1PRMC

Two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC TYROSINE KINASE SH3 DOMAIN
publication title Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
pubmed rcsb
source organism Gallus gallus
molecule tags Complex (signal transduction/peptide)
total genus 5
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1prmC00
1PNJA 1WXUA 2CT3A 1T3LA 3M0SA 2EYYA 3VRZA 5I22A 1GFCA 2ENMA 2DA9A 2J06A 1WFWA 1OPLA 2ESWA 1NG2A 2DL5A 1OPKA 2GQIA 1ABQA 1CSKA 4LUDA 2CUDA 5GJWB 2MOXA 2W10A 1PHTA 1A0NB 1Z9ZA 2OJ2A 1T0JA 4WCIA 2YUPA 4DEXA 5IXFA 1S1NA 1AOJA 2DILA 2C0IA 2KRNA 3EG1A 3FJ5A 2LMJA 2L2PA 4LUEA 4DEYA 1UGVA 3REAB 1J3TA 2VVKA 4CC7A 2P4RA 1VA7A 2KRMA 4GLMA 2KYMA 1SSHA 1Y0MA 1W1FA 1M27C 3LH5A 2YUOA 2AZVA 2GTOA 1K0SA 2NUZA 3I9QA 2JMAA 2NWMA 2K79A 2YSQA 4E6RA 5IHKA 4JJBA 1WIEA 1E6GA 2EW3A 2KXDA 4A63B 3VS1A 2KGTA 2EGAA 1AWJA 1OEBA 2DJQA 2DF6A 2LQNA 4OMOA 4Z88A 2J05A 3VS3A 2BZYA 2M0YA 2D1XA 4RTVA 2LJ3A 2LNHB 2RMOA 1BK2A 2CT4A 3PE0A 1VYTA 1AD5A 2VWFA 4F16A 1NLPC 2FO0A 2FEIA 2XMFA 2J6FA 3EGUA 4RTZA 2DLPA 2LQWA 1U06A 1RI9A 1T0HA 2EYXA 1WLPB 2RQVA 3M0QA 4KRTA 3VS0A 1G2BA 1TUCA 1QWEA 1BB9A 4LE9A 1EFNA 2DRMA 1W6XA 1TG0A 2G6FX 1U3OA 3KFVA 1M3AA 4AFZC 1GCPA 1AWOA 4JJCA 3THKA 4M4ZA 1NYFA 2A36A 1X69A 2C0OA 1U5SA 2JS0A 1QLYA 1X2KA 1MV0B 4CC3A 1KJWA 1FYNA 4J9IA 3JV3A 2K2MA 1SRMA 4Z8AA 1RLQC 2SRCA 2KT1A 1LCKA 2EPDA 2FPFA 2O2OA 1JEGA 1ZSGA 2JMCA 3I35A 3VS5A 2OAWA 2HDAA 4D8KA 1H92A 4RTUA 1OOTA 3REBB 1UFFA 1YWOA 2PNIA 1H3HA 5IH2A 2BTTA 1NM7A 2V1QA 2O9SA 1VYUA 3H0HA 2LZ6B 1SRLA 4FSSA 2DL8A 2EKHA 1V1CA 3EHQA 4AG2C 3M0UA 2MIOA 2JS2A 1M8MA 2RQWA 3PVLA 3TSZA 1YN8A 4K11A 1PWTA 4AFUC 2GTJA 2LCSA 2DRKA 3A98A 1HSQA 4J9CA 2X3XD 2LJ1A 4AG1C 2L3PA 1ZLMA 1FMKA 1RUWA 2CDTA 2K7AA 5IHNA 2DE0X 1AEYA 5ECAA 4HXJA 1X27A 2SEMA 1JO8A 1SPKA 4GBQA 2DBKA 2J6KA 1GFDA 1KSWA 3UATA 1WX6A 3SEMA 2ED1A 4RTTA 3NPFA 1QCFA 2DYBA 5FWCA 3RBBB 4CC4B 2DMOA 1N5ZA 1ZX6A 2RQTA 4JZ3A 3NMZC 2KNBB 4JZ4A 4OMQA 1GBQA 4EIKA 1ZUKA 4Y92A 2J7IA 5I11A 3H0IA 1ZBJA 2YDLA 1HJDA 1X43A 1AZGB 2ED0A 4J9DA 2O88A 3ZL7C 4F17A 2EYZA 5L23A 2PTKA 1K1ZA 2A28A 3I5RA 4LN2A 4JJDA 3UA7A 4RUGA 1PRLC 3NHNA 2LX7A 1NYGA 3M0RA 1OV3A 3ULRB 1JXMA 2O9VA 2DBMA 2HCKA 4Z89A 2HEQA 4F14A 1QWFA 2FPEA 3H0FA 3VS7A 2JM9A 2YUQA 1PRMC 2KEAA 3M0PA 1CKBA 2L3SA 2RQRA 2K3BA 4AFQC 4X1VA 2M51A 1UHCA 2KRSA 2A08A 1H8KA 1YP5A 2RQUA 1MUZA 2JT4A 4OMLA 2EGEA 2RF0A 2D8JA 3VS2A 1E6HA 4AFSC 1ZUUA 2B86A 2ABLA 1M3BA 1WI7A 1PKTA 1AWWA 2EBPA 3QWYA 2QDLA 1HD3A 5FWBA 2DL7A 2AKLA 1YCSB 2FRWA 3UF4A 2OI3A 4JPBW 5FW9A 2X3WD 3VRYA 2YT6A 2H8HA 2KXCA 1AZEA 2LJ0A 1JXOA 1SHFA 4OMPA 2GGRA 1KFZA 2GBQA 1Z9QA 2K6DA 1JQQA 4ZNXA 3TVTA 2ROLA 1BBZA 4J9HA 4CC2A 1GRIA 2PZ1A 1GCQC 3EHRA 2GNCA 3CQTA 5EC7A 3TSWA 2JXBA 2KBTA 1UG1A 1GCQA 3VS4A 2K9GA 5IXBA 1QKXA 3EG0A 3QWXX 2L3QA 4OMNA 5HCKA 4ORZA 2YUNA 2KROA 2JTEA 1RLPC 2AZSA 2CH4W 1K76A 1NEBA 1NEGA 4HVVA 2V1RA 2AK5A 4J9EA 1NLOC 4HCKA 1T3SA 3RNJA 1M3CA 2HSPA 2C0TA 4LNPA 2MCNA 1TUDA 3GBQA 1W70A 3IQLA 2I0NA 2RNAA 1K9AA 1ABOA 1B3QA 1WXBA 1YWPA 2DNUA 1I1JA 2EVRA 3NGPA 2VKNA 1GBRA 3SHWA 1WXTA 4J9FA 2LP5A 3I5SA 1GL5A 2F2XA 3EG3A 5GJVB 4ESRA 1I07A 2F2WA 3UA6A 3H41A 4QT7A 2EYWA 1Y57A 1UJ0A 2D0NA 3U23A 1X6BA 4RTXA 3O5ZA 2BZ8A 1X6GA 1E7OA 1K4US 1UECA 2KR3A 2EQIA 2AKKA 1WYXA 2ROTA 4R0KA 1IO6A 2FPDA 2ECZA 1I0CA 1QKWA 2CSQA 1AVZC 2DL3A 4HVWA 2JW4A 4IIOA 2IIMA 2KT8A 2J6OA 2L0AA 1BU1A 1M30A 2CH4A 2A37A 2E5KA 2RN8A 2KE9A 4IIMA 1UE9A 3PVQA 2CUBA 2DM1A 4OMMA 1SHGA 1YNZA 2DX1A 3EG2A 1X2QA 1MV3A 2RPNA 4J9GA 2CREA 4HVUA 2DL4A 1SEMA 3R6NA 2KYBA 1UHFA 5IHIA 1UUEA 2BZXA 3VS6A 1UDLA 2W0ZA 4J9BA 4D8DA 1VYVA 1K0XA 2CSIA 4RTWA 2DVJA 3C0CA 1ARKA 1PKSA 1CKAA 2FG0A 1XOVA 2D8HA 2HBWA 1AWXA 1B07A 1JU5C 1WDXA 4RTYA 3M0TA 1G83A 2EGCA 1UJYA 2O31A 2F2VA 1UTIA 2JM8A 1ZUYA 1WA7A 2FRYA 1KIKA
chains in the Genus database with same CATH superfamily
2MWPA 1FWZA 2CT3A 1T3LA 1UGSB 2XICA 3VRZA 3INZA 1GFCA 2ENMA 1WFWA 4JRIA 1VQ6T 2ESWA 5LJ5g 3CCLA 1M2OA 1NG2A 1OPKA 1CSKA 2LQ8A 2CUDA 4PL6A 5GJWB 1KK7A 3OBYA 2W10A 2XDBA 1ZSZC 1Z9ZA 2OJ2A 3X20B 1K9MC 3BE3A 4WCIA 2PUOB 3V7CA 1N8RR 5IXFA 1S1NA 3LH0A 3FJ5A 5DLQE 5KCOA 3V8KA 4O6JA 3JCMP 1RAIB 4PJOF 3FDRA 2QQRA 3OW2S 2X4XA 3REAB 1J3TA 1S72A 5IT9E 1VA7A 1TSFA 1YFNA 4GLMA 4AMCA 5KYYA 2OTLQ 2PVGB 2CGHA 3E9FA 3CPWS 1JJ2S 1WHJA 1YJWT 2XU8A 2GTOA 3S3OA 1K0SA 2NUZA 2JMAA 4C8QF 5GANe 2WSFE 5IHKA 5J26A 1QCNA 4IUUA 4XK8E 2KXDA 3SD4A 3CCUQ 2CZ6B 2EGAA 2X4YA 5GAMe 2OAUA 2LQNA 2VV5A 4Z88A 2J05A 2BZYA 1OQKA 1VQ7Q 4XTVA 2RMOA 1BK2A 2KQWA 3CEYA 2MYSA 4M7DF 1AD5A 2VWFA 5GANd 1ZA1B 3GOXA 1NJIR 3EGUA 3MEUA 5GAOr 1IZ6A 3CCQQ 5FU7C 2EYXA 5GAMd 1WLPB 3M0QA 3SWNC 1G2BA 1TUCA 4N4HA 3CMET 4F7UE 3OYNA 1EFNA 1ZBXA 1M1KC 2FHDA 3CC7T 2PU9B 4BACA 5DY9A 4ME7A 1K73C 2LCLA 4X9CA 3KXTA 4M4ZA 2DXCA 5CQXA 5GAN5 4HT9A 4JLIA 1QVFS 4J7IA 1X69A 1Q86C 2GF7A 3OSSC 2E4HA 2HL3A 2RHIA 1TWBA 3CCJT 4X9DA 4Z8AA 5GAN7 2KT1A 3GLXA 2LTOA 5GAOq 1N27A 3CCVT 4FYYB 3D7SB 5DM7R 1H92A 2RO0A 4XU1A 3CC2Q 2BTTA 5LJ3g 1I81A 2NUPA 4JDSA 1VYUA 3H0HA 4FSSA 5GAOn 2QEXT 4AG2C 4FT2A 5KYXA 1PSEA 1IHWA 2COWA 4XU0A 2CS7A 1YITT 2DRKA 3A98A 3JB9J 1HSQA 1M90R 4M75C 2LJ1A 4FYVB 4AG1C 3C12A 5L8RE 1FMKA 2CDTA 4HXJA 5CCAA 4QVCA 3CCSQ 2DYIA 1VIFA 1Y96A 4L59A 4PJOD 4ANJA 2DBKA 2JN0A 5D6YA 3G71A 3SEMA 3A8OB 2ED1A 1Q7YU 1V29B 2DYBA 4F7UB 2RK1A 1N5ZA 5AYFA 1D0YA 4KUIA 1XNIA 4RCBA 3NMZC 2KNBB 4JZ4A 4OMQA 3JCMW 3CCMT 1ZUKA 2RK2A 3NTHA 4C8QD 5I11A 4XTXA 1O9SA 1R0CB 2YDLA 3RESA 2F69A 3UT1A 4EMGA 1BIAA 3OS0A 4J9DA 2O88A 2VC8A 3ZL7C 1AHJB 4R55A 2V8JA 3CD6T 3URGA 1BKBA 2FB7A 3UA7A 1VQ5A 4RUGA 3QDFA 1VQPA 3HFNA 4M7DD 1KG1A 3M0RA 3RDVA 2DBMA 4ZTJA 4LDYA 4F14A 2QASA 1QWFA 1YI2Q 1TU0B 2XK0A 3VJPA 2ZCFB 3X26B 2RQRA 2K3BA 2E3HA 4M77G 2M51A 3QZ5B 2DXBA 1H8KA 1KQSA 1D0ZA 1GXIE 2RF0A 2E65A 3DKMA 4OGEA 3VS2A 3OYDA 1E6HA 4AFSC 2O4XA 4II1A 2JTFA 1K9MR 1WI7A 1PKTA 3SFMA 5KCHA 1HD3A 3AT1B 4LDWA 5FW9A 3OS2A 2LC4A 2K5FA 3ZEHA 2GGRA 4PLIA 2RHYA 3A8GB 1JQQA 4FW2A 2QI2A 1VQLQ 1OU9A 5CKDA 3A1PA 3EG9B 2PZ1A 4QW2A 3CC4A 1GCQC 4KGVB 3EHRA 1G5VA 2KVQG 4XTWA 3G1JA 2DXTA 1QKXA 4RG2A 2OTLT 2QTXA 4OMNA 2M16A 