1SSHA

Crystal structure of the sh3 domain from a s. cerevisiae hypothetical 40.4 kda protein in complex with a peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
GSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Yeast SH3 domain structural genomics
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region
total genus 12
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2004-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1sshA00
2K79A 1K4US 5EC7A 5FWBA 3M0RA 1UHFA 2DNUA 2RQRA 1AWOA 3EG3A 4F16A 4DEYA 2KROA 3TSWA 3PVLA 1JO8A 2DJQA 2EYZA 2M0YA 2BZ8A 3EG0A 1NG2A 4R0KA 1S1NA 4J9IA 1OPLA 4J9HA 1PNJA 2KRNA 3VS1A 1MV0B 2KBTA 1MUZA 4K11A 2D8JA 4OMQA 1PKTA 2RF0A 1NLOC 1T0HA 3UA7A 1W70A 5ECAA 2J7IA 1QWEA 2DVJA 1KJWA 2C0OA 2CSIA 2GNCA 1UJYA 1JQQA 1Z9QA 1WDXA 4WCIA 1UG1A 1W6XA 2LMJA 2XMFA 3EGUA 4X1VA 2DRMA 2MIOA 1X43A 1J3TA 1UDLA 4OMOA 1OPKA 5GJVB 2A36A 2D1XA 1ZX6A 1GFDA 1M8MA 1GL5A 2F2WA 1FMKA 1YCSB 4D8DA 2YUPA 3I5SA 2C0IA 1U5SA 4OMMA 1HSQA 2DM1A 2C0TA 2KYMA 1M27C 2DA9A 1JXOA 4F17A 2GQIA 1SSHA 3VS3A 2KE9A 2BTTA 2LJ3A 1AOJA 2E5KA 5L23A 2RN8A 2NWMA 1T0JA 1GBQA 1X27A 2LP5A 3PVQA 1U3OA 1NLPC 1WLPB 2BZYA 3M0PA 1KFZA 2RNAA 4J9EA 1ZBJA 1IO6A 2DLPA 3O5ZA 1ZUYA 4RTYA 2RPNA 3C0CA 5I22A 4RTUA 1WA7A 1JXMA 3NGPA 1K0SA 1SRLA 2JTEA 4JZ4A 2EPDA 1M3CA 2JM8A 2FPDA 2W0ZA 1B3QA 1UFFA 3UF4A 1H92A 1SEMA 2DBMA 2DYBA 1NYFA 3QWXX 1BB9A 1KIKA 2RMOA 2L2PA 4RTVA 1PRMC 3SEMA 2CUDA 2EW3A 2LQNA 2PTKA 1X2QA 2H8HA 4AG2C 2B86A 3FJ5A 2ROLA 3PE0A 2LJ0A 3U23A 2O88A 2K6DA 2YUQA 4LUEA 2P4RA 2A37A 1YN8A 4CC7A 5IHKA 1CKBA 2J6OA 1ARKA 2ED1A 3LH5A 2KT1A 1NEGA 2OJ2A 2EYYA 2L0AA 1I1JA 2DL5A 4Z89A 1UECA 1NYGA 2J6KA 1OV3A 3NHNA 2LZ6B 1SRMA 2A08A 2PNIA 2ECZA 1OEBA 1YWPA 1BK2A 1M3BA 2CSQA 2EGAA 2QDLA 2X3XD 5IH2A 2ROTA 3RBBB 1X2KA 4JZ3A 2MCNA 1M3AA 1VYVA 2HSPA 1N5ZA 1H8KA 2DL8A 2LQWA 1QKXA 3GBQA 1UE9A 1VYUA 3I9QA 4J9DA 2JMCA 2FO0A 2ESWA 2AZSA 3NPFA 2MOXA 1PKSA 4DEXA 3TVTA 1E6HA 1ABQA 2RQTA 2K7AA 1GBRA 2O9VA 3UA6A 4D8KA 1K1ZA 1HJDA 1UJ0A 1TG0A 1PRLC 1E7OA 1PHTA 2DL4A 2KGTA 5FW9A 4CC2A 4A63B 4LN2A 2W10A 4OMNA 4J9BA 4AFSC 2JMAA 1UHCA 2O31A 2KXDA 3THKA 4ORZA 3KFVA 1EFNA 4IIOA 3EHRA 4LE9A 2DL7A 4AFZC 2K2MA 3M0QA 2YSQA 1AWWA 1BU1A 2AKKA 1X6GA 2M51A 3I35A 4HCKA 1WYXA 1AZGB 4OMPA 3QWYA 5IHIA 1GFCA 3VS5A 1PWTA 2L3QA 1SPKA 2EVRA 1JU5C 3M0UA 3SHWA 2DBKA 1V1CA 1VYTA 1GCQA 4J9FA 2DF6A 4M4ZA 1AWXA 4J9CA 4GBQA 2AZVA 2I0NA 4ZNXA 5GJWB 2FEIA 1I07A 1QLYA 2OAWA 1H3HA 4LNPA 2CH4A 1ABOA 4JJCA 1YP5A 2VWFA 3IQLA 2L3PA 4AFUC 3VS2A 1I0CA 5IXFA 2HCKA 2JS2A 1G2BA 2RQUA 1AVZC 1RI9A 2DX1A 2AK5A 2GTOA 1KSWA 2CDTA 4GLMA 2DILA 4JJBA 2D0NA 2EGCA 4KRTA 4ESRA 1NM7A 2KRMA 2YT6A 2ABLA 2AKLA 2GTJA 1RUWA 3VS4A 2LJ1A 4Z88A 4J9GA 1JEGA 4RUGA 4RTZA 2RQWA 4IIMA 1K76A 4Y92A 2DMOA 3VS0A 2DL3A 1T3LA 4HVUA 1B07A 2D8HA 1UTIA 1HD3A 2ENMA 2J06A 4AFQC 5IXBA 2SEMA 3EG2A 2V1QA 2JS0A 2YDLA 2KT8A 1AWJA 2OI3A 1UUEA 3I5RA 2KYBA 1WI7A 2X3WD 1CSKA 2J6FA 2KRSA 3VRYA 2DRKA 3EHQA 3M0TA 1U06A 1WXTA 4AG1C 2LNHB 2O2OA 1YNZA 1YWOA 2JT4A 4F14A 1NEBA 2KR3A 1A0NB 1TUDA 3REAB 3ULRB 2EKHA 2GGRA 1AZEA 1T3SA 1W1FA 3H0IA 1G83A 1BBZA 2CH4W 3H0HA 2K9GA 4JPBW 2KEAA 2RQVA 4Z8AA 2F2XA 1QWFA 2VVKA 1LCKA 4JJDA 1AEYA 4HVVA 3ZL7C 4LUDA 2CT4A 2F2VA 1ZUKA 3UATA 2HDAA 1X69A 4E6RA 1FYNA 2YUOA 5I11A 2HEQA 2KNBB 2NUZA 4QT7A 2EQIA 3TSZA 3H41A 3EG1A 4FSSA 3VRZA 2KXCA 1CKAA 4HXJA 1GRIA 1WXBA 3JV3A 4RTWA 2ED0A 2FG0A 2LX7A 1QCFA 2HBWA 2GBQA 3RNJA 2JW4A 2BZXA 2FRYA 1E6GA 2J05A 3REBB 2PZ1A 2CT3A 3CQTA 1QKWA 4OMLA 2FRWA 1RLPC 3VS7A 4EIKA 4RTTA 1TUCA 1Z9ZA 2G6FX 5HCKA 2O9SA 1M30A 1Y57A 1Y0MA 1MV3A 2SRCA 2L3SA 1GCQC 1SHGA 2CREA 4HVWA 1WIEA 4RTXA 2JXBA 1ZUUA 1WXUA 1OOTA 5IHNA 3NMZC 1RLQC 2K3BA 1UGVA 2JM9A 1X6BA 3R6NA 3M0SA 5FWCA 2EYWA 2VKNA 2CUBA 2FPEA 3H0FA 1K9AA 2EBPA 2A28A 1WX6A 1SHFA 1WFWA 4CC3A 2YUNA 2EGEA 2V1RA 3A98A 2IIMA 4CC4B 1GCPA 1ZSGA 3VS6A 2FPFA 2LCSA 2EYXA 1XOVA 1ZLMA 1AD5A 1K0XA 2DE0X 1VA7A
chains in the Genus database with same CATH superfamily
2K79A 4PNOA 4RCBA 4M7AE 4FW2A 2CP2A 4CRIA 4OMFB 4DEYA 2VGMA 2O4XB 2KROA 2Z0WA 4Z02A 1JRIA 2M0YA 4GY5A 4DOWA 4NL2A 2RJEA 4A4EA 1OX8A 3V8JA 1PNJA 4YTLA 3R6OA 4E7KA 1MUZA 2QGGA 4K11A 4BE0A 4Q5WA 2P0PA 1ZA2B 1G8XA 2COYA 5A0GA 4J6WA 3OMGA 1WPYA 1PC0A 3G71T 2LT1A 1W2BA 2OTLQ 4RMOA 2JZ2A 1IHWA 2GQVA 1IHVA 3V8LA 4FM4B 4KGVB 1TTHB 3CCRT 1ZX6A 2A0FB 4FYXB 5DY9A 1HXDA 2VXFA 1U5SA 3OB9A 1JXOA 2WACA 4F17A 1Y96A 1MMDA 4JDSA 3E9FA 3CBOA 4LDUA 2LJ3A 2L89A 3OQ5A 1UEBA 5HK0A 5FU6B 5L23A 4A53A 1EX4A 3OBYA 1X27A 5KCOA 2H3EB 1U3OA 1WLPB 1YI2A 1D1CA 1NE8A 1WZOA 5GAN8 2DXBA 5IAYA 3O5ZA 5I22A 2DPPB 3P8HA 1JXMA 1VQ5Q 3RUXA 3H9NA 2E5QA 1SRLA 2EPDA 2EJFA 4FT4A 2JM8A 1F1BB 1YJ9T 1QW1A 3UF4A 1PSFA 4JLGA 2QA4A 5GAN7 2X51A 1KIKA 1BI0A 4EMHA 2RMOA 3M56A 2LQNA 1VQ5A 5GAMj 1VQLQ 4M77G 2P4RA 4ATOA 2A37A 5GANf 5IHKA 4E47A 2WSCE 2EYYA 1UECA 2LQKA 3E19A 2J6KA 3PIOA 1PSEA 2ZPGB 2A08A 2KK4A 2P4TA 1YWPA 1UB4A 1M3BA 2RK2A 2QDLA 1YHQA 3RBBB 5CVIA 4JZ3A 1OU8A 4XTYA 2HSPA 4OB3B 2COZA 2RM4A 1VQ8Q 1H8KA 3LLRA 2LQWA 4E7IA 4OB0B 2QQRA 3JCMQ 1M1GA 2ZPBB 3NPFA 3T9NA 2XU8A 4RKUE 2FZCB 1I5OB 2DTHA 2RHZA 2RQTA 2O9VA 4C5IA 4XU0A 1B34B 2QGFB 5M9OA 4M75G 1PRLC 3QDFA 1PHTA 3LGLA 2DL4A 2KGTA 2G3RA 4A63B 4BI3A 4J9BA 2AHJB 4ORZA 2E4HA 2IG0A 4M7DF 2E10A 3EHRA 3L2VA 3CCEA 2K2MA 3X26B 3OW2S 4HCKA 1X6GA 3I35A 3MP6A 1WYXA 2KMTA 2AT1B 3INZA 4OMPA 3QWYA 2YWWA 2IVWA 4PK4A 1PWTA 4C92F 3META 2K2VA 2JTFA 4BDZA 2ZCFB 4F7UB 1VYTA 1WJQA 1K73U 2V8KA 3OYBA 5CO7A 4M77F 2H3JA 4M75C 2F69A 4PFZA 2PU9B 1H3HA 4LNPA 2QTXA 1RAAB 5A0DA 2DTOA 4IUUA 3CC4Q 1QVGS 3CXCP 3VS2A 5GAMe 2OTLA 1N8RR 5IXFA 2RQUA 1AVZC 2DX1A 4L5GA 2AK5A 1K8AR 1VQNT 2D0QB 2GTOA 4XU2A 4R56A 1KSWA 3OYKA 2I2LA 3VKIA 3I56T 2DILA 1VIFA 3CCMQ 4PJOD 1VOMA 2RD1A 2RI2A 3SFMA 3CCMT 2ABLA 2LQ8A 2QASA 1YJNT 2CS7A 4QVZA 2GFAA 1KQ2A 4OGCA 1K76A 4Y92A 5CQYA 4C92B 4JS4A 3VS0A 1KD1U 5GANg 5GANh 2XDPA 2E3HA 4AFQC 2EAYA 2R5AA 1D0YA 2VV5A 3EG2A 1QVFA 2YDLA 2K3XA 2KYBA 3UWNA 4O6JA 4C8QB 3KUFA 4IUTA 1IRXA 2O2OA 1VQNQ 1B34A 1NEBA 2KR3A 3TQ7P 1TUDA 2EKHA 1AZEA 4Y91A 3H0IA 5J3BA 3CPWS 1RABB 1BBZA 1M8VA 1MGQA 3H0HA 1M1KU 