2RMOA

Solution structure of alpha-spectrin_sh3-bergerac from chicken
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKATANGKTYERQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Study of the structure and dynamics of a chimeric variant of the SH3 domain (SHA-Bergerac) by NMR spectroscopy
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rmoA00
2LJ3A 1AZGB 1JU5C 4M4ZA 4LUDA 3R6NA 1ABQA 1Y0MA 4EIKA 1GRIA 1BU1A 2CUDA 1UECA 2J6KA 5IHIA 3VS7A 4RUGA 1AEYA 2CSIA 2DBKA 2DJQA 3RBBB 2ECZA 2H8HA 1MV0B 2YUNA 1V1CA 2KRNA 2YUOA 3I35A 2DYBA 1X6GA 1FYNA 2K3BA 1UHFA 3TSWA 1QKWA 2AZVA 4JJCA 1PKTA 1TUCA 3NGPA 2LJ0A 2CT3A 2F2VA 2KT1A 2NUZA 2EBPA 1N5ZA 1U06A 4AFZC 3QWYA 1NLOC 1E7OA 1RLPC 2XMFA 3FJ5A 2LNHB 5FWBA 4OMLA 4F16A 2RPNA 1K0SA 4J9EA 2FPDA 2DL3A 2C0TA 2EVRA 2D8JA 1VYVA 2X3XD 2LJ1A 3SEMA 2RQTA 2LCSA 2FPEA 5IH2A 2O9VA 1WYXA 1AWWA 1HSQA 1SHGA 2SEMA 1T3LA 2ESWA 2JM9A 1ZUUA 3VS3A 1X2KA 4CC4B 3ULRB 4JJBA 2FRWA 3VS4A 1CKAA 3EGUA 4J9CA 2GGRA 2K79A 1ZUKA 1GBRA 1ZLMA 1JXMA 4CC2A 2NWMA 2BZXA 2ABLA 1CKBA 2FEIA 3UA7A 3M0TA 1UTIA 2W10A 2DL4A 4JPBW 2L3PA 3NHNA 2KYMA 4LNPA 1ZX6A 1SRMA 4RTUA 4RTVA 2GTOA 3I5RA 2RMOA 3CQTA 2L2PA 3EG1A 1HJDA 2JMAA 1IO6A 1NEBA 2L3SA 3THKA 2MOXA 1Z9ZA 2RQVA 1UG1A 1EFNA 2CUBA 2VVKA 2JT4A 4Z88A 1M3AA 4AG1C 1PHTA 2ROTA 2ED0A 2DX1A 1UJ0A 2SRCA 2ROLA 4RTYA 1KFZA 2G6FX 1QLYA 5EC7A 3EHRA 2JMCA 1UDLA 4ESRA 3KFVA 1OV3A 2EQIA 2FRYA 1ARKA 2K2MA 2RQUA 1H3HA 2KYBA 4J9FA 5FW9A 1X43A 3REBB 1K76A 2EYWA 1AWOA 4KRTA 2JXBA 1KSWA 4DEXA 1NG2A 2HDAA 2KR3A 3ZL7C 1UE9A 2P4RA 1W6XA 2DA9A 1YNZA 4Y92A 1J3TA 2V1QA 1B07A 4OMNA 2EW3A 1G2BA 4D8DA 1UJYA 1W70A 4HVWA 1K9AA 2JM8A 1GBQA 1GCQC 2VKNA 4JZ4A 2E5KA 4JJDA 1T3SA 1WFWA 1WLPB 1NYFA 2AKKA 1QKXA 2YSQA 4GLMA 4HXJA 3I9QA 2M0YA 3PE0A 4RTXA 1K4US 1WA7A 2KROA 2O2OA 2BZ8A 1SHFA 1WI7A 3M0QA 1JXOA 3TVTA 1U5SA 1X27A 1SSHA 4AFQC 2FO0A 3I5SA 1SRLA 2BTTA 2KXCA 4JZ3A 3REAB 2CREA 2DM1A 1WIEA 5FWCA 4K11A 2DILA 5L23A 1JO8A 2YUQA 4FSSA 3EG3A 1VA7A 3LH5A 1U3OA 1I1JA 1TUDA 3U23A 1NYGA 3H41A 4LE9A 2M51A 4ZNXA 2GQIA 4GBQA 1AWXA 1AWJA 5GJWB 3UATA 2KRSA 3EG2A 3RNJA 2LX7A 2RN8A 3SHWA 2O9SA 3M0RA 2B86A 2PNIA 2HBWA 2DL5A 2YDLA 3EG0A 3VRZA 2DRKA 2A36A 2C0OA 4AG2C 5IHNA 2OAWA 4J9HA 3QWXX 1ABOA 2DE0X 1RUWA 2PZ1A 2EKHA 3M0PA 1T0HA 5I11A 1JEGA 4OMQA 2MCNA 1H92A 2X3WD 2CDTA 3C0CA 1B3QA 1BK2A 4HVVA 4DEYA 1UUEA 4IIMA 1BBZA 1X2QA 2I0NA 2LZ6B 1M27C 4RTWA 3M0SA 1OPLA 2EGAA 2DL8A 1AOJA 3VRYA 1SPKA 2LQWA 2KRMA 1GCPA 1T0JA 1VYUA 2BZYA 2C0IA 1K0XA 1UHCA 1XOVA 1Z9QA 2CH4W 2RQWA 4IIOA 1AVZC 2RQRA 4RTZA 2A37A 2JW4A 2EPDA 2DNUA 2K7AA 2OI3A 1UFFA 2IIMA 2AZSA 2O88A 3H0FA 2L3QA 2W0ZA 4D8KA 2HCKA 1SEMA 2KT8A 1OOTA 1WDXA 1MUZA 2K9GA 2QDLA 2RF0A 1ZBJA 1QWFA 2FPFA 2YUPA 1ZSGA 4QT7A 2PTKA 4HVUA 3PVLA 1G83A 2A28A 5I22A 1NEGA 4J9IA 4J9GA 3TSZA 2HEQA 1E6HA 2DL7A 2KEAA 2J05A 2K6DA 1GL5A 1A0NB 1YCSB 2YT6A 2GTJA 1W1FA 1AZEA 1PNJA 5IXFA 4CC3A 3UA6A 1S1NA 3VS2A 2LQNA 2DRMA 3IQLA 4OMMA 4J9BA 2KE9A 2F2XA 1YN8A 2V1RA 5IXBA 2D8HA 2KXDA 2KGTA 1BB9A 2AKLA 1JQQA 4CC7A 1Y57A 2FG0A 2DF6A 1PKSA 2F2WA 1RI9A 1WXTA 1M30A 1I0CA 4LN2A 4AFSC 1UGVA 4R0KA 1GFCA 5GJVB 1PRLC 2MIOA 4OMOA 4HCKA 2CT4A 2ENMA 2CH4A 4F14A 2LP5A 1X6BA 4Z8AA 1M3BA 1KJWA 4ORZA 4Z89A 1QWEA 1WXBA 1GCQA 1ZUYA 3VS1A 1E6GA 2DLPA 3H0IA 4LUEA 1YWPA 4OMPA 1OEBA 2J06A 2D0NA 2J7IA 3O5ZA 2EGEA 2VWFA 1M3CA 1WX6A 2HSPA 3PVQA 1GFDA 2KBTA 2A08A 1AD5A 1YWOA 4RTTA 5HCKA 2GBQA 1RLQC 1HD3A 1M8MA 1X69A 3VS6A 3VS5A 1PRMC 2JS0A 2KNBB 2RNAA 1CSKA 2O31A 3H0HA 2LMJA 2J6FA 4AFUC 2DBMA 5ECAA 2AK5A 2EGCA 3GBQA 3NPFA 1VYTA 3EHQA 2EYXA 1FMKA 2L0AA 1OPKA 2ED1A 1H8KA 3A98A 1QCFA 3JV3A 2CSQA 4WCIA 2DVJA 4X1VA 3VS0A 4F17A 1K1ZA 2OJ2A 5IHKA 3M0UA 1LCKA 2JTEA 1NM7A 4E6RA 3UF4A 4A63B 1WXUA 2JS2A 2EYYA 1YP5A 2GNCA 1NLPC 1TG0A 4J9DA 2D1XA 1KIKA 2DMOA 3NMZC 1MV3A 1PWTA 1I07A 2EYZA 2J6OA
chains in the Genus database with same CATH superfamily
3G71Q 2ZCFB 2IVWA 2RJCA 4EIKA 1GRIA 1BU1A 2CUDA 1UECA 1WQWA 3VS7A 4DOVA 4RUGA 1AEYA 2DBKA 8ATCB 3BW1A 3CCRQ 3RBBB 5GAMh 2H8HA 1MV0B 2HKNA 3QDRB 1EZZB 2VC8A 1OU9A 1FMVA 4IUQA 4C8QC 3I35A 1X6GA 4OF1A 1TU0B 3L2ZA 4Z02A 2E5QA 1QVPA 1W2BP 1Q95G 4C5IA 1PKTA 1TUCA 1QVGA 1RAIB 2M02A 4XTYA 4HT8A 2KT1A 3QYHB 2NUZA 1N5ZA 4XAXB 4AFZC 3QWYA 1YITT 1VQLT 1KQ1A 8AT1B 2LNHB 5FWBA 1YI2A 2O4XA 3CMAA 2RB6A 2DD4A 2FPDA 2EJGA 3G6ET 2DL3A 2DZ9A 1VYVA 2CP7A 3OYJA 2RI5A 1AT1B 2A7YA 1HSQA 2SEMA 4E7IA 1IGQA 2CP5A 2RH2A 3EFOB 1G3YA 2A3LA 2LCLA 3EGUA 1ZUKA 2BKDN 1ZLMA 1MMAA 3A8MB 4M78G 3CD6A 2X9HA 1ACMB 2NWMA 2ABLA 3PMTA 2D0QB 3JCMW 1ZSZA 2KYMA 4LNPA 4BUGA 3H8ZA 4RTUA 5FU6C 3G71A 2JOYA 1C1AA 1KQSP 2RMOA 3CPWS 4J8OA 1HJDA 4N0AA 2JMAA 3VUBA 4MZMA 3G1JA 5I21A 4OGCA 3EGXB 3ME9A 2X4XA 3HSBA 1BI0A 1KD1C 2CUBA 4Z88A 5KYXB 1ZHIA 2ROTA 2NYSA 2DK3A 2DX1A 3PFSA 3QXEB 3I56T 2ROLA 2B8AA 4RTYA 3RKXA 1OULA 2G6FX 2GFAA 3C4SA 1QLYA 4M77D 5EC7A 4M7AA 1XJWB 4C92D 3OW2S 1MGQA 3KFVA 1OV3A 2EQIA 2GF7A 2RQUA 4J9FA 2XU8A 3FEOA 5FW9A 1K76A 2EYWA 3G4ST 1AWOA 2DEUA 1KSWA 2RHZA 1BKBA 4DEXA 4XTXA 1NG2A 3CXCS 2HQHA 2KR3A 2P4RA 4Y92A 1J3TA 2DA9A 1YNZA 3I56Q 5FLXE 1UGRB 1VOMA 2KMTA 1QVFA 3V7SA 1GCQC 4MZTA 2VKNA 2YLBA 3ZBDA 1WFWA 1PD0A 3G4SQ 3I9QA 1OX9A 1K9MU 3FJPA 1D0ZA 2NUTB 2D9TA 1IGUA 1JXOA 2ZPHB 2LNVA 3G7ZA 2EQUA 2ZPFB 1SSHA 1KC8C 2BTTA 2KXCA 3REAB 2CREA 1WIEA 2QGGA 5FWCA 3QSUA 2PQWA 3CC2T 3EG3A 1R0BG 2WSFE 3LH5A 5DLOA 2QEXT 5KE2A 3H41A 4LE9A 4N0AC 1JRIA 4XU0A 4HCCA 2K3XA 3JCMg 2DFUA 5GJWB 3UATA 2MF2A 5FRMA 1QP2A 2RN8A 1PM3A 3OBYA 3X26B 3M0RA 2PNIA 1Y7XA 4M78D 3EGDA 3VU3C 4UC4A 2K5IA 2A36A 3FRNA 1H3ZA 4J6WA 1WZOA 4BY6B 5DY9A 3MHXA 2QEXQ 4J9HA 4PJLA 4PK4A 1ABOA 4XTUA 1Y71A 3X24B 5GANh 3OSSC 4M7AC 2PZ1A 3HP9A 5KYYA 1T0HA 5I11A 1WJSA 1YFNA 3M56A 1KD1U 3CCET 4HT9A 1M5Q1 1U1SA 1B3QA 4DEYA 1D3BA 1UUEA 3QJYA 4QW2A 1X2QA 3OYAA 3HHTB 5A0DA 2EGAA 2DL8A 4DBFA 1AOJA 4II1A 4DA4A 3C12A 1BI2A 3I56A 2KRMA 2BZYA 4PJOD 3RUXA 1UHCA 5GMKj 2RQRA 4RTZA 2EPDA 5D6XA 2LTOA 2YWWA 2LCCA 1JJ2S 5GMKe 2JN0A 1R77A 3PT9A 5KYUA 2F1LA 1SEMA 1OOTA 1WDXA 1M1KR 2D6FA 2FPFA 4P5NA 3CC7Q 1NJIR 4QT7A 1RAGB 5GAN5 3L2QA 5GAOq 1ZA2B 3PIPA 1K8AR 3PVLA 5C6SA 1G83A 