2KROA 2VGMA 1PM3A 2AZSA 1IGQA 1RACB 1WJRA 1NLOC 5KE3A 1G3YA 2MF2A 4M78G 3CCUT 1M1GA 3EFSA 1W70A 1QCOA 2I0NA 3CMAA 2NUPB 4WTOB 1QP3A 4E7SA 1OZ2A 2HMAA 2QAZA 3A8MB 4LXCA 2YWWA 1WXBA 1YWPA 2DNUA 4M77C 1I1JA 2EVRA 2HAXA 2VKNA 4B6MA 2ZAEA 4J9FA 3QIIA 1M1KR 1EX4A 3EG3A 4ESRA 5IAYA 3CCQT 1IGUA 1K73R 1VUBA 3O8VA 3JCMX 3L2VA 4QT7A 1VQOA 5D6WA 1Y57A 2X9HA 4C92A 2L89A 3SB2A 3QXEB 2BZ8A 2HNIA 4NL3A 1UECA 4FW1A 2E64A 3JB9H 2KMTA 1VQ8Q 1Q81R 4C8QA 3ER0A 3PTAA 4OB0B 1Y96B 1TH7A 5CIUA 2FPDA 1QKWA 4UC4A 3EFOB 2DFUA 5I21A 2DL3A 2KT8A 1TXQA 2L0AA 1M30A 2E5KA 3HL8A 2RN8A 1UE9A 2CUBA 4DOWA 1MV3A 4J9GA 2DEUA 2CREA 1OYXA 3V8JA 1KQ2A 2DL4A 3R6NA 4IUQA 5M9OA 3OS1A 3JCMf 2EQKA 4M7AC 4BE1A 3HPWA 1Q7YR 3NTKA 1UDLA 1WGSA 4DOVA 3CC2T 4VUBA 2LQKA 1FMWA 1YHQA 3BFMA 1NJIC 1ARKA 1PKSA 2FG0A 1XOVA 3UWNA 1KQ1A 4RTYA 2EGCA 3CXCP 4FYXB 2NLUA 2P0QA 1ZUYA 3UPUA 1PNJA 4PJOE 1YBYA 2EYYA 2ZPBB 3CCJQ 4QVDA 3M59A 1OPLA 3CCST 2AT1B 4LUDA 3E2UA 2VXEA 4M75D 4FM4B 3FRNA 2MOXA 2DJZA 1W2BA 1T0JA 4KBMB 4C8QE 1C6VX 3JCMb 1ZSZA 1AOJA 1G3TA 1NPRA 1SG5A 4DBFA 5KE2A 1N6AA 4DA4A 2RJDA 4IURA 3OYMA 4M77F 2OTJT 2QEXQ 1I5OB 5CO7A 1YJWA 4LUEA 1YJ9A 1FXXA 4DEYA 2VVKA 2JOYA 1SKUB 2P4RA 5FU6C 4M7DE 2KRMA 3GIBA 1OI1A 1KC8C 3E9GA 2KYMA 2DPPB 5C0MA 1W1FA 3LH5A 5D6XA 2YUOA 4KGXB 4E7HA 3G6ET 3I55A 1HXDA 2YSQA 1YJNA 4PK4A 2EW3A 3OSVA 2IPOB 1M90C 1YI2T 3VS1A 2HQEA 1AWJA 1OEBA 3V7SA 2DF6A 2QA4A 3L2ZA 4P5NA 3VS3A 4RTVA 2CZ0B 3QKJA 4ZGDB 3OYYA 1VYTA 4F16A 2QQAA 3JB9G 2FO0A 3CCEA 3JCMh 1OULA 2G3RA 1YCYA 2XMFA 2J6FA 4L6V5 3CCMQ 2DLPA 2LQWA 1U1TA 1RI9A 1K8AU 4IUPA 3I56A 2DTHA 4PJOB 4PFZA 1BYMA 1W4SA 1BB9A 5GAN2 4FU6A 2G6FX 3KUFA 4M78F 4KUDK 1GCPA 4EMKC 3E1SA 5KYNA 2VGNA 1X6OA 1VQLT 3CCVA 4C8QB 4HA8A 2C0OA 1QLYA 1X2KA 4CC3A 4RKUE 5J39A 2CP0A 2K2MA 2KK4A 4A4HA 3VS5A 3FJPA 1YIJA 3GF5A 2OAWA 4D8KA 2L5QA 1ZHIA 4M7DB 1YWOA 2MI6A 2PNIA 2QQSA 1KD1R 1NM7A 2V1QA 4HCCA 2O9SA 1BCOA 5HKCA 2X4JA 2LZ6B 4F7UA 5GAN8 5AT1B 3M0UA 4DQ2A 5LL6S 1C1AA 2RQWA 3PVLA 3TSZA 4BI4A 1KHIA 2B8AA 1PWTA 2RJFA 2GTJA 2LCSA 4KT0E 4A4FA 4J9CA 4OF1A 5GAN6 3QJ6A 1G3SA 1R0BG 4FSXA 4M75A 2DD4A 2HQXA 5GAOp 3R6OA 3FC3A 3C94A 3H6ZA 3MCAB 2PVOB 2PVDB 5ECAA 3FB9A 2VYTA 4M77D 1RAHB 1JO8A 1M2VA 4GBQA 1VQ8T 4PFPA 3UATA 3NPFA 4CC4B 5FWCA 4ELZC 4ZN1A 1ZSZB 4MZPA 4F04B 2QG9B 4XTYA 3LLRA 2K57A 3CCRA 1M1FA 1VQMT 1FX7A 4A54A 5KH6A 2V8IA 6AT1B 2ED0A 3RMQA 3HSBA 2E6NA 1F1BB 2DZCA 3QO3A 3OQ5A 3H9NA 4CRIA 2LX7A 3ULRB 4CI0C 3EH1A 1JXMA 2O9VA 4Z89A 4OB3B 2HEQA 4A4EA 1BI2A 4GLKA 2BKDN 2QQ9A 5GMKm 4M7AD 2FPEA 3VS7A 2XDPA 2K4YA 3LWIA 1IRXA 1CKBA 2L3SA 3T9NA 1VQ9A 3EG9A 4X1VA 3G71Q 2A08A 4BI3A 2EGEA 4A4GA 2D8JA 1RAAB 3LW5E 4MMKA 4M75E 3ZBDA 1OX9A 4FIBA 2ABLA 2DO3A 4C5GA 3OYFA 1Q81C 5A0DA 3QG1A 3G4ST 4ZTFA 3TCJA 2QGFB 1I5LA 2X4WA 3CXCS 5FWBA 2AKLA 4LDUA 2FRWA 3V8LA 2OI3A 4JPBW 3P8BB 1SSFA 2X3WD 2Y4XA 5FU7B 3OYHA 2YT6A 2H8HA 2KXCA 2RHXA 1AZEA 2RI3A 1D0XA 3FLGA 1SHFA 2YRVA 3SWNB 2LRQA 2K6DA 1KC8R 4ZNXA 4HT8A 2DERA 4N4IA 1M5Q1 3L2WA 1Q7YC 5EC7A 2JXBA 2KBTA 2ZPEB 1D1BA 2R5MA 1GCQA 4QKUA 3JB9F 3VS4A 2GFAA 3HTRA 3EG0A 4BY6C 2MWOA 3P8DA 2DTIA 3LWHA 4BE2A 3RKWA 4B9XA 4HVVA 1VQ7A 5LJ5f 2V1RA 2DK3A 2XG8D 4LDVA 2MMPA 5HY6A 3OYGA 2HSPA 3CCLT 1MMDA 2XI9A 3EGXB 4LNPA 1X01A 2MCNA 2DVEA 3HHTB 1TUDA 3GBQA 3EFOA 2RHUA 3IQLA 2RNAA 5D7UA 4C0FA 1K9AA 1ABOA 1Y07A 1QVGA 3MP6A 1WHGA 4KH0B 1BIBA 3META 2OTJQ 5GMKl 1GBRA 2LP5A 3I5SA 2IG0A 3CC4Q 1I07A 1UB4A 3H41A 1Y7XA 2EYWA 4M75B 1X6BA 4RTXA 5CAIA 3O5ZA 1X6GA 2MAMA 2A0FB 5GAN4 1K4US 3MP8A 3G6EQ 2FZKB 3CPFA 2AKKA 1WYXA 3JRZA 4R0KA 1IO6A 2EWNA 2ECZA 1M2VB 2CSQA 1AVZC 3C95A 3M53A 4HVWA 2FL7A 3OMGA 2CH4A 1TS9A 2KE9A 5A0GA 3N5BB 4OMMA 3PFSA 1RL2A 4WF2A 2DX1A 3OMCA 1X2QA 3CC2A 1VQNA 4L5GA 3UDCA 1VQKA 4EPCA 4BDYA 3VU3C 1UGQB 1UHFA 4BE0A 3C4SA 4M7AA 2K3XA 2EJFA 2DD5A 5HK3A 3VS6A 5GMKj 1I4K1 2W0ZA 1VQOQ 1K0XA 3OYIA 4RTWA 3C0CA 1UEBA 2GCXA 1JU5C 3M0TA 4Y91A 1NPPA 2ZGWA 3BY7A 1UJYA 3CCSA 3LYIA 5CKBA 2JM8A 2PUKB 3L2QA 1KIKA 1LPLA 4J6WA 3HRUA 4M77E 3OW2A 5LJ5h 3M0SA 2ZPHB 1KQSP 1M4ZA 2DA9A 2J06A 4BB7A 3PNWC 2GQIA 1ABQA 3CPWA 4DBHA 1JJ2A 2F5KA 3OA6A 3Q1JA 5LJ3f 3OY9A 3OYBA 1B7TA 1OX8A 1BCMA 3ASKA 5CKEA 4C5EA 7AT1B 1MMAA 1WJSA 3CBOA 3GNFB 5I2SA 3BW1A 2KRNA 1IREB 4GY5A 2LMJA 2L2PA 5FLXE 2WSCE 2VB6A 2QTVA 4N0AA 3VV0A 1UGVA 2CP6A 2EQJA 4CC7A 1KD1C 3JCMe 4LDXA 5J3BA 3TQ7P 4QQDA 3A8HB 4KULA 3M57A 4OP0A 3CBMA 4OGCA 1M27C 3JB9I 1HYOA 4M7AE 4PJOA 2AZVA 2KAFA 3I9QA 3QYGB 2NWMA 4XQ3A 1WHKA 2ZPFB 3HKSA 2RD1A 4BDZA 1WIEA 2CP3A 3PIPA 1QQJA 1VQ4A 5CQYA 4C0DC 4A63B 3RUXA 2M1HA 4MDXA 2A7YA 1U8RA 4OMOA 3MP1A 2YHTA 2M0YA 4ZN3A 2K5IA 3G71T 1Q82U 3RKXA 1BI1A 1QVFA 3M9QA 3HRTA 4RG8A 1YJ9Q 1U06A 5GAN3 1T0HA 2D9TA 3VYHB 2IVWA 1VQMQ 4IUVA 4M7DA 1XTDA 4M77B 4XU3A 3VS0A 3FEOA 4EMHA 1VQLA 1QWEA 5GAOm 3ZFJA 4LE9A 2DRMA 1W6XA 1TG0A 1U3OA 4XTZA 4C5HA 2YLCA 4AFZC 3I55Q 1VQ5T 3M4GA 2H3JA 2K2VA 4NOYA 1MGQA 4PJOG 2R58A 1YJNQ 2Z0WA 3THKA 1NYFA 1N8RU 2A36A 2D6FA 4M78C 2JS0A 5C6SA 1OU8A 4C92G 1MV0B 4J9IA 3JV3A 1OZ3A 1VQ6A 1SRMA 1RLQC 2SRCA 2EPDA 3MO8A 2O2OA 3LGLA 1QP2A 2JMCA 2O01E 4C8QG 3RKYA 1QVFP 2HDAA 1EIFA 3CCEQ 4KH1B 5LJ3h 3S3NA 1OOTA 3REBB 1UFFA 1PD0A 3S3MA 4J7FA 3G4SQ 4JS4A 4PJJA 4LD9K 4M7AB 5CKFA 3I56Q 2DL8A 4M7DG 4PFOA 1NZ9A 2FYKA 2E6ZA 1M8MA 4E7IA 3NFCA 3WVEB 1YN8A 1LOJA 3J80E 2VXFA 3ME9A 1JBMA 2HKNA 1Q95G 2L3PA 1JB0E 3CC4T 5GANj 2JVVA 1NJIU 2F1LA 1RUWA 4BD3A 3GNGA 3OYAA 1MHNA 2E1HA 2DE0X 3M56A 3LX7A 1AEYA 2PQWA 2DEQA 1WZOA 5GAMj 2YXYA 2QK0A 3QUIA 4PJMA 2J6KA 1KSWA 1K8AC 3RERA 1WHLA 3MEVA 2BUDA 2RM4A 2DMOA 3CCLQ 3M5AA 1ZX6A 5GAOl 5IN1A 2X51A 1W2BP 1GBQA 4EIKA 1WHMA 4Y92A 2J7IA 3CMAT 3H0IA 1ZBJA 2WSEE 5CKHA 1HJDA 4C92C 5LJ5j 1H641 3CMEA 2CP2A 4F17A 2PTKA 3QYHB 3CC7A 1D1AA 2JJ9A 3I5RA 3VUBA 4JRPA 4JJDA 2NUTA 1S72Q 3NHNA 2P0KA 2QXFA 5FU6B 4E7JA 1VQOT 3SWNA 2L8DA 1XQHA 3H0FA 2XHCA 4NL2A 2JM9A 1PRMC 3M0PA 2YRDA 4AFQC 3CCJA 1UHCA 2R57A 4J8OA 4J6YA 2RQUA 4Z02A 2JT4A 2KY9A 4OMLA 3EGDB 2CP5A 5EG2A 2XDDA 3J7AF 3PMIA 1ZUUA 1M90U 3MEWA 1IXDA 1HK9A 2V8KA 3CCRQ 4PKCC 2EBPA 3QWYA 4XTUA 2DL7A 2Y4YA 3CBPA 2QEXA 4D6WA 2R5AA 3EGXA 3VRYA 1PC0A 2LJ0A 1JXOA 3X24B 