3P8DA 2RQVA 2XKOC 4JJDA 2HD0A 4LUDA 3HFOA 4MMKA 3LH0A 3HRTA 3UATA 1QVFS 4P5NA 2DXTA 2KY9A 1X69A 3Q1JA 2YUOA 4ZGEB 4HT8A 1C6VX 3MP8A 3CXCA 2KNBB 2NUZA 3A8GB 3EG1A 4TVRA 4BB7A 4MDXA 1ZSZB 2LRQA 4RTWA 2ED0A 2FG0A 2LX7A 3CC7Q 2ZPIB 3RNJA 3SD4A 3JCMh 3JCMg 2FRYA 3QXEB 3MHXA 1RI0A 1YI2Q 2PZ1A 4HT9A 3OS1A 3A8OB 5HK3A 5CR2A 2FRWA 3G7ZA 3MJXA 1ZSZA 2O9SA 3OS5A 1UGPB 2JUFA 1I4K1 3QYHB 4QW2A 1VQ4A 1PG5B 2V8JA 3GLXA 4HKEA 1WIEA 9ATCB 3JAME 1OOTA 3BDLA 1MNDA 3A8LB 5LL6S 1RLQC 1ZA1B 3G6EA 1YJNQ 3CCET 4EMKA 3OYEA 5KE3A 5GMKe 1D0XA 2K3YA 4C8QC 2E6ZA 4M7DB 2VKNA 4XQ3A 1Q81R 4C0DC 4JRIA 1FX7A 4LXCA 2P0QA 4CC3A 2YUNA 5GAOm 3A98A 2IIMA 5D6YA 3RMSA 3ZFJA 1GCPA 2MWPA 2EYXA 4RG8A 2RH2A 3DKMA 5GAN5 1IGQA 2DE0X 1K4US 5EC7A 3QJYA 1VQ6T 3FEOA 3JCMd 3PIPA 3GIBA 3EG3A 3CD6Q 4F16A 4M78F 2X4YA 3X20B 3ER0A 3TSWA 3PVLA 1JO8A 2QEXT 2E3IA 3L2UA 4QVCA 1VQNA 2BZ8A 3CC7T 3JB9F 4FSXA 2C06A 4II1A 1JJ2P 4V2SA 5GAOq 3EH2A 3OYNA 3JCMb 3EFRA 4QKUA 2KBTA 3I56A 4C8QG 4BY6C 1PKTA 2DEUA 2RF0A 4OF1A 5J26A 4ZTFA 1QVGA 1W70A 5GAOn 1C0MA 2GNCA 2JJ9A 3OS2A 3EH1A 3EAEA 3CCJT 4BI8B 1MNEA 2YRDA 3CCSQ 2ATCB 2HKQB 1W6XA 4XU1A 2LMJA 2KVQG 2EJ9A 3EGUA 4X1VA 1W4SA 2DRMA 4OMOA 1OPKA 5GJVB 4C8QA 2MK5A 4NOYA 4IURA 2MWOA 2A36A 2CP6A 4JJNK 2Y90A 1GFDA 2EQUA 1M8MA 2DD4A 5DLQE 3OBWA 4D8DA 4XK8E 3WVEB 2O01E 2C0TA 1YITT 1M27C 2DXCA 2HKNA 1NJIC 2X35A 2DAQA 1SSHA 1YCYA 3VS3A 2BUDA 2HQXA 1O9SA 1AOJA 3PFSA 3FB9A 1NJIU 2LP5A 1Q82R 3CD6T 2BZYA 2VB6A 3MKDA 2RNAA 4J9EA 4PLIA 4MMLA 2R5MA 4RTYA 1VQPT 2RPNA 1WA7A 1SKUB 3NGPA 2RA2A 5AT1B 5GMKi 5FROA 1U1TA 4E2FB 4BE1A 3VUBA 4JRPA 4QQGA 8AT1B 4M78E 3L2WA 2COWA 2NLUA 3QJ6A 1NYFA 2L2PA 1B7TA 4M7DD 2CP5A 2CUDA 1KQSS 2EW3A 2H8HA 2K4YA 3CXCS 1D0ZA 2O88A 1K9MU 4KGZB 2YUQA 4LUEA 3CMAT 3GPLA 1VQ7Q 4M75E 1YN8A 4C0DB 4ELYC 2XI9A 3JCMJ 4IUQA 1VIEA 4EMKC 2OJ2A 2YLBA 1K9MC 2DL5A 4PJJA 1VQPQ 1N27A 5LJ3d 3CC2A 4E7SA 1N8RC 2QTVA 4A54A 3E9GA 2XHCA 2DZ9A 3OYAA 2CSQA 4F7UA 4BACA 4PJLA 4XAXB 1X2KA 2CGHA 2MCNA 1M3AA 1VYVA 1OYXA 1M90U 2FVUA 2ZZDA 1VYUA 3M58A 2BKDN 4PLLA 2ESWA 2MOXA 2MYSA 4QQDA 5L8RE 3TVTA 2K57A 2WSEE 1ABQA 3NTIA 1OX9A 3UA6A 3ASKA 4M77A 4ZGDB 5HKCA 2QXFA 5LJ5f 1TG0A 4A4HA 3M9QA 1MMAA 3PNWC 4A4GA 5FLXE 4FIBA 4LN2A 2W10A 2JMAA 2VASA 4PJOA 2YXYA 2KXDA 2PVDB 1YFNA 1YHQT 2DFUA 1D3BA 3V7SA 1YHQQ 2HNIA 2YSQA 2D9TA 2E41A 4LD6A 1BU1A 2AKKA 2M51A 1VQOQ 1WQ7A 7AT1B 1GFCA 3L42A 2EVRA 3M0UA 4EMKB 2F5TX 2EQMA 3QKJA 2DIGA 3PTAA 2FZKB 4M4ZA 1AWXA 1N9SA 4J9CA 3SB2A 1VQLA 4M77E 2I0NA 2HQEA 4F7UF 2FEIA 2XDBA 4ZTJA 1W2BS 1SSFA 2PVOB 1TU0B 1BYMA 1ABOA 3FDRA 2FHDA 4MDWA 1NPRA 2L3PA 2HAXA 4M7AD 3RKWA 4DOVA 4R55A 3JB9D 2DEQA 1YIJQ 3LYIA 1IZ6A 4JJBA 3BFMA 4M78D 2KDSA 4KRTA 5GMKl 2XIDA 4JRKA 2ZGWA 4J9GA 5CKEA 1IREB 1Q82C 2DMOA 1RL2A 1KHCA 2D8HA 1UTIA 3UT1A 4FL6A 2R57A 1RAFB 1ACMB 3M53A 2DJZA 3G1JA 3ZBDA 3I56Q 2KT8A 1AWJA 1UUEA 4FYYB 3CPFA 3EFSA 3VRYA 2RB6A 4ANJA 4AT1B 1YWOA 4CI0C 4M7DE 1TSFA 2QG9B 2ZPEB 2RHIA 3ULRB 2M9UA 3VYGA 2GGRA 5FU7C 3QSUA 1QQJA 4J6XA 4C8QE 8ATCB 5I2SA 3LW5E 2CZ7B 4JPBW 4PKCC 3EG9B 4Z8AA 3SWNA 1Q86C 2LT4A 4HCCA 2F2VA 1K73C 4WF2A 3OYYA 3SWNB 1Q81C 1FMWA 3CCJQ 1XJWB 2L8DA 3CCLT 1RAIB 3SWNC 4RCCA 1V76A 4EPCA 1VQMT 4O5VA 2PUOB 3V7RA 3VRZA 1YIJT 4J7FA 1CKAA 1GRIA 5KYYA 4QQ6A 4F7UG 1QCFA 5I21A 1R0BG 2HBWA 4C0FA 2GF7A 3LWHA 3EFOA 4XTZA 3J7AF 3E2UA 1VQ9A 5KE2A 5CAIA 2J05A 1G3YA 1VQ9Q 2EKOA 3QUIA 2E6NA 2CT3A 4LDYA 5GAMh 3CQTA 5GAMg 1QKWA 4OMLA 1YJ9Q 1RLPC 3VS7A 4RTTA 1VQKT 5HCKA 3NTKA 3VYHB 2SRCA 2XG8D 1KQSA 3M59A 2MF2A 4RTXA 1M90R 1WXUA 5LJ5e 5IHNA 3NMZC 2OTJQ 4KULA 2K3BA 4KBMB 5D6WA 2JM9A 3R6NA 3CCUQ 2M0OA 4XU3A 1VQOA 3OYFA 5FWCA 3CCRA 2FPEA 4M7AF 1K9AA 1KQ1A 4PJOG 2DIQA 4RG2A 1WX6A 3I55Q 1SHFA 1WFWA 3NTHA 4WTOB 2EGEA 4M77B 1D3BB 1ZSGA 3VS6A 2XICA 5KH6A 1PD0A 1XOVA 2CZ0B 1K0XA 3VU3C 1M1FA 1MMGA 2JNGA 5FWBA 3M0RA 4BUGA 1W2BP 2LCLA 1VQKA 2NUPB 4PJNA 1VQMQ 5KYXB 1KHIA 3CMEA 5GAMd 2OTLT 5KYNA 2EYZA 3M55A 2DERA 5IN1A 3EG0A 5KYWB 4R0KA 4M78B 1LNXA 1OPLA 1OZ3A 3X25B 2KRNA 2CP0A 3VS1A 1WHMA 3MEUA 1MV0B 3OYIA 4BI4A 5LJ3j 2IPOB 3EGDB 5CKBA 1NLOC 3TEEA 2CP3A 5KYUB 4LD9K 4PJOB 3CD6A 3WXMB 1KC8C 1HYOA 4HCZA 1QWEA 1VQ8A 1YI2T 1TUGB 2CP7A 2RHXA 4PJOC 4OB2B 1QP3A 1BI2A 2X4JA 1Z9QA 1WDXA 4WCIA 2HL5C 1UG1A 2DVEA 3DLMA 5C6SA 2MIOA 1X43A 1RAGB 1UDLA 1ZQ1A 5AYFA 3CPWP 2BE9B 2ZPFB 1IXDA 4LDXA 1QCNA 2F1LA 4LDWA 2F2WA 1Q95G 2JTMA 3FLGA 3GOXA 1Y07A 3NFCA 1ZHIA 1HSQA 2DM1A 5LJ5d 2QYZA 5GMKh 3CEYA 2K5LA 2BTTA 2KE9A 1VQ8T 2PVGB 3HTRA 2NWMA 3CCMA 1T0JA 5GAN2 2RHUA 1NLPC 3G71A 1WJSA 3M0PA 1KFZA 2RK1A 1R8OB 2EIFA 3RDVA 4KUDK 2JN0A 4A4KA 3C0CA 1RACB 4RTUA 5EG2A 3HL8A 1K0SA 4JZ4A 2KAFA 2P0KA 3FIFA 2FPDA 2W0ZA 1UFFA 2M16A 2QEXQ 1SEMA 1K8AC 3QWXX 5D6XA 3OS0A 4VUBA 4ELZC 4RTVA 3RKXA 4DA4A 1WQWA 2E1HA 2PTKA 1XNIA 1X2QA 1YBYA 3DB4A 4AG2C 1YITA 3FJ5A 3MEVA 2ROLA 3PE0A 2LJ0A 3U23A 3ZEHA 1XTDA 3C12A 3D7SB 5FRMA 4DQ2A 1X01A 1I8FA 4OGEA 4CC7A 2HL3A 2J6OA 2ED1A 3LH5A 3V8KA 4ME7A 1I1JA 1PM3A 4Z89A 4FCYA 1NYGA 3L2RA 3NHNA 2LZ6B 3OYLA 1SRMA 1YJWA 2A7YA 2PNIA 2ECZA 2V8IA 3CCEQ 3CC2Q 1OEBA 3JB9I 1KC8R 1BK2A 1U1SA 1M90C 3G4SQ 1TWBA 3TCJA 2EGAA 5IH2A 3G4ST 2ROTA 2CZ6B 1YJ9A 3J81E 2RJDA 2NYSA 1N5ZA 4F7UE 2DKGA 2RHYA 3G71Q 1QKXA 3GBQA 1UE9A 4J83A 3I9QA 4J9DA 5CKHA 2QQSA 3CCVA 1RAHB 2HMAA 1PKSA 4UC4A 4DEXA 1E6HA 1VQ7T 3VV0A 2LNVA 2E70A 4D8KA 1VQ9T 5FU6C 1K1ZA 1HJDA 4N4GA 1EIFA 1N9RA 3GP8A 4E7LA 1VQKQ 5FW9A 4CC2A 3RKYA 1NBEB 2NUTB 4OMNA 1V29B 4L59A 2RI3A 2O31A 3JCMf 4XTXA 3C4SA 3C94A 2VGNA 1WHKA 1K8AU 2MAMA 2LDMA 4IIOA 1DJ7B 3PMIA 3QHSA 4AFZC 3JCMe 3QG1A 2QA4Q 1LVKA 1QP2A 2KI7A 4M7DA 1JB0E 1H641 3JB9G 4PL6A 2V26A 1Q7YC 1JU5C 3SHWA 1M1KR 2DBKA 1V1CA 5CKDA 1GCQA 4J9FA 2A3LA 2DF6A 2VYTA 4GBQA 3A8HB 4KH0B 1R0CB 4ZNXA 2B8AA 5GJWB 3MCAB 3AHUA 2DZCA 2VUBA 2RJFA 1VQOT 2CH4A 2BIVA 3QO3A 2YLCA 3X28B 4JJCA 2VWFA 3IQLA 4DBQA 4X34A 3M54A 1M2OA 5LJ5j 4ZN3A 1I0CA 2KSSA 4LDVA 2HCKA 4BD3A 2JS2A 3M57A 5CK9A 1VQ7A 2OTJA 1RI9A 5J39A 1NJIR 3RERA 1LPLA 3QBYA 1SF9A 3PGGA 4GLMA 4MZPA 3MEWA 2D0NA 4M78C 2EGCA 1FXXA 4ESRA 1NM7A 3MEAA 2ZAEA 1G3TA 4KH1B 3JCMc 3L2ZA 2AKLA 1Q7YR 2GTJA 1RUWA 3VS4A 2LJ1A 3OSVA 4RUGA 2K5IA 3FRNA 2YHTA 