1SSHA

Crystal structure of the sh3 domain from a s. cerevisiae hypothetical 40.4 kda protein in complex with a peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
b'GSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region
publication title Yeast SH3 domain structural genomics
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 12
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2004-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1sshA00
1KSWA 2RN8A 1OEBA 1E6HA 3UF4A 2W0ZA 4RTWA 2LNHB 1G2BA 1JU5C 2KR3A 1UE9A 3EG3A 2BTTA 1UDLA 1GFDA 3I9QA 4HVUA 2KT8A 2J6FA 1CKBA 2DRKA 1CKAA 1CSKA 2CUDA 1X6GA 3M0RA 3EHQA 1NLOC 2FG0A 2W10A 2RNAA 1ZX6A 1WFWA 1PHTA 1ZSGA 1YWPA 2CT4A 2DVJA 3TVTA 3RNJA 2SRCA 3M0PA 1K76A 1GRIA 4JJDA 2LJ3A 1SRMA 5ECAA 1XOVA 2L3SA 4AFUC 1K1ZA 1M27C 2HSPA 1M3AA 4HVWA 5GJWB 2A36A 1M30A 4Y92A 1HSQA 2DBMA 2FPEA 2IIMA 3UATA 1S1NA 1UHCA 1WXBA 2GQIA 2PTKA 5IH2A 2V1QA 2F2XA 1K0SA 2ESWA 2YUNA 3ZL7C 1E6GA 1AOJA 1UJYA 1GBRA 2HBWA 2X3XD 4OMQA 1GL5A 1NEGA 2L2PA 5FWCA 1PRLC 2KXDA 1GFCA 1PNJA 2K9GA 1SHFA 2DL8A 1AZGB 2GBQA 2EVRA 3VS1A 2ECZA 2LJ0A 1W70A 2O31A 1A0NB 1NYGA 5IXFA 2AKKA 1VYTA 2LJ1A 4RUGA 2OJ2A 4X1VA 4CC7A 2JMCA 2EYXA 2A28A 2O9SA 3VRYA 1YCSB 1AWWA 1HJDA 4OMPA 1RI9A 3TSZA 1MV0B 3PVLA 3VS6A 2M51A 1JQQA 1WXTA 1WA7A 3EGUA 1VYUA 1UGVA 2X3WD 2DF6A 1X2QA 1KFZA 4OMOA 1AEYA 4IIMA 4RTYA 4OMLA 2C0IA 3PVQA 2L3PA 4AFZC 4ESRA 2YSQA 1N5ZA 1QKWA 1J3TA 3U23A 1K9AA 2LZ6B 4Z8AA 4LUDA 3UA7A 2CT3A 1X6BA 2C0TA 2YDLA 4D8KA 2EKHA 1HD3A 2B86A 2EPDA 1NEBA 3NMZC 2D1XA 2DILA 2F2VA 4AG1C 1WDXA 4HCKA 2FRYA 2MIOA 3EG0A 1I1JA 2V1RA 3QWYA 4LUEA 1M8MA 2JS0A 1QWFA 2AZSA 1U5SA 3IQLA 1PRMC 2J05A 3VS3A 1FMKA 1OOTA 1YNZA 1MUZA 1KJWA 2JS2A 1X27A 1LCKA 1YN8A 1KIKA 2DMOA 2DBKA 3I35A 2JT4A 2DM1A 2GTOA 4RTVA 2JM9A 2AZVA 1QWEA 3VS7A 2KYBA 1ZUUA 1NM7A 2G6FX 4JZ3A 1AWOA 3VS2A 2DE0X 4HVVA 3KFVA 4JPBW 2FRWA 2DRMA 1UHFA 4CC4B 2KEAA 1RUWA 4D8DA 4J9FA 1RLQC 1UG1A 2YUOA 4OMNA 2AK5A 1K4US 1AVZC 1WXUA 2VWFA 1ZUKA 2KGTA 1VA7A 2KRMA 1UFFA 4AG2C 2KXCA 4ORZA 1EFNA 2K6DA 2EBPA 2FPDA 4IIOA 4J9CA 1ZUYA 3SHWA 1H3HA 3LH5A 3CQTA 4RTTA 1SRLA 1WX6A 1QKXA 2CREA 1ABQA 2I0NA 1RLPC 2J06A 2YUPA 3EHRA 3R6NA 4HXJA 1ABOA 1NYFA 3I5SA 2DLPA 2P4RA 2LP5A 3M0UA 2AKLA 2D0NA 3EG2A 5L23A 1X2KA 1WYXA 3NGPA 2QDLA 2VKNA 2NUZA 1Z9ZA 1GCQC 1M3BA 2CSIA 2DL7A 2SEMA 3H41A 1VYVA 4CC3A 3VS5A 2J7IA 3H0HA 1M3CA 1PKTA 4QT7A 1WIEA 4Z88A 3M0TA 