E 1KJWA 3VRZA 1WHJA 2QDYB 2GNCA 3CBOA 1M27C 4XU3A 4J9EA 1VQ5Q 2ZPBB 3M5AA 3A8MB 1UJ0A 4J83A 4L59A 4PJOA 2RJEA 2PVDB 5KYYB 2DF6A 3QIIA 3CMAT 1JXMA 4Y28E 1M1KC 1AZEA 3L2QA 2LT1A 4ESRA 4DEYA 1WI7A 1D09B 4C92F 4E2FB 5GMKm 3GNFB 1MV0B 2MMPA 5GAN7 3M4GA 3OYHA 4B9XA 3CCMQ 3MO8A 3CCET 2LDMA 4C92C 3CCLT 1YP5A 1BI0A 4O5VA 3CMEQ 3OYIA 4J9BA 4RTTA 1U06A 2OTLQ 2F5TX 5IXBA 5EG2A 2HMAA 3VS6A 2VGNA 3SEMA 5CAIA 4IUTA 1NJIR 4NL2A 2RF0A 3G71Q 2L0AA 2DZ9A 2DLPA 2A0FB 2CGHA 3JB9J 4NS5A 3J80E 1IRXA 3FEOA 1K8AC 4M75D 1M1FA 4PJNA 2CSQA 3CCEQ 1MMAA 1TUDA 4XU0A 2COWA 3A8LB 5GANd 5GMKi 1C6VX 2FZCB 1VQOA 1M2OA 1TUCA 3M53A 1W4SA 5L8RE 3OMCA 4JRKA 2HEQA 4FYXB 2GFUA 2OTLT 1YIJQ 2M51A 2MIOA 1OZ3A 1QWEA 2KT8A 4M7AE 4LDXA 2JZ2A 4PJMA 2JM8A 2PVOB 1V76A 2KXCA 2PZ1A 1MGQA 4P5NA 2IIMA 4DBHA 3I55T 3I56Q 3QDRB 2DL8A 2FEIA 1M90U 4JJNK 4E7JA 1N8RU 1OV3A 4CC4B 3QZ5B 4C92D 3C4SA 4JLGA 2K3XA 3H8ZA 2KYBA 2J6FA 3P8BB 2RM4A 4Z8AA 1M4ZA 2PNIA 4J8OA 1RL2A 3M0RA 3G4SQ 1E6HA 5A0DA 4GY5A 1KK7A 4MMKA 4XTUA 1ABOA 5KYUB 4E7ZA 4QQGA 1M3CA 1QCOA 2E4HA 1UTIA 2JNGA 2VXEA 4XQ3A 1YJ9Q 4OMNA 3M58A 1K9MR 1RADB 1G3SA 2JT4A 2RHYA 4J5YA 3GPLA 1Q82C 5GAOq 2XU8A 2VYTA 1JRIA 2AIRB 3MJXA 3TREA 1Q7YR 3JB9H 1UGQB 2LQ8A 1ZSZC 3VUZA 4N4GA 4OB1B 5LJ3f 5C6SA 4PJOF 4QQ6A 1Q81U 2Y4XA 1MUZA 1KD1R 4RCCA 1YI2A 5KYNA 3MCAB 1PCXA 2M1HA 2ATCB 3REAB 2JN0A 4C8QG 3CCQA 1TOVA 5J3BA 4LN2A 3VS7A 1KQ2A 2BUDA 1ZSZB 2JMAA 2J7IA 1K0SA 2DFUA 1LNXA 2KK4A 3BDUA 1UDLA 4M78F 2PVGB 2MCNA 2X4YA 2DEQA 4ZGEB 4K11A 4FM4B 1SHGA 2VKNA 2KGTA 3VKIA 4B6MA 2QA4Q 2YRCA 1TWBA 3M55A 4VUBA 1VQOQ 5AT1B 2ED1A 1KQSP 5CKFA 3VS2A 4PKCC 5FW9A 3OYMA 2K3YA 4F17A 4JZ3A 4M78E 1G3TA 4FW2A 1LCKA 1VQ9Q 4M7DF 1UG1A 1YI2Q 2QDLA 2JOYA 1M90R 1OX8A 3ZBDA 4C0DB 1NEBA 5GAOl 3EH1A 1WJRA 2VXFA 1JO8A 4FT4A 1WGSA 1S72A 3PVLA 1IGQA 2EYZA 1NJIC 2HNIA 1K73R 3JCMQ 2R58A 3CBMA 2K2MA 2A3LA 2HSPA 4OGCA 3PTAA 1OYXA 3CCUA 1YHQA 2EW3A 1Y07A 4RTWA 3PIPA 3OYJA 4CC7A 4JRIA 1QLYA 5LJ5e 1GCQC 1Y0MA 2A37A 3QJYA 4ATOA 4X1VA 2BZXA 2P84A 3I9QA 3JCMb 3V7RA 1I4K1 3G6ET 1SPKA 1M8VA 1S1NA 4PLLA 2X35A 2RD1A 4M7AD 3QJ6A 1ZX6A 1YN8A 5CR2A 2CYZB 2C0TA 1H3HA 1BB9A 3GOXA 3LH0A 3VS4A 4KGVB 2K7AA 1MMNA 4E47A 2V1QA 3NTHA 1RAHB 5CIUA 3WVDB 4A4EA 3V7SA 2DA9A 5GANg 5DLOA 1ZSZA 4PJJA 2JMCA 4QVZA 4C92B 2DEUA 1N27A 1I81A 2P0QA 3A8HB 4M4ZA 4C5EA 1RLPC 4N4IA 4CRIA 3R6NA 3KXTA 3FJPA 2R5MA 4C0ZA 5GANj 1AWXA 1WIEA 1GRIA 3TCJA 1WHKA 5A0GA 1KD1C 1VQKQ 1ARKA 4ZN3A 3E9FA 3A8GB 4J6WA 2NWMA 4A54A 1Q7YU 5KYXA 2HBWA 3HPWA 3X26B 3HSBA 4KGZB 2DXCA 2L5QA 4HVUA 2RQWA 1X69A 2ZGWA 3E9GA 2CH4W 4M7AC 2YUQA 1U8RA 3CMAA 5DY9A 1K9MC 2D8JA 1AVZC 2E5KA 4JJBA 1XNIA 2GF7A 2DBMA 4DBFA 2EYXA 1D0YA 1SF9A 2KVQG 3URGA 3OSSC 2X4WA 4ELYC 2KXDA 2MOXA 1D3BB 4C0DC 2LNVA 4M7AA 3CCST 3H0FA 1VQ4T 1NEGA 2V8IA 1VQ8T 2EJ9A 1VQ5T
chains in the Genus database with same CATH topology
2D0NA 3UA7A 5L23A 3EG0A 2L3QA 4OMMA 1KSWA 4HXJA 2GTOA 5I22A 2G6FX 3EHQA 2DRKA 2CT3A 4F16A 1PWTA 2LNHB 1WXTA 2W10A 3IQLA 5GJWB 3NMZC 3TSZA 1UE9A 2X3WD 4QT7A 1PHTA 5I11A 1V1CA 2EYYA 1E7OA 1NLPC 1KJWA 3VRZA 1K1ZA 4Z88A 2DL4A 2GNCA 1M27C 2J05A 1OOTA 4J9EA 3KFVA 1B07A 2ENMA 3H0IA 1UJ0A 1FYNA 2L3PA 2ESWA 2JM9A 1NG2A 2DYBA 2DF6A 2LMJA 1U3OA 1JXMA 1X6GA 2B86A 1AZEA 1M3BA 1VYTA 4ESRA 4DEYA 1WI7A 4GLMA 2YUPA 1WDXA 4Y92A 1MV0B 3VRYA 2J6KA 2LJ3A 2KT1A 4OMOA 2ABLA 1GFDA 2XMFA 4EIKA 4LUEA 1YP5A 2KEAA 2EYWA 1NM7A 2EQIA 2O9SA 1VYVA 2D1XA 4J9BA 4RTTA 1U06A 2KYMA 3QWYA 5IXBA 2K3BA 1X2KA 1AWJA 1ABQA 1WXUA 3VS6A 2J06A 1HSQA 5IHIA 3SEMA 4IIMA 4JPBW 3NHNA 2FPEA 2YUOA 2L3SA 1VYUA 1M3AA 2RF0A 2GTJA 2JS2A 4ZNXA 2L0AA 2LQWA 2DMOA 2PTKA 2JW4A 2DLPA 2KRNA 4RTUA 4D8KA 1H8KA 2EVRA 3H0HA 2FG0A 1PNJA 3THKA 2EGEA 3I5RA 2I0NA 3M0SA 1YWOA 2CSQA 2HDAA 2SRCA 1PRLC 1SRLA 3C0CA 1TUDA 2HCKA 1JU5C 2LJ0A 2OJ2A 1ZLMA 1TUCA 3VS3A 2K9GA 4F14A 2EPDA 2HEQA 1MV3A 2CREA 4FSSA 4LE9A 2GBQA 4J9GA 2M51A 4J9HA 2DJQA 2MIOA 4J9FA 1I1JA 3A98A 1QWEA 2KT8A 1TG0A 1GCQA 1NLOC 2ROTA 2JM8A 1J3TA 2P4RA 2DVJA 2KXCA 2PZ1A 2IIMA 1SRMA 2W0ZA 4D8DA 2KNBB 2AKLA 2DL8A 2FEIA 2LX7A 1AWWA 2RMOA 3PE0A 1ZUUA 1OV3A 1QWFA 4CC4B 1X2QA 2FRWA 2KE9A 1Z9ZA 4JZ4A 2O31A 1AZGB 2ECZA 4HVVA 3RBBB 2KYBA 1JXOA 2J6FA 5EC7A 2DBKA 3SHWA 4Z8AA 2YT6A 1KFZA 2O88A 2O2OA 2PNIA 1ZUYA 5IH2A 3M0RA 1EFNA 3UF4A 1E6HA 2JS0A 1QCFA 2ROLA 1GFCA 1ABOA 1OPKA 2DL7A 1M3CA 1SSHA 1NYGA 1PKSA 3EG3A 1RI9A 1UTIA 1UECA 2AKKA 2RQRA 3M0TA 4OMNA 2JTEA 3M0UA 4AFZC 1HJDA 2YDLA 2JT4A 