4M75A 2DL3A 2E65A 3HFNA 1B07A 4HVUA 3OW2A 4X9CA 1ZSZC 3TREA 2J06A 1BI3A 4NS5A 1YJWT 2DXUA 1VQMA 1M5Q1 1TXQA 3KBGA 4IUPA 3UPUA 4MZMA 1Q82U 2NUTA 5HY6A 3JCMV 3URGA 3S3OA 1GXIE 1WHLA 2EQJA 1WI7A 2WSFE 2X3WD 2J6FA 2KRSA 2DRKA 3M0TA 3OYJA 1U06A 4PFPA 5GAN3 1YNZA 2JT4A 1UGRB 1A0NB 3CCVQ 3BW1A 1BKBA 2CYZB 1T3SA 3A1PA 3OYGA 3CCJA 4ZGJB 3JB9H 1HK9A 3M4GA 4HCBA 2CH4W 1S72Q 5LJ3e 4C92G 1LCKA 3GF5A 4HVVA 1M9SA 5GAN4 3HKSA 4M78G 2CT4A 2HDAA 3KXTA 4PFOA 5D7UA 4C0GA 1FYNA 1YJWQ 4E7HA 3JCMX 3L2QA 2HEQA 1TOVA 2RI5A 4QT7A 3TSZA 3PT9A 3H41A 2ZPHB 2KXCA 5CIUA 4C92E 4HA8A 5CKFA 2LTOA 3O8VA 1N6AA 2GBQA 3BY7A 2JW4A 5FU7B 2DTIA 4M7DC 2E64A 6AT1B 1P92A 3OSSC 1TUCA 1KG1A 3MPUB 1Z9ZA 1M30A 2EFIA 3HHTB 2QEXA 2AIRB 2L3SA 4N0AC 1SHGA 3N5BB 1VQPA 4C92C 1EZZB 5GMKm 4JS5A 1ZUUA 2X4WA 3JSCA 4M75D 1H3ZA 2MI6A 4KGXB 5I2MA 3QZ5B 3OYHA 1FWZA 3CC2T 1S72A 4M77C 4Y28E 4M75F 2Y4XA 3H0FA 2EBPA 3LGFA 2YRVA 2A28A 4AMCA 4BY6B 2FPFA 2F5KA 2QQ9A 4J8OA 2LCSA 5GANj 2FZGB 1ZLMA 3CC4T 1AD5A 4M7DG 4F04B 2OX7A 4PJMA 3CCVT 1UGSB 5KYXA 1UHFA 2DNUA 3L1AA 2RQRA 1AWOA 1R77A 4QVDA 3S3NA 2DJQA 5CCAA 2VC8A 5GANe 1NG2A 3CBMA 1S1NA 4J9IA 1KC8U 4J9HA 4E7JA 1G5VA 3AT1B 1QCOA 3CCQT 2HBPA 4DBRA 3LX7A 3CCQQ 1MHNA 2D8JA 1OU9A 4OMQA 5KCHA 3RMQA 1T0HA 3UA7A 5ECAA 2J7IA 3GNFB 3OW2P 2DVJA 2MPXC 1KJWA 4A4FA 2DETA 2C0OA 2CSIA 2L3RA 1UJYA 4M75B 1WJRA 1JQQA 4B9WA 2EYQA 5DLOA 1K9MR 4IUVA 1OULA 2XMFA 3H6ZA 4OB1B 1J3TA 3OY9A 3DLLA 1QVPA 2K5FA 1OQKA 2D1XA 3WVDB 1VUBA 3RR6A 1GL5A 1FMKA 2NUPA 1YCSB 3CC7A 2YUPA 3I5SA 3HPWA 2C0IA 4OMMA 4JRQA 2JVVA 2KYMA 2DA9A 4L6V5 3SDZA 1M2VB 2GQIA 1WNLA 2FYKA 5GAN6 2CZ1B 4ZN1A 2E5KA 3CMAA 1M4ZA 2RN8A 1GBQA 3PVQA 4DBFA 1ZBJA 1IO6A 1NZ9A 2DLPA 2FB7A 3CCLQ 3CPWA 1ZUYA 1YIJA 2QI2A 3JCMP 4OP0A 3VUZA 3BE3A 1YJNA 2JTEA 4KUIA 5IT9E 3E1SA 1M3CA 2P84A 1TH7A 4KT0E 4X9DA 1B3QA 5GAOp 2M02A 1LOJA 1SG5A 1H92A 2DBMA 2DYBA 1BB9A 1K73R 4NL3A 1AHJB 1PRMC 3SEMA 4DBHA 1C1AA 2YRCA 2B86A 5DM7R 3DB3A 5GANd 1KQSP 1G3WA 2K6DA 1VQ4T 3EGXB 1D1BA 2EWNA 2MMPA 4C8QF 1CKBA 1ARKA 2RO0A 4EDUA 2KT1A 1NEGA 3A5ZB 2L0AA 3EG9A 3QZ9B 3G6ET 1OV3A 4C8QD 4C92A 4JUVA 3QIIA 2D6FA 1BCMA 2X3XD 1U8RA 4JLIA 4E7ZA 1BCOA 1D09B 3OA6A 3P8BB 5A2QE 2DL8A 3OYCA 5GAOr 2JMCA 2FO0A 2VXEA 2AZSA 1TS9A 2HQHA 4J6YA 3JB9J 4FYWB 1LJOA 2K7AA 1GBRA 2HZYA 3QDRB 1UJ0A 1BIBA 2GFUA 1VQ6A 3CCRQ 1E7OA 1MMNA 1AT1B 4FYVB 3I55T 1RAEB 2HSEB 4AFSC 1WHJA 1UHCA 1YITQ 3J80E 2DK3A 3THKA 3KFVA 1D1AA 1EFNA 4M7AA 1PD1A 4LE9A 4J5YA 2DL7A 3M0QA 2PQWA 1AWWA 4IKFA 1AZGB 3QPHA 5IHIA 4BDYA 4FW1A 3TU4K 3VS5A 2PUKB 2DO3A 2L3QA 1SPKA 4XTVA 3HP9A 4N4HA 2O4XA 3MP1A 2LVMA 3G6EQ 1QMCA 3HRUA 2X4XA 4N0AA 4FU6A 1BI1A 5LJ5g 5LJ5h 1NPPA 4J7IA 1Q7YU 2JOYA 2AZVA 1N8RU 2FL7A 1Q81U 1VQ4Q 1OZ2A 1VQ6Q 1I07A 1QLYA 2OAWA 4M7AC 5LJ3f 1WGSA 1I81A 2EQKA 1YP5A 1WHHA 4AFUC 4FT2A 1G3SA 3CCLA 3HSBA 1G2BA 3V7CA 1Y71A 2E12A 2QA4T 1BIAA 5C0MA 2CDTA 2Y4YA 2QK0A 3BDUA 2L5QA 4C5EA 5A0LA 4EMGA 3ME9A 4M77D 1KD1R 2RJCA 3GNGA 2KRMA 3CC4A 2YT6A 2XDDA 4Z88A 1JEGA 1M2VA 4RTZA 2RQWA 4IIMA 3S3MA 3FJPA 4XTUA 1T3LA 1HD3A 1I5LA 2ENMA 4BE2A 4C92D 1IB8A 3M4YA 5IXBA 2X9HA 1JJ2S 2SEMA 2V1QA 3S6WA 3CCQA 2JS0A 1XQHA 2OAUA 2OI3A 3I5RA 2M1HA 1OI1A 4MZTA 1X75C 1KD1C 2XD0A 1CSKA 4M7AG 3EHQA 1UGQB 1WXTA 4PJOF 4AG1C 2LNHB 2OTJT 1M1KC 1Q86R 4F14A 3REAB 1IGUA 2XK0A 3CCUT 2QQBA 5GAMf 1W1FA 4N4IA 3HRSA 3CCSA 1G83A 3A8MB 2K9GA 3C95A 2LC4A 2KEAA 3OYDA 2QAZA 2F2XA 1QWFA 2VVKA 2CKKA 1AEYA 3VJPA 4C5HA 3EGDA 3ZL7C 4B9XA 1ZUKA 5KYUA 1WHGA 3RESA 4E6RA 1ZBXA 2DYIA 4B6MA 5I11A 4M78A 4GLKA 5KYWA 2EQIA 1X6OA 3CMAQ 4FSSA 3UDCA 1S72T 4HXJA 1WXBA 3JV3A 4D6WA 1Y96B 3CMET 3JCMW 3PMTA 1KK7A 3CMEQ 1O75A 2BZXA 1E6GA 1RADB 3REBB 2EJGA 3OMCA 1PCXA 3X24B 1VQ5T 4PJOE 3CBPA 3EFOB 2QDYB 5FRNA 4EIKA 2DD5A 5GMKj 4C0ZA 3CCST 2G6FX 4OVAA 2KQWA 5KYYB 1Y57A 2QQAA 1Y0MA 1MV3A 4XTWA 3MO8A 1GCQC 3I55A 2CREA 4HVWA 2BE7D 2JXBA 3M5AA 3EGXA 3OYMA 3F70A 3RIRA 1VQLT 3FC3A 1UGVA 2GCXA 4C5GA 3CCUA 2R58A 1X6BA 5CQXA 2LCCA 3H8ZA 3G4SA 3M0SA 3QYGB 1JBMA 1JJ2A 2EYWA 1QVFP 3JRZA 2CUBA 3LWIA 1FMVA 5LJ3h 5LJ3g 2V1RA 4CC4B 1Y7XA 4M7AB 2LX9A 5GAOl 1QVGP 1Q86U 1VA7A
chains in the Genus database with same CATH topology
2K79A 1K4US 5EC7A 5FWBA 3M0RA 1UHFA 2DNUA 2RQRA 1AWOA 3EG3A 4F16A 4DEYA 2KROA 3TSWA 3PVLA 1JO8A 2DJQA 2EYZA 2M0YA 2BZ8A 3EG0A 1NG2A 4R0KA 1S1NA 4J9IA 1OPLA 4J9HA 1PNJA 2KRNA 3VS1A 1MV0B 2KBTA 1MUZA 4K11A 2D8JA 4OMQA 1PKTA 2RF0A 1NLOC 1T0HA 3UA7A 1W70A 5ECAA 2J7IA 1QWEA 2DVJA 1KJWA 2C0OA 2CSIA 2GNCA 1UJYA 1JQQA 1Z9QA 1WDXA 4WCIA 1UG1A 1W6XA 2LMJA 2XMFA 3EGUA 4X1VA 2DRMA 2MIOA 1X43A 1J3TA 1UDLA 4OMOA 1OPKA 5GJVB 2A36A 2D1XA 1ZX6A 1GFDA 1M8MA 1GL5A 2F2WA 1FMKA 1YCSB 4D8DA 2YUPA 3I5SA 2C0IA 1U5SA 4OMMA 1HSQA 2DM1A 2C0TA 2KYMA 1M27C 2DA9A 1JXOA 4F17A 2GQIA 1SSHA 3VS3A 2KE9A 2BTTA 2LJ3A 1AOJA 2E5KA 5L23A 2RN8A 2NWMA 1T0JA 1GBQA 1X27A 2LP5A 3PVQA 1U3OA 1NLPC 1WLPB 2BZYA 3M0PA 1KFZA 2RNAA 4J9EA 1ZBJA 1IO6A 2DLPA 3O5ZA 1ZUYA 4RTYA 2RPNA 3C0CA 5I22A 4RTUA 1WA7A 1JXMA 3NGPA 1K0SA 1SRLA 2JTEA 4JZ4A 2EPDA 1M3CA 2JM8A 2FPDA 2W0ZA 1B3QA 1UFFA 3UF4A 1H92A 1SEMA 2DBMA 2DYBA 1NYFA 3QWXX 1BB9A 1KIKA 2RMOA 2L2PA 4RTVA 1PRMC 3SEMA 2CUDA 2EW3A 2LQNA 2PTKA 1X2QA 2H8HA 4AG2C 2B86A 3FJ5A 2ROLA 3PE0A 2LJ0A 3U23A 2O88A 2K6DA 2YUQA 4LUEA 2P4RA 2A37A 1YN8A 4CC7A 5IHKA 1CKBA 2J6OA 1ARKA 2ED1A 3LH5A 2KT1A 1NEGA 2OJ2A 2EYYA 2L0AA 1I1JA 2DL5A 4Z89A 1UECA 1NYGA 2J6KA 1OV3A 3NHNA 2LZ6B 1SRMA 2A08A 2PNIA 2ECZA 1OEBA 1YWPA 1BK2A 1M3BA 2CSQA 2EGAA 2QDLA 2X3XD 5IH2A 2ROTA 3RBBB 1X2KA 4JZ3A 2MCNA 1M3AA 1VYVA 2HSPA 1N5ZA 1H8KA 2DL8A 2LQWA 1QKXA 3GBQA 1UE9A 1VYUA 3I9QA 4J9DA 2JMCA 2FO0A 2ESWA 2AZSA 3NPFA 2MOXA 1PKSA 4DEXA 3TVTA 1E6HA 1ABQA 2RQTA 2K7AA 1GBRA 2O9VA 3UA6A 4D8KA 1K1ZA 1HJDA 1UJ0A 1TG0A 1PRLC 1E7OA 1PHTA 2DL4A 2KGTA 5FW9A 4CC2A 4A63B 4LN2A 2W10A 4OMNA 4J9BA 4AFSC 2JMAA 1UHCA 2O31A 2KXDA 3THKA 4ORZA 3KFVA 1EFNA 4IIOA 3EHRA 4LE9A 2DL7A 4AFZC 2K2MA 3M0QA 2YSQA 1AWWA 1BU1A 2AKKA 1X6GA 2M51A 3I35A 4HCKA 1WYXA 1AZGB 4OMPA 3QWYA 5IHIA 1GFCA 3VS5A 1PWTA 2L3QA 1SPKA 2EVRA 1JU5C 3M0UA 3SHWA 2DBKA 1V1CA 1VYTA 1GCQA 4J9FA 2DF6A 4M4ZA 1AWXA 4J9CA 4GBQA 2AZVA 2I0NA 4ZNXA 5GJWB 