4LN2A 2M0YA 1OPLA 1G83A 5IHIA 2FO0A 1MV3A 2DL5A 1SSHA 1Y0MA 1UJ0A 2HEQA 2DL4A 1FYNA 2EW3A 1YWOA 5FW9A 1BB9A 2DX1A 4GBQA 2RPNA 1GBQA 3PE0A 1GCQA 1T0HA 4M4ZA 1AWXA 2ED1A 4GLMA 2A37A 3C0CA 1Y57A 4KRTA 1AD5A 2ENMA 2YT6A 2KROA 3H0FA 1Z9QA 2RMOA 2K7AA 1BK2A 2RQWA 1OV3A 5HCKA 4DEXA 2MCNA 2O9VA 2C0OA 2EYZA 1NLPC 4LE9A 1ZLMA 4AFSC 2MOXA 4K11A 1YP5A 1AWJA 1SHGA 2LX7A 2RQVA 4F17A 2K2MA 4F16A 4ZNXA 2EYWA 4JJCA 2JW4A 1BBZA 2H8HA 4FSSA 1PKSA 1JXMA 1B07A 4J9IA 2A08A 3REBB 1IO6A 3REAB 4E6RA 4LNPA 4OMMA 2BZXA 2GNCA 3ULRB 3GBQA 2GGRA 3SEMA 4CC2A 5EC7A 1T3SA 2JMAA 1JXOA 2EYYA 1W1FA 1UTIA 1X69A 1UUEA 2DL3A 2DNUA 2RQUA 2HCKA 2CH4W 2DJQA 5I11A 2JXBA 1WLPB 2CSQA 2RF0A 2RQTA 2XMFA 1WI7A 2J6KA 2BZ8A 4WCIA 1I0CA 3QWXX 3H0IA 3JV3A 1UECA 1X43A 2VVKA 1ARKA 1K0XA 4RTXA 3VS0A 2O2OA 4F14A 2YUQA 2KNBB 4JZ4A 1SEMA 2ROLA 4JJBA 2JTEA 3VS4A 2RQRA 3THKA 1PWTA 4DEYA 4J9GA 2OI3A 2LQWA 2HDAA 1BU1A 3VRZA 2JM8A 5IXBA 2J6OA 2CUBA 2PZ1A 2CH4A 1OPKA 2F2WA 3TSWA 3UA6A 3M0SA 2ABLA 2LMJA 1SPKA 1NG2A 3NHNA 5I22A 2D8JA 2FPFA 2NWMA 2PNIA 1TUDA 2ROTA 1T3LA 2KE9A 5IHKA 1U3OA 4J9HA 2OAWA 2KYMA 2EGAA 1T0JA 4EIKA 4J9BA 2KRNA 2L0AA 1H92A 1V1CA 1W6XA 1I07A 2BZYA 3RBBB 3EG1A 2DA9A 2EQIA 1QLYA 4RTZA 2K3BA 4A63B 2EGCA 2LCSA 2EGEA 5IHNA 4R0KA 2K79A 2D8HA 1ZBJA 1JO8A 3NPFA 3I5RA 2KRSA 5GJVB 2O88A 1B3QA 4Z89A 2FEIA 3FJ5A 2CDTA 4J9DA 2L3QA 1U06A 1AZEA 2KT1A 1TUCA 5FWBA 3O5ZA 2DYBA 3M0QA 1QCFA 2GTJA 2ED0A 4RTUA 1H8KA 1GCPA 2LQNA 1JEGA 1TG0A 2E5KA 1E7OA 2KBTA 4AFQC 4J9EA 3A98A
chains in the Genus database with same CATH superfamily
2RN8A 1VQMQ 3CMEQ 3C94A 1VQOQ 2W0ZA 4RTWA 2LNHB 1G2BA 1JU5C 1BCOA 3H9NA 2BTTA 2ZPFB 1GFDA 3I9QA 1QP3A 3OW2S 4E7IA 1CKBA 2LCCA 4LDXA 1YBYA 2O01E 2E1HA 3M0RA 2RNAA 2EJGA 3GOXA 2A7YA 1TOVA 2RHXA 1TU0B 4RMOA 2EKOA 4FT2A 3JCMh 2A36A 1M30A 1QVGP 2DBMA 3HRTA 1MHNA 1S72Q 1UHCA 4M75G 2GQIA 4KGVB 1VQNQ 2C06A 3V8JA 2ESWA 1E6GA 1UJYA 1QCOA 4C92E 2ZGWA 5LL6S 2ZPEB 3VYGA 2ZCFB 3EGXA 3Q1JA 4PK4A 5LJ3h 1GFCA 3UT1A 3FLGA 2BKDN 1M2VA 5GAOr 2G3RA 2ECZA 3NTKA 3HKSA 2LJ0A 2L5QA 2K4YA 1M1KR 4M7DE 4RG8A 5GMKe 3A8GB 2QTXA 1TXQA 2LJ1A 2PUOB 5CAIA 2M02A 1G3TA 4F7UE 2QEXA 1ZQ1A 2FZKB 2P84A 1AWWA 4QW2A 4OMPA 1RAIB 3JCMc 3PVLA 1Y71A 1GXIE 1WXTA 1WA7A 2X35A 1LPLA 5CKBA 3RMQA 3LWHA 4E7ZA 3OS1A 2DF6A 1VQMA 5GMKj 4A53A 1XNIA 5IN1A 2C0IA 1VQOA 2VV5A 2VXFA 3QDFA 5AT1B 4PFZA 2JOYA 2QGGA 4OB2B 3OYCA 1WHHA 2DAQA 1K9AA 4Z8AA 1VQ9T 4JRQA 4LUDA 