1NLOC

Structure of signal transduction protein, nmr, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC
publication title Molecular basis for the binding of SH3 ligands with non-peptide elements identified by combinatorial synthesis.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Complex (transferase/peptide)
total genus 7
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1996-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1nloC00
3EG3A 1K76A 3GBQA 2DL7A 1KFZA 3VS6A 2D8JA 2NUZA 2EQIA 4AFSC 3VS7A 2AZSA 4J9CA 2J05A 1QWEA 1Y57A 2I0NA 1ZUUA 2V1RA 1PWTA 2DBMA 3I5RA 2FRYA 1J3TA 2YUPA 4RTUA 2ED0A 3VS0A 3QWYA 2RQWA 2O88A 2LQWA 1X27A 1SSHA 2A37A 3R6NA 3PVQA 2JXBA 2DL4A 3H0IA 1I0CA 2A36A 4GLMA 2DA9A 2LQNA 3QWXX 2KE9A 1ZUYA 4RTTA 1AWOA 2KT8A 2JS2A 4J9BA 1OOTA 2MCNA 3O5ZA 2DM1A 2JM8A 1E6HA 3CQTA 1VYTA 3UATA 1E6GA 1SHFA 1A0NB 2C0TA 1MV0B 3NMZC 1M27C 3H0FA 2LP5A 4D8DA 3VS4A 3ZL7C 1M8MA 1NM7A 2K2MA 2CSIA 2GGRA 2F2VA 1UDLA 1ABOA 1H8KA 1AOJA 3M0QA 1GCQA 4KRTA 1Z9ZA 1QLYA 2ECZA 1FYNA 2IIMA 4J9IA 2HDAA 4DEYA 5FW9A 4LUEA 1X2KA 3M0PA 2EKHA 4LNPA 2AKKA 2DBKA 1BK2A 4HVUA 2KNBB 1U5SA 1SRLA 3VS3A 1JO8A 2CUDA 2DMOA 5IXFA 1M3CA 3FJ5A 2AKLA 2DJQA 2EYZA 3M0RA 2ED1A 2YUNA 1WXBA 4DEXA 5I22A 2DL5A 1H92A 4Z8AA 1JXOA 1NLOC 2LZ6B 2YSQA 2GTJA 1GBQA 2KRSA 2YUQA 3I5SA 2D0NA 2KRMA 4RTVA 2MOXA 2CT4A 1WXUA 2FRWA 1BBZA 2EGAA 2RMOA 2EGEA 2DX1A 2KXCA 2EVRA 2J6FA 1SEMA 1QWFA 2L0AA 3NPFA 1CSKA 2GNCA 1V1CA 2DL8A 1HJDA 4CC2A 5L23A 4LUDA 2JMAA 1G83A 2HBWA 4Z88A 1LCKA 4AFZC 2OI3A 2EYWA 4Z89A 5IHIA 2A08A 3TSZA 3M0TA 1MUZA 2JTEA 2NWMA 2K9GA 1SRMA 1NEGA 4FSSA 3EGUA 2C0IA 4RTWA 3KFVA 2ROLA 2YT6A 1X6GA 2L2PA 4RUGA 3U23A 2EYYA 2FG0A 4GBQA 2W10A 1PRLC 2CH4W 5FWCA 2FPDA 4CC3A 4JZ3A 2LJ3A 4OMPA 1Y0MA 2PZ1A 1KJWA 1N5ZA 2RNAA 1KIKA 2HCKA 1PHTA 2DF6A 4CC7A 2DE0X 4JJBA 2CREA 4F16A 3ULRB 1HSQA 2P4RA 3H41A 1UG1A 3EG0A 2LJ1A 1PKSA 2O2OA 2X3WD 2LMJA 2RN8A 1UECA 3A98A 2GQIA 2RQUA 2DILA 4JPBW 1NG2A 4HVVA 1SHGA 4AFQC 1T0HA 1UFFA 2BZXA 2HSPA 1AD5A 1X2QA 2G6FX 2AK5A 5IHNA 5I11A 2EPDA 5HCKA 1W70A 2ESWA 2DYBA 1WXTA 2KBTA 2OJ2A 1K0XA 2XMFA 3NGPA 5FWBA 4OMLA 1OV3A 2VWFA 1B3QA 3UF4A 2FPFA 2M51A 1K9AA 2LCSA 1I07A 1GCQC 4RTYA 2BTTA 1OPKA 2D8HA 2V1QA 3EHRA 2BZYA 5GJWB 3VRZA 1Z9QA 2KGTA 1K0SA 3VS1A 2YUOA 1OPLA 1BU1A 2FEIA 1UE9A 1OEBA 1SPKA 2EW3A 1M3BA 1AWWA 1B07A 2L3SA 4WCIA 1NYGA 1AWJA 2GTOA 1UGVA 2EBPA 1QKWA 1WFWA 1JU5C 3M0UA 4ORZA 5EC7A 1QKXA 4J9DA 1E7OA 4JJCA 1WYXA 1T3LA 1PNJA 2LJ0A 4J9EA 3VS2A 1UTIA 2PTKA 1WI7A 2RQTA 1JQQA 2J7IA 2KROA 1WA7A 4HCKA 4J9HA 4QT7A 4ZNXA 2JS0A 4J9GA 4OMNA 1GRIA 2HEQA 1TUDA 2F2WA 4IIOA 4AG1C 2GBQA 4EIKA 1ZBJA 5IHKA 2ROTA 3I9QA 3H0HA 2EGCA 2X3XD 1VYUA 4M4ZA 1K1ZA 2CUBA 2LNHB 3C0CA 2J6OA 4CC4B 5GJVB 1QCFA 2JW4A 4JJDA 1HD3A 3VS5A 2VVKA 3SHWA 3LH5A 4R0KA 1YCSB 1UHFA 2YDLA 2A28A 2H8HA 1NYFA 1AZGB 2CT3A 1NEBA 1M30A 3PE0A 4JZ4A 2PNIA 2KR3A 1H3HA 2ABLA 4RTZA 3REBB 2LX7A 1RI9A 5IH2A 4ESRA 2K3BA 1ARKA 1G2BA 3THKA 2MIOA 2QDLA 1CKAA 2CDTA 3EG1A 2DVJA 3PVLA 1NLPC 4A63B 1RLQC 1GL5A 1AVZC 2L3QA 2FO0A 2DRMA 1GCPA 1TG0A 1VYVA 1YP5A 2O9VA 1ZLMA 4F17A 2M0YA 1U3OA 2AZVA 1CKBA 1WX6A 3JV3A 4X1VA 1ZUKA 1TUCA 1AEYA 3TVTA 1BB9A 1JEGA 1U06A 1YN8A 2K79A 5ECAA 3RBBB 4OMMA 1XOVA 4Y92A 2CSQA 1EFNA 1RUWA 2W0ZA 2K6DA 1YWOA 2KYMA 2RF0A 2FPEA 2RPNA 1AWXA 2BZ8A 4D8KA 1GFCA 2ENMA 2O31A 4HVWA 1T3SA 5IXBA 4RTXA 2JT4A 1UJ0A 2CH4A 1W6XA 1ABQA 2J06A 1X6BA 1YWPA 1UHCA 2DLPA 1GBRA 1ZSGA 2K7AA 3EHQA 1UUEA 1RLPC 3RNJA 1FMKA 1T0JA 2C0OA 2KXDA 3REAB 3UA7A 1WLPB 2L3PA 2OAWA 2JMCA 3M0SA 1X69A 2SEMA 1S1NA 4LN2A 1AZEA 4OMQA 2F2XA 2KEAA 2KT1A 4K11A 3UA6A 4IIMA 2B86A 4LE9A 3I35A 2DL3A 2E5KA 4HXJA 2RQRA 1VA7A 4J9FA 4AG2C 3EG2A 1X43A 1ZX6A 2DNUA 2KYBA 2D1XA 3IQLA 1MV3A 1KSWA 1JXMA 1M3AA 1UJYA 4AFUC 3TSWA 1W1FA 1WDXA 3SEMA 1IO6A 1I1JA 1PKTA 1WIEA 2VKNA 1YNZA 4F14A 2J6KA 2RQVA 1PRMC 3VRYA 2EYXA 2JM9A 2SRCA 1K4US 2KRNA 4OMOA 2DRKA 1GFDA 4E6RA 2O9SA 3NHNA
chains in the Genus database with same CATH superfamily
1K76A 1AT1B 3G4ST 5LJ5g 2D8JA 3H6ZA 4M78D 3EGDB 4FYYB 2E65A 5LJ5j 3CCET 2FRYA 2LTOA 3QWYA 3VS0A 1RAAB 2K57A 3OS5A 3R6NA 1ZA2B 4FT2A 4E7LA 3M56A 4IKFA 5FU7B 3H0IA 2OTLT 4EMKC 5HK3A 3CCEQ 1I0CA 2P4TA 2DETA 4J7FA 5LJ5e 4BE0A 4NS5A 3MEUA 1OZ2A 2MCNA 2OTLQ 3ASKA 1R0CB 4E7IA 4C0GA 1QCNA 3UATA 1E6GA 1SHFA 1A0NB 2RHYA 2C0TA 3RMQA 1VQ8T 2ZZDA 3ZEHA 3JCMh 5FRMA 2E1HA 4M7AD 2RHUA 2LP5A 2DIGA 4D8DA 4M7DF 2XIDA 3OBYA 3JCMV 4GLKA 1K73U 1VQ8Q 4F7UB 1MMAA 3H8ZA 1VQ6T 4PJOC 1AOJA 1UGSB 3CD6Q 4HCCA 3QZ9B 5CKDA 3PT9A 4DEYA 1FYNA 3CCSA 3SD4A 5L8RE 4N0AA 2AKKA 1O75A 4HVUA 1RABB 3ER0A 1G3TA 3GF5A 1JO8A 5IXFA 2R58A 1M3CA 3I55T 2RA2A 4IUQA 4B6MA 4M77A 4M75C 2JN0A 2DJQA 5A0GA 4J5YA 4GY5A 5I22A 1JB0E 3I55Q 1H92A 1JXOA 4FYVB 5KYWA 1Q81R 3FB9A 1D1BA 3CCQA 1GBQA 4EPCA 2YUQA 4RTVA 2EJFA 1PG5B 1BBZA 1VQOA 4J6WA 5CVIA 4M75E 4JS5A 1OYXA 3MHXA 4XU1A 4Y91A 2KXCA 3OSSC 1PSFA 2L0AA 1WQ7A 4CC2A 3HFOA 2PU9B 4LUDA 2HBWA 3NTIA 2NUPB 1LCKA 4AFZC 2OX7A 1JJ2A 2LRQA 3EG9B 2A0FB 2QDYB 2EYWA 2K5LA 2EIFA 1Y07A 4C0FA 4DBQA 3A8OB 2R5MA 2K9GA 1NEGA 1HK9A 3META 4LD6A 4RUGA 1YJWT 2EYYA 3OYFA 2CH4W 4KUIA 2FPDA 4JZ3A 4OMPA 1Y0MA 2PZ1A 1BI0A 1KJWA 4C92G 2G3RA 3BE3A 5IT9E 2DF6A 4MMLA 1YJWQ 4JJBA 5KH6A 1RAFB 3JSCA 4A4FA 2LJ1A 2X3WD 2DZ9A 1UECA 5LJ3d 2QK0A 2E4HA 2RHXA 3QG1A 3QDRB 1T0HA 4E7ZA 1FWZA 2BZXA 1YBYA 4XQ3A 4XU0A 2AK5A 3DKMA 2E5QA 3O8VA 3RUXA 1JJ2S 1WXTA 2HQHA 2KBTA 2VUBA 2OJ2A 1BCOA 4LD9K 2LT4A 2DTIA 2MYSA 3ME9A 3SWNB 2X4XA 2OTJA 3DLMA 4J6XA 3RESA 3OYNA 2M51A 3FDRA 2LCSA 2KY9A 1I07A 3OYMA 1S72T 1Q82C 1NJIU 1K73R 5GAOn 2K3XA 1GCQC 4RTYA 3LLRA 3EHRA 1SKUB 4FW2A 1MGQA 1VQ9T 1BU1A 2EWNA 2RK1A 1MNEA 2P0KA 3P8HA 1SPKA 2EW3A 1M3BA 3I56Q 1VQ9Q 3CC4A 1QKWA 1JU5C 3M0UA 1WYXA 1T3LA 5GMKj 2RJCA 4J9EA 4FSXA 4M7DG 4FYXB 4BDZA 2YXYA 5GAMh 3AHUA 2EFIA 8AT1B 2HEQA 3NFCA 4IIOA 1ZBJA 3T9NA 3G7ZA 4E7JA 3CMAT 5GMKe 3HPWA 2COZA 1VYUA 2VYTA 4JLIA 1SG5A 2J6OA 4EMKB 5GJVB 2JNGA 1I4K1 4LXCA 2XICA 1RAGB 5GAN5 2ZAEA 3SHWA 2DXBA 3CCLT 3CCUQ 4R0KA 3JB9G 1YCSB 4MDXA 4C5HA 1AZGB 3PE0A 4AMCA 3G6EA 1N6AA 4QQGA 2PNIA 5GAN3 2X35A 2CP6A 4ESRA 1G2BA 2MIOA 2DTOA 1CKAA 