2RMOA

Solution structure of alpha-spectrin_sh3-bergerac from chicken
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKATANGKTYERQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Study of the structure and dynamics of a chimeric variant of the SH3 domain (SHA-Bergerac) by NMR spectroscopy
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rmoA00
2DX1A 2FO0A 4J9DA 5FW9A 4OMOA 2PNIA 1GCPA 2JM9A 2F2WA 2JM8A 4J9GA 2KR3A 2K6DA 2DBMA 2K2MA 1CKBA 3VRZA 3UA6A 2DL3A 2BZ8A 2ESWA 1WX6A 2O31A 4D8KA 2KNBB 4J9IA 4CC4B 2DNUA 2EYZA 2CUBA 4JJCA 1NM7A 1AVZC 3H0HA 2F2XA 2ED0A 1EFNA 1OPLA 2FPDA 2O88A 2GBQA 1H8KA 2M51A 2QDLA 5FWCA 1T0HA 2HSPA 2C0IA 4GBQA 5I11A 1MV0B 1T0JA 1Z9QA 2O9VA 1M3AA 1W70A 2YT6A 2D8JA 1GL5A 4J9FA 1QKWA 1GCQA 4CC2A 2DLPA 2KRSA 1ABOA 2L0AA 3THKA 1UHCA 1NLOC 2MCNA 2J7IA 1K1ZA 2VKNA 1M27C 1JO8A 2EBPA 2PZ1A 2DVJA 1PKTA 4HVUA 4JZ3A 4R0KA 1WXBA 2BTTA 2CH4W 1ZUUA 5FWBA 4HVWA 4WCIA 1CSKA 3VS3A 3QWYA 1M3CA 1RI9A 2DRKA 1GCQC 4OMNA 4M4ZA 4AG1C 1YNZA 1E6HA 1M30A 1ZUKA 1X43A 4AFUC 2HEQA 2C0TA 1W6XA 1U3OA 1X6BA 1T3LA 3ULRB 1YWOA 4AFZC 2CT3A 1PHTA 3EG3A 4HCKA 1WXUA 2HCKA 3VRYA 2LP5A 1KIKA 4RTTA 1AD5A 2DILA 5EC7A 2A08A 1HJDA 4LUDA 2YSQA 2KBTA 2CT4A 3NMZC 1TUCA 2W0ZA 1UTIA 1PWTA 1G2BA 1JXMA 2GTOA 4D8DA 1IO6A 1VYVA 1QKXA 1GFCA 2ED1A 2GQIA 4A63B 3EHQA 1WLPB 2A28A 2K7AA 2EYWA 3QWXX 2DYBA 2LJ1A 2W10A 2L3SA 1I07A 4RTWA 3U23A 3I5SA 2EQIA 2AKLA 2GTJA 3LH5A 2D8HA 1E7OA 2CREA 1UDLA 1UUEA 1X69A 1BK2A 1ZSGA 1G83A 2DM1A 2DJQA 2DL7A 3JV3A 2KYBA 4E6RA 3TSWA 1Y0MA 1UFFA 2LQWA 2RN8A 3SHWA 2EVRA 1SRMA 1K0SA 1N5ZA 2D0NA 2KRMA 3NPFA 2KGTA 1KFZA 3SEMA 1ZBJA 3REAB 1W1FA 2OI3A 2DMOA 3EG0A 3H0IA 2HDAA 4JJDA 4K11A 3M0QA 4J9HA 4Y92A 3R6NA 2KXCA 2D1XA 2LX7A 1QLYA 1V1CA 2ECZA 2KXDA 4RUGA 4RTYA 1ARKA 1Z9ZA 2I0NA 5ECAA 1X2QA 2JTEA 3VS1A 4RTVA 2P4RA 5GJWB 3NGPA 3VS5A 2GGRA 1WDXA 2A37A 4X1VA 4EIKA 1U5SA 2KROA 4ORZA 1E6GA 1GFDA 4F14A 1PKSA 4OMPA 2O2OA 3H41A 2J6FA 2KYMA 3TVTA 1NYFA 1JU5C 2JW4A 4J9BA 3UA7A 4JPBW 1H3HA 2JT4A 1WXTA 1NEGA 2RQTA 2J6KA 2LJ0A 1K4US 2AKKA 1UECA 1HSQA 3FJ5A 4CC7A 5I22A 4JJBA 1NEBA 3O5ZA 1SPKA 2FEIA 4ZNXA 1YWPA 2LQNA 2NUZA 3ZL7C 4RTZA 2OAWA 2RNAA 1NYGA 3RNJA 2F2VA 1Y57A 1M8MA 1UJ0A 2MIOA 1PNJA 2EGAA 3EG2A 1BBZA 2J06A 1YP5A 4J9EA 3VS2A 4AFSC 4RTXA 1QCFA 2J05A 1PRMC 2YUOA 3I9QA 4F17A 5IH2A 3M0SA 1AOJA 2M0YA 2KEAA 2KE9A 4KRTA 2K3BA 2FG0A 1I1JA 1X2KA 4Z88A 1UJYA 3EGUA 4JZ4A 1BU1A 1AWOA 1FYNA 1AWWA 2JS0A 2ABLA 2DL4A 1AEYA 1MUZA 1WA7A 5HCKA 2YDLA 2EPDA 3VS0A 2JXBA 3I5RA 1ZX6A 4ESRA 1WYXA 3EHRA 3GBQA 3M0RA 4LUEA 4RTUA 5IHNA 2RPNA 4QT7A 1B3QA 4Z89A 4HXJA 1WIEA 1HD3A 5IXFA 1K76A 1AWJA 1JQQA 1M3BA 1OV3A 2H8HA 3PVLA 2YUQA 2JMAA 2A36A 2LJ3A 4LE9A 2BZYA 2G6FX 3A98A 1ZUYA 1GRIA 1WI7A 2RQWA 2AZSA 2AZVA 4OMMA 2V1QA 2XMFA 2B86A 1SHGA 1BB9A 1SHFA 4FSSA 1B07A 1YCSB 2EYYA 1MV3A 3I35A 2FRYA 2IIMA 3REBB 1VYUA 1SRLA 2O9SA 5IHKA 2ROTA 2E5KA 3VS6A 4LN2A 1CKAA 1KJWA 2DRMA 4LNPA 1GBRA 2RQUA 2MOXA 2CSIA 2YUNA 2DL8A 2DF6A 1X27A 2VWFA 2DE0X 1AZEA 2OJ2A 2EW3A 1UGVA 1XOVA 1AWXA 1GBQA 3PVQA 2CSQA 2DA9A 2ROLA 2KT1A 2L3QA 1TG0A 3M0TA 2RQRA 1KSWA 3NHNA 3VS7A 2J6OA 1AZGB 4GLMA 1ABQA 3PE0A 4HVVA 3H0FA 1JEGA 1PRLC 1U06A 4IIMA 2LMJA 5IXBA 1T3SA 2CDTA 1OPKA 1VYTA 2EGCA 1NG2A 1QWFA 1I0CA 1RUWA 2VVKA 3EG1A 3M0PA 2KRNA 5IHIA 2DL5A 1QWEA 2X3WD 1UE9A 1TUDA 2FPFA 2DBKA 3KFVA 1K0XA 3IQLA 2NWMA 2LNHB 3M0UA 2JS2A 4AG2C 2L2PA 2PTKA 3TSZA 2LZ6B 3C0CA 2EYXA 1A0NB 1YN8A 2V1RA 2CH4A 1X6GA 2L3PA 1OOTA 2AK5A 1K9AA 1SSHA 2RF0A 2EGEA 3CQTA 2BZXA 2JMCA 1WFWA 2SRCA 3RBBB 1VA7A 4CC3A 5GJVB 2SEMA 3UATA 1RLPC 2YUPA 2LCSA 4F16A 4OMQA 4DEYA 1SEMA 2FPEA 2ENMA 2C0OA 2EKHA 4J9CA 4OMLA 2K9GA 2K79A 4Z8AA 2HBWA 1FMKA 1RLQC 1LCKA 1UG1A 3UF4A 4DEXA 3VS4A 2RMOA 1JXOA 1H92A 1OEBA 1S1NA 1ZLMA 4IIOA 5L23A 2KT8A 2RQVA 1NLPC 2CUDA 2GNCA 4AFQC 1J3TA 1UHFA 2X3XD 2FRWA
chains in the Genus database with same CATH superfamily
2FO0A 1FXXA 4F7UB 4KH1B 4OMOA 2PNIA 2JM8A 2KR3A 4PK4A 5GAOp 1D1AA 3UA6A 4BDZA 1WX6A 1WHJA 4GY5A 4J9IA 4CI0C 2HD0A 3S3OA 4OMFB 5FLXE 2X9HA 4JLGA 2NLUA 1VQNT 2O88A 2FPDA 1OPLA 1VQOT 3H6ZA 2GBQA 1Q82R 4KULA 4M7AE 2HSPA 2C0IA 2PQWA 1VQ6Q 3SWNC 4XQ3A 1Z9QA 4UC4A 1M3AA 3ME9A 2KI7A 3RMSA 2OAUA 2EYQA 1QKWA 5LJ3f 4CC2A 2IG0A 2EIFA 4IUPA 5LJ5d 4M7DF 1AHJB 1NLOC 1K1ZA 1JO8A 2EBPA 3JRZA 1G5VA 3PNWC 3GOXA 3CC7Q 2DYIA 2DD5A 5GANd 4F7UF 3VUZA 4HCCA 1S72T 1ZUUA 4O6JA 4PFPA 2E6NA 4WCIA 3E2UA 1ZSZB 2JTFA 2DIQA 4ELYC 2V8JA 1SKUB 4M4ZA 3RDVA 4AG1C 3SDZA 2KY9A 2V8IA 2OTJA 1PD1A 3HRUA 3G6EQ 2M1HA 4AFZC 1M90C 1PHTA 1TWBA 3VRYA 1AD5A 1VOMA 5EC7A 1HJDA 4LUDA 2BUDA 1OZ3A 3ZFJA 5LJ5h 2PUOB 1TUCA 1D09B 3HPWA 3V8JA 1G2BA 5GAMe 4E7KA 2QTVA 1KD1R 2WSFE 5GANh 1TS9A 3EGDA 2ED1A 3CCEA 2Y90A 4A63B 2DD4A 3MJXA 2P0KA 3QWXX 2DYBA 1C6VX 3U23A 2L3SA 2EQIA 3LH5A 2P84A 5GAMg 1VQLA 2NUTA 3CC2Q 1G8XA 1VQMA 2DXUA 1BK2A 5IT9E 1YIJQ 2KYBA 3JCMf 1VQ8T 2EVRA 1N5ZA 4KH0B 1YHQT 2RJDA 3JCMP 1ZBJA 1YJ9T 3REAB 1PSEA 3M9QA 2DXCA 5CKDA 4M78E 1VQPT 1YITA 4FL6A 2GFUA 4J9HA 1KQSP 2DXTA 2E5QA 3FB9A 1IHWA 2D1XA 4D6WA 3CMEA 1QLYA 1V1CA 4RUGA 3M56A 1JB0E 3PIPA 3VS1A 4ZN1A 4DBQA 2QA4A 2GGRA 4X1VA 5KYNA 3S3MA 4OB0B 5HK0A 4HA8A 4F14A 3TEEA 4OMPA 3H41A 1VQKT 4NL2A 4CRIA 1YJNA 1NYFA 1JU5C 3L2VA 5LJ3e 4M7AG 1NEGA 2QGFB 2J6KA 2WSEE 2M16A 3WXMB 1IRXA 2QQAA 3JB9D 1LJOA 3URGA 1BYMA 3VUBA 2RK2A 2FEIA 1LNXA 1QVGP 2E1HA 4JS4A 2MF2A 3A5ZB 3ZL7C 2E65A 3RNJA 2BKDN 2F2VA 2LQKA 3GIBA 1PNJA 3CCST 1YP5A 2J06A 4J9EA 2OTJQ 4HKEA 2BE9B 4OP0A 2XU8A 1PRMC 2P4TA 2QEXT 2YUOA 3I9QA 3CCLA 4LXCA 1AOJA 1BI2A 2K3BA 5DM7R 3QSUA 2DPPB 2HKQB 4Z88A 1FYNA 4M7DE 2HAXA 5C6SA 5KH6A 2DL4A 1AEYA 1WJQA 4FU6A 1I81A 5CKEA 1WA7A 3CCEQ 4QQDA 2FVUA 3JB9F 3VS0A 2RHIA 4F7UE 3I5RA 5GMKh 1ZX6A 3OYIA 1O75A 3GBQA 1N8RU 2RPNA 4QT7A 1B3QA 1NJIC 1WIEA 1HD3A 1VQLQ 1K76A 2RO0A 4Q5WA 1VQMQ 4M7DC 1NJIR 4LD6A 1M2OA 3TQ7P 3EH2A 3DLMA 2AZVA 1PD0A 2XMFA 4EMKB 2RI2A 1BI0A 1BB9A 1BCMA 1YITQ 1TXQA 3QHSA 4ZN3A 2EYYA 5J26A 3REBB 2O9SA 3CMEQ 5IHKA 1K73R 3CCJT 4LDUA 5IN1A 4LNPA 1GBRA 2RQUA 2DAQA 2QA4Q 4M78G 4PJMA 2R57A 3INZA 3A1PA 2DF6A 1X27A 1ZSZA 3OSVA 2GFAA 2OJ2A 4Y91A 2EW3A 2QG9B 5GAOm 1GBQA 