1NLOC

Structure of signal transduction protein, nmr, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the binding of SH3 ligands with non-peptide elements identified by combinatorial synthesis.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Complex (transferase/peptide)
molecule keywords C-SRC
total genus 7
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1996-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1nloC00
2LZ6B 1UTIA 3NGPA 2GQIA 1RUWA 3VS6A 2FO0A 1VYTA 4J9FA 2GBQA 2V1QA 2X3WD 1AD5A 3CQTA 3REBB 3REAB 1GBRA 2KRNA 2YSQA 1MUZA 2RNAA 3VS2A 1H92A 1BU1A 3I35A 1UUEA 1NLOC 4R0KA 1PRMC 2DBMA 2EYZA 1X27A 1G83A 4EIKA 2M51A 1B3QA 2EQIA 1E7OA 1NYFA 4JJDA 3KFVA 2L0AA 2SEMA 1YNZA 3FJ5A 4KRTA 1FMKA 2E5KA 2PTKA 5FWCA 1ABQA 1PNJA 3JV3A 2EYXA 1H8KA 1SHGA 1MV3A 2BTTA 4JZ4A 1WXBA 2VKNA 3M0SA 4K11A 1ABOA 3M0TA 3H41A 4LUEA 2FPDA 1B07A 2KRMA 2DL3A 1AOJA 5FWBA 1S1NA 3QWXX 1NM7A 1ARKA 1V1CA 4J9DA 3TSWA 1T0JA 1HD3A 1Y0MA 3A98A 5IHNA 3UA6A 4OMOA 2K6DA 1AWOA 1XOVA 3H0FA 3UATA 2W0ZA 1YP5A 3PE0A 1T3LA 2CSIA 1YWOA 1TUDA 1NYGA 2X3XD 5FW9A 2O88A 1W70A 1JU5C 1YWPA 2LQNA 1KFZA 5HCKA 2FEIA 1QKXA 2MOXA 3PVQA 2KT8A 2DJQA 2L3QA 3EHQA 2ED0A 3SHWA 1U5SA 4ORZA 5EC7A 2L3SA 3VRYA 1MV0B 1K0SA 1PRLC 1SEMA 3NMZC 4RTUA 3R6NA 2J6KA 1W6XA 1U3OA 1AWWA 2QDLA 3IQLA 4OMNA 5IXBA 2YT6A 1WFWA 2ROTA 2EYWA 2KXCA 2LNHB 2LX7A 2W10A 2AKLA 5GJWB 1GRIA 2J6OA 4CC2A 1I1JA 1K4US 1EFNA 4GLMA 4HVVA 1RLPC 2O9SA 2KEAA 3H0IA 2GNCA 1CKAA 2ESWA 2MCNA 2ROLA 3VS7A 4OMMA 2RQUA 3VS1A 1OOTA 2ECZA 4X1VA 1X2QA 1UE9A 3ULRB 2OI3A 1AWJA 4WCIA 1GFDA 1UJYA 1GBQA 4ESRA 1WYXA 1BB9A 3M0RA 1GL5A 5I22A 3VS0A 3EG1A 4AG2C 4HVWA 2JMAA 2VWFA 2EGCA 2AZVA 4JJBA 2RQVA 2DM1A 2JT4A 1UHCA 2DRMA 2RPNA 3LH5A 1AEYA 2EGAA 2FG0A 1QWFA 1YN8A 1PKTA 1FYNA 2I0NA 5I11A 2RMOA 4AFUC 4RUGA 1JXOA 2J06A 2AK5A 4RTYA 4D8DA 1Z9QA 4QT7A 2J6FA 2LJ0A 1K9AA 2FRWA 2XMFA 1ZUUA 1U06A 3VS5A 1W1FA 2O9VA 1T3SA 2A28A 2CREA 2KYBA 1K76A 1NLPC 1SRMA 1VYUA 4RTXA 2J05A 2KNBB 2HDAA 3TSZA 5IH2A 1SPKA 1SHFA 2CT3A 2KYMA 2EPDA 2D8JA 4RTVA 1LCKA 4F14A 4J9EA 2YUOA 2EKHA 4OMLA 2DLPA 1I07A 2ENMA 2DX1A 2M0YA 1WI7A 2JXBA 2DE0X 4LNPA 1OEBA 1JQQA 2SRCA 1WIEA 1QWEA 2J7IA 1TG0A 1E6GA 4RTWA 2FPFA 1RLQC 4AFZC 1AVZC 3M0PA 2VVKA 3I5SA 2EBPA 2DBKA 4A63B 1GCQA 1UHFA 2DL5A 2CH4W 2DNUA 1OPLA 2JS2A 2EW3A 2C0TA 2BZYA 2IIMA 4HXJA 4F17A 4HCKA 2EYYA 3I9QA 2HBWA 1H3HA 1KIKA 3QWYA 4LN2A 2F2WA 4Z8AA 2DL7A 1M8MA 1QKWA 1ZUKA 4AFQC 4OMPA 4JJCA 4FSSA 1T0HA 2RF0A 2LCSA 3UA7A 2DRKA 1GFCA 2MIOA 3H0HA 5L23A 4LUDA 1IO6A 2O31A 4J9GA 1M3BA 2A08A 2KBTA 2CUBA 4AG1C 4RTZA 1NEGA 4DEXA 4F16A 4D8KA 4J9HA 1UJ0A 1OV3A 1X6BA 2LJ1A 2KRSA 3I5RA 4GBQA 2H8HA 4Z88A 2G6FX 1VYVA 2OAWA 2JM9A 2JW4A 1X6GA 1RI9A 2AKKA 1NG2A 4ZNXA 4CC3A 1TUCA 3EG0A 3M0UA 2K79A 5GJVB 2LQWA 4M4ZA 2JTEA 3VS3A 1X43A 2B86A 3C0CA 1QCFA 1UFFA 5IXFA 4AFSC 2DL4A 3EG3A 1WDXA 2OJ2A 1VA7A 2KGTA 3RBBB 4JPBW 1AZEA 1CKBA 2C0IA 1ZX6A 2BZ8A 2DL8A 2YDLA 3SEMA 2EGEA 3NPFA 2LMJA 4Y92A 2DMOA 1GCQC 1ZLMA 1HJDA 1SRLA 2PZ1A 2O2OA 4HVUA 3M0QA 2YUPA 2A37A 2DYBA 3U23A 1QLYA 4J9CA 2AZSA 2L3PA 1K1ZA 2GTOA 4LE9A 1A0NB 3VS4A 1Z9ZA 3ZL7C 1M27C 1ZBJA 2D8HA 2CSQA 2FRYA 2LJ3A 5IHIA 1WLPB 1UGVA 1JXMA 3GBQA 4Z89A 1K0XA 2KE9A 2NUZA 5IHKA 1GCPA 3EG2A 2CH4A 1WX6A 2L2PA 1I0CA 2K2MA 2YUQA 1SSHA 4E6RA 1OPKA 1X2KA 2JM8A 2PNIA 4J9BA 2KROA 2F2VA 2GGRA 2RQTA 1YCSB 2NWMA 3EHRA 1Y57A 1AZGB 3EGUA 4OMQA 4RTTA 2RQRA 2BZXA 1HSQA 1UG1A 2HSPA 1J3TA 4JZ3A 2EVRA 1NEBA 2HCKA 1X69A 1ZSGA 5ECAA 1PKSA 2C0OA 2ED1A 1KJWA 2DF6A 4IIOA 1UECA 2CT4A 4CC7A 2DVJA 1BBZA 2K7AA 2RN8A 1G2BA 2D1XA 2JS0A 4CC4B 1PWTA 2KT1A 3NHNA 1M3CA 2K9GA 2ABLA 1JEGA 4IIMA 1M30A 2LP5A 2RQWA 2A36A 1M3AA 1CSKA 1KSWA 1UDLA 2P4RA 2HEQA 1JO8A 2F2XA 2DILA 2GTJA 1BK2A 2CDTA 4DEYA 3TVTA 3RNJA 1AWXA 2DA9A 1E6HA 1ZUYA 2D0NA 1WXTA 2FPEA 3THKA 2KXDA 2JMCA 1N5ZA 4J9IA 3UF4A 1PHTA 2KR3A 3VRZA 1WXUA 2CUDA 2V1RA 3PVLA 1WA7A 2K3BA 3O5ZA 2YUNA
chains in the Genus database with same CATH superfamily
2GQIA 4E7HA 1IGUA 4C5HA 3CMAT 1ZSZC 2FO0A 4HCZA 4LD9K 3QZ5B 1AD5A 2DETA 3REBB 1Y7XA 5FRMA 3REAB 4C92C 1MUZA 3C4SA 2EQJA 2VXFA 1Q81R 1UUEA 4MMKA 2KMTA 1JJ2A 1PRMC 1QQJA 1X27A 1NYFA 1TSFA 3FJ5A 4KRTA 4M77G 1VQ9A 1QVGP 1VQLA 7AT1B 3JV3A 5LJ3f 4CRIA 3EAEA 4A4KA 4JZ4A 4O6JA 1BI2A 2R5AA 3M0TA 4LUEA 2FPDA 3CC2Q 1B07A 1IB8A 1K8AC 4PKCC 1YJWT 3OYAA 1V1CA 5CR2A 4XU2A 1X6OA 2DTOA 3FJPA 5GAMj 3TSWA 1PD0A 1T0JA 3OMGA 1HD3A 3QZ9B 4DA4A 1N27A 2K6DA 2DFUA 2ZPFB 1XOVA 3H0FA 3V7SA 4B6MA 2EQUA 2W0ZA 3PE0A 4KH1B 3G71T 2CSIA 1YWOA 1WHMA 3GIBA 1TUDA 1IREB 4J7FA 5FW9A 3S3OA 2XD0A 2EQMA 4M7AD 4XU1A 4B9WA 1XJWB 3RKYA 3PIOA 4M78B 3E1SA 3VUZA 5GAN4 4C8QD 3M58A 1S72A 1VQ6A 4QQ6A 3NTKA 5EC7A 2L3SA 3VRYA 3CCSA 3L2WA 1YJ9Q 1HYOA 3JCMh 4ZTJA 3L2RA 2GQVA 4X9CA 5GAOq 1IGQA 3R6NA 1OULA 1U3OA 1MGQA 1BI1A 1Q7YR 4M77E 4R55A 3JB9H 4ZGDB 3JCMJ 5GJWB 3OW2S 1VQ7A 3CPWS 2PVGB 4M78G 2J6OA 4DOWA 4A4FA 1QVGS 1K73U 1K4US 4HVVA 2BIVA 2KEAA 2KI7A 2COZA 3M55A 3MEUA 4C92E 3QYGB 4OMMA 5CKFA 1VQ7T 3QO3A 3JCMe 2ECZA 3HRTA 2MWPA 2BUDA 1WYXA 2QAZA 1JJ2P 4C0DB 2E5QA 4HT8A 3X28B 1KQ1A 2K2VA 3QPHA 3G6EQ 5LL6S 3I56Q 2KAFA 3FEOA 4JJBA 1U1TA 2DM1A 1G3WA 1AEYA 1UHCA 2RPNA 3LH5A 1VQ4Q 4ANJA 1QWFA 2DO3A 4FYWB 5C6SA 1IRXA 1FYNA 3LYIA 2LCLA 1TUGB 2V8JA 2LJ0A 5CKDA 1K9AA 3CCUT 2MMPA 3S3NA 1VQMQ 2PVOB 3QYHB 4ZGJB 5I21A 1W1FA 3P8HA 1T3SA 2CREA 1K76A 2LT4A 1VQPQ 1PM3A 3ME9A 2HDAA 4LD6A 1SHFA 1VQ8T 5A0DA 2ZCFB 3DLLA 4M77F 5FROA 2M0YA 1M8VA 1OEBA 2DXBA 3A1PA 2XK0A 3L42A 2L8DA 2A3LA 3OYJA 1K9MU 2CKKA 2EIFA 3URGA 1AVZC 3M0PA 1GXIE 2VVKA 3I5SA 2EBPA 2DBKA 5GAN8 4PJOE 2XKOC 5GAN7 2DEQA 1QP3A 2JS2A 4UC4A 2IIMA 2EJFA 2CP5A 1D1AA 4HXJA 4F17A 3OYFA 1Q82U 5CKHA 1VQ8Q 2EYYA 1M90C 1KQSP 1K73C 3NTHA 5GMKj 4Z8AA 1ZUKA 1VQ5T 2E41A 2HZYA 5GANe 1FWZA 1RAHB 1RAFB 2O31A 4J9GA 2EWNA 3CCLT 4IKFA 4E7KA 5D6WA 1EIFA 5KYYA 4N0AA 2G3RA 1VUBA 4DEXA 2E70A 3L1AA 2RHUA 4ME7A 2E10A 2KRSA 3JB9J 2MI6A 4PL6A 3CPFA 3M54A 2H8HA 2CGHA 3LLRA 2M0OA 5L8RE 2ZPEB 2OAWA 1D3BA 3OMCA 1VQ9T 1YJ9A 4CC3A 1NG2A 4F7UE 4M7AB 4FT2A 3VS3A 1VQNQ 1WQWA 2D0QB 3EG3A 5GMKh 2QA4Q 2KY9A 2KGTA 1UGSB 3VV0A 1VQKA 1ZSZA 2DAQA 