1NLOC

Structure of signal transduction protein, nmr, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC
publication title Molecular basis for the binding of SH3 ligands with non-peptide elements identified by combinatorial synthesis.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Complex (transferase/peptide)
total genus 7
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1996-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1nloC00
2SRCA 1AWJA 4GBQA 1NLPC 1WDXA 1UG1A 2MCNA 3FJ5A 3R6NA 4JZ4A 1WYXA 2EYYA 5IHNA 1WFWA 1UHFA 4JJBA 2LJ3A 2DL7A 2KNBB 4ORZA 3NMZC 2A28A 2X3WD 2W0ZA 3I9QA 2ENMA 2C0OA 2OAWA 3M0UA 1WIEA 1E7OA 1AVZC 2JT4A 2CH4W 2VVKA 3THKA 1NEGA 1ZUYA 2DF6A 4OMOA 3TSZA 1X6BA 1SPKA 1Z9ZA 2EQIA 4EIKA 1AD5A 3QWYA 4R0KA 2LNHB 3PVLA 3UA7A 1WXTA 2OI3A 2DRKA 1GRIA 1OPKA 1YN8A 2AZVA 1I1JA 1JXMA 1ABQA 1I07A 4X1VA 4E6RA 2K7AA 1QWEA 2RMOA 2KROA 1M8MA 2O31A 4RUGA 3EHQA 5IXFA 2O2OA 2LCSA 1YP5A 1KFZA 1ZSGA 1Y0MA 3PE0A 2AKLA 2DL3A 1AZEA 2CH4A 2GTJA 1X2QA 2DE0X 1LCKA 3UA6A 5FW9A 3EG2A 2FPFA 2EBPA 2LX7A 1PHTA 4IIMA 1OV3A 1UHCA 1X6GA 1RLPC 3VS2A 2CSIA 2BZXA 3RNJA 2ESWA 1MUZA 1NYGA 2KT1A 2BZYA 2CDTA 2F2XA 2HBWA 1AWWA 1T0JA 2RPNA 1WA7A 1TG0A 1H92A 3EG1A 2ECZA 2B86A 4LN2A 2JW4A 1NM7A 1G2BA 3RBBB 2A08A 4Z88A 1TUCA 2J6FA 3TSWA 4OMPA 2YSQA 1WX6A 3KFVA 3H0HA 3UATA 1YCSB 2JS2A 1WXUA 2DRMA 2EGAA 4D8KA 4F14A 1N5ZA 1Y57A 1GCQC 1JO8A 1AOJA 1SRLA 4RTVA 1K76A 1M3AA 4QT7A 4AFQC 1PRLC 1ZLMA 1X27A 4AFZC 1WLPB 2VKNA 4J9CA 2HEQA 3I5RA 1CKBA 2J05A 1FYNA 2KYBA 4CC7A 1UTIA 5HCKA 1NG2A 2C0TA 2RQUA 1W1FA 2GQIA 1JU5C 5I22A 1T3LA 1ZX6A 1X69A 3EG0A 4RTWA 1OPLA 1VYVA 3M0TA 1SHFA 2ROLA 2L3PA 3C0CA 2DM1A 2K6DA 2VWFA 4J9BA 5ECAA 3I35A 1HJDA 1ABOA 1B3QA 2AK5A 2YT6A 3ULRB 4KRTA 5I11A 3VS6A 2DBKA 2A36A 2KRSA 3M0QA 3CQTA 2J06A 3H41A 4ESRA 4JPBW 1U06A 2JMAA 3VRYA 1GBRA 2DYBA 4A63B 2RQVA 2D8HA 1E6HA 1VYUA 1K0SA 2ED0A 1CSKA 3NPFA 1M3CA 1H3HA 4Y92A 2H8HA 2GNCA 2YUOA 3UF4A 1IO6A 1KIKA 1T3SA 1UGVA 2AZSA 3SHWA 2P4RA 4LUDA 3H0FA 2FPEA 2L3SA 2JS0A 4OMQA 2DL5A 1ARKA 4FSSA 2BTTA 5FWBA 1AWOA 1PKTA 1JQQA 2W10A 2AKKA 2JM9A 2L0AA 5GJWB 1RLQC 4LE9A 2K2MA 2DILA 1AWXA 4J9FA 1T0HA 1UDLA 2GBQA 3PVQA 4Z89A 2KT8A 1U3OA 1HD3A 1OOTA 2FO0A 4JJCA 2FPDA 1NYFA 2YUPA 5IH2A 2DNUA 1S1NA 2I0NA 2FEIA 1GCQA 2YDLA 4HVWA 1FMKA 1PWTA 1NLOC 1AEYA 2NUZA 1U5SA 2EGCA 4ZNXA 2NWMA 1XOVA 4F17A 2D8JA 2DL4A 2K9GA 1X2KA 3JV3A 4LUEA 4CC2A 1UFFA 2RNAA 4J9IA 2BZ8A 2DBMA 1PKSA 2JM8A 1YWOA 1M27C 2GGRA 1K9AA 3GBQA 2HCKA 2D0NA 2DX1A 3M0SA 2RQRA 3LH5A 1J3TA 1JEGA 2YUNA 1MV0B 2CT3A 3I5SA 1W6XA 2V1QA 4RTZA 1UJ0A 1QCFA 3NHNA 2CREA 1QKXA 5IHIA 4DEXA 2LJ0A 1V1CA 1YNZA 4HVUA 5EC7A 2GTOA 2ROTA 4D8DA 3VS0A 4OMNA 4K11A 2ABLA 3VS4A 4JZ3A 2EVRA 5GJVB 2PTKA 1BK2A 4WCIA 2EYXA 3QWXX 2K3BA 2LJ1A 4AFUC 2KRNA 3ZL7C 2DL8A 2KBTA 2LQWA 4Z8AA 1QKWA 3REAB 3VS1A 2ED1A 4J9DA 3VS7A 4AG2C 1UE9A 2YUQA 1MV3A 1QLYA 2DJQA 2HSPA 2E5KA 3EG3A 1OEBA 4OMLA 2D1XA 2RN8A 2J7IA 5IHKA 3O5ZA 2KYMA 1GFDA 1GBQA 3EGUA 2J6KA 2PNIA 2MIOA 2X3XD 2A37A 5IXBA 2KXDA 2QDLA 2EW3A 2KGTA 4CC4B 2KXCA 2OJ2A 3REBB 2JTEA 2DVJA 1UECA 2JMCA 2LZ6B 2KRMA 1W70A 3SEMA 2O9VA 2C0IA 1SHGA 2CUDA 2M0YA 1M3BA 2LP5A 4AFSC 3VS3A 2O9SA 4J9GA 2V1RA 1UUEA 2CT4A 4F16A 4OMMA 2KE9A 4JJDA 1E6GA 5FWCA 1WXBA 1BU1A 2XMFA 2EGEA 2L2PA 2RF0A 4AG1C 4HCKA 3U23A 2IIMA 4RTUA 1PNJA 4LNPA 4J9HA 1RUWA 1A0NB 4GLMA 1M30A 2EKHA 3A98A 1K1ZA 2KEAA 1HSQA 1EFNA 1GL5A 4RTYA 2MOXA 3VRZA 4RTTA 2FG0A 3EHRA 2O88A 1GFCA 2CUBA 1UJYA 2F2WA 2J6OA 2SEMA 3M0RA 2PZ1A 2EYZA 1H8KA 2M51A 1PRMC 1X43A 2RQWA 1ZUKA 1BB9A 2LQNA 1YWPA 3IQLA 1JXOA 1G83A 1KJWA 1B07A 1K0XA 1VA7A 2CSQA 2HDAA 5L23A 2DMOA 2EPDA 2DA9A 2KR3A 2L3QA 1QWFA 2JXBA 3M0PA 1ZBJA 4IIOA 2LMJA 2RQTA 1VYTA 3VS5A 1SRMA 2K79A 4DEYA 1CKAA 1WI7A 4CC3A 2F2VA 1ZUUA 4HVVA 1SSHA 1Z9QA 1GCPA 1RI9A 3H0IA 2FRWA 4M4ZA 1KSWA 2DLPA 1K4US 2FRYA 4RTXA 1NEBA 2EYWA 3NGPA 1AZGB 2G6FX 3TVTA 1I0CA 1BBZA 1TUDA 4HXJA 4J9EA 1SEMA
chains in the Genus database with same CATH superfamily
4FYXB 2P0KA 5DLQE 5CK9A 2D6FA 2EQUA 4DOVA 1WFWA 1UHFA 1C6VX 4NL3A 1VQNA 4C92E 1NJIU 3RERA 3CC2A 4JJBA 3RKXA 2ZPEB 1VQ5T 1OULA 2DTOA 3OQ5A 1RAEB 1RABB 1WIEA 1AVZC 1RAFB 2NUTB 4B9WA 4IUVA 2VVKA 3E9GA 3L2WA 1X6BA 3OW2A 5HY6A 4N4HA 4KH0B 1TOVA 2OI3A 2RO0A 3SFMA 2DRKA 2ZCFB 2E1HA 1OPKA 3CCSQ 1Q86R 2EQMA 2L8DA 4E6RA 4JJNK 4J7FA 3CCRT 3I55T 4JRIA 4M78G 1D0YA 3OYJA 3CCQQ 2O31A 4PFPA 3HFOA 3FEOA 4PJOC 5EG2A 2DEQA 4KT0E 2OAUA 1YP5A 1KFZA 1ZSGA 1Y0MA 2DZ9A 2LCLA 2MK5A 1U1SA 5HK3A 4Z02A 3MCAB 3CCSA 1Q82C 1WHHA 2P0PA 3PFSA 1X6GA 1WPYA 2CSIA 2QQBA 3L2ZA 3CCQA 3JCMQ 1G3SA 3CPFA 2R58A 2KT1A 2BZYA 4F7UF 2VC8A 2EQJA 1PCXA 2RPNA 4YTLA 2DAQA 5GAMg 5GANf 4LN2A 2KK4A 1IHVA 3KBGA 1BI2A 1FMWA 1VIEA 2A08A 4Z88A 2JTFA 3TSWA 3OYCA 1FMVA 3KFVA 3JCMb 3H0HA 2K4YA 4FM4B 1YCSB 2VUBA 4C0GA 2DD5A 2EGAA 1WNLA 2A7YA 2X4JA 3H6ZA 3N5BB 1Y57A 3HHTB 5GANj 3FRNA 3D7SB 1JO8A 3G7ZA 1SRLA 3OB9A 3GOXA 1M3AA 1BIBA 3JCMf 4AFQC 2V8KA 1ZLMA 4XTWA 1X27A 2YWWA 3ER0A 1D3BA 2FL7A 2D9TA 5GAOn 3I5RA 3JAME 3MP8A 3CCST 1M9SA 3BY7A 1Q86C 4CC7A 3QDRB 2EWNA 2E64A 1NG2A 1G3WA 3RESA 3NTHA 3CCQT 3SD4A 2DTHA 1ZX6A 1Y96B 3MPUB 1UB4A 2L3PA 4LDUA 2VWFA 5KCHA 5DLOA 1HJDA 1M2VA 4DA4A 3QYHB 2YT6A 3ULRB 2R5MA 2X4YA 4PJLA 4JRQA 3CQTA 2J06A 4IUTA 3P8HA 2QXFA 4JPBW 4NOYA 5GAN4 5CQYA 4BDZA 2MI6A 1IRXA 4BE0A 4PFOA 3RKWA 2OTLQ 2B8AA 4ZN3A 1E6HA 3QO3A 3C95A 1NBEB 3NPFA 2XDDA 1M3CA 3GIBA 1RAIB 3QYGB 1IO6A 1KIKA 2CP6A 2HAXA 2P4RA 1B7TA 3H0FA 2FPEA 5LJ5f 4BI3A 2K5LA 4OMQA 2L5QA 1K8AR 4FSSA 4F7UB 2W10A 1M2OA 4LE9A 2F1LA 2K2MA 2FHDA 1MNEA 2OTLA 1QVFP 2LRQA 2CP7A 2JTMA 5LJ5j 2FPDA 4C5GA 2DYIA 2YUPA 5IH2A 2DNUA 3P8BB 2CZ0B 2RK1A 1FMKA 1JJ2A 2NWMA 2F69A 4F17A 3DLLA 1ZSZA 2DL4A 3JV3A 3LWHA 3VJPA 1UFFA 3WVEB 2DBMA 2DIGA 2JM8A 3I56T 1M27C 4J5YA 2E4HA 4C8QE 3GBQA 2DX1A 1YJNT 3M0SA 1TUGB 1MV0B 3CCMA 1W6XA 4RTZA 1WHMA 5KYYB 1IREB 1QCOA 1SG5A 1G5VA 3CD6Q 2QA4Q 3OSSC 2LJ0A 3QSUA 4E2FB 3BDUA 4M7DF 2RHYA 4JDSA 2ABLA 2Y4YA 3QIIA 4J6YA 1BK2A 1KQ2A 2K3BA 2GQVA 4A4KA 3VYHB 1F1BB 4M7DE 3REAB 4A54A 4NL2A 1QVGA 1QLYA 2HSPA 3CD6A 2QA4A 4LXCA 3EG3A 3ME9A 2D1XA 3CCVQ 1YFNA 1HYOA 3EGUA 