3V8KA 3RESA 1YJNQ 5LL6S 1K8AU 4M7AB 1VQ6T 2CSQA 3OYKA 3M0TA 4BB7A 1VQ5A 4M7AD 2R5AA 5KYXB 1TUGB 3PE0A 4HVVA 2LMJA 4KUIA 4RCBA 1RUWA 2A0FB 3OW2P 2LRQA 3GLXA 3ZEHA 3A8MB 4IUVA 4X9CA 2X3WD 1UE9A 2XG8D 2FPFA 4OGEA 4QQ6A 1K0XA 4XK8E 1ZSZC 2L5QA 2RHYA 3TSZA 4J7IA 4M77A 3C0CA 3N5BB 2EYXA 2NUPB 5EG2A 2HNIA 1X6GA 2L3PA 3CCLQ 2EWNA 2QQBA 1OX9A 2RF0A 8AT1B 3OYNA 1WJRA 2XICA 1Y07A 2JMCA 2YXYA 3HHTB 2SRCA 4IUUA 1OYXA 2SEMA 2ZZDA 3G71T 3GNFB 1MNDA 1I5LA 3LW5E 2YUPA 1R0CB 1SEMA 4J9CA 2RK1A 2MI6A 4RG2A 2LT1A 2HBWA 1M8VA 1LCKA 3UF4A 4DEXA 3GF5A 2DETA 1N9SA 2GNCA 4M7DG 4AFQC 4XU0A 1UHFA 2QK0A 2FRWA 1SF9A 4EMHA 2DX1A 2EJFA 4F7UG 2QQSA 1Q82U 2JM9A 4KGVB 4DOWA 4P5NA 2K6DA 1CKBA 3VRZA 1UGPB 2BZ8A 4D8KA 2KNBB 2DNUA 2D0QB 2CUBA 1BCOA 2QQRA 4JJCA 3H0HA 3PMTA 4JLIA 4L59A 3I55T 1KHCA 2DVEA 1W2BP 1Q81R 3CCVT 4M78B 2M51A 2DO3A 1FMWA 2JTMA 4M78D 4PFOA 4LDVA 1PSFA 1T0JA 5GAMj 1M2VB 2D8JA 4E7SA 4A54A 3CD6A 2OTLT 3EGXB 1VQ7A 2KRSA 4C5EA 1VQ5Q 2EKOA 1ABOA 4RMOA 2E3HA 2MCNA 2J7IA 1ACMB 3MP6A 2QAZA 4XTYA 3C94A 3OYHA 4LD9K 1Y96B 4C92F 1G3WA 2JJ9A 3CCQA 1D1BA 4HVUA 1NE8A 2M02A 5GAN5 2BTTA 2CH4W 5C0MA 1TOVA 3X25B 4ELZC 4L6V5 3GPLA 2DTOA 1CSKA 2K4YA 4RCCA 5CKBA 3RKXA 3FRNA 2HBPA 1YNZA 2LTOA 1RAFB 2LQ8A 1W6XA 1QW1A 1KD1U 1T3LA 5LJ5e 3ULRB 5GAMf 3OYEA 3EG3A 3FEOA 1WXUA 2LP5A 1KIKA 4RTTA 2DILA 2VV5A 2VASA 5GANe 2Y4XA 4EMKA 2K5FA 4J6WA 5LJ5g 1V76A 4QVZA 3JCMV 1WPYA 1AT1B 5LJ3j 1VYVA 1HK9A 3EH1A 3JCMc 1D3BB 1YJWT 2K7AA 2HKNA 1MMDA 1XQHA 4M7DB 3RERA 1F1BB 4PNOA 4M7DD 3QXEB 1E7OA 2CREA 1UDLA 3HTRA 2MK5A 3TSWA 3L42A 2RN8A 3X20B 5CQYA 2GQVA 1VQMT 1SRMA 4M7AA 2KRMA 4EMKC 3MKDA 2RA2A 1TSFA 1Q82C 2OI3A 2DMOA 4JJDA 1V29B 4PJOB 2HQXA 3R6NA 1FMVA 3OA6A 3E9FA 1JRIA 4PJOD 4FW1A 1H641 3KXTA 2LX7A 3HRSA 1YITT 2ECZA 4E47A 4FT4A 2L8DA 5D7UA 1YFNA 2RM4A 5ECAA 5J39A 1X2QA 5AT1B 1NZ9A 2EQUA 4DBHA 2JTEA 3PIOA 3CMET 1WQWA 2P4RA 3O8VA 1VIFA 1IB8A 3NGPA 2CP3A 1G3TA 1E6GA 3CD6Q 2NUPA 2O2OA 1VQ7Q 4M7AC 2LC4A 2I2LA 1X75C 3CCRA 4MDXA 3OYFA 2DKGA 4J9BA 4PKCC 4JPBW 1H3HA 2RQTA 2LJ0A 1RADB 5IAYA 3JB9G 1HSQA 4IKFA 3FJ5A 3M58A 4CC7A 3CCQQ 2X51A 5GAOq 1EZZB 4JRPA 3SFMA 4ZNXA 3SD4A 3EFRA 2NUZA 3MPUB 4PJOF 4BACA 1YI2T 1IXDA 1SSFA 2QTXA 5AYFA 3OYCA 1M1GA 2ZCFB 1M8MA 2X4WA 1W4SA 1Q7YR 3OQ5A 1OQKA 1BBZA 1QVPA 3VS2A 2EJ9A 4N0AA 3LH0A 3CPWS 5IH2A 1KD1C 2IPOB 3C4SA 2YLCA 3CPFA 2FG0A 3HKSA 5GMKm 3CMAT 5GAOr 4JZ4A 5GMKe 1NJIU 3JCMX 2ABLA 1MUZA 4E7JA 5DY9A 1KQSA 2EPDA 4FYWB 2FL7A 4BE1A 4ESRA 3I56A 1M1FA 4M78A 1VQ4T 1AWJA 2XDPA 1M3BA 2KDSA 3PVLA 3CCMA 2YUQA 1M2VA 4N0AC 5D6YA 3META 5KYUB 3FC3A 1ZUYA 1WI7A 2RQWA 4ANJA 1C0MA 3EGXA 1WJSA 1OI1A 1LPLA 1B7TA 5KE3A 4FSSA 2CP2A 1YCSB 1VQ9T 4DA4A 2COYA 3I35A 1FX7A 2FRYA 3QG1A 1VQNA 2E4HA 3V8LA 2M0OA 3OBWA 1VQOA 1SRLA 1SG5A 1Y96A 2JVVA 2XDBA 2ROTA 4BY6B 2E5KA 4M78C 2P0QA 3QJYA 1RAHB 1KJWA 2RI5A 2XKOC 1QP3A 2YUNA 4C0ZA 4FYVB 1U1TA 3NTHA 1AZEA 4Y28E 3A8HB 2JUFA 2YRDA 5KCOA 1XOVA 3OYMA 2RHZA 3CCRQ 3JSCA 2DA9A 3CBMA 2ROLA 4OVAA 4C5GA 2FYKA 2J6OA 4GLMA 3H0FA 4IIMA 2GF7A 2RJEA 2H3JA 5CCAA 1VYTA 2A7YA 1VQ5T 5GAOl 4BUGA 3ASKA 1OU9A 1XTDA 4J6XA 1QCNA 1QWEA 3HFOA 2DBKA 5GAOn 2D6FA 3CC4T 3IQLA 2NWMA 2LNHB 1D3BA 3M0UA 4MZMA 1I8FA 2JS2A 4MMKA 1XJWB 3OS0A 1WNLA 2PTKA 4M75B 3RMQA 2LZ6B 4FT2A 4MDWA 4M7DA 1OU8A 1KC8R 1A0NB 4M75D 5I2MA 2NYSA 1PCXA 5CKFA 2V1RA 3PFSA 4F7UA 3DB3A 1SSHA 2DTHA 2EGEA 3CQTA 2BZXA 3CBPA 2M9UA 3PMIA 3QZ9B 3S6WA 1WFWA 3RBBB 4CC3A 3UATA 4PJNA 3CXCP 3JCMQ 1QVFP 2LCSA 4PJJA 1G3SA 2QQ9A 4DEYA 4C8QF 5GAN8 1MMGA 4PJOA 3CCUT 3NTKA 2ENMA 2C0OA 2EKHA 4OMLA 2LX9A 2XK0A 2ATCB 3VV0A 3I56Q 2KAFA 4E7ZA 2K79A 2QYZA 1RLQC 3LGLA 4A4EA 4DOVA 2RMOA 1JXOA 3OY9A 1H92A 3CCMQ 3OYAA 1RAIB 3VKIA 4PJOE 3WVEB 1VQ8A 2KSSA 2EJGA 3E1SA 5FW9A 1U8RA 1YHQA 2LCCA 4M75F 1UGRB 3OB9A 1GCPA 4C92G 2F2WA 3G1JA 1YJ9A 2DBMA 2K2MA 2FB7A 2XDDA 2DL3A 2ESWA 1VQPA 1K73C 4CC4B 2EYZA 4BD3A 1VQNQ 4PJOC 5KCHA 1MGQA 1C1AA 1TU0B 8ATCB 5LJ5j 1VQOQ 5LJ3d 2MWOA 1NM7A 2F2XA 2RHXA 2ED0A 4C5IA 1K9MR 4HCZA 5DLOA 1PG5B 3CEYA 4VUBA 2QDLA 5GANj 4E2FB 2RHUA 4GBQA 2K3XA 2CYZB 5I11A 1MV0B 3FLGA 5GMKi 3WVDB 3JCMg 1GL5A 2YLBA 3QDRB 1VQKA 1GCQA 1I5OB 2CZ1B 2F69A 4JRIA 4C0DB 1KQSS 1X6OA 4XU3A 4ZGEB 4YTLA 3PGGA 3THKA 3FDRA 3UPUA 3JB9I 3MHXA 2VKNA 1M27C 1RAEB 3HSBA 3LGFA 2A3LA 2DVJA 1ZBXA 1PKTA 2DEQA 3KUFA 2AT1B 3CC7T 4JZ3A 3D7SB 4LDWA 4LDYA 4BDYA 1WXBA 5LJ3h 2X35A 2VB6A 5FWBA 2COZA 4HVWA 3J7AF 5LJ5f 3QWYA 4OF1A 1RI9A 3M55A 2FZCB 1GCQC 1D0XA 2QASA 5GANf 1M30A 3CCSA 1JJ2P 1ZHIA 1X43A 4AFUC 2HEQA 1KK7A 2QEXA 3EG9B 2LT4A 5CAIA 2ZPIB 3BW1A 4HCKA 5KYUA 5HKCA 3UT1A 3LWHA 1IGQA 3G6ET 2A08A 4X34A 1QVGS 1RI0A 2YSQA 3NMZC 1EX4A 2W0ZA 3FJPA 4NOYA 2JN0A 1OULA 1UTIA 4HT8A 1PWTA 1JXMA 4OB1B 3JCMd 2GTOA 2MMPA 1IO6A 2ZPEB 1QKXA 3JAME 1B34B 1UGQB 2EYWA 2LJ1A 4JUVA 4JS5A 1I07A 4RTWA 2AKLA 4RKUE 3MEVA 2D8HA 2RJCA 1O9SA 1UUEA 2R58A 2JNGA 1X69A 4OB2B 1G83A 1VQ8Q 2DM1A 3CC2T 4C92B 2DL7A 4E6RA 1Y0MA 2LQWA 1OX8A 1YIJT 1YHQQ 4C92D 3CXCS 1K0SA 1YJ9Q 4DBRA 3NPFA 2KGTA 4B9WA 5A0LA 1BIBA 4KT0E 1HYOA 1VQPQ 1Q81C 4J6YA 1W1FA 1N8RR 3H0IA 4FYXB 4K11A 3QKJA 4PJOG 4Y92A 4XTVA 3CPWA 2KXCA 4BY6C 1Y71A 3H9NA 3CCJA 2KXDA 4RTYA 3JCMh 3HL8A 1Z9ZA 1WQ7A 2I0NA 1GXIE 4B6MA 1PM3A 4C8QE 5DLQE 4NL3A 3OMGA 5GMKj 1M4ZA 4RTVA 5GJWB 3VS5A 5KYYB 1WDXA 3VYHB 4EIKA 2KROA 2PU9B 4ORZA 1VQKQ 4M75A 3MCAB 2EAYA 2WSCE 2J6FA 2KYMA 3PT9A 3TVTA 2JW4A 3EAEA 3UA7A 3A8LB 4PLIA 1K4US 2AKKA 2H3EB 1N6AA 4M75E 3RKWA 4JJBA 1NEBA 1WHKA 2K2VA 3O5ZA 1Q7YU 1SPKA 2LQNA 3P8BB 2KQWA 1Q86R 4RTZA 2OAWA 2RI3A 5HY6A 2RNAA 1NYGA 3DB4A 4M75C 3G4SA 1Y57A 2OX7A 2JOYA 3CCSQ 1UJ0A 2MIOA 4HCBA 4V2SA 1XNIA 1ZA1B 4A4KA 2QEXQ 4PJLA 3RIRA 4AFSC 4RTXA 1QCFA 4F17A 3OW2S 2OTJT 3QPHA 2M0YA 2KEAA 2KE9A 3G71A 4QVDA 1M1KR 1I1JA 3A8OB 1X2KA 3OSSC 3EGUA 1AWOA 4FSXA 1M5Q1 3VJPA 5HCKA 2YDLA 1IZ6A 2QXFA 3P8DA 2JXBA 2HQEA 3JCMJ 2K5IA 3CCET 1WYXA 2XI9A 1FWZA 1YBYA 3M0RA 4LUEA 4RTUA 3DKMA 3L2ZA 2E70A 4Z89A 3BY7A 5GMKl 1QMCA 3QDFA 2VGNA 3JCMb 5IXFA 1JQQA 4C0GA 1VQLT 2K3YA 4N4GA 3MEAA 2HSEB 3A98A 1MNEA 4EDUA 2V26A 3TCJA 5KYXA 5I21A 2LDMA 2B86A 1SHFA 3Q1JA 4HT9A 1B07A 4O5VA 5A0DA 2DXBA 4NS5A 3M54A 3I55A 4PLLA 