2RMOA

Solution structure of alpha-spectrin_sh3-bergerac from chicken
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKATANGKTYERQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Spectrin alpha chain, brain
publication title Study of the structure and dynamics of a chimeric variant of the SH3 domain (SHA-Bergerac) by NMR spectroscopy
pubmed doi rcsb
source organism Gallus gallus
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rmoA00
3I5RA 2L3PA 3GBQA 2JW4A 1U5SA 2GQIA 3VS4A 1V1CA 2DF6A 2FRWA 1X43A 1VA7A 2JTEA 1T3LA 2JS2A 1WFWA 1Z9ZA 1WA7A 2KNBB 3EG3A 2KGTA 2FPEA 1FMKA 2RMOA 1T0JA 1AVZC 2DLPA 4RUGA 4RTZA 4ORZA 1PKTA 4LE9A 3H41A 3M0TA 2NUZA 3VS6A 1ABQA 5I22A 2DRMA 2FO0A 4DEYA 1UJYA 2MCNA 5IXBA 4JZ4A 2CUBA 1Y0MA 3TSZA 4D8DA 1JXOA 1M3BA 1UGVA 3LH5A 1JU5C 2LQWA 1X69A 3H0IA 2KE9A 3PVLA 2AZVA 1B3QA 3CQTA 2C0OA 2L0AA 1MV3A 1LCKA 2RQRA 1YNZA 2KEAA 2RN8A 1BBZA 1AWXA 2DM1A 1WYXA 4K11A 5GJVB 2I0NA 3M0PA 1MUZA 4CC3A 1WDXA 3PVQA 5GJWB 2BTTA 3H0HA 1K9AA 1GFCA 2DX1A 4JZ3A 2YUOA 2JT4A 2JMAA 1SSHA 2GBQA 3VS3A 2CH4W 1PRLC 1H92A 1ZBJA 2D8HA 4GBQA 1X6GA 2IIMA 1GCPA 2ECZA 1AWOA 2CSQA 2O9SA 2A37A 2ESWA 2HBWA 3EG0A 3VRYA 1M8MA 2YT6A 1NEGA 4AFQC 2MOXA 2LMJA 1QWEA 1UFFA 2K79A 4J9BA 4AG1C 1YN8A 1M3AA 4R0KA 1QKWA 2RQVA 4D8KA 2F2VA 3VS2A 2HEQA 1SHFA 2RNAA 4CC4B 2DL8A 1T3SA 1PHTA 5EC7A 3RBBB 4CC7A 2DNUA 1K76A 2FG0A 2DBKA 3FJ5A 1AWJA 3KFVA 4KRTA 2M51A 2GGRA 4Y92A 3PE0A 1CKAA 2SRCA 4DEXA 2O31A 2J7IA 4J9FA 2EYYA 4Z8AA 4RTYA 1GBRA 2OAWA 4J9EA 1NLPC 1TG0A 1ZUKA 1HSQA 1K4US 2EGCA 1BU1A 1AWWA 2PTKA 3A98A 2KT1A 3NPFA 1WIEA 3TSWA 1PNJA 1HJDA 2JXBA 1I1JA 1GBQA 1EFNA 3TVTA 1BK2A 2EGAA 1X6BA 1KSWA 2K6DA 1BB9A 4ESRA 5IXFA 1AOJA 3SEMA 4OMNA 1B07A 1NLOC 2EYWA 1E6HA 2F2WA 1Z9QA 2EKHA 1OPLA 4JJCA 1UUEA 1WX6A 3UATA 1AD5A 2MIOA 2L2PA 2LQNA 1SPKA 2FPFA 1X2KA 2LCSA 1AZEA 4LN2A 4F16A 2B86A 2SEMA 2KYBA 2LX7A 2A36A 2X3XD 2AKLA 4J9IA 4AFSC 1G2BA 4AFUC 4ZNXA 2D1XA 2DBMA 2K2MA 1GFDA 1UECA 4F17A 1K1ZA 1GRIA 4M4ZA 4OMLA 1TUCA 4JJDA 4A63B 1ZUYA 4WCIA 4AG2C 4IIMA 2DILA 2RQTA 2EYZA 2XMFA 2ED0A 3IQLA 4E6RA 5HCKA 2FEIA 2DRKA 2LZ6B 4HXJA 3U23A 1TUDA 2JM8A 2ROLA 4J9DA 2YUNA 4OMPA 2GNCA 3ULRB 5L23A 2AZSA 1RLPC 2G6FX 1KJWA 3NHNA 2CT4A 1IO6A 2JS0A 1H8KA 2KYMA 3I5SA 1W6XA 2K9GA 5I11A 1WI7A 3UA7A 1J3TA 2A08A 5FWBA 1YWOA 1QKXA 4GLMA 4HCKA 2ED1A 1T0HA 3C0CA 4RTVA 1A0NB 2DL3A 2L3QA 1WXUA 2ABLA 1UTIA 2DL5A 4Z89A 3M0RA 2EVRA 1ARKA 2EBPA 1GCQA 3O5ZA 1Y57A 1WXTA 3VS7A 2DE0X 3I35A 4QT7A 5FWCA 2DA9A 2FRYA 1SRMA 2DL7A 1KFZA 4LNPA 2OI3A 2DL4A 1ZUUA 2LJ3A 1W70A 2DYBA 3UF4A 2K3BA 2GTJA 1G83A 4OMMA 1NYGA 4IIOA 3R6NA 4LUEA 2C0TA 2EYXA 3QWYA 1PRMC 4RTWA 1K0XA 4HVWA 5IHNA 4CC2A 2M0YA 2DVJA 3VS0A 2F2XA 3QWXX 1OV3A 2LNHB 1X27A 1YCSB 3THKA 2KRMA 2NWMA 2L3SA 1M3CA 1UHFA 2JM9A 2RQWA 5ECAA 2PNIA 2KBTA 4LUDA 2EGEA 4JPBW 1U06A 1VYVA 3I9QA 2HDAA 2EPDA 3REBB 2YUPA 1KIKA 2YUQA 3EG2A 4JJBA 4AFZC 1ZSGA 1NYFA 3M0SA 5IHIA 3VS5A 4X1VA 3EG1A 2W10A 1YWPA 1QCFA 2KRNA 2V1QA 1VYUA 4J9CA 1OOTA 2W0ZA 3SHWA 3REAB 1NEBA 1RI9A 2CSIA 1SHGA 1RUWA 2YDLA 3NGPA 2ROTA 1S1NA 1SEMA 1PKSA 2RPNA 3JV3A 2D8JA 2KT8A 2J6KA 2CT3A 1I0CA 3UA6A 2YSQA 1ZLMA 2PZ1A 4RTXA 2O88A 1PWTA 1U3OA 4F14A 2EQIA 2J6OA 2ENMA 1HD3A 1JO8A 1QLYA 5FW9A 2VWFA 1VYTA 1CSKA 3EHRA 2CREA 1FYNA 4HVUA 2J05A 1I07A 5IHKA 3EHQA 2DMOA 2LP5A 2QDLA 2O9VA 1UJ0A 4HVVA 2FPDA 1GCQC 4OMQA 2K7AA 3H0FA 2HSPA 2KXDA 4OMOA 1RLQC 1UG1A 4EIKA 2J06A 2RQUA 3M0QA 2C0IA 1W1FA 2E5KA 3M0UA 1WXBA 2RF0A 1QWFA 2BZYA 2J6FA 1NG2A 2KROA 1AEYA 1UHCA 3RNJA 1YP5A 2AK5A 3EGUA 1JEGA 2CUDA 3VRZA 1OPKA 2LJ0A 1MV0B 1M27C 1ABOA 2VKNA 2BZ8A 1JXMA 2A28A 4RTUA 1CKBA 4J9GA 1N5ZA 2KRSA 2HCKA 1AZGB 2GTOA 2V1RA 2H8HA 1UDLA 2D0NA 5IH2A 1X2QA 1M30A 1WLPB 2VVKA 2JMCA 2BZXA 2P4RA 2O2OA 4RTTA 1SRLA 1GL5A 2CH4A 2KR3A 2EW3A 1E6GA 2CDTA 3NMZC 1NM7A 1UE9A 2DJQA 1E7OA 4FSSA 4Z88A 1OEBA 1K0SA 2OJ2A 1XOVA 1H3HA 2X3WD 4J9HA 3VS1A 1JQQA 3ZL7C 2LJ1A 2KXCA 2AKKA 1ZX6A
chains in the Genus database with same CATH superfamily
3EGDB 3OW2A 3GBQA 2JW4A 3CCQA 3DB4A 2GQIA 1SKUB 1TXQA 3VS4A 4PJOG 4LDWA 2E70A 4XTVA 2JTEA 2JS2A 1WFWA 2K2VA 1RADB 2VB6A 3SWNA 2KGTA 5CIUA 1FMKA 2RMOA 1T0JA 4Y91A 4VUBA 4NL2A 1VQ8Q 4M7AD 4ORZA 2P4TA 3VS6A 4DBQA 1WZOA 1M2OA 5I22A 1UJYA 1NE8A 2CUBA 1Y0MA 4OB2B 1WGSA 2HKQB 2KK4A 4LDXA 1U1TA 1TTHB 1X69A 2F5TX 3H0IA 2RO0A 1DJ7B 3CQTA 2C0OA 3HHTB 3M53A 1BIAA 3CC7A 3FRNA 3LW5E 1AWXA 3JCMb 4ZGJB 1QCNA 2COZA 3S3MA 4O5VA 2K57A 3N5BB 2NUPB 3P8HA 3M0PA 4CC3A 3I56A 2RM4A 3NTHA 4C8QB 3H0HA 3ASKA 3QIIA 2YUOA 1XJWB 5D6YA 4RG2A 2OTLA 5KYXA 3TREA 4PFOA 1VQOQ 2CSQA 2O9SA 1PG5B 3RMSA 3VRYA 2K3YA 1NEGA 3L2UA 4C92D 3WXMB 4GY5A 2YHTA 3JCMX 4PJMA 2E4HA 3CCJT 1QP3A 1SHFA 2RNAA 4CC4B 3MEUA 1PHTA 2COWA 2DNUA 1RAAB 2E1HA 4KBMB 1N8RR 5D6WA 3MP8A 4ME7A 5FU6B 5M9OA 2LTOA 2M51A 2HKNA 4Y92A 4JUVA 1CKAA 2SRCA 3HKSA 4JRQA 3VYHB 2J7IA 3Q1JA 4Y28E 1D1AA 1TG0A 2JN0A 1YI2A 3CPWS 4BI4A 2PTKA 3CCSQ 2KT1A 1HJDA 1KC8U 1EFNA 3CBOA 2M9UA 3TVTA 1BK2A 2GF7A 5GAOq 2O4XA 4ESRA 5IXFA 3OW2P 4OMNA 1B07A 3CCRT 1N6AA 2EYWA 1E6HA 5C0MA 5D7UA 4M7DG 1UUEA 2IVWA 3LGLA 4A4KA 2FPFA 3M4GA 4LD9K 4LN2A 2V8JA 2CP0A 2JVVA 2X35A 3NFCA 1K8AR 4AFSC 5LJ5d 4MZMA 1G2BA 2CS7A 2EIFA 2M0OA 2E3IA 3M56A 3CCLT 4OF1A 3QO3A 3CCJQ 2V8KA 3VUZA 3DKMA 1GRIA 3ZBDA 4E7SA 5GAOl 2LCCA 1ZUYA 1K73U 3RIRA 1Q82U 2CP2A 2DILA 2DAQA 5LJ5f 3L2RA 5HCKA 1KQSS 2H3EB 2DRKA 2JTFA 1TUDA 2JM8A 5GAN7 2P84A 5CKDA 3L42A 2AZSA 4B9XA 2QQAA 2G6FX 1VQLA 4ZN3A 1JRIA 3PFSA 2QQ9A 3NHNA 3MCAB 2BUDA 1H8KA 3PIOA 2KYMA 5CKFA 3I5SA 4OB0B 3VKIA 4M78G 4ANJA 2ZPBB 3QPHA 2QA4Q 2EJFA 2A08A 1YWOA 4XTUA 5IAYA 1XTDA 4M75C 3OYMA 1T0HA 4RTVA 3G1JA 2DL3A 4A54A 2ABLA 4Z89A 1X6OA 5KYWA 4PJOC 2DD5A 3O5ZA 1VQ5A 3BY7A 4BUGA 2EFIA 1IZ6A 4OVAA 1I81A 4MMLA 3TCJA 4E47A 4PJOA 5KYXB 2KDSA 2KVQG 3CC4T 2OI3A 2DL4A 1ZUUA 3OS5A 2LJ3A 5AYFA 2K3BA 4MDWA 1TS9A 4OMMA 1NYGA 1D09B 2OAUA 4N4IA 2EYXA 1UGRB 4CC2A 1O9SA 2F2XA 1VQ8A 2VC8A 3QYHB 4C8QF 1NJIC 3L1AA 4FT2A 5KCOA 4BY6B 5A0DA 2AIRB 2DD4A 5ECAA 1PC0A 2PNIA 3OYEA 5GAOn 2AT1B 4QVZA 4JPBW 2E64A 1U06A 2YRDA 4A4EA 1VYVA 3REBB 2YUQA 4JJBA 3OYDA 2QK0A 1ZSGA 1NYFA 3BFMA 3M0SA 4X1VA 