1PRMC

Two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-SRC TYROSINE KINASE SH3 DOMAIN
publication title Two binding orientations for peptides to the Src SH3 domain: development of a general model for SH3-ligand interactions.
pubmed rcsb
source organism Gallus gallus
molecule tags Complex (signal transduction/peptide)
total genus 5
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1prmC00
2YUOA 2AK5A 3EHRA 2OAWA 3R6NA 1GFDA 2XMFA 1E6GA 1M3AA 1YWOA 3VS2A 2CREA 2DILA 4RTUA 1AZGB 1NEGA 1UHCA 2J6FA 3VS5A 2HSPA 2K6DA 1OEBA 4JZ3A 2GTOA 1HSQA 1G2BA 1V1CA 2CSIA 1X2KA 2H8HA 3REBB 2RMOA 3UA7A 1SPKA 2ED1A 1GCQC 4AG1C 4CC7A 3ULRB 2QDLA 4HCKA 3JV3A 3I5RA 1T0HA 2K3BA 1JEGA 2SRCA 4F16A 1W6XA 2DL5A 5IHIA 2A08A 4J9GA 2EKHA 4Z8AA 2A37A 3VS0A 2JM9A 1X6GA 2NWMA 3RBBB 1X2QA 4IIMA 1TUCA 2KEAA 2O9SA 4J9IA 5ECAA 2J6OA 2JS0A 4M4ZA 1Z9ZA 1K1ZA 2LQNA 3EG3A 1AVZC 1UG1A 1VYTA 3NMZC 1SRLA 2KR3A 2KGTA 2AKKA 1Y0MA 2LX7A 2O2OA 2MIOA 2ROTA 2KRMA 2V1QA 2GBQA 3PVQA 2CUBA 2J05A 4CC4B 2RNAA 2K9GA 2X3XD 4QT7A 3ZL7C 5IXFA 1A0NB 4X1VA 3U23A 2LMJA 3FJ5A 4LUDA 5FWBA 4E6RA 1MUZA 3VS3A 4OMPA 1WI7A 4OMNA 2F2XA 1CSKA 1T0JA 1G83A 4AFUC 1WYXA 2KRNA 4Z89A 3TSWA 2DRKA 3NPFA 3EG1A 1Y57A 2RPNA 4OMOA 5FWCA 1SHFA 5HCKA 1QCFA 2ESWA 2AKLA 1B07A 2EPDA 2KROA 4IIOA 4LUEA 1ZX6A 2FG0A 1E7OA 4HVWA 1BU1A 3I5SA 1SHGA 2FPEA 1QWFA 2EW3A 1SRMA 4J9EA 2RQVA 2DBMA 1ZSGA 3CQTA 3PE0A 2EBPA 4JJCA 2GGRA 4RTXA 3I35A 1M3CA 2DE0X 2GTJA 2MOXA 1J3TA 2CUDA 2PZ1A 2L3SA 4HXJA 2DRMA 2YT6A 3IQLA 4J9HA 2ECZA 2J7IA 2KBTA 1EFNA 1MV3A 4Z88A 3SEMA 3TVTA 1UECA 4KRTA 2RQTA 1HJDA 3RNJA 1ZBJA 4RTZA 1BB9A 1CKBA 1M27C 3UATA 5L23A 4A63B 1AD5A 1GCPA 3H41A 2LQWA 1I07A 2OJ2A 1UUEA 2K2MA 2VWFA 5IH2A 2O31A 4AFSC 2JT4A 1U3OA 3A98A 2L3PA 4J9DA 2F2WA 1U5SA 5GJVB 2YDLA 2MCNA 1ARKA 1X27A 2EGAA 2CH4W 4Y92A 2ABLA 2E5KA 3LH5A 1AEYA 1TUDA 2BZ8A 1VYVA 3M0SA 1OOTA 1PNJA 2W10A 2M0YA 1UJYA 4RTWA 2DBKA 2DX1A 2KXCA 4AG2C 3M0RA 1U06A 2JXBA 2RN8A 4R0KA 2K7AA 2LP5A 2DNUA 4JJBA 4CC2A 5IXBA 2GQIA 2F2VA 1UHFA 2BTTA 2LJ3A 4JJDA 2D8JA 2GNCA 1NEBA 3THKA 5GJWB 2CT4A 3GBQA 1K4US 4ORZA 1OPKA 1N5ZA 2DF6A 4HVUA 1QKXA 1M3BA 4AFQC 1JU5C 2DL8A 2JMAA 1X69A 3M0TA 4ZNXA 4HVVA 1NYGA 2HDAA 1WLPB 2C0OA 1NM7A 3VRZA 2YUQA 1QLYA 1VA7A 1RI9A 3EHQA 1AZEA 4JZ4A 1WA7A 2KXDA 2YUNA 4JPBW 1GCQA 2ROLA 3M0QA 1H8KA 2RQWA 2YUPA 1AOJA 2P4RA 4GLMA 2O88A 2FPFA 1WDXA 1NG2A 2B86A 2DLPA 2PNIA 2JS2A 1M30A 1PWTA 1JQQA 1H3HA 4OMQA 1SEMA 3EGUA 4RTVA 1PRLC 1WXUA 3EG2A 4DEXA 1LCKA 1AWJA 3TSZA 1ZUUA 2A36A 1K0XA 2CT3A 4FSSA 2CH4A 2DVJA 2JM8A 2DA9A 4ESRA 4F17A 2EVRA 5I11A 1KIKA 1UTIA 2HBWA 1E6HA 2FPDA 2EYYA 2I0NA 1AWOA 4AFZC 1UFFA 2D0NA 2KNBB 2AZSA 1OPLA 1PRMC 4OMLA 2ED0A 1BK2A 2AZVA 2NUZA 2C0TA 2LNHB 1WFWA 3NGPA 2LCSA 4D8KA 1ZLMA 2DM1A 3VRYA 1W1FA 2D8HA 3KFVA 1Z9QA 2CDTA 1K0SA 2EGEA 1PKSA 1K76A 2KT1A 2IIMA 2L0AA 4EIKA 2LJ1A 2M51A 2JW4A 1RLQC 2PTKA 1KFZA 3QWXX 2EYZA 2O9VA 1YNZA 2JTEA 3H0FA 2ENMA 2VVKA 1UDLA 2EYWA 2KYBA 1WXTA 3UA6A 2KT8A 4RUGA 1X43A 1PHTA 1I1JA 4J9BA 1M8MA 2EGCA 1T3SA 1MV0B 1PKTA 1T3LA 1VYUA 2DL3A 3NHNA 2BZXA 1JO8A 1WXBA 2KE9A 3UF4A 2BZYA 2LZ6B 1NLOC 1OV3A 3EG0A 2KRSA 4LNPA 2EQIA 1QKWA 3M0UA 2G6FX 1KJWA 2FRYA 2W0ZA 1YWPA 2A28A 2SEMA 3VS1A 2DYBA 3REAB 1WX6A 2K79A 3VS4A 2RF0A 3PVLA 4LN2A 5I22A 4F14A 1GRIA 1CKAA 1UGVA 1ZUYA 2DL4A 5FW9A 1B3QA 4CC3A 2RQRA 1H92A 3C0CA 1IO6A 2JMCA 2LJ0A 4DEYA 3H0IA 2FRWA 2FEIA 2X3WD 1FYNA 1ABOA 2C0IA 1SSHA 1AWXA 2VKNA 2HEQA 2D1XA 2RQUA 1RUWA 1NYFA 4RTYA 1GBRA 2DMOA 2V1RA 2DJQA 2HCKA 3I9QA 2FO0A 4OMMA 1GBQA 1RLPC 2EYXA 2J6KA 4RTTA 1JXMA 2YSQA 1YP5A 2L3QA 2OI3A 3H0HA 5IHKA 2J06A 1KSWA 1W70A 4LE9A 2CSQA 1BBZA 1GFCA 1I0CA 1X6BA 1ZUKA 1UJ0A 1AWWA 5IHNA 3O5ZA 1ABQA 1HD3A 1TG0A 4J9FA 1XOVA 4K11A 1YN8A 5EC7A 1K9AA 1S1NA 1FMKA 3SHWA 2DL7A 4D8DA 1JXOA 1GL5A 4GBQA 2KYMA 4WCIA 3VS6A 1WIEA 2L2PA 3M0PA 4J9CA 1QWEA 1YCSB 1NLPC 3QWYA 1UE9A 3VS7A
chains in the Genus database with same CATH superfamily
1LPLA 2AK5A 3DB4A 3R6OA 2R58A 4FW2A 1H3ZA 2M16A 3X20B 1JJ2S 1QVGP 1U1SA 3A8OB 2HL3A 1SKUB 2J6FA 3RERA 2GTOA 3RMSA 1VQLQ 2H8HA 3REBB 3CCLT 1SF9A 3UA7A 1SPKA 2YRDA 3OSSC 3RR6A 2X4XA 3JV3A 5FU7B 3P8BB 2K3BA 4PLIA 1VQ4T 4DBFA 4J7IA 2FZCB 3QKJA 2V26A 1UGQB 3VKIA 3OYBA 3SFMA 4FCYA 4C92C 1X2QA 3M56A 4IIMA 4A54A 3MEVA 1Q86R 4A4HA 3CCLQ 2O9SA 1X6OA 2COYA 2JS0A 1OI1A 2DERA 2PUOB 1VOMA 3JB9H 1AVZC 3HFNA 2KR3A 4ELYC 2KGTA 3HP9A 4M7DG 1VQ4Q 1G3SA 1QVFA 3SWNA 2KQWA 1ZQ1A 1QW1A 2DYIA 3FLGA 3L42A 2R57A 5I2MA 5GAMj 2NLUA 3QDRB 1TTHB 2VB6A 4BUGA 3FJ5A 2K5IA 4D6WA 3G1JA 2DXBA 2RHYA 2YWWA 2CZ1B 1OQKA 4IUUA 2D9TA 3MPUB 5KYYA 1T0JA 3SB2A 4JRPA 1LJOA 4MDWA 3M9QA 1QVFP 2DRKA 1M90R 1YJWA 2RPNA 4OMOA 5GMKh 5I21A 4BE0A 1QP3A 1QCFA 2ESWA 5LL6S 1VIEA 4M77G 1YBYA 2A0FB 3UWNA 2VGNA 3EAEA 4ME7A 4MZPA 3QHSA 2FG0A 1QVPA 4C5IA 1BU1A 2DAQA 1SHGA 2LNVA 2ZPGB 1R77A 2NYSA 1ZBXA 2QAZA 3FIFA 3JB9I 1ZSGA 4JJCA 2YRVA 3I35A 3BFMA 4P5NA 1UEBA 2RM4A 1VQ5A 2RD1A 2KBTA 3EGXA 3CMAA 3RDVA 1YJWT 1KQSS 4M78C 2LT1A 3E2UA 5DM7R 3RNJA 4C0DC 1M27C 2RHIA 1GCPA 4LD9K 2KSSA 3JCMg 1M1KC 2OJ2A 4PJJA 2LX9A 2P4TA 2JZ2A 4PFPA 4AFSC 2M02A 2L3PA 4OMFB 2EKOA 2JUFA 2YDLA 4QKUA 1RABB 1SG5A 3Q1JA 2CH4W 4Y92A 1YJWQ 2BZ8A 1PNJA 1UJYA 2X51A 4RTWA 4B9WA 4XTXA 1M1KU 2JXBA 2ZPIB 1VQ5T 2YHTA 3OYCA 3OY9A 1W2BS 2WSCE 4M75C 5GANe 4CC2A 3CBOA 3CMAT 2E10A 2DEQA 2QDYB 2GQIA 2XIDA 3X24B 1IGUA 2LJ3A 3C94A 2D8JA 4UC4A 5CR2A 3VU3C 3THKA 4Y91A 4BY6B 4ORZA 1QP2A 2CKKA 3OYFA 2XDPA 4AFQC 1JU5C 5GAMf 3QZ9B 4ZN3A 1VQ5Q 1KC8R 1I5LA 2DO3A 2RI5A 1D0ZA 3HL8A 3FB9A 2O4XA 1QLYA 3CMAQ 1KHCA 2F69A 3EHQA 1Q81C 2COWA 2EQMA 3S3NA 2DETA 2QA4T 4HCZA 4JZ4A 1Q95G 1AT1B 1ZA2B 2KXDA 4JPBW 4B9XA 2EYQA 4R55A 3OYEA 1H8KA 4EMHA 2P4RA 4GLMA 3O8VA 3S3OA 4DOVA 1Y07A 2JS2A 1JQQA 3JB9G 4ZTFA 1MHNA 2HZYA 4C92A 5L8RE 1LCKA 1AWJA 2LQKA 1ZUUA 5FRNA 2QA4Q 2L5QA 1K0XA 5CQYA 2HQXA 2CH4A 3HFOA 4ESRA 1Q7YR 2EVRA 2QQSA 3NFCA 5GMKm 2XD0A 2F5TX 4Y28E 3G4SA 1UTIA 3M5AA 2E70A 2JTMA 4Q5WA 2WSFE 5LJ3g 2LQ8A 1UFFA 2ZPBB 3GIBA 4OMLA 1BK2A 3ME9A 3NGPA 1R0BG 1WHLA 4D8KA 1N9SA 1MMDA 2DM1A 3KFVA 1M9SA 2G3RA 2KT1A 2HBPA 1Y71A 2JW4A 2CZ7B 2PTKA 1YNZA 2JTEA 4J7FA 