1YITA 1WQ7A 3PGGA 4OMPA 1KQSS 1Z9QA 2A3LA 1RADB 2ROLA 1YHQT 1BBZA 4CC2A 2HL5C 2KI7A 3CQTA 4EMKB 4R56A 1VQ9Q 4PNOA 1MMGA 1B34B 4OB2B 1X75C 3QWXX 3VYGA 2L3QA 3FIFA 2AIRB 4E7KA 1TTHB 5GMKi 1K76A 1NEBA 1NEGA 4E7ZA 4FL6A 2COZA 3F70A 4HCKA 1T3SA 3RNJA 2Y90A 4OB1B 1M3CA 2X35A 5GMKh 2YRCA 3CCMA 2KSSA 3MPUB 2ATCB 2EIFA 4C92F 2DKGA 5DLOA 3NGPA 2AHJB 3A5ZB 5I2MA 3CD6A 2F2XA 3EAEA 5GJVB 1YJ9T 4F7UG 2DXUA 2DIQA 2F2WA 1K9MU 3UA6A 5LJ3j 1QW1A 3TEEA 1UJ0A 2D0NA 2EYQA 2EJGA 2I2LA 4EDUA 1E7OA 1LNXA 2KR3A 3HFOA 2P84A 2E3IA 3WXMB 3I55T 2ZPIB 4M75G 3SDZA 1YJNT 1I0CA 4KGZB 1WJQA 3LGFA 4IIOA 2IIMA 1G3WA 4YTLA 2HSEB 2HD0A 3L2UA 2QA4T 4DBQA 2YLBA 2A37A 3PVQA 2RH2A 2DM1A 1P92A 2JZ2A 3EG2A 5KYWA 4PLLA 3QZ9B 3CCET 5LJ5e 4QVZA 1BI3A 4M78D 4OMFB 2FZGB 5GANf 1M9SA 1VYVA 2CSIA 4MDWA 3I56T 1H3ZA 2DVJA 2NUTB 2D8HA 2HBWA 2RA2A 3TU4K 1AWXA 5FROA 5GAMf 1WDXA 5LJ5d 1VQ5Q 1VQPQ 2LCCA 3G7ZA 3GPLA 2JNGA 1RABB 2OTLA 2F2VA 1UTIA 2OX7A 4JRKA 2M0OA 1WXUA 5FRNA 2QQBA 1QVPA 1K8AR 2QGGA 5I22A 1M1KU 2E12A 2M9UA 3CCUA 1VQNQ 1VQKQ 2DL5A 1K73U 3KBGA 2V26A 1YIJT 2MPXC 4BUGA 2LVMA 1A0NB 1PHTA 2HKQB 2YUPA 4DEXA 3HRSA 2M02A 1ZA2B 1N9RA 1Q86U 2DILA 2C0IA 1Q81U 4E2FB 3EG1A 3E19A 2LT4A 4FT4A 4MMLA 5KYUB 3CCQA 3RR6A 1WPYA 2CP7A 2COYA 4BI8B 3QJYA 1SF9A 3JCMV 1SSHA 1N9SA 1Y0MA 4M77A 4JS5A 4JLGA 5HK0A 1W2BS 2CZ1B 2K79A 1S72T 2FVUA 2DIGA 4E6RA 4JJBA 4BY6B 1E6GA 2JTMA 4C92D 2RHZA 1R8OB 2KGTA 3OYEA 1O75A 2DJQA 4V2SA 2D1XA 2LJ3A 2LNHB 2CT4A 1PG5B 3PE0A 1VIEA 1RAFB 1NLPC 4E47A 2FEIA 4RTZA 3JCMg 3CMAQ 1QVGP 2L3RA 2K5LA 5KYYB 1LJOA 2LT1A 2EAYA 2RQVA 3CCRT 5GANh 4MZTA 4KRTA 2BE9B 1D3BA 5LJ3e 3MKDA 3JAME 3KFVA 2HZYA 4Y28E 2RJEA 5GAMh 1M3AA 2BIVA 3EH2A 2RB6A 2CKKA 1AWOA 4JJCA 3OBWA 2EQMA 1VQ4Q 3DLLA 1U5SA 2WACA 2FZCB 1UGPB 1KJWA 1FYNA 4M78A 2RJCA 4ZGEB 5LJ3d 1VQ9T 4J83A 3JCMJ 2LDMA 1LCKA 2FPFA 3OYJA 4MZMA 4ATOA 1JEGA 1ZSGA 3I35A 3EFRA 4F7UF 3OYCA 4C5IA 4IUTA 4RTUA 5KYWB 2XD0A 2KDSA 1H3HA 5IH2A 3GP8A 2OTJA 1SRLA 2EKHA 1V1CA 3QHSA 3EHQA 4M75F 1G8XA 2MIOA 3JB9D 2JS2A 4C0ZA 4M7AG 4A4KA 4K11A 4OVAA 4AFUC 3RMSA 1I8FA 3OB9A 1YHQQ 2X3XD 4FYWB 3VKIA 5CK9A 3G6EA 1U1SA 1PSFA 1ZLMA 1Q82C 2D0QB 1MNDA 2K7AA 4QQGA 5IHNA 2E41A 1VQ6Q 1X27A 2SEMA 2P0PA 1YI2A 1AT1B 3OW2P 2GQVA 1SPKA 3JSCA 3TREA 4Q5WA 1GFDA 1VQ7T 2CZ7B 1WX6A 1ZQ1A 3DB3A 4RTTA 1QCFA 4PJLA 3RBBB 3CPWP 2EQUA 1JJ2P 2RQTA 4JZ3A 3JCMd 4O5VA 5KYXB 4E7LA 3EGDA 2BE7D 4M78E 9ATCB 5A0LA 1VOMA 1N8RC 4B9WA 1X43A 3OYLA 3J81E 1AZGB 3VUZA 1EZZB 3DLMA 3L42A 2XIDA 2EYZA 5L23A 4C0GA 1YJWQ 4HCBA 1Q86R 1K1ZA 2A28A 4NS5A 4LN2A 3M55A 1NE8A 1PRLC 5CR2A 1NYGA 1OV3A 1UGRB 1WNLA 2HCKA 3L2RA 4JUVA 3M4YA 2VASA 3CXCA 3MJXA 4XU2A 1JRIA 1IB8A 4XAXB 1KD1U 1IHVA 2RI5A 4FCYA 1V76A 2YUQA 1C0MA 2QYZA 2KEAA 3PMTA 1R77A 3QDRB 2EFIA 1VQPT 2KRSA 1YP5A 1RI0A 1MUZA 4C0DB 4EMKA 8ATCB 2CYZB 1B34A 3OS5A 2HQHA 3PT9A 2QA4Q 2B86A 1M3BA 5CVIA 1RAEB 1VQNT 1AWWA 3M54A 1VQKT 4TVRA 2QDLA 3CMEQ 1WQWA 3H8ZA 2JUFA 1YCSB 3UF4A 3M58A 3QBYA 1TUGB 1D09B 3CC7Q 1D3BB 3BDUA 3WVDB 2C06A 3OYKA 5GMKe 2QDYB 4DBRA 2GBQA 1KFZA 2GFUA 3TVTA 4J6XA 3V7RA 4J9HA 1GRIA 4RCCA 2GNCA 3TSWA 4LD6A 4AT1B 4JJNK 1UG1A 2LNVA 1KHCA 1MMNA 2K9GA 3DB4A 5IXBA 2O4XB 5HCKA 4ORZA 2YUNA 4M78B 4C92E 5A2QE 2JTEA 3CCVQ 2H3EB 1RLPC 2E5QA 1RAGB 2CH4W 2MK5A 2E10A 3BDLA 1VQ8A 2AK5A 4J9EA 4JRQA 3RIRA 8AT1B 1YIJQ 1Y71A 2C0TA 4A53A 4N0AC 2ZPGB 2P4TA 3JCMQ 4N4GA 2ZZDA 1VQMA 2F5TX 2HBPA 1YITQ 1B3QA 3S6WA 4ZGJB 4IKFA 4PJOC 3SHWA 1WXTA 4HCZA 1GL5A 2DETA 3MEAA 3PIOA 3QSUA 2DTOA 2LX9A 2RI2A 2DAQA 1D1CA 4QQ6A 3U23A 3L1AA 3HP9A 1DJ7B 1TOVA 1PCXA 2EJ9A 4HKEA 4C8QC 2EQIA 1M8VA 2ROTA 1QVGS 3AHUA 2VUBA 2NYSA 3X25B 1MNEA 1VQ4T 1NBEB 2JW4A 1KC8U 4M7AF 1XJWB 5FRMA 2J6OA 3NTIA 1BU1A 1QMCA 4IIMA 1LVKA 3JCMc 4M7DC 2EKOA 3MHXA 3G4SA 1SHGA 1YNZA 2RPNA 4HVUA 1SEMA 2KYBA 5IHIA 1ACMB 1UUEA 2BZXA 3QPHA 5GANg 3CD6Q 4ELYC 4J5YA 4C92B 2E70A 2K3YA 4J9BA 4D8DA 5GAMg 1PD1A 4RMOA 1WHHA 1CKAA 3A8LB 1Q82R 1B07A 1FMVA 4PJNA 1BI0A 1G83A 3X28B 5KYUA 2DZ9A 4X34A 2O31A 3P8HA 2XKOC 1WA7A 2FRYA
chains in the Genus database with same CATH topology
1PNJA 1WXUA 2CT3A 1T3LA 3M0SA 2EYYA 3VRZA 5I22A 1GFCA 2ENMA 2DA9A 2J06A 1WFWA 1OPLA 2ESWA 1NG2A 2DL5A 1OPKA 2GQIA 1ABQA 1CSKA 4LUDA 2CUDA 5GJWB 2MOXA 2W10A 1PHTA 1A0NB 1Z9ZA 2OJ2A 1T0JA 4WCIA 2YUPA 4DEXA 5IXFA 1S1NA 1AOJA 2DILA 2C0IA 2KRNA 3EG1A 3FJ5A 2LMJA 2L2PA 4LUEA 4DEYA 1UGVA 3REAB 1J3TA 2VVKA 4CC7A 2P4RA 1VA7A 2KRMA 4GLMA 2KYMA 1SSHA 1Y0MA 1W1FA 1M27C 3LH5A 2YUOA 2AZVA 2GTOA 1K0SA 2NUZA 3I9QA 2JMAA 2NWMA 2K79A 2YSQA 4E6RA 5IHKA 4JJBA 1WIEA 1E6GA 2EW3A 2KXDA 4A63B 3VS1A 2KGTA 2EGAA 1AWJA 1OEBA 2DJQA 2DF6A 2LQNA 4OMOA 4Z88A 2J05A 3VS3A 2BZYA 2M0YA 2D1XA 4RTVA 2LJ3A 2LNHB 2RMOA 1BK2A 2CT4A 3PE0A 1VYTA 1AD5A 2VWFA 4F16A 1NLPC 2FO0A 2FEIA 2XMFA 2J6FA 3EGUA 4RTZA 2DLPA 2LQWA 1U06A 1RI9A 1T0HA 2EYXA 1WLPB 2RQVA 3M0QA 4KRTA 3VS0A 1G2BA 1TUCA 1QWEA 1BB9A 4LE9A 1EFNA 2DRMA 1W6XA 1TG0A 2G6FX 1U3OA 3KFVA 1M3AA 4AFZC 1GCPA 1AWOA 4JJCA 3THKA 4M4ZA 1NYFA 2A36A 1X69A 2C0OA 1U5SA 2JS0A 1QLYA 1X2KA 1MV0B 4CC3A 1KJWA 1FYNA 4J9IA 3JV3A 2K2MA 1SRMA 4Z8AA 1RLQC 2SRCA 2KT1A 1LCKA 2EPDA 2FPFA 2O2OA 1JEGA 1ZSGA 2JMCA 3I35A 3VS5A 2OAWA 2HDAA 4D8KA 1H92A 4RTUA 1OOTA 3REBB 1UFFA 1YWOA 2PNIA 1H3HA 5IH2A 2BTTA 1NM7A 2V1QA 2O9SA 1VYUA 3H0HA 2LZ6B 1SRLA 4FSSA 2DL8A 2EKHA 1V1CA 3EHQA 4AG2C 3M0UA 2MIOA 2JS2A 1M8MA 2RQWA 3PVLA 3TSZA 1YN8A 4K11A 1PWTA 4AFUC 2GTJA 2LCSA 2DRKA 3A98A 1HSQA 4J9CA 2X3XD 2LJ1A 4AG1C 2L3PA 1ZLMA 1FMKA 1RUWA 2CDTA 2K7AA 5IHNA 2DE0X 1AEYA 5ECAA 4HXJA 1X27A 2SEMA 1JO8A 1SPKA 4GBQA 2DBKA 2J6KA 1GFDA 1KSWA 3UATA 1WX6A 3SEMA 2ED1A 4RTTA 3NPFA 1QCFA 2DYBA 5FWCA 3RBBB 4CC4B 2DMOA 1N5ZA 1ZX6A 2RQTA 4JZ3A 3NMZC 2KNBB 4JZ4A 4OMQA 1GBQA 4EIKA 1ZUKA 4Y92A 2J7IA 5I11A 3H0IA 1ZBJA 2YDLA 1HJDA 1X43A 1AZGB 2ED0A 4J9DA 2O88A 3ZL7C 4F17A 2EYZA 5L23A 2PTKA 1K1ZA 2A28A 3I5RA 4LN2A 4JJDA 3UA7A 4RUGA 1PRLC 3NHNA 2LX7A 1NYGA 3M0RA 1OV3A 3ULRB 1JXMA 2O9VA 2DBMA 2HCKA 4Z89A 2HEQA 4F14A 1QWFA 2FPEA 3H0FA 3VS7A 2JM9A 2YUQA 1PRMC 2KEAA 3M0PA 1CKBA 2L3SA 2RQRA 2K3BA 4AFQC 4X1VA 2M51A 1UHCA 2KRSA 2A08A 1H8KA 1YP5A 2RQUA 1MUZA 2JT4A 4OMLA 2EGEA 