1VQ7Q 3N5BB 4F04B 4C0FA 3CC7A 2YDLA 1WHLA 2DD5A 1YBYA 3HHTB 3NFCA 4N4IA 4EMGA 8ATCB 3OW2A 2PZ1A 2O2OA 1I5LA 3M0QA 2GFAA 3HSBA 1YJWQ 1M4ZA 3TQ7P 3G4SA 2L3PA 2GTOA 3MEAA 3VS4A 1BCOA 3ZL7C 2ZGWA 1M27C 5IHIA 2JZ2A 4OB2B 3CC2T 1WLPB 4IUTA 3HFOA 2FZKB 1NZ9A 5IHKA 3CBPA 3SD4A 3EG2A 1YFNA 1I0CA 4VUBA 1SSHA 4E6RA 1YJ9T 2JM8A 2PNIA 4J9BA 2F2VA 2QEXT 4OB3B 2RQTA 3BDUA 4DBHA 1YCSB 3CC4Q 5DLQE 2NWMA 3OYYA 3SWNB 1RAAB 3OW2P 3LW5E 4XQ3A 1HSQA 3I55Q 2QGFB 3CCJT 2HSPA 3V8LA 1OI1A 1NEBA 1X69A 3J80E 5ECAA 3CCLA 3QJ6A 2ED1A 4IIOA 3CXCP 2FZCB 3MKDA 1PD1A 1BBZA 2K7AA 4BI3A 1RACB 2YRCA 2HD0A 2DVEA 4PLLA 3NHNA 5FU6B 1VQ5A 2VXEA 4IIMA 2QK0A 2LP5A 2OTLA 2RQWA 4J83A 4KGZB 1KSWA 1UDLA 2VUBA 5KYUA 3ZBDA 2F2XA 2GTJA 2CDTA 4DEYA 3AHUA 4F7UA 1RABB 5HKCA 1ZUYA 3KXTA 4MZMA 4BACA 3BFMA 4JS5A 2VASA 5A0GA 1DJ7B 2KXDA 2NLUA 3CCVT 2OX7A 1N5ZA 4J9IA 4LDVA 5D6XA 3VRZA 1WXUA 1KC8U 4QVDA 5GAN6 2YUNA 1PSFA 2A0FB 3OSSC 4M78F 2OTLQ 1QVFA 4ELZC 1VQ8A 2V1QA 3CCUQ 1VQMT 1OQKA 1VQOA 1GBRA 2BE7D 2RNAA 3JB9D 3A5ZB 1H92A 1K73R 1BU1A 4BDYA 1F1BB 1OX8A 4R0KA 3PMTA 4EMKB 1MMNA 1G83A 3QDFA 2M51A 1E7OA 2X51A 4M7DF 3KFVA 2L0AA 2SEMA 1LVKA 1YNZA 1FMKA 3MP6A 2E5KA 5FWCA 1PNJA 3M4GA 2EFIA 3X26B 1Q82C 4JLIA 3JCMV 4AMCA 4JRKA 1QVFS 4XTZA 2V26A 5D6YA 4J6XA 4JRPA 2Y90A 2XG8D 1LOJA 2R5MA 5KYNA 4E7JA 4PK4A 2LRQA 3C12A 4C5EA 4J9DA 4C92F 2KVQG 2X35A 2QASA 3CC4T 2EQKA 4OMOA 1KQSS 3Q1JA 3UATA 1YP5A 3CCMA 3EGDB 1NJIC 2X3XD 3NTIA 3JCMW 1TU0B 5KE2A 3CD6T 3HL8A 1OZ3A 2HL3A 1M9SA 4KGXB 1Q86U 4II1A 4X9DA 5HCKA 1QKXA 2FEIA 3OA6A 2WACA 3PVQA 2KT8A 5GAN2 3UT1A 2DZ9A 5GAOp 3EHQA 2PVDB 3SHWA 1U5SA 1EZZB 4J7IA 4A4EA 1VQ5Q 3PNWC 2KK4A 2L5QA 4F7UG 2DD4A 1SEMA 1KHCA 4J6YA 4JLGA 4RTUA 2J6KA 4OF1A 2QQBA 1OYXA 3CBMA 1G3YA 2QDLA 4MZPA 4BB7A 4FYVB 1O75A 3CCEA 2HMAA 2MPXC 4M78D 3VJPA 3JCMQ 3J81E 1OZ2A 2LNHB 2W10A 3I55T 3CCST 1K9MR 2CZ0B 3CCRQ 4M75F 1S72T 4M77C 2E65A 1Q86C 1VQ6T 5AYFA 1I1JA 1TXQA 1EFNA 2GNCA 1VQPA 5LJ3g 2FL7A 2ROLA 3VS7A 1QVFP 1Q82R 5A2QE 3CCRT 4RMOA 2WSCE 1VQLQ 4X1VA 1YHQT 3JB9I 3ULRB 3J7AF 1AWJA 2CZ1B 3M59A 2LDMA 3PIPA 1UJYA 1XTDA 4OP0A 2R58A 1GL5A 2CZ7B 3P8DA 3F70A 5LJ3e 3VS0A 1BIBA 4AG2C 2L89A 4HVWA 1XQHA 3VYGA 1YJWA 2MK5A 2K3XA 4BI8B 2EGCA 2AZVA 1H3ZA 2OTJA 2VGMA 2DRMA 5KYWB 3GNFB 2FG0A 1N6AA 2E64A 4IUUA 1Q7YC 1SG5A 3ZEHA 5GMKl 4Y91A 4JJNK 4BY6C 3CCQA 1TWBA 1PCXA 4RTYA 1VQLT 4QT7A 1YHQQ 2J6FA 2FRWA 5FLXE 2XMFA 4C5GA 5CVIA 3BW1A 1U06A 1PSEA 3OYCA 5GAMd 2QQSA 2A28A 4WF2A 3HRSA 1N8RC 1NLPC 1TOVA 1G5VA 4E7IA 2J05A 4M77A 1MNEA 2JVVA 1RAEB 3TSZA 1SPKA 2CT3A 4DBQA 5D7UA 2EPDA 2D8JA 3EH2A 3MJXA 3CMAA 4J9EA 2YUOA 4C0ZA 3QKJA 2ENMA 1WI7A 2DIGA 4LNPA 4KUIA 2YRDA 1R8OB 2SRCA 1KC8C 1C0MA 2J7IA 1FXXA 4M7DE 2JOYA 4P5NA 1E6GA 4RTWA 4R56A 2FPFA 1JRIA 1FMWA 1NE8A 1WGSA 5KYWA 1JBMA 1UHFA 2QA4A 1KHIA 1YITT 2RHYA 3QHSA 2EW3A 5GANj 1G3SA 4HCKA 1VIFA 3MCAB 3SB2A 5KYXB 2HBWA 2QGGA 3I56A 1H3HA 2HBPA 4LN2A 5LJ5e 1YITQ 3EGXA 4AFQC 2RH2A 5DM7R 4V2SA 1T0HA 3UA7A 1QP2A 2RK2A 3H0HA 3OB9A 1IO6A 1MHNA 2QQAA 2A08A 2HKQB 3E2UA 2RK1A 2RJFA 2RJEA 5GAOn 2CUBA 1Y96A 1W4SA 5CQXA 4M75A 1UJ0A 1YI2Q 2ZZDA 3C94A 3V7CA 1M1GA 2LJ1A 4FIBA 5GAOm 4Z88A 1VYVA 2O01E 1KD1R 3V7RA 3E19A 4ZNXA 1TUCA 3EG9B 4NL2A 2K79A 5GJVB 2LQWA 4M4ZA 1X43A 1OX9A 2B86A 3S6WA 1BYMA 1UFFA 2CP6A 4M77B 4EMHA 2DL4A 1VA7A 2ZPHB 4DOVA 4LDYA 1ZSZB 3LH0A 3TREA 4C92A 5A0LA 4E7ZA 1CKBA 2RJCA 2C0IA 2BZ8A 2DL8A 2PQWA 1KC8R 3QUIA 3LWHA 2DXTA 2AT1B 3L2VA 1MMAA 4HVUA 3FB9A 3JRZA 2YUPA 2X4WA 2A37A 2LVMA 3U23A 1QLYA 2AZSA 2Y4XA 4M75D 1OU8A 2LTOA 4WTOB 4LE9A 4M7DA 4F7UB 3CMAQ 1B34B 3CC7Q 5GAN5 5J39A 1YIJA 2NUZA 3OBWA 2DXCA 3DKMA 1YI2A 3X24B 1Y07A 5I2MA 1OPKA 1WHHA 2KROA 1XNIA 3EHRA 2F5KA 1LPLA 1Y57A 2FVUA 1AZGB 2CS7A 1WQ7A 2V8IA 3OYEA 1J3TA 1VQOQ 2M16A 5KYXA 1G8XA 1QCOA 1KJWA 2DF6A 4JUVA 3G1JA 1ZA2B 4C92D 3EGXB 2DVJA 4XAXB 2P0PA 2D1XA 4EMKA 3TCJA 3OY9A 4CC4B 1PWTA 1QW1A 2GCXA 2H3JA 2KT1A 3EFSA 2YLCA 2E1HA 1NBEB 1S72Q 1VQ6Q 1SF9A 3GPLA 4E7LA 1M3AA 2HEQA 2DILA 5LJ3h 1BK2A 1Q86R 2FYKA 1E6HA 5IN1A 2X9HA 3G6EA 1QCNA 2NUTA 1LJOA 2DKGA 2KR3A 4C5IA 4KULA 5FU7B 2CUDA 3EG9A 1M1KC 1VQNA 1I8FA 2LZ6B 1UTIA 4LDUA 3JB9G 1RUWA 1VYTA 4BDZA 2X3WD 2CP2A 3CQTA 3JCMg 2KRNA 2YSQA 2V8KA 3M4YA 3MO8A 3VS2A 3I35A 1NLOC 2ZAEA 3OYMA 3CMEA 2EYZA 4EIKA 1B3QA 2EQIA 3GF5A 4MZTA 4JJDA 1BI0A 5DLOA 2DTIA 5LJ5d 3MEWA 3MEVA 3WVDB 1VQ9Q 4M7AE 2PTKA 2HQXA 3UPUA 3JCMb 4IUQA 3PFSA 1H8KA 1MNDA 1SHGA 1WXBA 3RKXA 4J5YA 3VYHB 2VKNA 3M0SA 3PTAA 4FW1A 3EFOB 1D0ZA 3H41A 3LGLA 3CCLQ 5GAN3 3PMIA 4CI0C 4TVRA 2DL3A 1S1NA 2ZPIB 5LJ5f 4FW2A 2P84A 3OYHA 5C0MA 1NM7A 1ARKA 1VIEA 3SWNC 5LJ3d 2RHIA 2COWA 2JN0A 2XIDA 4M78C 1Y0MA 3A98A 5IHNA 2KSSA 3UA6A 1AWOA 3FDRA 1WJQA 1T3LA 3EH1A 1NYGA 4QVZA 1QVGA 2O88A 1JU5C 1KFZA 2GF7A 4HT9A 4ZTFA 2MOXA 4PJJA 2L3QA 2ED0A 1UEBA 2MF2A 2XICA 1PRLC 3LWIA 3FRNA 3NMZC 3MP1A 1VQ4A 1D09B 1W6XA 3QSUA 4KGVB 4M7DD 4C8QA 3IQLA 4OMNA 2M02A 5HK3A 1D1CA 2YT6A 1WFWA 2LC4A 4MDXA 4QVCA 1R0BG 2AKLA 4PJMA 1GRIA 3JCMd 2DK3A 3OYBA 4C8QE 3QG1A 2CYZB 4ZN3A 1YITA 3H0IA 2E6ZA 4L6V5 2ESWA 5CK9A 2Y4YA 4XK8E 5KE3A 3META 3JCMc 4L5GA 4IUVA 1UE9A 1WJSA 2OI3A 2DERA 4BY6B 3QDRB 5CAIA 3M0RA 3EFOA 1HXDA 2QQRA 2YRVA 3RDVA 5I22A 3OSVA 4XU3A 2BE9B 4M78A 2QQ9A 3D7SB 3EG1A 3ER0A 1VQ4T 2X4XA 4KH0B 2P4TA 3KUFA 2JMAA 2QEXQ 5IT9E 2MYSA 2VWFA 2X4JA 4FSXA 4NOYA 5GANh 2RQVA 3T9NA 1YN8A 3MHXA 1PKTA 4PJNA 1Q95G 4L59A 3OS5A 4AFUC 4RUGA 2J06A 2LCCA 1Y71A 5GANf 1KD1U 4FT4A 3JCMP 1K9MC 3JB9F 4M78E 1ZUUA 4PJOF 2IPOB 2VYTA 1EX4A 1BIAA 1VYUA 2EJGA 4RTXA 3TEEA 3A8OB 3CCSQ 2KYMA 4F14A 5KYYB 3MP8A 4C0GA 2DLPA 3JCMf 2XDBA 3HRUA 2IVWA 2DX1A 2JXBA 3CCEQ 3JSCA 2P0QA 2EAYA 2DE0X 1JQQA 2FHDA 3O8VA 1WIEA 1QWEA 1KK7A 1M1KU 5DY9A 1KG1A 1RAIB 1RLQC 4AFZC 2JUFA 4J8OA 4A63B 1GCQA 4PFOA 5KYUB 2DL5A 2CH4W 2C0TA 3HKSA 1TH7A 3OS2A 3I9QA 4XTUA 5LJ5h 2HNIA 1KIKA 2F2WA 2DL7A 1M8MA 3H6ZA 2Z0WA 1R0CB 1VQNT 4OMPA 2QTVA 3OYKA 4N4GA 2DRKA 2MIOA 3CXCA 1B7TA 3LGFA 4X34A 2I2LA 2AHJB 5J3BA 4HKEA 3QXEB 2LNVA 2MAMA 2KBTA 4M7DB 4AG1C 4RTZA 5GAMh 2XI9A 5CKBA 4D8KA 5GMKi 4LDWA 4RG8A 2WSFE 3CCQQ 3CD6A 1OV3A 4XTVA 2QTXA 2AKKA 1KQSA 3OYIA 2M1HA 1V76A 2JTEA 1YJNT 2DEUA 2QYZA 