3CCMA 1BIBA 2ENMA 2VVKA 2R5AA 2KYBA 2RHUA 2HKQB 4IKFA 3UA6A 4A4KA 3I56A 3G4ST 4RUGA 5D6WA 3PFSA 4DBHA 2KK4A 3A8HB 2EGCA 1MV0B 3V8JA 4NOYA 5GAN5 2L89A 2A3LA 3BE3A 4X9CA 2BZXA 2ATCB 2KE9A 3BW1A 3EG0A 2XHCA 2EWNA 1OZ2A 3PTAA 1S72A 3JCMe 3QJYA 4LDUA 3G4SQ 4DQ2A 4E7KA 3EG9A 4A53A 3VS1A 1Q82R 3VS4A 2CS7A 5I22A 4M78A 1XJWB 3CCMT 2X4JA 5GAOr 1RAEB 2NUPB 1VQOA 1CKAA 1OYXA 5LJ3j 5HY6A 1H92A 3I56T 1Q82C 3UT1A 4RCCA 1JJ2A 2C0IA 3CCQA 1PD0A 1AWXA 2D1XA 5DLQE 2V1RA 1FMWA 2PVOB 3CCMQ 3JCMf 1PG5B 1Q82U 1S72T 2LVMA 3ZBDA 2P84A 3I56Q 2YSQA 1YP5A 4M75A 2OI3A 3H0HA 3DLLA 1JJ2P 2YXYA 1W70A 1D09B 2CSQA 1ZUKA 2RK1A 1AWWA 3O5ZA 1NPPA 1TG0A 3TEEA 3KXTA 1VQOT 1RAIB 5EC7A 1K9AA 1S1NA 3SHWA 4KGXB 2DL7A 3PIPA 1JXOA 4C0ZA 1M1FA 1GL5A 5CCAA 4BE2A 1S72Q 2P0KA 2KYMA 2L2PA 1EIFA 1BIAA 1YCSB 3CCQT 1UE9A 2Y4YA 3VS7A 2YUOA 1JBMA 3EHRA 2HAXA 3UPUA 1GFDA 1E6GA 1YWOA 3VS2A 2DILA 3MP6A 1VQOQ 4RTUA 1NEGA 3VS5A 2MPXC 1D3BB 2K6DA 2L3RA 4E2FB 1V1CA 4WF2A 2XG8D 1OU9A 3X25B 2E4HA 1U8RA 3RKYA 2E12A 2ED1A 2EQUA 3ULRB 1HXDA 3L2UA 3CCQQ 1M1GA 1T0HA 3G71A 1G3TA 2EJGA 3OYKA 1W6XA 2DTOA 5IHIA 3GF5A 4EMKC 4Z8AA 2A37A 2JM9A 2Y90A 2NWMA 5LJ5h 2COZA 3FC3A 2KEAA 3CCUA 5A0LA 2E6ZA 1Z9ZA 2XDBA 2K5FA 5KYWB 1SRLA 4ZTJA 2OX7A 4EMGA 1Y0MA 2GFAA 2LX7A 3QUIA 2KRMA 4M78F 3JB9D 3CCJT 2GBQA 2CP7A 4XK8E 4CC4B 2VXFA 2RNAA 2K9GA 4LDYA 4QT7A 3ZL7C 2QGFB 4X1VA 2VXEA 4C8QA 3VUZA 3CMEA 5LJ3f 2QQ9A 3VS3A 5GMKl 3RMQA 2F2XA 3A1PA 4RG8A 1G83A 1KQSA 2DD4A 2KRNA 3BDUA 3RUXA 3TSWA 3NPFA 3CCJQ 4M7DC 3DB3A 4ANJA 5FWCA 1SHFA 3PNWC 2FZKB 3CCUT 4M75F 3V7RA 2EPDA 4IIOA 5HK3A 2H3JA 1KQSP 5M9OA 1QWFA 1SRMA 2H3EB 2RQVA 2DBMA 3PE0A 4JRKA 1W2BA 5CAIA 2GGRA 1Y96B 3TQ7P 3CMET 4O5VA 3ER0A 5I2SA 3CCUQ 7AT1B 3DKMA 2QQRA 3E19A 5CIUA 2X4WA 3QDFA 4M77C 5DY9A 5GANg 2J7IA 1WNLA 1EFNA 3ZEHA 5FU6B 3SEMA 4JRIA 3TVTA 5KYUB 4R56A 2RQTA 1B34A 3PMTA 1HJDA 1ZBJA 4RTZA 5L23A 4A63B 1AD5A 2RJFA 4M78E 1KD1C 3CMEQ 2QEXA 2QASA 4N4IA 3EH2A 2NUTA 2K2MA 2VWFA 6AT1B 5IH2A 2MAMA 2O31A 2E5QA 4J9DA 1U5SA 2PU9B 2MCNA 3TCJA 1WHJA 2QK0A 5CQXA 2E5KA 3LH5A 1TUDA 1VYVA 1OOTA 5FU7C 4FYWB 2DBKA 4AG2C 1KD1U 5GAN3 2MYSA 1NBEB 1U06A 4PJOA 1V29B 4O6JA 2OTLA 1M8VA 3S3MA 4M7AA 2K7AA 3QSUA 4OVAA 3JB9J 5GAOm 4JJBA 2ZGWA 5KYNA 4F7UA 2F2VA 2CYZB 4M75E 1OZ3A 2GCXA 3GBQA 3GNGA 1AHJB 1N5ZA 1WZOA 2QEXT 4HVUA 1QKXA 5A2QE 2X9HA 4C8QF 2DL8A 3M0TA 5KYXA 1NYGA 1MNEA 4N0AC 3ZFJA 2YUQA 1VA7A 2VYTA 1M2OA 3E9FA 1HYOA 1TXQA 2Z0WA 5GANj 2DIQA 3JCMJ 2E64A 2ROLA 1MMNA 4JJNK 4ZGEB 3GLXA 3MKDA 2OTLT 1VQ8A 2QEXQ 1VQ9A 5IAYA 1NPRA 3FEOA 1NG2A 5IT9E 5J3BA 2DLPA 1M5Q1 4EMKA 4EDUA 1FXXA 3EGUA 1PRLC 5KCOA 2MF2A 4E7HA 4FW1A 1MNDA 3QO3A 5GAOp 1ZSZB 3S6WA 2DVJA 2E3IA 4JUVA 2XU8A 3OA6A 3D7SB 1KHIA 3CPFA 2OTLQ 2AT1B 1NJIC 2HBWA 3OW2S 1E6HA 4IUQA 3INZA 4XU3A 2EYYA 3LWHA 3QXEB 1AWOA 2D0NA 2K2VA 3E1SA 3EFOB 5GAN7 4JDSA 1M1KR 1PRMC 3J81E 4KULA 1N27A 1G3YA 2AZVA 3M4GA 2LNHB 1WFWA 3LX7A 1ZLMA 3VRYA 2DPPB 2D8HA 1VQ8T 3L2VA 2KMTA 2D0QB 1VQ9T 1VQMA 1NJIU 4HCCA 1PKSA 1K76A 2IIMA 1WHMA 4EIKA 1IHVA 4BI8B 1RLQC 4M7DA 3A8GB 1KFZA 5CKEA 2O9VA 3L2WA 4E7SA 1DJ7B 2PQWA 4C8QE 1K73C 4V2SA 1FX7A 4KH0B 1UDLA 5J26A 3HTRA 2QA4A 2EYWA 1WXTA 2KVQG 2JOYA 4PJNA 1HK9A 1VQ8Q 1IHWA 1X43A 4PJOF 3OYLA 1VQ9Q 1M8MA 4M7AF 1QMCA 4PNOA 3NHNA 3OYYA 4WTOB 2VASA 4OB0B 2K4YA 4F7UF 1K73U 2HKNA 2LZ6B 4FU6A 1C1AA 1NLOC 3CXCS 3JCMX 4LNPA 1M2VA 2JVVA 1QVGS 1N8RC 1I4K1 3M0UA 5KE2A 1VQMT 4M77A 2FB7A 2GQVA 1Q81R 2FHDA 2FRYA 1WJRA 2A28A 2EJFA 1RI0A 5KE3A 2QXFA 2SEMA 2E41A 2WSEE 1LNXA 2K79A 1KQ2A 4BY6C 3JCMc 3GP8A 2F5KA 4LN2A 1D1BA 5LJ5e 2GF7A 1ZUYA 1UGVA 1KQ1A 2DIGA 3P8HA 1N8RU 3V8KA 3WVDB 2LJ0A 2VC8A 3JCMb 3H0IA 2FRWA 2FEIA 1VQMQ 4BI3A 1FYNA 5GANf 2GFUA 2VKNA 1G3WA 3RESA 2WACA 3OYAA 2EQJA 1XNIA 3RIRA 2RK2A 1Q81U 1VQNA 3CC4T 2DJQA 2HCKA 1RLPC 1KG1A 4VUBA 3NTKA 2QTVA 2L3QA 4LE9A 4NL2A 1BBZA 2MWOA 3SD4A 4E7IA 1UJ0A 1TU0B 3MEAA 4E7JA 4M78G 3HRTA 4PLLA 4PJOE 3EGDB 4C5GA 3CC4Q 1PSEA 3UDCA 4M7AE 5FRMA 2LC4A 4XTZA 2AIRB 4F7UE 2KAFA 1QWEA 1NLPC 4N0AA 3C95A 3LWIA 2OAWA 4NL3A 5GAOl 3R6NA 1M3AA 1VQNT 1C6VX 3JCMW 1AZGB 1UHCA 1RADB 2HSPA 3CCVA 1OEBA 1LOJA 1HSQA 4L5GA 2CSIA 1X2KA 3H8ZA 1OX8A 4RCBA 4BACA 2RMOA 5GMKj 4HCBA 4KUDK 4M75G 1GCQC 4CC7A 2QDLA 3I5RA 1YCYA 1BI3A 4PJMA 1JEGA 2SRCA 4F16A 2A08A 4J9GA 3L2RA 3URGA 1VQNQ 5CK9A 3PMIA 3VS0A 1X6GA 2AHJB 2BE7D 4RKUE 2E6NA 4PFZA 1TUCA 4J9IA 5ECAA 1IZ6A 4M4ZA 1K1ZA 2LQNA 4HA8A 3WVEB 1UG1A 1VYTA 2QTXA 1R0CB 1R8OB 4OF1A 2MIOA 2ROTA 3CCVT 1QCNA 4QQ6A 2EFIA 1JB0E 3NTHA 2X3XD 1A0NB 3NTIA 2LMJA 2FL7A 1OU8A 5FWBA 3OYGA 1WI7A 4OMNA 1CSKA 3F70A 2VV5A 1YI2A 3X28B 4AFUC 2K57A 3QIIA 3DLMA 3CBMA 4KBMB 3EG1A 2YLCA 3TU4K 4C92F 3CCVQ 4L59A 3LGLA 4XU0A 2LCCA 5HCKA 1D0XA 2QI2A 3VV0A 1B07A 4MZMA 2BE9B 4LUEA 4B6MA 1ZX6A 1IB8A 1E7OA 1RACB 3HKSA 3N5BB 3CCRA 5GMKe 2EW3A 1BI0A 2XK0A 4J9EA 3CQTA 4RTXA 1M3CA 2GTJA 2MOXA 1EZZB 4C8QG 2CUDA 2PZ1A 2L3SA 2ZZDA 3BDLA 4HXJA 4ZGJB 3OS2A 4XQ3A 2OTJA 5GAMd 3EFRA 2M1HA 3OS0A 1YI2T 3QJ6A 4J9HA 3OMCA 3SWNB 2MK5A 4BI4A 2ECZA 1NZ9A 5GAMh 4Z88A 4CRIA 1UECA 3CCJA 4KRTA 1GXIE 3SWNC 2RO0A 1BB9A 1CKBA 4FM4B 1LVKA 1FMVA 3H41A 5KYYB 2LQWA 1I07A 3JAME 3J7AF 2K5LA 3HPWA 4DOWA 2RJCA 2JT4A 3MCAB 2L8DA 3FJPA 3A98A 3V7SA 1YI2Q 2F2WA 5GAOn 3CCRT 5D7UA 1X27A 2EGAA 4KH1B 1WHKA 2ABLA 1AEYA 4PFOA 1TOVA 4YTLA 1I8FA 2FZGB 2M0YA 1F1BB 3H6ZA 1UGSB 2DX1A 3VYHB 3HRUA 3M0RA 3BY7A 3PIOA 1MMAA 3JCMV 2RN8A 2OTJT 4R0KA 1TH7A 1K8AC 4C92E 1X75C 4JLGA 4KGVB 4LD6A 3CCRQ 2GNCA 1UGPB 2DTIA 1YFNA 5GJWB 3OW2A 3M54A 1WHHA 3OB9A 4XTWA 4IUPA 2BKDN 2KY9A 1RAAB 1K8AU 3HRSA 4ZNXA 2OTJQ 3EGXB 4NS5A 5AYFA 5HK0A 2C0OA 2K3XA 1RI9A 4M78D 3GOXA 2DJZA 1WA7A 2YUNA 4CI0C 1GCQA 4HKEA 3OW2P 3M0QA 4ZGDB 2BUDA 2RQWA 2YUPA 3GNFB 4PJOG 2FPFA 3OYMA 4M7AG 2B86A 1PWTA 2QQBA 3V7CA 4F7UG 2E3HA 5KCHA 2CP2A 3EG2A 2HL5C 4DEXA 1VQ6A 3TSZA 2DXTA 3OS5A 4JRQA 2VUBA 3QZ5B 3OYHA 2DXUA 2JM8A 2RI3A 2DA9A 4F17A 5I11A 1KIKA 1I81A 4M75D 3CXCA 4IUTA 1RL2A 1MGQA 2I0NA 4FIBA 4AFZC 2LT4A 3CPWS 3LW5E 1OPLA 1KD1R 4KUIA 4E7ZA 3OYDA 4GY5A 2DZ9A 2LCSA 4OB2B 3MHXA 1O75A 2NUPA 1W1FA 4QVZA 1W2BP 3AHUA 1K0SA 2EGEA 5FU6C 3I55A 1K9MC 2O4XB 3CXCP 2LTOA 3C4SA 4J5YA 