4C0DB

Structure of the not module of the human ccr4-not complex (cnot1-cnot2-cnot3)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
191
structure length
191
Chain Sequence
MVTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
publication title Structure and Assembly of the not Module of the Human Ccr4-not Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c0dB00
4C0FA 5FU6C 5FU7C 4BY6B 4C0DB 4C0GA 5FU6B 4BY6C 4C0DC 5FU7B
chains in the Genus database with same CATH superfamily
1GCPA 5A0LA 1PRLC 3VRYA 2FZKB 3M55A 3G6EA 4AFQC 2J05A 1IRXA 1JXOA 1I4K1 4ANJA 1X2KA 1TU0B 3EGDA 1OZ3A 3OYKA 3F70A 2RJDA 2ECZA 1W1FA 1WDXA 3G4ST 1RL2A 1UHFA 4Y91A 5CVIA 4RG8A 1PCXA 2K2MA 3QUIA 3L2QA 2LDMA 1BBZA 2D0NA 3LH5A 5GANj 4F7UG 5GAN5 3S6WA 2EJGA 2KY9A 4JJDA 1SRLA 1NLPC 2J6KA 1RACB 4F7UA 1Q95G 2OTJQ 4BD3A 3M57A 5CK9A 1RAFB 3PGGA 3JB9I 3OYYA 1YWPA 2CREA 2VGMA 2EJ9A 2JW4A 2M1HA 2LP5A 2VVKA 1ZX6A 1N8RC 1WZOA 3I35A 4IUQA 1YJNA 2RI2A 2K3BA 3CD6A 3J80E 2DEUA 1VYUA 3OYJA 6AT1B 2O4XA 2RD1A 3PIOA 1B34A 5KYUA 1QKWA 2DVEA 2OTJT 1XQHA 3CCRQ 1FXXA 3FLGA 1H92A 3MJXA 3C12A 5GAN8 3CCMT 2OJ2A 1NM7A 5GAMj 3BDUA 3QDFA 3SB2A 1VQ4Q 4FYWB 1ZSGA 3CCMA 4M7DA 1VQ5T 2JVVA 2ATCB 4GBQA 3M56A 2L0AA 1ABOA 3CC4Q 4OMQA 1VQ5A 4B9WA 5FRMA 5AYFA 2DPPB 2CT3A 3CCRT 3O5ZA 1WYXA 5GAN4 3M4GA 2LNVA 3EGDB 3PIPA 4BI4A 3CCRA 1NPPA 2EYQA 1ZA2B 1G3SA 3RERA 5IHNA 4C0FA 1VQ4T 3S3NA 1TUCA 3VS7A 2VUBA 1QP3A 2DZ9A 3OY9A 1M1KU 5J39A 3LH0A 1U06A 2YSQA 1VQ4A 3QHSA 1MHNA 1KQSS 4MZPA 3CC4T 1W70A 1M4ZA 3I55A 3CCJQ 3OYDA 4IUUA 3KXTA 4XTVA 2CP7A 1OYXA 3BFMA 4PJOD 5FWBA 3JCMc 2EYZA 4F7UB 2EFIA 3QJ6A 1T0JA 1KQSP 1KIKA 2BE9B 1Y96A 2DKGA 2HBPA 2EYXA 5GMKj 2DBKA 2KRSA 2VKNA 2MIOA 1WHHA 2E4HA 4HKEA 1U5SA 2RM4A 3CCJT 3OYGA 2FL7A 3Q1JA 3TCJA 2YUQA 1G5VA 2JJ9A 3CBOA 1MMDA 2QDYB 1RAGB 2O4XB 4KBMB 5GANg 1B34B 5KYUB 2CGHA 4C8QC 3A8MB 2D6FA 3V8JA 3TQ7P 5GJWB 2XDPA 2KR3A 1VQ8A 1U1TA 4AT1B 1X75C 1Q82U 4QW2A 5CKBA 2Y90A 2DETA 4M4ZA 4M77D 4V2SA 4M7DB 1NJIU 2L89A 3CCVQ 3DLMA 3VUBA 1RI9A 3L2VA 3H0HA 2RA2A 1KHCA 5IN1A 3GNFB 4FW1A 3N5BB 2CSIA 4JJNK 3OYNA 3RKYA 4M78E 4F7UF 1D0XA 1Q81C 2XDDA 1QVGA 1YCSB 5GANh 2OAWA 3CCUA 4CI0C 4MMLA 4BACA 2QTXA 1YJ9Q 4O6JA 1UFFA 4QQDA 2X4JA 1WXBA 3CCVT 4C0DC 5GAMg 2NUTA 1YI2A 4PJOG 3VS2A 5KYWA 1QKXA 1VQMQ 3MP6A 3HPWA 1TOVA 2CP3A 1J3TA 5D6WA 3QPHA 1WI7A 2OAUA 1K9MC 2RQTA 4C92A 3LLRA 1TSFA 2DYIA 2JTFA 3P8HA 3NMZC 1BI2A 1Y96B 1RADB 3M0PA 1UHCA 1KD1U 1YJ9T 1TWBA 4E6RA 4HCBA 4RTWA 4FL6A 5A0DA 4OMMA 2D8JA 1M90C 5DLOA 5D7UA 2F5TX 1YIJQ 4JLGA 1YJ9A 1Y71A 2PVOB 1ABQA 5HKCA 4BY6C 2DILA 1VQMT 1YN8A 4M78C 1PRMC 2HMAA 2QI2A 5LJ5d 4DEXA 5GAMh 2OTLT 3VS5A 1X6GA 1TS9A 2X4XA 3J81E 4PNOA 4MZMA 2OTLA 4LDWA 2FYKA 4M77G 1M90U 1M30A 2CH4W 1Y57A 3C0CA 4JPBW 3JB9F 1YIJT 4OP0A 3MHXA 1WIEA 1WJQA 1ZUYA 4JS4A 3NGPA 4JRIA 3V8KA 2CYZB 2E3IA 5GAN6 3UT1A 1YIJA 2FRYA 5FU7C 3NTKA 3NHNA 3SFMA 2YUPA 4EMKC 4LN2A 2KAFA 1IB8A 3SWNC 5CAIA 5DY9A 1E6HA 1HJDA 5GANe 2KT8A 5LJ3f 3JV3A 1IXDA 1GL5A 5A2QE 2E41A 4RUGA 3M9QA 2A37A 3RBBB 3CCQA 2NUTB 2LX9A 4FM4B 2LJ3A 3JAME 1V1CA 1F1BB 2DERA 1G3WA 1FMVA 3KBGA 3LGFA 3V7SA 2EGCA 4OMOA 1H641 5GMKh 4LDXA 1NJIR 3CPWS 2C0IA 3HL8A 4XU2A 4C92B 4LUDA 1QCOA 4FCYA 4AG1C 2L3QA 1SSHA 3UWNA 2JTEA 4M7AC 2PU9B 4E7JA 1MMAA 3MKDA 1UTIA 2RHYA 1RLPC 3L42A 3CPWP 2R57A 1MNEA 2GGRA 2DFUA 1ZBJA 3VYHB 3M54A 2XU8A 3X26B 1WHLA 2YUOA 2KRNA 1K8AC 2JN0A 1A0NB 4RCCA 3ULRB 4JRPA 3QJYA 3DKMA 1SPKA 2LQKA 2DJZA 4FT4A 1M3BA 2A3LA 3HSBA 2K3XA 4BDZA 4OMFB 2AZSA 1TUGB 2FPDA 2K4YA 1PHTA 2G6FX 2ROLA 1BIBA 1G2BA 4FSXA 3QO3A 1B3QA 2FB7A 2EW3A 1JB0E 1BI3A 4PJOE 1WXUA 4RCBA 1KD1R 3X20B 2OI3A 1QQJA 2GQIA 2KSSA 4HCKA 2DLPA 3BW1A 3R6NA 3HTRA 1AZGB 1W4SA 2EQIA 4OMNA 3FRNA 2RK1A 4C92F 5FROA 5GANf 2GTOA 2X9HA 5GMKi 4KUIA 4LD9K 2O31A 2X35A 1K9AA 2XIDA 4JRQA 1PSFA 1AVZC 3JB9J 3REAB 2LMJA 2M16A 4ZN3A 5GAN3 3L2ZA 4R56A 1M90R 5LJ3j 2O9SA 2CP5A 2D9TA 4N0AC 1K73U 1IGUA 2K57A 4AFSC 4OB1B 1JU5C 1NEGA 2VXEA 2C0TA 1VQ9Q 1OI1A 2O9VA 4RG2A 4FYVB 4J9DA 2XDBA 2XKOC 2LQ8A 3OMGA 4M75C 4R55A 4M77E 2W10A 4OMPA 4PFZA 2HKQB 2FPEA 3P8DA 2JXBA 3MO8A 5KYXA 4E47A 1KC8C 2EBPA 2Y4YA 1PG5B 3G6EQ 2HEQA 2LTOA 5HK3A 1JQQA 1MV3A 3MP8A 4A4EA 5EC7A 1PNJA 2ZZDA 1VQ7A 1VQ9T 3KFVA 5CO7A 3CPFA 4LE9A 4CC7A 4E2FB 1Y0MA 1SF9A 3CBPA 2RN8A 3QKJA 1KHIA 1TTHB 1YITQ 3EH2A 4M7DD 2HL3A 1G3TA 2E6ZA 3GNGA 3MP1A 4C8QA 1AZEA 5AT1B 1LOJA 2VB6A 1SRMA 3CMET 4DBQA 3G6ET 3QSUA 1M3CA 2ED1A 3OW2P 3MEWA 3CMEA 2LC4A 1LJOA 1KQSA 3VJPA 4N4IA 2EGEA 5GAOq 3JCMP 3HRTA 5FW9A 2FEIA 3JB9D 4LNPA 4A4GA 1YITT 2K7AA 3EG0A 5CKHA 3PFSA 1VQOA 4EIKA 2OX7A 4KULA 1YITA 3D7SB 1E7OA 4ATOA 1Z9QA 2QQBA 1YJNQ 1CKBA 4ZGEB 1MGQA 3CCLA 2WSEE 4J8OA 2MYSA 3CD6Q 4LD6A 1K0XA 2YRDA 2HAXA 1D0YA 1FMWA 2DE0X 2JM8A 2CSQA 3I56Q 5GAOl 1YHQT 4KGXB 4BI8B 1M9SA 2MPXC 4Z02A 2L3SA 1ZUKA 1K8AR 2KI7A 3JCMf 1YHQA 3S3OA 2L8DA 4DEYA 5IAYA 3GPLA 1EFNA 4PK4A 1WGSA 2XG8D 4ME7A 1D1CA 2MF2A 4KRTA 2DK3A 3CCMQ 1YJNT 3G1JA 2QQ9A 3UF4A 2QA4Q 3PNWC 1AOJA 4XTUA 4DQ2A 3CD6T 3LW5E 1VQ5Q 2XK0A 5KYXB 4KT0E 2L2PA 3ER0A 1OU9A 3RKXA 3I56T 3I5SA 2DIQA 1WHGA 2HCKA 3I56A 4M78A 5DM7R 2BZYA 5LJ3g 1HK9A 5GANd 4M7DG 4Z89A 1VYTA 4TVRA 4O5VA 4XQ3A 3EG9B 1T3LA 2X3WD 2K5LA 3VYGA 1OULA 3HHTB 3ZBDA 1H8KA 2QA4T 1K73R 1VQPT 4LUEA 3L1AA 2HD0A 4C8QB 3REBB 4MDWA 3V7CA 2F2XA 3VS0A 3I55Q 1M1KC 1QP2A 3OYFA 2QA4A 2EQJA 1VQPA 3GLXA 2O88A 1KJWA 4BUGA 1SEMA 2RQRA 2RHIA 4RTUA 4RTVA 2A36A 2H8HA 5HCKA 1VA7A 1NYFA 2BZXA 3JB9G 1VOMA 4HVWA 3P8BB 4DBHA 5KYNA 2DA9A 1X43A 4J6XA 3FDRA 2NWMA 1BIAA 9ATCB 1BCOA 2YRCA 3O8VA 3TVTA 4EMKA 2QEXA 1M8VA 2QG9B 3SWNA 4HCZA 2RB6A 4A54A 3CCSQ 5LJ3h 3I55T 3X28B 1LVKA 1RLQC 2COWA 1WXTA 2ZGWA 2DTHA 2A28A 5GAMd 2DRKA 1Q7YU 2BKDN 4C92D 2KVQG 1N9RA 5M9OA 2EAYA 1KC8R 4C0DB 2RJCA 2PQWA 3UPUA 1VQ8Q 4KH1B 1RABB 2CP2A 2DJQA 3PMIA 3CCST 2JS0A 4UC4A 3META 4PLLA 1R0CB 4M75D 2DL5A 4C8QF 3CCSA 3SHWA 2K2VA 4MDXA 1Q82C 1KQ2A 5EG2A 1AT1B 2M0OA 2ZPEB 2D8HA 1V29B 4JZ4A 4PL6A 4M7AA 3RDVA 2DXCA 1OV3A 2D1XA 4J9IA 1NJIC 3RESA 4A4FA 1ACMB 2FVUA 2F1LA 1YP5A 1VQ8T 4BY6B 5C0MA 1WPYA 2PNIA 2RH2A 4M78B 4AFZC 2DTOA 3CCUQ 1C0MA 1WX6A 2A08A 4FYYB 2A7YA 4JLIA 1ZQ1A 1YI2Q 4NS5A 2RMOA 