4L5GA 2FB7A 2DVJA 5KE2A 3OYYA 4A63B 3JB9I 4IUVA 1VQKA 4ME7A 4OF1A 2X4JA 3HL8A 1I81A 1VYVA 4F17A 2M0YA 2EKOA 3HHTB 2D0QB 1CKBA 2EQKA 3QUIA 1D0ZA 3OYEA 4M75B 1TUCA 2H3EB 4JRPA 1VUBA 3OYKA 1JEGA 1U06A 1KD1C 4XK8E 4PJOA 1XOVA 2CZ6B 2CSQA 3TQ7P 1EFNA 3NTHA 2COYA 2K6DA 2RF0A 3X25B 3HP9A 4X9DA 4ZGDB 3QYGB 5IXBA 2JT4A 2HQEA 3DLLA 2VB6A 2ZPGB 3M53A 4N0AC 5LJ5d 1JJ2P 3MJXA 1WHJA 1KQSA 2V8KA 3C12A 2K7AA 1NJIR 5J3BA 2KXDA 2I2LA 4JUVA 2V8JA 4M77C 1RI0A 2DERA 2MK5A 3QJ6A 2JMCA 3M0SA 2SEMA 1I5LA 4O6JA 2DKGA 4PFZA 1AZEA 4IIMA 2DXCA 3LWHA 4C8QG 3I35A 3M5AA 2E5KA 3EGXB 3EG2A 1YIJT 4II1A 2KYBA 3IQLA 3PIOA 4AFUC 1YITT 4F7UE 1IGUA 2O4XB 1YIJQ 1W1FA 5KYXA 4KH0B 1K9MC 3OS2A 4J8OA 1XNIA 1YITQ 1OQKA 3OYBA 2WSCE 2DJZA 2MWOA 1M90U 2PQWA 3V8JA 3VV0A 3RDVA 3NHNA 4ZGEB 4PLLA 4KT0E 3CPWA 1KFZA 2NUZA 1M1GA 3VS7A 2AZSA 4PLIA 4RMOA 2E10A 2DD5A 1TWBA 4NOYA 5GANg 4JJNK 1UGPB 1YHQT 1VQPT 1PWTA 2LCCA 1QCOA 2YUPA 1YJNA 1C1AA 2VGMA 1I8FA 2LQWA 5GANj 1X27A 3SFMA 1VQPQ 1PM3A 3BDUA 3OYAA 2A36A 3OMGA 2HBPA 4DBRA 1AWOA 2KT8A 5GAOp 1OOTA 1MHNA 3O5ZA 2JM8A 5GANe 1Y96B 1MV0B 2E3IA 1M27C 1VQ7T 2KSSA 4BI8B 1H641 3VJPA 3VS4A 3ZL7C 2GGRA 4MMKA 3TCJA 3JB9J 1VQ7Q 1UDLA 4BACA 1ABOA 4M75D 1H8KA 4PJNA 3CPWS 4KRTA 1GCQA 3PIPA 2CYZB 1WHKA 5DM7R 9ATCB 4NL3A 2BUDA 5CKFA 5I21A 1QLYA 2IIMA 3QBYA 1KHCA 2HDAA 1SSFA 2ATCB 5FW9A 5GAN7 4LUEA 2A3LA 2EKHA 2DBKA 1BK2A 3V7SA 4JDSA 2CUDA 1VQLT 2AIRB 3FJ5A 3KUFA 2AKLA 3TREA 2RH2A 1D3BB 4A4GA 2YRDA 1TUGB 3M0RA 3CMET 3OYJA 4DEXA 5I2MA 4A4EA 1VQLQ 1VQ5Q 2YSQA 3JCMc 2GTJA 1H3ZA 3MKDA 2KRSA 2FHDA 3UDCA 4C92A 3CMEQ 1WXUA 4E2FB 1N8RC 1WJRA 2RMOA 2EGEA 3CCVA 1KK7A 2A7YA 2J6FA 2HKNA 3OS1A 2QEXT 1HJDA 5L23A 2DD4A 1X6OA 2RK2A 3FEOA 1OU8A 2GFAA 2JMAA 4BI3A 4HKEA 2OI3A 2K5FA 1WGSA 5CCAA 5IHIA 2A08A 3M59A 3M0TA 2HL5C 3CXCA 1SRMA 2L5QA 2QQ9A 4FSSA 3EGUA 4E7KA 5GAOm 2YT6A 3E19A 3S3MA 3MEAA 1M90R 3G4SQ 4PJLA 3OMCA 1UEBA 2MMPA 2HCKA 1NPPA 8ATCB 2DE0X 2OTLA 1B34A 4F16A 5GANf 2P4RA 4JS4A 1M2OA 4MZMA 5GAN6 1PKSA 2LMJA 1M8VA 5LL6S 3A98A 1KQSP 2RQUA 3QHSA 2DILA 1M2VA 3CCRA 1NG2A 3EAEA 1YCYA 2DXTA 4J7IA 3MPUB 4PFPA 5AYFA 1UFFA 2R57A 2ZPIB 2HSPA 2LT1A 4OB1B 4DBHA 1VQ8A 1X2QA 3L1AA 4ELYC 3J80E 3CD6A 2CP5A 3MEWA 2CZ1B 4M77B 2DYBA 4PK4A 2HZYA 3CBMA 3EGDA 1IREB 4KBMB 4M7DA 3NGPA 5FWBA 2BE7D 3X20B 2JVVA 5KYWB 3CXCS 4JRKA 2FL7A 3UF4A 1TXQA 1WPYA 1VQ6Q 5CQYA 1VIFA 1K9AA 3A8LB 3S3NA 2EQUA 5EG2A 4ZGJB 2M0OA 5KCHA 3I55A 4M78G 2BZYA 4PJOE 1X75C 1NJIC 1ZHIA 2QTXA 3CC7T 1YI2T 3C94A 1PD1A 1UE9A 2FEIA 1Q86U 4E7HA 2L3SA 2XDDA 3CCST 4WCIA 1KQ2A 1NYGA 3OYHA 1D0YA 3CPWP 1QVFA 2EBPA 3A8GB 3G71T 1VOMA 1WFWA 2EJ9A 3CC7Q 5EC7A 1YI2Q 4E7SA 3M55A 1E7OA 2M9UA 2NYSA 2FYKA 1UTIA 3CCSQ 4F7UF 2PTKA 1WI7A 2ZPEB 3G71Q 2KROA 3OYCA 4QVCA 2CS7A 5CR2A 2JS0A 3HFNA 4J9GA 4OMNA 2YHTA 2F2WA 4KGZB 2EQJA 4OVAA 2ROTA 3RIRA 1SF9A 1IB8A 3H0HA 3URGA 2EGCA 1FMVA 4FIBA 3VYGA 5KYYA 4M7AG 4CC4B 3EFRA 4A53A 2JW4A 5KE3A 1HD3A 3SB2A 3LH5A 4BD3A 2R5AA 1YJWA 1UHFA 1TSFA 1YJ9A 5HKCA 1NYFA 4C5EA 5LJ5f 2IPOB 4QQDA 1IXDA 2LC4A 3HTRA 3JCMg 2YWWA 1M30A 4JZ4A 3JCMb 4N4GA 2DEQA 2C06A 4FW1A 2RI3A 5CO7A 1W2BA 2HNIA 2JZ2A 1IHVA 1QVFS 1RI9A 2GF7A 1ARKA 3L2WA 3THKA 3LYIA 2QDLA 2JTMA 3PGGA 3JCMQ 2JUFA 3EG1A 4C5IA 3A5ZB 3PVLA 3M9QA 1RLQC 1BKBA 2FO0A 4BE1A 2ZGWA 3JCMe 3E1SA 1IHWA 2RHZA 4RKUE 2E3HA 3MEVA 3MP6A 1R77A 5D6XA 3F70A 4CI0C 1WX6A 1ZSZC 2DPPB 4C8QA 3QPHA 1FMWA 2P0QA 1AEYA 3RR6A 2DEUA 5IAYA 1YN8A 5FRNA 2K79A 5ECAA 3RBBB 2P84A 3AT1B 3OYGA 1XTDA 4M77D 2K4YA 1KC8R 2BZ8A 4IUUA 2F69A 2M1HA 4HVWA 3I56A 6AT1B 3EFOA 4MZPA 4B9WA 5C6SA 1VQ4T 1S72Q 2FZGB 2Z0WA 3WVDB 2PUOB 3QKJA 1W2BS 1GBRA 3EHQA 3RNJA 4RCBA 3UA7A 3REAB 3CXCP 2CP2A 5GANd 1FXXA 2L3PA 2NUTA 1VQ4Q 2LNVA 1X69A 4J6YA 2BKDN 3EH2A 4OMQA 2KEAA 3UA6A 3PMIA 2B86A 2PUKB 1Q86R 1ACMB 1WHMA 3OYLA 1X43A 1KQ1A 4C92C 2CZ0B 2NLUA 2CP0A 1Q7YR 2HSEB 1KSWA 4DOWA 2QXFA 1JXMA 1IGQA 1PC0A 5D6YA 3CCUA 1M9SA 1WDXA 1WIEA 1I1JA 4XTWA 3CMAQ 1YNZA 2J6KA 4C92E 3VRYA 1NPRA 3QZ5B 2JM9A 2SRCA 2KRNA 4IURA 1MMGA 2O9SA 1NZ9A 5CKEA 3HRTA 3GBQA 1M1KU 4OB0B 3JCMX 3X26B 3CCLQ 1MMNA 2EQIA 2YRCA 5CKBA 5LJ3h 1M90C 1JRIA 1QWEA 4BE2A 2K2VA 2I0NA 1UGQB 1ZUUA 2VGNA 2V1RA 4F7UG 2DBMA 3I5RA 5GAOr 2F1LA 4RTUA 2ED0A 2HAXA 2XDBA 3PMTA 2O88A 4PJOB 3OY9A 2VXEA 2A37A 1SSHA 4RG2A 5HK0A 3M58A 1KG1A 3Q1JA 2DL4A 3MO8A 3CC2T 4GLMA 2DA9A 4HCBA 1V29B 4A54A 3LWIA 5GAOl 2CP7A 2JTFA 3QXEB 2JS2A 2E6NA 4BY6C 1O9SA 1E6HA 3CC2Q 2JOYA 1VYTA 1QVFP 4J83A 3UT1A 4JRIA 1VQKT 1QMCA 4BDYA 3MP8A 4M7DC 1M8MA 1NM7A 2CSIA 3GLXA 4RCCA 1PSEA 1NE8A 4PJOF 5FU6C 1Q82U 2QAZA 4IUTA 4R56A 1Z9ZA 4J9IA 2ECZA 5FU7C 1WHGA 1X2KA 4HT8A 4LNPA 1U5SA 5KYXB 5C0MA 4FYWB 2DMOA 4UC4A 5GMKl 4M75F 1Q81C 2ED1A 1K8AU 2QA4T 4QW2A 4Y28E 1YIJA 4Z8AA 2LZ6B 4M77E 2XDPA 3I5SA 2JJ9A 2KRMA 3QDFA 2MOXA 4KH1B 1YITA 2FRWA 1W2BP 2QA4Q 3JRZA 1TU0B 2EGAA 2V8IA 1U1TA 1SEMA 4ELZC 3NPFA 1CSKA 4PJJA 3QJYA 3GOXA 3GP8A 2ZPHB 3RERA 4X34A 1G83A 4DQ2A 2F5KA 1OULA 5J26A 3TSZA 4F04B 3OYDA 2ZPBB 3CCMA 2COWA 2JTEA 4RTWA 2LVMA 4R55A 2ROLA 4PKCC 1VQPA 2L2PA 2FG0A 5FWCA 4CC3A 1M1KR 2XD0A 2CGHA 1KIKA 3CBPA 1YHQQ 3SDZA 1PHTA 5KYNA 4CC7A 2CREA 5GMKi 3ULRB 1VIEA 1HSQA 1VQMA 1VQNA 4FCYA 4M78A 1D09B 2QQRA 2EJGA 4OGEA 4JPBW 2RJEA 1OU9A 4PJOD 4AFQC 1SHGA 1ZSZA 1C0MA 3E9FA 2D6FA 1AD5A 5IHNA 1VQ7A 5I11A 2QQAA 1RAHB 5HCKA 5LJ5h 1R0BG 1LNXA 2ESWA 4KUDK 4C8QC 1RAEB 2DFUA 3GNGA 2IVWA 2KDSA 1UGRB 4QVDA 1KD1U 2ZPFB 1HYOA 3FIFA 5KYUA 4JLGA 3RKXA 1OV3A 1TOVA 1WZOA 2QYZA 3BW1A 1QP2A 1K73C 3NTKA 1B3QA 5IN1A 4C92B 4C8QE 3RKWA 2DXUA 1BCMA 1TS9A 3RMSA 2F5TX 4M7AA 1OPKA 4A4KA 1VQLA 4A4HA 1VQ5A 4BUGA 2DAQA 3CCJT 1Z9QA 2KGTA 1Q82R 1K0SA 3S3OA 3VS1A 1OPLA 3JCMd 1UB4A 1OZ3A 1OEBA 3CMEA 4C5GA 3VUBA 3CCJQ 3PTAA 4QVZA 4EMHA 4ORZA 1Q86C 3ZBDA 5CQXA 4JJCA 4ANJA 1W4SA 1IZ6A 2RQTA 1K8AR 2O01E 2KAFA 4HCKA 4J9HA 3OW2S 4ZNXA 4RG8A 4FU6A 4ATOA 1GRIA 4AG1C 2DVEA 4C92F 5IHKA 4OB3B 2FZKB 2MF2A 1K9MU 1WQWA 1B34B 3LGLA 5D7UA 2QEXQ 3G4SA 2RJDA 4M4ZA 4EMGA 2FVUA 2LNHB 3C0CA 2Y90A 3HRUA 1QCFA 4XTZA 5FLXE 3VS5A 3QYHB 1G3YA 1LPLA 1M2VB 4Q5WA 4M75G 3CCEA 1EIFA 1ZA1B 2RHIA 2X4WA 4OP0A 2A28A 2YDLA 4XAXB 3X28B 4BY6B 2CT3A 3OYIA 1NEBA 2MWPA 