3HHTB 1RAFB 1QQJA 1IRXA 4N4GA 3M53A 1OX9A 1VQ6T 3OMGA 3OSVA 5LJ5g 4N4HA 2LCLA 3JCMd 5A0GA 4RMOA 2RJEA 3PT9A 3CBPA 2KT8A 2LRQA 4TVRA 1K9MU 1Y7XA 3JSCA 1PHTA 1I1JA 4J9BA 3JCMh 4FT2A 1T3SA 1PKTA 1T3LA 2F1LA 1VYUA 2EIFA 2DL3A 4C92B 1JO8A 1X01A 1PM3A 2CZ0B 3UF4A 2BZYA 2ZPHB 1ZA1B 1VQ6Q 3LH0A 2KRSA 4E7LA 2XDDA 4OP0A 2E1HA 4EPCA 1TUGB 3OQ5A 4ELZC 4Z02A 1N9RA 2G6FX 2OAUA 3I55T 1P92A 1YITA 2W0ZA 1YWPA 3GPLA 1WQ7A 4XU1A 1PD1A 2HSEB 1WX6A 1W4SA 4FYYB 3SDZA 2RF0A 2MMPA 1Q86C 3CC2A 1GRIA 2DL4A 2YLBA 5D6XA 3OBYA 5FW9A 2EQKA 3V8LA 4CC3A 2JMCA 1D3BA 3M55A 1WJQA 1XTDA 3I55Q 4DBRA 1XQHA 4C8QD 2RQUA 2V8KA 4PK4A 1YJ9A 1Q86U 1RUWA 2CP5A 2E65A 1IREB 1GBRA 2DMOA 5IN1A 1V76A 1NJIR 4OMMA 1GBQA 2EYXA 4X9DA 4JS5A 3KUFA 3MP1A 1YITT 2EAYA 3VYGA 1JXMA 5IHKA 5LJ5j 4DA4A 5FLXE 2ZCFB 1M90C 4ATOA 2KI7A 3RKWA 5IHNA 1ZSZC 2DZCA 5CO7A 3CC2T 5KYWA 4FYXB 4K11A 1YN8A 2DD5A 3L2ZA 3EG9B 4WCIA 3VS6A 1WIEA 3JRZA 4J9CA 4C5HA 1M90U 1YITQ 1K73R 4AT1B 4J6XA 2DK3A 5LJ3d 4M78B 1VIFA 1YJ9T 2RHXA 3OBWA 4C0DB 2RH2A 2XMFA 4MDXA 3MEUA 3MJXA 4OGCA 1OULA 2DFUA 5LJ3h 2CREA 3CC2Q 4JS4A 5CKBA 4C92G 4JZ3A 1G2BA 4MMLA 1B7TA 2QQAA 4AG1C 4HCKA 3HSBA 4J83A 2IVWA 3PGGA 1N8RR 1YJ9Q 5GAMe 2DL5A 2BIVA 4XTVA 2EKHA 4XU2A 5CVIA 9ATCB 2CZ6B 4M75B 3CC4A 1ZHIA 4QVCA 3RBBB 2RI2A 5FROA 2J6OA 4BE1A 4FYVB 5GAOq 1BKBA 3EG3A 1Y96A 4PJOD 4JLIA 3NMZC 4HT8A 2A7YA 3TREA 4QVDA 2HQEA 3VUBA 4M7AD 2AKKA 3CC7A 2O2OA 5CKFA 4FSXA 2V1QA 2ZAEA 2MI6A 3PVQA 4XAXB 2CUBA 2HNIA 2J05A 2XI9A 2ZPFB 4A4FA 5KYUA 4J6WA 5IXFA 1ACMB 3U23A 4LUDA 4XTYA 4E6RA 1MUZA 1PSFA 4OMPA 3L1AA 3M58A 4C0FA 3OYIA 1WYXA 4Z89A 1RAGB 2HMAA 2M0OA 1Y57A 2YRCA 4II1A 1KC8C 4DBQA 2JTFA 3FDRA 4BD3A 2AKLA 4OGEA 5C0MA 1RAHB 2KROA 3AT1B 4AMCA 2P0QA 2X35A 4GLKA 1IGQA 3CC7T 4HVWA 5LJ5f 3I5SA 3KBGA 3RKXA 5GMKi 2Y4XA 3QPHA 2FPEA 1KC8U 1YIJA 2CGHA 2FYKA 3EH1A 2EBPA 2M9UA 1QVFS 5CKHA 2DE0X 1J3TA 4LXCA 1G8XA 1TS9A 2DRMA 3VJPA 2YT6A 3IQLA 5C6SA 1BCMA 2V8JA 4QQDA 5J39A 2DVEA 3CC7Q 4LDWA 2LDMA 4OB3B 4M7DF 1MV3A 1Q7YC 3E9GA 3J80E 2I2LA 2MWPA 1UB4A 1FWZA 4X34A 3A8LB 4MZTA 4C8QB 3UATA 5HKCA 2RJDA 2QGGA 1UUEA 1VQPA 4C8QC 2RHZA 1U3OA 3H9NA 3FRNA 1YHQA 5GJVB 1ARKA 1Q7YU 2PUKB 4M7DD 2IPOB 1YIJT 4FL6A 3QYGB 4IUVA 3M0SA 2P0PA 2W10A 1WJSA 2CP6A 2KXCA 4C5EA 3META 4M77F 1PCXA 1ZSZA 4IURA 2LP5A 3L2QA 2QYZA 2DNUA 2HQHA 1H641 1BCOA 5IXBA 4F04B 1UHFA 2BTTA 5EG2A 4JJDA 1D0YA 1WHGA 1BI1A 3EFOA 1QCOA 1YIJQ 1O9SA 1PC0A 1NEBA 2JNGA 2CT4A 1K4US 1VQKA 1OPKA 2DF6A 4J8OA 1M3BA 3CPWA 2JMAA 1X69A 1VQPT 4M77D 4HVVA 1YHQT 2HDAA 2V8IA 1WLPB 1YJNA 4LDXA 1NM7A 3VRZA 3WXMB 2ZPEB 1B34B 3A5ZB 2DKGA 3ASKA 2EJ9A 1AZEA 2O01E 4QW2A 3CD6A 2NUTB 1NE8A 4M7DE 1AOJA 3CPWP 4PJLA 2O88A 1WDXA 1KK7A 4C0GA 1WQWA 1VQPQ 2DTHA 2PNIA 1M30A 1H3HA 4OMQA 1YHQQ 1SEMA 2XKOC 4RTVA 8AT1B 1WXUA 3P8DA 4RG2A 4OB1B 2A36A 2CT3A 3MP8A 4FSSA 4ZN1A 3LLRA 4PKCC 4C92D 3OYJA 3OYNA 4PJOB 2PVGB 3QG1A 1VQKT 3A8MB 3JCMP 4M7AB 2IG0A 3QBYA 2XICA 2FVUA 4F7UB 3G7ZA 2FPDA 1YJNT 4J6YA 4PJOC 1SSFA 3X26B 4M7AC 4KGZB 2KNBB 2AZSA 4L6V5 2CP0A 1VQ7A 4M77E 1TWBA 2ED0A 2NUZA 2C0TA 4XTUA 5AT1B 3CD6T 5KYXB 3M4YA 1VQKQ 1Z9QA 2CDTA 3OS1A 2L0AA 5GANd 5GAN6 4BDZA 2LJ1A 4E47A 2JJ9A 2M51A 1YJNQ 2K3YA 5D6YA 3QWXX 5CKDA 2EYZA 5GANh 1MMGA 1D1AA 3H0FA 1K8AR 2D6FA 1BYMA 2DEUA 3T9NA 3CCEA 3CD6Q 3JCMQ 5GAN8 4HT9A 5DLOA 4EMKB 1VUBA 4MMKA 2KDSA 1IXDA 1D1CA 2CP3A 3CCSA 3LGFA 5LJ3e 2HD0A 3JB9F 5LJ5d 4BDYA 3G6EA 1VQ7T 1N6AA 1WXBA 2R5MA 1OV3A 3M59A 3QYHB 3EFSA 2EQIA 1QKWA 1WGSA 3EGDA 3MO8A 3LYIA 3M57A 1KJWA 5A0DA 2DYBA 3REAB 3MEWA 2VGMA 1U1TA 3PVLA 2JN0A 2DXCA 2C06A 4F14A 1VQ7Q 2QG9B 1G5VA 2RB6A 4KT0E 3CCET 1BI2A 2RA2A 3CEYA 1B3QA 1VQLA 8ATCB 2RQRA 3C0CA 1IO6A 4DEYA 2X3WD 1ABOA 4M7DB 1SSHA 3CCST 3G71T 2HEQA 3G6ET 3C12A 1NYFA 5GAN2 4RTYA 4A4EA 2B8AA 3I9QA 2FO0A 3CCEQ 2X4YA 1TSFA 1UGRB 2J6KA 4RTTA 4BB7A 3CCLA 4FT4A 2J06A 1KSWA 2PVDB 1I5OB 4A4GA 1GFCA 1JRIA 1I0CA 1X6BA 3CCSQ 3G71Q 1M4ZA 1EX4A 1ABQA 1HD3A 5GAMg 5GAN4 1QVGA 3G6EQ 4J9FA 1VQ4A 1XOVA 1WPYA 1M2VB 1K9MR 4PL6A 1FMKA 5KH6A 4M77B 1VQLT 4LDVA 4QQGA 4D8DA 4GBQA 3M0PA 1C0MA 3QWYA
chains in the Genus database with same CATH topology
2YUOA 2AK5A 3EHRA 2OAWA 3R6NA 1GFDA 2XMFA 1E6GA 1M3AA 1YWOA 3VS2A 2CREA 2DILA 4RTUA 1AZGB 1NEGA 1UHCA 2J6FA 3VS5A 2HSPA 2K6DA 1OEBA 4JZ3A 2GTOA 1HSQA 1G2BA 1V1CA 2CSIA 1X2KA 2H8HA 3REBB 2RMOA 3UA7A 1SPKA 2ED1A 1GCQC 4AG1C 4CC7A 3ULRB 2QDLA 4HCKA 3JV3A 3I5RA 1T0HA 2K3BA 1JEGA 2SRCA 4F16A 1W6XA 2DL5A 5IHIA 2A08A 4J9GA 2EKHA 4Z8AA 2A37A 3VS0A 2JM9A 1X6GA 2NWMA 3RBBB 1X2QA 4IIMA 1TUCA 2KEAA 2O9SA 4J9IA 5ECAA 2J6OA 2JS0A 4M4ZA 1Z9ZA 1K1ZA 2LQNA 3EG3A 1AVZC 1UG1A 1VYTA 3NMZC 1SRLA 2KR3A 2KGTA 2AKKA 1Y0MA 2LX7A 2O2OA 2MIOA 2ROTA 2KRMA 2V1QA 2GBQA 3PVQA 2CUBA 2J05A 4CC4B 2RNAA 2K9GA 2X3XD 4QT7A 3ZL7C 5IXFA 1A0NB 4X1VA 3U23A 2LMJA 3FJ5A 4LUDA 5FWBA 4E6RA 1MUZA 3VS3A 4OMPA 1WI7A 4OMNA 2F2XA 1CSKA 1T0JA 1G83A 4AFUC 1WYXA 2KRNA 4Z89A 3TSWA 2DRKA 3NPFA 3EG1A 1Y57A 2RPNA 4OMOA 5FWCA 1SHFA 5HCKA 1QCFA 2ESWA 2AKLA 1B07A 2EPDA 2KROA 4IIOA 4LUEA 1ZX6A 2FG0A 1E7OA 4HVWA 1BU1A 3I5SA 1SHGA 2FPEA 1QWFA 2EW3A 1SRMA 4J9EA 2RQVA 2DBMA 1ZSGA 3CQTA 3PE0A 2EBPA 4JJCA 2GGRA 4RTXA 3I35A 1M3CA 2DE0X 2GTJA 2MOXA 1J3TA 2CUDA 2PZ1A 2L3SA 4HXJA 2DRMA 2YT6A 3IQLA 4J9HA 2ECZA 2J7IA 2KBTA 1EFNA 1MV3A 4Z88A 3SEMA 3TVTA 1UECA 4KRTA 2RQTA 1HJDA 3RNJA 1ZBJA 4RTZA 1BB9A 1CKBA 1M27C 3UATA 5L23A 4A63B 1AD5A 1GCPA 3H41A 2LQWA 1I07A 2OJ2A 1UUEA 2K2MA 2VWFA 5IH2A 2O31A 4AFSC 2JT4A 1U3OA 3A98A 2L3PA 4J9DA 2F2WA 1U5SA 5GJVB 2YDLA 2MCNA 1ARKA 1X27A 2EGAA 2CH4W 4Y92A 2ABLA 2E5KA 3LH5A 1AEYA 1TUDA 2BZ8A 1VYVA 3M0SA 1OOTA 1PNJA 2W10A 2M0YA 1UJYA 4RTWA 2DBKA 2DX1A 2KXCA 4AG2C 3M0RA 1U06A 2JXBA 2RN8A 4R0KA 2K7AA 2LP5A 2DNUA 4JJBA 4CC2A 5IXBA 2GQIA 2F2VA 1UHFA 2BTTA 2LJ3A 4JJDA 2D8JA 2GNCA 1NEBA 3THKA 5GJWB 2CT4A 3GBQA 1K4US 4ORZA 1OPKA 1N5ZA 2DF6A 4HVUA 1QKXA 1M3BA 4AFQC 1JU5C 2DL8A 2JMAA 1X69A 3M0TA 4ZNXA 4HVVA 1NYGA 2HDAA 1WLPB 2C0OA 1NM7A 3VRZA 2YUQA 1QLYA 1VA7A 1RI9A 3EHQA 1AZEA 4JZ4A 1WA7A 2KXDA 2YUNA 4JPBW 1GCQA 2ROLA 3M0QA 1H8KA 2RQWA 2YUPA 1AOJA 2P4RA 4GLMA 2O88A 2FPFA 1WDXA 1NG2A 2B86A 2DLPA 2PNIA 2JS2A 1M30A 