1YWPA 2L2PA 1BU1A 1IO6A 1U5SA 1PRMC 2D8HA 2RN8A 2DL5A 1GBRA 1Y57A 1AEYA 3H41A 1CKAA 4AFUC 1B3QA 5GJVB 1ZBJA 2CUBA 1K4US 1VA7A 5ECAA 1JQQA 4DEXA 3EGUA 1MUZA 3VS1A 2AK5A 3REBB 1K0XA 5IXFA 1RUWA 1AWOA 2BZYA 3U23A 3REAB 1BBZA 4LNPA 2KROA 3M0PA 4LN2A 2YSQA 3VS7A 1I0CA 2A28A 1N5ZA 3M0QA 2JMAA 2J7IA 1G83A 1K0SA 1I07A 3ULRB 2LP5A 4HCKA 4J9CA 5FWCA 2X3XD 4JJDA 2DE0X 1WX6A 4IIOA 1UDLA 4RTYA 1WA7A 2EGAA 2FRYA 1KIKA 2MCNA 3EG2A 1FMKA 1WYXA 4K11A 1SHGA 2VKNA 2M0YA 1T0HA 2KGTA 2FO0A 4WCIA 1XOVA 2ED1A 2OI3A 4OMQA 3VS2A 2GGRA 2A08A 2A36A 5FW9A 3VS5A 4F17A 4ORZA 4JZ3A 2LCSA 4J9DA 1A0NB 4HVWA 1LCKA 4RTXA 1UG1A 2ED0A 1G2BA 1YCSB 1WFWA 2QDLA 3I5SA 2SEMA 1NEBA 2KRMA 4RUGA 1JO8A 2LZ6B 5IHKA 2DRMA 2GQIA 4AG1C 1T0JA 4CC2A 1QKWA 3PVLA 1BK2A 4OMLA 2EYZA 2RPNA 2KRSA 2K2MA 2BTTA 3EG1A 2HSPA 4JJCA 2CH4A 1NYFA 1WLPB 2DNUA 3JV3A 2EW3A 2AZSA 4RTWA 1UJYA 2CUDA 5HCKA 4OMPA 4CC7A 1QLYA 2RQTA 4AG2C 2YUNA 1GCQC 1Y0MA 2A37A 4X1VA 2K6DA 2JXBA 3NPFA 2BZXA 1OEBA 3I9QA 2KBTA 1UGVA 1GL5A 1WXBA 2RQVA 1X27A 1SPKA 1CSKA 4KRTA 1SHFA 1S1NA 2KR3A 3LH5A 3UA6A 1SEMA 1AD5A 3TSWA 2RQUA 1ZX6A 1W6XA 1YN8A 2CT4A 1ZUKA 2C0TA 1H3HA 1BB9A 2F2XA 1H92A 3VS4A 2VWFA 2K7AA 1UHCA 4Z89A 2V1QA 2FPFA 1AOJA 2EBPA 3UATA 2VVKA 1X6BA 1ZSGA 1OPLA 2DA9A 3PVQA 1M8MA 4AFSC 4J9IA 1UHFA 3I35A 1W70A 4GBQA 2FPDA 2JMCA 2EGCA 5IHNA 3RNJA 4E6RA 4M4ZA 4RTZA 1RLPC 1K9AA 1X43A 4CC3A 1YNZA 1UFFA 4A63B 4RTVA 3R6NA 2NUZA 2CSIA 2OAWA 2EKHA 2CDTA 3GBQA 1W1FA 1AWXA 1WIEA 1GRIA 2H8HA 3ZL7C 1E6GA 2J6OA 1GBQA 1M30A 2DILA 2DL3A 2F2VA 3QWXX 1ARKA 3NGPA 1QKXA 2DM1A 2NWMA 2K79A 2C0IA 2LQNA 2HBWA 2C0OA 2F2WA 3EHRA 3O5ZA 2LJ1A 5FWBA 4HVUA 2RQWA 1PKTA 1X69A 2CH4W 1JEGA 1Z9QA 3FJ5A 2YUQA 2D8JA 1AVZC 2E5KA 4JJBA 2BZ8A 1HD3A 3VS0A 2DBMA 2EYXA 2V1RA 1RLQC 4AFQC 3TVTA 1UUEA 1T3LA 1K76A 2MOXA 2KXDA 2AZVA 2O9VA 3CQTA 1GCPA 1T3SA 4LUDA 3H0FA 1NEGA 2DX1A 2RNAA 4R0KA 1CKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0N A;  3UA7 A;  5L23 A;  3EG0 A;  2L3Q A;  4OMM A;  1KSW A;  4HXJ A;  2GTO A;  5I22 A;  2G6F X;  3EHQ A;  2DRK A;  2CT3 A;  4F16 A;  1PWT A;  2LNH B;  1WXT A;  2W10 A;  3IQL A;  5GJW B;  3NMZ C;  3TSZ A;  1UE9 A;  2X3W D;  4QT7 A;  1PHT A;  5I11 A;  1V1C A;  2EYY A;  1E7O A;  1NLP C;  1KJW A;  3VRZ A;  1K1Z A;  4Z88 A;  2DL4 A;  2GNC A;  1M27 C;  2J05 A;  1OOT A;  4J9E A;  3KFV A;  1B07 A;  2ENM A;  3H0I A;  1UJ0 A;  1FYN A;  2L3P A;  2ESW A;  2JM9 A;  1NG2 A;  2DYB A;  2DF6 A;  2LMJ A;  1U3O A;  1JXM A;  1X6G A;  2B86 A;  1AZE A;  1M3B A;  1VYT A;  4ESR A;  4DEY A;  1WI7 A;  4GLM A;  2YUP A;  1WDX A;  4Y92 A;  1MV0 B;  3VRY A;  2J6K A;  2LJ3 A;  2KT1 A;  4OMO A;  2ABL A;  1GFD A;  2XMF A;  4EIK A;  4LUE A;  1YP5 A;  2KEA A;  2EYW A;  1NM7 A;  2EQI A;  2O9S A;  1VYV A;  2D1X A;  4J9B A;  4RTT A;  1U06 A;  2KYM A;  3QWY A;  5IXB A;  2K3B A;  1X2K A;  1AWJ A;  1ABQ A;  1WXU A;  3VS6 A;  2J06 A;  1HSQ A;  5IHI A;  3SEM A;  4IIM A;  4JPB W;  3NHN A;  2FPE A;  2YUO A;  2L3S A;  1VYU A;  1M3A A;  2RF0 A;  2GTJ A;  2JS2 A;  4ZNX A;  2L0A A;  2LQW A;  2DMO A;  2PTK A;  2JW4 A;  2DLP A;  2KRN A;  4RTU A;  4D8K A;  1H8K A;  2EVR A;  3H0H A;  2FG0 A;  1PNJ A;  3THK A;  2EGE A;  3I5R A;  2I0N A;  3M0S A;  1YWO A;  2CSQ A;  2HDA A;  2SRC A;  1PRL C;  1SRL A;  3C0C A;  1TUD A;  2HCK A;  1JU5 C;  2LJ0 A;  2OJ2 A;  1ZLM A;  1TUC A;  3VS3 A;  2K9G A;  4F14 A;  2EPD A;  2HEQ A;  1MV3 A;  2CRE A;  4FSS A;  4LE9 A;  2GBQ A;  4J9G A;  2M51 A;  4J9H A;  2DJQ A;  2MIO A;  4J9F A;  1I1J A;  3A98 A;  1QWE A;  2KT8 A;  1TG0 A;  1GCQ A;  1NLO C;  2ROT A;  2JM8 A;  1J3T A;  2P4R A;  2DVJ A;  2KXC A;  2PZ1 A;  2IIM A;  1SRM A;  2W0Z A;  4D8D A;  2KNB B;  2AKL A;  2DL8 A;  2FEI A;  2LX7 A;  1AWW A;  2RMO A;  3PE0 A;  1ZUU A;  1OV3 A;  1QWF A;  4CC4 B;  1X2Q A;  2FRW A;  2KE9 A;  1Z9Z A;  4JZ4 A;  2O31 A;  1AZG B;  2ECZ A;  4HVV A;  3RBB B;  2KYB A;  1JXO A;  2J6F A;  5EC7 A;  2DBK A;  3SHW A;  4Z8A A;  2YT6 A;  1KFZ A;  2O88 A;  2O2O A;  2PNI A;  1ZUY A;  5IH2 A;  3M0R A;  1EFN A;  3UF4 A;  1E6H A;  2JS0 A;  1QCF A;  2ROL A;  1GFC A;  1ABO A;  1OPK A;  2DL7 A;  1M3C A;  1SSH A;  1NYG A;  1PKS A;  3EG3 A;  1RI9 A;  1UTI A;  1UEC A;  2AKK A;  2RQR A;  3M0T A;  4OMN A;  2JTE A;  3M0U A;  4AFZ C;  1HJD A;  2YDL A;  2JT4 A;  1YWP A;  2L2P A;  1BU1 A;  1IO6 A;  1U5S A;  1PRM C;  2D8H A;  2RN8 A;  2DL5 A;  1GBR A;  1Y57 A;  1AEY A;  3H41 A;  1CKA A;  4AFU