1B7TA 5LL6S 4JZ3A 2RHXA 1R8OB 4D8DA 3M0QA 4F7UE 4XTWA 2L3PA 3BDLA 1TXQA 4IIMA 2DTIA 4YTLA 2DO3A 2E70A 4BB7A 5KYYA 2JTMA 2ZPGB 2KDSA 4WF2A 5C6SA 3M0RA 3PVQA 3CCUT 2KEAA 4LXCA 3M0TA 1HXDA 3ZEHA 5FU7B 1D1AA 2VWFA 2QQSA 4KGVB 3CPWA 2XD0A 2COZA 4EMKB 4XAXB 4PLIA 5LJ3e 2J6OA 1W6XA 2RPNA 3SWNB 4DA4A 1YI2T 2FPFA 3JCMb 3UDCA 2JS2A 1KD1C 3CC2Q 2EKHA 4PFPA 4C92G 2AIRB 3AT1B 2V1QA 3RMQA 1PWTA 1WHJA 3OS1A 2G3RA 4XTYA 3M0UA 3EFRA 4F17A 1QCNA 2ABLA 4LDVA 2OTLQ 2QTVA 1ZHIA 4E7KA 4N0AA 1M2OA 4M75G 1WA7A 1S72A 2AKKA 1I07A 4J9FA 3CC2T 2CZ7B 1IHWA 2QDLA 5KE2A 3X25B 1ZSZC 4M7DF 1ZUUA 3QYHB 4M75A 1OPLA 4M7AB 3CC2A 4HT9A 5IXFA 4HCCA 3A8GB 2E65A 2BE7D 1M1KR 2K6DA 2EIFA 2HSEB 2GBQA 2GFUA 1U3OA 3SDZA 3CC7Q 4NL3A 2MK5A 2KQWA 4J7IA 1JXMA 7AT1B 3PVLA 4ZTJA 3A1PA 2COYA 2J7IA 3FJ5A 2BTTA 1C1AA 4J7FA 2RHZA 1BI1A 2WACA 3ZL7C 3CCQQ 3AHUA 2FG0A 1M5Q1 2ZPFB 4KUDK 3OBWA 4C5HA 5HK0A 5CKFA 4R0KA 1I0CA 1UGPB 2EQKA 1KK7A 4PKCC 2P4RA 2QAZA 5A0GA 1N27A 2HSPA 3JCMV 3JCMg 3CC7T 2MWOA 5KYYB 4RTYA 3V7RA 2DXBA 1TH7A 1G3YA 1R0BG 3CC7A 1KQ1A 2DYBA 4N4HA 3VS1A 1VQKA 2KROA 2FHDA 1XJWB 2NLUA 4DOVA 1OU8A 2K5IA 3FEOA 1NBEB 3I5RA 3CCQT 1NZ9A 2LQWA 4ZGJB 2EJFA 1Q86U 4HT8A 2LZ6B 3JCMQ 2VXFA 4M7AF 2YLBA 2PTKA 3H8ZA 4E7SA 2VC8A 1Q82R 4JDSA 4A4HA 2AKLA 2KYMA 1WHMA 2GFAA 3H0IA 2X4WA 2JUFA 2VASA 5GAN7 3E9FA 4PFOA 1UEBA 2SRCA 2RQVA 3RR6A 3JCMh 1LPLA 2H3EB 3QBYA 2PVDB 2JNGA 2ZCFB 3OYBA 1ARKA 4J6YA 1XOVA 3HP9A 4C0GA 3OS5A 1HYOA 1YWOA 3OYIA 2W0ZA 4M75B 3EFOA 3CEYA 4Z8AA 2LRQA 4WTOB 5GAOn 5CR2A 3KUFA 2ZPIB 2B8AA 2PUOB 1SKUB 3HFNA 2V8KA 1QVGP 4E7ZA 2RNAA 4C5EA 4C8QD 3M53A 4IKFA 4RMOA 1VQLA 4KGZB 3QXEB 2MI6A 2CP0A 4XK8E 3M5AA 1NPRA 2ZAEA 5I21A 1NLOC 2YT6A 1CSKA 2M9UA 3FIFA 5HY6A 3OYAA 4QVCA 2EYWA 2X3XD 1RI0A 2A0FB 3J7AF 1JO8A 3CCEQ 5GAOr 5I2MA 1BI0A 1X6BA 3CMAQ 1IZ6A 4IIOA 4CC2A 3OSVA 1PKTA 2MOXA 1GBQA 5GJVB 2DXTA 1K73C 3MCAB 2DD4A 3PTAA 1VQNQ 4BE2A 1QWEA 1M2VA 2FRWA 3TSZA 3IQLA 1M27C 1MV0B 2Z0WA 1TG0A 1NE8A 1QWFA 2JM9A 4L5GA 1V76A 4HVUA 4LDYA 4A63B 1X01A 3E2UA 3LYIA 2V8JA 3EHQA 3OMCA 4M75F 2HQEA 3CCET 2L5QA 1VQ7Q 3CMAT 3CQTA 2QASA 1UUEA 2LCSA 1AWJA 5FRNA 1RAHB 3CBMA 4J83A 5D6YA 2GQVA 1VQNT 3CCEA 3CMAA 2E5KA 1QVFS 4X9CA 4AFUC 3JCMe 2DMOA 1VQNA 1H3ZA 2O2OA 4PJOC 2VV5A 2RI5A 3JRZA 3VS4A 4OB2B 2JT4A 2DL7A 3OSSC 1BU1A 1D1BA 2MAMA 1VQ7T 1QVFP 3CMEQ 1W2BS 2YUNA 1G83A 3EFOB 1BK2A 3MEVA 4M78D 3QIIA 3URGA 2P4TA 2NUPA 1Q86R 1ZLMA 2L3RA 3C95A 4E7HA 4C8QG 1FX7A 2HDAA 5IH2A 3RUXA 3EG9A 5ECAA 3OW2S 1VQOQ 2QGFB 3G71A 4JJBA 3THKA 1W2BP 1GFDA 4JJCA 5LJ3d 2CP6A 3SD4A 1OPKA 4IUVA 5FU6C 3G7ZA 3CCLQ 2RK2A 1QMCA 3L2RA 1K0SA 1PD0A 2QQRA 2LT4A 2ENMA 5J3BA 2PUKB 3FB9A 1X2QA 1PD1A 3CXCP 2PZ1A 1GBRA 1HD3A 1X6OA 4M77C 4JS5A 5KCOA 3V8LA 2DX1A 5KH6A 4IUPA 4MZTA 4XTXA 2QGGA 1YHQQ 2EYYA 1VQOT 4QT7A 3GIBA 3QYGB 4RTTA 1UGRB 1EIFA 1M2VB 2D0QB 3QZ5B 1VUBA 4QVZA 3VUZA 2DEQA 1XTDA 3JCMW 3CCLT 1WLPB 1UECA 2VYTA 5IHIA 5LJ5e 3L2WA 1SSFA 2R58A 3WVEB 2GTJA 4OB3B 4FT2A 4OF1A 5KE3A 1I5OB 2M02A 4XU0A 2NUZA 1OX9A 4LDUA 3LX7A 3MEUA 3INZA 5GAOm 3OB9A 1YNZA 4QKUA 3GOXA 1CKAA 1YCYA 4XU3A 3G4SA 3OYLA 5I2SA 1JEGA 3EGXB 4Q5WA 4GY5A 4KH0B 1UJ0A 1IHVA 1YFNA 2C06A 1ZA1B 4X1VA 4M7AD 2BUDA 2O01E 1G8XA 4FSSA 1VQPQ 1I1JA 4BI3A 1WFWA 3BE3A 3H9NA 4M78G 3OYMA 2YDLA 1N6AA 2JZ2A 3HFOA 4ZNXA 1YJWQ 3NPFA 2KXCA 1VYVA 2EKOA 4FYXB 2XMFA 2KT1A 1ZSZA 4XTZA 3U23A 2GCXA 2V1RA 4J9GA 2V8IA 2NUPB 1JJ2S 2JMCA 1WHKA 2ZPBB 1I81A 2BZ8A 4ZTFA 3DB3A 2QEXQ 5KCHA 1O75A 4HXJA 4CRIA 2LX7A 4EMGA 3JSCA 2RJFA 2H3JA 4CC3A 2KXDA 1N9SA 2CUBA 4RTXA 2HBWA 1JJ2P 1GCQC 1LNXA 3VRZA 2CZ0B 2SEMA 1YJWT 4N4GA 1E6GA 4AMCA 5IT9E 2OTJA 1BCMA 3OYHA 1N8RU 1YJWA 3WVDB 1Q7YC 2QEXT 4NOYA 1EZZB 1SG5A 2K3YA 1D0ZA 4F04B 1VIFA 4L59A 5LJ5f 1MNDA 3PE0A 3JCMX 2DF6A 3TSWA 2C0OA 1I5LA 1BB9A 2F2WA 2YHTA 8AT1B 1JRIA 4EPCA 3R6OA 1WQWA 2DVJA 1K4US 2I2LA 2EQMA 2EPDA 4II1A 2CDTA 2K79A 4CC4B 1ZBXA 4J9BA 4C8QE 3OYEA 3LWIA 1UGQB 2DZCA 2KBTA 2R5AA 1LCKA 3BY7A 1M1GA 3QDRB 4M7AG 2RF0A 3VS6A 2CH4A 4PJMA 1WNLA 3M58A 4FW2A 4HVVA 2M0YA 4Z88A 2FZCB 2RHUA 3CC4A 1OEBA 1AWOA 2M51A 1UDLA 3UA7A 3S3MA 4ESRA 2KRMA 3M59A 4L6V5 5GAN2 2B86A 4VUBA 2MWPA 3NTIA 4HA8A 4JUVA 1ZSZB 2EQUA 5FWCA 3JCMJ 2CZ6B 2PVGB 4OB0B 5GAOp 3UA6A 3SEMA 2NYSA 2DXUA 3EH1A 1AEYA 3CCJA 1R77A 3A8LB 3PMTA 1T0HA 5J26A 1N5ZA 4C0ZA 4JRKA 2KE9A 2JOYA 4J6WA 1FYNA 4E7IA 2ED0A 2LQNA 2RI3A 4QQGA 2EGAA 3JCMd 1M8MA 1JBMA 1S72Q 3RNJA 2LJ1A 2AK5A 4OGEA 4C5GA 4QVDA 2P84A 3A8HB 2J6FA 3H0FA 1WJRA 2KMTA 1DJ7B 2DAQA 3TREA 3DLLA 3UATA 1PM3A 1EX4A 3QWXX 2EWNA 4DOWA 4OGCA 3JB9H 2BIVA 2DM1A 4EDUA 1Y07A 2F69A 1QLYA 2LVMA 2DBMA 2LCCA 1RUWA 3DB4A 4BE1A 2AHJB 3M4YA 5LJ5j 2FZGB 2HQXA 1IGQA 4EMHA 3HRSA 1S72T 4J9CA 1XNIA 4M7DE 4M78F 3HKSA 4BE0A 3X24B 3E9GA 2E5QA 3ZFJA 1N8RR 3CCVA 1Q81U 4Y92A 4PJOA 4K11A 2CS7A 1OX8A 1UG1A 5I22A 4RKUE 4A4KA 3RKWA 1I8FA 5L23A 2K9GA 1VQKQ 2KYBA 1UGVA 1Q7YR 5CQYA 4MMKA 2GF7A 3A5ZB 1K9MU 4D6WA 2QYZA 1VQMA 3C94A 1KFZA 2XHCA 3GBQA 4RTZA 1Q86C 4DBFA 5CKDA 4M7DC 2R5MA 1WJSA 2WSCE 3E1SA 2E1HA 2MMPA 3NFCA 1UE9A 2CZ1B 1VQKT 3ME9A 1UGSB 3VKIA 2LT1A 2YWWA 1WQ7A 2IIMA 3VV0A 1MMNA 3LWHA 4OMLA 4QQ6A 3OA6A 4M7AE 4M77A 1M3AA 2HL5C 1U8RA 1PSEA 1BKBA 4ZGDB 3T9NA 4F16A 3EG1A 1BYMA 2RQWA 1QVFA 2E12A 5I11A 4PJLA 4X9DA 1AHJB 5IXBA 3NTHA 3EFSA 1KSWA 1U1SA 1YBYA 2E64A 1TUDA 3A8OB 2ZPHB 3HRUA 3PT9A 2KGTA 4PJNA 2IG0A 2YXYA 1W2BA 2HNIA 3OQ5A 4IUTA 4GLKA 3QWYA 1OZ2A 2QXFA 4IURA 2HZYA 4D8KA 4AG2C 1VQLQ 2E10A 4P5NA 2RJEA 1MUZA 1RAIB 4ELYC 2K5FA 1Z9ZA 5KYWB 4J9EA 3VU3C 2DL8A 3OW2A 1AD5A 3OBYA 3CXCA 3OS2A 5DLQE 1QVGS 1K1ZA 2F5KA 1P92A 4PJOB 2EVRA 2ROTA 3EGUA 1IO6A 2X4YA 3LGLA 3QZ9B 3ASKA 4WCIA 3VS3A 4XU1A 1H3HA 5D6XA 3H41A 3FC3A 3OYCA 2MCNA 2YRVA 1SHFA 1VQLT 3TU4K 2XICA 2CT4A 2I0NA 1D3BA 5LJ5g 2KNBB 1HSQA 2KK4A 4BDYA 2E3HA 3WXMB 1QW1A 3GP8A 5GAMe 4PJJA 8ATCB 1VQ6Q 2VGNA 4C5IA 4DBRA 1GXIE 1D09B 2CUDA 1X69A 4X34A 1QCFA 4F14A 1FMKA 4C92E 2HQHA 2CKKA 2E6NA 2QQAA 1RAAB 1S1NA 2LNHB 4NL2A 1M1FA 3EG3A 2RQUA 5FU6B 1O9SA 2XI9A 2YLCA 1GCQA 5CCAA 2DL3A 1RAEB 4A53A 1Q81R 1NYGA 1KG1A 1MMGA 1PC0A 2F2VA 2P0PA 3TEEA 1NEBA 4M75E 1K8AU 3GF5A 4E7LA 4M77B 5CIUA 1VQ6T 3OS0A 2GNCA 2AZVA 5LJ5h 4B9XA 1VQ6A 1SHGA 3A98A 3MPUB 4FIBA 1X27A 4PJOF 2IVWA 1AWXA 3M0SA 1K9MR 5CKEA 1NG2A 2DNUA 4OVAA 3C4SA 2RO0A 3G71Q 2DL4A 5GMKm 5GMKl 1OOTA 1T3SA 5CQXA 3EGXA 2FO0A 1JJ2A 4FU6A 4C92C 4Y28E 2IPOB 3EHRA 3EAEA 3EG2A 2X51A 1GRIA 1OQKA 2DIGA 2WSFE 5GMKe 1C6VX 3I9QA 2J06A 3FJPA 1PKSA 1AWWA 2HKNA 3E19A 3MEAA 5IHKA 1VIEA 2AT1B 2DRMA 1K76A 3RIRA 3G71T 4ZN1A 2P0KA 2P0QA 2V26A 3CXCS 1D3BB 3RMSA 4J5YA 4M77F 1Y7XA 1UJYA 4ELZC 5GAMf 2LJ0A 1B07A 2Y4XA 2JMAA 4J9HA 1UB4A 4GLMA 5FLXE 1FWZA 5L8RE 1QVPA 1VQ9A 1GFCA 4ORZA 2QK0A 2DD5A 3G4SQ 1IREB 3H6ZA 2LCLA 3QG1A 1KC8U 3L2UA 4B6MA 2ESWA