2RF0A 2D8JA 3VS2A 1E6HA 4AFSC 1ZUUA 2B86A 2ABLA 1M3BA 1WI7A 1PKTA 1AWWA 2EBPA 3QWYA 2QDLA 1HD3A 5FWBA 2DL7A 2AKLA 1YCSB 2FRWA 3UF4A 2OI3A 4JPBW 5FW9A 2X3WD 3VRYA 2YT6A 2H8HA 2KXCA 1AZEA 2LJ0A 1JXOA 1SHFA 4OMPA 2GGRA 1KFZA 2GBQA 1Z9QA 2K6DA 1JQQA 4ZNXA 3TVTA 2ROLA 1BBZA 4J9HA 4CC2A 1GRIA 2PZ1A 1GCQC 3EHRA 2GNCA 3CQTA 5EC7A 3TSWA 2JXBA 2KBTA 1UG1A 1GCQA 3VS4A 2K9GA 5IXBA 1QKXA 3EG0A 3QWXX 2L3QA 4OMNA 5HCKA 4ORZA 2YUNA 2KROA 2JTEA 1RLPC 2AZSA 2CH4W 1K76A 1NEBA 1NEGA 4HVVA 2V1RA 2AK5A 4J9EA 1NLOC 4HCKA 1T3SA 3RNJA 1M3CA 2HSPA 2C0TA 4LNPA 2MCNA 1TUDA 3GBQA 1W70A 3IQLA 2I0NA 2RNAA 1K9AA 1ABOA 1B3QA 1WXBA 1YWPA 2DNUA 1I1JA 2EVRA 3NGPA 2VKNA 1GBRA 3SHWA 1WXTA 4J9FA 2LP5A 3I5SA 1GL5A 2F2XA 3EG3A 5GJVB 4ESRA 1I07A 2F2WA 3UA6A 3H41A 4QT7A 2EYWA 1Y57A 1UJ0A 2D0NA 3U23A 1X6BA 4RTXA 3O5ZA 2BZ8A 1X6GA 1E7OA 1K4US 1UECA 2KR3A 2EQIA 2AKKA 1WYXA 2ROTA 4R0KA 1IO6A 2FPDA 2ECZA 1I0CA 1QKWA 2CSQA 1AVZC 2DL3A 4HVWA 2JW4A 4IIOA 2IIMA 2KT8A 2J6OA 2L0AA 1BU1A 1M30A 2CH4A 2A37A 2E5KA 2RN8A 2KE9A 4IIMA 1UE9A 3PVQA 2CUBA 2DM1A 4OMMA 1SHGA 1YNZA 2DX1A 3EG2A 1X2QA 1MV3A 2RPNA 4J9GA 2CREA 4HVUA 2DL4A 1SEMA 3R6NA 2KYBA 1UHFA 5IHIA 1UUEA 2BZXA 3VS6A 1UDLA 2W0ZA 4J9BA 4D8DA 1VYVA 1K0XA 2CSIA 4RTWA 2DVJA 3C0CA 1ARKA 1PKSA 1CKAA 2FG0A 1XOVA 2D8HA 2HBWA 1AWXA 1B07A 1JU5C 1WDXA 4RTYA 3M0TA 1G83A 2EGCA 1UJYA 2O31A 2F2VA 1UTIA 2JM8A 1ZUYA 1WA7A 2FRYA 1KIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PNJ A;  1WXU A;  2CT3 A;  1T3L A;  3M0S A;  2EYY A;  3VRZ A;  5I22 A;  1GFC A;  2ENM A;  2DA9 A;  2J06 A;  1WFW A;  1OPL A;  2ESW A;  1NG2 A;  2DL5 A;  1OPK A;  2GQI A;  1ABQ A;  1CSK A;  4LUD A;  2CUD A;  5GJW B;  2MOX A;  2W10 A;  1PHT A;  1A0N B;  1Z9Z A;  2OJ2 A;  1T0J A;  4WCI A;  2YUP A;  4DEX A;  5IXF A;  1S1N A;  1AOJ A;  2DIL A;  2C0I A;  2KRN A;  3EG1 A;  3FJ5 A;  2LMJ A;  2L2P A;  4LUE A;  4DEY A;  1UGV A;  3REA B;  1J3T A;  2VVK A;  4CC7 A;  2P4R A;  1VA7 A;  2KRM A;  4GLM A;  2KYM A;  1SSH A;  1Y0M A;  1W1F A;  1M27 C;  3LH5 A;  2YUO A;  2AZV A;  2GTO A;  1K0S A;  2NUZ A;  3I9Q A;  2JMA A;  2NWM A;  2K79 A;  2YSQ A;  4E6R A;  5IHK A;  4JJB A;  1WIE A;  1E6G A;  2EW3 A;  2KXD A;  4A63 B;  3VS1 A;  2KGT A;  2EGA A;  1AWJ A;  1OEB A;  2DJQ A;  2DF6 A;  2LQN A;  4OMO A;  4Z88 A;  2J05 A;  3VS3 A;  2BZY A;  2M0Y A;  2D1X A;  4RTV A;  2LJ3 A;  2LNH B;  2RMO A;  1BK2 A;  2CT4 A;  3PE0 A;  1VYT A;  1AD5 A;  2VWF A;  4F16 A;  1NLP C;  2FO0 A;  2FEI A;  2XMF A;  2J6F A;  3EGU A;  4RTZ A;  2DLP A;  2LQW A;  1U06 A;  1RI9 A;  1T0H A;  2EYX A;  1WLP B;  2RQV A;  3M0Q A;  4KRT A;  3VS0 A;  1G2B A;  1TUC A;  1QWE A;  1BB9 A;  4LE9 A;  1EFN A;  2DRM A;  1W6X A;  1TG0 A;  2G6F X;  1U3O A;  3KFV A;  1M3A A;  4AFZ C;  1GCP A;  1AWO A;  4JJC A;  3THK A;  4M4Z A;  1NYF A;  2A36 A;  1X69 A;  2C0O A;  1U5S A;  2JS0 A;  1QLY A;  1X2K A;  1MV0 B;  4CC3 A;  1KJW A;  1FYN A;  4J9I A;  3JV3 A;  2K2M A;  1SRM A;  4Z8A A;  1RLQ C;  2SRC A;  2KT1 A;  1LCK A;  2EPD A;  2FPF A;  2O2O A;  1JEG A;  1ZSG A;  2JMC A;  3I35 A;  3VS5 A;  2OAW A;  2HDA A;  4D8K A;  1H92 A;  4RTU A;  1OOT A;  3REB B;  1UFF A;  1YWO A;  2PNI A;  1H3H A;  5IH2 A;  2BTT A;  1NM7 A;  2V1Q A;  2O9S A;  1VYU A;  3H0H A;  2LZ6 B;  1SRL A;  4FSS A;  2DL8 A;  2EKH A;  1V1C A;  3EHQ A;  4AG2 C;  3M0U A;  2MIO A;  2JS2 A;  1M8M A;  2RQW A;  3PVL A;  3TSZ A;  1YN8 A;  4K11 A;  1PWT A;  4AFU C;  2GTJ A;  2LCS A;  2DRK A;  3A98 A;  1HSQ A;  4J9C A;  2X3X D;  2LJ1 A;  4AG1 C;  2L3P A;  1ZLM A;  1FMK A;  1RUW A;  2CDT A;  2K7A A;  5IHN A;  2DE0 X;  1AEY A;  5ECA A;  4HXJ A;  1X27 A;  2SEM A;  1JO8 A;  1SPK A;  4GBQ A;  2DBK A;  2J6K A;  1GFD A;  1KSW A;  3UAT A;  1WX6 A;  3SEM A;  2ED1 A;  4RTT A;  3NPF A;  1QCF A;  2DYB A;  5FWC A;  3RBB B;  4CC4 B;  2DMO A;  1N5Z A;  1ZX6 A;  2RQT A;  4JZ3 A;  3NMZ C;  2KNB B;  4JZ4 A;  4OMQ A;  1GBQ A;  4EIK A;  1ZUK A;  4Y92 A;  2J7I A;  5I11 A;  3H0I A;  1ZBJ A;  2YDL A;  1HJD A;  1X43 A;  1AZG B;  2ED0 A;  4J9D A;  2O88 A;  3ZL7 C;  4F17 A;  2EYZ A;  5L23 A;  2PTK A;  1K1Z A;  2A28 A;  3I5R A;  4LN2 A;  4JJD A;  3UA7 A;  4RUG A;  1PRL C;  3NHN A;  2LX7 A;  1NYG A;  3M0R A;  1OV3 A;  3ULR B;  1JXM A;  2O9V A;  2DBM A;  2HCK A;  4Z89 A;  2HEQ A;  4F14 A;  1QWF A;  2FPE A;  3H0F A;  3VS7 A;  2JM9 A;  2YUQ A;  1PRM C;  2KEA A;  3M0P A;  1CKB A;  2L3S A;  2RQR A;  2K3B A;  4AFQ C;  4X1V A;  2M51 A;  1UHC A;  2KRS A;  2A08 A;  1H8K A;  1YP5 A;  2RQU A;  1MUZ A;  2JT4 A;  4OML A;  2EGE A;  2RF0 A;  2D8J A;  3VS2 A;  1E6H A;  4AFS C;  1ZUU A;  2B86 A;  2ABL A;  1M3B A;  1WI7 A;  1PKT A;  1AWW A;  2EBP A;  3QWY A;  2QDL A;  1HD3 A;  5FWB A;  2DL7 A;  2AKL A;  1YCS B;  2FRW A;  3UF4 A;  2OI3 A;  4JPB W;  5FW9 A;  2X3W D;  3VRY A;  2YT6 A;  2H8H A;  2KXC A;  1AZE A;  2LJ0 A;  1JXO A;  1SHF A;  4OMP A;  2GGR A;  1KFZ A;  2GBQ A;  1Z9Q A;  2K6D A;  1JQQ A;  4ZNX A;  3TVT A;  2ROL A;  1BBZ A;  4J9H A;  4CC2 A;  1GRI A;  2PZ1 A;  1GCQ C;  3EHR A;  2GNC A;  3CQT A;  5EC7 A;  3TSW A;  2JXB A;  2KBT A;  1UG1 A;  1GCQ A;  3VS4 A;  2K9G A;  5IXB A;  1QKX A;  3EG0 A;  3QWX X;  2L3Q A;  4OMN A;  5HCK A;  4ORZ A;  2YUN A;  2KRO A;  2JTE A;  1RLP C;  2AZS A;  2CH4 W;  1K76 A;  1NEB A;  1NEG A;  4HVV A;  2V1R A;  2AK5 A;  4J9E A;  1NLO C;  4HCK A;  1T3S A;  3RNJ A;  1M3C A;  2HSP A;  2C0T A;  4LNP A;  2MCN A;  1TUD A;  3GBQ A;  1W70 A;  3IQL A;  2I0N A;  2RNA A;  1K9A A;  1ABO A;  1B3Q A;  1WXB A;  1YWP A;  2DNU A;  1I1J A;  2EVR A;  3NGP A;  2VKN A;  1GBR A;  3SHW A;  1WXT A;  4J9F A;  2LP5 A;  3I5S A;  1GL5 A;  2F2X A;  3EG3 A;  5GJV B;  4ESR A;  1I07 A;  2F2W A;  3UA6 A;  3H41 A;  4QT7 A;  2EYW A;  1Y57 A;  1UJ0 A;  2D0N A;  3U23 A;  1X6B A;  4RTX A;  3O5Z A;  2BZ8 A;  1X6G A;  1E7O A;  1K4U S;  1UEC A;  2KR3 A;  2EQI A;  2AKK A;  1WYX A;  2ROT A;  4R0K A;  1IO6 A;  2FPD A;  2ECZ A;  1I0C A;  1QKW A;  2CSQ A;  1AVZ C;  2DL3 A;  4HVW A;  2JW4 A;  4IIO A;  2IIM A;  2KT8 A;  2J6O A;  2L0A A;  1BU1 A;  1M30 A;  2CH4 A;  2A37 A;  2E5K A;  2RN8 A;  2KE9 A;  4IIM A;  1UE9 A;  3PVQ A;  2CUB A;  2DM1 A;  4OMM A;  1SHG A;  1YNZ A;  2DX1 A;  3EG2 A;  1X2Q A;  1MV3 A;  2RPN A;  4J9G A;  2CRE A;  4HVU A;  2DL4 A;  1SEM A;  3R6N A;  2KYB A;  1UHF A;  5IHI A;  1UUE A;  2BZX A;  3VS6 A;  1UDL A;  2W0Z A;  4J9B A;  4D8D A;  1VYV A;  1K0X A;  2CSI A;  4RTW A;  2DVJ A;  3C0C A;  1ARK A;  1PKS A;  1CKA A;  2FG0 A;  1XOV A;  2D8H A;  2HBW A;  1AWX A;  1B07 A;  1JU5 C;  1WDX A;  4RTY A;  3M0T A;  1G83 A;  2EGC A;  1UJY A;  2O31 A;  2F2V A;  1UTI A;  2JM8 A;  1ZUY A;  1WA7 A;  2FRY A;  1KIK A; 