2FEIA 1I07A 1QLYA 2OAWA 1H3HA 4LNPA 2CH4A 1ABOA 4JJCA 1YP5A 2VWFA 3IQLA 2L3PA 4AFUC 3VS2A 1I0CA 5IXFA 2HCKA 2JS2A 1G2BA 2RQUA 1AVZC 1RI9A 2DX1A 2AK5A 2GTOA 1KSWA 2CDTA 4GLMA 2DILA 4JJBA 2D0NA 2EGCA 4KRTA 4ESRA 1NM7A 2KRMA 2YT6A 2ABLA 2AKLA 2GTJA 1RUWA 3VS4A 2LJ1A 4Z88A 4J9GA 1JEGA 4RUGA 4RTZA 2RQWA 4IIMA 1K76A 4Y92A 2DMOA 3VS0A 2DL3A 1T3LA 4HVUA 1B07A 2D8HA 1UTIA 1HD3A 2ENMA 2J06A 4AFQC 5IXBA 2SEMA 3EG2A 2V1QA 2JS0A 2YDLA 2KT8A 1AWJA 2OI3A 1UUEA 3I5RA 2KYBA 1WI7A 2X3WD 1CSKA 2J6FA 2KRSA 3VRYA 2DRKA 3EHQA 3M0TA 1U06A 1WXTA 4AG1C 2LNHB 2O2OA 1YNZA 1YWOA 2JT4A 4F14A 1NEBA 2KR3A 1A0NB 1TUDA 3REAB 3ULRB 2EKHA 2GGRA 1AZEA 1T3SA 1W1FA 3H0IA 1G83A 1BBZA 2CH4W 3H0HA 2K9GA 4JPBW 2KEAA 2RQVA 4Z8AA 2F2XA 1QWFA 2VVKA 1LCKA 4JJDA 1AEYA 4HVVA 3ZL7C 4LUDA 2CT4A 2F2VA 1ZUKA 3UATA 2HDAA 1X69A 4E6RA 1FYNA 2YUOA 5I11A 2HEQA 2KNBB 2NUZA 4QT7A 2EQIA 3TSZA 3H41A 3EG1A 4FSSA 3VRZA 2KXCA 1CKAA 4HXJA 1GRIA 1WXBA 3JV3A 4RTWA 2ED0A 2FG0A 2LX7A 1QCFA 2HBWA 2GBQA 3RNJA 2JW4A 2BZXA 2FRYA 1E6GA 2J05A 3REBB 2PZ1A 2CT3A 3CQTA 1QKWA 4OMLA 2FRWA 1RLPC 3VS7A 4EIKA 4RTTA 1TUCA 1Z9ZA 2G6FX 5HCKA 2O9SA 1M30A 1Y57A 1Y0MA 1MV3A 2SRCA 2L3SA 1GCQC 1SHGA 2CREA 4HVWA 1WIEA 4RTXA 2JXBA 1ZUUA 1WXUA 1OOTA 5IHNA 3NMZC 1RLQC 2K3BA 1UGVA 2JM9A 1X6BA 3R6NA 3M0SA 5FWCA 2EYWA 2VKNA 2CUBA 2FPEA 3H0FA 1K9AA 2EBPA 2A28A 1WX6A 1SHFA 1WFWA 4CC3A 2YUNA 2EGEA 2V1RA 3A98A 2IIMA 4CC4B 1GCPA 1ZSGA 3VS6A 2FPFA 2LCSA 2EYXA 1XOVA 1ZLMA 1AD5A 1K0XA 2DE0X 1VA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K79 A;  1K4U S;  5EC7 A;  5FWB A;  3M0R A;  1UHF A;  2DNU A;  2RQR A;  1AWO A;  3EG3 A;  4F16 A;  4DEY A;  2KRO A;  3TSW A;  3PVL A;  1JO8 A;  2DJQ A;  2EYZ A;  2M0Y A;  2BZ8 A;  3EG0 A;  1NG2 A;  4R0K A;  1S1N A;  4J9I A;  1OPL A;  4J9H A;  1PNJ A;  2KRN A;  3VS1 A;  1MV0 B;  2KBT A;  1MUZ A;  4K11 A;  2D8J A;  4OMQ A;  1PKT A;  2RF0 A;  1NLO C;  1T0H A;  3UA7 A;  1W70 A;  5ECA A;  2J7I A;  1QWE A;  2DVJ A;  1KJW A;  2C0O A;  2CSI A;  2GNC A;  1UJY A;  1JQQ A;  1Z9Q A;  1WDX A;  4WCI A;  1UG1 A;  1W6X A;  2LMJ A;  2XMF A;  3EGU A;  4X1V A;  2DRM A;  2MIO A;  1X43 A;  1J3T A;  1UDL A;  4OMO A;  1OPK A;  5GJV B;  2A36 A;  2D1X A;  1ZX6 A;  1GFD A;  1M8M A;  1GL5 A;  2F2W A;  1FMK A;  1YCS B;  4D8D A;  2YUP A;  3I5S A;  2C0I A;  1U5S A;  4OMM A;  1HSQ A;  2DM1 A;  2C0T A;  2KYM A;  1M27 C;  2DA9 A;  1JXO A;  4F17 A;  2GQI A;  1SSH A;  3VS3 A;  2KE9 A;  2BTT A;  2LJ3 A;  1AOJ A;  2E5K A;  5L23 A;  2RN8 A;  2NWM A;  1T0J A;  1GBQ A;  1X27 A;  2LP5 A;  3PVQ A;  1U3O A;  1NLP C;  1WLP B;  2BZY A;  3M0P A;  1KFZ A;  2RNA A;  4J9E A;  1ZBJ A;  1IO6 A;  2DLP A;  3O5Z A;  1ZUY A;  4RTY A;  2RPN A;  3C0C A;  5I22 A;  4RTU A;  1WA7 A;  1JXM A;  3NGP A;  1K0S A;  1SRL A;  2JTE A;  4JZ4 A;  2EPD A;  1M3C A;  2JM8 A;  2FPD A;  2W0Z A;  1B3Q A;  1UFF A;  3UF4 A;  1H92 A;  1SEM A;  2DBM A;  2DYB A;  1NYF A;  3QWX X;  1BB9 A;  1KIK A;  2RMO A;  2L2P A;  4RTV A;  1PRM C;  3SEM A;  2CUD A;  2EW3 A;  2LQN A;  2PTK A;  1X2Q A;  2H8H A;  4AG2 C;  2B86 A;  3FJ5 A;  2ROL A;  3PE0 A;  2LJ0 A;  3U23 A;  2O88 A;  2K6D A;  2YUQ A;  4LUE A;  2P4R A;  2A37 A;  1YN8 A;  4CC7 A;  5IHK A;  1CKB A;  2J6O A;  1ARK A;  2ED1 A;  3LH5 A;  2KT1 A;  1NEG A;  2OJ2 A;  2EYY A;  2L0A A;  1I1J A;  2DL5 A;  4Z89 A;  1UEC A;  1NYG A;  2J6K A;  1OV3 A;  3NHN A;  2LZ6 B;  1SRM A;  2A08 A;  2PNI A;  2ECZ A;  1OEB A;  1YWP A;  1BK2 A;  1M3B A;  2CSQ A;  2EGA A;  2QDL A;  2X3X D;  5IH2 A;  2ROT A;  3RBB B;  1X2K A;  4JZ3 A;  2MCN A;  1M3A A;  1VYV A;  2HSP A;  1N5Z A;  1H8K A;  2DL8 A;  2LQW A;  1QKX A;  3GBQ A;  1UE9 A;  1VYU A;  3I9Q A;  4J9D A;  2JMC A;  2FO0 A;  2ESW A;  2AZS A;  3NPF A;  2MOX A;  1PKS A;  4DEX A;  3TVT A;  1E6H A;  1ABQ A;  2RQT A;  2K7A A;  1GBR A;  2O9V A;  3UA6 A;  4D8K A;  1K1Z A;  1HJD A;  1UJ0 A;  1TG0 A;  1PRL C;  1E7O A;  1PHT A;  2DL4 A;  2KGT A;  5FW9 A;  4CC2 A;  4A63 B;  4LN2 A;  2W10 A;  4OMN A;  4J9B A;  4AFS C;  2JMA A;  1UHC A;  2O31 A;  2KXD A;  3THK A;  4ORZ A;  3KFV A;  1EFN A;  4IIO A;  3EHR A;  4LE9 A;  2DL7 A;  4AFZ C;  2K2M A;  3M0Q A;  2YSQ A;  1AWW A;  1BU1 A;  2AKK A;  1X6G A;  2M51 A;  3I35 A;  4HCK A;  1WYX A;  1AZG B;  4OMP A;  3QWY A;  5IHI A;  1GFC A;  3VS5 A;  1PWT A;  2L3Q A;  1SPK A;  2EVR A;  1JU5 C;  3M0U A;  3SHW A;  2DBK A;  1V1C A;  1VYT A;  1GCQ A;  4J9F A;  2DF6 A;  4M4Z A;  1AWX A;  4J9C A;  4GBQ A;  2AZV A;  2I0N A;  4ZNX A;  5GJW B;  2FEI A;  1I07 A;  1QLY A;  2OAW A;  1H3H A;  4LNP A;  2CH4 A;  1ABO A;  4JJC A;  1YP5 A;  2VWF A;  3IQL A;  2L3P A;  4AFU C;  3VS2 A;  1I0C A;  5IXF A;  2HCK A;  2JS2 A;  1G2B A;  2RQU A;  1AVZ C;  1RI9 A;  2DX1 A;  2AK5 A;  2GTO A;  1KSW A;  2CDT A;  4GLM A;  2DIL A;  4JJB A;  2D0N A;  2EGC A;  4KRT A;  4ESR A;  1NM7 A;  2KRM A;  2YT6 A;  2ABL A;  2AKL A;  2GTJ A;  1RUW A;  3VS4 A;  2LJ1 A;  4Z88 A;  4J9G A;  1JEG A;  4RUG A;  4RTZ A;  2RQW A;  4IIM A;  1K76 A;  4Y92 A;  2DMO A;  3VS0 A;  2DL3 A;  1T3L A;  4HVU A;  1B07 A;  2D8H A;  1UTI A;  1HD3 A;  2ENM A;  2J06 A;  4AFQ C;  5IXB A;  2SEM A;  3EG2 A;  2V1Q A;  2JS0 A;  2YDL A;  2KT8 A;  1AWJ A;  2OI3 A;  1UUE A;  3I5R A;  2KYB A;  1WI7 A;  2X3W D;  1CSK A;  2J6F A;  2KRS A;  3VRY A;  2DRK A;  3EHQ A;  3M0T A;  1U06 A;  1WXT A;  4AG1 C;  2LNH B;  2O2O A;  1YNZ A;  1YWO A;  2JT4 A;  4F14 A;  1NEB A;  2KR3 A;  1A0N B;  1TUD A;  3REA B;  3ULR B;  2EKH A;  2GGR A;  1AZE A;  1T3S A;  1W1F A;  3H0I A;  1G83 A;  1BBZ A;  2CH4 W;  3H0H A;  2K9G A;  4JPB W;  2KEA A;  2RQV A;  4Z8A A;  2F2X A;  1QWF A;  2VVK A;  1LCK A;  4JJD A;  1AEY A;  4HVV A;  3ZL7 C;  4LUD A;  2CT4 A;  2F2V A;  1ZUK A;  3UAT A;  2HDA A;  1X69 A;  4E6R A;  1FYN A;  2YUO A;  5I11 A;  2HEQ A;  2KNB B;  2NUZ A;  4QT7 A;  2EQI A;  3TSZ A;  3H41 A;  3EG1 A;  4FSS A;  3VRZ A;  2KXC A;  1CKA A;  4HXJ A;  1GRI A;  1WXB A;  3JV3 A;  4RTW A;  2ED0 A;  2FG0 A;  2LX7 A;  1QCF A;  2HBW A;  2GBQ A;  3RNJ A;  2JW4 A;  2BZX A;  2FRY A;  1E6G A;  2J05 A;  3REB B;  2PZ1 A;  2CT3 A;  3CQT A;  1QKW A;  4OML A;  2FRW A;  1RLP C;  3VS7 A;  4EIK A;  4RTT A;  1TUC A;  1Z9Z A;  2G6F X;  5HCK A;  2O9S A;  1M30 A;  1Y57 A;  1Y0M A;  1MV3 A;  2SRC A;  2L3S A;  1GCQ C;  1SHG A;  2CRE A;  4HVW A;  1WIE A;  4RTX A;  2JXB A;  1ZUU A;  1WXU A;  1OOT A;  5IHN A;  3NMZ C;  1RLQ C;  2K3B A;  1UGV A;  2JM9 A;  1X6B A;  3R6N A;  3M0S A;  5FWC A;  2EYW A;  2VKN A;  2CUB A;  2FPE A;  3H0F A;  1K9A A;  2EBP A;  2A28 A;  1WX6 A;  1SHF A;  1WFW A;  4CC3 A;  2YUN A;  2EGE A;  2V1R A;  3A98 A;  2IIM A;  4CC4 B;  1GCP A;  1ZSG A;  3VS6 A;  2FPF A;  2LCS A;  2EYX A;  1XOV A;  1ZLM A;  1AD5 A;  1K0X A;  2DE0 X;  1VA7 A; 