chains in the Genus database with same CATH topology
2A3LA 5A0LA 5KE2A 3X25B 1ZBXA 3HSBA 4M7DF 2K3XA 3M55A 3QYHB 4BDZA 4C8QE 4M75A 3OYEA 3LWIA 3G6EA 1UGQB 4OMFB 4M7AB 3CC2A 2DZCA 4HT9A 2K4YA 2R5AA 4HCCA 3BY7A 1I4K1 1M1GA 3A8GB 2E65A 1OZ3A 3OYKA 3QDRB 4M7AG 2EIFA 1BIBA 3F70A 2GFUA 2RJDA 4FSXA 1WNLA 3M58A 3QO3A 3SDZA 3G4ST 1RL2A 2FB7A 2RHUA 3CC4A 1JB0E 1BI3A 4PJOE 4RCBA 4NL3A 4Y91A 2KQWA 5CVIA 4J7IA 4RG8A 3S3MA 3QUIA 3X20B 3L2QA 4ZTJA 2KSSA 3M59A 4L6V5 2LDMA 3BW1A 5GAN2 1W4SA 4J7FA 4VUBA 2MWPA 5GANj 2RHZA 3FRNA 2RK1A 3NTIA 4F7UG 4C92F 1BI1A 2WACA 4HA8A 5FROA 4JUVA 3S6WA 5GANf 5GAN5 3AHUA 1M5Q1 2EQUA 2ZPFB 2EJGA 2KY9A 3JCMJ 4KUDK 2CZ6B 2PVGB 3OBWA 4C5HA 5HK0A 5GMKi 4KUIA 4LD9K 4OB0B 5GAOp 5CKFA 1UGPB 2EQKA 4PKCC 5A0GA 1N27A 2X35A 4F7UA 2XIDA 4JRQA 3JCMV 1PSFA 4BD3A 3JCMg 3CC7T 2MWOA 3M57A 5CK9A 2DXUA 3JB9J 3V7RA 3CCJA 2DXBA 2M16A 1TH7A 3A8LB 3OYYA 3PGGA 3L2ZA 4ZN3A 5GAN3 3JB9I 4R56A 1G3YA 2VGMA 3PMTA 5LJ3j 3CC7A 2EJ9A 1KQ1A 2M1HA 2D9TA 4N0AC 5J26A 4N4HA 1VQKA 1K73U 4C0ZA 2FHDA 1N8RC 4JRKA 2NLUA 4DOVA 2K5IA 2K57A 4IUQA 4OB1B 3FEOA 3CCQT 2JOYA 1NZ9A 4ZGJB 1YJNA 4J6WA 2VXEA 2EJFA 1Q86U 4HT8A 1OI1A 2RI2A 4RG2A 4E7IA 2XDBA 2XKOC 3CD6A 2LQ8A 3OMGA 3J80E 3JCMQ 2VXFA 2RI3A 3OYJA 4QQGA 2O4XA 4M75C 2RD1A 4R55A 4M77E 3PIOA 4M7AF 2YLBA 3JCMd 1B34A 1JBMA 3H8ZA 2DVEA 2OTJT 2VC8A 1XQHA 1FXXA 4JDSA 4OGEA 4C5GA 4QVDA 4A4HA 3FLGA 3A8HB 2GFAA 1WJRA 3C12A 3P8DA 2KMTA 3MO8A 1DJ7B 2DAQA 2JUFA 2X4WA 3TREA 3DLLA 5GAN8 3CCMT 4E47A 1KC8C 5GAMj 2Y4YA 5GAN7 3E9FA 2EWNA 2LTOA 3BDUA 5HK3A 3SB2A 1UEBA 3MP8A 4A4EA 4OGCA 4DOWA 3JB9H 3JCMh 3CCMA 2BIVA 2ZZDA 1VQ7A 1VQ5T 4EDUA 4M7DA 1Y07A 3QBYA 1VQ9T 2PVDB 2F69A 2JVVA 5CO7A 2JNGA 2ZCFB 2LVMA 3CPFA 3OYBA 2LCCA 3DB4A 4BE1A 2AHJB 3M4YA 5LJ5j 3M56A 4J6YA 1XOVA 1VQ5A 3CBPA 2HQXA 4EMHA 3HP9A 4C0GA 3OS5A 3QKJA 3HRSA 4B9WA 1KHIA 1S72T 5FRMA 5AYFA 2DPPB 3OYIA 4M75B 3CCRT 1XNIA 4M7DD 4M7DE 4M78F 3CEYA 1G3TA 2E6ZA 3GNGA 3HKSA 3M4GA 3MP1A 5GAN4 4BE0A 2LNVA 4C8QA 3PIPA 4BI4A 3X24B 3E9GA 2E5QA 3ZFJA 1LOJA 2LRQA 5GAOn 3CCRA 1NPPA 5CR2A 3KUFA 3CMET 2ZPIB 2EYQA 3G6ET 3CCVA 1G3SA 2B8AA 2PUOB 3RERA 4C0FA 1VQ4T 3QSUA 3S3NA 3HFNA 2VUBA 2V8KA 1VQ6T 1QP3A 2DZ9A 3MEWA 3OY9A 4C5EA 3CMEA 2LC4A 4C8QD 3M53A 3LH0A 5J39A 1LJOA 1Q81U 1KQSA 4IKFA 3VJPA 4PJOA 2CS7A 1VQ4A 4RMOA 1VQLA 3QHSA 4N4IA 1MHNA 3QXEB 2MI6A 1KQSS 4MZPA 5GAOq 4M7AE 3CC4T 4XK8E 3M5AA 3JCMP 1NPRA 1M4ZA 5I21A 3I55A 3HRTA 4RKUE 4A4GA 4A4KA 3JB9D 3OYDA 2M9UA 4IUUA 1YITT 3RKWA 3FIFA 3KXTA 1I8FA 4XTVA 1OYXA 5CKHA 3BFMA 5HY6A 3PFSA 1VQOA 4PJOD 3OYAA 4QVCA 4KULA 3JCMc 1YITA 1RI0A 4ATOA 3J7AF 4F7UB 2EFIA 5CQYA 5GAOr 2QQBA 3QJ6A 1BI0A 4MMKA 5I2MA 1IZ6A 4ZGEB 1MGQA 1Y96A 2GF7A 3OSVA 3A5ZB 2DKGA 3CCLA 2WSEE 4J8OA 1K9MU 2HBPA 2DXTA 4LD6A 1K73C 4D6WA 1VQMA 3MCAB 2DD4A 3PTAA 4BE2A 3C94A 5GMKj 2HAXA 2XHCA 1Q86C 5GAOl 1YHQT 5CKDA 4M7DC 2R5MA 4BI8B 1M9SA 2WSCE 1WJSA 4HKEA 3E1SA 1NE8A 2E1HA 2RM4A 4Z02A 3CCJT 3OYGA 2MMPA 2FL7A 4L5GA 3NFCA 3Q1JA 3JCMf 1YHQA 3TCJA 3S3OA 2L8DA 4LDYA 5IAYA 3GPLA 1G5VA 1X01A 2CZ1B 3CBOA 3LYIA 1UGSB 1WGSA 2LT1A 2V8JA 2XG8D 3ME9A 1WQ7A 4ME7A 3VKIA 2QDYB 2MF2A 2O4XB 3OMCA 4M75F 3VV0A 2DK3A 2HQEA 4KBMB 5GANg 3LWHA 3CCET 2L5QA 1B34B 1YJNT 3CMAT 4QQ6A 2CGHA 2QQ9A 4C8QC 3A8MB 4M77A 3OA6A 3PNWC 5FRNA 2D6FA 3V8JA 4XTUA 1U8RA 1PSEA 1BKBA 3CBMA 4DQ2A 3T9NA 4ZGDB 3LW5E 3CD6T 4J83A 5D6YA 1BYMA 1QVFA 2XDPA 2E12A 2GQVA 1VQNT 3CCEA 1VQ8A 3CMAA 1U1TA 2XK0A 1AHJB 4KT0E 4X9DA 3NTHA 3EFSA 1X75C 3ER0A 1QVFS 1U1SA 2E64A 1YBYA 3RKXA 3I56T 1Q82U 4X9CA 4QW2A 3JCMe 3A8OB 5CKBA 2Y90A 2ZPHB 3HRUA 1VQNA 4M77D 4V2SA 2DIQA 1H3ZA 4PJOC 2VV5A 4M7DB 3PT9A 1NJIU 2L89A 3I56A 2RI5A 4FT4A 3JRZA 4M78A 4OB2B 5DM7R 5LJ3g 3DLMA 1HK9A 2IG0A 3VUBA 5GANd 1W2BA 3OSSC 4TVRA 2HNIA 3L2VA 4M7DG 3OQ5A 4IUTA 4GLKA 4O5VA 4XQ3A 2RA2A 1OZ2A 2QXFA 1KHCA 4IURA 5IN1A 2MAMA 3VYGA 2K5LA 1VQ7T 3GNFB 3HHTB 3ZBDA 1W2BS 3N5BB 2QA4T 1VQPT 4JJNK 2E10A 3OYNA 3L1AA 2HD0A 4P5NA 3MEVA 3RKYA 4C8QB 4M78D 4M78E 2RJEA 3QIIA 4MDWA 3URGA 2P4TA 4F7UF 3V7CA 4ELYC 2L3RA 3C95A 2K5FA 1M1KC 1QP2A 3OYFA 2QA4A 3VU3C 2XDDA 4E7HA 1Q81C 4C8QG 2EQJA 3OW2A 1VQPA 3GLXA 3OBYA 5GANh 1QVGA 1FX7A 3CXCA 3CCUA 4CI0C 4MMLA 3OS2A 4BACA 3RUXA 5DLQE 4BUGA 1QVGS 3OW2S 2RHIA 3G71A 2QTXA 2F5KA 4O6JA 4QQDA 5LJ3d 3SD4A 2X4JA 1P92A 4PJOB 3CCVT 3JB9G 3P8BB 4C0DC 2X4YA 3LGLA 3QZ9B 5GAMg 1YI2A 3ASKA 4IUVA 5FU6C 3G7ZA 4J6XA 4XU1A 5D6XA 3FDRA 2RK2A 1BIAA 4PJOG 3L2RA 3FC3A 3OYCA 3O8VA 3MP6A 3HPWA 4EMKA 4MDXA 2QQRA 2QEXA 2LT4A 2YRVA 1VQLT 5D6WA 5J3BA 1M8VA 2PUKB 3TU4K 3QPHA 3FB9A 3SWNA 2XICA 2RB6A 4HCZA 2OAUA 4A54A 1D3BA 5LJ3h 5LJ5g 1K9MC 4C92A 1M1KU 3I55T 3LLRA 1X6OA 2JTFA 4M77C 3X28B 2KK4A 4JS5A 5KCOA 4BDYA 3V8LA 3P8HA 5KH6A 3WXMB 4IUPA 4MZTA 1QW1A 4XTXA 3GP8A 1BI2A 1Y96B 5GAMe 2ZGWA 1VQOT 2VGNA 4C5IA 2DTHA 1YJ9T 1KD1U 4HCBA 3GIBA 1GXIE 3QYGB 5GAMd 1UGRB 4X34A 2BKDN 4FL6A 1EIFA 1Q7YU 2D0QB 3QZ5B 1VUBA 4QVZA 3VUZA 4C92D 4C92E 5A0DA 2KVQG 1M90C 2DEQA 5DLOA 1N9RA 5M9OA 2EAYA 2CKKA 2E6NA 2F5TX 1XTDA 2QQAA 4JLGA 4NL2A 3CCLT 3JCMW 1Y71A 2PVOB 1YJ9A 4C0DB 2RJCA 2VYTA 1M1FA 5HKCA 5LJ5e 4BY6C 5FU6B 1VQMT 2PQWA 4M78C 1O9SA 3L2WA 3UPUA 1SSFA 2XI9A 2R58A 2YLCA 2QI2A 3WVEB 5CCAA 5LJ5d 4OB3B 3PMIA 4FT2A 4OF1A 4A53A 5KE3A 3CCST 1KG1A 4UC4A 4XU0A 5GAMh 2OTLT 3META 4PLLA 2P0PA 4LDUA 3TEEA 3LX7A 2X4XA 3MEUA 3INZA 4M75D 4M75E 1K8AU 3GF5A 4C8QF 5GAOm 3J81E 3CCSA 4E7LA 2K2VA 3OB9A 4M77B 4PNOA 4MZMA 5CIUA 1Q82C 3OS0A 3GOXA 5EG2A 1VQKT 2OTLA 1KQ2A 2M0OA 2ZPEB 4LDWA 1V29B 1YCYA 2FYKA 4PL6A 4XU3A 4M7AA 4M77G 3G4SA 2DXCA 5LJ5h 1M90U 4B9XA 1NJIC 