1Q81U 4R56A 1X6BA 4D8KA 2V8IA 2EKHA 2B86A 3C4SA 3G71T 3L1AA 5LJ5j 1O75A 3EG0A 1K8AC 1QVFS 2GF7A 2AZSA 5D6YA 4EPCA 3EFOB 1VQ6A 3X26B 1KJWA 1BI1A 1S72A 1K8AU 1LCKA 3I56A 2DBKA 1JBMA 1VQNA 5HK3A 4RTVA 2EQMA 1Y96B 1I5LA 1NM7A 2EJ9A 3RR6A 3OYGA 1UHFA 3MKDA 4CC4B 5LJ5g 1RUWA 4D8DA 3VYHB 4J9FA 4DBRA 1RLQC 1BKBA 1UG1A 4MDXA 6AT1B 1N9RA 2EWNA 4FYVB 1WXUA 4BDYA 1YIJQ 1B7TA 3BFMA 1SF9A 3CCJQ 4AG2C 1LJOA 4IIOA 2FPDA 5GAMd 1Q81R 2YRDA 1KQSP 3SHWA 4D6WA 3LH5A 4XU0A 3QHSA 3R6NA 4BE0A 2DTHA 1ABOA 4QQDA 2P4RA 2M0OA 2AKLA 2HNIA 3SWNC 2RHZA 3CCET 2JJ9A 2ZPHB 3CC7Q 1K8AR 1Z9ZA 5I2SA 2MI6A 2CSIA 2DL7A 2MWOA 4PJOC 3JCMe 1MMNA 2YLBA 3MEVA 3A8LB 5FU7C 5KE3A 3LWIA 2PU9B 1XTDA 2Y4YA 3CCQT 2COWA 4PJOD 4QT7A 4LN2A 2NUTA 1G83A 1SSHA 3SWNA 1Y0MA 1UJ0A 2K3YA 2E4HA 2YHTA 1VQ7T 1FYNA 3MEWA 2NYSA 1YWOA 3A1PA 1VQKT 5DY9A 2DXUA 2RA2A 5LJ3e 1GBQA 3BDUA 4Z02A 1YI2Q 3CC2T 1VQPQ 1T0HA 1M90R 2XHCA 1M1FA 4PJOA 1D1CA 2ENMA 2YT6A 2KROA 3H0FA 1Z9QA 3HL8A 3RESA 1KHIA 4NS5A 4DEXA 4JS5A 2CS7A 4LE9A 1IXDA 1U1TA 1NPPA 1OQKA 4F17A 5LJ3j 2K5FA 2JW4A 1BBZA 4E47A 1B34B 4N0AC 3RKYA 2A08A 3JCMg 3OYYA 2HZYA 4E6RA 2KQWA 4OMMA 2GNCA 3VV0A 1NE8A 3GBQA 4FYWB 1WHKA 4CC2A 1WQWA 1BI3A 3M53A 5GANd 2ZAEA 1X69A 4HCZA 2LDMA 2XK0A 1D1AA 1PCXA 4ZTJA 3OYAA 1WZOA 1WLPB 2JXBA 3JRZA 2CSQA 2RQTA 3OYHA 2YXYA 1I0CA 5LJ3g 2HMAA 3L2VA 1UECA 3KBGA 3WVDB 2QDYB 1ARKA 4F7UF 1YITT 2O2OA 4F14A 2DERA 2YUQA 1SEMA 3OYMA 3CC7A 3L42A 3VS4A 3P8DA 2OI3A 8AT1B 4ZGEB 1BU1A 2F5TX 1YJWA 2OTLA 4M77G 3OYFA 3X20B 2CH4A 4HKEA 3OBWA 4AMCA 1OPKA 4C5IA 4ZGDB 2ABLA 4A4HA 5J39A 2Y90A 3V8KA 1SPKA 4PLIA 1QW1A 3R6OA 2PNIA 2E5QA 2LRQA 1YHQQ 3EGXB 1YJNT 1YI2A 1VQPA 1RADB 3GP8A 2YRCA 2X9HA 3OYBA 4PJOE 1M2VB 1Q95G 2OAUA 3M5AA 3TEEA 5GMKl 1NBEB 3RBBB 2EQUA 2LT1A 1IRXA 2EQIA 2H3JA 3GNGA 4QKUA 4L5GA 2VB6A 1M1GA 2XIDA 3EFSA 2RH2A 1FX7A 2D8HA 1JO8A 2DIQA 3NPFA 3EAEA 2COZA 3I5RA 3O8VA 2VASA 4LDVA 5GJVB 3P8HA 3FC3A 1U1SA 4J6WA 2FEIA 5DLOA 3VUBA 4A4KA 3A5ZB 4CI0C 2KT1A 1I81A 2QQAA 1VIFA 2CZ0B 2DPPB 3LLRA 4J8OA 4DOVA 1D0ZA 4BACA 3GF5A 3MEUA 1GCPA 3QBYA 3CCMT 1KC8C 3UPUA 1YJ9T 1HXDA 1E7OA 2KBTA 4JDSA 2JZ2A 3M56A 4J9EA 1K9MC 1KSWA 2MYSA 1OEBA 1E6HA 1KC8U 4E7HA 1BI0A 3V7SA 2PUKB 1W2BA 3X24B 1UE9A 3EG3A 4XTUA 1UDLA 5HY6A 2RHIA 1Y7XA 3CC4Q 2R5MA 2DRKA 2EYQA 5FROA 1AT1B 3N5BB 1NLOC 2FG0A 2W10A 1ZX6A 1WFWA 1ZSGA 2VGMA 3OS2A 2DTOA 2E3IA 2R58A 3CPWA 2LJ3A 4BE2A 4M77E 3L2UA 3I55T 4C8QG 2DYIA 2LT4A 