1PRMC

Two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
pubmed rcsb
source organism Gallus gallus
molecule tags Complex (signal transduction/peptide)
molecule keywords C-SRC TYROSINE KINASE SH3 DOMAIN
total genus 5
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1prmC00
2JM9A 3EG1A 1UECA 1B07A 1YP5A 2BTTA 4D8DA 1AEYA 2DX1A 1QKXA 3A98A 2AKKA 2EGEA 2JXBA 1RLPC 4HVWA 3I35A 4AFUC 1QWEA 5I11A 2K7AA 2LZ6B 2OJ2A 4RTYA 2MCNA 2ENMA 4E6RA 2ECZA 3EHRA 1GL5A 4KRTA 2XMFA 2RPNA 2W10A 1YNZA 3H0IA 2DM1A 1T3LA 2DRKA 1M3AA 1UTIA 1PNJA 1PRMC 1KSWA 2A36A 2D0NA 2LJ0A 3PVLA 4J9DA 2KXCA 1ZBJA 3I5SA 1HJDA 1UGVA 1OOTA 1G2BA 2IIMA 1QLYA 5GJWB 1B3QA 2MOXA 2JMCA 2ABLA 2G6FX 1EFNA 1K76A 3FJ5A 2O2OA 2LCSA 2L3QA 5GJVB 2CREA 2AZSA 4OMQA 1VYTA 3O5ZA 5FWBA 1MV3A 2X3XD 4CC4B 4IIMA 4Z8AA 1NYFA 1G83A 1K1ZA 2HDAA 2DBKA 2AK5A 1UUEA 4IIOA 2DNUA 2LMJA 4J9FA 2CUDA 4J9IA 3VS7A 2ROLA 1ABQA 1NEBA 4GLMA 1WLPB 1JQQA 2ED0A 2LQWA 3JV3A 2GQIA 2CH4A 2EGAA 1M3BA 1BBZA 4RTTA 1E6HA 4M4ZA 1W70A 2BZ8A 2EGCA 1WXBA 2W0ZA 3LH5A 1OPKA 4JPBW 2J6OA 3SEMA 3M0RA 2K79A 1W1FA 3VS5A 1OEBA 2CSIA 4JZ4A 1ZUYA 1YWOA 2LP5A 2O9SA 1JU5C 1PKTA 2YUNA 3NPFA 2KROA 2CDTA 4AFZC 3PVQA 1AWOA 5IHKA 3KFVA 1GCQA 1GCQC 2DJQA 2B86A 1M30A 2GGRA 2KBTA 3RNJA 2O31A 4FSSA 3UA6A 1E6GA 1GBRA 1X6GA 2RMOA 2DILA 1X6BA 4F14A 3EGUA 3VRYA 4CC2A 1RUWA 1IO6A 1Y57A 2CT3A 2FRYA 4OMLA 4AG1C 2OAWA 2RQRA 2K9GA 4RTWA 1SRLA 4RTUA 1XOVA 2KT8A 1K9AA 2V1RA 2DE0X 4CC3A 4HXJA 3M0QA 1Z9QA 2JS0A 1I0CA 2VWFA 2CUBA 2BZXA 2ROTA 5EC7A 2CH4W 2J7IA 2O9VA 1CKAA 3I5RA 1NLOC 3EG2A 1H8KA 4JZ3A 2DMOA 2D8JA 1M8MA 2JM8A 1TUCA 2KRMA 1OPLA 1SEMA 2C0TA 1U3OA 4D8KA 4Z88A 2K6DA 2JW4A 2VKNA 2KRNA 4ZNXA 1X2QA 4J9BA 4RTXA 4ESRA 4EIKA 2FPFA 1AWJA 2EYZA 2X3WD 4J9EA 3CQTA 1X69A 1ZX6A 2EBPA 4AFSC 1ZUUA 2ED1A 3REAB 1X43A 3NGPA 1ZLMA 2EW3A 2DL7A 4WCIA 1SHGA 3UF4A 2RQUA 1ABOA 2YUPA 5I22A 3VS6A 2EVRA 2K3BA 3VS2A 2LJ3A 4HCKA 2F2XA 1GRIA 2CSQA 2DYBA 2KRSA 1A0NB 2JS2A 4HVUA 4OMPA 3ZL7C 2D8HA 4DEXA 4K11A 1U5SA 4LNPA 1E7OA 2DA9A 1PWTA 2RQVA 2L0AA 1ZSGA 3IQLA 2FEIA 3UATA 1TUDA 1X27A 2RF0A 1N5ZA 1SSHA 2GTOA 5IXFA 3ULRB 2K2MA 2EYWA 4J9HA 5IXBA 2ESWA 2LJ1A 3SHWA 1WDXA 3NMZC 2PZ1A 2YT6A 1H92A 2FRWA 2AZVA 1S1NA 3REBB 1J3TA 1HD3A 2KT1A 3THKA 1QWFA 1SRMA 2DL5A 4RTZA 1WYXA 2CT4A 2KE9A 2PNIA 3M0TA 4Y92A 1AZGB 2P4RA 1UHFA 2I0NA 1WA7A 4CC7A 1KIKA 1M3CA 2HSPA 5IH2A 1K0SA 1JXMA 3VS1A 4R0KA 1M27C 1AWXA 1UFFA 2O88A 1VYVA 1BU1A 1CKBA 1QCFA 2SRCA 2J06A 1JXOA 5ECAA 2YUQA 1GBQA 1PHTA 4QT7A 3TSZA 2JTEA 4LE9A 2M0YA 2KGTA 1RI9A 2DL8A 2D1XA 3M0PA 2EQIA 2A37A 1UHCA 3EG0A 4F16A 2KR3A 2RN8A 1PKSA 2DLPA 3NHNA 1YCSB 4J9CA 3GBQA 2J6FA 4JJCA 3EHQA 5FW9A 2EKHA 1X2KA 2JMAA 3PE0A 2BZYA 2LNHB 4LN2A 1MUZA 2KYMA 1FMKA 2DVJA 4LUEA 4DEYA 1K0XA 2EPDA 2FPDA 2L2PA 3EG3A 1NLPC 4JJBA 2F2WA 1CSKA 1NG2A 2FO0A 2C0OA 4X1VA 2YUOA 5L23A 1GFDA 1HSQA 2PTKA 2LX7A 2QDLA 2DRMA 4F17A 1GCPA 2SEMA 1AZEA 1BB9A 1WX6A 3U23A 1I07A 1V1CA 1WXTA 1UJ0A 1AVZC 2JT4A 1RLQC 1VA7A 2RQTA 1BK2A 1VYUA 2MIOA 2DL3A 3M0SA 1SHFA 1FYNA 1UJYA 1U06A 3I9QA 2L3SA 1H3HA 1NYGA 1PRLC 4ORZA 2A28A 5FWCA 3C0CA 3H0FA 5HCKA 1TG0A 4Z89A 2H8HA 2DF6A 2J05A 3VRZA 2YSQA 2FG0A 5IHNA 2RNAA 1UE9A 1Y0MA 4J9GA 1YN8A 4LUDA 1NEGA 1I1JA 2RQWA 1UG1A 2YDLA 1OV3A 2HCKA 2GTJA 2KNBB 2NWMA 3QWXX 4OMNA 3RBBB 1WI7A 1AWWA 2KYBA 2OI3A 1WFWA 2AKLA 1NM7A 4JJDA 2HEQA 2L3PA 3TSWA 4AFQC 1AD5A 1LCKA 3UA7A 3H0HA 4AG2C 3TVTA 2LQNA 2M51A 2V1QA 1YWPA 2FPEA 2VVKA 1WXUA 1ZUKA 3R6NA 4HVVA 1T0HA 2GNCA 3VS0A 1ARKA 1K4US 1SPKA 1KFZA 2EYYA 4RUGA 4RTVA 3QWYA 1Z9ZA 1UDLA 2HBWA 3H41A 5IHIA 2NUZA 2KEAA 2EYXA 4A63B 2KXDA 2E5KA 2DL4A 2C0IA 1GFCA 1T0JA 1AOJA 2J6KA 4OMMA 1T3SA 4OMOA 1JEGA 1JO8A 2F2VA 1QKWA 1WIEA 1KJWA 2DBMA 1MV0B 3VS4A 3M0UA 3VS3A 2GBQA 2A08A 4GBQA 1W6XA
chains in the Genus database with same CATH superfamily
1PSFA 4M7AB 4C0DB 2DZCA 1YP5A 2XU8A 4QW2A 3LWIA 2DERA 3CCRT 2EGEA 4J5YA 2ZAEA 1QWEA 4C8QA 3HP9A 3G6EA 3CMAT 1YJ9Q 3OYYA 5KYUA 2ENMA 3MCAB 2ECZA 1TSFA 3EHRA 2KQWA 2XMFA 1D3BB 3QDFA 2P0KA 1YNZA 4M7DF 2MMPA 1T3LA 5CKFA 1M3AA 2MK5A 2DKGA 1UTIA 2EJGA 1YJWA 1PNJA 1KSWA 1UGRB 2A36A 4QKUA 5FROA 2JTFA 3PVLA 2LT4A 1TXQA 2VXFA 1TWBA 1MMGA 5GAMh 2JTMA 4HCZA 3FIFA 1G3TA 2LQKA 4J6WA 5GAN4 1UGPB 5A0GA 2BUDA 2CREA 3E9GA 4DBRA 1VYTA 2XDPA 4BI4A 3GNGA 3TREA 4M75G 3BY7A 4JDSA 4IIMA 4Z8AA 3X28B 4C8QD 3SFMA 1HYOA 2DIQA 4M7DC 4N4GA 1QP3A 2LMJA 4J9FA 3OS2A 4E7KA 1FX7A 2P4TA 1NEBA 3OYAA 4GLMA 3T9NA 3KXTA 1W4SA 2ED0A 2CH4A 4FCYA 2EGAA 3A8HB 3HFNA 4PFOA 1I81A 2HKNA 4JPBW 3SEMA 3JSCA 3M0RA 1M4ZA 3VS5A 1OEBA 4JZ4A 1M90U 3RKYA 1QCOA 3SD4A 2LP5A 2O4XA 1JU5C 1VQ8T 4KGZB 2CDTA 5AT1B 2RHXA 2DAQA 1GXIE 3PMTA 2COZA 5L8RE 1GCQC 3I55A 2MF2A 2M1HA 2B86A 3LWHA 3X26B 5C6SA 3RNJA 1G5VA 1ZA2B 5GAOr 4PL6A 3I56T 2DILA 5DM7R 1D3BA 4XU1A 4C0GA 4E2FB 2A7YA 3EFOA 3EFRA 3VRYA 3CCEA 2LDMA 2DTOA 4DBFA 4OMLA 1VQ5T 2VGMA 5GAOl 1K9AA 2VASA 1OU8A 1VQKQ 2JS0A 2VWFA 2HL5C 2E12A 2BZXA 2ROTA 5EC7A 4FYYB 1H8KA 5GANg 1LVKA 2DMOA 3A8MB 4FT4A 1D1AA 2X4WA 2FHDA 4WTOB 4LDUA 1TUCA 4GLKA 2C0TA 1U3OA 4D8KA 2K6DA 2KRNA 1VQKA 2WACA 2DXBA 3E9FA 2QYZA 3M4GA 5D7UA 5GAMg 5GANh 2EYZA 5LJ3e 3VUZA 3CQTA 1UGSB 1ZX6A 1ZUUA 2ED1A 3M53A 3H9NA 5CKEA 2EW3A 5KE2A 3JB9J 1KG1A 2RM4A 1ABOA 1VQLQ 3OYIA 2RO0A 4RMOA 1VQPQ 2CSQA 3L2VA 2DYBA 2LC4A 2ZPBB 1IZ6A 2E64A 2KAFA 3JCMe 4K11A 4LNPA 1PWTA 2RQVA 1M9SA 1U1SA 3UATA 1TUDA 2GTOA 2QI2A 5IXFA 1VQLA 2K4YA 3A8LB 2K2MA 3M54A 3MKDA 4J9HA 1VOMA 2M9UA 1Q81U 4IUVA 4XTZA 4PJOG 4PJJA 2AZVA 4M77G 1S1NA 4MMKA 1W2BP 1HD3A 4JS5A 3RKWA 2CZ1B 2DL5A 4PNOA 2IG0A 4M78C 1TH7A 3QSUA 3V7RA 2KE9A 2F5TX 2RHUA 2EAYA 2P4RA 2I0NA 2RI5A 1C0MA 4MDWA 1KIKA 1M3CA 2HSPA 3V8JA 1K0SA 4J83A 5A0LA 1JXMA 1G3WA 4M7AA 5D6XA 3ZEHA 4KULA 1UFFA 3OYLA 3S6WA 1VYVA 1CKBA 4IUQA 3CCLQ 3CCRQ 1WJQA 1JJ2S 4QQGA 3CC4T 3SWNA 1GBQA 1PSEA 1Q81R 4QT7A 4LE9A 1JRIA 1OULA 2QQRA 2DL8A 1HXDA 2LNVA 5A0DA 3CCMA 1UHCA 3GP8A 1X75C 2XDDA 4ANJA 3JCMP 3CCLA 3EFOB 4C92C 2EQMA 1NJIR 3A5ZB 4JJCA 2CZ7B 1K73R 2ZCFB 4NS5A 2GFUA 2JMAA 3PE0A 2BZYA 2LNHB 4JLGA 5CKHA 4LUEA 2OTLQ 1H641 2FPDA 1NLPC 4JJBA 1PD1A 1R0CB 2YUOA 1HSQA 3CPWS 1Y07A 2QDLA 