2RMOA

Solution structure of alpha-spectrin_sh3-bergerac from chicken
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
b'MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKATANGKTYERQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
molecule tags Signaling protein
source organism Gallus gallus
publication title Study of the structure and dynamics of a chimeric variant of the SH3 domain (SHA-Bergerac) by NMR spectroscopy
pubmed doi rcsb
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rmoA00
4JJDA 1I0CA 5I11A 2EYYA 3M0TA 2I0NA 1VYTA 2K2MA 3SHWA 5EC7A 2ESWA 2DBMA 3QWYA 1SEMA 4GLMA 2JTEA 2B86A 2LQWA 2DE0X 3EG1A 1GCQC 1ARKA 1U3OA 3C0CA 4HVWA 1M8MA 1JO8A 2K9GA 2D1XA 2M0YA 1YWOA 2LJ0A 2MCNA 2HDAA 2E5KA 1AZGB 3I5RA 4RTVA 2LCSA 1K76A 3EG0A 1Y57A 4LUDA 1TG0A 4DEYA 1HSQA 2CH4A 2RNAA 3SEMA 1T3SA 1GRIA 2RQVA 1UJ0A 4J9CA 2DL4A 4KRTA 3RNJA 2LP5A 2CUDA 1RLPC 3M0QA 1ZBJA 2DVJA 1CSKA 1M3CA 1BBZA 3PVLA 2EYWA 1M3AA 2PZ1A 2ROLA 2EGAA 1H92A 4GBQA 4D8DA 1WA7A 1OPKA 1AD5A 2V1QA 1V1CA 3REAB 3M0UA 2GTOA 1PWTA 2JMAA 2GNCA 2F2XA 3EHRA 4J9BA 2KXDA 2OI3A 5IHNA 1H8KA 1I1JA 2X3WD 3UATA 1K4US 1YCSB 5L23A 2YSQA 1BB9A 2EYXA 2EGCA 2YUNA 2YUQA 2M51A 1X6GA 2ED1A 3NPFA 1AWJA 1M27C 1QKXA 4OMPA 2CSIA 2DMOA 1TUCA 2LJ1A 4F17A 4AG2C 3JV3A 3EHQA 1AWWA 2XMFA 4OMLA 2RPNA 3VS4A 2MIOA 3M0PA 3VS6A 2LX7A 1UHFA 5HCKA 4M4ZA 2BZ8A 2K79A 3M0RA 2YUOA 3UA6A 5FW9A 1B3QA 1OEBA 2H8HA 2F2WA 1Z9QA 3EGUA 2VWFA 1VYUA 1UUEA 1NG2A 3TSZA 2JW4A 2CDTA 4LN2A 1X69A 1YNZA 4D8KA 2OJ2A 2AZVA 2KNBB 2ROTA 1MV0B 2GGRA 1NEGA 2LJ3A 2J05A 5GJVB 3TVTA 2DF6A 2YDLA 1W1FA 2FG0A 2DM1A 1NEBA 1SRMA 2KRNA 2AZSA 1HD3A 3VRYA 1UGVA 1KIKA 1QWFA 4RTWA 2K3BA 2EBPA 4E6RA 3A98A 1LCKA 1SHGA 1NYGA 2L2PA 2J06A 2DNUA 1ZUYA 1T0JA 1UE9A 3VS2A 2D8JA 1UG1A 2CREA 3VS7A 1JEGA 2KEAA 1HJDA 1YP5A 2KT1A 3LH5A 2QDLA 1EFNA 3IQLA 5IHKA 4JZ3A 2GTJA 1WXUA 1GL5A 1QKWA 2O31A 4HCKA 2EVRA 1X27A 1H3HA 4Z88A 3PVQA 1WXTA 4J9EA 2JXBA 1QWEA 3H0FA 1NLOC 2PNIA 1SSHA 1JXOA 4JZ4A 4ESRA 3H41A 4QT7A 2KYMA 1G83A 1K0SA 3NGPA 5GJWB 1PKTA 2DX1A 4F16A 2EYZA 1M30A 1NM7A 4OMNA 1SPKA 2EPDA 4K11A 2ENMA 2C0OA 4HXJA 2EQIA 2FEIA 1AWXA 4AFQC 2DBKA 1WIEA 1CKBA 1WFWA 1AOJA 4AFSC 1X6BA 1QCFA 4J9GA 2CH4W 1FMKA 1RI9A 4AG1C 1SHFA 2KRMA 1UECA 2DRKA 2G6FX 2DILA 1NLPC 2X3XD 2OAWA 2JS0A 2AK5A 4OMQA 2LMJA 3VS5A 1WLPB 3NMZC 1ZSGA 1XOVA 2DYBA 1PRLC 2F2VA 2HBWA 1ZX6A 1E6HA 2NWMA 2EGEA 4J9FA 1UFFA 2A37A 2SEMA 4LE9A 3REBB 2BZXA 4A63B 4J9DA 1UTIA 4HVUA 1B07A 5IXFA 1UHCA 2AKKA 2D0NA 2YT6A 1ZLMA 2J6OA 2SRCA 3M0SA 2FRWA 2EW3A 2CT4A 4AFUC 1PKSA 2ECZA 2PTKA 4FSSA 2RQRA 1J3TA 2LQNA 3PE0A 2HSPA 2DLPA 2ABLA 2BZYA 2EKHA 1BK2A 4HVVA 5IXBA 1G2BA 2A08A 5IH2A 4CC3A 1ABOA 1KFZA 1GCQA 2RQUA 2FPEA 1W6XA 1CKAA 2HCKA 2NUZA 1U5SA 4J9HA 2RN8A 3EG3A 3CQTA 2LNHB 2MOXA 4ORZA 4RTTA 1WXBA 3QWXX 2IIMA 1VA7A 2A28A 1OPLA 4Z89A 1GBQA 3O5ZA 2GQIA 3GBQA 3VRZA 3KFVA 2W10A 2O9VA 4RTZA 2CUBA 3H0HA 3UA7A 2KBTA 4Y92A 1KSWA 2CT3A 3NHNA 4JJBA 1UDLA 2DL7A 3VS1A 2JM8A 2AKLA 1AZEA 3I9QA 2VKNA 4OMMA 1JU5C 3I35A 4JJCA 2FPDA 2O9SA 2DRMA 1JXMA 2LZ6B 1E7OA 1E6GA 2P4RA 4F14A 1OOTA 1W70A 1TUDA 1Z9ZA 2KGTA 1WX6A 2L3QA 3EG2A 2RF0A 1Y0MA 1GFCA 1OV3A 1UJYA 1FYNA 2K7AA 2HEQA 1MUZA 1ZUKA 1K1ZA 5FWBA 1K9AA 2RMOA 2L3SA 1GCPA 2J6FA 2W0ZA 4X1VA 1WI7A 1ZUUA 2GBQA 1AWOA 2BTTA 2KT8A 4RTYA 4CC7A 1PHTA 1GFDA 1X2QA 2A36A 2ED0A 4J9IA 4WCIA 2KRSA 3RBBB 3U23A 1YN8A 2V1RA 2JS2A 2FRYA 2L3PA 2KE9A 2JMCA 1PRMC 2FPFA 1BU1A 3ZL7C 1T3LA 2KROA 1JQQA 2DA9A 4JPBW 2C0TA 1WDXA 2DJQA 2K6DA 5IHIA 4EIKA 4RUGA 3TSWA 1RUWA 3I5SA 2C0IA 2YUPA 1SRLA 2D8HA 4RTXA 2DL8A 2FO0A 1WYXA 1A0NB 1PNJA 1GBRA 3UF4A 4CC2A 2KYBA 1ABQA 1K0XA 2RQTA 4R0KA 4OMOA 1AEYA 2J7IA 2J6KA 2O2OA 4AFZC 4ZNXA 1YWPA 1U06A 3THKA 1QLYA 1I07A 2O88A 2L0AA 1AVZC 3VS0A 5I22A 1X2KA 1KJWA 4IIMA 1T0HA 2DL5A 4CC4B 5FWCA 2DL3A 1NYFA 3ULRB 3FJ5A 4RTUA 1RLQC 3VS3A 5ECAA 3H0IA 1M3BA 1S1NA 1IO6A 2JT4A 4DEXA 1MV3A 4LUEA 1N5ZA 2JM9A 2VVKA 2KR3A 2CSQA 2KXCA 4IIOA 4LNPA 1VYVA 3R6NA 1X43A 2RQWA 4Z8AA
chains in the Genus database with same CATH superfamily
1IRXA 2XG8D 4CRIA 1YHQT 3OW2P 3OSVA 4FM4B 2KSSA 5EC7A 3V7SA 1N6AA 1VQ7A 1VQLA 5AT1B 2JTEA 4GY5A 4OB3B 1GCQC 2DTHA 1ARKA 1KG1A 3C0CA 2Y4XA 2ZPFB 3FDRA 2HQEA 4LDWA 3MP6A 4A4GA 2K9GA 1MMDA 3CD6Q 4M75E 3TU4K 1YJNA 1VQ6T 2DTOA 2LJ0A 1Q7YC 1TH7A 5CK9A 3DB4A 5J26A 3JCMX 3JCMd 1G3SA 4IUVA 1GXIE 2CH4A 1T3SA 2HZYA 2RQVA 4J9CA 3CMAQ 5LJ3g 2YHTA 1YIJQ 3M0QA 1YI2T 1VQ8T 1G3WA 2FYKA 1BBZA 5GAN3 2EYWA 1VQ9T 2QTVA 3OYBA 3EGXA 3RERA 1FXXA 1AD5A 4IKFA 3JB9F 4IUTA 3ZFJA 3M0UA 2E6ZA 2O01E 2GNCA 2F2XA 5IHNA 3C94A 3EAEA 3MCAB 1YJWQ 2YUQA 2M51A 3JCMV 2RH2A 2E12A 3EG9A 5D6WA 2DMOA 3JCMf 4C92A 3PMTA 1WGSA 4PJOE 4Z02A 2MIOA 3CXCA 3M59A 4MMLA 2PQWA 1N8RR 3M0RA 3UA6A 5KCOA 4J83A 2H8HA 2PU9B 4RMOA 4R55A 1VYUA 5LJ3h 2LT4A 1NG2A 4C8QF 5GMKl 2JW4A 3CCEQ 4LN2A 1YIJA 3CD6T 2XD0A 4J8OA 1QVPA 1WHGA 1RAHB 2X4WA 1U1TA 2NYSA 4M78G 2KNBB 3HRSA 4PL6A 8ATCB 3M58A 2X4XA 2RHZA 3RR6A 4BE0A 1W1FA 2DM1A 1KC8R 4KGVB 1M1KR 4A4FA 2FZCB 1KC8C 2EJFA 3MKDA 4E6RA 4EMKC 4MZPA 2EQKA 4M75B 2D8JA 3OYGA 4ZN3A 4VUBA 4M7AB 1WPYA 3P8HA 3HKSA 2FZKB 1OU9A 1VQMQ 2OTJT 1K8AU 3LH5A 5A0DA 1PC0A 1EFNA 3EG9B 3IQLA 4AMCA 3LGLA 3S3OA 3ZBDA 4M78F 4X9CA 1QP2A 3MHXA 4M7AA 2RI3A 3M4GA 3I56A 1UEBA 1QWEA 3P8BB 3KXTA 4C8QB 3G4SQ 1F1BB 3HTRA 2AT1B 1VQ4A 3OYKA 4QT7A 3DLLA 1KQ2A 3EH2A 5GJWB 1X75C 2EPDA 1K73C 2ENMA 4XTYA 3CCQQ 3QZ5B 2Y4YA 2DBKA 2AIRB 1WIEA 1BCMA 1OX9A 1M1FA 4J7IA 2QG9B 3OQ5A 2YLCA 1NJIU 3VU3C 4UC4A 4AG1C 2GFAA 5IN1A 3J81E 1SHFA 2KRMA 3A8MB 2G6FX 4OB1B 1NLPC 2MI6A 2OAWA 2VASA 2RJEA 1FWZA 3QPHA 3VS5A 1HK9A 3X24B 2VGNA 4A63B 5CQYA 1VQNQ 1UTIA 1BI1A 2HSEB 5KYXA 2AKKA 2YT6A 2ZCFB 2J6OA 2NUTB 3HRTA 2CT4A 4AFUC 2K57A 3S6WA 1NPRA 2YLBA 2CP2A 4M7DD 2RQRA 4JRIA 4BDZA 5GAN6 4C92G 2COWA 3FEOA 1YJ9Q 5D7UA 1Q7YR 4HKEA 2CZ0B 3MEVA 1ABOA 4A4KA 1VQPT 4FT2A 1WQ7A 2OTLQ 4M7AE 3CXCP 2RQUA 2DVEA 4WTOB 1W6XA 2HCKA 2QQ9A 4C5EA 1JJ2A 3V8KA 1N27A 4J9HA 2RN8A 2IVWA 2KVQG 3CQTA 2X51A 3PMIA 2MOXA 4ORZA 3QWXX 1VQOQ 5CKDA 2D0QB 3I55Q 1GBQA 3VRZA 3CCVQ 2CUBA 4PJOB 1BIBA 1ZQ1A 3HRUA 4N0AC 4Y92A 4FT4A 1KSWA 2CT3A 4JJBA 2HD0A 