3R6OA 4ZTFA 1IHVA 3CCVA 3CCJQ 3RUXA 3E9GA 1KHIA 3A8GB 1CKAA 1KQ1A 2DRMA 3AHUA 1LOJA 2E3IA 2MOXA 2VUBA 5CIUA 2DL8A 3NFCA 4BI4A 2LNVA 2YHTA 2VWFA 3OYLA 2QA4T 3L2QA 1U1SA 2DE0X 4L5GA 4J7FA 1RAGB 2OTLA 2FHDA 5GAN3 4PL6A 4JDSA 4C0DC 2L3QA 4XAXB 1TG0A 1YJNT 3EG9A 2XIDA 1MHNA 4C8QG 1ZA2B 1W2BS 1ABQA 3J81E 1JEGA 1PRLC 1U06A 5IXBA 1T3SA 3L2RA 1OPKA 1JBMA 2EGCA 1QWFA 3H8ZA 1I0CA 4PFZA 1BI1A 1KC8U 3EG1A 4E7LA 4N4HA 4KGXB 3M57A 2AIRB 1TUDA 2LVMA 4XTWA 2ZPGB 2EQKA 2WACA 5GAN4 1Q7YC 2PVDB 4AMCA 3TREA 4KBMB 4XU1A 1B34A 3G4SQ 4AG2C 2EFIA 2L2PA 3GNGA 4M75G 3QO3A 3V7SA 1KQ2A 3JCMW 2DIGA 2ZPHB 3EFSA 1OOTA 2AK5A 5FU7B 4C92A 1WHGA 1EIFA 3CCLT 3G71Q 1VA7A 5GAN6 4OB3B 1M9SA 4FCYA 1PC0A 4F04B 4J8OA 3EFOB 2E10A 4F16A 1M90R 2E64A 2FZGB 4EMGA 4OMQA 2DZ9A 2QGGA 3X26B 4C92E 4QKUA 1YJWA 3OYGA 2V8KA 4Z8AA 2VXFA 5FRMA 3VS4A 1ZLMA 1S1NA 4IIOA 3OBYA 4ZGJB 5L23A 2RQVA 1NLPC 4M77B 2CUDA 4C92C 5KYYA 4BE2A 2RJFA 4M77D 1K73U 3KBGA 2X3XD 1K9MU 1R0BG 2E12A 4J9DA 4FW2A 2PVGB 2QI2A 4II1A 4J9GA 2QDYB 3QYHB 2MYSA 2O31A 3OS2A 1KG1A 4IUTA 3I55Q 2K57A 3CCVQ 1AVZC 4QW2A 1EFNA 2CP7A 1H8KA 1QP2A 3HRTA 1QVGA 4FM4B 5FWCA 1T0HA 2F5TX 2E6ZA 2HL3A 1MMAA 1VUBA 4WTOB 2O9VA 1W70A 2DFUA 2YT6A 4DQ2A 2HL5C 2OTLQ 5A2QE 4J9FA 4ME7A 4C8QB 2DLPA 1LVKA 4C8QD 5CVIA 4EPCA 2L0AA 1WZOA 4M77F 2DERA 1UHCA 2EQJA 1WHMA 5KYWB 3CBOA 1S72A 3BDUA 4MZPA 2DTIA 2PZ1A 4N4IA 1N27A 3S3NA 3CXCA 2O4XB 2Y4YA 1DJ7B 4A53A 5CR2A 4ZTJA 4R0KA 1QVFA 3QZ5B 5GAMd 1KC8C 3MEWA 3V7CA 1YI2A 3TU4K 2K5LA 2PUKB 5LJ3g 3VS3A 1M3CA 2VYTA 3HP9A 2DRKA 4OMNA 1E6HA 2X4XA 1Y7XA 3M53A 1ZUKA 2HQHA 3SB2A 2C0TA 1QQJA 1U3OA 1X6BA 3RKYA 3LYIA 1YWOA 2CT3A 3L2UA 1IREB 2HCKA 2YRCA 2DEUA 1R77A 4JRKA 3FIFA 4ZGDB 2BE7D 2CT4A 2KBTA 4B9XA 3CMAA 2CZ6B 2C06A 4C5HA 2RH2A 4D8DA 2MWPA 1YJWQ 2VXEA 6AT1B 1GFCA 3M5AA 2GQIA 3EHQA 1WLPB 2A28A 1Q95G 1VQ4A 5I2SA 5GAMh 2W10A 2XD0A 2BIVA 3I5SA 2CS7A 2GTJA 5FU6B 5A0GA 1BKBA 2KVQG 1ZSGA 2MPXC 1G3YA 1Q81U 2DJQA 3JV3A 4OGCA 3PTAA 1WHHA 2ZAEA 1UFFA 5FRNA 4DBFA 3SHWA 3V7RA 2D0NA 4GLKA 4J83A 1UGSB 5GAN7 1K9MC 1KFZA 3SEMA 2Z0WA 9ATCB 1VQ9A 5D6XA 5CO7A 4KUDK 2L3RA 3EG0A 2HDAA 1ZQ1A 2F5KA 4QQGA 3JCMe 3M0QA 3MEUA 3OW2A 3JB9J 3DLLA 1WGSA 1ARKA 2EQMA 5HK3A 2CP5A 3E19A 4ATOA 3SWNB 4MZTA 2G3RA 2JZ2A 2A37A 1U5SA 1GFDA 1PKSA 1RACB 3CD6T 3NTIA 1RABB 1JJ2A 1NPRA 2VC8A 1VQ7T 1BIAA 2AHJB 2JT4A 4A4HA 1WXTA 1Q86U 1UB4A 2L89A 1S72Q 2LCLA 2MAMA 2CP0A 1UECA 2X4YA 3OYYA 2YRVA 4E7IA 5I22A 3EFOA 3OS1A 3CCQT 1TH7A 2CGHA 1YI2Q 3CC4A 1YWPA 5CQXA 1P92A 3BFMA 2CP6A 1D0YA 1WHLA 4LDXA 5M9OA 2R5MA 1M1KU 5KE2A 2CZ0B 2EGAA 3EG2A 1X01A 3L1AA 3G4ST 4QVCA 5FU7C 2J05A 2KK4A 1QCOA 3M0SA 2IVWA 4KRTA 3VU3C 4XTZA 3CMAQ 2RB6A 2DJZA 1UJYA 4A4FA 4M77E 1BU1A 3ZBDA 3CCUA 2DZCA 1AWWA 2X4JA 2JS0A 4R55A 4M7AF 2VGMA 3AT1B 3X28B 1OZ2A 4JJNK 1W2BA 4FYYB 2ZPFB 3HFNA 4BI3A 3QIIA 1VQ4Q 3P8HA 3EHRA 2HZYA 5IHNA 4HXJA 2H8HA 1OV3A 4C0FA 3GP8A 3BE3A 4M77C 4R56A 2JMAA 2A36A 2LJ3A 4LE9A 3LX7A 2BZYA 5L8RE 2D9TA 2G6FX 4XTUA 1N8RC 1QVFS 2B8AA 1GRIA 3RR6A 4C8QA 2AZSA 4OMMA 2FZKB 2V1QA 1VIEA 1MMNA 1SHGA 3F70A 1VQ9Q 1I4K1 1N9RA 4IUQA 1YCYA 3OYDA 5KYWA 4XTXA 1MV3A 7AT1B 2IIMA 3EGDB 1VYUA 3M59A 3LLRA 4RG8A 3M4YA 3VS6A 4MMLA 4LN2A 2O4XA 3UDCA 3LWIA 2ZGWA 4XU2A 2NUTB 2CSIA 4BE0A 1VQ6A 4AT1B 3T9NA 4TVRA 1UEBA 3QJ6A 4IURA 4J5YA 1UGVA 3UWNA 2P0PA 1AWXA 4C8QC 2HMAA 3C95A 3PVQA 3M4GA 2KT1A 2RQRA 3CCRT 1KSWA 3NHNA 3VS7A 1AZGB 1NBEB 5CK9A 1D1CA 2CDTA 3BDLA 1BI3A 3OYBA 1D0ZA 1K8AC 1NG2A 1Q86C 2VVKA 3CC7A 3CPWP 2PVOB 1K8AR 3M0PA 1IGUA 4JRQA 2KRNA 5IHIA 2DL5A 3CC4Q 2CZ7B 2GCXA 2F1LA 3KFVA 3OS5A 1R8OB 5J3BA 4WF2A 4KGZB 5CKHA 5FROA 1M90U 3MP1A 1YN8A 2YWWA 1M1KC 2CH4A 3X24B 1TTHB 4M78F 1K9AA 2DK3A 1RAAB 3G6EA 3OMCA 4E7HA 1HXDA 3MO8A 3QYGB 5GAN2 3J80E 2RD1A 1H3ZA 5GJVB 3G7ZA 2E41A 3QBYA 1RLPC 4FIBA 4Z02A 5D6WA 3CCUQ 3QUIA 4A4GA 2FPEA 4X9DA 3JB9H 1JJ2S 2K9GA 2O01E 3MP8A 2KMTA 2ZPBB 1FMKA 2COWA 1UG1A 3I56T 3ER0A 2CKKA 5FU6C 5GANg 1OEBA 2KT8A 2XHCA 3CC2A 4M77G 1RL2A 1NPPA 3OYJA 4BI8B 3SWNA 3CCMT 3VYGA 1J3TA 1YIJA 3C12A 3L2WA
chains in the Genus database with same CATH topology
2DX1A 2FO0A 4J9DA 5FW9A 4OMOA 2PNIA 1GCPA 2JM9A 2F2WA 2JM8A 4J9GA 2KR3A 2K6DA 2DBMA 2K2MA 1CKBA 3VRZA 3UA6A 2DL3A 2BZ8A 2ESWA 1WX6A 2O31A 4D8KA 2KNBB 4J9IA 4CC4B 2DNUA 2EYZA 2CUBA 4JJCA 1NM7A 1AVZC 3H0HA 2F2XA 2ED0A 1EFNA 1OPLA 2FPDA 2O88A 2GBQA 1H8KA 2M51A 2QDLA 5FWCA 1T0HA 2HSPA 2C0IA 4GBQA 5I11A 1MV0B 1T0JA 1Z9QA 2O9VA 1M3AA 1W70A 2YT6A 2D8JA 1GL5A 4J9FA 1QKWA 1GCQA 4CC2A 2DLPA 2KRSA 1ABOA 2L0AA 3THKA 1UHCA 1NLOC 2MCNA 2J7IA 1K1ZA 2VKNA 1M27C 1JO8A 2EBPA 2PZ1A 2DVJA 1PKTA 4HVUA 4JZ3A 4R0KA 1WXBA 2BTTA 2CH4W 1ZUUA 5FWBA 4HVWA 4WCIA 1CSKA 3VS3A 3QWYA 1M3CA 1RI9A 2DRKA 1GCQC 4OMNA 4M4ZA 4AG1C 1YNZA 1E6HA 1M30A 1ZUKA 1X43A 4AFUC 2HEQA 2C0TA 1W6XA 1U3OA 1X6BA 1T3LA 3ULRB 1YWOA 4AFZC 2CT3A 1PHTA 3EG3A 4HCKA 1WXUA 2HCKA 3VRYA 2LP5A 1KIKA 4RTTA 1AD5A 2DILA 5EC7A 2A08A 1HJDA 4LUDA 2YSQA 2KBTA 2CT4A 3NMZC 1TUCA 2W0ZA 1UTIA 1PWTA 1G2BA 1JXMA 2GTOA 4D8DA 1IO6A 1VYVA 1QKXA 1GFCA 2ED1A 2GQIA 4A63B 3EHQA 1WLPB 2A28A 2K7AA 2EYWA 3QWXX 2DYBA 2LJ1A 2W10A 2L3SA 1I07A 4RTWA 3U23A 3I5SA 2EQIA 2AKLA 2GTJA 3LH5A 2D8HA 1E7OA 2CREA 1UDLA 1UUEA 1X69A 1BK2A 1ZSGA 1G83A 2DM1A 2DJQA 2DL7A 3JV3A 2KYBA 4E6RA 3TSWA 1Y0MA 1UFFA 2LQWA 2RN8A 3SHWA 2EVRA 1SRMA 1K0SA 1N5ZA 2D0NA 2KRMA 3NPFA 2KGTA 1KFZA 3SEMA 1ZBJA 3REAB 1W1FA 2OI3A 2DMOA 3EG0A 3H0IA 2HDAA 4JJDA 4K11A 3M0QA 4J9HA 4Y92A 3R6NA 2KXCA 2D1XA 2LX7A 1QLYA 1V1CA 2ECZA 2KXDA 4RUGA 4RTYA 1ARKA 1Z9ZA 2I0NA 5ECAA 1X2QA 2JTEA 3VS1A 4RTVA 2P4RA 5GJWB 3NGPA 3VS5A 2GGRA 1WDXA 2A37A 4X1VA 4EIKA 1U5SA 2KROA 4ORZA 1E6GA 1GFDA 4F14A 1PKSA 4OMPA 2O2OA 3H41A 2J6FA 2KYMA 3TVTA 1NYFA 1JU5C 2JW4A 4J9BA 3UA7A 4JPBW 1H3HA 2JT4A 1WXTA 1NEGA 2RQTA 2J6KA 2LJ0A 1K4US 2AKKA 1UECA 1HSQA 3FJ5A 4CC7A 5I22A 4JJBA 1NEBA 3O5ZA 1SPKA 2FEIA 4ZNXA 1YWPA 2LQNA 2NUZA 3ZL7C 4RTZA 2OAWA 2RNAA 1NYGA 3RNJA 2F2VA 1Y57A 1M8MA 1UJ0A 2MIOA 1PNJA 2EGAA 3EG2A 1BBZA 2J06A 1YP5A 4J9EA 3VS2A 4AFSC 4RTXA 1QCFA 2J05A 1PRMC 2YUOA 3I9QA 4F17A 5IH2A 3M0SA 1AOJA 2M0YA 2KEAA 2KE9A 4KRTA 2K3BA 2FG0A 1I1JA 1X2KA 4Z88A 1UJYA 