1QVGA 1RADB 2KK4A 4ZN3A 2HKQB 2KR3A 2ABLA 3M4GA 4RTZA 3REBB 4M7DB 2V26A 2DIQA 2E6ZA 1N9SA 2LX7A 5IH2A 2K3BA 2Y4YA 1D0XA 2CDTA 5FU6B 2HMAA 2LQ8A 4PL6A 4WTOB 2L3QA 3L42A 1N27A 1YP5A 1ZLMA 3LH0A 4DBFA 1U3OA 2RM4A 2AZVA 1KC8U 2WSFE 2M16A 5I2SA 1ZUKA 1VQ6A 1M4ZA 1JBMA 5GMKm 3CCRT 3V7CA 3OS0A 1BB9A 4N4IA 4LDXA 4OMMA 4Y92A 1RUWA 1Y7XA 2W0ZA 3CCRQ 3CD6T 3TEEA 1KD1R 3GPLA 2YLCA 3LGFA 2O31A 1T3SA 3J81E 4RTXA 1G3WA 1UJ0A 3CC7A 1QVGS 1YI2A 1ABQA 3HKSA 2FZCB 3OBWA 2J06A 5A0DA 1ZSGA 4C92D 1FMKA 1T0JA 3G71A 5A0LA 4FT4A 5KYYB 1NBEB 1WLPB 4ZTFA 4M77F 1Q7YU 3MCAB 2OAWA 4PFOA 1V76A 1S1NA 4O5VA 2K5IA 2F2XA 2KT1A 1N9RA 4N4HA 3JB9F 2X4YA 2LQKA 3QIIA 4HXJA 1I5OB 3MP1A 1WNLA 3C4SA 4F7UA 2VXFA 5A2QE 4AG2C 1ZX6A 1GXIE 2DNUA 4LDWA 1N8RU 3E9GA 2WACA 3CCQT 1MV3A 5CAIA 7AT1B 3FC3A 1VQOT 3FJPA 2BE9B 2VASA 3SEMA 3CCQQ 3CPFA 2VKNA 3M54A 1MMDA 4Z02A 5CK9A 2RQVA 3VKIA 1PRMC 2QQBA 2EYXA 1VQOQ 1K9MR 2RO0A 4OMOA 1GFDA 1WJSA 1D1AA 2YRVA 5GMKh 3OW2P 3EG3A 1R8OB 5GAMd 3H9NA 3L2VA 2DL7A 3VS6A 4AFSC 2QASA 4J9CA 1P92A 2J05A 2QGFB 3UWNA 1M1KC 1Y57A 4C8QB 3V8LA 1M1FA 2KVQG 2CP3A 5GAN4 1U8RA 1G8XA 1J3TA 4CRIA 1YJ9T 3OB9A 3V7RA 2E64A 2RQWA 3DB4A 2XHCA 4BI4A 4DOVA 3PVQA 2NUPA 2JXBA 3EG9A 4PJMA 1YJ9Q 3M4YA 4M78C 3V8KA 4OMFB 1LOJA 2GQVA 2LQNA 3QWXX 2RJFA 4M7DD 4XTYA 3EFOB 2B8AA 2KE9A 1G5VA 1ZUYA 4RTTA 4J9BA 2GCXA 2DM1A 3CQTA 1BIAA 3NMZC 4M78E 2NUTB 3CBOA 3H0FA 1BI1A 4E47A 1S72A 4JRQA 4C8QF 2K2MA 2F2VA 1QP3A 1VQ9A 2H3JA 3JB9D 3M0QA 3A8HB 2DZCA 1PD0A 5D6WA 1VQ4A 2QGGA 1BYMA 4XTXA 2OTJT 4LDYA 5HY6A 1DJ7B 3EFSA 4LDUA 4M7AC 3M0PA 3VYHB 2EYQA 2KNBB 1SRLA 3L2QA 1EZZB 3VS3A 2OTJQ 4ZN1A 1BI3A 1QW1A 3I56T 5CIUA 2HL3A 2EYZA 1WHLA 4HT9A 2RI2A 4QKUA 2YUNA 1WXBA 2Y4XA 3WXMB 4M7AE 2DL5A 2K3YA 1NLOC 1B7TA 4L59A 1QVGP 3SWNA 3CC4T 3CMAA 1K8AC 2EAYA 2D0NA 2CT4A 2VC8A 3QO3A 4VUBA 2DO3A 2DX1A 1BI2A 3CC4Q 2EVRA 5AT1B 4OGCA 1QWFA 4XU2A 4YTLA 5GAN2 2GNCA 1N8RR 5J39A 1V1CA 2DL8A 3CCLA 3P8BB 3ZFJA 4Z88A 1QVPA 1F1BB 2OAUA 1FX7A 4Z89A 3CCUT 3X24B 2DYIA 1MUZA 4ZTJA 2NWMA 4M77G 2C0IA 4C0DC 3KFVA 2GFUA 4B9XA 1X6GA 3U23A 2XG8D 3HSBA 4KGXB 2VV5A 4GBQA 2W10A 1PRLC 3JCMf 1LJOA 2LJ3A 1WJQA 2YLBA 2RNAA 1N5ZA 2KI7A 2QI2A 3G6ET 3CC2A 4L6V5 3H41A 1EX4A 1UG1A 2M02A 3EG0A 2O2OA 4EMKA 2IG0A 3A8MB 4C8QD 2RN8A 1G3SA 3G6EQ 5DLQE 3LX7A 2GQIA 1MNDA 4HVVA 4QQ6A 5CKHA 3VU3C 2XU8A 2DK3A 3TU4K 2G6FX 3M57A 2EPDA 1D1CA 1W70A 2D9TA 2AT1B 2DTHA 5GAMg 3QSUA 1M5Q1 1K0XA 1VQKQ 2XMFA 5GANh 4OMLA 1AHJB 2KMTA 2VWFA 3LW5E 4KGVB 5GAMj 1RAIB 4V2SA 3PFSA 4M7DE 2E70A 2FPFA 4XTUA 2EQMA 3OSVA 2BTTA 2D8HA 2V1QA 3INZA 1KHIA 2PVGB 5GJWB 3VRZA 3JCMW 1BIBA 2E12A 2YUOA 5GAMe 3G1JA 1AWWA 1C6VX 4M75A 2QA4A 1B07A 1AWJA 3CEYA 2GTOA 1UGVA 5LJ3g 2L89A 4HA8A 3JCMP 1QKXA 4J9DA 1PNJA 2LJ0A 3FLGA 2PVDB 3WVEB 3VS2A 2RI5A 1JQQA 5LJ3j 2J7IA 1WA7A 4X9CA 4QT7A 1TH7A 4WF2A 4LDVA 2LCLA 1TUDA 2GBQA 4EIKA 3KXTA 2AHJB 3BY7A 3I9QA 2X3XD 1HXDA 4OB2B 1X01A 1K1ZA 2CUBA 3L2RA 5LJ3e 3RKYA 4M78B 4JJDA 2XKOC 2VVKA 3P8DA 2WSEE 5KCOA 1XJWB 3PNWC 1YHQA 2CKKA 4MDWA 4EDUA 2XI9A 2L8DA 1ZSZB 2H8HA 3EGXA 1XQHA 3HRSA 1U1SA 4XTVA 3DB3A 4P5NA 4NL2A 1RL2A 3CCMT 3BFMA 3A1PA 3VUZA 1H3HA 1KQSS 4FL6A 2O4XA 5KYUB 2RD1A 3UPUA 2KQWA 1QQJA 3CCMQ 4BB7A 1TTHB 1YJNT 3GIBA 2LDMA 1IRXA 2E41A 2HD0A 3GNFB 2PVOB 1NLPC 1Q95G 2P0PA 4TVRA 1GL5A 1AVZC 2RB6A 3OW2A 1YJNQ 1VQMT 2DRMA 4XU3A 4M7AB 4M78F 1GCPA 1TG0A 3E2UA 1OI1A 2O9VA 1VQNT 2LX9A 1LVKA 2QTVA 3C95A 5M9OA 3JV3A 4X1VA 1VQMQ 1VQNQ 3JAME 3TVTA 1OX9A 3KBGA 3L2ZA 1ZQ1A 1KC8C 2QQSA 5DY9A 1YWOA 5GAMf 2KYMA 4IUPA 2FPEA 2RPNA 1YFNA 1AWXA 4C0ZA 2ZCFB 4D8KA 1GFCA 2ENMA 2MI6A 3CCJA 2X51A 2CH4A 5FROA 2MPXC 2HQXA 3BDLA 1W6XA 4KULA 1PCXA 1RACB 1X6BA 1YWPA 1UHCA 1ZBXA 2DLPA 1Y96A 1UUEA 1RLPC 2C0OA 4M7AF 2BIVA 2L3RA 1Q81U 4D6WA 4LN2A 1VQ5T 2XK0A 4K11A 2X9HA 5DLOA 3D7SB 3OQ5A 4LE9A 2DL3A 1Q7YC 2RQRA 4C0DB 3FRNA 1VA7A 3SWNC 1OX8A 4J9FA 1WHHA 2QEXA 5LJ3f 1Y71A 2MAMA 3L2UA 3JB9H 4PNOA 4PJOG 4DA4A 2D1XA 3R6OA 1M3AA 1UJYA 4AT1B 3JCMJ 5GAN8 3TSWA 4MZTA 2CZ7B 2QG9B 3CCVT 1IO6A 4F14A 1PKTA 3J7AF 3S6WA 4FM4B 1D3BA 1K4US 2DRKA 3EH1A 4HCZA 5GAOq 3CCVQ 3OA6A 4E6RA 3N5BB
chains in the Genus database with same CATH topology
3EG3A 1K76A 3GBQA 2DL7A 1KFZA 3VS6A 2D8JA 2NUZA 2EQIA 4AFSC 3VS7A 2AZSA 4J9CA 2J05A 1QWEA 1Y57A 2I0NA 1ZUUA 2V1RA 1PWTA 2DBMA 3I5RA 2FRYA 1J3TA 2YUPA 4RTUA 2ED0A 3VS0A 3QWYA 2RQWA 2O88A 2LQWA 1X27A 1SSHA 2A37A 3R6NA 3PVQA 2JXBA 2DL4A 3H0IA 1I0CA 2A36A 4GLMA 2DA9A 2LQNA 3QWXX 2KE9A 1ZUYA 4RTTA 1AWOA 2KT8A 2JS2A 4J9BA 1OOTA 2MCNA 3O5ZA 2DM1A 2JM8A 1E6HA 3CQTA 1VYTA 3UATA 1E6GA 1SHFA 1A0NB 2C0TA 1MV0B 3NMZC 1M27C 3H0FA 2LP5A 4D8DA 3VS4A 3ZL7C 1M8MA 1NM7A 2K2MA 2CSIA 2GGRA 2F2VA 1UDLA 1ABOA 1H8KA 1AOJA 3M0QA 1GCQA 4KRTA 1Z9ZA 1QLYA 2ECZA 1FYNA 2IIMA 4J9IA 2HDAA 4DEYA 5FW9A 4LUEA 1X2KA 3M0PA 2EKHA 4LNPA 2AKKA 2DBKA 1BK2A 4HVUA 2KNBB 1U5SA 1SRLA 3VS3A 1JO8A 2CUDA 2DMOA 5IXFA 1M3CA 3FJ5A 2AKLA 2DJQA 2EYZA 3M0RA 2ED1A 2YUNA 1WXBA 4DEXA 5I22A 2DL5A 1H92A 4Z8AA 1JXOA 1NLOC 2LZ6B 2YSQA 2GTJA 1GBQA 2KRSA 2YUQA 3I5SA 2D0NA 2KRMA 4RTVA 2MOXA 2CT4A 1WXUA 2FRWA 1BBZA 2EGAA 2RMOA 2EGEA 2DX1A 2KXCA 2EVRA 2J6FA 1SEMA 1QWFA 2L0AA 3NPFA 1CSKA 2GNCA 1V1CA 2DL8A 1HJDA 4CC2A 5L23A 4LUDA 2JMAA 1G83A 2HBWA 4Z88A 1LCKA 4AFZC 2OI3A 2EYWA 4Z89A 5IHIA 2A08A 3TSZA 3M0TA 1MUZA 2JTEA 2NWMA 2K9GA 1SRMA 1NEGA 4FSSA 3EGUA 2C0IA 4RTWA 3KFVA 2ROLA 2YT6A 1X6GA 2L2PA 4RUGA 3U23A 2EYYA 2FG0A 4GBQA 2W10A 1PRLC 2CH4W 5FWCA 2FPDA 4CC3A 4JZ3A 2LJ3A 4OMPA 1Y0MA 2PZ1A 1KJWA 1N5ZA 2RNAA 1KIKA 2HCKA 1PHTA 2DF6A 4CC7A 2DE0X 4JJBA 2CREA 4F16A 3ULRB 1HSQA 2P4RA 3H41A 1UG1A 3EG0A 2LJ1A 1PKSA 2O2OA 2X3WD 2LMJA 2RN8A 1UECA 3A98A 2GQIA 2RQUA 2DILA 4JPBW 1NG2A 4HVVA 1SHGA 4AFQC 1T0HA 1UFFA 2BZXA 2HSPA 1AD5A 1X2QA 2G6FX 2AK5A 5IHNA 5I11A 2EPDA 5HCKA 1W70A 2ESWA 2DYBA 1WXTA 2KBTA 2OJ2A 1K0XA 2XMFA 3NGPA 5FWBA 4OMLA 1OV3A 2VWFA 1B3QA 3UF4A 2FPFA 2M51A 1K9AA 2LCSA 1I07A 1GCQC 4RTYA 2BTTA 1OPKA 2D8HA 2V1QA 3EHRA 2BZYA 5GJWB 3VRZA 1Z9QA 2KGTA 1K0SA 3VS1A 2YUOA 1OPLA 1BU1A 2FEIA 1UE9A 1OEBA 1SPKA 2EW3A 1M3BA 1AWWA 1B07A 2L3SA 4WCIA 1NYGA 1AWJA 2GTOA 1UGVA 2EBPA 1QKWA 1WFWA 1JU5C 3M0UA 4ORZA 5EC7A 