1PRMC

Two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (signal transduction/peptide)
molecule keywords C-SRC TYROSINE KINASE SH3 DOMAIN
publication title Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
pubmed rcsb
source organism Gallus gallus
total genus 5
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1prmC00
1WX6A 2JMCA 4CC2A 2J06A 1X2KA 2KYMA 4HVWA 1W6XA 1JU5C 2CSIA 2O9SA 3I9QA 2HBWA 4AFSC 2LCSA 2ROTA 1MV3A 2A08A 2EYWA 1K0SA 2EGEA 2O9VA 3CQTA 1W1FA 2CUDA 2FRYA 2C0OA 2CUBA 1B3QA 2GTOA 2LQNA 2HCKA 1M8MA 1YP5A 1RI9A 4J9DA 4J9IA 2FO0A 1TUCA 2AK5A 3EG0A 2V1QA 2D8HA 5IXFA 2YUQA 2AZVA 1I07A 2EGAA 2LJ0A 4LN2A 1WXTA 2O31A 4RUGA 5IHIA 5IXBA 2NUZA 1YCSB 1V1CA 1X2QA 2DL8A 4GLMA 4RTUA 1PHTA 1HJDA 2DVJA 1UHFA 2RQWA 4JZ3A 2PZ1A 1AWWA 2KEAA 2FEIA 2G6FX 1H92A 2CH4A 3EG2A 3H0FA 1NEGA 1BB9A 2DRMA 4RTZA 2CT3A 1WIEA 1QKXA 2DBMA 3QWYA 2I0NA 2MCNA 4OMNA 4ORZA 3FJ5A 1A0NB 4J9BA 1VYUA 4X1VA 1UG1A 4AFQC 1AD5A 1LCKA 1UHCA 3EGUA 2EYYA 3C0CA 2RMOA 2YUOA 1ABOA 3M0TA 2FPFA 2L3QA 1OV3A 2SEMA 1WXUA 1BBZA 1K1ZA 4HVUA 2KRSA 1E6GA 1UUEA 2KROA 1Z9QA 1UE9A 2CREA 1OPLA 1JO8A 1PWTA 1NEBA 2DBKA 4AG2C 2K9GA 5IH2A 2ENMA 2BTTA 4AFZC 2DA9A 2NWMA 4KRTA 4HVVA 1QWFA 2RPNA 1PRLC 1T0HA 1RLPC 2FPEA 1WDXA 2YDLA 3RBBB 2M51A 3REBB 1SRLA 2F2VA 1TG0A 2JW4A 1SSHA 2LQWA 4RTTA 2VWFA 2EGCA 1Z9ZA 3I35A 2K3BA 3SEMA 1CSKA 4OMPA 2ROLA 3NGPA 1NM7A 2DL5A 1ZUUA 2DF6A 2O2OA 4RTWA 1NLPC 2KBTA 1H8KA 2LMJA 3EG1A 3M0PA 1YNZA 1UECA 1UFFA 2F2XA 2RNAA 2DLPA 1FYNA 3QWXX 4WCIA 2DE0X 4HCKA 2J7IA 1SEMA 2EKHA 2AKLA 2DL3A 2K2MA 2YT6A 2K6DA 1OEBA 2E5KA 2EQIA 2KNBB 5IHNA 4F16A 1T0JA 5L23A 3EHQA 3RNJA 1K4US 4R0KA 2RQRA 2LP5A 2ECZA 1NLOC 2BZXA 1HD3A 4HXJA 5ECAA 4AG1C 1E6HA 2EVRA 1H3HA 1NG2A 1WXBA 2DILA 2JMAA 2X3XD 3VS6A 1KJWA 1M3CA 1I0CA 5FWCA 1OPKA 4AFUC 3NPFA 1T3LA 4GBQA 1CKBA 2DX1A 2W0ZA 2CDTA 4RTXA 2EBPA 4ESRA 1UDLA 1WLPB 1B07A 2PNIA 2DNUA 3GBQA 2HEQA 2K7AA 3ZL7C 1GFDA 2W10A 4JJDA 4A63B 1M3BA 2FG0A 5IHKA 3VS7A 1J3TA 2HSPA 1ZLMA 2A28A 2YUPA 2L2PA 2OAWA 3I5RA 4ZNXA 1PRMC 3IQLA 3UA6A 2VVKA 4K11A 4J9CA 2D1XA 3VRYA 1GBQA 4F14A 1WI7A 2ED1A 4LNPA 3M0RA 2DM1A 2OI3A 3M0QA 1UGVA 4D8KA 2IIMA 1W70A 2DL4A 2JM8A 1SRMA 1ZBJA 3PE0A 2LJ1A 1GCPA 5I11A 3PVQA 2VKNA 3M0SA 1S1NA 4OMLA 1AWXA 5HCKA 4JZ4A 2DMOA 1HSQA 1G2BA 3VS0A 4DEXA 2GNCA 4J9HA 2M0YA 3M0UA 2EYZA 4IIMA 1M3AA 2CH4W 2JTEA 4CC4B 2XMFA 2P4RA 1GCQA 2RQUA 1KSWA 2GGRA 2BZ8A 1U5SA 3REAB 1IO6A 4LUEA 1RUWA 4OMMA 1GBRA 1Y57A 2YSQA 1FMKA 4FSSA 4LE9A 2FRWA 1G83A 3H41A 2KT1A 3R6NA 4D8DA 5FW9A 3VS3A 2DJQA 2C0IA 2LJ3A 3EHRA 3NHNA 3ULRB 4LUDA 5FWBA 2RN8A 3UA7A 2J6OA 2FPDA 2EW3A 3VS4A 1ZSGA 2YUNA 3VS2A 4CC7A 5EC7A 2C0TA 2RF0A 2X3WD 1JXMA 2ABLA 2D8JA 2GQIA 2KRNA 4F17A 1QCFA 4IIOA 3UF4A 2JXBA 4Z8AA 2L3SA 3H0HA 3NMZC 4DEYA 1OOTA 1SPKA 3TVTA 1TUDA 2GTJA 2KGTA 1VYVA 4JJBA 1T3SA 2O88A 1GRIA 1QWEA 4J9FA 3VS5A 1QLYA 2SRCA 2K79A 3A98A 1AEYA 4OMQA 1WA7A 5GJVB 2EYXA 2J6FA 2JS2A 2CSQA 2KT8A 1CKAA 4CC3A 4JJCA 4OMOA 1AOJA 1BU1A 2LX7A 1UTIA 2JT4A 3PVLA 2JS0A 1K0XA 3TSWA 3H0IA 1Y0MA 1JXOA 2OJ2A 1XOVA 2A36A 1YWPA 2GBQA 1M27C 1AZGB 2V1RA 1RLQC 2D0NA 3U23A 4RTVA 2BZYA 1UJYA 1N5ZA 1WYXA 1QKWA 2CT4A 1AZEA 2DYBA 2KXCA 1BK2A 1X6GA 3UATA 1YN8A 2L3PA 1AWOA 2J05A 2QDLA 4QT7A 1SHGA 1KFZA 2PTKA 1ARKA 1I1JA 1M30A 1E7OA 4Z88A 3TSZA 2F2WA 2KR3A 1AWJA 1NYGA 1ZUYA 3I5SA 1SHFA 2ED0A 1GFCA 1AVZC 2JM9A 1JQQA 1MUZA 1ZUKA 1KIKA 1GL5A 2AKKA 1U06A 2ESWA 2LNHB 1MV0B 1JEGA 1VA7A 1GCQC 3EG3A 1PKTA 1YWOA 4E6RA 2HDAA 5GJWB 1PNJA 2B86A 1U3OA 2RQTA 2KYBA 2KXDA 3VS1A 1PKSA 2EPDA 1NYFA 3VRZA 2MOXA 3O5ZA 4M4ZA 2AZSA 2RQVA 2KRMA 1X43A 4JPBW 2KE9A 2A37A 5I22A 1X6BA 1K76A 2L0AA 1ABQA 3JV3A 1UJ0A 1X69A 3KFVA 4Z89A 1X27A 4RTYA 4EIKA 2LZ6B 2J6KA 1K9AA 4Y92A 1WFWA 3SHWA 4J9EA 4J9GA 2H8HA 1ZX6A 1VYTA 3THKA 2MIOA 3LH5A 2DRKA 1EFNA 2DL7A
chains in the Genus database with same CATH superfamily
3F70A 1WHGA 1QQJA 1GXIE 1W6XA 3PMTA 4LXCA 2CSIA 1YJ9A 4AFSC 2MYSA 2LCSA 1KQSS 1K0SA 3FEOA 4HT9A 3CQTA 1W1FA 2LTOA 1W2BS 4C8QF 2RH2A 1C0MA 2QQ9A 2A7YA 4BDZA 2C0OA 2QA4A 2CP5A 5D6YA 2GTOA 1ZSZB 3CPFA 2XKOC 4F7UF 3M59A 3OS0A 4J9IA 2AK5A 5GAOq 2DETA 1QCOA 3I56T 4RUGA 5IHIA 1KHCA 4QW2A 3MP8A 3VV0A 1YCSB 4GLMA 4M7AA 3AT1B 1VQLA 2DVJA 1UHFA 2CZ1B 2CP6A 4JZ3A 3UPUA 4NL2A 1AWWA 2COWA 3JB9F 2MPXC 3PIPA 3H0FA 2RK2A 2GF7A 1JJ2A 5J26A 1NEGA 1S72A 2DRMA 4Z02A 3V8JA 5KE2A 1KD1R 3MEWA 3QWYA 4QVDA 1BKBA 2JTFA 4ORZA 1NZ9A 1IB8A 1A0NB 1VYUA 2MWOA 3GPLA 4X1VA 5I2SA 4AFQC 1UHCA 2OX7A 3OYCA 2EYYA 1VQ6Q 2FPFA 3A8OB 1Q86U 4P5NA 3CCQQ 4KUIA 5FU7C 2HMAA 3PGGA 1IXDA 1Z9QA 1UE9A 1OPLA 3CCMQ 3EH2A 1K73C 5IH2A 5KE3A 4O5VA 3CCLQ 3CD6T 2DA9A 3M5AA 2DD5A 3UWNA 1B7TA 1FMWA 3M56A 4RG2A 2F2VA 2EAYA 3CC7A 3OYHA 4DBHA 1D09B 5KYXB 3I35A 3CC2T 2K3BA 4HA8A 3OYBA 3SEMA 2LQKA 5CKHA 3OYDA 2ROLA 3ZEHA 2RHUA 5A0GA 4PJOG 2O2OA 2ZPHB 4RTWA 2M0OA 3JCMe 1N6AA 1W4SA 1NLPC 2KBTA 2LMJA 2MAMA 3EG1A 1VQOT 1VQ5T 1UFFA 4WTOB 4WCIA 3CCET 2DE0X 5KYYB 3CCUA 5LJ3g 3CEYA 2EKHA 1N8RC 3EGXA 1YJNA 2DL3A 1EIFA 2YT6A 1X6OA 2E3HA 2EQIA 2KNBB 4OB2B 4F16A 5L23A 1VQMT 3G4SQ 1WHHA 1Y71A 1K4US 2RQRA 1BIAA 1NLOC 4HXJA 3GNGA 5ECAA 4L5GA 3JB9J 2X3XD 2DD4A 1K8AU 1KJWA 1M3CA 3NPFA 2V8JA 4QQ6A 4M77C 4BE0A 5DM7R 1YJ9Q 2NUTA 4HCBA 5CVIA 1UDLA 3SWNA 3LGFA 4DA4A 1ACMB 1B07A 2QGGA 2QTXA 3EG9A 3QJ6A 3S6WA 2QA4Q 1Q82U 2EYQA 3GBQA 5CIUA 4PJOB 5IN1A 1GFDA 3MO8A 1M3BA 2FG0A 5CAIA 3VS7A 2MMPA 1J3TA 5GMKm 1X75C 3OMCA 1YHQA 3E19A 1TXQA 4ZNXA 1PRMC 2A3LA 3UA6A 2VVKA 4K11A 2QQBA 2DJZA 1H3ZA 4J9CA 2E1HA 3VRYA 3OYNA 4F14A 1WI7A 2ED1A 2DM1A 4MDWA 3M0QA 1QMCA 4KGVB 1VQLQ 3X24B 1Y96A 4LDVA 2FZKB 2WACA 3MEVA 4FT2A 1ZBJA 2LJ1A 1G8XA 3M0SA 5GAN8 2FB7A 1S72Q 2DMOA 4D6WA 1HSQA 4C5EA 2YWWA 4FL6A 1G2BA 1K73U 2CZ0B 1Q81C 2MF2A 3MP1A 4N4IA 1M3AA 2CH4W 2RO0A 4M75D 4CC4B 3JCMQ 3N5BB 2ATCB 1OI1A 3OYKA 1OU9A 1KK7A 2P0QA 3ME9A 1IO6A 2DTIA 1N9RA 3G71A 4XTWA 3X28B 4LE9A 4KT0E 4M75A 2M9UA 4FW1A 3R6NA 3QDRB 2DKGA 3M57A 4C8QC 3VS3A 2IG0A 2C0IA 3NHNA 1VQ6T 2F5TX 3CCQT 2FPDA 3QPHA 2VXEA 1NPPA 1M1KU 3VS2A 4CC7A 1BI1A 4M7AE 3KXTA 2RF0A 2X3WD 3URGA 2BE7D 3H8ZA 4F17A 1KHIA 1Y7XA 3UF4A 3CCLT 3L2VA 4NL3A 3H0HA 