#chains in the Genus database with same CATH topology
 2K79 A;  4PNO A;  4RCB A;  4M7A E;  4FW2 A;  2CP2 A;  4CRI A;  4OMF B;  4DEY A;  2VGM A;  2O4X B;  2KRO A;  2Z0W A;  4Z02 A;  1JRI A;  2M0Y A;  4GY5 A;  4DOW A;  4NL2 A;  2RJE A;  4A4E A;  1OX8 A;  3V8J A;  1PNJ A;  4YTL A;  3R6O A;  4E7K A;  1MUZ A;  2QGG A;  4K11 A;  4BE0 A;  4Q5W A;  2P0P A;  1ZA2 B;  1G8X A;  2COY A;  5A0G A;  4J6W A;  3OMG A;  1WPY A;  1PC0 A;  3G71 T;  2LT1 A;  1W2B A;  2OTL Q;  4RMO A;  2JZ2 A;  1IHW A;  2GQV A;  1IHV A;  3V8L A;  4FM4 B;  4KGV B;  1TTH B;  3CCR T;  1ZX6 A;  2A0F B;  4FYX B;  5DY9 A;  1HXD A;  2VXF A;  1U5S A;  3OB9 A;  1JXO A;  2WAC A;  4F17 A;  1Y96 A;  1MMD A;  4JDS A;  3E9F A;  3CBO A;  4LDU A;  2LJ3 A;  2L89 A;  3OQ5 A;  1UEB A;  5HK0 A;  5FU6 B;  5L23 A;  4A53 A;  1EX4 A;  3OBY A;  1X27 A;  5KCO A;  2H3E B;  1U3O A;  1WLP B;  1YI2 A;  1D1C A;  1NE8 A;  1WZO A;  5GAN 8;  2DXB A;  5IAY A;  3O5Z A;  5I22 A;  2DPP B;  3P8H A;  1JXM A;  1VQ5 Q;  3RUX A;  3H9N A;  2E5Q A;  1SRL A;  2EPD A;  2EJF A;  4FT4 A;  2JM8 A;  1F1B B;  1YJ9 T;  1QW1 A;  3UF4 A;  1PSF A;  4JLG A;  2QA4 A;  5GAN 7;  2X51 A;  1KIK A;  1BI0 A;  4EMH A;  2RMO A;  3M56 A;  2LQN A;  1VQ5 A;  5GAM j;  1VQL Q;  4M77 G;  2P4R A;  4ATO A;  2A37 A;  5GAN f;  5IHK A;  4E47 A;  2WSC E;  2EYY A;  1UEC A;  2LQK A;  3E19 A;  2J6K A;  3PIO A;  1PSE A;  2ZPG B;  2A08 A;  2KK4 A;  2P4T A;  1YWP A;  1UB4 A;  1M3B A;  2RK2 A;  2QDL A;  1YHQ A;  3RBB B;  5CVI A;  4JZ3 A;  1OU8 A;  4XTY A;  2HSP A;  4OB3 B;  2COZ A;  2RM4 A;  1VQ8 Q;  1H8K A;  3LLR A;  2LQW A;  4E7I A;  4OB0 B;  2QQR A;  3JCM Q;  1M1G A;  2ZPB B;  3NPF A;  3T9N A;  2XU8 A;  4RKU E;  2FZC B;  1I5O B;  2DTH A;  2RHZ A;  2RQT A;  2O9V A;  4C5I A;  4XU0 A;  1B34 B;  2QGF B;  5M9O A;  4M75 G;  1PRL C;  3QDF A;  1PHT A;  3LGL A;  2DL4 A;  2KGT A;  2G3R A;  4A63 B;  4BI3 A;  4J9B A;  2AHJ B;  4ORZ A;  2E4H A;  2IG0 A;  4M7D F;  2E10 A;  3EHR A;  3L2V A;  3CCE A;  2K2M A;  3X26 B;  3OW2 S;  4HCK A;  1X6G A;  3I35 A;  3MP6 A;  1WYX A;  2KMT A;  2AT1 B;  3INZ A;  4OMP A;  3QWY A;  2YWW A;  2IVW A;  4PK4 A;  1PWT A;  4C92 F;  3MET A;  2K2V A;  2JTF A;  4BDZ A;  2ZCF B;  4F7U B;  1VYT A;  1WJQ A;  1K73 U;  2V8K A;  3OYB A;  5CO7 A;  4M77 F;  2H3J A;  4M75 C;  2F69 A;  4PFZ A;  2PU9 B;  1H3H A;  4LNP A;  2QTX A;  1RAA B;  5A0D A;  2DTO A;  4IUU A;  3CC4 Q;  1QVG S;  3CXC P;  3VS2 A;  5GAM e;  2OTL A;  1N8R R;  5IXF A;  2RQU A;  1AVZ C;  2DX1 A;  4L5G A;  2AK5 A;  1K8A R;  1VQN T;  2D0Q B;  2GTO A;  4XU2 A;  4R56 A;  1KSW A;  3OYK A;  2I2L A;  3VKI A;  3I56 T;  2DIL A;  1VIF A;  3CCM Q;  4PJO D;  1VOM A;  2RD1 A;  2RI2 A;  3SFM A;  3CCM T;  2ABL A;  2LQ8 A;  2QAS A;  1YJN T;  2CS7 A;  4QVZ A;  2GFA A;  1KQ2 A;  4OGC A;  1K76 A;  4Y92 A;  5CQY A;  4C92 B;  4JS4 A;  3VS0 A;  1KD1 U;  5GAN g;  5GAN h;  2XDP A;  2E3H A;  4AFQ C;  2EAY A;  2R5A A;  1D0Y A;  2VV5 A;  3EG2 A;  1QVF A;  2YDL A;  2K3X A;  2KYB A;  3UWN A;  4O6J A;  4C8Q B;  3KUF A;  4IUT A;  1IRX A;  2O2O A;  1VQN Q;  1B34 A;  1NEB A;  2KR3 A;  3TQ7 P;  1TUD A;  2EKH A;  1AZE A;  4Y91 A;  3H0I A;  5J3B A;  3CPW S;  1RAB B;  1BBZ A;  1M8V A;  1MGQ A;  3H0H A;  1M1K U;  3P8D A;  2RQV A;  2XKO C;  4JJD A;  2HD0 A;  4LUD A;  3HFO A;  4MMK A;  3LH0 A;  3HRT A;  3UAT A;  1QVF S;  4P5N A;  2DXT A;  2KY9 A;  1X69 A;  3Q1J A;  2YUO A;  4ZGE B;  4HT8 A;  1C6V X;  3MP8 A;  3CXC A;  2KNB B;  2NUZ A;  3A8G B;  3EG1 A;  4TVR A;  4BB7 A;  4MDX A;  1ZSZ B;  2LRQ A;  4RTW A;  2ED0 A;  2FG0 A;  2LX7 A;  3CC7 Q;  2ZPI B;  3RNJ A;  3SD4 A;  3JCM h;  3JCM g;  2FRY A;  3QXE B;  3MHX A;  1RI0 A;  1YI2 Q;  2PZ1 A;  4HT9 A;  3OS1 A;  3A8O B;  5HK3 A;  5CR2 A;  2FRW A;  3G7Z A;  3MJX A;  1ZSZ A;  2O9S A;  3OS5 A;  1UGP B;  2JUF A;  1I4K 1;  3QYH B;  4QW2 A;  1VQ4 A;  1PG5 B;  2V8J A;  3GLX A;  4HKE A;  1WIE A;  9ATC B;  3JAM E;  1OOT A;  3BDL A;  1MND A;  3A8L B;  5LL6 S;  1RLQ C;  1ZA1 B;  3G6E A;  1YJN Q;  3CCE T;  4EMK A;  3OYE A;  5KE3 A;  5GMK e;  1D0X A;  2K3Y A;  4C8Q C;  2E6Z A;  4M7D B;  2VKN A;  4XQ3 A;  1Q81 R;  4C0D C;  4JRI A;  1FX7 A;  4LXC A;  2P0Q A;  4CC3 A;  2YUN A;  5GAO m;  3A98 A;  2IIM A;  5D6Y A;  3RMS A;  3ZFJ A;  1GCP A;  2MWP A;  2EYX A;  4RG8 A;  2RH2 A;  3DKM A;  5GAN 5;  1IGQ A;  2DE0 X;  1K4U S;  5EC7 A;  3QJY A;  1VQ6 T;  3FEO A;  3JCM d;  3PIP A;  3GIB A;  3EG3 A;  3CD6 Q;  4F16 A;  4M78 F;  2X4Y A;  3X20 B;  3ER0 A;  3TSW A;  3PVL A;  1JO8 A;  2QEX T;  2E3I A;  3L2U A;  4QVC A;  1VQN A;  2BZ8 A;  3CC7 T;  3JB9 F;  4FSX A;  2C06 A;  4II1 A;  1JJ2 P;  4V2S A;  5GAO q;  3EH2 A;  3OYN A;  3JCM b;  3EFR A;  4QKU A;  2KBT A;  3I56 A;  4C8Q G;  4BY6 C;  1PKT A;  2DEU A;  2RF0 A;  4OF1 A;  5J26 A;  4ZTF A;  1QVG A;  1W70 A;  5GAO n;  1C0M A;  2GNC A;  2JJ9 A;  3OS2 A;  3EH1 A;  3EAE A;  3CCJ T;  4BI8 B;  1MNE A;  2YRD A;  3CCS Q;  2ATC B;  2HKQ B;  1W6X A;  4XU1 A;  2LMJ A;  2KVQ G;  2EJ9 A;  3EGU A;  4X1V A;  1W4S A;  2DRM A;  4OMO A;  1OPK A;  5GJV B;  4C8Q A;  2MK5 A;  4NOY A;  4IUR A;  2MWO A;  2A36 A;  2CP6 A;  4JJN K;  2Y90 A;  1GFD A;  2EQU A;  1M8M A;  2DD4 A;  5DLQ E;  3OBW A;  4D8D A;  4XK8 E;  3WVE B;  2O01 E;  2C0T A;  1YIT T;  1M27 C;  2DXC A;  2HKN A;  1NJI C;  2X35 A;  2DAQ A;  1SSH A;  1YCY A;  3VS3 A;  2BUD A;  2HQX A;  1O9S A;  1AOJ A;  3PFS A;  3FB9 A;  1NJI U;  2LP5 A;  1Q82 R;  3CD6 T;  2BZY A;  2VB6 A;  3MKD A;  2RNA A;  4J9E A;  4PLI A;  4MML A;  2R5M