1PRMC

Two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
pubmed rcsb
source organism Gallus gallus
molecule tags Complex (signal transduction/peptide)
molecule keywords C-SRC TYROSINE KINASE SH3 DOMAIN
total genus 5
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1prmC00
2BTTA 1N5ZA 2V1QA 4HVVA 3EG2A 4KRTA 2F2WA 1SHGA 4RTWA 2K9GA 1H3HA 3CQTA 1UJ0A 5FWBA 1ZBJA 4AFSC 2X3WD 3VS7A 1W1FA 4AG2C 5HCKA 1VA7A 1MV0B 4J9IA 1WXUA 1WXTA 5IXFA 3FJ5A 1NG2A 1QKWA 4AFUC 3M0TA 2EYXA 4OMOA 2DILA 2EYYA 2KT1A 1KJWA 2FG0A 4JJCA 1EFNA 1NYGA 1ZUYA 2JS2A 4RTXA 3H0FA 2RQWA 1UJYA 4JJBA 2XMFA 3JV3A 3NGPA 5IHKA 2DYBA 2KROA 1X69A 5GJWB 1XOVA 1AWOA 1ZSGA 2HEQA 2JMAA 3H0IA 4ORZA 1MV3A 1M3CA 4HXJA 2F2XA 1X6GA 2DX1A 2LNHB 3U23A 1CKBA 1SPKA 2DLPA 2V1RA 1I0CA 3UF4A 3NMZC 2AKKA 1G2BA 1ABQA 3M0UA 5L23A 2EGCA 2LX7A 4RTYA 4M4ZA 4Y92A 2D0NA 2SEMA 2KNBB 3EHQA 1AEYA 1WDXA 2QDLA 1ZX6A 1OPLA 2CSQA 1K0XA 1QWFA 3ULRB 1RI9A 1PKSA 4J9HA 4RUGA 2DL8A 2L3SA 1PWTA 1NLPC 1OOTA 2DA9A 1WI7A 2I0NA 2JM9A 1AWXA 1M27C 4AFQC 1GCQA 1A0NB 3O5ZA 1KFZA 1VYUA 2CSIA 2K6DA 4LUEA 2DL5A 2JMCA 2J6FA 1WLPB 4J9FA 2J06A 1QCFA 2DBKA 2CH4W 2EYWA 2HSPA 2MOXA 1GL5A 1SRLA 1WA7A 3THKA 2KT8A 2YDLA 2FEIA 3H41A 2NWMA 1UHFA 2AK5A 1K1ZA 2OJ2A 4HVWA 1NEGA 2FPFA 3M0QA 5EC7A 3RNJA 2J05A 2KRSA 1AZGB 2J6OA 2CUBA 1W6XA 3VS0A 1BU1A 1QWEA 1JO8A 3NHNA 1UTIA 1VYTA 1M30A 3M0SA 2RMOA 2EGEA 2SRCA 2RN8A 2GTOA 2J7IA 2YUQA 1GCPA 1QLYA 2JTEA 4OMLA 1FMKA 3UA7A 5IHIA 2ABLA 1HSQA 1BB9A 2JW4A 1G83A 3C0CA 2DE0X 3EGUA 2AZSA 2RQVA 1J3TA 1JU5C 2BZ8A 1JXMA 1TUDA 1NYFA 2ESWA 2LJ0A 1JQQA 4RTTA 1NLOC 2FPEA 4E6RA 2PZ1A 1E6HA 1AZEA 4J9EA 1UDLA 2JT4A 4JZ4A 1Y57A 3M0RA 3PVLA 4D8DA 1GBRA 1H8KA 1H92A 1RLPC 1SRMA 2EQIA 1YWOA 1K0SA 2CT3A 3I35A 1Z9ZA 4JZ3A 2G6FX 1K76A 1PNJA 1WYXA 1AD5A 3M0PA 2RNAA 2GBQA 4F16A 1WFWA 4EIKA 1U3OA 1YN8A 3REBB 1IO6A 2DVJA 1BBZA 2EW3A 4DEXA 2D1XA 3PVQA 4JPBW 5I11A 1ZLMA 2BZYA 1MUZA 3EHRA 2RQUA 1SSHA 1NEBA 4J9DA 1PKTA 4A63B 2RF0A 1GFDA 1B07A 1M3AA 2ECZA 2AZVA 5IH2A 3H0HA 2NUZA 5FWCA 2RPNA 2DL7A 1SHFA 1WX6A 2E5KA 3VS5A 2A08A 2FRWA 5IXBA 1HD3A 1W70A 2LMJA 4J9CA 3VS6A 3R6NA 2VVKA 2O88A 2C0OA 4OMPA 2CT4A 3NPFA 2W0ZA 2DF6A 2GGRA 2CH4A 2A28A 2IIMA 1SEMA 2ED0A 2ED1A 1S1NA 5FW9A 5ECAA 3VRYA 1YNZA 1AVZC 2EYZA 1T0JA 1AOJA 1PRMC 2JM8A 1WXBA 2HBWA 1M8MA 4HVUA 4CC4B 1M3BA 2AKLA 1QKXA 2LJ3A 2F2VA 2GQIA 4ESRA 2DNUA 4RTZA 4GLMA 1T3SA 1X27A 2L0AA 2VWFA 2KGTA 3GBQA 3I5SA 5IHNA 3TSZA 2MIOA 2YSQA 4X1VA 2L2PA 2DBMA 1U5SA 2J6KA 2ENMA 1NM7A 1TUCA 1ZUUA 2C0TA 3UA6A 1RUWA 1OPKA 4QT7A 2KEAA 2KR3A 2JS0A 2KE9A 2FO0A 4LE9A 4WCIA 4HCKA 2GNCA 3I9QA 4LN2A 3VS1A 1Z9QA 2HDAA 1LCKA 2OI3A 3EG3A 3TSWA 2O9VA 2JXBA 2X3XD 4F14A 2LJ1A 2EBPA 2LP5A 2D8HA 4D8KA 4AG1C 2KRMA 2KBTA 3RBBB 2C0IA 1X43A 4GBQA 1UGVA 3PE0A 1T0HA 1GFCA 4Z88A 1GCQC 1T3LA 2DJQA 3SEMA 4AFZC 1K4US 2O9SA 2P4RA 3EG1A 2OAWA 2O2OA 1BK2A 1UFFA 1X2QA 4JJDA 2YUPA 4CC3A 1I1JA 4Z89A 3A98A 3TVTA 2K79A 1YWPA 2LQWA 2LQNA 1ARKA 3EG0A 2KYMA 1UE9A 2DM1A 2ROTA 3VS4A 2A36A 1PRLC 2PTKA 2EPDA 4FSSA 1U06A 4LNPA 3ZL7C 1UG1A 4IIOA 1JXOA 1OEBA 2CDTA 2CREA 3UATA 1PHTA 4LUDA 3QWYA 2BZXA 2VKNA 2KYBA 1UECA 2EGAA 1OV3A 3SHWA 2M0YA 2LZ6B 1VYVA 2RQTA 2DMOA 2B86A 3IQLA 2O31A 5GJVB 4R0KA 2MCNA 4ZNXA 4RTVA 2ROLA 2A37A 4IIMA 2W10A 3REAB 2DRMA 4OMNA 1E6GA 2KXCA 2YT6A 2KRNA 5I22A 1UUEA 2DRKA 4K11A 4CC7A 3QWXX 1YCSB 2HCKA 1YP5A 2FRYA 1FYNA 1AWJA 1CKAA 3I5RA 1B3QA 4CC2A 3KFVA 2FPDA 4Z8AA 1KSWA 1CSKA 1I07A 1KIKA 4OMMA 1X2KA 1WIEA 3VRZA 1V1CA 4OMQA 4RTUA 2H8HA 2LCSA 2YUOA 2DL4A 2M51A 2EVRA 1X6BA 1ZUKA 1TG0A 2EKHA 4J9GA 1RLQC 1E7OA 3VS2A 1ABOA 2GTJA 1JEGA 4J9BA 2KXDA 1GRIA 1K9AA 2K2MA 2CUDA 2D8JA 1HJDA 1Y0MA 3LH5A 2PNIA 2YUNA 4DEYA 4F17A 1UHCA 2RQRA 2K7AA 3VS3A 1AWWA 2DL3A 2K3BA 1GBQA 2L3QA 2L3PA
chains in the Genus database with same CATH superfamily
2BTTA 3A8MB 1U1SA 4OMFB 2F2WA 2K9GA 2QXFA 2YRVA 3HRTA 3GNGA 1ZBJA 4AFSC 1RL2A 4OGCA 4MZTA 5DM7R 3G6EQ 1NJIR 4QQ6A 4JJNK 4JLGA 3I56A 4RG2A 1M4ZA 4LDVA 1KC8R 5GMKi 2EYXA 2DIQA 3I55Q 2EYYA 3FIFA 1PD0A 3L2WA 2FG0A 1EFNA 4RTXA 3H0FA 1Q86R 4JJBA 1VQ6T 2XMFA 4M77F 5IHKA 2DYBA 2KROA 1G3WA 2E1HA 2P0QA 2QA4A 1XOVA 1AWOA 1Y71A 2JMAA 2KY9A 3CEYA 3GNFB 4ORZA 1M3CA 3QJYA 1X6GA 5GAMh 2DX1A 2LNHB 1CKBA 3V7SA 2D6FA 3A8GB 3VV0A 1G2BA 1TWBA 5LJ3f 4J83A 4M77E 2LX7A 1VQKA 1QMCA 3CCUQ 4CRIA 4Y92A 4M78D 4ELYC 2RJDA 5CKHA 3LW5E 1K0XA 2RK2A 1PKSA 2KQWA 4LDUA 2XDDA 4LDXA 3VYHB 1WI7A 4ZTJA 2DIGA 2I2LA 1YITT 1AWXA 1WHHA 1QVGP 1OX9A 3EH2A 2CSIA 1KFZA 2K6DA 4JRPA 3DB4A 1UB4A 2DL5A 4BDZA 4PFPA 3ME9A 1WLPB 2LQ8A 2RB6A 2EQKA 4J9FA 2J06A 3UT1A 3LGFA 5J39A 5FU6B 3QBYA 2DBKA 3JCMJ 3CXCP 2CH4W 3CD6T 2JVVA 2MOXA 1UGPB 2ZPEB 5GAN5 1TS9A 2M02A 2YDLA 2EJ9A 3G1JA 3X28B 2NWMA 3SWNC 4C5IA 3CC2A 3CCLQ 2OJ2A 1O75A 4HVWA 1NEGA 3OS5A 2FPFA 1NE8A 2J05A 4M75G 2KRSA 2PU9B 3C12A 2K5LA 2MWPA 3LYIA 3CCVT 1JO8A 1QWEA 3PTAA 3NHNA 2CGHA 5KCHA 3CCQQ 2RN8A 1VQ9A 2ZPGB 2LTOA 4OMLA 1FMKA 3EGXA 4BDYA 3UDCA 1M1GA 4RKUE 1YHQQ 2JW4A 1BB9A 4IUQA 3C0CA 5KYYA 2AZSA 2RQVA 1R77A 2YWWA 1JU5C 2EAYA 5EG2A 3CCEQ 1EZZB 2LJ0A 3BY7A 3J7AF 3SFMA 2DD4A 1WJRA 2EKOA 1NLOC 2FPEA 4E6RA 2O4XA 1Q81C 2JT4A 1WZOA 5CKBA 1IB8A 2QQSA 3M0RA 4D8DA 2PVDB 2ZAEA 1QQJA 1WNLA 1EX4A 4D6WA 1VQOQ 1X6OA 4M78B 2RK1A 1K0SA 3QDFA 3SDZA 3G7ZA 3SB2A 1Z9ZA 1KQ2A 1UGSB 1ZBXA 1K76A 3A1PA 1IHVA 4F16A 1WFWA 5J3BA 3EG9B 2DO3A 1U3OA 4E7LA 1IO6A 1BBZA 2EW3A 1RADB 3PVQA 1MUZA 3EHRA 1JJ2S 5GAMf 4C5HA 1PKTA 2GQVA 2EWNA 1M3AA 2ECZA 2VYTA 2XG8D 1XJWB 1WPYA 4ZN1A 2F5KA 2NUZA 2HKQB 1B34A 4J6XA 2RA2A 1SHFA 5LJ3h 4C8QF 3OS1A 2E5KA 1RAHB 1JJ2A 4N4HA 2VVKA 1RAGB 2A7YA 4RCBA 2CT4A 3NPFA 2W0ZA 4ME7A 2F69A 2GGRA 1VQ6Q 3DB3A 2M16A 1VQPQ 2A28A 4Q5WA 2IIMA 4M77C 3M59A 3L2ZA 3HL8A 3CC2Q 5M9OA 1S1NA 2OTJA 1OZ2A 2KK4A 2LT1A 4JRIA 2EYZA 1T0JA 1PRMC 2HBWA 3A8LB 2DKGA 4HVUA 2Y4YA 4O6JA 2X4XA 1VUBA 3NFCA 2FL7A 1Q7YR 1QKXA 2HBPA 1SG5A 2DEUA 2F2VA 4KGXB 1T3SA 2L0AA 4HCZA 3VUBA 2QGGA 1D3BB 2KGTA 5IHNA 3I5SA 5KCOA 3QXEB 5LJ5e 5FU7C 4M7DG 2WSFE 2CZ1B 3TCJA 5GANe 4WTOB 4C92D 2V8IA 1TUCA 5KYXA 1KQSP 1RUWA 3NTKA 4IUPA 2IG0A 4FL6A 1IREB 2YRDA 4PK4A 3JCMe 1BIAA 1C0MA 4LN2A 