1R8OB 4IUPA 4AFUC 1K1ZA 1MMGA 2X4JA 1YHQA 1M3AA 4HCCA 1EX4A 3L2QA 2CP5A 1KHCA 2CP0A 3ASKA 4OB0B 5KE2A 2PTKA 3CCST 4C92C 3SD4A 2YUNA 3ZL7C 1MNDA 4C92D 4OMQA 1JJ2A 1GL5A 5LJ5h 2DXBA 1VQ8A 1NEGA 2L2PA 5M9OA 4BUGA 2D0QB 2KXDA 2DD5A 2K9GA 1QP2A 4FYXB 3CMET 2DL8A 2PVDB 3EG9A 5KCOA 4FM4B 1VQOT 4M7DC 3VS1A 3BDLA 1W70A 2O31A 1A0NB 5GAMj 4M7DD 2A3LA 2DFUA 3GLXA 4RCBA 2X4YA 1VYTA 4C92A 4RUGA 4X1VA 3HHTB 4CC7A 1MMAA 2JMCA 2HQXA 2P4TA 3L2WA 3VRYA 4PJLA 4ELYC 4M7AG 1YCSB 2ZZDA 1HJDA 2E3HA 2M1HA 1RI9A 1MV0B 3QJ6A 1ACMB 1OU8A 3VS6A 2NUTB 2M51A 3CCRT 1IHWA 3EGUA 1VYUA 1UGVA 4C0GA 4E7JA 1M8VA 4XTWA 1JJ2S 1KFZA 4M7DA 3SWNB 5CVIA 4ZTFA 4IIMA 1P92A 5GAMg 1S72T 1ZSZC 3QZ5B 4AFZC 1VQ5Q 2YSQA 1QKWA 3TU4K 4C0DB 4F7UA 1VQNT 3CC4A 1FMWA 1TUGB 3LH0A 4E7KA 3CXCP 1QVGA 4PJOB 3UA7A 4N4IA 3OYLA 5CKFA 3X25B 2HBPA 4E7SA 4J5YA 3PMTA 2D1XA 2DILA 9ATCB 2RI2A 4AG1C 4PLLA 2FRYA 2MIOA 5GAN5 4OMFB 2V1RA 4LUEA 1M8MA 2OTJT 1QWFA 1OZ3A 3VS3A 1FMKA 3UWNA 1OOTA 4P5NA 2FZCB 1X75C 4DA4A 4C8QE 1DJ7B 4KUDK 4PJOF 3RDVA 5GANe 3EFRA 3E9FA 2EAYA 2GTOA 2JM9A 1W4SA 2AZVA 2YWWA 5CR2A 3VS7A 4JZ3A 2KYBA 2X4XA 4M75C 3VS2A 4HVVA 4JPBW 3CCLA 4M78G 3JCMP 5DLQE 4KT0E 3OW2P 2YUOA 4LDYA 1VQ6Q 4JLIA 1K4US 3OS0A 2HAXA 4KBMB 2DO3A 3I56Q 2GFAA 2XDBA 3S3NA 5GANj 4WTOB 1UFFA 4ORZA 2V26A 2O4XA 1G3SA 3FIFA 3JB9G 1BI2A 3BW1A 4RTTA 2QYZA 1WX6A 2CZ1B 1QKXA 4VUBA 2CREA 1ABQA 3CBOA 1Q82C 3KXTA 4JJNK 2CP6A 2YUPA 2IVWA 7AT1B 1NYFA 3I5SA 5GAOm 2LP5A 3F70A 1IGQA 2DTIA 1Q82U 2D0NA 3EG2A 1WHJA 5GANg 4M7AE 2VUBA 1VYVA 2KSSA 1VQ5A 3H0HA 1PKTA 4DBFA 4Z88A 2XDPA 2DL5A 3E2UA 4OGEA 5LJ5e 1YIJT 1VQLA 4GBQA 5DM7R 2RPNA 3FDRA 3CCJT 3PE0A 4X9DA 2CP3A 4KRTA 4FL6A 3M9QA 5FLXE 2RMOA 2K7AA 3CD6A 2C0OA 2EYZA 3QO3A 4IKFA 1NLPC 1ZLMA 4K11A 4LDWA 3ER0A 1YP5A 4XU2A 1TS9A 5D7UA 2VYTA 4BI8B 2E64A 1R0CB 4ZNXA 1Q82R 1RACB 3JCMb 1PSFA 2DXTA 5GMKi 2DEUA 2BZXA 3ULRB 2GGRA 4KGZB 3PTAA 4FCYA 2A0FB 4M78E 4L59A 3MP6A 1WGSA 2RQUA 1QCNA 2CH4W 4Y28E 3GPLA 1BCMA 4M75E 2XICA 1QVFP 5GAN7 5GAN3 3GNFB 1D0YA 1FMVA 3L2RA 3JV3A 1ZHIA 4EMGA 3QPHA 2VVKA 4RTXA 5IT9E 5GAOl 3TQ7P 3JSCA 3JCMf 5CQYA 2KNBB 5KYYA 4MZMA 2JTEA 5A0GA 2LQWA 4PL6A 2LC4A 2EIFA 3HPWA 2JM8A 3MHXA 3OB9A 3VRZA 5CK9A 3OMCA 5IXBA 2J6OA 2BIVA 2R5AA 3QIIA 2CUBA 3RIRA 2BE9B 1Y07A 3M0SA 5LJ3f 2R57A 4Y91A 1EZZB 1QMCA 5I22A 3QSUA 2FPFA 3MO8A 4KUIA 2NWMA 4PNOA 3H6ZA 1TUDA 2OX7A 2XG8D 4HT8A 3LW5E 2DD4A 4NL2A 3EH1A 3G71Q 1YJWQ 2OTLQ 