3QO3A 4E7SA 3GNGA 2JM8A 1C1AA 2VKNA 3JCMc 3I35A 1VQKA 4NL2A 1M8VA 4C0GA 2FPDA 4EMKB 1QVGA 4XTWA 3BDUA 4F14A 1W70A 5LJ3e 3PFSA 1TUDA 1WX6A 2L3QA 3EG2A 2GCXA 3ZEHA 3V8LA 2F5KA 3AT1B 2QA4Q 3CPWP 2HEQA 5GAOn 1C6VX 5FWBA 5GAN5 2EKOA 1D0YA 1P92A 4BI3A 1GCPA 1G8XA 4QVDA 4RG2A 1BI0A 4X1VA 3MEAA 4XTVA 4P5NA 1D1CA 4C0DC 3CCJT 4CC7A 1VQLQ 1WHLA 2M16A 2V8KA 1X2QA 2A36A 4J9IA 1KD1U 5EG2A 2RHYA 3U23A 2LX9A 3RBBB 5GAN8 4JS5A 4E7IA 4N4HA 2L3PA 2JMCA 3A8HB 4M78A 2FPFA 4BACA 3ZL7C 1ZBXA 4R56A 3CC4T 1T3LA 2H3JA 2DA9A 2DJQA 5IHIA 4EIKA 4RUGA 3TSWA 2ZPGB 4ZTFA 2YUPA 2RI2A 4M7AF 4L6V5 1BCOA 3CCEA 4M77C 2DZCA 1R8OB 1YITT 1JRIA 2RQTA 4R0KA 3CMAT 2XU8A 1LOJA 4DOWA 1KD1C 4BY6C 2J6KA 2O2OA 3THKA 1NBEB 1Q82U 2O88A 1RACB 2HQHA 3M9QA 1AVZC 1LVKA 1W2BP 3OYYA 5I22A 1KQSP 2RI5A 1KJWA 3QJ6A 2YRDA 2DJZA 4E7HA 2A7YA 3HFOA 2JOYA 7AT1B 1TUGB 2KQWA 5GMKe 2A0FB 3JCMe 3FJ5A 4XK8E 2EYQA 3H6ZA 4PFZA 1RLQC 3VS3A 4BE1A 5ECAA 3H0IA 1XJWB 5KYNA 2JT4A 4E7JA 1MV3A 4LUEA 4PFPA 1Y96A 3FIFA 2DXUA 1O9SA 3TEEA 2JM9A 2VVKA 2QGFB 3MP8A 4PLLA 3R6NA 1X43A 2RQWA 3OYMA 2P84A 3ASKA 1NE8A 3A8GB 2EYYA 3M0TA 2DO3A 4PFOA 2I0NA 1VYTA 2K2MA 2HL5C 2PVDB 2MPXC 3T9NA 4PJMA 3I56T 1YITQ 4J5YA 3QXEB 2B86A 2DE0X 3UT1A 1U3OA 4M7AC 2HNIA 3OYHA 4M77F 1D3BA 1K9MU 2QQAA 1WHKA 5KH6A 1PM3A 2LCSA 3CMEA 4LUDA 3WXMB 2OAUA 3PGGA 3SEMA 1M1KU 1VQ7T 2EAYA 1GRIA 1UJ0A 1VQPA 4KUDK 2K3YA 4KRTA 1IHWA 1RLPC 3RDVA 2OX7A 1XTDA 2DAQA 2E10A 4M78C 2QQSA 2FVUA 2PZ1A 4C5HA 4L59A 3X25B 1H92A 2JUFA 1I81A 3L2WA 3J80E 3SWNA 4LD9K 4NS5A 5KE3A 3V7CA 2NUTA 5GANh 4A54A 2DK3A 2EQMA 5GAOl 2X3WD 2D6FA 3UATA 1YCSB 5L23A 2XK0A 3N5BB 5CCAA 2QEXT 1JB0E 3A5ZB 4RCBA 2ED1A 3EGDA 4C92E 1M2VA 4OMPA 1TUCA 4F17A 1WZOA 5A2QE 4AG2C 3JV3A 3JB9G 3A8LB 1AWWA 2RPNA 4N4GA 3I55T 4DBQA 3VS6A 4LXCA 2LX7A 5HCKA 3OYEA 1ZA1B 5FW9A 1B3QA 4AT1B 1VQ5A 3OMGA 1PG5B 1MMAA 3EGUA 2ATCB 2VWFA 4FYWB 1VQPQ 3TSZA 2M1HA 2HKNA 3G6EQ 1X69A 1YNZA 1LJOA 3CC2T 1S72T 3QYHB 2OJ2A 1X01A 3L42A 4M7DF 4OMFB 1NEGA 5GJVB 2J05A 1M4ZA 2YDLA 3JB9D 2FG0A 2ZGWA 3INZA 2E41A 1TWBA 5FLXE 5I21A 1RABB 1SRMA 1PD0A 2KRNA 2AZSA 4LD6A 4OGCA 4PJNA 2K3BA 1Q81C 2EBPA 2QEXQ 1NYGA 2L2PA 4C8QA 3OYFA 2J06A 1ZUYA 3VS2A 1UG1A 5FRMA 2CREA 3RESA 5KYWB 2E65A 3M56A 2KEAA 1HJDA 2Z0WA 1YP5A 3QG1A 4BI8B 3CCLA 2B8AA 2QDLA 3G71Q 5IT9E 1WXUA 1IXDA 4HCKA 1X27A 2HKQB 1RAIB 4OF1A 2DERA 1Q7YU 4HT8A 2XDBA 1MNDA 2CP7A 3PVQA 1WXTA 4IURA 1R77A 3H0FA 3CCJA 1SSHA 1JXOA 2G3RA 2VXFA 4JZ4A 4ESRA 1FX7A 3LLRA 2KYMA 1S72A 5CO7A 2K5IA 1M30A 1QVFP 4EPCA 4M7DB 2VV5A 4O5VA 1LNXA 3VUZA 2QQBA 4K11A 2BIVA 4PJOF 3CCQT 3PIOA 3X28B 3JCMP 2YWWA 5GAOq 1MNEA 5M9OA 4QVZA 4IUUA 2DETA 1ZHIA 2FEIA 3E2UA 4AFQC 1AHJB 4NOYA 1M1GA 3G4ST 4AFSC 3HFNA 1YIJT 2RM4A 1R0CB 2EQUA 3HP9A 1RI9A 5HY6A 2E70A 2R5MA 1TOVA 3JCMg 1S72Q 4J7FA 1OX8A 2JS0A 1K73U 3CC2Q 2AK5A 4F7UF 2DD5A 2WSFE 3G6ET 1WLPB 2QYZA 3NMZC 1UGPB 1WJSA 1PRLC 4C0FA 1E6HA 2NWMA 3OYJA 2ZZDA 1YJWA 3LGFA 3A1PA 2P0PA 4HVUA 1UB4A 1EZZB 3EFRA 3QUIA 1UHCA 4XAXB 3SDZA 1ZLMA 2ZPIB 3M0SA 2CKKA 4XU0A 3PNWC 1PKSA 3G71A 4E2FB 1BIAA 4PJJA 3CC4A 2ECZA 3QSUA 2PVOB 5CKBA 4FSSA 1MGQA 3PE0A 2X4JA 4E7ZA 2ABLA 3GLXA 2EKHA 4C92F 4D6WA 4HVVA 2IG0A 1G2BA 2JTMA 2YXYA 3RKWA 3OYNA 1GCQA 5CVIA 2FPEA 3GIBA 5IAYA 4O6JA 1G5VA 4B9XA 4DQ2A 4IUQA 3MEUA 1YBYA 1WXBA 3KUFA 1VA7A 3M4YA 3OYAA 2M9UA 2PVGB 1YJNQ 5KYYA 1KQSA 3HL8A 3O5ZA 1VUBA 3GBQA 1Q82R 4FYXB 3KFVA 2W10A 4Q5WA 4RTZA 5FROA 2CZ1B 3X26B 3SB2A 3NHNA 1UDLA 3VS1A 2EJ9A 3I9QA 1JU5C 2A3LA 3OW2S 1VQLT 4KH0B 2DD4A 2DRMA 4OGEA 1JXMA 3HSBA 2OTLA 4N0AA 1OOTA 3HHTB 2RF0A 2QA4T 1Y0MA 4RG8A 1FYNA 4M7DA 4FSXA 3CEYA 5GANd 1QVFA 2F1LA 1FMVA 2EFIA 1WI7A 2GBQA 1AWOA 1Q86R 3NTIA 4RTYA 1W2BA 4RKUE 3JRZA 2VC8A 2V8JA 4ATOA 1RAFB 1VQ8A 5GMKh 1YN8A 4HCZA 2V1RA 4M75C 1YI2A 2RJCA 2FRYA 1KHCA 2KE9A 3CC7T 1KQSS 5I2MA 5CKHA 1JQQA 4X9DA 2F69A 1IB8A 2RHXA 4KBMB 2XIDA 2D8HA 2DL8A 2CP5A 2MF2A 3VUBA 1PNJA 2JN0A 4M7AG 3PT9A 2OTLT 1ABQA 2J7IA 3BDLA 4ZNXA 1YWPA 5A0GA 1U06A 2RHIA 1YHQQ 1OZ3A 5DM7R 2JNGA 2LRQA 2HAXA 2L0AA 3RUXA 1XNIA 1B34A 1I5OB 1PCXA 2FZGB 4L5GA 1X2KA 2K2VA 5C0MA 1OU8A 1T0HA 2QQRA 5CKFA 1I8FA 5KYUB 1MHNA 1NYFA 3ULRB 3P8DA 4RTUA 1M90R 1VIEA 1M3BA 1S1NA 4OB0B 1VQKQ 4QQDA 4NL3A 1VYVA 5LJ3f 2CS7A 4Z8AA 1KC8U 3MJXA 4JJDA 5I11A 3NTKA 1RAEB 3GP8A 2MWOA 3CCJQ 2ESWA 2DBMA 1YJ9A 3I55A 4GLMA 3EG1A 1QVFS 3SFMA 2LCLA 2F5TX 1M8MA 1K8AR 2DTIA 1O75A 2M0YA 1YWOA 2KI7A 3VJPA 2MCNA 4II1A 2E5KA 2NUPB 3WVDB 2D9TA 2MMPA 4E47A 2R5AA 4DEYA 5GAOp 1HSQA 1V29B 2RNAA 3JB9H 2XDPA 4J6WA 5LJ3d 4BE2A 2P0QA 2DL4A 2CUDA 3L2VA 1NJIC 4KH1B 3CCVT 2DVJA 1CSKA 1M3CA 4XTZA 2VXEA 1X6OA 1M3AA 2ROLA 2EGAA 4J6XA 2IPOB 2EQJA 2OTJQ 1QVGP 1WA7A 2WACA 5LJ5e 2GTOA 1PWTA 4J9BA 2KXDA 1H8KA 2YSQA 3L2QA 2EYXA 2EGCA 2YUNA 2EJGA 1X6GA 2RJFA 1YJ9T 3LWIA 1AWJA 2JTFA 1QKXA 3OBWA 2CSIA 3LYIA 4CI0C 3EHQA 3MP1A 2E4HA 2XMFA 1I4K1 5KYWA 1ZSZA 3VS4A 4QW2A 4MDXA 1H641 4M4ZA 2BZ8A 4FW1A 1MMGA 3CCET 3QYGB 4KULA 5FU7C 2X4YA 3CPFA 1Z9QA 4JRPA 2M02A 4M78E 1SG5A 2CDTA 4B9WA 4XTXA 3G4SA 4QKUA 2E5QA 2XKOC 3R6OA 3L1AA 2AZVA 3EFOA 2ROTA 3C95A 2LJ3A 4MDWA 2DF6A 5LJ5g 1NEBA 1IZ6A 1HD3A 1UGVA 1KIKA 4RTWA 1LCKA 3CBOA 4EMHA 2DNUA 3G71T 3OA6A 2XICA 4M7DG 3KBGA 3OY9A 1ZSZB 5LJ5j 1JEGA 4M75F 4ELZC 2QA4A 1YCYA 4BDYA 3DB3A 3JCMW 2XHCA 3L2UA 3GF5A 1M2VB 5IHKA 4JZ3A 2GTJA 2M0OA 1VQ9Q 1GL5A 3S3MA 2EVRA 5FU6B 4C8QE 1R0BG 3OS1A 3JAME 2KAFA 1OI1A 4ZGJB 3M5AA 2HL3A 2RB6A 3QKJA 3H41A 3AHUA 2H3EB 1G83A 2EWNA 1K0SA 3NGPA 4HA8A 4DA4A 2DX1A 2EYZA 3FLGA 1NM7A 3QBYA 1IREB 2C0OA 4HXJA 1D1AA 1VQ6Q 3G7ZA 1PSEA 2EQIA 5DY9A 3EFSA 4PLIA 5HK0A 1KHIA 3F70A 4M7AD 3QZ9B 2K4YA 4PNOA 4PK4A 4ZN1A 1YFNA 1VQ5T 2LNVA 4M77G 1QCFA 1Y71A 3VYGA 1UGSB 3CCMQ 2CH4W 4M75G 3DLMA 1FMKA 1TSFA 4DBRA 1UECA 2DRKA 2RD1A 4EDUA 2X3XD 3OSSC 1OYXA 2RO0A 5KYYB 3RIRA 1D3BB 3FC3A 3X20B 3BY7A 1IHVA 2LMJA 3NTHA 1ZSGA 1XOVA 2DYBA 5GAOr 2F2VA 5GAN7 2HBWA 3QHSA 1ZX6A 3GOXA 2EGEA 2SEMA 3REBB 2BZXA 6AT1B 3PIPA 5IXFA 2GFUA 4ANJA 3CCRQ 2D0NA 2C06A 2RJDA 1UGRB 2FRWA 1VQMA 3UPUA 1D0ZA 2EW3A 4F7UG 3CC4Q 4JUVA 4QQGA 4M75D 1Y07A 3J7AF 2I2LA 1J3TA 2LQNA 3META 2FB7A 1BK2A 2P0KA 4XTUA 1HXDA 5KE2A 5C6SA 2A08A 2ZAEA 4TVRA 1Y7XA 