1EZZB 1IGQA 3QUIA 4RKUE 3LLRA 3TVTA 3CC7Q 1D1CA 2GTJA 2ZPGB 3OYGA 1RI0A 1T3SA 1GRIA 2PQWA 1M90R 4ELZC 3A98A 4LD6A 4OMQA 3WVEB 1M9SA 1WA7A 2CSQA 2VYTA 4CC3A 3NTKA 2OTLT 1OYXA 1BU1A 2LX7A 3QHSA 1UTIA 2JT4A 1M2VA 5FRNA 4V2SA 1K0XA 3H0IA 2E4HA 1XOVA 2DPPB 4BD3A 3CCUQ 2A36A 3P8BB 1D1AA 1AZGB 1R77A 1AHJB 1RLQC 3JB9H 3U23A 1YJNQ 5GAOr 1UJYA 2DYBA 2KXCA 1X6GA 4M7AF 2L3PA 2KI7A 2CP7A 4QT7A 1SHGA 1PG5B 1IHVA 4JRIA 4RG8A 2DXUA 1K9MC 4PFZA 2YHTA 1OQKA 2KMTA 2KR3A 3DLMA 1NYGA 1B34B 1I5LA 1AVZC 2P0KA 1GL5A 2RHIA 5CKBA 1EX4A 2ESWA 2AHJB 5HK0A 1OU8A 1YWOA 4E6RA 1V29B 4XTVA 1YJ9T 3OYAA 2RQTA 2KQWA 1RAEB 1ZQ1A 1Q81U 1QVFA 3O5ZA 4M4ZA 3MPUB 2QA4T 1O75A 3MCAB 4BB7A 2RQVA 2KRMA 1X43A 1YHQQ 2KAFA 5GMKe 4PK4A 1X6BA 3OSSC 3JV3A 5FU7B 2E10A 3QXEB 1YITA 2K3YA 4XU0A 1YI2T 3KFVA 5GAMh 3JSCA 2NLUA 4B9WA 4EIKA 4IUPA 4LDUA 2R58A 2XI9A 2VGMA 3TREA 1VQNA 2QQRA 2DEQA 1VQLT 2DTOA 1WQWA 2RHXA 5LJ5d 1WX6A 4XU2A 1S72T 3MKDA 2CS7A 1X2KA 2KYMA 1JU5C 2O9SA 2Z0WA 5KYYA 1UGSB 4FIBA 3CCSA 3G71Q 2ROTA 5EG2A 3PT9A 1AT1B 4L6V5 2EGEA 3OYMA 5L8RE 3OYYA 4J83A 1Q7YC 2O4XA 5DLOA 2QASA 3JCMf 4M78G 4JRKA 3C95A 5IXFA 2PVDB 3CXCA 4EMHA 2AZVA 1I07A 2KDSA 1MMNA 4LN2A 4PJOD 4FU6A 2NUZA 3SFMA 4C5IA 5CR2A 2KSSA 4E7LA 1JRIA 3WXMB 1PC0A 2FEIA 2F69A 1H92A 4PJOA 4ATOA 2EJFA 3A5ZB 2HAXA 5GANd 3CC7T 2XIDA 4MMLA 2XHCA 3EFRA 4M75E 1K9MU 1Q86C 4M77B 1DJ7B 2QI2A 2XG8D 1AD5A 1LCKA 3A8HB 2L3QA 2SEMA 1OV3A 1WXUA 3P8HA 1ZBXA 2E6NA 2DXCA 1ZA1B 1XNIA 1OZ3A 2G3RA 1VQ7A 8AT1B 1UUEA 4EMKB 4VUBA 1M8VA 1PWTA 2QQAA 2ENMA 2IPOB 4M78B 1QP3A 4JLIA 4A54A 4PFPA 1YJNT 4HVVA 1QWFA 1I4K1 2NUPB 3REBB 1SRLA 1KQSA 2ZPBB 5GANf 1LNXA 4RTTA 4OGEA 1W2BA 1Z9ZA 4C92C 2Y4XA 1RAGB 4DBFA 1JJ2P 1CSKA 3NGPA 3GOXA 2DIGA 2HD0A 4FCYA 1NM7A 4M75F 2DL5A 2DF6A 2K5FA 3G7ZA 4BI3A 1H8KA 1RAIB 1XQHA 3M0PA 1YNZA 2WSCE 1YFNA 2F2XA 3QWXX 3CCJA 3MEAA 4OVAA 1YITQ 1I5OB 4HCKA 1YHQT 5GAOm 3BW1A 1YBYA 4XQ3A 2BKDN 3NTIA 4PJLA 3DLLA 2K2MA 4XU3A 1Q7YU 2CZ6B 3KBGA 5IHNA 1VQNQ 4M7AC 1MMDA 1K8AC 4PNOA 4R0KA 1KC8C 4QVCA 2D6FA 1RAHB 2LCLA 3J81E 1H3HA 2DILA 4M7DG 1MHNA 1HYOA 1MNDA 5FWCA 1OPKA 1T3LA 1NBEB 1CKBA 3CCSQ 1N8RR 4ELYC 1Q82C 2EBPA 2DYIA 1G3YA 1WLPB 2VV5A 5I21A 2HSEB 3LH0A 3PTAA 2VASA 5CKEA 3G71T 2K7AA 2R5AA 3ZL7C 3META 4JJDA 2XDDA 3RMQA 4E7SA 1FXXA 2HNIA 2YUPA 4A4EA 2OAWA 3QSUA 2E70A 2PVGB 2D1XA 2ZPFB 3ER0A 4XAXB 4D8KA 2DL4A 4JRPA 2JM8A 3NTHA 1GCPA 1P92A 3PVQA 3T9NA 3OYIA 3BE3A 1BYMA 5KCHA 1TSFA 2GNCA 1JJ2S 4M7DB 1TOVA 3OA6A 4PL6A 2XMFA 2P4RA 1OZ2A 4MZPA 3JRZA 2GGRA 2PUKB 1U5SA 3REAB 4OMMA 1RUWA 5LJ3h 1WJSA 3FIFA 4FSSA 4E2FB 1BI0A 3OB9A 4KGXB 3HP9A 2K2VA 2KT1A 3HHTB 3JCMW 3RESA 2EKOA 1VQ7Q 5DY9A 4N4GA 4II1A 1VIFA 4MZTA 2DJQA 2LJ3A 1M1KC 3EHRA 2DEUA 2RI2A 2RN8A 4NS5A 4DOWA 2WSFE 3V8LA 3OBYA 2DK3A 2C0TA 2QEXA 1JXMA 2ABLA 2KRNA 2JXBA 3OW2A 4PJOE 1G3SA 4QQDA 4Y28E 1OOTA 3I55A 1VQKA 3QYHB 5LJ5e 3M54A 3M58A 4JJBA 1QWEA 3KUFA 2HBPA 4TVRA 2COYA 2EJ9A 4ZGDB 2K79A 5KH6A 1AEYA 4J6YA 1VQ4A 5CCAA 5GJVB 1QW1A 3SWNC 2KT8A 1CKAA 4PKCC 1KC8U 1KD1C 2LX9A 3TSWA 1Y0MA 1TWBA 3CCJQ 5FRMA 1RAAB 2I2LA 5IT9E 3D7SB 1YWPA 2GBQA 5GAN2 1M27C 1TTHB 1SF9A 2D0NA 4IKFA 4M77D 4RTVA 1VQ9A 1M5Q1 4BUGA 1YITT 1AZEA 3CCVA 4N0AA 1YN8A 4XU1A 2VB6A 1AWOA 2J05A 5HKCA 3V7RA 1KFZA 4L59A 4EDUA 1VQ8A 5KYNA 4RCCA 3MEUA 1I1JA 4Z88A 3TSZA 4PJOF 2F2WA 4E7IA 1VQNT 2HQEA 2XDBA 5GANe 3M9QA 1SHFA 4C0FA 1XJWB 2AKKA 4M78D 2QG9B 5FU6C 1JEGA 5DLQE 1VA7A 3EFOB 4BDYA 1NJIR 3H9NA 1FX7A 3C12A 1PNJA 2JZ2A 1WJRA 4KULA 1WPYA 1HXDA 1WNLA 3X25B 1Y07A 2R57A 4M75C 3CPWP 2E41A 2F5KA 2AZSA 3EH1A 2NUPA 4JPBW 2KE9A 5I22A 5CK9A 2L0AA 3GIBA 4XTZA 4Z89A 1X27A 1WHMA 4BY6B 4E7KA 1D3BB 1IREB 3HL8A 4J9GA 2A0FB 5FROA 1Q95G 1U1SA 2H8HA 3CCMT 2MIOA 4JDSA 3H6ZA 4OB0B 1LJOA 4YTLA 2DL7A 2JMCA 3A1PA 3PFSA 2J06A 5GAN6 4HVWA 3I9QA 4C92B 1MV3A 3V7SA 1ZSZA 4N4HA 2CUDA 2QXFA 2FRYA 2V8IA 3TEEA 1I8FA 5GAN5 4UC4A 1B3QA 3ASKA 1RAFB 3GNFB 1UB4A 2LQNA 4BE1A 1YP5A 4J9DA 3E9FA 2FO0A 4JRQA 1VQ7T 3EG0A 2V1QA 3OY9A 2QEXQ 2D8HA 2DZ9A 2RD1A 2YUQA 4FSXA 2EGAA 2LJ0A 1KD1U 1PCXA 3FJPA 1M2OA 1IGUA 5IXBA 2K5LA 2XK0A 1V1CA 1X2QA 1PHTA 4C0DC 4MDXA 3LW5E 3HRUA 1VQKQ 2PU9B 3EG2A 2RA2A 3A8GB 3FB9A 4M7AB 1C1AA 2CZ7B 2KVQG 5GANj 2CT3A 3BDLA 2DBMA 1XTDA 2ZAEA 1VQ4Q 2MCNA 4OMNA 4PFOA 3FJ5A 1JB0E 3G4ST 3P8DA 1WZOA 3CCEA 3JCMX 3OYEA 3CPWS 3CMAA 4HT8A 3C0CA 2YUOA 1ABOA 3M0TA 2YRVA 4PLLA 1K1ZA 4FT4A 3CC4A 1M1GA 4M7DD 2KROA 3RR6A 1VOMA 2DZCA 4IUTA 3CCJT 4GY5A 1VQ9Q 2DBKA 2K9GA 3CCVQ 4ME7A 2BTTA 1ZHIA 3M4YA 4M7DA 2DXBA 4AFZC 3M4GA 1Q86R 3O8VA 1VQ8Q 2OAUA 4KRTA 2RPNA 3JCMc 2FPEA 5FLXE 1WDXA 1JBMA 1WHJA 5KYXA 3RBBB 5GAMd 1BCOA 1UGRB 2LQWA 2VWFA 1UGQB 2EGCA 1VQPA 3A8MB 3JB9I 1NPRA 2OTJA 2GFAA 2GFUA 4FYVB 4OMPA 3JCMh 3MHXA 4ZN1A 3BY7A 4FYWB 4M77G 3RKWA 1D0YA 1UECA 2QAZA 5GMKl 2RNAA 3QDFA 3CBPA 2EQKA 3OQ5A 4B6MA 1SEMA 3G6EA 2AKLA 1M1FA 1QCNA 2O01E 4KUDK 2X9HA 2ZPEB 4M77E 2C06A 4A4KA 2X35A 1OEBA 2E5KA 1QVGP 4DBRA 3A8LB 3JCMg 5GAMf 1T0JA 1MGQA 3EGXB 3S3OA 2LP5A 1HD3A 4AG1C 3SD4A 1E6HA 2E64A 1WXBA 3OYLA 3VS6A 4PJMA 4PJOC 3GF5A 4OF1A 5KYUB 4AFUC 2MK5A 2E5QA 3UT1A 2DX1A 5LJ5f 2CDTA 2VXFA 4M78E 1QVPA 2LC4A 5LJ5g 3JCMb 4CRIA 1QP2A 1KQ1A 4IUQA 3DB3A 3HKSA 2RI3A 1OX9A 2HEQA 2NUTB 3FLGA 1K8AR 4C0GA 2DAQA 4HCZA 2W10A 3VJPA 2HSPA 1ZLMA 2A28A 2JN0A 2LNVA 2L2PA 4R56A 3IQLA 1Q82R 1GBQA 4LNPA 4C8QG 3M0RA 2R5MA 3G1JA 2QEXT 1UGVA 2IIMA 1W70A 3EFOA 1YJWA 2IVWA 4M77F 5GMKj 2FVUA 4JUVA 5CO7A 3PE0A 4F7UG 5I11A 3CCUT 3INZA 1S1NA 3ZFJA 1R0BG 4JZ4A 3PIOA 1BI2A 3WVDB 1BCMA 5CQXA 2OTLA 1VQKT 3VS0A 1KG1A 3CBOA 4JJNK 1D0XA 2EYZA 1N27A 4IIMA 1F1BB 2JTEA 1GCQA 1BIBA 1KSWA 2BZ8A 3CCEQ 1VQ4T 5GANg 4M78F 4X34A 3CMAQ 2RJEA 2YSQA 4E7HA 2K57A 5AYFA 5FU6B 3JB9G 2JOYA 4DOVA 2CKKA 2FRWA 3E1SA 2VGNA 1MMGA 2BIVA 5KYWB 3HTRA 1K73R 3CC4Q 1D3BA 2X4JA 2DXTA 2HL5C 5FWBA 1YCYA 3UA7A 2J6OA 4E47A 1IHWA 3JCMP 2XU8A 5J39A 4C92D 1ZSGA 2YUNA 3LGLA 5EC7A 2RJCA 3LWHA 1QVGS 1M90U 4WF2A 2P84A 1VQ9T 2GCXA 2GQIA 4C8QB 1QCFA 2EQMA 2FZCB 2QK0A 4IIOA 3CCVT 1YIJA 2L3SA 2JNGA 3NMZC 1VQ8T 4Q5WA 2EIFA 1SPKA 2HQHA 4F7UB 1VQPQ 2QTVA 1M1KR 1PM3A 3QKJA 1U8RA 2OTJQ 2K4YA 2XD0A 2COZA 2SRCA 1X01A 2HL3A 