3MEWA 4F17A 1AZEA 3M5AA 1WX6A 3LYIA 2EWNA 1V1CA 1WXTA 4M78F 2JT4A 4JRIA 4NL2A 1OZ3A 3PT9A 5KYNA 2K57A 1ZSZC 4FIBA 2RHIA 1H3HA 5CCAA 3BDLA 4E7JA 3C0CA 3DB3A 2QGFB 2HZYA 2H8HA 2B8AA 2DF6A 2J05A 4TVRA 1QCNA 2FG0A 5IHNA 2EKOA 2YRVA 3META 1VIEA 3E2UA 1NEGA 4C0DC 1I4K1 2C06A 3ZFJA 1KD1U 3LGFA 2GTJA 2KNBB 3OYKA 2NWMA 3JCMf 3RBBB 4N0AA 1WFWA 2L3PA 1AD5A 1YHQT 5KYWA 3H0HA 3OYGA 4YTLA 1YWPA 3VJPA 3DLMA 3GNFB 3BDUA 3BE3A 1EZZB 3UPUA 3JCMW 3OSSC 1ARKA 2QTVA 4DQ2A 1KFZA 3C12A 2R58A 1Z9ZA 3H41A 2DTIA 4E7HA 3A1PA 2QGGA 5HK0A 4A63B 2LT1A 3WVDB 2E6NA 4DOWA 1KC8C 4C92G 2L8DA 3RMQA 3QDRB 3KUFA 1MHNA 2DBMA 3C4SA 4X9DA 2NUTB 2GBQA 3FB9A 4JLIA 5A2QE 2WSEE 2JM9A 3G71T 4XU3A 1YJ9T 4DBQA 1B07A 2BTTA 1OU9A 3CCQQ 2DX1A 1QKXA 2AKKA 2E5QA 1M90C 3J7AF 4AFUC 2CZ0B 2Y4XA 2GCXA 1VQ8A 2K7AA 4E6RA 4II1A 3M57A 1Q86U 1GL5A 4F7UF 4KRTA 4N0AC 1M2OA 4KGXB 5CR2A 4C92B 1ZBXA 5GAN8 2LJ0A 1XQHA 2QA4Q 5I2SA 2QQAA 4J9DA 1LPLA 2DD5A 2KXCA 2M16A 2V8IA 3OYEA 1JB0E 4KGVB 3HRSA 3CEYA 1QQJA 1OOTA 1JBMA 4P5NA 3L42A 2O2OA 5GJVB 3I56A 3O5ZA 2CP5A 1NPPA 1EX4A 3CBPA 1NYFA 1KHIA 1VQMQ 2HNIA 1D0XA 4M77A 1UUEA 2HSEB 2RB6A 2CUDA 3CC7T 1ZA1B 4BI8B 1D09B 2AHJB 1JQQA 3JV3A 2LQWA 3ME9A 2GQIA 2A3LA 1BBZA 2VC8A 3HHTB 1WPYA 2EGCA 3A8OB 5LJ5d 2W0ZA 4ELYC 4M7AE 1VQNQ 3PIOA 2J6OA 2K5LA 1W1FA 3CD6T 1F1BB 3OYFA 2DEQA 4ZGEB 3M55A 2CSIA 3OYNA 1RL2A 1QVFS 1C6VX 3NTIA 4C8QB 1PM3A 1G8XA 1YWOA 3EFSA 3CCVA 4BDYA 1M1KC 1PKTA 5GAN5 4Z02A 3NPFA 2DXTA 4F04B 4QVZA 3Q1JA 3GOXA 5IHKA 4FSXA 3CCQT 2DJQA 3CC2Q 2RK2A 5GMKj 3E1SA 1M30A 3QUIA 4CRIA 2KBTA 4FSSA 1VQ6Q 2E6ZA 3UA6A 2RMOA 2GFAA 1IHWA 4L5GA 4OVAA 4HT9A 1BKBA 3WXMB 1H3ZA 3NTKA 2XD0A 4CC2A 4JUVA 1RUWA 1Y57A 4M75D 4AG1C 2OAWA 2RQRA 3CBMA 4E47A 1Q81C 4RG8A 4HCBA 1XOVA 3DKMA 2XK0A 1K9MU 2A0FB 1VQ6A 5LJ3g 3QG1A 1N9RA 3JCMd 5LJ5j 1ZQ1A 1NBEB 5GAOm 4C92E 3CCSA 1B7TA 4PJMA 3EH2A 3L1AA 3I5RA 3OYJA 3UWNA 4JZ3A 4LDWA 2D8JA 5CQYA 4XTYA 1WJRA 2JM8A 2QK0A 2P0PA 1SEMA 3RERA 2NLUA 4ZNXA 3L2ZA 3JB9G 4PJOC 4PJLA 5GAN6 1YITT 4JJNK 2COWA 3PFSA 1NPRA 2FPFA 1AWJA 3DB4A 1KQ1A 2FYKA 1VQ4T 2DL7A 3QJYA 2H3EB 1SHGA 3CBOA 4ZTFA 3QO3A 4BE1A 2CP2A 4JRKA 3OY9A 1UEBA 3VS6A 2EVRA 1Y96A 3VS2A 4HCKA 2F2XA 2K2VA 5GAOp 5KYXB 1QVGP 2RI3A 1Q82R 2FB7A 1A0NB 4LDYA 5LJ3d 3TCJA 4EMHA 3ZL7C 1I8FA 4AT1B 2L0AA 2MPXC 3IQLA 2FEIA 1X27A 3VYGA 1SSHA 2EQUA 4M78G 4A4GA 4VUBA 5IXBA 2DVEA 2LJ1A 1XJWB 3SHWA 1WDXA 3NMZC 1KQSA 1J3TA 1FMVA 3THKA 4QQ6A 4M75A 5KCHA 4RTZA 4M78A 4LXCA 4Y92A 1SSFA 3M9QA 1WA7A 5GAOq 4RCBA 4XU0A 2HAXA 2BE9B 2QTXA 1S72A 2RA2A 2AT1B 4R0KA 1U8RA 4M7DB 2DTHA 2CP6A 2DEUA 1BU1A 3CCUQ 4HT8A 3CC4Q 2ZGWA 4BB7A 5LJ3j 4R56A 1YHQA 3LLRA 4PJOA 1K73C 1PHTA 5GMKi 2JN0A 2M0YA 4EMGA 5FRMA 1S72Q 4ZTJA 2OX7A 2RHYA 3M0PA 2A37A 3QZ9B 2YRDA 1QVPA 2VXEA 3EAEA 1PKSA 3CPWA 1YCSB 3GBQA 2J6FA 3AHUA 2PVOB 1RAGB 5FW9A 2EKHA 2DIGA 2MWOA 3JB9I 3MEVA 1MNDA 1MUZA 1FMKA 2DVJA 3RUXA 2QEXA 1K0XA 3OB9A 4NOYA 2EPDA 5HKCA 2FZGB 3H8ZA 2FO0A 4X1VA 5L23A 1KC8U 3KBGA 2DRMA 3VV0A 4LD9K 1GCPA 1RADB 3EG9A 1K8AC 3VKIA 5FU6B 1N8RU 3UT1A 4FU6A 1MMDA 3C94A 3GF5A 1UJ0A 3HL8A 1RLQC 1VA7A 2PUKB 1YIJQ 5GAN2 2MIOA 2DL3A 2COYA 3A8GB 5IAYA 4Q5WA 2M02A 5I21A 2DJZA 3CCST 1IREB 1U06A 2KI7A 4MZPA 1PRLC 4XAXB 7AT1B 4ORZA 2D6FA 4Z89A 1TG0A 1BIBA 1I5LA 1YJWQ 2OTJT 4A4EA 5KYYB 4C92F 4BD3A 5D6WA 1Y0MA 5GAN3 1YN8A 1VQ4Q 1YIJA 1Q7YR 1UG1A 3CPFA 4F7UA 1JJ2A 1IHVA 3QIIA 1OV3A 3HTRA 2O4XB 3CC7Q 1WI7A 4A4HA 2E65A 4OF1A 5CKBA 1YITA 4JRQA 4JJDA 3TSWA 2DXUA 1YJNQ 4M7DD 1NJIC 1VQ4A 2VVKA 4Y28E 1T0HA 4C0FA 1K4US 3CC7A 1SPKA 2YHTA 2BIVA 2XG8D 3QYGB 4IUPA 4PKCC 1BYMA 1AHJB 4PFZA 2EYXA 1YJNA 5GAN7 3CMET 1O75A 4KH1B 2C0IA 1LNXA 1GFCA 2XDBA 1T0JA 2J6KA 4OMMA 4F7UE 4C8QE 5GMKe 3M56A 1RABB 3FEOA 3VS3A 4C8QF 2A08A 4GBQA 1W6XA 2JZ2A 1UECA 3CD6A 1AT1B 3HFOA 1Q7YC 1BCMA 3I55Q 5I11A 3PNWC 1XNIA 3FJPA 1FMWA 2LZ6B 4RTYA 3OYCA 4FW2A 1MGQA 1R0BG 4A54A 4A53A 3SB2A 3OQ5A 2PVGB 3HRUA 1QVFP 2MYSA 3H0IA 3CCEQ 3CD6Q 4EMKA 3FRNA 2QQ9A 4DOVA 3OBYA 2IVWA 4X9CA 3JCMh 4C5HA 1VQ9T 1PRMC 1YJWT 3OBWA 3X24B 1TOVA 2G3RA 1BI0A 4M77C 1HJDA 1UGVA 1HK9A 1G2BA 2IIMA 1QLYA 3R6OA 2QG9B 2MOXA 3OSVA 2GQVA 2NUPB 2ABLA 2G6FX 1EFNA 1K76A 2LCSA 1R77A 2PQWA 3MEUA 3NFCA 3NTHA 3O8VA 1M5Q1 1K9MC 4OMQA 4M77D 1QW1A 1MMNA 2FZCB 1VQ6T 2HQHA 1D1CA 2X3XD 4CC4B 1BI2A 5CQXA 3L2QA 2XICA 1ZHIA 4IIOA 2DNUA 4XTVA 2RH2A 3VS7A 2CZ6B 1MNEA 2QEXT 3MP1A 3V7SA 4BE2A 2R5MA 4RTTA 2KDSA 1N6AA 4M4ZA 1VQLT 1W70A 2BZ8A 1YFNA 1WXBA 1Q82C 3PIPA 4ATOA 1OPKA 4QVDA 3RMSA 3ZBDA 2FZKB 2K79A 4LD6A 3SWNB 2WSCE 3HKSA 1KD1R 2GF7A 4IUTA 3OS1A 3INZA 1ZUYA 5LJ5h 2NUTA 1KHCA 5LJ3f 2O9SA 2XKOC 4OB0B 2YUNA 3N5BB 3V7CA 4M75E 3OS5A 4Y91A 3LGLA 1RI0A 3I55T 1KD1C 4PJOB 1VIFA 1Y71A 3D7SB 1GCQA 3CCUT 5FU7B 2E41A 5GAMe 1WNLA 2GGRA 5GMKh 1PD0A 4DBHA 1KQ2A 2O31A 1E6GA 4XTWA 1GBRA 1X6BA 2E3IA 4E7LA 4F14A 1X6OA 2K5IA 3P8HA 5GAOn 1PC0A 4C5GA 4OGCA 3DLLA 1RAAB 2ATCB 2DD4A 5J26A 3QPHA 4NL3A 2K9GA 4RTWA 1VQ5Q 1SRLA 3JCMQ 3CMEQ 4RTUA 2KT8A 2V1RA 4M7AG 4XQ3A 2E70A 4HXJA 2K5FA 4HCCA 3M0QA 1LOJA 4E7IA 3BW1A 1D1BA 4UC4A 1I0CA 2F69A 4E7ZA 2CUBA 1N27A 4M7AD 1VQOA 2J7IA 2O9VA 1CKAA 5DLOA 1NLOC 2ZPEB 2V8KA 2ZPGB 3EH1A 4M75F 2I2LA 2K3YA 1YJNT 1OPLA 1WHLA 1VQ5A 3CCRA 3CMEA 2CS7A 4Z88A 2VKNA 1M1GA 3RIRA 2MAMA 1WHJA 1PCXA 2FVUA 1SG5A 4RKUE 1X2QA 3S3MA 4RTXA 4ESRA 1M2VA 4EIKA 4AMCA 4FYXB 5LL6S 3SDZA 1VQOQ 3EGXA 2EBPA 1M2VB 3CCMQ 2LX9A 3NGPA 1Q86C 4WCIA 2F1LA 4J6YA 4E7SA 2RQUA 2JVVA 2YUPA 4F7UB 5I22A 1V76A 3VUBA 1C1AA 4DA4A 1WHGA 1QVFA 3CXCP 3CCJA 2KRSA 1D0ZA 2OTLA 2HMAA 2JS2A 2XHCA 4EPCA 4HA8A 1U5SA 2DA9A 1DJ7B 2LCLA 1ZSGA 4N4HA 3X25B 2RJFA 1VQ9A 1N5ZA 1K9MR 4HKEA 3ULRB 2EYWA 2D9TA 3CCJQ 2ESWA 4GY5A 1K8AU 3OW2S 2PZ1A 2YT6A 1H92A 3ASKA 2KK4A 3REBB 2E1HA 3V8LA 2EJ9A 4FYWB 3OW2A 5GAMj 2EFIA 2V26A 1IGUA 1IXDA 1VQ9Q 2KSSA 4A4FA 4XTXA 5EG2A 1WYXA 4M7AF 3QHSA 3V8KA 5CIUA 5FU6C 3M0TA 2LVMA 2E10A 4OB1B 1QMCA 1UHFA 5IH2A 2HD0A 3OS0A 3OMGA 2X35A 4PJOD 1YIJT 3CC2T 4EMKB 1FXXA 5M9OA 1QCFA 3EGDA 3CCLT 4C92A 5ECAA 4QQDA 5LJ5e 4BUGA 2F5KA 2HKQB 3TSZA 1M90R 3VU3C 1RAIB 2KGTA 3JCMJ 3G7ZA 1WHKA 2EQIA 1NJIU 3EG0A 4F16A 2RN8A 1YBYA 2RJCA 1BI1A 2CGHA 