#chains in the Genus database with same CATH topology
 2MWP A;  1FWZ A;  2CT3 A;  1T3L A;  1UGS B;  2XIC A;  3VRZ A;  3INZ A;  1GFC A;  2ENM A;  1WFW A;  4JRI A;  1VQ6 T;  2ESW A;  5LJ5 g;  3CCL A;  1M2O A;  1NG2 A;  1OPK A;  1CSK A;  2LQ8 A;  2CUD A;  4PL6 A;  5GJW B;  1KK7 A;  3OBY A;  2W10 A;  2XDB A;  1ZSZ C;  1Z9Z A;  2OJ2 A;  3X20 B;  1K9M C;  3BE3 A;  4WCI A;  2PUO B;  3V7C A;  1N8R R;  5IXF A;  1S1N A;  3LH0 A;  3FJ5 A;  5DLQ E;  5KCO A;  3V8K A;  4O6J A;  3JCM P;  1RAI B;  4PJO F;  3FDR A;  2QQR A;  3OW2 S;  2X4X A;  3REA B;  1J3T A;  1S72 A;  5IT9 E;  1VA7 A;  1TSF A;  1YFN A;  4GLM A;  4AMC A;  5KYY A;  2OTL Q;  2PVG B;  2CGH A;  3E9F A;  3CPW S;  1JJ2 S;  1WHJ A;  1YJW T;  2XU8 A;  2GTO A;  3S3O A;  1K0S A;  2NUZ A;  2JMA A;  4C8Q F;  5GAN e;  2WSF E;  5IHK A;  5J26 A;  1QCN A;  4IUU A;  4XK8 E;  2KXD A;  3SD4 A;  3CCU Q;  2CZ6 B;  2EGA A;  2X4Y A;  5GAM e;  2OAU A;  2LQN A;  2VV5 A;  4Z88 A;  2J05 A;  2BZY A;  1OQK A;  1VQ7 Q;  4XTV A;  2RMO A;  1BK2 A;  2KQW A;  3CEY A;  2MYS A;  4M7D F;  1AD5 A;  2VWF A;  5GAN d;  1ZA1 B;  3GOX A;  1NJI R;  3EGU A;  3MEU A;  5GAO r;  1IZ6 A;  3CCQ Q;  5FU7 C;  2EYX A;  5GAM d;  1WLP B;  3M0Q A;  3SWN C;  1G2B A;  1TUC A;  4N4H A;  3CME T;  4F7U E;  3OYN A;  1EFN A;  1ZBX A;  1M1K C;  2FHD A;  3CC7 T;  2PU9 B;  4BAC A;  5DY9 A;  4ME7 A;  1K73 C;  2LCL A;  4X9C A;  3KXT A;  4M4Z A;  2DXC A;  5CQX A;  5GAN 5;  4HT9 A;  4JLI A;  1QVF S;  4J7I A;  1X69 A;  1Q86 C;  2GF7 A;  3OSS C;  2E4H A;  2HL3 A;  2RHI A;  1TWB A;  3CCJ T;  4X9D A;  4Z8A A;  5GAN 7;  2KT1 A;  3GLX A;  2LTO A;  5GAO q;  1N27 A;  3CCV T;  4FYY B;  3D7S B;  5DM7 R;  1H92 A;  2RO0 A;  4XU1 A;  3CC2 Q;  2BTT A;  5LJ3 g;  1I81 A;  2NUP A;  4JDS A;  1VYU A;  3H0H A;  4FSS A;  5GAO n;  2QEX T;  4AG2 C;  4FT2 A;  5KYX A;  1PSE A;  1IHW A;  2COW A;  4XU0 A;  2CS7 A;  1YIT T;  2DRK A;  3A98 A;  3JB9 J;  1HSQ A;  1M90 R;  4M75 C;  2LJ1 A;  4FYV B;  4AG1 C;  3C12 A;  5L8R E;  1FMK A;  2CDT A;  4HXJ A;  5CCA A;  4QVC A;  3CCS Q;  2DYI A;  1VIF A;  1Y96 A;  4L59 A;  4PJO D;  4ANJ A;  2DBK A;  2JN0 A;  5D6Y A;  3G71 A;  3SEM A;  3A8O B;  2ED1 A;  1Q7Y U;  1V29 B;  2DYB A;  4F7U B;  2RK1 A;  1N5Z A;  5AYF A;  1D0Y A;  4KUI A;  1XNI A;  4RCB A;  3NMZ C;  2KNB B;  4JZ4 A;  4OMQ A;  3JCM W;  3CCM T;  1ZUK A;  2RK2 A;  3NTH A;  4C8Q D;  5I11 A;  4XTX A;  1O9S A;  1R0C B;  2YDL A;  3RES A;  2F69 A;  3UT1 A;  4EMG A;  1BIA A;  3OS0 A;  4J9D A;  2O88 A;  2VC8 A;  3ZL7 C;  1AHJ B;  4R55 A;  2V8J A;  3CD6 T;  3URG A;  1BKB A;  2FB7 A;  3UA7 A;  1VQ5 A;  4RUG A;  3QDF A;  1VQP A;  3HFN A;  4M7D D;  1KG1 A;  3M0R A;  3RDV A;  2DBM A;  4ZTJ A;  4LDY A;  4F14 A;  2QAS A;  1QWF A;  1YI2 Q;  1TU0 B;  2XK0 A;  3VJP A;  2ZCF B;  3X26 B;  2RQR A;  2K3B A;  2E3H A;  4M77 G;  2M51 A;  3QZ5 B;  2DXB A;  1H8K A;  1KQS A;  1D0Z A;  1GXI E;  2RF0 A;  2E65 A;  3DKM A;  4OGE A;  3VS2 A;  3OYD A;  1E6H A;  4AFS C;  2O4X A;  4II1 A;  2JTF A;  1K9M R;  1WI7 A;  1PKT A;  3SFM A;  5KCH A;  1HD3 A;  3AT1 B;  4LDW A;  5FW9 A;  3OS2 A;  2LC4 A;  2K5F A;  3ZEH A;  2GGR A;  4PLI A;  2RHY A;  3A8G B;  1JQQ A;  4FW2 A;  2QI2 A;  1VQL Q;  1OU9 A;  5CKD A;  3A1P A;  3EG9 B;  2PZ1 A;  4QW2 A;  3CC4 A;  1GCQ C;  4KGV B;  3EHR A;  1G5V A;  2KVQ G;  4XTW A;  3G1J A;  2DXT A;  1QKX A;  4RG2 A;  2OTL T;  2QTX A;  4OMN A;  2M16 A;  2KRO A;  2VGM A;  1PM3 A;  2AZS A;  1IGQ A;  1RAC B;  1WJR A;  1NLO C;  5KE3 A;  1G3Y A;  2MF2 A;  4M78 G;  3CCU T;  1M1G A;  3EFS A;  1W70 A;  1QCO A;  2I0N A;  3CMA A;  2NUP B;  4WTO B;  1QP3 A;  4E7S A;  1OZ2 A;  2HMA A;  2QAZ A;  3A8M B;  4LXC A;  2YWW A;  1WXB A;  1YWP A;  2DNU A;  4M77 C;  1I1J A;  2EVR A;  2HAX A;  2VKN A;  4B6M A;  2ZAE A;  4J9F A;  3QII A;  1M1K R;  1EX4 A;  3EG3 A;  4ESR A;  5IAY A;  3CCQ T;  1IGU A;  1K73 R;  1VUB A;  3O8V A;  3JCM X;  3L2V A;  4QT7 A;  1VQO A;  5D6W A;  1Y57 A;  2X9H A;  4C92 A;  2L89 A;  3SB2 A;  3QXE B;  2BZ8 A;  2HNI A;  4NL3 A;  1UEC A;  4FW1 A;  2E64 A;  3JB9 H;  2KMT A;  1VQ8 Q;  1Q81 R;  4C8Q A;  3ER0 A;  3PTA A;  4OB0 B;  1Y96 B;  1TH7 A;  5CIU A;  2FPD A;  1QKW A;  4UC4 A;  3EFO B;  2DFU A;  5I21 A;  2DL3 A;  2KT8 A;  1TXQ A;  2L0A A;  1M30 A;  2E5K A;  3HL8 A;  2RN8 A;  1UE9 A;  2CUB A;  4DOW A;  1MV3 A;  4J9G A;  2DEU A;  2CRE A;  1OYX A;  3V8J A;  1KQ2 A;  2DL4 A;  3R6N A;  4IUQ A;  5M9O A;  3OS1 A;  3JCM f;  2EQK A;  4M7A C;  4BE1 A;  3HPW A;  1Q7Y R;  3NTK A;  1UDL A;  1WGS A;  4DOV A;  3CC2 T;  4VUB A;  2LQK A;  1FMW A;  1YHQ A;  3BFM A;  1NJI C;  1ARK A;  1PKS A;  2FG0 A;  1XOV A;  3UWN A;  1KQ1 A;  4RTY A;  2EGC A;  3CXC P;  4FYX B;  2NLU A;  2P0Q A;  1ZUY A;  3UPU A;  1PNJ A;  4PJO E;  1YBY A;  2EYY A;  2ZPB B;  3CCJ Q;  4QVD A;  3M59 A;  1OPL A;  3CCS T;  2AT1 B;  4LUD A;  3E2U A;  2VXE A;  4M75 D;  4FM4 B;  3FRN A;  2MOX A;  2DJZ A;  1W2B A;  1T0J A;  4KBM B;  4C8Q E;  1C6V X;  3JCM b;  1ZSZ A;  1AOJ A;  1G3T A;  1NPR A;  1SG5 A;  4DBF A;  5KE2 A;  1N6A A;  4DA4 A;  2RJD A;  4IUR A;  3OYM A;  4M77 F;  2OTJ T;  2QEX Q;  1I5O B;  5CO7 A;  1YJW A;  4LUE A;  1YJ9 A;  1FXX A;  4DEY A;  2VVK A;  2JOY A;  1SKU B;  2P4R A;  5FU6 C;  4M7D E;  2KRM A;  3GIB A;  1OI1 A;  1KC8 C;  3E9G A;  2KYM A;  2DPP B;  5C0M A;  1W1F A;  3LH5 A;  5D6X A;  2YUO A;  4KGX B;  4E7H A;  3G6E T;  3I55 A;  1HXD A;  2YSQ A;  1YJN A;  4PK4 A;  2EW3 A;  3OSV A;  2IPO B;  1M90 C;  1YI2 T;  3VS1 A;  2HQE A;  1AWJ A;  1OEB A;  3V7S A;  2DF6 A;  2QA4 A;  3L2Z A;  4P5N A;  