1Q7YR 1K8AC 2HMAA 2KXDA 3DLMA 1QMCA 1VQMQ 2JTEA 1IB8A 3HRSA 3UPUA 3CCMT 2CUDA 3TQ7P 5KH6A 4BB7A 2LP5A 3E19A 3SWNC 2HZYA 3BE3A 3LGFA 5GAN3 2ZAEA 2CT4A 4F16A 5J39A 4QW2A 2M9UA 5C0MA 2EAYA 5CKHA 1M4ZA 2EGEA 2RF0A 3CCVA 3L2QA 3L1AA 2NUPA 2LVMA 2Y90A 4J9HA 1RUWA 4OB0B 1VQMA 2EKHA 1YIJQ 3A98A 1HSQA 3NFCA 4O5VA 3J81E 1VQPT 2QA4T 3CD6T 3VU3C 5GAMf 4KUIA 3X28B 3CXCA 5AYFA 1UJYA 2SEMA 4N4IA 2OX7A 2PZ1A 2QI2A 1OX8A 1BIAA 1QW1A 3OW2S 2QDYB 2QG9B 5GAMj 4J8OA 1JXOA 1G83A 1G3YA 1YIJA 1VA7A 4M77E 4M7DB 1SKUB 2JXBA 3M0PA 2QAZA 1VUBA 2LMJA 1RI0A 2VGMA 2QEXT 4ELZC 5GANg 5KE3A 3FDRA 3SWNB 1IXDA 2H3EB 4DEYA 5HKCA 1Q7YC 3PIOA 5GAMd 2ZPBB 1ZUUA 3LGLA 5A0LA 3P8DA 4OGCA 2BE9B 2FRWA 4M4ZA 1D0ZA 4LD6A 2FRYA 4EPCA 4HT9A 1WQ7A 4QVZA 4ZGEB 2FVUA 1YBYA 4PL6A 4BACA 1VQ7Q 3A8OB 2DTIA 1M90U 1YJWQ 4HXJA 3JCMg 2SRCA 4X34A 1UG1A 2M0OA 4E47A 3R6OA 1D09B 2EKOA 1V29B 3C94A 4RCCA 4EMKA 1M1KU 3G71T 5GAMh 1Q81U 4XTVA 3NMZC 2A28A 4JS4A 2W0ZA 3I9QA 2ENMA 5GAN7 2C0OA 1VQ7A 3CCEQ 4IKFA 1E7OA 2CP2A 2CH4W 1P92A 1YJWA 1NEGA 1WJRA 1SPKA 2XICA 1Z9ZA 1R8OB 2EQIA 4IUQA 4DBHA 4EIKA 1AD5A 3QWYA 4R0KA 3PVLA 1NE8A 1WXTA 2BE7D 2DXCA 1RL2A 1YN8A 2G3RA 1ABQA 4M75F 1I07A 4IURA 1W2BP 2K7AA 1KC8R 2ZPIB 5CR2A 1M8MA 4RUGA 1C0MA 2QTVA 3CCEA 2O2OA 4PJOD 5GAOq 2NUTA 1AZEA 2GTJA 2JZ2A 1LCKA 2FPFA 4BI8B 4BE1A 2LX7A 7AT1B 2HQEA 4IIMA 5LJ5g 4PKCC 3QDFA 5CKBA 3VS2A 4M75C 3L42A 1NYGA 1YJWT 1MNDA 3QHSA 3I55Q 3HSBA 3HFNA 1AWWA 4JS5A 1WA7A 1H92A 2RJDA 5CKEA 2FZCB 3S3MA 2X35A 5KYUB 1NM7A 4M7AF 3RBBB 3CC4Q 2DO3A 4QQDA 1XQHA 2JNGA 2QK0A 2IVWA 4D6WA 2M16A 3V8KA 2KSSA 4J6XA 2YLCA 1N5ZA 5LL6S 1AT1B 1GCQC 1Q82R 4DQ2A 1H641 5C6SA 3OS0A 1LVKA 3OBWA 3GPLA 1KQSP 1K76A 4XK8E 2MWOA 3A8GB 3JSCA 3I55A 2MF2A 4C92F 1MGQA 4AFZC 1DJ7B 2VKNA 3M59A 3CC4A 3GNFB 2J05A 1FYNA 4ZGDB 1UTIA 1BI1A 3MJXA 4HCZA 2RQUA 4XU1A 3PIPA 1KC8C 5GMKi 1S72T 4M7AC 1YI2T 3WVDB 1Q95G 5I22A 1KD1R 4M78E 3Q1JA 2E5QA 2QASA 2LTOA 1JJ2S 1Y7XA 2COYA 4RTWA 3QPHA 1IZ6A 3M0TA 2ROLA 3OYGA 2CYZB 4M75B 2DM1A 1ABOA 4QKUA 2AK5A 4KRTA 2QGFB 1D1BA 5I11A 4PJOA 4C92C 2DBKA 3L2UA 4OVAA 2A36A 2IG0A 3M0QA 4FU6A 4XTXA 2QYZA 1U06A 1LPLA 2JMAA 2XHCA 1K9MU 1GBRA 4A63B 1Y96A 1NJIR 2D8HA 1K0SA 1BKBA 3CC4T 5GANe 4Y92A 4NS5A 4UC4A 2H8HA 1GXIE 2E3IA 3ASKA 1D1AA 3RUXA 1OYXA 3X24B 4PK4A 3ZFJA 3BDLA 3X20B 1OU8A 4MMLA 1I4K1 1MMAA 4N0AA 1QVGS 5CQXA 5LJ3f 3LX7A 3LWIA 5FWBA 1WHKA 4WF2A 2AKKA 4VUBA 4E7LA 1B34B 2DILA 1LNXA 1UDLA 4M7AB 1N8RR 3OS2A 4Z89A 1U3OA 1HD3A 1OOTA 3JCMe 4N0AC 2KQWA 3EAEA 5CO7A 4PJOG 5LJ3j 4EMGA 1RAGB 1VQOQ 2ZZDA 4EMHA 4HVWA 1PWTA 3C12A 4C0FA 1KD1C 4R56A 2D8JA 3F70A 1X2KA 1RAHB 1BYMA 4P5NA 1PKSA 2KI7A 1VQ8T 4C92B 4F7UA 1YHQT 4KGXB 5GAN5 3LH5A 8ATCB 2QQ9A 1JEGA 1TU0B 4C5HA 2L89A 1UJ0A 1QCFA 1QKXA 5IHIA 4HVUA 5EC7A 1VQOA 2WACA 1XNIA 3PNWC 4D8DA 3VS0A 1MHNA 4OMNA 4JRKA 5GANd 3X25B 4PJNA 2DD4A 2P0QA 3OYFA 4WCIA 4ZTFA 3CXCS 1BCOA 4PLLA 1NJIC 1RAAB 4QQ6A 2AHJB 2VXFA 4FW1A 1VQLQ 3I56Q 1UGRB 5FRNA 4AG2C 1YJNQ 2RK2A 2YUQA 1MV3A 5KYYA 1X6OA 3V7CA 2RN8A 5KYWA 1GFDA 1N9SA 3JCMd 1GBQA 4HCCA 2J6KA 3EG9B 3OYLA 1KHCA 3ZEHA 4F7UG 5LJ5e 1MMNA 2EW3A 4CC4B 2RHZA 1YJ9A 2OJ2A 3REBB 2HBPA 5GMKl 1UECA 2LZ6B 3EFRA 2CZ6B 1TTHB 1N8RC 5GANh 1W70A 4BI4A 2O9VA 4RG8A 1SHGA 1M3BA 4DBRA 5FU6B 3EGXB 1VQLA 3I56A 2V1RA 1UUEA 1VQOT 2QGGA 2HL3A 2BIVA 4OMMA 2KE9A 3TEEA 3JB9J 3QJ6A 1E6GA 4MDXA 1VQ4Q 1YJNA 4KH1B 3HL8A 4ELYC 1Y71A 1PNJA 2DVEA 5DM7R 1MMDA 3JCMh 1G8XA 1BCMA 2KEAA 2GCXA 3CCMQ 2MOXA 2RI5A 2HD0A 3S3NA 1VQ4A 3JB9F 2DPPB 3MEUA 3EHRA 1GFCA 2DXTA 3SDZA 2A0FB 3OYKA 4C8QF 1YJ9T 2EYZA 2M51A 3TCJA 1PRMC 3PMTA 2YHTA 4AMCA 3HP9A 3KUFA 2MWPA 1VQLT 2LT1A 5FRMA 5L23A 4QVDA 5LJ5d 2EPDA 2KR3A 2DA9A 3JCMP 3OS5A 1ZBJA 5KYNA 1X75C 2RJCA 2MAMA 2K79A 1VQPQ 1CKAA 3M4YA 4V2SA 2QQAA 1VQ6T 3HRTA 5KYXA 1SSHA 1Z9QA 2DJZA 2K3YA 2K5FA 1KQ1A 3VUBA 1K4US 3MEVA 4C8QC 3EH1A 2F5TX 1WGSA 1VQ4T 2HQHA 2XD0A 5LJ5h 3ZBDA 1AWJA 1VQPA 1WDXA 2R57A 3FJ5A 3R6NA 3OYHA 2CZ7B 2YRCA 2LQKA 2QEXQ 3SWNA 2EYYA 4FIBA 4A4HA 3G4ST 4HCBA 2BUDA 2LJ3A 1AHJB 2DETA 4XTZA 1U8RA 2X4XA 4ANJA 4M7DC 2X3WD 1I8FA 1KG1A 2JT4A 4XTUA 3THKA 1ZUYA 2RHXA 3DB4A 5GAMe 4OMOA 3SB2A 3TSZA 2PU9B 1WHJA 2RH2A 2ZPFB 2LNHB 2CP0A 1ZA1B 1GRIA 2BKDN 4E7IA 2QEXA 2HKQB 2P84A 1JXMA 4EDUA 4MZPA 3QUIA 3QG1A 5I21A 1QWEA 3RDVA 2RMOA 3M55A 4IUPA 4GLKA 3V8LA 3G71Q 2L3RA 2E65A 2MMPA 4E7KA 5IXFA 4C8QB 3CMAA 3PE0A 2DL3A 4PNOA 2LT4A 3OY9A 1ZSZB 1KHIA 4MMKA 1X2QA 1W2BA 2EFIA 2XDBA 4E7HA 3UA6A 3EG2A 3JCMc 3CC7Q 2EBPA 4M77F 3QZ9B 1JJ2P 1OV3A 1TSFA 3RMSA 5LJ3g 3JCMW 1RLPC 3CCUQ 1IGUA 3LW5E 3RNJA 3G71A 2ESWA 5IAYA 2XK0A 1XTDA 4M75D 4X9DA 2H3JA 5D6XA 2HBWA 2O4XB 1T0JA 3AT1B 1TG0A 2Y4XA 1D1CA 2B86A 1RADB 2CP3A 1PSFA 2M02A 5GAOl 3S6WA 2PVDB 4OMPA 3CC7A 1WX6A 2WSEE 3EFSA 3EFOB 2I2LA 1WXUA 2DRMA 2VV5A 4D8KA 1M5Q1 3L2VA 4LDWA 1AOJA 4M77C 4OB2B 2GF7A 3CCUA 5A2QE 4A4GA 3CMAT 3M5AA 4LDXA 2COZA 3RR6A 2RJEA 1TWBA 1WLPB 3VKIA 1QVGP 2GFUA 2HEQA 1G3TA 5KYUA 4FCYA 2C0TA 2AT1B 5KE2A 2GQIA 1JU5C 4JRPA 1KQSA 4M7AD 2AIRB 1T3LA 2CKKA 3CPWA 3EG0A 1VYVA 4L6V5 1UGQB 2DXUA 3C0CA 2HNIA 3LYIA 5J26A 5ECAA 3I35A 3CC7T 4RCBA 1B3QA 2EIFA 1M90R 9ATCB 5CVIA 2NLUA 4C92D 3PTAA 1Y07A 2JOYA 3OMGA 3RMQA 4ESRA 3CCUT 3OYBA 1S72Q 1YI2Q 3VV0A 2DK3A 2XKOC 2E10A 1VQ9T 2DYBA 2CZ1B 1M1KR 1CSKA 2KAFA 4M77B 4MDWA 4DBFA 1UGVA 4M75A 3CXCP 4HT8A 2L3SA 4A53A 3JB9H 3L2RA 1ARKA 2BTTA 3GNGA 1JQQA 3MHXA 1VQKT 2JM9A 2L0AA 2RM4A 1S72A 1YI2A 4II1A 1SSFA 1AWXA 4J9FA 5L8RE 5GAOp 2GBQA 1PSEA 4GY5A 2E41A 5GMKm 2ZPHB 2FO0A 4MZTA 2M1HA 2RHIA 1S1NA 2FEIA 1YITT 1GCQA 2YDLA 2DERA 1Q82U 4PJMA 1NPRA 2EGCA 1XOVA 3CCJQ 2DIQA 4PJJA 4CC2A 4LUEA 3J80E 4J9IA 1JBMA 2GGRA 1K9AA 2HCKA 3H8ZA 4L5GA 1B34A 2YUNA 4M75G 1KK7A 2A3LA 4FT2A 4M7AA 3M56A 3NHNA 4HA8A 4O6JA 1KD1U 1V1CA 4M78F 1M90C 2ROTA 4XQ3A 2E70A 3EGDB 4K11A 2CP5A 3CCJA 2K2VA 2WSFE 5GJVB 2PTKA 2EYXA 2PUOB 3MKDA 2LJ1A 4AFUC 3OYDA 1M1KC 3NTIA 1NZ9A 3ZL7C 2LQWA 4Z8AA 3OSVA 4C92A 1PC0A 2LQ8A 1R0BG 1VQ8Q 2K57A 4J9DA 2X9HA 3JRZA 3VS7A 1YHQQ 1UE9A 3S3OA 1Q86U 1C1AA 2E5KA 4TVRA 1SF9A 2KMTA 4OMLA 2J7IA 5IHKA 3PGGA 2KYMA 2HQXA 2MIOA 4PJOF 2X3XD 2A37A 4Q5WA 4M78C 2KGTA 2QDLA 5LJ3e 1K73R 3QJYA 2DVJA 