2QYZA 3GOXA 3KBGA 3PT9A 4OP0A 4C8QE 4BDZA 2LQ8A 4JLGA 2OTJT 3JCMP 2KRNA 4WF2A 1NJIU 2W0ZA 1O75A 4HA8A 1YJWT 3H6ZA 4MZPA 3EFOA 1VQOA 2ROTA 3V8LA 2YLBA 2CP3A 1PSFA 2RPNA 2O4XB 3JV3A 1VQPT 1G5VA 2IG0A 3CC4Q 2YSQA 2PZ1A 3QHSA 4M7AG 5FROA 1PWTA 1U3OA 3CPWA 2EQIA 2HQXA 1R77A 1W2BP 1VYTA 5GAMd 1M1FA 1B34A 2CREA 4HVUA 5DY9A 4RCBA 4X9DA 3CD6Q 1IHWA 4HCCA 3QSUA 2ZCFB 2LQKA 5GAMf 1UJ0A 1GCQC 2K5IA 2I2LA 1QVFA 2KSSA 3JAME 3OS0A 4R55A 5GAOm 4DOWA 2DXBA 3OW2S 1YHQT 1ZQ1A 2J06A 3M57A 3H8ZA 1D3BB 2C0IA 3JCMV 2E5KA 2O01E 3JCMW 2HAXA 3V7RA 1MMNA 2QXFA 4M77G 2HBPA 2KROA 4M7DC 1FWZA 3RNJA 3BDLA 5GMKm 1KC8R 2OTJQ 4YTLA 1ACMB 1JJ2A 1MV0B 2VKNA 4M7DA 5KE3A 1YJWQ 1JXMA 2A28A 1N8RC 5HK3A 1CKBA 4M7AE 2KRSA 2HCKA 3BW1A 4C92G 4C0DC 2WSFE 1I5OB 2Z0WA 3S3OA 2H8HA 1UDLA 1BCMA 1X2QA 5DLQE 1WLPB 1VQPQ 2RHIA 3MP6A 5J26A 3JB9H 2M02A 4RMOA 4M75B 2RI2A 3EAEA 3EH2A 4OGCA 3NMZC 2DJQA 4O6JA 1E7OA 3V8JA 1XOVA 2RB6A 3CCJA 1QVGP 1H3HA 4J9HA 2DZ9A 2RHYA 3GLXA 2KXCA 1LPLA 5A2QE 1VQ7T 4C0GA 1K73R 1Q82R 5FLXE 1WQ7A 4BE2A 4XK8E 4M78C 1EZZB 2EWNA 4F7UB 4PK4A 3EG3A 2FPEA 4XTYA 3T9NA 5IN1A 1YHQQ 4M78A 3OYHA 3H41A 2NUZA 3MKDA 1K8AC 4A53A 2DRMA 2FO0A 1FX7A 4JZ4A 2NUTA 2HZYA 1JXOA 3C94A 1JU5C 2KE9A 1YJNT 2HSEB 1PSEA 2AZVA 2VASA 1MV3A 1LCKA 3QZ9B 3OS1A 2DO3A 2KEAA 5GAOr 2DM1A 1RACB 3JCMQ 5GJVB 2KMTA 4J7FA 5LJ3d 3QUIA 1GFCA 3MEAA 3CC2T 2DX1A 3EFOB 1PCXA 2GBQA 1H92A 3OYKA 1FXXA 2DVEA 3M54A 4GBQA 5LJ3f 2IIMA 2HQHA 1QVFP 1GCPA 1OX8A 2ECZA 1AWOA 3L2WA 3CCLA 3GNGA 3FB9A 5GANf 2YT6A 2FZCB 3QKJA 4TVRA 4KH1B 4AFQC 1VOMA 1VQ7Q 2BIVA 2LMJA 3X20B 1UFFA 2K79A 3URGA 4BI3A 1N27A 4QQDA 4GLKA 4R0KA 2RI3A 2RQVA 1JJ2P 2HEQA 2DL8A 3GF5A 5EC7A 3RBBB 5GAMe 1KQ1A 5IT9E 1IREB 2CP7A 1VQ4Q 2DBKA 3KXTA 3FJ5A 4F04B 1RAEB 4A4FA 2MWPA 4KRTA 1Y96A 1GXIE 1YJNQ 1Q86U 3V8KA 3NTKA 3CBPA 2EYYA 4Z8AA 1D0XA 1WHLA 1NPPA 2VXEA 1ZSZC 3OYYA 1HSQA 4MMKA 1K4US 5GANg 3A5ZB 1WIEA 1PNJA 2LX9A 4V2SA 4XU1A 1GBQA 1PD1A 4M7AA 2DIQA 5EG2A 1ZSZA 4FYXB 5LJ5h 3C12A 1H641 3CC2Q 3WVDB 3CC4A 1BB9A 4EPCA 3CBMA 4MZTA 1Y7XA 1NLOC 3EG9B 2L89A 2K5FA 2YLCA 2LNVA 2HL3A 4JJCA 2DFUA 1WX6A 3META 2E41A 2MK5A 3UATA 2LQNA 1SPKA 3CMAT 3CD6A 3NTIA 4F16A 2B86A 1V29B 2LVMA 2E3HA 2LX7A 2A36A 4M77C 1SSFA 2AKLA 5L8RE 2MI6A 2DK3A 2COYA 2EAYA 3A8HB 4UC4A 2K2MA 5GMKi 4M77A 2F1LA 4J5YA 3CCST 4HCBA 4M4ZA 1TUCA 4LDYA 2V8IA 4C92C 2EYZA 2E10A 4ZN1A 2F69A 3IQLA 3WVEB 2MYSA 2FHDA 3GPLA 3E9FA 4IURA 3RERA 3U23A 4J9DA 2OTJA 4M75F 1YITT 4DBFA 2YUNA 3ULRB 4C92A 1QP2A 3SD4A 5A0GA 1YJWA 2RD1A 2QASA 1TU0B 2ZPHB 3UA7A 2CP5A 1SF9A 2P0QA 3HRUA 1U8RA 3J7AF 3RESA 2XU8A 3JB9G 3CEYA 1VQPA 3AT1B 1Y71A 4F7UF 4HCKA 2HQEA 3VUBA 5LL6S 1WXUA 2DL5A 2C06A 2L5QA 2EBPA 1Y57A 3VS7A 4EMKC 1KC8C 2DA9A 1SRMA 4OGEA 1KFZA 2KAFA 3UF4A 4EMKA 3CMAQ 2QTVA 5LJ3e 3S6WA 4F7UE 2GTJA 1D1CA 3VJPA 1G83A 3JCMg 1EX4A 4BDYA 3R6NA 4LUEA 1TSFA 3QWYA 3GP8A 1MMDA 1YHQA 1MMAA 1OV3A 1D1BA 2QA4T 2EKOA 1C0MA 1TWBA 3M55A 2KBTA 4LUDA 3J80E 1YITQ 1VIEA 3I9QA 1KIKA 3EG2A 4RCCA 1VQMT 3VS5A 1K73C 1Q82C 1QVFS 2PUOB 4P5NA 1OU8A 3JCMJ 3CPFA 3OQ5A 3HL8A 4E7LA 5GAMh 1RAIB 3FDRA 2CYZB 1RI9A 2CSIA 3OMCA 2E6ZA 4PFZA 2YDLA 5GAN2 2ZAEA 1JJ2S 1LJOA 2X4WA 2BE9B 2D8JA 1I0CA 1ZBXA 4N4GA 3SWNB 1W2BA 1M2VA 1M1KU 1VQ7A 2CZ6B 4II1A 1Q7YU 1IHVA 1I5LA 2KI7A 3EHRA 4LDUA 2DIGA 4ZGDB 5KYYA 1MNDA 5CQYA 2PU9B 3RKXA 3QG1A 4XU0A 1QW1A 2QDLA 1G3TA 4PJJA 5CKBA 2DPPB 2K7AA 4KGVB 2YRVA 3H0FA 3LH0A 1YJ9Q 2QQBA 4J6WA 1YJNA 1RLQC 1Q86R 4CRIA 4C8QG 1WHJA 2X4XA 4C5IA 2RQUA 3HSBA 1VQMQ 2QEXT 2FL7A 3M0UA 1WXBA 1TUGB 2HMAA 5GMKh 1NG2A 2Y90A 2K5LA 5GAN4 2AK5A 1M4ZA 3VRZA 1OPKA 2LJ0A 4QKUA 1M27C 1ABOA 3OSSC 4X9CA 3CC2A 3CCUT 3CCVT 2HNIA 4J9GA 1R8OB 2V1RA 3PIPA 3OA6A 2MPXC 1WJSA 1VQ9T 3CD6T 2DETA 2VVKA 1S72T 4IKFA 2JJ9A 2LC4A 2XG8D 4RTTA 4M75D 3HP9A 2CKKA 2KR3A 3P8DA 2AHJB 3J81E 1QVGA 1Q81R 1OQKA 4PJOD 4KH0B 8AT1B 1UEBA 1JQQA 4HKEA 2MWOA 2GQVA 1VQKT 4A4GA 2RJEA 2JUFA 2A3LA 2Y4YA 3P8BB 3X24B 4KT0E 2FRWA 1X43A 3RKYA 1VA7A 4HT9A 2KNBB 3ZFJA 2M1HA 3FEOA 4RTZA 5LJ3h 1PKTA 1BI1A 2QEXQ 1ABQA 4FSXA 1OX9A 2L3RA 2MCNA 5IXBA 1IRXA 5GANh 3JB9J 2P0PA 1UGVA 3LH5A 3HTRA 3V7SA 3A8MB 2EQUA 1FMVA 1G3YA 4FL6A 3QZ5B 2L0AA 3HFNA 1X75C 2RQRA 3CCUQ 3CCVQ 1BBZA 1WYXA 5GAN8 3EFSA 2XDDA 4DA4A 1MUZA 6AT1B 1KK7A 1LVKA 1VQ9Q 2LCLA 2XHCA 1S72Q 2QDYB 4JZ3A 2JT4A 3CMAA 2YRCA 1UGQB 3VS3A 3F70A 2CH4W 1X6GA 3X26B 3A1PA 5LJ5e 1BIBA 2RK2A 5CVIA 3G4ST 1M2VB 2A37A 2EYQA 3JCMc 2HBWA 4BE1A 1VQKQ 3CCSA 1PM3A 2MOXA 4JRKA 3INZA 4AG1C 1YN8A 3CC7Q 1D0YA 1BI2A 1M3AA 1QKWA 2FVUA 2RHUA 1YITA 2F2VA 3VS2A 3V7CA 3VYGA 1RABB 2R57A 4CC7A 2FYKA 1K76A 2QGFB 1ZA1B 1AWJA 1WHKA 3KFVA 4JS4A 3AHUA 5J39A 1HYOA 2MMPA 2GGRA 8ATCB 5KYWB 3LX7A 2D6FA 1TH7A 3DB3A 4IUUA 3EGDA 2O31A 5DLOA 4RTYA 3OBWA 1GBRA 2EQKA 4J9EA 2CZ0B 4PJOB 5LJ5j 3FC3A 2OX7A 4LDVA 1BU1A 1KQ2A 1AWWA 4KUIA 2V26A 3A98A 3TSWA 2NLUA 3E1SA 1I1JA 3CXCA 2FB7A 5GAN6 2CZ7B 1UB4A 5KE2A 1X6BA 3RR6A 3M59A 1AOJA 3SEMA 1KD1U 1M1KR 4RKUE 1Q7YR 4FIBA 1Z9QA 1OPLA 4Z02A 3G4SQ 5GAN5 1AD5A 4JS5A 4C8QC 1VQ4T 3LLRA 1X2KA 2LCSA 4JRPA 1AZEA 5KYUA 1MGQA 2SEMA 1JB0E 2KYBA 2NUPA 2QA4A 4C8QA 7AT1B 1D0ZA 2D1XA 2DBMA 1WNLA 1UECA 1I8FA 1K1ZA 4LXCA 1VQMA 1M90U 4IIMA 2RQTA 2QQRA 2XMFA 2E5QA 5FU7C 1LOJA 2LZ6B 4HXJA 5GANd 4M78D 3OYBA 2VV5A 4PLIA 2HL5C 2RK1A 2ZZDA 5D6XA 4EMGA 4PJLA 2CT4A 1RAHB 2JS0A 2LT4A 1QQJA 5I11A 2DTIA 5KCHA 4XTWA 1WI7A 5FU6C 5CQXA 1J3TA 1TOVA 1K9MU 1Q86C 4ELZC 1QKXA 4ZTJA 3M58A 5CCAA 1B34B 2L3QA 1UTIA 3M0RA 4DBHA 1ARKA 4ELYC 1JBMA 2DE0X 1QVPA 3I35A 4JRIA 5FWCA 1LNXA 2ZPIB 2FRYA 1NPRA 1W70A 1OI1A 3MO8A 1G8XA 1QMCA 2JOYA 3QXEB 2C0TA 4M7AC 3UT1A 1W2BS 3UDCA 1PRMC 1K0XA 4PL6A 2M0YA 2DVJA 4IUTA 2LNHB 3TQ7P 1X27A 2QEXA 1WHMA 3QJYA 1YCSB 4XQ3A 1R0CB 4XU3A 2E12A 4M7DB 4NS5A 1UHFA 2JM9A 3CXCP 1BCOA 2EGEA 2XD0A 3L2ZA 3JRZA 4FCYA 3RUXA 2YUPA 4AFZC 3OYJA 3CCUA 3CCVA 5IHIA 4C0DB 5GAMj 1YWPA 4M75G 3FJPA 1QCFA 1MNEA 1RI0A 2V1QA 1VYUA 3FLGA 3CMET 1BI3A 1VQ9A 1S72A 4ATOA 2XI9A 3SHWA 3QJ6A 1Q81U 3REAB 5GMKe 3MEWA 4BACA 2P0KA 2MAMA 4FW1A 3OYGA 1G3WA 3QYGB 2DXTA 1V76A 4F7UG 3CCET 3JCMd 2KT8A 2J6KA 2VGNA 2GFAA 3UA6A 3RMQA 1VQKA 1ZLMA 3OYIA 4F14A 4M78B 4KULA 1XNIA 1HD3A 