1PWTA 1JQQA 1H3HA 4OMQA 1SEMA 3EGUA 4RTVA 1PRLC 1WXUA 3EG2A 4DEXA 1LCKA 1AWJA 3TSZA 1ZUUA 2A36A 1K0XA 2CT3A 4FSSA 2CH4A 2DVJA 2JM8A 2DA9A 4ESRA 4F17A 2EVRA 5I11A 1KIKA 1UTIA 2HBWA 1E6HA 2FPDA 2EYYA 2I0NA 1AWOA 4AFZC 1UFFA 2D0NA 2KNBB 2AZSA 1OPLA 1PRMC 4OMLA 2ED0A 1BK2A 2AZVA 2NUZA 2C0TA 2LNHB 1WFWA 3NGPA 2LCSA 4D8KA 1ZLMA 2DM1A 3VRYA 1W1FA 2D8HA 3KFVA 1Z9QA 2CDTA 1K0SA 2EGEA 1PKSA 1K76A 2KT1A 2IIMA 2L0AA 4EIKA 2LJ1A 2M51A 2JW4A 1RLQC 2PTKA 1KFZA 3QWXX 2EYZA 2O9VA 1YNZA 2JTEA 3H0FA 2ENMA 2VVKA 1UDLA 2EYWA 2KYBA 1WXTA 3UA6A 2KT8A 4RUGA 1X43A 1PHTA 1I1JA 4J9BA 1M8MA 2EGCA 1T3SA 1MV0B 1PKTA 1T3LA 1VYUA 2DL3A 3NHNA 2BZXA 1JO8A 1WXBA 2KE9A 3UF4A 2BZYA 2LZ6B 1NLOC 1OV3A 3EG0A 2KRSA 4LNPA 2EQIA 1QKWA 3M0UA 2G6FX 1KJWA 2FRYA 2W0ZA 1YWPA 2A28A 2SEMA 3VS1A 2DYBA 3REAB 1WX6A 2K79A 3VS4A 2RF0A 3PVLA 4LN2A 5I22A 4F14A 1GRIA 1CKAA 1UGVA 1ZUYA 2DL4A 5FW9A 1B3QA 4CC3A 2RQRA 1H92A 3C0CA 1IO6A 2JMCA 2LJ0A 4DEYA 3H0IA 2FRWA 2FEIA 2X3WD 1FYNA 1ABOA 2C0IA 1SSHA 1AWXA 2VKNA 2HEQA 2D1XA 2RQUA 1RUWA 1NYFA 4RTYA 1GBRA 2DMOA 2V1RA 2DJQA 2HCKA 3I9QA 2FO0A 4OMMA 1GBQA 1RLPC 2EYXA 2J6KA 4RTTA 1JXMA 2YSQA 1YP5A 2L3QA 2OI3A 3H0HA 5IHKA 2J06A 1KSWA 1W70A 4LE9A 2CSQA 1BBZA 1GFCA 1I0CA 1X6BA 1ZUKA 1UJ0A 1AWWA 5IHNA 3O5ZA 1ABQA 1HD3A 1TG0A 4J9FA 1XOVA 4K11A 1YN8A 5EC7A 1K9AA 1S1NA 1FMKA 3SHWA 2DL7A 4D8DA 1JXOA 1GL5A 4GBQA 2KYMA 4WCIA 3VS6A 1WIEA 2L2PA 3M0PA 4J9CA 1QWEA 1YCSB 1NLPC 3QWYA 1UE9A 3VS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUO A;  2AK5 A;  3EHR A;  2OAW A;  3R6N A;  1GFD A;  2XMF A;  1E6G A;  1M3A A;  1YWO A;  3VS2 A;  2CRE A;  2DIL A;  4RTU A;  1AZG B;  1NEG A;  1UHC A;  2J6F A;  3VS5 A;  2HSP A;  2K6D A;  1OEB A;  4JZ3 A;  2GTO A;  1HSQ A;  1G2B A;  1V1C A;  2CSI A;  1X2K A;  2H8H A;  3REB B;  2RMO A;  3UA7 A;  1SPK A;  2ED1 A;  1GCQ C;  4AG1 C;  4CC7 A;  3ULR B;  2QDL A;  4HCK A;  3JV3 A;  3I5R A;  1T0H A;  2K3B A;  1JEG A;  2SRC A;  4F16 A;  1W6X A;  2DL5 A;  5IHI A;  2A08 A;  4J9G A;  2EKH A;  4Z8A A;  2A37 A;  3VS0 A;  2JM9 A;  1X6G A;  2NWM A;  3RBB B;  1X2Q A;  4IIM A;  1TUC A;  2KEA A;  2O9S A;  4J9I A;  5ECA A;  2J6O A;  2JS0 A;  4M4Z A;  1Z9Z A;  1K1Z A;  2LQN A;  3EG3 A;  1AVZ C;  1UG1 A;  1VYT A;  3NMZ C;  1SRL A;  2KR3 A;  2KGT A;  2AKK A;  1Y0M A;  2LX7 A;  2O2O A;  2MIO A;  2ROT A;  2KRM A;  2V1Q A;  2GBQ A;  3PVQ A;  2CUB A;  2J05 A;  4CC4 B;  2RNA A;  2K9G A;  2X3X D;  4QT7 A;  3ZL7 C;  5IXF A;  1A0N B;  4X1V A;  3U23 A;  2LMJ A;  3FJ5 A;  4LUD A;  5FWB A;  4E6R A;  1MUZ A;  3VS3 A;  4OMP A;  1WI7 A;  4OMN A;  2F2X A;  1CSK A;  1T0J A;  1G83 A;  4AFU C;  1WYX A;  2KRN A;  4Z89 A;  3TSW A;  2DRK A;  3NPF A;  3EG1 A;  1Y57 A;  2RPN A;  4OMO A;  5FWC A;  1SHF A;  5HCK A;  1QCF A;  2ESW A;  2AKL A;  1B07 A;  2EPD A;  2KRO A;  4IIO A;  4LUE A;  1ZX6 A;  2FG0 A;  1E7O A;  4HVW A;  1BU1 A;  3I5S A;  1SHG A;  2FPE A;  1QWF A;  2EW3 A;  1SRM A;  4J9E A;  2RQV A;  2DBM A;  1ZSG A;  3CQT A;  3PE0 A;  2EBP A;  4JJC A;  2GGR A;  4RTX A;  3I35 A;  1M3C A;  2DE0 X;  2GTJ A;  2MOX A;  1J3T A;  2CUD A;  2PZ1 A;  2L3S A;  4HXJ A;  2DRM A;  2YT6 A;  3IQL A;  4J9H A;  2ECZ A;  2J7I A;  2KBT A;  1EFN A;  1MV3 A;  4Z88 A;  3SEM A;  3TVT A;  1UEC A;  4KRT A;  2RQT A;  1HJD A;  3RNJ A;  1ZBJ A;  4RTZ A;  1BB9 A;  1CKB A;  1M27 C;  3UAT A;  5L23 A;  4A63 B;  1AD5 A;  1GCP A;  3H41 A;  2LQW A;  1I07 A;  2OJ2 A;  1UUE A;  2K2M A;  2VWF A;  5IH2 A;  2O31 A;  4AFS C;  2JT4 A;  1U3O A;  3A98 A;  2L3P A;  4J9D A;  2F2W A;  1U5S A;  5GJV B;  2YDL A;  2MCN A;  1ARK A;  1X27 A;  2EGA A;  2CH4 W;  4Y92 A;  2ABL A;  2E5K A;  3LH5 A;  1AEY A;  1TUD A;  2BZ8 A;  1VYV A;  3M0S A;  1OOT A;  1PNJ A;  2W10 A;  2M0Y A;  1UJY A;  4RTW A;  2DBK A;  2DX1 A;  2KXC A;  4AG2 C;  3M0R A;  1U06 A;  2JXB A;  2RN8 A;  4R0K A;  2K7A A;  2LP5 A;  2DNU A;  4JJB A;  4CC2 A;  5IXB A;  2GQI A;  2F2V A;  1UHF A;  2BTT A;  2LJ3 A;  4JJD A;  2D8J A;  2GNC A;  1NEB A;  3THK A;  5GJW B;  2CT4 A;  3GBQ A;  1K4U S;  4ORZ A;  1OPK A;  1N5Z A;  2DF6 A;  4HVU A;  1QKX A;  1M3B A;  4AFQ C;  1JU5 C;  2DL8 A;  2JMA A;  1X69 A;  3M0T A;  4ZNX A;  4HVV A;  1NYG A;  2HDA A;  1WLP B;  2C0O A;  1NM7 A;  3VRZ A;  2YUQ A;  1QLY A;  1VA7 A;  1RI9 A;  3EHQ A;  1AZE A;  4JZ4 A;  1WA7 A;  2KXD A;  2YUN A;  4JPB W;  1GCQ A;  2ROL A;  3M0Q A;  1H8K A;  2RQW A;  2YUP A;  1AOJ A;  2P4R A;  4GLM A;  2O88 A;  2FPF A;  1WDX A;  1NG2 A;  2B86 A;  2DLP A;  2PNI A;  2JS2 A;  1M30 A;  1PWT A;  1JQQ A;  1H3H A;  4OMQ A;  1SEM A;  3EGU A;  4RTV A;  1PRL C;  1WXU A;  3EG2 A;  4DEX A;  1LCK A;  1AWJ A;  3TSZ A;  1ZUU A;  2A36 A;  1K0X A;  2CT3 A;  4FSS A;  2CH4 A;  2DVJ A;  2JM8 A;  2DA9 A;  4ESR A;  4F17 A;  2EVR A;  5I11 A;  1KIK A;  1UTI A;  2HBW A;  1E6H A;  2FPD A;  2EYY A;  2I0N A;  1AWO A;  4AFZ C;  1UFF A;  2D0N A;  2KNB B;  2AZS A;  1OPL A;  1PRM C;  4OML A;  2ED0 A;  1BK2 A;  2AZV A;  2NUZ A;  2C0T A;  2LNH B;  1WFW A;  3NGP A;  2LCS A;  4D8K A;  1ZLM A;  2DM1 A;  3VRY A;  1W1F A;  2D8H A;  3KFV A;  1Z9Q A;  2CDT A;  1K0S A;  2EGE A;  1PKS A;  1K76 A;  2KT1 A;  2IIM A;  2L0A A;  4EIK A;  2LJ1 A;  2M51 A;  2JW4 A;  1RLQ C;  2PTK A;  1KFZ A;  3QWX X;  2EYZ A;  2O9V A;  1YNZ A;  2JTE A;  3H0F A;  2ENM A;  2VVK A;  1UDL A;  2EYW A;  2KYB A;  1WXT A;  3UA6 A;  2KT8 A;  4RUG A;  1X43 A;  1PHT A;  1I1J A;  4J9B A;  1M8M A;  2EGC A;  1T3S A;  1MV0 B;  1PKT A;  1T3L A;  1VYU A;  2DL3 A;  3NHN A;  2BZX A;  1JO8 A;  1WXB A;  2KE9 A;  3UF4 A;  2BZY A;  2LZ6 B;  1NLO C;  1OV3 A;  3EG0 A;  2KRS A;  4LNP A;  2EQI A;  1QKW A;  3M0U A;  2G6F X;  1KJW A;  2FRY A;  2W0Z A;  1YWP A;  2A28 A;  2SEM A;  3VS1 A;  2DYB A;  3REA B;  1WX6 A;  2K79 A;  3VS4 A;  2RF0 A;  3PVL A;  4LN2 A;  5I22 A;  4F14 A;  1GRI A;  1CKA A;  1UGV A;  1ZUY A;  2DL4 A;  5FW9 A;  1B3Q A;  4CC3 A;  2RQR A;  1H92 A;  3C0C A;  1IO6 A;  2JMC A;  2LJ0 A;  4DEY A;  3H0I A;  2FRW A;  2FEI A;  2X3W D;  1FYN A;  1ABO A;  2C0I A;  1SSH A;  1AWX A;  2VKN A;  2HEQ A;  2D1X A;  2RQU A;  1RUW A;  1NYF A;  4RTY A;  1GBR A;  2DMO A;  2V1R A;  2DJQ A;  2HCK A;  3I9Q A;  2FO0 A;  4OMM A;  1GBQ A;  1RLP C;  2EYX A;  2J6K A;  4RTT A;  1JXM A;  2YSQ A;  1YP5 A;  2L3Q A;  2OI3 A;  3H0H A;  5IHK A;  2J06 A;  1KSW A;  1W70 A;  4LE9 A;  2CSQ A;  1BBZ A;  1GFC A;  1I0C A;  1X6B A;  1ZUK A;  1UJ0 A;  1AWW A;  5IHN A;  3O5Z A;  1ABQ A;  1HD3 A;  1TG0 A;  4J9F A;  1XOV A;  4K11 A;  1YN8 A;  5EC7 A;  1K9A A;  1S1N A;  1FMK A;  3SHW A;  2DL7 A;  4D8D A;  1JXO A;  1GL5 A;  4GBQ A;  2KYM A;  4WCI A;  3VS6 A;  1WIE A;  2L2P A;  3M0P A;  4J9C A;  1QWE A;  1YCS B;  1NLP C;  3QWY A;  1UE9 A;  3VS7 A; 