3VS3 A;  4RTV A;  2CZ0 B;  3QKJ A;  4ZGD B;  3OYY A;  1VYT A;  4F16 A;  2QQA A;  3JB9 G;  2FO0 A;  3CCE A;  3JCM h;  1OUL A;  2G3R A;  1YCY A;  2XMF A;  2J6F A;  4L6V 5;  3CCM Q;  2DLP A;  2LQW A;  1U1T A;  1RI9 A;  1K8A U;  4IUP A;  3I56 A;  2DTH A;  4PJO B;  4PFZ A;  1BYM A;  1W4S A;  1BB9 A;  5GAN 2;  4FU6 A;  2G6F X;  3KUF A;  4M78 F;  4KUD K;  1GCP A;  4EMK C;  3E1S A;  5KYN A;  2VGN A;  1X6O A;  1VQL T;  3CCV A;  4C8Q B;  4HA8 A;  2C0O A;  1QLY A;  1X2K A;  4CC3 A;  4RKU E;  5J39 A;  2CP0 A;  2K2M A;  2KK4 A;  4A4H A;  3VS5 A;  3FJP A;  1YIJ A;  3GF5 A;  2OAW A;  4D8K A;  2L5Q A;  1ZHI A;  4M7D B;  1YWO A;  2MI6 A;  2PNI A;  2QQS A;  1KD1 R;  1NM7 A;  2V1Q A;  4HCC A;  2O9S A;  1BCO A;  5HKC A;  2X4J A;  2LZ6 B;  4F7U A;  5GAN 8;  5AT1 B;  3M0U A;  4DQ2 A;  5LL6 S;  1C1A A;  2RQW A;  3PVL A;  3TSZ A;  4BI4 A;  1KHI A;  2B8A A;  1PWT A;  2RJF A;  2GTJ A;  2LCS A;  4KT0 E;  4A4F A;  4J9C A;  4OF1 A;  5GAN 6;  3QJ6 A;  1G3S A;  1R0B G;  4FSX A;  4M75 A;  2DD4 A;  2HQX A;  5GAO p;  3R6O A;  3FC3 A;  3C94 A;  3H6Z A;  3MCA B;  2PVO B;  2PVD B;  5ECA A;  3FB9 A;  2VYT A;  4M77 D;  1RAH B;  1JO8 A;  1M2V A;  4GBQ A;  1VQ8 T;  4PFP A;  3UAT A;  3NPF A;  4CC4 B;  5FWC A;  4ELZ C;  4ZN1 A;  1ZSZ B;  4MZP A;  4F04 B;  2QG9 B;  4XTY A;  3LLR A;  2K57 A;  3CCR A;  1M1F A;  1VQM T;  1FX7 A;  4A54 A;  5KH6 A;  2V8I A;  6AT1 B;  2ED0 A;  3RMQ A;  3HSB A;  2E6N A;  1F1B B;  2DZC A;  3QO3 A;  3OQ5 A;  3H9N A;  4CRI A;  2LX7 A;  3ULR B;  4CI0 C;  3EH1 A;  1JXM A;  2O9V A;  4Z89 A;  4OB3 B;  2HEQ A;  4A4E A;  1BI2 A;  4GLK A;  2BKD N;  2QQ9 A;  5GMK m;  4M7A D;  2FPE A;  3VS7 A;  2XDP A;  2K4Y A;  3LWI A;  1IRX A;  1CKB A;  2L3S A;  3T9N A;  1VQ9 A;  3EG9 A;  4X1V A;  3G71 Q;  2A08 A;  4BI3 A;  2EGE A;  4A4G A;  2D8J A;  1RAA B;  3LW5 E;  4MMK A;  4M75 E;  3ZBD A;  1OX9 A;  4FIB A;  2ABL A;  2DO3 A;  4C5G A;  3OYF A;  1Q81 C;  5A0D A;  3QG1 A;  3G4S T;  4ZTF A;  3TCJ A;  2QGF B;  1I5L A;  2X4W A;  3CXC S;  5FWB A;  2AKL A;  4LDU A;  2FRW A;  3V8L A;  2OI3 A;  4JPB W;  3P8B B;  1SSF A;  2X3W D;  2Y4X A;  5FU7 B;  3OYH A;  2YT6 A;  2H8H A;  2KXC A;  2RHX A;  1AZE A;  2RI3 A;  1D0X A;  3FLG A;  1SHF A;  2YRV A;  3SWN B;  2LRQ A;  2K6D A;  1KC8 R;  4ZNX A;  4HT8 A;  2DER A;  4N4I A;  1M5Q 1;  3L2W A;  1Q7Y C;  5EC7 A;  2JXB A;  2KBT A;  2ZPE B;  1D1B A;  2R5M A;  1GCQ A;  4QKU A;  3JB9 F;  3VS4 A;  2GFA A;  3HTR A;  3EG0 A;  4BY6 C;  2MWO A;  3P8D A;  2DTI A;  3LWH A;  4BE2 A;  3RKW A;  4B9X A;  4HVV A;  1VQ7 A;  5LJ5 f;  2V1R A;  2DK3 A;  2XG8 D;  4LDV A;  2MMP A;  5HY6 A;  3OYG A;  2HSP A;  3CCL T;  1MMD A;  2XI9 A;  3EGX B;  4LNP A;  1X01 A;  2MCN A;  2DVE A;  3HHT B;  1TUD A;  3GBQ A;  3EFO A;  2RHU A;  3IQL A;  2RNA A;  5D7U A;  4C0F A;  1K9A A;  1ABO A;  1Y07 A;  1QVG A;  3MP6 A;  1WHG A;  4KH0 B;  1BIB A;  3MET A;  2OTJ Q;  5GMK l;  1GBR A;  2LP5 A;  3I5S A;  2IG0 A;  3CC4 Q;  1I07 A;  1UB4 A;  3H41 A;  1Y7X A;  2EYW A;  4M75 B;  1X6B A;  4RTX A;  5CAI A;  3O5Z A;  1X6G A;  2MAM A;  2A0F B;  5GAN 4;  1K4U S;  3MP8 A;  3G6E Q;  2FZK B;  3CPF A;  2AKK A;  1WYX A;  3JRZ A;  4R0K A;  1IO6 A;  2EWN A;  2ECZ A;  1M2V B;  2CSQ A;  1AVZ C;  3C95 A;  3M53 A;  4HVW A;  2FL7 A;  3OMG A;  2CH4 A;  1TS9 A;  2KE9 A;  5A0G A;  3N5B B;  4OMM A;  3PFS A;  1RL2 A;  4WF2 A;  2DX1 A;  3OMC A;  1X2Q A;  3CC2 A;  1VQN A;  4L5G A;  3UDC A;  1VQK A;  4EPC A;  4BDY A;  3VU3 C;  1UGQ B;  1UHF A;  4BE0 A;  3C4S A;  4M7A A;  2K3X A;  2EJF A;  2DD5 A;  5HK3 A;  3VS6 A;  5GMK j;  1I4K 1;  2W0Z A;  1VQO Q;  1K0X A;  3OYI A;  4RTW A;  3C0C A;  1UEB A;  2GCX A;  1JU5 C;  3M0T A;  4Y91 A;  1NPP A;  2ZGW A;  3BY7 A;  1UJY A;  3CCS A;  3LYI A;  5CKB A;  2JM8 A;  2PUK B;  3L2Q A;  1KIK A;  1LPL A;  4J6W A;  3HRU A;  4M77 E;  3OW2 A;  5LJ5 h;  3M0S A;  2ZPH B;  1KQS P;  1M4Z A;  2DA9 A;  2J06 A;  4BB7 A;  3PNW C;  2GQI A;  1ABQ A;  3CPW A;  4DBH A;  1JJ2 A;  2F5K A;  3OA6 A;  3Q1J A;  5LJ3 f;  3OY9 A;  3OYB A;  1B7T A;  1OX8 A;  1BCM A;  3ASK A;  5CKE A;  4C5E A;  7AT1 B;  1MMA A;  1WJS A;  3CBO A;  3GNF B;  5I2S A;  3BW1 A;  2KRN A;  1IRE B;  4GY5 A;  2LMJ A;  2L2P A;  5FLX E;  2WSC E;  2VB6 A;  2QTV A;  4N0A A;  3VV0 A;  1UGV A;  2CP6 A;  2EQJ A;  4CC7 A;  1KD1 C;  3JCM e;  4LDX A;  5J3B A;  3TQ7 P;  4QQD A;  3A8H B;  4KUL A;  3M57 A;  4OP0 A;  3CBM A;  4OGC A;  1M27 C;  3JB9 I;  1HYO A;  4M7A E;  4PJO A;  2AZV A;  2KAF A;  3I9Q A;  3QYG B;  2NWM A;  4XQ3 A;  1WHK A;  2ZPF B;  3HKS A;  2RD1 A;  4BDZ A;  1WIE A;  2CP3 A;  3PIP A;  1QQJ A;  1VQ4 A;  5CQY A;  4C0D C;  4A63 B;  3RUX A;  2M1H A;  4MDX A;  2A7Y A;  1U8R A;  4OMO A;  3MP1 A;  2YHT A;  2M0Y A;  4ZN3 A;  2K5I A;  3G71 T;  1Q82 U;  3RKX A;  1BI1 A;  1QVF A;  3M9Q A;  3HRT A;  4RG8 A;  1YJ9 Q;  1U06 A;  5GAN 3;  1T0H A;  2D9T A;  3VYH B;  2IVW A;  1VQM Q;  4IUV A;  4M7D A;  1XTD A;  4M77 B;  4XU3 A;  3VS0 A;  3FEO A;  4EMH A;  1VQL A;  1QWE A;  5GAO m;  3ZFJ A;  4LE9 A;  2DRM A;  1W6X A;  1TG0 A;  1U3O A;  4XTZ A;  4C5H A;  2YLC A;  4AFZ C;  3I55 Q;  1VQ5 T;  3M4G A;  2H3J A;  2K2V A;  4NOY A;  1MGQ A;  4PJO G;  2R58 A;  1YJN Q;  2Z0W A;  3THK A;  1NYF A;  1N8R U;  2A36 A;  2D6F A;  4M78 C;  2JS0 A;  5C6S A;  1OU8 A;  4C92 G;  1MV0 B;  4J9I A;  3JV3 A;  1OZ3 A;  1VQ6 A;  1SRM A;  1RLQ C;  2SRC A;  2EPD A;  3MO8 A;  2O2O A;  3LGL A;  1QP2 A;  2JMC A;  2O01 E;  4C8Q G;  3RKY A;  1QVF P;  2HDA A;  1EIF A;  3CCE Q;  4KH1 B;  5LJ3 h;  3S3N A;  1OOT A;  3REB B;  1UFF A;  1PD0 A;  3S3M A;  4J7F A;  3G4S Q;  4JS4 A;  4PJJ A;  4LD9 K;  4M7A B;  5CKF A;  3I56 Q;  2DL8 A;  4M7D G;  4PFO A;  1NZ9 A;  2FYK A;  2E6Z A;  1M8M A;  4E7I A;  3NFC A;  3WVE B;  1YN8 A;  1LOJ A;  3J80 E;  2VXF A;  3ME9 A;  1JBM A;  2HKN A;  1Q95 G;  2L3P A;  1JB0 E;  3CC4 T;  5GAN j;  2JVV A;  1NJI U;  2F1L A;  1RUW A;  4BD3 A;  3GNG A;  3OYA A;  1MHN A;  2E1H A;  2DE0 X;  3M56 A;  3LX7 A;  1AEY A;  2PQW A;  2DEQ A;  1WZO A;  5GAM j;  2YXY A;  2QK0 A;  3QUI A;  4PJM A;  2J6K A;  1KSW A;  1K8A C;  3RER A;  1WHL