3SD4A 2E3IA 3CC2A 1CKAA 2WSEE 1YJNT 2NUZA 1WJQA 3OS5A 3EG3A 5HK3A 3DKMA 5GAMf 4RTTA 3CCQA 2NUPA 1OPLA 1B7TA 1VQ6A 2CP6A 2E1HA 5I2SA 3UA7A 1YI2Q 2KBTA 2DL7A 5GMKm 1VQ4Q 4Y28E 4KUIA 1JJ2P 2VYTA 2O9SA 3L2RA 2LZ6B 1M90U 3CMAA 1E6GA 3CXCS 3FJPA 1Z9ZA 4M78B 2KGTA 1OZ2A 2BKDN 4WF2A 5GAOm 3CCLT 2MK5A 9ATCB 1GFCA 1BKBA 1MUZA 4FYYB 4M77E 3L2ZA 4KT0E 2J6FA 4PJOC 2W0ZA 4MZMA 4M77B 2VB6A 1PHTA 2QXFA 1GFDA 2O4XB 3O8VA 3QDFA 2KDSA 2DXCA 5KYUA 2JZ2A 3LWHA 2WSCE 4LDVA 4KGXB 1M2OA 4HT9A 1K9MC 1B34B 2R58A 1SF9A 2HBPA 4JPBW 3LH0A 2C0TA 2K6DA 4OP0A 1RUWA 4M75A 2C0IA 1SRLA 3E1SA 3JCMh 3URGA 4C8QG 2DFUA 3OW2A 3UF4A 4CC2A 3JB9J 1SKUB 4FW2A 4JLGA 5CAIA 1K0XA 1IGQA 4PJOA 1AEYA 2GF7A 3LW5E 4PJLA 4AFZC 3G6EA 5CIUA 5LJ5h 4BUGA 3QDRB 4JRQA 1I07A 3QJYA 4YTLA 1ZA2B 2KMTA 2DXBA 3CCUQ 5CQXA 4IIMA 5FU7B 1RADB 4C5GA 4CC4B 1Q81R 4KGZB 2LTOA 5FWCA 2O4XA 2DKGA 1UGQB 3MO8A 2CZ6B 3OYDA 3RKXA 1IO6A 2GQVA 3G1JA 3CCUT 2KR3A 3D7SB 4LNPA 3VV0A 4FCYA 5GANj 1I0CA 5LJ3j 5DLQE 5KYXB 3E9FA 3SHWA 4HCBA 3QWYA 2LDMA 5J39A 2MWPA 1SEMA 1VQKT 2LC4A 1LPLA 3M53A 2LQWA 4HVWA 3SWNB 1VQOT 2L89A 1JO8A 4E7LA 4FL6A 2QEXA 2D1XA 5GANf 3EGXB 3FRNA 3CC7A 2HDAA 5GMKi 3OBYA 1AZGB 3I5RA 4RTVA 4PJOD 5GMKj 2DZ9A 5FU6C 1K76A 3EG0A 1Y57A 4E7KA 1TG0A 3JCMJ 2FL7A 2QASA 3BFMA 4LDYA 4PJOG 1WHHA 4FU6A 3RNJA 2LP5A 3OMCA 1ZBJA 5A0LA 2JVVA 4C8QD 3JB9I 4M77D 4ME7A 3PVLA 1KD1R 5HKCA 2HMAA 4ZTJA 1KQ1A 2V8IA 1KK7A 2E3HA 1QMCA 4GBQA 4D8DA 1OPKA 2V1QA 1G3TA 1V1CA 3REAB 1W4SA 1QW1A 2JMAA 3EHRA 2OI3A 1I1JA 1D0XA 1K4US 4QVCA 5GAMh 1BB9A 3CPWA 2L5QA 1RAAB 2ZPBB 3NPFA 3OYLA 1VQ4T 3A8OB 1M27C 2LJ1A 1K73R 2DEUA 1SSFA 4OMLA 2V26A 2HQXA 3RMSA 3GNFB 4DOVA 3M0PA 4F7UE 2ZPEB 4B6MA 1UHFA 1MMNA 3FB9A 2K79A 5GAN2 4PKCC 1YHQA 2YUOA 4C92D 1OEBA 2F2WA 1HYOA 4XU2A 2QI2A 4ZGDB 2DYIA 2VGMA 5J3BA 3SWNC 1UUEA 1XQHA 1M90C 2X35A 3NFCA 2COZA 2COYA 3EH1A 3MPUB 3TCJA 2QAZA 3RKYA 4JDSA 4D8KA 2LCCA 4ZGEB 1MV0B 5LJ5d 1Q82C 2GGRA 3TVTA 3I56Q 3OYCA 1U1SA 5L8RE 3VRYA 1N9RA 1WJRA 1QWFA 1WHMA 4DBHA 3A98A 4M77A 1M1KC 1BI3A 1SHGA 4Y91A 1T0JA 1UE9A 1VQMT 1ACMB 1D1BA 3OB9A 3GPLA 1BYMA 2PUOB 2BE9B 5AYFA 3VS7A 3C4SA 1ZSZC 1YITA 4C92B 2KT1A 3C12A 4JRKA 2K3XA 1K9MR 1QKWA 2O31A 1H3HA 2ZPHB 3LX7A 3Q1JA 3CCMT 4Z88A 4J9EA 2JXBA 3TQ7P 1NLOC 2PNIA 1H3ZA 1AT1B 1VQ5Q 5LJ5f 4V2SA 1QP3A 1PKTA 2DEQA 4F16A 2JJ9A 3OYIA 3UDCA 1TXQA 4OMNA 1SPKA 5KCHA 2L8DA 2EIFA 3OS2A 4OVAA 1PD1A 4OB2B 3EFOB 4JS4A 3BE3A 4M7DE 1N8RU 1Q86U 1AWXA 4EMKA 1QQJA 2K5FA 1QCOA 2NLUA 3CPWS 1U8RA 1CKBA 1WFWA 1AOJA 3JCMQ 4C0DB 2LQ8A 1X6BA 1N9SA 4J9GA 1FMWA 3MEWA 1VQOA 2QTXA 4F7UB 2DILA 4MZTA 2K5LA 2KK4A 2P4TA 4X34A 1EIFA 2R57A 1YJWT 4OMQA 4M78D 2YRCA 3M54A 1VOMA 1N8RC 2DIGA 4J9FA 2RA2A 1UFFA 2A37A 4XU1A 4LE9A 4LDXA 2YRVA 4J9DA 1B07A 3ER0A 4F04B 2FHDA 3CMEQ 2XDDA 5LL6S 2MYSA 2SRCA 3PTAA 2MAMA 5D6XA 2L3RA 1VQ8Q 1PSFA 3VYHB 2PTKA 1DJ7B 1Y96B 4ELYC 2HSPA 2DLPA 4BD3A 4MMKA 2BZYA 3S3NA 4JJNK 1IGUA 2BE7D 1OULA 4HCCA 1WNLA 3JCMb 5IXBA 5IH2A 4CC3A 2X9HA 4C0ZA 1JJ2S 1KFZA 1W2BS 1M9SA 3M57A 1EX4A 1BI2A 4RCCA 1RL2A 1U5SA 3CD6A 2LQKA 3RMQA 2LNHB 2IIMA 2A28A 4JLIA 2RHUA 4Z89A 2GQIA 2O9VA 3QIIA 4F7UA 3H0HA 5CR2A 4GLKA 2Y90A 4A4EA 2AKLA 1AZEA 2CGHA 4OMMA 2DPPB 1Q81U 2LT1A 3V8JA 4JJCA 1D09B 1OQKA 4C8QC 1RI0A 5GAMj 1NJIR 1E7OA 3ME9A 2P4RA 3BW1A 1VIFA 2VUBA 3M55A 2BUDA 4A53A 2OTJA 3H8ZA 1C0MA 1OV3A 4C92C 1UJYA 2K7AA 1VQNT 3CCLQ 1ZUKA 3VKIA 3HPWA 1K1ZA 2QGGA 1K9AA 2RMOA 2L3SA 5GAMg 1NZ9A 3CC7Q 1G3YA 3CCSA 1ZUUA 2BTTA 3CCST 2KT8A 1TTHB 3CCRA 5GANe 1Q86C 4FYVB 2ED0A 2CYZB 4WCIA 2KRSA 2JS2A 1TU0B 4LDUA 5DLOA 5GANg 4QQ6A 1PRMC 2CP3A 2KY9A 2DXTA 1BU1A 4C5IA 2KROA 1M5Q1 3OS0A 4EMGA 3UWNA 2LVMA 3TREA 4IUPA 1WDXA 3CMET 4N4IA 5CKEA 3E9GA 1TS9A 2XI9A 3I5SA 1RAGB 4FIBA 2CZ7B 4RTXA 1QVGS 2DIQA 2FO0A 1WYXA 3CCMA 1A0NB 1GBRA 2KYBA 1I5LA 4XU3A 4OMOA 4BY6B 2QK0A 2AHJB 1Q95G 1QCNA 2E64A 3CBPA 1VQ7Q 5FRNA 3E19A 1QLYA 5GAN4 4A4HA 1WQWA 1K8AC 4BI4A 3CCUA 3VS0A 8AT1B 3CCSQ 4XQ3A 5GAMe 3EGDB 2RK1A 2E6NA 2DL5A 3WVEB 1WHJA 1V76A 3CCRT 5GAMd 1VQNA 2DL3A 2CP0A 3JSCA 2PUKB 3CBMA 5D6YA 4DBFA 4J6YA 3CCVA 4M7DC 4DEXA 1JBMA 3H9NA 1N5ZA 2RK2A 1NPPA 2CSQA 2KXCA 3V7RA 4IIOA 1VQ9A 2QDYB 4BB7A
chains in the Genus database with same CATH topology
4JJDA 1I0CA 5I11A 2EYYA 3M0TA 2I0NA 1VYTA 2K2MA 3SHWA 5EC7A 2ESWA 2DBMA 3QWYA 1SEMA 4GLMA 2JTEA 2B86A 2LQWA 2DE0X 3EG1A 1GCQC 1ARKA 1U3OA 3C0CA 4HVWA 1M8MA 1JO8A 2K9GA 2D1XA 2M0YA 1YWOA 2LJ0A 2MCNA 2HDAA 2E5KA 1AZGB 3I5RA 4RTVA 2LCSA 1K76A 3EG0A 1Y57A 4LUDA 1TG0A 4DEYA 1HSQA 2CH4A 2RNAA 3SEMA 1T3SA 1GRIA 2RQVA 1UJ0A 4J9CA 2DL4A 4KRTA 3RNJA 2LP5A 2CUDA 1RLPC 3M0QA 1ZBJA 2DVJA 1CSKA 1M3CA 1BBZA 3PVLA 2EYWA 1M3AA 2PZ1A 2ROLA 2EGAA 1H92A 4GBQA 4D8DA 1WA7A 1OPKA 1AD5A 2V1QA 1V1CA 3REAB 3M0UA 2GTOA 1PWTA 2JMAA 2GNCA 2F2XA 3EHRA 4J9BA 2KXDA 2OI3A 5IHNA 1H8KA 1I1JA 2X3WD 3UATA 1K4US 1YCSB 5L23A 2YSQA 1BB9A 2EYXA 2EGCA 2YUNA 2YUQA 2M51A 1X6GA 2ED1A 3NPFA 1AWJA 1M27C 1QKXA 4OMPA 2CSIA 2DMOA 1TUCA 2LJ1A 4F17A 4AG2C 3JV3A 3EHQA 1AWWA 2XMFA 4OMLA 2RPNA 3VS4A 2MIOA 3M0PA 3VS6A 2LX7A 1UHFA 5HCKA 4M4ZA 2BZ8A 2K79A 3M0RA 2YUOA 3UA6A 5FW9A 1B3QA 1OEBA 2H8HA 2F2WA 1Z9QA 3EGUA 2VWFA 1VYUA 1UUEA 1NG2A 3TSZA 2JW4A 2CDTA 4LN2A 1X69A 1YNZA 4D8KA 2OJ2A 2AZVA 2KNBB 2ROTA 1MV0B 2GGRA 1NEGA 2LJ3A 2J05A 5GJVB 3TVTA 2DF6A 2YDLA 1W1FA 2FG0A 2DM1A 1NEBA 1SRMA 2KRNA 2AZSA 1HD3A 3VRYA 1UGVA 1KIKA 1QWFA 4RTWA 2K3BA 2EBPA 4E6RA 3A98A 1LCKA 1SHGA 1NYGA 2L2PA 2J06A 2DNUA 1ZUYA 1T0JA 1UE9A 3VS2A 2D8JA 1UG1A 2CREA 3VS7A 1JEGA 2KEAA 1HJDA 1YP5A 2KT1A 3LH5A 2QDLA 1EFNA 3IQLA 5IHKA 4JZ3A 2GTJA 1WXUA 1GL5A 1QKWA 2O31A 4HCKA 2EVRA 1X27A 1H3HA 4Z88A 3PVQA 1WXTA 4J9EA 2JXBA 1QWEA 3H0FA 1NLOC 2PNIA 1SSHA 1JXOA 4JZ4A 4ESRA 3H41A 4QT7A 2KYMA 1G83A 1K0SA 3NGPA 5GJWB 1PKTA 2DX1A 4F16A 2EYZA 1M30A 1NM7A 4OMNA 1SPKA 2EPDA 4K11A 2ENMA 2C0OA 4HXJA 2EQIA 2FEIA 1AWXA 4AFQC 2DBKA 1WIEA 1CKBA 1WFWA 1AOJA 4AFSC 1X6BA 1QCFA 4J9GA 2CH4W 1FMKA 1RI9A 4AG1C 1SHFA 2KRMA 1UECA 2DRKA 2G6FX 2DILA 1NLPC 2X3XD 2OAWA 2JS0A 2AK5A 4OMQA 2LMJA 3VS5A 1WLPB 3NMZC 1ZSGA 1XOVA 2DYBA 1PRLC 2F2VA 2HBWA 1ZX6A 1E6HA 2NWMA 2EGEA 4J9FA 1UFFA 2A37A 2SEMA 4LE9A 3REBB 2BZXA 4A63B 4J9DA 