#chains in the Genus database with same CATH topology
 1LPL A;  2AK5 A;  3DB4 A;  3R6O A;  2R58 A;  4FW2 A;  1H3Z A;  2M16 A;  3X20 B;  1JJ2 S;  1QVG P;  1U1S A;  3A8O B;  2HL3 A;  1SKU B;  2J6F A;  3RER A;  2GTO A;  3RMS A;  1VQL Q;  2H8H A;  3REB B;  3CCL T;  1SF9 A;  3UA7 A;  1SPK A;  2YRD A;  3OSS C;  3RR6 A;  2X4X A;  3JV3 A;  5FU7 B;  3P8B B;  2K3B A;  4PLI A;  1VQ4 T;  4DBF A;  4J7I A;  2FZC B;  3QKJ A;  2V26 A;  1UGQ B;  3VKI A;  3OYB A;  3SFM A;  4FCY A;  4C92 C;  1X2Q A;  3M56 A;  4IIM A;  4A54 A;  3MEV A;  1Q86 R;  4A4H A;  3CCL Q;  2O9S A;  1X6O A;  2COY A;  2JS0 A;  1OI1 A;  2DER A;  2PUO B;  1VOM A;  3JB9 H;  1AVZ C;  3HFN A;  2KR3 A;  4ELY C;  2KGT A;  3HP9 A;  4M7D G;  1VQ4 Q;  1G3S A;  1QVF A;  3SWN A;  2KQW A;  1ZQ1 A;  1QW1 A;  2DYI A;  3FLG A;  3L42 A;  2R57 A;  5I2M A;  5GAM j;  2NLU A;  3QDR B;  1TTH B;  2VB6 A;  4BUG A;  3FJ5 A;  2K5I A;  4D6W A;  3G1J A;  2DXB A;  2RHY A;  2YWW A;  2CZ1 B;  1OQK A;  4IUU A;  2D9T A;  3MPU B;  5KYY A;  1T0J A;  3SB2 A;  4JRP A;  1LJO A;  4MDW A;  3M9Q A;  1QVF P;  2DRK A;  1M90 R;  1YJW A;  2RPN A;  4OMO A;  5GMK h;  5I21 A;  4BE0 A;  1QP3 A;  1QCF A;  2ESW A;  5LL6 S;  1VIE A;  4M77 G;  1YBY A;  2A0F B;  3UWN A;  2VGN A;  3EAE A;  4ME7 A;  4MZP A;  3QHS A;  2FG0 A;  1QVP A;  4C5I A;  1BU1 A;  2DAQ A;  1SHG A;  2LNV A;  2ZPG B;  1R77 A;  2NYS A;  1ZBX A;  2QAZ A;  3FIF A;  3JB9 I;  1ZSG A;  4JJC A;  2YRV A;  3I35 A;  3BFM A;  4P5N A;  1UEB A;  2RM4 A;  1VQ5 A;  2RD1 A;  2KBT A;  3EGX A;  3CMA A;  3RDV A;  1YJW T;  1KQS S;  4M78 C;  2LT1 A;  3E2U A;  5DM7 R;  3RNJ A;  4C0D C;  1M27 C;  2RHI A;  1GCP A;  4LD9 K;  2KSS A;  3JCM g;  1M1K C;  2OJ2 A;  4PJJ A;  2LX9 A;  2P4T A;  2JZ2 A;  4PFP A;  4AFS C;  2M02 A;  2L3P A;  4OMF B;  2EKO A;  2JUF A;  2YDL A;  4QKU A;  1RAB B;  1SG5 A;  3Q1J A;  2CH4 W;  4Y92 A;  1YJW Q;  2BZ8 A;  1PNJ A;  1UJY A;  2X51 A;  4RTW A;  4B9W A;  4XTX A;  1M1K U;  2JXB A;  2ZPI B;  1VQ5 T;  2YHT A;  3OYC A;  3OY9 A;  1W2B S;  2WSC E;  4M75 C;  5GAN e;  4CC2 A;  3CBO A;  3CMA T;  2E10 A;  2DEQ A;  2QDY B;  2GQI A;  2XID A;  3X24 B;  1IGU A;  2LJ3 A;  3C94 A;  2D8J A;  4UC4 A;  5CR2 A;  3VU3 C;  3THK A;  4Y91 A;  4BY6 B;  4ORZ A;  1QP2 A;  2CKK A;  3OYF A;  2XDP A;  4AFQ C;  1JU5 C;  5GAM f;  3QZ9 B;  4ZN3 A;  1VQ5 Q;  1KC8 R;  1I5L A;  2DO3 A;  2RI5 A;  1D0Z A;  3HL8 A;  3FB9 A;  2O4X A;  1QLY A;  3CMA Q;  1KHC A;  2F69 A;  3EHQ A;  1Q81 C;  2COW A;  2EQM A;  3S3N A;  2DET A;  2QA4 T;  4HCZ A;  4JZ4 A;  1Q95 G;  1AT1 B;  1ZA2 B;  2KXD A;  4JPB W;  4B9X A;  2EYQ A;  4R55 A;  3OYE A;  1H8K A;  4EMH A;  2P4R A;  4GLM A;  3O8V A;  3S3O A;  4DOV A;  1Y07 A;  2JS2 A;  1JQQ A;  3JB9 G;  4ZTF A;  1MHN A;  2HZY A;  4C92 A;  5L8R E;  1LCK A;  1AWJ A;  2LQK A;  1ZUU A;  5FRN A;  2QA4 Q;  2L5Q A;  1K0X A;  5CQY A;  2HQX A;  2CH4 A;  3HFO A;  4ESR A;  1Q7Y R;  2EVR A;  2QQS A;  3NFC A;  5GMK m;  2XD0 A;  2F5T X;  4Y28 E;  3G4S A;  1UTI A;  3M5A A;  2E70 A;  2JTM A;  4Q5W A;  2WSF E;  5LJ3 g;  2LQ8 A;  1UFF A;  2ZPB B;  3GIB A;  4OML A;  1BK2 A;  3ME9 A;  3NGP A;  1R0B G;  1WHL A;  4D8K A;  1N9S A;  1MMD A;  2DM1 A;  3KFV A;  1M9S A;  2G3R A;  2KT1 A;  2HBP A;  1Y71 A;  2JW4 A;  2CZ7 B;  2PTK A;  1YNZ A;  2JTE A;  4J7F A;  3CCM A;  1BIB A;  2ENM A;  2VVK A;  2R5A A;  2KYB A;  2RHU A;  2HKQ B;  4IKF A;  3UA6 A;  4A4K A;  3I56 A;  3G4S T;  4RUG A;  5D6W A;  3PFS A;  4DBH A;  2KK4 A;  3A8H B;  2EGC A;  1MV0 B;  3V8J A;  4NOY A;  5GAN 5;  2L89 A;  2A3L A;  3BE3 A;  4X9C A;  2BZX A;  2ATC B;  2KE9 A;  3BW1 A;  3EG0 A;  2XHC A;  2EWN A;  1OZ2 A;  3PTA A;  1S72 A;  3JCM e;  3QJY A;  4LDU A;  3G4S Q;  4DQ2 A;  4E7K A;  3EG9 A;  4A53 A;  3VS1 A;  1Q82 R;  3VS4 A;  2CS7 A;  5I22 A;  4M78 A;  1XJW B;  3CCM T;  2X4J A;  5GAO r;  1RAE B;  2NUP B;  1VQO A;  1CKA A;  1OYX A;  5LJ3 j;  5HY6 A;  1H92 A;  3I56 T;  1Q82 C;  3UT1 A;  4RCC A;  1JJ2 A;  2C0I A;  3CCQ A;  1PD0 A;  1AWX A;  2D1X A;  5DLQ E;  2V1R A;  1FMW A;  2PVO B;  3CCM Q;  3JCM f;  1PG5 B;  1Q82 U;  1S72 T;  2LVM A;  3ZBD A;  2P84 A;  3I56 Q;  2YSQ A;  1YP5 A;  4M75 A;  2OI3 A;  3H0H A;  3DLL A;  1JJ2 P;  2YXY A;  1W70 A;  1D09 B;  2CSQ A;  1ZUK A;  2RK1 A;  1AWW A;  3O5Z A;  1NPP A;  1TG0 A;  3TEE A;  3KXT A;  1VQO T;  1RAI B;  5EC7 A;  1K9A A;  1S1N A;  3SHW A;  4KGX B;  2DL7 A;  3PIP A;  1JXO A;  4C0Z A;  1M1F A;  1GL5 A;  5CCA A;  4BE2 A;  1S72 Q;  2P0K A;  2KYM A;  2L2P A;  1EIF A;  1BIA A;  1YCS B;  3CCQ T;  1UE9 A;  2Y4Y A;  3VS7 A;  2YUO A;  1JBM A;  3EHR A;  2HAX A;  3UPU A;  1GFD A;  1E6G A;  1YWO A;  3VS2 A;  2DIL A;  3MP6 A;  1VQO Q;  4RTU A;  1NEG A;  3VS5 A;  2MPX C;  1D3B B;  2K6D A;  2L3R A;  4E2F B;  1V1C A;  4WF2 A;  2XG8 D;  1OU9 A;  3X25 B;  2E4H A;  1U8R A;  3RKY A;  2E12 A;  2ED1 A;  2EQU A;  3ULR B;  1HXD A;  3L2U A;  3CCQ Q;  1M1G A;  1T0H A;  3G71 A;  1G3T A;  2EJG A;  3OYK A;  1W6X A;  2DTO A;  5IHI A;  3GF5 A;  4EMK C;  4Z8A A;  2A37 A;  2JM9 A;  2Y90 A;  2NWM A;  5LJ5 h;  2COZ A;  3FC3 A;  2KEA A;  3CCU A;  5A0L A;  2E6Z A;  1Z9Z A;  2XDB A;  2K5F A;  5KYW B;  1SRL A;  4ZTJ A;  2OX7 A;  4EMG A;  1Y0M A;  2GFA A;  2LX7 A;  3QUI A;  2KRM A;  4M78 F;  3JB9 D;  3CCJ T;  2GBQ A;  2CP7 A;  4XK8 E;  4CC4 B;  2VXF A;  2RNA A;  2K9G A;  4LDY A;  4QT7 A;  3ZL7 C;  2QGF B;  4X1V A;  2VXE A;  4C8Q A;  3VUZ A;  3CME A;  5LJ3 f;  2QQ9 A;  3VS3 A;  5GMK l;  3RMQ A;  2F2X A;  3A1P A;  4RG8 A;  1G83 A;  1KQS A;  2DD4 A;  2KRN A;  