1QKXA 4J9DA 1E7OA 4JJCA 1WYXA 1T3LA 1PNJA 2LJ0A 4J9EA 3VS2A 1UTIA 2PTKA 1WI7A 2RQTA 1JQQA 2J7IA 2KROA 1WA7A 4HCKA 4J9HA 4QT7A 4ZNXA 2JS0A 4J9GA 4OMNA 1GRIA 2HEQA 1TUDA 2F2WA 4IIOA 4AG1C 2GBQA 4EIKA 1ZBJA 5IHKA 2ROTA 3I9QA 3H0HA 2EGCA 2X3XD 1VYUA 4M4ZA 1K1ZA 2CUBA 2LNHB 3C0CA 2J6OA 4CC4B 5GJVB 1QCFA 2JW4A 4JJDA 1HD3A 3VS5A 2VVKA 3SHWA 3LH5A 4R0KA 1YCSB 1UHFA 2YDLA 2A28A 2H8HA 1NYFA 1AZGB 2CT3A 1NEBA 1M30A 3PE0A 4JZ4A 2PNIA 2KR3A 1H3HA 2ABLA 4RTZA 3REBB 2LX7A 1RI9A 5IH2A 4ESRA 2K3BA 1ARKA 1G2BA 3THKA 2MIOA 2QDLA 1CKAA 2CDTA 3EG1A 2DVJA 3PVLA 1NLPC 4A63B 1RLQC 1GL5A 1AVZC 2L3QA 2FO0A 2DRMA 1GCPA 1TG0A 1VYVA 1YP5A 2O9VA 1ZLMA 4F17A 2M0YA 1U3OA 2AZVA 1CKBA 1WX6A 3JV3A 4X1VA 1ZUKA 1TUCA 1AEYA 3TVTA 1BB9A 1JEGA 1U06A 1YN8A 2K79A 5ECAA 3RBBB 4OMMA 1XOVA 4Y92A 2CSQA 1EFNA 1RUWA 2W0ZA 2K6DA 1YWOA 2KYMA 2RF0A 2FPEA 2RPNA 1AWXA 2BZ8A 4D8KA 1GFCA 2ENMA 2O31A 4HVWA 1T3SA 5IXBA 4RTXA 2JT4A 1UJ0A 2CH4A 1W6XA 1ABQA 2J06A 1X6BA 1YWPA 1UHCA 2DLPA 1GBRA 1ZSGA 2K7AA 3EHQA 1UUEA 1RLPC 3RNJA 1FMKA 1T0JA 2C0OA 2KXDA 3REAB 3UA7A 1WLPB 2L3PA 2OAWA 2JMCA 3M0SA 1X69A 2SEMA 1S1NA 4LN2A 1AZEA 4OMQA 2F2XA 2KEAA 2KT1A 4K11A 3UA6A 4IIMA 2B86A 4LE9A 3I35A 2DL3A 2E5KA 4HXJA 2RQRA 1VA7A 4J9FA 4AG2C 3EG2A 1X43A 1ZX6A 2DNUA 2KYBA 2D1XA 3IQLA 1MV3A 1KSWA 1JXMA 1M3AA 1UJYA 4AFUC 3TSWA 1W1FA 1WDXA 3SEMA 1IO6A 1I1JA 1PKTA 1WIEA 2VKNA 1YNZA 4F14A 2J6KA 2RQVA 1PRMC 3VRYA 2EYXA 2JM9A 2SRCA 1K4US 2KRNA 4OMOA 2DRKA 1GFDA 4E6RA 2O9SA 3NHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG3 A;  1K76 A;  3GBQ A;  2DL7 A;  1KFZ A;  3VS6 A;  2D8J A;  2NUZ A;  2EQI A;  4AFS C;  3VS7 A;  2AZS A;  4J9C A;  2J05 A;  1QWE A;  1Y57 A;  2I0N A;  1ZUU A;  2V1R A;  1PWT A;  2DBM A;  3I5R A;  2FRY A;  1J3T A;  2YUP A;  4RTU A;  2ED0 A;  3VS0 A;  3QWY A;  2RQW A;  2O88 A;  2LQW A;  1X27 A;  1SSH A;  2A37 A;  3R6N A;  3PVQ A;  2JXB A;  2DL4 A;  3H0I A;  1I0C A;  2A36 A;  4GLM A;  2DA9 A;  2LQN A;  3QWX X;  2KE9 A;  1ZUY A;  4RTT A;  1AWO A;  2KT8 A;  2JS2 A;  4J9B A;  1OOT A;  2MCN A;  3O5Z A;  2DM1 A;  2JM8 A;  1E6H A;  3CQT A;  1VYT A;  3UAT A;  1E6G A;  1SHF A;  1A0N B;  2C0T A;  1MV0 B;  3NMZ C;  1M27 C;  3H0F A;  2LP5 A;  4D8D A;  3VS4 A;  3ZL7 C;  1M8M A;  1NM7 A;  2K2M A;  2CSI A;  2GGR A;  2F2V A;  1UDL A;  1ABO A;  1H8K A;  1AOJ A;  3M0Q A;  1GCQ A;  4KRT A;  1Z9Z A;  1QLY A;  2ECZ A;  1FYN A;  2IIM A;  4J9I A;  2HDA A;  4DEY A;  5FW9 A;  4LUE A;  1X2K A;  3M0P A;  2EKH A;  4LNP A;  2AKK A;  2DBK A;  1BK2 A;  4HVU A;  2KNB B;  1U5S A;  1SRL A;  3VS3 A;  1JO8 A;  2CUD A;  2DMO A;  5IXF A;  1M3C A;  3FJ5 A;  2AKL A;  2DJQ A;  2EYZ A;  3M0R A;  2ED1 A;  2YUN A;  1WXB A;  4DEX A;  5I22 A;  2DL5 A;  1H92 A;  4Z8A A;  1JXO A;  1NLO C;  2LZ6 B;  2YSQ A;  2GTJ A;  1GBQ A;  2KRS A;  2YUQ A;  3I5S A;  2D0N A;  2KRM A;  4RTV A;  2MOX A;  2CT4 A;  1WXU A;  2FRW A;  1BBZ A;  2EGA A;  2RMO A;  2EGE A;  2DX1 A;  2KXC A;  2EVR A;  2J6F A;  1SEM A;  1QWF A;  2L0A A;  3NPF A;  1CSK A;  2GNC A;  1V1C A;  2DL8 A;  1HJD A;  4CC2 A;  5L23 A;  4LUD A;  2JMA A;  1G83 A;  2HBW A;  4Z88 A;  1LCK A;  4AFZ C;  2OI3 A;  2EYW A;  4Z89 A;  5IHI A;  2A08 A;  3TSZ A;  3M0T A;  1MUZ A;  2JTE A;  2NWM A;  2K9G A;  1SRM A;  1NEG A;  4FSS A;  3EGU A;  2C0I A;  4RTW A;  3KFV A;  2ROL A;  2YT6 A;  1X6G A;  2L2P A;  4RUG A;  3U23 A;  2EYY A;  2FG0 A;  4GBQ A;  2W10 A;  1PRL C;  2CH4 W;  5FWC A;  2FPD A;  4CC3 A;  4JZ3 A;  2LJ3 A;  4OMP A;  1Y0M A;  2PZ1 A;  1KJW A;  1N5Z A;  2RNA A;  1KIK A;  2HCK A;  1PHT A;  2DF6 A;  4CC7 A;  2DE0 X;  4JJB A;  2CRE A;  4F16 A;  3ULR B;  1HSQ A;  2P4R A;  3H41 A;  1UG1 A;  3EG0 A;  2LJ1 A;  1PKS A;  2O2O A;  2X3W D;  2LMJ A;  2RN8 A;  1UEC A;  3A98 A;  2GQI A;  2RQU A;  2DIL A;  4JPB W;  1NG2 A;  4HVV A;  1SHG A;  4AFQ C;  1T0H A;  1UFF A;  2BZX A;  2HSP A;  1AD5 A;  1X2Q A;  2G6F X;  2AK5 A;  5IHN A;  5I11 A;  2EPD A;  5HCK A;  1W70 A;  2ESW A;  2DYB A;  1WXT A;  2KBT A;  2OJ2 A;  1K0X A;  2XMF A;  3NGP A;  5FWB A;  4OML A;  1OV3 A;  2VWF A;  1B3Q A;  3UF4 A;  2FPF A;  2M51 A;  1K9A A;  2LCS A;  1I07 A;  1GCQ C;  4RTY A;  2BTT A;  1OPK A;  2D8H A;  2V1Q A;  3EHR A;  2BZY A;  5GJW B;  3VRZ A;  1Z9Q A;  2KGT A;  1K0S A;  3VS1 A;  2YUO A;  1OPL A;  1BU1 A;  2FEI A;  1UE9 A;  1OEB A;  1SPK A;  2EW3 A;  1M3B A;  1AWW A;  1B07 A;  2L3S A;  4WCI A;  1NYG A;  1AWJ A;  2GTO A;  1UGV A;  2EBP A;  1QKW A;  1WFW A;  1JU5 C;  3M0U A;  4ORZ A;  5EC7 A;  1QKX A;  4J9D A;  1E7O A;  4JJC A;  1WYX A;  1T3L A;  1PNJ A;  2LJ0 A;  4J9E A;  3VS2 A;  1UTI A;  2PTK A;  1WI7 A;  2RQT A;  1JQQ A;  2J7I A;  2KRO A;  1WA7 A;  4HCK A;  4J9H A;  4QT7 A;  4ZNX A;  2JS0 A;  4J9G A;  4OMN A;  1GRI A;  2HEQ A;  1TUD A;  2F2W A;  4IIO A;  4AG1 C;  2GBQ A;  4EIK A;  1ZBJ A;  5IHK A;  2ROT A;  3I9Q A;  3H0H A;  2EGC A;  2X3X D;  1VYU A;  4M4Z A;  1K1Z A;  2CUB A;  2LNH B;  3C0C A;  2J6O A;  4CC4 B;  5GJV B;  1QCF A;  2JW4 A;  4JJD A;  1HD3 A;  3VS5 A;  2VVK A;  3SHW A;  3LH5 A;  4R0K A;  1YCS B;  1UHF A;  2YDL A;  2A28 A;  2H8H A;  1NYF A;  1AZG B;  2CT3 A;  1NEB A;  1M30 A;  3PE0 A;  4JZ4 A;  2PNI A;  2KR3 A;  1H3H A;  2ABL A;  4RTZ A;  3REB B;  2LX7 A;  1RI9 A;  5IH2 A;  4ESR A;  2K3B A;  1ARK A;  1G2B A;  3THK A;  2MIO A;  2QDL A;  1CKA A;  2CDT A;  3EG1 A;  2DVJ A;  3PVL A;  1NLP C;  4A63 B;  1RLQ C;  1GL5 A;  1AVZ C;  2L3Q A;  2FO0 A;  2DRM A;  1GCP A;  1TG0 A;  1VYV A;  1YP5 A;  2O9V A;  1ZLM A;  4F17 A;  2M0Y A;  1U3O A;  2AZV A;  1CKB A;  1WX6 A;  3JV3 A;  4X1V A;  1ZUK A;  1TUC A;  1AEY A;  3TVT A;  1BB9 A;  1JEG A;  1U06 A;  1YN8 A;  2K79 A;  5ECA A;  3RBB B;  4OMM A;  1XOV A;  4Y92 A;  2CSQ A;  1EFN A;  1RUW A;  2W0Z A;  2K6D A;  1YWO A;  2KYM A;  2RF0 A;  2FPE A;  2RPN A;  1AWX A;  2BZ8 A;  4D8K A;  1GFC A;  2ENM A;  2O31 A;  4HVW A;  1T3S A;  5IXB A;  4RTX A;  2JT4 A;  1UJ0 A;  2CH4 A;  1W6X A;  1ABQ A;  2J06 A;  1X6B A;  1YWP A;  1UHC A;  2DLP A;  1GBR A;  1ZSG A;  2K7A A;  3EHQ A;  1UUE A;  1RLP C;  3RNJ A;  1FMK A;  1T0J A;  2C0O A;  2KXD A;  3REA B;  3UA7 A;  1WLP B;  2L3P A;  2OAW A;  2JMC A;  3M0S A;  1X69 A;  2SEM A;  1S1N A;  4LN2 A;  1AZE A;  4OMQ A;  2F2X A;  2KEA A;  2KT1 A;  4K11 A;  3UA6 A;  4IIM A;  2B86 A;  4LE9 A;  3I35 A;  2DL3 A;  2E5K A;  4HXJ A;  2RQR A;  1VA7 A;  4J9F A;  4AG2 C;  3EG2 A;  1X43 A;  1ZX6 A;  2DNU A;  2KYB A;  2D1X A;  3IQL A;  1MV3 A;  1KSW A;  1JXM A;  1M3A A;  1UJY A;  4AFU C;  3TSW A;  1W1F A;  1WDX A;  3SEM A;  1IO6 A;  1I1J A;  1PKT A;  1WIE A;  2VKN A;  1YNZ A;  4F14 A;  2J6K A;  2RQV A;  1PRM C;  3VRY A;  2EYX A;  2JM9 A;  2SRC A;  1K4U S;  2KRN A;  4OMO A;  2DRK A;  1GFD A;  4E6R A;  2O9S A;  3NHN A; 