3C0CA 1QCFA 1UGQB 5IXFA 2P0KA 4AFSC 1WDXA 2OJ2A 4C8QB 3RBBB 5J26A 2K5FA 4OGCA 5CQYA 3X20B 1G3TA 4E2FB 4BE1A 3QJYA 1GCQC 4YTLA 4PLIA 1RAGB 2HKNA 1HJDA 2RB6A 1X75C 1Q81C 3RUXA 3A8HB 4J9CA 3HPWA 4PJOB 1K1ZA 1YI2T 2EJ9A 3CCMQ 1A0NB 3SFMA 3CPWP 1N9SA 2D8HA 2F5TX 1YIJT 3VKIA 1JXMA 1K0XA 2KE9A 2X4YA 4RCCA 4OGEA 4BE0A 1GCPA 3DLMA 4HA8A 9ATCB 1YJNA 2CH4A 3A8LB 3SDZA 1WX6A 2L2PA 1U1SA 2K2MA 2YUQA 2NUTB 4PFPA 1X2KA 2EKOA 1NPRA 3RIRA 3ZFJA 4C8QG 2QI2A 1ZBXA 5GAOr 4MMLA 3FIFA 2H3EB 2RI2A 3EGUA 4RTTA 5GAOl 3OS0A 1UG1A 1IXDA 2HL5C 1VQKQ 3WVEB 4N4HA 1U8RA 4XTWA 2RHXA 2EVRA 2HCKA 1ZSGA 2C0OA 1RI0A 2XU8A 2NUPB 2CT4A 2RN8A 4XU0A 2IG0A 1C1AA 2JS0A 4C92G 1M90R 4ATOA 3OYLA 4M75E 5LJ5g 2K9GA 1BCMA 1JEGA 1QVPA 2ZPGB 1CSKA 2E12A 3OYGA 1UGPB 1JO8A 3A8MB 1Y96B 3TVTA 3HFNA 3RNJA 2DA9A 2K5LA 2FPEA 3DB3A 4PJOC 3THKA 3BY7A 4RKUE 1YJNQ 3JCMX 4RG2A 3UF4A 5CIUA 3PVLA 5FRNA 3VUBA 2VB6A 4F7UF 4BE2A 5FU7C 3NGPA 4XTXA 3VS6A 1YIJQ 3E9GA 4J9FA 1M2VB 1WJRA 2GBQA 2E3IA 1LNXA 3EGDA 2VGNA 4A53A 4FCYA 3BE3A 2B8AA 5CKEA 4LXCA 3P8BB 2DBMA 4J6WA 2ATCB 3RR6A 1OU9A 3JAME 1ZHIA 3M57A 4PFZA 1NJIU 4PJOA 1ABQA 2K57A 2EYXA 1MV3A 2BTTA 2LQ8A 4IUPA 4O5VA 2YLBA 3GNGA 4K11A 2MWOA 1ABOA 5GAMe 1FX7A 4M7DC 3CC7T 2KRMA 3EFRA 4BD3A 4M7AF 1W2BP 1AOJA 5FWBA 2NUPA 4KUDK 3QWXX 2DPPB 5LJ3j 1D0XA 1AHJB 2A7YA 1NPPA 3G4SQ 3I56T 4DQ2A 5IAYA 4PJOG 3CCJQ 3QBYA 1N8RR 5GANd 3RERA 1B34A 4A4GA 4KT0E 1W70A 1YWPA 4FU6A 1R77A 1RL2A 2LQNA 2QA4T 4XTYA 4FYYB 2DJQA 3GP8A 3MPUB 5GANg 1K8AU 3RMQA 3BDLA 2OTJT 4ORZA 1K0SA 1MV0B 1HK9A 1ZQ1A 4OMFB 1JJ2S 4M7AA 1O9SA 2RI3A 1AWWA 4HCCA 3H9NA 2LQKA 2COYA 1QMCA 3R6OA 1SSFA 3UDCA 5IXBA 4N0AC 4IURA 4A54A 2ROTA 2EYWA 2KXCA 3LX7A 2LX7A 1YHQA 3CBOA 3OYDA 1M1KR 5KCOA 1I81A 2K3YA 2RM4A 2CP3A 4CC2A 4LDXA 1Q81U 4GLMA 1RLPC 2JTFA 2O9SA 4EMKC 1CKAA 4M7DG 2YXYA 2MCNA 3UWNA 2HQEA 3KBGA 2RQUA 3VS1A 1RADB 2DXUA 1OOTA 3GLXA 2HQHA 1X2QA 2O4XB 2E3HA 4WCIA 1GFDA 3C95A 1W2BS 3OBYA 1GBQA 3PGGA 4ESRA 1KD1C 1BB9A 3CCQT 4BI4A 4DBRA 1SKUB 4FM4B 3G71Q 1IHWA 2LX9A 1D3BB 1WHKA 4OB0B 1VOMA 4GY5A 2BKDN 1MMDA 2JT4A 1V29B 2CP7A 2DZCA 4JS4A 2EGAA 1KQ2A 4GLKA 4C0DC 2HAXA 2E4HA 2I0NA 5I11A 3CXCS 2RMOA 4B9XA 1JXOA 3CCUA 3CCMT 2AK5A 4D8DA 1Z9QA 3PT9A 4QKUA 2RI5A 3CCRA 2FZGB 1ACMB 2VV5A 3VS5A 3CMET 5FU6C 3FLGA 2O9VA 2RHZA 1VQPT 2KYBA 1SRMA 5GMKm 1UGRB 2KNBB 2AIRB 1D0YA 3CCVQ 5IH2A 4Z02A 2QDYB 3I55A 2RO0A 4BUGA 4RTVA 1LCKA 4FYXB 2D9TA 2OAUA 3M56A 4E7SA 2EKHA 3FC3A 2XHCA 4OMLA 1TS9A 6AT1B 1I07A 2LT1A 1Q7YU 3CCET 1WHJA 3CD6Q 2RD1A 1JB0E 3M53A 4PNOA 2VC8A 2XDDA 4M75G 1TG0A 1YCYA 2NYSA 2OTJQ 5CO7A 3WXMB 3CPWA 5I2SA 8AT1B 3G6ET 4JRQA 2RA2A 5LJ5j 2DNUA 1OPLA 2BZYA 1M2OA 1VQOT 2DIQA 3INZA 3GOXA 3S3MA 4A4HA 4C92B 2QXFA 3QWYA 1WNLA 1QKWA 3AT1B 1WZOA 1PC0A 2YWWA 2XDPA 3ASKA 4JJCA 4QW2A 1N9RA 4FSSA 2RF0A 2LCSA 3CC4A 1GFCA 1BKBA 5L23A 4LUDA 3HTRA 1M3BA 2K4YA 2JNGA 3CCVA 4ZN1A 4AT1B 2O4XA 4FL6A 1NEGA 2CZ6B 3L2QA 1IHVA 4JRIA 3G7ZA 4C8QC 4F16A 2PU9B 4J9HA 4M75B 4OVAA 2CP0A 1UB4A 1X6BA 1BI3A 3X25B 1M90U 4JDSA 3I5RA 2KQWA 3H8ZA 4M7AC 4EDUA 4GBQA 3G71A 4DBFA 2G6FX 5M9OA 1ZA1B 2JM9A 3A8GB 1X6GA 2JW4A 1RI9A 2F69A 3EG0A 3M0UA 2PUKB 2M9UA 1M5Q1 1FMVA 2YHTA 1WHGA 1C6VX 3V8JA 5KH6A 4JPBW 4EPCA 1M2VA 4RCBA 2D6FA 2L3RA 2DTHA 3CEYA 4M77D 1VQMA 3CCJA 2GFUA 1AZEA 2PUOB 5EG2A 1ZX6A 5CCAA 5HK0A 3M9QA 3SEMA 2JTMA 2EGEA 3NPFA 1D1BA 2LMJA 4Y92A 2DMOA 3TU4K 1ZLMA 1SRLA 2QEXA 2DYBA 1P92A 5KCHA 4E47A 5GMKe 2E6NA 3L2ZA 3RESA 2DJZA 2FB7A 2RJDA 1Z9ZA 1ZBJA 2LJ3A 2CSQA 1WPYA 2FRYA 3RMSA 1UGVA 3GBQA 4Z89A 1X01A 3OS1A 3DB4A 1AT1B 2OTLT 1PG5B 4NL3A 4KBMB 1NJIR 4ELYC 3M5AA 2GGRA 5GAMf 1H641 3VU3C 1TTHB 2HSEB 3V8KA 5GAMg 2DYIA 2JJ9A 3SWNA 4M7AG 4OMQA 2WSEE 3RKWA 2RQRA 2BZXA 1I5OB 1W2BA 4PJOD 4JZ3A 1VQKT 3E9FA 5AT1B 1I4K1 1PKSA 2F1LA 1IZ6A 1UECA 4QQGA 4CC7A 2K5IA 1G2BA 4Q5WA 5HY6A 3CMEQ 2KDSA 4PJLA 4C8QF 1M3CA 3QIIA 2ABLA 3OQ5A 1M30A 4HCBA 2A36A 1N8RU 2ZPBB 2P4RA 1M1FA 2C06A 2QG9B 1AWXA 2D0NA 4M75C 3CC2A 1WXTA 1K8AR 4D6WA 2EYQA 4MDWA 2JMCA 3L2UA 4OB1B 3G4ST 2R57A 1PHTA 4NS5A 3OYNA 1MMGA 4QQDA 3HP9A 2V1RA 1WA7A 4ZGEB 2K3BA 4Y28E 3O5ZA
chains in the Genus database with same CATH topology
2LZ6B 1UTIA 3NGPA 2GQIA 1RUWA 3VS6A 2FO0A 1VYTA 4J9FA 2GBQA 2V1QA 2X3WD 1AD5A 3CQTA 3REBB 3REAB 1GBRA 2KRNA 2YSQA 1MUZA 2RNAA 3VS2A 1H92A 1BU1A 3I35A 1UUEA 1NLOC 4R0KA 1PRMC 2DBMA 2EYZA 1X27A 1G83A 4EIKA 2M51A 1B3QA 2EQIA 1E7OA 1NYFA 4JJDA 3KFVA 2L0AA 2SEMA 1YNZA 3FJ5A 4KRTA 1FMKA 2E5KA 2PTKA 5FWCA 1ABQA 1PNJA 3JV3A 2EYXA 1H8KA 1SHGA 1MV3A 2BTTA 4JZ4A 1WXBA 2VKNA 3M0SA 4K11A 1ABOA 3M0TA 3H41A 4LUEA 2FPDA 1B07A 2KRMA 2DL3A 1AOJA 5FWBA 1S1NA 3QWXX 1NM7A 1ARKA 1V1CA 4J9DA 3TSWA 1T0JA 1HD3A 1Y0MA 3A98A 5IHNA 3UA6A 4OMOA 2K6DA 1AWOA 1XOVA 3H0FA 3UATA 2W0ZA 1YP5A 3PE0A 1T3LA 2CSIA 1YWOA 1TUDA 1NYGA 2X3XD 5FW9A 2O88A 1W70A 1JU5C 1YWPA 2LQNA 1KFZA 5HCKA 2FEIA 1QKXA 2MOXA 3PVQA 2KT8A 2DJQA 2L3QA 3EHQA 2ED0A 3SHWA 1U5SA 4ORZA 5EC7A 2L3SA 3VRYA 1MV0B 1K0SA 1PRLC 1SEMA 3NMZC 4RTUA 3R6NA 2J6KA 1W6XA 1U3OA 1AWWA 2QDLA 3IQLA 4OMNA 5IXBA 2YT6A 1WFWA 2ROTA 2EYWA 2KXCA 2LNHB 2LX7A 2W10A 2AKLA 5GJWB 1GRIA 2J6OA 4CC2A 1I1JA 1K4US 1EFNA 4GLMA 4HVVA 1RLPC 2O9SA 2KEAA 3H0IA 2GNCA 1CKAA 2ESWA 2MCNA 2ROLA 3VS7A 4OMMA 2RQUA 3VS1A 1OOTA 2ECZA 4X1VA 1X2QA 1UE9A 3ULRB 2OI3A 1AWJA 4WCIA 1GFDA 1UJYA 1GBQA 4ESRA 1WYXA 1BB9A 3M0RA 1GL5A 5I22A 3VS0A 3EG1A 4AG2C 4HVWA 2JMAA 2VWFA 2EGCA 2AZVA 4JJBA 2RQVA 2DM1A 2JT4A 1UHCA 2DRMA 2RPNA 3LH5A 1AEYA 2EGAA 2FG0A 1QWFA 1YN8A 1PKTA 1FYNA 2I0NA 5I11A 2RMOA 4AFUC 4RUGA 1JXOA 2J06A 2AK5A 4RTYA 4D8DA 1Z9QA 4QT7A 2J6FA 2LJ0A 1K9AA 2FRWA 2XMFA 1ZUUA 1U06A 3VS5A 1W1FA 2O9VA 1T3SA 2A28A 2CREA 2KYBA 1K76A 1NLPC 1SRMA 1VYUA 4RTXA 2J05A 2KNBB 2HDAA 3TSZA 5IH2A 1SPKA 1SHFA 2CT3A 2KYMA 2EPDA 2D8JA 4RTVA 1LCKA 4F14A 4J9EA 2YUOA 2EKHA 4OMLA 2DLPA 1I07A 2ENMA 2DX1A 2M0YA 1WI7A 2JXBA 2DE0X 4LNPA 1OEBA 1JQQA 2SRCA 1WIEA 1QWEA 2J7IA 1TG0A 1E6GA 4RTWA 2FPFA 1RLQC 4AFZC 1AVZC 3M0PA 2VVKA 3I5SA 2EBPA 2DBKA 4A63B 1GCQA 1UHFA 2DL5A 2CH4W 2DNUA 1OPLA 2JS2A 2EW3A 2C0TA 2BZYA 2IIMA 4HXJA 4F17A 4HCKA 2EYYA 3I9QA 2HBWA 1H3HA 1KIKA 3QWYA 4LN2A 2F2WA 4Z8AA 2DL7A 1M8MA 