3EGUA 4JZ4A 1BU1A 1AWOA 1FYNA 1AWWA 2JS0A 2ABLA 2DL4A 1AEYA 1MUZA 1WA7A 5HCKA 2YDLA 2EPDA 3VS0A 2JXBA 3I5RA 1ZX6A 4ESRA 1WYXA 3EHRA 3GBQA 3M0RA 4LUEA 4RTUA 5IHNA 2RPNA 4QT7A 1B3QA 4Z89A 4HXJA 1WIEA 1HD3A 5IXFA 1K76A 1AWJA 1JQQA 1M3BA 1OV3A 2H8HA 3PVLA 2YUQA 2JMAA 2A36A 2LJ3A 4LE9A 2BZYA 2G6FX 3A98A 1ZUYA 1GRIA 1WI7A 2RQWA 2AZSA 2AZVA 4OMMA 2V1QA 2XMFA 2B86A 1SHGA 1BB9A 1SHFA 4FSSA 1B07A 1YCSB 2EYYA 1MV3A 3I35A 2FRYA 2IIMA 3REBB 1VYUA 1SRLA 2O9SA 5IHKA 2ROTA 2E5KA 3VS6A 4LN2A 1CKAA 1KJWA 2DRMA 4LNPA 1GBRA 2RQUA 2MOXA 2CSIA 2YUNA 2DL8A 2DF6A 1X27A 2VWFA 2DE0X 1AZEA 2OJ2A 2EW3A 1UGVA 1XOVA 1AWXA 1GBQA 3PVQA 2CSQA 2DA9A 2ROLA 2KT1A 2L3QA 1TG0A 3M0TA 2RQRA 1KSWA 3NHNA 3VS7A 2J6OA 1AZGB 4GLMA 1ABQA 3PE0A 4HVVA 3H0FA 1JEGA 1PRLC 1U06A 4IIMA 2LMJA 5IXBA 1T3SA 2CDTA 1OPKA 1VYTA 2EGCA 1NG2A 1QWFA 1I0CA 1RUWA 2VVKA 3EG1A 3M0PA 2KRNA 5IHIA 2DL5A 1QWEA 2X3WD 1UE9A 1TUDA 2FPFA 2DBKA 3KFVA 1K0XA 3IQLA 2NWMA 2LNHB 3M0UA 2JS2A 4AG2C 2L2PA 2PTKA 3TSZA 2LZ6B 3C0CA 2EYXA 1A0NB 1YN8A 2V1RA 2CH4A 1X6GA 2L3PA 1OOTA 2AK5A 1K9AA 1SSHA 2RF0A 2EGEA 3CQTA 2BZXA 2JMCA 1WFWA 2SRCA 3RBBB 1VA7A 4CC3A 5GJVB 2SEMA 3UATA 1RLPC 2YUPA 2LCSA 4F16A 4OMQA 4DEYA 1SEMA 2FPEA 2ENMA 2C0OA 2EKHA 4J9CA 4OMLA 2K9GA 2K79A 4Z8AA 2HBWA 1FMKA 1RLQC 1LCKA 1UG1A 3UF4A 4DEXA 3VS4A 2RMOA 1JXOA 1H92A 1OEBA 1S1NA 1ZLMA 4IIOA 5L23A 2KT8A 2RQVA 1NLPC 2CUDA 2GNCA 4AFQC 1J3TA 1UHFA 2X3XD 2FRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DX1 A;  2FO0 A;  4J9D A;  5FW9 A;  4OMO A;  2PNI A;  1GCP A;  2JM9 A;  2F2W A;  2JM8 A;  4J9G A;  2KR3 A;  2K6D A;  2DBM A;  2K2M A;  1CKB A;  3VRZ A;  3UA6 A;  2DL3 A;  2BZ8 A;  2ESW A;  1WX6 A;  2O31 A;  4D8K A;  2KNB B;  4J9I A;  4CC4 B;  2DNU A;  2EYZ A;  2CUB A;  4JJC A;  1NM7 A;  1AVZ C;  3H0H A;  2F2X A;  2ED0 A;  1EFN A;  1OPL A;  2FPD A;  2O88 A;  2GBQ A;  1H8K A;  2M51 A;  2QDL A;  5FWC A;  1T0H A;  2HSP A;  2C0I A;  4GBQ A;  5I11 A;  1MV0 B;  1T0J A;  1Z9Q A;  2O9V A;  1M3A A;  1W70 A;  2YT6 A;  2D8J A;  1GL5 A;  4J9F A;  1QKW A;  1GCQ A;  4CC2 A;  2DLP A;  2KRS A;  1ABO A;  2L0A A;  3THK A;  1UHC A;  1NLO C;  2MCN A;  2J7I A;  1K1Z A;  2VKN A;  1M27 C;  1JO8 A;  2EBP A;  2PZ1 A;  2DVJ A;  1PKT A;  4HVU A;  4JZ3 A;  4R0K A;  1WXB A;  2BTT A;  2CH4 W;  1ZUU A;  5FWB A;  4HVW A;  4WCI A;  1CSK A;  3VS3 A;  3QWY A;  1M3C A;  1RI9 A;  2DRK A;  1GCQ C;  4OMN A;  4M4Z A;  4AG1 C;  1YNZ A;  1E6H A;  1M30 A;  1ZUK A;  1X43 A;  4AFU C;  2HEQ A;  2C0T A;  1W6X A;  1U3O A;  1X6B A;  1T3L A;  3ULR B;  1YWO A;  4AFZ C;  2CT3 A;  1PHT A;  3EG3 A;  4HCK A;  1WXU A;  2HCK A;  3VRY A;  2LP5 A;  1KIK A;  4RTT A;  1AD5 A;  2DIL A;  5EC7 A;  2A08 A;  1HJD A;  4LUD A;  2YSQ A;  2KBT A;  2CT4 A;  3NMZ C;  1TUC A;  2W0Z A;  1UTI A;  1PWT A;  1G2B A;  1JXM A;  2GTO A;  4D8D A;  1IO6 A;  1VYV A;  1QKX A;  1GFC A;  2ED1 A;  2GQI A;  4A63 B;  3EHQ A;  1WLP B;  2A28 A;  2K7A A;  2EYW A;  3QWX X;  2DYB A;  2LJ1 A;  2W10 A;  2L3S A;  1I07 A;  4RTW A;  3U23 A;  3I5S A;  2EQI A;  2AKL A;  2GTJ A;  3LH5 A;  2D8H A;  1E7O A;  2CRE A;  1UDL A;  1UUE A;  1X69 A;  1BK2 A;  1ZSG A;  1G83 A;  2DM1 A;  2DJQ A;  2DL7 A;  3JV3 A;  2KYB A;  4E6R A;  3TSW A;  1Y0M A;  1UFF A;  2LQW A;  2RN8 A;  3SHW A;  2EVR A;  1SRM A;  1K0S A;  1N5Z A;  2D0N A;  2KRM A;  3NPF A;  2KGT A;  1KFZ A;  3SEM A;  1ZBJ A;  3REA B;  1W1F A;  2OI3 A;  2DMO A;  3EG0 A;  3H0I A;  2HDA A;  4JJD A;  4K11 A;  3M0Q A;  4J9H A;  4Y92 A;  3R6N A;  2KXC A;  2D1X A;  2LX7 A;  1QLY A;  1V1C A;  2ECZ A;  2KXD A;  4RUG A;  4RTY A;  1ARK A;  1Z9Z A;  2I0N A;  5ECA A;  1X2Q A;  2JTE A;  3VS1 A;  4RTV A;  2P4R A;  5GJW B;  3NGP A;  3VS5 A;  2GGR A;  1WDX A;  2A37 A;  4X1V A;  4EIK A;  1U5S A;  2KRO A;  4ORZ A;  1E6G A;  1GFD A;  4F14 A;  1PKS A;  4OMP A;  2O2O A;  3H41 A;  2J6F A;  2KYM A;  3TVT A;  1NYF A;  1JU5 C;  2JW4 A;  4J9B A;  3UA7 A;  4JPB W;  1H3H A;  2JT4 A;  1WXT A;  1NEG A;  2RQT A;  2J6K A;  2LJ0 A;  1K4U S;  2AKK A;  1UEC A;  1HSQ A;  3FJ5 A;  4CC7 A;  5I22 A;  4JJB A;  1NEB A;  3O5Z A;  1SPK A;  2FEI A;  4ZNX A;  1YWP A;  2LQN A;  2NUZ A;  3ZL7 C;  4RTZ A;  2OAW A;  2RNA A;  1NYG A;  3RNJ A;  2F2V A;  1Y57 A;  1M8M A;  1UJ0 A;  2MIO A;  1PNJ A;  2EGA A;  3EG2 A;  1BBZ A;  2J06 A;  1YP5 A;  4J9E A;  3VS2 A;  4AFS C;  4RTX A;  1QCF A;  2J05 A;  1PRM C;  2YUO A;  3I9Q A;  4F17 A;  5IH2 A;  3M0S A;  1AOJ A;  2M0Y A;  2KEA A;  2KE9 A;  4KRT A;  2K3B A;  2FG0 A;  1I1J A;  1X2K A;  4Z88 A;  1UJY A;  3EGU A;  4JZ4 A;  1BU1 A;  1AWO A;  1FYN A;  1AWW A;  2JS0 A;  2ABL A;  2DL4 A;  1AEY A;  1MUZ A;  1WA7 A;  5HCK A;  2YDL A;  2EPD A;  3VS0 A;  2JXB A;  3I5R A;  1ZX6 A;  4ESR A;  1WYX A;  3EHR A;  3GBQ A;  3M0R A;  4LUE A;  4RTU A;  5IHN A;  2RPN A;  4QT7 A;  1B3Q A;  4Z89 A;  4HXJ A;  1WIE A;  1HD3 A;  5IXF A;  1K76 A;  1AWJ A;  1JQQ A;  1M3B A;  1OV3 A;  2H8H A;  3PVL A;  2YUQ A;  2JMA A;  2A36 A;  2LJ3 A;  4LE9 A;  2BZY A;  2G6F X;  3A98 A;  1ZUY A;  1GRI A;  1WI7 A;  2RQW A;  2AZS A;  2AZV A;  4OMM A;  2V1Q A;  2XMF A;  2B86 A;  1SHG A;  1BB9 A;  1SHF A;  4FSS A;  1B07 A;  1YCS B;  2EYY A;  1MV3 A;  3I35 A;  2FRY A;  2IIM A;  3REB B;  1VYU A;  1SRL A;  2O9S A;  5IHK A;  2ROT A;  2E5K A;  3VS6 A;  4LN2 A;  1CKA A;  1KJW A;  2DRM A;  4LNP A;  1GBR A;  2RQU A;  2MOX A;  2CSI A;  2YUN A;  2DL8 A;  2DF6 A;  1X27 A;  2VWF A;  2DE0 X;  1AZE A;  2OJ2 A;  2EW3 A;  1UGV A;  1XOV A;  1AWX A;  1GBQ A;  3PVQ A;  2CSQ A;  2DA9 A;  2ROL A;  2KT1 A;  2L3Q A;  1TG0 A;  3M0T A;  2RQR A;  1KSW A;  3NHN A;  3VS7 A;  2J6O A;  1AZG B;  4GLM A;  1ABQ A;  3PE0 A;  4HVV A;  3H0F A;  1JEG A;  1PRL C;  1U06 A;  4IIM A;  2LMJ A;  5IXB A;  1T3S A;  2CDT A;  1OPK A;  1VYT A;  2EGC A;  1NG2 A;  1QWF A;  1I0C A;  1RUW A;  2VVK A;  3EG1 A;  3M0P A;  2KRN A;  5IHI A;  2DL5 A;  1QWE A;  2X3W D;  1UE9 A;  1TUD A;  2FPF A;  2DBK A;  3KFV A;  1K0X A;  3IQL A;  2NWM A;  2LNH B;  3M0U A;  2JS2 A;  4AG2 C;  2L2P A;  2PTK A;  3TSZ A;  2LZ6 B;  3C0C A;  2EYX A;  1A0N B;  1YN8 A;  2V1R A;  2CH4 A;  1X6G A;  2L3P A;  1OOT A;  2AK5 A;  1K9A A;  1SSH A;  2RF0 A;  2EGE A;  3CQT A;  2BZX A;  2JMC A;  1WFW A;  2SRC A;  3RBB B;  1VA7 A;  4CC3 A;  5GJV B;  2SEM A;  3UAT A;  1RLP C;  2YUP A;  2LCS A;  4F16 A;  4OMQ A;  4DEY A;  1SEM A;  2FPE A;  2ENM A;  2C0O A;  2EKH A;  4J9C A;  4OML A;  2K9G A;  2K79 A;  4Z8A A;  2HBW A;  1FMK A;  1RLQ C;  1LCK A;  1UG1 A;  3UF4 A;  4DEX A;  3VS4 A;  2RMO A;  1JXO A;  1H92 A;  1OEB A;  1S1N A;  1ZLM A;  4IIO A;  5L23 A;  2KT8 A;  2RQV A;  1NLP C;  2CUD A;  2GNC A;  4AFQ C;  1J3T A;  1UHF A;  2X3X D;  2FRW A; 