1T0JA 2DK3A 3JCMV 4JRKA 3VKIA 3EG9B 1M4ZA 3CCVT 3M55A 1N9SA 2JTFA 2BZYA 2WSCE 1VOMA 1PSEA 4OF1A 2K57A 1QLYA 2XD0A 4C92B 2RK2A 4BDZA 2EGEA 4R0KA 2K79A 4BY6C 1B3QA 3OYJA 2HKNA 1PD0A 2CDTA 4M7DB 3S3OA 1TWBA 2L3QA 2QG9B 3QDRB 2RM4A 5KYXB 2GQVA 2GTJA 4C92F 4F7UB 1BYMA 2MPXC 2K5IA 1N27A 2L8DA 2ZPBB 2ATCB 4J83A 1YHQT 3L2ZA 2BE7D 3UF4A 2MAMA 3M4GA 5GAMh 2DJZA 4M7DF 4OB1B 1TTHB 2KR3A 1IZ6A 1TH7A 3GIBA 2E10A 2J6FA 4PFOA 2XU8A 2CUDA 2COYA 3MEAA 2HKQB 4N0AA 1OX8A 1PHTA 3FJPA 1YWPA 2DVJA 4OB3B 4UC4A 1HYOA 4M77C 2RJEA 2SRCA 3PT9A 4JJDA 4GY5A 5IAYA 1MNEA 1VQ9A 4EMKC 2VC8A 4M77D 2QQRA 1RAHB 2L3SA 2HSPA 5FRNA 4C0FA 5KCHA 3G71A 4HVWA 5CIUA 4Y92A 1HSQA 3VJPA 1VQ7Q 3MJXA 1I5OB 2FPEA 1KG1A 1RAAB 1VQKQ 2NUPA 2LQ8A 2CZ7B 1D3BA 5IH2A 1VIEA 4WF2A 1RAEB 3HRSA 4X9CA 1UGPB 2O4XB 4M77A 3OYNA 2CKKA 2HBWA 4PJJA 3PFSA 5CO7A 1C1AA 1NZ9A 1PM3A 4LD6A 4XTZA 3OYEA 2KI7A 3MPUB 1I8FA 1SHFA 1N6AA 5GAOp 1I4K1 2EVRA 8ATCB 4XAXB 2CP7A 4IUUA 1ZA2B 4J7IA 3OSSC 2AKKA 3CC4T 3QXEB 2FYKA 4BB7A 3CMAQ 2KVQG 3CPFA 2OJ2A 3M4YA 2E12A 3E1SA 1H3ZA 1VQ8Q 3A8OB 3DKMA 4M75F 3RUXA 3TSZA 3NFCA 2IG0A 1JQQA 2FVUA 2X3WD 3LGFA 3INZA 1RABB 5GANh 4RTYA 2QAZA 4OMLA 1YITQ 3QYHB 3CCEA 2L3PA 5C0MA 4ESRA 4E7LA 1N5ZA 4KH0B 1J3TA 4QQ6A 2LZ6B 2YDLA 5J3BA 4EMHA 1VUBA 1HD3A 3NMZC 4BE1A 3MP1A 2RK1A 3C12A 1R0BG 4ANJA 3EH2A 2WACA 4IUTA 2L3RA 2JS0A 1K9MU 1U5SA 1PRMC 2J05A 5KYWA 1VQ7A 2RJFA 4C8QC 2HSEB 4N4GA 1YNZA 4E2FB 3QYGB 1MUZA 1VQKA 4KH1B 1X27A 1YN8A 2DMOA 1OX9A 3CC2A 2X4WA 3M54A 3E9GA 4QQGA 4C8QD 3A8MB 2PVOB 1NPRA 3I35A 2JT4A 2DM1A 4C5HA 1KK7A 3OSVA 1QWEA 4AT1B 1ZUUA 2LCLA 1AWOA 2DE0X 5KH6A 3KFVA 3EGDA 2DRMA 3V8LA 1N8RC 3H8ZA 2KEAA 2DIGA 1N8RU 2F5KA 2VWFA 3M59A 4C8QA 3OY9A 1ZUKA 4TVRA 3PNWC 2KGTA 4FW2A 2KRMA 2RD1A 1W2BS 3OMGA 5KYYB 1G5VA 2KXCA 2XI9A 3J7AF 2Z0WA 1EFNA 2EBPA 5GAMe 3M58A 2QEXT 1ZUYA 3CMAA 1HK9A 1UB4A 3RMSA 3QUIA 3CCLQ 4MMKA 1G3YA 2L89A 5AYFA 3DLMA 2I0NA 2J06A 1KC8R 3EHRA 2E70A 4HXJA 1D09B 1VQMT 3CPWS 3CXCA 3M0UA 3HTRA 1K9MR 4KULA 4M7AC 1K73C 2FL7A 3G4SQ 1WYXA 3JB9I 1YJ9Q 1YITA 2QDLA 5L8RE 2VKNA 2NUZA 1KQ1A 2Y4XA 1ZBXA 1GCQC 2M16A 4M7AD 1M2OA 3OYDA 3ZFJA 3H41A 1K73U 3OYKA 2CYZB 2J7IA 4FU6A 1M3CA 1UEBA 4JRIA 1PG5B 1WIEA 2RB6A 1D1BA 1MV3A 5FU6C 2HEQA 2WSFE 4M7AA 2LQKA 2EW3A 1VQ6T 5KYXA 5FW9A 3G7ZA 1BB9A 3I56T 2DX1A 1UGSB 3CCUQ 1GCQA 1AWXA 4ATOA 4GLMA 1Y57A 3KUFA 1AD5A 3G6EQ 3TREA 3OW2A 5FU7B 1V76A 1BK2A 2RQWA 1OV3A 5HCKA 4F7UG 1RI0A 