3VS1A 1RABB 4C0GA 3M57A 2OI3A 2XD0A 3DLMA 2DXCA 1BKBA 2DXTA 4F14A 2LJ1A 1ZA1B 2RHUA 4E7KA 2D8HA 5I2MA 4D8KA 3HTRA 2DAQA 2DTIA 1OX8A 3RBBB 4FSXA 2NUTA 2C0IA 1X43A 3INZA 1Y96A 4GBQA 3QO3A 3CCVA 2RO0A 3HPWA 2EQMA 1T3LA 4DBRA 1MHNA 1OQKA 2GFAA 2ZPHB 3OSSC 4M78E 2O2OA 1M1KC 2HQXA 4CC3A 3RERA 2K5FA 1YJ9Q 1K9MR 2DXBA 4OB0B 2VUBA 2K2VA 3X24B 4BY6B 2MMPA 5GANd 2KYMA 3RR6A 3VS4A 2FVUA 3MO8A 2EPDA 4FSSA 3MPUB 4LNPA 3L2RA 1IHWA 1JXOA 2CREA 1N9RA 2VXEA 3CXCS 1VQOT 4LUDA 2LRQA 4C0DB 3PT9A 1KG1A 4BI3A 1UECA 1OV3A 2V8KA 1YI2Q 4LD6A 2M0YA 2LZ6B 4M75F 5GAN3 2B86A 5GJVB 4R0KA 1QVGS 4M7AD 4RTVA 4M7DF 4OB1B 3CCUA 4Z02A 3L2VA 1UUEA 5KYYB 1K73C 1MNEA 3GF5A 2KSSA 2KI7A 1FYNA 3E19A 2DFUA 3I5RA 1OYXA 3KXTA 4Z8AA 1KD1C 1YHQT 2O4XB 1I81A 2QEXQ 4ATOA 4M7AF 1SKUB 1WIEA 4RTUA 2CZ7B 2H8HA 2LCLA 1N8RC 2XICA 1WHMA 3JCMc 2EVRA 3V8LA 3OS0A 1ZUKA 4E47A 4J9GA 3GOXA 3VS2A 1JEGA 1MMNA 2XHCA 1BCOA 1KHIA 1RAFB 1G8XA 3G6ET 2K3YA 3VKIA 4CI0C 3EG9A 5I2SA 2JNGA 4DEYA 2L3RA 4F17A 2LDMA 1M9SA 3MJXA 2RHZA 2E41A 4B6MA 3OYBA 2QQBA 2PUKB 2V1QA 4HVVA 4PJOE 1QVFA 2L89A 4PJMA 3CMEQ 4RTWA 2A3LA 3JSCA 1PD1A 1M5Q1 5FU7B 1UJ0A 4C8QG 2LNVA 3LLRA 1FX7A 1U1TA 2DD5A 4FYXB 3VS7A 1W1FA 3P8DA 1WGSA 5HCKA 4J9IA 4MZPA 4F7UA 1WXTA 1NG2A 4OMOA 2V26A 1HYOA 1PC0A 3FB9A 3JB9D 1YJ9T 2DEQA 2P84A 3JCMV 8AT1B 4HCCA 1MV3A 4L6V5 1KC8C 4J7IA 1SPKA 1I0CA 3QZ5B 1YJNQ 1Y07A 1RAEB 4DOVA 2AKKA 3TU4K 5GANj 2R5AA 2COWA 4E7SA 3CCQA 3M0UA 5L23A 2EGCA 2SEMA 3CMET 1NJIU 2PVGB 3JB9F 3EHQA 2M9UA 4XTZA 4BE1A 4M78C 4OGEA 1VQMT 2MWOA 3HP9A 4XU2A 2L5QA 2HD0A 2L3SA 1PWTA 1OOTA 2DA9A 2EJGA 2QQAA 4DQ2A 4BE2A 1QVFP 1LPLA 5KYXB 4E7JA 5GAOl 3JCMd 5KH6A 1GCQA 1A0NB 1WQ7A 3O5ZA 3JCMP 1VYUA 3CC7A 4LUEA 3GPLA 1ACMB 3SWNB 4PJOG 2J6FA 3I56Q 1D0ZA 2ZGWA 2EFIA 2P0KA 2COYA 2HSPA 1HK9A 3CMAA 4PJOC 1TSFA 5LJ5d 1K8AU 4RG8A 4EMGA 1OU8A 1MMAA 4BI4A 4ZTFA 2KT8A 4E2FB 2Z0WA 3QG1A 4KUDK 1QCNA 3H41A 4XU1A 2D9TA 4QVCA 3M9QA 1ZSZB 1AZGB 2X4WA 2CUBA 3OSVA 2QG9B 4KH1B 3MEWA 3N5BB 1VQ5A 3KBGA 2JTMA 2EGEA 2SRCA 1Q81U 1LJOA 1YI2T 4AMCA 2J7IA 1VQ8T 2YUQA 4J5YA 1GCPA 2JTEA 2QK0A 4HKEA 3UA7A 5IHIA 1XNIA 4OVAA 1HSQA 1KQ1A 1G83A 1UGRB 2WSCE 2DERA 1I5OB 2XDBA 1VQ6A 4N4IA 3M54A 3JB9G 2YLCA 1K9MU 3MEVA 1QVFS 1JQQA 1I4K1 2QA4Q 5FROA 3QIIA 3WVDB 4KH0B 4J9EA 1BI1A 1Y57A 1JRIA 4PLIA 1H92A 4FW2A 4JS4A 4C92E 5KYUB 1SRMA 1VQKQ 4JZ3A 1Q81R 3QDRB 4M77G 2LCCA 1MMDA 2Y90A 2GBQA 1VOMA 2R57A 2QQRA 1YN8A 3REBB 2DVJA 2D1XA 4JPBW 4KGVB 1ZLMA 1M90U 4IUUA 2L8DA 5A2QE 2DZCA 3QUIA 1KQSA 2AZVA 3TEEA 3H0HA 4JS5A 2RPNA 2DL7A 4J6YA 1BI2A 2HAXA 3BDLA 1VQ5Q 2RJFA 3M58A 2A08A 2FRWA 3PIPA 5IXBA 4JUVA 2FYKA 2O88A 3V7RA 2C0OA 5CKFA 5IAYA 2DF6A 1JBMA 1UGQB 2NUPA 5D6XA 2FHDA 1Q82C 2R58A 2ED0A 4EMKA 2ED1A 2X9HA 3HFOA 3CCVQ 3MKDA 5GAOn 1VQ4A 3G71A 1V76A 2EQUA 2P4TA 5C6SA 1WXBA 1BI3A 3CCLT 2RHIA 4F7UB 1VQ7T 2JUFA 4CC4B 2EJFA 4ZGJB 1M3BA 5A0DA 2CP6A 5KYWB 3M4YA 1BI0A 1YIJT 2K57A 3OYJA 2OTLA 2GQIA 1OI1A 2DNUA 4F7UE 4XU3A 1X27A 5LJ5j 1XTDA 3GIBA 2VWFA 4XU0A 3CPWP 5CKDA 3GBQA 5HK0A 2MIOA 3S6WA 2JJ9A 4PFOA 3CD6A 5LJ5h 5CVIA 2DBMA 4A54A 4FT2A 4II1A 1ZUUA 4C92C 3JCMg 3OYGA 2WACA 3META 1RI0A 4XTWA 2VB6A 4IKFA 3I9QA 4X9CA 1Z9QA 3V8KA 1ZA2B 3RKYA 2JXBA 2LX9A 2CP0A 2NYSA 2EBPA 2LP5A 2KBTA 3HRUA 3V8JA 1PSEA 3OYEA 3DLLA 1M90C 1UGVA 1SSFA 5D7UA 4QQGA 3MP6A 4Z88A 1VQ4Q 3G71Q 5GAOr 4L59A 4PJOD 3SD4A 1W2BA 4JJDA 3CPFA 3TVTA 1PSFA 2EIFA 3MEAA 5IN1A 3CCMA 2OTLQ 2LQNA 1ARKA 3EGDB 3P8BB 1UE9A 2ROTA 2QA4T 4R55A 4XTVA 5GAMe 1NPRA 2PTKA 4MMLA 2QI2A 6AT1B 1RAIB 1U06A 1N6AA 2CDTA 3F70A 3UATA 3OA6A 3QWYA 2VKNA 2AIRB 2EGAA 3WXMB 3SHWA 2RQTA 1VYVA 4QKUA 5GMKj 5HKCA 4MMKA 2YLBA 4EDUA 4X34A 1ZSZC 2O31A 4MZMA 3P8HA 3REAB 4E7IA 2BE7D 1K8AC 2KXCA 5I22A 3C4SA 4CC7A 5GMKl 4C8QB 1YCSB 3JB9J 1D0YA 2HCKA 5D6YA 2FRYA 1AWJA 2XI9A 2LC4A 1V1CA 4OMQA 2WSEE 3QZ9B 1K73R 2HSEB 3CC7Q 2QASA 4B9XA 1TG0A 1MGQA 1RLQC 4UC4A 2YXYA 4J9BA 2K2MA 1OULA 2D8JA 7AT1B 2RQRA 4ZN3A 3HKSA 5KYNA 3VS3A 4M7AA 2K3BA 2F5TX 2L3QA 2E65A 3CC2T 1YJWA 4B9WA 3M55A 2XK0A 1Q95G 1SHGA 1H3HA 2BUDA 2M0OA 4PNOA 2FZGB 3CQTA 2FB7A 5FWBA 4M77A 2X3WD 4DBQA 2E70A 4AG2C 2XKOC 1VA7A 5FU6C 3T9NA 1YJNT 1NZ9A 1YJWT 1WXUA 5IXFA 1QCOA 1F1BB 3FJ5A 1QKWA 4AFUC 3O8VA 5L8RE 1OU9A 4PKCC 3M0TA 2DILA 3OS2A 5CR2A 1KJWA 3CCST 4JJCA 2JS2A 4M7DC 2NUPB 2RQWA 1UJYA 3CC4Q 3D7SB 1TUGB 3JCMX 3PIOA 1NJIC 4Y28E 5GJWB 4EMKB 2KAFA 1KQSS 5LJ3d 3JB9H 2HEQA 1W2BS 3R6OA 4KUIA 4C0FA 1YI2A 3CCMT 2DLPA 3L42A 1Q86C 2VXFA 3EFRA 1G3YA 3FLGA 2EQJA 5KYWA 4RTYA 5CKEA 1WJQA 2KNBB 1AEYA 2QDLA 2PUOB 3RMSA 4JRKA 4X9DA 3URGA 2K5IA 2CKKA 5LJ3e 1QWFA 1R0BG 3ULRB 1RI9A 4PL6A 4RUGA 2RD1A 1Q7YU 1NLPC 1ZQ1A 3HSBA 2FZKB 2VASA 2I0NA 2DJZA 2JM9A 5FRMA 2IPOB 1W2BP 1N27A 2HMAA 3OW2A 4QQDA 1LVKA 3PFSA 4JLIA 4DBHA 3I56T 4C8QE 3OYYA 4QVDA 1D1BA 1M2VB 4BB7A 3CCSQ 1IRXA 1SRLA 1WA7A 3THKA 5GAN7 2QTXA 3OYMA 4A4HA 4PJLA 1VQPA 5CIUA 4M7DB 2RHXA 1XQHA 1VQNT 5LJ3j 1UHFA 2OTJQ 3FEOA 3M0QA 3MEUA 2D0QB 1W6XA 3C94A 1BU1A 3TQ7P 2CP5A 4PJNA 2HZYA 1VYTA 1M30A 3G6EA 1PM3A 1JJ2P 3J80E 2JZ2A 1VQ4T 2YHTA 5D6WA 3CCRQ 1I8FA 3EGUA 4EMKC 3JCMh 3VYGA 1JXMA 1NYFA 2X51A 2K3XA 2KVQG 4DA4A 3M5AA 1AZEA 2RJEA 1UDLA 2FZCB 1IZ6A 4JZ4A 8ATCB 4KULA 3PVLA 5DLQE 1RLPC 3CCUT 4BD3A 1Q86U 2EQIA 1YWOA 2CT3A 4XAXB 3I35A 2MK5A 2G6FX 4NS5A 2A0FB 3OYLA 1BCMA 1EIFA 1PNJA 4RCCA 4C8QA 2DETA 3HHTB 3OW2S 2MF2A 4DEXA 5I11A 4LD9K 3QYGB 4C8QC 4NL3A 1V29B 2PVOB 4A63B 2RF0A 1GFDA 4JDSA 4A4KA 3G4ST 5IH2A 3JRZA 1KC8U 5FWCA 1WX6A 1VQLA 4HCBA 4M7AG 4R56A 3QPHA 1HD3A 3FJPA 1W70A 2GFUA 4C5EA 4J9CA 3MCAB 3VS6A 3R6NA 3CCRA 1VQ7Q 5FRNA 3M4GA 4OMPA 1WJSA 4M75D 2R5MA 3A8OB 1AHJB 3EH1A 2XDPA 3V7CA 1ZHIA 4EMHA 1YBYA 2QQ9A 5I21A 2G3RA 2LT4A 1SEMA 3LGLA 3OB9A 1VQLT 4M7AE 1TH7A 1M2OA 3VUZA 3EGXB 1YITQ 1YNZA 5A0LA 1YFNA 1AOJA 4V2SA 2JM8A 2CYZB 3G4SA 1U8RA 4ANJA 1Q82R 3E2UA 3HFNA 1M8MA 5GANg 2X35A 2JTFA 3CCMQ 2LJ3A 5LJ5f 4C92B 1QVGA 4ESRA 4GLMA 4M7DE 4BUGA 5GANf 3CCJQ 2AT1B 2OAUA 2YSQA 5LL6S 3CPWS 3BW1A 3L1AA 1VIFA 4M78A 2QEXA 1LNXA 1WHKA 3JCMf 3FRNA 2DVEA 1U5SA 1B7TA 3S3MA 2J6KA 1G3SA 2ENMA 1NM7A 3BDUA 2MI6A 3M56A 1S72T 1VQLQ 3UA6A 1OPKA 2O01E 4QT7A 2KEAA 