1UTIA 4HVUA 1B07A 5IXFA 1UHCA 2AKKA 2D0NA 2YT6A 1ZLMA 2J6OA 2SRCA 3M0SA 2FRWA 2EW3A 2CT4A 4AFUC 1PKSA 2ECZA 2PTKA 4FSSA 2RQRA 1J3TA 2LQNA 3PE0A 2HSPA 2DLPA 2ABLA 2BZYA 2EKHA 1BK2A 4HVVA 5IXBA 1G2BA 2A08A 5IH2A 4CC3A 1ABOA 1KFZA 1GCQA 2RQUA 2FPEA 1W6XA 1CKAA 2HCKA 2NUZA 1U5SA 4J9HA 2RN8A 3EG3A 3CQTA 2LNHB 2MOXA 4ORZA 4RTTA 1WXBA 3QWXX 2IIMA 1VA7A 2A28A 1OPLA 4Z89A 1GBQA 3O5ZA 2GQIA 3GBQA 3VRZA 3KFVA 2W10A 2O9VA 4RTZA 2CUBA 3H0HA 3UA7A 2KBTA 4Y92A 1KSWA 2CT3A 3NHNA 4JJBA 1UDLA 2DL7A 3VS1A 2JM8A 2AKLA 1AZEA 3I9QA 2VKNA 4OMMA 1JU5C 3I35A 4JJCA 2FPDA 2O9SA 2DRMA 1JXMA 2LZ6B 1E7OA 1E6GA 2P4RA 4F14A 1OOTA 1W70A 1TUDA 1Z9ZA 2KGTA 1WX6A 2L3QA 3EG2A 2RF0A 1Y0MA 1GFCA 1OV3A 1UJYA 1FYNA 2K7AA 2HEQA 1MUZA 1ZUKA 1K1ZA 5FWBA 1K9AA 2RMOA 2L3SA 1GCPA 2J6FA 2W0ZA 4X1VA 1WI7A 1ZUUA 2GBQA 1AWOA 2BTTA 2KT8A 4RTYA 4CC7A 1PHTA 1GFDA 1X2QA 2A36A 2ED0A 4J9IA 4WCIA 2KRSA 3RBBB 3U23A 1YN8A 2V1RA 2JS2A 2FRYA 2L3PA 2KE9A 2JMCA 1PRMC 2FPFA 1BU1A 3ZL7C 1T3LA 2KROA 1JQQA 2DA9A 4JPBW 2C0TA 1WDXA 2DJQA 2K6DA 5IHIA 4EIKA 4RUGA 3TSWA 1RUWA 3I5SA 2C0IA 2YUPA 1SRLA 2D8HA 4RTXA 2DL8A 2FO0A 1WYXA 1A0NB 1PNJA 1GBRA 3UF4A 4CC2A 2KYBA 1ABQA 1K0XA 2RQTA 4R0KA 4OMOA 1AEYA 2J7IA 2J6KA 2O2OA 4AFZC 4ZNXA 1YWPA 1U06A 3THKA 1QLYA 1I07A 2O88A 2L0AA 1AVZC 3VS0A 5I22A 1X2KA 1KJWA 4IIMA 1T0HA 2DL5A 4CC4B 5FWCA 2DL3A 1NYFA 3ULRB 3FJ5A 4RTUA 1RLQC 3VS3A 5ECAA 3H0IA 1M3BA 1S1NA 1IO6A 2JT4A 4DEXA 1MV3A 4LUEA 1N5ZA 2JM9A 2VVKA 2KR3A 2CSQA 2KXCA 4IIOA 4LNPA 1VYVA 3R6NA 1X43A 2RQWA 4Z8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJD A;  1I0C A;  5I11 A;  2EYY A;  3M0T A;  2I0N A;  1VYT A;  2K2M A;  3SHW A;  5EC7 A;  2ESW A;  2DBM A;  3QWY A;  1SEM A;  4GLM A;  2JTE A;  2B86 A;  2LQW A;  2DE0 X;  3EG1 A;  1GCQ C;  1ARK A;  1U3O A;  3C0C A;  4HVW A;  1M8M A;  1JO8 A;  2K9G A;  2D1X A;  2M0Y A;  1YWO A;  2LJ0 A;  2MCN A;  2HDA A;  2E5K A;  1AZG B;  3I5R A;  4RTV A;  2LCS A;  1K76 A;  3EG0 A;  1Y57 A;  4LUD A;  1TG0 A;  4DEY A;  1HSQ A;  2CH4 A;  2RNA A;  3SEM A;  1T3S A;  1GRI A;  2RQV A;  1UJ0 A;  4J9C A;  2DL4 A;  4KRT A;  3RNJ A;  2LP5 A;  2CUD A;  1RLP C;  3M0Q A;  1ZBJ A;  2DVJ A;  1CSK A;  1M3C A;  1BBZ A;  3PVL A;  2EYW A;  1M3A A;  2PZ1 A;  2ROL A;  2EGA A;  1H92 A;  4GBQ A;  4D8D A;  1WA7 A;  1OPK A;  1AD5 A;  2V1Q A;  1V1C A;  3REA B;  3M0U A;  2GTO A;  1PWT A;  2JMA A;  2GNC A;  2F2X A;  3EHR A;  4J9B A;  2KXD A;  2OI3 A;  5IHN A;  1H8K A;  1I1J A;  2X3W D;  3UAT A;  1K4U S;  1YCS B;  5L23 A;  2YSQ A;  1BB9 A;  2EYX A;  2EGC A;  2YUN A;  2YUQ A;  2M51 A;  1X6G A;  2ED1 A;  3NPF A;  1AWJ A;  1M27 C;  1QKX A;  4OMP A;  2CSI A;  2DMO A;  1TUC A;  2LJ1 A;  4F17 A;  4AG2 C;  3JV3 A;  3EHQ A;  1AWW A;  2XMF A;  4OML A;  2RPN A;  3VS4 A;  2MIO A;  3M0P A;  3VS6 A;  2LX7 A;  1UHF A;  5HCK A;  4M4Z A;  2BZ8 A;  2K79 A;  3M0R A;  2YUO A;  3UA6 A;  5FW9 A;  1B3Q A;  1OEB A;  2H8H A;  2F2W A;  1Z9Q A;  3EGU A;  2VWF A;  1VYU A;  1UUE A;  1NG2 A;  3TSZ A;  2JW4 A;  2CDT A;  4LN2 A;  1X69 A;  1YNZ A;  4D8K A;  2OJ2 A;  2AZV A;  2KNB B;  2ROT A;  1MV0 B;  2GGR A;  1NEG A;  2LJ3 A;  2J05 A;  5GJV B;  3TVT A;  2DF6 A;  2YDL A;  1W1F A;  2FG0 A;  2DM1 A;  1NEB A;  1SRM A;  2KRN A;  2AZS A;  1HD3 A;  3VRY A;  1UGV A;  1KIK A;  1QWF A;  4RTW A;  2K3B A;  2EBP A;  4E6R A;  3A98 A;  1LCK A;  1SHG A;  1NYG A;  2L2P A;  2J06 A;  2DNU A;  1ZUY A;  1T0J A;  1UE9 A;  3VS2 A;  2D8J A;  1UG1 A;  2CRE A;  3VS7 A;  1JEG A;  2KEA A;  1HJD A;  1YP5 A;  2KT1 A;  3LH5 A;  2QDL A;  1EFN A;  3IQL A;  5IHK A;  4JZ3 A;  2GTJ A;  1WXU A;  1GL5 A;  1QKW A;  2O31 A;  4HCK A;  2EVR A;  1X27 A;  1H3H A;  4Z88 A;  3PVQ A;  1WXT A;  4J9E A;  2JXB A;  1QWE A;  3H0F A;  1NLO C;  2PNI A;  1SSH A;  1JXO A;  4JZ4 A;  4ESR A;  3H41 A;  4QT7 A;  2KYM A;  1G83 A;  1K0S A;  3NGP A;  5GJW B;  1PKT A;  2DX1 A;  4F16 A;  2EYZ A;  1M30 A;  1NM7 A;  4OMN A;  1SPK A;  2EPD A;  4K11 A;  2ENM A;  2C0O A;  4HXJ A;  2EQI A;  2FEI A;  1AWX A;  4AFQ C;  2DBK A;  1WIE A;  1CKB A;  1WFW A;  1AOJ A;  4AFS C;  1X6B A;  1QCF A;  4J9G A;  2CH4 W;  1FMK A;  1RI9 A;  4AG1 C;  1SHF A;  2KRM A;  1UEC A;  2DRK A;  2G6F X;  2DIL A;  1NLP C;  2X3X D;  2OAW A;  2JS0 A;  2AK5 A;  4OMQ A;  2LMJ A;  3VS5 A;  1WLP B;  3NMZ C;  1ZSG A;  1XOV A;  2DYB A;  1PRL C;  2F2V A;  2HBW A;  1ZX6 A;  1E6H A;  2NWM A;  2EGE A;  4J9F A;  1UFF A;  2A37 A;  2SEM A;  4LE9 A;  3REB B;  2BZX A;  4A63 B;  4J9D A;  1UTI A;  4HVU A;  1B07 A;  5IXF A;  1UHC A;  2AKK A;  2D0N A;  2YT6 A;  1ZLM A;  2J6O A;  2SRC A;  3M0S A;  2FRW A;  2EW3 A;  2CT4 A;  4AFU C;  1PKS A;  2ECZ A;  2PTK A;  4FSS A;  2RQR A;  1J3T A;  2LQN A;  3PE0 A;  2HSP A;  2DLP A;  2ABL A;  2BZY A;  2EKH A;  1BK2 A;  4HVV A;  5IXB A;  1G2B A;  2A08 A;  5IH2 A;  4CC3 A;  1ABO A;  1KFZ A;  1GCQ A;  2RQU A;  2FPE A;  1W6X A;  1CKA A;  2HCK A;  2NUZ A;  1U5S A;  4J9H A;  2RN8 A;  3EG3 A;  3CQT A;  2LNH B;  2MOX A;  4ORZ A;  4RTT A;  1WXB A;  3QWX X;  2IIM A;  1VA7 A;  2A28 A;  1OPL A;  4Z89 A;  1GBQ A;  3O5Z A;  2GQI A;  3GBQ A;  3VRZ A;  3KFV A;  2W10 A;  2O9V A;  4RTZ A;  2CUB A;  3H0H A;  3UA7 A;  2KBT A;  4Y92 A;  1KSW A;  2CT3 A;  3NHN A;  4JJB A;  1UDL A;  2DL7 A;  3VS1 A;  2JM8 A;  2AKL A;  1AZE A;  3I9Q A;  2VKN A;  4OMM A;  1JU5 C;  3I35 A;  4JJC A;  2FPD A;  2O9S A;  2DRM A;  1JXM A;  2LZ6 B;  1E7O A;  1E6G A;  2P4R A;  4F14 A;  1OOT A;  1W70 A;  1TUD A;  1Z9Z A;  2KGT A;  1WX6 A;  2L3Q A;  3EG2 A;  2RF0 A;  1Y0M A;  1GFC A;  1OV3 A;  1UJY A;  1FYN A;  2K7A A;  2HEQ A;  1MUZ A;  1ZUK A;  1K1Z A;  5FWB A;  1K9A A;  2RMO A;  2L3S A;  1GCP A;  2J6F A;  2W0Z A;  4X1V A;  1WI7 A;  1ZUU A;  2GBQ A;  1AWO A;  2BTT A;  2KT8 A;  4RTY A;  4CC7 A;  1PHT A;  1GFD A;  1X2Q A;  2A36 A;  2ED0 A;  4J9I A;  4WCI A;  2KRS A;  3RBB B;  3U23 A;  1YN8 A;  2V1R A;  2JS2 A;  2FRY A;  2L3P A;  2KE9 A;  2JMC A;  1PRM C;  2FPF A;  1BU1 A;  3ZL7 C;  1T3L A;  2KRO A;  1JQQ A;  2DA9 A;  4JPB W;  2C0T A;  1WDX A;  2DJQ A;  2K6D A;  5IHI A;  4EIK A;  4RUG A;  3TSW A;  1RUW A;  3I5S A;  2C0I A;  2YUP A;  1SRL A;  2D8H A;  4RTX A;  2DL8 A;  2FO0 A;  1WYX A;  1A0N B;  1PNJ A;  1GBR A;  3UF4 A;  4CC2 A;  2KYB A;  1ABQ A;  1K0X A;  2RQT A;  4R0K A;  4OMO A;  1AEY A;  2J7I A;  2J6K A;  2O2O A;  4AFZ C;  4ZNX A;  1YWP A;  1U06 A;  3THK A;  1QLY A;  1I07 A;  2O88 A;  2L0A A;  1AVZ C;  3VS0 A;  5I22 A;  1X2K A;  1KJW A;  4IIM A;  1T0H A;  2DL5 A;  4CC4 B;  5FWC A;  2DL3 A;  1NYF A;  3ULR B;  3FJ5 A;  4RTU A;  1RLQ C;  3VS3 A;  5ECA A;  3H0I A;  1M3B A;  1S1N A;  1IO6 A;  2JT4 A;  4DEX A;  1MV3 A;  4LUE A;  1N5Z A;  2JM9 A;  2VVK A;  2KR3 A;  2CSQ A;  2KXC A;  4IIO A;  4LNP A;  1VYV A;  3R6N A;  1X43 A;  2RQW A;  4Z8A A; 