2MCNA 1VQ4Q 2MOXA 2BUDA 3JCMJ 1RL2A 4B9XA 1JJ2P 1MGQA 3SDZA 2K2MA 4B6MA 4F16A 1ZA1B 1VQLQ 2HQHA 1BIBA 2JVVA 4MDWA 2H8HA 4FSSA 2F69A 1R77A 1B07A 4J9IA 3REBB 1ZSZA 4PKCC 1IO6A 5J26A 2D9TA 2RJCA 1SSFA 4M78C 4X34A 3D7SB 1K73R 1G8XA 2QA4Q 5EC7A 2FHDA 2QXFA 4RG2A 4A4FA 4BY6B 2K2VA 3HRUA 4M78D 3CD6Q 2JMAA 1JXOA 4J6YA 5I21A 2EYYA 1KD1C 1M1KC 2E65A 4DBHA 2DL3A 2DNUA 2HCKA 2DJQA 2RI3A 1PD1A 1C0MA 5I11A 1QVGS 5GAN8 2RF0A 1KD1U 1M1KU 2QQSA 4M75D 4WCIA 4XU1A 1K0XA 4LXCA 3VUZA 3VS0A 3BE3A 3JB9D 4M78A 4XTXA 3CCMA 4NOYA 3G4SA 1YJ9A 3NTIA 3CCRQ 4DEYA 4J9GA 1IHVA 2QASA 4M75A 1SG5A 4OP0A 4HA8A 1YFNA 2NUPB 5LJ5f 5GAN6 2F2WA 3TSWA 5KYUB 4C5EA 2LMJA 1D3BB 5KYNA 4JS4A 4M77B 2ROTA 1T3LA 2KE9A 2E6ZA 4ME7A 2DXCA 4KGXB 4MMLA 4J9HA 4EMKB 3JB9J 1M9SA 5CKHA 3CCUA 4FW1A 3I55A 5CKEA 4J9BA 2H3EB 3V7CA 3G6EA 2OTJQ 2RO0A 2QQBA 2L0AA 1H92A 1KD1R 1W6XA 3EG1A 1VQ4A 5CQXA 4ZN1A 4OGCA 4RTZA 2EGCA 3CCSA 4M77F 2HQEA 5IHNA 2XDDA 2KRSA 1QVFA 4JLGA 3HSBA 4LD9K 2M9UA 2QA4A 3WVEB 3CMEA 4MZPA 4IUQA 4LDUA 3LX7A 1AZEA 2K3XA 3HFOA 1Q81C 3O5ZA 2DYBA 3M0QA 1KQSA 2ED0A 5A0LA 1O9SA 4RTUA 3AHUA 1H8KA 2F1LA 2LQNA 3CC7T 1JEGA 3C95A 4AFQC 2FB7A 2FZGB 2LTOA 1YJWT 2OTLT 1SKUB 3CCRA 4DBQA 1BIAA 1JRIA 1FWZA 1LVKA 3RKWA 4HVUA 2KT8A 5KYWB 1CKAA 1CSKA 2V8KA 1X6GA 2PQWA 3RKXA 3EHQA 3TVTA 2CT4A 3RNJA 3M0PA 1K76A 1GRIA 4C0ZA 5CKDA 1KQSS 1YI2T 1SRMA 3WXMB 3JAME 1VQPT 5ECAA 1WQ7A 1XOVA 1QQJA 1WJQA 1AHJB 1M27C 3EGDB 2HD0A 5GJWB 3T9NA 4GLKA 1Q86C 1H641 3URGA 5CCAA 4RKUE 1M90C 2IIMA 1C6VX 3UATA 2OTJA 1S1NA 4O5VA 1EIFA 1WXBA 4C8QB 2V1QA 2CP2A 2F2XA 1Q86U 1K0SA 1M90U 4PJMA 1RAFB 4XU3A 1VQ9Q 1AOJA 3NTHA 4BI4A 4J6XA 1GBRA 5GAOn 2X3XD 1V29B 5FWCA 1PRLC 2ZPGB 1PNJA 2E6NA 2EQKA 1U8RA 1MMDA 1AZGB 2GBQA 1IREB 2E41A 2I2LA 1LNXA 2B8AA 3S3MA 1NYGA 5IXFA 3J80E 4O6JA 2WSEE 3G1JA 4C8QF 3RERA 1YCYA 4C0DC 3LGLA 2JTMA 2QQ9A 5A0DA 2EYXA 1IGUA 1KQ2A 4QVZA 2A28A 1XQHA 2O9SA 1QVPA 5GAN4 2NLUA 2XKOC 4F04B 3BY7A 3TCJA 2RHUA 1FXXA 2YRVA 4RCCA 1X2QA 4PJOG 4OMOA 1AEYA 1WHMA 2KY9A 5D6XA 4M7AB 1JB0E 3PVQA 1Q86R 3U23A 3X28B 5GMKm 1F1BB 2CT3A 2C0TA 2V8JA 2KMTA 2AHJB 2EQJA 2EPDA 1UGQB 5FRMA 1NEBA 3VU3C 3CEYA 2K5LA 2F2VA 3V7RA 1WDXA 4HCKA 4IUVA 4JRPA 5FU6B 3FB9A 1I1JA 3QWYA 3OQ5A 3CCEQ 4PJNA 4M7AF 3IQLA 2QK0A 3DB4A 4A4EA 1ZSZB 2JS2A 1YIJA 5C6SA 3CMAT 1KIKA 2JNGA 4FSXA 3CCJA 1XJWB 5A2QE 1VQ8T 3LYIA 3AT1B 1Q7YC 3DB3A 3CCQQ 3QKJA 2G6FX 2P0PA 3CCVQ 3MP8A 2FRWA 1Q7YU 1OYXA 3QZ9B 