#chains in the Genus database with same CATH topology
 1K76 A;  1AT1 B;  3G4S T;  5LJ5 g;  2D8J A;  3H6Z A;  4M78 D;  3EGD B;  4FYY B;  2E65 A;  5LJ5 j;  3CCE T;  2FRY A;  2LTO A;  3QWY A;  3VS0 A;  1RAA B;  2K57 A;  3OS5 A;  3R6N A;  1ZA2 B;  4FT2 A;  4E7L A;  3M56 A;  4IKF A;  5FU7 B;  3H0I A;  2OTL T;  4EMK C;  5HK3 A;  3CCE Q;  1I0C A;  2P4T A;  2DET A;  4J7F A;  5LJ5 e;  4BE0 A;  4NS5 A;  3MEU A;  1OZ2 A;  2MCN A;  2OTL Q;  3ASK A;  1R0C B;  4E7I A;  4C0G A;  1QCN A;  3UAT A;  1E6G A;  1SHF A;  1A0N B;  2RHY A;  2C0T A;  3RMQ A;  1VQ8 T;  2ZZD A;  3ZEH A;  3JCM h;  5FRM A;  2E1H A;  4M7A D;  2RHU A;  2LP5 A;  2DIG A;  4D8D A;  4M7D F;  2XID A;  3OBY A;  3JCM V;  4GLK A;  1K73 U;  1VQ8 Q;  4F7U B;  1MMA A;  3H8Z A;  1VQ6 T;  4PJO C;  1AOJ A;  1UGS B;  3CD6 Q;  4HCC A;  3QZ9 B;  5CKD A;  3PT9 A;  4DEY A;  1FYN A;  3CCS A;  3SD4 A;  5L8R E;  4N0A A;  2AKK A;  1O75 A;  4HVU A;  1RAB B;  3ER0 A;  1G3T A;  3GF5 A;  1JO8 A;  5IXF A;  2R58 A;  1M3C A;  3I55 T;  2RA2 A;  4IUQ A;  4B6M A;  4M77 A;  4M75 C;  2JN0 A;  2DJQ A;  5A0G A;  4J5Y A;  4GY5 A;  5I22 A;  1JB0 E;  3I55 Q;  1H92 A;  1JXO A;  4FYV B;  5KYW A;  1Q81 R;  3FB9 A;  1D1B A;  3CCQ A;  1GBQ A;  4EPC A;  2YUQ A;  4RTV A;  2EJF A;  1PG5 B;  1BBZ A;  1VQO A;  4J6W A;  5CVI A;  4M75 E;  4JS5 A;  1OYX A;  3MHX A;  4XU1 A;  4Y91 A;  2KXC A;  3OSS C;  1PSF A;  2L0A A;  1WQ7 A;  4CC2 A;  3HFO A;  2PU9 B;  4LUD A;  2HBW A;  3NTI A;  2NUP B;  1LCK A;  4AFZ C;  2OX7 A;  1JJ2 A;  2LRQ A;  3EG9 B;  2A0F B;  2QDY B;  2EYW A;  2K5L A;  2EIF A;  1Y07 A;  4C0F A;  4DBQ A;  3A8O B;  2R5M A;  2K9G A;  1NEG A;  1HK9 A;  3MET A;  4LD6 A;  4RUG A;  1YJW T;  2EYY A;  3OYF A;  2CH4 W;  4KUI A;  2FPD A;  4JZ3 A;  4OMP A;  1Y0M A;  2PZ1 A;  1BI0 A;  1KJW A;  4C92 G;  2G3R A;  3BE3 A;  5IT9 E;  2DF6 A;  4MML A;  1YJW Q;  4JJB A;  5KH6 A;  1RAF B;  3JSC A;  4A4F A;  2LJ1 A;  2X3W D;  2DZ9 A;  1UEC A;  5LJ3 d;  2QK0 A;  2E4H A;  2RHX A;  3QG1 A;  3QDR B;  1T0H A;  4E7Z A;  1FWZ A;  2BZX A;  1YBY A;  4XQ3 A;  4XU0 A;  2AK5 A;  3DKM A;  2E5Q A;  3O8V A;  3RUX A;  1JJ2 S;  1WXT A;  2HQH A;  2KBT A;  2VUB A;  2OJ2 A;  1BCO A;  4LD9 K;  2LT4 A;  2DTI A;  2MYS A;  3ME9 A;  3SWN B;  2X4X A;  2OTJ A;  3DLM A;  4J6X A;  3RES A;  3OYN A;  2M51 A;  3FDR A;  2LCS A;  2KY9 A;  1I07 A;  3OYM A;  1S72 T;  1Q82 C;  1NJI U;  1K73 R;  5GAO n;  2K3X A;  1GCQ C;  4RTY A;  3LLR A;  3EHR A;  1SKU B;  4FW2 A;  1MGQ A;  1VQ9 T;  1BU1 A;  2EWN A;  2RK1 A;  1MNE A;  2P0K A;  3P8H A;  1SPK A;  2EW3 A;  1M3B A;  3I56 Q;  1VQ9 Q;  3CC4 A;  1QKW A;  1JU5 C;  3M0U A;  1WYX A;  1T3L A;  5GMK j;  2RJC A;  4J9E A;  4FSX A;  4M7D G;  4FYX B;  4BDZ A;  2YXY A;  5GAM h;  3AHU A;  2EFI A;  8AT1 B;  2HEQ A;  3NFC A;  4IIO A;  1ZBJ A;  3T9N A;  3G7Z A;  4E7J A;  3CMA T;  5GMK e;  3HPW A;  2COZ A;  1VYU A;  2VYT A;  4JLI A;  1SG5 A;  2J6O A;  4EMK B;  5GJV B;  2JNG A;  1I4K 1;  4LXC A;  2XIC A;  1RAG B;  5GAN 5;  2ZAE A;  3SHW A;  2DXB A;  3CCL T;  3CCU Q;  4R0K A;  3JB9 G;  1YCS B;  4MDX A;  4C5H A;  1AZG B;  3PE0 A;  4AMC A;  3G6E A;  1N6A A;  4QQG A;  2PNI A;  5GAN 3;  2X35 A;  2CP6 A;  4ESR A;  1G2B A;  2MIO A;  2DTO A;  1CKA A;  4L5G A;  2FB7 A;  2DVJ A;  5KE2 A;  3OYY A;  4A63 B;  3JB9 I;  4IUV A;  1VQK A;  4ME7 A;  4OF1 A;  2X4J A;  3HL8 A;  1I81 A;  1VYV A;  4F17 A;  2M0Y A;  2EKO A;  3HHT B;  2D0Q B;  1CKB A;  2EQK A;  3QUI A;  1D0Z A;  3OYE A;  4M75 B;  1TUC A;  2H3E B;  4JRP A;  1VUB A;  3OYK A;  1JEG A;  1U06 A;  1KD1 C;  4XK8 E;  4PJO A;  1XOV A;  2CZ6 B;  2CSQ A;  3TQ7 P;  1EFN A;  3NTH A;  2COY A;  2K6D A;  2RF0 A;  3X25 B;  3HP9 A;  4X9D A;  4ZGD B;  3QYG B;  5IXB A;  2JT4 A;  2HQE A;  3DLL A;  2VB6 A;  2ZPG B;  3M53 A;  4N0A C;  5LJ5 d;  1JJ2 P;  3MJX A;  1WHJ A;  1KQS A;  2V8K A;  3C12 A;  2K7A A;  1NJI R;  5J3B A;  2KXD A;  2I2L A;  4JUV A;  2V8J A;  4M77 C;  1RI0 A;  2DER A;  2MK5 A;  3QJ6 A;  2JMC A;  3M0S A;  2SEM A;  1I5L A;  4O6J A;  2DKG A;  4PFZ A;  1AZE A;  4IIM A;  2DXC A;  3LWH A;  4C8Q G;  3I35 A;  3M5A A;  2E5K A;  3EGX B;  3EG2 A;  1YIJ T;  4II1 A;  2KYB A;  3IQL A;  3PIO A;  4AFU C;  1YIT T;  4F7U E;  1IGU A;  2O4X B;  1YIJ Q;  1W1F A;  5KYX A;  4KH0 B;  1K9M C;  3OS2 A;  4J8O A;  1XNI A;  1YIT Q;  1OQK A;  3OYB A;  2WSC E;  2DJZ A;  2MWO A;  1M90 U;  2PQW A;  3V8J A;  3VV0 A;  3RDV A;  3NHN A;  4ZGE B;  4PLL A;  4KT0 E;  3CPW A;  1KFZ A;  2NUZ A;  1M1G A;  3VS7 A;  2AZS A;  4PLI A;  4RMO A;  2E10 A;  2DD5 A;  1TWB A;  4NOY A;  5GAN g;  4JJN K;  1UGP B;  1YHQ T;  1VQP T;  1PWT A;  2LCC A;  1QCO A;  2YUP A;  1YJN A;  1C1A A;  2VGM A;  1I8F A;  2LQW A;  5GAN j;  1X27 A;  3SFM A;  1VQP Q;  1PM3 A;  3BDU A;  3OYA A;  2A36 A;  3OMG A;  2HBP A;  4DBR A;  1AWO A;  2KT8 A;  5GAO p;  1OOT A;  1MHN A;  3O5Z A;  2JM8 A;  5GAN e;  1Y96 B;  1MV0 B;  2E3I A;  1M27 C;  1VQ7 T;  2KSS A;  4BI8 B;  1H64 1;  3VJP A;  3VS4 A;  3ZL7 C;  2GGR A;  4MMK A;  3TCJ A;  3JB9 J;  1VQ7 Q;  1UDL A;  4BAC A;  1ABO A;  4M75 D;  1H8K A;  4PJN A;  3CPW S;  4KRT A;  1GCQ A;  3PIP A;  2CYZ B;  1WHK A;  5DM7 R;  9ATC B;  4NL3 A;  2BUD A;  5CKF A;  5I21 A;  1QLY A;  2IIM A;  3QBY A;  1KHC A;  2HDA A;  1SSF A;  2ATC B;  5FW9 A;  5GAN 7;  4LUE A;  2A3L A;  2EKH A;  2DBK A;  1BK2 A;  3V7S A;  4JDS A;  2CUD A;  1VQL T;  2AIR B;  3FJ5 A;  3KUF A;  2AKL A;  3TRE A;  2RH2 A;  1D3B B;  4A4G A;  2YRD A;  1TUG B;  3M0R A;  3CME T;  3OYJ A;  4DEX A;  5I2M A;  