3BDU A;  3RUX A;  3TSW A;  3NPF A;  3CCJ Q;  4M7D C;  3DB3 A;  4ANJ A;  5FWC A;  1SHF A;  3PNW C;  2FZK B;  3CCU T;  4M75 F;  3V7R A;  2EPD A;  4IIO A;  5HK3 A;  2H3J A;  1KQS P;  5M9O A;  1QWF A;  1SRM A;  2H3E B;  2RQV A;  2DBM A;  3PE0 A;  4JRK A;  1W2B A;  5CAI A;  2GGR A;  1Y96 B;  3TQ7 P;  3CME T;  4O5V A;  3ER0 A;  5I2S A;  3CCU Q;  7AT1 B;  3DKM A;  2QQR A;  3E19 A;  5CIU A;  2X4W A;  3QDF A;  4M77 C;  5DY9 A;  5GAN g;  2J7I A;  1WNL A;  1EFN A;  3ZEH A;  5FU6 B;  3SEM A;  4JRI A;  3TVT A;  5KYU B;  4R56 A;  2RQT A;  1B34 A;  3PMT A;  1HJD A;  1ZBJ A;  4RTZ A;  5L23 A;  4A63 B;  1AD5 A;  2RJF A;  4M78 E;  1KD1 C;  3CME Q;  2QEX A;  2QAS A;  4N4I A;  3EH2 A;  2NUT A;  2K2M A;  2VWF A;  6AT1 B;  5IH2 A;  2MAM A;  2O31 A;  2E5Q A;  4J9D A;  1U5S A;  2PU9 B;  2MCN A;  3TCJ A;  1WHJ A;  2QK0 A;  5CQX A;  2E5K A;  3LH5 A;  1TUD A;  1VYV A;  1OOT A;  5FU7 C;  4FYW B;  2DBK A;  4AG2 C;  1KD1 U;  5GAN 3;  2MYS A;  1NBE B;  1U06 A;  4PJO A;  1V29 B;  4O6J A;  2OTL A;  1M8V A;  3S3M A;  4M7A A;  2K7A A;  3QSU A;  4OVA A;  3JB9 J;  5GAO m;  4JJB A;  2ZGW A;  5KYN A;  4F7U A;  2F2V A;  2CYZ B;  4M75 E;  1OZ3 A;  2GCX A;  3GBQ A;  3GNG A;  1AHJ B;  1N5Z A;  1WZO A;  2QEX T;  4HVU A;  1QKX A;  5A2Q E;  2X9H A;  4C8Q F;  2DL8 A;  3M0T A;  5KYX A;  1NYG A;  1MNE A;  4N0A C;  3ZFJ A;  2YUQ A;  1VA7 A;  2VYT A;  1M2O A;  3E9F A;  1HYO A;  1TXQ A;  2Z0W A;  5GAN j;  2DIQ A;  3JCM J;  2E64 A;  2ROL A;  1MMN A;  4JJN K;  4ZGE B;  3GLX A;  3MKD A;  2OTL T;  1VQ8 A;  2QEX Q;  1VQ9 A;  5IAY A;  1NPR A;  3FEO A;  1NG2 A;  5IT9 E;  5J3B A;  2DLP A;  1M5Q 1;  4EMK A;  4EDU A;  1FXX A;  3EGU A;  1PRL C;  5KCO A;  2MF2 A;  4E7H A;  4FW1 A;  1MND A;  3QO3 A;  5GAO p;  1ZSZ B;  3S6W A;  2DVJ A;  2E3I A;  4JUV A;  2XU8 A;  3OA6 A;  3D7S B;  1KHI A;  3CPF A;  2OTL Q;  2AT1 B;  1NJI C;  2HBW A;  3OW2 S;  1E6H A;  4IUQ A;  3INZ A;  4XU3 A;  2EYY A;  3LWH A;  3QXE B;  1AWO A;  2D0N A;  2K2V A;  3E1S A;  3EFO B;  5GAN 7;  4JDS A;  1M1K R;  1PRM C;  3J81 E;  4KUL A;  1N27 A;  1G3Y A;  2AZV A;  3M4G A;  2LNH B;  1WFW A;  3LX7 A;  1ZLM A;  3VRY A;  2DPP B;  2D8H A;  1VQ8 T;  3L2V A;  2KMT A;  2D0Q B;  1VQ9 T;  1VQM A;  1NJI U;  4HCC A;  1PKS A;  1K76 A;  2IIM A;  1WHM A;  4EIK A;  1IHV A;  4BI8 B;  1RLQ C;  4M7D A;  3A8G B;  1KFZ A;  5CKE A;  2O9V A;  3L2W A;  4E7S A;  1DJ7 B;  2PQW A;  4C8Q E;  1K73 C;  4V2S A;  1FX7 A;  4KH0 B;  1UDL A;  5J26 A;  3HTR A;  2QA4 A;  2EYW A;  1WXT A;  2KVQ G;  2JOY A;  4PJN A;  1HK9 A;  1VQ8 Q;  1IHW A;  1X43 A;  4PJO F;  3OYL A;  1VQ9 Q;  1M8M A;  4M7A F;  1QMC A;  4PNO A;  3NHN A;  3OYY A;  4WTO B;  2VAS A;  4OB0 B;  2K4Y A;  4F7U F;  1K73 U;  2HKN A;  2LZ6 B;  4FU6 A;  1C1A A;  1NLO C;  3CXC S;  3JCM X;  4LNP A;  1M2V A;  2JVV A;  1QVG S;  1N8R C;  1I4K 1;  3M0U A;  5KE2 A;  1VQM T;  4M77 A;  2FB7 A;  2GQV A;  1Q81 R;  2FHD A;  2FRY A;  1WJR A;  2A28 A;  2EJF A;  1RI0 A;  5KE3 A;  2QXF A;  2SEM A;  2E41 A;  2WSE E;  1LNX A;  2K79 A;  1KQ2 A;  4BY6 C;  3JCM c;  3GP8 A;  2F5K A;  4LN2 A;  1D1B A;  5LJ5 e;  2GF7 A;  1ZUY A;  1UGV A;  1KQ1 A;  2DIG A;  3P8H A;  1N8R U;  3V8K A;  3WVD B;  2LJ0 A;  2VC8 A;  3JCM b;  3H0I A;  2FRW A;  2FEI A;  1VQM Q;  4BI3 A;  1FYN A;  5GAN f;  2GFU A;  2VKN A;  1G3W A;  3RES A;  2WAC A;  3OYA A;  2EQJ A;  1XNI A;  3RIR A;  2RK2 A;  1Q81 U;  1VQN A;  3CC4 T;  2DJQ A;  2HCK A;  1RLP C;  1KG1 A;  4VUB A;  3NTK A;  2QTV A;  2L3Q A;  4LE9 A;  4NL2 A;  1BBZ A;  2MWO A;  3SD4 A;  4E7I A;  1UJ0 A;  1TU0 B;  3MEA A;  4E7J A;  4M78 G;  3HRT A;  4PLL A;  4PJO E;  3EGD B;  4C5G A;  3CC4 Q;  1PSE A;  3UDC A;  4M7A E;  5FRM A;  2LC4 A;  4XTZ A;  2AIR B;  4F7U E;  2KAF A;  1QWE A;  1NLP C;  4N0A A;  3C95 A;  3LWI A;  2OAW A;  4NL3 A;  5GAO l;  3R6N A;  1M3A A;  1VQN T;  1C6V X;  3JCM W;  1AZG B;  1UHC A;  1RAD B;  2HSP A;  3CCV A;  1OEB A;  1LOJ A;  1HSQ A;  4L5G A;  2CSI A;  1X2K A;  3H8Z A;  1OX8 A;  4RCB A;  4BAC A;  2RMO A;  5GMK j;  4HCB A;  4KUD K;  4M75 G;  1GCQ C;  4CC7 A;  2QDL A;  3I5R A;  1YCY A;  1BI3 A;  4PJM A;  1JEG A;  2SRC A;  4F16 A;  2A08 A;  4J9G A;  3L2R A;  3URG A;  1VQN Q;  5CK9 A;  3PMI A;  3VS0 A;  1X6G A;  2AHJ B;  2BE7 D;  4RKU E;  2E6N A;  4PFZ A;  1TUC A;  4J9I A;  5ECA A;  1IZ6 A;  4M4Z A;  1K1Z A;  2LQN A;  4HA8 A;  3WVE B;  1UG1 A;  1VYT A;  2QTX A;  1R0C B;  1R8O B;  4OF1 A;  2MIO A;  2ROT A;  3CCV T;  1QCN A;  4QQ6 A;  2EFI A;  1JB0 E;  3NTH A;  2X3X D;  1A0N B;  3NTI A;  2LMJ A;  2FL7 A;  1OU8 A;  5FWB A;  3OYG A;  1WI7 A;  4OMN A;  1CSK A;  3F70 A;  2VV5 A;  1YI2 A;  3X28 B;  4AFU C;  2K57 A;  3QII A;  3DLM A;  3CBM A;  4KBM B;  3EG1 A;  2YLC A;  3TU4 K;  4C92 F;  3CCV Q;  4L59 A;  3LGL A;  4XU0 A;  2LCC A;  5HCK A;  1D0X A;  2QI2 A;  3VV0 A;  1B07 A;  4MZM A;  2BE9 B;  4LUE A;  4B6M A;  1ZX6 A;  1IB8 A;  1E7O A;  1RAC B;  3HKS A;  3N5B B;  3CCR A;  5GMK e;  2EW3 A;  1BI0 A;  2XK0 A;  4J9E A;  3CQT A;  4RTX A;  1M3C A;  2GTJ A;  2MOX A;  1EZZ B;  4C8Q G;  2CUD A;  2PZ1 A;  2L3S A;  2ZZD A;  3BDL A;  4HXJ A;  4ZGJ B;  3OS2 A;  4XQ3 A;  2OTJ A;  5GAM d;  3EFR A;  2M1H A;  3OS0 A;  1YI2 T;  3QJ6 A;  4J9H A;  3OMC A;  3SWN B;  2MK5 A;  4BI4 A;  2ECZ A;  1NZ9 A;  5GAM h;  4Z88 A;  4CRI A;  1UEC A;  3CCJ A;  4KRT A;  1GXI E;  3SWN C;  2RO0 A;  1BB9 A;  1CKB A;  4FM4 B;  1LVK A;  1FMV A;  3H41 A;  5KYY B;  2LQW A;  1I07 A;  3JAM E;  3J7A F;  2K5L A;  3HPW A;  4DOW A;  2RJC A;  2JT4 A;  3MCA B;  2L8D A;  3FJP A;  3A98 A;  3V7S A;  1YI2 Q;  2F2W A;  5GAO n;  3CCR T;  5D7U A;  1X27 A;  2EGA A;  4KH1 B;  1WHK A;  2ABL A;  1AEY A;  4PFO A;  1TOV A;  4YTL A;  1I8F A;  2FZG B;  2M0Y A;  1F1B B;  3H6Z A;  1UGS B;  2DX1 A;  3VYH B;  3HRU A;  3M0R A;  3BY7 A;  3PIO A;  1MMA A;  3JCM V;  2RN8 A;  2OTJ T;  4R0K A;  1TH7 A;  1K8A C;  4C92 E;  1X75 C;  4JLG A;  4KGV B;  4LD6 A;  3CCR Q;  2GNC A;  1UGP B;  2DTI A;  1YFN A;  5GJW B;  3OW2 A;  3M54 A;  1WHH A;  3OB9 A;  4XTW A;  4IUP A;  2BKD N;  2KY9 A;  1RAA B;  1K8A U;  3HRS A;  4ZNX A;  2OTJ Q;  3EGX B;  4NS5 