1QKWA 1ZUKA 4AFQC 4OMPA 4JJCA 4FSSA 1T0HA 2RF0A 2LCSA 3UA7A 2DRKA 1GFCA 2MIOA 3H0HA 5L23A 4LUDA 1IO6A 2O31A 4J9GA 1M3BA 2A08A 2KBTA 2CUBA 4AG1C 4RTZA 1NEGA 4DEXA 4F16A 4D8KA 4J9HA 1UJ0A 1OV3A 1X6BA 2LJ1A 2KRSA 3I5RA 4GBQA 2H8HA 4Z88A 2G6FX 1VYVA 2OAWA 2JM9A 2JW4A 1X6GA 1RI9A 2AKKA 1NG2A 4ZNXA 4CC3A 1TUCA 3EG0A 3M0UA 2K79A 5GJVB 2LQWA 4M4ZA 2JTEA 3VS3A 1X43A 2B86A 3C0CA 1QCFA 1UFFA 5IXFA 4AFSC 2DL4A 3EG3A 1WDXA 2OJ2A 1VA7A 2KGTA 3RBBB 4JPBW 1AZEA 1CKBA 2C0IA 1ZX6A 2BZ8A 2DL8A 2YDLA 3SEMA 2EGEA 3NPFA 2LMJA 4Y92A 2DMOA 1GCQC 1ZLMA 1HJDA 1SRLA 2PZ1A 2O2OA 4HVUA 3M0QA 2YUPA 2A37A 2DYBA 3U23A 1QLYA 4J9CA 2AZSA 2L3PA 1K1ZA 2GTOA 4LE9A 1A0NB 3VS4A 1Z9ZA 3ZL7C 1M27C 1ZBJA 2D8HA 2CSQA 2FRYA 2LJ3A 5IHIA 1WLPB 1UGVA 1JXMA 3GBQA 4Z89A 1K0XA 2KE9A 2NUZA 5IHKA 1GCPA 3EG2A 2CH4A 1WX6A 2L2PA 1I0CA 2K2MA 2YUQA 1SSHA 4E6RA 1OPKA 1X2KA 2JM8A 2PNIA 4J9BA 2KROA 2F2VA 2GGRA 2RQTA 1YCSB 2NWMA 3EHRA 1Y57A 1AZGB 3EGUA 4OMQA 4RTTA 2RQRA 2BZXA 1HSQA 1UG1A 2HSPA 1J3TA 4JZ3A 2EVRA 1NEBA 2HCKA 1X69A 1ZSGA 5ECAA 1PKSA 2C0OA 2ED1A 1KJWA 2DF6A 4IIOA 1UECA 2CT4A 4CC7A 2DVJA 1BBZA 2K7AA 2RN8A 1G2BA 2D1XA 2JS0A 4CC4B 1PWTA 2KT1A 3NHNA 1M3CA 2K9GA 2ABLA 1JEGA 4IIMA 1M30A 2LP5A 2RQWA 2A36A 1M3AA 1CSKA 1KSWA 1UDLA 2P4RA 2HEQA 1JO8A 2F2XA 2DILA 2GTJA 1BK2A 2CDTA 4DEYA 3TVTA 3RNJA 1AWXA 2DA9A 1E6HA 1ZUYA 2D0NA 1WXTA 2FPEA 3THKA 2KXDA 2JMCA 1N5ZA 4J9IA 3UF4A 1PHTA 2KR3A 3VRZA 1WXUA 2CUDA 2V1RA 3PVLA 1WA7A 2K3BA 3O5ZA 2YUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LZ6 B;  1UTI A;  3NGP A;  2GQI A;  1RUW A;  3VS6 A;  2FO0 A;  1VYT A;  4J9F A;  2GBQ A;  2V1Q A;  2X3W D;  1AD5 A;  3CQT A;  3REB B;  3REA B;  1GBR A;  2KRN A;  2YSQ A;  1MUZ A;  2RNA A;  3VS2 A;  1H92 A;  1BU1 A;  3I35 A;  1UUE A;  1NLO C;  4R0K A;  1PRM C;  2DBM A;  2EYZ A;  1X27 A;  1G83 A;  4EIK A;  2M51 A;  1B3Q A;  2EQI A;  1E7O A;  1NYF A;  4JJD A;  3KFV A;  2L0A A;  2SEM A;  1YNZ A;  3FJ5 A;  4KRT A;  1FMK A;  2E5K A;  2PTK A;  5FWC A;  1ABQ A;  1PNJ A;  3JV3 A;  2EYX A;  1H8K A;  1SHG A;  1MV3 A;  2BTT A;  4JZ4 A;  1WXB A;  2VKN A;  3M0S A;  4K11 A;  1ABO A;  3M0T A;  3H41 A;  4LUE A;  2FPD A;  1B07 A;  2KRM A;  2DL3 A;  1AOJ A;  5FWB A;  1S1N A;  3QWX X;  1NM7 A;  1ARK A;  1V1C A;  4J9D A;  3TSW A;  1T0J A;  1HD3 A;  1Y0M A;  3A98 A;  5IHN A;  3UA6 A;  4OMO A;  2K6D A;  1AWO A;  1XOV A;  3H0F A;  3UAT A;  2W0Z A;  1YP5 A;  3PE0 A;  1T3L A;  2CSI A;  1YWO A;  1TUD A;  1NYG A;  2X3X D;  5FW9 A;  2O88 A;  1W70 A;  1JU5 C;  1YWP A;  2LQN A;  1KFZ A;  5HCK A;  2FEI A;  1QKX A;  2MOX A;  3PVQ A;  2KT8 A;  2DJQ A;  2L3Q A;  3EHQ A;  2ED0 A;  3SHW A;  1U5S A;  4ORZ A;  5EC7 A;  2L3S A;  3VRY A;  1MV0 B;  1K0S A;  1PRL C;  1SEM A;  3NMZ C;  4RTU A;  3R6N A;  2J6K A;  1W6X A;  1U3O A;  1AWW A;  2QDL A;  3IQL A;  4OMN A;  5IXB A;  2YT6 A;  1WFW A;  2ROT A;  2EYW A;  2KXC A;  2LNH B;  2LX7 A;  2W10 A;  2AKL A;  5GJW B;  1GRI A;  2J6O A;  4CC2 A;  1I1J A;  1K4U S;  1EFN A;  4GLM A;  4HVV A;  1RLP C;  2O9S A;  2KEA A;  3H0I A;  2GNC A;  1CKA A;  2ESW A;  2MCN A;  2ROL A;  3VS7 A;  4OMM A;  2RQU A;  3VS1 A;  1OOT A;  2ECZ A;  4X1V A;  1X2Q A;  1UE9 A;  3ULR B;  2OI3 A;  1AWJ A;  4WCI A;  1GFD A;  1UJY A;  1GBQ A;  4ESR A;  1WYX A;  1BB9 A;  3M0R A;  1GL5 A;  5I22 A;  3VS0 A;  3EG1 A;  4AG2 C;  4HVW A;  2JMA A;  2VWF A;  2EGC A;  2AZV A;  4JJB A;  2RQV A;  2DM1 A;  2JT4 A;  1UHC A;  2DRM A;  2RPN A;  3LH5 A;  1AEY A;  2EGA A;  2FG0 A;  1QWF A;  1YN8 A;  1PKT A;  1FYN A;  2I0N A;  5I11 A;  2RMO A;  4AFU C;  4RUG A;  1JXO A;  2J06 A;  2AK5 A;  4RTY A;  4D8D A;  1Z9Q A;  4QT7 A;  2J6F A;  2LJ0 A;  1K9A A;  2FRW A;  2XMF A;  1ZUU A;  1U06 A;  3VS5 A;  1W1F A;  2O9V A;  1T3S A;  2A28 A;  2CRE A;  2KYB A;  1K76 A;  1NLP C;  1SRM A;  1VYU A;  4RTX A;  2J05 A;  2KNB B;  2HDA A;  3TSZ A;  5IH2 A;  1SPK A;  1SHF A;  2CT3 A;  2KYM A;  2EPD A;  2D8J A;  4RTV A;  1LCK A;  4F14 A;  4J9E A;  2YUO A;  2EKH A;  4OML A;  2DLP A;  1I07 A;  2ENM A;  2DX1 A;  2M0Y A;  1WI7 A;  2JXB A;  2DE0 X;  4LNP A;  1OEB A;  1JQQ A;  2SRC A;  1WIE A;  1QWE A;  2J7I A;  1TG0 A;  1E6G A;  4RTW A;  2FPF A;  1RLQ C;  4AFZ C;  1AVZ C;  3M0P A;  2VVK A;  3I5S A;  2EBP A;  2DBK A;  4A63 B;  1GCQ A;  1UHF A;  2DL5 A;  2CH4 W;  2DNU A;  1OPL A;  2JS2 A;  2EW3 A;  2C0T A;  2BZY A;  2IIM A;  4HXJ A;  4F17 A;  4HCK A;  2EYY A;  3I9Q A;  2HBW A;  1H3H A;  1KIK A;  3QWY A;  4LN2 A;  2F2W A;  4Z8A A;  2DL7 A;  1M8M A;  1QKW A;  1ZUK A;  4AFQ C;  4OMP A;  4JJC A;  4FSS A;  1T0H A;  2RF0 A;  2LCS A;  3UA7 A;  2DRK A;  1GFC A;  2MIO A;  3H0H A;  5L23 A;  4LUD A;  1IO6 A;  2O31 A;  4J9G A;  1M3B A;  2A08 A;  2KBT A;  2CUB A;  4AG1 C;  4RTZ A;  1NEG A;  4DEX A;  4F16 A;  4D8K A;  4J9H A;  1UJ0 A;  1OV3 A;  1X6B A;  2LJ1 A;  2KRS A;  3I5R A;  4GBQ A;  2H8H A;  4Z88 A;  2G6F X;  1VYV A;  2OAW A;  2JM9 A;  2JW4 A;  1X6G A;  1RI9 A;  2AKK A;  1NG2 A;  4ZNX A;  4CC3 A;  1TUC A;  3EG0 A;  3M0U A;  2K79 A;  5GJV B;  2LQW A;  4M4Z A;  2JTE A;  3VS3 A;  1X43 A;  2B86 A;  3C0C A;  1QCF A;  1UFF A;  5IXF A;  4AFS C;  2DL4 A;  3EG3 A;  1WDX A;  2OJ2 A;  1VA7 A;  2KGT A;  3RBB B;  4JPB W;  1AZE A;  1CKB A;  2C0I A;  1ZX6 A;  2BZ8 A;  2DL8 A;  2YDL A;  3SEM A;  2EGE A;  3NPF A;  2LMJ A;  4Y92 A;  2DMO A;  1GCQ C;  1ZLM A;  1HJD A;  1SRL A;  2PZ1 A;  2O2O A;  4HVU A;  3M0Q A;  2YUP A;  2A37 A;  2DYB A;  3U23 A;  1QLY A;  4J9C A;  2AZS A;  2L3P A;  1K1Z A;  2GTO A;  4LE9 A;  1A0N B;  3VS4 A;  1Z9Z A;  3ZL7 C;  1M27 C;  1ZBJ A;  2D8H A;  2CSQ A;  2FRY A;  2LJ3 A;  5IHI A;  1WLP B;  1UGV A;  1JXM A;  3GBQ A;  4Z89 A;  1K0X A;  2KE9 A;  2NUZ A;  5IHK A;  1GCP A;  3EG2 A;  2CH4 A;  1WX6 A;  2L2P A;  1I0C A;  2K2M A;  2YUQ A;  1SSH A;  4E6R A;  1OPK A;  1X2K A;  2JM8 A;  2PNI A;  4J9B A;  2KRO A;  2F2V A;  2GGR A;  2RQT A;  1YCS B;  2NWM A;  3EHR A;  1Y57 A;  1AZG B;  3EGU A;  4OMQ A;  4RTT A;  2RQR A;  2BZX A;  1HSQ A;  1UG1 A;  2HSP A;  1J3T A;  4JZ3 A;  2EVR A;  1NEB A;  2HCK A;  1X69 A;  1ZSG A;  5ECA A;  1PKS A;  2C0O A;  2ED1 A;  1KJW A;  2DF6 A;  4IIO A;  1UEC A;  2CT4 A;  4CC7 A;  2DVJ A;  1BBZ A;  2K7A A;  2RN8 A;  1G2B A;  2D1X A;  2JS0 A;  4CC4 B;  1PWT A;  2KT1 A;  3NHN A;  1M3C A;  2K9G A;  2ABL A;  1JEG A;  4IIM A;  1M30 A;  2LP5 A;  2RQW A;  2A36 A;  1M3A A;  1CSK A;  1KSW A;  1UDL A;  2P4R A;  2HEQ A;  1JO8 A;  2F2X A;  2DIL A;  2GTJ A;  1BK2 A;  2CDT A;  4DEY A;  3TVT A;  3RNJ A;  1AWX A;  2DA9 A;  1E6H A;  1ZUY A;  2D0N A;  1WXT A;  2FPE A;  3THK A;  2KXD A;  2JMC A;  1N5Z A;  4J9I A;  3UF4 A;  1PHT A;  2KR3 A;  3VRZ A;  1WXU A;  2CUD A;  2V1R A;  3PVL A;  1WA7 A;  2K3B A;  3O5Z A;  2YUN A; 