C;  1B3Q A;  5GJV B;  1ZBJ A;  2CUB A;  1K4U S;  1VA7 A;  5ECA A;  1JQQ A;  4DEX A;  3EGU A;  1MUZ A;  3VS1 A;  2AK5 A;  3REB B;  1K0X A;  5IXF A;  1RUW A;  1AWO A;  2BZY A;  3U23 A;  3REA B;  1BBZ A;  4LNP A;  2KRO A;  3M0P A;  4LN2 A;  2YSQ A;  3VS7 A;  1I0C A;  2A28 A;  1N5Z A;  3M0Q A;  2JMA A;  2J7I A;  1G83 A;  1K0S A;  1I07 A;  3ULR B;  2LP5 A;  4HCK A;  4J9C A;  5FWC A;  2X3X D;  4JJD A;  2DE0 X;  1WX6 A;  4IIO A;  1UDL A;  4RTY A;  1WA7 A;  2EGA A;  2FRY A;  1KIK A;  2MCN A;  3EG2 A;  1FMK A;  1WYX A;  4K11 A;  1SHG A;  2VKN A;  2M0Y A;  1T0H A;  2KGT A;  2FO0 A;  4WCI A;  1XOV A;  2ED1 A;  2OI3 A;  4OMQ A;  3VS2 A;  2GGR A;  2A08 A;  2A36 A;  5FW9 A;  3VS5 A;  4F17 A;  4ORZ A;  4JZ3 A;  2LCS A;  4J9D A;  1A0N B;  4HVW A;  1LCK A;  4RTX A;  1UG1 A;  2ED0 A;  1G2B A;  1YCS B;  1WFW A;  2QDL A;  3I5S A;  2SEM A;  1NEB A;  2KRM A;  4RUG A;  1JO8 A;  2LZ6 B;  5IHK A;  2DRM A;  2GQI A;  4AG1 C;  1T0J A;  4CC2 A;  1QKW A;  3PVL A;  1BK2 A;  4OML A;  2EYZ A;  2RPN A;  2KRS A;  2K2M A;  2BTT A;  3EG1 A;  2HSP A;  4JJC A;  2CH4 A;  1NYF A;  1WLP B;  2DNU A;  3JV3 A;  2EW3 A;  2AZS A;  4RTW A;  1UJY A;  2CUD A;  5HCK A;  4OMP A;  4CC7 A;  1QLY A;  2RQT A;  4AG2 C;  2YUN A;  1GCQ C;  1Y0M A;  2A37 A;  4X1V A;  2K6D A;  2JXB A;  3NPF A;  2BZX A;  1OEB A;  3I9Q A;  2KBT A;  1UGV A;  1GL5 A;  1WXB A;  2RQV A;  1X27 A;  1SPK A;  1CSK A;  4KRT A;  1SHF A;  1S1N A;  2KR3 A;  3LH5 A;  3UA6 A;  1SEM A;  1AD5 A;  3TSW A;  2RQU A;  1ZX6 A;  1W6X A;  1YN8 A;  2CT4 A;  1ZUK A;  2C0T A;  1H3H A;  1BB9 A;  2F2X A;  1H92 A;  3VS4 A;  2VWF A;  2K7A A;  1UHC A;  4Z89 A;  2V1Q A;  2FPF A;  1AOJ A;  2EBP A;  3UAT A;  2VVK A;  1X6B A;  1ZSG A;  1OPL A;  2DA9 A;  3PVQ A;  1M8M A;  4AFS C;  4J9I A;  1UHF A;  3I35 A;  1W70 A;  4GBQ A;  2FPD A;  2JMC A;  2EGC A;  5IHN A;  3RNJ A;  4E6R A;  4M4Z A;  4RTZ A;  1RLP C;  1K9A A;  1X43 A;  4CC3 A;  1YNZ A;  1UFF A;  4A63 B;  4RTV A;  3R6N A;  2NUZ A;  2CSI A;  2OAW A;  2EKH A;  2CDT A;  3GBQ A;  1W1F A;  1AWX A;  1WIE A;  1GRI A;  2H8H A;  3ZL7 C;  1E6G A;  2J6O A;  1GBQ A;  1M30 A;  2DIL A;  2DL3 A;  2F2V A;  3QWX X;  1ARK A;  3NGP A;  1QKX A;  2DM1 A;  2NWM A;  2K79 A;  2C0I A;  2LQN A;  2HBW A;  2C0O A;  2F2W A;  3EHR A;  3O5Z A;  2LJ1 A;  5FWB A;  4HVU A;  2RQW A;  1PKT A;  1X69 A;  2CH4 W;  1JEG A;  1Z9Q A;  3FJ5 A;  2YUQ A;  2D8J A;  1AVZ C;  2E5K A;  4JJB A;  2BZ8 A;  1HD3 A;  3VS0 A;  2DBM A;  2EYX A;  2V1R A;  1RLQ C;  4AFQ C;  3TVT A;  1UUE A;  1T3L A;  1K76 A;  2MOX A;  2KXD A;  2AZV A;  2O9V A;  3CQT A;  1GCP A;  1T3S A;  4LUD A;  3H0F A;  1NEG A;  2DX1 A;  2RNA A;  4R0K A;  1CKB A; 
#chains in the Genus database with same CATH topology
 1VQ8 Q;  3UA7 A;  5L23 A;  2RH2 A;  2E10 A;  2CP7 A;  2RI2 A;  1KSW A;  3EHQ A;  1NJI U;  2K2V A;  2CP0 A;  2CT3 A;  5CQY A;  1YBY A;  1ZA1 B;  2X3W D;  1JBM A;  4QT7 A;  3A8O B;  2QA4 A;  2EYY A;  1W2B S;  2XIC A;  1W2B P;  1E7O A;  3CCV T;  3SWN A;  2NYS A;  2E41 A;  1X6O A;  5GAO n;  3G7Z A;  1WZO A;  3UWN A;  1OOT A;  5LJ5 g;  3KFV A;  5IAY A;  2ENM A;  3BY7 A;  1FYN A;  1QMC A;  1JJ2 P;  1VIF A;  2L3P A;  4QKU A;  2HZY A;  3H6Z A;  2ZPG B;  1NG2 A;  5GAN 5;  4BAC A;  1JJ2 A;  5GAM e;  1X6G A;  4LD6 A;  2GFA A;  3MP1 A;  2F5K A;  3MP6 A;  4PLI A;  3FLG A;  1OZ2 A;  3UDC A;  4GLM A;  3TU4 K;  5FU7 B;  2YUP A;  2GQV A;  4Y92 A;  1JB0 E;  5HK3 A;  4EDU A;  1VQM A;  2XMF A;  4EIK A;  1H64 1;  3R6O A;  2XK0 A;  2KEA A;  3GP8 A;  1OQK A;  2EQI A;  5GAN e;  2D1X A;  2KYM A;  2IG0 A;  2WAC A;  3QWY A;  5IT9 E;  3OYA A;  2LQK A;  2Y90 A;  1AWJ A;  1ABQ A;  2O01 E;  2J06 A;  4XK8 E;  1HSQ A;  2EYQ A;  1P92 A;  4IIM A;  1Y96 A;  2OTJ T;  3M4Y A;  4E7I A;  1IB8 A;  3NHN A;  2FPE A;  2L3S A;  3P8H A;  1VYU A;  1M3A A;  2RHX A;  1PC0 A;  4WF2 A;  1YJ9 A;  3BDL A;  2LQW A;  2PTK A;  2QEX Q;  2LT4 A;  3PMI A;  3LW5 E;  4FIB A;  3CC2 T;  4D8K A;  4E7S A;  4II1 A;  3CCV A;  1KHI A;  3OMG A;  3THK A;  2EGE A;  4IUP A;  1WJQ A;  4M75 E;  2I2L A;  3C0C A;  1WJS A;  2XHC A;  2GCX A;  2OJ2 A;  3FB9 A;  4HA8 A;  4C5H A;  3UPU A;  1FWZ A;  1FMV A;  5KYY A;  2EPD A;  5CVI A;  2CRE A;  2K4Y A;  3OQ5 A;  4J9G A;  2DJQ A;  1VQ4 A;  3A98 A;  1VQL A;  2HKQ B;  2XID A;  3DKM A;  2DVJ A;  3ZFJ A;  2YRV A;  4IUU A;  2DTH A;  2W0Z A;  1YI2 T;  3S6W A;  2QXF A;  2LX7 A;  2XI9 A;  1VQ9 A;  