5J39A 2QQBA 2RD1A 1ACMB 4JS4A 5HK3A 1VQPA 1VQ7T 2KYMA 5GAMd 2Y4YA 3ER0A 4DEYA 2QASA 1NG2A 1CSKA 3RKXA 1GFDA 1ZSZB 2MWPA 3SWNC 2LX7A 2EQJA 1I5OB 5CVIA 2SEMA 4L6V5 1M8VA 1BB9A 3U23A 2X4XA 1I07A 3JB9F 4M7AC 2RQTA 1VQ8Q 3P8DA 3M0SA 1R8OB 4OB2B 1SHFA 4ELZC 1G3SA 1FYNA 5HY6A 3M59A 3QYHB 2JJ9A 4F7UG 1NYGA 1BI3A 4M7DG 2DO3A 3QJ6A 3UDCA 3LW5E 5C0MA 2VGNA 2QA4T 2YSQA 5KH6A 5KYUB 2R57A 1WQ7A 3EGXB 1UE9A 1WGSA 2PVDB 1VQNT 2CKKA 4J9GA 1WZOA 4PK4A 4LUDA 1I1JA 4IKFA 4MZTA 1OZ2A 2CP3A 2YDLA 1IB8A 2EJFA 3FC3A 2HCKA 4XK8E 1M1KR 3L2WA 4FM4B 1AWWA 2KYBA 2OI3A 4KBMB 3CCJT 4L59A 2AKLA 1VQMT 1NM7A 3UA7A 2LRQA 5GAMf 4AG2C 3WVEB 4C92D 2HQEA 3LX7A 4XTUA 3JCMV 1WXUA 3RDVA 1ZUKA 2QDYB 2OTLT 4EDUA 2EYYA 4RUGA 3JB9D 1OI1A 3HSBA 2EYQA 3MP6A 3OYMA 1SF9A 1TTHB 2NUZA 3S3NA 4J8OA 4M77B 2KXDA 3TQ7P 2E5KA 1VQNA 2DL4A 3C95A 4B9XA 1KQSP 1AOJA 1T3SA 4KH0B 4OMOA 3G4ST 3OYDA 2F2VA 1QKWA 8AT1B 4B6MA 4BY6C 1KJWA 2DK3A 3QBYA 1OYXA 1WJSA 1UB4A 1VUBA 3EG1A 4N4IA 3PMIA 4V2SA 4D8DA 1AEYA 4KUIA 3A98A 5CKDA 1Y7XA 2LTOA 2DPPB 2JXBA 5LJ5f 1RLPC 4HVWA 3I35A 4LDXA 2R5AA 3CC2A 3OW2P 6AT1B 2OJ2A 2MCNA 2QXFA 2RHZA 3OA6A 3VYHB 4LDVA 2M0OA 4FYVB 2RPNA 2W10A 1K73U 2DM1A 2DRKA 2XIDA 3L2RA 2D0NA 4D6WA 2ZPFB 3PTAA 3JRZA 3QXEB 2NUPA 3RESA 1ZBJA 3I5SA 5GJWB 1SKUB 1B3QA 2FL7A 2JMCA 3CCSQ 1KQSS 3FJ5A 1BIAA 2L3QA 1VQ7A 4A4KA 2P84A 2AZSA 4MDXA 4WF2A 5I2MA 5FWBA 1MV3A 2CP7A 4M75B 1G83A 2JNGA 1K1ZA 2HDAA 2DBKA 2AK5A 4BI3A 3MEAA 1QVGS 4ZN3A 4J9IA 1N8RC 2ROLA 1ABQA 2VUBA 4J6XA 3CCVT 1WLPB 1VQ7Q 1M3BA 3G1JA 1E6HA 1VQPT 4MZMA 4M77F 5FU7C 3MO8A 3LH5A 5GANf 1TS9A 2NYSA 2RJEA 4RCCA 1RAEB 3HPWA 2HBPA 3OMCA 4RG2A 5FRNA 4QVCA 1IGQA 2Y90A 2LCCA 4M78E 1LJOA 4M7DA 2KROA 1O9SA 4AFZC 3PVQA 1AWOA 3CMAQ 4X34A 3CCQA 2VV5A 3KFVA 2BKDN 3FDRA 5KYWB 3L2UA 2OAUA 3GLXA 3OYBA 3OYHA 1N9SA 4FT2A 3FLGA 1X6GA 2E4HA 5KCOA 3AT1B 1VQKT 4PJNA 3EGUA 1WHHA 3G6ET 3CMAA 2O01E 3RR6A 1IO6A 4JRPA 2CT3A 4BACA 2FRYA 2YWWA 5IT9E 4J7IA 2DYIA 3J80E 2QA4A 1KC8R 4ZGJB 1Q95G 2DE0X 1NE8A 4CC3A 1Z9QA 4FW1A 1S72T 2L5QA 1YCYA 2CH4W 3I56Q 3EG2A 1MMAA 4M78B 1Q86R 1M8MA 1YI2A 2H3JA 2KRMA 4C0ZA 1WHMA 2EIFA 4OP0A 1VQMA 2JW4A 3QZ5B 1YHQQ 5D6YA 2X4JA 4IURA 4J9BA 1Q7YU 2X3WD 4J9EA 2CP0A 2IPOB 4AFSC 1X69A 2HQXA 3MP8A 5J3BA 3REAB 4ME7A 1X43A 1ZLMA 2D0QB 3M4YA 4CI0C 1YI2Q 5LJ3h 3UF4A 5GANe 9ATCB 4M78D 2K3BA 2MI6A 1QP2A 2LJ3A 1VQOT 1GRIA 1P92A 3CCVQ 2QEXQ 2WSFE 1IRXA 4HVUA 4OMPA 2D8HA 1G3YA 4DEXA 1E7OA 2DXCA 2DFUA 3MJXA 4M75C 2RF0A 4MMLA 3JCMb 1TUGB 1TU0B 2JUFA 2ZPIB 3CXCA 2FRWA 2YRCA 4PLIA 4KUDK 3X20B 2KT1A 1XTDA 3CXCS 1QWFA 1SRMA 2QAZA 4M7DE 3EGDB 5DLQE 5DY9A 4BE0A 4O5VA 2CT4A 2PNIA 2AIRB 4PFPA 1AZGB 1Q82U 5AYFA 1OX9A 4CC7A 8ATCB 3M58A 4C5EA 4PLLA 5GANd 2KVQG 1RACB 3VS1A 2KY9A 2HL3A 1M27C 1AWXA 1YITQ 3E19A 2O88A 3GPLA 2SRCA 3MHXA 2J06A 1JXOA 3F70A 3P8BB 2YUQA 1D0YA 3J81E 2EQKA 3HRTA 5CO7A 4J7FA 2Z0WA 2VYTA 2JTEA 4ZGDB 4M77E 3PGGA 1RI9A 4PJOE 2RK1A 2YLCA 2X51A 2D1XA 2JOYA 3TEEA 5KYXA 1K8AR 2KR3A 4PJOF 1U1TA 2DLPA 3NHNA 3G4SQ 3EG9B 4J9CA 3MPUB 3EHQA 1X2KA 4LN2A 5CK9A 1KK7A 2E3HA 1PG5B 4C8QG 3S3OA 2L2PA 3EG3A 1OX8A 1RAHB 2F2WA 1JJ2P 2C0OA 2PTKA 2L89A 2QQSA 2PUOB 3G4SA 4XU2A 2V8JA 5GANj 5FLXE 2YXYA 1AVZC 5GMKm 4OB3B 2DZ9A 2L3RA 4O6JA 1FWZA 1BK2A 1EIFA 1QVGA 1VYUA 1M1FA 1N8RR 3JAME 3H6ZA 5CAIA 3JCMX 5LJ5g 2DETA 1UJYA 3I9QA 2X4YA 2L3SA 2YLBA 4BY6B 2XI9A 1W2BA 2A28A 5FWCA 3H0FA 3LH0A 5HCKA 3JB9H 3URGA 3VRZA 1W2BS 1RAFB 2OTJQ 2RNAA 1YI2T 1V29B 2CYZB 1M1KU 3CCET 4ZN1A 1Y96B 1NZ9A 2RQWA 2BE7D 3CCMT 2X9HA 4IUUA 1BCOA 4OMNA 3QWXX 3BFMA 4FL6A 1UGQB 4C5IA 4KT0E 2HEQA 3JCMc 3CCUA 4AFQC 5KYYA 2LQ8A 2OTJA 3CC4A 1LCKA 2RI2A 3CPWP 3TVTA 4OGEA 2P0QA 2LQNA 2M51A 2V1QA 2VB6A 3GIBA 3G71Q 2FPEA 3QKJA 4EMKC 4R55A 5GMKl 3R6NA 4HVVA 5KE3A 3TU4K 2GNCA 3VS0A 4B9WA 1B34B 4RTVA 5IN1A 4C8QC 3QWYA 1UDLA 2HBWA 2PU9B 5IHIA 2KEAA 1OQKA 1B34A 3JCMg 4BDZA 2RJDA 1ZSZA 1WQWA 1X01A 2ZPHB 2K3XA 3G71A 3G6EQ 1YJ9A 1JEGA 1JO8A 1WIEA 2KMTA 2ZZDA 1MV0B 3VS4A 3M0UA 4OMFB
chains in the Genus database with same CATH topology
2JM9A 3EG1A 1UECA 1B07A 1YP5A 2BTTA 4D8DA 1AEYA 2DX1A 1QKXA 3A98A 2AKKA 2EGEA 2JXBA 1RLPC 4HVWA 3I35A 4AFUC 1QWEA 5I11A 2K7AA 2LZ6B 2OJ2A 4RTYA 2MCNA 2ENMA 4E6RA 2ECZA 3EHRA 1GL5A 4KRTA 2XMFA 2RPNA 2W10A 1YNZA 3H0IA 2DM1A 1T3LA 2DRKA 1M3AA 1UTIA 1PNJA 1PRMC 1KSWA 2A36A 2D0NA 2LJ0A 3PVLA 4J9DA 2KXCA 1ZBJA 3I5SA 1HJDA 1UGVA 1OOTA 1G2BA 2IIMA 1QLYA 5GJWB 1B3QA 2MOXA 2JMCA 2ABLA 2G6FX 1EFNA 1K76A 3FJ5A 2O2OA 2LCSA 2L3QA 5GJVB 2CREA 2AZSA 4OMQA 1VYTA 3O5ZA 5FWBA 1MV3A 2X3XD 4CC4B 4IIMA 4Z8AA 1NYFA 1G83A 1K1ZA 2HDAA 2DBKA 2AK5A 1UUEA 4IIOA 2DNUA 2LMJA 4J9FA 2CUDA 4J9IA 3VS7A 2ROLA 1ABQA 1NEBA 4GLMA 1WLPB 1JQQA 2ED0A 2LQWA 3JV3A 2GQIA 2CH4A 2EGAA 1M3BA 1BBZA 4RTTA 1E6HA 4M4ZA 1W70A 2BZ8A 2EGCA 1WXBA 2W0ZA 3LH5A 1OPKA 4JPBW 2J6OA 3SEMA 3M0RA 2K79A 1W1FA 3VS5A 1OEBA 2CSIA 4JZ4A 1ZUYA 1YWOA 2LP5A 2O9SA 1JU5C 1PKTA 2YUNA 3NPFA 2KROA 2CDTA 4AFZC 3PVQA 1AWOA 5IHKA 3KFVA 1GCQA 1GCQC 2DJQA 2B86A 1M30A 2GGRA 2KBTA 3RNJA 2O31A 4FSSA 3UA6A 1E6GA 1GBRA 1X6GA 2RMOA 2DILA 1X6BA 4F14A 3EGUA 3VRYA 4CC2A 1RUWA 1IO6A 1Y57A 2CT3A 2FRYA 4OMLA 4AG1C 2OAWA 2RQRA 2K9GA 4RTWA 1SRLA 4RTUA 1XOVA 2KT8A 1K9AA 2V1RA 2DE0X 4CC3A 4HXJA 3M0QA 1Z9QA 2JS0A 1I0CA 2VWFA 2CUBA 2BZXA 2ROTA 5EC7A 2CH4W 2J7IA 2O9VA 1CKAA 3I5RA 1NLOC 3EG2A 1H8KA 4JZ3A 2DMOA 2D8JA 1M8MA 2JM8A 1TUCA 2KRMA 1OPLA 1SEMA 2C0TA 1U3OA 4D8KA 4Z88A 2K6DA 2JW4A 2VKNA 2KRNA 4ZNXA 1X2QA 4J9BA 4RTXA 4ESRA 4EIKA 2FPFA 1AWJA 2EYZA 2X3WD 4J9EA 3CQTA 1X69A 1ZX6A 2EBPA 4AFSC 1ZUUA 2ED1A 3REAB 1X43A 3NGPA 1ZLMA 2EW3A 2DL7A 4WCIA 1SHGA 3UF4A 2RQUA 1ABOA 2YUPA 5I22A 3VS6A 2EVRA 2K3BA 3VS2A 2LJ3A 4HCKA 2F2XA 1GRIA 2CSQA 2DYBA 2KRSA 1A0NB 2JS2A 4HVUA 4OMPA 3ZL7C 2D8HA 4DEXA 4K11A 1U5SA 4LNPA 1E7OA 2DA9A 1PWTA 2RQVA 2L0AA 1ZSGA 3IQLA 2FEIA 3UATA 1TUDA 1X27A 2RF0A 1N5ZA 1SSHA 2GTOA 5IXFA 3ULRB 2K2MA 2EYWA 4J9HA 5IXBA 2ESWA 2LJ1A 3SHWA 1WDXA 3NMZC 2PZ1A 2YT6A 1H92A 2FRWA 2AZVA 1S1NA 3REBB 1J3TA 1HD3A 2KT1A 3THKA 1QWFA 1SRMA 2DL5A 4RTZA 1WYXA 2CT4A 2KE9A 2PNIA 3M0TA 4Y92A 1AZGB 2P4RA 1UHFA 2I0NA 1WA7A 4CC7A 1KIKA 1M3CA 2HSPA 5IH2A 