2AT1B 2IPOB 1HK9A 2XG8D 4OB1B 4J9GA 3HRUA 1VQ4Q 2HEQA 4M75A 3AHUA 3BDUA 2I2LA 3M55A 4F7UE 2F5TX 2DPPB 3JCMJ 2K4YA 5IXFA 4C8QD 3MJXA 4JLGA 3UA6A 1S1NA 1Y07A 2LQNA 3FLGA 2E64A 2DETA 1YHQT 4J9BA 2F2XA 1MNDA 5DM7R 5CCAA 2DJZA 2LC4A 5GAOp 2HSEB 3OS5A 4RKUE 3SWNA 1PKSA 1W2BA 1FXXA 4E7KA 2V8JA 2MAMA 1QW1A 3OYCA 1UB4A 3J7AF 2HBPA 1PG5B 1VQNQ 4E7ZA 1YHQQ 2DTOA 1X6BA 4Z8AA 4EMKA 1PC0A 1KJWA 3JCMd 4FYVB 4PFZA 4L59A 2YLCA 2P4TA 4FCYA 2QQAA 3CCVQ 5GAN2 4KGVB 1QP3A 3PVQA 3DB3A 2JUFA 1AD5A 1QVGS 2V26A 2JS0A 1NBEB 4MDWA 1D1AA 3CC7A 2ZPIB 4M75F 4MMLA 3M54A 3S3OA 1PD1A 2DBMA 1WHLA 1WHJA 2HQXA 1VQ4A 1OPKA 2ED1A 4M78A 3PTAA 2QGFB 2AHJB 1VQMT 4X1VA 1M1GA 1LCKA 1NM7A 4FW1A 5GANj 4OMFB 4A63B 4R56A 4J7IA 3QG1A 3JCMf 4J7FA 3M59A 2VXEA 5GANe 4A4EA 4EPCA 1N9SA 4C5HA 1PWTA 3LGLA 3CCSQ 2E6ZA 2EYZA 3LH0A 2J6OA 1SG5A 4IUTA 2LJ3A 2VV5A 3WVEB 5GMKm 4M4ZA 3CCJQ 4LUDA 1ABQA 1KK7A 4ZGDB 4GLKA 1K73C 2RA2A 3M4YA 3OYKA 3GNGA 1VQNA 5CKFA 2DO3A 1YHQA 1V76A 1UEBA 1BIAA 4EMKC 4QKUA 1TH7A 2P84A 1WJRA 2M9UA 4DOWA 6AT1B 2KRNA 2YUOA 3A5ZB 3CCVA 2K3BA 1QKWA 4JJCA 2L89A 5D6YA 2LJ0A 2EWNA 4B6MA 1M90R 1VQ9A 1KHCA 2XMFA 3FJ5A 3OY9A 4F16A 1N8RU 2F5KA 1TSFA 1BI3A 1LNXA 2C0TA 2D8JA 4N4GA 2LJ1A 3SEMA 1JBMA 2LCSA 1YI2T 2QI2A 2LT4A 3QZ9B 2O9VA 3CMAT 2DXTA 1T3LA 2ESWA 1QVFS 4O5VA 3VS3A 2E3IA 2MWOA 2HMAA 3P8DA 3DLMA 4F7UB 3ULRB 5CKDA 3PIOA 4M78C 3KUFA 4J9CA 4ZTFA 4BDYA 2OTJQ 2EAYA 3OS1A 3ASKA 3LW5E 2F69A 4CC2A 3JB9J 1OZ2A 1OU8A 1SKUB 2FEIA 1EX4A 5C0MA 4OB3B 5LJ3g 3L2VA 3CD6T 2DL4A 4JPBW 2L3PA 4N4HA 5KYXA 2HAXA 2MI6A 3OQ5A 3KXTA 1SRMA 4NOYA 3CCSA 2NLUA 4JLIA 2EKOA 4Y28E 3CCJA 4PJOC 2L2PA 3HFOA 1ZBXA 3MP8A 1IO6A 3TQ7P 3V8JA 4XK8E 3G71T 1XNIA 3CEYA 3CD6Q 3GP8A 1M2OA 3UT1A 3BY7A 2LRQA 2YRCA 1M3AA 4AG1C 1K73U 4KT0E 4LDXA 3VYHB 2X4JA 5KYWB 2QTVA 1KFZA 1FX7A 1TTHB 3VKIA 4ESRA 2E41A 3MCAB 1YJWQ 3MEAA 2KYBA 1X43A 3P8BB 3OS2A 3TREA 1RABB 2RJDA 5CK9A 1UGSB 4F7UG 2HDAA 2NUTA 1UE9A 2DXUA 2NUPA 9ATCB 2EW3A 3META 3MEVA 1IXDA 1W70A 4HVWA 1K9AA 1Q81U 1GBQA 4JJNK 2RJFA 3LWIA 3T9NA 1PSEA 2E4HA 1LOJA 4C0ZA 2CZ1B 1VQ7A 2FZKB 3MKDA 1T3SA 4PFOA 1QMCA 4GLMA 2OTJA 2LVMA 4HXJA 2Y4YA 3FC3A 2K57A 4QQGA 2QXFA 4RTXA 3JCMX 2BZ8A 1UGPB 2MMPA 4HCZA 4PFPA 3TVTA 2DTIA 4M7DE 4E2FB 5IT9E 1VQ6Q 1C0MA 2DM1A 2X35A 1G3WA 2DILA 4KUIA 2YUQA 2JVVA 4KH1B 2DEQA 5A2QE 1MMNA 3CC4Q 3L2UA 5J3BA 2DERA 4XTWA 2GQIA 4GBQA 1YJ9Q 2XIDA 4FYWB 1BYMA 1R8OB 1BCOA 3DKMA 5D7UA 5CIUA 3A8OB 3RNJA 2R58A 2LX7A 1WNLA 2HZYA 3SHWA 4PKCC 4WF2A 3V8KA 5GMKh 3WVDB 2B86A 2DIGA 2HBWA 2DL5A 5LJ5d 2YDLA 1M1KC 3C95A 2CYZB 2YRDA 2XDPA 1NJIC 2C0OA 5LJ3d 5FU7C 3RDVA 1Q86R 3QWXX 3JB9I 3OW2P 2DE0X 1W2BS 3M0PA 1N27A 1YJWA 2X3WD 3LX7A 2CDTA 1KHIA 2YHTA 3V7RA 2DXBA 4RTWA 3I55A 1OPLA 4L6V5 1YCYA 1BI1A 2ZAEA 1T0JA 2C0IA 4BDZA 4M75D 3FIFA 2CH4W 3VYGA 2KY9A 2A37A 3J80E 2ZPEB 2QA4Q 3DLLA 1UFFA 2IIMA 4XU2A 1SF9A 1MMGA 1N6AA 3RR6A 3S3MA 3H0FA 3PGGA 2HCKA 1UGQB 4JS4A 1N9RA 2QK0A 1MUZA 2QDLA 2RF0A 4QVZA 1ZSGA 4NL2A 3CMET 4HVUA 2AIRB 5LJ5f 1IRXA 4FM4B 5I22A 1VQ6A 4XTZA 5LJ3f 4MZPA 1B34B 1X6OA 2DL7A 2FB7A 3A8LB 3CC4A 2PVOB 2K6DA 3JCMc 1GL5A 1YCSB 2GTJA 1AZEA 5AYFA 4M7DF 1LPLA 1YJ9A 3PMIA 4CC3A 5HKCA 3CMEQ 2L3RA 4EMGA 4C0FA 1D0YA 2V1RA 4LDWA 2D8HA 2JTFA 2R5MA 1ZSZC 1BB9A 2AKLA 4CC7A 4VUBA 4RG2A 2DF6A 5GAOn 1WXTA 2BE9B 1RL2A 2DXCA 2MIOA 4OMOA 2VYTA 3CCUT 2ENMA 2LP5A 1M3BA 3OMCA 1LJOA 2IG0A 4Z89A 1QWEA 3VV0A 5KH6A 1WXBA 4J5YA 3VS1A 2DLPA 3H0IA 3DB4A 2XKOC 5GAN4 2J06A 1U1TA 2DKGA 3O5ZA 2EGEA 2KDSA 2R57A 1JJ2P 2QA4A 4HA8A 2HSPA 5I2SA 3CCUQ 1XTDA 3VJPA 2DYIA 1GFDA 2H3JA 2A08A 2Y4XA 2E12A 4RTTA 2GBQA 4KULA 4LDYA 1RLQC 1X69A 2BIVA 4IUUA 2ZPBB 1PRMC 1OI1A 4TVRA 1CSKA 2O31A 4X34A 1MNEA 4M7DB 1XQHA 2J6FA 1SSFA 3SDZA 1M1FA 2K3YA 2DVEA 3CC7T 3EHQA 1S72T 1KG1A 4C0DB 1VQPT 4KUDK 3JCMe 2CKKA 2VASA 3JV3A 4WCIA 3A8HB 2DVJA 4FYYB 1VQ4T 4F17A 2OJ2A 3RMSA 4E6RA 2A0FB 2KVQG 1WXUA 3CMEA 1K9MR 3GOXA 1M90C 1Q82C 2EIFA 3MPUB 3UPUA 4FT2A 1S72Q 1VQPQ 2BE7D 4J83A 2VB6A 4FT4A 2ZGWA 1AZGB 3QKJA 1JU5C 4E47A 2HNIA 1Y0MA 2CZ6B 4O6JA 1WPYA 1RAHB 5CVIA 3E9GA 4QQ6A 4AT1B 2ZPGB 4CI0C 4M77E 1KC8U 2DJQA 4C92E 5GAMd 5CKHA 1VQNT 1DJ7B 1V1CA 1YIJA 4F04B 1OYXA 2DYBA 4BE0A 1UHFA 4XQ3A 2AZVA 1QVGP 3CCUA 4M7DG 3EH2A 2F2VA 4F7UA 3CCVT 3NTKA 2EBPA 3CCMQ 1TS9A 2EJ9A 1AHJB 1RLPC 3HL8A 4OMLA 1M2VB 5KYNA 2RPNA 4JRKA 3OYDA 5J39A 3JB9G 2PVGB 1VQ9T 5GAOl 3URGA 3RMQA 1NE8A 2FPEA 1AWWA 2DTHA 2JM9A 1VQ5Q 1ZQ1A 3QDFA 3EG9B 1BIBA 4HKEA 4JJBA 2FRWA 3VS4A 1CKAA 5CO7A 2GGRA 2EQMA 2M1HA 2PUKB 1WHHA 2FZCB 2P0PA 1VQ9Q 3N5BB 1CKBA 5GAMf 2QDYB 2K2VA 4ELZC 3UA7A 3M0TA 1UTIA 2W10A 2FYKA 4RG8A 1S72A 3NHNA 4ZTJA 3C94A 4J6XA 3L2WA 3CCLQ 1VQPA 1ZX6A 5KYWA 3SFMA 1Q82U 3CQTA 2KI7A 3EG1A 4M75C 1M9SA 2RD1A 4A53A 1KQSA 3CCST 2MOXA 3CCJT 1Q7YR 3EGDB 3GPLA 1D1BA 2V8IA 2RQVA 3M9QA 3GIBA 1UG1A 2VVKA 2JT4A 4A4FA 1PHTA 2ED0A 3V7CA 2SRCA 4KGXB 4F7UF 2K5LA 4C92F 4PJOE 4C5EA 1I8FA 2QAZA 3EHRA 3MP1A 3QZ5B 3SWNC 1D3BB 2FVUA 2LQ8A 4Y91A 1G5VA 2K2MA 3CCMA 3JAME 4KRTA 2JXBA 3MEWA 3TU4K 4PNOA 4BE2A 3ZL7C 3OYFA 1WGSA 1B07A 3E2UA 4D8DA 1UJYA 1I5OB 3L1AA 1VQKT 4MDXA 5HK3A 3ER0A 2QQ9A 1RACB 4LDUA 1VQ5A 2VGNA 1I81A 1Q86C 1WLPB 4ANJA 1X75C 2AKKA 4KH0B 1QKXA 2KK4A 3EFOA 3JSCA 4PJJA 4M7DD 1WQ7A 1VQ7T 3PE0A 1K4US 1WA7A 2KROA 1TUGB 2O2OA 1OZ3A 1WI7A 2RO0A 4ELYC 5CKEA 4ZGEB 2OTJT 3OYNA 1X27A 1U8RA 4AFQC 1VQKQ 2FO0A 4C8QE 4RCCA 4ME7A 2E3HA 4ZN3A 5DLQE 3CCLA 4K11A 5L23A 4LD9K 3L2RA 1WJQA 5GAN3 1VA7A 1U3OA 1VQ7Q 3U23A 4M77B 5I2MA 1IREB 2M51A 4ZNXA 4C92B 3RERA 5A0GA 2XDBA 2OAUA 2X51A 3OSVA 2DIQA 2CS7A 3EG2A 3QPHA 4BB7A 2O9SA 2XK0A 3CBMA 1G3TA 5LJ5g 3EGXA 3EFSA 3P8HA 1NPPA 4BE1A 5IHNA 2OAWA 2FHDA 1RUWA 3BE3A 5GANd 2EKHA 2CP6A 1JEGA 4OMQA 2MCNA 1H92A 3M5AA 3C0CA 1PCXA 5FROA 1BK2A 2RHYA 3M53A 1D0XA 1BBZA 2P0KA 1M27C 3M0SA 4LXCA 1YJWT 5GAOr 3VRYA 1GCPA 1VYUA 1K0XA 3CPFA 3I55T 1XOVA 2RQWA 1QCNA 3INZA 2JW4A 2DNUA 2K7AA 2OI3A 4BI4A 5AT1B 2QTXA 1B34A 1D09B 1G3SA 5LJ3j 1VUBA 4LDVA 4RMOA 2L3QA 2W0ZA 2R5AA 5LJ3e 2EQKA 2K9GA 1ZBJA 2COYA 1QWFA 4PLLA 3I55Q 2YUPA 4HCBA 2QQBA 2PU9B 4M77G 4A4HA 1VQKA 3QBYA 1N8RR 2K5FA 4C92G 1D1CA 3EFRA 3NFCA 4J9IA 3HTRA 3JCMV 5GMKi 