4XQ3A 1O9SA 2KE9A 4LE9A 1D0XA 3E1SA 4HCKA 3OYNA 1VQ7A 1LCKA 1X01A 3OY9A 3NTIA 3JB9I 3RIRA 2O9VA 4J6WA 4HA8A 2X3XD 3X20B 1M1KR 4O5VA 1MMGA 2CS7A 1K9MC 4KT0E 1D1CA 4WF2A 4MDXA 1T0HA 1GFCA 4AFZC 2DJQA 4FW1A 1KD1U 1K4US 1N9SA 1SF9A 3G4SQ 1UFFA 1S72A 2E5QA 1I1JA 3PNWC 2RHYA 3A98A 4XTUA 4HT8A 2K79A 1D1AA 4E7ZA 1M2VA 4JRQA 1YWPA 3EG0A 4MDWA 3HRSA 3EFSA 4ELZC 3I55A 2E6NA 5A0GA 1PCXA 2A36A 3EFOB 4M7DA 2DXUA 4C92F 1UG1A 4IIOA 1OEBA 1I5LA 2YRCA 3OYKA 2EYQA 4C0DC 4F7UG 2OTLT 3X26B 2BZXA 3OBWA 2KYBA 1QP3A 4PJJA 3KUFA 2DMOA 5GAN8 2COZA 1BIBA 2QAZA 3IQLA 4ZNXA 2ROLA 3H8ZA 2E12A 3G71T 1D3BA 1KD1R 4OMNA 4A53A 2YT6A 4OB3B 2DRKA 2E3HA 3QWXX 5CO7A 3QKJA 4KBMB 4IUVA 1C6VX 1CKAA 1VQKT 4CC2A 1KK7A 1KSWA 2DPPB 1I07A 4GLKA 3CBOA 4BI8B 1K8AR 4M77D 2YUOA 1M1FA 2EKHA 2ZPBB 1FWZA 1E7OA 4M7DD 1ABOA 1YJ9A 1K9AA 2NUTB 2CUDA 5GAMj 4BY6C 1Y0MA 1Y96B 2PNIA 3CMAQ 9ATCB 1N8RR 3CCSA 2LQKA 3H9NA 3SWNA 2K7AA 3ASKA 1TXQA 4VUBA 3C95A 1GBQA 3L2UA 3UPUA 1N5ZA 1GXIE 3EG2A 4KRTA 4M75E 1D09B 2ZPFB 4OF1A 3ZBDA 1AT1B 2E3IA 4FIBA 3OBYA 4M75B 2CP7A 1K73U 4M78G 1MV0B 3J81E 2HL5C 1P92A 1ZSZA 3AT1B 3UWNA 2RJCA 3A8HB 1W4SA 2KT1A 4M7AC 1ZUYA 1NYGA 1N8RU 3NGPA 3JV3A 1HXDA 4KGZB 1X69A 4GY5A 4N4GA 3LH0A 3PMTA 5GAMd 2E6ZA 1ZSGA 3H0IA 4HXJA 2F2XA 1H3ZA 2AHJB 3U23A 2V1RA 3ZFJA 4E7HA 3UF4A 3LWIA 1VQ5T 2BIVA 3NMZC 2LVMA 3MHXA 3X25B 1ABQA 3NTHA 4PFZA 4M4ZA 4C92A 3GLXA 3TREA 3OYHA 2D0NA 3VJPA 5LJ3g 1VQMQ 1WDXA 2NLUA 2HL3A 3RDVA 1G3TA 1ZX6A 1OPLA 3OQ5A 2CSQA 1VQPT 3QYHB 5KYUA 3CCEA 2MPXC 1YJWQ 1H641 4J9HA 2CP2A 2DL8A 3OYCA 3RMQA 1NBEB 2MAMA 2RH2A 3QHSA 4TVRA 3GP8A 1IGUA 5GAOm 4AFQC 1M27C 4LDWA 1OZ3A 3CBPA 2JMCA 4C0ZA 1VQOA 2BE9B 1QCFA 3BFMA 1Q82U 4DBFA 1LOJA 1RACB 1X75C 2EYWA 1KHCA 5GAMg 1GL5A 4QVZA 3CC4A 1NPPA 4A4GA 4PJOA 2FEIA 5CAIA 3A5ZB 2AK5A 1K1ZA 3CMEA 4LXCA 5EC7A 3RNJA 3JAME 4RMOA 3S3OA 2J6OA 3VS0A 3JCMb 4FM4B 2C06A 3Q1JA 1UTIA 1M8VA 2E64A 3M0SA 2RMOA 2HNIA 3VU3C 2GTOA 1TU0B 4C8QD 1QLYA 3RUXA 1IXDA 2ZPIB 2OTJT 2ABLA 4FCYA 3RKXA 5FLXE 5AYFA 5KE2A 3CCJA 2CZ0B 3EFOA 3QJ6A 2DE0X 1QP2A 1J3TA 2JOYA 2E4HA 2BZ8A 3OMGA 1TUDA 2CP3A 2ESWA 4F7UF 3MP1A 2K4YA 4RTTA 4YTLA 2PZ1A 1PG5B 1E6HA 3OW2P 5GAN6 2DTHA 1GBRA 2VGMA 3ER0A 1H8KA 3E9GA 2QEXT 1YIJQ 4XTYA 4AT1B 5IT9E 1WYXA 3M0PA 1AD5A 3OYIA 2RNAA 1RAAB 1Y7XA 4EIKA 4BACA 3CBMA 3LX7A 2BZYA 1IGQA 4L5GA 2RQUA 3S3NA 1SSHA 5CCAA 1NEBA 4J9DA 5AT1B 2Y4XA 1B07A 3CCLA 1R0CB 1WHGA 4M78F 5CQYA 2GF7A 2DTOA 2ZCFB 3VS5A 1S72Q 4FT4A 2QTVA 3PGGA 1FMVA 2RI2A 3PMIA 1C1AA 4EPCA 2LMJA 3LWHA 4N0AC 4IURA 1YHQA 3OYDA 3RKWA 2QGFB 3CCRT 2HKNA 2CH4A 4M75C 4QW2A 2VC8A 1VIEA 4FU6A 1WHJA 2PQWA 1YCYA 4XK8E 1Q7YC 3EGDA 5FW9A 5ECAA 3VRYA 3OYAA 2QYZA 1AVZC 2DK3A 1VQ9T 3OMCA 4M75A 4PLLA 2X4JA 1VQ9Q 1VQNQ 4PJOF 2AKLA 1FXXA 4Y91A 3H6ZA 5KE3A 3FDRA 5C0MA 2H3JA 5GANh 2V8JA 4RTZA 4IUTA 4DOWA 2H3EB 2HQHA 5GMKh 1MNDA 3RESA 3TSZA 2B8AA 4X1VA 3I55T 2L2PA 2QDYB 3JCMQ 5CQXA 3AHUA 4OB2B 5GAN4 5GAOp 4P5NA 2C0TA 2XU8A 1DJ7B 3CC7T 1YIJA 2KR3A 2JS0A 4WCIA 2FO0A 3MP8A 2OX7A 2GNCA 4C92G 2GCXA 2HDAA 4FYVB 5J26A 3EG3A 2DZ9A 4OP0A 3TSWA 4XTXA 2RM4A 3CCET 4AG1C 1VQ8A 2KRMA 3QSUA 4NOYA 3CPWA 3CXCA 2DYIA 3EAEA 3PE0A 1FMWA 1QVPA 4N0AA 1GCQC 3SEMA 2O9SA 2P4RA 4M7AB 3EG1A 4NL2A 2OAWA 5GAOq 3CCQT 2KMTA 1BK2A 1X2QA 2YUPA 2VV5A 4FYYB 1VQNA 4Z89A 4ZGDB 3E9FA 4C5GA 1TOVA 2LQWA 3CC4T 1M90R 4J7FA 3BE3A 1R8OB 4M77B 2DM1A 5HY6A 3DKMA 3CMAT 1PRLC 4BE0A 4PJOB 5LJ5g 3JCMW 3ZL7C 5GAN2 2BKDN 2VGNA 1M1KU 2RI3A 3CD6Q 1WHLA 1PHTA 2RI5A 1TTHB 4LDYA 5CK9A 1YITA 5HK3A 2HQEA 2M1HA 4A4EA 5GMKm 3L2QA 1YJNA 2MCNA 1QW1A 2ZZDA 4FYWB 4A4FA 2A37A 4IIMA 2W10A 3M53A 2DRMA 2P0PA 1E6GA 2F1LA 3OYFA 2KRNA 1VQMA 4K11A 1JB0E 1UEBA 1YP5A 1VQ8Q 1B3QA 3KFVA 2FPDA 2ATCB 2X4YA 2JN0A 1CSKA 5DY9A 1KIKA 4OMMA 1X2KA 3VRZA 2CZ6B 2KDSA 2LCSA 2IVWA 5DLOA 2MYSA 2DL4A 1WQWA 2E10A 2M51A 4ZGEB 1G5VA 3CCJT 5GMKe 1B34B 1X6BA 4J8OA 3FC3A 2GTJA 2KXDA 2XIDA 1GRIA 3ZEHA 1HJDA 3WVEB 3LH5A 2YUNA 4HT9A 4F04B 1UHCA 1AWWA 2DL3A 1BYMA 2L3PA
chains in the Genus database with same CATH topology
2BTTA 1N5ZA 2V1QA 4HVVA 3EG2A 4KRTA 2F2WA 1SHGA 4RTWA 2K9GA 1H3HA 3CQTA 1UJ0A 5FWBA 1ZBJA 4AFSC 2X3WD 3VS7A 1W1FA 4AG2C 5HCKA 1VA7A 1MV0B 4J9IA 1WXUA 1WXTA 5IXFA 3FJ5A 1NG2A 1QKWA 4AFUC 3M0TA 2EYXA 4OMOA 2DILA 2EYYA 2KT1A 1KJWA 2FG0A 4JJCA 1EFNA 1NYGA 1ZUYA 2JS2A 4RTXA 3H0FA 2RQWA 1UJYA 4JJBA 2XMFA 3JV3A 3NGPA 5IHKA 2DYBA 2KROA 1X69A 5GJWB 1XOVA 1AWOA 1ZSGA 2HEQA 2JMAA 3H0IA 4ORZA 1MV3A 1M3CA 4HXJA 2F2XA 1X6GA 2DX1A 2LNHB 3U23A 1CKBA 1SPKA 2DLPA 2V1RA 1I0CA 3UF4A 3NMZC 2AKKA 1G2BA 1ABQA 3M0UA 5L23A 2EGCA 2LX7A 4RTYA 4M4ZA 4Y92A 2D0NA 2SEMA 2KNBB 3EHQA 1AEYA 1WDXA 2QDLA 1ZX6A 1OPLA 2CSQA 1K0XA 1QWFA 3ULRB 1RI9A 1PKSA 4J9HA 4RUGA 2DL8A 2L3SA 1PWTA 1NLPC 1OOTA 2DA9A 1WI7A 2I0NA 2JM9A 1AWXA 1M27C 4AFQC 1GCQA 1A0NB 3O5ZA 1KFZA 1VYUA 2CSIA 2K6DA 4LUEA 2DL5A 2JMCA 2J6FA 1WLPB 4J9FA 2J06A 1QCFA 2DBKA 2CH4W 2EYWA 2HSPA 2MOXA 1GL5A 1SRLA 1WA7A 3THKA 2KT8A 2YDLA 2FEIA 3H41A 2NWMA 1UHFA 2AK5A 1K1ZA 2OJ2A 4HVWA 1NEGA 2FPFA 3M0QA 5EC7A 3RNJA 2J05A 2KRSA 1AZGB 2J6OA 2CUBA 1W6XA 3VS0A 1BU1A 1QWEA 1JO8A 3NHNA 1UTIA 1VYTA 1M30A 3M0SA 2RMOA 2EGEA 2SRCA 2RN8A 2GTOA 2J7IA 2YUQA 1GCPA 1QLYA 2JTEA 4OMLA 1FMKA 3UA7A 5IHIA 2ABLA 1HSQA 1BB9A 2JW4A 1G83A 3C0CA 2DE0X 3EGUA 2AZSA 2RQVA 1J3TA 1JU5C 2BZ8A 1JXMA 1TUDA 1NYFA 2ESWA 2LJ0A 1JQQA 4RTTA 1NLOC 2FPEA 4E6RA 2PZ1A 1E6HA 1AZEA 4J9EA 1UDLA 2JT4A 4JZ4A 1Y57A 3M0RA 3PVLA 4D8DA 1GBRA 1H8KA 1H92A 1RLPC 1SRMA 2EQIA 1YWOA 1K0SA 2CT3A 3I35A 1Z9ZA 4JZ3A 2G6FX 1K76A 1PNJA 1WYXA 1AD5A 3M0PA 2RNAA 2GBQA 4F16A 1WFWA 4EIKA 1U3OA 1YN8A 3REBB 1IO6A 2DVJA 1BBZA 2EW3A 4DEXA 2D1XA 3PVQA 4JPBW 5I11A 1ZLMA 2BZYA 1MUZA 3EHRA 2RQUA 1SSHA 1NEBA 4J9DA 1PKTA 4A63B 2RF0A 1GFDA 1B07A 1M3AA 2ECZA 2AZVA 5IH2A 3H0HA 2NUZA 5FWCA 2RPNA 2DL7A 1SHFA 1WX6A 2E5KA 3VS5A 2A08A 2FRWA 5IXBA 1HD3A 1W70A 2LMJA 4J9CA 3VS6A 3R6NA 2VVKA 2O88A 2C0OA 4OMPA 2CT4A 3NPFA 2W0ZA 2DF6A 2GGRA 2CH4A 2A28A 2IIMA 1SEMA 2ED0A 2ED1A 1S1NA 5FW9A 5ECAA 3VRYA 1YNZA 1AVZC 2EYZA 1T0JA 1AOJA 1PRMC 2JM8A 1WXBA 2HBWA 1M8MA 4HVUA 4CC4B 1M3BA 2AKLA 1QKXA 2LJ3A 2F2VA 2GQIA 4ESRA 2DNUA 