1K0SA 1JXMA 3VS1A 4R0KA 1M27C 1AWXA 1UFFA 2O88A 1VYVA 1BU1A 1CKBA 1QCFA 2SRCA 2J06A 1JXOA 5ECAA 2YUQA 1GBQA 1PHTA 4QT7A 3TSZA 2JTEA 4LE9A 2M0YA 2KGTA 1RI9A 2DL8A 2D1XA 3M0PA 2EQIA 2A37A 1UHCA 3EG0A 4F16A 2KR3A 2RN8A 1PKSA 2DLPA 3NHNA 1YCSB 4J9CA 3GBQA 2J6FA 4JJCA 3EHQA 5FW9A 2EKHA 1X2KA 2JMAA 3PE0A 2BZYA 2LNHB 4LN2A 1MUZA 2KYMA 1FMKA 2DVJA 4LUEA 4DEYA 1K0XA 2EPDA 2FPDA 2L2PA 3EG3A 1NLPC 4JJBA 2F2WA 1CSKA 1NG2A 2FO0A 2C0OA 4X1VA 2YUOA 5L23A 1GFDA 1HSQA 2PTKA 2LX7A 2QDLA 2DRMA 4F17A 1GCPA 2SEMA 1AZEA 1BB9A 1WX6A 3U23A 1I07A 1V1CA 1WXTA 1UJ0A 1AVZC 2JT4A 1RLQC 1VA7A 2RQTA 1BK2A 1VYUA 2MIOA 2DL3A 3M0SA 1SHFA 1FYNA 1UJYA 1U06A 3I9QA 2L3SA 1H3HA 1NYGA 1PRLC 4ORZA 2A28A 5FWCA 3C0CA 3H0FA 5HCKA 1TG0A 4Z89A 2H8HA 2DF6A 2J05A 3VRZA 2YSQA 2FG0A 5IHNA 2RNAA 1UE9A 1Y0MA 4J9GA 1YN8A 4LUDA 1NEGA 1I1JA 2RQWA 1UG1A 2YDLA 1OV3A 2HCKA 2GTJA 2KNBB 2NWMA 3QWXX 4OMNA 3RBBB 1WI7A 1AWWA 2KYBA 2OI3A 1WFWA 2AKLA 1NM7A 4JJDA 2HEQA 2L3PA 3TSWA 4AFQC 1AD5A 1LCKA 3UA7A 3H0HA 4AG2C 3TVTA 2LQNA 2M51A 2V1QA 1YWPA 2FPEA 2VVKA 1WXUA 1ZUKA 3R6NA 4HVVA 1T0HA 2GNCA 3VS0A 1ARKA 1K4US 1SPKA 1KFZA 2EYYA 4RUGA 4RTVA 3QWYA 1Z9ZA 1UDLA 2HBWA 3H41A 5IHIA 2NUZA 2KEAA 2EYXA 4A63B 2KXDA 2E5KA 2DL4A 2C0IA 1GFCA 1T0JA 1AOJA 2J6KA 4OMMA 1T3SA 4OMOA 1JEGA 1JO8A 2F2VA 1QKWA 1WIEA 1KJWA 2DBMA 1MV0B 3VS4A 3M0UA 3VS3A 2GBQA 2A08A 4GBQA 1W6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JM9 A;  3EG1 A;  1UEC A;  1B07 A;  1YP5 A;  2BTT A;  4D8D A;  1AEY A;  2DX1 A;  1QKX A;  3A98 A;  2AKK A;  2EGE A;  2JXB A;  1RLP C;  4HVW A;  3I35 A;  4AFU C;  1QWE A;  5I11 A;  2K7A A;  2LZ6 B;  2OJ2 A;  4RTY A;  2MCN A;  2ENM A;  4E6R A;  2ECZ A;  3EHR A;  1GL5 A;  4KRT A;  2XMF A;  2RPN A;  2W10 A;  1YNZ A;  3H0I A;  2DM1 A;  1T3L A;  2DRK A;  1M3A A;  1UTI A;  1PNJ A;  1PRM C;  1KSW A;  2A36 A;  2D0N A;  2LJ0 A;  3PVL A;  4J9D A;  2KXC A;  1ZBJ A;  3I5S A;  1HJD A;  1UGV A;  1OOT A;  1G2B A;  2IIM A;  1QLY A;  5GJW B;  1B3Q A;  2MOX A;  2JMC A;  2ABL A;  2G6F X;  1EFN A;  1K76 A;  3FJ5 A;  2O2O A;  2LCS A;  2L3Q A;  5GJV B;  2CRE A;  2AZS A;  4OMQ A;  1VYT A;  3O5Z A;  5FWB A;  1MV3 A;  2X3X D;  4CC4 B;  4IIM A;  4Z8A A;  1NYF A;  1G83 A;  1K1Z A;  2HDA A;  2DBK A;  2AK5 A;  1UUE A;  4IIO A;  2DNU A;  2LMJ A;  4J9F A;  2CUD A;  4J9I A;  3VS7 A;  2ROL A;  1ABQ A;  1NEB A;  4GLM A;  1WLP B;  1JQQ A;  2ED0 A;  2LQW A;  3JV3 A;  2GQI A;  2CH4 A;  2EGA A;  1M3B A;  1BBZ A;  4RTT A;  1E6H A;  4M4Z A;  1W70 A;  2BZ8 A;  2EGC A;  1WXB A;  2W0Z A;  3LH5 A;  1OPK A;  4JPB W;  2J6O A;  3SEM A;  3M0R A;  2K79 A;  1W1F A;  3VS5 A;  1OEB A;  2CSI A;  4JZ4 A;  1ZUY A;  1YWO A;  2LP5 A;  2O9S A;  1JU5 C;  1PKT A;  2YUN A;  3NPF A;  2KRO A;  2CDT A;  4AFZ C;  3PVQ A;  1AWO A;  5IHK A;  3KFV A;  1GCQ A;  1GCQ C;  2DJQ A;  2B86 A;  1M30 A;  2GGR A;  2KBT A;  3RNJ A;  2O31 A;  4FSS A;  3UA6 A;  1E6G A;  1GBR A;  1X6G A;  2RMO A;  2DIL A;  1X6B A;  4F14 A;  3EGU A;  3VRY A;  4CC2 A;  1RUW A;  1IO6 A;  1Y57 A;  2CT3 A;  2FRY A;  4OML A;  4AG1 C;  2OAW A;  2RQR A;  2K9G A;  4RTW A;  1SRL A;  4RTU A;  1XOV A;  2KT8 A;  1K9A A;  2V1R A;  2DE0 X;  4CC3 A;  4HXJ A;  3M0Q A;  1Z9Q A;  2JS0 A;  1I0C A;  2VWF A;  2CUB A;  2BZX A;  2ROT A;  5EC7 A;  2CH4 W;  2J7I A;  2O9V A;  1CKA A;  3I5R A;  1NLO C;  3EG2 A;  1H8K A;  4JZ3 A;  2DMO A;  2D8J A;  1M8M A;  2JM8 A;  1TUC A;  2KRM A;  1OPL A;  1SEM A;  2C0T A;  1U3O A;  4D8K A;  4Z88 A;  2K6D A;  2JW4 A;  2VKN A;  2KRN A;  4ZNX A;  1X2Q A;  4J9B A;  4RTX A;  4ESR A;  4EIK A;  2FPF A;  1AWJ A;  2EYZ A;  2X3W D;  4J9E A;  3CQT A;  1X69 A;  1ZX6 A;  2EBP A;  4AFS C;  1ZUU A;  2ED1 A;  3REA B;  1X43 A;  3NGP A;  1ZLM A;  2EW3 A;  2DL7 A;  4WCI A;  1SHG A;  3UF4 A;  2RQU A;  1ABO A;  2YUP A;  5I22 A;  3VS6 A;  2EVR A;  2K3B A;  3VS2 A;  2LJ3 A;  4HCK A;  2F2X A;  1GRI A;  2CSQ A;  2DYB A;  2KRS A;  1A0N B;  2JS2 A;  4HVU A;  4OMP A;  3ZL7 C;  2D8H A;  4DEX A;  4K11 A;  1U5S A;  4LNP A;  1E7O A;  2DA9 A;  1PWT A;  2RQV A;  2L0A A;  1ZSG A;  3IQL A;  2FEI A;  3UAT A;  1TUD A;  1X27 A;  2RF0 A;  1N5Z A;  1SSH A;  2GTO A;  5IXF A;  3ULR B;  2K2M A;  2EYW A;  4J9H A;  5IXB A;  2ESW A;  2LJ1 A;  3SHW A;  1WDX A;  3NMZ C;  2PZ1 A;  2YT6 A;  1H92 A;  2FRW A;  2AZV A;  1S1N A;  3REB B;  1J3T A;  1HD3 A;  2KT1 A;  3THK A;  1QWF A;  1SRM A;  2DL5 A;  4RTZ A;  1WYX A;  2CT4 A;  2KE9 A;  2PNI A;  3M0T A;  4Y92 A;  1AZG B;  2P4R A;  1UHF A;  2I0N A;  1WA7 A;  4CC7 A;  1KIK A;  1M3C A;  2HSP A;  5IH2 A;  1K0S A;  1JXM A;  3VS1 A;  4R0K A;  1M27 C;  1AWX A;  1UFF A;  2O88 A;  1VYV A;  1BU1 A;  1CKB A;  1QCF A;  2SRC A;  2J06 A;  1JXO A;  5ECA A;  2YUQ A;  1GBQ A;  1PHT A;  4QT7 A;  3TSZ A;  2JTE A;  4LE9 A;  2M0Y A;  2KGT A;  1RI9 A;  2DL8 A;  2D1X A;  3M0P A;  2EQI A;  2A37 A;  1UHC A;  3EG0 A;  4F16 A;  2KR3 A;  2RN8 A;  1PKS A;  2DLP A;  3NHN A;  1YCS B;  4J9C A;  3GBQ A;  2J6F A;  4JJC A;  3EHQ A;  5FW9 A;  2EKH A;  1X2K A;  2JMA A;  3PE0 A;  2BZY A;  2LNH B;  4LN2 A;  1MUZ A;  2KYM A;  1FMK A;  2DVJ A;  4LUE A;  4DEY A;  1K0X A;  2EPD A;  2FPD A;  2L2P A;  3EG3 A;  1NLP C;  4JJB A;  2F2W A;  1CSK A;  1NG2 A;  2FO0 A;  2C0O A;  4X1V A;  2YUO A;  5L23 A;  1GFD A;  1HSQ A;  2PTK A;  2LX7 A;  2QDL A;  2DRM A;  4F17 A;  1GCP A;  2SEM A;  1AZE A;  1BB9 A;  1WX6 A;  3U23 A;  1I07 A;  1V1C A;  1WXT A;  1UJ0 A;  1AVZ C;  2JT4 A;  1RLQ C;  1VA7 A;  2RQT A;  1BK2 A;  1VYU A;  2MIO A;  2DL3 A;  3M0S A;  1SHF A;  1FYN A;  1UJY A;  1U06 A;  3I9Q A;  2L3S A;  1H3H A;  1NYG A;  1PRL C;  4ORZ A;  2A28 A;  5FWC A;  3C0C A;  3H0F A;  5HCK A;  1TG0 A;  4Z89 A;  2H8H A;  2DF6 A;  2J05 A;  3VRZ A;  2YSQ A;  2FG0 A;  5IHN A;  2RNA A;  1UE9 A;  1Y0M A;  4J9G A;  1YN8 A;  4LUD A;  1NEG A;  1I1J A;  2RQW A;  1UG1 A;  2YDL A;  1OV3 A;  2HCK A;  2GTJ A;  2KNB B;  2NWM A;  3QWX X;  4OMN A;  3RBB B;  1WI7 A;  1AWW A;  2KYB A;  2OI3 A;  1WFW A;  2AKL A;  1NM7 A;  4JJD A;  2HEQ A;  2L3P A;  3TSW A;  4AFQ C;  1AD5 A;  1LCK A;  3UA7 A;  3H0H A;  4AG2 C;  3TVT A;  2LQN A;  2M51 A;  2V1Q A;  1YWP A;  2FPE A;  2VVK A;  1WXU A;  1ZUK A;  3R6N A;  4HVV A;  1T0H A;  2GNC A;  3VS0 A;  1ARK A;  1K4U S;  1SPK A;  1KFZ A;  2EYY A;  4RUG A;  4RTV A;  3QWY A;  1Z9Z A;  1UDL A;  2HBW A;  3H41 A;  5IHI A;  2NUZ A;  2KEA A;  2EYX A;  4A63 B;  2KXD A;  2E5K A;  2DL4 A;  2C0I A;  1GFC A;  1T0J A;  1AOJ A;  2J6K A;  4OMM A;  1T3S A;  4OMO A;  1JEG A;  1JO8 A;  2F2V A;  1QKW A;  1WIE A;  1KJW A;  2DBM A;  1MV0 B;  3VS4 A;  3M0U A;  3VS3 A;  2GBQ A;  2A08 A;  4GBQ A;  1W6X A; 