4JDS A;  4XTY A;  3BW1 A;  2IVW A;  4DOW A;  1ZUU A;  1M2V A;  1S72 Q;  2FRW A;  2KE9 A;  1WQW A;  4JZ4 A;  2PUK B;  2ECZ A;  2L89 A;  2WSE E;  2DBK A;  2YT6 A;  4F7U B;  4OMF B;  2RJC A;  2O2O A;  1IRE B;  1EFN A;  1M9S A;  4C8Q B;  2JS0 A;  1KC8 R;  1OPK A;  4M75 F;  1WQ7 A;  4LDU A;  4AT1 B;  8AT1 B;  1WNL A;  5CKD A;  3QYH B;  4D6W A;  2Y4Y A;  3FDR A;  3M0U A;  1VQL T;  4AFZ C;  1HJD A;  3PMT A;  3X25 B;  4C8Q C;  3QUI A;  1RAB B;  3VU3 C;  1U5S A;  1PRM C;  4ZGD B;  5CCA A;  3JB9 F;  2LC4 A;  4OB0 B;  3CCU Q;  1YJN T;  2E3I A;  1K73 C;  5GJV B;  2DXB A;  4MZT A;  1M5Q 1;  5LJ3 d;  5ECA A;  1JQQ A;  2O4X A;  4FYV B;  2HQE A;  3RES A;  5GAN 2;  4R55 A;  4XTW A;  1PG5 B;  2AK5 A;  2R57 A;  3CXC S;  1YHQ Q;  1K0X A;  4J7I A;  1AWO A;  1BBZ A;  4LNP A;  2MAM A;  3WXM B;  1O9S A;  2HD0 A;  2YSQ A;  3EG9 A;  3OYN A;  3G6E Q;  1N5Z A;  2MI6 A;  3M0Q A;  3RMS A;  1MND A;  2P0P A;  3L2Z A;  4HCK A;  2OTJ Q;  2X3X D;  4NOY A;  1WX6 A;  2FRY A;  3RDV A;  3L42 A;  1YIT A;  3T9N A;  1WYX A;  5KE2 A;  1NBE B;  4EMK A;  5J39 A;  4PK4 A;  3FC3 A;  3ZEH A;  1KC8 U;  2FO0 A;  2MF2 A;  2V8K A;  4C8Q D;  1VQP A;  2KDS A;  4ZTF A;  3G4S T;  5CKE A;  2GGR A;  3CCR T;  1ZQ1 A;  3S3M A;  4IUV A;  3CC7 A;  2A36 A;  3VS5 A;  5LJ5 d;  8ATC B;  2FHD A;  3PNW C;  1DJ7 B;  1A0N B;  2X4X A;  2ED0 A;  1YCS B;  4PJO G;  3F70 A;  2X9H A;  3I5S A;  3X20 B;  2CKK A;  3PIO A;  3VYG A;  4RUG A;  5GAO r;  2LZ6 B;  3I56 T;  1KC8 C;  2DRM A;  2ZCF B;  2GQI A;  4B9W A;  4FT2 A;  4CC2 A;  3X28 B;  1MMG A;  1ZA2 B;  1BK2 A;  1BI1 A;  4F7U A;  1YIJ A;  2RJD A;  2OX7 A;  1NYF A;  3SWN B;  1WLP B;  3PT9 A;  1C1A A;  3LLR A;  2EQU A;  1N9S A;  5CKH A;  2JTM A;  3VYH B;  2CUD A;  4M78 D;  2KMT A;  4AG2 C;  1RAF B;  2YHT A;  2K6D A;  3CBP A;  1B7T A;  5GMK e;  1OEB A;  3EGX B;  3LWH A;  1I5L A;  3RKW A;  1VQ5 A;  2ZPI B;  2NUT A;  3SWN C;  3QDF A;  1X27 A;  2CP5 A;  2LTO A;  1SHF A;  1VUB A;  3G71 A;  1N6A A;  3LH5 A;  4O6J A;  4R56 A;  2ZPH B;  1PSF A;  2RQU A;  1W6X A;  2CT4 A;  3A1P A;  4HCB A;  2QAZ A;  3GIB A;  2VWF A;  1QVF S;  5D7U A;  5HKC A;  3C12 A;  1M8M A;  5LJ5 h;  3CC2 A;  1W70 A;  4GBQ A;  1IGU A;  4KUI A;  4UC4 A;  3RNJ A;  4E6R A;  3NFC A;  1QCN A;  2D6F A;  2DJZ A;  3G6E A;  3CCL A;  4QVD A;  3QXE B;  3TQ7 P;  4CC3 A;  2HQH A;  4OGE A;  4A63 B;  3JCM W;  2QTX A;  2VGM A;  1AT1 B;  4M7A G;  4PJL A;  1Y7X A;  1E6G A;  1TH7 A;  4M78 C;  2HBP A;  1M30 A;  4XTZ A;  1RI0 A;  2RHZ A;  2DM1 A;  3CD6 Q;  2BE9 B;  1VQP T;  4F7U E;  2LQN A;  1WPY A;  2C0O A;  3CCR A;  1VQN T;  1SG5 A;  4A4H A;  4PJO D;  1PKT A;  2NUP B;  4ZN1 A;  3J7A F;  1K9M U;  4EMG A;  3FJ5 A;  5FRN A;  4KGX B;  1HD3 A;  3VS0 A;  3I55 A;  1EX4 A;  2V1R A;  5GAO m;  3OA6 A;  1RLQ C;  4FCY A;  3RR6 A;  4M77 D;  4BB7 A;  2DZC A;  4JS5 A;  4C8Q A;  1BKB A;  3CQT A;  2WSC E;  2RNA A;  3ASK A;  2QGG A;  2JTF A;  1M2V B;  2D0N A;  2OTL A;  2FYK A;  2BKD N;  3EG0 A;  4OMM A;  1QVG A;  4HXJ A;  5A2Q E;  3SD4 A;  1VQO T;  5J26 A;  3SFM A;  2DRK A;  2KI7 A;  3OYG A;  1D0Z A;  4Z02 A;  3LYI A;  5GMK j;  3JCM X;  3OS5 A;  3IQL A;  5GJW B;  3NMZ C;  2RB6 A;  5C0M A;  1Y96 B;  5LJ3 g;  4L6V 5;  1IHV A;  5GAN 4;  4L5G A;  1QP2 A;  1QQJ A;  5HK0 A;  4BDY A;  4NL3 A;  1K1Z A;  5HY6 A;  4EMH A;  1D1B A;  1D3B A;  4Y91 A;  2LRQ A;  1VQ6 A;  3DLL A;  4BI4 A;  2D9T A;  3FRN A;  2B86 A;  2QYZ A;  4F04 B;  1M3B A;  3H9N A;  4E7K A;  3OYY A;  5IN1 A;  1N8R C;  2E6Z A;  3VRY A;  2E64 A;  3JB9 I;  1M90 C;  4OB2 B;  3CEY A;  2ABL A;  1GFD A;  4M7D G;  1HYO A;  3OYE A;  3KUF A;  4C8Q F;  1X01 A;  4FYW B;  1NM7 A;  2O9S A;  3EH2 A;  2EKO A;  2Z0W A;  2RK2 A;  2R5A A;  4JRQ A;  3OSV A;  2E5Q A;  1X2K A;  4WTO B;  1QVF P;  2CZ0 B;  4HT8 A;  5IHI A;  4M77 B;  4KUD K;  4J6X A;  2GTJ A;  2JS2 A;  4ZNX A;  5D6W A;  2DMO A;  2JW4 A;  2KRN A;  4J6Y A;  1RAA B;  4RTU A;  3JCM g;  1H8K A;  1BI2 A;  2FG0 A;  1R8O B;  3JAM E;  3I5R A;  2EIF A;  3O8V A;  5CQX A;  5DM7 R;  1I8F A;  2I0N A;  2G3R A;  1SSF A;  1YWO A;  3M0S A;  1YJW Q;  2CP6 A;  2HDA A;  2SRC A;  4A4F A;  1PRL C;  1SRL A;  1R77 A;  2HCK A;  2DXT A;  2RJF A;  3M59 A;  3E19 A;  2DIQ A;  3MPU B;  3E1S A;  2K9G A;  1LJO A;  1MV3 A;  2QQS A;  2YWW A;  3PFS A;  3HRT A;  4LE9 A;  3Q1J A;  2GBQ A;  4J9H A;  3CCR Q;  4J9F A;  3VJP A;  3CXC A;  2QEX A;  1GCQ A;  1LOJ A;  1NLO C;  