A;  3MEV A;  2BUD A;  2RM4 A;  2DMO A;  3CCL Q;  3M5A A;  1ZX6 A;  5GAO l;  5IN1 A;  2X51 A;  1W2B P;  1GBQ A;  4EIK A;  1WHM A;  4Y92 A;  2J7I A;  3CMA T;  3H0I A;  1ZBJ A;  2WSE E;  5CKH A;  1HJD A;  4C92 C;  5LJ5 j;  1H64 1;  3CME A;  2CP2 A;  4F17 A;  2PTK A;  3QYH B;  3CC7 A;  1D1A A;  2JJ9 A;  3I5R A;  3VUB A;  4JRP A;  4JJD A;  2NUT A;  1S72 Q;  3NHN A;  2P0K A;  2QXF A;  5FU6 B;  4E7J A;  1VQO T;  3SWN A;  2L8D A;  1XQH A;  3H0F A;  2XHC A;  4NL2 A;  2JM9 A;  1PRM C;  3M0P A;  2YRD A;  4AFQ C;  3CCJ A;  1UHC A;  2R57 A;  4J8O A;  4J6Y A;  2RQU A;  4Z02 A;  2JT4 A;  2KY9 A;  4OML A;  3EGD B;  2CP5 A;  5EG2 A;  2XDD A;  3J7A F;  3PMI A;  1ZUU A;  1M90 U;  3MEW A;  1IXD A;  1HK9 A;  2V8K A;  3CCR Q;  4PKC C;  2EBP A;  3QWY A;  4XTU A;  2DL7 A;  2Y4Y A;  3CBP A;  2QEX A;  4D6W A;  2R5A A;  3EGX A;  3VRY A;  1PC0 A;  2LJ0 A;  1JXO A;  3X24 B;  1YIT A;  1WQ7 A;  3PGG A;  4OMP A;  1KQS S;  1Z9Q A;  2A3L A;  1RAD B;  2ROL A;  1YHQ T;  1BBZ A;  4CC2 A;  2HL5 C;  2KI7 A;  3CQT A;  4EMK B;  4R56 A;  1VQ9 Q;  4PNO A;  1MMG A;  1B34 B;  4OB2 B;  1X75 C;  3QWX X;  3VYG A;  2L3Q A;  3FIF A;  2AIR B;  4E7K A;  1TTH B;  5GMK i;  1K76 A;  1NEB A;  1NEG A;  4E7Z A;  4FL6 A;  2COZ A;  3F70 A;  4HCK A;  1T3S A;  3RNJ A;  2Y90 A;  4OB1 B;  1M3C A;  2X35 A;  5GMK h;  2YRC A;  3CCM A;  2KSS A;  3MPU B;  2ATC B;  2EIF A;  4C92 F;  2DKG A;  5DLO A;  3NGP A;  2AHJ B;  3A5Z B;  5I2M A;  3CD6 A;  2F2X A;  3EAE A;  5GJV B;  1YJ9 T;  4F7U G;  2DXU A;  2DIQ A;  2F2W A;  1K9M U;  3UA6 A;  5LJ3 j;  1QW1 A;  3TEE A;  1UJ0 A;  2D0N A;  2EYQ A;  2EJG A;  2I2L A;  4EDU A;  1E7O A;  1LNX A;  2KR3 A;  3HFO A;  2P84 A;  2E3I A;  3WXM B;  3I55 T;  2ZPI B;  4M75 G;  3SDZ A;  1YJN T;  1I0C A;  4KGZ B;  1WJQ A;  3LGF A;  4IIO A;  2IIM A;  1G3W A;  4YTL A;  2HSE B;  2HD0 A;  3L2U A;  2QA4 T;  4DBQ A;  2YLB A;  2A37 A;  3PVQ A;  2RH2 A;  2DM1 A;  1P92 A;  2JZ2 A;  3EG2 A;  5KYW A;  4PLL A;  3QZ9 B;  3CCE T;  5LJ5 e;  4QVZ A;  1BI3 A;  4M78 D;  4OMF B;  2FZG B;  5GAN f;  1M9S A;  1VYV A;  2CSI A;  4MDW A;  3I56 T;  1H3Z A;  2DVJ A;  2NUT B;  2D8H A;  2HBW A;  2RA2 A;  3TU4 K;  1AWX A;  5FRO A;  5GAM f;  1WDX A;  5LJ5 d;  1VQ5 Q;  1VQP Q;  2LCC A;  3G7Z A;  3GPL A;  2JNG A;  1RAB B;  2OTL A;  2F2V A;  1UTI A;  2OX7 A;  4JRK A;  2M0O A;  1WXU A;  5FRN A;  2QQB A;  1QVP A;  1K8A R;  2QGG A;  5I22 A;  1M1K U;  2E12 A;  2M9U A;  3CCU A;  1VQN Q;  1VQK Q;  2DL5 A;  1K73 U;  3KBG A;  2V26 A;  1YIJ T;  2MPX C;  4BUG A;  2LVM A;  1A0N B;  1PHT A;  2HKQ B;  2YUP A;  4DEX A;  3HRS A;  2M02 A;  1ZA2 B;  1N9R A;  1Q86 U;  2DIL A;  2C0I A;  1Q81 U;  4E2F B;  3EG1 A;  3E19 A;  2LT4 A;  4FT4 A;  4MML A;  5KYU B;  3CCQ A;  3RR6 A;  1WPY A;  2CP7 A;  2COY A;  4BI8 B;  3QJY A;  1SF9 A;  3JCM V;  1SSH A;  1N9S A;  1Y0M A;  4M77 A;  4JS5 A;  4JLG A;  5HK0 A;  1W2B S;  2CZ1 B;  2K79 A;  1S72 T;  2FVU A;  2DIG A;  4E6R A;  4JJB A;  4BY6 B;  1E6G A;  2JTM A;  4C92 D;  2RHZ A;  1R8O B;  2KGT A;  3OYE A;  1O75 A;  2DJQ A;  4V2S A;  2D1X A;  2LJ3 A;  2LNH B;  2CT4 A;  1PG5 B;  3PE0 A;  1VIE A;  1RAF B;  1NLP C;  4E47 A;  2FEI A;  4RTZ A;  3JCM g;  3CMA Q;  1QVG P;  2L3R A;  2K5L A;  5KYY B;  1LJO A;  2LT1 A;  2EAY A;  2RQV A;  3CCR T;  5GAN h;  4MZT A;  4KRT A;  2BE9 B;  1D3B A;  5LJ3 e;  3MKD A;  3JAM E;  3KFV A;  2HZY A;  4Y28 E;  2RJE A;  5GAM h;  1M3A A;  2BIV A;  3EH2 A;  2RB6 A;  2CKK A;  1AWO A;  4JJC A;  3OBW A;  2EQM A;  1VQ4 Q;  3DLL A;  1U5S A;  2WAC A;  2FZC B;  1UGP B;  1KJW A;  1FYN A;  4M78 A;  2RJC A;  4ZGE B;  5LJ3 d;  1VQ9 T;  4J83 A;  3JCM J;  2LDM A;  1LCK A;  2FPF A;  3OYJ A;  4MZM A;  4ATO A;  1JEG A;  1ZSG A;  3I35 A;  3EFR A;  4F7U F;  3OYC A;  4C5I A;  4IUT A;  4RTU A;  5KYW B;  2XD0 A;  2KDS A;  1H3H A;  5IH2 A;  3GP8 A;  2OTJ A;  1SRL A;  2EKH A;  1V1C A;  3QHS A;  3EHQ A;  4M75 F;  1G8X A;  2MIO A;  3JB9 D;  2JS2 A;  4C0Z A;  4M7A G;  4A4K A;  4K11 A;  4OVA A;  4AFU C;  3RMS A;  1I8F A;  3OB9 A;  1YHQ Q;  2X3X D;  4FYW B;  3VKI A;  5CK9 A;  3G6E A;  1U1S A;  1PSF A;  1ZLM A;  1Q82 C;  2D0Q B;  1MND A;  2K7A A;  4QQG A;  5IHN A;  2E41 A;  1VQ6 Q;  1X27 A;  2SEM A;  2P0P A;  1YI2 A;  1AT1 B;  3OW2 P;  2GQV A;  1SPK A;  3JSC A;  3TRE A;  4Q5W A;  1GFD A;  1VQ7 T;  2CZ7 B;  1WX6 A;  1ZQ1 A;  3DB3 A;  4RTT A;  1QCF A;  4PJL A;  3RBB B;  3CPW P;  2EQU A;  1JJ2 P;  2RQT A;  4JZ3 A;  3JCM d;  4O5V A;  5KYX B;  4E7L A;  3EGD A;  2BE7 D;  4M78 E;  9ATC B;  5A0L A;  1VOM A;  1N8R C;  4B9W A;  1X43 A;  3OYL A;  3J81 E;  1AZG B;  3VUZ A;  1EZZ B;  3DLM A;  3L42 A;  2XID A;  2EYZ A;  5L23 A;  4C0G A;  1YJW Q;  4HCB A;  1Q86 R;  1K1Z A;  2A28 A;  4NS5 A;  4LN2 A;  3M55 A;  1NE8 A;  1PRL C;  5CR2 A;  1NYG A;  1OV3 A;  1UGR B;  1WNL A;  2HCK A;  3L2R A;  4JUV A;  3M4Y A;  2VAS A;  3CXC A;  3MJX A;  4XU2 A;  1JRI A;  1IB8 A;  4XAX B;  1KD1 U;  1IHV A;  2RI5 A;  4FCY A;  1V76 A;  2YUQ A;  1C0M A;  2QYZ A;  2KEA A;  3PMT A;  1R77 A;  3QDR B;  2EFI A;  1VQP T;  2KRS A;  1YP5 A;  1RI0 A;  1MUZ A;  4C0D B;  4EMK A;  8ATC B;  2CYZ B;  1B34 A;  3OS5 A;  2HQH A;  3PT9 A;  2QA4 Q;  2B86 A;  1M3B A;  5CVI A;  1RAE B;  1VQN T;  1AWW A;  3M54 A;  1VQK T;  4TVR A;  2QDL A;  3CME Q;  1WQW A;  3H8Z A;  2JUF A;  1YCS B;  3UF4 A;  3M58 A;  3QBY A;  1TUG B;  1D09 B;  3CC7 Q;  1D3B B;  3BDU A;  3WVD B;  2C06 A;  3OYK A;  5GMK e;  2QDY B;  4DBR A;  2GBQ A;  1KFZ A;  2GFU A;  3TVT A;  4J6X A;  3V7R A;  4J9H A;  1GRI A;  4RCC A;  2GNC A;  3TSW A;  4LD6 A;  4AT1 B;  4JJN K;  1UG1 A;  2LNV A;  1KHC A;  1MMN A;  2K9G A;  3DB4 A;  5IXB A;  2O4X B;  5HCK A;  4ORZ A;  2YUN A;  4M78 B;  4C92 E;  5A2Q E;  2JTE A;  3CCV Q;  2H3E B;  1RLP C;  2E5Q A;  1RAG B;  2CH4 W;  2MK5 A;  2E10 A;  3BDL A;  1VQ8 A;  2AK5 A;  4J9E A;  4JRQ A;  3RIR A;  8AT1 B;  1YIJ Q;  1Y71 A;  2C0T A;  4A53 A;  4N0A C;  2ZPG B;  2P4T A;  3JCM Q;  4N4G A;  2ZZD A;  1VQM A;  2F5T X;  2HBP A;  1YIT Q;  1B3Q A;  3S6W A;  4ZGJ B;  4IKF A;  4PJO C;  3SHW A;  1WXT A;  4HCZ A;  1GL5 A;  2DET A;  3MEA A;  3PIO A;  3QSU A;  2DTO A;  2LX9 A;  2RI2 A;  2DAQ A;  1D1C A;  4QQ6 A;  3U23 A;  3L1A A;  3HP9 A;  1DJ7 B;  1TOV A;  1PCX A;  2EJ9 A;  4HKE A;  4C8Q C;  2EQI A;  1M8V A;  2ROT A;  1QVG S;  3AHU A;  2VUB A;  2NYS A;  3X25 B;  1MNE A;  1VQ4 T;  1NBE B;  2JW4 A;  1KC8 U;  4M7A F;  1XJW B;  5FRM A;  2J6O A;  3NTI A;  1BU1 A;  1QMC A;  4IIM A;  1LVK A;  3JCM c;  4M7D C;  2EKO A;  3MHX A;  3G4S A;  1SHG A;  1YNZ A;  2RPN A;  4HVU A;  1SEM A;  2KYB A;  5IHI A;  1ACM B;  1UUE A;  2BZX A;  3QPH A;  5GAN g;  3CD6 Q;  4ELY C;  4J5Y A;  4C92 B;  2E70 A;  2K3Y A;  4J9B A;  4D8D A;  5GAM g;  1PD1 A;  4RMO A;  1WHH A;  1CKA A;  3A8L B;  1Q82 R;  1B07 A;  1FMV A;  4PJN A;  1BI0 A;  1G83 A;  3X28 B;  5KYU A;  2DZ9 A;  4X34 A;  2O31 A;  3P8H A;  2XKO C;  1WA7 A;  2FRY A; 