#chains in the Genus database with same CATH topology
 1PSF A;  4M7A B;  4C0D B;  2DZC A;  1YP5 A;  2XU8 A;  4QW2 A;  3LWI A;  2DER A;  3CCR T;  2EGE A;  4J5Y A;  2ZAE A;  1QWE A;  4C8Q A;  3HP9 A;  3G6E A;  3CMA T;  1YJ9 Q;  3OYY A;  5KYU A;  2ENM A;  3MCA B;  2ECZ A;  1TSF A;  3EHR A;  2KQW A;  2XMF A;  1D3B B;  3QDF A;  2P0K A;  1YNZ A;  4M7D F;  2MMP A;  1T3L A;  5CKF A;  1M3A A;  2MK5 A;  2DKG A;  1UTI A;  2EJG A;  1YJW A;  1PNJ A;  1KSW A;  1UGR B;  2A36 A;  4QKU A;  5FRO A;  2JTF A;  3PVL A;  2LT4 A;  1TXQ A;  2VXF A;  1TWB A;  1MMG A;  5GAM h;  2JTM A;  4HCZ A;  3FIF A;  1G3T A;  2LQK A;  4J6W A;  5GAN 4;  1UGP B;  5A0G A;  2BUD A;  2CRE A;  3E9G A;  4DBR A;  1VYT A;  2XDP A;  4BI4 A;  3GNG A;  3TRE A;  4M75 G;  3BY7 A;  4JDS A;  4IIM A;  4Z8A A;  3X28 B;  4C8Q D;  3SFM A;  1HYO A;  2DIQ A;  4M7D C;  4N4G A;  1QP3 A;  2LMJ A;  4J9F A;  3OS2 A;  4E7K A;  1FX7 A;  2P4T A;  1NEB A;  3OYA A;  4GLM A;  3T9N A;  3KXT A;  1W4S A;  2ED0 A;  2CH4 A;  4FCY A;  2EGA A;  3A8H B;  3HFN A;  4PFO A;  1I81 A;  2HKN A;  4JPB W;  3SEM A;  3JSC A;  3M0R A;  1M4Z A;  3VS5 A;  1OEB A;  4JZ4 A;  1M90 U;  3RKY A;  1QCO A;  3SD4 A;  2LP5 A;  2O4X A;  1JU5 C;  1VQ8 T;  4KGZ B;  2CDT A;  5AT1 B;  2RHX A;  2DAQ A;  1GXI E;  3PMT A;  2COZ A;  5L8R E;  1GCQ C;  3I55 A;  2MF2 A;  2M1H A;  2B86 A;  3LWH A;  3X26 B;  5C6S A;  3RNJ A;  1G5V A;  1ZA2 B;  5GAO r;  4PL6 A;  3I56 T;  2DIL A;  5DM7 R;  1D3B A;  4XU1 A;  4C0G A;  4E2F B;  2A7Y A;  3EFO A;  3EFR A;  3VRY A;  3CCE A;  2LDM A;  2DTO A;  4DBF A;  4OML A;  1VQ5 T;  2VGM A;  5GAO l;  1K9A A;  2VAS A;  1OU8 A;  1VQK Q;  2JS0 A;  2VWF A;  2HL5 C;  2E12 A;  2BZX A;  2ROT A;  5EC7 A;  4FYY B;  1H8K A;  5GAN g;  1LVK A;  2DMO A;  3A8M B;  4FT4 A;  1D1A A;  2X4W A;  2FHD A;  4WTO B;  4LDU A;  1TUC A;  4GLK A;  2C0T A;  1U3O A;  4D8K A;  2K6D A;  2KRN A;  1VQK A;  2WAC A;  2DXB A;  3E9F A;  2QYZ A;  3M4G A;  5D7U A;  5GAM g;  5GAN h;  2EYZ A;  5LJ3 e;  3VUZ A;  3CQT A;  1UGS B;  1ZX6 A;  1ZUU A;  2ED1 A;  3M53 A;  3H9N A;  5CKE A;  2EW3 A;  5KE2 A;  3JB9 J;  1KG1 A;  2RM4 A;  1ABO A;  1VQL Q;  3OYI A;  2RO0 A;  4RMO A;  1VQP Q;  2CSQ A;  3L2V A;  2DYB A;  2LC4 A;  2ZPB B;  1IZ6 A;  2E64 A;  2KAF A;  3JCM e;  4K11 A;  4LNP A;  1PWT A;  2RQV A;  1M9S A;  1U1S A;  3UAT A;  1TUD A;  2GTO A;  2QI2 A;  5IXF A;  1VQL A;  2K4Y A;  3A8L B;  2K2M A;  3M54 A;  3MKD A;  4J9H A;  1VOM A;  2M9U A;  1Q81 U;  4IUV A;  4XTZ A;  4PJO G;  4PJJ A;  2AZV A;  4M77 G;  1S1N A;  4MMK A;  1W2B P;  1HD3 A;  4JS5 A;  3RKW A;  2CZ1 B;  2DL5 A;  4PNO A;  2IG0 A;  4M78 C;  1TH7 A;  3QSU A;  3V7R A;  2KE9 A;  2F5T X;  2RHU A;  2EAY A;  2P4R A;  2I0N A;  2RI5 A;  1C0M A;  4MDW A;  1KIK A;  1M3C A;  2HSP A;  3V8J A;  1K0S A;  4J83 A;  5A0L A;  1JXM A;  1G3W A;  4M7A A;  5D6X A;  3ZEH A;  4KUL A;  1UFF A;  3OYL A;  3S6W A;  1VYV A;  1CKB A;  4IUQ A;  3CCL Q;  3CCR Q;  1WJQ A;  1JJ2 S;  4QQG A;  3CC4 T;  3SWN A;  1GBQ A;  1PSE A;  1Q81 R;  4QT7 A;  4LE9 A;  1JRI A;  1OUL A;  2QQR A;  2DL8 A;  1HXD A;  2LNV A;  5A0D A;  3CCM A;  1UHC A;  3GP8 A;  1X75 C;  2XDD A;  4ANJ A;  3JCM P;  3CCL A;  3EFO B;  4C92 C;  2EQM A;  1NJI R;  3A5Z B;  4JJC A;  2CZ7 B;  1K73 R;  2ZCF B;  4NS5 A;  2GFU A;  2JMA A;  3PE0 A;  2BZY A;  2LNH B;  4JLG A;  5CKH A;  4LUE A;  2OTL Q;  1H64 1;  2FPD A;  1NLP C;  4JJB A;  1PD1 A;  1R0C B;  2YUO A;  1HSQ A;  3CPW S;  1Y07 A;  2QDL A;  3MEW A;  4F17 A;  1AZE A;  3M5A A;  1WX6 A;  3LYI A;  2EWN A;  1V1C A;  1WXT A;  4M78 F;  2JT4 A;  4JRI A;  4NL2 A;  1OZ3 A;  3PT9 A;  5KYN A;  2K57 A;  1ZSZ C;  4FIB A;  2RHI A;  1H3H A;  5CCA A;  3BDL A;  4E7J A;  3C0C A;  3DB3 A;  2QGF B;  2HZY A;  2H8H A;  2B8A A;  2DF6 A;  2J05 A;  4TVR A;  1QCN A;  2FG0 A;  5IHN A;  2EKO A;  2YRV A;  3MET A;  1VIE A;  3E2U A;  1NEG A;  4C0D C;  1I4K 1;  2C06 A;  3ZFJ A;  1KD1 U;  3LGF A;  2GTJ A;  2KNB B;  3OYK A;  2NWM A;  3JCM f;  3RBB B;  4N0A A;  1WFW A;  2L3P A;  1AD5 A;  1YHQ T;  5KYW A;  3H0H A;  3OYG A;  4YTL A;  1YWP A;  3VJP A;  3DLM A;  3GNF B;  3BDU A;  3BE3 A;  1EZZ B;  3UPU A;  3JCM W;  3OSS C;  1ARK A;  2QTV A;  4DQ2 A;  1KFZ A;  3C12 A;  2R58 A;  1Z9Z A;  3H41 A;  2DTI A;  4E7H A;  3A1P A;  2QGG A;  5HK0 A;  4A63 B;  2LT1 A;  3WVD B;  2E6N A;  4DOW A;  1KC8 C;  4C92 G;  2L8D A;  3RMQ A;  3QDR B;  3KUF A;  1MHN A;  2DBM A;  3C4S A;  4X9D A;  2NUT B;  2GBQ A;  3FB9 A;  4JLI A;  5A2Q E;  2WSE E;  2JM9 A;  3G71 T;  4XU3 A;  1YJ9 T;  4DBQ A;  1B07 A;  2BTT A;  1OU9 A;  3CCQ Q;  2DX1 A;  1QKX A;  2AKK A;  2E5Q A;  1M90 C;  3J7A F;  4AFU C;  2CZ0 B;  2Y4X A;  2GCX A;  1VQ8 A;  2K7A A;  4E6R A;  4II1 A;  3M57 A;  1Q86 U;  1GL5 A;  4F7U F;  4KRT A;  4N0A C;  1M2O A;  4KGX B;  5CR2 A;  4C92 B;  1ZBX A;  5GAN 8;  2LJ0 A;  1XQH A;  2QA4 Q;  5I2S A;  2QQA A;  4J9D A;  1LPL A;  2DD5 A;  2KXC A;  2M16 A;  2V8I A;  3OYE A;  1JB0 E;  4KGV B;  3HRS A;  3CEY A;  1QQJ A;  1OOT A;  1JBM A;  4P5N A;  3L42 A;  2O2O A;  5GJV B;  3I56 A;  3O5Z A;  2CP5 A;  1NPP A;  1EX4 A;  3CBP A;  1NYF A;  1KHI A;  1VQM Q;  2HNI A;  1D0X A;  4M77 A;  1UUE A;  2HSE B;  2RB6 A;  2CUD A;  3CC7 T;  1ZA1 B;  4BI8 B;  1D09 B;  2AHJ B;  1JQQ A;  3JV3 A;  2LQW A;  3ME9 A;  2GQI A;  2A3L A;  1BBZ A;  2VC8 A;  3HHT B;  1WPY A;  2EGC A;  3A8O B;  5LJ5 d;  2W0Z A;  4ELY C;  4M7A E;  1VQN Q;  3PIO A;  2J6O A;  2K5L A;  1W1F A;  3CD6 T;  1F1B B;  3OYF A;  2DEQ A;  4ZGE B;  3M55 A;  2CSI A;  3OYN A;  1RL2 A;  1QVF S;  1C6V X;  3NTI A;  4C8Q B;  1PM3 A;  