1U1TA 2DTHA 2EYXA 1UGPB 4ANJA 2YLBA 3RKYA 5IAYA 1AOJA 2PVOB 4B9XA 2JS0A 2BUDA 4M7AD 1YI2A 2YLCA 3CMEA 2OJ2A 2Y90A 4A53A 4O6JA 4RCBA 1M2VB 4M7DE 1VIEA 3G6EQ 2L8DA 2LQ8A 3TQ7P 2BZYA 1WYXA 1QKWA 2CT4A 4A4GA 1BK2A 2E6ZA 2JUFA 2LCCA 1B34A 3JAME 2L5QA 4RMOA 1SKUB 1M30A 1E7OA 5C0MA 2D9TA 2E65A 4C0DB 3I5SA 1TUGB 1OX8A 3VKIA 3OW2P 4J7FA 1WHLA 3CBMA 2MWPA 3OS5A 1U06A 2LNHB 2RI5A 1MV0B 3ZBDA 3QBYA 4C5GA 3LYIA 1VUBA 2RK1A 3L2WA 5J3BA 1U3OA 2KYBA 2KXDA 2LDMA 2ZCFB 1PKSA 1PD0A 1RABB 1IRXA 1NYFA 3OYFA 5GMKh 4MZMA 5LJ3d 3CCRA 4C5HA 3HPWA 2RHYA 3FC3A 1ZA2B 3OS2A 1SG5A 4M7DF 1RACB 1X69A 2E12A 1YJWQ 2LZ6B 2J6KA 2GQVA 5D6WA 1Q81R 3L1AA 1N9SA 3RKXA 4Y92A 5GAMe 1WQ7A 4J9EA 3SDZA 1ZX6A 1VYTA 2FZGB 2OTLQ 2V8KA 5CQYA 2K5IA 3LH5A 2DRKA 5LL6S 2HKQB 3RIRA 3QJYA 1V76A 3DB4A 1D0ZA 4CC2A 3EFSA 3TCJA 2M1HA 2HBWA 2CGHA 4R55A 2A08A 2EYWA 2O9VA 4KGZB 1BI3A 3PNWC 5LJ3f 3VU3C 4XTUA 3EGDB 2CUBA 2ZZDA 5GAN3 3CMAT 2QQSA 1O9SA 2M02A 4E7JA 1TH7A 2HCKA 1M8MA 1RI9A 3CC4T 1TUCA 2X4WA 2O4XB 3NFCA 4C0ZA 5KYUA 4JS4A 3E2UA 1WXTA 2O31A 3C4SA 1YIJQ 4N0AC 3J7AF 2EWNA 4RTUA 2DL8A 1HJDA 2D0QB 2ZGWA 2RQWA 2QGFB 4AT1B 2PZ1A 3X26B 2KEAA 3OW2S 3L2QA 2K3XA 3RMSA 2G6FX 2CH4A 2BE9B 5A0LA 4XK8E 1BB9A 4RTZA 1WIEA 4DBQA 1QKXA 2AT1B 4M77A 1VQPT 2I0NA 2Y4YA 1UEBA 4EMKC 2OTJT 1SSFA 2NYSA 2WSEE 2DVEA 3HFOA 3M53A 4J9BA 4X9DA 5D6XA 1UG1A 1FMVA 3PMIA 1YI2Q 3EGUA 4EMKA 4C92G 4M78C 2RMOA 5AT1B 2YXYA 3CMEQ 2CP3A 3L42A 1BBZA 2LT4A 4HVUA 2KRSA 4LDXA 2H3EB 2EFIA 3CCST 1E6GA 4M78A 3RUXA 2YRDA 4LDWA 4LDYA 4PJNA 4J6XA 5GAOl 2CREA 1JO8A 2RJFA 1K9MR 3FRNA 1NEBA 3I56A 4AG2C 2DO3A 4C92E 3G6ET 2V26A 3OS1A 2NWMA 4E7ZA 3QYGB 1PRLC 3OMGA 1T0HA 1RLPC 5GAMj 2LT1A 3MJXA 2YDLA 2M51A 2JTMA 2QDYB 1TG0A 2JW4A 1SSHA 3BFMA 5KYWA 1RL2A 1WHKA 1M4ZA 5HK3A 2XDPA 4JLGA 3VYGA 4M7AG 4OP0A 2PUOB 4OB3B 4C8QD 5LJ5j 5GAOp 2X51A 3M55A 3SB2A 7AT1B 5HY6A 1ZUUA 1ZSZC 4C8QA 3CCRQ 4J6WA 4AMCA 2DLPA 1FYNA 2RHZA 1LOJA 2VC8A 6AT1B 4F7UA 3AHUA 2J7IA 2FHDA 2QYZA 3GP8A 1G3TA 3CD6A 4XTXA 1I81A 4LD9K 3QG1A 2LVMA 2K6DA 4OB1B 4C92F 3JB9D 1N8RU 1QVFP 2XICA 3EHQA 2H3JA 3RNJA 3QZ5B 1YJWT 5C6SA 2ECZA 2BZXA 8ATCB 1H641 2EVRA 1NG2A 2JMAA 4IUVA 1MMAA 3CPWA 1I0CA 3QIIA 3CC2A 4J7IA 4GBQA 3I55Q 1Q7YR 2EQJA 3VYHB 4XTYA 3S3NA 2RB6A 4OGCA 2W0ZA 3HRSA 4RTXA 4GLKA 4FYXB 4ESRA 4QQGA 3L2ZA 2PNIA 4A4FA 2DNUA 3HSBA 4IUUA 1VQOA 1VQ5A 4A63B 3RERA 5IHKA 1NJIC 4QKUA 2YRCA 4HKEA 3I5RA 2X4YA 4A4HA 3OBWA 4KH0B 2OI3A 4M7DC 2P4TA 1VQMA 5GAN7 2EJGA 2E3IA 1SRMA 3JCMV 1PSEA 4HCCA 2VKNA 1YIJT 4OMLA 1AWXA 4FYYB 2ZPIB 3BDUA 5HCKA 5CKDA 4DEXA 4J9HA 3CXCP 2M0YA 3M0UA 2DIQA 3L2RA 2RQUA 3J80E 5I2MA 4LUEA 3DKMA 1GBRA 1Y57A 2MI6A 5KCOA 1FMKA 1IZ6A 4FW2A 1G83A 3H41A 5LJ3e 3VUZA 2F1LA 4D8DA 4CI0C 4ZGEB 5FW9A 3C94A 4FM4B 3JCMd 3HRTA 3ULRB 3CMET 4LUDA 3LWIA 3I56Q 4BACA 1M90C 2EQUA 3Q1JA 2EW3A 4ZGJB 3VS4A 2M16A 1QVFS 2HZYA 3QZ9B 4MMKA 2DFUA 2D8JA 3S3MA 4Z8AA 2L89A 5LJ5h 2JJ9A 2HKNA 4DEYA 1TU0B 3VUBA 1TUDA 3EGDA 2KGTA 1VYVA 3LX7A 2O88A 4J9FA 3VS5A 1QLYA 5GAMg 4DQ2A 4BI4A 1LVKA 3L2UA 2J6FA 2JS2A 4IURA 1FWZA 4QVZA 4J5YA 4JJCA 3GLXA 2L3RA 2B8AA 4OMOA 1HK9A 3UDCA 1KQSP 3PVLA 4J8OA 4F04B 1WJQA 3MP6A 4EMGA 1VQ6A 1W2BP 2RJDA 1JXOA 3CCQA 3RDVA 3CCRT 1G3WA 3CD6Q 1RADB 3EAEA 3SWNB 2V1RA 3HFNA 4ZTFA 2KK4A 1KC8R 4M75G 3V7CA 5GMKi 3EG9B 3CCMA 4BE2A 1N5ZA 5A2QE 3UATA 1R8OB 3CCLA 5GAN4 2CP0A 2QDLA 3FDRA 4EPCA 3E9GA 2PTKA 4KBMB 1ARKA 1NJIU 5GANh 2P0PA 3CXCS 2CYZB 5GAOn 1G5VA 3X20B 1AWJA 3JCMJ 1ZUYA 4BI8B 3CC2Q 2JVVA 2ED0A 5D7UA 1GFCA 4X9CA 4ZTJA 2JM9A 3R6OA 1JQQA 1WGSA 4PLIA 1MUZA 1ZUKA 1KIKA 1D1BA 4OMFB 2HQXA 1GCQC 3EG3A 1PKTA 1Y96B 3I55T 3OSVA 2HDAA 5GJWB 1VQOQ 2B86A 4C8QE 1VQ5Q 4ZN3A 3VS1A 2RM4A 2EPDA 4Y91A 5LJ3j 3VRZA 1QVGA 2MOXA 3OYJA 4NOYA 1PSFA 3V8KA 4F7UE 1NE8A 4BY6C 1TS9A 2KY9A 2A37A 1KQ2A 5M9OA 1K76A 1ABQA 3TU4K 1UJ0A 2LRQA 2FYKA 2DERA 1VQMQ 4KH1B 4M75B 4RTYA 2FL7A 1K9AA 1MNEA 1OULA 2X4XA 1WFWA 3SHWA 1R0CB 1C6VX 2CP2A 1LPLA 5A0DA 3G4SA 3THKA 4PJJA 9ATCB 1PD1A 5CKFA 1EFNA 4JS5A 2AIRB 2VUBA 4C92A 3QO3A
chains in the Genus database with same CATH topology
1WX6A 2JMCA 4CC2A 2J06A 1X2KA 2KYMA 4HVWA 1W6XA 1JU5C 2CSIA 2O9SA 3I9QA 2HBWA 4AFSC 2LCSA 2ROTA 1MV3A 2A08A 2EYWA 1K0SA 2EGEA 2O9VA 3CQTA 1W1FA 2CUDA 2FRYA 2C0OA 2CUBA 1B3QA 2GTOA 2LQNA 2HCKA 1M8MA 1YP5A 1RI9A 4J9DA 4J9IA 2FO0A 1TUCA 2AK5A 3EG0A 2V1QA 2D8HA 5IXFA 2YUQA 2AZVA 1I07A 2EGAA 2LJ0A 4LN2A 1WXTA 2O31A 4RUGA 5IHIA 5IXBA 2NUZA 1YCSB 1V1CA 1X2QA 2DL8A 4GLMA 4RTUA 1PHTA 1HJDA 2DVJA 1UHFA 2RQWA 4JZ3A 2PZ1A 1AWWA 2KEAA 2FEIA 2G6FX 1H92A 2CH4A 3EG2A 3H0FA 1NEGA 1BB9A 2DRMA 4RTZA 2CT3A 1WIEA 1QKXA 2DBMA 3QWYA 2I0NA 2MCNA 4OMNA 4ORZA 3FJ5A 1A0NB 4J9BA 1VYUA 4X1VA 1UG1A 4AFQC 1AD5A 1LCKA 1UHCA 3EGUA 2EYYA 3C0CA 2RMOA 2YUOA 1ABOA 3M0TA 2FPFA 2L3QA 1OV3A 2SEMA 1WXUA 1BBZA 1K1ZA 4HVUA 2KRSA 1E6GA 1UUEA 2KROA 1Z9QA 1UE9A 2CREA 1OPLA 1JO8A 1PWTA 1NEBA 2DBKA 4AG2C 2K9GA 5IH2A 2ENMA 2BTTA 4AFZC 2DA9A 2NWMA 4KRTA 4HVVA 1QWFA 2RPNA 1PRLC 1T0HA 1RLPC 2FPEA 1WDXA 2YDLA 3RBBB 2M51A 3REBB 1SRLA 2F2VA 1TG0A 2JW4A 1SSHA 2LQWA 4RTTA 2VWFA 2EGCA 1Z9ZA 3I35A 2K3BA 3SEMA 1CSKA 4OMPA 2ROLA 3NGPA 1NM7A 2DL5A 1ZUUA 2DF6A 2O2OA 4RTWA 1NLPC 2KBTA 1H8KA 2LMJA 3EG1A 3M0PA 1YNZA 1UECA 1UFFA 2F2XA 2RNAA 2DLPA 1FYNA 3QWXX 4WCIA 2DE0X 4HCKA 2J7IA 1SEMA 2EKHA 2AKLA 2DL3A 2K2MA 2YT6A 2K6DA 1OEBA 2E5KA 2EQIA 2KNBB 5IHNA 4F16A 1T0JA 5L23A 3EHQA 3RNJA 1K4US 4R0KA 2RQRA 2LP5A 2ECZA 1NLOC 2BZXA 1HD3A 4HXJA 5ECAA 4AG1C 1E6HA 2EVRA 1H3HA 1NG2A 1WXBA 2DILA 2JMAA 2X3XD 3VS6A 1KJWA 1M3CA 1I0CA 5FWCA 1OPKA 4AFUC 3NPFA 1T3LA 4GBQA 1CKBA 2DX1A 2W0ZA 2CDTA 4RTXA 2EBPA 4ESRA 1UDLA 1WLPB 1B07A 2PNIA 2DNUA 3GBQA 2HEQA 2K7AA 3ZL7C 1GFDA 2W10A 4JJDA 4A63B 1M3BA 2FG0A 5IHKA 3VS7A 1J3TA 2HSPA 1ZLMA 2A28A 2YUPA 2L2PA 2OAWA 3I5RA 4ZNXA 1PRMC 3IQLA 3UA6A 2VVKA 4K11A 4J9CA 2D1XA 3VRYA 1GBQA 4F14A 1WI7A 2ED1A 4LNPA 3M0RA 2DM1A 2OI3A 3M0QA 1UGVA 4D8KA 2IIMA 1W70A 2DL4A 2JM8A 1SRMA 1ZBJA 3PE0A 2LJ1A 1GCPA 5I11A 3PVQA 2VKNA 3M0SA 1S1NA 4OMLA 1AWXA 5HCKA 4JZ4A 2DMOA 1HSQA 1G2BA 3VS0A 4DEXA 2GNCA 4J9HA 2M0YA 3M0UA 2EYZA 4IIMA 1M3AA 2CH4W 2JTEA 4CC4B 2XMFA 2P4RA 1GCQA 2RQUA 