4RTZA 4GLMA 1T3SA 1X27A 2L0AA 2VWFA 2KGTA 3GBQA 3I5SA 5IHNA 3TSZA 2MIOA 2YSQA 4X1VA 2L2PA 2DBMA 1U5SA 2J6KA 2ENMA 1NM7A 1TUCA 1ZUUA 2C0TA 3UA6A 1RUWA 1OPKA 4QT7A 2KEAA 2KR3A 2JS0A 2KE9A 2FO0A 4LE9A 4WCIA 4HCKA 2GNCA 3I9QA 4LN2A 3VS1A 1Z9QA 2HDAA 1LCKA 2OI3A 3EG3A 3TSWA 2O9VA 2JXBA 2X3XD 4F14A 2LJ1A 2EBPA 2LP5A 2D8HA 4D8KA 4AG1C 2KRMA 2KBTA 3RBBB 2C0IA 1X43A 4GBQA 1UGVA 3PE0A 1T0HA 1GFCA 4Z88A 1GCQC 1T3LA 2DJQA 3SEMA 4AFZC 1K4US 2O9SA 2P4RA 3EG1A 2OAWA 2O2OA 1BK2A 1UFFA 1X2QA 4JJDA 2YUPA 4CC3A 1I1JA 4Z89A 3A98A 3TVTA 2K79A 1YWPA 2LQWA 2LQNA 1ARKA 3EG0A 2KYMA 1UE9A 2DM1A 2ROTA 3VS4A 2A36A 1PRLC 2PTKA 2EPDA 4FSSA 1U06A 4LNPA 3ZL7C 1UG1A 4IIOA 1JXOA 1OEBA 2CDTA 2CREA 3UATA 1PHTA 4LUDA 3QWYA 2BZXA 2VKNA 2KYBA 1UECA 2EGAA 1OV3A 3SHWA 2M0YA 2LZ6B 1VYVA 2RQTA 2DMOA 2B86A 3IQLA 2O31A 5GJVB 4R0KA 2MCNA 4ZNXA 4RTVA 2ROLA 2A37A 4IIMA 2W10A 3REAB 2DRMA 4OMNA 1E6GA 2KXCA 2YT6A 2KRNA 5I22A 1UUEA 2DRKA 4K11A 4CC7A 3QWXX 1YCSB 2HCKA 1YP5A 2FRYA 1FYNA 1AWJA 1CKAA 3I5RA 1B3QA 4CC2A 3KFVA 2FPDA 4Z8AA 1KSWA 1CSKA 1I07A 1KIKA 4OMMA 1X2KA 1WIEA 3VRZA 1V1CA 4OMQA 4RTUA 2H8HA 2LCSA 2YUOA 2DL4A 2M51A 2EVRA 1X6BA 1ZUKA 1TG0A 2EKHA 4J9GA 1RLQC 1E7OA 3VS2A 1ABOA 2GTJA 1JEGA 4J9BA 2KXDA 1GRIA 1K9AA 2K2MA 2CUDA 2D8JA 1HJDA 1Y0MA 3LH5A 2PNIA 2YUNA 4DEYA 4F17A 1UHCA 2RQRA 2K7AA 3VS3A 1AWWA 2DL3A 2K3BA 1GBQA 2L3QA 2L3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BTT A;  1N5Z A;  2V1Q A;  4HVV A;  3EG2 A;  4KRT A;  2F2W A;  1SHG A;  4RTW A;  2K9G A;  1H3H A;  3CQT A;  1UJ0 A;  5FWB A;  1ZBJ A;  4AFS C;  2X3W D;  3VS7 A;  1W1F A;  4AG2 C;  5HCK A;  1VA7 A;  1MV0 B;  4J9I A;  1WXU A;  1WXT A;  5IXF A;  3FJ5 A;  1NG2 A;  1QKW A;  4AFU C;  3M0T A;  2EYX A;  4OMO A;  2DIL A;  2EYY A;  2KT1 A;  1KJW A;  2FG0 A;  4JJC A;  1EFN A;  1NYG A;  1ZUY A;  2JS2 A;  4RTX A;  3H0F A;  2RQW A;  1UJY A;  4JJB A;  2XMF A;  3JV3 A;  3NGP A;  5IHK A;  2DYB A;  2KRO A;  1X69 A;  5GJW B;  1XOV A;  1AWO A;  1ZSG A;  2HEQ A;  2JMA A;  3H0I A;  4ORZ A;  1MV3 A;  1M3C A;  4HXJ A;  2F2X A;  1X6G A;  2DX1 A;  2LNH B;  3U23 A;  1CKB A;  1SPK A;  2DLP A;  2V1R A;  1I0C A;  3UF4 A;  3NMZ C;  2AKK A;  1G2B A;  1ABQ A;  3M0U A;  5L23 A;  2EGC A;  2LX7 A;  4RTY A;  4M4Z A;  4Y92 A;  2D0N A;  2SEM A;  2KNB B;  3EHQ A;  1AEY A;  1WDX A;  2QDL A;  1ZX6 A;  1OPL A;  2CSQ A;  1K0X A;  1QWF A;  3ULR B;  1RI9 A;  1PKS A;  4J9H A;  4RUG A;  2DL8 A;  2L3S A;  1PWT A;  1NLP C;  1OOT A;  2DA9 A;  1WI7 A;  2I0N A;  2JM9 A;  1AWX A;  1M27 C;  4AFQ C;  1GCQ A;  1A0N B;  3O5Z A;  1KFZ A;  1VYU A;  2CSI A;  2K6D A;  4LUE A;  2DL5 A;  2JMC A;  2J6F A;  1WLP B;  4J9F A;  2J06 A;  1QCF A;  2DBK A;  2CH4 W;  2EYW A;  2HSP A;  2MOX A;  1GL5 A;  1SRL A;  1WA7 A;  3THK A;  2KT8 A;  2YDL A;  2FEI A;  3H41 A;  2NWM A;  1UHF A;  2AK5 A;  1K1Z A;  2OJ2 A;  4HVW A;  1NEG A;  2FPF A;  3M0Q A;  5EC7 A;  3RNJ A;  2J05 A;  2KRS A;  1AZG B;  2J6O A;  2CUB A;  1W6X A;  3VS0 A;  1BU1 A;  1QWE A;  1JO8 A;  3NHN A;  1UTI A;  1VYT A;  1M30 A;  3M0S A;  2RMO A;  2EGE A;  2SRC A;  2RN8 A;  2GTO A;  2J7I A;  2YUQ A;  1GCP A;  1QLY A;  2JTE A;  4OML A;  1FMK A;  3UA7 A;  5IHI A;  2ABL A;  1HSQ A;  1BB9 A;  2JW4 A;  1G83 A;  3C0C A;  2DE0 X;  3EGU A;  2AZS A;  2RQV A;  1J3T A;  1JU5 C;  2BZ8 A;  1JXM A;  1TUD A;  1NYF A;  2ESW A;  2LJ0 A;  1JQQ A;  4RTT A;  1NLO C;  2FPE A;  4E6R A;  2PZ1 A;  1E6H A;  1AZE A;  4J9E A;  1UDL A;  2JT4 A;  4JZ4 A;  1Y57 A;  3M0R A;  3PVL A;  4D8D A;  1GBR A;  1H8K A;  1H92 A;  1RLP C;  1SRM A;  2EQI A;  1YWO A;  1K0S A;  2CT3 A;  3I35 A;  1Z9Z A;  4JZ3 A;  2G6F X;  1K76 A;  1PNJ A;  1WYX A;  1AD5 A;  3M0P A;  2RNA A;  2GBQ A;  4F16 A;  1WFW A;  4EIK A;  1U3O A;  1YN8 A;  3REB B;  1IO6 A;  2DVJ A;  1BBZ A;  2EW3 A;  4DEX A;  2D1X A;  3PVQ A;  4JPB W;  5I11 A;  1ZLM A;  2BZY A;  1MUZ A;  3EHR A;  2RQU A;  1SSH A;  1NEB A;  4J9D A;  1PKT A;  4A63 B;  2RF0 A;  1GFD A;  1B07 A;  1M3A A;  2ECZ A;  2AZV A;  5IH2 A;  3H0H A;  2NUZ A;  5FWC A;  2RPN A;  2DL7 A;  1SHF A;  1WX6 A;  2E5K A;  3VS5 A;  2A08 A;  2FRW A;  5IXB A;  1HD3 A;  1W70 A;  2LMJ A;  4J9C A;  3VS6 A;  3R6N A;  2VVK A;  2O88 A;  2C0O A;  4OMP A;  2CT4 A;  3NPF A;  2W0Z A;  2DF6 A;  2GGR A;  2CH4 A;  2A28 A;  2IIM A;  1SEM A;  2ED0 A;  2ED1 A;  1S1N A;  5FW9 A;  5ECA A;  3VRY A;  1YNZ A;  1AVZ C;  2EYZ A;  1T0J A;  1AOJ A;  1PRM C;  2JM8 A;  1WXB A;  2HBW A;  1M8M A;  4HVU A;  4CC4 B;  1M3B A;  2AKL A;  1QKX A;  2LJ3 A;  2F2V A;  2GQI A;  4ESR A;  2DNU A;  4RTZ A;  4GLM A;  1T3S A;  1X27 A;  2L0A A;  2VWF A;  2KGT A;  3GBQ A;  3I5S A;  5IHN A;  3TSZ A;  2MIO A;  2YSQ A;  4X1V A;  2L2P A;  2DBM A;  1U5S A;  2J6K A;  2ENM A;  1NM7 A;  1TUC A;  1ZUU A;  2C0T A;  3UA6 A;  1RUW A;  1OPK A;  4QT7 A;  2KEA A;  2KR3 A;  2JS0 A;  2KE9 A;  2FO0 A;  4LE9 A;  4WCI A;  4HCK A;  2GNC A;  3I9Q A;  4LN2 A;  3VS1 A;  1Z9Q A;  2HDA A;  1LCK A;  2OI3 A;  3EG3 A;  3TSW A;  2O9V A;  2JXB A;  2X3X D;  4F14 A;  2LJ1 A;  2EBP A;  2LP5 A;  2D8H A;  4D8K A;  4AG1 C;  2KRM A;  2KBT A;  3RBB B;  2C0I A;  1X43 A;  4GBQ A;  1UGV A;  3PE0 A;  1T0H A;  1GFC A;  4Z88 A;  1GCQ C;  1T3L A;  2DJQ A;  3SEM A;  4AFZ C;  1K4U S;  2O9S A;  2P4R A;  3EG1 A;  2OAW A;  2O2O A;  1BK2 A;  1UFF A;  1X2Q A;  4JJD A;  2YUP A;  4CC3 A;  1I1J A;  4Z89 A;  3A98 A;  3TVT A;  2K79 A;  1YWP A;  2LQW A;  2LQN A;  1ARK A;  3EG0 A;  2KYM A;  1UE9 A;  2DM1 A;  2ROT A;  3VS4 A;  2A36 A;  1PRL C;  2PTK A;  2EPD A;  4FSS A;  1U06 A;  4LNP A;  3ZL7 C;  1UG1 A;  4IIO A;  1JXO A;  1OEB A;  2CDT A;  2CRE A;  3UAT A;  1PHT A;  4LUD A;  3QWY A;  2BZX A;  2VKN A;  2KYB A;  1UEC A;  2EGA A;  1OV3 A;  3SHW A;  2M0Y A;  2LZ6 B;  1VYV A;  2RQT A;  2DMO A;  2B86 A;  3IQL A;  2O31 A;  5GJV B;  4R0K A;  2MCN A;  4ZNX A;  4RTV A;  2ROL A;  2A37 A;  4IIM A;  2W10 A;  3REA B;  2DRM A;  4OMN A;  1E6G A;  2KXC A;  2YT6 A;  2KRN A;  5I22 A;  1UUE A;  2DRK A;  4K11 A;  4CC7 A;  3QWX X;  1YCS B;  2HCK A;  1YP5 A;  2FRY A;  1FYN A;  1AWJ A;  1CKA A;  3I5R A;  1B3Q A;  4CC2 A;  3KFV A;  2FPD A;  4Z8A A;  1KSW A;  1CSK A;  1I07 A;  1KIK A;  4OMM A;  1X2K A;  1WIE A;  3VRZ A;  1V1C A;  4OMQ A;  4RTU A;  2H8H A;  2LCS A;  2YUO A;  2DL4 A;  2M51 A;  2EVR A;  1X6B A;  1ZUK A;  1TG0 A;  2EKH A;  4J9G A;  1RLQ C;  1E7O A;  3VS2 A;  1ABO A;  2GTJ A;  1JEG A;  4J9B A;  2KXD A;  1GRI A;  1K9A A;  2K2M A;  2CUD A;  2D8J A;  1HJD A;  1Y0M A;  3LH5 A;  2PNI A;  2YUN A;  4DEY A;  4F17 A;  1UHC A;  2RQR A;  2K7A A;  3VS3 A;  1AWW A;  2DL3 A;  2K3B A;  1GBQ A;  2L3Q A;  2L3P A; 