#chains in the Genus database with same CATH topology
 2GQI A;  4E7H A;  1IGU A;  4C5H A;  3CMA T;  1ZSZ C;  2FO0 A;  4HCZ A;  4LD9 K;  3QZ5 B;  1AD5 A;  2DET A;  3REB B;  1Y7X A;  5FRM A;  3REA B;  4C92 C;  1MUZ A;  3C4S A;  2EQJ A;  2VXF A;  1Q81 R;  1UUE A;  4MMK A;  2KMT A;  1JJ2 A;  1PRM C;  1QQJ A;  1X27 A;  1NYF A;  1TSF A;  3FJ5 A;  4KRT A;  4M77 G;  1VQ9 A;  1QVG P;  1VQL A;  7AT1 B;  3JV3 A;  5LJ3 f;  4CRI A;  3EAE A;  4A4K A;  4JZ4 A;  4O6J A;  1BI2 A;  2R5A A;  3M0T A;  4LUE A;  2FPD A;  3CC2 Q;  1B07 A;  1IB8 A;  1K8A C;  4PKC C;  1YJW T;  3OYA A;  1V1C A;  5CR2 A;  4XU2 A;  1X6O A;  2DTO A;  3FJP A;  5GAM j;  3TSW A;  1PD0 A;  1T0J A;  3OMG A;  1HD3 A;  3QZ9 B;  4DA4 A;  1N27 A;  2K6D A;  2DFU A;  2ZPF B;  1XOV A;  3H0F A;  3V7S A;  4B6M A;  2EQU A;  2W0Z A;  3PE0 A;  4KH1 B;  3G71 T;  2CSI A;  1YWO A;  1WHM A;  3GIB A;  1TUD A;  1IRE B;  4J7F A;  5FW9 A;  3S3O A;  2XD0 A;  2EQM A;  4M7A D;  4XU1 A;  4B9W A;  1XJW B;  3RKY A;  3PIO A;  4M78 B;  3E1S A;  3VUZ A;  5GAN 4;  4C8Q D;  3M58 A;  1S72 A;  1VQ6 A;  4QQ6 A;  3NTK A;  5EC7 A;  2L3S A;  3VRY A;  3CCS A;  3L2W A;  1YJ9 Q;  1HYO A;  3JCM h;  4ZTJ A;  3L2R A;  2GQV A;  4X9C A;  5GAO q;  1IGQ A;  3R6N A;  1OUL A;  1U3O A;  1MGQ A;  1BI1 A;  1Q7Y R;  4M77 E;  4R55 A;  3JB9 H;  4ZGD B;  3JCM J;  5GJW B;  3OW2 S;  1VQ7 A;  3CPW S;  2PVG B;  4M78 G;  2J6O A;  4DOW A;  4A4F A;  1QVG S;  1K73 U;  1K4U S;  4HVV A;  2BIV A;  2KEA A;  2KI7 A;  2COZ A;  3M55 A;  3MEU A;  4C92 E;  3QYG B;  4OMM A;  5CKF A;  1VQ7 T;  3QO3 A;  3JCM e;  2ECZ A;  3HRT A;  2MWP A;  2BUD A;  1WYX A;  2QAZ A;  1JJ2 P;  4C0D B;  2E5Q A;  4HT8 A;  3X28 B;  1KQ1 A;  2K2V A;  3QPH A;  3G6E Q;  5LL6 S;  3I56 Q;  2KAF A;  3FEO A;  4JJB A;  1U1T A;  2DM1 A;  1G3W A;  1AEY A;  1UHC A;  2RPN A;  3LH5 A;  1VQ4 Q;  4ANJ A;  1QWF A;  2DO3 A;  4FYW B;  5C6S A;  1IRX A;  1FYN A;  3LYI A;  2LCL A;  1TUG B;  2V8J A;  2LJ0 A;  5CKD A;  1K9A A;  3CCU T;  2MMP A;  3S3N A;  1VQM Q;  2PVO B;  3QYH B;  4ZGJ B;  5I21 A;  1W1F A;  3P8H A;  1T3S A;  2CRE A;  1K76 A;  2LT4 A;  1VQP Q;  1PM3 A;  3ME9 A;  2HDA A;  4LD6 A;  1SHF A;  1VQ8 T;  5A0D A;  2ZCF B;  3DLL A;  4M77 F;  5FRO A;  2M0Y A;  1M8V A;  1OEB A;  2DXB A;  3A1P A;  2XK0 A;  3L42 A;  2L8D A;  2A3L A;  3OYJ A;  1K9M U;  2CKK A;  2EIF A;  3URG A;  1AVZ C;  3M0P A;  1GXI E;  2VVK A;  3I5S A;  2EBP A;  2DBK A;  5GAN 8;  4PJO E;  2XKO C;  5GAN 7;  2DEQ A;  1QP3 A;  2JS2 A;  4UC4 A;  2IIM A;  2EJF A;  2CP5 A;  1D1A A;  4HXJ A;  4F17 A;  3OYF A;  1Q82 U;  5CKH A;  1VQ8 Q;  2EYY A;  1M90 C;  1KQS P;  1K73 C;  3NTH A;  5GMK j;  4Z8A A;  1ZUK A;  1VQ5 T;  2E41 A;  2HZY A;  5GAN e;  1FWZ A;  1RAH B;  1RAF B;  2O31 A;  4J9G A;  2EWN A;  3CCL T;  4IKF A;  4E7K A;  5D6W A;  1EIF A;  5KYY A;  4N0A A;  2G3R A;  1VUB A;  4DEX A;  2E70 A;  3L1A A;  2RHU A;  4ME7 A;  2E10 A;  2KRS A;  3JB9 J;  2MI6 A;  4PL6 A;  3CPF A;  3M54 A;  2H8H A;  2CGH A;  3LLR A;  2M0O A;  5L8R E;  2ZPE B;  2OAW A;  1D3B A;  3OMC A;  1VQ9 T;  1YJ9 A;  4CC3 A;  1NG2 A;  4F7U E;  4M7A B;  4FT2 A;  3VS3 A;  1VQN Q;  1WQW A;  2D0Q B;  3EG3 A;  5GMK h;  2QA4 Q;  2KY9 A;  2KGT A;  1UGS B;  3VV0 A;  1VQK A;  1ZSZ A;  2DAQ A;  1VQ7 Q;  3N5B B;  4F04 B;  4C0F A;  3CC7 A;  2YDL A;  1WHL A;  2DD5 A;  1YBY A;  3HHT B;  3NFC A;  4N4I A;  4EMG A;  8ATC B;  3OW2 A;  2PZ1 A;  2O2O A;  1I5L A;  3M0Q A;  2GFA A;  3HSB A;  1YJW Q;  1M4Z A;  3TQ7 P;  3G4S A;  2L3P A;  2GTO A;  3MEA A;  3VS4 A;  1BCO A;  3ZL7 C;  2ZGW A;  1M27 C;  5IHI A;  2JZ2 A;  4OB2 B;  3CC2 T;  1WLP B;  4IUT A;  3HFO A;  2FZK B;  1NZ9 A;  5IHK A;  3CBP A;  3SD4 A;  3EG2 A;  1YFN A;  1I0C A;  4VUB A;  1SSH A;  4E6R A;  1YJ9 T;  2JM8 A;  2PNI A;  4J9B A;  2F2V A;  2QEX T;  4OB3 B;  2RQT A;  3BDU A;  4DBH A;  1YCS B;  3CC4 Q;  5DLQ E;  2NWM A;  3OYY A;  3SWN B;  1RAA B;  3OW2 P;  3LW5 E;  4XQ3 A;  1HSQ A;  3I55 Q;  2QGF B;  3CCJ T;  2HSP A;  3V8L A;  1OI1 A;  1NEB A;  1X69 A;  3J80 E;  5ECA A;  3CCL A;  3QJ6 A;  2ED1 A;  4IIO A;  3CXC P;  2FZC B;  3MKD A;  1PD1 A;  1BBZ A;  2K7A A;  4BI3 A;  1RAC B;  2YRC A;  2HD0 A;  2DVE A;  4PLL A;  3NHN A;  5FU6 B;  1VQ5 A;  2VXE A;  4IIM A;  2QK0 A;  2LP5 A;  2OTL A;  2RQW A;  4J83 A;  4KGZ B;  1KSW A;  1UDL A;  2VUB A;  5KYU A;  3ZBD A;  2F2X A;  2GTJ A;  2CDT A;  4DEY A;  3AHU A;  4F7U A;  1RAB B;  5HKC A;  1ZUY A;  3KXT A;  4MZM A;  4BAC A;  3BFM A;  4JS5 A;  2VAS A;  5A0G A;  1DJ7 B;  2KXD A;  2NLU A;  3CCV T;  2OX7 A;  1N5Z A;  4J9I A;  4LDV A;  5D6X A;  3VRZ A;  1WXU A;  1KC8 U;  4QVD A;  5GAN 6;  2YUN A;  1PSF A;  2A0F B;  3OSS C;  4M78 F;  2OTL Q;  1QVF A;  4ELZ C;  1VQ8 A;  2V1Q A;  3CCU Q;  1VQM T;  1OQK A;  1VQO A;  1GBR A;  2BE7 D;  2RNA A;  3JB9 D;  3A5Z B;  1H92 A;  1K73 R;  1BU1 A;  4BDY A;  1F1B B;  1OX8 A;  4R0K A;  3PMT A;  4EMK B;  1MMN A;  1G83 A;  3QDF A;  2M51 A;  1E7O A;  2X51 A;  4M7D F;  3KFV A;  2L0A A;  2SEM A;  1LVK A;  1YNZ A;  1FMK A;  3MP6 A;  2E5K A;  5FWC A;  1PNJ A;  3M4G A;  2EFI A;  3X26 B;  1Q82 C;  4JLI A;  3JCM V;  4AMC A;  4JRK A;  1QVF S;  4XTZ A;  2V26 A;  5D6Y A;  4J6X A;  4JRP A;  2Y90 A;  2XG8 D;  1LOJ A;  2R5M A;  5KYN A;  4E7J A;  4PK4 A;  2LRQ A;  3C12 A;  4C5E A;  4J9D A;  4C92 F;  2KVQ G;  2X35 A;  2QAS A;  3CC4 T;  2EQK A;  4OMO A;  1KQS S;  3Q1J A;  3UAT A;  1YP5 A;  3CCM A;  3EGD B;  1NJI C;  2X3X D;  3NTI A;  3JCM W;  1TU0 B;  5KE2 A;  3CD6 T;  3HL8 A;  1OZ3 A;  2HL3 A;  1M9S