2JMCA 1QP3A 2KRMA 4A4EA 4M7AG 3SEMA 3CEYA 2K3XA 2M0YA 2O9SA 4F04B 3MO8A 1R77A 2F5KA 1VQ8A 4PJOE 4JJDA 1YHQA 1QQJA 5CCAA 3CMET 3V7SA 5D6YA 1BU1A 1RACB 1ZA2B 2XMFA 4XAXB 3X26B 2PUKB 3U23A 3CCJT 1N8RU 5FLXE 3A8MB 4L59A 4E7SA 3EG9A 4C92G 4GLMA 1M30A 3E1SA 2HL5C 4KGVB 1K1ZA 3LH0A 5I2SA 3JCMJ 5D6WA 1EFNA 4ATOA 1BI0A 1N27A 1PD1A 4A4FA 1GL5A 4RTYA 3O8VA 3EGXA 3VRZA 3QBYA 3UT1A 2DFUA 2RA2A 1K9MR 1K73U 2O88A 1VQNT 4J7IA 4FL6A 1MMGA 2DXBA 2RJFA 2D0QB 2F2WA 4XU0A 3CC2T 3A5ZB 3M0RA 4BUGA 2FB7A 5DY9A 1H8KA 1X43A 2RQWA 5FU6C 3IQLA 1BB9A 2LQNA 4X9CA 4OP0A 2EQKA 1XJWB 4E7JA 1KJWA 1B07A 3H9NA 1K0XA 2HDAA 1QVFA 4M78B 4C0DC 5LJ3d 5A0GA 1ZHIA 2R5AA 4IIOA 1M1GA 2RQTA 3NTKA 4DOWA 3VS5A 5IN1A 2KDSA 1EZZB 2K5IA 2OTJQ 5HK0A 1OU9A 4CC3A 4F7UE 1K73C 2YRDA 3QXEB 3E2UA 2PVGB 1RI9A 3H0IA 2XDPA 4B9XA 1KSWA 1YJ9Q 3JB9D 2YLBA 1W2BS 1OQKA 4BE2A 2LX9A 4RTXA 4C8QD 2EYWA 3NGPA 1AZGB 2G6FX 2EJ9A 5GAN8 2KY9A 2V8IA 3CBPA 1I0CA 3MEWA 4J9EA 3HRUA 4FT4A 4BDYA 4PJOB 4GBQA 5LJ3h 5CAIA 1NLPC 4PLIA 2MCNA 4FYYB 3M9QA 4JZ4A 3OW2P 2OTJA 1WYXA 5IHNA 1IGQA 4QVCA 1N9RA 2LC4A 1TS9A 5GAOm 1VQ6Q 2DL7A 2KNBB 4ORZA 3A8LB 2RI2A 2GFAA 1ZQ1A 4M7DD 2OAWA 3M0UA 4AT1B 3OYMA 4KGZB 2DF6A 4Y28E 1K9MC 3JB9I 3C4SA 4KULA 3A1PA 4C0DB 1K8AU 3UA7A 2YRVA 3HKSA 4DBQA 1O9SA 2AZVA 3FLGA 1I1JA 4JLGA 4X1VA 4BY6C 2YXYA 4FYVB 2VASA 1PM3A 1VQ6A 3CCLQ 2KROA 3G4SQ 5CIUA 3OYAA 1X01A 3EHQA 1QVPA 5D7UA 1UGPB 4B6MA 4BD3A 2LCSA 1KQSS 4FYWB 3CPWS 2AKLA 2CH4A 2OTJT 2COWA 2DE0X 5FW9A 4QQGA 2VYTA 4R55A 1WQWA 1PHTA 3A8HB 1WJQA 1NPPA 1UHCA 3JCMV 1FX7A 2LNVA 3CCLA 3G4SA 3URGA 2BZXA 4WTOB 1MUZA 2LCCA 3GF5A 2CDTA 2F2XA 1D3BB 4FSXA 3EG1A 4ZN1A 2ECZA 2JW4A 1G2BA 4C8QA 3OA6A 3OYYA 1TUCA 2J6FA 2JUFA 2HKNA 2YSQA 2CGHA 4KBMB 3UATA 2XG8D 3GLXA 2JS2A 4F14A 3RIRA 4CRIA 2HSEB 2PVOB 5GAOr 4RTVA 4BY6B 4M77D 4FW2A 1ZSZC 4E7ZA 4QT7A 1PRLC 1Q7YU 1YCYA 1JRIA 1M2VB 5KYWB 2O4XA 3QZ5B 3V7RA 4J9CA 4LDVA 3RKYA 4M7DA 1CKBA 4RMOA 2KYBA 5HCKA 3OYNA 1OI1A 5KCOA 1W1FA 4XU3A 5J3BA 3CCLT 3EFOA 2O01E 4C5EA 2OTLT 3JB9G 1X69A 2PQWA 1FWZA 1OPLA 4C8QG 4RKUE 3DB3A 3BW1A 1I81A 2RB6A 2V8JA 2DKGA 3FC3A 1QCNA 1SHFA 3CMAQ 1R0CB 2K6DA 4J9BA 4OGEA 2Z0WA 3TU4K 3KXTA 3EH2A 3UDCA 3BFMA 5GMKe 3VS6A 3AHUA 5GAN6 3QKJA 2KRSA 5AT1B 3OS1A 3H41A 2VXEA 3GP8A 3VYGA 3VRYA 8AT1B 3E9FA 1WHGA 2QQRA 2RQVA 1VYUA 4M7DG 2ED0A 1U1TA 4LD9K 1H3HA 2YUOA 2GNCA 1ACMB 2CS7A 3OYIA 3UF4A 3J7AF 1T3SA 2AZSA 3HPWA 2FYKA 2RD1A 2DEUA 1FXXA 4J83A 2E6NA 3SHWA 4LUDA 2JS0A 5FROA 2DL5A 2VB6A 1OZ2A 4HKEA 1AWOA 1PKTA 5GJWB 1RLQC 3CBMA 4ZTJA 3FJPA 1T0HA 3LLRA 3PVQA 2EJFA 2KT8A 2VGNA 3JCMX 3PT9A 2P4TA 4JJCA 4ZGJB 1VQ9Q 1NYFA 5GMKj 5KYXB 2I0NA 1TXQA 4OMFB 1NLOC 3PMIA 4M77A 1I5LA 1AEYA 2NUZA 2EJGA 1U5SA 4ZNXA 2E3HA 3VUZA 1JB0E 2K9GA 3G1JA 2RI3A 2RNAA 1OX9A 4PFZA 2BZ8A 3DKMA 1YWOA 2D0NA 2V26A 2RQRA 1J3TA 3UWNA 1VQKQ 2CT3A 3I5SA 2LDMA 3CCVT 2V1QA 2CREA 3FIFA 2RHUA 4DEXA 1YNZA 4RG2A 1VQ9A 5FU7C 1O75A 1M8VA 2GTOA 2JJ9A 5IT9E 1M1FA 2QQSA 1VQMT 1YITQ 1WJSA 3VS4A 4JZ3A 2EVRA 2FZKB 1WZOA 3V8JA 4C5IA 4OB3B 3QWXX 5M9OA 2KRNA 4LDYA 2DL8A 2KBTA 1QKWA 4M77G 3MP6A 1VQKA 3VS1A 2JVVA 2ED1A 2X51A 4XTYA 3G6EQ 1V76A 2KVQG 1PD0A 5GMKh 2DJQA 1OEBA 1I5OB 1KC8U 1QVFS 2NUPB 3OBYA 3O5ZA 2PNIA 1EIFA 1W4SA 5IXBA 1YITA 5A0DA 4KUDK 1YIJT 4IUUA 2KXCA 3META 3EGDA 3HTRA 3TREA 4M78D 5GAN2 2XIDA 1H3ZA 1LJOA 4JLIA 4OF1A 2C0IA 1WHLA 2DZCA 4AFSC 3VS3A 4JUVA 4J9GA 2X4WA 3FB9A 4EMKC 1HXDA 3CBOA 5FWCA 3G6EA 1Q81R 1WXBA 2L2PA 4AG1C 2IPOB 4HCKA 2FZGB 2IIMA 2NYSA 3MP1A 4J6WA 4LNPA 4OB1B 4RTUA 1ZBXA 3WXMB 4C0ZA 5FU7B 1VIFA 1A0NB 3M53A 5CKFA 2XI9A 1QP2A 2XU8A 1VQ5Q 2QTXA 4M75E 1PG5B 3M58A 4RTTA 3T9NA 2FG0A 1UEBA 2CUBA 6AT1B 2J6OA 2MPXC 3CMEQ 2C06A 1VOMA 3M54A 3OMCA 3MEAA 1VQ7T 1ZUKA 1YWPA 5I2MA 2E6ZA 3CCRQ 2MYSA 4Y91A 2CSQA 1IHWA 1N6AA 1VQ5A 3INZA 2DMOA 5CKDA 3G6ET 2L3QA 1QWFA 1TH7A 2JN0A 2ZGWA 1VYTA 3M4GA 1SRMA 4XU2A 1HK9A 1LOJA 4CI0C 2EYQA 1WI7A 4EMKB 2F2VA 3CMEA 4HVVA 1BI3A 1VQNQ 1GCPA 3M57A 3CC2Q 1EX4A 2DLPA 1D0XA 4ME7A 4M7AE 2E12A 2ZPGB 3CCET 1NEBA 3CCRA 1OZ3A 2ATCB 1UGSB 3CPWP 4N4GA 4MZMA 1Q81C 3TVTA 3OYEA 4M78A 1BBZA 1TUDA 2WSCE 1SEMA
chains in the Genus database with same CATH topology
2SRCA 1AWJA 4GBQA 1NLPC 1WDXA 1UG1A 2MCNA 3FJ5A 3R6NA 4JZ4A 1WYXA 2EYYA 5IHNA 1WFWA 1UHFA 4JJBA 2LJ3A 2DL7A 2KNBB 4ORZA 3NMZC 2A28A 2X3WD 2W0ZA 3I9QA 2ENMA 2C0OA 2OAWA 3M0UA 1WIEA 1E7OA 1AVZC 2JT4A 2CH4W 2VVKA 3THKA 1NEGA 1ZUYA 2DF6A 4OMOA 3TSZA 1X6BA 1SPKA 1Z9ZA 2EQIA 4EIKA 1AD5A 3QWYA 4R0KA 2LNHB 3PVLA 3UA7A 1WXTA 2OI3A 2DRKA 1GRIA 1OPKA 1YN8A 2AZVA 1I1JA 1JXMA 1ABQA 1I07A 4X1VA 4E6RA 2K7AA 1QWEA 2RMOA 2KROA 1M8MA 2O31A 4RUGA 3EHQA 5IXFA 2O2OA 2LCSA 1YP5A 1KFZA 1ZSGA 1Y0MA 3PE0A 2AKLA 2DL3A 1AZEA 2CH4A 2GTJA 1X2QA 2DE0X 1LCKA 3UA6A 5FW9A 3EG2A 2FPFA 2EBPA 2LX7A 1PHTA 4IIMA 1OV3A 1UHCA 1X6GA 1RLPC 3VS2A 2CSIA 2BZXA 3RNJA 2ESWA 1MUZA 1NYGA 2KT1A 2BZYA 2CDTA 2F2XA 2HBWA 1AWWA 1T0JA 2RPNA 1WA7A 1TG0A 1H92A 3EG1A 2ECZA 2B86A 4LN2A 2JW4A 1NM7A 1G2BA 3RBBB 2A08A 4Z88A 1TUCA 2J6FA 3TSWA 4OMPA 2YSQA 1WX6A 3KFVA 3H0HA 3UATA 1YCSB 2JS2A 1WXUA 2DRMA 2EGAA 4D8KA 4F14A 1N5ZA 1Y57A 1GCQC 1JO8A 1AOJA 1SRLA 4RTVA 1K76A 1M3AA 4QT7A 4AFQC 1PRLC 1ZLMA 1X27A 4AFZC 1WLPB 2VKNA 4J9CA 2HEQA 3I5RA 1CKBA 2J05A 1FYNA 2KYBA 4CC7A 1UTIA 5HCKA 1NG2A 2C0TA 2RQUA 1W1FA 2GQIA 1JU5C 5I22A 1T3LA 1ZX6A 1X69A 3EG0A 4RTWA 1OPLA 1VYVA 3M0TA 1SHFA 2ROLA 2L3PA 3C0CA 2DM1A 2K6DA 2VWFA 4J9BA 5ECAA 3I35A 1HJDA 1ABOA 1B3QA 2AK5A 2YT6A 3ULRB 4KRTA 5I11A 3VS6A 2DBKA 2A36A 2KRSA 3M0QA 3CQTA 2J06A 3H41A 4ESRA 4JPBW 1U06A 2JMAA 3VRYA 1GBRA 2DYBA 4A63B 2RQVA 2D8HA 1E6HA 1VYUA 1K0SA 2ED0A 1CSKA 3NPFA 1M3CA 1H3HA 4Y92A 2H8HA 2GNCA 2YUOA 3UF4A 1IO6A 1KIKA 1T3SA 1UGVA 2AZSA 3SHWA 2P4RA 4LUDA 3H0FA 2FPEA 2L3SA 2JS0A 4OMQA 2DL5A 1ARKA 4FSSA 2BTTA 5FWBA 1AWOA 1PKTA 1JQQA 2W10A 2AKKA 2JM9A 2L0AA 5GJWB 1RLQC 4LE9A 2K2MA 2DILA 1AWXA 4J9FA 1T0HA 1UDLA 2GBQA 3PVQA 4Z89A 2KT8A 1U3OA 1HD3A 1OOTA 2FO0A 4JJCA 2FPDA 1NYFA 2YUPA 5IH2A 2DNUA 1S1NA 2I0NA 2FEIA 1GCQA 2YDLA 4HVWA 1FMKA 1PWTA 1NLOC 1AEYA 2NUZA 1U5SA 2EGCA 4ZNXA 2NWMA 1XOVA 4F17A 2D8JA 2DL4A 2K9GA 1X2KA 3JV3A 4LUEA 4CC2A 1UFFA 2RNAA 4J9IA 