1KSWA 2GGRA 2BZ8A 1U5SA 3REAB 1IO6A 4LUEA 1RUWA 4OMMA 1GBRA 1Y57A 2YSQA 1FMKA 4FSSA 4LE9A 2FRWA 1G83A 3H41A 2KT1A 3R6NA 4D8DA 5FW9A 3VS3A 2DJQA 2C0IA 2LJ3A 3EHRA 3NHNA 3ULRB 4LUDA 5FWBA 2RN8A 3UA7A 2J6OA 2FPDA 2EW3A 3VS4A 1ZSGA 2YUNA 3VS2A 4CC7A 5EC7A 2C0TA 2RF0A 2X3WD 1JXMA 2ABLA 2D8JA 2GQIA 2KRNA 4F17A 1QCFA 4IIOA 3UF4A 2JXBA 4Z8AA 2L3SA 3H0HA 3NMZC 4DEYA 1OOTA 1SPKA 3TVTA 1TUDA 2GTJA 2KGTA 1VYVA 4JJBA 1T3SA 2O88A 1GRIA 1QWEA 4J9FA 3VS5A 1QLYA 2SRCA 2K79A 3A98A 1AEYA 4OMQA 1WA7A 5GJVB 2EYXA 2J6FA 2JS2A 2CSQA 2KT8A 1CKAA 4CC3A 4JJCA 4OMOA 1AOJA 1BU1A 2LX7A 1UTIA 2JT4A 3PVLA 2JS0A 1K0XA 3TSWA 3H0IA 1Y0MA 1JXOA 2OJ2A 1XOVA 2A36A 1YWPA 2GBQA 1M27C 1AZGB 2V1RA 1RLQC 2D0NA 3U23A 4RTVA 2BZYA 1UJYA 1N5ZA 1WYXA 1QKWA 2CT4A 1AZEA 2DYBA 2KXCA 1BK2A 1X6GA 3UATA 1YN8A 2L3PA 1AWOA 2J05A 2QDLA 4QT7A 1SHGA 1KFZA 2PTKA 1ARKA 1I1JA 1M30A 1E7OA 4Z88A 3TSZA 2F2WA 2KR3A 1AWJA 1NYGA 1ZUYA 3I5SA 1SHFA 2ED0A 1GFCA 1AVZC 2JM9A 1JQQA 1MUZA 1ZUKA 1KIKA 1GL5A 2AKKA 1U06A 2ESWA 2LNHB 1MV0B 1JEGA 1VA7A 1GCQC 3EG3A 1PKTA 1YWOA 4E6RA 2HDAA 5GJWB 1PNJA 2B86A 1U3OA 2RQTA 2KYBA 2KXDA 3VS1A 1PKSA 2EPDA 1NYFA 3VRZA 2MOXA 3O5ZA 4M4ZA 2AZSA 2RQVA 2KRMA 1X43A 4JPBW 2KE9A 2A37A 5I22A 1X6BA 1K76A 2L0AA 1ABQA 3JV3A 1UJ0A 1X69A 3KFVA 4Z89A 1X27A 4RTYA 4EIKA 2LZ6B 2J6KA 1K9AA 4Y92A 1WFWA 3SHWA 4J9EA 4J9GA 2H8HA 1ZX6A 1VYTA 3THKA 2MIOA 3LH5A 2DRKA 1EFNA 2DL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX6 A;  2JMC A;  4CC2 A;  2J06 A;  1X2K A;  2KYM A;  4HVW A;  1W6X A;  1JU5 C;  2CSI A;  2O9S A;  3I9Q A;  2HBW A;  4AFS C;  2LCS A;  2ROT A;  1MV3 A;  2A08 A;  2EYW A;  1K0S A;  2EGE A;  2O9V A;  3CQT A;  1W1F A;  2CUD A;  2FRY A;  2C0O A;  2CUB A;  1B3Q A;  2GTO A;  2LQN A;  2HCK A;  1M8M A;  1YP5 A;  1RI9 A;  4J9D A;  4J9I A;  2FO0 A;  1TUC A;  2AK5 A;  3EG0 A;  2V1Q A;  2D8H A;  5IXF A;  2YUQ A;  2AZV A;  1I07 A;  2EGA A;  2LJ0 A;  4LN2 A;  1WXT A;  2O31 A;  4RUG A;  5IHI A;  5IXB A;  2NUZ A;  1YCS B;  1V1C A;  1X2Q A;  2DL8 A;  4GLM A;  4RTU A;  1PHT A;  1HJD A;  2DVJ A;  1UHF A;  2RQW A;  4JZ3 A;  2PZ1 A;  1AWW A;  2KEA A;  2FEI A;  2G6F X;  1H92 A;  2CH4 A;  3EG2 A;  3H0F A;  1NEG A;  1BB9 A;  2DRM A;  4RTZ A;  2CT3 A;  1WIE A;  1QKX A;  2DBM A;  3QWY A;  2I0N A;  2MCN A;  4OMN A;  4ORZ A;  3FJ5 A;  1A0N B;  4J9B A;  1VYU A;  4X1V A;  1UG1 A;  4AFQ C;  1AD5 A;  1LCK A;  1UHC A;  3EGU A;  2EYY A;  3C0C A;  2RMO A;  2YUO A;  1ABO A;  3M0T A;  2FPF A;  2L3Q A;  1OV3 A;  2SEM A;  1WXU A;  1BBZ A;  1K1Z A;  4HVU A;  2KRS A;  1E6G A;  1UUE A;  2KRO A;  1Z9Q A;  1UE9 A;  2CRE A;  1OPL A;  1JO8 A;  1PWT A;  1NEB A;  2DBK A;  4AG2 C;  2K9G A;  5IH2 A;  2ENM A;  2BTT A;  4AFZ C;  2DA9 A;  2NWM A;  4KRT A;  4HVV A;  1QWF A;  2RPN A;  1PRL C;  1T0H A;  1RLP C;  2FPE A;  1WDX A;  2YDL A;  3RBB B;  2M51 A;  3REB B;  1SRL A;  2F2V A;  1TG0 A;  2JW4 A;  1SSH A;  2LQW A;  4RTT A;  2VWF A;  2EGC A;  1Z9Z A;  3I35 A;  2K3B A;  3SEM A;  1CSK A;  4OMP A;  2ROL A;  3NGP A;  1NM7 A;  2DL5 A;  1ZUU A;  2DF6 A;  2O2O A;  4RTW A;  1NLP C;  2KBT A;  1H8K A;  2LMJ A;  3EG1 A;  3M0P A;  1YNZ A;  1UEC A;  1UFF A;  2F2X A;  2RNA A;  2DLP A;  1FYN A;  3QWX X;  4WCI A;  2DE0 X;  4HCK A;  2J7I A;  1SEM A;  2EKH A;  2AKL A;  2DL3 A;  2K2M A;  2YT6 A;  2K6D A;  1OEB A;  2E5K A;  2EQI A;  2KNB B;  5IHN A;  4F16 A;  1T0J A;  5L23 A;  3EHQ A;  3RNJ A;  1K4U S;  4R0K A;  2RQR A;  2LP5 A;  2ECZ A;  1NLO C;  2BZX A;  1HD3 A;  4HXJ A;  5ECA A;  4AG1 C;  1E6H A;  2EVR A;  1H3H A;  1NG2 A;  1WXB A;  2DIL A;  2JMA A;  2X3X D;  3VS6 A;  1KJW A;  1M3C A;  1I0C A;  5FWC A;  1OPK A;  4AFU C;  3NPF A;  1T3L A;  4GBQ A;  1CKB A;  2DX1 A;  2W0Z A;  2CDT A;  4RTX A;  2EBP A;  4ESR A;  1UDL A;  1WLP B;  1B07 A;  2PNI A;  2DNU A;  3GBQ A;  2HEQ A;  2K7A A;  3ZL7 C;  1GFD A;  2W10 A;  4JJD A;  4A63 B;  1M3B A;  2FG0 A;  5IHK A;  3VS7 A;  1J3T A;  2HSP A;  1ZLM A;  2A28 A;  2YUP A;  2L2P A;  2OAW A;  3I5R A;  4ZNX A;  1PRM C;  3IQL A;  3UA6 A;  2VVK A;  4K11 A;  4J9C A;  2D1X A;  3VRY A;  1GBQ A;  4F14 A;  1WI7 A;  2ED1 A;  4LNP A;  3M0R A;  2DM1 A;  2OI3 A;  3M0Q A;  1UGV A;  4D8K A;  2IIM A;  1W70 A;  2DL4 A;  2JM8 A;  1SRM A;  1ZBJ A;  3PE0 A;  2LJ1 A;  1GCP A;  5I11 A;  3PVQ A;  2VKN A;  3M0S A;  1S1N A;  4OML A;  1AWX A;  5HCK A;  4JZ4 A;  2DMO A;  1HSQ A;  1G2B A;  3VS0 A;  4DEX A;  2GNC A;  4J9H A;  2M0Y A;  3M0U A;  2EYZ A;  4IIM A;  1M3A A;  2CH4 W;  2JTE A;  4CC4 B;  2XMF A;  2P4R A;  1GCQ A;  2RQU A;  1KSW A;  2GGR A;  2BZ8 A;  1U5S A;  3REA B;  1IO6 A;  4LUE A;  1RUW A;  4OMM A;  1GBR A;  1Y57 A;  2YSQ A;  1FMK A;  4FSS A;  4LE9 A;  2FRW A;  1G83 A;  3H41 A;  2KT1 A;  3R6N A;  4D8D A;  5FW9 A;  3VS3 A;  2DJQ A;  2C0I A;  2LJ3 A;  3EHR A;  3NHN A;  3ULR B;  4LUD A;  5FWB A;  2RN8 A;  3UA7 A;  2J6O A;  2FPD A;  2EW3 A;  3VS4 A;  1ZSG A;  2YUN A;  3VS2 A;  4CC7 A;  5EC7 A;  2C0T A;  2RF0 A;  2X3W D;  1JXM A;  2ABL A;  2D8J A;  2GQI A;  2KRN A;  4F17 A;  1QCF A;  4IIO A;  3UF4 A;  2JXB A;  4Z8A A;  2L3S A;  3H0H A;  3NMZ C;  4DEY A;  1OOT A;  1SPK A;  3TVT A;  1TUD A;  2GTJ A;  2KGT A;  1VYV A;  4JJB A;  1T3S A;  2O88 A;  1GRI A;  1QWE A;  4J9F A;  3VS5 A;  1QLY A;  2SRC A;  2K79 A;  3A98 A;  1AEY A;  4OMQ A;  1WA7 A;  5GJV B;  2EYX A;  2J6F A;  2JS2 A;  2CSQ A;  2KT8 A;  1CKA A;  4CC3 A;  4JJC A;  4OMO A;  1AOJ A;  1BU1 A;  2LX7 A;  1UTI A;  2JT4 A;  3PVL A;  2JS0 A;  1K0X A;  3TSW A;  3H0I A;  1Y0M A;  1JXO A;  2OJ2 A;  1XOV A;  2A36 A;  1YWP A;  2GBQ A;  1M27 C;  1AZG B;  2V1R A;  1RLQ C;  2D0N A;  3U23 A;  4RTV A;  2BZY A;  1UJY A;  1N5Z A;  1WYX A;  1QKW A;  2CT4 A;  1AZE A;  2DYB A;  2KXC A;  1BK2 A;  1X6G A;  3UAT A;  1YN8 A;  2L3P A;  1AWO A;  2J05 A;  2QDL A;  4QT7 A;  1SHG A;  1KFZ A;  2PTK A;  1ARK A;  1I1J A;  1M30 A;  1E7O A;  4Z88 A;  3TSZ A;  2F2W A;  2KR3 A;  1AWJ A;  1NYG A;  1ZUY A;  3I5S A;  1SHF A;  2ED0 A;  1GFC A;  1AVZ C;  2JM9 A;  1JQQ A;  1MUZ A;  1ZUK A;  1KIK A;  1GL5 A;  2AKK A;  1U06 A;  2ESW A;  2LNH B;  1MV0 B;  1JEG A;  1VA7 A;  1GCQ C;  3EG3 A;  1PKT A;  1YWO A;  4E6R A;  2HDA A;  5GJW B;  1PNJ A;  2B86 A;  1U3O A;  2RQT A;  2KYB A;  2KXD A;  3VS1 A;  1PKS A;  2EPD A;  1NYF A;  3VRZ A;  2MOX A;  3O5Z A;  4M4Z A;  2AZS A;  2RQV A;  2KRM A;  1X43 A;  4JPB W;  2KE9 A;  2A37 A;  5I22 A;  1X6B A;  1K76 A;  2L0A A;  1ABQ A;  3JV3 A;  1UJ0 A;  1X69 A;  3KFV A;  4Z89 A;  1X27 A;  4RTY A;  4EIK A;  2LZ6 B;  2J6K A;  1K9A A;  4Y92 A;  1WFW A;  3SHW A;  4J9E A;  4J9G A;  2H8H A;  1ZX6 A;  1VYT A;  3THK A;  2MIO A;  3LH5 A;  2DRK A;  1EFN A;  2DL7 A; 