1G8X A;  1YWO A;  3EFS A;  3CCV A;  4BDY A;  1M1K C;  1PKT A;  5GAN 5;  4Z02 A;  3NPF A;  2DXT A;  4F04 B;  4QVZ A;  3Q1J A;  3GOX A;  5IHK A;  4FSX A;  3CCQ T;  2DJQ A;  3CC2 Q;  2RK2 A;  5GMK j;  3E1S A;  1M30 A;  3QUI A;  4CRI A;  2KBT A;  4FSS A;  1VQ6 Q;  2E6Z A;  3UA6 A;  2RMO A;  2GFA A;  1IHW A;  4L5G A;  4OVA A;  4HT9 A;  1BKB A;  3WXM B;  1H3Z A;  3NTK A;  2XD0 A;  4CC2 A;  4JUV A;  1RUW A;  1Y57 A;  4M75 D;  4AG1 C;  2OAW A;  2RQR A;  3CBM A;  4E47 A;  1Q81 C;  4RG8 A;  4HCB A;  1XOV A;  3DKM A;  2XK0 A;  1K9M U;  2A0F B;  1VQ6 A;  5LJ3 g;  3QG1 A;  1N9R A;  3JCM d;  5LJ5 j;  1ZQ1 A;  1NBE B;  5GAO m;  4C92 E;  3CCS A;  1B7T A;  4PJM A;  3EH2 A;  3L1A A;  3I5R A;  3OYJ A;  3UWN A;  4JZ3 A;  4LDW A;  2D8J A;  5CQY A;  4XTY A;  1WJR A;  2JM8 A;  2QK0 A;  2P0P A;  1SEM A;  3RER A;  2NLU A;  4ZNX A;  3L2Z A;  3JB9 G;  4PJO C;  4PJL A;  5GAN 6;  1YIT T;  4JJN K;  2COW A;  3PFS A;  1NPR A;  2FPF A;  1AWJ A;  3DB4 A;  1KQ1 A;  2FYK A;  1VQ4 T;  2DL7 A;  3QJY A;  2H3E B;  1SHG A;  3CBO A;  4ZTF A;  3QO3 A;  4BE1 A;  2CP2 A;  4JRK A;  3OY9 A;  1UEB A;  3VS6 A;  2EVR A;  1Y96 A;  3VS2 A;  4HCK A;  2F2X A;  2K2V A;  5GAO p;  5KYX B;  1QVG P;  2RI3 A;  1Q82 R;  2FB7 A;  1A0N B;  4LDY A;  5LJ3 d;  3TCJ A;  4EMH A;  3ZL7 C;  1I8F A;  4AT1 B;  2L0A A;  2MPX C;  3IQL A;  2FEI A;  1X27 A;  3VYG A;  1SSH A;  2EQU A;  4M78 G;  4A4G A;  4VUB A;  5IXB A;  2DVE A;  2LJ1 A;  1XJW B;  3SHW A;  1WDX A;  3NMZ C;  1KQS A;  1J3T A;  1FMV A;  3THK A;  4QQ6 A;  4M75 A;  5KCH A;  4RTZ A;  4M78 A;  4LXC A;  4Y92 A;  1SSF A;  3M9Q A;  1WA7 A;  5GAO q;  4RCB A;  4XU0 A;  2HAX A;  2BE9 B;  2QTX A;  1S72 A;  2RA2 A;  2AT1 B;  4R0K A;  1U8R A;  4M7D B;  2DTH A;  2CP6 A;  2DEU A;  1BU1 A;  3CCU Q;  4HT8 A;  3CC4 Q;  2ZGW A;  4BB7 A;  5LJ3 j;  4R56 A;  1YHQ A;  3LLR A;  4PJO A;  1K73 C;  1PHT A;  5GMK i;  2JN0 A;  2M0Y A;  4EMG A;  5FRM A;  1S72 Q;  4ZTJ A;  2OX7 A;  2RHY A;  3M0P A;  2A37 A;  3QZ9 B;  2YRD A;  1QVP A;  2VXE A;  3EAE A;  1PKS A;  3CPW A;  1YCS B;  3GBQ A;  2J6F A;  3AHU A;  2PVO B;  1RAG B;  5FW9 A;  2EKH A;  2DIG A;  2MWO A;  3JB9 I;  3MEV A;  1MND A;  1MUZ A;  1FMK A;  2DVJ A;  3RUX A;  2QEX A;  1K0X A;  3OB9 A;  4NOY A;  2EPD A;  5HKC A;  2FZG B;  3H8Z A;  2FO0 A;  4X1V A;  5L23 A;  1KC8 U;  3KBG A;  2DRM A;  3VV0 A;  4LD9 K;  1GCP A;  1RAD B;  3EG9 A;  1K8A C;  3VKI A;  5FU6 B;  1N8R U;  3UT1 A;  4FU6 A;  1MMD A;  3C94 A;  3GF5 A;  1UJ0 A;  3HL8 A;  1RLQ C;  1VA7 A;  2PUK B;  1YIJ Q;  5GAN 2;  2MIO A;  2DL3 A;  2COY A;  3A8G B;  5IAY A;  4Q5W A;  2M02 A;  5I21 A;  2DJZ A;  3CCS T;  1IRE B;  1U06 A;  2KI7 A;  4MZP A;  1PRL C;  4XAX B;  7AT1 B;  4ORZ A;  2D6F A;  4Z89 A;  1TG0 A;  1BIB A;  1I5L A;  1YJW Q;  2OTJ T;  4A4E A;  5KYY B;  4C92 F;  4BD3 A;  5D6W A;  1Y0M A;  5GAN 3;  1YN8 A;  1VQ4 Q;  1YIJ A;  1Q7Y R;  1UG1 A;  3CPF A;  4F7U A;  1JJ2 A;  1IHV A;  3QII A;  1OV3 A;  3HTR A;  2O4X B;  3CC7 Q;  1WI7 A;  4A4H A;  2E65 A;  4OF1 A;  5CKB A;  1YIT A;  4JRQ A;  4JJD A;  3TSW A;  2DXU A;  1YJN Q;  4M7D D;  1NJI C;  1VQ4 A;  2VVK A;  4Y28 E;  1T0H A;  4C0F A;  1K4U S;  3CC7 A;  1SPK A;  2YHT A;  2BIV A;  2XG8 D;  3QYG B;  4IUP A;  4PKC C;  1BYM A;  1AHJ B;  4PFZ A;  2EYX A;  1YJN A;  5GAN 7;  3CME T;  1O75 A;  4KH1 B;  2C0I A;  1LNX A;  1GFC A;  2XDB A;  1T0J A;  2J6K A;  4OMM A;  4F7U E;  4C8Q E;  5GMK e;  3M56 A;  1RAB B;  3FEO A;  3VS3 A;  4C8Q F;  2A08 A;  4GBQ A;  1W6X A;  2JZ2 A;  1UEC A;  3CD6 A;  1AT1 B;  3HFO A;  1Q7Y C;  1BCM A;  3I55 Q;  5I11 A;  3PNW C;  1XNI A;  3FJP A;  1FMW A;  2LZ6 B;  4RTY A;  3OYC A;  4FW2 A;  1MGQ A;  1R0B G;  4A54 A;  4A53 A;  3SB2 A;  3OQ5 A;  2PVG B;  3HRU A;  1QVF P;  2MYS A;  3H0I A;  3CCE Q;  3CD6 Q;  4EMK A;  3FRN A;  2QQ9 A;  4DOV A;  3OBY A;  2IVW A;  4X9C A;  3JCM h;  4C5H A;  1VQ9 T;  1PRM C;  1YJW T;  3OBW A;  3X24 B;  1TOV A;  2G3R A;  1BI0 A;  4M77 C;  1HJD A;  1UGV A;  1HK9 A;  1G2B A;  2IIM A;  1QLY A;  3R6O A;  2QG9 B;  2MOX A;  3OSV A;  2GQV A;  2NUP B;  2ABL A;  2G6F X;  1EFN A;  1K76 A;  2LCS A;  1R77 A;  2PQW A;  3MEU A;  3NFC A;  3NTH A;  3O8V A;  1M5Q 1;  1K9M C;  4OMQ A;  4M77 D;  1QW1 A;  1MMN A;  2FZC B;  1VQ6 T;  2HQH A;  1D1C A;  2X3X D;  4CC4 B;  1BI2 A;  5CQX A;  3L2Q A;  2XIC A;  1ZHI A;  4IIO A;  2DNU A;  4XTV A;  2RH2 A;  3VS7 A;  2CZ6 B;  1MNE A;  2QEX T;  3MP1 A;  3V7S A;  4BE2 A;  2R5M A;  4RTT A;  2KDS A;  1N6A A;  4M4Z A;  1VQL T;  1W70 A;  2BZ8 A;  1YFN A;  1WXB A;  1Q82 C;  3PIP A;  4ATO A;  1OPK A;  4QVD A;  3RMS A;  3ZBD A;  2FZK B;  2K79 A;  4LD6 A;  3SWN B;  2WSC E;  3HKS A;  1KD1 R;  2GF7 A;  4IUT A;  3OS1 A;  3INZ A;  1ZUY A;  5LJ5 h;  2NUT A;  1KHC A;  5LJ3 f;  2O9S A;  2XKO C;  4OB0 B;  2YUN A;  3N5B B;  3V7C A;  4M75 E;  3OS5 A;  4Y91 A;  3LGL A;  1RI0 A;  3I55 T;  1KD1 C;  4PJO B;  1VIF A;  1Y71 A;  3D7S B;  1GCQ A;  3CCU T;  5FU7 B;  2E41 A;  5GAM e;  1WNL A;  2GGR A;  5GMK h;  1PD0 A;  4DBH A;  1KQ2 A;  2O31 A;  1E6G A;  4XTW A;  1GBR A;  1X6B A;  2E3I A;  4E7L A;  4F14 A;  1X6O A;  2K5I A;  3P8H A;  5GAO n;  1PC0 A;  4C5G A;  4OGC A;  3DLL A;  1RAA B;  2ATC B;  2DD4 A;  5J26 A;  3QPH A;  4NL3 A;  2K9G A;  4RTW A;  1VQ5 Q;  1SRL A;  3JCM Q;  3CME Q;  4RTU A;  2KT8 A;  2V1R A;  4M7A G;  4XQ3 A;  2E70 A;  4HXJ A;  2K5F A;  4HCC A;  3M0Q A;  1LOJ A;  4E7I A;  3BW1 A;  1D1B A;  4UC4 A;  1I0C A;  2F69 A;  4E7Z A;  2CUB A;  1N27 A;  4M7A D;  1VQO A;  2J7I A;  2O9V A;  1CKA A;  5DLO A;  1NLO C;  2ZPE B;  2V8K A;  2ZPG B;  3EH1 A;  4M75 F;  2I2L A;  2K3Y A;  1YJN T;  1OPL A;  1WHL A;  1VQ5 A;  3CCR A;  3CME A;  2CS7 A;  4Z88 A;  2VKN A;  1M1G A;  3RIR A;  2MAM A;  1WHJ A;  1PCX A;  2FVU A;  1SG5 A;  4RKU E;  1X2Q A;  3S3M A;  4RTX A;  4ESR A;  1M2V A;  4EIK A;  4AMC A;  4FYX B;  5LL6 S;  3SDZ A;  1VQO Q;  3EGX A;  2EBP A;  1M2V B;  3CCM Q;  2LX9 A;  3NGP A;  1Q86 C;  4WCI A;  2F1L A;  4J6Y A;  4E7S A;  2RQU A;  2JVV A;  2YUP A;  4F7U B;  5I22 A;  1V76 A;  3VUB A;  1C1A A;  4DA4 A;  1WHG A;  1QVF A;  3CXC