1JO8A 2VWFA 3TU4K 1CSKA 4D6WA 5HY6A 3JCMf 4BE0A 4PJOF 4N4HA 3OY9A 4XTXA 5KYUB 2NUTB 2QI2A 3JSCA 1FYNA 2A0FB 2J05A 1I07A 2DTOA 2EQMA 4FM4B 2MF2A 3VV0A 2BKDN 2LP5A 4QW2A 4C0ZA 1QVGS 2O9VA 2FPDA 3E2UA 1IGUA 3C95A 4M75E 4M77D 4DOVA 4OMOA 2G3RA 5GMKj 2CGHA 4PJOE 1C1AA 2XK0A 1W1FA 4XAXB 3RKWA 3A8GB 2RF0A 2BZYA 4WTOB 2J6FA 2DXUA 1AEYA 4BY6C 1UHCA 2DTHA 3CMEQ 5FU7B 4KGXB 4QVCA 3G71T 1Y07A 2XDBA 5GANe 1WQWA 3G6ET 1KD1R 2R5AA 1AZGB 1N9SA 2GTOA 3MEVA 2D0NA 3G4SA 1M30A 3CCEQ 2ATCB 3M5AA 3GIBA 3MP1A 2JMCA 4R56A 1YJ9T 2O2OA 1SRLA 2CH4A 3JB9F 2EW3A 2CDTA 3I55T 1NM7A 2DXCA 3HRSA 1VQ6T 1RL2A 3L2VA 1OEBA 3CCMT 1Y96B 1M9SA 3VS1A 3ZL7C 1NZ9A 1WHHA 2AKKA 4OMPA 1ZX6A 4J6XA 1M1KC 3I5RA 2L3PA 2E65A 1U5SA 3BDUA 1Q7YC 1M90R 2RJCA 1V1CA 4J83A 2DF6A 5LJ3j 1BYMA 1T3LA 4PJNA 1Z9ZA 1WA7A 1AVZC 5GANj 4M7AB 5GAN3 2DLPA 4RUGA 1ZSZB 4LE9A 3M0TA 4QQGA 3QDFA 3LWHA 4L6V5 2F5KA 4PKCC 4DEYA 3MHXA 5DM7R 2RJDA 3PNWC 3TSZA 1VQNT 4D8DA 3OYFA 1M3BA 2RA2A 2LQWA 3MPUB 4L5GA 2DERA 1G3SA 1K9MR 1IB8A 3PVLA 3G71Q 1BI0A 3HRTA 3PTAA 1B3QA 3PMIA 1YNZA 2RN8A 1YIJT 1R0BG 3G6EQ 4K11A 4E7IA 4C5EA 3OB9A 2I0NA 1WDXA 3PVQA 5GJWB 1D3BA 2BTTA 2RH2A 2IPOB 1RAGB 2R5MA 1K9AA 1VQ4A 4M7DF 2KQWA 5CK9A 4PFPA 3S3NA 2CP6A 2JMAA 1SSHA 3ME9A 4M77B 1I4K1 4E7ZA 5GMKl 1PRLC 4XU2A 1OU9A 3OYAA 3CXCS 1YFNA 2DEUA 2RHZA 3I55Q 1ZBJA 2D8HA 1VQ6Q 4J6YA 2DZCA 2ESWA 3CCMQ 3EG0A 1M8MA 3G7ZA 4M7DE 4C92B 1QWEA 3JCMe 4J9BA 4C5HA 2BE7D 1EIFA 3CCRQ 2WACA 4D8KA 3HFOA 3PMTA 4M75A 5LJ5g 4IUVA 1T3SA 2VXFA 3MJXA 4KGZB 1P92A 2FZKB 2FG0A 3CCQT 4OB1B 5CKHA 4X34A 1VQNQ 1AHJB 3PE0A 1OYXA 4DQ2A 4M78F 4DEXA 3E19A 4J9FA 2RI5A 3QBYA 2OAWA 4BB7A 5CAIA 3CCLQ 1NLPC 1ZUKA 1YIJQ 4F7UA 2QG9B 2EGCA 2QAZA 1VUBA 4EMKB 3NPFA 2JXBA 2VYTA 4AMCA 2EGAA 2YWWA 3OS2A 1KSWA 4AT1B 2K6DA 4M78E 4NOYA 3HPWA 3CC7T 1BKBA 5KYNA 3UPUA 5HKCA 3RDVA 2F2WA 2EKHA 4EDUA 3I56T 2H3JA 2MIOA 2LRQA 2L2PA 2M16A 3TEEA 4A4HA 4B6MA 4C0FA 4C5GA 2OTLT 3A8OB 3C4SA 1UGPB 2X3XD 4J9IA 4MDXA 1WHGA 1X01A 4AFUC 3L2QA 4DBRA 4N0AC 4ZNXA 1GFDA 2VUBA 1QCOA 1IXDA 1OZ2A 1KHCA 4F17A 2HD0A 2D9TA 4BI8B 4OMLA 4JJDA 2VGMA 4WCIA 4A63B 4AG2C 5GAOp 3CCQQ 1SG5A 4N0AA 1WPYA 5CR2A 2ED0A 1AT1B 4E6RA 2FEIA 5HK0A 4FYWB 2ROLA 2X4YA 2Y4XA 5C6SA 4B9WA 3OSVA 3CMEA 2GNCA 5L23A 1ZA2B 1RLPC 3OYLA 3JB9D 1KJWA 2DKGA 3D7SB 1IO6A 2K3XA 2QGGA 1M8VA 3PGGA 1W6XA 2K9GA 2WSCE 2XKOC 4KUDK 4NL3A 1H3ZA 3DLMA 1MHNA 3CCEA 5FWBA 3M9QA 4FT4A 1F1BB 3X25B 1C6VX 4GLMA 4JDSA 2ED1A 1KHIA 3C0CA 3X28B 1OULA 1A0NB 5KYYB 3FIFA 2ZPEB 3EGXA 1YI2T 2PVDB 3BE3A 2EVRA 4M7AF 1GCQA 1WXTA 4QT7A 1IGQA 4ZTFA 3I56Q 1B7TA 2K4YA 2DYIA 2DL7A 4LNPA 3JB9I 2DYBA 4PLLA 2OTLQ 3O8VA 2JTMA 1KD1C 2NYSA 5CKEA 4IIOA 2GFUA 3DLLA 1KQSA 1XQHA 4E2FB 4RTWA 1M5Q1 4OB3B 4HVWA 4L59A 5IHNA 3VS0A 3QWXX 5GAMg 5A0LA 3EG9A 4FYVB 3THKA 2DJZA 2KRMA 2E6NA 2X4JA 4Q5WA 4E7JA 2NWMA 4M7DD 2L3SA 1M3CA 2RQWA 4JJNK 4CI0C 2QQSA 4M77F 1OZ3A 1WJQA 1ZHIA 3SFMA 3G71A 1HK9A 2HDAA 2EPDA 2X51A 3OYCA 1RAFB 1PD0A 3JCMh 1M90C 1N8RU 3G6EA 3EG1A 4ZGEB 4E7KA 2JZ2A 4RG8A 3M4YA 2W10A 3SB2A 2EJ9A 1W4SA 4C92F 4J9CA 2RJFA 2ZPFB 4FW2A 1OOTA 1UGSB 3SDZA 4OMFB 4J8OA 4M77E 1VQLT 1Q95G 1NEBA 1YBYA 1YI2Q 2EQJA 1YJ9A 4IUQA 4HT8A 1SHGA 1RUWA 3I55A 3LGFA 3NGPA 4QVDA 1S1NA 1SEMA 1VQ6A 5KH6A 4XTZA 1PKSA 3QDRB 1K9MC 2A7YA 3EFRA 3CCMA 2LT1A 2YXYA 2CT3A 4C92E 2XIDA 1N9RA 4HCZA 4RTXA 2O88A 2J6OA 2B8AA 3GNFB 2ENMA 4J7IA 1VQ5T 1QLYA 5FRNA 5FW9A 5J3BA 3CPWP 3CCRA 4FU6A 2FZGB 2PVGB 5IHKA 3OYNA 3EH1A 3EHQA 3ZEHA 4C8QD 5I2MA 2DMOA 3LWIA 1K8AU 4JLIA 4HVVA 5I21A 4OMQA 2PVOB 1VQNA 3A8LB 2HSPA 2KXDA 1MMGA 1KG1A 2D0QB 1NBEB 1UG1A 4EIKA 3LYIA 4LD6A 1VQ8T 2L8DA 2RHXA 3M0QA 2DEQA 4FYYB 2PQWA 1U1SA 1YIJA 9ATCB 1QWFA 4IUPA 3H9NA 3KUFA 4E7HA 1YP5A 3EGUA 1JEGA 2CUDA 2XICA 3VU3C 2GCXA 2QTXA 1VQLQ 2XDPA 2BZ8A 1HXDA 5FRMA 4EMHA 2JNGA 3E9GA 4RTUA 2KY9A 3OBYA 1N5ZA 3ER0A 3OMGA 4BD3A 2PUKB 5IH2A 1KQSP 1VIFA 5AT1B 2LDMA 1YCYA 3EGXB 1Q81C 4PNOA 2BZXA 2P4RA 5LJ3g 1GL5A 1NJIR 3R6OA 2WSEE 1VQ5Q 2X9HA 2EJGA 1VQOT 1E6GA 2CZ1B 1UE9A 4QQ6A 2ZGWA 4FSSA 4Z88A 1K0SA 2OJ2A 2R58A 2X3WD 5CO7A 1WJRA 2LJ1A 1M1GA 2ZPGB 5I2SA 3UWNA 1FMWA 3SWNC
chains in the Genus database with same CATH topology
3I5RA 2L3PA 3GBQA 2JW4A 1U5SA 2GQIA 3VS4A 1V1CA 2DF6A 2FRWA 1X43A 1VA7A 2JTEA 1T3LA 2JS2A 1WFWA 1Z9ZA 1WA7A 2KNBB 3EG3A 2KGTA 2FPEA 1FMKA 2RMOA 1T0JA 1AVZC 2DLPA 4RUGA 4RTZA 4ORZA 1PKTA 4LE9A 3H41A 3M0TA 2NUZA 3VS6A 1ABQA 5I22A 2DRMA 2FO0A 4DEYA 1UJYA 2MCNA 5IXBA 4JZ4A 2CUBA 1Y0MA 3TSZA 4D8DA 1JXOA 1M3BA 1UGVA 3LH5A 1JU5C 2LQWA 1X69A 3H0IA 2KE9A 3PVLA 2AZVA 1B3QA 3CQTA 2C0OA 2L0AA 1MV3A 1LCKA 2RQRA 1YNZA 2KEAA 2RN8A 1BBZA 1AWXA 2DM1A 1WYXA 4K11A 5GJVB 2I0NA 3M0PA 1MUZA 4CC3A 1WDXA 3PVQA 5GJWB 2BTTA 3H0HA 1K9AA 1GFCA 2DX1A 4JZ3A 2YUOA 2JT4A 2JMAA 1SSHA 2GBQA 3VS3A 2CH4W 1PRLC 1H92A 1ZBJA 2D8HA 4GBQA 1X6GA 2IIMA 1GCPA 2ECZA 1AWOA 2CSQA 2O9SA 2A37A 2ESWA 2HBWA 3EG0A 3VRYA 1M8MA 2YT6A 1NEGA 4AFQC 2MOXA 2LMJA 1QWEA 1UFFA 2K79A 4J9BA 4AG1C 1YN8A 1M3AA 4R0KA 1QKWA 2RQVA 4D8KA 2F2VA 3VS2A 2HEQA 1SHFA 2RNAA 4CC4B 2DL8A 1T3SA 1PHTA 5EC7A 3RBBB 4CC7A 2DNUA 1K76A 2FG0A 2DBKA 3FJ5A 1AWJA 3KFVA 4KRTA 2M51A 2GGRA 4Y92A 3PE0A 1CKAA 2SRCA 4DEXA 2O31A 2J7IA 4J9FA 2EYYA 4Z8AA 4RTYA 1GBRA 2OAWA 4J9EA 1NLPC 1TG0A 1ZUKA 1HSQA 1K4US 2EGCA 1BU1A 1AWWA 2PTKA 3A98A 2KT1A 3NPFA 1WIEA 3TSWA 1PNJA 1HJDA 2JXBA 1I1JA 1GBQA 1EFNA 3TVTA 1BK2A 2EGAA 1X6BA 1KSWA 2K6DA 1BB9A 4ESRA 5IXFA 1AOJA 3SEMA 4OMNA 1B07A 1NLOC 2EYWA 1E6HA 2F2WA 1Z9QA 2EKHA 1OPLA 4JJCA 1UUEA 1WX6A 3UATA 1AD5A 2MIOA 2L2PA 2LQNA 1SPKA 2FPFA 1X2KA 2LCSA 1AZEA 4LN2A 4F16A 2B86A 2SEMA 2KYBA 2LX7A 2A36A 2X3XD 2AKLA 4J9IA 4AFSC 1G2BA 4AFUC 4ZNXA 2D1XA 2DBMA 2K2MA 1GFDA 1UECA 4F17A 1K1ZA 1GRIA 4M4ZA 4OMLA 1TUCA 4JJDA 4A63B 1ZUYA 4WCIA 4AG2C 4IIMA 2DILA 2RQTA 2EYZA 2XMFA 2ED0A 3IQLA 4E6RA 5HCKA 2FEIA 2DRKA 2LZ6B 4HXJA 3U23A 1TUDA 2JM8A 2ROLA 4J9DA 2YUNA 4OMPA 2GNCA 3ULRB 5L23A 2AZSA 1RLPC 2G6FX 1KJWA 3NHNA 2CT4A 1IO6A 2JS0A 1H8KA 2KYMA 3I5SA 1W6XA 2K9GA 5I11A 1WI7A 3UA7A 1J3TA 2A08A 5FWBA 1YWOA 1QKXA 4GLMA 4HCKA 2ED1A 1T0HA 3C0CA 4RTVA 1A0NB 2DL3A 2L3QA 1WXUA 2ABLA 1UTIA 2DL5A 4Z89A 3M0RA 2EVRA 1ARKA 2EBPA 