4N4H A;  4BD3 A;  3A5Z B;  1Q7Y C;  1J3T A;  3CCL Q;  2LX9 A;  1SRM A;  4XU2 A;  2KNB B;  3D7S B;  1F1B B;  3VUB A;  1O75 A;  1AWW A;  2DD5 A;  2RMO A;  4N0A A;  4BE0 A;  1Z9Z A;  1IZ6 A;  2O31 A;  1EIF A;  4HVV A;  3RBB B;  1JXO A;  1UB4 A;  1VQ8 A;  2CZ1 B;  4C92 A;  3SHW A;  2DK3 A;  1KFZ A;  5KCH A;  1PD1 A;  3CD6 T;  2XDB A;  4XU1 A;  1ZUY A;  3UF4 A;  3CC2 Q;  4BDZ A;  3SDZ A;  2PU9 B;  1QCF A;  2E70 A;  2ROL A;  1GFC A;  5D6Y A;  3QPH A;  1VQ6 Q;  3MHX A;  2DL7 A;  1M1K U;  4M7D B;  1SSH A;  1NYG A;  1U1S A;  1YIT Q;  5FRM A;  1YIT T;  5KH6 A;  2AKK A;  4M7D D;  1LPL A;  2RQR A;  2JTE A;  1VQ7 Q;  5I21 A;  1IHW A;  2B8A A;  1VOM A;  3OYL A;  1YWP A;  1QVG S;  3L1A A;  4RG8 A;  3MET A;  4PL6 A;  5LJ3 h;  1IO6 A;  3MEW A;  2D8H A;  2RN8 A;  4M77 G;  2MK5 A;  1GBR A;  2E65 A;  1R0C B;  3H41 A;  1CKA A;  4PNO A;  4AFU C;  1B3Q A;  1BIA A;  2CUB A;  1MNE A;  1K4U S;  4X9C A;  3FIF A;  3JCM h;  2YRD A;  2COY A;  4DEX A;  3EAE A;  1BYM A;  3VS1 A;  3HRS A;  5KYU A;  3REB B;  2K5F A;  3CCJ T;  4XTX A;  1VQM Q;  1YCY A;  2BZY A;  5FRO A;  4EPC A;  5LJ3 j;  3VV0 A;  4ZGJ B;  4C0G A;  3AHU A;  5LJ5 j;  1I0C A;  3LGL A;  2A28 A;  4XAX B;  3OS1 A;  2DYI A;  3G71 T;  1G83 A;  3GF5 A;  2BE7 D;  2WSF E;  3ULR B;  1YJN Q;  4J9C A;  5FWC A;  2E12 A;  4RTY A;  1Q86 C;  1VQ7 T;  2EGA A;  5FU6 B;  5GAN 6;  3CCJ A;  4C92 G;  3CCJ Q;  4A53 A;  1D0X A;  3INZ A;  2M0Y A;  1T0H A;  2X51 A;  3JSC A;  3L2V A;  2XD0 A;  4WCI A;  1K8A U;  1XOV A;  4HT9 A;  2FZK B;  1ZBX A;  2OI3 A;  4OMQ A;  4ZTJ A;  2A08 A;  1W2B A;  2PQW A;  3P8D A;  2EJG A;  2NLU A;  2OTJ A;  2RA2 A;  5GAM h;  4ORZ A;  2LVM A;  4BI8 B;  5DLQ E;  4J9D A;  3RIR A;  3RMQ A;  2RHI A;  1VQK A;  1N8R R;  4MZP A;  1G2B A;  5FLX E;  2NUP A;  2QAS A;  1OU9 A;  4FSX A;  2H3E B;  1Q81 R;  2KRM A;  2O4X B;  1X75 C;  3OBY A;  3JCM d;  5GAO p;  1FXX A;  5M9O A;  2EWN A;  3CC4 Q;  5CKB A;  3JCM J;  1QKW A;  4BUG A;  2E1H A;  1PSE A;  4MDW A;  3C95 A;  2QQ9 A;  4JJC A;  2M0O A;  3JV3 A;  2DNU A;  3HHT B;  4HCC A;  2LCL A;  3OYD A;  2V26 A;  1EZZ B;  5HCK A;  1VQK T;  1VIE A;  2RQT A;  2YUN A;  2AHJ B;  3QHS A;  4AMC A;  3NPF A;  4JS4 A;  2D0Q B;  3L2U A;  1OU8 A;  2KBT A;  3OYF A;  1UGV A;  4BI3 A;  4C5G A;  3RKX A;  2KR3 A;  2QA4 T;  2DIG A;  1RAG B;  3TSW A;  2P4T A;  4M77 E;  5CO7 A;  4OF1 A;  1NPP A;  2F2X A;  3MEV A;  1H92 A;  1UHC A;  4YTL A;  4Z89 A;  2EBP A;  3RUX A;  2XDD A;  1B34 A;  1ZSG A;  1OPL A;  2RI5 A;  1H3Z A;  3PVQ A;  3QBY A;  2HL5 C;  1YJN A;  1UHF A;  2VB6 A;  4DA4 A;  3I35 A;  5GAM g;  2FPD A;  4KH1 B;  4Q5W A;  1RAE B;  5IHN A;  4RKU E;  4RTZ A;  1QP3 A;  1K9A A;  1VQM T;  3QO3 A;  2NUZ A;  4DOV A;  2CSI A;  2CDT A;  3GBQ A;  4C0F A;  4QW2 A;  7AT1 B;  4PFZ A;  1NPR A;  5D6X A;  2EQM A;  3CMA Q;  2H8H A;  3ZL7 C;  2DPP B;  2RI3 A;  2J6O A;  5GAN f;  1RAC B;  4M77 C;  1IXD A;  1GBQ A;  2DIL A;  2F2V A;  2H3J A;  3QWX X;  2X4J A;  3QYG B;  1QKX A;  4OP0 A;  1ZHI A;  1UGS B;  2K79 A;  1BCM A;  5GAN h;  1U1T A;  2E3H A;  3O5Z A;  4J7F A;  3S3N A;  3LGF A;  3DB4 A;  2V8J A;  2RO0 A;  5FWB A;  5GMK h;  3CCE A;  1N9R A;  3S3O A;  1JEG A;  5GAM j;  1Z9Q A;  1C0M A;  2FL7 A;  3DB3 A;  2XG8 D;  2OAU A;  3JCM e;  3CC4 A;  1OI1 A;  3MEA A;  2QG9 B;  3E2U A;  3BE3 A;  3OBW A;  3UT1 A;  4BE1 A;  1KG1 A;  1T3L A;  2NUT B;  2AZV A;  2O9V A;  3G4S A;  1WHL A;  2L3R A;  1GCP A;  2DX1 A;  4R0K A;  1CKB A;  5A0L A;  4M7A F;  4C5I A;  5LJ5 f;  1BCO A;  2KQW A;  2L3Q A;  3EFO A;  2GTO A;  2YXY A;  2HKN A;  1TSF A;  2LNH B;  1AHJ B;  1WXT A;  3TSZ A;  3HTR A;  3CPF A;  3MP8 A;  1FMW A;  1PHT A;  4A4K A;  3JCM P;  2C06 A;  1XTD A;  4IKF A;  1WHG A;  4JUV A;  4Z88 A;  3EGD B;  3CCM A;  2M9U A;  1XQH A;  2DL4 A;  2QEX T;  2QK0 A;  2J05 A;  1GXI E;  1QVF A;  1B07 A;  1YIJ T;  3H0I A;  1UGP B;  2K5I A;  2XKO C;  2QGF B;  2P0K A;  1VQN Q;  3OS0 A;  3HL8 A;  4IUQ A;  5KYW A;  4MML A;  3EGD A;  2ESW A;  2JM9 A;  4PFP A;  1I5O B;  2DYB A;  2LMJ A;  4LDW A;  1U3O A;  4IUR A;  1VYT A;  3ER0 A;  2HL3 A;  4DBQ A;  1QVP A;  1WDX A;  4HCZ A;  2HSE B;  2J6K A;  2LCC A;  2KT1 A;  2LJ3 A;  2ZPF B;  2QI2 A;  1PM3 A;  3LX7 A;  4OMO A;  3AT1 B;  1VQN A;  2CP3 A;  4LXC A;  4LUE A;  1D1A A;  3L2W A;  5I2M A;  4PJO B;  2EYW A;  2VUB A;  4M78 A;  1VYV A;  2K3B A;  1WXU A;  2QQB A;  1G3W A;  4QQD A;  2MYS A;  3RKY A;  