2BZ8A 2DBMA 1PKSA 2JM8A 1YWOA 1M27C 2GGRA 1K9AA 3GBQA 2HCKA 2D0NA 2DX1A 3M0SA 2RQRA 3LH5A 1J3TA 1JEGA 2YUNA 1MV0B 2CT3A 3I5SA 1W6XA 2V1QA 4RTZA 1UJ0A 1QCFA 3NHNA 2CREA 1QKXA 5IHIA 4DEXA 2LJ0A 1V1CA 1YNZA 4HVUA 5EC7A 2GTOA 2ROTA 4D8DA 3VS0A 4OMNA 4K11A 2ABLA 3VS4A 4JZ3A 2EVRA 5GJVB 2PTKA 1BK2A 4WCIA 2EYXA 3QWXX 2K3BA 2LJ1A 4AFUC 2KRNA 3ZL7C 2DL8A 2KBTA 2LQWA 4Z8AA 1QKWA 3REAB 3VS1A 2ED1A 4J9DA 3VS7A 4AG2C 1UE9A 2YUQA 1MV3A 1QLYA 2DJQA 2HSPA 2E5KA 3EG3A 1OEBA 4OMLA 2D1XA 2RN8A 2J7IA 5IHKA 3O5ZA 2KYMA 1GFDA 1GBQA 3EGUA 2J6KA 2PNIA 2MIOA 2X3XD 2A37A 5IXBA 2KXDA 2QDLA 2EW3A 2KGTA 4CC4B 2KXCA 2OJ2A 3REBB 2JTEA 2DVJA 1UECA 2JMCA 2LZ6B 2KRMA 1W70A 3SEMA 2O9VA 2C0IA 1SHGA 2CUDA 2M0YA 1M3BA 2LP5A 4AFSC 3VS3A 2O9SA 4J9GA 2V1RA 1UUEA 2CT4A 4F16A 4OMMA 2KE9A 4JJDA 1E6GA 5FWCA 1WXBA 1BU1A 2XMFA 2EGEA 2L2PA 2RF0A 4AG1C 4HCKA 3U23A 2IIMA 4RTUA 1PNJA 4LNPA 4J9HA 1RUWA 1A0NB 4GLMA 1M30A 2EKHA 3A98A 1K1ZA 2KEAA 1HSQA 1EFNA 1GL5A 4RTYA 2MOXA 3VRZA 4RTTA 2FG0A 3EHRA 2O88A 1GFCA 2CUBA 1UJYA 2F2WA 2J6OA 2SEMA 3M0RA 2PZ1A 2EYZA 1H8KA 2M51A 1PRMC 1X43A 2RQWA 1ZUKA 1BB9A 2LQNA 1YWPA 3IQLA 1JXOA 1G83A 1KJWA 1B07A 1K0XA 1VA7A 2CSQA 2HDAA 5L23A 2DMOA 2EPDA 2DA9A 2KR3A 2L3QA 1QWFA 2JXBA 3M0PA 1ZBJA 4IIOA 2LMJA 2RQTA 1VYTA 3VS5A 1SRMA 2K79A 4DEYA 1CKAA 1WI7A 4CC3A 2F2VA 1ZUUA 4HVVA 1SSHA 1Z9QA 1GCPA 1RI9A 3H0IA 2FRWA 4M4ZA 1KSWA 2DLPA 1K4US 2FRYA 4RTXA 1NEBA 2EYWA 3NGPA 1AZGB 2G6FX 3TVTA 1I0CA 1BBZA 1TUDA 4HXJA 4J9EA 1SEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SRC A;  1AWJ A;  4GBQ A;  1NLP C;  1WDX A;  1UG1 A;  2MCN A;  3FJ5 A;  3R6N A;  4JZ4 A;  1WYX A;  2EYY A;  5IHN A;  1WFW A;  1UHF A;  4JJB A;  2LJ3 A;  2DL7 A;  2KNB B;  4ORZ A;  3NMZ C;  2A28 A;  2X3W D;  2W0Z A;  3I9Q A;  2ENM A;  2C0O A;  2OAW A;  3M0U A;  1WIE A;  1E7O A;  1AVZ C;  2JT4 A;  2CH4 W;  2VVK A;  3THK A;  1NEG A;  1ZUY A;  2DF6 A;  4OMO A;  3TSZ A;  1X6B A;  1SPK A;  1Z9Z A;  2EQI A;  4EIK A;  1AD5 A;  3QWY A;  4R0K A;  2LNH B;  3PVL A;  3UA7 A;  1WXT A;  2OI3 A;  2DRK A;  1GRI A;  1OPK A;  1YN8 A;  2AZV A;  1I1J A;  1JXM A;  1ABQ A;  1I07 A;  4X1V A;  4E6R A;  2K7A A;  1QWE A;  2RMO A;  2KRO A;  1M8M A;  2O31 A;  4RUG A;  3EHQ A;  5IXF A;  2O2O A;  2LCS A;  1YP5 A;  1KFZ A;  1ZSG A;  1Y0M A;  3PE0 A;  2AKL A;  2DL3 A;  1AZE A;  2CH4 A;  2GTJ A;  1X2Q A;  2DE0 X;  1LCK A;  3UA6 A;  5FW9 A;  3EG2 A;  2FPF A;  2EBP A;  2LX7 A;  1PHT A;  4IIM A;  1OV3 A;  1UHC A;  1X6G A;  1RLP C;  3VS2 A;  2CSI A;  2BZX A;  3RNJ A;  2ESW A;  1MUZ A;  1NYG A;  2KT1 A;  2BZY A;  2CDT A;  2F2X A;  2HBW A;  1AWW A;  1T0J A;  2RPN A;  1WA7 A;  1TG0 A;  1H92 A;  3EG1 A;  2ECZ A;  2B86 A;  4LN2 A;  2JW4 A;  1NM7 A;  1G2B A;  3RBB B;  2A08 A;  4Z88 A;  1TUC A;  2J6F A;  3TSW A;  4OMP A;  2YSQ A;  1WX6 A;  3KFV A;  3H0H A;  3UAT A;  1YCS B;  2JS2 A;  1WXU A;  2DRM A;  2EGA A;  4D8K A;  4F14 A;  1N5Z A;  1Y57 A;  1GCQ C;  1JO8 A;  1AOJ A;  1SRL A;  4RTV A;  1K76 A;  1M3A A;  4QT7 A;  4AFQ C;  1PRL C;  1ZLM A;  1X27 A;  4AFZ C;  1WLP B;  2VKN A;  4J9C A;  2HEQ A;  3I5R A;  1CKB A;  2J05 A;  1FYN A;  2KYB A;  4CC7 A;  1UTI A;  5HCK A;  1NG2 A;  2C0T A;  2RQU A;  1W1F A;  2GQI A;  1JU5 C;  5I22 A;  1T3L A;  1ZX6 A;  1X69 A;  3EG0 A;  4RTW A;  1OPL A;  1VYV A;  3M0T A;  1SHF A;  2ROL A;  2L3P A;  3C0C A;  2DM1 A;  2K6D A;  2VWF A;  4J9B A;  5ECA A;  3I35 A;  1HJD A;  1ABO A;  1B3Q A;  2AK5 A;  2YT6 A;  3ULR B;  4KRT A;  5I11 A;  3VS6 A;  2DBK A;  2A36 A;  2KRS A;  3M0Q A;  3CQT A;  2J06 A;  3H41 A;  4ESR A;  4JPB W;  1U06 A;  2JMA A;  3VRY A;  1GBR A;  2DYB A;  4A63 B;  2RQV A;  2D8H A;  1E6H A;  1VYU A;  1K0S A;  2ED0 A;  1CSK A;  3NPF A;  1M3C A;  1H3H A;  4Y92 A;  2H8H A;  2GNC A;  2YUO A;  3UF4 A;  1IO6 A;  1KIK A;  1T3S A;  1UGV A;  2AZS A;  3SHW A;  2P4R A;  4LUD A;  3H0F A;  2FPE A;  2L3S A;  2JS0 A;  4OMQ A;  2DL5 A;  1ARK A;  4FSS A;  2BTT A;  5FWB A;  1AWO A;  1PKT A;  1JQQ A;  2W10 A;  2AKK A;  2JM9 A;  2L0A A;  5GJW B;  1RLQ C;  4LE9 A;  2K2M A;  2DIL A;  1AWX A;  4J9F A;  1T0H A;  1UDL A;  2GBQ A;  3PVQ A;  4Z89 A;  2KT8 A;  1U3O A;  1HD3 A;  1OOT A;  2FO0 A;  4JJC A;  2FPD A;  1NYF A;  2YUP A;  5IH2 A;  2DNU A;  1S1N A;  2I0N A;  2FEI A;  1GCQ A;  2YDL A;  4HVW A;  1FMK A;  1PWT A;  1NLO C;  1AEY A;  2NUZ A;  1U5S A;  2EGC A;  4ZNX A;  2NWM A;  1XOV A;  4F17 A;  2D8J A;  2DL4 A;  2K9G A;  1X2K A;  3JV3 A;  4LUE A;  4CC2 A;  1UFF A;  2RNA A;  4J9I A;  2BZ8 A;  2DBM A;  1PKS A;  2JM8 A;  1YWO A;  1M27 C;  2GGR A;  1K9A A;  3GBQ A;  2HCK A;  2D0N A;  2DX1 A;  3M0S A;  2RQR A;  3LH5 A;  1J3T A;  1JEG A;  2YUN A;  1MV0 B;  2CT3 A;  3I5S A;  1W6X A;  2V1Q A;  4RTZ A;  1UJ0 A;  1QCF A;  3NHN A;  2CRE A;  1QKX A;  5IHI A;  4DEX A;  2LJ0 A;  1V1C A;  1YNZ A;  4HVU A;  5EC7 A;  2GTO A;  2ROT A;  4D8D A;  3VS0 A;  4OMN A;  4K11 A;  2ABL A;  3VS4 A;  4JZ3 A;  2EVR A;  5GJV B;  2PTK A;  1BK2 A;  4WCI A;  2EYX A;  3QWX X;  2K3B A;  2LJ1 A;  4AFU C;  2KRN A;  3ZL7 C;  2DL8 A;  2KBT A;  2LQW A;  4Z8A A;  1QKW A;  3REA B;  3VS1 A;  2ED1 A;  4J9D A;  3VS7 A;  4AG2 C;  1UE9 A;  2YUQ A;  1MV3 A;  1QLY A;  2DJQ A;  2HSP A;  2E5K A;  3EG3 A;  1OEB A;  4OML A;  2D1X A;  2RN8 A;  2J7I A;  5IHK A;  3O5Z A;  2KYM A;  1GFD A;  1GBQ A;  3EGU A;  2J6K A;  2PNI A;  2MIO A;  2X3X D;  2A37 A;  5IXB A;  2KXD A;  2QDL A;  2EW3 A;  2KGT A;  4CC4 B;  2KXC A;  2OJ2 A;  3REB B;  2JTE A;  2DVJ A;  1UEC A;  2JMC A;  2LZ6 B;  2KRM A;  1W70 A;  3SEM A;  2O9V A;  2C0I A;  1SHG A;  2CUD A;  2M0Y A;  1M3B A;  2LP5 A;  4AFS C;  3VS3 A;  2O9S A;  4J9G A;  2V1R A;  1UUE A;  2CT4 A;  4F16 A;  4OMM A;  2KE9 A;  4JJD A;  1E6G A;  5FWC A;  1WXB A;  1BU1 A;  2XMF A;  2EGE A;  2L2P A;  2RF0 A;  4AG1 C;  4HCK A;  3U23 A;  2IIM A;  4RTU A;  1PNJ A;  4LNP A;  4J9H A;  1RUW A;  1A0N B;  4GLM A;  1M30 A;  2EKH A;  3A98 A;  1K1Z A;  2KEA A;  1HSQ A;  1EFN A;  1GL5 A;  4RTY A;  2MOX A;  3VRZ A;  4RTT A;  2FG0 A;  3EHR A;  2O88 A;  1GFC A;  2CUB A;  1UJY A;  2F2W A;  2J6O A;  2SEM A;  3M0R A;  2PZ1 A;  2EYZ A;  1H8K A;  2M51 A;  1PRM C;  1X43 A;  2RQW A;  1ZUK A;  1BB9 A;  2LQN A;  1YWP A;  3IQL A;  1JXO A;  1G83 A;  1KJW A;  1B07 A;  1K0X A;  1VA7 A;  2CSQ A;  2HDA A;  5L23 A;  2DMO A;  2EPD A;  2DA9 A;  2KR3 A;  2L3Q A;  1QWF A;  2JXB A;  3M0P A;  1ZBJ A;  4IIO A;  2LMJ A;  2RQT A;  1VYT A;  3VS5 A;  1SRM A;  2K79 A;  4DEY A;  1CKA A;  1WI7 A;  4CC3 A;  2F2V A;  1ZUU A;  4HVV A;  1SSH A;  1Z9Q A;  1GCP A;  1RI9 A;  3H0I A;  2FRW A;  4M4Z A;  1KSW A;  2DLP A;  1K4U S;  2FRY A;  4RTX A;  1NEB A;  2EYW A;  3NGP A;  1AZG B;  2G6F X;  3TVT A;  1I0C A;  1BBZ A;  1TUD A;  4HXJ A;  4J9E A;  1SEM A; 