#chains in the Genus database with same CATH topology
 2BTT A;  3A8M B;  1U1S A;  4OMF B;  2F2W A;  2K9G A;  2QXF A;  2YRV A;  3HRT A;  3GNG A;  1ZBJ A;  4AFS C;  1RL2 A;  4OGC A;  4MZT A;  5DM7 R;  3G6E Q;  1NJI R;  4QQ6 A;  4JJN K;  4JLG A;  3I56 A;  4RG2 A;  1M4Z A;  4LDV A;  1KC8 R;  5GMK i;  2EYX A;  2DIQ A;  3I55 Q;  2EYY A;  3FIF A;  1PD0 A;  3L2W A;  2FG0 A;  1EFN A;  4RTX A;  3H0F A;  1Q86 R;  4JJB A;  1VQ6 T;  2XMF A;  4M77 F;  5IHK A;  2DYB A;  2KRO A;  1G3W A;  2E1H A;  2P0Q A;  2QA4 A;  1XOV A;  1AWO A;  1Y71 A;  2JMA A;  2KY9 A;  3CEY A;  3GNF B;  4ORZ A;  1M3C A;  3QJY A;  1X6G A;  5GAM h;  2DX1 A;  2LNH B;  1CKB A;  3V7S A;  2D6F A;  3A8G B;  3VV0 A;  1G2B A;  1TWB A;  5LJ3 f;  4J83 A;  4M77 E;  2LX7 A;  1VQK A;  1QMC A;  3CCU Q;  4CRI A;  4Y92 A;  4M78 D;  4ELY C;  2RJD A;  5CKH A;  3LW5 E;  1K0X A;  2RK2 A;  1PKS A;  2KQW A;  4LDU A;  2XDD A;  4LDX A;  3VYH B;  1WI7 A;  4ZTJ A;  2DIG A;  2I2L A;  1YIT T;  1AWX A;  1WHH A;  1QVG P;  1OX9 A;  3EH2 A;  2CSI A;  1KFZ A;  2K6D A;  4JRP A;  3DB4 A;  1UB4 A;  2DL5 A;  4BDZ A;  4PFP A;  3ME9 A;  1WLP B;  2LQ8 A;  2RB6 A;  2EQK A;  4J9F A;  2J06 A;  3UT1 A;  3LGF A;  5J39 A;  5FU6 B;  3QBY A;  2DBK A;  3JCM J;  3CXC P;  2CH4 W;  3CD6 T;  2JVV A;  2MOX A;  1UGP B;  2ZPE B;  5GAN 5;  1TS9 A;  2M02 A;  2YDL A;  2EJ9 A;  3G1J A;  3X28 B;  2NWM A;  3SWN C;  4C5I A;  3CC2 A;  3CCL Q;  2OJ2 A;  1O75 A;  4HVW A;  1NEG A;  3OS5 A;  2FPF A;  1NE8 A;  2J05 A;  4M75 G;  2KRS A;  2PU9 B;  3C12 A;  2K5L A;  2MWP A;  3LYI A;  3CCV T;  1JO8 A;  1QWE A;  3PTA A;  3NHN A;  2CGH A;  5KCH A;  3CCQ Q;  2RN8 A;  1VQ9 A;  2ZPG B;  2LTO A;  4OML A;  1FMK A;  3EGX A;  4BDY A;  3UDC A;  1M1G A;  4RKU E;  1YHQ Q;  2JW4 A;  1BB9 A;  4IUQ A;  3C0C A;  5KYY A;  2AZS A;  2RQV A;  1R77 A;  2YWW A;  1JU5 C;  2EAY A;  5EG2 A;  3CCE Q;  1EZZ B;  2LJ0 A;  3BY7 A;  3J7A F;  3SFM A;  2DD4 A;  1WJR A;  2EKO A;  1NLO C;  2FPE A;  4E6R A;  2O4X A;  1Q81 C;  2JT4 A;  1WZO A;  5CKB A;  1IB8 A;  2QQS A;  3M0R A;  4D8D A;  2PVD B;  2ZAE A;  1QQJ A;  1WNL A;  1EX4 A;  4D6W A;  1VQO Q;  1X6O A;  4M78 B;  2RK1 A;  1K0S A;  3QDF A;  3SDZ A;  3G7Z A;  3SB2 A;  1Z9Z A;  1KQ2 A;  1UGS B;  1ZBX A;  1K76 A;  3A1P A;  1IHV A;  4F16 A;  1WFW A;  5J3B A;  3EG9 B;  2DO3 A;  1U3O A;  4E7L A;  1IO6 A;  1BBZ A;  2EW3 A;  1RAD B;  3PVQ A;  1MUZ A;  3EHR A;  1JJ2 S;  5GAM f;  4C5H A;  1PKT A;  2GQV A;  2EWN A;  1M3A A;  2ECZ A;  2VYT A;  2XG8 D;  1XJW B;  1WPY A;  4ZN1 A;  2F5K A;  2NUZ A;  2HKQ B;  1B34 A;  4J6X A;  2RA2 A;  1SHF A;  5LJ3 h;  4C8Q F;  3OS1 A;  2E5K A;  1RAH B;  1JJ2 A;  4N4H A;  2VVK A;  1RAG B;  2A7Y A;  4RCB A;  2CT4 A;  3NPF A;  2W0Z A;  4ME7 A;  2F69 A;  2GGR A;  1VQ6 Q;  3DB3 A;  2M16 A;  1VQP Q;  2A28 A;  4Q5W A;  2IIM A;  4M77 C;  3M59 A;  3L2Z A;  3HL8 A;  3CC2 Q;  5M9O A;  1S1N A;  2OTJ A;  1OZ2 A;  2KK4 A;  2LT1 A;  4JRI A;  2EYZ A;  1T0J A;  1PRM C;  2HBW A;  3A8L B;  2DKG A;  4HVU A;  2Y4Y A;  4O6J A;  2X4X A;  1VUB A;  3NFC A;  2FL7 A;  1Q7Y R;  1QKX A;  2HBP A;  1SG5 A;  2DEU A;  2F2V A;  4KGX B;  1T3S A;  2L0A A;  4HCZ A;  3VUB A;  2QGG A;  1D3B B;  2KGT A;  5IHN A;  3I5S A;  5KCO A;  3QXE B;  5LJ5 e;  5FU7 C;  4M7D G;  2WSF E;  2CZ1 B;  3TCJ A;  5GAN e;  4WTO B;  4C92 D;  2V8I A;  1TUC A;  5KYX A;  1KQS P;  1RUW A;  3NTK A;  4IUP A;  2IG0 A;  4FL6 A;  1IRE B;  2YRD A;  4PK4 A;  3JCM e;  1BIA A;  1C0M A;  4LN2 A;  3VS1 A;  1RAB B;  4C0G A;  3M57 A;  2OI3 A;  2XD0 A;  3DLM A;  2DXC A;  1BKB A;  2DXT A;  4F14 A;  2LJ1 A;  1ZA1 B;  2RHU A;  4E7K A;  2D8H A;  5I2M A;  4D8K A;  3HTR A;  2DAQ A;  2DTI A;  1OX8 A;  3RBB B;  4FSX A;  2NUT A;  2C0I A;  1X43 A;  3INZ A;  1Y96 A;  4GBQ A;  3QO3 A;  3CCV A;  2RO0 A;  3HPW A;  2EQM A;  1T3L A;  4DBR A;  1MHN A;  1OQK A;  2GFA A;  2ZPH B;  3OSS C;  4M78 E;  2O2O A;  1M1K C;  2HQX A;  4CC3 A;  3RER A;  2K5F A;  1YJ9 Q;  1K9M R;  2DXB A;  4OB0 B;  2VUB A;  2K2V A;  3X24 B;  4BY6 B;  2MMP A;  5GAN d;  2KYM A;  3RR6 A;  3VS4 A;  2FVU A;  3MO8 A;  2EPD A;  4FSS A;  3MPU B;  4LNP A;  3L2R A;  1IHW A;  1JXO A;  2CRE A;  1N9R A;  2VXE A;  3CXC S;  1VQO T;  4LUD A;  2LRQ A;  4C0D B;  3PT9 A;  1KG1 A;  4BI3 A;  1UEC A;  1OV3 A;  2V8K A;  1YI2 Q;  4LD6 A;  2M0Y A;  2LZ6 B;  4M75 F;  5GAN 3;  2B86 A;  5GJV B;  4R0K A;  1QVG S;  4M7A D;  4RTV A;  4M7D F;  4OB1 B;  3CCU A;  4Z02 A;  3L2V A;  1UUE A;  5KYY B;  1K73 C;  1MNE A;  3GF5 A;  2KSS A;  2KI7 A;  1FYN A;  3E19 A;  2DFU A;  3I5R A;  1OYX A;  3KXT A;  4Z8A A;  1KD1 C;  1YHQ T;  2O4X B;  1I81 A;  2QEX Q;  4ATO A;  4M7A F;  1SKU B;  1WIE A;  4RTU A;  2CZ7 B;  2H8H A;  2LCL A;  1N8R C;  2XIC A;  1WHM A;  3JCM c;  2EVR A;  3V8L A;  3OS0 A;  1ZUK A;  4E47 A;  4J9G A;  3GOX A;  3VS2 A;  1JEG A;  1MMN A;  2XHC A;  1BCO A;  1KHI A;  1RAF B;  1G8X A;  3G6E T;  2K3Y A;  3VKI A;  4CI0 C;  3EG9 A;  5I2S A;  2JNG A;  4DEY A;  2L3R A;  4F17 A;  2LDM A;  1M9S A;  3MJX A;  2RHZ A;  2E41 A;  4B6M A;  3OYB A;  2QQB A;  2PUK B;  2V1Q A;  4HVV A;  4PJO E;  1QVF A;  2L89 A;  4PJM A;  3CME Q;  4RTW A;  2A3L A;  3JSC A;  1PD1 A;  1M5Q 1;  5FU7 B;  1UJ0 A;  4C8Q G;  2LNV A;  3LLR A;  1FX7 A;  1U1T A;  2DD5 A;  4FYX B;  3VS7 A;  1W1F A;  3P8D A;  1WGS A;  5HCK A;  4J9I A;  4MZP A;  4F7U A;  1WXT A;  1NG2 A;  4OMO A;  2V26 A;  1HYO A;  1PC0 A;  3FB9 A;  3JB9 D;  1YJ9 T;  2DEQ A;  2P84 A;  3JCM V;  8AT1 B;  4HCC A;  1MV3 A;  4L6V 5;  1KC8 C;  4J7I A;  1SPK A;  1I0C A;  3QZ5 B;  1YJN Q;  1Y07 A;  1RAE B;  4DOV A;  