A;  5AYF A;  5HK0 A;  2C0O A;  2K3X A;  1RI9 A;  4M78 D;  3GOX A;  2DJZ A;  1WA7 A;  2YUN A;  4CI0 C;  1GCQ A;  4HKE A;  3OW2 P;  3M0Q A;  4ZGD B;  2BUD A;  2RQW A;  2YUP A;  3GNF B;  4PJO G;  2FPF A;  3OYM A;  4M7A G;  2B86 A;  1PWT A;  2QQB A;  3V7C A;  4F7U G;  2E3H A;  5KCH A;  2CP2 A;  3EG2 A;  2HL5 C;  4DEX A;  1VQ6 A;  3TSZ A;  2DXT A;  3OS5 A;  4JRQ A;  2VUB A;  3QZ5 B;  3OYH A;  2DXU A;  2JM8 A;  2RI3 A;  2DA9 A;  4F17 A;  5I11 A;  1KIK A;  1I81 A;  4M75 D;  3CXC A;  4IUT A;  1RL2 A;  1MGQ A;  2I0N A;  4FIB A;  4AFZ C;  2LT4 A;  3CPW S;  3LW5 E;  1OPL A;  1KD1 R;  4KUI A;  4E7Z A;  3OYD A;  4GY5 A;  2DZ9 A;  2LCS A;  4OB2 B;  3MHX A;  1O75 A;  2NUP A;  1W1F A;  4QVZ A;  1W2B P;  3AHU A;  1K0S A;  2EGE A;  5FU6 C;  3I55 A;  1K9M C;  2O4X B;  3CXC P;  2LTO A;  3C4S A;  4J5Y A;  3HHT B;  1RAF B;  1QQJ A;  1IRX A;  4N4G A;  3M53 A;  1OX9 A;  1VQ6 T;  3OMG A;  3OSV A;  5LJ5 g;  4N4H A;  2LCL A;  3JCM d;  5A0G A;  4RMO A;  2RJE A;  3PT9 A;  3CBP A;  2KT8 A;  2LRQ A;  4TVR A;  1K9M U;  1Y7X A;  3JSC A;  1PHT A;  1I1J A;  4J9B A;  3JCM h;  4FT2 A;  1T3S A;  1PKT A;  1T3L A;  2F1L A;  1VYU A;  2EIF A;  2DL3 A;  4C92 B;  1JO8 A;  1X01 A;  1PM3 A;  2CZ0 B;  3UF4 A;  2BZY A;  2ZPH B;  1ZA1 B;  1VQ6 Q;  3LH0 A;  2KRS A;  4E7L A;  2XDD A;  4OP0 A;  2E1H A;  4EPC A;  1TUG B;  3OQ5 A;  4ELZ C;  4Z02 A;  1N9R A;  2G6F X;  2OAU A;  3I55 T;  1P92 A;  1YIT A;  2W0Z A;  1YWP A;  3GPL A;  1WQ7 A;  4XU1 A;  1PD1 A;  2HSE B;  1WX6 A;  1W4S A;  4FYY B;  3SDZ A;  2RF0 A;  2MMP A;  1Q86 C;  3CC2 A;  1GRI A;  2DL4 A;  2YLB A;  5D6X A;  3OBY A;  5FW9 A;  2EQK A;  3V8L A;  4CC3 A;  2JMC A;  1D3B A;  3M55 A;  1WJQ A;  1XTD A;  3I55 Q;  4DBR A;  1XQH A;  4C8Q D;  2RQU A;  2V8K A;  4PK4 A;  1YJ9 A;  1Q86 U;  1RUW A;  2CP5 A;  2E65 A;  1IRE B;  1GBR A;  2DMO A;  5IN1 A;  1V76 A;  1NJI R;  4OMM A;  1GBQ A;  2EYX A;  4X9D A;  4JS5 A;  3KUF A;  3MP1 A;  1YIT T;  2EAY A;  3VYG A;  1JXM A;  5IHK A;  5LJ5 j;  4DA4 A;  5FLX E;  2ZCF B;  1M90 C;  4ATO A;  2KI7 A;  3RKW A;  5IHN A;  1ZSZ C;  2DZC A;  5CO7 A;  3CC2 T;  5KYW A;  4FYX B;  4K11 A;  1YN8 A;  2DD5 A;  3L2Z A;  3EG9 B;  4WCI A;  3VS6 A;  1WIE A;  3JRZ A;  4J9C A;  4C5H A;  1M90 U;  1YIT Q;  1K73 R;  4AT1 B;  4J6X A;  2DK3 A;  5LJ3 d;  4M78 B;  1VIF A;  1YJ9 T;  2RHX A;  3OBW A;  4C0D B;  2RH2 A;  2XMF A;  4MDX A;  3MEU A;  3MJX A;  4OGC A;  1OUL A;  2DFU A;  5LJ3 h;  2CRE A;  3CC2 Q;  4JS4 A;  5CKB A;  4C92 G;  4JZ3 A;  1G2B A;  4MML A;  1B7T A;  2QQA A;  4AG1 C;  4HCK A;  3HSB A;  4J83 A;  2IVW A;  3PGG A;  1N8R R;  1YJ9 Q;  5GAM e;  2DL5 A;  2BIV A;  4XTV A;  2EKH A;  4XU2 A;  5CVI A;  9ATC B;  2CZ6 B;  4M75 B;  3CC4 A;  1ZHI A;  4QVC A;  3RBB B;  2RI2 A;  5FRO A;  2J6O A;  4BE1 A;  4FYV B;  5GAO q;  1BKB A;  3EG3 A;  1Y96 A;  4PJO D;  4JLI A;  3NMZ C;  4HT8 A;  2A7Y A;  3TRE A;  4QVD A;  2HQE A;  3VUB A;  4M7A D;  2AKK A;  3CC7 A;  2O2O A;  5CKF A;  4FSX A;  2V1Q A;  2ZAE A;  2MI6 A;  3PVQ A;  4XAX B;  2CUB A;  2HNI A;  2J05 A;  2XI9 A;  2ZPF B;  4A4F A;  5KYU A;  4J6W A;  5IXF A;  1ACM B;  3U23 A;  4LUD A;  4XTY A;  4E6R A;  1MUZ A;  1PSF A;  4OMP A;  3L1A A;  3M58 A;  4C0F A;  3OYI A;  1WYX A;  4Z89 A;  1RAG B;  2HMA A;  2M0O A;  1Y57 A;  2YRC A;  4II1 A;  1KC8 C;  4DBQ A;  2JTF A;  3FDR A;  4BD3 A;  2AKL A;  4OGE A;  5C0M A;  1RAH B;  2KRO A;  3AT1 B;  4AMC A;  2P0Q A;  2X35 A;  4GLK A;  1IGQ A;  3CC7 T;  4HVW A;  5LJ5 f;  3I5S A;  3KBG A;  3RKX A;  5GMK i;  2Y4X A;  3QPH A;  2FPE A;  1KC8 U;  1YIJ A;  2CGH A;  2FYK A;  3EH1 A;  2EBP A;  2M9U A;  1QVF S;  5CKH A;  2DE0 X;  1J3T A;  4LXC A;  1G8X A;  1TS9 A;  2DRM A;  3VJP A;  2YT6 A;  3IQL A;  5C6S A;  1BCM A;  2V8J A;  4QQD A;  5J39 A;  2DVE A;  3CC7 Q;  4LDW A;  2LDM A;  4OB3 B;  4M7D F;  1MV3 A;  1Q7Y C;  3E9G A;  3J80 E;  2I2L A;  2MWP A;  1UB4 A;  1FWZ A;  4X34 A;  3A8L B;  4MZT A;  4C8Q B;  3UAT A;  5HKC A;  2RJD A;  2QGG A;  1UUE A;  1VQP A;  4C8Q C;  2RHZ A;  1U3O A;  3H9N A;  3FRN A;  1YHQ A;  5GJV B;  1ARK A;  1Q7Y U;  2PUK B;  4M7D D;  2IPO B;  1YIJ T;  4FL6 A;  3QYG B;  4IUV A;  3M0S A;  2P0P A;  2W10 A;  1WJS A;  2CP6 A;  2KXC A;  4C5E A;  3MET A;  4M77 F;  1PCX A;  1ZSZ A;  4IUR A;  2LP5 A;  3L2Q A;  2QYZ A;  2DNU A;  2HQH A;  1H64 1;  1BCO A;  5IXB A;  4F04 B;  1UHF A;  2BTT A;  5EG2 A;  4JJD A;  1D0Y A;  1WHG A;  1BI1 A;  3EFO A;  1QCO A;  1YIJ Q;  1O9S A;  1PC0 A;  1NEB A;  2JNG A;  2CT4 A;  1K4U S;  1VQK A;  1OPK A;  2DF6 A;  4J8O A;  1M3B A;  3CPW A;  2JMA A;  1X69 A;  1VQP T;  4M77 D;  4HVV A;  1YHQ T;  2HDA A;  2V8I A;  1WLP B;  1YJN A;  4LDX A;  1NM7 A;  3VRZ A;  3WXM B;  2ZPE B;  1B34 B;  3A5Z B;  2DKG A;  3ASK A;  2EJ9 A;  1AZE A;  2O01 E;  4QW2 A;  3CD6 A;  2NUT B;  1NE8 A;  4M7D E;  1AOJ A;  3CPW P;  4PJL A;  2O88 A;  1WDX A;  1KK7 A;  4C0G A;  1WQW A;  1VQP Q;  2DTH A;  2PNI A;  1M30 A;  1H3H A;  4OMQ A;  1YHQ Q;  1SEM A;  2XKO C;  4RTV A;  8AT1 B;  1WXU A;  3P8D A;  4RG2 A;  4OB1 B;  2A36 A;  2CT3 A;  3MP8 A;  4FSS A;  4ZN1 A;  3LLR A;  4PKC C;  4C92 D;  3OYJ A;  3OYN A;  4PJO B;  2PVG B;  3QG1 A;  1VQK T;  3A8M B;  3JCM P;  4M7A B;  2IG0 A;  3QBY A;  2XIC A;  2FVU A;  4F7U B;  3G7Z A;  2FPD A;  1YJN T;  4J6Y A;  4PJO C;  1SSF A;  3X26 B;  4M7A C;  4KGZ B;  2KNB B;  2AZS A;  4L6V 5;  2CP0 A;  1VQ7 A;  4M77 E;  1TWB A;  2ED0 A;  2NUZ A;  2C0T A;  4XTU A;  5AT1 B;  3CD6 T;  5KYX B;  3M4Y A;  1VQK Q;  1Z9Q A;  2CDT A;  3OS1 A;  2L0A A;  5GAN d;  5GAN 6;  4BDZ A;  2LJ1 A;  4E47 A;  2JJ9 A;  2M51 A;  1YJN Q;  2K3Y A;  5D6Y A;  3QWX X;  5CKD A;  2EYZ A;  5GAN h;  1MMG A;  1D1A A;  3H0F A;  1K8A R;  2D6F A;  1BYM A;  2DEU A;  3T9N A;  3CCE A;  3CD6 Q;  3JCM Q;  5GAN 8;  4HT9 A;  5DLO A;  4EMK B;  1VUB A;  4MMK A;  2KDS A;  1IXD A;  1D1C A;  2CP3 A;  3CCS A;  3LGF A;  5LJ3 e;  2HD0 A;  3JB9 F;  5LJ5 d;  4BDY A;  3G6E A;  1VQ7 T;  1N6A A;  1WXB A;  2R5M A;  1OV3 A;  3M59 A;  3QYH B;  3EFS A;  2EQI A;  1QKW A;  1WGS A;  3EGD A;  3MO8 A;  3LYI A;  3M57 A;  1KJW A;  5A0D A;  2DYB A;  3REA B;  3MEW A;  2VGM A;  1U1T A;  3PVL A;  2JN0 A;  2DXC A;  2C06 A;  4F14 A;  1VQ7 Q;  2QG9 B;  1G5V A;  2RB6 A;  4KT0 E;  3CCE T;  1BI2 A;  2RA2 A;  3CEY A;  1B3Q A;  1VQL A;  8ATC B;  2RQR A;  3C0C A;  1IO6 A;  4DEY A;  2X3W D;  1ABO A;  4M7D B;  1SSH A;  3CCS T;  3G71 T;  2HEQ A;  3G6E T;  3C12 A;  1NYF A;  5GAN 2;  4RTY A;  4A4E A;  2B8A A;  3I9Q A;  2FO0 A;  3CCE Q;  2X4Y A;  1TSF A;  1UGR B;  2J6K A;  4RTT A;  4BB7 A;  3CCL A;  4FT4 A;  2J06 A;  1KSW A;  2PVD B;  1I5O B;  4A4G A;  1GFC A;  1JRI A;  1I0C A;  1X6B A;  3CCS Q;  3G71 Q;  1M4Z A;  1EX4 A;  1ABQ A;  1HD3 A;  5GAM g;  5GAN 4;  1QVG A;  3G6E Q;  4J9F A;  1VQ4 A;  1XOV A;  1WPY A;  1M2V B;  1K9M R;  4PL6 A;  1FMK A;  5KH6 A;  4M77 B;  1VQL T;  4LDV A;  4QQG A;  4D8D A;  4GBQ A;  3M0P A;  1C0M A;  3QWY A; 