1GCQA 3O5ZA 1Y57A 1WXTA 3VS7A 2DE0X 3I35A 4QT7A 5FWCA 2DA9A 2FRYA 1SRMA 2DL7A 1KFZA 4LNPA 2OI3A 2DL4A 1ZUUA 2LJ3A 1W70A 2DYBA 3UF4A 2K3BA 2GTJA 1G83A 4OMMA 1NYGA 4IIOA 3R6NA 4LUEA 2C0TA 2EYXA 3QWYA 1PRMC 4RTWA 1K0XA 4HVWA 5IHNA 4CC2A 2M0YA 2DVJA 3VS0A 2F2XA 3QWXX 1OV3A 2LNHB 1X27A 1YCSB 3THKA 2KRMA 2NWMA 2L3SA 1M3CA 1UHFA 2JM9A 2RQWA 5ECAA 2PNIA 2KBTA 4LUDA 2EGEA 4JPBW 1U06A 1VYVA 3I9QA 2HDAA 2EPDA 3REBB 2YUPA 1KIKA 2YUQA 3EG2A 4JJBA 4AFZC 1ZSGA 1NYFA 3M0SA 5IHIA 3VS5A 4X1VA 3EG1A 2W10A 1YWPA 1QCFA 2KRNA 2V1QA 1VYUA 4J9CA 1OOTA 2W0ZA 3SHWA 3REAB 1NEBA 1RI9A 2CSIA 1SHGA 1RUWA 2YDLA 3NGPA 2ROTA 1S1NA 1SEMA 1PKSA 2RPNA 3JV3A 2D8JA 2KT8A 2J6KA 2CT3A 1I0CA 3UA6A 2YSQA 1ZLMA 2PZ1A 4RTXA 2O88A 1PWTA 1U3OA 4F14A 2EQIA 2J6OA 2ENMA 1HD3A 1JO8A 1QLYA 5FW9A 2VWFA 1VYTA 1CSKA 3EHRA 2CREA 1FYNA 4HVUA 2J05A 1I07A 5IHKA 3EHQA 2DMOA 2LP5A 2QDLA 2O9VA 1UJ0A 4HVVA 2FPDA 1GCQC 4OMQA 2K7AA 3H0FA 2HSPA 2KXDA 4OMOA 1RLQC 1UG1A 4EIKA 2J06A 2RQUA 3M0QA 2C0IA 1W1FA 2E5KA 3M0UA 1WXBA 2RF0A 1QWFA 2BZYA 2J6FA 1NG2A 2KROA 1AEYA 1UHCA 3RNJA 1YP5A 2AK5A 3EGUA 1JEGA 2CUDA 3VRZA 1OPKA 2LJ0A 1MV0B 1M27C 1ABOA 2VKNA 2BZ8A 1JXMA 2A28A 4RTUA 1CKBA 4J9GA 1N5ZA 2KRSA 2HCKA 1AZGB 2GTOA 2V1RA 2H8HA 1UDLA 2D0NA 5IH2A 1X2QA 1M30A 1WLPB 2VVKA 2JMCA 2BZXA 2P4RA 2O2OA 4RTTA 1SRLA 1GL5A 2CH4A 2KR3A 2EW3A 1E6GA 2CDTA 3NMZC 1NM7A 1UE9A 2DJQA 1E7OA 4FSSA 4Z88A 1OEBA 1K0SA 2OJ2A 1XOVA 1H3HA 2X3WD 4J9HA 3VS1A 1JQQA 3ZL7C 2LJ1A 2KXCA 2AKKA 1ZX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5R A;  2L3P A;  3GBQ A;  2JW4 A;  1U5S A;  2GQI A;  3VS4 A;  1V1C A;  2DF6 A;  2FRW A;  1X43 A;  1VA7 A;  2JTE A;  1T3L A;  2JS2 A;  1WFW A;  1Z9Z A;  1WA7 A;  2KNB B;  3EG3 A;  2KGT A;  2FPE A;  1FMK A;  2RMO A;  1T0J A;  1AVZ C;  2DLP A;  4RUG A;  4RTZ A;  4ORZ A;  1PKT A;  4LE9 A;  3H41 A;  3M0T A;  2NUZ A;  3VS6 A;  1ABQ A;  5I22 A;  2DRM A;  2FO0 A;  4DEY A;  1UJY A;  2MCN A;  5IXB A;  4JZ4 A;  2CUB A;  1Y0M A;  3TSZ A;  4D8D A;  1JXO A;  1M3B A;  1UGV A;  3LH5 A;  1JU5 C;  2LQW A;  1X69 A;  3H0I A;  2KE9 A;  3PVL A;  2AZV A;  1B3Q A;  3CQT A;  2C0O A;  2L0A A;  1MV3 A;  1LCK A;  2RQR A;  1YNZ A;  2KEA A;  2RN8 A;  1BBZ A;  1AWX A;  2DM1 A;  1WYX A;  4K11 A;  5GJV B;  2I0N A;  3M0P A;  1MUZ A;  4CC3 A;  1WDX A;  3PVQ A;  5GJW B;  2BTT A;  3H0H A;  1K9A A;  1GFC A;  2DX1 A;  4JZ3 A;  2YUO A;  2JT4 A;  2JMA A;  1SSH A;  2GBQ A;  3VS3 A;  2CH4 W;  1PRL C;  1H92 A;  1ZBJ A;  2D8H A;  4GBQ A;  1X6G A;  2IIM A;  1GCP A;  2ECZ A;  1AWO A;  2CSQ A;  2O9S A;  2A37 A;  2ESW A;  2HBW A;  3EG0 A;  3VRY A;  1M8M A;  2YT6 A;  1NEG A;  4AFQ C;  2MOX A;  2LMJ A;  1QWE A;  1UFF A;  2K79 A;  4J9B A;  4AG1 C;  1YN8 A;  1M3A A;  4R0K A;  1QKW A;  2RQV A;  4D8K A;  2F2V A;  3VS2 A;  2HEQ A;  1SHF A;  2RNA A;  4CC4 B;  2DL8 A;  1T3S A;  1PHT A;  5EC7 A;  3RBB B;  4CC7 A;  2DNU A;  1K76 A;  2FG0 A;  2DBK A;  3FJ5 A;  1AWJ A;  3KFV A;  4KRT A;  2M51 A;  2GGR A;  4Y92 A;  3PE0 A;  1CKA A;  2SRC A;  4DEX A;  2O31 A;  2J7I A;  4J9F A;  2EYY A;  4Z8A A;  4RTY A;  1GBR A;  2OAW A;  4J9E A;  1NLP C;  1TG0 A;  1ZUK A;  1HSQ A;  1K4U S;  2EGC A;  1BU1 A;  1AWW A;  2PTK A;  3A98 A;  2KT1 A;  3NPF A;  1WIE A;  3TSW A;  1PNJ A;  1HJD A;  2JXB A;  1I1J A;  1GBQ A;  1EFN A;  3TVT A;  1BK2 A;  2EGA A;  1X6B A;  1KSW A;  2K6D A;  1BB9 A;  4ESR A;  5IXF A;  1AOJ A;  3SEM A;  4OMN A;  1B07 A;  1NLO C;  2EYW A;  1E6H A;  2F2W A;  1Z9Q A;  2EKH A;  1OPL A;  4JJC A;  1UUE A;  1WX6 A;  3UAT A;  1AD5 A;  2MIO A;  2L2P A;  2LQN A;  1SPK A;  2FPF A;  1X2K A;  2LCS A;  1AZE A;  4LN2 A;  4F16 A;  2B86 A;  2SEM A;  2KYB A;  2LX7 A;  2A36 A;  2X3X D;  2AKL A;  4J9I A;  4AFS C;  1G2B A;  4AFU C;  4ZNX A;  2D1X A;  2DBM A;  2K2M A;  1GFD A;  1UEC A;  4F17 A;  1K1Z A;  1GRI A;  4M4Z A;  4OML A;  1TUC A;  4JJD A;  4A63 B;  1ZUY A;  4WCI A;  4AG2 C;  4IIM A;  2DIL A;  2RQT A;  2EYZ A;  2XMF A;  2ED0 A;  3IQL A;  4E6R A;  5HCK A;  2FEI A;  2DRK A;  2LZ6 B;  4HXJ A;  3U23 A;  1TUD A;  2JM8 A;  2ROL A;  4J9D A;  2YUN A;  4OMP A;  2GNC A;  3ULR B;  5L23 A;  2AZS A;  1RLP C;  2G6F X;  1KJW A;  3NHN A;  2CT4 A;  1IO6 A;  2JS0 A;  1H8K A;  2KYM A;  3I5S A;  1W6X A;  2K9G A;  5I11 A;  1WI7 A;  3UA7 A;  1J3T A;  2A08 A;  5FWB A;  1YWO A;  1QKX A;  4GLM A;  4HCK A;  2ED1 A;  1T0H A;  3C0C A;  4RTV A;  1A0N B;  2DL3 A;  2L3Q A;  1WXU A;  2ABL A;  1UTI A;  2DL5 A;  4Z89 A;  3M0R A;  2EVR A;  1ARK A;  2EBP A;  1GCQ A;  3O5Z A;  1Y57 A;  1WXT A;  3VS7 A;  2DE0 X;  3I35 A;  4QT7 A;  5FWC A;  2DA9 A;  2FRY A;  1SRM A;  2DL7 A;  1KFZ A;  4LNP A;  2OI3 A;  2DL4 A;  1ZUU A;  2LJ3 A;  1W70 A;  2DYB A;  3UF4 A;  2K3B A;  2GTJ A;  1G83 A;  4OMM A;  1NYG A;  4IIO A;  3R6N A;  4LUE A;  2C0T A;  2EYX A;  3QWY A;  1PRM C;  4RTW A;  1K0X A;  4HVW A;  5IHN A;  4CC2 A;  2M0Y A;  2DVJ A;  3VS0 A;  2F2X A;  3QWX X;  1OV3 A;  2LNH B;  1X27 A;  1YCS B;  3THK A;  2KRM A;  2NWM A;  2L3S A;  1M3C A;  1UHF A;  2JM9 A;  2RQW A;  5ECA A;  2PNI A;  2KBT A;  4LUD A;  2EGE A;  4JPB W;  1U06 A;  1VYV A;  3I9Q A;  2HDA A;  2EPD A;  3REB B;  2YUP A;  1KIK A;  2YUQ A;  3EG2 A;  4JJB A;  4AFZ C;  1ZSG A;  1NYF A;  3M0S A;  5IHI A;  3VS5 A;  4X1V A;  3EG1 A;  2W10 A;  1YWP A;  1QCF A;  2KRN A;  2V1Q A;  1VYU A;  4J9C A;  1OOT A;  2W0Z A;  3SHW A;  3REA B;  1NEB A;  1RI9 A;  2CSI A;  1SHG A;  1RUW A;  2YDL A;  3NGP A;  2ROT A;  1S1N A;  1SEM A;  1PKS A;  2RPN A;  3JV3 A;  2D8J A;  2KT8 A;  2J6K A;  2CT3 A;  1I0C A;  3UA6 A;  2YSQ A;  1ZLM A;  2PZ1 A;  4RTX A;  2O88 A;  1PWT A;  1U3O A;  4F14 A;  2EQI A;  2J6O A;  2ENM A;  1HD3 A;  1JO8 A;  1QLY A;  5FW9 A;  2VWF A;  1VYT A;  1CSK A;  3EHR A;  2CRE A;  1FYN A;  4HVU A;  2J05 A;  1I07 A;  5IHK A;  3EHQ A;  2DMO A;  2LP5 A;  2QDL A;  2O9V A;  1UJ0 A;  4HVV A;  2FPD A;  1GCQ C;  4OMQ A;  2K7A A;  3H0F A;  2HSP A;  2KXD A;  4OMO A;  1RLQ C;  1UG1 A;  4EIK A;  2J06 A;  2RQU A;  3M0Q A;  2C0I A;  1W1F A;  2E5K A;  3M0U A;  1WXB A;  2RF0 A;  1QWF A;  2BZY A;  2J6F A;  1NG2 A;  2KRO A;  1AEY A;  1UHC A;  3RNJ A;  1YP5 A;  2AK5 A;  3EGU A;  1JEG A;  2CUD A;  3VRZ A;  1OPK A;  2LJ0 A;  1MV0 B;  1M27 C;  1ABO A;  2VKN A;  2BZ8 A;  1JXM A;  2A28 A;  4RTU A;  1CKB A;  4J9G A;  1N5Z A;  2KRS A;  2HCK A;  1AZG B;  2GTO A;  2V1R A;  2H8H A;  1UDL A;  2D0N A;  5IH2 A;  1X2Q A;  1M30 A;  1WLP B;  2VVK A;  2JMC A;  2BZX A;  2P4R A;  2O2O A;  4RTT A;  1SRL A;  1GL5 A;  2CH4 A;  2KR3 A;  2EW3 A;  1E6G A;  2CDT A;  3NMZ C;  1NM7 A;  1UE9 A;  2DJQ A;  1E7O A;  4FSS A;  4Z88 A;  1OEB A;  1K0S A;  2OJ2 A;  1XOV A;  1H3H A;  2X3W D;  4J9H A;  3VS1 A;  1JQQ A;  3ZL7 C;  2LJ1 A;  2KXC A;  2AKK A;  1ZX6 A; 