2AKK A;  3TU4 K;  5GAN j;  2R5A A;  2COW A;  4E7S A;  3CCQ A;  3M0U A;  5L23 A;  2EGC A;  2SEM A;  3CME T;  1NJI U;  2PVG B;  3JB9 F;  3EHQ A;  2M9U A;  4XTZ A;  4BE1 A;  4M78 C;  4OGE A;  1VQM T;  2MWO A;  3HP9 A;  4XU2 A;  2L5Q A;  2HD0 A;  2L3S A;  1PWT A;  1OOT A;  2DA9 A;  2EJG A;  2QQA A;  4DQ2 A;  4BE2 A;  1QVF P;  1LPL A;  5KYX B;  4E7J A;  5GAO l;  3JCM d;  5KH6 A;  1GCQ A;  1A0N B;  1WQ7 A;  3O5Z A;  3JCM P;  1VYU A;  3CC7 A;  4LUE A;  3GPL A;  1ACM B;  3SWN B;  4PJO G;  2J6F A;  3I56 Q;  1D0Z A;  2ZGW A;  2EFI A;  2P0K A;  2COY A;  2HSP A;  1HK9 A;  3CMA A;  4PJO C;  1TSF A;  5LJ5 d;  1K8A U;  4RG8 A;  4EMG A;  1OU8 A;  1MMA A;  4BI4 A;  4ZTF A;  2KT8 A;  4E2F B;  2Z0W A;  3QG1 A;  4KUD K;  1QCN A;  3H41 A;  4XU1 A;  2D9T A;  4QVC A;  3M9Q A;  1ZSZ B;  1AZG B;  2X4W A;  2CUB A;  3OSV A;  2QG9 B;  4KH1 B;  3MEW A;  3N5B B;  1VQ5 A;  3KBG A;  2JTM A;  2EGE A;  2SRC A;  1Q81 U;  1LJO A;  1YI2 T;  4AMC A;  2J7I A;  1VQ8 T;  2YUQ A;  4J5Y A;  1GCP A;  2JTE A;  2QK0 A;  4HKE A;  3UA7 A;  5IHI A;  1XNI A;  4OVA A;  1HSQ A;  1KQ1 A;  1G83 A;  1UGR B;  2WSC E;  2DER A;  1I5O B;  2XDB A;  1VQ6 A;  4N4I A;  3M54 A;  3JB9 G;  2YLC A;  1K9M U;  3MEV A;  1QVF S;  1JQQ A;  1I4K 1;  2QA4 Q;  5FRO A;  3QII A;  3WVD B;  4KH0 B;  4J9E A;  1BI1 A;  1Y57 A;  1JRI A;  4PLI A;  1H92 A;  4FW2 A;  4JS4 A;  4C92 E;  5KYU B;  1SRM A;  1VQK Q;  4JZ3 A;  1Q81 R;  3QDR B;  4M77 G;  2LCC A;  1MMD A;  2Y90 A;  2GBQ A;  1VOM A;  2R57 A;  2QQR A;  1YN8 A;  3REB B;  2DVJ A;  2D1X A;  4JPB W;  4KGV B;  1ZLM A;  1M90 U;  4IUU A;  2L8D A;  5A2Q E;  2DZC A;  3QUI A;  1KQS A;  2AZV A;  3TEE A;  3H0H A;  4JS5 A;  2RPN A;  2DL7 A;  4J6Y A;  1BI2 A;  2HAX A;  3BDL A;  1VQ5 Q;  2RJF A;  3M58 A;  2A08 A;  2FRW A;  3PIP A;  5IXB A;  4JUV A;  2FYK A;  2O88 A;  3V7R A;  2C0O A;  5CKF A;  5IAY A;  2DF6 A;  1JBM A;  1UGQ B;  2NUP A;  5D6X A;  2FHD A;  1Q82 C;  2R58 A;  2ED0 A;  4EMK A;  2ED1 A;  2X9H A;  3HFO A;  3CCV Q;  3MKD A;  5GAO n;  1VQ4 A;  3G71 A;  1V76 A;  2EQU A;  2P4T A;  5C6S A;  1WXB A;  1BI3 A;  3CCL T;  2RHI A;  4F7U B;  1VQ7 T;  2JUF A;  4CC4 B;  2EJF A;  4ZGJ B;  1M3B A;  5A0D A;  2CP6 A;  5KYW B;  3M4Y A;  1BI0 A;  1YIJ T;  2K57 A;  3OYJ A;  2OTL A;  2GQI A;  1OI1 A;  2DNU A;  4F7U E;  4XU3 A;  1X27 A;  5LJ5 j;  1XTD A;  3GIB A;  2VWF A;  4XU0 A;  3CPW P;  5CKD A;  3GBQ A;  5HK0 A;  2MIO A;  3S6W A;  2JJ9 A;  4PFO A;  3CD6 A;  5LJ5 h;  5CVI A;  2DBM A;  4A54 A;  4FT2 A;  4II1 A;  1ZUU A;  4C92 C;  3JCM g;  3OYG A;  2WAC A;  3MET A;  1RI0 A;  4XTW A;  2VB6 A;  4IKF A;  3I9Q A;  4X9C A;  1Z9Q A;  3V8K A;  1ZA2 B;  3RKY A;  2JXB A;  2LX9 A;  2CP0 A;  2NYS A;  2EBP A;  2LP5 A;  2KBT A;  3HRU A;  3V8J A;  1PSE A;  3OYE A;  3DLL A;  1M90 C;  1UGV A;  1SSF A;  5D7U A;  4QQG A;  3MP6 A;  4Z88 A;  1VQ4 Q;  3G71 Q;  5GAO r;  4L59 A;  4PJO D;  3SD4 A;  1W2B A;  4JJD A;  3CPF A;  3TVT A;  1PSF A;  2EIF A;  3MEA A;  5IN1 A;  3CCM A;  2OTL Q;  2LQN A;  1ARK A;  3EGD B;  3P8B B;  1UE9 A;  2ROT A;  2QA4 T;  4R55 A;  4XTV A;  5GAM e;  1NPR A;  2PTK A;  4MML A;  2QI2 A;  6AT1 B;  1RAI B;  1U06 A;  1N6A A;  2CDT A;  3F70 A;  3UAT A;  3OA6 A;  3QWY A;  2VKN A;  2AIR B;  2EGA A;  3WXM B;  3SHW A;  2RQT A;  1VYV A;  4QKU A;  5GMK j;  5HKC A;  4MMK A;  2YLB A;  4EDU A;  4X34 A;  1ZSZ C;  2O31 A;  4MZM A;  3P8H A;  3REA B;  4E7I A;  2BE7 D;  1K8A C;  2KXC A;  5I22 A;  3C4S A;  4CC7 A;  5GMK l;  4C8Q B;  1YCS B;  3JB9 J;  1D0Y A;  2HCK A;  5D6Y A;  2FRY A;  1AWJ A;  2XI9 A;  2LC4 A;  1V1C A;  4OMQ A;  2WSE E;  3QZ9 B;  1K73 R;  2HSE B;  3CC7 Q;  2QAS A;  4B9X A;  1TG0 A;  1MGQ A;  1RLQ C;  4UC4 A;  2YXY A;  4J9B A;  2K2M A;  1OUL A;  2D8J A;  7AT1 B;  2RQR A;  4ZN3 A;  3HKS A;  5KYN A;  3VS3 A;  4M7A A;  2K3B A;  2F5T X;  2L3Q A;  2E65 A;  3CC2 T;  1YJW A;  4B9W A;  3M55 A;  2XK0 A;  1Q95 G;  1SHG A;  1H3H A;  2BUD A;  2M0O A;  4PNO A;  2FZG B;  3CQT A;  2FB7 A;  5FWB A;  4M77 A;  2X3W D;  4DBQ A;  2E70 A;  4AG2 C;  2XKO C;  1VA7 A;  5FU6 C;  3T9N A;  1YJN T;  1NZ9 A;  1YJW T;  1WXU A;  5IXF A;  1QCO A;  1F1B B;  3FJ5 A;  1QKW A;  4AFU C;  3O8V A;  5L8R E;  1OU9 A;  4PKC C;  3M0T A;  2DIL A;  3OS2 A;  5CR2 A;  1KJW A;  3CCS T;  4JJC A;  2JS2 A;  4M7D C;  2NUP B;  2RQW A;  1UJY A;  3CC4 Q;  3D7S B;  1TUG B;  3JCM X;  3PIO A;  1NJI C;  4Y28 E;  5GJW B;  4EMK B;  2KAF A;  1KQS S;  5LJ3 d;  3JB9 H;  2HEQ A;  1W2B S;  3R6O A;  4KUI A;  4C0F A;  1YI2 A;  3CCM T;  2DLP A;  3L42 A;  1Q86 C;  2VXF A;  3EFR A;  1G3Y A;  3FLG A;  2EQJ A;  5KYW A;  4RTY A;  5CKE A;  1WJQ A;  2KNB B;  1AEY A;  2QDL A;  2PUO B;  3RMS A;  4JRK A;  4X9D A;  3URG A;  2K5I A;  2CKK A;  5LJ3 e;  1QWF A;  1R0B G;  3ULR B;  1RI9 A;  4PL6 A;  4RUG A;  2RD1 A;  1Q7Y U;  1NLP C;  1ZQ1 A;  3HSB A;  2FZK B;  2VAS A;  2I0N A;  2DJZ A;  2JM9 A;  5FRM A;  2IPO B;  1W2B P;  1N27 A;  2HMA A;  3OW2 A;  4QQD A;  1LVK A;  3PFS A;  4JLI A;  4DBH A;  3I56 T;  4C8Q E;  3OYY A;  4QVD A;  1D1B A;  1M2V B;  4BB7 A;  3CCS Q;  1IRX A;  1SRL A;  1WA7 A;  3THK A;  5GAN 7;  2QTX A;  3OYM A;  4A4H A;  4PJL A;  1VQP A;  5CIU A;  4M7D B;  2RHX A;  1XQH A;  1VQN T;  5LJ3 j;  1UHF A;  2OTJ Q;  3FEO A;  3M0Q A;  3MEU A;  2D0Q B;  1W6X A;  3C94 A;  1BU1 A;  3TQ7 P;  2CP5 A;  4PJN A;  2HZY A;  1VYT A;  1M30 A;  3G6E A;  1PM3 A;  1JJ2 P;  3J80 E;  2JZ2 A;  1VQ4 T;  2YHT A;  5D6W A;  3CCR Q;  1I8F A;  3EGU A;  4EMK C;  3JCM h;  3VYG A;  1JXM A;  1NYF A;  2X51 A;  2K3X A;  2KVQ G;  4DA4 A;  3M5A A;  1AZE A;  2RJE A;  1UDL A;  2FZC B;  1IZ6 A;  4JZ4 A;  8ATC B;  4KUL A;  3PVL A;  5DLQ E;  1RLP C;  3CCU T;  4BD3 A;  1Q86 U;  2EQI A;  1YWO A;  2CT3 A;  4XAX B;  3I35 A;  2MK5 A;  2G6F X;  4NS5 A;  2A0F B;  3OYL A;  1BCM A;  1EIF A;  1PNJ A;  4RCC A;  4C8Q A;  2DET A;  3HHT B;  3OW2 S;  2MF2 A;  4DEX A;  5I11 A;  4LD9 K;  3QYG B;  4C8Q C;  4NL3 A;  1V29 B;  2PVO B;  4A63 B;  2RF0 A;  1GFD A;  4JDS A;  4A4K A;  3G4S T;  5IH2 A;  3JRZ A;  1KC8 U;  5FWC A;  1WX6 A;  1VQL A;  4HCB A;  4M7A G;  4R56 