4OP0A 2MYSA 5HY6A 2KEAA 3LYIA 2J05A 2VUBA 5GANf 1VQ6T 4RCBA 1VQ8Q 2YT6A 4C8QF 4QQDA 4PLIA 3CC4T 3HRSA 3VS2A 3D7SB 4ZN1A 2CZ0B 5IAYA 1OX8A 2DRMA 3IQLA 2RK2A 4OMMA 1KQ2A 1Y96B 2KE9A 1YJ9T 1YN8A 1LVKA 2KXDA 2KGTA 1JQQA 4PJOB 2FG0A 4LN2A 1I0CA 4AFSC 2GQVA 4R0KA 3TEEA 5GJVB 3OYMA 3CPWP 1PRLC 2OTLT 3BDLA 2FL7A 3QYGB 4F14A 1WHGA 3X25B 1I5LA 1IHVA 1EIFA 3ZFJA 2RHIA 2X4YA 4IUVA 3JCMh 1VQOA 4E7SA 2FZGB 3FDRA 2KSSA 1K9MC 1GCQA 1ZUYA 2DD5A 4M7DA 1YWPA 1NPRA 2EQJA 1K73R 3OYLA 1M3CA 1GXIE 1QCOA 4EMHA 1K8AC 2OTLQ 1YITQ 2E70A 1VQLQ 3L42A 4N4IA 2KBTA 1YWOA 3FB9A 3VS6A 3CBOA 1TXQA 2QA4T 3VS5A 3G6EQ 1H641 2KNBB 4LD6A 2RNAA 1I4K1 4FSXA 3CXCP 4C8QB 1TOVA 4AFUC 2M0OA 2YRVA 2LDMA 1X01A 3A1PA 3WXMB 3GLXA 5J26A 5ECAA 4QVDA 4OB0B 2EGCA 2XD0A 3GBQA 3NPFA 1Q81R 2E10A 4C0GA 2EYXA 4M7AE 2L0AA 3TCJA 4GY5A 1H8KA 2JTMA 3A98A 1VQ8A 3CCRA 4PJOG 5IHKA 3MO8A 2JTEA 3OBWA 4JRIA 4BD3A 1YJNT 3QJ6A 2GNCA 1NLPC 3E9FA 1TG0A 2D1XA 2CP3A 3M4GA 3OYYA 1MV3A 2VXFA 5CAIA 3F70A 2LQKA 3CBPA 3LLRA 2COZA 3R6NA 4BY6C 2CP0A 1ZA1B 2J6KA 5IHIA 1KQSS 1YJNQ 2CSIA 2V8KA 3CCQT 3JCMP 1IZ6A 2JNGA 2M16A 4E7HA 2EYQA 5GAMg 2P0QA 2ECZA 2WACA 5FU7B 5D6WA 1M2VA 2YUNA 4X9CA 3MEUA 4L5GA 1FWZA 1B7TA 4M7DC 2RI3A 2HL5C 5FU6B 3UWNA 1RAEB 1O75A 1FYNA 1YIJT 3JB9F 3TSWA 2Z0WA 4C8QG 2OTLA 4IUPA 1YITA 1VQLA 3NGPA 3NTIA 3CCQQ 2CT3A 2WSEE 3EG9A 4C0DC 4OVAA 1IHWA 1U06A 1M1KU 3G6EA 1NLOC 1E7OA 1YBYA 2NUPB 2JJ9A 1NJIU 1K8AU 1Q7YC 4J9EA 1K0SA 2EVRA 2X3XD 1F1BB 1YIJQ 5GAMj 2RQTA 5IH2A 1WYXA 1SHGA 1ZUUA 1RAFB 1X2KA 5L8RE 5CQXA 4CC4B 4JUVA 5GAMe 3RKYA 4KBMB 4NL3A 1HXDA 2K79A 5GAOm 1GBRA 2O4XB 3S6WA 4FIBA 4Q5WA 1JXMA 2BZXA 5KE3A 4M7AF 2DAQA 3CC2Q 1JB0E 4OGEA 4DBQA 2QG9B 2CP2A 1MMDA 2CGHA 3X28B 4RTVA 3EAEA 1IB8A 2Y90A 2GTOA 3I5RA 3PNWC 2DZCA 3Q1JA 1YJNA 1NEBA 2VGMA 3BFMA 2L3SA 3THKA 1Z9ZA 1ZSZB 3JRZA 1EFNA 5HK0A 3CCEQ 1UJ0A 3OA6A 4YTLA 4M75E 2JMCA 3G4SA 2HD0A 4AMCA 2RJEA 2KAFA 5CQYA 1UDLA 4A4GA 3OYHA 3H6ZA 3CCQA 2FRYA 1ARKA 1H3HA 5KCOA 3REBB 2EJFA 3O8VA 4X9DA 3S3NA 2RHXA 2C06A 1W6XA 3CCMT 5CR2A 2PUOB 2V1QA 2KQWA 3MP6A 4OMNA 1G2BA 4JS5A 3J81E 2X4WA 4CRIA 2JM8A 4M7AB 4A54A 3H9NA 2PVDB 2QYZA 4JZ4A 1C6VX 1RADB 4R55A 2E5KA 4JJDA 3QO3A 1FMWA 1NYFA 4C5GA 1Q7YU 4V2SA 2YSQA 2GCXA 4XU3A 4OB2B 4M77A 1VQ5T 2M0YA 5IN1A 2XHCA 4C92A 1KD1R 5M9OA 1SHFA 3M0QA 1U5SA 2OX7A 5GAN8 2QQSA 3VUZA 3CC2A 2GFUA 3I5SA 1SRLA 5FRNA 4JZ3A 2QEXA 2ATCB 3OYBA 3OMGA 1HYOA 1JO8A 1NZ9A 4WTOB 4FSSA 3A8GB 3CPWA 2HKQB 1I1JA 1TUDA 3CCLT 2JZ2A 2ZZDA 1NYGA 3JCMQ 2CZ7B 2LT1A 1AWXA 1AWJA 2QQRA 3QHSA 4BACA 2KRSA 7AT1B 4IKFA 4DQ2A 1MHNA 3V8LA 4JRQA 2QASA 5LJ5h 4B9WA 3EG0A 3RKWA 2DRKA 3VRZA 3X20B 3NTHA 3HPWA 5LJ3h 4AG2C 3CCEA 3AT1B 1N8RC 3KBGA 3LWHA 3QIIA 5GANg 3OYIA 3OW2A 1BCMA 3JB9H 4M78E 4NS5A 1M90U 4XU1A 2RM4A 4HVVA 4M7AG 4IIMA 4PJNA 2I0NA 2LZ6B 3CXCA 2COWA 1KC8R 4E7JA 1SPKA 2LQWA 3GF5A 1Z9QA 4IIOA 2G3RA 5LL6S 1AVZC 3UDCA 5GAN6 5KYYB 4M77F 3EH1A 4DBRA 4FU6A 3E1SA 4E7LA 1V29B 2O01E 2AZSA 2O88A 4BI8B 3M58A 4A4KA 4XTVA 4JDSA 3RESA 4D8KA 3OYEA 4M77C 2KT8A 1R0CB 4C92C 2PTKA 1Y96A 2A28A 1NEGA 2MPXC 3E19A 3TSZA 3HKSA 2XDDA 1QVFP 2YXYA 1VQMQ 4PJOA 1E6HA 4EDUA 1PSFA 1A0NB 5KYUB 4ZGJB 1W1FA 1PNJA 1VIFA 2RI2A 3OS0A 3QUIA 4FW2A 1RAAB 5GAN7 4KGZB 5IXBA 1Y57A 4M75B 2F2WA 3JB9D 1RI9A 2H3EB 2HQEA 1M30A 4B9XA 1UGVA 2RHUA 1GFCA 1Q81C 3OYGA 4HCKA 2CT4A 1Q82R 1P92A 2CH4A 2E1HA 4ATOA 3OB9A 3R6OA 4ORZA 1O9SA 4FYXB 1WHMA 3LGFA 1OQKA 4M78F 4C8QA 1E6GA 2MWPA 4QVCA 4BI3A 3SB2A 4LUEA 3SWNB 4OMPA 1OEBA 2XI9A 1VQOT 2D0NA 2J7IA 2LX9A 2VWFA 1WX6A 2E65A 1QQJA 1JJ2A 4JRPA 3GNFB 1TWBA 4PL6A 5HCKA 1HD3A 1M8MA 1W4SA 5EG2A 4EMKB 2EFIA 1M4ZA 1RI0A 1YI2Q 3HFNA 5KCHA 3CMAQ 4M7AD 3H0HA 1VQOQ 2LMJA 2MK5A 4PJOF 3RIRA 2AK5A 2WSCE 4IURA 1VQMA 1VYTA 2RK1A 1FMKA 4D6WA 1WHKA 5LJ5j 4J6YA 3HRTA 1QCFA 2CSQA 3JCMb 3ZEHA 3VS0A 2XICA 1K1ZA 2HL3A 2L8DA 1G8XA 3M0UA 4M75G 5LJ5e 5CKBA 3UF4A 2E6NA 2JS2A 4MMKA 2EYYA 5GMKl 1VQ8T 3M57A 1YP5A 3CCRT 5A0LA 2L5QA 4J9DA 4PJMA 1KIKA 1Q86U 2DMOA 4FL6A 1VIEA 3NMZC 2BUDA 3SD4A 1M8VA 1I07A 4M78B 4DBHA
chains in the Genus database with same CATH topology
2LJ3A 1AZGB 1JU5C 4M4ZA 4LUDA 3R6NA 1ABQA 1Y0MA 4EIKA 1GRIA 1BU1A 2CUDA 1UECA 2J6KA 5IHIA 3VS7A 4RUGA 1AEYA 2CSIA 2DBKA 2DJQA 3RBBB 2ECZA 2H8HA 1MV0B 2YUNA 1V1CA 2KRNA 2YUOA 3I35A 2DYBA 1X6GA 1FYNA 2K3BA 1UHFA 3TSWA 1QKWA 2AZVA 4JJCA 1PKTA 1TUCA 3NGPA 2LJ0A 2CT3A 2F2VA 2KT1A 2NUZA 2EBPA 1N5ZA 1U06A 4AFZC 3QWYA 1NLOC 1E7OA 1RLPC 2XMFA 3FJ5A 2LNHB 5FWBA 4OMLA 4F16A 2RPNA 1K0SA 4J9EA 2FPDA 2DL3A 2C0TA 2EVRA 2D8JA 1VYVA 2X3XD 2LJ1A 3SEMA 2RQTA 2LCSA 2FPEA 5IH2A 2O9VA 1WYXA 1AWWA 1HSQA 1SHGA 2SEMA 1T3LA 2ESWA 2JM9A 1ZUUA 3VS3A 1X2KA 4CC4B 3ULRB 4JJBA 2FRWA 3VS4A 1CKAA 3EGUA 4J9CA 2GGRA 2K79A 1ZUKA 1GBRA 1ZLMA 1JXMA 4CC2A 2NWMA 2BZXA 2ABLA 1CKBA 2FEIA 3UA7A 3M0TA 1UTIA 2W10A 2DL4A 4JPBW 2L3PA 3NHNA 2KYMA 4LNPA 1ZX6A 1SRMA 4RTUA 4RTVA 2GTOA 3I5RA 2RMOA 3CQTA 2L2PA 3EG1A 1HJDA 2JMAA 1IO6A 1NEBA 2L3SA 3THKA 2MOXA 1Z9ZA 2RQVA 1UG1A 1EFNA 2CUBA 2VVKA 2JT4A 4Z88A 1M3AA 4AG1C 1PHTA 2ROTA 2ED0A 2DX1A 1UJ0A 2SRCA 2ROLA 4RTYA 1KFZA 2G6FX 1QLYA 5EC7A 3EHRA 2JMCA 1UDLA 4ESRA 3KFVA 1OV3A 2EQIA 2FRYA 1ARKA 2K2MA 2RQUA 1H3HA 2KYBA 4J9FA 5FW9A 1X43A 3REBB 1K76A 2EYWA 1AWOA 4KRTA 2JXBA 1KSWA 4DEXA 1NG2A 2HDAA 2KR3A 3ZL7C 1UE9A 2P4RA 1W6XA 2DA9A 1YNZA 4Y92A 1J3TA 2V1QA 1B07A 4OMNA 2EW3A 1G2BA 4D8DA 1UJYA 1W70A 4HVWA 1K9AA 2JM8A 1GBQA 1GCQC 2VKNA 4JZ4A 2E5KA 4JJDA 1T3SA 1WFWA 1WLPB 1NYFA 2AKKA 1QKXA 2YSQA 4GLMA 4HXJA 3I9QA 2M0YA 3PE0A 4RTXA 1K4US 1WA7A 2KROA 2O2OA 2BZ8A 1SHFA 1WI7A 3M0QA 1JXOA 3TVTA 1U5SA 1X27A 1SSHA 4AFQC 2FO0A 3I5SA 1SRLA 2BTTA 2KXCA 4JZ3A 3REAB 2CREA 2DM1A 1WIEA 5FWCA 4K11A 2DILA 5L23A 1JO8A 2YUQA 4FSSA 3EG3A 1VA7A 3LH5A 1U3OA 1I1JA 1TUDA 3U23A 1NYGA 3H41A 4LE9A 2M51A 4ZNXA 2GQIA 4GBQA 1AWXA 1AWJA 5GJWB 3UATA 2KRSA 3EG2A 3RNJA 2LX7A 2RN8A 3SHWA 2O9SA 3M0RA 2B86A 2PNIA 2HBWA 2DL5A 2YDLA 3EG0A 3VRZA 2DRKA 2A36A 2C0OA 4AG2C 5IHNA 2OAWA 4J9HA 3QWXX 1ABOA 2DE0X 1RUWA 2PZ1A 2EKHA 3M0PA 1T0HA 5I11A 1JEGA 4OMQA 2MCNA 1H92A 2X3WD 2CDTA 3C0CA 1B3QA 1BK2A 4HVVA 4DEYA 1UUEA 4IIMA 1BBZA 1X2QA 2I0NA 2LZ6B 1M27C 