4DOWA 2QGFB 3ZEHA 4OMNA 2AK5A 2KK4A 1AVZC 4ZGJB 2QTVA 5KYUA 3CC2Q 1VA7A 2DETA 4M78B 1RAGB 1TSFA 3OA6A 2K6DA 2GCXA 4J9CA 2PVGB 2LNVA 2VGNA 3QJYA 1H3HA 3CQTA 4EMKA 1SRLA 4EDUA 4M75B 3JCMX 2LX9A 1RLPC 1OU9A 3P8BB 2DLPA 4XK8E 2DZCA 3OBYA 2AIRB 5L23A 1X2KA 3JCMW 3NGPA 4M78F 1IB8A 5I2MA 3FRNA 3DLLA 1M3BA 3SFMA 2SEMA 3CBMA 4CC3A 3VS5A 2GFUA 4ZN3A 1G3WA 3SB2A 2KAFA 3M0TA 2M0YA 1OPLA 3MCAB 5IHIA 2FO0A 1Q7YR 5GAN2 4QVCA 3OYIA 4XTVA 3A8HB 3PIOA 1WNLA 2EJFA 3JB9F 2DL4A 2DEQA 1OULA 2LVMA 4FIBA 5HK0A 5LJ5d 4IURA 2RHYA 4M4ZA 2ED1A 2A37A 2CGHA 3C0CA 4ELZC 3CCLT 2EFIA 4HT9A 2O9VA 4J7FA 4AFSC 3CCQA 4BI3A 1M5Q1 2QI2A 4JUVA 1AWJA 1SHGA 2LX7A 3FEOA 3CCVA 4OVAA 2RQVA 2HL5C 2EYWA 4JJCA 1WJSA 3EFOA 1PKSA 1JXMA 3PIPA 3JCMQ 5GAMf 2KDSA 3REAB 3G4ST 5HKCA 4LNPA 1WHLA 4HCBA 1UGRB 1YJNQ 1X01A 3E19A 3SEMA 4NL3A 1T3SA 1Y96A 1W1FA 1UTIA 1OI1A 1LOJA 4QVDA 1UUEA 4Q5WA 2P0KA 3PMIA 3CBPA 3OS5A 2XMFA 1WI7A 2J6KA 2BZ8A 4XTYA 4V2SA 4A4GA 3QWXX 3H0IA 2MK5A 1X43A 3HFNA 4R55A 2ZPIB 1NJIC 1WHGA 4JZ4A 3META 2CZ6B 2ROLA 4N4HA 4JJBA 1VQ5T 4BD3A 3CCUT 4B9WA 1NJIU 5GMKh 2RQRA 3J81E 3THKA 1PWTA 2RI5A 3G6ET 2HDAA 2DZ9A 4FT4A 1VQ4T 1X6OA 2PZ1A 4PFPA 3UA6A 1VQLT 1NG2A 3NHNA 2D8JA 2HL3A 4C5GA 3CCMQ 1W2BP 3UDCA 5IHKA 1D0XA 2JUFA 1U3OA 3M57A 2YLCA 5D6WA 2OAWA 2KYMA 3S6WA 2QA4T 2EGAA 3JCMd 2VXEA 3ME9A 3CD6T 4EIKA 4C92G 2P0QA 1WJRA 2KRNA 4YTLA 1V1CA 3CPWP 5EG2A 1I07A 3HP9A 1OZ2A 4MZTA 2DA9A 4A54A 2MMPA 2K3BA 4A63B 1N8RR 2X51A 2DKGA 4M7DG 2LCSA 5GANf 3CXCS 5LJ3d 3JB9H 3I55Q 1ZBJA 1NJIR 4II1A 2O88A 5GAOq 1YJNA 4Z89A 2AT1B 2RJDA 2JN0A 3ZBDA 3FJ5A 4J9DA 4L6V5 1U06A 2MWPA 1PC0A 1TUCA 2IPOB 5FWBA 3CCSQ 1QCFA 2MF2A 1B34A 2DVEA 2D6FA 2QEXQ 4CRIA 1WPYA 3PGGA 3QG1A 4XQ3A 4FYYB 1TG0A 2E5KA 4DQ2A 3A98A
chains in the Genus database with same CATH topology
1KSWA 2RN8A 1OEBA 1E6HA 3UF4A 2W0ZA 4RTWA 2LNHB 1G2BA 1JU5C 2KR3A 1UE9A 3EG3A 2BTTA 1UDLA 1GFDA 3I9QA 4HVUA 2KT8A 2J6FA 1CKBA 2DRKA 1CKAA 1CSKA 2CUDA 1X6GA 3M0RA 3EHQA 1NLOC 2FG0A 2W10A 2RNAA 1ZX6A 1WFWA 1PHTA 1ZSGA 1YWPA 2CT4A 2DVJA 3TVTA 3RNJA 2SRCA 3M0PA 1K76A 1GRIA 4JJDA 2LJ3A 1SRMA 5ECAA 1XOVA 2L3SA 4AFUC 1K1ZA 1M27C 2HSPA 1M3AA 4HVWA 5GJWB 2A36A 1M30A 4Y92A 1HSQA 2DBMA 2FPEA 2IIMA 3UATA 1S1NA 1UHCA 1WXBA 2GQIA 2PTKA 5IH2A 2V1QA 2F2XA 1K0SA 2ESWA 2YUNA 3ZL7C 1E6GA 1AOJA 1UJYA 1GBRA 2HBWA 2X3XD 4OMQA 1GL5A 1NEGA 2L2PA 5FWCA 1PRLC 2KXDA 1GFCA 1PNJA 2K9GA 1SHFA 2DL8A 1AZGB 2GBQA 