#chains in the Genus database with same CATH topology
 4FYX B;  2P0K A;  5DLQ E;  5CK9 A;  2D6F A;  2EQU A;  4DOV A;  1WFW A;  1UHF A;  1C6V X;  4NL3 A;  1VQN A;  4C92 E;  1NJI U;  3RER A;  3CC2 A;  4JJB A;  3RKX A;  2ZPE B;  1VQ5 T;  1OUL A;  2DTO A;  3OQ5 A;  1RAE B;  1RAB B;  1WIE A;  1AVZ C;  1RAF B;  2NUT B;  4B9W A;  4IUV A;  2VVK A;  3E9G A;  3L2W A;  1X6B A;  3OW2 A;  5HY6 A;  4N4H A;  4KH0 B;  1TOV A;  2OI3 A;  2RO0 A;  3SFM A;  2DRK A;  2ZCF B;  2E1H A;  1OPK A;  3CCS Q;  1Q86 R;  2EQM A;  2L8D A;  4E6R A;  4JJN K;  4J7F A;  3CCR T;  3I55 T;  4JRI A;  4M78 G;  1D0Y A;  3OYJ A;  3CCQ Q;  2O31 A;  4PFP A;  3HFO A;  3FEO A;  4PJO C;  5EG2 A;  2DEQ A;  4KT0 E;  2OAU A;  1YP5 A;  1KFZ A;  1ZSG A;  1Y0M A;  2DZ9 A;  2LCL A;  2MK5 A;  1U1S A;  5HK3 A;  4Z02 A;  3MCA B;  3CCS A;  1Q82 C;  1WHH A;  2P0P A;  3PFS A;  1X6G A;  1WPY A;  2CSI A;  2QQB A;  3L2Z A;  3CCQ A;  3JCM Q;  1G3S A;  3CPF A;  2R58 A;  2KT1 A;  2BZY A;  4F7U F;  2VC8 A;  2EQJ A;  1PCX A;  2RPN A;  4YTL A;  2DAQ A;  5GAM g;  5GAN f;  4LN2 A;  2KK4 A;  1IHV A;  3KBG A;  1BI2 A;  1FMW A;  1VIE A;  2A08 A;  4Z88 A;  2JTF A;  3TSW A;  3OYC A;  1FMV A;  3KFV A;  3JCM b;  3H0H A;  2K4Y A;  4FM4 B;  1YCS B;  2VUB A;  4C0G A;  2DD5 A;  2EGA A;  1WNL A;  2A7Y A;  2X4J A;  3H6Z A;  3N5B B;  1Y57 A;  3HHT B;  5GAN j;  3FRN A;  3D7S B;  1JO8 A;  3G7Z A;  1SRL A;  3OB9 A;  3GOX A;  1M3A A;  1BIB A;  3JCM f;  4AFQ C;  2V8K A;  1ZLM A;  4XTW A;  1X27 A;  2YWW A;  3ER0 A;  1D3B A;  2FL7 A;  2D9T A;  5GAO n;  3I5R A;  3JAM E;  3MP8 A;  3CCS T;  1M9S A;  3BY7 A;  1Q86 C;  4CC7 A;  3QDR B;  2EWN A;  2E64 A;  1NG2 A;  1G3W A;  3RES A;  3NTH A;  3CCQ T;  3SD4 A;  2DTH A;  1ZX6 A;  1Y96 B;  3MPU B;  1UB4 A;  2L3P A;  4LDU A;  2VWF A;  5KCH A;  5DLO A;  1HJD A;  1M2V A;  4DA4 A;  3QYH B;  2YT6 A;  3ULR B;  2R5M A;  2X4Y A;  4PJL A;  4JRQ A;  3CQT A;  2J06 A;  4IUT A;  3P8H A;  2QXF A;  4JPB W;  4NOY A;  5GAN 4;  5CQY A;  4BDZ A;  2MI6 A;  1IRX A;  4BE0 A;  4PFO A;  3RKW A;  2OTL Q;  2B8A A;  4ZN3 A;  1E6H A;  3QO3 A;  3C95 A;  1NBE B;  3NPF A;  2XDD A;  1M3C A;  3GIB A;  1RAI B;  3QYG B;  1IO6 A;  1KIK A;  2CP6 A;  2HAX A;  2P4R A;  1B7T A;  3H0F A;  2FPE A;  5LJ5 f;  4BI3 A;  2K5L A;  4OMQ A;  2L5Q A;  1K8A R;  4FSS A;  4F7U B;  2W10 A;  1M2O A;  4LE9 A;  2F1L A;  2K2M A;  2FHD A;  1MNE A;  2OTL A;  1QVF P;  2LRQ A;  2CP7 A;  2JTM A;  5LJ5 j;  2FPD A;  4C5G A;  2DYI A;  2YUP A;  5IH2 A;  2DNU A;  3P8B B;  2CZ0 B;  2RK1 A;  1FMK A;  1JJ2 A;  2NWM A;  2F69 A;  4F17 A;  3DLL A;  1ZSZ A;  2DL4 A;  3JV3 A;  3LWH A;  3VJP A;  1UFF A;  3WVE B;  2DBM A;  2DIG A;  2JM8 A;  3I56 T;  1M27 C;  4J5Y A;  2E4H A;  4C8Q E;  3GBQ A;  2DX1 A;  1YJN T;  3M0S A;  1TUG B;  1MV0 B;  3CCM A;  1W6X A;  4RTZ A;  1WHM A;  5KYY B;  1IRE B;  1QCO A;  1SG5 A;  1G5V A;  3CD6 Q;  2QA4 Q;  3OSS C;  2LJ0 A;  3QSU A;  4E2F B;  3BDU A;  4M7D F;  2RHY A;  4JDS A;  2ABL A;  2Y4Y A;  3QII A;  4J6Y A;  1BK2 A;  1KQ2 A;  2K3B A;  2GQV A;  4A4K A;  3VYH B;  1F1B B;  4M7D E;  3REA B;  4A54 A;  4NL2 A;  1QVG A;  1QLY A;  2HSP A;  3CD6 A;  2QA4 A;  4LXC A;  3EG3 A;  3ME9 A;  2D1X A;  3CCV Q;  1YFN A;  1HYO A;  3EGU A;  1Q7Y R;  1K8A C;  2HMA A;  2KXD A;  3DLM A;  1QMC A;  1VQM Q;  2JTE A;  1IB8 A;  3HRS A;  3UPU A;  3CCM T;  2CUD A;  3TQ7 P;  5KH6 A;  4BB7 A;  2LP5 A;  3E19 A;  3SWN C;  2HZY A;  3BE3 A;  3LGF A;  5GAN 3;  2ZAE A;  2CT4 A;  4F16 A;  5J39 A;  4QW2 A;  2M9U A;  5C0M A;  2EAY A;  5CKH A;  1M4Z A;  2EGE A;  2RF0 A;  3CCV A;  3L2Q A;  3L1A A;  2NUP A;  2LVM A;  2Y90 A;  4J9H A;  1RUW A;  4OB0 B;  1VQM A;  2EKH A;  1YIJ Q;  3A98 A;  1HSQ A;  3NFC A;  4O5V A;  3J81 E;  1VQP T;  2QA4 T;  3CD6 T;  3VU3 C;  5GAM f;  4KUI A;  3X28 B;  3CXC A;  5AYF A;  1UJY A;  2SEM A;  4N4I A;  2OX7 A;  2PZ1 A;  2QI2 A;  1OX8 A;  1BIA A;  1QW1 A;  3OW2 S;  2QDY B;  2QG9 B;  5GAM j;  4J8O A;  1JXO A;  1G83 A;  1G3Y A;  1YIJ A;  1VA7 A;  4M77 E;  4M7D B;  1SKU B;  2JXB A;  3M0P A;  2QAZ A;  1VUB A;  2LMJ A;  1RI0 A;  2VGM A;  2QEX T;  4ELZ C;  5GAN g;  5KE3 A;  3FDR A;  3SWN B;  1IXD A;  2H3E B;  4DEY A;  5HKC A;  1Q7Y C;  3PIO A;  5GAM d;  2ZPB B;  1ZUU A;  3LGL A;  5A0L A;  3P8D A;  4OGC A;  2BE9 B;  2FRW A;  4M4Z A;  1D0Z A;  4LD6 A;  2FRY A;  4EPC A;  4HT9 A;  1WQ7 A;  4QVZ A;  4ZGE B;  2FVU A;  1YBY A;  4PL6 A;  4BAC A;  1VQ7 Q;  3A8O B;  2DTI A;  1M90 U;  1YJW Q;  4HXJ A;  3JCM g;  2SRC A;  4X34 A;  1UG1 A;  2M0O A;  4E47 A;  3R6O A;  1D09 B;  2EKO A;  1V29 B;  3C94 A;  4RCC A;  4EMK A;  1M1K U;  3G71 T;  5GAM h;  1Q81 U;  4XTV A;  3NMZ C;  2A28 A;  4JS4 A;  2W0Z A;  3I9Q A;  2ENM A;  5GAN 7;  2C0O A;  1VQ7 A;  3CCE Q;  4IKF A;  1E7O A;  2CP2 A;  2CH4 W;  1P92 A;  1YJW A;  1NEG A;  1WJR A;  1SPK A;  2XIC A;  1Z9Z A;  1R8O B;  2EQI A;  4IUQ A;  4DBH A;  4EIK A;  1AD5 A;  3QWY A;  4R0K A;  3PVL A;  1NE8 A;  1WXT A;  2BE7 D;  2DXC A;  1RL2 A;  1YN8 A;  2G3R A;  1ABQ A;  4M75 F;  1I07 A;  4IUR A;  1W2B P;  2K7A A;  1KC8 R;  2ZPI B;  5CR2 A;  1M8M A;  4RUG A;  1C0M A;  2QTV A;  3CCE A;  2O2O A;  4PJO D;  5GAO q;  2NUT A;  1AZE A;  2GTJ A;  2JZ2 A;  1LCK A;  2FPF A;  4BI8 B;  4BE1 A;  2LX7 A;  7AT1 B;  2HQE A;  4IIM A;  5LJ5 g;  4PKC C;  3QDF A;  5CKB A;  3VS2 A;  4M75 C;  3L42 A;  1NYG A;  1YJW T;  1MND A;  3QHS A;  3I55 Q;  3HSB A;  3HFN A;  1AWW A;  4JS5 A;  1WA7 A;  1H92 A;  2RJD A;  5CKE A;  2FZC B;  3S3M A;  2X35 A;  5KYU B;  1NM7 A;  