4RTWA 3M0SA 1OPLA 2EGAA 2DL8A 1AOJA 3VRYA 1SPKA 2LQWA 2KRMA 1GCPA 1T0JA 1VYUA 2BZYA 2C0IA 1K0XA 1UHCA 1XOVA 1Z9QA 2CH4W 2RQWA 4IIOA 1AVZC 2RQRA 4RTZA 2A37A 2JW4A 2EPDA 2DNUA 2K7AA 2OI3A 1UFFA 2IIMA 2AZSA 2O88A 3H0FA 2L3QA 2W0ZA 4D8KA 2HCKA 1SEMA 2KT8A 1OOTA 1WDXA 1MUZA 2K9GA 2QDLA 2RF0A 1ZBJA 1QWFA 2FPFA 2YUPA 1ZSGA 4QT7A 2PTKA 4HVUA 3PVLA 1G83A 2A28A 5I22A 1NEGA 4J9IA 4J9GA 3TSZA 2HEQA 1E6HA 2DL7A 2KEAA 2J05A 2K6DA 1GL5A 1A0NB 1YCSB 2YT6A 2GTJA 1W1FA 1AZEA 1PNJA 5IXFA 4CC3A 3UA6A 1S1NA 3VS2A 2LQNA 2DRMA 3IQLA 4OMMA 4J9BA 2KE9A 2F2XA 1YN8A 2V1RA 5IXBA 2D8HA 2KXDA 2KGTA 1BB9A 2AKLA 1JQQA 4CC7A 1Y57A 2FG0A 2DF6A 1PKSA 2F2WA 1RI9A 1WXTA 1M30A 1I0CA 4LN2A 4AFSC 1UGVA 4R0KA 1GFCA 5GJVB 1PRLC 2MIOA 4OMOA 4HCKA 2CT4A 2ENMA 2CH4A 4F14A 2LP5A 1X6BA 4Z8AA 1M3BA 1KJWA 4ORZA 4Z89A 1QWEA 1WXBA 1GCQA 1ZUYA 3VS1A 1E6GA 2DLPA 3H0IA 4LUEA 1YWPA 4OMPA 1OEBA 2J06A 2D0NA 2J7IA 3O5ZA 2EGEA 2VWFA 1M3CA 1WX6A 2HSPA 3PVQA 1GFDA 2KBTA 2A08A 1AD5A 1YWOA 4RTTA 5HCKA 2GBQA 1RLQC 1HD3A 1M8MA 1X69A 3VS6A 3VS5A 1PRMC 2JS0A 2KNBB 2RNAA 1CSKA 2O31A 3H0HA 2LMJA 2J6FA 4AFUC 2DBMA 5ECAA 2AK5A 2EGCA 3GBQA 3NPFA 1VYTA 3EHQA 2EYXA 1FMKA 2L0AA 1OPKA 2ED1A 1H8KA 3A98A 1QCFA 3JV3A 2CSQA 4WCIA 2DVJA 4X1VA 3VS0A 4F17A 1K1ZA 2OJ2A 5IHKA 3M0UA 1LCKA 2JTEA 1NM7A 4E6RA 3UF4A 4A63B 1WXUA 2JS2A 2EYYA 1YP5A 2GNCA 1NLPC 1TG0A 4J9DA 2D1XA 1KIKA 2DMOA 3NMZC 1MV3A 1PWTA 1I07A 2EYZA 2J6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ3 A;  1AZG B;  1JU5 C;  4M4Z A;  4LUD A;  3R6N A;  1ABQ A;  1Y0M A;  4EIK A;  1GRI A;  1BU1 A;  2CUD A;  1UEC A;  2J6K A;  5IHI A;  3VS7 A;  4RUG A;  1AEY A;  2CSI A;  2DBK A;  2DJQ A;  3RBB B;  2ECZ A;  2H8H A;  1MV0 B;  2YUN A;  1V1C A;  2KRN A;  2YUO A;  3I35 A;  2DYB A;  1X6G A;  1FYN A;  2K3B A;  1UHF A;  3TSW A;  1QKW A;  2AZV A;  4JJC A;  1PKT A;  1TUC A;  3NGP A;  2LJ0 A;  2CT3 A;  2F2V A;  2KT1 A;  2NUZ A;  2EBP A;  1N5Z A;  1U06 A;  4AFZ C;  3QWY A;  1NLO C;  1E7O A;  1RLP C;  2XMF A;  3FJ5 A;  2LNH B;  5FWB A;  4OML A;  4F16 A;  2RPN A;  1K0S A;  4J9E A;  2FPD A;  2DL3 A;  2C0T A;  2EVR A;  2D8J A;  1VYV A;  2X3X D;  2LJ1 A;  3SEM A;  2RQT A;  2LCS A;  2FPE A;  5IH2 A;  2O9V A;  1WYX A;  1AWW A;  1HSQ A;  1SHG A;  2SEM A;  1T3L A;  2ESW A;  2JM9 A;  1ZUU A;  3VS3 A;  1X2K A;  4CC4 B;  3ULR B;  4JJB A;  2FRW A;  3VS4 A;  1CKA A;  3EGU A;  4J9C A;  2GGR A;  2K79 A;  1ZUK A;  1GBR A;  1ZLM A;  1JXM A;  4CC2 A;  2NWM A;  2BZX A;  2ABL A;  1CKB A;  2FEI A;  3UA7 A;  3M0T A;  1UTI A;  2W10 A;  2DL4 A;  4JPB W;  2L3P A;  3NHN A;  2KYM A;  4LNP A;  1ZX6 A;  1SRM A;  4RTU A;  4RTV A;  2GTO A;  3I5R A;  2RMO A;  3CQT A;  2L2P A;  3EG1 A;  1HJD A;  2JMA A;  1IO6 A;  1NEB A;  2L3S A;  3THK A;  2MOX A;  1Z9Z A;  2RQV A;  1UG1 A;  1EFN A;  2CUB A;  2VVK A;  2JT4 A;  4Z88 A;  1M3A A;  4AG1 C;  1PHT A;  2ROT A;  2ED0 A;  2DX1 A;  1UJ0 A;  2SRC A;  2ROL A;  4RTY A;  1KFZ A;  2G6F X;  1QLY A;  5EC7 A;  3EHR A;  2JMC A;  1UDL A;  4ESR A;  3KFV A;  1OV3 A;  2EQI A;  2FRY A;  1ARK A;  2K2M A;  2RQU A;  1H3H A;  2KYB A;  4J9F A;  5FW9 A;  1X43 A;  3REB B;  1K76 A;  2EYW A;  1AWO A;  4KRT A;  2JXB A;  1KSW A;  4DEX A;  1NG2 A;  2HDA A;  2KR3 A;  3ZL7 C;  1UE9 A;  2P4R A;  1W6X A;  2DA9 A;  1YNZ A;  4Y92 A;  1J3T A;  2V1Q A;  1B07 A;  4OMN A;  2EW3 A;  1G2B A;  4D8D A;  1UJY A;  1W70 A;  4HVW A;  1K9A A;  2JM8 A;  1GBQ A;  1GCQ C;  2VKN A;  4JZ4 A;  2E5K A;  4JJD A;  1T3S A;  1WFW A;  1WLP B;  1NYF A;  2AKK A;  1QKX A;  2YSQ A;  4GLM A;  4HXJ A;  3I9Q A;  2M0Y A;  3PE0 A;  4RTX A;  1K4U S;  1WA7 A;  2KRO A;  2O2O A;  2BZ8 A;  1SHF A;  1WI7 A;  3M0Q A;  1JXO A;  3TVT A;  1U5S A;  1X27 A;  1SSH A;  4AFQ C;  2FO0 A;  3I5S A;  1SRL A;  2BTT A;  2KXC A;  4JZ3 A;  3REA B;  2CRE A;  2DM1 A;  1WIE A;  5FWC A;  4K11 A;  2DIL A;  5L23 A;  1JO8 A;  2YUQ A;  4FSS A;  3EG3 A;  1VA7 A;  3LH5 A;  1U3O A;  1I1J A;  1TUD A;  3U23 A;  1NYG A;  3H41 A;  4LE9 A;  2M51 A;  4ZNX A;  2GQI A;  4GBQ A;  1AWX A;  1AWJ A;  5GJW B;  3UAT A;  2KRS A;  3EG2 A;  3RNJ A;  2LX7 A;  2RN8 A;  3SHW A;  2O9S A;  3M0R A;  2B86 A;  2PNI A;  2HBW A;  2DL5 A;  2YDL A;  3EG0 A;  3VRZ A;  2DRK A;  2A36 A;  2C0O A;  4AG2 C;  5IHN A;  2OAW A;  4J9H A;  3QWX X;  1ABO A;  2DE0 X;  1RUW A;  2PZ1 A;  2EKH A;  3M0P A;  1T0H A;  5I11 A;  1JEG A;  4OMQ A;  2MCN A;  1H92 A;  2X3W D;  2CDT A;  3C0C A;  1B3Q A;  1BK2 A;  4HVV A;  4DEY A;  1UUE A;  4IIM A;  1BBZ A;  1X2Q A;  2I0N A;  2LZ6 B;  1M27 C;  4RTW A;  3M0S A;  1OPL A;  2EGA A;  2DL8 A;  1AOJ A;  3VRY A;  1SPK A;  2LQW A;  2KRM A;  1GCP A;  1T0J A;  1VYU A;  2BZY A;  2C0I A;  1K0X A;  1UHC A;  1XOV A;  1Z9Q A;  2CH4 W;  2RQW A;  4IIO A;  1AVZ C;  2RQR A;  4RTZ A;  2A37 A;  2JW4 A;  2EPD A;  2DNU A;  2K7A A;  2OI3 A;  1UFF A;  2IIM A;  2AZS A;  2O88 A;  3H0F A;  2L3Q A;  2W0Z A;  4D8K A;  2HCK A;  1SEM A;  2KT8 A;  1OOT A;  1WDX A;  1MUZ A;  2K9G A;  2QDL A;  2RF0 A;  1ZBJ A;  1QWF A;  2FPF A;  2YUP A;  1ZSG A;  4QT7 A;  2PTK A;  4HVU A;  3PVL A;  1G83 A;  2A28 A;  5I22 A;  1NEG A;  4J9I A;  4J9G A;  3TSZ A;  2HEQ A;  1E6H A;  2DL7 A;  2KEA A;  2J05 A;  2K6D A;  1GL5 A;  1A0N B;  1YCS B;  2YT6 A;  2GTJ A;  1W1F A;  1AZE A;  1PNJ A;  5IXF A;  4CC3 A;  3UA6 A;  1S1N A;  3VS2 A;  2LQN A;  2DRM A;  3IQL A;  4OMM A;  4J9B A;  2KE9 A;  2F2X A;  1YN8 A;  2V1R A;  5IXB A;  2D8H A;  2KXD A;  2KGT A;  1BB9 A;  2AKL A;  1JQQ A;  4CC7 A;  1Y57 A;  2FG0 A;  2DF6 A;  1PKS A;  2F2W A;  1RI9 A;  1WXT A;  1M30 A;  1I0C A;  4LN2 A;  4AFS C;  1UGV A;  4R0K A;  1GFC A;  5GJV B;  1PRL C;  2MIO A;  4OMO A;  4HCK A;  2CT4 A;  2ENM A;  2CH4 A;  4F14 A;  2LP5 A;  1X6B A;  4Z8A A;  1M3B A;  1KJW A;  4ORZ A;  4Z89 A;  1QWE A;  1WXB A;  1GCQ A;  1ZUY A;  3VS1 A;  1E6G A;  2DLP A;  3H0I A;  4LUE A;  1YWP A;  4OMP A;  1OEB A;  2J06 A;  2D0N A;  2J7I A;  3O5Z A;  2EGE A;  2VWF A;  1M3C A;  1WX6 A;  2HSP A;  3PVQ A;  1GFD A;  2KBT A;  2A08 A;  1AD5 A;  1YWO A;  4RTT A;  5HCK A;  2GBQ A;  1RLQ C;  1HD3 A;  1M8M A;  1X69 A;  3VS6 A;  3VS5 A;  1PRM C;  2JS0 A;  2KNB B;  2RNA A;  1CSK A;  2O31 A;  3H0H A;  2LMJ A;  2J6F A;  4AFU C;  2DBM A;  5ECA A;  2AK5 A;  2EGC A;  3GBQ A;  3NPF A;  1VYT A;  3EHQ A;  2EYX A;  1FMK A;  2L0A A;  1OPK A;  2ED1 A;  1H8K A;  3A98 A;  1QCF A;  3JV3 A;  2CSQ A;  4WCI A;  2DVJ A;  4X1V A;  3VS0 A;  4F17 A;  1K1Z A;  2OJ2 A;  5IHK A;  3M0U A;  1LCK A;  2JTE A;  1NM7 A;  4E6R A;  3UF4 A;  4A63 B;  1WXU A;  2JS2 A;  2EYY A;  1YP5 A;  2GNC A;  1NLP C;  1TG0 A;  4J9D A;  2D1X A;  1KIK A;  2DMO A;  3NMZ C;  1MV3 A;  1PWT A;  1I07 A;  2EYZ A;  2J6O A; 