#chains in the Genus database with same CATH topology
 2FO0 A;  1FXX A;  4F7U B;  4KH1 B;  4OMO A;  2PNI A;  2JM8 A;  2KR3 A;  4PK4 A;  5GAO p;  1D1A A;  3UA6 A;  4BDZ A;  1WX6 A;  1WHJ A;  4GY5 A;  4J9I A;  4CI0 C;  2HD0 A;  3S3O A;  4OMF B;  5FLX E;  2X9H A;  4JLG A;  2NLU A;  1VQN T;  2O88 A;  2FPD A;  1OPL A;  1VQO T;  3H6Z A;  2GBQ A;  1Q82 R;  4KUL A;  4M7A E;  2HSP A;  2C0I A;  2PQW A;  1VQ6 Q;  3SWN C;  4XQ3 A;  1Z9Q A;  4UC4 A;  1M3A A;  3ME9 A;  2KI7 A;  3RMS A;  2OAU A;  2EYQ A;  1QKW A;  5LJ3 f;  4CC2 A;  2IG0 A;  2EIF A;  4IUP A;  5LJ5 d;  4M7D F;  1AHJ B;  1NLO C;  1K1Z A;  1JO8 A;  2EBP A;  3JRZ A;  1G5V A;  3PNW C;  3GOX A;  3CC7 Q;  2DYI A;  2DD5 A;  5GAN d;  4F7U F;  3VUZ A;  4HCC A;  1S72 T;  1ZUU A;  4O6J A;  4PFP A;  2E6N A;  4WCI A;  3E2U A;  1ZSZ B;  2JTF A;  2DIQ A;  4ELY C;  2V8J A;  1SKU B;  4M4Z A;  3RDV A;  4AG1 C;  3SDZ A;  2KY9 A;  2V8I A;  2OTJ A;  1PD1 A;  3HRU A;  3G6E Q;  2M1H A;  4AFZ C;  1M90 C;  1PHT A;  1TWB A;  3VRY A;  1AD5 A;  1VOM A;  5EC7 A;  1HJD A;  4LUD A;  2BUD A;  1OZ3 A;  3ZFJ A;  5LJ5 h;  2PUO B;  1TUC A;  1D09 B;  3HPW A;  3V8J A;  1G2B A;  5GAM e;  4E7K A;  2QTV A;  1KD1 R;  2WSF E;  5GAN h;  1TS9 A;  3EGD A;  2ED1 A;  3CCE A;  2Y90 A;  4A63 B;  2DD4 A;  3MJX A;  2P0K A;  3QWX X;  2DYB A;  1C6V X;  3U23 A;  2L3S A;  2EQI A;  3LH5 A;  2P84 A;  5GAM g;  1VQL A;  2NUT A;  3CC2 Q;  1G8X A;  1VQM A;  2DXU A;  1BK2 A;  5IT9 E;  1YIJ Q;  2KYB A;  3JCM f;  1VQ8 T;  2EVR A;  1N5Z A;  4KH0 B;  1YHQ T;  2RJD A;  3JCM P;  1ZBJ A;  1YJ9 T;  3REA B;  1PSE A;  3M9Q A;  2DXC A;  5CKD A;  4M78 E;  1VQP T;  1YIT A;  4FL6 A;  2GFU A;  4J9H A;  1KQS P;  2DXT A;  2E5Q A;  3FB9 A;  1IHW A;  2D1X A;  4D6W A;  3CME A;  1QLY A;  1V1C A;  4RUG A;  3M56 A;  1JB0 E;  3PIP A;  3VS1 A;  4ZN1 A;  4DBQ A;  2QA4 A;  2GGR A;  4X1V A;  5KYN A;  3S3M A;  4OB0 B;  5HK0 A;  4HA8 A;  4F14 A;  3TEE A;  4OMP A;  3H41 A;  1VQK T;  4NL2 A;  4CRI A;  1YJN A;  1NYF A;  1JU5 C;  3L2V A;  5LJ3 e;  4M7A G;  1NEG A;  2QGF B;  2J6K A;  2WSE E;  2M16 A;  3WXM B;  1IRX A;  2QQA A;  3JB9 D;  1LJO A;  3URG A;  1BYM A;  3VUB A;  2RK2 A;  2FEI A;  1LNX A;  1QVG P;  2E1H A;  4JS4 A;  2MF2 A;  3A5Z B;  3ZL7 C;  2E65 A;  3RNJ A;  2BKD N;  2F2V A;  2LQK A;  3GIB A;  1PNJ A;  3CCS T;  1YP5 A;  2J06 A;  4J9E A;  2OTJ Q;  4HKE A;  2BE9 B;  4OP0 A;  2XU8 A;  1PRM C;  2P4T A;  2QEX T;  2YUO A;  3I9Q A;  3CCL A;  4LXC A;  1AOJ A;  1BI2 A;  2K3B A;  5DM7 R;  3QSU A;  2DPP B;  2HKQ B;  4Z88 A;  1FYN A;  4M7D E;  2HAX A;  5C6S A;  5KH6 A;  2DL4 A;  1AEY A;  1WJQ A;  4FU6 A;  1I81 A;  5CKE A;  1WA7 A;  3CCE Q;  4QQD A;  2FVU A;  3JB9 F;  3VS0 A;  2RHI A;  4F7U E;  3I5R A;  5GMK h;  1ZX6 A;  3OYI A;  1O75 A;  3GBQ A;  1N8R U;  2RPN A;  4QT7 A;  1B3Q A;  1NJI C;  1WIE A;  1HD3 A;  1VQL Q;  1K76 A;  2RO0 A;  4Q5W A;  1VQM Q;  4M7D C;  1NJI R;  4LD6 A;  1M2O A;  3TQ7 P;  3EH2 A;  3DLM A;  2AZV A;  1PD0 A;  2XMF A;  4EMK B;  2RI2 A;  1BI0 A;  1BB9 A;  1BCM A;  1YIT Q;  1TXQ A;  3QHS A;  4ZN3 A;  2EYY A;  5J26 A;  3REB B;  2O9S A;  3CME Q;  5IHK A;  1K73 R;  3CCJ T;  4LDU A;  5IN1 A;  4LNP A;  1GBR A;  2RQU A;  2DAQ A;  2QA4 Q;  4M78 G;  4PJM A;  2R57 A;  3INZ A;  3A1P A;  2DF6 A;  1X27 A;  1ZSZ A;  3OSV A;  2GFA A;  2OJ2 A;  4Y91 A;  2EW3 A;  2QG9 B;  5GAO m;  1GBQ A;  3V8K A;  3RES A;  1YJN Q;  5LL6 S;  1K8A U;  4M7A B;  1VQ6 T;  2CSQ A;  3OYK A;  3M0T A;  4BB7 A;  1VQ5 A;  4M7A D;  2R5A A;  5KYX B;  1TUG B;  3PE0 A;  4HVV A;  2LMJ A;  4KUI A;  4RCB A;  1RUW A;  2A0F B;  3OW2 P;  2LRQ A;  3GLX A;  3ZEH A;  3A8M B;  4IUV A;  4X9C A;  2X3W D;  1UE9 A;  2XG8 D;  2FPF A;  4OGE A;  4QQ6 A;  1K0X A;  4XK8 E;  1ZSZ C;  2L5Q A;  2RHY A;  3TSZ A;  4J7I A;  4M77 A;  3C0C A;  3N5B B;  2EYX A;  2NUP B;  5EG2 A;  2HNI A;  1X6G A;  2L3P A;  3CCL Q;  2EWN A;  2QQB A;  1OX9 A;  2RF0 A;  8AT1 B;  3OYN A;  1WJR A;  2XIC A;  1Y07 A;  2JMC A;  2YXY A;  3HHT B;  2SRC A;  4IUU A;  1OYX A;  2SEM A;  2ZZD A;  3G71 T;  3GNF B;  1MND A;  1I5L A;  3LW5 E;  2YUP A;  1R0C B;  1SEM A;  4J9C A;  2RK1 A;  2MI6 A;  4RG2 A;  2LT1 A;  2HBW A;  1M8V A;  1LCK A;  3UF4 A;  4DEX A;  3GF5 A;  2DET A;  1N9S A;  2GNC A;  4M7D G;  4AFQ C;  4XU0 A;  1UHF A;  2QK0 A;  2FRW A;  1SF9 A;  4EMH A;  2DX1 A;  2EJF A;  4F7U G;  2QQS A;  1Q82 U;  2JM9 A;  4KGV B;  4DOW A;  4P5N A;  2K6D A;  1CKB A;  3VRZ A;  1UGP B;  2BZ8 A;  4D8K A;  2KNB B;  2DNU A;  2D0Q B;  2CUB A;  1BCO A;  2QQR A;  4JJC A;  3H0H A;  3PMT A;  4JLI A;  4L59 A;  3I55 T;  1KHC A;  2DVE A;  1W2B P;  1Q81 R;  3CCV T;  4M78 B;  2M51 A;  2DO3 A;  1FMW A;  2JTM A;  4M78 D;  4PFO A;  4LDV A;  1PSF A;  1T0J A;  5GAM j;  1M2V B;  2D8J A;  4E7S A;  4A54 A;  3CD6 A;  2OTL T;  3EGX B;  1VQ7 A;  2KRS A;  4C5E A;  1VQ5 Q;  2EKO A;  1ABO A;  4RMO A;  2E3H A;  2MCN A;  2J7I A;  1ACM B;  3MP6 A;  2QAZ A;  4XTY A;  3C94 A;  3OYH A;  4LD9 K;  1Y96 B;  4C92 F;  1G3W A;  2JJ9 A;  3CCQ A;  1D1B A;  4HVU A;  1NE8 A;  2M02 A;  5GAN 5;  2BTT A;  2CH4 W;  5C0M A;  1TOV A;  3X25 B;  4ELZ C;  4L6V 5;  3GPL A;  2DTO A;  1CSK A;  2K4Y A;  4RCC A;  5CKB A;  3RKX A;  3FRN A;  2HBP A;  1YNZ A;  2LTO A;  1RAF B;  2LQ8 A;  1W6X A;  1QW1 A;  1KD1 U;  1T3L A;  5LJ5 e;  3ULR B;  5GAM f;  3OYE A;  3EG3 A;  3FEO A;  1WXU A;  2LP5 A;  1KIK A;  4RTT A;  2DIL A;  2VV5 A;  2VAS A;  5GAN e;  2Y4X A;  4EMK A;  2K5F A;  4J6W A;  5LJ5 g;  1V76 A;  4QVZ A;  3JCM V;  1WPY A;  1AT1 B;  5LJ3 j;  1VYV A;  1HK9 A;  3EH1 