4A4E A;  1VQL Q;  1VQ5 Q;  2YSQ A;  3JCM c;  2GTJ A;  1H3Z A;  3MKD A;  2KRS A;  2FHD A;  3UDC A;  4C92 A;  3CME Q;  1WXU A;  4E2F B;  1N8R C;  1WJR A;  2RMO A;  2EGE A;  3CCV A;  1KK7 A;  2A7Y A;  2J6F A;  2HKN A;  3OS1 A;  2QEX T;  1HJD A;  5L23 A;  2DD4 A;  1X6O A;  2RK2 A;  3FEO A;  1OU8 A;  2GFA A;  2JMA A;  4BI3 A;  4HKE A;  2OI3 A;  2K5F A;  1WGS A;  5CCA A;  5IHI A;  2A08 A;  3M59 A;  3M0T A;  2HL5 C;  3CXC A;  1SRM A;  2L5Q A;  2QQ9 A;  4FSS A;  3EGU A;  4E7K A;  5GAO m;  2YT6 A;  3E19 A;  3S3M A;  3MEA A;  1M90 R;  3G4S Q;  4PJL A;  3OMC A;  1UEB A;  2MMP A;  2HCK A;  1NPP A;  8ATC B;  2DE0 X;  2OTL A;  1B34 A;  4F16 A;  5GAN f;  2P4R A;  4JS4 A;  1M2O A;  4MZM A;  5GAN 6;  1PKS A;  2LMJ A;  1M8V A;  5LL6 S;  3A98 A;  1KQS P;  2RQU A;  3QHS A;  2DIL A;  1M2V A;  3CCR A;  1NG2 A;  3EAE A;  1YCY A;  2DXT A;  4J7I A;  3MPU B;  4PFP A;  5AYF A;  1UFF A;  2R57 A;  2ZPI B;  2HSP A;  2LT1 A;  4OB1 B;  4DBH A;  1VQ8 A;  1X2Q A;  3L1A A;  4ELY C;  3J80 E;  3CD6 A;  2CP5 A;  3MEW A;  2CZ1 B;  4M77 B;  2DYB A;  4PK4 A;  2HZY A;  3CBM A;  3EGD A;  1IRE B;  4KBM B;  4M7D A;  3NGP A;  5FWB A;  2BE7 D;  3X20 B;  2JVV A;  5KYW B;  3CXC S;  4JRK A;  2FL7 A;  3UF4 A;  1TXQ A;  1WPY A;  1VQ6 Q;  5CQY A;  1VIF A;  1K9A A;  3A8L B;  3S3N A;  2EQU A;  5EG2 A;  4ZGJ B;  2M0O A;  5KCH A;  3I55 A;  4M78 G;  2BZY A;  4PJO E;  1X75 C;  1NJI C;  1ZHI A;  2QTX A;  3CC7 T;  1YI2 T;  3C94 A;  1PD1 A;  1UE9 A;  2FEI A;  1Q86 U;  4E7H A;  2L3S A;  2XDD A;  3CCS T;  4WCI A;  1KQ2 A;  1NYG A;  3OYH A;  1D0Y A;  3CPW P;  1QVF A;  2EBP A;  3A8G B;  3G71 T;  1VOM A;  1WFW A;  2EJ9 A;  3CC7 Q;  5EC7 A;  1YI2 Q;  4E7S A;  3M55 A;  1E7O A;  2M9U A;  2NYS A;  2FYK A;  1UTI A;  3CCS Q;  4F7U F;  2PTK A;  1WI7 A;  2ZPE B;  3G71 Q;  2KRO A;  3OYC A;  4QVC A;  2CS7 A;  5CR2 A;  2JS0 A;  3HFN A;  4J9G A;  4OMN A;  2YHT A;  2F2W A;  4KGZ B;  2EQJ A;  4OVA A;  2ROT A;  3RIR A;  1SF9 A;  1IB8 A;  3H0H A;  3URG A;  2EGC A;  1FMV A;  4FIB A;  3VYG A;  5KYY A;  4M7A G;  4CC4 B;  3EFR A;  4A53 A;  2JW4 A;  5KE3 A;  1HD3 A;  3SB2 A;  3LH5 A;  4BD3 A;  2R5A A;  1YJW A;  1UHF A;  1TSF A;  1YJ9 A;  5HKC A;  1NYF A;  4C5E A;  5LJ5 f;  2IPO B;  4QQD A;  1IXD A;  2LC4 A;  3HTR A;  3JCM g;  2YWW A;  1M30 A;  4JZ4 A;  3JCM b;  4N4G A;  2DEQ A;  2C06 A;  4FW1 A;  2RI3 A;  5CO7 A;  1W2B A;  2HNI A;  2JZ2 A;  1IHV A;  1QVF S;  1RI9 A;  2GF7 A;  1ARK A;  3L2W A;  3THK A;  3LYI A;  2QDL A;  2JTM A;  3PGG A;  3JCM Q;  2JUF A;  3EG1 A;  4C5I A;  3A5Z B;  3PVL A;  3M9Q A;  1RLQ C;  1BKB A;  2FO0 A;  4BE1 A;  2ZGW A;  3JCM e;  3E1S A;  1IHW A;  2RHZ A;  4RKU E;  2E3H A;  3MEV A;  3MP6 A;  1R77 A;  5D6X A;  3F70 A;  4CI0 C;  1WX6 A;  1ZSZ C;  2DPP B;  4C8Q A;  3QPH A;  1FMW A;  2P0Q A;  1AEY A;  3RR6 A;  2DEU A;  5IAY A;  1YN8 A;  5FRN A;  2K79 A;  5ECA A;  3RBB B;  2P84 A;  3AT1 B;  3OYG A;  1XTD A;  4M77 D;  2K4Y A;  1KC8 R;  2BZ8 A;  4IUU A;  2F69 A;  2M1H A;  4HVW A;  3I56 A;  6AT1 B;  3EFO A;  4MZP A;  4B9W A;  5C6S A;  1VQ4 T;  1S72 Q;  2FZG B;  2Z0W A;  3WVD B;  2PUO B;  3QKJ A;  1W2B S;  1GBR A;  3EHQ A;  3RNJ A;  4RCB A;  3UA7 A;  3REA B;  3CXC P;  2CP2 A;  5GAN d;  1FXX A;  2L3P A;  2NUT A;  1VQ4 Q;  2LNV A;  1X69 A;  4J6Y A;  2BKD N;  3EH2 A;  4OMQ A;  2KEA A;  3UA6 A;  3PMI A;  2B86 A;  2PUK B;  1Q86 R;  1ACM B;  1WHM A;  3OYL A;  1X43 A;  1KQ1 A;  4C92 C;  2CZ0 B;  2NLU A;  2CP0 A;  1Q7Y R;  2HSE B;  1KSW A;  4DOW A;  2QXF A;  1JXM A;  1IGQ A;  1PC0 A;  5D6Y A;  3CCU A;  1M9S A;  1WDX A;  1WIE A;  1I1J A;  4XTW A;  3CMA Q;  1YNZ A;  2J6K A;  4C92 E;  3VRY A;  1NPR A;  3QZ5 B;  2JM9 A;  2SRC A;  2KRN A;  4IUR A;  1MMG A;  2O9S A;  1NZ9 A;  5CKE A;  3HRT A;  3GBQ A;  1M1K U;  4OB0 B;  3JCM X;  3X26 B;  3CCL Q;  1MMN A;  2EQI A;  2YRC A;  5CKB A;  5LJ3 h;  1M90 C;  1JRI A;  1QWE A;  4BE2 A;  2K2V A;  2I0N A;  1UGQ B;  1ZUU A;  2VGN A;  2V1R A;  4F7U G;  2DBM A;  3I5R A;  5GAO r;  2F1L A;  4RTU A;  2ED0 A;  2HAX A;  2XDB A;  3PMT A;  2O88 A;  4PJO B;  3OY9 A;  2VXE A;  2A37 A;  1SSH A;  4RG2 A;  5HK0 A;  3M58 A;  1KG1 A;  3Q1J A;  2DL4 A;  3MO8 A;  3CC2 T;  4GLM A;  2DA9 A;  4HCB A;  1V29 B;  4A54 A;  3LWI A;  5GAO l;  2CP7 A;  2JTF A;  3QXE B;  2JS2 A;  2E6N A;  4BY6 C;  1O9S A;  1E6H A;  3CC2 Q;  2JOY A;  1VYT A;  1QVF P;  4J83 A;  3UT1 A;  4JRI A;  1VQK T;  1QMC A;  4BDY A;  3MP8 A;  4M7D C;  1M8M A;  1NM7 A;  2CSI A;  3GLX A;  4RCC A;  1PSE A;  1NE8 A;  4PJO F;  5FU6 C;  1Q82 U;  2QAZ A;  4IUT A;  4R56 A;  1Z9Z A;  4J9I A;  2ECZ A;  5FU7 C;  1WHG A;  1X2K A;  4HT8 A;  4LNP A;  1U5S A;  5KYX B;  5C0M A;  4FYW B;  2DMO A;  4UC4 A;  5GMK l;  4M75 F;  1Q81 C;  2ED1 A;  1K8A U;  2QA4 T;  4QW2 A;  4Y28 E;  1YIJ A;  4Z8A A;  2LZ6 B;  4M77 E;  2XDP A;  3I5S A;  2JJ9 A;  2KRM A;  3QDF A;  2MOX A;  4KH1 B;  1YIT A;  2FRW A;  1W2B P;  2QA4 Q;  3JRZ A;  1TU0 B;  2EGA A;  2V8I A;  1U1T A;  1SEM A;  4ELZ C;  3NPF A;  1CSK A;  4PJJ A;  3QJY A;  3GOX A;  3GP8 A;  2ZPH B;  3RER A;  4X34 A;  1G83 A;  4DQ2 A;  2F5K A;  1OUL A;  5J26 A;  3TSZ A;  4F04 B;  3OYD A;  2ZPB B;  3CCM A;  2COW A;  2JTE A;  4RTW A;  2LVM A;  4R55 A;  2ROL A;  4PKC C;  1VQP A;  2L2P A;  2FG0 A;  5FWC A;  4CC3 A;  1M1K R;  2XD0 A;  2CGH A;  1KIK A;  3CBP A;  1YHQ Q;  3SDZ A;  1PHT A;  5KYN A;  4CC7 A;  2CRE A;  5GMK i;  3ULR B;  1VIE A;  1HSQ A;  1VQM A;  1VQN A;  4FCY A;  4M78 A;  1D09 B;  2QQR A;  2EJG A;  4OGE A;  4JPB W;  2RJE A;  1OU9 A;  4PJO D;  4AFQ C;  1SHG A;  1ZSZ A;  1C0M A;  3E9F A;  2D6F A;  1AD5 A;  5IHN A;  1VQ7 A;  5I11 A;  2QQA A;  1RAH B;  5HCK A;  5LJ5 h;  1R0B G;  1LNX A;  2ESW A;  4KUD K;  4C8Q C;  1RAE B;  2DFU A;  3GNG A;  2IVW A;  2KDS A;  1UGR B;  4QVD A;  1KD1 U;  2ZPF B;  1HYO A;  3FIF A;  5KYU A;  4JLG A;  3RKX A;  1OV3 A;  1TOV A;  1WZO A;  2QYZ A;  3BW1 A;  1QP2 A;  1K73 C;  3NTK A;  1B3Q A;  5IN1 A;  4C92 B;  4C8Q E;  3RKW A;  2DXU A;  1BCM A;  1TS9 A;  3RMS A;  2F5T X;  4M7A A;  1OPK A;  4A4K A;  1VQL A;  4A4H A;  1VQ5 A;  4BUG A;  2DAQ A;  3CCJ T;  1Z9Q A;  