P;  3CCJ A;  2KRS A;  1D0Z A;  2OTL A;  2HMA A;  2JS2 A;  2XHC A;  4EPC A;  4HA8 A;  1U5S A;  2DA9 A;  1DJ7 B;  2LCL A;  1ZSG A;  4N4H A;  3X25 B;  2RJF A;  1VQ9 A;  1N5Z A;  1K9M R;  4HKE A;  3ULR B;  2EYW A;  2D9T A;  3CCJ Q;  2ESW A;  4GY5 A;  1K8A U;  3OW2 S;  2PZ1 A;  2YT6 A;  1H92 A;  3ASK A;  2KK4 A;  3REB B;  2E1H A;  3V8L A;  2EJ9 A;  4FYW B;  3OW2 A;  5GAM j;  2EFI A;  2V26 A;  1IGU A;  1IXD A;  1VQ9 Q;  2KSS A;  4A4F A;  4XTX A;  5EG2 A;  1WYX A;  4M7A F;  3QHS A;  3V8K A;  5CIU A;  5FU6 C;  3M0T A;  2LVM A;  2E10 A;  4OB1 B;  1QMC A;  1UHF A;  5IH2 A;  2HD0 A;  3OS0 A;  3OMG A;  2X35 A;  4PJO D;  1YIJ T;  3CC2 T;  4EMK B;  1FXX A;  5M9O A;  1QCF A;  3EGD A;  3CCL T;  4C92 A;  5ECA A;  4QQD A;  5LJ5 e;  4BUG A;  2F5K A;  2HKQ B;  3TSZ A;  1M90 R;  3VU3 C;  1RAI B;  2KGT A;  3JCM J;  3G7Z A;  1WHK A;  2EQI A;  1NJI U;  3EG0 A;  4F16 A;  2RN8 A;  1YBY A;  2RJC A;  1BI1 A;  2CGH A;  5J39 A;  2QQB A;  2RD1 A;  1ACM B;  4JS4 A;  5HK3 A;  1VQP A;  1VQ7 T;  2KYM A;  5GAM d;  2Y4Y A;  3ER0 A;  4DEY A;  2QAS A;  1NG2 A;  1CSK A;  3RKX A;  1GFD A;  1ZSZ B;  2MWP A;  3SWN C;  2LX7 A;  2EQJ A;  1I5O B;  5CVI A;  2SEM A;  4L6V 5;  1M8V A;  1BB9 A;  3U23 A;  2X4X A;  1I07 A;  3JB9 F;  4M7A C;  2RQT A;  1VQ8 Q;  3P8D A;  3M0S A;  1R8O B;  4OB2 B;  1SHF A;  4ELZ C;  1G3S A;  1FYN A;  5HY6 A;  3M59 A;  3QYH B;  2JJ9 A;  4F7U G;  1NYG A;  1BI3 A;  4M7D G;  2DO3 A;  3QJ6 A;  3UDC A;  3LW5 E;  5C0M A;  2VGN A;  2QA4 T;  2YSQ A;  5KH6 A;  5KYU B;  2R57 A;  1WQ7 A;  3EGX B;  1UE9 A;  1WGS A;  2PVD B;  1VQN T;  2CKK A;  4J9G A;  1WZO A;  4PK4 A;  4LUD A;  1I1J A;  4IKF A;  4MZT A;  1OZ2 A;  2CP3 A;  2YDL A;  1IB8 A;  2EJF A;  3FC3 A;  2HCK A;  4XK8 E;  1M1K R;  3L2W A;  4FM4 B;  1AWW A;  2KYB A;  2OI3 A;  4KBM B;  3CCJ T;  4L59 A;  2AKL A;  1VQM T;  1NM7 A;  3UA7 A;  2LRQ A;  5GAM f;  4AG2 C;  3WVE B;  4C92 D;  2HQE A;  3LX7 A;  4XTU A;  3JCM V;  1WXU A;  3RDV A;  1ZUK A;  2QDY B;  2OTL T;  4EDU A;  2EYY A;  4RUG A;  3JB9 D;  1OI1 A;  3HSB A;  2EYQ A;  3MP6 A;  3OYM A;  1SF9 A;  1TTH B;  2NUZ A;  3S3N A;  4J8O A;  4M77 B;  2KXD A;  3TQ7 P;  2E5K A;  1VQN A;  2DL4 A;  3C95 A;  4B9X A;  1KQS P;  1AOJ A;  1T3S A;  4KH0 B;  4OMO A;  3G4S T;  3OYD A;  2F2V A;  1QKW A;  8AT1 B;  4B6M A;  4BY6 C;  1KJW A;  2DK3 A;  3QBY A;  1OYX A;  1WJS A;  1UB4 A;  1VUB A;  3EG1 A;  4N4I A;  3PMI A;  4V2S A;  4D8D A;  1AEY A;  4KUI A;  3A98 A;  5CKD A;  1Y7X A;  2LTO A;  2DPP B;  2JXB A;  5LJ5 f;  1RLP C;  4HVW A;  3I35 A;  4LDX A;  2R5A A;  3CC2 A;  3OW2 P;  6AT1 B;  2OJ2 A;  2MCN A;  2QXF A;  2RHZ A;  3OA6 A;  3VYH B;  4LDV A;  2M0O A;  4FYV B;  2RPN A;  2W10 A;  1K73 U;  2DM1 A;  2DRK A;  2XID A;  3L2R A;  2D0N A;  4D6W A;  2ZPF B;  3PTA A;  3JRZ A;  3QXE B;  2NUP A;  3RES A;  1ZBJ A;  3I5S A;  5GJW B;  1SKU B;  1B3Q A;  2FL7 A;  2JMC A;  3CCS Q;  1KQS S;  3FJ5 A;  1BIA A;  2L3Q A;  1VQ7 A;  4A4K A;  2P84 A;  2AZS A;  4MDX A;  4WF2 A;  5I2M A;  5FWB A;  1MV3 A;  2CP7 A;  4M75 B;  1G83 A;  2JNG A;  1K1Z A;  2HDA A;  2DBK A;  2AK5 A;  4BI3 A;  3MEA A;  1QVG S;  4ZN3 A;  4J9I A;  1N8R C;  2ROL A;  1ABQ A;  2VUB A;  4J6X A;  3CCV T;  1WLP B;  1VQ7 Q;  1M3B A;  3G1J A;  1E6H A;  1VQP T;  4MZM A;  4M77 F;  5FU7 C;  3MO8 A;  3LH5 A;  5GAN f;  1TS9 A;  2NYS A;  2RJE A;  4RCC A;  1RAE B;  3HPW A;  2HBP A;  3OMC A;  4RG2 A;  5FRN A;  4QVC A;  1IGQ A;  2Y90 A;  2LCC A;  4M78 E;  1LJO A;  4M7D A;  2KRO A;  1O9S A;  4AFZ C;  3PVQ A;  1AWO A;  3CMA Q;  4X34 A;  3CCQ A;  2VV5 A;  3KFV A;  2BKD N;  3FDR A;  5KYW B;  3L2U A;  2OAU A;  3GLX A;  3OYB A;  3OYH A;  1N9S A;  4FT2 A;  3FLG A;  1X6G A;  2E4H A;  5KCO A;  3AT1 B;  1VQK T;  4PJN A;  3EGU A;  1WHH A;  3G6E T;  3CMA A;  2O01 E;  3RR6 A;  1IO6 A;  4JRP A;  2CT3 A;  4BAC A;  2FRY A;  2YWW A;  5IT9 E;  4J7I A;  2DYI A;  3J80 E;  2QA4 A;  1KC8 R;  4ZGJ B;  1Q95 G;  2DE0 X;  1NE8 A;  4CC3 A;  1Z9Q A;  4FW1 A;  1S72 T;  2L5Q A;  1YCY A;  2CH4 W;  3I56 Q;  3EG2 A;  1MMA A;  4M78 B;  1Q86 R;  1M8M A;  1YI2 A;  2H3J A;  2KRM A;  4C0Z A;  1WHM A;  2EIF A;  4OP0 A;  1VQM A;  2JW4 A;  3QZ5 B;  1YHQ Q;  5D6Y A;  2X4J A;  4IUR A;  4J9B A;  1Q7Y U;  2X3W D;  4J9E A;  2CP0 A;  2IPO B;  4AFS C;  1X69 A;  2HQX A;  3MP8 A;  5J3B A;  3REA B;  4ME7 A;  1X43 A;  1ZLM A;  2D0Q B;  3M4Y A;  4CI0 C;  1YI2 Q;  5LJ3 h;  3UF4 A;  5GAN e;  9ATC B;  4M78 D;  2K3B A;  2MI6 A;  1QP2 A;  2LJ3 A;  1VQO T;  1GRI A;  1P92 A;  3CCV Q;  2QEX Q;  2WSF E;  1IRX A;  4HVU A;  4OMP A;  2D8H A;  1G3Y A;  4DEX A;  1E7O A;  2DXC A;  2DFU A;  3MJX A;  4M75 C;  2RF0 A;  4MML A;  3JCM b;  1TUG B;  1TU0 B;  2JUF A;  2ZPI B;  3CXC A;  2FRW A;  2YRC A;  4PLI A;  4KUD K;  3X20 B;  2KT1 A;  1XTD A;  3CXC S;  1QWF A;  1SRM A;  2QAZ A;  4M7D E;  3EGD B;  5DLQ E;  5DY9 A;  4BE0 A;  4O5V A;  2CT4 A;  2PNI A;  2AIR B;  4PFP A;  1AZG B;  1Q82 U;  5AYF A;  1OX9 A;  4CC7 A;  8ATC B;  3M58 A;  4C5E A;  4PLL A;  5GAN d;  2KVQ G;  1RAC B;  3VS1 A;  2KY9 A;  2HL3 A;  1M27 C;  1AWX A;  1YIT Q;  3E19 A;  2O88 A;  3GPL A;  2SRC A;  3MHX A;  2J06 A;  1JXO A;  3F70 A;  3P8B B;  2YUQ A;  1D0Y A;  3J81 E;  2EQK A;  3HRT A;  5CO7 A;  4J7F A;  2Z0W A;  2VYT A;  2JTE A;  4ZGD B;  4M77 E;  3PGG A;  1RI9 A;  4PJO E;  2RK1 A;  2YLC A;  2X51 A;  2D1X A;  2JOY A;  3TEE A;  5KYX A;  1K8A R;  2KR3 A;  4PJO F;  1U1T A;  2DLP A;  3NHN A;  3G4S Q;  3EG9 B;  4J9C A;  3MPU B;  3EHQ A;  1X2K A;  4LN2 A;  5CK9 A;  1KK7 A;  2E3H A;  1PG5 B;  4C8Q G;  3S3O A;  2L2P A;  3EG3 A;  1OX8 A;  1RAH B;  2F2W A;  1JJ2 P;  2C0O A;  2PTK A;  2L89 A;  2QQS A;  2PUO B;  3G4S A;  4XU2 A;  2V8J A;  5GAN j;  5FLX E;  2YXY A;  1AVZ C;  5GMK m;  4OB3 B;  2DZ9 A;  2L3R A;  4O6J A;  1FWZ A;  1BK2 A;  1EIF A;  1QVG A;  1VYU A;  1M1F A;  1N8R R;  3JAM E;  3H6Z A;  5CAI A;  3JCM X;  5LJ5 g;  2DET A;  1UJY A;  3I9Q A;  2X4Y A;  2L3S A;  2YLB A;  4BY6 B;  2XI9 A;  1W2B A;  2A28 A;  5FWC A;  3H0F A;  3LH0 A;  5HCK A;  3JB9 H;  3URG A;  3VRZ A;  1W2B S;  1RAF B;  2OTJ Q;  2RNA A;  1YI2 T;  1V29 B;  2CYZ B;  1M1K U;  3CCE T;  4ZN1 A;  1Y96 B;  1NZ9 A;  2RQW A;  2BE7 D;  3CCM T;  2X9H A;  4IUU A;  1BCO A;  4OMN A;  3QWX X;  3BFM A;  4FL6 A;  1UGQ B;  4C5I A;  4KT0 E;  2HEQ A;  3JCM c;  3CCU A;  4AFQ C;  5KYY A;  2LQ8 A;  2OTJ A;  3CC4 A;  1LCK A;  2RI2 A;  3CPW P;  3TVT A;  4OGE A;  2P0Q A;  2LQN A;  2M51 A;  2V1Q A;  2VB6 A;  3GIB A;  3G71 Q;  2FPE A;  3QKJ A;  4EMK C;  4R55 A;  5GMK l;  3R6N A;  4HVV A;  5KE3 A;  3TU4 K;  2GNC A;  3VS0 A;  4B9W A;  1B34 B;  4RTV A;  5IN1 A;  4C8Q C;  3QWY A;  1UDL A;  2HBW A;  2PU9 B;  5IHI A;  2KEA A;  1OQK A;  1B34 A;  3JCM g;  4BDZ A;  2RJD A;  1ZSZ A;  1WQW A;  1X01 A;  2ZPH B;  2K3X A;  3G71 A;  3G6E Q;  1YJ9 A;  1JEG A;  1JO8 A;  1WIE A;  2KMT A;  2ZZD A;  1MV0 B;  3VS4 A;  3M0U A;  4OMF B; 