A;  3JCM c;  1D3B B;  1YJW T;  2K7A A;  2HKN A;  1MMD A;  1XQH A;  4M7D B;  3RER A;  1F1B B;  4PNO A;  4M7D D;  3QXE B;  1E7O A;  2CRE A;  1UDL A;  3HTR A;  2MK5 A;  3TSW A;  3L42 A;  2RN8 A;  3X20 B;  5CQY A;  2GQV A;  1VQM T;  1SRM A;  4M7A A;  2KRM A;  4EMK C;  3MKD A;  2RA2 A;  1TSF A;  1Q82 C;  2OI3 A;  2DMO A;  4JJD A;  1V29 B;  4PJO B;  2HQX A;  3R6N A;  1FMV A;  3OA6 A;  3E9F A;  1JRI A;  4PJO D;  4FW1 A;  1H64 1;  3KXT A;  2LX7 A;  3HRS A;  1YIT T;  2ECZ A;  4E47 A;  4FT4 A;  2L8D A;  5D7U A;  1YFN A;  2RM4 A;  5ECA A;  5J39 A;  1X2Q A;  5AT1 B;  1NZ9 A;  2EQU A;  4DBH A;  2JTE A;  3PIO A;  3CME T;  1WQW A;  2P4R A;  3O8V A;  1VIF A;  1IB8 A;  3NGP A;  2CP3 A;  1G3T A;  1E6G A;  3CD6 Q;  2NUP A;  2O2O A;  1VQ7 Q;  4M7A C;  2LC4 A;  2I2L A;  1X75 C;  3CCR A;  4MDX A;  3OYF A;  2DKG A;  4J9B A;  4PKC C;  4JPB W;  1H3H A;  2RQT A;  2LJ0 A;  1RAD B;  5IAY A;  3JB9 G;  1HSQ A;  4IKF A;  3FJ5 A;  3M58 A;  4CC7 A;  3CCQ Q;  2X51 A;  5GAO q;  1EZZ B;  4JRP A;  3SFM A;  4ZNX A;  3SD4 A;  3EFR A;  2NUZ A;  3MPU B;  4PJO F;  4BAC A;  1YI2 T;  1IXD A;  1SSF A;  2QTX A;  5AYF A;  3OYC A;  1M1G A;  2ZCF B;  1M8M A;  2X4W A;  1W4S A;  1Q7Y R;  3OQ5 A;  1OQK A;  1BBZ A;  1QVP A;  3VS2 A;  2EJ9 A;  4N0A A;  3LH0 A;  3CPW S;  5IH2 A;  1KD1 C;  2IPO B;  3C4S A;  2YLC A;  3CPF A;  2FG0 A;  3HKS A;  5GMK m;  3CMA T;  5GAO r;  4JZ4 A;  5GMK e;  1NJI U;  3JCM X;  2ABL A;  1MUZ A;  4E7J A;  5DY9 A;  1KQS A;  2EPD A;  4FYW B;  2FL7 A;  4BE1 A;  4ESR A;  3I56 A;  1M1F A;  4M78 A;  1VQ4 T;  1AWJ A;  2XDP A;  1M3B A;  2KDS A;  3PVL A;  3CCM A;  2YUQ A;  1M2V A;  4N0A C;  5D6Y A;  3MET A;  5KYU B;  3FC3 A;  1ZUY A;  1WI7 A;  2RQW A;  4ANJ A;  1C0M A;  3EGX A;  1WJS A;  1OI1 A;  1LPL A;  1B7T A;  5KE3 A;  4FSS A;  2CP2 A;  1YCS B;  1VQ9 T;  4DA4 A;  2COY A;  3I35 A;  1FX7 A;  2FRY A;  3QG1 A;  1VQN A;  2E4H A;  3V8L A;  2M0O A;  3OBW A;  1VQO A;  1SRL A;  1SG5 A;  1Y96 A;  2JVV A;  2XDB A;  2ROT A;  4BY6 B;  2E5K A;  4M78 C;  2P0Q A;  3QJY A;  1RAH B;  1KJW A;  2RI5 A;  2XKO C;  1QP3 A;  2YUN A;  4C0Z A;  4FYV B;  1U1T A;  3NTH A;  1AZE A;  4Y28 E;  3A8H B;  2JUF A;  2YRD A;  5KCO A;  1XOV A;  3OYM A;  2RHZ A;  3CCR Q;  3JSC A;  2DA9 A;  3CBM A;  2ROL A;  4OVA A;  4C5G A;  2FYK A;  2J6O A;  4GLM A;  3H0F A;  4IIM A;  2GF7 A;  2RJE A;  2H3J A;  5CCA A;  1VYT A;  2A7Y A;  1VQ5 T;  5GAO l;  4BUG A;  3ASK A;  1OU9 A;  1XTD A;  4J6X A;  1QCN A;  1QWE A;  3HFO A;  2DBK A;  5GAO n;  2D6F A;  3CC4 T;  3IQL A;  2NWM A;  2LNH B;  1D3B A;  3M0U A;  4MZM A;  1I8F A;  2JS2 A;  4MMK A;  1XJW B;  3OS0 A;  1WNL A;  2PTK A;  4M75 B;  3RMQ A;  2LZ6 B;  4FT2 A;  4MDW A;  4M7D A;  1OU8 A;  1KC8 R;  1A0N B;  4M75 D;  5I2M A;  2NYS A;  1PCX A;  5CKF A;  2V1R A;  3PFS A;  4F7U A;  3DB3 A;  1SSH A;  2DTH A;  2EGE A;  3CQT A;  2BZX A;  3CBP A;  2M9U A;  3PMI A;  3QZ9 B;  3S6W A;  1WFW A;  3RBB B;  4CC3 A;  3UAT A;  4PJN A;  3CXC P;  3JCM Q;  1QVF P;  2LCS A;  4PJJ A;  1G3S A;  2QQ9 A;  4DEY A;  4C8Q F;  5GAN 8;  1MMG A;  4PJO A;  3CCU T;  3NTK A;  2ENM A;  2C0O A;  2EKH A;  4OML A;  2LX9 A;  2XK0 A;  2ATC B;  3VV0 A;  3I56 Q;  2KAF A;  4E7Z A;  2K79 A;  2QYZ A;  1RLQ C;  3LGL A;  4A4E A;  4DOV A;  2RMO A;  1JXO A;  3OY9 A;  1H92 A;  3CCM Q;  3OYA A;  1RAI B;  3VKI A;  4PJO E;  3WVE B;  1VQ8 A;  2KSS A;  2EJG A;  3E1S A;  5FW9 A;  1U8R A;  1YHQ A;  2LCC A;  4M75 F;  1UGR B;  3OB9 A;  1GCP A;  4C92 G;  2F2W A;  3G1J A;  1YJ9 A;  2DBM A;  2K2M A;  2FB7 A;  2XDD A;  2DL3 A;  2ESW A;  1VQP A;  1K73 C;  4CC4 B;  2EYZ A;  4BD3 A;  1VQN Q;  4PJO C;  5KCH A;  1MGQ A;  1C1A A;  1TU0 B;  8ATC B;  5LJ5 j;  1VQO Q;  5LJ3 d;  2MWO A;  1NM7 A;  2F2X A;  2RHX A;  2ED0 A;  4C5I A;  1K9M R;  4HCZ A;  5DLO A;  1PG5 B;  3CEY A;  4VUB A;  2QDL A;  5GAN j;  4E2F B;  2RHU A;  4GBQ A;  2K3X A;  2CYZ B;  5I11 A;  1MV0 B;  3FLG A;  5GMK i;  3WVD B;  3JCM g;  1GL5 A;  2YLB A;  3QDR B;  1VQK A;  1GCQ A;  1I5O B;  2CZ1 B;  2F69 A;  4JRI A;  4C0D B;  1KQS S;  1X6O A;  4XU3 A;  4ZGE B;  4YTL A;  3PGG A;  3THK A;  3FDR A;  3UPU A;  3JB9 I;  3MHX A;  2VKN A;  1M27 C;  1RAE B;  3HSB A;  3LGF A;  2A3L A;  2DVJ A;  1ZBX A;  1PKT A;  2DEQ A;  3KUF A;  2AT1 B;  3CC7 T;  4JZ3 A;  3D7S B;  4LDW A;  4LDY A;  4BDY A;  1WXB A;  5LJ3 h;  2X35 A;  2VB6 A;  5FWB A;  2COZ A;  4HVW A;  3J7A F;  5LJ5 f;  3QWY A;  4OF1 A;  1RI9 A;  3M55 A;  2FZC B;  1GCQ C;  1D0X A;  2QAS A;  5GAN f;  1M30 A;  3CCS A;  1JJ2 P;  1ZHI A;  1X43 A;  4AFU C;  2HEQ A;  1KK7 A;  2QEX A;  3EG9 B;  2LT4 A;  5CAI A;  2ZPI B;  3BW1 A;  4HCK A;  5KYU A;  5HKC A;  3UT1 A;  3LWH A;  1IGQ A;  3G6E T;  2A08 A;  4X34 A;  1QVG S;  1RI0 A;  2YSQ A;  3NMZ C;  1EX4 A;  2W0Z A;  3FJP A;  4NOY A;  2JN0 A;  1OUL A;  1UTI A;  4HT8 A;  1PWT A;  1JXM A;  4OB1 B;  3JCM d;  2GTO A;  2MMP A;  1IO6 A;  2ZPE B;  1QKX A;  3JAM E;  1B34 B;  1UGQ B;  2EYW A;  2LJ1 A;  4JUV A;  4JS5 A;  1I07 A;  4RTW A;  2AKL A;  4RKU E;  3MEV A;  2D8H A;  2RJC A;  1O9S A;  1UUE A;  2R58 A;  2JNG A;  1X69 A;  4OB2 B;  1G83 A;  1VQ8 Q;  2DM1 A;  3CC2 T;  4C92 B;  2DL7 A;  4E6R A;  1Y0M A;  2LQW A;  1OX8 A;  1YIJ T;  1YHQ Q;  4C92 D;  3CXC S;  1K0S A;  1YJ9 Q;  4DBR A;  3NPF A;  2KGT A;  4B9W A;  5A0L A;  1BIB A;  4KT0 E;  1HYO A;  1VQP Q;  1Q81 C;  4J6Y A;  1W1F A;  1N8R R;  3H0I A;  4FYX B;  4K11 A;  3QKJ A;  4PJO G;  4Y92 A;  4XTV A;  3CPW A;  2KXC A;  4BY6 C;  1Y71 A;  3H9N A;  3CCJ A;  2KXD A;  4RTY A;  3JCM h;  3HL8 A;  1Z9Z A;  1WQ7 A;  2I0N A;  1GXI E;  4B6M A;  1PM3 A;  4C8Q E;  5DLQ E;  4NL3 A;  3OMG A;  5GMK j;  1M4Z A;  4RTV A;  5GJW B;  3VS5 A;  5KYY B;  1WDX A;  3VYH B;  4EIK A;  2KRO A;  2PU9 B;  4ORZ A;  1VQK Q;  4M75 A;  3MCA B;  2EAY A;  2WSC E;  2J6F A;  2KYM A;  3PT9 A;  3TVT A;  2JW4 A;  3EAE A;  3UA7 A;  3A8L B;  4PLI A;  1K4U S;  2AKK A;  2H3E B;  1N6A A;  4M75 E;  3RKW A;  4JJB A;  1NEB A;  1WHK A;  2K2V A;  3O5Z A;  1Q7Y U;  1SPK A;  2LQN A;  3P8B B;  2KQW A;  1Q86 R;  4RTZ A;  2OAW A;  2RI3 A;  5HY6 A;  2RNA A;  1NYG A;  3DB4 