1Q82 U;  4JPB W;  2HQX A;  5FU7 C;  6AT1 B;  2QQR A;  2DET A;  2F69 A;  2YUO A;  3HFN A;  5I2S A;  2A7Y A;  4MZM A;  4N0A C;  3NTI A;  3CME T;  1HXD A;  4OB3 B;  3X24 B;  4RG2 A;  3OY9 A;  2EVR A;  3H0H A;  1PNJ A;  4C92 E;  2DD4 A;  3JB9 D;  2QTV A;  4ME7 A;  4LDV A;  3HFO A;  3CCM T;  4RMO A;  1JU5 C;  1OUL A;  2DAQ A;  2LJ0 A;  3OB9 A;  1ZLM A;  3VS3 A;  5GAM d;  2AT1 B;  1YJW T;  2BIV A;  1TUG B;  3CCU T;  4F14 A;  3WVE B;  1VQ7 A;  4FSS A;  1K73 U;  2DO3 A;  4X9D A;  1I1J A;  1TG0 A;  3M9Q A;  1Q95 G;  4E7H A;  3EGX A;  2CZ6 B;  2E6N A;  2ZAE A;  2ROT A;  3EFS A;  2P4R A;  1BIB A;  3NTK A;  4X34 A;  3ME9 A;  3LWI A;  3CPW S;  3QSU A;  3CPW P;  4D8D A;  3JB9 G;  1BI3 A;  2AKL A;  3J81 E;  3L2R A;  1TS9 A;  4M75 C;  3CPW A;  3PE0 A;  1XJW B;  2EJF A;  1QWF A;  1X2Q A;  5LL6 S;  1MMD A;  1AZG B;  2DTI A;  3OYK A;  3C94 A;  1G5V A;  4DBR A;  5FU6 C;  1UGR B;  5EC7 A;  2HAX A;  4HKE A;  3CME A;  1FX7 A;  1ACM B;  2O88 A;  5KYX B;  5KE3 A;  5IH2 A;  3HKS A;  3I56 A;  2K5L A;  3M57 A;  5CK9 A;  2VAS A;  1PKS A;  2L8D A;  3EG3 A;  1RI9 A;  1UEC A;  2M16 A;  3M0T A;  3CC7 T;  1VQ6 T;  3OYC A;  4M78 B;  2YDL A;  1WHM A;  2MPX C;  1R0B G;  2L2P A;  4JLI A;  1BU1 A;  1JJ2 S;  2DL5 A;  2ZPE B;  2DTO A;  1KQ1 A;  1AEY A;  1Y57 A;  3CD6 A;  3QKJ A;  4PJO C;  1TTH B;  4GLK A;  1ZBJ A;  4M75 A;  1VA7 A;  3N5B B;  4F7U G;  2RK1 A;  3EGU A;  4FW1 A;  3OS2 A;  2COZ A;  1KD1 U;  3JCM c;  5IXF A;  1RUW A;  3U23 A;  4DQ2 A;  4PFO A;  5GAN 3;  2DXU A;  2KRO A;  3M0P A;  4FU6 A;  3QG1 A;  4KUL A;  5GAN 8;  1Q86 U;  1VQP Q;  1I07 A;  3BFM A;  2LP5 A;  1QW1 A;  1MHN A;  1UEB A;  4FYY B;  3JRZ A;  4JJD A;  2JVV A;  1YJ9 T;  2DE0 X;  4IIO A;  2EQJ A;  1WA7 A;  2K57 A;  3DLM A;  4LD9 K;  1WHH A;  1KIK A;  3EG2 A;  1FMK A;  3I55 Q;  5GMK l;  2PUO B;  1M1K R;  2MWP A;  2MWO A;  4TVR A;  3M56 A;  2EAY A;  4M7D A;  4ELZ C;  3EFO B;  4OVA A;  1Q86 R;  1M1G A;  1K8A R;  2IPO B;  3CCS A;  2LCS A;  2DVE A;  2EFI A;  5KCO A;  2CP2 A;  4HVW A;  4RTX A;  4E7L A;  1WFW A;  4A4G A;  3GLX A;  4M77 A;  2SEM A;  3CCQ Q;  4M7D E;  3G1J A;  3OW2 P;  5IHK A;  4AG1 C;  1T0J A;  2QQA A;  2CS7 A;  2FVU A;  2KAF A;  4OML A;  2RPN A;  1YFN A;  3OW2 A;  2KRS A;  2F1L A;  2BTT A;  4F7U F;  1TXQ A;  4M78 G;  2CZ7 B;  3EG1 A;  2CH4 A;  1VQ9 T;  1SKU B;  1G8X A;  4MDX A;  4FL6 A;  1NZ9 A;  3QZ9 B;  2AZS A;  1UJY A;  4OMP A;  1LVK A;  2JXB A;  4ANJ A;  3M54 A;  3V8J A;  3MEU A;  3KBG A;  4BE2 A;  1GL5 A;  2YLC A;  1WXB A;  2RQV A;  4M7A B;  1CSK A;  4KRT A;  4M75 G;  1HK9 A;  4QVC A;  3UA6 A;  1SEM A;  3CC4 T;  1AD5 A;  4KH0 B;  1YJW A;  1B34 B;  3CCQ T;  3EFR A;  1ZUK A;  4EMK B;  1D1C A;  4RCB A;  5KYW B;  2FPF A;  1AOJ A;  2M02 A;  3UAT A;  3JCM V;  2VVK A;  1X6B A;  4AFS C;  4J9I A;  3HP9 A;  4PJO E;  1VQ4 Q;  2EGC A;  4V2S A;  2JUF A;  4BY6 B;  1RAI B;  2XDP A;  4EMK C;  3RER A;  3TEE A;  1KQS S;  1X43 A;  3MKD A;  1YNZ A;  1UFF A;  4RTV A;  3PGG A;  2OAW A;  2EKH A;  1W1F A;  1KQS A;  1YHQ T;  4JRP A;  2DL3 A;  1G3Y A;  4C8Q E;  3V7C A;  4BY6 C;  2VV5 A;  1Y71 A;  3NGP A;  4M77 F;  5GAM f;  3CCS Q;  2C0I A;  1Q81 C;  4LDY A;  4KBM B;  2F2W A;  3EHR A;  5LJ3 e;  1V29 B;  1OX9 A;  2LJ1 A;  2FZG B;  2RHU A;  1S72 T;  5AYF A;  9ATC B;  3CXC P;  3CCV Q;  3V8K A;  2ZZD A;  2BZ8 A;  4XTV A;  4M7D C;  2YLB A;  3V8L A;  1QVG P;  4CI0 C;  3OW2 S;  4AFQ C;  3TVT A;  1UUE A;  1K76 A;  1TU0 B;  1T3S A;  3HRU A;  4LUD A;  2KY9 A;  3GNG A;  3SB2 A;  5I22 A;  2G6F X;  3CC7 Q;  3EG9 B;  1VQL Q;  1Q82 R;  3OYB A;  2DKG A;  1PD0 A;  2DER A;  4F16 A;  2JJ9 A;  1PWT A;  2W10 A;  2EQK A;  1KHC A;  2VC8 A;  1UE9 A;  4M75 B;  5I11 A;  1V1C A;  2FB7 A;  2KSS A;  1NE8 A;  3JCM f;  1NLP C;  4KT0 E;  1KJW A;  3VRZ A;  1WHJ A;  2QDY B;  2GNC A;  3CBO A;  1M27 C;  4XU3 A;  4J9E A;  1VQ5 Q;  2ZPB B;  3M5A A;  3A8M B;  1UJ0 A;  4J83 A;  4L59 A;  4PJO A;  2RJE A;  2PVD B;  5KYY B;  2DF6 A;  3QII A;  3CMA T;  1JXM A;  4Y28 E;  1M1K C;  1AZE A;  3L2Q A;  2LT1 A;  4ESR A;  4DEY A;  1WI7 A;  1D09 B;  4C92 F;  4E2F B;  5GMK m;  3GNF B;  1MV0 B;  2MMP A;  5GAN 7;  3M4G A;  3OYH A;  4B9X A;  3CCM Q;  3MO8 A;  3CCE T;  2LDM A;  4C92 C;  3CCL T;  1YP5 A;  1BI0 A;  4O5V A;  3CME Q;  3OYI A;  4J9B A;  4RTT A;  1U06 A;  2OTL Q;  2F5T X;  5IXB A;  5EG2 A;  2HMA A;  3VS6 A;  2VGN A;  3SEM A;  5CAI A;  4IUT A;  1NJI R;  