4M7A F;  3RBB B;  3CC4 Q;  2DO3 A;  4QQD A;  1XQH A;  2JNG A;  2QK0 A;  2IVW A;  4D6W A;  2M16 A;  3V8K A;  2KSS A;  4J6X A;  2YLC A;  1N5Z A;  5LL6 S;  1AT1 B;  1GCQ C;  1Q82 R;  4DQ2 A;  1H64 1;  5C6S A;  3OS0 A;  1LVK A;  3OBW A;  3GPL A;  1KQS P;  1K76 A;  4XK8 E;  2MWO A;  3A8G B;  3JSC A;  3I55 A;  2MF2 A;  4C92 F;  1MGQ A;  4AFZ C;  1DJ7 B;  2VKN A;  3M59 A;  3CC4 A;  3GNF B;  2J05 A;  1FYN A;  4ZGD B;  1UTI A;  1BI1 A;  3MJX A;  4HCZ A;  2RQU A;  4XU1 A;  3PIP A;  1KC8 C;  5GMK i;  1S72 T;  4M7A C;  1YI2 T;  3WVD B;  1Q95 G;  5I22 A;  1KD1 R;  4M78 E;  3Q1J A;  2E5Q A;  2QAS A;  2LTO A;  1JJ2 S;  1Y7X A;  2COY A;  4RTW A;  3QPH A;  1IZ6 A;  3M0T A;  2ROL A;  3OYG A;  2CYZ B;  4M75 B;  2DM1 A;  1ABO A;  4QKU A;  2AK5 A;  4KRT A;  2QGF B;  1D1B A;  5I11 A;  4PJO A;  4C92 C;  2DBK A;  3L2U A;  4OVA A;  2A36 A;  2IG0 A;  3M0Q A;  4FU6 A;  4XTX A;  2QYZ A;  1U06 A;  1LPL A;  2JMA A;  2XHC A;  1K9M U;  1GBR A;  4A63 B;  1Y96 A;  1NJI R;  2D8H A;  1K0S A;  1BKB A;  3CC4 T;  5GAN e;  4Y92 A;  4NS5 A;  4UC4 A;  2H8H A;  1GXI E;  2E3I A;  3ASK A;  1D1A A;  3RUX A;  1OYX A;  3X24 B;  4PK4 A;  3ZFJ A;  3BDL A;  3X20 B;  1OU8 A;  4MML A;  1I4K 1;  1MMA A;  4N0A A;  1QVG S;  5CQX A;  5LJ3 f;  3LX7 A;  3LWI A;  5FWB A;  1WHK A;  4WF2 A;  2AKK A;  4VUB A;  4E7L A;  1B34 B;  2DIL A;  1LNX A;  1UDL A;  4M7A B;  1N8R R;  3OS2 A;  4Z89 A;  1U3O A;  1HD3 A;  1OOT A;  3JCM e;  4N0A C;  2KQW A;  3EAE A;  5CO7 A;  4PJO G;  5LJ3 j;  4EMG A;  1RAG B;  1VQO Q;  2ZZD A;  4EMH A;  4HVW A;  1PWT A;  3C12 A;  4C0F A;  1KD1 C;  4R56 A;  2D8J A;  3F70 A;  1X2K A;  1RAH B;  1BYM A;  4P5N A;  1PKS A;  2KI7 A;  1VQ8 T;  4C92 B;  4F7U A;  1YHQ T;  4KGX B;  5GAN 5;  3LH5 A;  8ATC B;  2QQ9 A;  1JEG A;  1TU0 B;  4C5H A;  2L89 A;  1UJ0 A;  1QCF A;  1QKX A;  5IHI A;  4HVU A;  5EC7 A;  1VQO A;  2WAC A;  1XNI A;  3PNW C;  4D8D A;  3VS0 A;  1MHN A;  4OMN A;  4JRK A;  5GAN d;  3X25 B;  4PJN A;  2DD4 A;  2P0Q A;  3OYF A;  4WCI A;  4ZTF A;  3CXC S;  1BCO A;  4PLL A;  1NJI C;  1RAA B;  4QQ6 A;  2AHJ B;  2VXF A;  4FW1 A;  1VQL Q;  3I56 Q;  1UGR B;  5FRN A;  4AG2 C;  1YJN Q;  2RK2 A;  2YUQ A;  1MV3 A;  5KYY A;  1X6O A;  3V7C A;  2RN8 A;  5KYW A;  1GFD A;  1N9S A;  3JCM d;  1GBQ A;  4HCC A;  2J6K A;  3EG9 B;  3OYL A;  1KHC A;  3ZEH A;  4F7U G;  5LJ5 e;  1MMN A;  2EW3 A;  4CC4 B;  2RHZ A;  1YJ9 A;  2OJ2 A;  3REB B;  2HBP A;  5GMK l;  1UEC A;  2LZ6 B;  3EFR A;  2CZ6 B;  1TTH B;  1N8R C;  5GAN h;  1W70 A;  4BI4 A;  2O9V A;  4RG8 A;  1SHG A;  1M3B A;  4DBR A;  5FU6 B;  3EGX B;  1VQL A;  3I56 A;  2V1R A;  1UUE A;  1VQO T;  2QGG A;  2HL3 A;  2BIV A;  4OMM A;  2KE9 A;  3TEE A;  3JB9 J;  3QJ6 A;  1E6G A;  4MDX A;  1VQ4 Q;  1YJN A;  4KH1 B;  3HL8 A;  4ELY C;  1Y71 A;  1PNJ A;  2DVE A;  5DM7 R;  1MMD A;  3JCM h;  1G8X A;  1BCM A;  2KEA A;  2GCX A;  3CCM Q;  2MOX A;  2RI5 A;  2HD0 A;  3S3N A;  1VQ4 A;  3JB9 F;  2DPP B;  3MEU A;  3EHR A;  1GFC A;  2DXT A;  3SDZ A;  2A0F B;  3OYK A;  4C8Q F;  1YJ9 T;  2EYZ A;  2M51 A;  3TCJ A;  1PRM C;  3PMT A;  2YHT A;  4AMC A;  3HP9 A;  3KUF A;  2MWP A;  1VQL T;  2LT1 A;  5FRM A;  5L23 A;  4QVD A;  5LJ5 d;  2EPD A;  2KR3 A;  2DA9 A;  3JCM P;  3OS5 A;  1ZBJ A;  5KYN A;  1X75 C;  2RJC A;  2MAM A;  2K79 A;  1VQP Q;  1CKA A;  3M4Y A;  4V2S A;  2QQA A;  1VQ6 T;  3HRT A;  5KYX A;  1SSH A;  1Z9Q A;  2DJZ A;  2K3Y A;  2K5F A;  1KQ1 A;  3VUB A;  1K4U S;  3MEV A;  4C8Q C;  3EH1 A;  2F5T X;  1WGS A;  1VQ4 T;  2HQH A;  2XD0 A;  5LJ5 h;  3ZBD A;  1AWJ A;  1VQP A;  1WDX A;  2R57 A;  3FJ5 A;  3R6N A;  3OYH A;  2CZ7 B;  2YRC A;  2LQK A;  2QEX Q;  3SWN A;  2EYY A;  4FIB A;  4A4H A;  3G4S T;  4HCB A;  2BUD A;  2LJ3 A;  1AHJ B;  2DET A;  4XTZ A;  1U8R A;  2X4X A;  4ANJ A;  4M7D C;  2X3W D;  1I8F A;  1KG1 A;  2JT4 A;  4XTU A;  3THK A;  1ZUY A;  2RHX A;  3DB4 A;  5GAM e;  4OMO A;  3SB2 A;  3TSZ A;  2PU9 B;  1WHJ A;  2RH2 A;  2ZPF B;  2LNH B;  2CP0 A;  1ZA1 B;  1GRI A;  2BKD N;  4E7I A;  2QEX A;  2HKQ B;  2P84 A;  1JXM A;  4EDU A;  4MZP A;  3QUI A;  3QG1 A;  5I21 A;  1QWE A;  3RDV A;  2RMO A;  3M55 A;  4IUP A;  4GLK A;  3V8L A;  3G71 Q;  2L3R A;  2E65 A;  2MMP A;  4E7K A;  5IXF A;  4C8Q B;  3CMA A;  3PE0 A;  2DL3 A;  4PNO A;  2LT4 A;  3OY9 A;  1ZSZ B;  1KHI A;  4MMK A;  1X2Q A;  1W2B A;  2EFI A;  2XDB A;  4E7H A;  3UA6 A;  3EG2 A;  3JCM c;  3CC7 Q;  2EBP A;  4M77 F;  3QZ9 B;  1JJ2 P;  1OV3 A;  1TSF A;  3RMS A;  5LJ3 g;  3JCM W;  1RLP C;  3CCU Q;  1IGU A;  3LW5 E;  3RNJ A;  3G71 A;  2ESW A;  5IAY A;  2XK0 A;  1XTD A;  4M75 D;  4X9D A;  2H3J A;  5D6X A;  2HBW A;  2O4X B;  1T0J A;  3AT1 B;  1TG0 A;  2Y4X A;  1D1C A;  2B86 A;  1RAD B;  2CP3 A;  1PSF A;  2M02 A;  5GAO l;  3S6W A;  2PVD B;  4OMP A;  3CC7 A;  1WX6 A;  2WSE E;  3EFS A;  3EFO B;  2I2L A;  1WXU A;  2DRM A;  2VV5 A;  4D8K A;  1M5Q 1;  3L2V A;  4LDW A;  1AOJ A;  4M77 C;  4OB2 B;  2GF7 A;  3CCU A;  5A2Q E;  4A4G A;  3CMA T;  3M5A A;  4LDX A;  2COZ A;  3RR6 A;  2RJE A;  1TWB A;  1WLP B;  3VKI A;  1QVG P;  2GFU A;  2HEQ A;  1G3T A;  5KYU A;  4FCY A;  2C0T A;  2AT1 B;  5KE2 A;  2GQI A;  1JU5 C;  4JRP A;  1KQS A;  4M7A D;  2AIR B;  1T3L A;  2CKK A;  3CPW A;  3EG0 A;  1VYV A;  4L6V 5;  1UGQ B;  2DXU A;  3C0C A;  2HNI A;  3LYI A;  5J26 A;  5ECA A;  3I35 A;  3CC7 T;  4RCB A;  1B3Q A;  2EIF A;  1M90 R;  9ATC B;  5CVI A;  2NLU A;  4C92 D;  3PTA A;  1Y07 A;  2JOY A;  3OMG A;  3RMQ A;  4ESR A;  3CCU T;  3OYB A;  1S72 Q;  1YI2 Q;  3VV0 A;  2DK3 A;  2XKO C;  2E10 A;  1VQ9 T;  2DYB A;  2CZ1 B;  1M1K R;  1CSK A;  2KAF A;  4M77 B;  4MDW A;  4DBF A;  1UGV A;  4M75 A;  3CXC P;  4HT8 A;  2L3S A;  4A53 A;  3JB9 H;  3L2R A;  1ARK A;  2BTT A;  3GNG A;  1JQQ A;  3MHX A;  1VQK T;  2JM9 A;  2L0A A;  2RM4 A;  1S72 A;  1YI2 A;  4II1 A;  1SSF A;  1AWX A;  4J9F A;  5L8R E;  5GAO p;  2GBQ A;  1PSE A;  4GY5 A;  2E41 A;  5GMK m;  2ZPH B;  2FO0 A;  4MZT A;  2M1H A;  2RHI A;  1S1N A;  2FEI A;  1YIT T;  1GCQ A;  2YDL A;  2DER A;  1Q82 U;  4PJM A;  1NPR A;  2EGC A;  1XOV A;  3CCJ Q;  2DIQ A;  4PJJ A;  4CC2 A;  4LUE A;  