A;  4RTY A;  1VQP T;  2RPN A;  1WA7 A;  1SKU B;  3NGP A;  2RA2 A;  5AT1 B;  5GMK i;  5FRO A;  1U1T A;  4E2F B;  4BE1 A;  3VUB A;  4JRP A;  4QQG A;  8AT1 B;  4M78 E;  3L2W A;  2COW A;  2NLU A;  3QJ6 A;  1NYF A;  2L2P A;  1B7T A;  4M7D D;  2CP5 A;  2CUD A;  1KQS S;  2EW3 A;  2H8H A;  2K4Y A;  3CXC S;  1D0Z A;  2O88 A;  1K9M U;  4KGZ B;  2YUQ A;  4LUE A;  3CMA T;  3GPL A;  1VQ7 Q;  4M75 E;  1YN8 A;  4C0D B;  4ELY C;  2XI9 A;  3JCM J;  4IUQ A;  1VIE A;  4EMK C;  2OJ2 A;  2YLB A;  1K9M C;  2DL5 A;  4PJJ A;  1VQP Q;  1N27 A;  5LJ3 d;  3CC2 A;  4E7S A;  1N8R C;  2QTV A;  4A54 A;  3E9G A;  2XHC A;  2DZ9 A;  3OYA A;  2CSQ A;  4F7U A;  4BAC A;  4PJL A;  4XAX B;  1X2K A;  2CGH A;  2MCN A;  1M3A A;  1VYV A;  1OYX A;  1M90 U;  2FVU A;  2ZZD A;  1VYU A;  3M58 A;  2BKD N;  4PLL A;  2ESW A;  2MOX A;  2MYS A;  4QQD A;  5L8R E;  3TVT A;  2K57 A;  2WSE E;  1ABQ A;  3NTI A;  1OX9 A;  3UA6 A;  3ASK A;  4M77 A;  4ZGD B;  5HKC A;  2QXF A;  5LJ5 f;  1TG0 A;  4A4H A;  3M9Q A;  1MMA A;  3PNW C;  4A4G A;  5FLX E;  4FIB A;  4LN2 A;  2W10 A;  2JMA A;  2VAS A;  4PJO A;  2YXY A;  2KXD A;  2PVD B;  1YFN A;  1YHQ T;  2DFU A;  1D3B A;  3V7S A;  1YHQ Q;  2HNI A;  2YSQ A;  2D9T A;  2E41 A;  4LD6 A;  1BU1 A;  2AKK A;  2M51 A;  1VQO Q;  1WQ7 A;  7AT1 B;  1GFC A;  3L42 A;  2EVR A;  3M0U A;  4EMK B;  2F5T X;  2EQM A;  3QKJ A;  2DIG A;  3PTA A;  2FZK B;  4M4Z A;  1AWX A;  1N9S A;  4J9C A;  3SB2 A;  1VQL A;  4M77 E;  2I0N A;  2HQE A;  4F7U F;  2FEI A;  2XDB A;  4ZTJ A;  1W2B S;  1SSF A;  2PVO B;  1TU0 B;  1BYM A;  1ABO A;  3FDR A;  2FHD A;  4MDW A;  1NPR A;  2L3P A;  2HAX A;  4M7A D;  3RKW A;  4DOV A;  4R55 A;  3JB9 D;  2DEQ A;  1YIJ Q;  3LYI A;  1IZ6 A;  4JJB A;  3BFM A;  4M78 D;  2KDS A;  4KRT A;  5GMK l;  2XID A;  4JRK A;  2ZGW A;  4J9G A;  5CKE A;  1IRE B;  1Q82 C;  2DMO A;  1RL2 A;  1KHC A;  2D8H A;  1UTI A;  3UT1 A;  4FL6 A;  2R57 A;  1RAF B;  1ACM B;  3M53 A;  2DJZ A;  3G1J A;  3ZBD A;  3I56 Q;  2KT8 A;  1AWJ A;  1UUE A;  4FYY B;  3CPF A;  3EFS A;  3VRY A;  2RB6 A;  4ANJ A;  4AT1 B;  1YWO A;  4CI0 C;  4M7D E;  1TSF A;  2QG9 B;  2ZPE B;  2RHI A;  3ULR B;  2M9U A;  3VYG A;  2GGR A;  5FU7 C;  3QSU A;  1QQJ A;  4J6X A;  4C8Q E;  8ATC B;  5I2S A;  3LW5 E;  2CZ7 B;  4JPB W;  4PKC C;  3EG9 B;  4Z8A A;  3SWN A;  1Q86 C;  2LT4 A;  4HCC A;  2F2V A;  1K73 C;  4WF2 A;  3OYY A;  3SWN B;  1Q81 C;  1FMW A;  3CCJ Q;  1XJW B;  2L8D A;  3CCL T;  1RAI B;  3SWN C;  4RCC A;  1V76 A;  4EPC A;  1VQM T;  4O5V A;  2PUO B;  3V7R A;  3VRZ A;  1YIJ T;  4J7F A;  1CKA A;  1GRI A;  5KYY A;  4QQ6 A;  4F7U G;  1QCF A;  5I21 A;  1R0B G;  2HBW A;  4C0F A;  2GF7 A;  3LWH A;  3EFO A;  4XTZ A;  3J7A F;  3E2U A;  1VQ9 A;  5KE2 A;  5CAI A;  2J05 A;  1G3Y A;  1VQ9 Q;  2EKO A;  3QUI A;  2E6N A;  2CT3 A;  4LDY A;  5GAM h;  3CQT A;  5GAM g;  1QKW A;  4OML A;  1YJ9 Q;  1RLP C;  3VS7 A;  4RTT A;  1VQK T;  5HCK A;  3NTK A;  3VYH B;  2SRC A;  2XG8 D;  1KQS A;  3M59 A;  2MF2 A;  4RTX A;  1M90 R;  1WXU A;  5LJ5 e;  5IHN A;  3NMZ C;  2OTJ Q;  4KUL A;  2K3B A;  4KBM B;  5D6W A;  2JM9 A;  3R6N A;  3CCU Q;  2M0O A;  4XU3 A;  1VQO A;  3OYF A;  5FWC A;  3CCR A;  2FPE A;  4M7A F;  1K9A A;  1KQ1 A;  4PJO G;  2DIQ A;  4RG2 A;  1WX6 A;  3I55 Q;  1SHF A;  1WFW A;  3NTH A;  4WTO B;  2EGE A;  4M77 B;  1D3B B;  1ZSG A;  3VS6 A;  2XIC A;  5KH6 A;  1PD0 A;  1XOV A;  2CZ0 B;  1K0X A;  3VU3 C;  1M1F A;  1MMG A;  2JNG A;  5FWB A;  3M0R A;  4BUG A;  1W2B P;  2LCL A;  1VQK A;  2NUP B;  4PJN A;  1VQM Q;  5KYX B;  1KHI A;  3CME A;  5GAM d;  2OTL T;  5KYN A;  2EYZ A;  3M55 A;  2DER A;  5IN1 A;  3EG0 A;  5KYW B;  4R0K A;  4M78 B;  1LNX A;  1OPL A;  1OZ3 A;  3X25 B;  2KRN A;  2CP0 A;  3VS1 A;  1WHM A;  3MEU A;  1MV0 B;  3OYI A;  4BI4 A;  5LJ3 j;  2IPO B;  3EGD B;  5CKB A;  1NLO C;  3TEE A;  2CP3 A;  5KYU B;  4LD9 K;  4PJO B;  3CD6 A;  3WXM B;  1KC8 C;  1HYO A;  4HCZ A;  1QWE A;  1VQ8 A;  1YI2 T;  1TUG B;  2CP7 A;  2RHX A;  4PJO C;  4OB2 B;  1QP3 A;  1BI2 A;  2X4J A;  1Z9Q A;  1WDX A;  4WCI A;  2HL5 C;  1UG1 A;  2DVE A;  3DLM A;  5C6S A;  2MIO A;  1X43 A;  1RAG B;  1UDL A;  1ZQ1 A;  5AYF A;  3CPW P;  2BE9 B;  2ZPF B;  1IXD A;  4LDX A;  1QCN A;  2F1L A;  4LDW A;  2F2W A;  1Q95 G;  2JTM A;  3FLG A;  3GOX A;  1Y07 A;  3NFC A;  1ZHI A;  1HSQ A;  2DM1 A;  5LJ5 d;  2QYZ A;  5GMK h;  3CEY A;  2K5L A;  2BTT A;  2KE9 A;  1VQ8 T;  2PVG B;  3HTR A;  2NWM A;  3CCM A;  1T0J A;  5GAN 2;  2RHU A;  1NLP C;  3G71 A;  1WJS A;  3M0P A;  1KFZ A;  2RK1 A;  1R8O B;  2EIF A;  3RDV A;  4KUD K;  2JN0 A;  4A4K A;  3C0C A;  1RAC B;  4RTU A;  5EG2 A;  3HL8 A;  1K0S A;  4JZ4 A;  2KAF A;  2P0K A;  3FIF A;  2FPD A;  2W0Z A;  1UFF A;  2M16 A;  2QEX Q;  1SEM A;  1K8A C;  3QWX X;  5D6X A;  3OS0 A;  4VUB A;  4ELZ C;  4RTV A;  3RKX A;  4DA4 A;  1WQW A;  2E1H A;  2PTK A;  1XNI A;  1X2Q A;  1YBY A;  3DB4 A;  4AG2 C;  1YIT A;  3FJ5 A;  3MEV A;  2ROL A;  3PE0 A;  2LJ0 A;  3U23 A;  3ZEH A;  1XTD A;  3C12 A;  3D7S B;  5FRM A;  4DQ2 A;  1X01 A;  1I8F A;  4OGE A;  4CC7 A;  2HL3 A;  2J6O A;  2ED1 A;  3LH5 A;  3V8K A;  4ME7 A;  1I1J A;  1PM3 A;  4Z89 A;  4FCY A;  1NYG A;  3L2R A;  3NHN A;  2LZ6 B;  3OYL A;  1SRM A;  1YJW A;  2A7Y A;  2PNI A;  2ECZ A;  2V8I A;  3CCE Q;  3CC2 Q;  1OEB A;  3JB9 I;  1KC8 R;  1BK2 A;  1U1S A;  1M90 C;  3G4S Q;  1TWB A;  3TCJ A;  2EGA A;  5IH2 A;  3G4S T;  2ROT A;  2CZ6 B;  1YJ9 A;  3J81 E;  2RJD A;  2NYS A;  1N5Z A;  4F7U E;  2DKG A;  2RHY A;  3G71 Q;  1QKX A;  3GBQ A;  1UE9 A;  4J83 A;  3I9Q A;  4J9D A;  5CKH A;  2QQS A;  3CCV A;  1RAH B;  2HMA A;  1PKS A;  4UC4 A;  4DEX A;  1E6H A;  1VQ7 T;  3VV0 A;  2LNV A;  2E70 A;  4D8K A;  1VQ9 T;  5FU6 C;  1K1Z A;  1HJD A;  4N4G A;  1EIF A;  1N9R A;  3GP8 A;  4E7L A;  1VQK Q;  5FW9 A;  4CC2 A;  3RKY A;  1NBE B;  2NUT B;  4OMN A;  1V29 B;  4L59 A;  2RI3 A;  2O31 A;  3JCM f;  4XTX A;  3C4S A;  3C94 A;  2VGN A;  1WHK A;  1K8A U;  2MAM A;  2LDM A;  4IIO A;  1DJ7 B;  3PMI A;  3QHS A;  4AFZ C;  3JCM e;  3QG1 A;  2QA4 Q;  1LVK A;  1QP2 A;  2KI7 A;  4M7D A;  1JB0 E;  1H64 1;  3JB9 G;  4PL6 A;  