#chains in the Genus database with same CATH topology
 3EGD B;  3OW2 A;  3GBQ A;  2JW4 A;  3CCQ A;  3DB4 A;  2GQI A;  1SKU B;  1TXQ A;  3VS4 A;  4PJO G;  4LDW A;  2E70 A;  4XTV A;  2JTE A;  2JS2 A;  1WFW A;  2K2V A;  1RAD B;  2VB6 A;  3SWN A;  2KGT A;  5CIU A;  1FMK A;  2RMO A;  1T0J A;  4Y91 A;  4VUB A;  4NL2 A;  1VQ8 Q;  4M7A D;  4ORZ A;  2P4T A;  3VS6 A;  4DBQ A;  1WZO A;  1M2O A;  5I22 A;  1UJY A;  1NE8 A;  2CUB A;  1Y0M A;  4OB2 B;  1WGS A;  2HKQ B;  2KK4 A;  4LDX A;  1U1T A;  1TTH B;  1X69 A;  2F5T X;  3H0I A;  2RO0 A;  1DJ7 B;  3CQT A;  2C0O A;  3HHT B;  3M53 A;  1BIA A;  3CC7 A;  3FRN A;  3LW5 E;  1AWX A;  3JCM b;  4ZGJ B;  1QCN A;  2COZ A;  3S3M A;  4O5V A;  2K57 A;  3N5B B;  2NUP B;  3P8H A;  3M0P A;  4CC3 A;  3I56 A;  2RM4 A;  3NTH A;  4C8Q B;  3H0H A;  3ASK A;  3QII A;  2YUO A;  1XJW B;  5D6Y A;  4RG2 A;  2OTL A;  5KYX A;  3TRE A;  4PFO A;  1VQO Q;  2CSQ A;  2O9S A;  1PG5 B;  3RMS A;  3VRY A;  2K3Y A;  1NEG A;  3L2U A;  4C92 D;  3WXM B;  4GY5 A;  2YHT A;  3JCM X;  4PJM A;  2E4H A;  3CCJ T;  1QP3 A;  1SHF A;  2RNA A;  4CC4 B;  3MEU A;  1PHT A;  2COW A;  2DNU A;  1RAA B;  2E1H A;  4KBM B;  1N8R R;  5D6W A;  3MP8 A;  4ME7 A;  5FU6 B;  5M9O A;  2LTO A;  2M51 A;  2HKN A;  4Y92 A;  4JUV A;  1CKA A;  2SRC A;  3HKS A;  4JRQ A;  3VYH B;  2J7I A;  3Q1J A;  4Y28 E;  1D1A A;  1TG0 A;  2JN0 A;  1YI2 A;  3CPW S;  4BI4 A;  2PTK A;  3CCS Q;  2KT1 A;  1HJD A;  1KC8 U;  1EFN A;  3CBO A;  2M9U A;  3TVT A;  1BK2 A;  2GF7 A;  5GAO q;  2O4X A;  4ESR A;  5IXF A;  3OW2 P;  4OMN A;  1B07 A;  3CCR T;  1N6A A;  2EYW A;  1E6H A;  5C0M A;  5D7U A;  4M7D G;  1UUE A;  2IVW A;  3LGL A;  4A4K A;  2FPF A;  3M4G A;  4LD9 K;  4LN2 A;  2V8J A;  2CP0 A;  2JVV A;  2X35 A;  3NFC A;  1K8A R;  4AFS C;  5LJ5 d;  4MZM A;  1G2B A;  2CS7 A;  2EIF A;  2M0O A;  2E3I A;  3M56 A;  3CCL T;  4OF1 A;  3QO3 A;  3CCJ Q;  2V8K A;  3VUZ A;  3DKM A;  1GRI A;  3ZBD A;  4E7S A;  5GAO l;  2LCC A;  1ZUY A;  1K73 U;  3RIR A;  1Q82 U;  2CP2 A;  2DIL A;  2DAQ A;  5LJ5 f;  3L2R A;  5HCK A;  1KQS S;  2H3E B;  2DRK A;  2JTF A;  1TUD A;  2JM8 A;  5GAN 7;  2P84 A;  5CKD A;  3L42 A;  2AZS A;  4B9X A;  2QQA A;  2G6F X;  1VQL A;  4ZN3 A;  1JRI A;  3PFS A;  2QQ9 A;  3NHN A;  3MCA B;  2BUD A;  1H8K A;  3PIO A;  2KYM A;  5CKF A;  3I5S A;  4OB0 B;  3VKI A;  4M78 G;  4ANJ A;  2ZPB B;  3QPH A;  2QA4 Q;  2EJF A;  2A08 A;  1YWO A;  4XTU A;  5IAY A;  1XTD A;  4M75 C;  3OYM A;  1T0H A;  4RTV A;  3G1J A;  2DL3 A;  4A54 A;  2ABL A;  4Z89 A;  1X6O A;  5KYW A;  4PJO C;  2DD5 A;  3O5Z A;  1VQ5 A;  3BY7 A;  4BUG A;  2EFI A;  1IZ6 A;  4OVA A;  1I81 A;  4MML A;  3TCJ A;  4E47 A;  4PJO A;  5KYX B;  2KDS A;  2KVQ G;  3CC4 T;  2OI3 A;  2DL4 A;  1ZUU A;  3OS5 A;  2LJ3 A;  5AYF A;  2K3B A;  4MDW A;  1TS9 A;  4OMM A;  1NYG A;  1D09 B;  2OAU A;  4N4I A;  2EYX A;  1UGR B;  4CC2 A;  1O9S A;  2F2X A;  1VQ8 A;  2VC8 A;  3QYH B;  4C8Q F;  1NJI C;  3L1A A;  4FT2 A;  5KCO A;  4BY6 B;  5A0D A;  2AIR B;  2DD4 A;  5ECA A;  1PC0 A;  2PNI A;  3OYE A;  5GAO n;  2AT1 B;  4QVZ A;  4JPB W;  2E64 A;  1U06 A;  2YRD A;  4A4E A;  1VYV A;  3REB B;  2YUQ A;  4JJB A;  3OYD A;  2QK0 A;  1ZSG A;  1NYF A;  3BFM A;  3M0S A;  4X1V A;  2QYZ A;  3GOX A;  3KBG A;  3PT9 A;  4OP0 A;  4C8Q E;  4BDZ A;  2LQ8 A;  4JLG A;  2OTJ T;  3JCM P;  2KRN A;  4WF2 A;  1NJI U;  2W0Z A;  1O75 A;  4HA8 A;  1YJW T;  3H6Z A;  4MZP A;  3EFO A;  1VQO A;  2ROT A;  3V8L A;  2YLB A;  2CP3 A;  1PSF A;  2RPN A;  2O4X B;  3JV3 A;  1VQP T;  1G5V A;  2IG0 A;  3CC4 Q;  2YSQ A;  2PZ1 A;  3QHS A;  4M7A G;  5FRO A;  1PWT A;  1U3O A;  3CPW A;  2EQI A;  2HQX A;  1R77 A;  1W2B P;  1VYT A;  5GAM d;  1M1F A;  1B34 A;  2CRE A;  4HVU A;  5DY9 A;  4RCB A;  4X9D A;  3CD6 Q;  1IHW A;  4HCC A;  3QSU A;  2ZCF B;  2LQK A;  5GAM f;  1UJ0 A;  1GCQ C;  2K5I A;  2I2L A;  1QVF A;  2KSS A;  3JAM E;  3OS0 A;  4R55 A;  5GAO m;  4DOW A;  2DXB A;  3OW2 S;  1YHQ T;  1ZQ1 A;  2J06 A;  3M57 A;  3H8Z A;  1D3B B;  2C0I A;  3JCM V;  2E5K A;  2O01 E;  3JCM W;  2HAX A;  3V7R A;  1MMN A;  2QXF A;  4M77 G;  2HBP A;  2KRO A;  4M7D C;  1FWZ A;  3RNJ A;  3BDL A;  5GMK m;  1KC8 R;  2OTJ Q;  4YTL A;  1ACM B;  1JJ2 A;  1MV0 B;  2VKN A;  4M7D A;  5KE3 A;  1YJW Q;  1JXM A;  2A28 A;  1N8R C;  5HK3 A;  1CKB A;  4M7A E;  2KRS A;  2HCK A;  3BW1 A;  4C92 G;  4C0D C;  2WSF E;  1I5O B;  2Z0W A;  3S3O A;  2H8H A;  1UDL A;  1BCM A;  1X2Q A;  5DLQ E;  1WLP B;  1VQP Q;  2RHI A;  3MP6 A;  5J26 A;  3JB9 H;  2M02 A;  4RMO A;  4M75 B;  2RI2 A;  3EAE A;  3EH2 A;  4OGC A;  3NMZ C;  2DJQ A;  4O6J A;  1E7O A;  3V8J A;  1XOV A;  2RB6 A;  3CCJ A;  1QVG P;  1H3H A;  4J9H A;  2DZ9 A;  2RHY A;  3GLX A;  2KXC A;  1LPL A;  5A2Q E;  1VQ7 T;  4C0G A;  1K73 R;  1Q82 R;  5FLX E;  1WQ7 A;  4BE2 A;  4XK8 E;  4M78 C;  1EZZ B;  2EWN A;  4F7U B;  4PK4 A;  3EG3 A;  2FPE A;  4XTY A;  3T9N A;  5IN1 A;  1YHQ Q;  4M78 A;  3OYH A;  3H41 A;  2NUZ A;  3MKD A;  1K8A C;  4A53 A;  2DRM A;  2FO0 A;  1FX7 A;  4JZ4 A;  2NUT A;  2HZY A;  1JXO A;  3C94 A;  1JU5 C;  2KE9 A;  1YJN T;  2HSE B;  1PSE A;  2AZV A;  2VAS A;  1MV3 A;  1LCK A;  3QZ9 B;  3OS1 A;  2DO3 A;  2KEA A;  5GAO r;  2DM1 A;  1RAC B;  3JCM Q;  5GJV B;  2KMT A;  4J7F A;  5LJ3 d;  3QUI A;  1GFC A;  3MEA A;  3CC2 T;  2DX1 A;  3EFO B;  1PCX A;  2GBQ A;  1H92 A;  3OYK A;  1FXX A;  2DVE A;  3M54 A;  4GBQ A;  5LJ3 f;  2IIM A;  2HQH A;  1QVF P;  1GCP A;  1OX8 A;  2ECZ A;  1AWO A;  3L2W A;  3CCL A;  3GNG A;  3FB9 A;  