3J80 E;  4J9I A;  1JBM A;  2GGR A;  1K9A A;  2HCK A;  3H8Z A;  4L5G A;  1B34 A;  2YUN A;  4M75 G;  1KK7 A;  2A3L A;  4FT2 A;  4M7A A;  3M56 A;  3NHN A;  4HA8 A;  4O6J A;  1KD1 U;  1V1C A;  4M78 F;  1M90 C;  2ROT A;  4XQ3 A;  2E70 A;  3EGD B;  4K11 A;  2CP5 A;  3CCJ A;  2K2V A;  2WSF E;  5GJV B;  2PTK A;  2EYX A;  2PUO B;  3MKD A;  2LJ1 A;  4AFU C;  3OYD A;  1M1K C;  3NTI A;  1NZ9 A;  3ZL7 C;  2LQW A;  4Z8A A;  3OSV A;  4C92 A;  1PC0 A;  2LQ8 A;  1R0B G;  1VQ8 Q;  2K57 A;  4J9D A;  2X9H A;  3JRZ A;  3VS7 A;  1YHQ Q;  1UE9 A;  3S3O A;  1Q86 U;  1C1A A;  2E5K A;  4TVR A;  1SF9 A;  2KMT A;  4OML A;  2J7I A;  5IHK A;  3PGG A;  2KYM A;  2HQX A;  2MIO A;  4PJO F;  2X3X D;  2A37 A;  4Q5W A;  4M78 C;  2KGT A;  2QDL A;  5LJ3 e;  1K73 R;  3QJY A;  2DVJ A;  2JMC A;  1QP3 A;  2KRM A;  4A4E A;  4M7A G;  3SEM A;  3CEY A;  2K3X A;  2M0Y A;  2O9S A;  4F04 B;  3MO8 A;  1R77 A;  2F5K A;  1VQ8 A;  4PJO E;  4JJD A;  1YHQ A;  1QQJ A;  5CCA A;  3CME T;  3V7S A;  5D6Y A;  1BU1 A;  1RAC B;  1ZA2 B;  2XMF A;  4XAX B;  3X26 B;  2PUK B;  3U23 A;  3CCJ T;  1N8R U;  5FLX E;  3A8M B;  4L59 A;  4E7S A;  3EG9 A;  4C92 G;  4GLM A;  1M30 A;  3E1S A;  2HL5 C;  4KGV B;  1K1Z A;  3LH0 A;  5I2S A;  3JCM J;  5D6W A;  1EFN A;  4ATO A;  1BI0 A;  1N27 A;  1PD1 A;  4A4F A;  1GL5 A;  4RTY A;  3O8V A;  3EGX A;  3VRZ A;  3QBY A;  3UT1 A;  2DFU A;  2RA2 A;  1K9M R;  1K73 U;  2O88 A;  1VQN T;  4J7I A;  4FL6 A;  1MMG A;  2DXB A;  2RJF A;  2D0Q B;  2F2W A;  4XU0 A;  3CC2 T;  3A5Z B;  3M0R A;  4BUG A;  2FB7 A;  5DY9 A;  1H8K A;  1X43 A;  2RQW A;  5FU6 C;  3IQL A;  1BB9 A;  2LQN A;  4X9C A;  4OP0 A;  2EQK A;  1XJW B;  4E7J A;  1KJW A;  1B07 A;  3H9N A;  1K0X A;  2HDA A;  1QVF A;  4M78 B;  4C0D C;  5LJ3 d;  5A0G A;  1ZHI A;  2R5A A;  4IIO A;  1M1G A;  2RQT A;  3NTK A;  4DOW A;  3VS5 A;  5IN1 A;  2KDS A;  1EZZ B;  2K5I A;  2OTJ Q;  5HK0 A;  1OU9 A;  4CC3 A;  4F7U E;  1K73 C;  2YRD A;  3QXE B;  3E2U A;  2PVG B;  1RI9 A;  3H0I A;  2XDP A;  4B9X A;  1KSW A;  1YJ9 Q;  3JB9 D;  2YLB A;  1W2B S;  1OQK A;  4BE2 A;  2LX9 A;  4RTX A;  4C8Q D;  2EYW A;  3NGP A;  1AZG B;  2G6F X;  2EJ9 A;  5GAN 8;  2KY9 A;  2V8I A;  3CBP A;  1I0C A;  3MEW A;  4J9E A;  3HRU A;  4FT4 A;  4BDY A;  4PJO B;  4GBQ A;  5LJ3 h;  5CAI A;  1NLP C;  4PLI A;  2MCN A;  4FYY B;  3M9Q A;  4JZ4 A;  3OW2 P;  2OTJ A;  1WYX A;  5IHN A;  1IGQ A;  4QVC A;  1N9R A;  2LC4 A;  1TS9 A;  5GAO m;  1VQ6 Q;  2DL7 A;  2KNB B;  4ORZ A;  3A8L B;  2RI2 A;  2GFA A;  1ZQ1 A;  4M7D D;  2OAW A;  3M0U A;  4AT1 B;  3OYM A;  4KGZ B;  2DF6 A;  4Y28 E;  1K9M C;  3JB9 I;  3C4S A;  4KUL A;  3A1P A;  4C0D B;  1K8A U;  3UA7 A;  2YRV A;  3HKS A;  4DBQ A;  1O9S A;  2AZV A;  3FLG A;  1I1J A;  4JLG A;  4X1V A;  4BY6 C;  2YXY A;  4FYV B;  2VAS A;  1PM3 A;  1VQ6 A;  3CCL Q;  2KRO A;  3G4S Q;  5CIU A;  3OYA A;  1X01 A;  3EHQ A;  1QVP A;  5D7U A;  1UGP B;  4B6M A;  4BD3 A;  2LCS A;  1KQS S;  4FYW B;  3CPW S;  2AKL A;  2CH4 A;  2OTJ T;  2COW A;  2DE0 X;  5FW9 A;  4QQG A;  2VYT A;  4R55 A;  1WQW A;  1PHT A;  3A8H B;  1WJQ A;  1NPP A;  1UHC A;  3JCM V;  1FX7 A;  2LNV A;  3CCL A;  3G4S A;  3URG A;  2BZX A;  4WTO B;  1MUZ A;  2LCC A;  3GF5 A;  2CDT A;  2F2X A;  1D3B B;  4FSX A;  3EG1 A;  4ZN1 A;  2ECZ A;  2JW4 A;  1G2B A;  4C8Q A;  3OA6 A;  3OYY A;  1TUC A;  2J6F A;  2JUF A;  2HKN A;  2YSQ A;  2CGH A;  4KBM B;  3UAT A;  2XG8 D;  3GLX A;  2JS2 A;  4F14 A;  3RIR A;  4CRI A;  2HSE B;  2PVO B;  5GAO r;  4RTV A;  4BY6 B;  4M77 D;  4FW2 A;  1ZSZ C;  4E7Z A;  4QT7 A;  1PRL C;  1Q7Y U;  1YCY A;  1JRI A;  1M2V B;  5KYW B;  2O4X A;  3QZ5 B;  3V7R A;  4J9C A;  4LDV A;  3RKY A;  4M7D A;  1CKB A;  4RMO A;  2KYB A;  5HCK A;  3OYN A;  1OI1 A;  5KCO A;  1W1F A;  4XU3 A;  5J3B A;  3CCL T;  3EFO A;  2O01 E;  4C5E A;  2OTL T;  3JB9 G;  1X69 A;  2PQW A;  1FWZ A;  1OPL A;  4C8Q G;  4RKU E;  3DB3 A;  3BW1 A;  1I81 A;  2RB6 A;  2V8J A;  2DKG A;  3FC3 A;  1QCN A;  1SHF A;  3CMA Q;  1R0C B;  2K6D A;  4J9B A;  4OGE A;  2Z0W A;  3TU4 K;  3KXT A;  3EH2 A;  3UDC A;  3BFM A;  5GMK e;  3VS6 A;  3AHU A;  5GAN 6;  3QKJ A;  2KRS A;  5AT1 B;  3OS1 A;  3H41 A;  2VXE A;  3GP8 A;  3VYG A;  3VRY A;  8AT1 B;  3E9F A;  1WHG A;  2QQR A;  2RQV A;  1VYU A;  4M7D G;  2ED0 A;  1U1T A;  4LD9 K;  1H3H A;  2YUO A;  2GNC A;  1ACM B;  2CS7 A;  3OYI A;  3UF4 A;  3J7A F;  1T3S A;  2AZS A;  3HPW A;  2FYK A;  2RD1 A;  2DEU A;  1FXX A;  4J83 A;  2E6N A;  3SHW A;  4LUD A;  2JS0 A;  5FRO A;  2DL5 A;  2VB6 A;  1OZ2 A;  4HKE A;  1AWO A;  1PKT A;  5GJW B;  1RLQ C;  3CBM A;  4ZTJ A;  3FJP A;  1T0H A;  3LLR A;  3PVQ A;  2EJF A;  2KT8 A;  2VGN A;  3JCM X;  3PT9 A;  2P4T A;  4JJC A;  4ZGJ B;  1VQ9 Q;  1NYF A;  5GMK j;  5KYX B;  2I0N A;  1TXQ A;  4OMF B;  1NLO C;  3PMI A;  4M77 A;  1I5L A;  1AEY A;  2NUZ A;  2EJG A;  1U5S A;  4ZNX A;  2E3H A;  3VUZ A;  1JB0 E;  2K9G A;  3G1J A;  2RI3 A;  2RNA A;  1OX9 A;  4PFZ A;  2BZ8 A;  3DKM A;  1YWO A;  2D0N A;  2V26 A;  2RQR A;  1J3T A;  3UWN A;  1VQK Q;  2CT3 A;  3I5S A;  2LDM A;  3CCV T;  2V1Q A;  2CRE A;  3FIF A;  2RHU A;  4DEX A;  1YNZ A;  4RG2 A;  1VQ9 A;  5FU7 C;  1O75 A;  1M8V A;  2GTO A;  2JJ9 A;  5IT9 E;  1M1F A;  2QQS A;  1VQM T;  1YIT Q;  1WJS A;  3VS4 A;  4JZ3 A;  2EVR A;  2FZK B;  1WZO A;  3V8J A;  4C5I A;  4OB3 B;  3QWX X;  5M9O A;  2KRN A;  4LDY A;  2DL8 A;  2KBT A;  1QKW A;  4M77 G;  3MP6 A;  1VQK A;  3VS1 A;  2JVV A;  2ED1 A;  2X51 A;  4XTY A;  3G6E Q;  1V76 A;  2KVQ G;  1PD0 A;  5GMK h;  2DJQ A;  1OEB A;  1I5O B;  1KC8 U;  1QVF S;  2NUP B;  3OBY A;  3O5Z A;  2PNI A;  1EIF A;  1W4S A;  5IXB A;  1YIT A;  5A0D A;  4KUD K;  1YIJ T;  4IUU A;  2KXC A;  3MET A;  3EGD A;  3HTR A;  3TRE A;  4M78 D;  5GAN 2;  2XID A;  1H3Z A;  1LJO A;  4JLI A;  4OF1 A;  2C0I A;  1WHL A;  2DZC A;  4AFS C;  3VS3 A;  4JUV A;  4J9G A;  2X4W A;  3FB9 A;  4EMK C;  1HXD A;  3CBO A;  5FWC A;  3G6E A;  1Q81 R;  1WXB A;  2L2P A;  4AG1 C;  2IPO B;  4HCK A;  2FZG B;  2IIM A;  2NYS A;  3MP1 A;  4J6W A;  4LNP A;  4OB1 B;  4RTU A;  1ZBX A;  3WXM B;  4C0Z A;  5FU7 B;  1VIF A;  1A0N B;  3M53 A;  5CKF A;  2XI9 A;  1QP2 A;  2XU8 A;  1VQ5 Q;  2QTX A;  4M75 E;  1PG5 B;  3M58 A;  4RTT A;  3T9N A;  2FG0 A;  1UEB A;  2CUB A;  6AT1 B;  2J6O A;  2MPX C;  3CME Q;  2C06 A;  1VOM A;  3M54 A;  3OMC A;  3MEA A;  1VQ7 T;  1ZUK A;  1YWP A;  5I2M A;  2E6Z A;  3CCR Q;  2MYS A;  4Y91 A;  2CSQ A;  1IHW A;  1N6A A;  1VQ5 A;  3INZ A;  2DMO A;  5CKD A;  3G6E T;  2L3Q A;  1QWF A;  1TH7 A;  2JN0 A;  2ZGW A;  1VYT A;  3M4G A;  1SRM A;  4XU2 A;  1HK9 A;  1LOJ A;  4CI0 C;  2EYQ A;  1WI7 A;  4EMK B;  2F2V A;  3CME A;  4HVV A;  1BI3 A;  1VQN Q;  1GCP A;  3M57 A;  3CC2 Q;  1EX4 A;  2DLP A;  1D0X A;  4ME7 A;  4M7A E;  2E12 A;  2ZPG B;  3CCE T;  1NEB A;  3CCR A;  1OZ3 A;  2ATC B;  1UGS B;  3CPW P;  4N4G A;  4MZM A;  1Q81 C;  3TVT A;  3OYE A;  4M78 A;  1BBZ A;  1TUD A;  2WSC E;  1SEM A; 