3OYLA 1VQ6A 3RESA 5I2SA 4A4FA 3JB9F 1YIJT 4OP0A 3MHXA 1WJQA 4Q5WA 4GY5A 4FIBA 4JS4A 2FVUA 4JRIA 3V8KA 2C06A 2CYZB 4PJOF 2IVWA 5GAN6 1VQ8T 3UT1A 4BY6B 2BUDA 2O01E 1WPYA 5C0MA 2RH2A 1YIJA 4M7AD 4M78B 5CKEA 2DTOA 4BI3A 5FU7C 3NTKA 3SFMA 4OVAA 4M78G 4EMKC 3OYMA 3C4SA 2RO0A 1N6AA 2JZ2A 5GMKl 2KAFA 3HFOA 5GMKm 5CQXA 3SWNC 2A7YA 2EKOA 4FU6A 4C92C 4JLIA 4Y28E 1ZQ1A 5CAIA 1JJ2A 4XTZA 2GCXA 4NS5A 5DY9A 3EAEA 2V8IA 5LL6S 5GANe 1JJ2S 2RHXA 1R8OB 2DIGA 2ZPBB 4F7UE 1I81A 5LJ3f 4ZTFA 2WSFE 3DB3A 4XTWA 5GMKe 3BDLA 3FJPA 5KCHA 2DTIA 5A2QE 1O75A 2E41A 4YTLA 3E19A 2DO3A 2E70A 4BB7A 4CRIA 3MEAA 4EMGA 2JTMA 3M9QA 2ZPGB 3JSCA 2RJFA 2H3JA 2KDSA 3CCQA 4WF2A 1VIEA 5C6SA 2LX9A 3CCUT 4FM4B 1N9SA 3RIRA 3JAME 3G71T 1HXDA 1LNXA 2LQKA 5FU7B 3ZEHA 2QQSA 2CZ0B 4ZN1A 1G3WA 3CPWA 2XD0A 4EMKB 1YJWT 4N4GA 3KBGA 4XAXB 3LGFA 3V7SA 4PLIA 5LJ3e 2P0KA 1H641 5IT9E 4DA4A 3SWNB 2P0QA 5GMKh 1YI2T 4LDXA 3JCMb 3CPWS 3UDCA 3HL8A 1D3BB 4XU2A 3CXCS 2OTJA 4C92B 3OYHA 1KD1C 3RMSA 1N8RU 4J5YA 4M77F 1YJWA 1Y7XA 3WVDB 4ELZC 5GAMf 1Q7YC 2QEXT 3UWNA 4C92G 4M7AC 2PU9B 4NOYA 4E7JA 3RMQA 2Y4XA 3OS1A 1UB4A 2RHYA 2K3YA 1VIFA 2G3RA 4L59A 5FLXE 1FWZA 3L42A 5L8RE 4XTYA 5LJ5f 2R57A 1QVPA 1VQ9A 3EFRA 3JCMX 4LDVA 1I5LA 2DD5A 2YHTA 3VYHB 1JRIA 3M54A 4EPCA 2XU8A 3R6OA 1WQWA 1ZHIA 3X26B 4E7KA 1IREB 3H6ZA 4N0AA 2LCLA 1K8AC 4M75G 2JN0A 3QG1A 1KC8U 3L2UA 1S72A 4RCCA 4JRPA 3QJYA 2I2LA 2EQMA 3DKMA 4II1A 2DJZA 3CC2T 2CZ7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0F A;  5FU6 C;  5FU7 C;  4BY6 B;  4C0D B;  4C0G A;  5FU6 B;  4BY6 C;  4C0D C;  5FU7 B; 
#chains in the Genus database with same CATH topology
 1GCP A;  5A0L A;  1PRL C;  3VRY A;  2FZK B;  3M55 A;  3G6E A;  4AFQ C;  2J05 A;  1IRX A;  1JXO A;  1I4K 1;  4ANJ A;  1X2K A;  1TU0 B;  3EGD A;  1OZ3 A;  3OYK A;  3F70 A;  2RJD A;  2ECZ A;  1W1F A;  1WDX A;  3G4S T;  1RL2 A;  1UHF A;  4Y91 A;  5CVI A;  4RG8 A;  1PCX A;  2K2M A;  3QUI A;  3L2Q A;  2LDM A;  1BBZ A;  2D0N A;  3LH5 A;  5GAN j;  4F7U G;  5GAN 5;  3S6W A;  2EJG A;  2KY9 A;  4JJD A;  1SRL A;  1NLP C;  2J6K A;  1RAC B;  4F7U A;  1Q95 G;  2OTJ Q;  4BD3 A;  3M57 A;  5CK9 A;  1RAF B;  3PGG A;  3JB9 I;  3OYY A;  1YWP A;  2CRE A;  2VGM A;  2EJ9 A;  2JW4 A;  2M1H A;  2LP5 A;  2VVK A;  1ZX6 A;  1N8R C;  1WZO A;  3I35 A;  4IUQ A;  1YJN A;  2RI2 A;  2K3B A;  3CD6 A;  3J80 E;  2DEU A;  1VYU A;  3OYJ A;  6AT1 B;  2O4X A;  2RD1 A;  3PIO A;  1B34 A;  5KYU A;  1QKW A;  2DVE A;  2OTJ T;  1XQH A;  3CCR Q;  1FXX A;  3FLG A;  1H92 A;  3MJX A;  3C12 A;  5GAN 8;  3CCM T;  2OJ2 A;  1NM7 A;  5GAM j;  3BDU A;  3QDF A;  3SB2 A;  1VQ4 Q;  4FYW B;  1ZSG A;  3CCM A;  4M7D A;  1VQ5 T;  2JVV A;  2ATC B;  4GBQ A;  3M56 A;  2L0A A;  1ABO A;  3CC4 Q;  4OMQ A;  1VQ5 A;  4B9W A;  5FRM A;  5AYF A;  2DPP B;  2CT3 A;  3CCR T;  3O5Z A;  1WYX A;  5GAN 4;  3M4G A;  2LNV A;  3EGD B;  3PIP A;  4BI4 A;  3CCR A;  1NPP A;  2EYQ A;  1ZA2 B;  1G3S A;  3RER A;  5IHN A;  4C0F A;  1VQ4 T;  3S3N A;  1TUC A;  3VS7 A;  2VUB A;  1QP3 A;  2DZ9 A;  3OY9 A;  1M1K U;  5J39 A;  3LH0 A;  1U06 A;  2YSQ A;  1VQ4 A;  3QHS A;  1MHN A;  1KQS S;  4MZP A;  3CC4 T;  1W70 A;  1M4Z A;  3I55 A;  3CCJ Q;  3OYD A;  4IUU A;  3KXT A;  4XTV A;  2CP7 A;  1OYX A;  3BFM A;  4PJO D;  5FWB A;  3JCM c;  2EYZ A;  4F7U B;  2EFI A;  3QJ6 A;  1T0J A;  1KQS P;  1KIK A;  2BE9 B;  1Y96 A;  2DKG A;  2HBP A;  2EYX A;  5GMK j;  2DBK A;  2KRS A;  2VKN A;  2MIO A;  1WHH A;  2E4H A;  4HKE A;  1U5S A;  2RM4 A;  3CCJ T;  3OYG A;  2FL7 A;  3Q1J A;  3TCJ A;  2YUQ A;  1G5V A;  2JJ9 A;  3CBO A;  1MMD A;  2QDY B;  1RAG B;  2O4X B;  4KBM B;  5GAN g;  1B34 B;  5KYU B;  2CGH A;  4C8Q C;  3A8M B;  2D6F A;  3V8J A;  3TQ7 P;  5GJW B;  2XDP A;  2KR3 A;  1VQ8 A;  1U1T A;  4AT1 B;  1X75 C;  1Q82 U;  4QW2 A;  5CKB A;  2Y90 A;  2DET A;  4M4Z A;  4M77 D;  4V2S A;  4M7D B;  1NJI U;  2L89 A;  3CCV Q;  3DLM A;  3VUB A;  1RI9 A;  3L2V A;  3H0H A;  2RA2 A;  1KHC A;  5IN1 A;  3GNF B;  4FW1 A;  3N5B B;  2CSI A;  4JJN K;  3OYN A;  3RKY A;  4M78 E;  4F7U F;  1D0X A;  1Q81 C;  2XDD A;  1QVG A;  1YCS B;  5GAN h;  2OAW A;  3CCU A;  4CI0 C;  4MML A;  4BAC A;  2QTX A;  1YJ9 Q;  4O6J A;  1UFF A;  4QQD A;  2X4J A;  1WXB A;  3CCV T;  4C0D C;  5GAM g;  2NUT A;  1YI2 A;  4PJO G;  3VS2 A;  5KYW A;  1QKX A;  1VQM Q;  3MP6 A;  3HPW A;  1TOV A;  2CP3 A;  1J3T A;  5D6W A;  3QPH A;  1WI7 A;  2OAU A;  1K9M C;  2RQT A;  4C92 A;  3LLR A;  1TSF A;  2DYI A;  2JTF A;  3P8H A;  3NMZ C;  1BI2 A;  1Y96 B;  1RAD B;  3M0P A;  1UHC A;  1KD1 U;  1YJ9 T;  1TWB A;  4E6R A;  4HCB A;  4RTW A;  4FL6 A;  5A0D A;  4OMM A;  2D8J A;  1M90 C;  5DLO A;  5D7U A;  2F5T X;  1YIJ Q;  4JLG A;  1YJ9 A;  1Y71 A;  2PVO B;  1ABQ A;  5HKC A;  4BY6 C;  2DIL A;  1VQM T;  1YN8 A;  4M78 C;  1PRM C;  2HMA A;  2QI2 A;  5LJ5 d;  4DEX A;  5GAM h;  2OTL T;  3VS5 A;  1X6G A;  1TS9 A;  2X4X A;  3J81 E;  4PNO A;  4MZM A;  2OTL A;  4LDW A;  2FYK A;  4M77 G;  1M90 U;  1M30 A;  2CH4 W;  1Y57 A;  3C0C A;  4JPB W;  3JB9 F;  1YIJ T;  4OP0 A;  3MHX A;  1WIE A;  1WJQ A;  1ZUY A;  4JS4 A;  3NGP A;  4JRI A;  3V8K A;  2CYZ B;  2E3I A;  5GAN 6;  3UT1 A;  1YIJ A;  2FRY A;  5FU7 C;  3NTK A;  3NHN A;  3SFM A;  2YUP A;  4EMK C;  4LN2 A;  2KAF A;  1IB8 A;  3SWN C;  5CAI A;  5DY9 A;  1E6H A;  1HJD A;  5GAN e;  2KT8 A;  5LJ3 f;  3JV3 A;  1IXD A;  1GL5 A;  5A2Q E;  2E41 A;  4RUG A;  3M9Q A;  2A37 A;  3RBB B;  3CCQ A;  2NUT B;  2LX9 A;  4FM4 B;  2LJ3 A;  3JAM E;  1V1C A;  1F1B B;  2DER A;  1G3W A;  1FMV A;  3KBG A;  3LGF A;  3V7S A;  2EGC A;  4OMO A;  1H64 1;  5GMK h;  4LDX A;  1NJI R;  3CPW S;  2C0I A;  3HL8 A;  4XU2 A;  4C92 B;  4LUD A;  1QCO A;  4FCY A;  4AG1 C;  2L3Q A;  1SSH A;  3UWN A;  2JTE A;  4M7A C;  2PU9 B;  4E7J A;  1MMA A;  3MKD A;  1UTI A;  2RHY A;  1RLP C;  3L42 A;  3CPW P;  2R57 A;  1MNE A;  2GGR A;  2DFU A;  1ZBJ A;  3VYH B;  3M54 A;  2XU8 A;  3X26 B;  1WHL A;  2YUO A;  2KRN A;  1K8A C;  2JN0 A;  1A0N B;  4RCC A;  3ULR B;  4JRP A;  3QJY A;  3DKM A;  1SPK A;  2LQK A;  2DJZ A;  4FT4 A;  1M3B A;  2A3L A;  3HSB A;  2K3X A;  4BDZ A;  4OMF B;  2AZS A;  1TUG B;  