5GAN f;  2YT6 A;  2FZC B;  3QKJ A;  4TVR A;  4KH1 B;  4AFQ C;  1VOM A;  1VQ7 Q;  2BIV A;  2LMJ A;  3X20 B;  1UFF A;  2K79 A;  3URG A;  4BI3 A;  1N27 A;  4QQD A;  4GLK A;  4R0K A;  2RI3 A;  2RQV A;  1JJ2 P;  2HEQ A;  2DL8 A;  3GF5 A;  5EC7 A;  3RBB B;  5GAM e;  1KQ1 A;  5IT9 E;  1IRE B;  2CP7 A;  1VQ4 Q;  2DBK A;  3KXT A;  3FJ5 A;  4F04 B;  1RAE B;  4A4F A;  2MWP A;  4KRT A;  1Y96 A;  1GXI E;  1YJN Q;  1Q86 U;  3V8K A;  3NTK A;  3CBP A;  2EYY A;  4Z8A A;  1D0X A;  1WHL A;  1NPP A;  2VXE A;  1ZSZ C;  3OYY A;  1HSQ A;  4MMK A;  1K4U S;  5GAN g;  3A5Z B;  1WIE A;  1PNJ A;  2LX9 A;  4V2S A;  4XU1 A;  1GBQ A;  1PD1 A;  4M7A A;  2DIQ A;  5EG2 A;  1ZSZ A;  4FYX B;  5LJ5 h;  3C12 A;  1H64 1;  3CC2 Q;  3WVD B;  3CC4 A;  1BB9 A;  4EPC A;  3CBM A;  4MZT A;  1Y7X A;  1NLO C;  3EG9 B;  2L89 A;  2K5F A;  2YLC A;  2LNV A;  2HL3 A;  4JJC A;  2DFU A;  1WX6 A;  3MET A;  2E41 A;  2MK5 A;  3UAT A;  2LQN A;  1SPK A;  3CMA T;  3CD6 A;  3NTI A;  4F16 A;  2B86 A;  1V29 B;  2LVM A;  2E3H A;  2LX7 A;  2A36 A;  4M77 C;  1SSF A;  2AKL A;  5L8R E;  2MI6 A;  2DK3 A;  2COY A;  2EAY A;  3A8H B;  4UC4 A;  2K2M A;  5GMK i;  4M77 A;  2F1L A;  4J5Y A;  3CCS T;  4HCB A;  4M4Z A;  1TUC A;  4LDY A;  2V8I A;  4C92 C;  2EYZ A;  2E10 A;  4ZN1 A;  2F69 A;  3IQL A;  3WVE B;  2MYS A;  2FHD A;  3GPL A;  3E9F A;  4IUR A;  3RER A;  3U23 A;  4J9D A;  2OTJ A;  4M75 F;  1YIT T;  4DBF A;  2YUN A;  3ULR B;  4C92 A;  1QP2 A;  3SD4 A;  5A0G A;  1YJW A;  2RD1 A;  2QAS A;  1TU0 B;  2ZPH B;  3UA7 A;  2CP5 A;  1SF9 A;  2P0Q A;  3HRU A;  1U8R A;  3J7A F;  3RES A;  2XU8 A;  3JB9 G;  3CEY A;  1VQP A;  3AT1 B;  1Y71 A;  4F7U F;  4HCK A;  2HQE A;  3VUB A;  5LL6 S;  1WXU A;  2DL5 A;  2C06 A;  2L5Q A;  2EBP A;  1Y57 A;  3VS7 A;  4EMK C;  1KC8 C;  2DA9 A;  1SRM A;  4OGE A;  1KFZ A;  2KAF A;  3UF4 A;  4EMK A;  3CMA Q;  2QTV A;  5LJ3 e;  3S6W A;  4F7U E;  2GTJ A;  1D1C A;  3VJP A;  1G83 A;  3JCM g;  1EX4 A;  4BDY A;  3R6N A;  4LUE A;  1TSF A;  3QWY A;  3GP8 A;  1MMD A;  1YHQ A;  1MMA A;  1OV3 A;  1D1B A;  2QA4 T;  2EKO A;  1C0M A;  1TWB A;  3M55 A;  2KBT A;  4LUD A;  3J80 E;  1YIT Q;  1VIE A;  3I9Q A;  1KIK A;  3EG2 A;  4RCC A;  1VQM T;  3VS5 A;  1K73 C;  1Q82 C;  1QVF S;  2PUO B;  4P5N A;  1OU8 A;  3JCM J;  3CPF A;  3OQ5 A;  3HL8 A;  4E7L A;  5GAM h;  1RAI B;  3FDR A;  2CYZ B;  1RI9 A;  2CSI A;  3OMC A;  2E6Z A;  4PFZ A;  2YDL A;  5GAN 2;  2ZAE A;  1JJ2 S;  1LJO A;  2X4W A;  2BE9 B;  2D8J A;  1I0C A;  1ZBX A;  4N4G A;  3SWN B;  1W2B A;  1M2V A;  1M1K U;  1VQ7 A;  2CZ6 B;  4II1 A;  1Q7Y U;  1IHV A;  1I5L A;  2KI7 A;  3EHR A;  4LDU A;  2DIG A;  4ZGD B;  5KYY A;  1MND A;  5CQY A;  2PU9 B;  3RKX A;  3QG1 A;  4XU0 A;  1QW1 A;  2QDL A;  1G3T A;  4PJJ A;  5CKB A;  2DPP B;  2K7A A;  4KGV B;  2YRV A;  3H0F A;  3LH0 A;  1YJ9 Q;  2QQB A;  4J6W A;  1YJN A;  1RLQ C;  1Q86 R;  4CRI A;  4C8Q G;  1WHJ A;  2X4X A;  4C5I A;  2RQU A;  3HSB A;  1VQM Q;  2QEX T;  2FL7 A;  3M0U A;  1WXB A;  1TUG B;  2HMA A;  5GMK h;  1NG2 A;  2Y90 A;  2K5L A;  5GAN 4;  2AK5 A;  1M4Z A;  3VRZ A;  1OPK A;  2LJ0 A;  4QKU A;  1M27 C;  1ABO A;  3OSS C;  4X9C A;  3CC2 A;  3CCU T;  3CCV T;  2HNI A;  4J9G A;  1R8O B;  2V1R A;  3PIP A;  3OA6 A;  2MPX C;  1WJS A;  1VQ9 T;  3CD6 T;  2DET A;  2VVK A;  1S72 T;  4IKF A;  2JJ9 A;  2LC4 A;  2XG8 D;  4RTT A;  4M75 D;  3HP9 A;  2CKK A;  2KR3 A;  3P8D A;  2AHJ B;  3J81 E;  1QVG A;  1Q81 R;  1OQK A;  4PJO D;  4KH0 B;  8AT1 B;  1UEB A;  1JQQ A;  4HKE A;  2MWO A;  2GQV A;  1VQK T;  4A4G A;  2RJE A;  2JUF A;  2A3L A;  2Y4Y A;  3P8B B;  3X24 B;  4KT0 E;  2FRW A;  1X43 A;  3RKY A;  1VA7 A;  4HT9 A;  2KNB B;  3ZFJ A;  2M1H A;  3FEO A;  4RTZ A;  5LJ3 h;  1PKT A;  1BI1 A;  2QEX Q;  1ABQ A;  4FSX A;  1OX9 A;  2L3R A;  2MCN A;  5IXB A;  1IRX A;  5GAN h;  3JB9 J;  2P0P A;  1UGV A;  3LH5 A;  3HTR A;  3V7S A;  3A8M B;  2EQU A;  1FMV A;  1G3Y A;  4FL6 A;  3QZ5 B;  2L0A A;  3HFN A;  1X75 C;  2RQR A;  3CCU Q;  3CCV Q;  1BBZ A;  1WYX A;  5GAN 8;  3EFS A;  2XDD A;  4DA4 A;  1MUZ A;  6AT1 B;  1KK7 A;  1LVK A;  1VQ9 Q;  2LCL A;  2XHC A;  1S72 Q;  2QDY B;  4JZ3 A;  2JT4 A;  3CMA A;  2YRC A;  1UGQ B;  3VS3 A;  3F70 A;  2CH4 W;  1X6G A;  3X26 B;  3A1P A;  5LJ5 e;  1BIB A;  2RK2 A;  5CVI A;  3G4S T;  1M2V B;  2A37 A;  2EYQ A;  3JCM c;  2HBW A;  4BE1 A;  1VQK Q;  3CCS A;  1PM3 A;  2MOX A;  4JRK A;  3INZ A;  4AG1 C;  1YN8 A;  3CC7 Q;  1D0Y A;  1BI2 A;  1M3A A;  1QKW A;  2FVU A;  2RHU A;  1YIT A;  2F2V A;  3VS2 A;  3V7C A;  3VYG A;  1RAB B;  2R57 A;  4CC7 A;  2FYK A;  1K76 A;  2QGF B;  1ZA1 B;  1AWJ A;  1WHK A;  3KFV A;  4JS4 A;  3AHU A;  5J39 A;  1HYO A;  2MMP A;  2GGR A;  8ATC B;  5KYW B;  3LX7 A;  2D6F A;  1TH7 A;  3DB3 A;  4IUU A;  3EGD A;  2O31 A;  5DLO A;  4RTY A;  3OBW A;  1GBR A;  2EQK A;  4J9E A;  2CZ0 B;  4PJO B;  5LJ5 j;  3FC3 A;  2OX7 A;  4LDV A;  1BU1 A;  1KQ2 A;  1AWW A;  4KUI A;  2V26 A;  3A98 A;  3TSW A;  2NLU A;  3E1S A;  1I1J A;  3CXC A;  2FB7 A;  5GAN 6;  2CZ7 B;  1UB4 A;  5KE2 A;  1X6B A;  3RR6 A;  3M59 A;  1AOJ A;  3SEM A;  1KD1 U;  1M1K R;  4RKU E;  1Q7Y R;  4FIB A;  1Z9Q A;  1OPL A;  4Z02 A;  3G4S Q;  5GAN 5;  1AD5 A;  4JS5 A;  4C8Q C;  1VQ4 T;  3LLR A;  1X2K A;  2LCS A;  4JRP A;  1AZE A;  5KYU A;  1MGQ A;  2SEM A;  1JB0 E;  2KYB A;  2NUP A;  2QA4 A;  4C8Q A;  7AT1 B;  1D0Z A;  2D1X A;  2DBM A;  1WNL A;  1UEC A;  1I8F A;  1K1Z A;  4LXC A;  1VQM A;  1M90 U;  4IIM A;  2RQT A;  2QQR A;  2XMF A;  2E5Q A;  5FU7 C;  1LOJ A;  2LZ6 B;  4HXJ A;  5GAN d;  4M78 D;  3OYB A;  2VV5 A;  4PLI A;  2HL5 C;  2RK1 A;  2ZZD A;  5D6X A;  4EMG A;  4PJL A;  2CT4 A;  1RAH B;  2JS0 A;  2LT4 A;  1QQJ A;  5I11 A;  2DTI A;  5KCH A;  4XTW A;  1WI7 A;  5FU6 C;  5CQX A;  1J3T A;  1TOV A;  1K9M U;  1Q86 C;  4ELZ C;  1QKX A;  4ZTJ A;  3M58 A;  5CCA A;  1B34 B;  2L3Q A;  1UTI A;  3M0R A;  4DBH A;  1ARK A;  4ELY C;  1JBM A;  2DE0 X;  1QVP A;  3I35 A;  4JRI A;  5FWC A;  1LNX A;  2ZPI B;  2FRY A;  1NPR A;  1W70 A;  1OI1 A;  3MO8 A;  1G8X A;  1QMC A;  2JOY A;  3QXE B;  2C0T A;  4M7A C;  3UT1 A;  1W2B S;  3UDC A;  