A;  4M75 C;  3G4S A;  1Y57 A;  2OX7 A;  2JOY A;  3CCS Q;  1UJ0 A;  2MIO A;  4HCB A;  4V2S A;  1XNI A;  1ZA1 B;  4A4K A;  2QEX Q;  4PJL A;  3RIR A;  4AFS C;  4RTX A;  1QCF A;  4F17 A;  3OW2 S;  2OTJ T;  3QPH A;  2M0Y A;  2KEA A;  2KE9 A;  3G71 A;  4QVD A;  1M1K R;  1I1J A;  3A8O B;  1X2K A;  3OSS C;  3EGU A;  1AWO A;  4FSX A;  1M5Q 1;  3VJP A;  5HCK A;  2YDL A;  1IZ6 A;  2QXF A;  3P8D A;  2JXB A;  2HQE A;  3JCM J;  2K5I A;  3CCE T;  1WYX A;  2XI9 A;  1FWZ A;  1YBY A;  3M0R A;  4LUE A;  4RTU A;  3DKM A;  3L2Z A;  2E70 A;  4Z89 A;  3BY7 A;  5GMK l;  1QMC A;  3QDF A;  2VGN A;  3JCM b;  5IXF A;  1JQQ A;  4C0G A;  1VQL T;  2K3Y A;  4N4G A;  3MEA A;  2HSE B;  3A98 A;  1MNE A;  4EDU A;  2V26 A;  3TCJ A;  5KYX A;  5I21 A;  2LDM A;  2B86 A;  1SHF A;  3Q1J A;  4HT9 A;  1B07 A;  4O5V A;  5A0D A;  2DXB A;  4NS5 A;  3M54 A;  3I55 A;  4PLL A;  3R6O A;  4ZTF A;  1IHV A;  3CCV A;  3CCJ Q;  3RUX A;  3E9G A;  1KHI A;  3A8G B;  1CKA A;  1KQ1 A;  2DRM A;  3AHU A;  1LOJ A;  2E3I A;  2MOX A;  2VUB A;  5CIU A;  2DL8 A;  3NFC A;  4BI4 A;  2LNV A;  2YHT A;  2VWF A;  3OYL A;  2QA4 T;  3L2Q A;  1U1S A;  2DE0 X;  4L5G A;  4J7F A;  1RAG B;  2OTL A;  2FHD A;  5GAN 3;  4PL6 A;  4JDS A;  4C0D C;  2L3Q A;  4XAX B;  1TG0 A;  1YJN T;  3EG9 A;  2XID A;  1MHN A;  4C8Q G;  1ZA2 B;  1W2B S;  1ABQ A;  3J81 E;  1JEG A;  1PRL C;  1U06 A;  5IXB A;  1T3S A;  3L2R A;  1OPK A;  1JBM A;  2EGC A;  1QWF A;  3H8Z A;  1I0C A;  4PFZ A;  1BI1 A;  1KC8 U;  3EG1 A;  4E7L A;  4N4H A;  4KGX B;  3M57 A;  2AIR B;  1TUD A;  2LVM A;  4XTW A;  2ZPG B;  2EQK A;  2WAC A;  5GAN 4;  1Q7Y C;  2PVD B;  4AMC A;  3TRE A;  4KBM B;  4XU1 A;  1B34 A;  3G4S Q;  4AG2 C;  2EFI A;  2L2P A;  3GNG A;  4M75 G;  3QO3 A;  3V7S A;  1KQ2 A;  3JCM W;  2DIG A;  2ZPH B;  3EFS A;  1OOT A;  2AK5 A;  5FU7 B;  4C92 A;  1WHG A;  1EIF A;  3CCL T;  3G71 Q;  1VA7 A;  5GAN 6;  4OB3 B;  1M9S A;  4FCY A;  1PC0 A;  4F04 B;  4J8O A;  3EFO B;  2E10 A;  4F16 A;  1M90 R;  2E64 A;  2FZG B;  4EMG A;  4OMQ A;  2DZ9 A;  2QGG A;  3X26 B;  4C92 E;  4QKU A;  1YJW A;  3OYG A;  2V8K A;  4Z8A A;  2VXF A;  5FRM A;  3VS4 A;  1ZLM A;  1S1N A;  4IIO A;  3OBY A;  4ZGJ B;  5L23 A;  2RQV A;  1NLP C;  4M77 B;  2CUD A;  4C92 C;  5KYY A;  4BE2 A;  2RJF A;  4M77 D;  1K73 U;  3KBG A;  2X3X D;  1K9M U;  1R0B G;  2E12 A;  4J9D A;  4FW2 A;  2PVG B;  2QI2 A;  4II1 A;  4J9G A;  2QDY B;  3QYH B;  2MYS A;  2O31 A;  3OS2 A;  1KG1 A;  4IUT A;  3I55 Q;  2K57 A;  3CCV Q;  1AVZ C;  4QW2 A;  1EFN A;  2CP7 A;  1H8K A;  1QP2 A;  3HRT A;  1QVG A;  4FM4 B;  5FWC A;  1T0H A;  2F5T X;  2E6Z A;  2HL3 A;  1MMA A;  1VUB A;  4WTO B;  2O9V A;  1W70 A;  2DFU A;  2YT6 A;  4DQ2 A;  2HL5 C;  2OTL Q;  5A2Q E;  4J9F A;  4ME7 A;  4C8Q B;  2DLP A;  1LVK A;  4C8Q D;  5CVI A;  4EPC A;  2L0A A;  1WZO A;  4M77 F;  2DER A;  1UHC A;  2EQJ A;  1WHM A;  5KYW B;  3CBO A;  1S72 A;  3BDU A;  4MZP A;  2DTI A;  2PZ1 A;  4N4I A;  1N27 A;  3S3N A;  3CXC A;  2O4X B;  2Y4Y A;  1DJ7 B;  4A53 A;  5CR2 A;  4ZTJ A;  4R0K A;  1QVF A;  3QZ5 B;  5GAM d;  1KC8 C;  3MEW A;  3V7C A;  1YI2 A;  3TU4 K;  2K5L A;  2PUK B;  5LJ3 g;  3VS3 A;  1M3C A;  2VYT A;  3HP9 A;  2DRK A;  4OMN A;  1E6H A;  2X4X A;  1Y7X A;  3M53 A;  1ZUK A;  2HQH A;  3SB2 A;  2C0T A;  1QQJ A;  1U3O A;  1X6B A;  3RKY A;  3LYI A;  1YWO A;  2CT3 A;  3L2U A;  1IRE B;  2HCK A;  2YRC A;  2DEU A;  1R77 A;  4JRK A;  3FIF A;  4ZGD B;  2BE7 D;  2CT4 A;  2KBT A;  4B9X A;  3CMA A;  2CZ6 B;  2C06 A;  4C5H A;  2RH2 A;  4D8D A;  2MWP A;  1YJW Q;  2VXE A;  6AT1 B;  1GFC A;  3M5A A;  2GQI A;  3EHQ A;  1WLP B;  2A28 A;  1Q95 G;  1VQ4 A;  5I2S A;  5GAM h;  2W10 A;  2XD0 A;  2BIV A;  3I5S A;  2CS7 A;  2GTJ A;  5FU6 B;  5A0G A;  1BKB A;  2KVQ G;  1ZSG A;  2MPX C;  1G3Y A;  1Q81 U;  2DJQ A;  3JV3 A;  4OGC A;  3PTA A;  1WHH A;  2ZAE A;  1UFF A;  5FRN A;  4DBF A;  3SHW A;  3V7R A;  2D0N A;  4GLK A;  4J83 A;  1UGS B;  5GAN 7;  1K9M C;  1KFZ A;  3SEM A;  2Z0W A;  9ATC B;  1VQ9 A;  5D6X A;  5CO7 A;  4KUD K;  2L3R A;  3EG0 A;  2HDA A;  1ZQ1 A;  2F5K A;  4QQG A;  3JCM e;  3M0Q A;  3MEU A;  3OW2 A;  3JB9 J;  3DLL A;  1WGS A;  1ARK A;  2EQM A;  5HK3 A;  2CP5 A;  3E19 A;  4ATO A;  3SWN B;  4MZT A;  2G3R A;  2JZ2 A;  2A37 A;  1U5S A;  1GFD A;  1PKS A;  1RAC B;  3CD6 T;  3NTI A;  1RAB B;  1JJ2 A;  1NPR A;  2VC8 A;  1VQ7 T;  1BIA A;  2AHJ B;  2JT4 A;  4A4H A;  1WXT A;  1Q86 U;  1UB4 A;  2L89 A;  1S72 Q;  2LCL A;  2MAM A;  2CP0 A;  1UEC A;  2X4Y A;  3OYY A;  2YRV A;  4E7I A;  5I22 A;  3EFO A;  3OS1 A;  3CCQ T;  1TH7 A;  2CGH A;  1YI2 Q;  3CC4 A;  1YWP A;  5CQX A;  1P92 A;  3BFM A;  2CP6 A;  1D0Y A;  1WHL A;  4LDX A;  5M9O A;  2R5M A;  1M1K U;  5KE2 A;  2CZ0 B;  2EGA A;  3EG2 A;  1X01 A;  3L1A A;  3G4S T;  4QVC A;  5FU7 C;  2J05 A;  2KK4 A;  1QCO A;  3M0S A;  2IVW A;  4KRT A;  3VU3 C;  4XTZ A;  3CMA Q;  2RB6 A;  2DJZ A;  1UJY A;  4A4F A;  4M77 E;  1BU1 A;  3ZBD A;  3CCU A;  2DZC A;  1AWW A;  2X4J A;  2JS0 A;  4R55 A;  4M7A F;  2VGM A;  3AT1 B;  3X28 B;  1OZ2 A;  4JJN K;  1W2B A;  4FYY B;  2ZPF B;  3HFN A;  4BI3 A;  3QII A;  1VQ4 Q;  3P8H A;  3EHR A;  2HZY A;  5IHN A;  4HXJ A;  2H8H A;  1OV3 A;  4C0F A;  3GP8 A;  3BE3 A;  4M77 C;  4R56 A;  2JMA A;  2A36 A;  2LJ3 A;  4LE9 A;  3LX7 A;  2BZY A;  5L8R E;  2D9T A;  2G6F X;  4XTU A;  1N8R C;  1QVF S;  2B8A A;  1GRI A;  3RR6 A;  4C8Q A;  2AZS A;  4OMM A;  2FZK B;  2V1Q A;  1VIE A;  1MMN A;  1SHG A;  3F70 A;  1VQ9 Q;  1I4K 1;  1N9R A;  4IUQ A;  1YCY A;  3OYD A;  5KYW A;  4XTX A;  1MV3 A;  7AT1 B;  2IIM A;  3EGD B;  1VYU A;  3M59 A;  3LLR A;  4RG8 A;  3M4Y A;  3VS6 A;  4MML A;  4LN2 A;  2O4X A;  3UDC A;  3LWI A;  2ZGW A;  4XU2 A;  2NUT B;  2CSI A;  4BE0 A;  1VQ6 A;  4AT1 B;  3T9N A;  4TVR A;  1UEB A;  3QJ6 A;  4IUR A;  4J5Y A;  1UGV A;  3UWN A;  2P0P A;  1AWX A;  4C8Q C;  2HMA A;  3C95 A;  3PVQ A;  3M4G A;  2KT1 A;  2RQR A;  3CCR T;  1KSW A;  3NHN A;  3VS7 A;  1AZG B;  1NBE B;  5CK9 A;  1D1C A;  2CDT A;  3BDL A;  1BI3 A;  3OYB A;  1D0Z A;  1K8A C;  1NG2 A;  1Q86 C;  2VVK A;  3CC7 A;  3CPW P;  2PVO B;  1K8A R;  3M0P A;  1IGU A;  4JRQ A;  2KRN A;  5IHI A;  2DL5 A;  3CC4 Q;  2CZ7 B;  2GCX A;  2F1L A;  3KFV A;  3OS5 A;  1R8O B;  5J3B A;  4WF2 A;  4KGZ B;  5CKH A;  5FRO A;  1M90 U;  3MP1 A;  1YN8 A;  2YWW A;  1M1K C;  2CH4 A;  3X24 B;  1TTH B;  4M78 F;  1K9A A;  2DK3 A;  1RAA B;  3G6E A;  3OMC A;  4E7H A;  1HXD A;  3MO8 A;  3QYG B;  5GAN 2;  3J80 E;  2RD1 A;  1H3Z A;  5GJV B;  3G7Z A;  2E41 A;  3QBY A;  1RLP C;  4FIB A;  4Z02 A;  5D6W A;  3CCU Q;  3QUI A;  4A4G A;  2FPE A;  4X9D A;  3JB9 H;  1JJ2 S;  2K9G A;  2O01 E;  3MP8 A;  2KMT A;  2ZPB B;  1FMK A;  2COW A;  1UG1 A;  3I56 T;  3ER0 A;  2CKK A;  5FU6 C;  5GAN g;  1OEB A;  2KT8 A;  2XHC A;  3CC2 A;  4M77 G;  1RL2 A;  1NPP A;  3OYJ A;  4BI8 B;  3SWN A;  3CCM T;  3VYG A;  1J3T A;  1YIJ A;  3C12 A;  3L2W A; 