2FPD A;  2K4Y A;  1PHT A;  2G6F X;  2ROL A;  1BIB A;  1G2B A;  4FSX A;  3QO3 A;  1B3Q A;  2FB7 A;  2EW3 A;  1JB0 E;  1BI3 A;  4PJO E;  1WXU A;  4RCB A;  1KD1 R;  3X20 B;  2OI3 A;  1QQJ A;  2GQI A;  2KSS A;  4HCK A;  2DLP A;  3BW1 A;  3R6N A;  3HTR A;  1AZG B;  1W4S A;  2EQI A;  4OMN A;  3FRN A;  2RK1 A;  4C92 F;  5FRO A;  5GAN f;  2GTO A;  2X9H A;  5GMK i;  4KUI A;  4LD9 K;  2O31 A;  2X35 A;  1K9A A;  2XID A;  4JRQ A;  1PSF A;  1AVZ C;  3JB9 J;  3REA B;  2LMJ A;  2M16 A;  4ZN3 A;  5GAN 3;  3L2Z A;  4R56 A;  1M90 R;  5LJ3 j;  2O9S A;  2CP5 A;  2D9T A;  4N0A C;  1K73 U;  1IGU A;  2K57 A;  4AFS C;  4OB1 B;  1JU5 C;  1NEG A;  2VXE A;  2C0T A;  1VQ9 Q;  1OI1 A;  2O9V A;  4RG2 A;  4FYV B;  4J9D A;  2XDB A;  2XKO C;  2LQ8 A;  3OMG A;  4M75 C;  4R55 A;  4M77 E;  2W10 A;  4OMP A;  4PFZ A;  2HKQ B;  2FPE A;  3P8D A;  2JXB A;  3MO8 A;  5KYX A;  4E47 A;  1KC8 C;  2EBP A;  2Y4Y A;  1PG5 B;  3G6E Q;  2HEQ A;  2LTO A;  5HK3 A;  1JQQ A;  1MV3 A;  3MP8 A;  4A4E A;  5EC7 A;  1PNJ A;  2ZZD A;  1VQ7 A;  1VQ9 T;  3KFV A;  5CO7 A;  3CPF A;  4LE9 A;  4CC7 A;  4E2F B;  1Y0M A;  1SF9 A;  3CBP A;  2RN8 A;  3QKJ A;  1KHI A;  1TTH B;  1YIT Q;  3EH2 A;  4M7D D;  2HL3 A;  1G3T A;  2E6Z A;  3GNG A;  3MP1 A;  4C8Q A;  1AZE A;  5AT1 B;  1LOJ A;  2VB6 A;  1SRM A;  3CME T;  4DBQ A;  3G6E T;  3QSU A;  1M3C A;  2ED1 A;  3OW2 P;  3MEW A;  3CME A;  2LC4 A;  1LJO A;  1KQS A;  3VJP A;  4N4I A;  2EGE A;  5GAO q;  3JCM P;  3HRT A;  5FW9 A;  2FEI A;  3JB9 D;  4LNP A;  4A4G A;  1YIT T;  2K7A A;  3EG0 A;  5CKH A;  3PFS A;  1VQO A;  4EIK A;  2OX7 A;  4KUL A;  1YIT A;  3D7S B;  1E7O A;  4ATO A;  1Z9Q A;  2QQB A;  1YJN Q;  1CKB A;  4ZGE B;  1MGQ A;  3CCL A;  2WSE E;  4J8O A;  2MYS A;  3CD6 Q;  4LD6 A;  1K0X A;  2YRD A;  2HAX A;  1D0Y A;  1FMW A;  2DE0 X;  2JM8 A;  2CSQ A;  3I56 Q;  5GAO l;  1YHQ T;  4KGX B;  4BI8 B;  1M9S A;  2MPX C;  4Z02 A;  2L3S A;  1ZUK A;  1K8A R;  2KI7 A;  3JCM f;  1YHQ A;  3S3O A;  2L8D A;  4DEY A;  5IAY A;  3GPL A;  1EFN A;  4PK4 A;  1WGS A;  2XG8 D;  4ME7 A;  1D1C A;  2MF2 A;  4KRT A;  2DK3 A;  3CCM Q;  1YJN T;  3G1J A;  2QQ9 A;  3UF4 A;  2QA4 Q;  3PNW C;  1AOJ A;  4XTU A;  4DQ2 A;  3CD6 T;  3LW5 E;  1VQ5 Q;  2XK0 A;  5KYX B;  4KT0 E;  2L2P A;  3ER0 A;  1OU9 A;  3RKX A;  3I56 T;  3I5S A;  2DIQ A;  1WHG A;  2HCK A;  3I56 A;  4M78 A;  5DM7 R;  2BZY A;  5LJ3 g;  1HK9 A;  5GAN d;  4M7D G;  4Z89 A;  1VYT A;  4TVR A;  4O5V A;  4XQ3 A;  3EG9 B;  1T3L A;  2X3W D;  2K5L A;  3VYG A;  1OUL A;  3HHT B;  3ZBD A;  1H8K A;  2QA4 T;  1K73 R;  1VQP T;  4LUE A;  3L1A A;  2HD0 A;  4C8Q B;  3REB B;  4MDW A;  3V7C A;  2F2X A;  3VS0 A;  3I55 Q;  1M1K C;  1QP2 A;  3OYF A;  2QA4 A;  2EQJ A;  1VQP A;  3GLX A;  2O88 A;  1KJW A;  4BUG A;  1SEM A;  2RQR A;  2RHI A;  4RTU A;  4RTV A;  2A36 A;  2H8H A;  5HCK A;  1VA7 A;  1NYF A;  2BZX A;  3JB9 G;  1VOM A;  4HVW A;  3P8B B;  4DBH A;  5KYN A;  2DA9 A;  1X43 A;  4J6X A;  3FDR A;  2NWM A;  1BIA A;  9ATC B;  1BCO A;  2YRC A;  3O8V A;  3TVT A;  4EMK A;  2QEX A;  1M8V A;  2QG9 B;  3SWN A;  4HCZ A;  2RB6 A;  4A54 A;  3CCS Q;  5LJ3 h;  3I55 T;  3X28 B;  1LVK A;  1RLQ C;  2COW A;  1WXT A;  2ZGW A;  2DTH A;  2A28 A;  5GAM d;  2DRK A;  1Q7Y U;  2BKD N;  4C92 D;  2KVQ G;  1N9R A;  5M9O A;  2EAY A;  1KC8 R;  4C0D B;  2RJC A;  2PQW A;  3UPU A;  1VQ8 Q;  4KH1 B;  1RAB B;  2CP2 A;  2DJQ A;  3PMI A;  3CCS T;  2JS0 A;  4UC4 A;  3MET A;  4PLL A;  1R0C B;  4M75 D;  2DL5 A;  4C8Q F;  3CCS A;  3SHW A;  2K2V A;  4MDX A;  1Q82 C;  1KQ2 A;  5EG2 A;  1AT1 B;  2M0O A;  2ZPE B;  2D8H A;  1V29 B;  4JZ4 A;  4PL6 A;  4M7A A;  3RDV A;  2DXC A;  1OV3 A;  2D1X A;  4J9I A;  1NJI C;  3RES A;  4A4F A;  1ACM B;  2FVU A;  2F1L A;  1YP5 A;  1VQ8 T;  4BY6 B;  5C0M A;  1WPY A;  2PNI A;  2RH2 A;  4M78 B;  4AFZ C;  2DTO A;  3CCU Q;  1C0M A;  1WX6 A;  2A08 A;  4FYY B;  2A7Y A;  4JLI A;  1ZQ1 A;  1YI2 Q;  4NS5 A;  2RMO A;  1B7T A;  5LL6 S;  4JZ3 A;  2RHX A;  1R8O B;  4D8D A;  3M0Q A;  4F7U E;  4XTW A;  2L3P A;  3BDL A;  1TXQ A;  4IIM A;  2DTI A;  4YTL A;  2DO3 A;  2E70 A;  4BB7 A;  5KYY A;  2JTM A;  2ZPG B;  2KDS A;  4WF2 A;  5C6S A;  3M0R A;  3PVQ A;  3CCU T;  2KEA A;  4LXC A;  3M0T A;  1HXD A;  3ZEH A;  5FU7 B;  1D1A A;  2VWF A;  2QQS A;  4KGV B;  3CPW A;  2XD0 A;  2COZ A;  4EMK B;  4XAX B;  4PLI A;  5LJ3 e;  2J6O A;  1W6X A;  2RPN A;  3SWN B;  4DA4 A;  1YI2 T;  2FPF A;  3JCM b;  3UDC A;  2JS2 A;  1KD1 C;  3CC2 Q;  2EKH A;  4PFP A;  4C92 G;  2AIR B;  3AT1 B;  2V1Q A;  3RMQ A;  1PWT A;  1WHJ A;  3OS1 A;  2G3R A;  4XTY A;  3M0U A;  3EFR A;  4F17 A;  1QCN A;  2ABL A;  4LDV A;  2OTL Q;  2QTV A;  1ZHI A;  4E7K A;  4N0A A;  1M2O A;  4M75 G;  1WA7 A;  1S72 A;  2AKK A;  1I07 A;  4J9F A;  3CC2 T;  2CZ7 B;  1IHW A;  2QDL A;  5KE2 A;  3X25 B;  1ZSZ C;  4M7D F;  1ZUU A;  3QYH B;  4M75 A;  1OPL A;  4M7A B;  3CC2 A;  4HT9 A;  5IXF A;  4HCC A;  3A8G B;  2E65 A;  2BE7 D;  1M1K R;  2K6D A;  2EIF A;  2HSE B;  2GBQ A;  2GFU A;  1U3O A;  3SDZ A;  3CC7 Q;  4NL3 A;  2MK5 A;  2KQW A;  4J7I A;  1JXM A;  7AT1 B;  3PVL A;  4ZTJ A;  3A1P A;  2COY A;  2J7I A;  3FJ5 A;  2BTT A;  1C1A A;  4J7F A;  2RHZ A;  1BI1 A;  2WAC A;  3ZL7 C;  3CCQ Q;  3AHU A;  2FG0 A;  1M5Q 1;  2ZPF B;  4KUD K;  3OBW A;  4C5H A;  5HK0 A;  5CKF A;  4R0K A;  1I0C A;  1UGP B;  2EQK A;  1KK7 A;  4PKC C;  2P4R A;  2QAZ A;  5A0G A;  1N27 A;  2HSP A;  3JCM V;  3JCM g;  3CC7 T;  2MWO A;  5KYY B;  4RTY A;  3V7R A;  2DXB A;  1TH7 A;  1G3Y A;  1R0B G;  3CC7 A;  1KQ1 A;  2DYB A;  4N4H A;  3VS1 A;  1VQK A;  2KRO A;  2FHD A;  1XJW B;  2NLU A;  4DOV A;  1OU8 A;  2K5I A;  3FEO A;  1NBE B;  3I5R A;  3CCQ T;  1NZ9 A;  2LQW A;  4ZGJ B;  2EJF A;  1Q86 U;  4HT8 A;  2LZ6 B;  3JCM Q;  2VXF A;  4M7A F;  2YLB A;  2PTK A;  3H8Z A;  4E7S A;  2VC8 A;  1Q82 R;  4JDS A;  4A4H A;  2AKL A;  2KYM A;  1WHM A;  2GFA A;  3H0I A;  2X4W A;  2JUF A;  2VAS A;  5GAN 7;  3E9F A;  4PFO A;  1UEB A;  2SRC A;  2RQV A;  3RR6 A;  3JCM h;  1LPL A;  2H3E B;  3QBY A;  2PVD B;  2JNG A;  2ZCF B;  3OYB A;  1ARK A;  4J6Y A;  1XOV A;  3HP9 A;  4C0G A;  3OS5 A;  1HYO A;  