A;  3QPH A;  1HD3 A;  3FJP A;  1W70 A;  2GFU A;  4C5E A;  4J9C A;  3MCA B;  3VS6 A;  3R6N A;  3CCR A;  1VQ7 Q;  5FRN A;  3M4G A;  4OMP A;  1WJS A;  4M75 D;  2R5M A;  3A8O B;  1AHJ B;  3EH1 A;  2XDP A;  3V7C A;  1ZHI A;  4EMH A;  1YBY A;  2QQ9 A;  5I21 A;  2G3R A;  2LT4 A;  1SEM A;  3LGL A;  3OB9 A;  1VQL T;  4M7A E;  1TH7 A;  1M2O A;  3VUZ A;  3EGX B;  1YIT Q;  1YNZ A;  5A0L A;  1YFN A;  1AOJ A;  4V2S A;  2JM8 A;  2CYZ B;  3G4S A;  1U8R A;  4ANJ A;  1Q82 R;  3E2U A;  3HFN A;  1M8M A;  5GAN g;  2X35 A;  2JTF A;  3CCM Q;  2LJ3 A;  5LJ5 f;  4C92 B;  1QVG A;  4ESR A;  4GLM A;  4M7D E;  4BUG A;  5GAN f;  3CCJ Q;  2AT1 B;  2OAU A;  2YSQ A;  5LL6 S;  3CPW S;  3BW1 A;  3L1A A;  1VIF A;  4M78 A;  2QEX A;  1LNX A;  1WHK A;  3JCM f;  3FRN A;  2DVE A;  1U5S A;  1B7T A;  3S3M A;  2J6K A;  1G3S A;  2ENM A;  1NM7 A;  3BDU A;  2MI6 A;  3M56 A;  1S72 T;  1VQL Q;  3UA6 A;  1OPK A;  2O01 E;  4QT7 A;  2KEA A;  4XQ3 A;  1O9S A;  2KE9 A;  4LE9 A;  1D0X A;  3E1S A;  4HCK A;  3OYN A;  1VQ7 A;  1LCK A;  1X01 A;  3OY9 A;  3NTI A;  3JB9 I;  3RIR A;  2O9V A;  4J6W A;  4HA8 A;  2X3X D;  3X20 B;  1M1K R;  4O5V A;  1MMG A;  2CS7 A;  1K9M C;  4KT0 E;  1D1C A;  4WF2 A;  4MDX A;  1T0H A;  1GFC A;  4AFZ C;  2DJQ A;  4FW1 A;  1KD1 U;  1K4U S;  1N9S A;  1SF9 A;  3G4S Q;  1UFF A;  1S72 A;  2E5Q A;  1I1J A;  3PNW C;  2RHY A;  3A98 A;  4XTU A;  4HT8 A;  2K79 A;  1D1A A;  4E7Z A;  1M2V A;  4JRQ A;  1YWP A;  3EG0 A;  4MDW A;  3HRS A;  3EFS A;  4ELZ C;  3I55 A;  2E6N A;  5A0G A;  1PCX A;  2A36 A;  3EFO B;  4M7D A;  2DXU A;  4C92 F;  1UG1 A;  4IIO A;  1OEB A;  1I5L A;  2YRC A;  3OYK A;  2EYQ A;  4C0D C;  4F7U G;  2OTL T;  3X26 B;  2BZX A;  3OBW A;  2KYB A;  1QP3 A;  4PJJ A;  3KUF A;  2DMO A;  5GAN 8;  2COZ A;  1BIB A;  2QAZ A;  3IQL A;  4ZNX A;  2ROL A;  3H8Z A;  2E12 A;  3G71 T;  1D3B A;  1KD1 R;  4OMN A;  4A53 A;  2YT6 A;  4OB3 B;  2DRK A;  2E3H A;  3QWX X;  5CO7 A;  3QKJ A;  4KBM B;  4IUV A;  1C6V X;  1CKA A;  1VQK T;  4CC2 A;  1KK7 A;  1KSW A;  2DPP B;  1I07 A;  4GLK A;  3CBO A;  4BI8 B;  1K8A R;  4M77 D;  2YUO A;  1M1F A;  2EKH A;  2ZPB B;  1FWZ A;  1E7O A;  4M7D D;  1ABO A;  1YJ9 A;  1K9A A;  2NUT B;  2CUD A;  5GAM j;  4BY6 C;  1Y0M A;  1Y96 B;  2PNI A;  3CMA Q;  9ATC B;  1N8R R;  3CCS A;  2LQK A;  3H9N A;  3SWN A;  2K7A A;  3ASK A;  1TXQ A;  4VUB A;  3C95 A;  1GBQ A;  3L2U A;  3UPU A;  1N5Z A;  1GXI E;  3EG2 A;  4KRT A;  4M75 E;  1D09 B;  2ZPF B;  4OF1 A;  3ZBD A;  1AT1 B;  2E3I A;  4FIB A;  3OBY A;  4M75 B;  2CP7 A;  1K73 U;  4M78 G;  1MV0 B;  3J81 E;  2HL5 C;  1P92 A;  1ZSZ A;  3AT1 B;  3UWN A;  2RJC A;  3A8H B;  1W4S A;  2KT1 A;  4M7A C;  1ZUY A;  1NYG A;  1N8R U;  3NGP A;  3JV3 A;  1HXD A;  4KGZ B;  1X69 A;  4GY5 A;  4N4G A;  3LH0 A;  3PMT A;  5GAM d;  2E6Z A;  1ZSG A;  3H0I A;  4HXJ A;  2F2X A;  1H3Z A;  2AHJ B;  3U23 A;  2V1R A;  3ZFJ A;  4E7H A;  3UF4 A;  3LWI A;  1VQ5 T;  2BIV A;  3NMZ C;  2LVM A;  3MHX A;  3X25 B;  1ABQ A;  3NTH A;  4PFZ A;  4M4Z A;  4C92 A;  3GLX A;  3TRE A;  3OYH A;  2D0N A;  3VJP A;  5LJ3 g;  1VQM Q;  1WDX A;  2NLU A;  2HL3 A;  3RDV A;  1G3T A;  1ZX6 A;  1OPL A;  3OQ5 A;  2CSQ A;  1VQP T;  3QYH B;  5KYU A;  3CCE A;  2MPX C;  1YJW Q;  1H64 1;  4J9H A;  2CP2 A;  2DL8 A;  3OYC A;  3RMQ A;  1NBE B;  2MAM A;  2RH2 A;  3QHS A;  4TVR A;  3GP8 A;  1IGU A;  5GAO m;  4AFQ C;  1M27 C;  4LDW A;  1OZ3 A;  3CBP A;  2JMC A;  4C0Z A;  1VQO A;  2BE9 B;  1QCF A;  3BFM A;  1Q82 U;  4DBF A;  1LOJ A;  1RAC B;  1X75 C;  2EYW A;  1KHC A;  5GAM g;  1GL5 A;  4QVZ A;  3CC4 A;  1NPP A;  4A4G A;  4PJO A;  2FEI A;  5CAI A;  3A5Z B;  2AK5 A;  1K1Z A;  3CME A;  4LXC A;  5EC7 A;  3RNJ A;  3JAM E;  4RMO A;  3S3O A;  2J6O A;  3VS0 A;  3JCM b;  4FM4 B;  2C06 A;  3Q1J A;  1UTI A;  1M8V A;  2E64 A;  3M0S A;  2RMO A;  2HNI A;  3VU3 C;  2GTO A;  1TU0 B;  4C8Q D;  1QLY A;  3RUX A;  1IXD A;  2ZPI B;  2OTJ T;  2ABL A;  4FCY A;  3RKX A;  5FLX E;  5AYF A;  5KE2 A;  3CCJ A;  2CZ0 B;  3EFO A;  3QJ6 A;  2DE0 X;  1QP2 A;  1J3T A;  2JOY A;  2E4H A;  2BZ8 A;  3OMG A;  1TUD A;  2CP3 A;  2ESW A;  4F7U F;  3MP1 A;  2K4Y A;  4RTT A;  4YTL A;  2PZ1 A;  1PG5 B;  1E6H A;  3OW2 P;  5GAN 6;  2DTH A;  1GBR A;  2VGM A;  3ER0 A;  1H8K A;  3E9G A;  2QEX T;  1YIJ Q;  4XTY A;  4AT1 B;  5IT9 E;  1WYX A;  3M0P A;  1AD5 A;  3OYI A;  2RNA A;  1RAA B;  1Y7X A;  4EIK A;  4BAC A;  3CBM A;  3LX7 A;  2BZY A;  1IGQ A;  4L5G A;  2RQU A;  3S3N A;  1SSH A;  5CCA A;  1NEB A;  4J9D A;  5AT1 B;  2Y4X A;  1B07 A;  3CCL A;  1R0C B;  1WHG A;  4M78 F;  5CQY A;  2GF7 A;  2DTO A;  2ZCF B;  3VS5 A;  1S72 Q;  4FT4 A;  2QTV A;  3PGG A;  1FMV A;  2RI2 A;  3PMI A;  1C1A A;  4EPC A;  2LMJ A;  3LWH A;  4N0A C;  4IUR A;  1YHQ A;  3OYD A;  3RKW A;  2QGF B;  3CCR T;  2HKN A;  2CH4 A;  4M75 C;  4QW2 A;  2VC8 A;  1VIE A;  4FU6 A;  1WHJ A;  2PQW A;  1YCY A;  4XK8 E;  1Q7Y C;  3EGD A;  5FW9 A;  5ECA A;  3VRY A;  3OYA A;  2QYZ A;  1AVZ C;  2DK3 A;  1VQ9 T;  3OMC A;  4M75 A;  4PLL A;  2X4J A;  1VQ9 Q;  1VQN Q;  4PJO F;  2AKL A;  1FXX A;  4Y91 A;  3H6Z A;  5KE3 A;  3FDR A;  5C0M A;  2H3J A;  5GAN h;  2V8J A;  4RTZ A;  4IUT A;  4DOW A;  2H3E B;  2HQH A;  5GMK h;  1MND A;  3RES A;  3TSZ A;  2B8A A;  4X1V A;  3I55 T;  2L2P A;  2QDY B;  3JCM Q;  5CQX A;  3AHU A;  4OB2 B;  5GAN 4;  5GAO p;  4P5N A;  2C0T A;  2XU8 A;  1DJ7 B;  3CC7 T;  1YIJ A;  2KR3 A;  2JS0 A;  4WCI A;  2FO0 A;  3MP8 A;  2OX7 A;  2GNC A;  4C92 G;  2GCX A;  2HDA A;  4FYV B;  5J26 A;  3EG3 A;  2DZ9 A;  4OP0 A;  3TSW A;  4XTX A;  2RM4 A;  3CCE T;  4AG1 C;  1VQ8 A;  2KRM A;  3QSU A;  4NOY A;  3CPW A;  3CXC A;  2DYI A;  3EAE A;  3PE0 A;  1FMW A;  1QVP A;  4N0A A;  1GCQ C;  3SEM A;  2O9S A;  2P4R A;  4M7A B;  3EG1 A;  4NL2 A;  2OAW A;  5GAO q;  3CCQ T;  2KMT A;  1BK2 A;  1X2Q A;  2YUP A;  2VV5 A;  4FYY B;  1VQN A;  4Z89 A;  4ZGD B;  3E9F A;  4C5G A;  1TOV A;  2LQW A;  3CC4 T;  1M90 R;  4J7F A;  3BE3 A;  1R8O B;  4M77 B;  2DM1 A;  5HY6 A;  3DKM A;  3CMA T;  1PRL C;  4BE0 A;  4PJO B;  5LJ5 g;  3JCM W;  3ZL7 C;  5GAN 2;  2BKD N;  2VGN A;  1M1K U;  2RI3 A;  3CD6 Q;  1WHL A;  1PHT A;  2RI5 A;  1TTH B;  4LDY A;  5CK9 A;  1YIT A;  5HK3 A;  2HQE A;  2M1H A;  4A4E A;  5GMK m;  3L2Q A;  1YJN A;  2MCN A;  1QW1 A;  2ZZD A;  4FYW B;  4A4F A;  2A37 A;  4IIM A;  2W10 A;  3M53 A;  2DRM A;  2P0P A;  1E6G A;  2F1L A;  3OYF A;  2KRN A;  1VQM A;  4K11 A;  1JB0 E;  1UEB A;  1YP5 A;  1VQ8 Q;  1B3Q A;  3KFV A;  2FPD A;  2ATC B;  2X4Y A;  2JN0 A;  1CSK A;  5DY9 A;  1KIK A;  4OMM A;  1X2K A;  3VRZ A;  2CZ6 B;  2KDS A;  2LCS A;  2IVW A;  5DLO A;  2MYS A;  2DL4 A;  1WQW A;  2E10 A;  2M51 A;  4ZGE B;  1G5V A;  3CCJ T;  5GMK e;  1B34 B;  1X6B A;  4J8O A;  3FC3 A;  2GTJ A;  2KXD A;  2XID A;  1GRI A;  3ZEH A;  1HJD A;  3WVE B;  3LH5 A;  2YUN A;  4HT9 A;  4F04 B;  1UHC A;  1AWW A;  2DL3 A;  1BYM A;  2L3P A; 