#chains in the Genus database with same CATH homology
 1PNJ A;  1WXU A;  2CT3 A;  1T3L A;  3M0S A;  2EYY A;  3VRZ A;  5I22 A;  1GFC A;  2ENM A;  2DA9 A;  2J06 A;  1WFW A;  1OPL A;  2ESW A;  1NG2 A;  2DL5 A;  1OPK A;  2GQI A;  1ABQ A;  1CSK A;  4LUD A;  2CUD A;  5GJW B;  2MOX A;  2W10 A;  1PHT A;  1A0N B;  1Z9Z A;  2OJ2 A;  1T0J A;  4WCI A;  2YUP A;  4DEX A;  5IXF A;  1S1N A;  1AOJ A;  2DIL A;  2C0I A;  2KRN A;  3EG1 A;  3FJ5 A;  2LMJ A;  2L2P A;  4LUE A;  4DEY A;  1UGV A;  3REA B;  1J3T A;  2VVK A;  4CC7 A;  2P4R A;  1VA7 A;  2KRM A;  4GLM A;  2KYM A;  1SSH A;  1Y0M A;  1W1F A;  1M27 C;  3LH5 A;  2YUO A;  2AZV A;  2GTO A;  1K0S A;  2NUZ A;  3I9Q A;  2JMA A;  2NWM A;  2K79 A;  2YSQ A;  4E6R A;  5IHK A;  4JJB A;  1WIE A;  1E6G A;  2EW3 A;  2KXD A;  4A63 B;  3VS1 A;  2KGT A;  2EGA A;  1AWJ A;  1OEB A;  2DJQ A;  2DF6 A;  2LQN A;  4OMO A;  4Z88 A;  2J05 A;  3VS3 A;  2BZY A;  2M0Y A;  2D1X A;  4RTV A;  2LJ3 A;  2LNH B;  2RMO A;  1BK2 A;  2CT4 A;  3PE0 A;  1VYT A;  1AD5 A;  2VWF A;  4F16 A;  1NLP C;  2FO0 A;  2FEI A;  2XMF A;  2J6F A;  3EGU A;  4RTZ A;  2DLP A;  2LQW A;  1U06 A;  1RI9 A;  1T0H A;  2EYX A;  1WLP B;  2RQV A;  3M0Q A;  4KRT A;  3VS0 A;  1G2B A;  1TUC A;  1QWE A;  1BB9 A;  4LE9 A;  1EFN A;  2DRM A;  1W6X A;  1TG0 A;  2G6F X;  1U3O A;  3KFV A;  1M3A A;  4AFZ C;  1GCP A;  1AWO A;  4JJC A;  3THK A;  4M4Z A;  1NYF A;  2A36 A;  1X69 A;  2C0O A;  1U5S A;  2JS0 A;  1QLY A;  1X2K A;  1MV0 B;  4CC3 A;  1KJW A;  1FYN A;  4J9I A;  3JV3 A;  2K2M A;  1SRM A;  4Z8A A;  1RLQ C;  2SRC A;  2KT1 A;  1LCK A;  2EPD A;  2FPF A;  2O2O A;  1JEG A;  1ZSG A;  2JMC A;  3I35 A;  3VS5 A;  2OAW A;  2HDA A;  4D8K A;  1H92 A;  4RTU A;  1OOT A;  3REB B;  1UFF A;  1YWO A;  2PNI A;  1H3H A;  5IH2 A;  2BTT A;  1NM7 A;  2V1Q A;  2O9S A;  1VYU A;  3H0H A;  2LZ6 B;  1SRL A;  4FSS A;  2DL8 A;  2EKH A;  1V1C A;  3EHQ A;  4AG2 C;  3M0U A;  2MIO A;  2JS2 A;  1M8M A;  2RQW A;  3PVL A;  3TSZ A;  1YN8 A;  4K11 A;  1PWT A;  4AFU C;  2GTJ A;  2LCS A;  2DRK A;  3A98 A;  1HSQ A;  4J9C A;  2X3X D;  2LJ1 A;  4AG1 C;  2L3P A;  1ZLM A;  1FMK A;  1RUW A;  2CDT A;  2K7A A;  5IHN A;  2DE0 X;  1AEY A;  5ECA A;  4HXJ A;  1X27 A;  2SEM A;  1JO8 A;  1SPK A;  4GBQ A;  2DBK A;  2J6K A;  1GFD A;  1KSW A;  3UAT A;  1WX6 A;  3SEM A;  2ED1 A;  4RTT A;  3NPF A;  1QCF A;  2DYB A;  5FWC A;  3RBB B;  4CC4 B;  2DMO A;  1N5Z A;  1ZX6 A;  2RQT A;  4JZ3 A;  3NMZ C;  2KNB B;  4JZ4 A;  4OMQ A;  1GBQ A;  4EIK A;  1ZUK A;  4Y92 A;  2J7I A;  5I11 A;  3H0I A;  1ZBJ A;  2YDL A;  1HJD A;  1X43 A;  1AZG B;  2ED0 A;  4J9D A;  2O88 A;  3ZL7 C;  4F17 A;  2EYZ A;  5L23 A;  2PTK A;  1K1Z A;  2A28 A;  3I5R A;  4LN2 A;  4JJD A;  3UA7 A;  4RUG A;  1PRL C;  3NHN A;  2LX7 A;  1NYG A;  3M0R A;  1OV3 A;  3ULR B;  1JXM A;  2O9V A;  2DBM A;  2HCK A;  4Z89 A;  2HEQ A;  4F14 A;  1QWF A;  2FPE A;  3H0F A;  3VS7 A;  2JM9 A;  2YUQ A;  1PRM C;  2KEA A;  3M0P A;  1CKB A;  2L3S A;  2RQR A;  2K3B A;  4AFQ C;  4X1V A;  2M51 A;  1UHC A;  2KRS A;  2A08 A;  1H8K A;  1YP5 A;  2RQU A;  1MUZ A;  2JT4 A;  4OML A;  2EGE A;  2RF0 A;  2D8J A;  3VS2 A;  1E6H A;  4AFS C;  1ZUU A;  2B86 A;  2ABL A;  1M3B A;  1WI7 A;  1PKT A;  1AWW A;  2EBP A;  3QWY A;  2QDL A;  1HD3 A;  5FWB A;  2DL7 A;  2AKL A;  1YCS B;  2FRW A;  3UF4 A;  2OI3 A;  4JPB W;  5FW9 A;  2X3W D;  3VRY A;  2YT6 A;  2H8H A;  2KXC A;  1AZE A;  2LJ0 A;  1JXO A;  1SHF A;  4OMP A;  2GGR A;  1KFZ A;  2GBQ A;  1Z9Q A;  2K6D A;  1JQQ A;  4ZNX A;  3TVT A;  2ROL A;  1BBZ A;  4J9H A;  4CC2 A;  1GRI A;  2PZ1 A;  1GCQ C;  3EHR A;  2GNC A;  3CQT A;  5EC7 A;  3TSW A;  2JXB A;  2KBT A;  1UG1 A;  1GCQ A;  3VS4 A;  2K9G A;  5IXB A;  1QKX A;  3EG0 A;  3QWX X;  2L3Q A;  4OMN A;  5HCK A;  4ORZ A;  2YUN A;  2KRO A;  2JTE A;  1RLP C;  2AZS A;  2CH4 W;  1K76 A;  1NEB A;  1NEG A;  4HVV A;  2V1R A;  2AK5 A;  4J9E A;  1NLO C;  4HCK A;  1T3S A;  3RNJ A;  1M3C A;  2HSP A;  2C0T A;  4LNP A;  2MCN A;  1TUD A;  3GBQ A;  1W70 A;  3IQL A;  2I0N A;  2RNA A;  1K9A A;  1ABO A;  1B3Q A;  1WXB A;  1YWP A;  2DNU A;  1I1J A;  2EVR A;  3NGP A;  2VKN A;  1GBR A;  3SHW A;  1WXT A;  4J9F A;  2LP5 A;  3I5S A;  1GL5 A;  2F2X A;  3EG3 A;  5GJV B;  4ESR A;  1I07 A;  2F2W A;  3UA6 A;  3H41 A;  4QT7 A;  2EYW A;  1Y57 A;  1UJ0 A;  2D0N A;  3U23 A;  1X6B A;  4RTX A;  3O5Z A;  2BZ8 A;  1X6G A;  1E7O A;  1K4U S;  1UEC A;  2KR3 A;  2EQI A;  2AKK A;  1WYX A;  2ROT A;  4R0K A;  1IO6 A;  2FPD A;  2ECZ A;  1I0C A;  1QKW A;  2CSQ A;  1AVZ C;  2DL3 A;  4HVW A;  2JW4 A;  4IIO A;  2IIM A;  2KT8 A;  2J6O A;  2L0A A;  1BU1 A;  1M30 A;  2CH4 A;  2A37 A;  2E5K A;  2RN8 A;  2KE9 A;  4IIM A;  1UE9 A;  3PVQ A;  2CUB A;  2DM1 A;  4OMM A;  1SHG A;  1YNZ A;  2DX1 A;  3EG2 A;  1X2Q A;  1MV3 A;  2RPN A;  4J9G A;  2CRE A;  4HVU A;  2DL4 A;  1SEM A;  3R6N A;  2KYB A;  1UHF A;  5IHI A;  1UUE A;  2BZX A;  3VS6 A;  1UDL A;  2W0Z A;  4J9B A;  4D8D A;  1VYV A;  1K0X A;  2CSI A;  4RTW A;  2DVJ A;  3C0C A;  1ARK A;  1PKS A;  1CKA A;  2FG0 A;  1XOV A;  2D8H A;  2HBW A;  1AWX A;  1B07 A;  1JU5 C;  1WDX A;  4RTY A;  3M0T A;  1G83 A;  2EGC A;  1UJY A;  2O31 A;  2F2V A;  1UTI A;  2JM8 A;  1ZUY A;  1WA7 A;  2FRY A;  1KIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...