1PRM C;  1K0X A;  4PL6 A;  2M0Y A;  2DVJ A;  4IUT A;  2LNH B;  3TQ7 P;  1X27 A;  2QEX A;  1WHM A;  3QJY A;  1YCS B;  4XQ3 A;  1R0C B;  4XU3 A;  2E12 A;  4M7D B;  4NS5 A;  1UHF A;  2JM9 A;  3CXC P;  1BCO A;  2EGE A;  2XD0 A;  3L2Z A;  3JRZ A;  4FCY A;  3RUX A;  2YUP A;  4AFZ C;  3OYJ A;  3CCU A;  3CCV A;  5IHI A;  4C0D B;  5GAM j;  1YWP A;  4M75 G;  3FJP A;  1QCF A;  1MNE A;  1RI0 A;  2V1Q A;  1VYU A;  3FLG A;  3CME T;  1BI3 A;  1VQ9 A;  1S72 A;  4ATO A;  2XI9 A;  3SHW A;  3QJ6 A;  1Q81 U;  3REA B;  5GMK e;  3MEW A;  4BAC A;  2P0K A;  2MAM A;  4FW1 A;  3OYG A;  1G3W A;  3QYG B;  2DXT A;  1V76 A;  4F7U G;  3CCE T;  3JCM d;  2KT8 A;  2J6K A;  2VGN A;  2GFA A;  3UA6 A;  3RMQ A;  1VQK A;  1ZLM A;  3OYI A;  4F14 A;  4M78 B;  4KUL A;  1XNI A;  1HD3 A;  1JO8 A;  2VWF A;  3TU4 K;  1CSK A;  4D6W A;  5HY6 A;  3JCM f;  4BE0 A;  4PJO F;  4N4H A;  3OY9 A;  4XTX A;  5KYU B;  2NUT B;  2QI2 A;  3JSC A;  1FYN A;  2A0F B;  2J05 A;  1I07 A;  2DTO A;  2EQM A;  4FM4 B;  2MF2 A;  3VV0 A;  2BKD N;  2LP5 A;  4QW2 A;  4C0Z A;  1QVG S;  2O9V A;  2FPD A;  3E2U A;  1IGU A;  3C95 A;  4M75 E;  4M77 D;  4DOV A;  4OMO A;  2G3R A;  5GMK j;  2CGH A;  4PJO E;  1C1A A;  2XK0 A;  1W1F A;  4XAX B;  3RKW A;  3A8G B;  2RF0 A;  2BZY A;  4WTO B;  2J6F A;  2DXU A;  1AEY A;  4BY6 C;  1UHC A;  2DTH A;  3CME Q;  5FU7 B;  4KGX B;  4QVC A;  3G71 T;  1Y07 A;  2XDB A;  5GAN e;  1WQW A;  3G6E T;  1KD1 R;  2R5A A;  1AZG B;  1N9S A;  2GTO A;  3MEV A;  2D0N A;  3G4S A;  1M30 A;  3CCE Q;  2ATC B;  3M5A A;  3GIB A;  3MP1 A;  2JMC A;  4R56 A;  1YJ9 T;  2O2O A;  1SRL A;  2CH4 A;  3JB9 F;  2EW3 A;  2CDT A;  3I55 T;  1NM7 A;  2DXC A;  3HRS A;  1VQ6 T;  1RL2 A;  3L2V A;  1OEB A;  3CCM T;  1Y96 B;  1M9S A;  3VS1 A;  3ZL7 C;  1NZ9 A;  1WHH A;  2AKK A;  4OMP A;  1ZX6 A;  4J6X A;  1M1K C;  3I5R A;  2L3P A;  2E65 A;  1U5S A;  3BDU A;  1Q7Y C;  1M90 R;  2RJC A;  1V1C A;  4J83 A;  2DF6 A;  5LJ3 j;  1BYM A;  1T3L A;  4PJN A;  1Z9Z A;  1WA7 A;  1AVZ C;  5GAN j;  4M7A B;  5GAN 3;  2DLP A;  4RUG A;  1ZSZ B;  4LE9 A;  3M0T A;  4QQG A;  3QDF A;  3LWH A;  4L6V 5;  2F5K A;  4PKC C;  4DEY A;  3MHX A;  5DM7 R;  2RJD A;  3PNW C;  3TSZ A;  1VQN T;  4D8D A;  3OYF A;  1M3B A;  2RA2 A;  2LQW A;  3MPU B;  4L5G A;  2DER A;  1G3S A;  1K9M R;  1IB8 A;  3PVL A;  3G71 Q;  1BI0 A;  3HRT A;  3PTA A;  1B3Q A;  3PMI A;  1YNZ A;  2RN8 A;  1YIJ T;  1R0B G;  3G6E Q;  4K11 A;  4E7I A;  4C5E A;  3OB9 A;  2I0N A;  1WDX A;  3PVQ A;  5GJW B;  1D3B A;  2BTT A;  2RH2 A;  2IPO B;  1RAG B;  2R5M A;  1K9A A;  1VQ4 A;  4M7D F;  2KQW A;  5CK9 A;  4PFP A;  3S3N A;  2CP6 A;  2JMA A;  1SSH A;  3ME9 A;  4M77 B;  1I4K 1;  4E7Z A;  5GMK l;  1PRL C;  4XU2 A;  1OU9 A;  3OYA A;  3CXC S;  1YFN A;  2DEU A;  2RHZ A;  3I55 Q;  1ZBJ A;  2D8H A;  1VQ6 Q;  4J6Y A;  2DZC A;  2ESW A;  3CCM Q;  3EG0 A;  1M8M A;  3G7Z A;  4M7D E;  4C92 B;  1QWE A;  3JCM e;  4J9B A;  4C5H A;  2BE7 D;  1EIF A;  3CCR Q;  2WAC A;  4D8K A;  3HFO A;  3PMT A;  4M75 A;  5LJ5 g;  4IUV A;  1T3S A;  2VXF A;  3MJX A;  4KGZ B;  1P92 A;  2FZK B;  2FG0 A;  3CCQ T;  4OB1 B;  5CKH A;  4X34 A;  1VQN Q;  1AHJ B;  3PE0 A;  1OYX A;  4DQ2 A;  4M78 F;  4DEX A;  3E19 A;  4J9F A;  2RI5 A;  3QBY A;  2OAW A;  4BB7 A;  5CAI A;  3CCL Q;  1NLP C;  1ZUK A;  1YIJ Q;  4F7U A;  2QG9 B;  2EGC A;  2QAZ A;  1VUB A;  4EMK B;  3NPF A;  2JXB A;  2VYT A;  4AMC A;  2EGA A;  2YWW A;  3OS2 A;  1KSW A;  4AT1 B;  2K6D A;  4M78 E;  4NOY A;  3HPW A;  3CC7 T;  1BKB A;  5KYN A;  3UPU A;  5HKC A;  3RDV A;  2F2W A;  2EKH A;  4EDU A;  3I56 T;  2H3J A;  2MIO A;  2LRQ A;  2L2P A;  2M16 A;  3TEE A;  4A4H A;  4B6M A;  4C0F A;  4C5G A;  2OTL T;  3A8O B;  3C4S A;  1UGP B;  2X3X D;  4J9I A;  4MDX A;  1WHG A;  1X01 A;  4AFU C;  3L2Q A;  4DBR A;  4N0A C;  4ZNX A;  1GFD A;  2VUB A;  1QCO A;  1IXD A;  1OZ2 A;  1KHC A;  4F17 A;  2HD0 A;  2D9T A;  4BI8 B;  4OML A;  4JJD A;  2VGM A;  4WCI A;  4A63 B;  4AG2 C;  5GAO p;  3CCQ Q;  1SG5 A;  4N0A A;  1WPY A;  5CR2 A;  2ED0 A;  1AT1 B;  4E6R A;  2FEI A;  5HK0 A;  4FYW B;  2ROL A;  2X4Y A;  2Y4X A;  5C6S A;  4B9W A;  3OSV A;  3CME A;  2GNC A;  5L23 A;  1ZA2 B;  1RLP C;  3OYL A;  3JB9 D;  1KJW A;  2DKG A;  3D7S B;  1IO6 A;  2K3X A;  2QGG A;  1M8V A;  3PGG A;  1W6X A;  2K9G A;  2WSC E;  2XKO C;  4KUD K;  4NL3 A;  1H3Z A;  3DLM A;  1MHN A;  3CCE A;  5FWB A;  3M9Q A;  4FT4 A;  1F1B B;  3X25 B;  1C6V X;  4GLM A;  4JDS A;  2ED1 A;  1KHI A;  3C0C A;  3X28 B;  1OUL A;  1A0N B;  5KYY B;  3FIF A;  2ZPE B;  3EGX A;  1YI2 T;  2PVD B;  3BE3 A;  2EVR A;  4M7A F;  1GCQ A;  1WXT A;  4QT7 A;  1IGQ A;  4ZTF A;  3I56 Q;  1B7T A;  2K4Y A;  2DYI A;  2DL7 A;  4LNP A;  3JB9 I;  2DYB A;  4PLL A;  2OTL Q;  3O8V A;  2JTM A;  1KD1 C;  2NYS A;  5CKE A;  4IIO A;  2GFU A;  3DLL A;  1KQS A;  1XQH A;  4E2F B;  4RTW A;  1M5Q 1;  4OB3 B;  4HVW A;  4L59 A;  5IHN A;  3VS0 A;  3QWX X;  5GAM g;  5A0L A;  3EG9 A;  4FYV B;  3THK A;  2DJZ A;  2KRM A;  2E6N A;  2X4J A;  4Q5W A;  4E7J A;  2NWM A;  4M7D D;  2L3S A;  1M3C A;  2RQW A;  4JJN K;  4CI0 C;  2QQS A;  4M77 F;  1OZ3 A;  1WJQ A;  1ZHI A;  3SFM A;  3G71 A;  1HK9 A;  2HDA A;  2EPD A;  2X51 A;  3OYC A;  1RAF B;  1PD0 A;  3JCM h;  1M90 C;  1N8R U;  3G6E A;  3EG1 A;  4ZGE B;  4E7K A;  2JZ2 A;  4RG8 A;  3M4Y A;  2W10 A;  3SB2 A;  2EJ9 A;  1W4S A;  4C92 F;  4J9C A;  2RJF A;  2ZPF B;  4FW2 A;  1OOT A;  1UGS B;  3SDZ A;  4OMF B;  4J8O A;  4M77 E;  1VQL T;  1Q95 G;  1NEB A;  1YBY A;  1YI2 Q;  2EQJ A;  1YJ9 A;  4IUQ A;  4HT8 A;  1SHG A;  1RUW A;  3I55 A;  3LGF A;  3NGP A;  4QVD A;  1S1N A;  1SEM A;  1VQ6 A;  5KH6 A;  4XTZ A;  1PKS A;  3QDR B;  1K9M C;  2A7Y A;  3EFR A;  3CCM A;  2LT1 A;  2YXY A;  2CT3 A;  4C92 E;  2XID A;  1N9R A;  4HCZ A;  4RTX A;  2O88 A;  2J6O A;  2B8A A;  3GNF B;  2ENM A;  4J7I A;  1VQ5 T;  1QLY A;  5FRN A;  5FW9 A;  5J3B A;  3CPW P;  3CCR A;  4FU6 A;  2FZG B;  2PVG B;  5IHK A;  3OYN A;  3EH1 A;  3EHQ A;  3ZEH A;  4C8Q D;  5I2M A;  2DMO A;  3LWI A;  1K8A U;  4JLI A;  4HVV A;  5I21 A;  4OMQ A;  2PVO B;  1VQN A;  3A8L B;  2HSP A;  2KXD A;  1MMG A;  1KG1 A;  2D0Q B;  1NBE B;  1UG1 A;  4EIK A;  3LYI A;  4LD6 A;  1VQ8 T;  2L8D A;  2RHX A;  3M0Q A;  2DEQ A;  4FYY B;  2PQW A;  1U1S A;  1YIJ A;  9ATC B;  1QWF A;  4IUP A;  3H9N A;  3KUF A;  4E7H A;  1YP5 A;  3EGU A;  1JEG A;  2CUD A;  2XIC A;  3VU3 C;  2GCX A;  2QTX A;  1VQL Q;  2XDP A;  2BZ8 A;  1HXD A;  5FRM A;  4EMH A;  2JNG A;  3E9G A;  4RTU A;  2KY9 A;  3OBY A;  1N5Z A;  3ER0 A;  3OMG A;  4BD3 A;  2PUK B;  5IH2 A;  1KQS P;  1VIF A;  5AT1 B;  2LDM A;  1YCY A;  3EGX B;  1Q81 C;  4PNO A;  2BZX A;  2P4R A;  5LJ3 g;  1GL5 A;  1NJI R;  3R6O A;  2WSE E;  1VQ5 Q;  2X9H A;  2EJG A;  1VQO T;  1E6G A;  2CZ1 B;  1UE9 A;  4QQ6 A;  2ZGW A;  4FSS A;  4Z88 A;  1K0S A;  2OJ2 A;  2R58 A;  2X3W D;  5CO7 A;  1WJR A;  2LJ1 A;  1M1G A;  2ZPG B;  5I2S A;  3UWN A;  1FMW A;  3SWN C; 