#chains in the Genus database with same CATH topology
 3G71 Q;  2ZCF B;  2IVW A;  2RJC A;  4EIK A;  1GRI A;  1BU1 A;  2CUD A;  1UEC A;  1WQW A;  3VS7 A;  4DOV A;  4RUG A;  1AEY A;  2DBK A;  8ATC B;  3BW1 A;  3CCR Q;  3RBB B;  5GAM h;  2H8H A;  1MV0 B;  2HKN A;  3QDR B;  1EZZ B;  2VC8 A;  1OU9 A;  1FMV A;  4IUQ A;  4C8Q C;  3I35 A;  1X6G A;  4OF1 A;  1TU0 B;  3L2Z A;  4Z02 A;  2E5Q A;  1QVP A;  1W2B P;  1Q95 G;  4C5I A;  1PKT A;  1TUC A;  1QVG A;  1RAI B;  2M02 A;  4XTY A;  4HT8 A;  2KT1 A;  3QYH B;  2NUZ A;  1N5Z A;  4XAX B;  4AFZ C;  3QWY A;  1YIT T;  1VQL T;  1KQ1 A;  8AT1 B;  2LNH B;  5FWB A;  1YI2 A;  2O4X A;  3CMA A;  2RB6 A;  2DD4 A;  2FPD A;  2EJG A;  3G6E T;  2DL3 A;  2DZ9 A;  1VYV A;  2CP7 A;  3OYJ A;  2RI5 A;  1AT1 B;  2A7Y A;  1HSQ A;  2SEM A;  4E7I A;  1IGQ A;  2CP5 A;  2RH2 A;  3EFO B;  1G3Y A;  2A3L A;  2LCL A;  3EGU A;  1ZUK A;  2BKD N;  1ZLM A;  1MMA A;  3A8M B;  4M78 G;  3CD6 A;  2X9H A;  1ACM B;  2NWM A;  2ABL A;  3PMT A;  2D0Q B;  3JCM W;  1ZSZ A;  2KYM A;  4LNP A;  4BUG A;  3H8Z A;  4RTU A;  5FU6 C;  3G71 A;  2JOY A;  1C1A A;  1KQS P;  2RMO A;  3CPW S;  4J8O A;  1HJD A;  4N0A A;  2JMA A;  3VUB A;  4MZM A;  3G1J A;  5I21 A;  4OGC A;  3EGX B;  3ME9 A;  2X4X A;  3HSB A;  1BI0 A;  1KD1 C;  2CUB A;  4Z88 A;  5KYX B;  1ZHI A;  2ROT A;  2NYS A;  2DK3 A;  2DX1 A;  3PFS A;  3QXE B;  3I56 T;  2ROL A;  2B8A A;  4RTY A;  3RKX A;  1OUL A;  2G6F X;  2GFA A;  3C4S A;  1QLY A;  4M77 D;  5EC7 A;  4M7A A;  1XJW B;  4C92 D;  3OW2 S;  1MGQ A;  3KFV A;  1OV3 A;  2EQI A;  2GF7 A;  2RQU A;  4J9F A;  2XU8 A;  3FEO A;  5FW9 A;  1K76 A;  2EYW A;  3G4S T;  1AWO A;  2DEU A;  1KSW A;  2RHZ A;  1BKB A;  4DEX A;  4XTX A;  1NG2 A;  3CXC S;  2HQH A;  2KR3 A;  2P4R A;  4Y92 A;  1J3T A;  2DA9 A;  1YNZ A;  3I56 Q;  5FLX E;  1UGR B;  1VOM A;  2KMT A;  1QVF A;  3V7S A;  1GCQ C;  4MZT A;  2VKN A;  2YLB A;  3ZBD A;  1WFW A;  1PD0 A;  3G4S Q;  3I9Q A;  1OX9 A;  1K9M U;  3FJP A;  1D0Z A;  2NUT B;  2D9T A;  1IGU A;  1JXO A;  2ZPH B;  2LNV A;  3G7Z A;  2EQU A;  2ZPF B;  1SSH A;  1KC8 C;  2BTT A;  2KXC A;  3REA B;  2CRE A;  1WIE A;  2QGG A;  5FWC A;  3QSU A;  2PQW A;  3CC2 T;  3EG3 A;  1R0B G;  2WSF E;  3LH5 A;  5DLO A;  2QEX T;  5KE2 A;  3H41 A;  4LE9 A;  4N0A C;  1JRI A;  4XU0 A;  4HCC A;  2K3X A;  3JCM g;  2DFU A;  5GJW B;  3UAT A;  2MF2 A;  5FRM A;  1QP2 A;  2RN8 A;  1PM3 A;  3OBY A;  3X26 B;  3M0R A;  2PNI A;  1Y7X A;  4M78 D;  3EGD A;  3VU3 C;  4UC4 A;  2K5I A;  2A36 A;  3FRN A;  1H3Z A;  4J6W A;  1WZO A;  4BY6 B;  5DY9 A;  3MHX A;  2QEX Q;  4J9H A;  4PJL A;  4PK4 A;  1ABO A;  4XTU A;  1Y71 A;  3X24 B;  5GAN h;  3OSS C;  4M7A C;  2PZ1 A;  3HP9 A;  5KYY A;  1T0H A;  5I11 A;  1WJS A;  1YFN A;  3M56 A;  1KD1 U;  3CCE T;  4HT9 A;  1M5Q 1;  1U1S A;  1B3Q A;  4DEY A;  1D3B A;  1UUE A;  3QJY A;  4QW2 A;  1X2Q A;  3OYA A;  3HHT B;  5A0D A;  2EGA A;  2DL8 A;  4DBF A;  1AOJ A;  4II1 A;  4DA4 A;  3C12 A;  1BI2 A;  3I56 A;  2KRM A;  2BZY A;  4PJO D;  3RUX A;  1UHC A;  5GMK j;  2RQR A;  4RTZ A;  2EPD A;  5D6X A;  2LTO A;  2YWW A;  2LCC A;  1JJ2 S;  5GMK e;  2JN0 A;  1R77 A;  3PT9 A;  5KYU A;  2F1L A;  1SEM A;  1OOT A;  1WDX A;  1M1K R;  2D6F A;  2FPF A;  4P5N A;  3CC7 Q;  1NJI R;  4QT7 A;  1RAG B;  5GAN 5;  3L2Q A;  5GAO q;  1ZA2 B;  3PIP A;  1K8A R;  3PVL A;  5C6S A;  1G83 A;  2AT1 B;  2IPO B;  1HK9 A;  2XG8 D;  4OB1 B;  4J9G A;  3HRU A;  1VQ4 Q;  2HEQ A;  4M75 A;  3AHU A;  3BDU A;  2I2L A;  3M55 A;  4F7U E;  2F5T X;  2DPP B;  3JCM J;  2K4Y A;  5IXF A;  4C8Q D;  3MJX A;  4JLG A;  3UA6 A;  1S1N A;  1Y07 A;  2LQN A;  3FLG A;  2E64 A;  2DET A;  1YHQ T;  4J9B A;  2F2X A;  1MND A;  5DM7 R;  5CCA A;  2DJZ A;  2LC4 A;  5GAO p;  2HSE B;  3OS5 A;  4RKU E;  3SWN A;  1PKS A;  1W2B A;  1FXX A;  4E7K A;  2V8J A;  2MAM A;  1QW1 A;  3OYC A;  1UB4 A;  3J7A F;  2HBP A;  1PG5 B;  1VQN Q;  4E7Z A;  1YHQ Q;  2DTO A;  1X6B A;  4Z8A A;  4EMK A;  1PC0 A;  1KJW A;  3JCM d;  4FYV B;  4PFZ A;  4L59 A;  2YLC A;  2P4T A;  4FCY A;  2QQA A;  3CCV Q;  5GAN 2;  4KGV B;  1QP3 A;  3PVQ A;  3DB3 A;  2JUF A;  1AD5 A;  1QVG S;  2V26 A;  2JS0 A;  1NBE B;  4MDW A;  1D1A A;  3CC7 A;  2ZPI B;  4M75 F;  4MML A;  3M54 A;  3S3O A;  1PD1 A;  2DBM A;  1WHL A;  1WHJ A;  2HQX A;  1VQ4 A;  1OPK A;  2ED1 A;  4M78 A;  3PTA A;  2QGF B;  2AHJ B;  1VQM T;  4X1V A;  1M1G A;  1LCK A;  1NM7 A;  4FW1 A;  5GAN j;  4OMF B;  4A63 B;  4R56 A;  4J7I A;  3QG1 A;  3JCM f;  4J7F A;  3M59 A;  2VXE A;  5GAN e;  4A4E A;  4EPC A;  1N9S A;  4C5H A;  1PWT A;  3LGL A;  3CCS Q;  2E6Z A;  2EYZ A;  3LH0 A;  2J6O A;  1SG5 A;  4IUT A;  2LJ3 A;  2VV5 A;  3WVE B;  5GMK m;  4M4Z A;  3CCJ Q;  4LUD A;  1ABQ A;  1KK7 A;  4ZGD B;  4GLK A;  1K73 C;  2RA2 A;  3M4Y A;  3OYK A;  3GNG A;  1VQN A;  5CKF A;  2DO3 A;  1YHQ A;  1V76 A;  1UEB A;  1BIA A;  4EMK C;  4QKU A;  1TH7 A;  2P84 A;  1WJR A;  2M9U A;  4DOW A;  6AT1 B;  2KRN A;  2YUO A;  3A5Z B;  3CCV A;  2K3B A;  1QKW A;  4JJC A;  2L89 A;  5D6Y A;  2LJ0 A;  2EWN A;  4B6M A;  1M90 R;  1VQ9 A;  1KHC A;  2XMF A;  3FJ5 A;  3OY9 A;  4F16 A;  1N8R U;  2F5K A;  1TSF A;  1BI3 A;  1LNX A;  2C0T A;  2D8J A;  4N4G A;  2LJ1 A;  3SEM A;  1JBM A;  2LCS A;  1YI2 T;  2QI2 A;  2LT4 A;  3QZ9 B;  2O9V A;  3CMA T;  2DXT A;  1T3L A;  2ESW A;  1QVF S;  4O5V A;  3VS3 A;  2E3I A;  2MWO A;  2HMA A;  3P8D A;  3DLM A;  4F7U B;  3ULR B;  5CKD A;  3PIO A;  4M78 C;  3KUF A;  4J9C A;  4ZTF A;  4BDY A;  2OTJ Q;  2EAY A;  3OS1 A;  3ASK A;  3LW5 E;  2F69 A;  4CC2 A;  