#chains in the Genus database with same CATH topology
 1IRX A;  2XG8 D;  4CRI A;  1YHQ T;  3OW2 P;  3OSV A;  4FM4 B;  2KSS A;  5EC7 A;  3V7S A;  1N6A A;  1VQ7 A;  1VQL A;  5AT1 B;  2JTE A;  4GY5 A;  4OB3 B;  1GCQ C;  2DTH A;  1ARK A;  1KG1 A;  3C0C A;  2Y4X A;  2ZPF B;  3FDR A;  2HQE A;  4LDW A;  3MP6 A;  4A4G A;  2K9G A;  1MMD A;  3CD6 Q;  4M75 E;  3TU4 K;  1YJN A;  1VQ6 T;  2DTO A;  2LJ0 A;  1Q7Y C;  1TH7 A;  5CK9 A;  3DB4 A;  5J26 A;  3JCM X;  3JCM d;  1G3S A;  4IUV A;  1GXI E;  2CH4 A;  1T3S A;  2HZY A;  2RQV A;  4J9C A;  3CMA Q;  5LJ3 g;  2YHT A;  1YIJ Q;  3M0Q A;  1YI2 T;  1VQ8 T;  1G3W A;  2FYK A;  1BBZ A;  5GAN 3;  2EYW A;  1VQ9 T;  2QTV A;  3OYB A;  3EGX A;  3RER A;  1FXX A;  1AD5 A;  4IKF A;  3JB9 F;  4IUT A;  3ZFJ A;  3M0U A;  2E6Z A;  2O01 E;  2GNC A;  2F2X A;  5IHN A;  3C94 A;  3EAE A;  3MCA B;  1YJW Q;  2YUQ A;  2M51 A;  3JCM V;  2RH2 A;  2E12 A;  3EG9 A;  5D6W A;  2DMO A;  3JCM f;  4C92 A;  3PMT A;  1WGS A;  4PJO E;  4Z02 A;  2MIO A;  3CXC A;  3M59 A;  4MML A;  2PQW A;  1N8R R;  3M0R A;  3UA6 A;  5KCO A;  4J83 A;  2H8H A;  2PU9 B;  4RMO A;  4R55 A;  1VYU A;  5LJ3 h;  2LT4 A;  1NG2 A;  4C8Q F;  5GMK l;  2JW4 A;  3CCE Q;  4LN2 A;  1YIJ A;  3CD6 T;  2XD0 A;  4J8O A;  1QVP A;  1WHG A;  1RAH B;  2X4W A;  1U1T A;  2NYS A;  4M78 G;  2KNB B;  3HRS A;  4PL6 A;  8ATC B;  3M58 A;  2X4X A;  2RHZ A;  3RR6 A;  4BE0 A;  1W1F A;  2DM1 A;  1KC8 R;  4KGV B;  1M1K R;  4A4F A;  2FZC B;  1KC8 C;  2EJF A;  3MKD A;  4E6R A;  4EMK C;  4MZP A;  2EQK A;  4M75 B;  2D8J A;  3OYG A;  4ZN3 A;  4VUB A;  4M7A B;  1WPY A;  3P8H A;  3HKS A;  2FZK B;  1OU9 A;  1VQM Q;  2OTJ T;  1K8A U;  3LH5 A;  5A0D A;  1PC0 A;  1EFN A;  3EG9 B;  3IQL A;  4AMC A;  3LGL A;  3S3O A;  3ZBD A;  4M78 F;  4X9C A;  1QP2 A;  3MHX A;  4M7A A;  2RI3 A;  3M4G A;  3I56 A;  1UEB A;  1QWE A;  3P8B B;  3KXT A;  4C8Q B;  3G4S Q;  1F1B B;  3HTR A;  2AT1 B;  1VQ4 A;  3OYK A;  4QT7 A;  3DLL A;  1KQ2 A;  3EH2 A;  5GJW B;  1X75 C;  2EPD A;  1K73 C;  2ENM A;  4XTY A;  3CCQ Q;  3QZ5 B;  2Y4Y A;  2DBK A;  2AIR B;  1WIE A;  1BCM A;  1OX9 A;  1M1F A;  4J7I A;  2QG9 B;  3OQ5 A;  2YLC A;  1NJI U;  3VU3 C;  4UC4 A;  4AG1 C;  2GFA A;  5IN1 A;  3J81 E;  1SHF A;  2KRM A;  3A8M B;  2G6F X;  4OB1 B;  1NLP C;  2MI6 A;  2OAW A;  2VAS A;  2RJE A;  1FWZ A;  3QPH A;  3VS5 A;  1HK9 A;  3X24 B;  2VGN A;  4A63 B;  5CQY A;  1VQN Q;  1UTI A;  1BI1 A;  2HSE B;  5KYX A;  2AKK A;  2YT6 A;  2ZCF B;  2J6O A;  2NUT B;  3HRT A;  2CT4 A;  4AFU C;  2K57 A;  3S6W A;  1NPR A;  2YLB A;  2CP2 A;  4M7D D;  2RQR A;  4JRI A;  4BDZ A;  5GAN 6;  4C92 G;  2COW A;  3FEO A;  1YJ9 Q;  5D7U A;  1Q7Y R;  4HKE A;  2CZ0 B;  3MEV A;  1ABO A;  4A4K A;  1VQP T;  4FT2 A;  1WQ7 A;  2OTL Q;  4M7A E;  3CXC P;  2RQU A;  2DVE A;  4WTO B;  1W6X A;  2HCK A;  2QQ9 A;  4C5E A;  1JJ2 A;  3V8K A;  1N27 A;  4J9H A;  2RN8 A;  2IVW A;  2KVQ G;  3CQT A;  2X51 A;  3PMI A;  2MOX A;  4ORZ A;  3QWX X;  1VQO Q;  5CKD A;  2D0Q B;  3I55 Q;  1GBQ A;  3VRZ A;  3CCV Q;  2CUB A;  4PJO B;  1BIB A;  1ZQ1 A;  3HRU A;  4N0A C;  4Y92 A;  4FT4 A;  1KSW A;  2CT3 A;  4JJB A;  2HD0 A;  3QO3 A;  4E7S A;  3GNG A;  2JM8 A;  1C1A A;  2VKN A;  3JCM c;  3I35 A;  1VQK A;  4NL2 A;  1M8V A;  4C0G A;  2FPD A;  4EMK B;  1QVG A;  4XTW A;  3BDU A;  4F14 A;  1W70 A;  5LJ3 e;  3PFS A;  1TUD A;  1WX6 A;  2L3Q A;  3EG2 A;  2GCX A;  3ZEH A;  3V8L A;  2F5K A;  3AT1 B;  2QA4 Q;  3CPW P;  2HEQ A;  5GAO n;  1C6V X;  5FWB A;  5GAN 5;  2EKO A;  1D0Y A;  1P92 A;  4BI3 A;  1GCP A;  1G8X A;  4QVD A;  4RG2 A;  1BI0 A;  4X1V A;  3MEA A;  4XTV A;  4P5N A;  1D1C A;  4C0D C;  3CCJ T;  4CC7 A;  1VQL Q;  1WHL A;  2M16 A;  2V8K A;  1X2Q A;  2A36 A;  4J9I A;  1KD1 U;  5EG2 A;  2RHY A;  3U23 A;  2LX9 A;  3RBB B;  5GAN 8;  4JS5 A;  4E7I A;  4N4H A;  2L3P A;  2JMC A;  3A8H B;  4M78 A;  2FPF A;  4BAC A;  3ZL7 C;  1ZBX A;  4R56 A;  3CC4 T;  1T3L A;  2H3J A;  2DA9 A;  2DJQ A;  5IHI A;  4EIK A;  4RUG A;  3TSW A;  2ZPG B;  4ZTF A;  2YUP A;  2RI2 A;  4M7A F;  4L6V 5;  1BCO A;  3CCE A;  4M77 C;  2DZC A;  1R8O B;  1YIT T;  1JRI A;  2RQT A;  4R0K A;  3CMA T;  2XU8 A;  1LOJ A;  4DOW A;  1KD1 C;  4BY6 C;  2J6K A;  2O2O A;  3THK A;  1NBE B;  1Q82 U;  2O88 A;  1RAC B;  2HQH A;  3M9Q A;  1AVZ C;  1LVK A;  1W2B P;  3OYY A;  5I22 A;  1KQS P;  2RI5 A;  1KJW A;  3QJ6 A;  2YRD A;  2DJZ A;  4E7H A;  2A7Y A;  3HFO A;  2JOY A;  7AT1 B;  1TUG B;  2KQW A;  5GMK e;  2A0F B;  3JCM e;  3FJ5 A;  4XK8 E;  2EYQ A;  3H6Z A;  4PFZ A;  1RLQ C;  3VS3 A;  4BE1 A;  5ECA A;  3H0I A;  1XJW B;  5KYN A;  2JT4 A;  4E7J A;  1MV3 A;  4LUE A;  4PFP A;  1Y96 A;  3FIF A;  2DXU A;  1O9S A;  3TEE A;  2JM9 A;  2VVK A;  2QGF B;  3MP8 A;  4PLL A;  3R6N A;  1X43 A;  2RQW A;  3OYM A;  2P84 A;  3ASK A;  1NE8 A;  3A8G B;  2EYY A;  3M0T A;  2DO3 A;  4PFO A;  2I0N A;  1VYT A;  2K2M A;  2HL5 C;  2PVD B;  2MPX C;  3T9N A;  4PJM A;  3I56 T;  1YIT Q;  4J5Y A;  3QXE B;  2B86 A;  2DE0 X;  3UT1 A;  1U3O A;  4M7A C;  2HNI A;  3OYH A;  4M77 F;  1D3B A;  1K9M U;  2QQA A;  1WHK A;  5KH6 A;  1PM3 A;  2LCS A;  3CME A;  4LUD A;  3WXM B;  2OAU A;  3PGG A;  3SEM A;  1M1K U;  1VQ7 T;  2EAY A;  1GRI A;  1UJ0 A;  1VQP A;  4KUD K;  2K3Y A;  4KRT A;  1IHW A;  1RLP C;  3RDV A;  2OX7 A;  1XTD A;  2DAQ A;  2E10 A;  4M78 C;  2QQS A;  2FVU A;  2PZ1 A;  4C5H A;  4L59 A;  3X25 B;  1H92 A;  2JUF A;  1I81 A;  3L2W A;  3J80 E;  3SWN A;  4LD9 K;  4NS5 A;  5KE3 A;  3V7C A;  2NUT