#chains in the Genus database with same CATH homology
 2BTT A;  1N5Z A;  2V1Q A;  4HVV A;  3EG2 A;  4KRT A;  2F2W A;  1SHG A;  4RTW A;  2K9G A;  1H3H A;  3CQT A;  1UJ0 A;  5FWB A;  1ZBJ A;  4AFS C;  2X3W D;  3VS7 A;  1W1F A;  4AG2 C;  5HCK A;  1VA7 A;  1MV0 B;  4J9I A;  1WXU A;  1WXT A;  5IXF A;  3FJ5 A;  1NG2 A;  1QKW A;  4AFU C;  3M0T A;  2EYX A;  4OMO A;  2DIL A;  2EYY A;  2KT1 A;  1KJW A;  2FG0 A;  4JJC A;  1EFN A;  1NYG A;  1ZUY A;  2JS2 A;  4RTX A;  3H0F A;  2RQW A;  1UJY A;  4JJB A;  2XMF A;  3JV3 A;  3NGP A;  5IHK A;  2DYB A;  2KRO A;  1X69 A;  5GJW B;  1XOV A;  1AWO A;  1ZSG A;  2HEQ A;  2JMA A;  3H0I A;  4ORZ A;  1MV3 A;  1M3C A;  4HXJ A;  2F2X A;  1X6G A;  2DX1 A;  2LNH B;  3U23 A;  1CKB A;  1SPK A;  2DLP A;  2V1R A;  1I0C A;  3UF4 A;  3NMZ C;  2AKK A;  1G2B A;  1ABQ A;  3M0U A;  5L23 A;  2EGC A;  2LX7 A;  4RTY A;  4M4Z A;  4Y92 A;  2D0N A;  2SEM A;  2KNB B;  3EHQ A;  1AEY A;  1WDX A;  2QDL A;  1ZX6 A;  1OPL A;  2CSQ A;  1K0X A;  1QWF A;  3ULR B;  1RI9 A;  1PKS A;  4J9H A;  4RUG A;  2DL8 A;  2L3S A;  1PWT A;  1NLP C;  1OOT A;  2DA9 A;  1WI7 A;  2I0N A;  2JM9 A;  1AWX A;  1M27 C;  4AFQ C;  1GCQ A;  1A0N B;  3O5Z A;  1KFZ A;  1VYU A;  2CSI A;  2K6D A;  4LUE A;  2DL5 A;  2JMC A;  2J6F A;  1WLP B;  4J9F A;  2J06 A;  1QCF A;  2DBK A;  2CH4 W;  2EYW A;  2HSP A;  2MOX A;  1GL5 A;  1SRL A;  1WA7 A;  3THK A;  2KT8 A;  2YDL A;  2FEI A;  3H41 A;  2NWM A;  1UHF A;  2AK5 A;  1K1Z A;  2OJ2 A;  4HVW A;  1NEG A;  2FPF A;  3M0Q A;  5EC7 A;  3RNJ A;  2J05 A;  2KRS A;  1AZG B;  2J6O A;  2CUB A;  1W6X A;  3VS0 A;  1BU1 A;  1QWE A;  1JO8 A;  3NHN A;  1UTI A;  1VYT A;  1M30 A;  3M0S A;  2RMO A;  2EGE A;  2SRC A;  2RN8 A;  2GTO A;  2J7I A;  2YUQ A;  1GCP A;  1QLY A;  2JTE A;  4OML A;  1FMK A;  3UA7 A;  5IHI A;  2ABL A;  1HSQ A;  1BB9 A;  2JW4 A;  1G83 A;  3C0C A;  2DE0 X;  3EGU A;  2AZS A;  2RQV A;  1J3T A;  1JU5 C;  2BZ8 A;  1JXM A;  1TUD A;  1NYF A;  2ESW A;  2LJ0 A;  1JQQ A;  4RTT A;  1NLO C;  2FPE A;  4E6R A;  2PZ1 A;  1E6H A;  1AZE A;  4J9E A;  1UDL A;  2JT4 A;  4JZ4 A;  1Y57 A;  3M0R A;  3PVL A;  4D8D A;  1GBR A;  1H8K A;  1H92 A;  1RLP C;  1SRM A;  2EQI A;  1YWO A;  1K0S A;  2CT3 A;  3I35 A;  1Z9Z A;  4JZ3 A;  2G6F X;  1K76 A;  1PNJ A;  1WYX A;  1AD5 A;  3M0P A;  2RNA A;  2GBQ A;  4F16 A;  1WFW A;  4EIK A;  1U3O A;  1YN8 A;  3REB B;  1IO6 A;  2DVJ A;  1BBZ A;  2EW3 A;  4DEX A;  2D1X A;  3PVQ A;  4JPB W;  5I11 A;  1ZLM A;  2BZY A;  1MUZ A;  3EHR A;  2RQU A;  1SSH A;  1NEB A;  4J9D A;  1PKT A;  4A63 B;  2RF0 A;  1GFD A;  1B07 A;  1M3A A;  2ECZ A;  2AZV A;  5IH2 A;  3H0H A;  2NUZ A;  5FWC A;  2RPN A;  2DL7 A;  1SHF A;  1WX6 A;  2E5K A;  3VS5 A;  2A08 A;  2FRW A;  5IXB A;  1HD3 A;  1W70 A;  2LMJ A;  4J9C A;  3VS6 A;  3R6N A;  2VVK A;  2O88 A;  2C0O A;  4OMP A;  2CT4 A;  3NPF A;  2W0Z A;  2DF6 A;  2GGR A;  2CH4 A;  2A28 A;  2IIM A;  1SEM A;  2ED0 A;  2ED1 A;  1S1N A;  5FW9 A;  5ECA A;  3VRY A;  1YNZ A;  1AVZ C;  2EYZ A;  1T0J A;  1AOJ A;  1PRM C;  2JM8 A;  1WXB A;  2HBW A;  1M8M A;  4HVU A;  4CC4 B;  1M3B A;  2AKL A;  1QKX A;  2LJ3 A;  2F2V A;  2GQI A;  4ESR A;  2DNU A;  4RTZ A;  4GLM A;  1T3S A;  1X27 A;  2L0A A;  2VWF A;  2KGT A;  3GBQ A;  3I5S A;  5IHN A;  3TSZ A;  2MIO A;  2YSQ A;  4X1V A;  2L2P A;  2DBM A;  1U5S A;  2J6K A;  2ENM A;  1NM7 A;  1TUC A;  1ZUU A;  2C0T A;  3UA6 A;  1RUW A;  1OPK A;  4QT7 A;  2KEA A;  2KR3 A;  2JS0 A;  2KE9 A;  2FO0 A;  4LE9 A;  4WCI A;  4HCK A;  2GNC A;  3I9Q A;  4LN2 A;  3VS1 A;  1Z9Q A;  2HDA A;  1LCK A;  2OI3 A;  3EG3 A;  3TSW A;  2O9V A;  2JXB A;  2X3X D;  4F14 A;  2LJ1 A;  2EBP A;  2LP5 A;  2D8H A;  4D8K A;  4AG1 C;  2KRM A;  2KBT A;  3RBB B;  2C0I A;  1X43 A;  4GBQ A;  1UGV A;  3PE0 A;  1T0H A;  1GFC A;  4Z88 A;  1GCQ C;  1T3L A;  2DJQ A;  3SEM A;  4AFZ C;  1K4U S;  2O9S A;  2P4R A;  3EG1 A;  2OAW A;  2O2O A;  1BK2 A;  1UFF A;  1X2Q A;  4JJD A;  2YUP A;  4CC3 A;  1I1J A;  4Z89 A;  3A98 A;  3TVT A;  2K79 A;  1YWP A;  2LQW A;  2LQN A;  1ARK A;  3EG0 A;  2KYM A;  1UE9 A;  2DM1 A;  2ROT A;  3VS4 A;  2A36 A;  1PRL C;  2PTK A;  2EPD A;  4FSS A;  1U06 A;  4LNP A;  3ZL7 C;  1UG1 A;  4IIO A;  1JXO A;  1OEB A;  2CDT A;  2CRE A;  3UAT A;  1PHT A;  4LUD A;  3QWY A;  2BZX A;  2VKN A;  2KYB A;  1UEC A;  2EGA A;  1OV3 A;  3SHW A;  2M0Y A;  2LZ6 B;  1VYV A;  2RQT A;  2DMO A;  2B86 A;  3IQL A;  2O31 A;  5GJV B;  4R0K A;  2MCN A;  4ZNX A;  4RTV A;  2ROL A;  2A37 A;  4IIM A;  2W10 A;  3REA B;  2DRM A;  4OMN A;  1E6G A;  2KXC A;  2YT6 A;  2KRN A;  5I22 A;  1UUE A;  2DRK A;  4K11 A;  4CC7 A;  3QWX X;  1YCS B;  2HCK A;  1YP5 A;  2FRY A;  1FYN A;  1AWJ A;  1CKA A;  3I5R A;  1B3Q A;  4CC2 A;  3KFV A;  2FPD A;  4Z8A A;  1KSW A;  1CSK A;  1I07 A;  1KIK A;  4OMM A;  1X2K A;  1WIE A;  3VRZ A;  1V1C A;  4OMQ A;  4RTU A;  2H8H A;  2LCS A;  2YUO A;  2DL4 A;  2M51 A;  2EVR A;  1X6B A;  1ZUK A;  1TG0 A;  2EKH A;  4J9G A;  1RLQ C;  1E7O A;  3VS2 A;  1ABO A;  2GTJ A;  1JEG A;  4J9B A;  2KXD A;  1GRI A;  1K9A A;  2K2M A;  2CUD A;  2D8J A;  1HJD A;  1Y0M A;  3LH5 A;  2PNI A;  2YUN A;  4DEY A;  4F17 A;  1UHC A;  2RQR A;  2K7A A;  3VS3 A;  1AWW A;  2DL3 A;  2K3B A;  1GBQ A;  2L3Q A;  2L3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...