#chains in the Genus database with same CATH topology
 3F70 A;  1WHG A;  1QQJ A;  1GXI E;  1W6X A;  3PMT A;  4LXC A;  2CSI A;  1YJ9 A;  4AFS C;  2MYS A;  2LCS A;  1KQS S;  1K0S A;  3FEO A;  4HT9 A;  3CQT A;  1W1F A;  2LTO A;  1W2B S;  4C8Q F;  2RH2 A;  1C0M A;  2QQ9 A;  2A7Y A;  4BDZ A;  2C0O A;  2QA4 A;  2CP5 A;  5D6Y A;  2GTO A;  1ZSZ B;  3CPF A;  2XKO C;  4F7U F;  3M59 A;  3OS0 A;  4J9I A;  2AK5 A;  5GAO q;  2DET A;  1QCO A;  3I56 T;  4RUG A;  5IHI A;  1KHC A;  4QW2 A;  3MP8 A;  3VV0 A;  1YCS B;  4GLM A;  4M7A A;  3AT1 B;  1VQL A;  2DVJ A;  1UHF A;  2CZ1 B;  2CP6 A;  4JZ3 A;  3UPU A;  4NL2 A;  1AWW A;  2COW A;  3JB9 F;  2MPX C;  3PIP A;  3H0F A;  2RK2 A;  2GF7 A;  1JJ2 A;  5J26 A;  1NEG A;  1S72 A;  2DRM A;  4Z02 A;  3V8J A;  5KE2 A;  1KD1 R;  3MEW A;  3QWY A;  4QVD A;  1BKB A;  2JTF A;  4ORZ A;  1NZ9 A;  1IB8 A;  1A0N B;  1VYU A;  2MWO A;  3GPL A;  4X1V A;  5I2S A;  4AFQ C;  1UHC A;  2OX7 A;  3OYC A;  2EYY A;  1VQ6 Q;  2FPF A;  3A8O B;  1Q86 U;  4P5N A;  3CCQ Q;  4KUI A;  5FU7 C;  2HMA A;  3PGG A;  1IXD A;  1Z9Q A;  1UE9 A;  1OPL A;  3CCM Q;  3EH2 A;  1K73 C;  5IH2 A;  5KE3 A;  4O5V A;  3CCL Q;  3CD6 T;  2DA9 A;  3M5A A;  2DD5 A;  3UWN A;  1B7T A;  1FMW A;  3M56 A;  4RG2 A;  2F2V A;  2EAY A;  3CC7 A;  3OYH A;  4DBH A;  1D09 B;  5KYX B;  3I35 A;  3CC2 T;  2K3B A;  4HA8 A;  3OYB A;  3SEM A;  2LQK A;  5CKH A;  3OYD A;  2ROL A;  3ZEH A;  2RHU A;  5A0G A;  4PJO G;  2O2O A;  2ZPH B;  4RTW A;  2M0O A;  3JCM e;  1N6A A;  1W4S A;  1NLP C;  2KBT A;  2LMJ A;  2MAM A;  3EG1 A;  1VQO T;  1VQ5 T;  1UFF A;  4WTO B;  4WCI A;  3CCE T;  2DE0 X;  5KYY B;  3CCU A;  5LJ3 g;  3CEY A;  2EKH A;  1N8R C;  3EGX A;  1YJN A;  2DL3 A;  1EIF A;  2YT6 A;  1X6O A;  2E3H A;  2EQI A;  2KNB B;  4OB2 B;  4F16 A;  5L23 A;  1VQM T;  3G4S Q;  1WHH A;  1Y71 A;  1K4U S;  2RQR A;  1BIA A;  1NLO C;  4HXJ A;  3GNG A;  5ECA A;  4L5G A;  3JB9 J;  2X3X D;  2DD4 A;  1K8A U;  1KJW A;  1M3C A;  3NPF A;  2V8J A;  4QQ6 A;  4M77 C;  4BE0 A;  5DM7 R;  1YJ9 Q;  2NUT A;  4HCB A;  5CVI A;  1UDL A;  3SWN A;  3LGF A;  4DA4 A;  1ACM B;  1B07 A;  2QGG A;  2QTX A;  3EG9 A;  3QJ6 A;  3S6W A;  2QA4 Q;  1Q82 U;  2EYQ A;  3GBQ A;  5CIU A;  4PJO B;  5IN1 A;  1GFD A;  3MO8 A;  1M3B A;  2FG0 A;  5CAI A;  3VS7 A;  2MMP A;  1J3T A;  5GMK m;  1X75 C;  3OMC A;  1YHQ A;  3E19 A;  1TXQ A;  4ZNX A;  1PRM C;  2A3L A;  3UA6 A;  2VVK A;  4K11 A;  2QQB A;  2DJZ A;  1H3Z A;  4J9C A;  2E1H A;  3VRY A;  3OYN A;  4F14 A;  1WI7 A;  2ED1 A;  2DM1 A;  4MDW A;  3M0Q A;  1QMC A;  4KGV B;  1VQL Q;  3X24 B;  1Y96 A;  4LDV A;  2FZK B;  2WAC A;  3MEV A;  4FT2 A;  1ZBJ A;  2LJ1 A;  1G8X A;  3M0S A;  5GAN 8;  2FB7 A;  1S72 Q;  2DMO A;  4D6W A;  1HSQ A;  4C5E A;  2YWW A;  4FL6 A;  1G2B A;  1K73 U;  2CZ0 B;  1Q81 C;  2MF2 A;  3MP1 A;  4N4I A;  1M3A A;  2CH4 W;  2RO0 A;  4M75 D;  4CC4 B;  3JCM Q;  3N5B B;  2ATC B;  1OI1 A;  3OYK A;  1OU9 A;  1KK7 A;  2P0Q A;  3ME9 A;  1IO6 A;  2DTI A;  1N9R A;  3G71 A;  4XTW A;  3X28 B;  4LE9 A;  4KT0 E;  4M75 A;  2M9U A;  4FW1 A;  3R6N A;  3QDR B;  2DKG A;  3M57 A;  4C8Q C;  3VS3 A;  2IG0 A;  2C0I A;  3NHN A;  1VQ6 T;  2F5T X;  3CCQ T;  2FPD A;  3QPH A;  2VXE A;  1NPP A;  1M1K U;  3VS2 A;  4CC7 A;  1BI1 A;  4M7A E;  3KXT A;  2RF0 A;  2X3W D;  3URG A;  2BE7 D;  3H8Z A;  4F17 A;  1KHI A;  1Y7X A;  3UF4 A;  3CCL T;  3L2V A;  4NL3 A;  3H0H A;  1EZZ B;  1IGQ A;  3QUI A;  4RKU E;  3LLR A;  3TVT A;  3CC7 Q;  1D1C A;  2GTJ A;  2ZPG B;  3OYG A;  1RI0 A;  1T3S A;  1GRI A;  2PQW A;  1M90 R;  4ELZ C;  3A98 A;  4LD6 A;  4OMQ A;  3WVE B;  1M9S A;  1WA7 A;  2CSQ A;  2VYT A;  4CC3 A;  3NTK A;  2OTL T;  1OYX A;  1BU1 A;  2LX7 A;  3QHS A;  1UTI A;  2JT4 A;  1M2V A;  5FRN A;  4V2S A;  1K0X A;  3H0I A;  2E4H A;  1XOV A;  2DPP B;  4BD3 A;  3CCU Q;  2A36 A;  3P8B B;  1D1A A;  1AZG B;  1R77 A;  1AHJ B;  1RLQ C;  3JB9 H;  3U23 A;  1YJN Q;  5GAO r;  1UJY A;  2DYB A;  2KXC A;  1X6G A;  4M7A F;  2L3P A;  2KI7 A;  2CP7 A;  4QT7 A;  1SHG A;  1PG5 B;  1IHV A;  4JRI A;  4RG8 A;  2DXU A;  1K9M C;  4PFZ A;  2YHT A;  1OQK A;  2KMT A;  2KR3 A;  3DLM A;  1NYG A;  1B34 B;  1I5L A;  1AVZ C;  2P0K A;  1GL5 A;  2RHI A;  5CKB A;  1EX4 A;  2ESW A;  2AHJ B;  5HK0 A;  1OU8 A;  1YWO A;  4E6R A;  1V29 B;  4XTV A;  1YJ9 T;  3OYA A;  2RQT A;  2KQW A;  1RAE B;  1ZQ1 A;  1Q81 U;  1QVF A;  3O5Z A;  4M4Z A;  3MPU B;  2QA4 T;  1O75 A;  3MCA B;  4BB7 A;  2RQV A;  2KRM A;  1X43 A;  1YHQ Q;  2KAF A;  5GMK e;  4PK4 A;  1X6B A;  3OSS C;  3JV3 A;  5FU7 B;  2E10 A;  3QXE B;  1YIT A;  2K3Y A;  4XU0 A;  1YI2 T;  3KFV A;  5GAM h;  3JSC A;  2NLU A;  4B9W A;  4EIK A;  4IUP A;  4LDU A;  2R58 A;  2XI9 A;  2VGM A;  3TRE A;  1VQN A;  2QQR A;  2DEQ A;  1VQL T;  2DTO A;  1WQW A;  2RHX A;  5LJ5 d;  1WX6 A;  4XU2 A;  1S72 T;  3MKD A;  2CS7 A;  1X2K A;  2KYM A;  1JU5 C;  2O9S A;  2Z0W A;  5KYY A;  1UGS B;  4FIB A;  3CCS A;  3G71 Q;  2ROT A;  5EG2 A;  3PT9 A;  1AT1 B;  4L6V 5;  2EGE A;  3OYM A;  5L8R E;  3OYY A;  4J83 A;  1Q7Y C;  2O4X A;  5DLO A;  2QAS A;  3JCM f;  4M78 G;  4JRK A;  3C95 A;  5IXF A;  2PVD B;  3CXC A;  4EMH A;  2AZV A;  1I07 A;  2KDS A;  1MMN A;  4LN2 A;  4PJO D;  4FU6 A;  2NUZ A;  3SFM A;  4C5I A;  5CR2 A;  2KSS A;  4E7L A;  1JRI A;  3WXM B;  1PC0 A;  2FEI A;  2F69 A;  1H92 A;  4PJO A;  4ATO A;  2EJF A;  3A5Z B;  2HAX A;  5GAN d;  3CC7 T;  2XID A;  4MML A;  2XHC A;  3EFR A;  4M75 E;  1K9M U;  1Q86 C;  4M77 B;  1DJ7 B;  2QI2 A;  2XG8 D;  1AD5 A;  1LCK A;  3A8H B;  2L3Q A;  2SEM A;  1OV3 A;  