A;  4KGX B;  1Q86 U;  4II1 A;  4X9D A;  5HCK A;  1QKX A;  2FEI A;  3OA6 A;  2WAC A;  3PVQ A;  2KT8 A;  5GAN 2;  3UT1 A;  2DZ9 A;  5GAO p;  3EHQ A;  2PVD B;  3SHW A;  1U5S A;  1EZZ B;  4J7I A;  4A4E A;  1VQ5 Q;  3PNW C;  2KK4 A;  2L5Q A;  4F7U G;  2DD4 A;  1SEM A;  1KHC A;  4J6Y A;  4JLG A;  4RTU A;  2J6K A;  4OF1 A;  2QQB A;  1OYX A;  3CBM A;  1G3Y A;  2QDL A;  4MZP A;  4BB7 A;  4FYV B;  1O75 A;  3CCE A;  2HMA A;  2MPX C;  4M78 D;  3VJP A;  3JCM Q;  3J81 E;  1OZ2 A;  2LNH B;  2W10 A;  3I55 T;  3CCS T;  1K9M R;  2CZ0 B;  3CCR Q;  4M75 F;  1S72 T;  4M77 C;  2E65 A;  1Q86 C;  1VQ6 T;  5AYF A;  1I1J A;  1TXQ A;  1EFN A;  2GNC A;  1VQP A;  5LJ3 g;  2FL7 A;  2ROL A;  3VS7 A;  1QVF P;  1Q82 R;  5A2Q E;  3CCR T;  4RMO A;  2WSC E;  1VQL Q;  4X1V A;  1YHQ T;  3JB9 I;  3ULR B;  3J7A F;  1AWJ A;  2CZ1 B;  3M59 A;  2LDM A;  3PIP A;  1UJY A;  1XTD A;  4OP0 A;  2R58 A;  1GL5 A;  2CZ7 B;  3P8D A;  3F70 A;  5LJ3 e;  3VS0 A;  1BIB A;  4AG2 C;  2L89 A;  4HVW A;  1XQH A;  3VYG A;  1YJW A;  2MK5 A;  2K3X A;  4BI8 B;  2EGC A;  2AZV A;  1H3Z A;  2OTJ A;  2VGM A;  2DRM A;  5KYW B;  3GNF B;  2FG0 A;  1N6A A;  2E64 A;  4IUU A;  1Q7Y C;  1SG5 A;  3ZEH A;  5GMK l;  4Y91 A;  4JJN K;  4BY6 C;  3CCQ A;  1TWB A;  1PCX A;  4RTY A;  1VQL T;  4QT7 A;  1YHQ Q;  2J6F A;  2FRW A;  5FLX E;  2XMF A;  4C5G A;  5CVI A;  3BW1 A;  1U06 A;  1PSE A;  3OYC A;  5GAM d;  2QQS A;  2A28 A;  4WF2 A;  3HRS A;  1N8R C;  1NLP C;  1TOV A;  1G5V A;  4E7I A;  2J05 A;  4M77 A;  1MNE A;  2JVV A;  1RAE B;  3TSZ A;  1SPK A;  2CT3 A;  4DBQ A;  5D7U A;  2EPD A;  2D8J A;  3EH2 A;  3MJX A;  3CMA A;  4J9E A;  2YUO A;  4C0Z A;  3QKJ A;  2ENM A;  1WI7 A;  2DIG A;  4LNP A;  4KUI A;  2YRD A;  1R8O B;  2SRC A;  1KC8 C;  1C0M A;  2J7I A;  1FXX A;  4M7D E;  2JOY A;  4P5N A;  1E6G A;  4RTW A;  4R56 A;  2FPF A;  1JRI A;  1FMW A;  1NE8 A;  1WGS A;  5KYW A;  1JBM A;  1UHF A;  2QA4 A;  1KHI A;  1YIT T;  2RHY A;  3QHS A;  2EW3 A;  5GAN j;  1G3S A;  4HCK A;  1VIF A;  3MCA B;  3SB2 A;  5KYX B;  2HBW A;  2QGG A;  3I56 A;  1H3H A;  2HBP A;  4LN2 A;  5LJ5 e;  1YIT Q;  3EGX A;  4AFQ C;  2RH2 A;  5DM7 R;  4V2S A;  1T0H A;  3UA7 A;  1QP2 A;  2RK2 A;  3H0H A;  3OB9 A;  1IO6 A;  1MHN A;  2QQA A;  2A08 A;  2HKQ B;  3E2U A;  2RK1 A;  2RJF A;  2RJE A;  5GAO n;  2CUB A;  1Y96 A;  1W4S A;  5CQX A;  4M75 A;  1UJ0 A;  1YI2 Q;  2ZZD A;  3C94 A;  3V7C A;  1M1G A;  2LJ1 A;  4FIB A;  5GAO m;  4Z88 A;  1VYV A;  2O01 E;  1KD1 R;  3V7R A;  3E19 A;  4ZNX A;  1TUC A;  3EG9 B;  4NL2 A;  2K79 A;  5GJV B;  2LQW A;  4M4Z A;  1X43 A;  1OX9 A;  2B86 A;  3S6W A;  1BYM A;  1UFF A;  2CP6 A;  4M77 B;  4EMH A;  2DL4 A;  1VA7 A;  2ZPH B;  4DOV A;  4LDY A;  1ZSZ B;  3LH0 A;  3TRE A;  4C92 A;  5A0L A;  4E7Z A;  1CKB A;  2RJC A;  2C0I A;  2BZ8 A;  2DL8 A;  2PQW A;  1KC8 R;  3QUI A;  3LWH A;  2DXT A;  2AT1 B;  3L2V A;  1MMA A;  4HVU A;  3FB9 A;  3JRZ A;  2YUP A;  2X4W A;  2A37 A;  2LVM A;  3U23 A;  1QLY A;  2AZS A;  2Y4X A;  4M75 D;  1OU8 A;  2LTO A;  4WTO B;  4LE9 A;  4M7D A;  4F7U B;  3CMA Q;  1B34 B;  3CC7 Q;  5GAN 5;  5J39 A;  1YIJ A;  2NUZ A;  3OBW A;  2DXC A;  3DKM A;  1YI2 A;  3X24 B;  1Y07 A;  5I2M A;  1OPK A;  1WHH A;  2KRO A;  1XNI A;  3EHR A;  2F5K A;  1LPL A;  1Y57 A;  2FVU A;  1AZG B;  2CS7 A;  1WQ7 A;  2V8I A;  3OYE A;  1J3T A;  1VQO Q;  2M16 A;  5KYX A;  1G8X A;  1QCO A;  1KJW A;  2DF6 A;  4JUV A;  3G1J A;  1ZA2 B;  4C92 D;  3EGX B;  2DVJ A;  4XAX B;  2P0P A;  2D1X A;  4EMK A;  3TCJ A;  3OY9 A;  4CC4 B;  1PWT A;  1QW1 A;  2GCX A;  2H3J A;  2KT1 A;  3EFS A;  2YLC A;  2E1H A;  1NBE B;  1S72 Q;  1VQ6 Q;  1SF9 A;  3GPL A;  4E7L A;  1M3A A;  2HEQ A;  2DIL A;  5LJ3 h;  1BK2 A;  1Q86 R;  2FYK A;  1E6H A;  5IN1 A;  2X9H A;  3G6E A;  1QCN A;  2NUT A;  1LJO A;  2DKG A;  2KR3 A;  4C5I A;  4KUL A;  5FU7 B;  2CUD A;  3EG9 A;  1M1K C;  1VQN A;  1I8F A;  2LZ6 B;  1UTI A;  4LDU A;  3JB9 G;  1RUW A;  1VYT A;  4BDZ A;  2X3W D;  2CP2 A;  3CQT A;  3JCM g;  2KRN A;  2YSQ A;  2V8K A;  3M4Y A;  3MO8 A;  3VS2 A;  3I35 A;  1NLO C;  2ZAE A;  3OYM A;  3CME A;  2EYZ A;  4EIK A;  1B3Q A;  2EQI A;  3GF5 A;  4MZT A;  4JJD A;  1BI0 A;  5DLO A;  2DTI A;  5LJ5 d;  3MEW A;  3MEV A;  3WVD B;  1VQ9 Q;  4M7A E;  2PTK A;  2HQX A;  3UPU A;  3JCM b;  4IUQ A;  3PFS A;  1H8K A;  1MND A;  1SHG A;  1WXB A;  3RKX A;  4J5Y A;  3VYH B;  2VKN A;  3M0S A;  3PTA A;  4FW1 A;  3EFO B;  1D0Z A;  3H41 A;  3LGL A;  3CCL Q;  5GAN 3;  3PMI A;  4CI0 C;  4TVR A;  2DL3 A;  1S1N A;  2ZPI B;  5LJ5 f;  4FW2 A;  2P84 A;  3OYH A;  5C0M A;  1NM7 A;  1ARK A;  1VIE A;  3SWN C;  5LJ3 d;  2RHI A;  2COW A;  2JN0 A;  2XID A;  4M78 C;  1Y0M A;  3A98 A;  5IHN A;  2KSS A;  3UA6 A;  1AWO A;  3FDR A;  1WJQ A;  1T3L A;  3EH1 A;  1NYG A;  4QVZ A;  1QVG A;  2O88 A;  1JU5 C;  1KFZ A;  2GF7 A;  4HT9 A;  4ZTF A;  2MOX A;  4PJJ A;  2L3Q A;  2ED0 A;  1UEB A;  2MF2 A;  2XIC A;  1PRL C;  3LWI A;  3FRN A;  3NMZ C;  3MP1 A;  1VQ4 A;  1D09 B;  1W6X A;  3QSU A;  4KGV B;  4M7D D;  4C8Q A;  3IQL A;  4OMN A;  2M02 A;  5HK3 A;  1D1C A;  2YT6 A;  1WFW A;  2LC4 A;  4MDX A;  4QVC A;  1R0B G;  2AKL A;  4PJM A;  1GRI A;  3JCM d;  2DK3 A;  3OYB A;  4C8Q E;  3QG1 A;  2CYZ B;  4ZN3 A;  1YIT A;  3H0I A;  2E6Z A;  4L6V 5;  2ESW A;  5CK9 A;  2Y4Y A;  4XK8 E;  5KE3 A;  3MET A;  3JCM c;  4L5G A;  4IUV A;  1UE9 A;  1WJS A;  2OI3 A;  2DER A;  4BY6 B;  3QDR B;  5CAI A;  3M0R A;  3EFO A;  1HXD A;  2QQR A;  2YRV A;  3RDV A;  5I22 A;  3OSV A;  4XU3 A;  2BE9 B;  4M78 A;  2QQ9 A;  3D7S B;  3EG1 A;  3ER0 A;  1VQ4 T;  2X4X A;  4KH0 B;  2P4T A;  3KUF A;  2JMA A;  2QEX Q;  5IT9 E;  2MYS A;  2VWF A;  2X4J A;  4FSX A;  4NOY A;  5GAN h;  2RQV A;  3T9N A;  1YN8 A;  3MHX A;  1PKT A;  4PJN A;  1Q95 G;  4L59 A;  3OS5 A;  4AFU C;  4RUG A;  2J06 A;  2LCC A;  1Y71 A;  5GAN f;  1KD1 U;  4FT4 A;  3JCM P;  1K9M C;  3JB9 F;  4M78 E;  1ZUU A;  4PJO F;  2IPO B;  2VYT A;  1EX4 A;  1BIA A;  1VYU A;  2EJG A;  4RTX A;  3TEE A;  3A8O B;  3CCS Q;  2KYM A;  4F14 A;  5KYY B;  3MP8 A;  4C0G A;  2DLP A;  3JCM f;  2XDB A;  3HRU A;  2IVW A;  2DX1 A;  2JXB A;  3CCE Q;  3JSC A;  2P0Q A;  2EAY A;  2DE0 X;  1JQQ A;  2FHD A;  3O8V A;  1WIE A;  1QWE A;  1KK7 A;  1M1K U;  5DY9 A;  1KG1 A;  1RAI B;  1RLQ C;  4AFZ C;  2JUF A;  4J8O A;  4A63 B;  1GCQ A;  4PFO A;  5KYU B;  2DL5 A;  2CH4 W;  2C0T A;  3HKS A;  1TH7 A;  3OS2 A;  3I9Q A;  4XTU A;  5LJ5 h;  2HNI A;  1KIK A;  2F2W A;  2DL7 A;  1M8M A;  3H6Z A;  2Z0W A;  1R0C B;  1VQN T;  4OMP A;  2QTV A;  3OYK A;  4N4G A;  2DRK A;  2MIO A;  3CXC A;  1B7T A;  3LGF A;  4X34 A;  2I2L A;  2AHJ B;  5J3B A;  4HKE A;  3QXE B;  2LNV A;  2MAM A;  2KBT A;  4M7D B;  4AG1 C;  4RTZ A;  5GAM h;  2XI9 A;  5CKB A;  4D8K A;  5GMK i;  4LDW A;  4RG8 A;  2WSF E;  3CCQ Q;  3CD6 A;  1OV3 A;  4XTV A;  2QTX A;  2AKK A;  1KQS A;  3OYI A;  2M1H A;  1V76 A;  2JTE A;  1YJN T;  2DEU A;  2QYZ A;  3C0C A;  1QCF A;  1UGQ B;  5IXF A;  2P0K A;  4AFS C;  1WDX A;  2OJ2 A;  4C8Q B;  3RBB B;  5J26 A;  2K5F A;  4OGC A;  5CQY A;  3X20 B;  1G3T A;  4E2F B;  4BE1 A;  3QJY A;  1GCQ C;  4YTL A;  4PLI A;  1RAG B;  2HKN A;  1HJD A;  2RB6 A;  1X75 C;  1Q81 C;  3RUX A;  3A8H B;  4J9C A;  3HPW A;  4PJO B;  1K1Z A;  1YI2 T;  2EJ9 A;  3CCM Q;  1A0N B;  3SFM A;  3CPW P;  1N9S A;  2D8H A;  2F5T X;  1YIJ T;  3VKI A;  1JXM A;  1K0X A;  2KE9 A;  2X4Y A;  4RCC A;  4OGE A;  4BE0 A;  1GCP A;  3DLM A;  4HA8 A;  9ATC B;  1YJN A;  2CH4 A;  3A8L B;  3SDZ A;  1WX6 A;  2L2P A;  1U1S A;  2K2M A;  2YUQ A;  2NUT B;  4PFP A;  1X2K A;  2EKO A;  1NPR A;  3RIR A;  3ZFJ A;  4C8Q G;  2QI2 A;  1ZBX A;  5GAO r;  4MML A;  3FIF A;  2H3E B;  2RI2 A;  3EGU A;  4RTT A;  5GAO l;  3OS0 A;  1UG1 A;  1IXD A;  2HL5 C;  1VQK Q;  3WVE B;  4N4H A;  1U8R A;  4XTW A;  2RHX A;  2EVR A;  2HCK A;  1ZSG A;  2C0O A;  1RI0 A;  2XU8 A;  2NUP B;  2CT4 A;  2RN8 A;  4XU0 A;  2IG0 A;  1C1A A;  2JS0 A;  4C92 G;  1M90 R;  4ATO A;  3OYL A;  4M75 E;  5LJ5 g;  2K9G A;  1BCM A;  1JEG A;  1QVP A;  2ZPG B;  1CSK A;  2E12 A;  3OYG A;  1UGP B;  1JO8 A;  3A8M B;  1Y96 B;  3TVT A;  3HFN A;  3RNJ A;  2DA9 A;  2K5L A;  2FPE A;  3DB3 A;  4PJO C;  3THK A;  3BY7 A;  4RKU E;  1YJN Q;  3JCM X;  4RG2 A;  3UF4 A;  5CIU A;  3PVL A;  5FRN A;  3VUB A;  2VB6 A;  4F7U F;  4BE2 A;  5FU7 C;  3NGP A;  4XTX A;  3VS6 A;  1YIJ Q;  3E9G A;  4J9F A;  1M2V B;  1WJR A;  2GBQ A;  2E3I A;  1LNX A;  3EGD A;  2VGN A;  4A53 A;  4FCY A;  3BE3 A;  2B8A A;  5CKE A;  4LXC A;  3P8B B;  2DBM A;  4J6W A;  2ATC B;  3RR6 A;  1OU9 A;  3JAM E;  1ZHI A;  3M57 A;  4PFZ A;  1NJI U;  4PJO A;  1ABQ A;  2K57 A;  2EYX A;  1MV3 A;  2BTT A;  2LQ8 A;  4IUP A;  4O5V A;  2YLB A;  3GNG A;  4K11 A;  2MWO A;  1ABO A;  5GAM e;  1FX7 A;  4M7D C;  3CC7 T;  2KRM A;  3EFR A;  4BD3 A;  4M7A F;  1W2B P;  1AOJ A;  5FWB A;  2NUP A;  4KUD K;  3QWX X;  2DPP B;  5LJ3 j;  1D0X A;  1AHJ B;  2A7Y A;  1NPP A;  3G4S Q;  3I56 T;  4DQ2 A;  5IAY A;  4PJO G;  3CCJ Q;  3QBY A;  1N8R R;  5GAN d;  3RER A;  1B34 A;  4A4G A;  4KT0 E;  1W70 A;  1YWP A;  4FU6 A;  1R77 A;  1RL2 A;  2LQN A;  2QA4 T;  4XTY A;  4FYY B;  2DJQ A;  3GP8 A;  3MPU B;  5GAN g;  1K8A U;  3RMQ A;  3BDL A;  2OTJ T;  4ORZ A;  1K0S A;  1MV0 B;  1HK9 A;  1ZQ1 A;  4OMF B;  1JJ2 S;  4M7A A;  1O9S A;  2RI3 A;  1AWW A;  4HCC A;  3H9N A;  2LQK A;  2COY A;  1QMC A;  3R6O A;  1SSF A;  3UDC A;  5IXB A;  4N0A C;  4IUR A;  4A54 A;  2ROT A;  2EYW A;  2KXC A;  3LX7 A;  2LX7 A;  1YHQ A;  3CBO A;  3OYD A;  1M1K R;  5KCO A;  1I81 A;  2K3Y A;  2RM4 A;  2CP3 A;  4CC2 A;  4LDX A;  1Q81 U;  4GLM A;  1RLP C;  2JTF A;  2O9S A;  4EMK C;  1CKA A;  4M7D G;  2YXY A;  2MCN A;  3UWN A;  2HQE A;  3KBG A;  2RQU A;  3VS1 A;  1RAD B;  2DXU A;  1OOT A;  3GLX A;  2HQH A;  1X2Q A;  2O4X B;  2E3H A;  4WCI A;  1GFD A;  3C95 A;  1W2B S;  3OBY A;  1GBQ A;  3PGG A;  4ESR A;  1KD1 C;  1BB9 A;  3CCQ T;  4BI4 A;  4DBR A;  1SKU B;  4FM4 B;  3G71 Q;  1IHW A;  2LX9 A;  1D3B B;  1WHK A;  4OB0 B;  1VOM A;  4GY5 A;  2BKD N;  1MMD A;  2JT4 A;  1V29 B;  2CP7 A;  2DZC A;  4JS4 A;  2EGA A;  1KQ2 A;  4GLK A;  4C0D C;  2HAX A;  2E4H A;  2I0N A;  5I11 A;  3CXC S;  2RMO A;  4B9X A;  1JXO A;  3CCU A;  3CCM T;  2AK5 A;  4D8D A;  1Z9Q A;  3PT9 A;  4QKU A;  2RI5 A;  3CCR A;  2FZG B;  1ACM B;  2VV5 A;  3VS5 A;  3CME T;  5FU6 C;  3FLG A;  2O9V A;  2RHZ A;  1VQP T;  2KYB A;  1SRM A;  5GMK m;  1UGR B;  2KNB B;  2AIR B;  1D0Y A;  3CCV Q;  5IH2 A;  4Z02 A;  2QDY B;  3I55 A;  2RO0 A;  4BUG A;  4RTV A;  1LCK A;  4FYX B;  2D9T A;  2OAU A;  3M56 A;  4E7S A;  2EKH A;  3FC3 A;  2XHC A;  4OML A;  1TS9 A;  6AT1 B;  1I07 A;  2LT1 A;  1Q7Y U;  3CCE T;  1WHJ A;  3CD6 Q;  2RD1 A;  1JB0 E;  3M53 A;  4PNO A;  2VC8 A;  2XDD A;  4M75 G;  1TG0 A;  1YCY A;  2NYS A;  2OTJ Q;  5CO7 A;  3WXM B;  3CPW A;  5I2S A;  8AT1 B;  3G6E T;  4JRQ A;  2RA2 A;  5LJ5 j;  2DNU A;  1OPL A;  2BZY A;  1M2O A;  1VQO T;  2DIQ A;  3INZ A;  3GOX A;  3S3M A;  4A4H A;  4C92 B;  2QXF A;  3QWY A;  1WNL A;  1QKW A;  3AT1 B;  1WZO A;  1PC0 A;  2YWW A;  2XDP A;  3ASK A;  4JJC A;  4QW2 A;  1N9R A;  4FSS A;  2RF0 A;  2LCS A;  3CC4 A;  1GFC A;  1BKB A;  5L23 A;  4LUD A;  3HTR A;  1M3B A;  2K4Y A;  2JNG A;  3CCV A;  4ZN1 A;  4AT1 B;  2O4X A;  4FL6 A;  1NEG A;  2CZ6 B;  3L2Q A;  1IHV A;  4JRI A;  3G7Z A;  4C8Q C;  4F16 A;  2PU9 B;  4J9H A;  4M75 B;  4OVA A;  2CP0 A;  1UB4 A;  1X6B A;  1BI3 A;  3X25 B;  1M90 U;  4JDS A;  3I5R A;  2KQW A;  3H8Z A;  4M7A C;  4EDU A;  4GBQ A;  3G71 A;  4DBF A;  2G6F X;  5M9O A;  1ZA1 B;  2JM9 A;  3A8G B;  1X6G A;  2JW4 A;  1RI9 A;  2F69 A;  3EG0 A;  3M0U A;  2PUK B;  2M9U A;  1M5Q 1;  1FMV A;  2YHT A;  1WHG A;  1C6V X;  3V8J A;  5KH6 A;  4JPB W;  4EPC A;  1M2V A;  4RCB A;  2D6F A;  2L3R A;  2DTH A;  3CEY A;  4M77 D;  1VQM A;  3CCJ A;  2GFU A;  1AZE A;  2PUO B;  5EG2 A;  1ZX6 A;  5CCA A;  5HK0 A;  3M9Q A;  3SEM A;  2JTM A;  2EGE A;  3NPF A;  1D1B A;  2LMJ A;  4Y92 A;  2DMO A;  3TU4 K;  1ZLM A;  1SRL A;  2QEX A;  2DYB A;  1P92 A;  5KCH A;  4E47 A;  5GMK e;  2E6N A;  3L2Z A;  3RES A;  2DJZ A;  2FB7 A;  2RJD A;  1Z9Z A;  1ZBJ A;  2LJ3 A;  2CSQ A;  1WPY A;  2FRY A;  3RMS A;  1UGV A;  3GBQ A;  4Z89 A;  1X01 A;  3OS1 A;  3DB4 A;  1AT1 B;  2OTL T;  1PG5 B;  4NL3 A;  4KBM B;  1NJI R;  4ELY C;  3M5A A;  2GGR A;  5GAM f;  1H64 1;  3VU3 C;  1TTH B;  2HSE B;  3V8K A;  5GAM g;  2DYI A;  2JJ9 A;  3SWN A;  4M7A G;  4OMQ A;  2WSE E;  3RKW A;  2RQR A;  2BZX A;  1I5O B;  1W2B A;  4PJO D;  4JZ3 A;  1VQK T;  3E9F A;  5AT1 B;  1I4K 1;  1PKS A;  2F1L A;  1IZ6 A;  1UEC A;  4QQG A;  4CC7 A;  2K5I A;  1G2B A;  4Q5W A;  5HY6 A;  3CME Q;  2KDS A;  4PJL A;  4C8Q F;  1M3C A;  3QII A;  2ABL A;  3OQ5 A;  1M30 A;  4HCB A;  2A36 A;  1N8R U;  2ZPB B;  2P4R A;  1M1F A;  2C06 A;  2QG9 B;  1AWX A;  2D0N A;  4M75 C;  3CC2 A;  1WXT A;  1K8A R;  4D6W A;  2EYQ A;  4MDW A;  2JMC A;  3L2U A;  4OB1 B;  3G4S T;  2R57 A;  1PHT A;  4NS5 A;  3OYN A;  1MMG A;  4QQD A;  3HP9 A;  2V1R A;  1WA7 A;  4ZGE B;  2K3B A;  4Y28 E;  3O5Z A; 