2KGT A;  1Q82 R;  1K0S A;  3S3O A;  3VS1 A;  1OPL A;  3JCM d;  1UB4 A;  1OZ3 A;  1OEB A;  3CME A;  4C5G A;  3VUB A;  3CCJ Q;  3PTA A;  4QVZ A;  4EMH A;  4ORZ A;  1Q86 C;  3ZBD A;  5CQX A;  4JJC A;  4ANJ A;  1W4S A;  1IZ6 A;  2RQT A;  1K8A R;  2O01 E;  2KAF A;  4HCK A;  4J9H A;  3OW2 S;  4ZNX A;  4RG8 A;  4FU6 A;  4ATO A;  1GRI A;  4AG1 C;  2DVE A;  4C92 F;  5IHK A;  4OB3 B;  2FZK B;  2MF2 A;  1K9M U;  1WQW A;  1B34 B;  3LGL A;  5D7U A;  2QEX Q;  3G4S A;  2RJD A;  4M4Z A;  4EMG A;  2FVU A;  2LNH B;  3C0C A;  2Y90 A;  3HRU A;  1QCF A;  4XTZ A;  5FLX E;  3VS5 A;  3QYH B;  1G3Y A;  1LPL A;  1M2V B;  4Q5W A;  4M75 G;  3CCE A;  1EIF A;  1ZA1 B;  2RHI A;  2X4W A;  4OP0 A;  2A28 A;  2YDL A;  4XAX B;  3X28 B;  4BY6 B;  2CT3 A;  3OYI A;  1NEB A;  2MWP A;  1QVG A;  1RAD B;  2KK4 A;  4ZN3 A;  2HKQ B;  2KR3 A;  2ABL A;  3M4G A;  4RTZ A;  3REB B;  4M7D B;  2V26 A;  2DIQ A;  2E6Z A;  1N9S A;  2LX7 A;  5IH2 A;  2K3B A;  2Y4Y A;  1D0X A;  2CDT A;  5FU6 B;  2HMA A;  2LQ8 A;  4PL6 A;  4WTO B;  2L3Q A;  3L42 A;  1N27 A;  1YP5 A;  1ZLM A;  3LH0 A;  4DBF A;  1U3O A;  2RM4 A;  2AZV A;  1KC8 U;  2WSF E;  2M16 A;  5I2S A;  1ZUK A;  1VQ6 A;  1M4Z A;  1JBM A;  5GMK m;  3CCR T;  3V7C A;  3OS0 A;  1BB9 A;  4N4I A;  4LDX A;  4OMM A;  4Y92 A;  1RUW A;  1Y7X A;  2W0Z A;  3CCR Q;  3CD6 T;  3TEE A;  1KD1 R;  3GPL A;  2YLC A;  3LGF A;  2O31 A;  1T3S A;  3J81 E;  4RTX A;  1G3W A;  1UJ0 A;  3CC7 A;  1QVG S;  1YI2 A;  1ABQ A;  3HKS A;  2FZC B;  3OBW A;  2J06 A;  5A0D A;  1ZSG A;  4C92 D;  1FMK A;  1T0J A;  3G71 A;  5A0L A;  4FT4 A;  5KYY B;  1NBE B;  1WLP B;  4ZTF A;  4M77 F;  1Q7Y U;  3MCA B;  2OAW A;  4PFO A;  1V76 A;  1S1N A;  4O5V A;  2K5I A;  2F2X A;  2KT1 A;  1N9R A;  4N4H A;  3JB9 F;  2X4Y A;  2LQK A;  3QII A;  4HXJ A;  1I5O B;  3MP1 A;  1WNL A;  3C4S A;  4F7U A;  2VXF A;  5A2Q E;  4AG2 C;  1ZX6 A;  1GXI E;  2DNU A;  4LDW A;  1N8R U;  3E9G A;  2WAC A;  3CCQ T;  1MV3 A;  5CAI A;  7AT1 B;  3FC3 A;  1VQO T;  3FJP A;  2BE9 B;  2VAS A;  3SEM A;  3CCQ Q;  3CPF A;  2VKN A;  3M54 A;  1MMD A;  4Z02 A;  5CK9 A;  2RQV A;  3VKI A;  1PRM C;  2QQB A;  2EYX A;  1VQO Q;  1K9M R;  2RO0 A;  4OMO A;  1GFD A;  1WJS A;  1D1A A;  2YRV A;  5GMK h;  3OW2 P;  3EG3 A;  1R8O B;  5GAM d;  3H9N A;  3L2V A;  2DL7 A;  3VS6 A;  4AFS C;  2QAS A;  4J9C A;  1P92 A;  2J05 A;  2QGF B;  3UWN A;  1M1K C;  1Y57 A;  4C8Q B;  3V8L A;  1M1F A;  2KVQ G;  2CP3 A;  5GAN 4;  1U8R A;  1G8X A;  1J3T A;  4CRI A;  1YJ9 T;  3OB9 A;  3V7R A;  2E64 A;  2RQW A;  3DB4 A;  2XHC A;  4BI4 A;  4DOV A;  3PVQ A;  2NUP A;  2JXB A;  3EG9 A;  4PJM A;  1YJ9 Q;  3M4Y A;  4M78 C;  3V8K A;  4OMF B;  1LOJ A;  2GQV A;  2LQN A;  3QWX X;  2RJF A;  4M7D D;  4XTY A;  3EFO B;  2B8A A;  2KE9 A;  1G5V A;  1ZUY A;  4RTT A;  4J9B A;  2GCX A;  2DM1 A;  3CQT A;  1BIA A;  3NMZ C;  4M78 E;  2NUT B;  3CBO A;  3H0F A;  1BI1 A;  4E47 A;  1S72 A;  4JRQ A;  4C8Q F;  2K2M A;  2F2V A;  1QP3 A;  1VQ9 A;  2H3J A;  3JB9 D;  3M0Q A;  3A8H B;  2DZC A;  1PD0 A;  5D6W A;  1VQ4 A;  2QGG A;  1BYM A;  4XTX A;  2OTJ T;  4LDY A;  5HY6 A;  1DJ7 B;  3EFS A;  4LDU A;  4M7A C;  3M0P A;  3VYH B;  2EYQ A;  2KNB B;  1SRL A;  3L2Q A;  1EZZ B;  3VS3 A;  2OTJ Q;  4ZN1 A;  1BI3 A;  1QW1 A;  3I56 T;  5CIU A;  2HL3 A;  2EYZ A;  1WHL A;  4HT9 A;  2RI2 A;  4QKU A;  2YUN A;  1WXB A;  2Y4X A;  3WXM B;  4M7A E;  2DL5 A;  2K3Y A;  1NLO C;  1B7T A;  4L59 A;  1QVG P;  3SWN A;  3CC4 T;  3CMA A;  1K8A C;  2EAY A;  2D0N A;  2CT4 A;  2VC8 A;  3QO3 A;  4VUB A;  2DO3 A;  2DX1 A;  1BI2 A;  3CC4 Q;  2EVR A;  5AT1 B;  4OGC A;  1QWF A;  4XU2 A;  4YTL A;  5GAN 2;  2GNC A;  1N8R R;  5J39 A;  1V1C A;  2DL8 A;  3CCL A;  3P8B B;  3ZFJ A;  4Z88 A;  1QVP A;  1F1B B;  2OAU A;  1FX7 A;  4Z89 A;  3CCU T;  3X24 B;  2DYI A;  1MUZ A;  4ZTJ A;  2NWM A;  4M77 G;  2C0I A;  4C0D C;  3KFV A;  2GFU A;  4B9X A;  1X6G A;  3U23 A;  2XG8 D;  3HSB A;  4KGX B;  2VV5 A;  4GBQ A;  2W10 A;  1PRL C;  3JCM f;  1LJO A;  2LJ3 A;  1WJQ A;  2YLB A;  2RNA A;  1N5Z A;  2KI7 A;  2QI2 A;  3G6E T;  3CC2 A;  4L6V 5;  3H41 A;  1EX4 A;  1UG1 A;  2M02 A;  3EG0 A;  2O2O A;  4EMK A;  2IG0 A;  3A8M B;  4C8Q D;  2RN8 A;  1G3S A;  3G6E Q;  5DLQ E;  3LX7 A;  2GQI A;  1MND A;  4HVV A;  4QQ6 A;  5CKH A;  3VU3 C;  2XU8 A;  2DK3 A;  3TU4 K;  2G6F X;  3M57 A;  2EPD A;  1D1C A;  1W70 A;  2D9T A;  2AT1 B;  2DTH A;  5GAM g;  3QSU A;  1M5Q 1;  1K0X A;  1VQK Q;  2XMF A;  5GAN h;  4OML A;  1AHJ B;  2KMT A;  2VWF A;  3LW5 E;  4KGV B;  5GAM j;  1RAI B;  4V2S A;  3PFS A;  4M7D E;  2E70 A;  2FPF A;  4XTU A;  2EQM A;  3OSV A;  2BTT A;  2D8H A;  2V1Q A;  3INZ A;  1KHI A;  2PVG B;  5GJW B;  3VRZ A;  3JCM W;  1BIB A;  2E12 A;  2YUO A;  5GAM e;  3G1J A;  1AWW A;  1C6V X;  4M75 A;  2QA4 A;  1B07 A;  1AWJ A;  3CEY A;  2GTO A;  1UGV A;  5LJ3 g;  2L89 A;  4HA8 A;  3JCM P;  1QKX A;  4J9D A;  1PNJ A;  2LJ0 A;  3FLG A;  2PVD B;  3WVE B;  3VS2 A;  2RI5 A;  1JQQ A;  5LJ3 j;  2J7I A;  1WA7 A;  4X9C A;  4QT7 A;  1TH7 A;  4WF2 A;  4LDV A;  2LCL A;  1TUD A;  2GBQ A;  4EIK A;  3KXT A;  2AHJ B;  3BY7 A;  3I9Q A;  2X3X D;  1HXD A;  4OB2 B;  1X01 A;  1K1Z A;  2CUB A;  3L2R A;  5LJ3 e;  3RKY A;  4M78 B;  4JJD A;  2XKO C;  2VVK A;  3P8D A;  2WSE E;  5KCO A;  1XJW B;  3PNW C;  1YHQ A;  2CKK A;  4MDW A;  4EDU A;  2XI9 A;  2L8D A;  1ZSZ B;  2H8H A;  3EGX A;  1XQH A;  3HRS A;  1U1S A;  4XTV A;  3DB3 A;  4P5N A;  4NL2 A;  1RL2 A;  3CCM T;  3BFM A;  3A1P A;  3VUZ A;  1H3H A;  1KQS S;  4FL6 A;  2O4X A;  5KYU B;  2RD1 A;  3UPU A;  2KQW A;  1QQJ A;  3CCM Q;  4BB7 A;  1TTH B;  1YJN T;  3GIB A;  2LDM A;  1IRX A;  2E41 A;  2HD0 A;  3GNF B;  2PVO B;  1NLP C;  1Q95 G;  2P0P A;  4TVR A;  1GL5 A;  1AVZ C;  2RB6 A;  3OW2 A;  1YJN Q;  1VQM T;  2DRM A;  4XU3 A;  4M7A B;  4M78 F;  1GCP A;  1TG0 A;  3E2U A;  1OI1 A;  2O9V A;  1VQN T;  2LX9 A;  1LVK A;  2QTV A;  3C95 A;  5M9O A;  3JV3 A;  4X1V A;  1VQM Q;  1VQN Q;  3JAM E;  3TVT A;  1OX9 A;  3KBG A;  3L2Z A;  1ZQ1 A;  1KC8 C;  2QQS A;  5DY9 A;  1YWO A;  5GAM f;  2KYM A;  4IUP A;  2FPE A;  2RPN A;  1YFN A;  1AWX A;  4C0Z A;  2ZCF B;  4D8K A;  1GFC A;  2ENM A;  2MI6 A;  3CCJ A;  2X51 A;  2CH4 A;  5FRO A;  2MPX C;  2HQX A;  3BDL A;  1W6X A;  4KUL A;  1PCX A;  1RAC B;  1X6B A;  1YWP A;  1UHC A;  1ZBX A;  2DLP A;  1Y96 A;  1UUE A;  1RLP C;  2C0O A;  4M7A F;  2BIV A;  2L3R A;  1Q81 U;  4D6W A;  4LN2 A;  1VQ5 T;  2XK0 A;  4K11 A;  2X9H A;  5DLO A;  3D7S B;  3OQ5 A;  4LE9 A;  2DL3 A;  1Q7Y C;  2RQR A;  4C0D B;  3FRN A;  1VA7 A;  3SWN C;  1OX8 A;  4J9F A;  1WHH A;  2QEX A;  5LJ3 f;  1Y71 A;  2MAM A;  3L2U A;  3JB9 H;  4PNO A;  4PJO G;  4DA4 A;  2D1X A;  3R6O A;  1M3A A;  1UJY A;  4AT1 B;  3JCM J;  5GAN 8;  3TSW A;  4MZT A;  2CZ7 B;  2QG9 B;  3CCV T;  1IO6 A;  4F14 A;  1PKT A;  3J7A F;  3S6W A;  4FM4 B;  1D3B A;  1K4U S;  2DRK A;  3EH1 A;  4HCZ A;  5GAO q;  3CCV Q;  3OA6 A;  4E6R A;  3N5B B; 