1WXU A;  3P8H A;  1ZBX A;  2E6N A;  2DXC A;  1ZA1 B;  1XNI A;  1OZ3 A;  2G3R A;  1VQ7 A;  8AT1 B;  1UUE A;  4EMK B;  4VUB A;  1M8V A;  1PWT A;  2QQA A;  2ENM A;  2IPO B;  4M78 B;  1QP3 A;  4JLI A;  4A54 A;  4PFP A;  1YJN T;  4HVV A;  1QWF A;  1I4K 1;  2NUP B;  3REB B;  1SRL A;  1KQS A;  2ZPB B;  5GAN f;  1LNX A;  4RTT A;  4OGE A;  1W2B A;  1Z9Z A;  4C92 C;  2Y4X A;  1RAG B;  4DBF A;  1JJ2 P;  1CSK A;  3NGP A;  3GOX A;  2DIG A;  2HD0 A;  4FCY A;  1NM7 A;  4M75 F;  2DL5 A;  2DF6 A;  2K5F A;  3G7Z A;  4BI3 A;  1H8K A;  1RAI B;  1XQH A;  3M0P A;  1YNZ A;  2WSC E;  1YFN A;  2F2X A;  3QWX X;  3CCJ A;  3MEA A;  4OVA A;  1YIT Q;  1I5O B;  4HCK A;  1YHQ T;  5GAO m;  3BW1 A;  1YBY A;  4XQ3 A;  2BKD N;  3NTI A;  4PJL A;  3DLL A;  2K2M A;  4XU3 A;  1Q7Y U;  2CZ6 B;  3KBG A;  5IHN A;  1VQN Q;  4M7A C;  1MMD A;  1K8A C;  4PNO A;  4R0K A;  1KC8 C;  4QVC A;  2D6F A;  1RAH B;  2LCL A;  3J81 E;  1H3H A;  2DIL A;  4M7D G;  1MHN A;  1HYO A;  1MND A;  5FWC A;  1OPK A;  1T3L A;  1NBE B;  1CKB A;  3CCS Q;  1N8R R;  4ELY C;  1Q82 C;  2EBP A;  2DYI A;  1G3Y A;  1WLP B;  2VV5 A;  5I21 A;  2HSE B;  3LH0 A;  3PTA A;  2VAS A;  5CKE A;  3G71 T;  2K7A A;  2R5A A;  3ZL7 C;  3MET A;  4JJD A;  2XDD A;  3RMQ A;  4E7S A;  1FXX A;  2HNI A;  2YUP A;  4A4E A;  2OAW A;  3QSU A;  2E70 A;  2PVG B;  2D1X A;  2ZPF B;  3ER0 A;  4XAX B;  4D8K A;  2DL4 A;  4JRP A;  2JM8 A;  3NTH A;  1GCP A;  1P92 A;  3PVQ A;  3T9N A;  3OYI A;  3BE3 A;  1BYM A;  5KCH A;  1TSF A;  2GNC A;  1JJ2 S;  4M7D B;  1TOV A;  3OA6 A;  4PL6 A;  2XMF A;  2P4R A;  1OZ2 A;  4MZP A;  3JRZ A;  2GGR A;  2PUK B;  1U5S A;  3REA B;  4OMM A;  1RUW A;  5LJ3 h;  1WJS A;  3FIF A;  4FSS A;  4E2F B;  1BI0 A;  3OB9 A;  4KGX B;  3HP9 A;  2K2V A;  2KT1 A;  3HHT B;  3JCM W;  3RES A;  2EKO A;  1VQ7 Q;  5DY9 A;  4N4G A;  4II1 A;  1VIF A;  4MZT A;  2DJQ A;  2LJ3 A;  1M1K C;  3EHR A;  2DEU A;  2RI2 A;  2RN8 A;  4NS5 A;  4DOW A;  2WSF E;  3V8L A;  3OBY A;  2DK3 A;  2C0T A;  2QEX A;  1JXM A;  2ABL A;  2KRN A;  2JXB A;  3OW2 A;  4PJO E;  1G3S A;  4QQD A;  4Y28 E;  1OOT A;  3I55 A;  1VQK A;  3QYH B;  5LJ5 e;  3M54 A;  3M58 A;  4JJB A;  1QWE A;  3KUF A;  2HBP A;  4TVR A;  2COY A;  2EJ9 A;  4ZGD B;  2K79 A;  5KH6 A;  1AEY A;  4J6Y A;  1VQ4 A;  5CCA A;  5GJV B;  1QW1 A;  3SWN C;  2KT8 A;  1CKA A;  4PKC C;  1KC8 U;  1KD1 C;  2LX9 A;  3TSW A;  1Y0M A;  1TWB A;  3CCJ Q;  5FRM A;  1RAA B;  2I2L A;  5IT9 E;  3D7S B;  1YWP A;  2GBQ A;  5GAN 2;  1M27 C;  1TTH B;  1SF9 A;  2D0N A;  4IKF A;  4M77 D;  4RTV A;  1VQ9 A;  1M5Q 1;  4BUG A;  1YIT T;  1AZE A;  3CCV A;  4N0A A;  1YN8 A;  4XU1 A;  2VB6 A;  1AWO A;  2J05 A;  5HKC A;  3V7R A;  1KFZ A;  4L59 A;  4EDU A;  1VQ8 A;  5KYN A;  4RCC A;  3MEU A;  1I1J A;  4Z88 A;  3TSZ A;  4PJO F;  2F2W A;  4E7I A;  1VQN T;  2HQE A;  2XDB A;  5GAN e;  3M9Q A;  1SHF A;  4C0F A;  1XJW B;  2AKK A;  4M78 D;  2QG9 B;  5FU6 C;  1JEG A;  5DLQ E;  1VA7 A;  3EFO B;  4BDY A;  1NJI R;  3H9N A;  1FX7 A;  3C12 A;  1PNJ A;  2JZ2 A;  1WJR A;  4KUL A;  1WPY A;  1HXD A;  1WNL A;  3X25 B;  1Y07 A;  2R57 A;  4M75 C;  3CPW P;  2E41 A;  2F5K A;  2AZS A;  3EH1 A;  2NUP A;  4JPB W;  2KE9 A;  5I22 A;  5CK9 A;  2L0A A;  3GIB A;  4XTZ A;  4Z89 A;  1X27 A;  1WHM A;  4BY6 B;  4E7K A;  1D3B B;  1IRE B;  3HL8 A;  4J9G A;  2A0F B;  5FRO A;  1Q95 G;  1U1S A;  2H8H A;  3CCM T;  2MIO A;  4JDS A;  3H6Z A;  4OB0 B;  1LJO A;  4YTL A;  2DL7 A;  2JMC A;  3A1P A;  3PFS A;  2J06 A;  5GAN 6;  4HVW A;  3I9Q A;  4C92 B;  1MV3 A;  3V7S A;  1ZSZ A;  4N4H A;  2CUD A;  2QXF A;  2FRY A;  2V8I A;  3TEE A;  1I8F A;  5GAN 5;  4UC4 A;  1B3Q A;  3ASK A;  1RAF B;  3GNF B;  1UB4 A;  2LQN A;  4BE1 A;  1YP5 A;  4J9D A;  3E9F A;  2FO0 A;  4JRQ A;  1VQ7 T;  3EG0 A;  2V1Q A;  3OY9 A;  2QEX Q;  2D8H A;  2DZ9 A;  2RD1 A;  2YUQ A;  4FSX A;  2EGA A;  2LJ0 A;  1KD1 U;  1PCX A;  3FJP A;  1M2O A;  1IGU A;  5IXB A;  2K5L A;  2XK0 A;  1V1C A;  1X2Q A;  1PHT A;  4C0D C;  4MDX A;  3LW5 E;  3HRU A;  1VQK Q;  2PU9 B;  3EG2 A;  2RA2 A;  3A8G B;  3FB9 A;  4M7A B;  1C1A A;  2CZ7 B;  2KVQ G;  5GAN j;  2CT3 A;  3BDL A;  2DBM A;  1XTD A;  2ZAE A;  1VQ4 Q;  2MCN A;  4OMN A;  4PFO A;  3FJ5 A;  1JB0 E;  3G4S T;  3P8D A;  1WZO A;  3CCE A;  3JCM X;  3OYE A;  3CPW S;  3CMA A;  4HT8 A;  3C0C A;  2YUO A;  1ABO A;  3M0T A;  2YRV A;  4PLL A;  1K1Z A;  4FT4 A;  3CC4 A;  1M1G A;  4M7D D;  2KRO A;  3RR6 A;  1VOM A;  2DZC A;  4IUT A;  3CCJ T;  4GY5 A;  1VQ9 Q;  2DBK A;  2K9G A;  3CCV Q;  4ME7 A;  2BTT A;  1ZHI A;  3M4Y A;  4M7D A;  2DXB A;  4AFZ C;  3M4G A;  1Q86 R;  3O8V A;  1VQ8 Q;  2OAU A;  4KRT A;  2RPN A;  3JCM c;  2FPE A;  5FLX E;  1WDX A;  1JBM A;  1WHJ A;  5KYX A;  3RBB B;  5GAM d;  1BCO A;  1UGR B;  2LQW A;  2VWF A;  1UGQ B;  2EGC A;  1VQP A;  3A8M B;  3JB9 I;  1NPR A;  2OTJ A;  2GFA A;  2GFU A;  4FYV B;  4OMP A;  3JCM h;  3MHX A;  4ZN1 A;  3BY7 A;  4FYW B;  4M77 G;  3RKW A;  1D0Y A;  1UEC A;  2QAZ A;  5GMK l;  2RNA A;  3QDF A;  3CBP A;  2EQK A;  3OQ5 A;  4B6M A;  1SEM A;  3G6E A;  2AKL A;  1M1F A;  1QCN A;  2O01 E;  4KUD K;  2X9H A;  2ZPE B;  4M77 E;  2C06 A;  4A4K A;  2X35 A;  1OEB A;  2E5K A;  1QVG P;  4DBR A;  3A8L B;  3JCM g;  5GAM f;  1T0J A;  1MGQ A;  3EGX B;  3S3O A;  2LP5 A;  1HD3 A;  4AG1 C;  3SD4 A;  1E6H A;  2E64 A;  1WXB A;  3OYL A;  3VS6 A;  4PJM A;  4PJO C;  3GF5 A;  4OF1 A;  5KYU B;  4AFU C;  2MK5 A;  2E5Q A;  3UT1 A;  2DX1 A;  5LJ5 f;  2CDT A;  2VXF A;  4M78 E;  1QVP A;  2LC4 A;  5LJ5 g;  3JCM b;  4CRI A;  1QP2 A;  1KQ1 A;  4IUQ A;  3DB3 A;  3HKS A;  2RI3 A;  1OX9 A;  2HEQ A;  2NUT B;  3FLG A;  1K8A R;  4C0G A;  2DAQ A;  4HCZ A;  2W10 A;  3VJP A;  2HSP A;  1ZLM A;  2A28 A;  2JN0 A;  2LNV A;  2L2P A;  4R56 A;  3IQL A;  1Q82 R;  1GBQ A;  4LNP A;  4C8Q G;  3M0R A;  2R5M A;  3G1J A;  2QEX T;  1UGV A;  2IIM A;  1W70 A;  3EFO A;  1YJW A;  2IVW A;  4M77 F;  5GMK j;  2FVU A;  4JUV A;  5CO7 A;  3PE0 A;  4F7U G;  5I11 A;  3CCU T;  3INZ A;  1S1N A;  3ZFJ A;  1R0B G;  4JZ4 A;  3PIO A;  1BI2 A;  3WVD B;  1BCM A;  5CQX A;  2OTL A;  1VQK T;  3VS0 