3JB9 J;  1OZ2 A;  1OU8 A;  1SKU B;  2FEI A;  1EX4 A;  5C0M A;  4OB3 B;  5LJ3 g;  3L2V A;  3CD6 T;  2DL4 A;  4JPB W;  2L3P A;  4N4H A;  5KYX A;  2HAX A;  2MI6 A;  3OQ5 A;  3KXT A;  1SRM A;  4NOY A;  3CCS A;  2NLU A;  4JLI A;  2EKO A;  4Y28 E;  3CCJ A;  4PJO C;  2L2P A;  3HFO A;  1ZBX A;  3MP8 A;  1IO6 A;  3TQ7 P;  3V8J A;  4XK8 E;  3G71 T;  1XNI A;  3CEY A;  3CD6 Q;  3GP8 A;  1M2O A;  3UT1 A;  3BY7 A;  2LRQ A;  2YRC A;  1M3A A;  4AG1 C;  1K73 U;  4KT0 E;  4LDX A;  3VYH B;  2X4J A;  5KYW B;  2QTV A;  1KFZ A;  1FX7 A;  1TTH B;  3VKI A;  4ESR A;  2E41 A;  3MCA B;  1YJW Q;  3MEA A;  2KYB A;  1X43 A;  3P8B B;  3OS2 A;  3TRE A;  1RAB B;  2RJD A;  5CK9 A;  1UGS B;  4F7U G;  2HDA A;  2NUT A;  1UE9 A;  2DXU A;  2NUP A;  9ATC B;  2EW3 A;  3MET A;  3MEV A;  1IXD A;  1W70 A;  4HVW A;  1K9A A;  1Q81 U;  1GBQ A;  4JJN K;  2RJF A;  3LWI A;  3T9N A;  1PSE A;  2E4H A;  1LOJ A;  4C0Z A;  2CZ1 B;  1VQ7 A;  2FZK B;  3MKD A;  1T3S A;  4PFO A;  1QMC A;  4GLM A;  2OTJ A;  2LVM A;  4HXJ A;  2Y4Y A;  3FC3 A;  2K57 A;  4QQG A;  2QXF A;  4RTX A;  3JCM X;  2BZ8 A;  1UGP B;  2MMP A;  4HCZ A;  4PFP A;  3TVT A;  2DTI A;  4M7D E;  4E2F B;  5IT9 E;  1VQ6 Q;  1C0M A;  2DM1 A;  2X35 A;  1G3W A;  2DIL A;  4KUI A;  2YUQ A;  2JVV A;  4KH1 B;  2DEQ A;  5A2Q E;  1MMN A;  3CC4 Q;  3L2U A;  5J3B A;  2DER A;  4XTW A;  2GQI A;  4GBQ A;  1YJ9 Q;  2XID A;  4FYW B;  1BYM A;  1R8O B;  1BCO A;  3DKM A;  5D7U A;  5CIU A;  3A8O B;  3RNJ A;  2R58 A;  2LX7 A;  1WNL A;  2HZY A;  3SHW A;  4PKC C;  4WF2 A;  3V8K A;  5GMK h;  3WVD B;  2B86 A;  2DIG A;  2HBW A;  2DL5 A;  5LJ5 d;  2YDL A;  1M1K C;  3C95 A;  2CYZ B;  2YRD A;  2XDP A;  1NJI C;  2C0O A;  5LJ3 d;  5FU7 C;  3RDV A;  1Q86 R;  3QWX X;  3JB9 I;  3OW2 P;  2DE0 X;  1W2B S;  3M0P A;  1N27 A;  1YJW A;  2X3W D;  3LX7 A;  2CDT A;  1KHI A;  2YHT A;  3V7R A;  2DXB A;  4RTW A;  3I55 A;  1OPL A;  4L6V 5;  1YCY A;  1BI1 A;  2ZAE A;  1T0J A;  2C0I A;  4BDZ A;  4M75 D;  3FIF A;  2CH4 W;  3VYG A;  2KY9 A;  2A37 A;  3J80 E;  2ZPE B;  2QA4 Q;  3DLL A;  1UFF A;  2IIM A;  4XU2 A;  1SF9 A;  1MMG A;  1N6A A;  3RR6 A;  3S3M A;  3H0F A;  3PGG A;  2HCK A;  1UGQ B;  4JS4 A;  1N9R A;  2QK0 A;  1MUZ A;  2QDL A;  2RF0 A;  4QVZ A;  1ZSG A;  4NL2 A;  3CME T;  4HVU A;  2AIR B;  5LJ5 f;  1IRX A;  4FM4 B;  5I22 A;  1VQ6 A;  4XTZ A;  5LJ3 f;  4MZP A;  1B34 B;  1X6O A;  2DL7 A;  2FB7 A;  3A8L B;  3CC4 A;  2PVO B;  2K6D A;  3JCM c;  1GL5 A;  1YCS B;  2GTJ A;  1AZE A;  5AYF A;  4M7D F;  1LPL A;  1YJ9 A;  3PMI A;  4CC3 A;  5HKC A;  3CME Q;  2L3R A;  4EMG A;  4C0F A;  1D0Y A;  2V1R A;  4LDW A;  2D8H A;  2JTF A;  2R5M A;  1ZSZ C;  1BB9 A;  2AKL A;  4CC7 A;  4VUB A;  4RG2 A;  2DF6 A;  5GAO n;  1WXT A;  2BE9 B;  1RL2 A;  2DXC A;  2MIO A;  4OMO A;  2VYT A;  3CCU T;  2ENM A;  2LP5 A;  1M3B A;  3OMC A;  1LJO A;  2IG0 A;  4Z89 A;  1QWE A;  3VV0 A;  5KH6 A;  1WXB A;  4J5Y A;  3VS1 A;  2DLP A;  3H0I A;  3DB4 A;  2XKO C;  5GAN 4;  2J06 A;  1U1T A;  2DKG A;  3O5Z A;  2EGE A;  2KDS A;  2R57 A;  1JJ2 P;  2QA4 A;  4HA8 A;  2HSP A;  5I2S A;  3CCU Q;  1XTD A;  3VJP A;  2DYI A;  1GFD A;  2H3J A;  2A08 A;  2Y4X A;  2E12 A;  4RTT A;  2GBQ A;  4KUL A;  4LDY A;  1RLQ C;  1X69 A;  2BIV A;  4IUU A;  2ZPB B;  1PRM C;  1OI1 A;  4TVR A;  1CSK A;  2O31 A;  4X34 A;  1MNE A;  4M7D B;  1XQH A;  2J6F A;  1SSF A;  3SDZ A;  1M1F A;  2K3Y A;  2DVE A;  3CC7 T;  3EHQ A;  1S72 T;  1KG1 A;  4C0D B;  1VQP T;  4KUD K;  3JCM e;  2CKK A;  2VAS A;  3JV3 A;  4WCI A;  3A8H B;  2DVJ A;  4FYY B;  1VQ4 T;  4F17 A;  2OJ2 A;  3RMS A;  4E6R A;  2A0F B;  2KVQ G;  1WXU A;  3CME A;  1K9M R;  3GOX A;  1M90 C;  1Q82 C;  2EIF A;  3MPU B;  3UPU A;  4FT2 A;  1S72 Q;  1VQP Q;  2BE7 D;  4J83 A;  2VB6 A;  4FT4 A;  2ZGW A;  1AZG B;  3QKJ A;  1JU5 C;  4E47 A;  2HNI A;  1Y0M A;  2CZ6 B;  4O6J A;  1WPY A;  1RAH B;  5CVI A;  3E9G A;  4QQ6 A;  4AT1 B;  2ZPG B;  4CI0 C;  4M77 E;  1KC8 U;  2DJQ A;  4C92 E;  5GAM d;  5CKH A;  1VQN T;  1DJ7 B;  1V1C A;  1YIJ A;  4F04 B;  1OYX A;  2DYB A;  4BE0 A;  1UHF A;  4XQ3 A;  2AZV A;  1QVG P;  3CCU A;  4M7D G;  3EH2 A;  2F2V A;  4F7U A;  3CCV T;  3NTK A;  2EBP A;  3CCM Q;  1TS9 A;  2EJ9 A;  1AHJ B;  1RLP C;  3HL8 A;  4OML A;  1M2V B;  5KYN A;  2RPN A;  4JRK A;  3OYD A;  5J39 A;  3JB9 G;  2PVG B;  1VQ9 T;  5GAO l;  3URG A;  3RMQ A;  1NE8 A;  2FPE A;  1AWW A;  2DTH A;  2JM9 A;  1VQ5 Q;  1ZQ1 A;  3QDF A;  3EG9 B;  1BIB A;  4HKE A;  4JJB A;  2FRW A;  3VS4 A;  1CKA A;  5CO7 A;  2GGR A;  2EQM A;  2M1H A;  2PUK B;  1WHH A;  2FZC B;  2P0P A;  1VQ9 Q;  3N5B B;  1CKB A;  5GAM f;  2QDY B;  2K2V A;  4ELZ C;  3UA7 A;  3M0T A;  1UTI A;  2W10 A;  2FYK A;  4RG8 A;  1S72 A;  3NHN A;  4ZTJ A;  3C94 A;  4J6X A;  3L2W A;  3CCL Q;  1VQP A;  1ZX6 A;  5KYW A;  3SFM A;  1Q82 U;  3CQT A;  2KI7 A;  3EG1 A;  4M75 C;  1M9S A;  2RD1 A;  4A53 A;  1KQS A;  3CCS T;  2MOX A;  3CCJ T;  1Q7Y R;  3EGD B;  3GPL A;  1D1B A;  2V8I A;  2RQV A;  3M9Q A;  3GIB A;  1UG1 A;  2VVK A;  2JT4 A;  4A4F A;  1PHT A;  2ED0 A;  3V7C A;  2SRC A;  4KGX B;  4F7U F;  2K5L A;  4C92 F;  4PJO E;  4C5E A;  1I8F A;  2QAZ A;  3EHR A;  3MP1 A;  3QZ5 B;  3SWN C;  1D3B B;  2FVU A;  2LQ8 A;  4Y91 A;  1G5V A;  2K2M A;  3CCM A;  3JAM E;  4KRT A;  2JXB A;  3MEW A;  3TU4 K;  4PNO A;  4BE2 A;  3ZL7 C;  3OYF A;  1WGS A;  1B07 A;  3E2U A;  4D8D A;  1UJY A;  1I5O B;  3L1A A;  1VQK T;  4MDX A;  5HK3 A;  3ER0 A;  2QQ9 A;  1RAC B;  4LDU A;  1VQ5 A;  2VGN A;  1I81 A;  1Q86 C;  1WLP B;  4ANJ A;  1X75 C;  2AKK A;  4KH0 B;  1QKX A;  2KK4 A;  3EFO A;  3JSC A;  4PJJ A;  4M7D D;  1WQ7 A;  1VQ7 T;  3PE0 A;  1K4U S;  1WA7 A;  2KRO A;  1TUG B;  2O2O A;  1OZ3 A;  1WI7 A;  2RO0 A;  4ELY C;  5CKE A;  4ZGE B;  2OTJ T;  3OYN A;  1X27 A;  1U8R A;  4AFQ C;  1VQK Q;  2FO0 A;  4C8Q E;  4RCC A;  4ME7 A;  2E3H A;  4ZN3 A;  5DLQ E;  3CCL A;  4K11 A;  5L23 A;  4LD9 K;  3L2R A;  1WJQ A;  5GAN 3;  1VA7 A;  1U3O A;  1VQ7 Q;  3U23 A;  4M77 B;  5I2M A;  1IRE B;  2M51 A;  4ZNX A;  4C92 B;  3RER A;  5A0G A;  2XDB A;  2OAU A;  2X51 A;  3OSV A;  2DIQ A;  2CS7 