4NL2 A;  2RF0 A;  3G71 Q;  2L0A A;  2DZ9 A;  2DLP A;  2A0F B;  2CGH A;  3JB9 J;  4NS5 A;  3J80 E;  1IRX A;  3FEO A;  1K8A C;  4M75 D;  1M1F A;  4PJN A;  2CSQ A;  3CCE Q;  1MMA A;  1TUD A;  4XU0 A;  2COW A;  3A8L B;  5GAN d;  5GMK i;  1C6V X;  2FZC B;  1VQO A;  1M2O A;  1TUC A;  3M53 A;  1W4S A;  5L8R E;  3OMC A;  4JRK A;  2HEQ A;  4FYX B;  2GFU A;  2OTL T;  1YIJ Q;  2M51 A;  2MIO A;  1OZ3 A;  1QWE A;  2KT8 A;  4M7A E;  4LDX A;  2JZ2 A;  4PJM A;  2JM8 A;  2PVO B;  1V76 A;  2KXC A;  2PZ1 A;  1MGQ A;  4P5N A;  2IIM A;  4DBH A;  3I55 T;  3I56 Q;  3QDR B;  2DL8 A;  2FEI A;  1M90 U;  4JJN K;  4E7J A;  1N8R U;  1OV3 A;  4CC4 B;  3QZ5 B;  4C92 D;  3C4S A;  4JLG A;  2K3X A;  3H8Z A;  2KYB A;  2J6F A;  3P8B B;  2RM4 A;  4Z8A A;  1M4Z A;  2PNI A;  4J8O A;  1RL2 A;  3M0R A;  3G4S Q;  1E6H A;  5A0D A;  4GY5 A;  1KK7 A;  4MMK A;  4XTU A;  1ABO A;  5KYU B;  4E7Z A;  4QQG A;  1M3C A;  1QCO A;  2E4H A;  1UTI A;  2JNG A;  2VXE A;  4XQ3 A;  1YJ9 Q;  4OMN A;  3M58 A;  1K9M R;  1RAD B;  1G3S A;  2JT4 A;  2RHY A;  4J5Y A;  3GPL A;  1Q82 C;  5GAO q;  2XU8 A;  2VYT A;  1JRI A;  2AIR B;  3MJX A;  3TRE A;  1Q7Y R;  3JB9 H;  1UGQ B;  2LQ8 A;  1ZSZ C;  3VUZ A;  4N4G A;  4OB1 B;  5LJ3 f;  5C6S A;  4PJO F;  4QQ6 A;  1Q81 U;  2Y4X A;  1MUZ A;  1KD1 R;  4RCC A;  1YI2 A;  5KYN A;  3MCA B;  1PCX A;  2M1H A;  2ATC B;  3REA B;  2JN0 A;  4C8Q G;  3CCQ A;  1TOV A;  5J3B A;  4LN2 A;  3VS7 A;  1KQ2 A;  2BUD A;  1ZSZ B;  2JMA A;  2J7I A;  1K0S A;  2DFU A;  1LNX A;  2KK4 A;  3BDU A;  1UDL A;  4M78 F;  2PVG B;  2MCN A;  2X4Y A;  2DEQ A;  4ZGE B;  4K11 A;  4FM4 B;  1SHG A;  2VKN A;  2KGT A;  3VKI A;  4B6M A;  2QA4 Q;  2YRC A;  1TWB A;  3M55 A;  4VUB A;  1VQO Q;  5AT1 B;  2ED1 A;  1KQS P;  5CKF A;  3VS2 A;  4PKC C;  5FW9 A;  3OYM A;  2K3Y A;  4F17 A;  4JZ3 A;  4M78 E;  1G3T A;  4FW2 A;  1LCK A;  1VQ9 Q;  4M7D F;  1UG1 A;  1YI2 Q;  2QDL A;  2JOY A;  1M90 R;  1OX8 A;  3ZBD A;  4C0D B;  1NEB A;  5GAO l;  3EH1 A;  1WJR A;  2VXF A;  1JO8 A;  4FT4 A;  1WGS A;  1S72 A;  3PVL A;  1IGQ A;  2EYZ A;  1NJI C;  2HNI A;  1K73 R;  3JCM Q;  2R58 A;  3CBM A;  2K2M A;  2A3L A;  2HSP A;  4OGC A;  3PTA A;  1OYX A;  3CCU A;  1YHQ A;  2EW3 A;  1Y07 A;  4RTW A;  3PIP A;  3OYJ A;  4CC7 A;  4JRI A;  1QLY A;  5LJ5 e;  1GCQ C;  1Y0M A;  2A37 A;  3QJY A;  4ATO A;  4X1V A;  2BZX A;  2P84 A;  3I9Q A;  3JCM b;  3V7R A;  1I4K 1;  3G6E T;  1SPK A;  1M8V A;  1S1N A;  4PLL A;  2X35 A;  2RD1 A;  4M7A D;  3QJ6 A;  1ZX6 A;  1YN8 A;  5CR2 A;  2CYZ B;  2C0T A;  1H3H A;  1BB9 A;  3GOX A;  3LH0 A;  3VS4 A;  4KGV B;  2K7A A;  1MMN A;  4E47 A;  2V1Q A;  3NTH A;  1RAH B;  5CIU A;  3WVD B;  4A4E A;  3V7S A;  2DA9 A;  5GAN g;  5DLO A;  1ZSZ A;  4PJJ A;  2JMC A;  4QVZ A;  4C92 B;  2DEU A;  1N27 A;  1I81 A;  2P0Q A;  3A8H B;  4M4Z A;  4C5E A;  1RLP C;  4N4I A;  4CRI A;  3R6N A;  3KXT A;  3FJP A;  2R5M A;  4C0Z A;  5GAN j;  1AWX A;  1WIE A;  1GRI A;  3TCJ A;  1WHK A;  5A0G A;  1KD1 C;  1VQK Q;  1ARK A;  4ZN3 A;  3E9F A;  3A8G B;  4J6W A;  2NWM A;  4A54 A;  1Q7Y U;  5KYX A;  2HBW A;  3HPW A;  3X26 B;  3HSB A;  4KGZ B;  2DXC A;  2L5Q A;  4HVU A;  2RQW A;  1X69 A;  2ZGW A;  3E9G A;  2CH4 W;  4M7A C;  2YUQ A;  1U8R A;  3CMA A;  5DY9 A;  1K9M C;  2D8J A;  1AVZ C;  2E5K A;  4JJB A;  1XNI A;  2GF7 A;  2DBM A;  4DBF A;  2EYX A;  1D0Y A;  1SF9 A;  2KVQ G;  3URG A;  3OSS C;  2X4W A;  4ELY C;  2KXD A;  2MOX A;  1D3B B;  4C0D C;  2LNV A;  4M7A A;  3CCS T;  3H0F A;  1VQ4 T;  1NEG A;  2V8I A;  1VQ8 T;  2EJ9 A;  1VQ5 T; 
#chains in the Genus database with same CATH homology
 2D0N A;  3UA7 A;  5L23 A;  3EG0 A;  2L3Q A;  4OMM A;  1KSW A;  4HXJ A;  2GTO A;  5I22 A;  2G6F X;  3EHQ A;  2DRK A;  2CT3 A;  4F16 A;  1PWT A;  2LNH B;  1WXT A;  2W10 A;  3IQL A;  5GJW B;  3NMZ C;  3TSZ A;  1UE9 A;  2X3W D;  4QT7 A;  1PHT A;  5I11 A;  1V1C A;  2EYY A;  1E7O A;  1NLP C;  1KJW A;  3VRZ A;  1K1Z A;  4Z88 A;  2DL4 A;  2GNC A;  1M27 C;  2J05 A;  1OOT A;  4J9E A;  3KFV A;  1B07 A;  2ENM A;  3H0I A;  1UJ0 A;  1FYN A;  2L3P A;  2ESW A;  2JM9 A;  1NG2 A;  2DYB A;  2DF6 A;  2LMJ A;  1U3O A;  1JXM A;  1X6G A;  2B86 A;  1AZE A;  1M3B A;  1VYT A;  4ESR A;  4DEY A;  1WI7 A;  4GLM A;  2YUP A;  1WDX A;  4Y92 A;  1MV0 B;  3VRY A;  2J6K A;  2LJ3 A;  2KT1 A;  4OMO A;  2ABL A;  1GFD A;  2XMF A;  4EIK A;  4LUE A;  1YP5 A;  2KEA A;  2EYW A;  1NM7 A;  2EQI A;  2O9S