A;  1KG1 A;  3CBO A;  4JJN K;  1D0X A;  2EYZ A;  1N27 A;  4IIM A;  1F1B B;  2JTE A;  1GCQ A;  1BIB A;  1KSW A;  2BZ8 A;  3CCE Q;  1VQ4 T;  5GAN g;  4M78 F;  4X34 A;  3CMA Q;  2RJE A;  2YSQ A;  4E7H A;  2K57 A;  5AYF A;  5FU6 B;  3JB9 G;  2JOY A;  4DOV A;  2CKK A;  2FRW A;  3E1S A;  2VGN A;  1MMG A;  2BIV A;  5KYW B;  3HTR A;  1K73 R;  3CC4 Q;  1D3B A;  2X4J A;  2DXT A;  2HL5 C;  5FWB A;  1YCY A;  3UA7 A;  2J6O A;  4E47 A;  1IHW A;  3JCM P;  2XU8 A;  5J39 A;  4C92 D;  1ZSG A;  2YUN A;  3LGL A;  5EC7 A;  2RJC A;  3LWH A;  1QVG S;  1M90 U;  4WF2 A;  2P84 A;  1VQ9 T;  2GCX A;  2GQI A;  4C8Q B;  1QCF A;  2EQM A;  2FZC B;  2QK0 A;  4IIO A;  3CCV T;  1YIJ A;  2L3S A;  2JNG A;  3NMZ C;  1VQ8 T;  4Q5W A;  2EIF A;  1SPK A;  2HQH A;  4F7U B;  1VQP Q;  2QTV A;  1M1K R;  1PM3 A;  3QKJ A;  1U8R A;  2OTJ Q;  2K4Y A;  2XD0 A;  2COZ A;  2SRC A;  1X01 A;  2HL3 A;  1U1T A;  2DTH A;  2EYX A;  1UGP B;  4ANJ A;  2YLB A;  3RKY A;  5IAY A;  1AOJ A;  2PVO B;  4B9X A;  2JS0 A;  2BUD A;  4M7A D;  1YI2 A;  2YLC A;  3CME A;  2OJ2 A;  2Y90 A;  4A53 A;  4O6J A;  4RCB A;  1M2V B;  4M7D E;  1VIE A;  3G6E Q;  2L8D A;  2LQ8 A;  3TQ7 P;  2BZY A;  1WYX A;  1QKW A;  2CT4 A;  4A4G A;  1BK2 A;  2E6Z A;  2JUF A;  2LCC A;  1B34 A;  3JAM E;  2L5Q A;  4RMO A;  1SKU B;  1M30 A;  1E7O A;  5C0M A;  2D9T A;  2E65 A;  4C0D B;  3I5S A;  1TUG B;  1OX8 A;  3VKI A;  3OW2 P;  4J7F A;  1WHL A;  3CBM A;  2MWP A;  3OS5 A;  1U06 A;  2LNH B;  2RI5 A;  1MV0 B;  3ZBD A;  3QBY A;  4C5G A;  3LYI A;  1VUB A;  2RK1 A;  3L2W A;  5J3B A;  1U3O A;  2KYB A;  2KXD A;  2LDM A;  2ZCF B;  1PKS A;  1PD0 A;  1RAB B;  1IRX A;  1NYF A;  3OYF A;  5GMK h;  4MZM A;  5LJ3 d;  3CCR A;  4C5H A;  3HPW A;  2RHY A;  3FC3 A;  1ZA2 B;  3OS2 A;  1SG5 A;  4M7D F;  1RAC B;  1X69 A;  2E12 A;  1YJW Q;  2LZ6 B;  2J6K A;  2GQV A;  5D6W A;  1Q81 R;  3L1A A;  1N9S A;  3RKX A;  4Y92 A;  5GAM e;  1WQ7 A;  4J9E A;  3SDZ A;  1ZX6 A;  1VYT A;  2FZG B;  2OTL Q;  2V8K A;  5CQY A;  2K5I A;  3LH5 A;  2DRK A;  5LL6 S;  2HKQ B;  3RIR A;  3QJY A;  1V76 A;  3DB4 A;  1D0Z A;  4CC2 A;  3EFS A;  3TCJ A;  2M1H A;  2HBW A;  2CGH A;  4R55 A;  2A08 A;  2EYW A;  2O9V A;  4KGZ B;  1BI3 A;  3PNW C;  5LJ3 f;  3VU3 C;  4XTU A;  3EGD B;  2CUB A;  2ZZD A;  5GAN 3;  3CMA T;  2QQS A;  1O9S A;  2M02 A;  4E7J A;  1TH7 A;  2HCK A;  1M8M A;  1RI9 A;  3CC4 T;  1TUC A;  2X4W A;  2O4X B;  3NFC A;  4C0Z A;  5KYU A;  4JS4 A;  3E2U A;  1WXT A;  2O31 A;  3C4S A;  1YIJ Q;  4N0A C;  3J7A F;  2EWN A;  4RTU A;  2DL8 A;  1HJD A;  2D0Q B;  2ZGW A;  2RQW A;  2QGF B;  4AT1 B;  2PZ1 A;  3X26 B;  2KEA A;  3OW2 S;  3L2Q A;  2K3X A;  3RMS A;  2G6F X;  2CH4 A;  2BE9 B;  5A0L A;  4XK8 E;  1BB9 A;  4RTZ A;  1WIE A;  4DBQ A;  1QKX A;  2AT1 B;  4M77 A;  1VQP T;  2I0N A;  2Y4Y A;  1UEB A;  4EMK C;  2OTJ T;  1SSF A;  2NYS A;  2WSE E;  2DVE A;  3HFO A;  3M53 A;  4J9B A;  4X9D A;  5D6X A;  1UG1 A;  1FMV A;  3PMI A;  1YI2 Q;  3EGU A;  4EMK A;  4C92 G;  4M78 C;  2RMO A;  5AT1 B;  2YXY A;  3CME Q;  2CP3 A;  3L42 A;  1BBZ A;  2LT4 A;  4HVU A;  2KRS A;  4LDX A;  2H3E B;  2EFI A;  3CCS T;  1E6G A;  4M78 A;  3RUX A;  2YRD A;  4LDW A;  4LDY A;  4PJN A;  4J6X A;  5GAO l;  2CRE A;  1JO8 A;  2RJF A;  1K9M R;  3FRN A;  1NEB A;  3I56 A;  4AG2 C;  2DO3 A;  4C92 E;  3G6E T;  2V26 A;  3OS1 A;  2NWM A;  4E7Z A;  3QYG B;  1PRL C;  3OMG A;  1T0H A;  1RLP C;  5GAM j;  2LT1 A;  3MJX A;  2YDL A;  2M51 A;  2JTM A;  2QDY B;  1TG0 A;  2JW4 A;  1SSH A;  3BFM A;  5KYW A;  1RL2 A;  1WHK A;  1M4Z A;  5HK3 A;  2XDP A;  4JLG A;  3VYG A;  4M7A G;  4OP0 A;  2PUO B;  4OB3 B;  4C8Q D;  5LJ5 j;  5GAO p;  2X51 A;  3M55 A;  3SB2 A;  7AT1 B;  5HY6 A;  1ZUU A;  1ZSZ C;  4C8Q A;  3CCR Q;  4J6W A;  4AMC A;  2DLP A;  1FYN A;  2RHZ A;  1LOJ A;  2VC8 A;  6AT1 B;  4F7U A;  3AHU A;  2J7I A;  2FHD A;  2QYZ A;  3GP8 A;  1G3T A;  3CD6 A;  4XTX A;  1I81 A;  4LD9 K;  3QG1 A;  2LVM A;  2K6D A;  4OB1 B;  4C92 F;  3JB9 D;  1N8R U;  1QVF P;  2XIC A;  3EHQ A;  2H3J A;  3RNJ A;  3QZ5 B;  1YJW T;  5C6S A;  2ECZ A;  2BZX A;  8ATC B;  1H64 1;  2EVR A;  1NG2 A;  2JMA A;  4IUV A;  1MMA A;  3CPW A;  1I0C A;  3QII A;  3CC2 A;  4J7I A;  4GBQ A;  3I55 Q;  1Q7Y R;  2EQJ A;  3VYH B;  4XTY A;  3S3N A;  2RB6 A;  4OGC A;  2W0Z A;  3HRS A;  4RTX A;  4GLK A;  4FYX B;  4ESR A;  4QQG A;  3L2Z A;  2PNI A;  4A4F A;  2DNU A;  3HSB A;  4IUU A;  1VQO A;  1VQ5 A;  4A63 B;  3RER A;  5IHK A;  1NJI C;  4QKU A;  2YRC A;  4HKE A;  3I5R A;  2X4Y A;  4A4H A;  3OBW A;  4KH0 B;  2OI3 A;  4M7D C;  2P4T A;  1VQM A;  5GAN 7;  2EJG A;  2E3I A;  1SRM A;  3JCM V;  1PSE A;  4HCC A;  2VKN A;  1YIJ T;  4OML A;  1AWX A;  4FYY B;  2ZPI B;  3BDU A;  5HCK A;  5CKD A;  4DEX A;  4J9H A;  3CXC P;  2M0Y A;  3M0U A;  2DIQ A;  3L2R A;  2RQU A;  3J80 E;  5I2M A;  4LUE A;  3DKM A;  1GBR A;  1Y57 A;  2MI6 A;  5KCO A;  1FMK A;  1IZ6 A;  4FW2 A;  1G83 A;  3H41 A;  5LJ3 e;  3VUZ A;  2F1L A;  4D8D A;  4CI0 C;  4ZGE B;  5FW9 A;  3C94 A;  4FM4 B;  3JCM d;  3HRT A;  3ULR B;  3CME T;  4LUD A;  3LWI A;  3I56 Q;  4BAC A;  1M90 C;  2EQU A;  3Q1J A;  2EW3 A;  4ZGJ B;  3VS4 A;  2M16 A;  1QVF S;  2HZY A;  3QZ9 B;  4MMK A;  2DFU A;  2D8J A;  3S3M A;  4Z8A A;  2L89 A;  5LJ5 h;  2JJ9 A;  2HKN A;  4DEY A;  1TU0 B;  3VUB A;  1TUD A;  3EGD A;  2KGT A;  1VYV A;  3LX7 A;  2O88 A;  4J9F A;  3VS5 A;  1QLY A;  5GAM g;  4DQ2 A;  4BI4 A;  1LVK A;  3L2U A;  2J6F A;  2JS2 A;  4IUR A;  1FWZ A;  4QVZ A;  4J5Y A;  4JJC A;  3GLX A;  2L3R A;  2B8A A;  4OMO A;  1HK9 A;  3UDC A;  1KQS P;  3PVL A;  4J8O A;  4F04 B;  1WJQ A;  3MP6 A;  4EMG A;  1VQ6 A;  1W2B P;  2RJD A;  1JXO A;  3CCQ A;  3RDV A;  3CCR T;  1G3W A;  3CD6 Q;  1RAD B;  3EAE A;  3SWN B;  2V1R A;  3HFN A;  4ZTF A;  2KK4 A;  1KC8 R;  4M75 G;  3V7C A;  5GMK i;  3EG9 B;  3CCM A;  4BE2 A;  1N5Z A;  5A2Q E;  3UAT A;  1R8O B;  3CCL A;  5GAN 4;  2CP0 A;  2QDL A;  3FDR A;  4EPC A;  3E9G A;  2PTK A;  4KBM B;  1ARK A;  1NJI U;  5GAN h;  2P0P A;  3CXC S;  2CYZ B;  5GAO n;  1G5V A;  3X20 B;  1AWJ A;  3JCM J;  1ZUY A;  4BI8 B;  3CC2 Q;  2JVV A;  2ED0 A;  5D7U A;  1GFC A;  4X9C A;  4ZTJ A;  2JM9 A;  3R6O A;  1JQQ A;  1WGS A;  4PLI A;  1MUZ A;  1ZUK A;  1KIK A;  1D1B A;  4OMF B;  2HQX A;  1GCQ C;  3EG3 A;  1PKT A;  1Y96 B;  3I55 T;  3OSV A;  2HDA A;  5GJW B;  1VQO Q;  2B86 A;  4C8Q E;  1VQ5 Q;  4ZN3 A;  3VS1 A;  2RM4 A;  2EPD A;  4Y91 A;  5LJ3 j;  3VRZ A;  1QVG A;  2MOX A;  3OYJ A;  4NOY A;  1PSF A;  3V8K A;  4F7U E;  1NE8 A;  4BY6 C;  1TS9 A;  2KY9 A;  2A37 A;  1KQ2 A;  5M9O A;  1K76 A;  1ABQ A;  3TU4 K;  1UJ0 A;  2LRQ A;  2FYK A;  2DER A;  1VQM Q;  4KH1 B;  4M75 B;  4RTY A;  2FL7 A;  1K9A A;  1MNE A;  1OUL A;  2X4X A;  1WFW A;  3SHW A;  1R0C B;  1C6V X;  2CP2 A;  1LPL A;  5A0D A;  3G4S A;  3THK A;  4PJJ A;  9ATC B;  1PD1 A;  5CKF A;  1EFN A;  4JS5 A;  2AIR B;  2VUB A;  4C92 A;  3QO3 A; 