#chains in the Genus database with same CATH homology
 3I5R A;  2L3P A;  3GBQ A;  2JW4 A;  1U5S A;  2GQI A;  3VS4 A;  1V1C A;  2DF6 A;  2FRW A;  1X43 A;  1VA7 A;  2JTE A;  1T3L A;  2JS2 A;  1WFW A;  1Z9Z A;  1WA7 A;  2KNB B;  3EG3 A;  2KGT A;  2FPE A;  1FMK A;  2RMO A;  1T0J A;  1AVZ C;  2DLP A;  4RUG A;  4RTZ A;  4ORZ A;  1PKT A;  4LE9 A;  3H41 A;  3M0T A;  2NUZ A;  3VS6 A;  1ABQ A;  5I22 A;  2DRM A;  2FO0 A;  4DEY A;  1UJY A;  2MCN A;  5IXB A;  4JZ4 A;  2CUB A;  1Y0M A;  3TSZ A;  4D8D A;  1JXO A;  1M3B A;  1UGV A;  3LH5 A;  1JU5 C;  2LQW A;  1X69 A;  3H0I A;  2KE9 A;  3PVL A;  2AZV A;  1B3Q A;  3CQT A;  2C0O A;  2L0A A;  1MV3 A;  1LCK A;  2RQR A;  1YNZ A;  2KEA A;  2RN8 A;  1BBZ A;  1AWX A;  2DM1 A;  1WYX A;  4K11 A;  5GJV B;  2I0N A;  3M0P A;  1MUZ A;  4CC3 A;  1WDX A;  3PVQ A;  5GJW B;  2BTT A;  3H0H A;  1K9A A;  1GFC A;  2DX1 A;  4JZ3 A;  2YUO A;  2JT4 A;  2JMA A;  1SSH A;  2GBQ A;  3VS3 A;  2CH4 W;  1PRL C;  1H92 A;  1ZBJ A;  2D8H A;  4GBQ A;  1X6G A;  2IIM A;  1GCP A;  2ECZ A;  1AWO A;  2CSQ A;  2O9S A;  2A37 A;  2ESW A;  2HBW A;  3EG0 A;  3VRY A;  1M8M A;  2YT6 A;  1NEG A;  4AFQ C;  2MOX A;  2LMJ A;  1QWE A;  1UFF A;  2K79 A;  4J9B A;  4AG1 C;  1YN8 A;  1M3A A;  4R0K A;  1QKW A;  2RQV A;  4D8K A;  2F2V A;  3VS2 A;  2HEQ A;  1SHF A;  2RNA A;  4CC4 B;  2DL8 A;  1T3S A;  1PHT A;  5EC7 A;  3RBB B;  4CC7 A;  2DNU A;  1K76 A;  2FG0 A;  2DBK A;  3FJ5 A;  1AWJ A;  3KFV A;  4KRT A;  2M51 A;  2GGR A;  4Y92 A;  3PE0 A;  1CKA A;  2SRC A;  4DEX A;  2O31 A;  2J7I A;  4J9F A;  2EYY A;  4Z8A A;  4RTY A;  1GBR A;  2OAW A;  4J9E A;  1NLP C;  1TG0 A;  1ZUK A;  1HSQ A;  1K4U S;  2EGC A;  1BU1 A;  1AWW A;  2PTK A;  3A98 A;  2KT1 A;  3NPF A;  1WIE A;  3TSW A;  1PNJ A;  1HJD A;  2JXB A;  1I1J A;  1GBQ A;  1EFN A;  3TVT A;  1BK2 A;  2EGA A;  1X6B A;  1KSW A;  2K6D A;  1BB9 A;  4ESR A;  5IXF A;  1AOJ A;  3SEM A;  4OMN A;  1B07 A;  1NLO C;  2EYW A;  1E6H A;  2F2W A;  1Z9Q A;  2EKH A;  1OPL A;  4JJC A;  1UUE A;  1WX6 A;  3UAT A;  1AD5 A;  2MIO A;  2L2P A;  2LQN A;  1SPK A;  2FPF A;  1X2K A;  2LCS A;  1AZE A;  4LN2 A;  4F16 A;  2B86 A;  2SEM A;  2KYB A;  2LX7 A;  2A36 A;  2X3X D;  2AKL A;  4J9I A;  4AFS C;  1G2B A;  4AFU C;  4ZNX A;  2D1X A;  2DBM A;  2K2M A;  1GFD A;  1UEC A;  4F17 A;  1K1Z A;  1GRI A;  4M4Z A;  4OML A;  1TUC A;  4JJD A;  4A63 B;  1ZUY A;  4WCI A;  4AG2 C;  4IIM A;  2DIL A;  2RQT A;  2EYZ A;  2XMF A;  2ED0 A;  3IQL A;  4E6R A;  5HCK A;  2FEI A;  2DRK A;  2LZ6 B;  4HXJ A;  3U23 A;  1TUD A;  2JM8 A;  2ROL A;  4J9D A;  2YUN A;  4OMP A;  2GNC A;  3ULR B;  5L23 A;  2AZS A;  1RLP C;  2G6F X;  1KJW A;  3NHN A;  2CT4 A;  1IO6 A;  2JS0 A;  1H8K A;  2KYM A;  3I5S A;  1W6X A;  2K9G A;  5I11 A;  1WI7 A;  3UA7 A;  1J3T A;  2A08 A;  5FWB A;  1YWO A;  1QKX A;  4GLM A;  4HCK A;  2ED1 A;  1T0H A;  3C0C A;  4RTV A;  1A0N B;  2DL3 A;  2L3Q A;  1WXU A;  2ABL A;  1UTI A;  2DL5 A;  4Z89 A;  3M0R A;  2EVR A;  1ARK A;  2EBP A;  1GCQ A;  3O5Z A;  1Y57 A;  1WXT A;  3VS7 A;  2DE0 X;  3I35 A;  4QT7 A;  5FWC A;  2DA9 A;  2FRY A;  1SRM A;  2DL7 A;  1KFZ A;  4LNP A;  2OI3 A;  2DL4 A;  1ZUU A;  2LJ3 A;  1W70 A;  2DYB A;  3UF4 A;  2K3B A;  2GTJ A;  1G83 A;  4OMM A;  1NYG A;  4IIO A;  3R6N A;  4LUE A;  2C0T A;  2EYX A;  3QWY A;  1PRM C;  4RTW A;  1K0X A;  4HVW A;  5IHN A;  4CC2 A;  2M0Y A;  2DVJ A;  3VS0 A;  2F2X A;  3QWX X;  1OV3 A;  2LNH B;  1X27 A;  1YCS B;  3THK A;  2KRM A;  2NWM A;  2L3S A;  1M3C A;  1UHF A;  2JM9 A;  2RQW A;  5ECA A;  2PNI A;  2KBT A;  4LUD A;  2EGE A;  4JPB W;  1U06 A;  1VYV A;  3I9Q A;  2HDA A;  2EPD A;  3REB B;  2YUP A;  1KIK A;  2YUQ A;  3EG2 A;  4JJB A;  4AFZ C;  1ZSG A;  1NYF A;  3M0S A;  5IHI A;  3VS5 A;  4X1V A;  3EG1 A;  2W10 A;  1YWP A;  1QCF A;  2KRN A;  2V1Q A;  1VYU A;  4J9C A;  1OOT A;  2W0Z A;  3SHW A;  3REA B;  1NEB A;  1RI9 A;  2CSI A;  1SHG A;  1RUW A;  2YDL A;  3NGP A;  2ROT A;  1S1N A;  1SEM A;  1PKS A;  2RPN A;  3JV3 A;  2D8J A;  2KT8 A;  2J6K A;  2CT3 A;  1I0C A;  3UA6 A;  2YSQ A;  1ZLM A;  2PZ1 A;  4RTX A;  2O88 A;  1PWT A;  1U3O A;  4F14 A;  2EQI A;  2J6O A;  2ENM A;  1HD3 A;  1JO8 A;  1QLY A;  5FW9 A;  2VWF A;  1VYT A;  1CSK A;  3EHR A;  2CRE A;  1FYN A;  4HVU A;  2J05 A;  1I07 A;  5IHK A;  3EHQ A;  2DMO A;  2LP5 A;  2QDL A;  2O9V A;  1UJ0 A;  4HVV A;  2FPD A;  1GCQ C;  4OMQ A;  2K7A A;  3H0F A;  2HSP A;  2KXD A;  4OMO A;  1RLQ C;  1UG1 A;  4EIK A;  2J06 A;  2RQU A;  3M0Q A;  2C0I A;  1W1F A;  2E5K A;  3M0U A;  1WXB A;  2RF0 A;  1QWF A;  2BZY A;  2J6F A;  1NG2 A;  2KRO A;  1AEY A;  1UHC A;  3RNJ A;  1YP5 A;  2AK5 A;  3EGU A;  1JEG A;  2CUD A;  3VRZ A;  1OPK A;  2LJ0 A;  1MV0 B;  1M27 C;  1ABO A;  2VKN A;  2BZ8 A;  1JXM A;  2A28 A;  4RTU A;  1CKB A;  4J9G A;  1N5Z A;  2KRS A;  2HCK A;  1AZG B;  2GTO A;  2V1R A;  2H8H A;  1UDL A;  2D0N A;  5IH2 A;  1X2Q A;  1M30 A;  1WLP B;  2VVK A;  2JMC A;  2BZX A;  2P4R A;  2O2O A;  4RTT A;  1SRL A;  1GL5 A;  2CH4 A;  2KR3 A;  2EW3 A;  1E6G A;  2CDT A;  3NMZ C;  1NM7 A;  1UE9 A;  2DJQ A;  1E7O A;  4FSS A;  4Z88 A;  1OEB A;  1K0S A;  2OJ2 A;  1XOV A;  1H3H A;  2X3W D;  4J9H A;  3VS1 A;  1JQQ A;  3ZL7 C;  2LJ1 A;  2KXC A;  2AKK A;  1ZX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...