A;  1VYV A;  2D1X A;  4J9B A;  4RTT A;  1U06 A;  2KYM A;  3QWY A;  5IXB A;  2K3B A;  1X2K A;  1AWJ A;  1ABQ A;  1WXU A;  3VS6 A;  2J06 A;  1HSQ A;  5IHI A;  3SEM A;  4IIM A;  4JPB W;  3NHN A;  2FPE A;  2YUO A;  2L3S A;  1VYU A;  1M3A A;  2RF0 A;  2GTJ A;  2JS2 A;  4ZNX A;  2L0A A;  2LQW A;  2DMO A;  2PTK A;  2JW4 A;  2DLP A;  2KRN A;  4RTU A;  4D8K A;  1H8K A;  2EVR A;  3H0H A;  2FG0 A;  1PNJ A;  3THK A;  2EGE A;  3I5R A;  2I0N A;  3M0S A;  1YWO A;  2CSQ A;  2HDA A;  2SRC A;  1PRL C;  1SRL A;  3C0C A;  1TUD A;  2HCK A;  1JU5 C;  2LJ0 A;  2OJ2 A;  1ZLM A;  1TUC A;  3VS3 A;  2K9G A;  4F14 A;  2EPD A;  2HEQ A;  1MV3 A;  2CRE A;  4FSS A;  4LE9 A;  2GBQ A;  4J9G A;  2M51 A;  4J9H A;  2DJQ A;  2MIO A;  4J9F A;  1I1J A;  3A98 A;  1QWE A;  2KT8 A;  1TG0 A;  1GCQ A;  1NLO C;  2ROT A;  2JM8 A;  1J3T A;  2P4R A;  2DVJ A;  2KXC A;  2PZ1 A;  2IIM A;  1SRM A;  2W0Z A;  4D8D A;  2KNB B;  2AKL A;  2DL8 A;  2FEI A;  2LX7 A;  1AWW A;  2RMO A;  3PE0 A;  1ZUU A;  1OV3 A;  1QWF A;  4CC4 B;  1X2Q A;  2FRW A;  2KE9 A;  1Z9Z A;  4JZ4 A;  2O31 A;  1AZG B;  2ECZ A;  4HVV A;  3RBB B;  2KYB A;  1JXO A;  2J6F A;  5EC7 A;  2DBK A;  3SHW A;  4Z8A A;  2YT6 A;  1KFZ A;  2O88 A;  2O2O A;  2PNI A;  1ZUY A;  5IH2 A;  3M0R A;  1EFN A;  3UF4 A;  1E6H A;  2JS0 A;  1QCF A;  2ROL A;  1GFC A;  1ABO A;  1OPK A;  2DL7 A;  1M3C A;  1SSH A;  1NYG A;  1PKS A;  3EG3 A;  1RI9 A;  1UTI A;  1UEC A;  2AKK A;  2RQR A;  3M0T A;  4OMN A;  2JTE A;  3M0U A;  4AFZ C;  1HJD A;  2YDL A;  2JT4 A;  1YWP A;  2L2P A;  1BU1 A;  1IO6 A;  1U5S A;  1PRM C;  2D8H A;  2RN8 A;  2DL5 A;  1GBR A;  1Y57 A;  1AEY A;  3H41 A;  1CKA A;  4AFU C;  1B3Q A;  5GJV B;  1ZBJ A;  2CUB A;  1K4U S;  1VA7 A;  5ECA A;  1JQQ A;  4DEX A;  3EGU A;  1MUZ A;  3VS1 A;  2AK5 A;  3REB B;  1K0X A;  5IXF A;  1RUW A;  1AWO A;  2BZY A;  3U23 A;  3REA B;  1BBZ A;  4LNP A;  2KRO A;  3M0P A;  4LN2 A;  2YSQ A;  3VS7 A;  1I0C A;  2A28 A;  1N5Z A;  3M0Q A;  2JMA A;  2J7I A;  1G83 A;  1K0S A;  1I07 A;  3ULR B;  2LP5 A;  4HCK A;  4J9C A;  5FWC A;  2X3X D;  4JJD A;  2DE0 X;  1WX6 A;  4IIO A;  1UDL A;  4RTY A;  1WA7 A;  2EGA A;  2FRY A;  1KIK A;  2MCN A;  3EG2 A;  1FMK A;  1WYX A;  4K11 A;  1SHG A;  2VKN A;  2M0Y A;  1T0H A;  2KGT A;  2FO0 A;  4WCI A;  1XOV A;  2ED1 A;  2OI3 A;  4OMQ A;  3VS2 A;  2GGR A;  2A08 A;  2A36 A;  5FW9 A;  3VS5 A;  4F17 A;  4ORZ A;  4JZ3 A;  2LCS A;  4J9D A;  1A0N B;  4HVW A;  1LCK A;  4RTX A;  1UG1 A;  2ED0 A;  1G2B A;  1YCS B;  1WFW A;  2QDL A;  3I5S A;  2SEM A;  1NEB A;  2KRM A;  4RUG A;  1JO8 A;  2LZ6 B;  5IHK A;  2DRM A;  2GQI A;  4AG1 C;  1T0J A;  4CC2 A;  1QKW A;  3PVL A;  1BK2 A;  4OML A;  2EYZ A;  2RPN A;  2KRS A;  2K2M A;  2BTT A;  3EG1 A;  2HSP A;  4JJC A;  2CH4 A;  1NYF A;  1WLP B;  2DNU A;  3JV3 A;  2EW3 A;  2AZS A;  4RTW A;  1UJY A;  2CUD A;  5HCK A;  4OMP A;  4CC7 A;  1QLY A;  2RQT A;  4AG2 C;  2YUN A;  1GCQ C;  1Y0M A;  2A37 A;  4X1V A;  2K6D A;  2JXB A;  3NPF A;  2BZX A;  1OEB A;  3I9Q A;  2KBT A;  1UGV A;  1GL5 A;  1WXB A;  2RQV A;  1X27 A;  1SPK A;  1CSK A;  4KRT A;  1SHF A;  1S1N A;  2KR3 A;  3LH5 A;  3UA6 A;  1SEM A;  1AD5 A;  3TSW A;  2RQU A;  1ZX6 A;  1W6X A;  1YN8 A;  2CT4 A;  1ZUK A;  2C0T A;  1H3H A;  1BB9 A;  2F2X A;  1H92 A;  3VS4 A;  2VWF A;  2K7A A;  1UHC A;  4Z89 A;  2V1Q A;  2FPF A;  1AOJ A;  2EBP A;  3UAT A;  2VVK A;  1X6B A;  1ZSG A;  1OPL A;  2DA9 A;  3PVQ A;  1M8M A;  4AFS C;  4J9I A;  1UHF A;  3I35 A;  1W70 A;  4GBQ A;  2FPD A;  2JMC A;  2EGC A;  5IHN A;  3RNJ A;  4E6R A;  4M4Z A;  4RTZ A;  1RLP C;  1K9A A;  1X43 A;  4CC3 A;  1YNZ A;  1UFF A;  4A63 B;  4RTV A;  3R6N A;  2NUZ A;  2CSI A;  2OAW A;  2EKH A;  2CDT A;  3GBQ A;  1W1F A;  1AWX A;  1WIE A;  1GRI A;  2H8H A;  3ZL7 C;  1E6G A;  2J6O A;  1GBQ A;  1M30 A;  2DIL A;  2DL3 A;  2F2V A;  3QWX X;  1ARK A;  3NGP A;  1QKX A;  2DM1 A;  2NWM A;  2K79 A;  2C0I A;  2LQN A;  2HBW A;  2C0O A;  2F2W A;  3EHR A;  3O5Z A;  2LJ1 A;  5FWB A;  4HVU A;  2RQW A;  1PKT A;  1X69 A;  2CH4 W;  1JEG A;  1Z9Q A;  3FJ5 A;  2YUQ A;  2D8J A;  1AVZ C;  2E5K A;  4JJB A;  2BZ8 A;  1HD3 A;  3VS0 A;  2DBM A;  2EYX A;  2V1R A;  1RLQ C;  4AFQ C;  3TVT A;  1UUE A;  1T3L A;  1K76 A;  2MOX A;  2KXD A;  2AZV A;  2O9V A;  3CQT A;  1GCP A;  1T3S A;  4LUD A;  3H0F A;  1NEG A;  2DX1 A;  2RNA A;  4R0K A;  1CKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...