2V26 A;  1Q7Y C;  1JU5 C;  3SHW A;  1M1K R;  2DBK A;  1V1C A;  5CKD A;  1GCQ A;  4J9F A;  2A3L A;  2DF6 A;  2VYT A;  4GBQ A;  3A8H B;  4KH0 B;  1R0C B;  4ZNX A;  2B8A A;  5GJW B;  3MCA B;  3AHU A;  2DZC A;  2VUB A;  2RJF A;  1VQO T;  2CH4 A;  2BIV A;  3QO3 A;  2YLC A;  3X28 B;  4JJC A;  2VWF A;  3IQL A;  4DBQ A;  4X34 A;  3M54 A;  1M2O A;  5LJ5 j;  4ZN3 A;  1I0C A;  2KSS A;  4LDV A;  2HCK A;  4BD3 A;  2JS2 A;  3M57 A;  5CK9 A;  1VQ7 A;  2OTJ A;  1RI9 A;  5J39 A;  1NJI R;  3RER A;  1LPL A;  3QBY A;  1SF9 A;  3PGG A;  4GLM A;  4MZP A;  3MEW A;  2D0N A;  4M78 C;  2EGC A;  1FXX A;  4ESR A;  1NM7 A;  3MEA A;  2ZAE A;  1G3T A;  4KH1 B;  3JCM c;  3L2Z A;  2AKL A;  1Q7Y R;  2GTJ A;  1RUW A;  3VS4 A;  2LJ1 A;  3OSV A;  4RUG A;  2K5I A;  3FRN A;  2YHT A;  4M75 A;  2DL3 A;  2E65 A;  3HFN A;  1B07 A;  4HVU A;  3OW2 A;  4X9C A;  1ZSZ C;  3TRE A;  2J06 A;  1BI3 A;  4NS5 A;  1YJW T;  2DXU A;  1VQM A;  1M5Q 1;  1TXQ A;  3KBG A;  4IUP A;  3UPU A;  4MZM A;  1Q82 U;  2NUT A;  5HY6 A;  3JCM V;  3URG A;  3S3O A;  1GXI E;  1WHL A;  2EQJ A;  1WI7 A;  2WSF E;  2X3W D;  2J6F A;  2KRS A;  2DRK A;  3M0T A;  3OYJ A;  1U06 A;  4PFP A;  5GAN 3;  1YNZ A;  2JT4 A;  1UGR B;  1A0N B;  3CCV Q;  3BW1 A;  1BKB A;  2CYZ B;  1T3S A;  3A1P A;  3OYG A;  3CCJ A;  4ZGJ B;  3JB9 H;  1HK9 A;  3M4G A;  4HCB A;  2CH4 W;  1S72 Q;  5LJ3 e;  4C92 G;  1LCK A;  3GF5 A;  4HVV A;  1M9S A;  5GAN 4;  3HKS A;  4M78 G;  2CT4 A;  2HDA A;  3KXT A;  4PFO A;  5D7U A;  4C0G A;  1FYN A;  1YJW Q;  4E7H A;  3JCM X;  3L2Q A;  2HEQ A;  1TOV A;  2RI5 A;  4QT7 A;  3TSZ A;  3PT9 A;  3H41 A;  2ZPH B;  2KXC A;  5CIU A;  4C92 E;  4HA8 A;  5CKF A;  2LTO A;  3O8V A;  1N6A A;  2GBQ A;  3BY7 A;  2JW4 A;  5FU7 B;  2DTI A;  4M7D C;  2E64 A;  6AT1 B;  1P92 A;  3OSS C;  1TUC A;  1KG1 A;  3MPU B;  1Z9Z A;  1M30 A;  2EFI A;  3HHT B;  2QEX A;  2AIR B;  2L3S A;  4N0A C;  1SHG A;  3N5B B;  1VQP A;  4C92 C;  1EZZ B;  5GMK m;  4JS5 A;  1ZUU A;  2X4W A;  3JSC A;  4M75 D;  1H3Z A;  2MI6 A;  4KGX B;  5I2M A;  3QZ5 B;  3OYH A;  1FWZ A;  3CC2 T;  1S72 A;  4M77 C;  4Y28 E;  4M75 F;  2Y4X A;  3H0F A;  2EBP A;  3LGF A;  2YRV A;  2A28 A;  4AMC A;  4BY6 B;  2FPF A;  2F5K A;  2QQ9 A;  4J8O A;  2LCS A;  5GAN j;  2FZG B;  1ZLM A;  3CC4 T;  1AD5 A;  4M7D G;  4F04 B;  2OX7 A;  4PJM A;  3CCV T;  1UGS B;  5KYX A;  1UHF A;  2DNU A;  3L1A A;  2RQR A;  1AWO A;  1R77 A;  4QVD A;  3S3N A;  2DJQ A;  5CCA A;  2VC8 A;  5GAN e;  1NG2 A;  3CBM A;  1S1N A;  4J9I A;  1KC8 U;  4J9H A;  4E7J A;  1G5V A;  3AT1 B;  1QCO A;  3CCQ T;  2HBP A;  4DBR A;  3LX7 A;  3CCQ Q;  1MHN A;  2D8J A;  1OU9 A;  4OMQ A;  5KCH A;  3RMQ A;  1T0H A;  3UA7 A;  5ECA A;  2J7I A;  3GNF B;  3OW2 P;  2DVJ A;  2MPX C;  1KJW A;  4A4F A;  2DET A;  2C0O A;  2CSI A;  2L3R A;  1UJY A;  4M75 B;  1WJR A;  1JQQ A;  4B9W A;  2EYQ A;  5DLO A;  1K9M R;  4IUV A;  1OUL A;  2XMF A;  3H6Z A;  4OB1 B;  1J3T A;  3OY9 A;  3DLL A;  1QVP A;  2K5F A;  1OQK A;  2D1X A;  3WVD B;  1VUB A;  3RR6 A;  1GL5 A;  1FMK A;  2NUP A;  1YCS B;  3CC7 A;  2YUP A;  3I5S A;  3HPW A;  2C0I A;  4OMM A;  4JRQ A;  2JVV A;  2KYM A;  2DA9 A;  4L6V 5;  3SDZ A;  1M2V B;  2GQI A;  1WNL A;  2FYK A;  5GAN 6;  2CZ1 B;  4ZN1 A;  2E5K A;  3CMA A;  1M4Z A;  2RN8 A;  1GBQ A;  3PVQ A;  4DBF A;  1ZBJ A;  1IO6 A;  1NZ9 A;  2DLP A;  2FB7 A;  3CCL Q;  3CPW A;  1ZUY A;  1YIJ A;  2QI2 A;  3JCM P;  4OP0 A;  3VUZ A;  3BE3 A;  1YJN A;  2JTE A;  4KUI A;  5IT9 E;  3E1S A;  1M3C A;  2P84 A;  1TH7 A;  4KT0 E;  4X9D A;  1B3Q A;  5GAO p;  2M02 A;  1LOJ A;  1SG5 A;  1H92 A;  2DBM A;  2DYB A;  1BB9 A;  1K73 R;  4NL3 A;  1AHJ B;  1PRM C;  3SEM A;  4DBH A;  1C1A A;  2YRC A;  2B86 A;  5DM7 R;  3DB3 A;  5GAN d;  1KQS P;  1G3W A;  2K6D A;  1VQ4 T;  3EGX B;  1D1B A;  2EWN A;  2MMP A;  4C8Q F;  1CKB A;  1ARK A;  2RO0 A;  4EDU A;  2KT1 A;  1NEG A;  3A5Z B;  2L0A A;  3EG9 A;  3QZ9 B;  3G6E T;  1OV3 A;  4C8Q D;  4C92 A;  4JUV A;  3QII A;  2D6F A;  1BCM A;  2X3X D;  1U8R A;  4JLI A;  4E7Z A;  1BCO A;  1D09 B;  3OA6 A;  3P8B B;  5A2Q E;  2DL8 A;  3OYC A;  5GAO r;  2JMC A;  2FO0 A;  2VXE A;  2AZS A;  1TS9 A;  2HQH A;  4J6Y A;  3JB9 J;  4FYW B;  1LJO A;  2K7A A;  1GBR A;  2HZY A;  3QDR B;  1UJ0 A;  1BIB A;  2GFU A;  1VQ6 A;  3CCR Q;  1E7O A;  1MMN A;  1AT1 B;  4FYV B;  3I55 T;  1RAE B;  2HSE B;  4AFS C;  1WHJ A;  1UHC A;  1YIT Q;  3J80 E;  2DK3 A;  3THK A;  3KFV A;  1D1A A;  1EFN A;  4M7A A;  1PD1 A;  4LE9 A;  4J5Y A;  2DL7 A;  3M0Q A;  2PQW A;  1AWW A;  4IKF A;  1AZG B;  3QPH A;  5IHI A;  4BDY A;  4FW1 A;  3TU4 K;  3VS5 A;  2PUK B;  2DO3 A;  2L3Q A;  1SPK A;  4XTV A;  3HP9 A;  4N4H A;  2O4X A;  3MP1 A;  2LVM A;  3G6E Q;  1QMC A;  3HRU A;  2X4X A;  4N0A A;  4FU6 A;  1BI1 A;  5LJ5 g;  5LJ5 h;  1NPP A;  4J7I A;  1Q7Y U;  2JOY A;  2AZV A;  1N8R U;  2FL7 A;  1Q81 U;  1VQ4 Q;  1OZ2 A;  1VQ6 Q;  1I07 A;  1QLY A;  2OAW A;  4M7A C;  5LJ3 f;  1WGS A;  1I81 A;  2EQK A;  1YP5 A;  1WHH A;  4AFU C;  4FT2 A;  1G3S A;  3CCL A;  3HSB A;  1G2B A;  3V7C A;  1Y71 A;  2E12 A;  2QA4 T;  1BIA A;  5C0M A;  2CDT A;  2Y4Y A;  2QK0 A;  3BDU A;  2L5Q A;  4C5E A;  5A0L A;  4EMG A;  3ME9 A;  4M77 D;  1KD1 R;  2RJC A;  3GNG A;  2KRM A;  3CC4 A;  2YT6 A;  2XDD A;  4Z88 A;  1JEG A;  1M2V A;  4RTZ A;  2RQW A;  4IIM A;  3S3M A;  3FJP A;  4XTU A;  1T3L A;  1HD3 A;  1I5L A;  2ENM A;  4BE2 A;  4C92 D;  1IB8 A;  3M4Y A;  5IXB A;  2X9H A;  1JJ2 S;  2SEM A;  2V1Q A;  3S6W A;  3CCQ A;  2JS0 A;  1XQH A;  2OAU A;  2OI3 A;  3I5R A;  2M1H A;  1OI1 A;  4MZT A;  1X75 C;  1KD1 C;  2XD0 A;  1CSK A;  4M7A G;  3EHQ A;  1UGQ B;  1WXT A;  4PJO F;  4AG1 C;  2LNH B;  2OTJ T;  1M1K C;  1Q86 R;  4F14 A;  3REA B;  1IGU A;  2XK0 A;  3CCU T;  2QQB A;  5GAM f;  1W1F A;  4N4I A;  3HRS A;  3CCS A;  1G83 A;  3A8M B;  2K9G A;  3C95 A;  2LC4 A;  2KEA A;  3OYD A;  2QAZ A;  2F2X A;  1QWF A;  2VVK A;  2CKK A;  1AEY A;  3VJP A;  4C5H A;  3EGD A;  3ZL7 C;  4B9X A;  1ZUK A;  5KYU A;  1WHG A;  3RES A;  4E6R A;  1ZBX A;  2DYI A;  4B6M A;  5I11 A;  4M78 A;  4GLK A;  5KYW A;  2EQI A;  1X6O A;  3CMA Q;  4FSS A;  3UDC A;  1S72 T;  4HXJ A;  1WXB A;  3JV3 A;  4D6W A;  1Y96 B;  3CME T;  3JCM W;  3PMT A;  1KK7 A;  3CME Q;  1O75 A;  2BZX A;  1E6G A;  1RAD B;  3REB B;  2EJG A;  3OMC A;  1PCX A;  3X24 B;  1VQ5 T;  4PJO E;  3CBP A;  3EFO B;  2QDY B;  5FRN A;  4EIK A;  2DD5 A;  5GMK j;  4C0Z A;  3CCS T;  2G6F X;  4OVA A;  2KQW A;  5KYY B;  1Y57 A;  2QQA A;  1Y0M A;  1MV3 A;  4XTW A;  3MO8 A;  1GCQ C;  3I55 A;  2CRE A;  4HVW A;  2BE7 D;  2JXB A;  3M5A A;  3EGX A;  3OYM A;  3F70 A;  3RIR A;  1VQL T;  3FC3 A;  1UGV A;  2GCX A;  4C5G A;  3CCU A;  2R58 A;  1X6B A;  5CQX A;  2LCC A;  3H8Z A;  3G4S A;  3M0S A;  3QYG B;  1JBM A;  1JJ2 A;  2EYW A;  1QVF P;  3JRZ A;  2CUB A;  3LWI A;  1FMV A;  5LJ3 h;  5LJ3 g;  2V1R A;  4CC4 B;  1Y7X A;  4M7A B;  2LX9 A;  5GAO l;  1QVG P;  1Q86 U;  1VA7 A; 