A;  5GAN h;  4A54 A;  2DK3 A;  2EQM A;  5GAO l;  2X3W D;  2D6F A;  3UAT A;  1YCS B;  5L23 A;  2XK0 A;  3N5B B;  5CCA A;  2QEX T;  1JB0 E;  3A5Z B;  4RCB A;  2ED1 A;  3EGD A;  4C92 E;  1M2V A;  4OMP A;  1TUC A;  4F17 A;  1WZO A;  5A2Q E;  4AG2 C;  3JV3 A;  3JB9 G;  3A8L B;  1AWW A;  2RPN A;  4N4G A;  3I55 T;  4DBQ A;  3VS6 A;  4LXC A;  2LX7 A;  5HCK A;  3OYE A;  1ZA1 B;  5FW9 A;  1B3Q A;  4AT1 B;  1VQ5 A;  3OMG A;  1PG5 B;  1MMA A;  3EGU A;  2ATC B;  2VWF A;  4FYW B;  1VQP Q;  3TSZ A;  2M1H A;  2HKN A;  3G6E Q;  1X69 A;  1YNZ A;  1LJO A;  3CC2 T;  1S72 T;  3QYH B;  2OJ2 A;  1X01 A;  3L42 A;  4M7D F;  4OMF B;  1NEG A;  5GJV B;  2J05 A;  1M4Z A;  2YDL A;  3JB9 D;  2FG0 A;  2ZGW A;  3INZ A;  2E41 A;  1TWB A;  5FLX E;  5I21 A;  1RAB B;  1SRM A;  1PD0 A;  2KRN A;  2AZS A;  4LD6 A;  4OGC A;  4PJN A;  2K3B A;  1Q81 C;  2EBP A;  2QEX Q;  1NYG A;  2L2P A;  4C8Q A;  3OYF A;  2J06 A;  1ZUY A;  3VS2 A;  1UG1 A;  5FRM A;  2CRE A;  3RES A;  5KYW B;  2E65 A;  3M56 A;  2KEA A;  1HJD A;  2Z0W A;  1YP5 A;  3QG1 A;  4BI8 B;  3CCL A;  2B8A A;  2QDL A;  3G71 Q;  5IT9 E;  1WXU A;  1IXD A;  4HCK A;  1X27 A;  2HKQ B;  1RAI B;  4OF1 A;  2DER A;  1Q7Y U;  4HT8 A;  2XDB A;  1MND A;  2CP7 A;  3PVQ A;  1WXT A;  4IUR A;  1R77 A;  3H0F A;  3CCJ A;  1SSH A;  1JXO A;  2G3R A;  2VXF A;  4JZ4 A;  4ESR A;  1FX7 A;  3LLR A;  2KYM A;  1S72 A;  5CO7 A;  2K5I A;  1M30 A;  1QVF P;  4EPC A;  4M7D B;  2VV5 A;  4O5V A;  1LNX A;  3VUZ A;  2QQB A;  4K11 A;  2BIV A;  4PJO F;  3CCQ T;  3PIO A;  3X28 B;  3JCM P;  2YWW A;  5GAO q;  1MNE A;  5M9O A;  4QVZ A;  4IUU A;  2DET A;  1ZHI A;  2FEI A;  3E2U A;  4AFQ C;  1AHJ B;  4NOY A;  1M1G A;  3G4S T;  4AFS C;  3HFN A;  1YIJ T;  2RM4 A;  1R0C B;  2EQU A;  3HP9 A;  1RI9 A;  5HY6 A;  2E70 A;  2R5M A;  1TOV A;  3JCM g;  1S72 Q;  4J7F A;  1OX8 A;  2JS0 A;  1K73 U;  3CC2 Q;  2AK5 A;  4F7U F;  2DD5 A;  2WSF E;  3G6E T;  1WLP B;  2QYZ A;  3NMZ C;  1UGP B;  1WJS A;  1PRL C;  4C0F A;  1E6H A;  2NWM A;  3OYJ A;  2ZZD A;  1YJW A;  3LGF A;  3A1P A;  2P0P A;  4HVU A;  1UB4 A;  1EZZ B;  3EFR A;  3QUI A;  1UHC A;  4XAX B;  3SDZ A;  1ZLM A;  2ZPI B;  3M0S A;  2CKK A;  4XU0 A;  3PNW C;  1PKS A;  3G71 A;  4E2F B;  1BIA A;  4PJJ A;  3CC4 A;  2ECZ A;  3QSU A;  2PVO B;  5CKB A;  4FSS A;  1MGQ A;  3PE0 A;  2X4J A;  4E7Z A;  2ABL A;  3GLX A;  2EKH A;  4C92 F;  4D6W A;  4HVV A;  2IG0 A;  1G2B A;  2JTM A;  2YXY A;  3RKW A;  3OYN A;  1GCQ A;  5CVI A;  2FPE A;  3GIB A;  5IAY A;  4O6J A;  1G5V A;  4B9X A;  4DQ2 A;  4IUQ A;  3MEU A;  1YBY A;  1WXB A;  3KUF A;  1VA7 A;  3M4Y A;  3OYA A;  2M9U A;  2PVG B;  1YJN Q;  5KYY A;  1KQS A;  3HL8 A;  3O5Z A;  1VUB A;  3GBQ A;  1Q82 R;  4FYX B;  3KFV A;  2W10 A;  4Q5W A;  4RTZ A;  5FRO A;  2CZ1 B;  3X26 B;  3SB2 A;  3NHN A;  1UDL A;  3VS1 A;  2EJ9 A;  3I9Q A;  1JU5 C;  2A3L A;  3OW2 S;  1VQL T;  4KH0 B;  2DD4 A;  2DRM A;  4OGE A;  1JXM A;  3HSB A;  2OTL A;  4N0A A;  1OOT A;  3HHT B;  2RF0 A;  2QA4 T;  1Y0M A;  4RG8 A;  1FYN A;  4M7D A;  4FSX A;  3CEY A;  5GAN d;  1QVF A;  2F1L A;  1FMV A;  2EFI A;  1WI7 A;  2GBQ A;  1AWO A;  1Q86 R;  3NTI A;  4RTY A;  1W2B A;  4RKU E;  3JRZ A;  2VC8 A;  2V8J A;  4ATO A;  1RAF B;  1VQ8 A;  5GMK h;  1YN8 A;  4HCZ A;  2V1R A;  4M75 C;  1YI2 A;  2RJC A;  2FRY A;  1KHC A;  2KE9 A;  3CC7 T;  1KQS S;  5I2M A;  5CKH A;  1JQQ A;  4X9D A;  2F69 A;  1IB8 A;  2RHX A;  4KBM B;  2XID A;  2D8H A;  2DL8 A;  2CP5 A;  2MF2 A;  3VUB A;  1PNJ A;  2JN0 A;  4M7A G;  3PT9 A;  2OTL T;  1ABQ A;  2J7I A;  3BDL A;  4ZNX A;  1YWP A;  5A0G A;  1U06 A;  2RHI A;  1YHQ Q;  1OZ3 A;  5DM7 R;  2JNG A;  2LRQ A;  2HAX A;  2L0A A;  3RUX A;  1XNI A;  1B34 A;  1I5O B;  1PCX A;  2FZG B;  4L5G A;  1X2K A;  2K2V A;  5C0M A;  1OU8 A;  1T0H A;  2QQR A;  5CKF A;  1I8F A;  5KYU B;  1MHN A;  1NYF A;  3ULR B;  3P8D A;  4RTU A;  1M90 R;  1VIE A;  1M3B A;  1S1N A;  4OB0 B;  1VQK Q;  4QQD A;  4NL3 A;  1VYV A;  5LJ3 f;  2CS7 A;  4Z8A A;  1KC8 U;  3MJX A;  4JJD A;  5I11 A;  3NTK A;  1RAE B;  3GP8 A;  2MWO A;  3CCJ Q;  2ESW A;  2DBM A;  1YJ9 A;  3I55 A;  4GLM A;  3EG1 A;  1QVF S;  3SFM A;  2LCL A;  2F5T X;  1M8M A;  1K8A R;  2DTI A;  1O75 A;  2M0Y A;  1YWO A;  2KI7 A;  3VJP A;  2MCN A;  4II1 A;  2E5K A;  2NUP B;  3WVD B;  2D9T A;  2MMP A;  4E47 A;  2R5A A;  4DEY A;  5GAO p;  1HSQ A;  1V29 B;  2RNA A;  3JB9 H;  2XDP A;  4J6W A;  5LJ3 d;  4BE2 A;  2P0Q A;  2DL4 A;  2CUD A;  3L2V A;  1NJI C;  4KH1 B;  3CCV T;  2DVJ A;  1CSK A;  1M3C A;  4XTZ A;  2VXE A;  1X6O A;  1M3A A;  2ROL A;  2EGA A;  4J6X A;  2IPO B;  2EQJ A;  2OTJ Q;  1QVG P;  1WA7 A;  2WAC A;  5LJ5 e;  2GTO A;  1PWT A;  4J9B A;  2KXD A;  1H8K A;  2YSQ A;  3L2Q A;  2EYX A;  2EGC A;  2YUN A;  2EJG A;  1X6G A;  2RJF A;  1YJ9 T;  3LWI A;  1AWJ A;  2JTF A;  1QKX A;  3OBW A;  2CSI A;  3LYI A;  4CI0 C;  3EHQ A;  3MP1 A;  2E4H A;  2XMF A;  1I4K 1;  5KYW A;  1ZSZ A;  3VS4 A;  4QW2 A;  4MDX A;  1H64 1;  4M4Z A;  2BZ8 A;  4FW1 A;  1MMG A;  3CCE T;  3QYG B;  4KUL A;  5FU7 C;  2X4Y A;  3CPF A;  1Z9Q A;  4JRP A;  2M02 A;  4M78 E;  1SG5 A;  2CDT A;  4B9W A;  4XTX A;  3G4S A;  4QKU A;  2E5Q A;  2XKO C;  3R6O A;  3L1A A;  2AZV A;  3EFO A;  2ROT A;  3C95 A;  2LJ3 A;  4MDW A;  2DF6 A;  5LJ5 g;  1NEB A;  1IZ6 A;  1HD3 A;  1UGV A;  1KIK A;  4RTW A;  1LCK A;  3CBO A;  4EMH A;  2DNU A;  3G71 T;  3OA6 A;  2XIC A;  4M7D G;  3KBG A;  3OY9 A;  1ZSZ B;  5LJ5 j;  1JEG A;  4M75 F;  4ELZ C;  2QA4 A;  1YCY A;  4BDY A;  3DB3 A;  3JCM W;  2XHC A;  3L2U A;  3GF5 A;  1M2V B;  5IHK A;  4JZ3 A;  2GTJ A;  2M0O A;  1VQ9 Q;  1GL5 A;  3S3M A;  2EVR A;  5FU6 B;  4C8Q E;  1R0B G;  3OS1 A;  3JAM E;  2KAF A;  1OI1 A;  4ZGJ B;  3M5A A;  2HL3 A;  2RB6 A;  3QKJ A;  3H41 A;  3AHU A;  2H3E B;  1G83 A;  2EWN A;  1K0S A;  3NGP A;  4HA8 A;  4DA4 A;  2DX1 A;  2EYZ A;  3FLG A;  1NM7 A;  3QBY A;  1IRE B;  2C0O A;  4HXJ A;  1D1A A;  1VQ6 Q;  3G7Z A;  1PSE A;  2EQI A;  5DY9 A;  3EFS A;  4PLI A;  5HK0 A;  1KHI A;  3F70 A;  4M7A D;  3QZ9 B;  2K4Y A;  4PNO A;  4PK4 A;  4ZN1 A;  1YFN A;  1VQ5 T;  2LNV A;  4M77 G;  1QCF A;  1Y71 