#chains in the Genus database with same CATH homology
 2LZ6 B;  1UTI A;  3NGP A;  2GQI A;  1RUW A;  3VS6 A;  2FO0 A;  1VYT A;  4J9F A;  2GBQ A;  2V1Q A;  2X3W D;  1AD5 A;  3CQT A;  3REB B;  3REA B;  1GBR A;  2KRN A;  2YSQ A;  1MUZ A;  2RNA A;  3VS2 A;  1H92 A;  1BU1 A;  3I35 A;  1UUE A;  1NLO C;  4R0K A;  1PRM C;  2DBM A;  2EYZ A;  1X27 A;  1G83 A;  4EIK A;  2M51 A;  1B3Q A;  2EQI A;  1E7O A;  1NYF A;  4JJD A;  3KFV A;  2L0A A;  2SEM A;  1YNZ A;  3FJ5 A;  4KRT A;  1FMK A;  2E5K A;  2PTK A;  5FWC A;  1ABQ A;  1PNJ A;  3JV3 A;  2EYX A;  1H8K A;  1SHG A;  1MV3 A;  2BTT A;  4JZ4 A;  1WXB A;  2VKN A;  3M0S A;  4K11 A;  1ABO A;  3M0T A;  3H41 A;  4LUE A;  2FPD A;  1B07 A;  2KRM A;  2DL3 A;  1AOJ A;  5FWB A;  1S1N A;  3QWX X;  1NM7 A;  1ARK A;  1V1C A;  4J9D A;  3TSW A;  1T0J A;  1HD3 A;  1Y0M A;  3A98 A;  5IHN A;  3UA6 A;  4OMO A;  2K6D A;  1AWO A;  1XOV A;  3H0F A;  3UAT A;  2W0Z A;  1YP5 A;  3PE0 A;  1T3L A;  2CSI A;  1YWO A;  1TUD A;  1NYG A;  2X3X D;  5FW9 A;  2O88 A;  1W70 A;  1JU5 C;  1YWP A;  2LQN A;  1KFZ A;  5HCK A;  2FEI A;  1QKX A;  2MOX A;  3PVQ A;  2KT8 A;  2DJQ A;  2L3Q A;  3EHQ A;  2ED0 A;  3SHW A;  1U5S A;  4ORZ A;  5EC7 A;  2L3S A;  3VRY A;  1MV0 B;  1K0S A;  1PRL C;  1SEM A;  3NMZ C;  4RTU A;  3R6N A;  2J6K A;  1W6X A;  1U3O A;  1AWW A;  2QDL A;  3IQL A;  4OMN A;  5IXB A;  2YT6 A;  1WFW A;  2ROT A;  2EYW A;  2KXC A;  2LNH B;  2LX7 A;  2W10 A;  2AKL A;  5GJW B;  1GRI A;  2J6O A;  4CC2 A;  1I1J A;  1K4U S;  1EFN A;  4GLM A;  4HVV A;  1RLP C;  2O9S A;  2KEA A;  3H0I A;  2GNC A;  1CKA A;  2ESW A;  2MCN A;  2ROL A;  3VS7 A;  4OMM A;  2RQU A;  3VS1 A;  1OOT A;  2ECZ A;  4X1V A;  1X2Q A;  1UE9 A;  3ULR B;  2OI3 A;  1AWJ A;  4WCI A;  1GFD A;  1UJY A;  1GBQ A;  4ESR A;  1WYX A;  1BB9 A;  3M0R A;  1GL5 A;  5I22 A;  3VS0 A;  3EG1 A;  4AG2 C;  4HVW A;  2JMA A;  2VWF A;  2EGC A;  2AZV A;  4JJB A;  2RQV A;  2DM1 A;  2JT4 A;  1UHC A;  2DRM A;  2RPN A;  3LH5 A;  1AEY A;  2EGA A;  2FG0 A;  1QWF A;  1YN8 A;  1PKT A;  1FYN A;  2I0N A;  5I11 A;  2RMO A;  4AFU C;  4RUG A;  1JXO A;  2J06 A;  2AK5 A;  4RTY A;  4D8D A;  1Z9Q A;  4QT7 A;  2J6F A;  2LJ0 A;  1K9A A;  2FRW A;  2XMF A;  1ZUU A;  1U06 A;  3VS5 A;  1W1F A;  2O9V A;  1T3S A;  2A28 A;  2CRE A;  2KYB A;  1K76 A;  1NLP C;  1SRM A;  1VYU A;  4RTX A;  2J05 A;  2KNB B;  2HDA A;  3TSZ A;  5IH2 A;  1SPK A;  1SHF A;  2CT3 A;  2KYM A;  2EPD A;  2D8J A;  4RTV A;  1LCK A;  4F14 A;  4J9E A;  2YUO A;  2EKH A;  4OML A;  2DLP A;  1I07 A;  2ENM A;  2DX1 A;  2M0Y A;  1WI7 A;  2JXB A;  2DE0 X;  4LNP A;  1OEB A;  1JQQ A;  2SRC A;  1WIE A;  1QWE A;  2J7I A;  1TG0 A;  1E6G A;  4RTW A;  2FPF A;  1RLQ C;  4AFZ C;  1AVZ C;  3M0P A;  2VVK A;  3I5S A;  2EBP A;  2DBK A;  4A63 B;  1GCQ A;  1UHF A;  2DL5 A;  2CH4 W;  2DNU A;  1OPL A;  2JS2 A;  2EW3 A;  2C0T A;  2BZY A;  2IIM A;  4HXJ A;  4F17 A;  4HCK A;  2EYY A;  3I9Q A;  2HBW A;  1H3H A;  1KIK A;  3QWY A;  4LN2 A;  2F2W A;  4Z8A A;  2DL7 A;  1M8M A;  1QKW A;  1ZUK A;  4AFQ C;  4OMP A;  4JJC A;  4FSS A;  1T0H A;  2RF0 A;  2LCS A;  3UA7 A;  2DRK A;  1GFC A;  2MIO A;  3H0H A;  5L23 A;  4LUD A;  1IO6 A;  2O31 A;  4J9G A;  1M3B A;  2A08 A;  2KBT A;  2CUB A;  4AG1 C;  4RTZ A;  1NEG A;  4DEX A;  4F16 A;  4D8K A;  4J9H A;  1UJ0 A;  1OV3 A;  1X6B A;  2LJ1 A;  2KRS A;  3I5R A;  4GBQ A;  2H8H A;  4Z88 A;  2G6F X;  1VYV A;  2OAW A;  2JM9 A;  2JW4 A;  1X6G A;  1RI9 A;  2AKK A;  1NG2 A;  4ZNX A;  4CC3 A;  1TUC A;  3EG0 A;  3M0U A;  2K79 A;  5GJV B;  2LQW A;  4M4Z A;  2JTE A;  3VS3 A;  1X43 A;  2B86 A;  3C0C A;  1QCF A;  1UFF A;  5IXF A;  4AFS C;  2DL4 A;  3EG3 A;  1WDX A;  2OJ2 A;  1VA7 A;  2KGT A;  3RBB B;  4JPB W;  1AZE A;  1CKB A;  2C0I A;  1ZX6 A;  2BZ8 A;  2DL8 A;  2YDL A;  3SEM A;  2EGE A;  3NPF A;  2LMJ A;  4Y92 A;  2DMO A;  1GCQ C;  1ZLM A;  1HJD A;  1SRL A;  2PZ1 A;  2O2O A;  4HVU A;  3M0Q A;  2YUP A;  2A37 A;  2DYB A;  3U23 A;  1QLY A;  4J9C A;  2AZS A;  2L3P A;  1K1Z A;  2GTO A;  4LE9 A;  1A0N B;  3VS4 A;  1Z9Z A;  3ZL7 C;  1M27 C;  1ZBJ A;  2D8H A;  2CSQ A;  2FRY A;  2LJ3 A;  5IHI A;  1WLP B;  1UGV A;  1JXM A;  3GBQ A;  4Z89 A;  1K0X A;  2KE9 A;  2NUZ A;  5IHK A;  1GCP A;  3EG2 A;  2CH4 A;  1WX6 A;  2L2P A;  1I0C A;  2K2M A;  2YUQ A;  1SSH A;  4E6R A;  1OPK A;  1X2K A;  2JM8 A;  2PNI A;  4J9B A;  2KRO A;  2F2V A;  2GGR A;  2RQT A;  1YCS B;  2NWM A;  3EHR A;  1Y57 A;  1AZG B;  3EGU A;  4OMQ A;  4RTT A;  2RQR A;  2BZX A;  1HSQ A;  1UG1 A;  2HSP A;  1J3T A;  4JZ3 A;  2EVR A;  1NEB A;  2HCK A;  1X69 A;  1ZSG A;  5ECA A;  1PKS A;  2C0O A;  2ED1 A;  1KJW A;  2DF6 A;  4IIO A;  1UEC A;  2CT4 A;  4CC7 A;  2DVJ A;  1BBZ A;  2K7A A;  2RN8 A;  1G2B A;  2D1X A;  2JS0 A;  4CC4 B;  1PWT A;  2KT1 A;  3NHN A;  1M3C A;  2K9G A;  2ABL A;  1JEG A;  4IIM A;  1M30 A;  2LP5 A;  2RQW A;  2A36 A;  1M3A A;  1CSK A;  1KSW A;  1UDL A;  2P4R A;  2HEQ A;  1JO8 A;  2F2X A;  2DIL A;  2GTJ A;  1BK2 A;  2CDT A;  4DEY A;  3TVT A;  3RNJ A;  1AWX A;  2DA9 A;  1E6H A;  1ZUY A;  2D0N A;  1WXT A;  2FPE A;  3THK A;  2KXD A;  2JMC A;  1N5Z A;  4J9I A;  3UF4 A;  1PHT A;  2KR3 A;  3VRZ A;  1WXU A;  2CUD A;  2V1R A;  3PVL A;  1WA7 A;  2K3B A;  3O5Z A;  2YUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...