#chains in the Genus database with same CATH homology
 2K79 A;  1K4U S;  5EC7 A;  5FWB A;  3M0R A;  1UHF A;  2DNU A;  2RQR A;  1AWO A;  3EG3 A;  4F16 A;  4DEY A;  2KRO A;  3TSW A;  3PVL A;  1JO8 A;  2DJQ A;  2EYZ A;  2M0Y A;  2BZ8 A;  3EG0 A;  1NG2 A;  4R0K A;  1S1N A;  4J9I A;  1OPL A;  4J9H A;  1PNJ A;  2KRN A;  3VS1 A;  1MV0 B;  2KBT A;  1MUZ A;  4K11 A;  2D8J A;  4OMQ A;  1PKT A;  2RF0 A;  1NLO C;  1T0H A;  3UA7 A;  1W70 A;  5ECA A;  2J7I A;  1QWE A;  2DVJ A;  1KJW A;  2C0O A;  2CSI A;  2GNC A;  1UJY A;  1JQQ A;  1Z9Q A;  1WDX A;  4WCI A;  1UG1 A;  1W6X A;  2LMJ A;  2XMF A;  3EGU A;  4X1V A;  2DRM A;  2MIO A;  1X43 A;  1J3T A;  1UDL A;  4OMO A;  1OPK A;  5GJV B;  2A36 A;  2D1X A;  1ZX6 A;  1GFD A;  1M8M A;  1GL5 A;  2F2W A;  1FMK A;  1YCS B;  4D8D A;  2YUP A;  3I5S A;  2C0I A;  1U5S A;  4OMM A;  1HSQ A;  2DM1 A;  2C0T A;  2KYM A;  1M27 C;  2DA9 A;  1JXO A;  4F17 A;  2GQI A;  1SSH A;  3VS3 A;  2KE9 A;  2BTT A;  2LJ3 A;  1AOJ A;  2E5K A;  5L23 A;  2RN8 A;  2NWM A;  1T0J A;  1GBQ A;  1X27 A;  2LP5 A;  3PVQ A;  1U3O A;  1NLP C;  1WLP B;  2BZY A;  3M0P A;  1KFZ A;  2RNA A;  4J9E A;  1ZBJ A;  1IO6 A;  2DLP A;  3O5Z A;  1ZUY A;  4RTY A;  2RPN A;  3C0C A;  5I22 A;  4RTU A;  1WA7 A;  1JXM A;  3NGP A;  1K0S A;  1SRL A;  2JTE A;  4JZ4 A;  2EPD A;  1M3C A;  2JM8 A;  2FPD A;  2W0Z A;  1B3Q A;  1UFF A;  3UF4 A;  1H92 A;  1SEM A;  2DBM A;  2DYB A;  1NYF A;  3QWX X;  1BB9 A;  1KIK A;  2RMO A;  2L2P A;  4RTV A;  1PRM C;  3SEM A;  2CUD A;  2EW3 A;  2LQN A;  2PTK A;  1X2Q A;  2H8H A;  4AG2 C;  2B86 A;  3FJ5 A;  2ROL A;  3PE0 A;  2LJ0 A;  3U23 A;  2O88 A;  2K6D A;  2YUQ A;  4LUE A;  2P4R A;  2A37 A;  1YN8 A;  4CC7 A;  5IHK A;  1CKB A;  2J6O A;  1ARK A;  2ED1 A;  3LH5 A;  2KT1 A;  1NEG A;  2OJ2 A;  2EYY A;  2L0A A;  1I1J A;  2DL5 A;  4Z89 A;  1UEC A;  1NYG A;  2J6K A;  1OV3 A;  3NHN A;  2LZ6 B;  1SRM A;  2A08 A;  2PNI A;  2ECZ A;  1OEB A;  1YWP A;  1BK2 A;  1M3B A;  2CSQ A;  2EGA A;  2QDL A;  2X3X D;  5IH2 A;  2ROT A;  3RBB B;  1X2K A;  4JZ3 A;  2MCN A;  1M3A A;  1VYV A;  2HSP A;  1N5Z A;  1H8K A;  2DL8 A;  2LQW A;  1QKX A;  3GBQ A;  1UE9 A;  1VYU A;  3I9Q A;  4J9D A;  2JMC A;  2FO0 A;  2ESW A;  2AZS A;  3NPF A;  2MOX A;  1PKS A;  4DEX A;  3TVT A;  1E6H A;  1ABQ A;  2RQT A;  2K7A A;  1GBR A;  2O9V A;  3UA6 A;  4D8K A;  1K1Z A;  1HJD A;  1UJ0 A;  1TG0 A;  1PRL C;  1E7O A;  1PHT A;  2DL4 A;  2KGT A;  5FW9 A;  4CC2 A;  4A63 B;  4LN2 A;  2W10 A;  4OMN A;  4J9B A;  4AFS C;  2JMA A;  1UHC A;  2O31 A;  2KXD A;  3THK A;  4ORZ A;  3KFV A;  1EFN A;  4IIO A;  3EHR A;  4LE9 A;  2DL7 A;  4AFZ C;  2K2M A;  3M0Q A;  2YSQ A;  1AWW A;  1BU1 A;  2AKK A;  1X6G A;  2M51 A;  3I35 A;  4HCK A;  1WYX A;  1AZG B;  4OMP A;  3QWY A;  5IHI A;  1GFC A;  3VS5 A;  1PWT A;  2L3Q A;  1SPK A;  2EVR A;  1JU5 C;  3M0U A;  3SHW A;  2DBK A;  1V1C A;  1VYT A;  1GCQ A;  4J9F A;  2DF6 A;  4M4Z A;  1AWX A;  4J9C A;  4GBQ A;  2AZV A;  2I0N A;  4ZNX A;  5GJW B;  2FEI A;  1I07 A;  1QLY A;  2OAW A;  1H3H A;  4LNP A;  2CH4 A;  1ABO A;  4JJC A;  1YP5 A;  2VWF A;  3IQL A;  2L3P A;  4AFU C;  3VS2 A;  1I0C A;  5IXF A;  2HCK A;  2JS2 A;  1G2B A;  2RQU A;  1AVZ C;  1RI9 A;  2DX1 A;  2AK5 A;  2GTO A;  1KSW A;  2CDT A;  4GLM A;  2DIL A;  4JJB A;  2D0N A;  2EGC A;  4KRT A;  4ESR A;  1NM7 A;  2KRM A;  2YT6 A;  2ABL A;  2AKL A;  2GTJ A;  1RUW A;  3VS4 A;  2LJ1 A;  4Z88 A;  4J9G A;  1JEG A;  4RUG A;  4RTZ A;  2RQW A;  4IIM A;  1K76 A;  4Y92 A;  2DMO A;  3VS0 A;  2DL3 A;  1T3L A;  4HVU A;  1B07 A;  2D8H A;  1UTI A;  1HD3 A;  2ENM A;  2J06 A;  4AFQ C;  5IXB A;  2SEM A;  3EG2 A;  2V1Q A;  2JS0 A;  2YDL A;  2KT8 A;  1AWJ A;  2OI3 A;  1UUE A;  3I5R A;  2KYB A;  1WI7 A;  2X3W D;  1CSK A;  2J6F A;  2KRS A;  3VRY A;  2DRK A;  3EHQ A;  3M0T A;  1U06 A;  1WXT A;  4AG1 C;  2LNH B;  2O2O A;  1YNZ A;  1YWO A;  2JT4 A;  4F14 A;  1NEB A;  2KR3 A;  1A0N B;  1TUD A;  3REA B;  3ULR B;  2EKH A;  2GGR A;  1AZE A;  1T3S A;  1W1F A;  3H0I A;  1G83 A;  1BBZ A;  2CH4 W;  3H0H A;  2K9G A;  4JPB W;  2KEA A;  2RQV A;  4Z8A A;  2F2X A;  1QWF A;  2VVK A;  1LCK A;  4JJD A;  1AEY A;  4HVV A;  3ZL7 C;  4LUD A;  2CT4 A;  2F2V A;  1ZUK A;  3UAT A;  2HDA A;  1X69 A;  4E6R A;  1FYN A;  2YUO A;  5I11 A;  2HEQ A;  2KNB B;  2NUZ A;  4QT7 A;  2EQI A;  3TSZ A;  3H41 A;  3EG1 A;  4FSS A;  3VRZ A;  2KXC A;  1CKA A;  4HXJ A;  1GRI A;  1WXB A;  3JV3 A;  4RTW A;  2ED0 A;  2FG0 A;  2LX7 A;  1QCF A;  2HBW A;  2GBQ A;  3RNJ A;  2JW4 A;  2BZX A;  2FRY A;  1E6G A;  2J05 A;  3REB B;  2PZ1 A;  2CT3 A;  3CQT A;  1QKW A;  4OML A;  2FRW A;  1RLP C;  3VS7 A;  4EIK A;  4RTT A;  1TUC A;  1Z9Z A;  2G6F X;  5HCK A;  2O9S A;  1M30 A;  1Y57 A;  1Y0M A;  1MV3 A;  2SRC A;  2L3S A;  1GCQ C;  1SHG A;  2CRE A;  4HVW A;  1WIE A;  4RTX A;  2JXB A;  1ZUU A;  1WXU A;  1OOT A;  5IHN A;  3NMZ C;  1RLQ C;  2K3B A;  1UGV A;  2JM9 A;  1X6B A;  3R6N A;  3M0S A;  5FWC A;  2EYW A;  2VKN A;  2CUB A;  2FPE A;  3H0F A;  1K9A A;  2EBP A;  2A28 A;  1WX6 A;  1SHF A;  1WFW A;  4CC3 A;  2YUN A;  2EGE A;  2V1R A;  3A98 A;  2IIM A;  4CC4 B;  1GCP A;  1ZSG A;  3VS6 A;  2FPF A;  2LCS A;  2EYX A;  1XOV A;  1ZLM A;  1AD5 A;  1K0X A;  2DE0 X;  1VA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...