#chains in the Genus database with same CATH homology
 2SRC A;  1AWJ A;  4GBQ A;  1NLP C;  1WDX A;  1UG1 A;  2MCN A;  3FJ5 A;  3R6N A;  4JZ4 A;  1WYX A;  2EYY A;  5IHN A;  1WFW A;  1UHF A;  4JJB A;  2LJ3 A;  2DL7 A;  2KNB B;  4ORZ A;  3NMZ C;  2A28 A;  2X3W D;  2W0Z A;  3I9Q A;  2ENM A;  2C0O A;  2OAW A;  3M0U A;  1WIE A;  1E7O A;  1AVZ C;  2JT4 A;  2CH4 W;  2VVK A;  3THK A;  1NEG A;  1ZUY A;  2DF6 A;  4OMO A;  3TSZ A;  1X6B A;  1SPK A;  1Z9Z A;  2EQI A;  4EIK A;  1AD5 A;  3QWY A;  4R0K A;  2LNH B;  3PVL A;  3UA7 A;  1WXT A;  2OI3 A;  2DRK A;  1GRI A;  1OPK A;  1YN8 A;  2AZV A;  1I1J A;  1JXM A;  1ABQ A;  1I07 A;  4X1V A;  4E6R A;  2K7A A;  1QWE A;  2RMO A;  2KRO A;  1M8M A;  2O31 A;  4RUG A;  3EHQ A;  5IXF A;  2O2O A;  2LCS A;  1YP5 A;  1KFZ A;  1ZSG A;  1Y0M A;  3PE0 A;  2AKL A;  2DL3 A;  1AZE A;  2CH4 A;  2GTJ A;  1X2Q A;  2DE0 X;  1LCK A;  3UA6 A;  5FW9 A;  3EG2 A;  2FPF A;  2EBP A;  2LX7 A;  1PHT A;  4IIM A;  1OV3 A;  1UHC A;  1X6G A;  1RLP C;  3VS2 A;  2CSI A;  2BZX A;  3RNJ A;  2ESW A;  1MUZ A;  1NYG A;  2KT1 A;  2BZY A;  2CDT A;  2F2X A;  2HBW A;  1AWW A;  1T0J A;  2RPN A;  1WA7 A;  1TG0 A;  1H92 A;  3EG1 A;  2ECZ A;  2B86 A;  4LN2 A;  2JW4 A;  1NM7 A;  1G2B A;  3RBB B;  2A08 A;  4Z88 A;  1TUC A;  2J6F A;  3TSW A;  4OMP A;  2YSQ A;  1WX6 A;  3KFV A;  3H0H A;  3UAT A;  1YCS B;  2JS2 A;  1WXU A;  2DRM A;  2EGA A;  4D8K A;  4F14 A;  1N5Z A;  1Y57 A;  1GCQ C;  1JO8 A;  1AOJ A;  1SRL A;  4RTV A;  1K76 A;  1M3A A;  4QT7 A;  4AFQ C;  1PRL C;  1ZLM A;  1X27 A;  4AFZ C;  1WLP B;  2VKN A;  4J9C A;  2HEQ A;  3I5R A;  1CKB A;  2J05 A;  1FYN A;  2KYB A;  4CC7 A;  1UTI A;  5HCK A;  1NG2 A;  2C0T A;  2RQU A;  1W1F A;  2GQI A;  1JU5 C;  5I22 A;  1T3L A;  1ZX6 A;  1X69 A;  3EG0 A;  4RTW A;  1OPL A;  1VYV A;  3M0T A;  1SHF A;  2ROL A;  2L3P A;  3C0C A;  2DM1 A;  2K6D A;  2VWF A;  4J9B A;  5ECA A;  3I35 A;  1HJD A;  1ABO A;  1B3Q A;  2AK5 A;  2YT6 A;  3ULR B;  4KRT A;  5I11 A;  3VS6 A;  2DBK A;  2A36 A;  2KRS A;  3M0Q A;  3CQT A;  2J06 A;  3H41 A;  4ESR A;  4JPB W;  1U06 A;  2JMA A;  3VRY A;  1GBR A;  2DYB A;  4A63 B;  2RQV A;  2D8H A;  1E6H A;  1VYU A;  1K0S A;  2ED0 A;  1CSK A;  3NPF A;  1M3C A;  1H3H A;  4Y92 A;  2H8H A;  2GNC A;  2YUO A;  3UF4 A;  1IO6 A;  1KIK A;  1T3S A;  1UGV A;  2AZS A;  3SHW A;  2P4R A;  4LUD A;  3H0F A;  2FPE A;  2L3S A;  2JS0 A;  4OMQ A;  2DL5 A;  1ARK A;  4FSS A;  2BTT A;  5FWB A;  1AWO A;  1PKT A;  1JQQ A;  2W10 A;  2AKK A;  2JM9 A;  2L0A A;  5GJW B;  1RLQ C;  4LE9 A;  2K2M A;  2DIL A;  1AWX A;  4J9F A;  1T0H A;  1UDL A;  2GBQ A;  3PVQ A;  4Z89 A;  2KT8 A;  1U3O A;  1HD3 A;  1OOT A;  2FO0 A;  4JJC A;  2FPD A;  1NYF A;  2YUP A;  5IH2 A;  2DNU A;  1S1N A;  2I0N A;  2FEI A;  1GCQ A;  2YDL A;  4HVW A;  1FMK A;  1PWT A;  1NLO C;  1AEY A;  2NUZ A;  1U5S A;  2EGC A;  4ZNX A;  2NWM A;  1XOV A;  4F17 A;  2D8J A;  2DL4 A;  2K9G A;  1X2K A;  3JV3 A;  4LUE A;  4CC2 A;  1UFF A;  2RNA A;  4J9I A;  2BZ8 A;  2DBM A;  1PKS A;  2JM8 A;  1YWO A;  1M27 C;  2GGR A;  1K9A A;  3GBQ A;  2HCK A;  2D0N A;  2DX1 A;  3M0S A;  2RQR A;  3LH5 A;  1J3T A;  1JEG A;  2YUN A;  1MV0 B;  2CT3 A;  3I5S A;  1W6X A;  2V1Q A;  4RTZ A;  1UJ0 A;  1QCF A;  3NHN A;  2CRE A;  1QKX A;  5IHI A;  4DEX A;  2LJ0 A;  1V1C A;  1YNZ A;  4HVU A;  5EC7 A;  2GTO A;  2ROT A;  4D8D A;  3VS0 A;  4OMN A;  4K11 A;  2ABL A;  3VS4 A;  4JZ3 A;  2EVR A;  5GJV B;  2PTK A;  1BK2 A;  4WCI A;  2EYX A;  3QWX X;  2K3B A;  2LJ1 A;  4AFU C;  2KRN A;  3ZL7 C;  2DL8 A;  2KBT A;  2LQW A;  4Z8A A;  1QKW A;  3REA B;  3VS1 A;  2ED1 A;  4J9D A;  3VS7 A;  4AG2 C;  1UE9 A;  2YUQ A;  1MV3 A;  1QLY A;  2DJQ A;  2HSP A;  2E5K A;  3EG3 A;  1OEB A;  4OML A;  2D1X A;  2RN8 A;  2J7I A;  5IHK A;  3O5Z A;  2KYM A;  1GFD A;  1GBQ A;  3EGU A;  2J6K A;  2PNI A;  2MIO A;  2X3X D;  2A37 A;  5IXB A;  2KXD A;  2QDL A;  2EW3 A;  2KGT A;  4CC4 B;  2KXC A;  2OJ2 A;  3REB B;  2JTE A;  2DVJ A;  1UEC A;  2JMC A;  2LZ6 B;  2KRM A;  1W70 A;  3SEM A;  2O9V A;  2C0I A;  1SHG A;  2CUD A;  2M0Y A;  1M3B A;  2LP5 A;  4AFS C;  3VS3 A;  2O9S A;  4J9G A;  2V1R A;  1UUE A;  2CT4 A;  4F16 A;  4OMM A;  2KE9 A;  4JJD A;  1E6G A;  5FWC A;  1WXB A;  1BU1 A;  2XMF A;  2EGE A;  2L2P A;  2RF0 A;  4AG1 C;  4HCK A;  3U23 A;  2IIM A;  4RTU A;  1PNJ A;  4LNP A;  4J9H A;  1RUW A;  1A0N B;  4GLM A;  1M30 A;  2EKH A;  3A98 A;  1K1Z A;  2KEA A;  1HSQ A;  1EFN A;  1GL5 A;  4RTY A;  2MOX A;  3VRZ A;  4RTT A;  2FG0 A;  3EHR A;  2O88 A;  1GFC A;  2CUB A;  1UJY A;  2F2W A;  2J6O A;  2SEM A;  3M0R A;  2PZ1 A;  2EYZ A;  1H8K A;  2M51 A;  1PRM C;  1X43 A;  2RQW A;  1ZUK A;  1BB9 A;  2LQN A;  1YWP A;  3IQL A;  1JXO A;  1G83 A;  1KJW A;  1B07 A;  1K0X A;  1VA7 A;  2CSQ A;  2HDA A;  5L23 A;  2DMO A;  2EPD A;  2DA9 A;  2KR3 A;  2L3Q A;  1QWF A;  2JXB A;  3M0P A;  1ZBJ A;  4IIO A;  2LMJ A;  2RQT A;  1VYT A;  3VS5 A;  1SRM A;  2K79 A;  4DEY A;  1CKA A;  1WI7 A;  4CC3 A;  2F2V A;  1ZUU A;  4HVV A;  1SSH A;  1Z9Q A;  1GCP A;  1RI9 A;  3H0I A;  2FRW A;  4M4Z A;  1KSW A;  2DLP A;  1K4U S;  2FRY A;  4RTX A;  1NEB A;  2EYW A;  3NGP A;  1AZG B;  2G6F X;  3TVT A;  1I0C A;  1BBZ A;  1TUD A;  4HXJ A;  4J9E A;  1SEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...