#chains in the Genus database with same CATH homology
 1WX6 A;  2JMC A;  4CC2 A;  2J06 A;  1X2K A;  2KYM A;  4HVW A;  1W6X A;  1JU5 C;  2CSI A;  2O9S A;  3I9Q A;  2HBW A;  4AFS C;  2LCS A;  2ROT A;  1MV3 A;  2A08 A;  2EYW A;  1K0S A;  2EGE A;  2O9V A;  3CQT A;  1W1F A;  2CUD A;  2FRY A;  2C0O A;  2CUB A;  1B3Q A;  2GTO A;  2LQN A;  2HCK A;  1M8M A;  1YP5 A;  1RI9 A;  4J9D A;  4J9I A;  2FO0 A;  1TUC A;  2AK5 A;  3EG0 A;  2V1Q A;  2D8H A;  5IXF A;  2YUQ A;  2AZV A;  1I07 A;  2EGA A;  2LJ0 A;  4LN2 A;  1WXT A;  2O31 A;  4RUG A;  5IHI A;  5IXB A;  2NUZ A;  1YCS B;  1V1C A;  1X2Q A;  2DL8 A;  4GLM A;  4RTU A;  1PHT A;  1HJD A;  2DVJ A;  1UHF A;  2RQW A;  4JZ3 A;  2PZ1 A;  1AWW A;  2KEA A;  2FEI A;  2G6F X;  1H92 A;  2CH4 A;  3EG2 A;  3H0F A;  1NEG A;  1BB9 A;  2DRM A;  4RTZ A;  2CT3 A;  1WIE A;  1QKX A;  2DBM A;  3QWY A;  2I0N A;  2MCN A;  4OMN A;  4ORZ A;  3FJ5 A;  1A0N B;  4J9B A;  1VYU A;  4X1V A;  1UG1 A;  4AFQ C;  1AD5 A;  1LCK A;  1UHC A;  3EGU A;  2EYY A;  3C0C A;  2RMO A;  2YUO A;  1ABO A;  3M0T A;  2FPF A;  2L3Q A;  1OV3 A;  2SEM A;  1WXU A;  1BBZ A;  1K1Z A;  4HVU A;  2KRS A;  1E6G A;  1UUE A;  2KRO A;  1Z9Q A;  1UE9 A;  2CRE A;  1OPL A;  1JO8 A;  1PWT A;  1NEB A;  2DBK A;  4AG2 C;  2K9G A;  5IH2 A;  2ENM A;  2BTT A;  4AFZ C;  2DA9 A;  2NWM A;  4KRT A;  4HVV A;  1QWF A;  2RPN A;  1PRL C;  1T0H A;  1RLP C;  2FPE A;  1WDX A;  2YDL A;  3RBB B;  2M51 A;  3REB B;  1SRL A;  2F2V A;  1TG0 A;  2JW4 A;  1SSH A;  2LQW A;  4RTT A;  2VWF A;  2EGC A;  1Z9Z A;  3I35 A;  2K3B A;  3SEM A;  1CSK A;  4OMP A;  2ROL A;  3NGP A;  1NM7 A;  2DL5 A;  1ZUU A;  2DF6 A;  2O2O A;  4RTW A;  1NLP C;  2KBT A;  1H8K A;  2LMJ A;  3EG1 A;  3M0P A;  1YNZ A;  1UEC A;  1UFF A;  2F2X A;  2RNA A;  2DLP A;  1FYN A;  3QWX X;  4WCI A;  2DE0 X;  4HCK A;  2J7I A;  1SEM A;  2EKH A;  2AKL A;  2DL3 A;  2K2M A;  2YT6 A;  2K6D A;  1OEB A;  2E5K A;  2EQI A;  2KNB B;  5IHN A;  4F16 A;  1T0J A;  5L23 A;  3EHQ A;  3RNJ A;  1K4U S;  4R0K A;  2RQR A;  2LP5 A;  2ECZ A;  1NLO C;  2BZX A;  1HD3 A;  4HXJ A;  5ECA A;  4AG1 C;  1E6H A;  2EVR A;  1H3H A;  1NG2 A;  1WXB A;  2DIL A;  2JMA A;  2X3X D;  3VS6 A;  1KJW A;  1M3C A;  1I0C A;  5FWC A;  1OPK A;  4AFU C;  3NPF A;  1T3L A;  4GBQ A;  1CKB A;  2DX1 A;  2W0Z A;  2CDT A;  4RTX A;  2EBP A;  4ESR A;  1UDL A;  1WLP B;  1B07 A;  2PNI A;  2DNU A;  3GBQ A;  2HEQ A;  2K7A A;  3ZL7 C;  1GFD A;  2W10 A;  4JJD A;  4A63 B;  1M3B A;  2FG0 A;  5IHK A;  3VS7 A;  1J3T A;  2HSP A;  1ZLM A;  2A28 A;  2YUP A;  2L2P A;  2OAW A;  3I5R A;  4ZNX A;  1PRM C;  3IQL A;  3UA6 A;  2VVK A;  4K11 A;  4J9C A;  2D1X A;  3VRY A;  1GBQ A;  4F14 A;  1WI7 A;  2ED1 A;  4LNP A;  3M0R A;  2DM1 A;  2OI3 A;  3M0Q A;  1UGV A;  4D8K A;  2IIM A;  1W70 A;  2DL4 A;  2JM8 A;  1SRM A;  1ZBJ A;  3PE0 A;  2LJ1 A;  1GCP A;  5I11 A;  3PVQ A;  2VKN A;  3M0S A;  1S1N A;  4OML A;  1AWX A;  5HCK A;  4JZ4 A;  2DMO A;  1HSQ A;  1G2B A;  3VS0 A;  4DEX A;  2GNC A;  4J9H A;  2M0Y A;  3M0U A;  2EYZ A;  4IIM A;  1M3A A;  2CH4 W;  2JTE A;  4CC4 B;  2XMF A;  2P4R A;  1GCQ A;  2RQU A;  1KSW A;  2GGR A;  2BZ8 A;  1U5S A;  3REA B;  1IO6 A;  4LUE A;  1RUW A;  4OMM A;  1GBR A;  1Y57 A;  2YSQ A;  1FMK A;  4FSS A;  4LE9 A;  2FRW A;  1G83 A;  3H41 A;  2KT1 A;  3R6N A;  4D8D A;  5FW9 A;  3VS3 A;  2DJQ A;  2C0I A;  2LJ3 A;  3EHR A;  3NHN A;  3ULR B;  4LUD A;  5FWB A;  2RN8 A;  3UA7 A;  2J6O A;  2FPD A;  2EW3 A;  3VS4 A;  1ZSG A;  2YUN A;  3VS2 A;  4CC7 A;  5EC7 A;  2C0T A;  2RF0 A;  2X3W D;  1JXM A;  2ABL A;  2D8J A;  2GQI A;  2KRN A;  4F17 A;  1QCF A;  4IIO A;  3UF4 A;  2JXB A;  4Z8A A;  2L3S A;  3H0H A;  3NMZ C;  4DEY A;  1OOT A;  1SPK A;  3TVT A;  1TUD A;  2GTJ A;  2KGT A;  1VYV A;  4JJB A;  1T3S A;  2O88 A;  1GRI A;  1QWE A;  4J9F A;  3VS5 A;  1QLY A;  2SRC A;  2K79 A;  3A98 A;  1AEY A;  4OMQ A;  1WA7 A;  5GJV B;  2EYX A;  2J6F A;  2JS2 A;  2CSQ A;  2KT8 A;  1CKA A;  4CC3 A;  4JJC A;  4OMO A;  1AOJ A;  1BU1 A;  2LX7 A;  1UTI A;  2JT4 A;  3PVL A;  2JS0 A;  1K0X A;  3TSW A;  3H0I A;  1Y0M A;  1JXO A;  2OJ2 A;  1XOV A;  2A36 A;  1YWP A;  2GBQ A;  1M27 C;  1AZG B;  2V1R A;  1RLQ C;  2D0N A;  3U23 A;  4RTV A;  2BZY A;  1UJY A;  1N5Z A;  1WYX A;  1QKW A;  2CT4 A;  1AZE A;  2DYB A;  2KXC A;  1BK2 A;  1X6G A;  3UAT A;  1YN8 A;  2L3P A;  1AWO A;  2J05 A;  2QDL A;  4QT7 A;  1SHG A;  1KFZ A;  2PTK A;  1ARK A;  1I1J A;  1M30 A;  1E7O A;  4Z88 A;  3TSZ A;  2F2W A;  2KR3 A;  1AWJ A;  1NYG A;  1ZUY A;  3I5S A;  1SHF A;  2ED0 A;  1GFC A;  1AVZ C;  2JM9 A;  1JQQ A;  1MUZ A;  1ZUK A;  1KIK A;  1GL5 A;  2AKK A;  1U06 A;  2ESW A;  2LNH B;  1MV0 B;  1JEG A;  1VA7 A;  1GCQ C;  3EG3 A;  1PKT A;  1YWO A;  4E6R A;  2HDA A;  5GJW B;  1PNJ A;  2B86 A;  1U3O A;  2RQT A;  2KYB A;  2KXD A;  3VS1 A;  1PKS A;  2EPD A;  1NYF A;  3VRZ A;  2MOX A;  3O5Z A;  4M4Z A;  2AZS A;  2RQV A;  2KRM A;  1X43 A;  4JPB W;  2KE9 A;  2A37 A;  5I22 A;  1X6B A;  1K76 A;  2L0A A;  1ABQ A;  3JV3 A;  1UJ0 A;  1X69 A;  3KFV A;  4Z89 A;  1X27 A;  4RTY A;  4EIK A;  2LZ6 B;  2J6K A;  1K9A A;  4Y92 A;  1WFW A;  3SHW A;  4J9E A;  4J9G A;  2H8H A;  1ZX6 A;  1VYT A;  3THK A;  2MIO A;  3LH5 A;  2DRK A;  1EFN A;  2DL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...