#chains in the Genus database with same CATH homology
 2JM9 A;  3EG1 A;  1UEC A;  1B07 A;  1YP5 A;  2BTT A;  4D8D A;  1AEY A;  2DX1 A;  1QKX A;  3A98 A;  2AKK A;  2EGE A;  2JXB A;  1RLP C;  4HVW A;  3I35 A;  4AFU C;  1QWE A;  5I11 A;  2K7A A;  2LZ6 B;  2OJ2 A;  4RTY A;  2MCN A;  2ENM A;  4E6R A;  2ECZ A;  3EHR A;  1GL5 A;  4KRT A;  2XMF A;  2RPN A;  2W10 A;  1YNZ A;  3H0I A;  2DM1 A;  1T3L A;  2DRK A;  1M3A A;  1UTI A;  1PNJ A;  1PRM C;  1KSW A;  2A36 A;  2D0N A;  2LJ0 A;  3PVL A;  4J9D A;  2KXC A;  1ZBJ A;  3I5S A;  1HJD A;  1UGV A;  1OOT A;  1G2B A;  2IIM A;  1QLY A;  5GJW B;  1B3Q A;  2MOX A;  2JMC A;  2ABL A;  2G6F X;  1EFN A;  1K76 A;  3FJ5 A;  2O2O A;  2LCS A;  2L3Q A;  5GJV B;  2CRE A;  2AZS A;  4OMQ A;  1VYT A;  3O5Z A;  5FWB A;  1MV3 A;  2X3X D;  4CC4 B;  4IIM A;  4Z8A A;  1NYF A;  1G83 A;  1K1Z A;  2HDA A;  2DBK A;  2AK5 A;  1UUE A;  4IIO A;  2DNU A;  2LMJ A;  4J9F A;  2CUD A;  4J9I A;  3VS7 A;  2ROL A;  1ABQ A;  1NEB A;  4GLM A;  1WLP B;  1JQQ A;  2ED0 A;  2LQW A;  3JV3 A;  2GQI A;  2CH4 A;  2EGA A;  1M3B A;  1BBZ A;  4RTT A;  1E6H A;  4M4Z A;  1W70 A;  2BZ8 A;  2EGC A;  1WXB A;  2W0Z A;  3LH5 A;  1OPK A;  4JPB W;  2J6O A;  3SEM A;  3M0R A;  2K79 A;  1W1F A;  3VS5 A;  1OEB A;  2CSI A;  4JZ4 A;  1ZUY A;  1YWO A;  2LP5 A;  2O9S A;  1JU5 C;  1PKT A;  2YUN A;  3NPF A;  2KRO A;  2CDT A;  4AFZ C;  3PVQ A;  1AWO A;  5IHK A;  3KFV A;  1GCQ A;  1GCQ C;  2DJQ A;  2B86 A;  1M30 A;  2GGR A;  2KBT A;  3RNJ A;  2O31 A;  4FSS A;  3UA6 A;  1E6G A;  1GBR A;  1X6G A;  2RMO A;  2DIL A;  1X6B A;  4F14 A;  3EGU A;  3VRY A;  4CC2 A;  1RUW A;  1IO6 A;  1Y57 A;  2CT3 A;  2FRY A;  4OML A;  4AG1 C;  2OAW A;  2RQR A;  2K9G A;  4RTW A;  1SRL A;  4RTU A;  1XOV A;  2KT8 A;  1K9A A;  2V1R A;  2DE0 X;  4CC3 A;  4HXJ A;  3M0Q A;  1Z9Q A;  2JS0 A;  1I0C A;  2VWF A;  2CUB A;  2BZX A;  2ROT A;  5EC7 A;  2CH4 W;  2J7I A;  2O9V A;  1CKA A;  3I5R A;  1NLO C;  3EG2 A;  1H8K A;  4JZ3 A;  2DMO A;  2D8J A;  1M8M A;  2JM8 A;  1TUC A;  2KRM A;  1OPL A;  1SEM A;  2C0T A;  1U3O A;  4D8K A;  4Z88 A;  2K6D A;  2JW4 A;  2VKN A;  2KRN A;  4ZNX A;  1X2Q A;  4J9B A;  4RTX A;  4ESR A;  4EIK A;  2FPF A;  1AWJ A;  2EYZ A;  2X3W D;  4J9E A;  3CQT A;  1X69 A;  1ZX6 A;  2EBP A;  4AFS C;  1ZUU A;  2ED1 A;  3REA B;  1X43 A;  3NGP A;  1ZLM A;  2EW3 A;  2DL7 A;  4WCI A;  1SHG A;  3UF4 A;  2RQU A;  1ABO A;  2YUP A;  5I22 A;  3VS6 A;  2EVR A;  2K3B A;  3VS2 A;  2LJ3 A;  4HCK A;  2F2X A;  1GRI A;  2CSQ A;  2DYB A;  2KRS A;  1A0N B;  2JS2 A;  4HVU A;  4OMP A;  3ZL7 C;  2D8H A;  4DEX A;  4K11 A;  1U5S A;  4LNP A;  1E7O A;  2DA9 A;  1PWT A;  2RQV A;  2L0A A;  1ZSG A;  3IQL A;  2FEI A;  3UAT A;  1TUD A;  1X27 A;  2RF0 A;  1N5Z A;  1SSH A;  2GTO A;  5IXF A;  3ULR B;  2K2M A;  2EYW A;  4J9H A;  5IXB A;  2ESW A;  2LJ1 A;  3SHW A;  1WDX A;  3NMZ C;  2PZ1 A;  2YT6 A;  1H92 A;  2FRW A;  2AZV A;  1S1N A;  3REB B;  1J3T A;  1HD3 A;  2KT1 A;  3THK A;  1QWF A;  1SRM A;  2DL5 A;  4RTZ A;  1WYX A;  2CT4 A;  2KE9 A;  2PNI A;  3M0T A;  4Y92 A;  1AZG B;  2P4R A;  1UHF A;  2I0N A;  1WA7 A;  4CC7 A;  1KIK A;  1M3C A;  2HSP A;  5IH2 A;  1K0S A;  1JXM A;  3VS1 A;  4R0K A;  1M27 C;  1AWX A;  1UFF A;  2O88 A;  1VYV A;  1BU1 A;  1CKB A;  1QCF A;  2SRC A;  2J06 A;  1JXO A;  5ECA A;  2YUQ A;  1GBQ A;  1PHT A;  4QT7 A;  3TSZ A;  2JTE A;  4LE9 A;  2M0Y A;  2KGT A;  1RI9 A;  2DL8 A;  2D1X A;  3M0P A;  2EQI A;  2A37 A;  1UHC A;  3EG0 A;  4F16 A;  2KR3 A;  2RN8 A;  1PKS A;  2DLP A;  3NHN A;  1YCS B;  4J9C A;  3GBQ A;  2J6F A;  4JJC A;  3EHQ A;  5FW9 A;  2EKH A;  1X2K A;  2JMA A;  3PE0 A;  2BZY A;  2LNH B;  4LN2 A;  1MUZ A;  2KYM A;  1FMK A;  2DVJ A;  4LUE A;  4DEY A;  1K0X A;  2EPD A;  2FPD A;  2L2P A;  3EG3 A;  1NLP C;  4JJB A;  2F2W A;  1CSK A;  1NG2 A;  2FO0 A;  2C0O A;  4X1V A;  2YUO A;  5L23 A;  1GFD A;  1HSQ A;  2PTK A;  2LX7 A;  2QDL A;  2DRM A;  4F17 A;  1GCP A;  2SEM A;  1AZE A;  1BB9 A;  1WX6 A;  3U23 A;  1I07 A;  1V1C A;  1WXT A;  1UJ0 A;  1AVZ C;  2JT4 A;  1RLQ C;  1VA7 A;  2RQT A;  1BK2 A;  1VYU A;  2MIO A;  2DL3 A;  3M0S A;  1SHF A;  1FYN A;  1UJY A;  1U06 A;  3I9Q A;  2L3S A;  1H3H A;  1NYG A;  1PRL C;  4ORZ A;  2A28 A;  5FWC A;  3C0C A;  3H0F A;  5HCK A;  1TG0 A;  4Z89 A;  2H8H A;  2DF6 A;  2J05 A;  3VRZ A;  2YSQ A;  2FG0 A;  5IHN A;  2RNA A;  1UE9 A;  1Y0M A;  4J9G A;  1YN8 A;  4LUD A;  1NEG A;  1I1J A;  2RQW A;  1UG1 A;  2YDL A;  1OV3 A;  2HCK A;  2GTJ A;  2KNB B;  2NWM A;  3QWX X;  4OMN A;  3RBB B;  1WI7 A;  1AWW A;  2KYB A;  2OI3 A;  1WFW A;  2AKL A;  1NM7 A;  4JJD A;  2HEQ A;  2L3P A;  3TSW A;  4AFQ C;  1AD5 A;  1LCK A;  3UA7 A;  3H0H A;  4AG2 C;  3TVT A;  2LQN A;  2M51 A;  2V1Q A;  1YWP A;  2FPE A;  2VVK A;  1WXU A;  1ZUK A;  3R6N A;  4HVV A;  1T0H A;  2GNC A;  3VS0 A;  1ARK A;  1K4U S;  1SPK A;  1KFZ A;  2EYY A;  4RUG A;  4RTV A;  3QWY A;  1Z9Z A;  1UDL A;  2HBW A;  3H41 A;  5IHI A;  2NUZ A;  2KEA A;  2EYX A;  4A63 B;  2KXD A;  2E5K A;  2DL4 A;  2C0I A;  1GFC A;  1T0J A;  1AOJ A;  2J6K A;  4OMM A;  1T3S A;  4OMO A;  1JEG A;  1JO8 A;  2F2V A;  1QKW A;  1WIE A;  1KJW A;  2DBM A;  1MV0 B;  3VS4 A;  3M0U A;  3VS3 A;  2GBQ A;  2A08 A;  4GBQ A;  1W6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...