A;  3EG2 A;  3QPH A;  4BB7 A;  2O9S A;  2XK0 A;  3CBM A;  1G3T A;  5LJ5 g;  3EGX A;  3EFS A;  3P8H A;  1NPP A;  4BE1 A;  5IHN A;  2OAW A;  2FHD A;  1RUW A;  3BE3 A;  5GAN d;  2EKH A;  2CP6 A;  1JEG A;  4OMQ A;  2MCN A;  1H92 A;  3M5A A;  3C0C A;  1PCX A;  5FRO A;  1BK2 A;  2RHY A;  3M53 A;  1D0X A;  1BBZ A;  2P0K A;  1M27 C;  3M0S A;  4LXC A;  1YJW T;  5GAO r;  3VRY A;  1GCP A;  1VYU A;  1K0X A;  3CPF A;  3I55 T;  1XOV A;  2RQW A;  1QCN A;  3INZ A;  2JW4 A;  2DNU A;  2K7A A;  2OI3 A;  4BI4 A;  5AT1 B;  2QTX A;  1B34 A;  1D09 B;  1G3S A;  5LJ3 j;  1VUB A;  4LDV A;  4RMO A;  2L3Q A;  2W0Z A;  2R5A A;  5LJ3 e;  2EQK A;  2K9G A;  1ZBJ A;  2COY A;  1QWF A;  4PLL A;  3I55 Q;  2YUP A;  4HCB A;  2QQB A;  2PU9 B;  4M77 G;  4A4H A;  1VQK A;  3QBY A;  1N8R R;  2K5F A;  4C92 G;  1D1C A;  3EFR A;  3NFC A;  4J9I A;  3HTR A;  3JCM V;  5GMK i;  4OP0 A;  2MYS A;  5HY6 A;  2KEA A;  3LYI A;  2J05 A;  2VUB A;  5GAN f;  1VQ6 T;  4RCB A;  1VQ8 Q;  2YT6 A;  4C8Q F;  4QQD A;  4PLI A;  3CC4 T;  3HRS A;  3VS2 A;  3D7S B;  4ZN1 A;  2CZ0 B;  5IAY A;  1OX8 A;  2DRM A;  3IQL A;  2RK2 A;  4OMM A;  1KQ2 A;  1Y96 B;  2KE9 A;  1YJ9 T;  1YN8 A;  1LVK A;  2KXD A;  2KGT A;  1JQQ A;  4PJO B;  2FG0 A;  4LN2 A;  1I0C A;  4AFS C;  2GQV A;  4R0K A;  3TEE A;  5GJV B;  3OYM A;  3CPW P;  1PRL C;  2OTL T;  3BDL A;  2FL7 A;  3QYG B;  4F14 A;  1WHG A;  3X25 B;  1I5L A;  1IHV A;  1EIF A;  3ZFJ A;  2RHI A;  2X4Y A;  4IUV A;  3JCM h;  1VQO A;  4E7S A;  2FZG B;  3FDR A;  2KSS A;  1K9M C;  1GCQ A;  1ZUY A;  2DD5 A;  4M7D A;  1YWP A;  1NPR A;  2EQJ A;  1K73 R;  3OYL A;  1M3C A;  1GXI E;  1QCO A;  4EMH A;  1K8A C;  2OTL Q;  1YIT Q;  2E70 A;  1VQL Q;  3L42 A;  4N4I A;  2KBT A;  1YWO A;  3FB9 A;  3VS6 A;  3CBO A;  1TXQ A;  2QA4 T;  3VS5 A;  3G6E Q;  1H64 1;  2KNB B;  4LD6 A;  2RNA A;  1I4K 1;  4FSX A;  3CXC P;  4C8Q B;  1TOV A;  4AFU C;  2M0O A;  2YRV A;  2LDM A;  1X01 A;  3A1P A;  3WXM B;  3GLX A;  5J26 A;  5ECA A;  4QVD A;  4OB0 B;  2EGC A;  2XD0 A;  3GBQ A;  3NPF A;  1Q81 R;  2E10 A;  4C0G A;  2EYX A;  4M7A E;  2L0A A;  3TCJ A;  4GY5 A;  1H8K A;  2JTM A;  3A98 A;  1VQ8 A;  3CCR A;  4PJO G;  5IHK A;  3MO8 A;  2JTE A;  3OBW A;  4JRI A;  4BD3 A;  1YJN T;  3QJ6 A;  2GNC A;  1NLP C;  3E9F A;  1TG0 A;  2D1X A;  2CP3 A;  3M4G A;  3OYY A;  1MV3 A;  2VXF A;  5CAI A;  3F70 A;  2LQK A;  3CBP A;  3LLR A;  2COZ A;  3R6N A;  4BY6 C;  2CP0 A;  1ZA1 B;  2J6K A;  5IHI A;  1KQS S;  1YJN Q;  2CSI A;  2V8K A;  3CCQ T;  3JCM P;  1IZ6 A;  2JNG A;  2M16 A;  4E7H A;  2EYQ A;  5GAM g;  2P0Q A;  2ECZ A;  2WAC A;  5FU7 B;  5D6W A;  1M2V A;  2YUN A;  4X9C A;  3MEU A;  4L5G A;  1FWZ A;  1B7T A;  4M7D C;  2RI3 A;  2HL5 C;  5FU6 B;  3UWN A;  1RAE B;  1O75 A;  1FYN A;  1YIJ T;  3JB9 F;  3TSW A;  2Z0W A;  4C8Q G;  2OTL A;  4IUP A;  1YIT A;  1VQL A;  3NGP A;  3NTI A;  3CCQ Q;  2CT3 A;  2WSE E;  3EG9 A;  4C0D C;  4OVA A;  1IHW A;  1U06 A;  1M1K U;  3G6E A;  1NLO C;  1E7O A;  1YBY A;  2NUP B;  2JJ9 A;  1NJI U;  1K8A U;  1Q7Y C;  4J9E A;  1K0S A;  2EVR A;  2X3X D;  1F1B B;  1YIJ Q;  5GAM j;  2RQT A;  5IH2 A;  1WYX A;  1SHG A;  1ZUU A;  1RAF B;  1X2K A;  5L8R E;  5CQX A;  4CC4 B;  4JUV A;  5GAM e;  3RKY A;  4KBM B;  4NL3 A;  1HXD A;  2K79 A;  5GAO m;  1GBR A;  2O4X B;  3S6W A;  4FIB A;  4Q5W A;  1JXM A;  2BZX A;  5KE3 A;  4M7A F;  2DAQ A;  3CC2 Q;  1JB0 E;  4OGE A;  4DBQ A;  2QG9 B;  2CP2 A;  1MMD A;  2CGH A;  3X28 B;  4RTV A;  3EAE A;  1IB8 A;  2Y90 A;  2GTO A;  3I5R A;  3PNW C;  2DZC A;  3Q1J A;  1YJN A;  1NEB A;  2VGM A;  3BFM A;  2L3S A;  3THK A;  1Z9Z A;  1ZSZ B;  3JRZ A;  1EFN A;  5HK0 A;  3CCE Q;  1UJ0 A;  3OA6 A;  4YTL A;  4M75 E;  2JMC A;  3G4S A;  2HD0 A;  4AMC A;  2RJE A;  2KAF A;  5CQY A;  1UDL A;  4A4G A;  3OYH A;  3H6Z A;  3CCQ A;  2FRY A;  1ARK A;  1H3H A;  5KCO A;  3REB B;  2EJF A;  3O8V A;  4X9D A;  3S3N A;  2RHX A;  2C06 A;  1W6X A;  3CCM T;  5CR2 A;  2PUO B;  2V1Q A;  2KQW A;  3MP6 A;  4OMN A;  1G2B A;  4JS5 A;  3J81 E;  2X4W A;  4CRI A;  2JM8 A;  4M7A B;  4A54 A;  3H9N A;  2PVD B;  2QYZ A;  4JZ4 A;  1C6V X;  1RAD B;  4R55 A;  2E5K A;  4JJD A;  3QO3 A;  1FMW A;  1NYF A;  4C5G A;  1Q7Y U;  4V2S A;  2YSQ A;  2GCX A;  4XU3 A;  4OB2 B;  4M77 A;  1VQ5 T;  2M0Y A;  5IN1 A;  2XHC A;  4C92 A;  1KD1 R;  5M9O A;  1SHF A;  3M0Q A;  1U5S A;  2OX7 A;  5GAN 8;  2QQS A;  3VUZ A;  3CC2 A;  2GFU A;  3I5S A;  1SRL A;  5FRN A;  4JZ3 A;  2QEX A;  2ATC B;  3OYB A;  3OMG A;  1HYO A;  1JO8 A;  1NZ9 A;  4WTO B;  4FSS A;  3A8G B;  3CPW A;  2HKQ B;  1I1J A;  1TUD A;  3CCL T;  2JZ2 A;  2ZZD A;  1NYG A;  3JCM Q;  2CZ7 B;  2LT1 A;  1AWX A;  1AWJ A;  2QQR A;  3QHS A;  4BAC A;  2KRS A;  7AT1 B;  4IKF A;  4DQ2 A;  1MHN A;  3V8L A;  4JRQ A;  2QAS A;  5LJ5 h;  4B9W A;  3EG0 A;  3RKW A;  2DRK A;  3VRZ A;  3X20 B;  3NTH A;  3HPW A;  5LJ3 h;  4AG2 C;  3CCE A;  3AT1 B;  1N8R C;  3KBG A;  3LWH A;  3QII A;  5GAN g;  3OYI A;  3OW2 A;  1BCM A;  3JB9 H;  4M78 E;  4NS5 A;  1M90 U;  4XU1 A;  2RM4 A;  4HVV A;  4M7A G;  4IIM A;  4PJN A;  2I0N A;  2LZ6 B;  3CXC A;  2COW A;  1KC8 R;  4E7J A;  1SPK A;  2LQW A;  3GF5 A;  1Z9Q A;  4IIO A;  2G3R A;  5LL6 S;  1AVZ C;  3UDC A;  5GAN 6;  5KYY B;  4M77 F;  3EH1 A;  4DBR A;  4FU6 A;  3E1S A;  4E7L A;  1V29 B;  2O01 E;  2AZS A;  2O88 A;  4BI8 B;  3M58 A;  4A4K A;  4XTV A;  4JDS A;  3RES A;  4D8K A;  3OYE A;  4M77 C;  2KT8 A;  1R0C B;  4C92 C;  2PTK A;  1Y96 A;  2A28 A;  1NEG A;  2MPX C;  3E19 A;  3TSZ A;  3HKS A;  2XDD A;  1QVF P;  2YXY A;  1VQM Q;  4PJO A;  1E6H A;  4EDU A;  1PSF A;  1A0N B;  5KYU B;  4ZGJ B;  1W1F A;  1PNJ A;  1VIF A;  2RI2 A;  3OS0 A;  3QUI A;  4FW2 A;  1RAA B;  5GAN 7;  4KGZ B;  5IXB A;  1Y57 A;  4M75 B;  2F2W A;  3JB9 D;  1RI9 A;  2H3E B;  2HQE A;  1M30 A;  4B9X A;  1UGV A;  2RHU A;  1GFC A;  1Q81 C;  3OYG A;  4HCK A;  2CT4 A;  1Q82 R;  1P92 A;  2CH4 A;  2E1H A;  4ATO A;  3OB9 A;  3R6O A;  4ORZ A;  1O9S A;  4FYX B;  1WHM A;  3LGF A;  1OQK A;  4M78 F;  4C8Q A;  1E6G A;  2MWP A;  4QVC A;  4BI3 A;  3SB2 A;  4LUE A;  3SWN B;  4OMP A;  1OEB A;  2XI9 A;  1VQO T;  2D0N A;  2J7I A;  2LX9 A;  2VWF A;  1WX6 A;  2E65 A;  1QQJ A;  1JJ2 A;  4JRP A;  3GNF B;  1TWB A;  4PL6 A;  5HCK A;  1HD3 A;  1M8M A;  1W4S A;  5EG2 A;  4EMK B;  2EFI A;  1M4Z A;  1RI0 A;  1YI2 Q;  3HFN A;  5KCH A;  3CMA Q;  4M7A D;  3H0H A;  1VQO Q;  2LMJ A;  2MK5 A;  4PJO F;  3RIR A;  2AK5 A;  2WSC E;  4IUR A;  1VQM A;  1VYT A;  2RK1 A;  1FMK A;  4D6W A;  1WHK A;  5LJ5 j;  4J6Y A;  3HRT A;  1QCF A;  2CSQ A;  3JCM b;  3ZEH A;  3VS0 A;  2XIC A;  1K1Z A;  2HL3 A;  2L8D A;  1G8X A;  3M0U A;  4M75 G;  5LJ5 e;  5CKB A;  3UF4 A;  2E6N A;  2JS2 A;  4MMK A;  2EYY A;  5GMK l;  1VQ8 T;  3M57 A;  1YP5 A;  3CCR T;  5A0L A;  2L5Q A;  4J9D A;  4PJM A;  1KIK A;  1Q86 U;  2DMO A;  4FL6 A;  1VIE A;  3NMZ C;  2BUD A;  3SD4 A;  1M8V A;  1I07 A;  4M78 B;  4DBH A; 