#chains in the Genus database with same CATH homology
 2DX1 A;  2FO0 A;  4J9D A;  5FW9 A;  4OMO A;  2PNI A;  1GCP A;  2JM9 A;  2F2W A;  2JM8 A;  4J9G A;  2KR3 A;  2K6D A;  2DBM A;  2K2M A;  1CKB A;  3VRZ A;  3UA6 A;  2DL3 A;  2BZ8 A;  2ESW A;  1WX6 A;  2O31 A;  4D8K A;  2KNB B;  4J9I A;  4CC4 B;  2DNU A;  2EYZ A;  2CUB A;  4JJC A;  1NM7 A;  1AVZ C;  3H0H A;  2F2X A;  2ED0 A;  1EFN A;  1OPL A;  2FPD A;  2O88 A;  2GBQ A;  1H8K A;  2M51 A;  2QDL A;  5FWC A;  1T0H A;  2HSP A;  2C0I A;  4GBQ A;  5I11 A;  1MV0 B;  1T0J A;  1Z9Q A;  2O9V A;  1M3A A;  1W70 A;  2YT6 A;  2D8J A;  1GL5 A;  4J9F A;  1QKW A;  1GCQ A;  4CC2 A;  2DLP A;  2KRS A;  1ABO A;  2L0A A;  3THK A;  1UHC A;  1NLO C;  2MCN A;  2J7I A;  1K1Z A;  2VKN A;  1M27 C;  1JO8 A;  2EBP A;  2PZ1 A;  2DVJ A;  1PKT A;  4HVU A;  4JZ3 A;  4R0K A;  1WXB A;  2BTT A;  2CH4 W;  1ZUU A;  5FWB A;  4HVW A;  4WCI A;  1CSK A;  3VS3 A;  3QWY A;  1M3C A;  1RI9 A;  2DRK A;  1GCQ C;  4OMN A;  4M4Z A;  4AG1 C;  1YNZ A;  1E6H A;  1M30 A;  1ZUK A;  1X43 A;  4AFU C;  2HEQ A;  2C0T A;  1W6X A;  1U3O A;  1X6B A;  1T3L A;  3ULR B;  1YWO A;  4AFZ C;  2CT3 A;  1PHT A;  3EG3 A;  4HCK A;  1WXU A;  2HCK A;  3VRY A;  2LP5 A;  1KIK A;  4RTT A;  1AD5 A;  2DIL A;  5EC7 A;  2A08 A;  1HJD A;  4LUD A;  2YSQ A;  2KBT A;  2CT4 A;  3NMZ C;  1TUC A;  2W0Z A;  1UTI A;  1PWT A;  1G2B A;  1JXM A;  2GTO A;  4D8D A;  1IO6 A;  1VYV A;  1QKX A;  1GFC A;  2ED1 A;  2GQI A;  4A63 B;  3EHQ A;  1WLP B;  2A28 A;  2K7A A;  2EYW A;  3QWX X;  2DYB A;  2LJ1 A;  2W10 A;  2L3S A;  1I07 A;  4RTW A;  3U23 A;  3I5S A;  2EQI A;  2AKL A;  2GTJ A;  3LH5 A;  2D8H A;  1E7O A;  2CRE A;  1UDL A;  1UUE A;  1X69 A;  1BK2 A;  1ZSG A;  1G83 A;  2DM1 A;  2DJQ A;  2DL7 A;  3JV3 A;  2KYB A;  4E6R A;  3TSW A;  1Y0M A;  1UFF A;  2LQW A;  2RN8 A;  3SHW A;  2EVR A;  1SRM A;  1K0S A;  1N5Z A;  2D0N A;  2KRM A;  3NPF A;  2KGT A;  1KFZ A;  3SEM A;  1ZBJ A;  3REA B;  1W1F A;  2OI3 A;  2DMO A;  3EG0 A;  3H0I A;  2HDA A;  4JJD A;  4K11 A;  3M0Q A;  4J9H A;  4Y92 A;  3R6N A;  2KXC A;  2D1X A;  2LX7 A;  1QLY A;  1V1C A;  2ECZ A;  2KXD A;  4RUG A;  4RTY A;  1ARK A;  1Z9Z A;  2I0N A;  5ECA A;  1X2Q A;  2JTE A;  3VS1 A;  4RTV A;  2P4R A;  5GJW B;  3NGP A;  3VS5 A;  2GGR A;  1WDX A;  2A37 A;  4X1V A;  4EIK A;  1U5S A;  2KRO A;  4ORZ A;  1E6G A;  1GFD A;  4F14 A;  1PKS A;  4OMP A;  2O2O A;  3H41 A;  2J6F A;  2KYM A;  3TVT A;  1NYF A;  1JU5 C;  2JW4 A;  4J9B A;  3UA7 A;  4JPB W;  1H3H A;  2JT4 A;  1WXT A;  1NEG A;  2RQT A;  2J6K A;  2LJ0 A;  1K4U S;  2AKK A;  1UEC A;  1HSQ A;  3FJ5 A;  4CC7 A;  5I22 A;  4JJB A;  1NEB A;  3O5Z A;  1SPK A;  2FEI A;  4ZNX A;  1YWP A;  2LQN A;  2NUZ A;  3ZL7 C;  4RTZ A;  2OAW A;  2RNA A;  1NYG A;  3RNJ A;  2F2V A;  1Y57 A;  1M8M A;  1UJ0 A;  2MIO A;  1PNJ A;  2EGA A;  3EG2 A;  1BBZ A;  2J06 A;  1YP5 A;  4J9E A;  3VS2 A;  4AFS C;  4RTX A;  1QCF A;  2J05 A;  1PRM C;  2YUO A;  3I9Q A;  4F17 A;  5IH2 A;  3M0S A;  1AOJ A;  2M0Y A;  2KEA A;  2KE9 A;  4KRT A;  2K3B A;  2FG0 A;  1I1J A;  1X2K A;  4Z88 A;  1UJY A;  3EGU A;  4JZ4 A;  1BU1 A;  1AWO A;  1FYN A;  1AWW A;  2JS0 A;  2ABL A;  2DL4 A;  1AEY A;  1MUZ A;  1WA7 A;  5HCK A;  2YDL A;  2EPD A;  3VS0 A;  2JXB A;  3I5R A;  1ZX6 A;  4ESR A;  1WYX A;  3EHR A;  3GBQ A;  3M0R A;  4LUE A;  4RTU A;  5IHN A;  2RPN A;  4QT7 A;  1B3Q A;  4Z89 A;  4HXJ A;  1WIE A;  1HD3 A;  5IXF A;  1K76 A;  1AWJ A;  1JQQ A;  1M3B A;  1OV3 A;  2H8H A;  3PVL A;  2YUQ A;  2JMA A;  2A36 A;  2LJ3 A;  4LE9 A;  2BZY A;  2G6F X;  3A98 A;  1ZUY A;  1GRI A;  1WI7 A;  2RQW A;  2AZS A;  2AZV A;  4OMM A;  2V1Q A;  2XMF A;  2B86 A;  1SHG A;  1BB9 A;  1SHF A;  4FSS A;  1B07 A;  1YCS B;  2EYY A;  1MV3 A;  3I35 A;  2FRY A;  2IIM A;  3REB B;  1VYU A;  1SRL A;  2O9S A;  5IHK A;  2ROT A;  2E5K A;  3VS6 A;  4LN2 A;  1CKA A;  1KJW A;  2DRM A;  4LNP A;  1GBR A;  2RQU A;  2MOX A;  2CSI A;  2YUN A;  2DL8 A;  2DF6 A;  1X27 A;  2VWF A;  2DE0 X;  1AZE A;  2OJ2 A;  2EW3 A;  1UGV A;  1XOV A;  1AWX A;  1GBQ A;  3PVQ A;  2CSQ A;  2DA9 A;  2ROL A;  2KT1 A;  2L3Q A;  1TG0 A;  3M0T A;  2RQR A;  1KSW A;  3NHN A;  3VS7 A;  2J6O A;  1AZG B;  4GLM A;  1ABQ A;  3PE0 A;  4HVV A;  3H0F A;  1JEG A;  1PRL C;  1U06 A;  4IIM A;  2LMJ A;  5IXB A;  1T3S A;  2CDT A;  1OPK A;  1VYT A;  2EGC A;  1NG2 A;  1QWF A;  1I0C A;  1RUW A;  2VVK A;  3EG1 A;  3M0P A;  2KRN A;  5IHI A;  2DL5 A;  1QWE A;  2X3W D;  1UE9 A;  1TUD A;  2FPF A;  2DBK A;  3KFV A;  1K0X A;  3IQL A;  2NWM A;  2LNH B;  3M0U A;  2JS2 A;  4AG2 C;  2L2P A;  2PTK A;  3TSZ A;  2LZ6 B;  3C0C A;  2EYX A;  1A0N B;  1YN8 A;  2V1R A;  2CH4 A;  1X6G A;  2L3P A;  1OOT A;  2AK5 A;  1K9A A;  1SSH A;  2RF0 A;  2EGE A;  3CQT A;  2BZX A;  2JMC A;  1WFW A;  2SRC A;  3RBB B;  1VA7 A;  4CC3 A;  5GJV B;  2SEM A;  3UAT A;  1RLP C;  2YUP A;  2LCS A;  4F16 A;  4OMQ A;  4DEY A;  1SEM A;  2FPE A;  2ENM A;  2C0O A;  2EKH A;  4J9C A;  4OML A;  2K9G A;  2K79 A;  4Z8A A;  2HBW A;  1FMK A;  1RLQ C;  1LCK A;  1UG1 A;  3UF4 A;  4DEX A;  3VS4 A;  2RMO A;  1JXO A;  1H92 A;  1OEB A;  1S1N A;  1ZLM A;  4IIO A;  5L23 A;  2KT8 A;  2RQV A;  1NLP C;  2CUD A;  2GNC A;  4AFQ C;  1J3T A;  1UHF A;  2X3X D;  2FRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...