1YWO A;  3OYI A;  2W0Z A;  4M75 B;  3EFO A;  3CEY A;  4Z8A A;  2LRQ A;  4WTO B;  5GAO n;  5CR2 A;  3KUF A;  2ZPI B;  2B8A A;  2PUO B;  1SKU B;  3HFN A;  2V8K A;  1QVG P;  4E7Z A;  2RNA A;  4C5E A;  4C8Q D;  3M53 A;  4IKF A;  4RMO A;  1VQL A;  4KGZ B;  3QXE B;  2MI6 A;  2CP0 A;  4XK8 E;  3M5A A;  1NPR A;  2ZAE A;  5I21 A;  1NLO C;  2YT6 A;  1CSK A;  2M9U A;  3FIF A;  5HY6 A;  3OYA A;  4QVC A;  2EYW A;  2X3X D;  1RI0 A;  2A0F B;  3J7A F;  1JO8 A;  3CCE Q;  5GAO r;  5I2M A;  1BI0 A;  1X6B A;  3CMA Q;  1IZ6 A;  4IIO A;  4CC2 A;  3OSV A;  1PKT A;  2MOX A;  1GBQ A;  5GJV B;  2DXT A;  1K73 C;  3MCA B;  2DD4 A;  3PTA A;  1VQN Q;  4BE2 A;  1QWE A;  1M2V A;  2FRW A;  3TSZ A;  3IQL A;  1M27 C;  1MV0 B;  2Z0W A;  1TG0 A;  1NE8 A;  1QWF A;  2JM9 A;  4L5G A;  1V76 A;  4HVU A;  4LDY A;  4A63 B;  1X01 A;  3E2U A;  3LYI A;  2V8J A;  3EHQ A;  3OMC A;  4M75 F;  2HQE A;  3CCE T;  2L5Q A;  1VQ7 Q;  3CMA T;  3CQT A;  2QAS A;  1UUE A;  2LCS A;  1AWJ A;  5FRN A;  1RAH B;  3CBM A;  4J83 A;  5D6Y A;  2GQV A;  1VQN T;  3CCE A;  3CMA A;  2E5K A;  1QVF S;  4X9C A;  4AFU C;  3JCM e;  2DMO A;  1VQN A;  1H3Z A;  2O2O A;  4PJO C;  2VV5 A;  2RI5 A;  3JRZ A;  3VS4 A;  4OB2 B;  2JT4 A;  2DL7 A;  3OSS C;  1BU1 A;  1D1B A;  2MAM A;  1VQ7 T;  1QVF P;  3CME Q;  1W2B S;  2YUN A;  1G83 A;  3EFO B;  1BK2 A;  3MEV A;  4M78 D;  3QII A;  3URG A;  2P4T A;  2NUP A;  1Q86 R;  1ZLM A;  2L3R A;  3C95 A;  4E7H A;  4C8Q G;  1FX7 A;  2HDA A;  5IH2 A;  3RUX A;  3EG9 A;  5ECA A;  3OW2 S;  1VQO Q;  2QGF B;  3G71 A;  4JJB A;  3THK A;  1W2B P;  1GFD A;  4JJC A;  5LJ3 d;  2CP6 A;  3SD4 A;  1OPK A;  4IUV A;  5FU6 C;  3G7Z A;  3CCL Q;  2RK2 A;  1QMC A;  3L2R A;  1K0S A;  1PD0 A;  2QQR A;  2LT4 A;  2ENM A;  5J3B A;  2PUK B;  3FB9 A;  1X2Q A;  1PD1 A;  3CXC P;  2PZ1 A;  1GBR A;  1HD3 A;  1X6O A;  4M77 C;  4JS5 A;  5KCO A;  3V8L A;  2DX1 A;  5KH6 A;  4IUP A;  4MZT A;  4XTX A;  2QGG A;  1YHQ Q;  2EYY A;  1VQO T;  4QT7 A;  3GIB A;  3QYG B;  4RTT A;  1UGR B;  1EIF A;  1M2V B;  2D0Q B;  3QZ5 B;  1VUB A;  4QVZ A;  3VUZ A;  2DEQ A;  1XTD A;  3JCM W;  3CCL T;  1WLP B;  1UEC A;  2VYT A;  5IHI A;  5LJ5 e;  3L2W A;  1SSF A;  2R58 A;  3WVE B;  2GTJ A;  4OB3 B;  4FT2 A;  4OF1 A;  5KE3 A;  1I5O B;  2M02 A;  4XU0 A;  2NUZ A;  1OX9 A;  4LDU A;  3LX7 A;  3MEU A;  3INZ A;  5GAO m;  3OB9 A;  1YNZ A;  4QKU A;  3GOX A;  1CKA A;  1YCY A;  4XU3 A;  3G4S A;  3OYL A;  5I2S A;  1JEG A;  3EGX B;  4Q5W A;  4GY5 A;  4KH0 B;  1UJ0 A;  1IHV A;  1YFN A;  2C06 A;  1ZA1 B;  4X1V A;  4M7A D;  2BUD A;  2O01 E;  1G8X A;  4FSS A;  1VQP Q;  1I1J A;  4BI3 A;  1WFW A;  3BE3 A;  3H9N A;  4M78 G;  3OYM A;  2YDL A;  1N6A A;  2JZ2 A;  3HFO A;  4ZNX A;  1YJW Q;  3NPF A;  2KXC A;  1VYV A;  2EKO A;  4FYX B;  2XMF A;  2KT1 A;  1ZSZ A;  4XTZ A;  3U23 A;  2GCX A;  2V1R A;  4J9G A;  2V8I A;  2NUP B;  1JJ2 S;  2JMC A;  1WHK A;  2ZPB B;  1I81 A;  2BZ8 A;  4ZTF A;  3DB3 A;  2QEX Q;  5KCH A;  1O75 A;  4HXJ A;  4CRI A;  2LX7 A;  4EMG A;  3JSC A;  2RJF A;  2H3J A;  4CC3 A;  2KXD A;  1N9S A;  2CUB A;  4RTX A;  2HBW A;  1JJ2 P;  1GCQ C;  1LNX A;  3VRZ A;  2CZ0 B;  2SEM A;  1YJW T;  4N4G A;  1E6G A;  4AMC A;  5IT9 E;  2OTJ A;  1BCM A;  3OYH A;  1N8R U;  1YJW A;  3WVD B;  1Q7Y C;  2QEX T;  4NOY A;  1EZZ B;  1SG5 A;  2K3Y A;  1D0Z A;  4F04 B;  1VIF A;  4L59 A;  5LJ5 f;  1MND A;  3PE0 A;  3JCM X;  2DF6 A;  3TSW A;  2C0O A;  1I5L A;  1BB9 A;  2F2W A;  2YHT A;  8AT1 B;  1JRI A;  4EPC A;  3R6O A;  1WQW A;  2DVJ A;  1K4U S;  2I2L A;  2EQM A;  2EPD A;  4II1 A;  2CDT A;  2K79 A;  4CC4 B;  1ZBX A;  4J9B A;  4C8Q E;  3OYE A;  3LWI A;  1UGQ B;  2DZC A;  2KBT A;  2R5A A;  1LCK A;  3BY7 A;  1M1G A;  3QDR B;  4M7A G;  2RF0 A;  3VS6 A;  2CH4 A;  4PJM A;  1WNL A;  3M58 A;  4FW2 A;  4HVV A;  2M0Y A;  4Z88 A;  2FZC B;  2RHU A;  3CC4 A;  1OEB A;  1AWO A;  2M51 A;  1UDL A;  3UA7 A;  3S3M A;  4ESR A;  2KRM A;  3M59 A;  4L6V 5;  5GAN 2;  2B86 A;  4VUB A;  2MWP A;  3NTI A;  4HA8 A;  4JUV A;  1ZSZ B;  2EQU A;  5FWC A;  3JCM J;  2CZ6 B;  2PVG B;  4OB0 B;  5GAO p;  3UA6 A;  3SEM A;  2NYS A;  2DXU A;  3EH1 A;  1AEY A;  3CCJ A;  1R77 A;  3A8L B;  3PMT A;  1T0H A;  5J26 A;  1N5Z A;  4C0Z A;  4JRK A;  2KE9 A;  2JOY A;  4J6W A;  1FYN A;  4E7I A;  2ED0 A;  2LQN A;  2RI3 A;  4QQG A;  2EGA A;  3JCM d;  1M8M A;  1JBM A;  1S72 Q;  3RNJ A;  2LJ1 A;  2AK5 A;  4OGE A;  4C5G A;  4QVD A;  2P84 A;  3A8H B;  2J6F A;  3H0F A;  1WJR A;  2KMT A;  1DJ7 B;  2DAQ A;  3TRE A;  3DLL A;  3UAT A;  1PM3 A;  1EX4 A;  3QWX X;  2EWN A;  4DOW A;  4OGC A;  3JB9 H;  2BIV A;  2DM1 A;  4EDU A;  1Y07 A;  2F69 A;  1QLY A;  2LVM A;  2DBM A;  2LCC A;  1RUW A;  3DB4 A;  4BE1 A;  2AHJ B;  3M4Y A;  5LJ5 j;  2FZG B;  2HQX A;  1IGQ A;  4EMH A;  3HRS A;  1S72 T;  4J9C A;  1XNI A;  4M7D E;  4M78 F;  3HKS A;  4BE0 A;  3X24 B;  3E9G A;  2E5Q A;  3ZFJ A;  1N8R R;  3CCV A;  1Q81 U;  4Y92 A;  4PJO A;  4K11 A;  2CS7 A;  1OX8 A;  1UG1 A;  5I22 A;  4RKU E;  4A4K A;  3RKW A;  1I8F A;  5L23 A;  2K9G A;  1VQK Q;  2KYB A;  1UGV A;  1Q7Y R;  5CQY A;  4MMK A;  2GF7 A;  3A5Z B;  1K9M U;  4D6W A;  2QYZ A;  1VQM A;  3C94 A;  1KFZ A;  2XHC A;  3GBQ A;  4RTZ A;  1Q86 C;  4DBF A;  5CKD A;  4M7D C;  2R5M A;  1WJS A;  2WSC E;  3E1S A;  2E1H A;  2MMP A;  3NFC A;  1UE9 A;  2CZ1 B;  1VQK T;  3ME9 A;  1UGS B;  3VKI A;  2LT1 A;  2YWW A;  1WQ7 A;  2IIM A;  3VV0 A;  1MMN A;  3LWH A;  4OML A;  4QQ6 A;  3OA6 A;  4M7A E;  4M77 A;  1M3A A;  2HL5 C;  1U8R A;  1PSE A;  1BKB A;  4ZGD B;  3T9N A;  4F16 A;  3EG1 A;  1BYM A;  2RQW A;  1QVF A;  2E12 A;  5I11 A;  4PJL A;  4X9D A;  1AHJ B;  5IXB A;  3NTH A;  3EFS A;  1KSW A;  1U1S A;  1YBY A;  2E64 A;  1TUD A;  3A8O B;  2ZPH B;  3HRU A;  3PT9 A;  2KGT A;  4PJN A;  2IG0 A;  2YXY A;  1W2B A;  2HNI A;  3OQ5 A;  4IUT A;  4GLK A;  3QWY A;  1OZ2 A;  2QXF A;  4IUR A;  2HZY A;  4D8K A;  4AG2 C;  1VQL Q;  2E10 A;  4P5N A;  2RJE A;  1MUZ A;  1RAI B;  4ELY C;  2K5F A;  1Z9Z A;  5KYW B;  4J9E A;  3VU3 C;  2DL8 A;  3OW2 A;  1AD5 A;  3OBY A;  3CXC A;  3OS2 A;  5DLQ E;  1QVG S;  1K1Z A;  2F5K A;  1P92 A;  4PJO B;  