A;  3VYG A;  1UGS B;  3CCM Q;  2CH4 W;  4M75 G;  3DLM A;  1FMK A;  1TSF A;  4DBR A;  1UEC A;  2DRK A;  2RD1 A;  4EDU A;  2X3X D;  3OSS C;  1OYX A;  2RO0 A;  5KYY B;  3RIR A;  1D3B B;  3FC3 A;  3X20 B;  3BY7 A;  1IHV A;  2LMJ A;  3NTH A;  1ZSG A;  1XOV A;  2DYB A;  5GAO r;  2F2V A;  5GAN 7;  2HBW A;  3QHS A;  1ZX6 A;  3GOX A;  2EGE A;  2SEM A;  3REB B;  2BZX A;  6AT1 B;  3PIP A;  5IXF A;  2GFU A;  4ANJ A;  3CCR Q;  2D0N A;  2C06 A;  2RJD A;  1UGR B;  2FRW A;  1VQM A;  3UPU A;  1D0Z A;  2EW3 A;  4F7U G;  3CC4 Q;  4JUV A;  4QQG A;  4M75 D;  1Y07 A;  3J7A F;  2I2L A;  1J3T A;  2LQN A;  3MET A;  2FB7 A;  1BK2 A;  2P0K A;  4XTU A;  1HXD A;  5KE2 A;  5C6S A;  2A08 A;  2ZAE A;  4TVR A;  1Y7X A;  3SD4 A;  2E3I A;  3CC2 A;  1CKA A;  2WSE E;  1YJN T;  2NUZ A;  1WJQ A;  3OS5 A;  3EG3 A;  5HK3 A;  3DKM A;  5GAM f;  4RTT A;  3CCQ A;  2NUP A;  1OPL A;  1B7T A;  1VQ6 A;  2CP6 A;  2E1H A;  5I2S A;  3UA7 A;  1YI2 Q;  2KBT A;  2DL7 A;  5GMK m;  1VQ4 Q;  4Y28 E;  4KUI A;  1JJ2 P;  2VYT A;  2O9S A;  3L2R A;  2LZ6 B;  1M90 U;  3CMA A;  1E6G A;  3CXC S;  3FJP A;  1Z9Z A;  4M78 B;  2KGT A;  1OZ2 A;  2BKD N;  4WF2 A;  5GAO m;  3CCL T;  2MK5 A;  9ATC B;  1GFC A;  1BKB A;  1MUZ A;  4FYY B;  4M77 E;  3L2Z A;  4KT0 E;  2J6F A;  4PJO C;  2W0Z A;  4MZM A;  4M77 B;  2VB6 A;  1PHT A;  2QXF A;  1GFD A;  2O4X B;  3O8V A;  3QDF A;  2KDS A;  2DXC A;  5KYU A;  2JZ2 A;  3LWH A;  2WSC E;  4LDV A;  4KGX B;  1M2O A;  4HT9 A;  1K9M C;  1B34 B;  2R58 A;  1SF9 A;  2HBP A;  4JPB W;  3LH0 A;  2C0T A;  2K6D A;  4OP0 A;  1RUW A;  4M75 A;  2C0I A;  1SRL A;  3E1S A;  3JCM h;  3URG A;  4C8Q G;  2DFU A;  3OW2 A;  3UF4 A;  4CC2 A;  3JB9 J;  1SKU B;  4FW2 A;  4JLG A;  5CAI A;  1K0X A;  1IGQ A;  4PJO A;  1AEY A;  2GF7 A;  3LW5 E;  4PJL A;  4AFZ C;  3G6E A;  5CIU A;  5LJ5 h;  4BUG A;  3QDR B;  4JRQ A;  1I07 A;  3QJY A;  4YTL A;  1ZA2 B;  2KMT A;  2DXB A;  3CCU Q;  5CQX A;  4IIM A;  5FU7 B;  1RAD B;  4C5G A;  4CC4 B;  1Q81 R;  4KGZ B;  2LTO A;  5FWC A;  2O4X A;  2DKG A;  1UGQ B;  3MO8 A;  2CZ6 B;  3OYD A;  3RKX A;  1IO6 A;  2GQV A;  3G1J A;  3CCU T;  2KR3 A;  3D7S B;  4LNP A;  3VV0 A;  4FCY A;  5GAN j;  1I0C A;  5LJ3 j;  5DLQ E;  5KYX B;  3E9F A;  3SHW A;  4HCB A;  3QWY A;  2LDM A;  5J39 A;  2MWP A;  1SEM A;  1VQK T;  2LC4 A;  1LPL A;  3M53 A;  2LQW A;  4HVW A;  3SWN B;  1VQO T;  2L89 A;  1JO8 A;  4E7L A;  4FL6 A;  2QEX A;  2D1X A;  5GAN f;  3EGX B;  3FRN A;  3CC7 A;  2HDA A;  5GMK i;  3OBY A;  1AZG B;  3I5R A;  4RTV A;  4PJO D;  5GMK j;  2DZ9 A;  5FU6 C;  1K76 A;  3EG0 A;  1Y57 A;  4E7K A;  1TG0 A;  3JCM J;  2FL7 A;  2QAS A;  3BFM A;  4LDY A;  4PJO G;  1WHH A;  4FU6 A;  3RNJ A;  2LP5 A;  3OMC A;  1ZBJ A;  5A0L A;  2JVV A;  4C8Q D;  3JB9 I;  4M77 D;  4ME7 A;  3PVL A;  1KD1 R;  5HKC A;  2HMA A;  4ZTJ A;  1KQ1 A;  2V8I A;  1KK7 A;  2E3H A;  1QMC A;  4GBQ A;  4D8D A;  1OPK A;  2V1Q A;  1G3T A;  1V1C A;  3REA B;  1W4S A;  1QW1 A;  2JMA A;  3EHR A;  2OI3 A;  1I1J A;  1D0X A;  1K4U S;  4QVC A;  5GAM h;  1BB9 A;  3CPW A;  2L5Q A;  1RAA B;  2ZPB B;  3NPF A;  3OYL A;  1VQ4 T;  3A8O B;  1M27 C;  2LJ1 A;  1K73 R;  2DEU A;  1SSF A;  4OML A;  2V26 A;  2HQX A;  3RMS A;  3GNF B;  4DOV A;  3M0P A;  4F7U E;  2ZPE B;  4B6M A;  1UHF A;  1MMN A;  3FB9 A;  2K79 A;  5GAN 2;  4PKC C;  1YHQ A;  2YUO A;  4C92 D;  1OEB A;  2F2W A;  1HYO A;  4XU2 A;  2QI2 A;  4ZGD B;  2DYI A;  2VGM A;  5J3B A;  3SWN C;  1UUE A;  1XQH A;  1M90 C;  2X35 A;  3NFC A;  2COZ A;  2COY A;  3EH1 A;  3MPU B;  3TCJ A;  2QAZ A;  3RKY A;  4JDS A;  4D8K A;  2LCC A;  4ZGE B;  1MV0 B;  5LJ5 d;  1Q82 C;  2GGR A;  3TVT A;  3I56 Q;  3OYC A;  1U1S A;  5L8R E;  3VRY A;  1N9R A;  1WJR A;  1QWF A;  1WHM A;  4DBH A;  3A98 A;  4M77 A;  1M1K C;  1BI3 A;  1SHG A;  4Y91 A;  1T0J A;  1UE9 A;  1VQM T;  1ACM B;  1D1B A;  3OB9 A;  3GPL A;  1BYM A;  2PUO B;  2BE9 B;  5AYF A;  3VS7 A;  3C4S A;  1ZSZ C;  1YIT A;  4C92 B;  2KT1 A;  3C12 A;  4JRK A;  2K3X A;  1K9M R;  1QKW A;  2O31 A;  1H3H A;  2ZPH B;  3LX7 A;  3Q1J A;  3CCM T;  4Z88 A;  4J9E A;  2JXB A;  3TQ7 P;  1NLO C;  2PNI A;  1H3Z A;  1AT1 B;  1VQ5 Q;  5LJ5 f;  4V2S A;  1QP3 A;  1PKT A;  2DEQ A;  4F16 A;  2JJ9 A;  3OYI A;  3UDC A;  1TXQ A;  4OMN A;  1SPK A;  5KCH A;  2L8D A;  2EIF A;  3OS2 A;  4OVA A;  1PD1 A;  4OB2 B;  3EFO B;  4JS4 A;  3BE3 A;  4M7D E;  1N8R U;  1Q86 U;  1AWX A;  4EMK A;  1QQJ A;  2K5F A;  1QCO A;  2NLU A;  3CPW S;  1U8R A;  1CKB A;  1WFW A;  1AOJ A;  3JCM Q;  4C0D B;  2LQ8 A;  1X6B A;  1N9S A;  4J9G A;  1FMW A;  3MEW A;  1VQO A;  2QTX A;  4F7U B;  2DIL A;  4MZT A;  2K5L A;  2KK4 A;  2P4T A;  4X34 A;  1EIF A;  2R57 A;  1YJW T;  4OMQ A;  4M78 D;  2YRC A;  3M54 A;  1VOM A;  1N8R C;  2DIG A;  4J9F A;  2RA2 A;  1UFF A;  2A37 A;  4XU1 A;  4LE9 A;  4LDX A;  2YRV A;  4J9D A;  1B07 A;  3ER0 A;  4F04 B;  2FHD A;  3CME Q;  2XDD A;  5LL6 S;  2MYS A;  2SRC A;  3PTA A;  2MAM A;  5D6X A;  2L3R A;  1VQ8 Q;  1PSF A;  3VYH B;  2PTK A;  1DJ7 B;  1Y96 B;  4ELY C;  2HSP A;  2DLP A;  4BD3 A;  4MMK A;  2BZY A;  3S3N A;  4JJN K;  1IGU A;  2BE7 D;  1OUL A;  4HCC A;  1WNL A;  3JCM b;  5IXB A;  5IH2 A;  4CC3 A;  2X9H A;  4C0Z A;  1JJ2 S;  1KFZ A;  1W2B S;  1M9S A;  3M57 A;  1EX4 A;  1BI2 A;  4RCC A;  1RL2 A;  1U5S A;  3CD6 A;  2LQK A;  3RMQ A;  2LNH B;  2IIM A;  2A28 A;  4JLI A;  2RHU A;  4Z89 A;  2GQI A;  2O9V A;  3QII A;  4F7U A;  3H0H A;  5CR2 A;  4GLK A;  2Y90 A;  4A4E A;  2AKL A;  1AZE A;  2CGH A;  4OMM A;  2DPP B;  1Q81 U;  2LT1 A;  3V8J A;  4JJC A;  1D09 B;  1OQK A;  4C8Q C;  1RI0 A;  5GAM j;  1NJI R;  1E7O A;  3ME9 A;  2P4R A;  3BW1 A;  1VIF A;  2VUB A;  3M55 A;  2BUD A;  4A53 A;  2OTJ A;  3H8Z A;  1C0M A;  1OV3 A;  4C92 C;  1UJY A;  2K7A A;  1VQN T;  3CCL Q;  1ZUK A;  3VKI A;  3HPW A;  1K1Z A;  2QGG A;  1K9A A;  2RMO A;  2L3S A;  5GAM g;  1NZ9 A;  3CC7 Q;  1G3Y A;  3CCS A;  1ZUU A;  2BTT A;  3CCS T;  2KT8 A;  1TTH B;  3CCR A;  5GAN e;  1Q86 C;  4FYV B;  2ED0 A;  2CYZ B;  4WCI A;  2KRS A;  2JS2 A;  1TU0 B;  4LDU A;  5DLO A;  5GAN g;  4QQ6 A;  1PRM C;  2CP3 A;  2KY9 A;  2DXT A;  1BU1 A;  4C5I A;  2KRO A;  1M5Q 1;  3OS0 A;  4EMG A;  3UWN A;  2LVM A;  3TRE A;  4IUP A;  1WDX A;  3CME T;  4N4I A;  5CKE A;  3E9G A;  1TS9 A;  2XI9 A;  3I5S A;  1RAG B;  4FIB A;  2CZ7 B;  4RTX A;  1QVG S;  2DIQ A;  2FO0 A;  1WYX A;  3CCM A;  1A0N B;  1GBR A;  2KYB A;  1I5L A;  4XU3 A;  4OMO A;  4BY6 B;  2QK0 A;  2AHJ B;  1Q95 G;  1QCN A;  2E64 A;  3CBP A;  1VQ7 Q;  5FRN A;  3E19 A;  1QLY A;  5GAN 4;  4A4H A;  1WQW A;  1K8A C;  4BI4 A;  3CCU A;  3VS0 A;  8AT1 B;  3CCS Q;  4XQ3 A;  5GAM e;  3EGD B;  2RK1 A;  2E6N A;  2DL5 A;  3WVE B;  1WHJ A;  1V76 A;  3CCR T;  5GAM d;  1VQN A;  2DL3 A;  2CP0 A;  3JSC A;  2PUK B;  3CBM A;  5D6Y A;  4DBF A;  4J6Y A;  3CCV A;  4M7D C;  4DEX A;  1JBM A;  3H9N A;  1N5Z A;  2RK2 A;  1NPP A;  2CSQ A;  2KXC A;  3V7R A;  4IIO A;  1VQ9 A;  2QDY B;  4BB7 A; 