#chains in the Genus database with same CATH homology
 3EG3 A;  1K76 A;  3GBQ A;  2DL7 A;  1KFZ A;  3VS6 A;  2D8J A;  2NUZ A;  2EQI A;  4AFS C;  3VS7 A;  2AZS A;  4J9C A;  2J05 A;  1QWE A;  1Y57 A;  2I0N A;  1ZUU A;  2V1R A;  1PWT A;  2DBM A;  3I5R A;  2FRY A;  1J3T A;  2YUP A;  4RTU A;  2ED0 A;  3VS0 A;  3QWY A;  2RQW A;  2O88 A;  2LQW A;  1X27 A;  1SSH A;  2A37 A;  3R6N A;  3PVQ A;  2JXB A;  2DL4 A;  3H0I A;  1I0C A;  2A36 A;  4GLM A;  2DA9 A;  2LQN A;  3QWX X;  2KE9 A;  1ZUY A;  4RTT A;  1AWO A;  2KT8 A;  2JS2 A;  4J9B A;  1OOT A;  2MCN A;  3O5Z A;  2DM1 A;  2JM8 A;  1E6H A;  3CQT A;  1VYT A;  3UAT A;  1E6G A;  1SHF A;  1A0N B;  2C0T A;  1MV0 B;  3NMZ C;  1M27 C;  3H0F A;  2LP5 A;  4D8D A;  3VS4 A;  3ZL7 C;  1M8M A;  1NM7 A;  2K2M A;  2CSI A;  2GGR A;  2F2V A;  1UDL A;  1ABO A;  1H8K A;  1AOJ A;  3M0Q A;  1GCQ A;  4KRT A;  1Z9Z A;  1QLY A;  2ECZ A;  1FYN A;  2IIM A;  4J9I A;  2HDA A;  4DEY A;  5FW9 A;  4LUE A;  1X2K A;  3M0P A;  2EKH A;  4LNP A;  2AKK A;  2DBK A;  1BK2 A;  4HVU A;  2KNB B;  1U5S A;  1SRL A;  3VS3 A;  1JO8 A;  2CUD A;  2DMO A;  5IXF A;  1M3C A;  3FJ5 A;  2AKL A;  2DJQ A;  2EYZ A;  3M0R A;  2ED1 A;  2YUN A;  1WXB A;  4DEX A;  5I22 A;  2DL5 A;  1H92 A;  4Z8A A;  1JXO A;  1NLO C;  2LZ6 B;  2YSQ A;  2GTJ A;  1GBQ A;  2KRS A;  2YUQ A;  3I5S A;  2D0N A;  2KRM A;  4RTV A;  2MOX A;  2CT4 A;  1WXU A;  2FRW A;  1BBZ A;  2EGA A;  2RMO A;  2EGE A;  2DX1 A;  2KXC A;  2EVR A;  2J6F A;  1SEM A;  1QWF A;  2L0A A;  3NPF A;  1CSK A;  2GNC A;  1V1C A;  2DL8 A;  1HJD A;  4CC2 A;  5L23 A;  4LUD A;  2JMA A;  1G83 A;  2HBW A;  4Z88 A;  1LCK A;  4AFZ C;  2OI3 A;  2EYW A;  4Z89 A;  5IHI A;  2A08 A;  3TSZ A;  3M0T A;  1MUZ A;  2JTE A;  2NWM A;  2K9G A;  1SRM A;  1NEG A;  4FSS A;  3EGU A;  2C0I A;  4RTW A;  3KFV A;  2ROL A;  2YT6 A;  1X6G A;  2L2P A;  4RUG A;  3U23 A;  2EYY A;  2FG0 A;  4GBQ A;  2W10 A;  1PRL C;  2CH4 W;  5FWC A;  2FPD A;  4CC3 A;  4JZ3 A;  2LJ3 A;  4OMP A;  1Y0M A;  2PZ1 A;  1KJW A;  1N5Z A;  2RNA A;  1KIK A;  2HCK A;  1PHT A;  2DF6 A;  4CC7 A;  2DE0 X;  4JJB A;  2CRE A;  4F16 A;  3ULR B;  1HSQ A;  2P4R A;  3H41 A;  1UG1 A;  3EG0 A;  2LJ1 A;  1PKS A;  2O2O A;  2X3W D;  2LMJ A;  2RN8 A;  1UEC A;  3A98 A;  2GQI A;  2RQU A;  2DIL A;  4JPB W;  1NG2 A;  4HVV A;  1SHG A;  4AFQ C;  1T0H A;  1UFF A;  2BZX A;  2HSP A;  1AD5 A;  1X2Q A;  2G6F X;  2AK5 A;  5IHN A;  5I11 A;  2EPD A;  5HCK A;  1W70 A;  2ESW A;  2DYB A;  1WXT A;  2KBT A;  2OJ2 A;  1K0X A;  2XMF A;  3NGP A;  5FWB A;  4OML A;  1OV3 A;  2VWF A;  1B3Q A;  3UF4 A;  2FPF A;  2M51 A;  1K9A A;  2LCS A;  1I07 A;  1GCQ C;  4RTY A;  2BTT A;  1OPK A;  2D8H A;  2V1Q A;  3EHR A;  2BZY A;  5GJW B;  3VRZ A;  1Z9Q A;  2KGT A;  1K0S A;  3VS1 A;  2YUO A;  1OPL A;  1BU1 A;  2FEI A;  1UE9 A;  1OEB A;  1SPK A;  2EW3 A;  1M3B A;  1AWW A;  1B07 A;  2L3S A;  4WCI A;  1NYG A;  1AWJ A;  2GTO A;  1UGV A;  2EBP A;  1QKW A;  1WFW A;  1JU5 C;  3M0U A;  4ORZ A;  5EC7 A;  1QKX A;  4J9D A;  1E7O A;  4JJC A;  1WYX A;  1T3L A;  1PNJ A;  2LJ0 A;  4J9E A;  3VS2 A;  1UTI A;  2PTK A;  1WI7 A;  2RQT A;  1JQQ A;  2J7I A;  2KRO A;  1WA7 A;  4HCK A;  4J9H A;  4QT7 A;  4ZNX A;  2JS0 A;  4J9G A;  4OMN A;  1GRI A;  2HEQ A;  1TUD A;  2F2W A;  4IIO A;  4AG1 C;  2GBQ A;  4EIK A;  1ZBJ A;  5IHK A;  2ROT A;  3I9Q A;  3H0H A;  2EGC A;  2X3X D;  1VYU A;  4M4Z A;  1K1Z A;  2CUB A;  2LNH B;  3C0C A;  2J6O A;  4CC4 B;  5GJV B;  1QCF A;  2JW4 A;  4JJD A;  1HD3 A;  3VS5 A;  2VVK A;  3SHW A;  3LH5 A;  4R0K A;  1YCS B;  1UHF A;  2YDL A;  2A28 A;  2H8H A;  1NYF A;  1AZG B;  2CT3 A;  1NEB A;  1M30 A;  3PE0 A;  4JZ4 A;  2PNI A;  2KR3 A;  1H3H A;  2ABL A;  4RTZ A;  3REB B;  2LX7 A;  1RI9 A;  5IH2 A;  4ESR A;  2K3B A;  1ARK A;  1G2B A;  3THK A;  2MIO A;  2QDL A;  1CKA A;  2CDT A;  3EG1 A;  2DVJ A;  3PVL A;  1NLP C;  4A63 B;  1RLQ C;  1GL5 A;  1AVZ C;  2L3Q A;  2FO0 A;  2DRM A;  1GCP A;  1TG0 A;  1VYV A;  1YP5 A;  2O9V A;  1ZLM A;  4F17 A;  2M0Y A;  1U3O A;  2AZV A;  1CKB A;  1WX6 A;  3JV3 A;  4X1V A;  1ZUK A;  1TUC A;  1AEY A;  3TVT A;  1BB9 A;  1JEG A;  1U06 A;  1YN8 A;  2K79 A;  5ECA A;  3RBB B;  4OMM A;  1XOV A;  4Y92 A;  2CSQ A;  1EFN A;  1RUW A;  2W0Z A;  2K6D A;  1YWO A;  2KYM A;  2RF0 A;  2FPE A;  2RPN A;  1AWX A;  2BZ8 A;  4D8K A;  1GFC A;  2ENM A;  2O31 A;  4HVW A;  1T3S A;  5IXB A;  4RTX A;  2JT4 A;  1UJ0 A;  2CH4 A;  1W6X A;  1ABQ A;  2J06 A;  1X6B A;  1YWP A;  1UHC A;  2DLP A;  1GBR A;  1ZSG A;  2K7A A;  3EHQ A;  1UUE A;  1RLP C;  3RNJ A;  1FMK A;  1T0J A;  2C0O A;  2KXD A;  3REA B;  3UA7 A;  1WLP B;  2L3P A;  2OAW A;  2JMC A;  3M0S A;  1X69 A;  2SEM A;  1S1N A;  4LN2 A;  1AZE A;  4OMQ A;  2F2X A;  2KEA A;  2KT1 A;  4K11 A;  3UA6 A;  4IIM A;  2B86 A;  4LE9 A;  3I35 A;  2DL3 A;  2E5K A;  4HXJ A;  2RQR A;  1VA7 A;  4J9F A;  4AG2 C;  3EG2 A;  1X43 A;  1ZX6 A;  2DNU A;  2KYB A;  2D1X A;  3IQL A;  1MV3 A;  1KSW A;  1JXM A;  1M3A A;  1UJY A;  4AFU C;  3TSW A;  1W1F A;  1WDX A;  3SEM A;  1IO6 A;  1I1J A;  1PKT A;  1WIE A;  2VKN A;  1YNZ A;  4F14 A;  2J6K A;  2RQV A;  1PRM C;  3VRY A;  2EYX A;  2JM9 A;  2SRC A;  1K4U S;  2KRN A;  4OMO A;  2DRK A;  1GFD A;  4E6R A;  2O9S A;  3NHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...