2EVR A;  2ROT A;  3EGU A;  1IO6 A;  2X4Y A;  3LGL A;  3QZ9 B;  3ASK A;  4WCI A;  3VS3 A;  4XU1 A;  1H3H A;  5D6X A;  3H41 A;  3FC3 A;  3OYC A;  2MCN A;  2YRV A;  1SHF A;  1VQL T;  3TU4 K;  2XIC A;  2CT4 A;  2I0N A;  1D3B A;  5LJ5 g;  2KNB B;  1HSQ A;  2KK4 A;  4BDY A;  2E3H A;  3WXM B;  1QW1 A;  3GP8 A;  5GAM e;  4PJJ A;  8ATC B;  1VQ6 Q;  2VGN A;  4C5I A;  4DBR A;  1GXI E;  1D09 B;  2CUD A;  1X69 A;  4X34 A;  1QCF A;  4F14 A;  1FMK A;  4C92 E;  2HQH A;  2CKK A;  2E6N A;  2QQA A;  1RAA B;  1S1N A;  2LNH B;  4NL2 A;  1M1F A;  3EG3 A;  2RQU A;  5FU6 B;  1O9S A;  2XI9 A;  2YLC A;  1GCQ A;  5CCA A;  2DL3 A;  1RAE B;  4A53 A;  1Q81 R;  1NYG A;  1KG1 A;  1MMG A;  1PC0 A;  2F2V A;  2P0P A;  3TEE A;  1NEB A;  4M75 E;  1K8A U;  3GF5 A;  4E7L A;  4M77 B;  5CIU A;  1VQ6 T;  3OS0 A;  2GNC A;  2AZV A;  5LJ5 h;  4B9X A;  1VQ6 A;  1SHG A;  3A98 A;  3MPU B;  4FIB A;  1X27 A;  4PJO F;  2IVW A;  1AWX A;  3M0S A;  1K9M R;  5CKE A;  1NG2 A;  2DNU A;  4OVA A;  3C4S A;  2RO0 A;  3G71 Q;  2DL4 A;  5GMK m;  5GMK l;  1OOT A;  1T3S A;  5CQX A;  3EGX A;  2FO0 A;  1JJ2 A;  4FU6 A;  4C92 C;  4Y28 E;  2IPO B;  3EHR A;  3EAE A;  3EG2 A;  2X51 A;  1GRI A;  1OQK A;  2DIG A;  2WSF E;  5GMK e;  1C6V X;  3I9Q A;  2J06 A;  3FJP A;  1PKS A;  1AWW A;  2HKN A;  3E19 A;  3MEA A;  5IHK A;  1VIE A;  2AT1 B;  2DRM A;  1K76 A;  3RIR A;  3G71 T;  4ZN1 A;  2P0K A;  2P0Q A;  2V26 A;  3CXC S;  1D3B B;  3RMS A;  4J5Y A;  4M77 F;  1Y7X A;  1UJY A;  4ELZ C;  5GAM f;  2LJ0 A;  1B07 A;  2Y4X A;  2JMA A;  4J9H A;  1UB4 A;  4GLM A;  5FLX E;  1FWZ A;  5L8R E;  1QVP A;  1VQ9 A;  1GFC A;  4ORZ A;  2QK0 A;  2DD5 A;  3G4S Q;  1IRE B;  3H6Z A;  2LCL A;  3QG1 A;  1KC8 U;  3L2U A;  4B6M A;  2ESW A; 
#chains in the Genus database with same CATH homology
 2A3L A;  5A0L A;  5KE2 A;  3X25 B;  1ZBX A;  3HSB A;  4M7D F;  2K3X A;  3M55 A;  3QYH B;  4BDZ A;  4C8Q E;  4M75 A;  3OYE A;  3LWI A;  3G6E A;  1UGQ B;  4OMF B;  4M7A B;  3CC2 A;  2DZC A;  4HT9 A;  2K4Y A;  2R5A A;  4HCC A;  3BY7 A;  1I4K 1;  1M1G A;  3A8G B;  2E65 A;  1OZ3 A;  3OYK A;  3QDR B;  4M7A G;  2EIF A;  1BIB A;  3F70 A;  2GFU A;  2RJD A;  4FSX A;  1WNL A;  3M58 A;  3QO3 A;  3SDZ A;  3G4S T;  1RL2 A;  2FB7 A;  2RHU A;  3CC4 A;  1JB0 E;  1BI3 A;  4PJO E;  4RCB A;  4NL3 A;  4Y91 A;  2KQW A;  5CVI A;  4J7I A;  4RG8 A;  3S3M A;  3QUI A;  3X20 B;  3L2Q A;  4ZTJ A;  2KSS A;  3M59 A;  4L6V 5;  2LDM A;  3BW1 A;  5GAN 2;  1W4S A;  4J7F A;  4VUB A;  2MWP A;  5GAN j;  2RHZ A;  3FRN A;  2RK1 A;  3NTI A;  4F7U G;  4C92 F;  1BI1 A;  2WAC A;  4HA8 A;  5FRO A;  4JUV A;  3S6W A;  5GAN f;  5GAN 5;  3AHU A;  1M5Q 1;  2EQU A;  2ZPF B;  2EJG A;  2KY9 A;  3JCM J;  4KUD K;  2CZ6 B;  2PVG B;  3OBW A;  4C5H A;  5HK0 A;  5GMK i;  4KUI A;  4LD9 K;  4OB0 B;  5GAO p;  5CKF A;  1UGP B;  2EQK A;  4PKC C;  5A0G A;  1N27 A;  2X35 A;  4F7U A;  2XID A;  4JRQ A;  3JCM V;  1PSF A;  4BD3 A;  3JCM g;  3CC7 T;  2MWO A;  3M57 A;  5CK9 A;  2DXU A;  3JB9 J;  3V7R A;  3CCJ A;  2DXB A;  2M16 A;  1TH7 A;  3A8L B;  3OYY A;  3PGG A;  3L2Z A;  4ZN3 A;  5GAN 3;  3JB9 I;  4R56 A;  1G3Y A;  2VGM A;  3PMT A;  5LJ3 j;  3CC7 A;  2EJ9 A;  1KQ1 A;  2M1H A;  2D9T A;  4N0A C;  5J26 A;  4N4H A;  1VQK A;  1K73 U;  4C0Z A;  2FHD A;  1N8R C;  4JRK A;  2NLU A;  4DOV A;  2K5I A;  2K57 A;  4IUQ A;  4OB1 B;  3FEO A;  3CCQ T;  2JOY A;  1NZ9 A;  4ZGJ B;  1YJN A;  4J6W A;  2VXE A;  2EJF A;  1Q86 U;  4HT8 A;  1OI1 A;  2RI2 A;  4RG2 A;  4E7I A;  2XDB A;  2XKO C;  3CD6 A;  2LQ8 A;  3OMG A;  3J80 E;  3JCM Q;  2VXF A;  2RI3 A;  3OYJ A;  4QQG A;  2O4X A;  4M75 C;  2RD1 A;  4R55 A;  4M77 E;  3PIO A;  4M7A F;  2YLB A;  3JCM d;  1B34 A;  1JBM A;  3H8Z A;  2DVE A;  2OTJ T;  2VC8 A;  1XQH A;  1FXX A;  4JDS A;  4OGE A;  4C5G A;  4QVD A;  4A4H A;  3FLG A;  3A8H B;  2GFA A;  1WJR A;  3C12 A;  3P8D A;  2KMT A;  3MO8 A;  1DJ7 B;  2DAQ A;  2JUF A;  2X4W A;  3TRE A;  3DLL A;  5GAN 8;  3CCM T;  4E47 A;  1KC8 C;  5GAM j;  2Y4Y A;  5GAN 7;  3E9F A;  2EWN A;  2LTO A;  3BDU A;  5HK3 A;  3SB2 A;  1UEB A;  3MP8 A;  4A4E A;  4OGC A;  4DOW A;  3JB9 H;  3JCM h;  3CCM A;  2BIV A;  2ZZD A;  1VQ7 A;  1VQ5 T;  4EDU A;  4M7D A;  1Y07 A;  3QBY A;  1VQ9 T;  2PVD B;  2F69 A;  2JVV A;  5CO7 A;  2JNG A;  2ZCF B;  2LVM A;  3CPF A;  3OYB A;  2LCC A;  3DB4 A;  4BE1 A;  2AHJ B;  3M4Y A;  5LJ5 j;  3M56 A;  4J6Y A;  1XOV A;  1VQ5 A;  3CBP A;  2HQX A;  4EMH A;  3HP9 A;  4C0G A;  3OS5 A;  3QKJ A;  3HRS A;  4B9W A;  1KHI A;  1S72 T;  5FRM A;  5AYF A;  2DPP B;  3OYI A;  4M75 B;  3CCR T;  1XNI A;  4M7D D;  4M7D E;  4M78 F;  3CEY A;  1G3T A;  2E6Z A;  3GNG A;  3HKS A;  3M4G A;  3MP1 A;  5GAN 4;  4BE0 A;  2LNV A;  4C8Q A;  3PIP A;  4BI4 A;  3X24 B;  3E9G A;  2E5Q A;  3ZFJ A;  1LOJ A;  2LRQ A;  5GAO n;  3CCR A;  1NPP A;  5CR2 A;  3KUF A;  3CME T;  2ZPI B;  2EYQ A;  3G6E T;  3CCV A;  1G3S A;  2B8A A;  2PUO B;  3RER A;  4C0F A;  1VQ4 T;  3QSU A;  3S3N A;  3HFN A;  2VUB A;  2V8K A;  1VQ6 T;  1QP3 A;  2DZ9 A;  3MEW A;  3OY9 A;  4C5E A;  3CME A;  2LC4 A;  4C8Q D;  3M53 A;  3LH0 A;  5J39 A;  1LJO A;  1Q81 U;  1KQS A;  4IKF A;  3VJP A;  4PJO A;  2CS7 A;  1VQ4 A;  4RMO A;  1VQL A;  3QHS A;  4N4I A;  1MHN A;  3QXE B;  2MI6 A;  1KQS S;  4MZP A;  5GAO q;  4M7A E;  3CC4 T;  4XK8 E;  3M5A A;  3JCM P;  1NPR A;  1M4Z A;  5I21 A;  3I55 A;  3HRT A;  4RKU E;  4A4G A;  4A4K A;  3JB9 D;  3OYD A;  2M9U A;  4IUU A;  1YIT T;  3RKW A;  3FIF A;  3KXT A;  1I8F A;  4XTV A;  1OYX A;  5CKH A;  3BFM A;  5HY6 A;  3PFS A;  1VQO A;  4PJO D;  3OYA A;  4QVC A;  4KUL A;  3JCM c;  1YIT A;  1RI0 A;  4ATO A;  3J7A F;  4F7U B;  2EFI A;  5CQY A;  5GAO r;  2QQB A;  3QJ6 A;  1BI0 A;  4MMK A;  5I2M A;  1IZ6 A;  4ZGE B;  1MGQ A;  1Y96 A;  2GF7 A;  3OSV A;  3A5Z B;  2DKG A;  3CCL A;  2WSE E;  4J8O A;  1K9M U;  2HBP A;  2DXT A;  4LD6 A;  1K73 C;  4D6W A;  1VQM A;  3MCA B;  2DD4 A;  3PTA A;  4BE2 A;  3C94 A;  5GMK j;  2HAX A;  2XHC A;  1Q86 C;  5GAO l;  1YHQ T;  5CKD A;  4M7D C;  2R5M A;  4BI8 B;  1M9S A;  2WSC E;  1WJS A;  4HKE A;  3E1S A;  1NE8 A;  2E1H A;  2RM4 A;  4Z02 A;  3CCJ T;  3OYG A;  2MMP A;  2FL7 A;  4L5G A;  3NFC A;  3Q1J A;  3JCM f;  1YHQ A;  3TCJ A;  3S3O A;  2L8D A;  4LDY A;  5IAY A;  3GPL A;  1G5V A;  1X01 A;  2CZ1 B;  3CBO A;  3LYI A;  1UGS B;  1WGS A;  2LT1 A;  2V8J A;  2XG8 D;  3ME9 A;  1WQ7 A;  4ME7 A;  3VKI A;  2QDY B;  2MF2 A;  2O4X B;  3OMC A;  4M75 F;  3VV0 A;  2DK3 A;  2HQE A;  4KBM B;  5GAN g;  3LWH A;  3CCE T;  2L5Q A;  1B34 B;  1YJN T;  3CMA T;  4QQ6 A;  2CGH A;  2QQ9 A;  4C8Q C;  3A8M B;  4M77 A;  3OA6 A;  3PNW C;  5FRN A;  2D6F A;  3V8J A;  4XTU A;  1U8R A;  1PSE A;  1BKB A;  3CBM A;  4DQ2 A;  3T9N A;  4ZGD B;  3LW5 E;  3CD6 T;  4J83 A;  5D6Y A;  1BYM A;  1QVF A;  2XDP A;  2E12 A;  2GQV A;  1VQN T;  3CCE A;  1VQ8 A;  3CMA A;  1U1T A;  2XK0 A;  1AHJ B;  4KT0 E;  4X9D A;  3NTH A;  3EFS A;  1X75 C;  3ER0 A;  1QVF S;  1U1S A;  2E64 A;  1YBY A;  3RKX A;  3I56 T;  1Q82 U;  4X9C A;  4QW2 A;  3JCM e;  3A8O B;  5CKB A;  2Y90 A;  2ZPH B;  3HRU A;  1VQN A;  4M77 D;  4V2S A;  2DIQ A;  1H3Z A;  4PJO C;  2VV5 A;  4M7D B;  3PT9 A;  1NJI U;  2L89 A;  3I56 A;  2RI5 A;  4FT4 A;  3JRZ A;  4M78 A;  4OB2 B;  5DM7 R;  5LJ3 g;  3DLM A;  1HK9 A;  2IG0 A;  3VUB A;  5GAN d;  1W2B A;  3OSS C;  4TVR A;  2HNI A;  3L2V A;  4M7D G;  3OQ5 A;  4IUT A;  4GLK A;  4O5V A;  4XQ3 A;  2RA2 A;  1OZ2 A;  2QXF A;  1KHC A;  4IUR A;  5IN1 A;  2MAM A;  3VYG A;  2K5L A;  1VQ7 T;  3GNF B;  3HHT B;  3ZBD A;  1W2B S;  3N5B B;  2QA4 T;  1VQP T;  4JJN K;  2E10 A;  3OYN A;  3L1A A;  2HD0 A;  4P5N A;  3MEV A;  3RKY A;  4C8Q B;  4M78 D;  4M78 E;  2RJE A;  3QII A;  4MDW A;  3URG A;  2P4T A;  4F7U F;  3V7C A;  4ELY C;  2L3R A;  3C95 A;  2K5F A;  1M1K C;  1QP2 A;  3OYF A;  2QA4 A;  3VU3 C;  2XDD A;  4E7H A;  1Q81 C;  4C8Q G;  2EQJ A;  3OW2 A;  1VQP A;  3GLX A;  3OBY A;  5GAN h;  1QVG A;  1FX7 A;  3CXC A;  3CCU A;  4CI0 C;  4MML A;  3OS2 A;  4BAC A;  3RUX A;  5DLQ E;  4BUG A;  1QVG S;  3OW2 S;  2RHI A;  3G71 A;  2QTX A;  2F5K A;  4O6J A;  4QQD A;  5LJ3 d;  3SD4 A;  2X4J A;  1P92 A;  4PJO B;  3CCV T;  3JB9 G;  3P8B B;  4C0D C;  2X4Y A;  3LGL A;  3QZ9 B;  5GAM g;  1YI2 A;  3ASK A;  4IUV A;  5FU6 C;  3G7Z A;  4J6X A;  4XU1 A;  5D6X A;  3FDR A;  2RK2 A;  1BIA A;  4PJO G;  3L2R A;  3FC3 A;  3OYC A;  3O8V A;  3MP6 A;  3HPW A;  4EMK A;  4MDX A;  2QQR A;  2QEX A;  2LT4 A;  2YRV A;  1VQL T;  5D6W A;  5J3B A;  1M8V A;  2PUK B;  3TU4 K;  3QPH A;  3FB9 A;  3SWN A;  2XIC A;  2RB6 A;  4HCZ A;  2OAU A;  4A54 A;  1D3B A;  5LJ3 h;  5LJ5 g;  1K9M C;  4C92 A;  1M1K U;  3I55 T;  3LLR A;  1X6O A;  2JTF A;  4M77 C;  3X28 B;  2KK4 A;  4JS5 A;  5KCO A;  4BDY A;  3V8L A;  3P8H A;  5KH6 A;  3WXM B;  4IUP A;  4MZT A;  1QW1 A;  4XTX A;  3GP8 A;  1BI2 A;  1Y96 B;  5GAM e;  2ZGW A;  1VQO T;  2VGN A;  4C5I A;  2DTH A;  1YJ9 T;  1KD1 U;  4HCB A;  3GIB A;  1GXI E;  3QYG B;  5GAM d;  1UGR B;  4X34 A;  2BKD N;  4FL6 A;  1EIF A;  1Q7Y U;  2D0Q B;  3QZ5 B;  1VUB A;  4QVZ A;  3VUZ A;  4C92 D;  4C92 E;  5A0D A;  2KVQ G;  1M90 C;  2DEQ A;  5DLO A;  1N9R A;  5M9O A;  2EAY A;  2CKK A;  2E6N A;  2F5T X;  1XTD A;  2QQA A;  4JLG A;  4NL2 A;  3CCL T;  3JCM W;  1Y71 A;  2PVO B;  1YJ9 A;  4C0D B;  2RJC A;  2VYT A;  1M1F A;  5HKC A;  5LJ5 e;  4BY6 C;  5FU6 B;  1VQM T;  2PQW A;  4M78 C;  1O9S A;  3L2W A;  3UPU A;  1SSF A;  2XI9 A;  2R58 A;  2YLC A;  2QI2 A;  3WVE B;  5CCA A;  5LJ5 d;  4OB3 B;  3PMI A;  4FT2 A;  4OF1 A;  4A53 A;  5KE3 A;  3CCS T;  1KG1 A;  4UC4 A;  4XU0 A;  5GAM h;  2OTL T;  3MET A;  4PLL A;  2P0P A;  4LDU A;  3TEE A;  3LX7 A;  2X4X A;  3MEU A;  3INZ A;  4M75 D;  4M75 E;  1K8A U;  3GF5 A;  4C8Q F;  5GAO m;  3J81 E;  3CCS A;  4E7L A;  2K2V A;  3OB9 A;  4M77 B;  4PNO A;  4MZM A;  5CIU A;  1Q82 C;  3OS0 A;  3GOX A;  5EG2 A;  1VQK T;  2OTL A;  1KQ2 A;  2M0O A;  2ZPE B;  4LDW A;  1V29 B;  1YCY A;  2FYK A;  4PL6 A;  4XU3 A;  4M7A A;  4M77 G;  3G4S A;  2DXC A;  5LJ5 h;  1M90 U;  4B9X A;  1NJI C;  3OYL A;  1VQ6 A;  3RES A;  5I2S A;  4A4F A;  3JB9 F;  1YIJ T;  4OP0 A;  3MHX A;  1WJQ A;  4Q5W A;  4GY5 A;  4FIB A;  4JS4 A;  2FVU A;  4JRI A;  3V8K A;  2C06 A;  2CYZ B;  4PJO F;  2IVW A;  5GAN 6;  1VQ8 T;  3UT1 A;  4BY6 B;  2BUD A;  2O01 E;  1WPY A;  5C0M A;  2RH2 A;  1YIJ A;  4M7A D;  4M78 B;  5CKE A;  2DTO A;  4BI3 A;  5FU7 C;  3NTK A;  3SFM A;  4OVA A;  4M78 G;  4EMK C;  3OYM A;  3C4S A;  2RO0 A;  1N6A A;  2JZ2 A;  5GMK l;  2KAF A;  3HFO A;  5GMK m;  5CQX A;  3SWN C;  2A7Y A;  2EKO A;  4FU6 A;  4C92 C;  4JLI A;  4Y28 E;  1ZQ1 A;  5CAI A;  1JJ2 A;  4XTZ A;  2GCX A;  4NS5 A;  5DY9 A;  3EAE A;  2V8I A;  5LL6 S;  5GAN e;  1JJ2 S;  2RHX A;  1R8O B;  2DIG A;  2ZPB B;  4F7U E;  1I81 A;  5LJ3 f;  4ZTF A;  2WSF E;  3DB3 A;  4XTW A;  5GMK e;  3BDL A;  3FJP A;  5KCH A;  2DTI A;  5A2Q E;  1O75 A;  2E41 A;  4YTL A;  3E19 A;  2DO3 A;  2E70 A;  4BB7 A;  4CRI A;  3MEA A;  4EMG A;  2JTM A;  3M9Q A;  2ZPG B;  3JSC A;  2RJF A;  2H3J A;  2KDS A;  3CCQ A;  4WF2 A;  1VIE A;  5C6S A;  2LX9 A;  3CCU T;  4FM4 B;  1N9S A;  3RIR A;  3JAM E;  3G71 T;  1HXD A;  1LNX A;  2LQK A;  5FU7 B;  3ZEH A;  2QQS A;  2CZ0 B;  4ZN1 A;  1G3W A;  3CPW A;  2XD0 A;  4EMK B;  1YJW T;  4N4G A;  3KBG A;  4XAX B;  3LGF A;  3V7S A;  4PLI A;  5LJ3 e;  2P0K A;  1H64 1;  5IT9 E;  4DA4 A;  3SWN B;  2P0Q A;  5GMK h;  1YI2 T;  4LDX A;  3JCM b;  3CPW S;  3UDC A;  3HL8 A;  1D3B B;  4XU2 A;  3CXC S;  2OTJ A;  4C92 B;  3OYH A;  1KD1 C;  3RMS A;  1N8R U;  4J5Y A;  4M77 F;  1YJW A;  1Y7X A;  3WVD B;  4ELZ C;  5GAM f;  1Q7Y C;  2QEX T;  3UWN A;  4C92 G;  4M7A C;  2PU9 B;  4NOY A;  4E7J A;  3RMQ A;  2Y4X A;  3OS1 A;  1UB4 A;  2RHY A;  2K3Y A;  1VIF A;  2G3R A;  4L59 A;  5FLX E;  1FWZ A;  3L42 A;  5L8R E;  4XTY A;  5LJ5 f;  2R57 A;  1QVP A;  1VQ9 A;  3EFR A;  3JCM X;  4LDV A;  1I5L A;  2DD5 A;  2YHT A;  3VYH B;  1JRI A;  3M54 A;  4EPC A;  2XU8 A;  3R6O A;  1WQW A;  1ZHI A;  3X26 B;  4E7K A;  1IRE B;  3H6Z A;  4N0A A;  2LCL A;  1K8A C;  4M75 G;  2JN0 A;  3QG1 A;  1KC8 U;  3L2U A;  1S72 A;  4RCC A;  4JRP A;  3QJY A;  2I2L A;  2EQM A;  3DKM A;  4II1 A;  2DJZ A;  3CC2 T;  2CZ7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...