#chains in the Genus database with same CATH homology
 4JJD A;  1I0C A;  5I11 A;  2EYY A;  3M0T A;  2I0N A;  1VYT A;  2K2M A;  3SHW A;  5EC7 A;  2ESW A;  2DBM A;  3QWY A;  1SEM A;  4GLM A;  2JTE A;  2B86 A;  2LQW A;  2DE0 X;  3EG1 A;  1GCQ C;  1ARK A;  1U3O A;  3C0C A;  4HVW A;  1M8M A;  1JO8 A;  2K9G A;  2D1X A;  2M0Y A;  1YWO A;  2LJ0 A;  2MCN A;  2HDA A;  2E5K A;  1AZG B;  3I5R A;  4RTV A;  2LCS A;  1K76 A;  3EG0 A;  1Y57 A;  4LUD A;  1TG0 A;  4DEY A;  1HSQ A;  2CH4 A;  2RNA A;  3SEM A;  1T3S A;  1GRI A;  2RQV A;  1UJ0 A;  4J9C A;  2DL4 A;  4KRT A;  3RNJ A;  2LP5 A;  2CUD A;  1RLP C;  3M0Q A;  1ZBJ A;  2DVJ A;  1CSK A;  1M3C A;  1BBZ A;  3PVL A;  2EYW A;  1M3A A;  2PZ1 A;  2ROL A;  2EGA A;  1H92 A;  4GBQ A;  4D8D A;  1WA7 A;  1OPK A;  1AD5 A;  2V1Q A;  1V1C A;  3REA B;  3M0U A;  2GTO A;  1PWT A;  2JMA A;  2GNC A;  2F2X A;  3EHR A;  4J9B A;  2KXD A;  2OI3 A;  5IHN A;  1H8K A;  1I1J A;  2X3W D;  3UAT A;  1K4U S;  1YCS B;  5L23 A;  2YSQ A;  1BB9 A;  2EYX A;  2EGC A;  2YUN A;  2YUQ A;  2M51 A;  1X6G A;  2ED1 A;  3NPF A;  1AWJ A;  1M27 C;  1QKX A;  4OMP A;  2CSI A;  2DMO A;  1TUC A;  2LJ1 A;  4F17 A;  4AG2 C;  3JV3 A;  3EHQ A;  1AWW A;  2XMF A;  4OML A;  2RPN A;  3VS4 A;  2MIO A;  3M0P A;  3VS6 A;  2LX7 A;  1UHF A;  5HCK A;  4M4Z A;  2BZ8 A;  2K79 A;  3M0R A;  2YUO A;  3UA6 A;  5FW9 A;  1B3Q A;  1OEB A;  2H8H A;  2F2W A;  1Z9Q A;  3EGU A;  2VWF A;  1VYU A;  1UUE A;  1NG2 A;  3TSZ A;  2JW4 A;  2CDT A;  4LN2 A;  1X69 A;  1YNZ A;  4D8K A;  2OJ2 A;  2AZV A;  2KNB B;  2ROT A;  1MV0 B;  2GGR A;  1NEG A;  2LJ3 A;  2J05 A;  5GJV B;  3TVT A;  2DF6 A;  2YDL A;  1W1F A;  2FG0 A;  2DM1 A;  1NEB A;  1SRM A;  2KRN A;  2AZS A;  1HD3 A;  3VRY A;  1UGV A;  1KIK A;  1QWF A;  4RTW A;  2K3B A;  2EBP A;  4E6R A;  3A98 A;  1LCK A;  1SHG A;  1NYG A;  2L2P A;  2J06 A;  2DNU A;  1ZUY A;  1T0J A;  1UE9 A;  3VS2 A;  2D8J A;  1UG1 A;  2CRE A;  3VS7 A;  1JEG A;  2KEA A;  1HJD A;  1YP5 A;  2KT1 A;  3LH5 A;  2QDL A;  1EFN A;  3IQL A;  5IHK A;  4JZ3 A;  2GTJ A;  1WXU A;  1GL5 A;  1QKW A;  2O31 A;  4HCK A;  2EVR A;  1X27 A;  1H3H A;  4Z88 A;  3PVQ A;  1WXT A;  4J9E A;  2JXB A;  1QWE A;  3H0F A;  1NLO C;  2PNI A;  1SSH A;  1JXO A;  4JZ4 A;  4ESR A;  3H41 A;  4QT7 A;  2KYM A;  1G83 A;  1K0S A;  3NGP A;  5GJW B;  1PKT A;  2DX1 A;  4F16 A;  2EYZ A;  1M30 A;  1NM7 A;  4OMN A;  1SPK A;  2EPD A;  4K11 A;  2ENM A;  2C0O A;  4HXJ A;  2EQI A;  2FEI A;  1AWX A;  4AFQ C;  2DBK A;  1WIE A;  1CKB A;  1WFW A;  1AOJ A;  4AFS C;  1X6B A;  1QCF A;  4J9G A;  2CH4 W;  1FMK A;  1RI9 A;  4AG1 C;  1SHF A;  2KRM A;  1UEC A;  2DRK A;  2G6F X;  2DIL A;  1NLP C;  2X3X D;  2OAW A;  2JS0 A;  2AK5 A;  4OMQ A;  2LMJ A;  3VS5 A;  1WLP B;  3NMZ C;  1ZSG A;  1XOV A;  2DYB A;  1PRL C;  2F2V A;  2HBW A;  1ZX6 A;  1E6H A;  2NWM A;  2EGE A;  4J9F A;  1UFF A;  2A37 A;  2SEM A;  4LE9 A;  3REB B;  2BZX A;  4A63 B;  4J9D A;  1UTI A;  4HVU A;  1B07 A;  5IXF A;  1UHC A;  2AKK A;  2D0N A;  2YT6 A;  1ZLM A;  2J6O A;  2SRC A;  3M0S A;  2FRW A;  2EW3 A;  2CT4 A;  4AFU C;  1PKS A;  2ECZ A;  2PTK A;  4FSS A;  2RQR A;  1J3T A;  2LQN A;  3PE0 A;  2HSP A;  2DLP A;  2ABL A;  2BZY A;  2EKH A;  1BK2 A;  4HVV A;  5IXB A;  1G2B A;  2A08 A;  5IH2 A;  4CC3 A;  1ABO A;  1KFZ A;  1GCQ A;  2RQU A;  2FPE A;  1W6X A;  1CKA A;  2HCK A;  2NUZ A;  1U5S A;  4J9H A;  2RN8 A;  3EG3 A;  3CQT A;  2LNH B;  2MOX A;  4ORZ A;  4RTT A;  1WXB A;  3QWX X;  2IIM A;  1VA7 A;  2A28 A;  1OPL A;  4Z89 A;  1GBQ A;  3O5Z A;  2GQI A;  3GBQ A;  3VRZ A;  3KFV A;  2W10 A;  2O9V A;  4RTZ A;  2CUB A;  3H0H A;  3UA7 A;  2KBT A;  4Y92 A;  1KSW A;  2CT3 A;  3NHN A;  4JJB A;  1UDL A;  2DL7 A;  3VS1 A;  2JM8 A;  2AKL A;  1AZE A;  3I9Q A;  2VKN A;  4OMM A;  1JU5 C;  3I35 A;  4JJC A;  2FPD A;  2O9S A;  2DRM A;  1JXM A;  2LZ6 B;  1E7O A;  1E6G A;  2P4R A;  4F14 A;  1OOT A;  1W70 A;  1TUD A;  1Z9Z A;  2KGT A;  1WX6 A;  2L3Q A;  3EG2 A;  2RF0 A;  1Y0M A;  1GFC A;  1OV3 A;  1UJY A;  1FYN A;  2K7A A;  2HEQ A;  1MUZ A;  1ZUK A;  1K1Z A;  5FWB A;  1K9A A;  2RMO A;  2L3S A;  1GCP A;  2J6F A;  2W0Z A;  4X1V A;  1WI7 A;  1ZUU A;  2GBQ A;  1AWO A;  2BTT A;  2KT8 A;  4RTY A;  4CC7 A;  1PHT A;  1GFD A;  1X2Q A;  2A36 A;  2ED0 A;  4J9I A;  4WCI A;  2KRS A;  3RBB B;  3U23 A;  1YN8 A;  2V1R A;  2JS2 A;  2FRY A;  2L3P A;  2KE9 A;  2JMC A;  1PRM C;  2FPF A;  1BU1 A;  3ZL7 C;  1T3L A;  2KRO A;  1JQQ A;  2DA9 A;  4JPB W;  2C0T A;  1WDX A;  2DJQ A;  2K6D A;  5IHI A;  4EIK A;  4RUG A;  3TSW A;  1RUW A;  3I5S A;  2C0I A;  2YUP A;  1SRL A;  2D8H A;  4RTX A;  2DL8 A;  2FO0 A;  1WYX A;  1A0N B;  1PNJ A;  1GBR A;  3UF4 A;  4CC2 A;  2KYB A;  1ABQ A;  1K0X A;  2RQT A;  4R0K A;  4OMO A;  1AEY A;  2J7I A;  2J6K A;  2O2O A;  4AFZ C;  4ZNX A;  1YWP A;  1U06 A;  3THK A;  1QLY A;  1I07 A;  2O88 A;  2L0A A;  1AVZ C;  3VS0 A;  5I22 A;  1X2K A;  1KJW A;  4IIM A;  1T0H A;  2DL5 A;  4CC4 B;  5FWC A;  2DL3 A;  1NYF A;  3ULR B;  3FJ5 A;  4RTU A;  1RLQ C;  3VS3 A;  5ECA A;  3H0I A;  1M3B A;  1S1N A;  1IO6 A;  2JT4 A;  4DEX A;  1MV3 A;  4LUE A;  1N5Z A;  2JM9 A;  2VVK A;  2KR3 A;  2CSQ A;  2KXC A;  4IIO A;  4LNP A;  1VYV A;  3R6N A;  1X43 A;  2RQW A;  4Z8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...