#chains in the Genus database with same CATH homology
 2YUO A;  2AK5 A;  3EHR A;  2OAW A;  3R6N A;  1GFD A;  2XMF A;  1E6G A;  1M3A A;  1YWO A;  3VS2 A;  2CRE A;  2DIL A;  4RTU A;  1AZG B;  1NEG A;  1UHC A;  2J6F A;  3VS5 A;  2HSP A;  2K6D A;  1OEB A;  4JZ3 A;  2GTO A;  1HSQ A;  1G2B A;  1V1C A;  2CSI A;  1X2K A;  2H8H A;  3REB B;  2RMO A;  3UA7 A;  1SPK A;  2ED1 A;  1GCQ C;  4AG1 C;  4CC7 A;  3ULR B;  2QDL A;  4HCK A;  3JV3 A;  3I5R A;  1T0H A;  2K3B A;  1JEG A;  2SRC A;  4F16 A;  1W6X A;  2DL5 A;  5IHI A;  2A08 A;  4J9G A;  2EKH A;  4Z8A A;  2A37 A;  3VS0 A;  2JM9 A;  1X6G A;  2NWM A;  3RBB B;  1X2Q A;  4IIM A;  1TUC A;  2KEA A;  2O9S A;  4J9I A;  5ECA A;  2J6O A;  2JS0 A;  4M4Z A;  1Z9Z A;  1K1Z A;  2LQN A;  3EG3 A;  1AVZ C;  1UG1 A;  1VYT A;  3NMZ C;  1SRL A;  2KR3 A;  2KGT A;  2AKK A;  1Y0M A;  2LX7 A;  2O2O A;  2MIO A;  2ROT A;  2KRM A;  2V1Q A;  2GBQ A;  3PVQ A;  2CUB A;  2J05 A;  4CC4 B;  2RNA A;  2K9G A;  2X3X D;  4QT7 A;  3ZL7 C;  5IXF A;  1A0N B;  4X1V A;  3U23 A;  2LMJ A;  3FJ5 A;  4LUD A;  5FWB A;  4E6R A;  1MUZ A;  3VS3 A;  4OMP A;  1WI7 A;  4OMN A;  2F2X A;  1CSK A;  1T0J A;  1G83 A;  4AFU C;  1WYX A;  2KRN A;  4Z89 A;  3TSW A;  2DRK A;  3NPF A;  3EG1 A;  1Y57 A;  2RPN A;  4OMO A;  5FWC A;  1SHF A;  5HCK A;  1QCF A;  2ESW A;  2AKL A;  1B07 A;  2EPD A;  2KRO A;  4IIO A;  4LUE A;  1ZX6 A;  2FG0 A;  1E7O A;  4HVW A;  1BU1 A;  3I5S A;  1SHG A;  2FPE A;  1QWF A;  2EW3 A;  1SRM A;  4J9E A;  2RQV A;  2DBM A;  1ZSG A;  3CQT A;  3PE0 A;  2EBP A;  4JJC A;  2GGR A;  4RTX A;  3I35 A;  1M3C A;  2DE0 X;  2GTJ A;  2MOX A;  1J3T A;  2CUD A;  2PZ1 A;  2L3S A;  4HXJ A;  2DRM A;  2YT6 A;  3IQL A;  4J9H A;  2ECZ A;  2J7I A;  2KBT A;  1EFN A;  1MV3 A;  4Z88 A;  3SEM A;  3TVT A;  1UEC A;  4KRT A;  2RQT A;  1HJD A;  3RNJ A;  1ZBJ A;  4RTZ A;  1BB9 A;  1CKB A;  1M27 C;  3UAT A;  5L23 A;  4A63 B;  1AD5 A;  1GCP A;  3H41 A;  2LQW A;  1I07 A;  2OJ2 A;  1UUE A;  2K2M A;  2VWF A;  5IH2 A;  2O31 A;  4AFS C;  2JT4 A;  1U3O A;  3A98 A;  2L3P A;  4J9D A;  2F2W A;  1U5S A;  5GJV B;  2YDL A;  2MCN A;  1ARK A;  1X27 A;  2EGA A;  2CH4 W;  4Y92 A;  2ABL A;  2E5K A;  3LH5 A;  1AEY A;  1TUD A;  2BZ8 A;  1VYV A;  3M0S A;  1OOT A;  1PNJ A;  2W10 A;  2M0Y A;  1UJY A;  4RTW A;  2DBK A;  2DX1 A;  2KXC A;  4AG2 C;  3M0R A;  1U06 A;  2JXB A;  2RN8 A;  4R0K A;  2K7A A;  2LP5 A;  2DNU A;  4JJB A;  4CC2 A;  5IXB A;  2GQI A;  2F2V A;  1UHF A;  2BTT A;  2LJ3 A;  4JJD A;  2D8J A;  2GNC A;  1NEB A;  3THK A;  5GJW B;  2CT4 A;  3GBQ A;  1K4U S;  4ORZ A;  1OPK A;  1N5Z A;  2DF6 A;  4HVU A;  1QKX A;  1M3B A;  4AFQ C;  1JU5 C;  2DL8 A;  2JMA A;  1X69 A;  3M0T A;  4ZNX A;  4HVV A;  1NYG A;  2HDA A;  1WLP B;  2C0O A;  1NM7 A;  3VRZ A;  2YUQ A;  1QLY A;  1VA7 A;  1RI9 A;  3EHQ A;  1AZE A;  4JZ4 A;  1WA7 A;  2KXD A;  2YUN A;  4JPB W;  1GCQ A;  2ROL A;  3M0Q A;  1H8K A;  2RQW A;  2YUP A;  1AOJ A;  2P4R A;  4GLM A;  2O88 A;  2FPF A;  1WDX A;  1NG2 A;  2B86 A;  2DLP A;  2PNI A;  2JS2 A;  1M30 A;  1PWT A;  1JQQ A;  1H3H A;  4OMQ A;  1SEM A;  3EGU A;  4RTV A;  1PRL C;  1WXU A;  3EG2 A;  4DEX A;  1LCK A;  1AWJ A;  3TSZ A;  1ZUU A;  2A36 A;  1K0X A;  2CT3 A;  4FSS A;  2CH4 A;  2DVJ A;  2JM8 A;  2DA9 A;  4ESR A;  4F17 A;  2EVR A;  5I11 A;  1KIK A;  1UTI A;  2HBW A;  1E6H A;  2FPD A;  2EYY A;  2I0N A;  1AWO A;  4AFZ C;  1UFF A;  2D0N A;  2KNB B;  2AZS A;  1OPL A;  1PRM C;  4OML A;  2ED0 A;  1BK2 A;  2AZV A;  2NUZ A;  2C0T A;  2LNH B;  1WFW A;  3NGP A;  2LCS A;  4D8K A;  1ZLM A;  2DM1 A;  3VRY A;  1W1F A;  2D8H A;  3KFV A;  1Z9Q A;  2CDT A;  1K0S A;  2EGE A;  1PKS A;  1K76 A;  2KT1 A;  2IIM A;  2L0A A;  4EIK A;  2LJ1 A;  2M51 A;  2JW4 A;  1RLQ C;  2PTK A;  1KFZ A;  3QWX X;  2EYZ A;  2O9V A;  1YNZ A;  2JTE A;  3H0F A;  2ENM A;  2VVK A;  1UDL A;  2EYW A;  2KYB A;  1WXT A;  3UA6 A;  2KT8 A;  4RUG A;  1X43 A;  1PHT A;  1I1J A;  4J9B A;  1M8M A;  2EGC A;  1T3S A;  1MV0 B;  1PKT A;  1T3L A;  1VYU A;  2DL3 A;  3NHN A;  2BZX A;  1JO8 A;  1WXB A;  2KE9 A;  3UF4 A;  2BZY A;  2LZ6 B;  1NLO C;  1OV3 A;  3EG0 A;  2KRS A;  4LNP A;  2EQI A;  1QKW A;  3M0U A;  2G6F X;  1KJW A;  2FRY A;  2W0Z A;  1YWP A;  2A28 A;  2SEM A;  3VS1 A;  2DYB A;  3REA B;  1WX6 A;  2K79 A;  3VS4 A;  2RF0 A;  3PVL A;  4LN2 A;  5I22 A;  4F14 A;  1GRI A;  1CKA A;  1UGV A;  1ZUY A;  2DL4 A;  5FW9 A;  1B3Q A;  4CC3 A;  2RQR A;  1H92 A;  3C0C A;  1IO6 A;  2JMC A;  2LJ0 A;  4DEY A;  3H0I A;  2FRW A;  2FEI A;  2X3W D;  1FYN A;  1ABO A;  2C0I A;  1SSH A;  1AWX A;  2VKN A;  2HEQ A;  2D1X A;  2RQU A;  1RUW A;  1NYF A;  4RTY A;  1GBR A;  2DMO A;  2V1R A;  2DJQ A;  2HCK A;  3I9Q A;  2FO0 A;  4OMM A;  1GBQ A;  1RLP C;  2EYX A;  2J6K A;  4RTT A;  1JXM A;  2YSQ A;  1YP5 A;  2L3Q A;  2OI3 A;  3H0H A;  5IHK A;  2J06 A;  1KSW A;  1W70 A;  4LE9 A;  2CSQ A;  1BBZ A;  1GFC A;  1I0C A;  1X6B A;  1ZUK A;  1UJ0 A;  1AWW A;  5IHN A;  3O5Z A;  1ABQ A;  1HD3 A;  1TG0 A;  4J9F A;  1XOV A;  4K11 A;  1YN8 A;  5EC7 A;  1K9A A;  1S1N A;  1FMK A;  3SHW A;  2DL7 A;  4D8D A;  1JXO A;  1GL5 A;  4GBQ A;  2KYM A;  4WCI A;  3VS6 A;  1WIE A;  2L2P A;  3M0P A;  4J9C A;  1QWE A;  1YCS B;  1NLP C;  3QWY A;  1UE9 A;  3VS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...