#chains in the Genus database with same CATH homology
 2LJ3 A;  1AZG B;  1JU5 C;  4M4Z A;  4LUD A;  3R6N A;  1ABQ A;  1Y0M A;  4EIK A;  1GRI A;  1BU1 A;  2CUD A;  1UEC A;  2J6K A;  5IHI A;  3VS7 A;  4RUG A;  1AEY A;  2CSI A;  2DBK A;  2DJQ A;  3RBB B;  2ECZ A;  2H8H A;  1MV0 B;  2YUN A;  1V1C A;  2KRN A;  2YUO A;  3I35 A;  2DYB A;  1X6G A;  1FYN A;  2K3B A;  1UHF A;  3TSW A;  1QKW A;  2AZV A;  4JJC A;  1PKT A;  1TUC A;  3NGP A;  2LJ0 A;  2CT3 A;  2F2V A;  2KT1 A;  2NUZ A;  2EBP A;  1N5Z A;  1U06 A;  4AFZ C;  3QWY A;  1NLO C;  1E7O A;  1RLP C;  2XMF A;  3FJ5 A;  2LNH B;  5FWB A;  4OML A;  4F16 A;  2RPN A;  1K0S A;  4J9E A;  2FPD A;  2DL3 A;  2C0T A;  2EVR A;  2D8J A;  1VYV A;  2X3X D;  2LJ1 A;  3SEM A;  2RQT A;  2LCS A;  2FPE A;  5IH2 A;  2O9V A;  1WYX A;  1AWW A;  1HSQ A;  1SHG A;  2SEM A;  1T3L A;  2ESW A;  2JM9 A;  1ZUU A;  3VS3 A;  1X2K A;  4CC4 B;  3ULR B;  4JJB A;  2FRW A;  3VS4 A;  1CKA A;  3EGU A;  4J9C A;  2GGR A;  2K79 A;  1ZUK A;  1GBR A;  1ZLM A;  1JXM A;  4CC2 A;  2NWM A;  2BZX A;  2ABL A;  1CKB A;  2FEI A;  3UA7 A;  3M0T A;  1UTI A;  2W10 A;  2DL4 A;  4JPB W;  2L3P A;  3NHN A;  2KYM A;  4LNP A;  1ZX6 A;  1SRM A;  4RTU A;  4RTV A;  2GTO A;  3I5R A;  2RMO A;  3CQT A;  2L2P A;  3EG1 A;  1HJD A;  2JMA A;  1IO6 A;  1NEB A;  2L3S A;  3THK A;  2MOX A;  1Z9Z A;  2RQV A;  1UG1 A;  1EFN A;  2CUB A;  2VVK A;  2JT4 A;  4Z88 A;  1M3A A;  4AG1 C;  1PHT A;  2ROT A;  2ED0 A;  2DX1 A;  1UJ0 A;  2SRC A;  2ROL A;  4RTY A;  1KFZ A;  2G6F X;  1QLY A;  5EC7 A;  3EHR A;  2JMC A;  1UDL A;  4ESR A;  3KFV A;  1OV3 A;  2EQI A;  2FRY A;  1ARK A;  2K2M A;  2RQU A;  1H3H A;  2KYB A;  4J9F A;  5FW9 A;  1X43 A;  3REB B;  1K76 A;  2EYW A;  1AWO A;  4KRT A;  2JXB A;  1KSW A;  4DEX A;  1NG2 A;  2HDA A;  2KR3 A;  3ZL7 C;  1UE9 A;  2P4R A;  1W6X A;  2DA9 A;  1YNZ A;  4Y92 A;  1J3T A;  2V1Q A;  1B07 A;  4OMN A;  2EW3 A;  1G2B A;  4D8D A;  1UJY A;  1W70 A;  4HVW A;  1K9A A;  2JM8 A;  1GBQ A;  1GCQ C;  2VKN A;  4JZ4 A;  2E5K A;  4JJD A;  1T3S A;  1WFW A;  1WLP B;  1NYF A;  2AKK A;  1QKX A;  2YSQ A;  4GLM A;  4HXJ A;  3I9Q A;  2M0Y A;  3PE0 A;  4RTX A;  1K4U S;  1WA7 A;  2KRO A;  2O2O A;  2BZ8 A;  1SHF A;  1WI7 A;  3M0Q A;  1JXO A;  3TVT A;  1U5S A;  1X27 A;  1SSH A;  4AFQ C;  2FO0 A;  3I5S A;  1SRL A;  2BTT A;  2KXC A;  4JZ3 A;  3REA B;  2CRE A;  2DM1 A;  1WIE A;  5FWC A;  4K11 A;  2DIL A;  5L23 A;  1JO8 A;  2YUQ A;  4FSS A;  3EG3 A;  1VA7 A;  3LH5 A;  1U3O A;  1I1J A;  1TUD A;  3U23 A;  1NYG A;  3H41 A;  4LE9 A;  2M51 A;  4ZNX A;  2GQI A;  4GBQ A;  1AWX A;  1AWJ A;  5GJW B;  3UAT A;  2KRS A;  3EG2 A;  3RNJ A;  2LX7 A;  2RN8 A;  3SHW A;  2O9S A;  3M0R A;  2B86 A;  2PNI A;  2HBW A;  2DL5 A;  2YDL A;  3EG0 A;  3VRZ A;  2DRK A;  2A36 A;  2C0O A;  4AG2 C;  5IHN A;  2OAW A;  4J9H A;  3QWX X;  1ABO A;  2DE0 X;  1RUW A;  2PZ1 A;  2EKH A;  3M0P A;  1T0H A;  5I11 A;  1JEG A;  4OMQ A;  2MCN A;  1H92 A;  2X3W D;  2CDT A;  3C0C A;  1B3Q A;  1BK2 A;  4HVV A;  4DEY A;  1UUE A;  4IIM A;  1BBZ A;  1X2Q A;  2I0N A;  2LZ6 B;  1M27 C;  4RTW A;  3M0S A;  1OPL A;  2EGA A;  2DL8 A;  1AOJ A;  3VRY A;  1SPK A;  2LQW A;  2KRM A;  1GCP A;  1T0J A;  1VYU A;  2BZY A;  2C0I A;  1K0X A;  1UHC A;  1XOV A;  1Z9Q A;  2CH4 W;  2RQW A;  4IIO A;  1AVZ C;  2RQR A;  4RTZ A;  2A37 A;  2JW4 A;  2EPD A;  2DNU A;  2K7A A;  2OI3 A;  1UFF A;  2IIM A;  2AZS A;  2O88 A;  3H0F A;  2L3Q A;  2W0Z A;  4D8K A;  2HCK A;  1SEM A;  2KT8 A;  1OOT A;  1WDX A;  1MUZ A;  2K9G A;  2QDL A;  2RF0 A;  1ZBJ A;  1QWF A;  2FPF A;  2YUP A;  1ZSG A;  4QT7 A;  2PTK A;  4HVU A;  3PVL A;  1G83 A;  2A28 A;  5I22 A;  1NEG A;  4J9I A;  4J9G A;  3TSZ A;  2HEQ A;  1E6H A;  2DL7 A;  2KEA A;  2J05 A;  2K6D A;  1GL5 A;  1A0N B;  1YCS B;  2YT6 A;  2GTJ A;  1W1F A;  1AZE A;  1PNJ A;  5IXF A;  4CC3 A;  3UA6 A;  1S1N A;  3VS2 A;  2LQN A;  2DRM A;  3IQL A;  4OMM A;  4J9B A;  2KE9 A;  2F2X A;  1YN8 A;  2V1R A;  5IXB A;  2D8H A;  2KXD A;  2KGT A;  1BB9 A;  2AKL A;  1JQQ A;  4CC7 A;  1Y57 A;  2FG0 A;  2DF6 A;  1PKS A;  2F2W A;  1RI9 A;  1WXT A;  1M30 A;  1I0C A;  4LN2 A;  4AFS C;  1UGV A;  4R0K A;  1GFC A;  5GJV B;  1PRL C;  2MIO A;  4OMO A;  4HCK A;  2CT4 A;  2ENM A;  2CH4 A;  4F14 A;  2LP5 A;  1X6B A;  4Z8A A;  1M3B A;  1KJW A;  4ORZ A;  4Z89 A;  1QWE A;  1WXB A;  1GCQ A;  1ZUY A;  3VS1 A;  1E6G A;  2DLP A;  3H0I A;  4LUE A;  1YWP A;  4OMP A;  1OEB A;  2J06 A;  2D0N A;  2J7I A;  3O5Z A;  2EGE A;  2VWF A;  1M3C A;  1WX6 A;  2HSP A;  3PVQ A;  1GFD A;  2KBT A;  2A08 A;  1AD5 A;  1YWO A;  4RTT A;  5HCK A;  2GBQ A;  1RLQ C;  1HD3 A;  1M8M A;  1X69 A;  3VS6 A;  3VS5 A;  1PRM C;  2JS0 A;  2KNB B;  2RNA A;  1CSK A;  2O31 A;  3H0H A;  2LMJ A;  2J6F A;  4AFU C;  2DBM A;  5ECA A;  2AK5 A;  2EGC A;  3GBQ A;  3NPF A;  1VYT A;  3EHQ A;  2EYX A;  1FMK A;  2L0A A;  1OPK A;  2ED1 A;  1H8K A;  3A98 A;  1QCF A;  3JV3 A;  2CSQ A;  4WCI A;  2DVJ A;  4X1V A;  3VS0 A;  4F17 A;  1K1Z A;  2OJ2 A;  5IHK A;  3M0U A;  1LCK A;  2JTE A;  1NM7 A;  4E6R A;  3UF4 A;  4A63 B;  1WXU A;  2JS2 A;  2EYY A;  1YP5 A;  2GNC A;  1NLP C;  1TG0 A;  4J9D A;  2D1X A;  1KIK A;  2DMO A;  3NMZ C;  1MV3 A;  1PWT A;  1I07 A;  2EYZ A;  2J6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...