2EVRA 3VS1A 2ECZA 2LJ0A 1W70A 2O31A 1A0NB 1NYGA 5IXFA 2AKKA 1VYTA 2LJ1A 4RUGA 2OJ2A 4X1VA 4CC7A 2JMCA 2EYXA 2A28A 2O9SA 3VRYA 1YCSB 1AWWA 1HJDA 4OMPA 1RI9A 3TSZA 1MV0B 3PVLA 3VS6A 2M51A 1JQQA 1WXTA 1WA7A 3EGUA 1VYUA 1UGVA 2X3WD 2DF6A 1X2QA 1KFZA 4OMOA 1AEYA 4IIMA 4RTYA 4OMLA 2C0IA 3PVQA 2L3PA 4AFZC 4ESRA 2YSQA 1N5ZA 1QKWA 1J3TA 3U23A 1K9AA 2LZ6B 4Z8AA 4LUDA 3UA7A 2CT3A 1X6BA 2C0TA 2YDLA 4D8KA 2EKHA 1HD3A 2B86A 2EPDA 1NEBA 3NMZC 2D1XA 2DILA 2F2VA 4AG1C 1WDXA 4HCKA 2FRYA 2MIOA 3EG0A 1I1JA 2V1RA 3QWYA 4LUEA 1M8MA 2JS0A 1QWFA 2AZSA 1U5SA 3IQLA 1PRMC 2J05A 3VS3A 1FMKA 1OOTA 1YNZA 1MUZA 1KJWA 2JS2A 1X27A 1LCKA 1YN8A 1KIKA 2DMOA 2DBKA 3I35A 2JT4A 2DM1A 2GTOA 4RTVA 2JM9A 2AZVA 1QWEA 3VS7A 2KYBA 1ZUUA 1NM7A 2G6FX 4JZ3A 1AWOA 3VS2A 2DE0X 4HVVA 3KFVA 4JPBW 2FRWA 2DRMA 1UHFA 4CC4B 2KEAA 1RUWA 4D8DA 4J9FA 1RLQC 1UG1A 2YUOA 4OMNA 2AK5A 1K4US 1AVZC 1WXUA 2VWFA 1ZUKA 2KGTA 1VA7A 2KRMA 1UFFA 4AG2C 2KXCA 4ORZA 1EFNA 2K6DA 2EBPA 2FPDA 4IIOA 4J9CA 1ZUYA 3SHWA 1H3HA 3LH5A 3CQTA 4RTTA 1SRLA 1WX6A 1QKXA 2CREA 1ABQA 2I0NA 1RLPC 2J06A 2YUPA 3EHRA 3R6NA 4HXJA 1ABOA 1NYFA 3I5SA 2DLPA 2P4RA 2LP5A 3M0UA 2AKLA 2D0NA 3EG2A 5L23A 1X2KA 1WYXA 3NGPA 2QDLA 2VKNA 2NUZA 1Z9ZA 1GCQC 1M3BA 2CSIA 2DL7A 2SEMA 3H41A 1VYVA 4CC3A 3VS5A 2J7IA 3H0HA 1M3CA 1PKTA 4QT7A 1WIEA 4Z88A 3M0TA 4LN2A 2M0YA 1OPLA 1G83A 5IHIA 2FO0A 1MV3A 2DL5A 1SSHA 1Y0MA 1UJ0A 2HEQA 2DL4A 1FYNA 2EW3A 1YWOA 5FW9A 1BB9A 2DX1A 4GBQA 2RPNA 1GBQA 3PE0A 1GCQA 1T0HA 4M4ZA 1AWXA 2ED1A 4GLMA 2A37A 3C0CA 1Y57A 4KRTA 1AD5A 2ENMA 2YT6A 2KROA 3H0FA 1Z9QA 2RMOA 2K7AA 1BK2A 2RQWA 1OV3A 5HCKA 4DEXA 2MCNA 2O9VA 2C0OA 2EYZA 1NLPC 4LE9A 1ZLMA 4AFSC 2MOXA 4K11A 1YP5A 1AWJA 1SHGA 2LX7A 2RQVA 4F17A 2K2MA 4F16A 4ZNXA 2EYWA 4JJCA 2JW4A 1BBZA 2H8HA 4FSSA 1PKSA 1JXMA 1B07A 4J9IA 2A08A 3REBB 1IO6A 3REAB 4E6RA 4LNPA 4OMMA 2BZXA 2GNCA 3ULRB 3GBQA 2GGRA 3SEMA 4CC2A 5EC7A 1T3SA 2JMAA 1JXOA 2EYYA 1W1FA 1UTIA 1X69A 1UUEA 2DL3A 2DNUA 2RQUA 2HCKA 2CH4W 2DJQA 5I11A 2JXBA 1WLPB 2CSQA 2RF0A 2RQTA 2XMFA 1WI7A 2J6KA 2BZ8A 4WCIA 1I0CA 3QWXX 3H0IA 3JV3A 1UECA 1X43A 2VVKA 1ARKA 1K0XA 4RTXA 3VS0A 2O2OA 4F14A 2YUQA 2KNBB 4JZ4A 1SEMA 2ROLA 4JJBA 2JTEA 3VS4A 2RQRA 3THKA 1PWTA 4DEYA 4J9GA 2OI3A 2LQWA 2HDAA 1BU1A 3VRZA 2JM8A 5IXBA 2J6OA 2CUBA 2PZ1A 2CH4A 1OPKA 2F2WA 3TSWA 3UA6A 3M0SA 2ABLA 2LMJA 1SPKA 1NG2A 3NHNA 5I22A 2D8JA 2FPFA 2NWMA 2PNIA 1TUDA 2ROTA 1T3LA 2KE9A 5IHKA 1U3OA 4J9HA 2OAWA 2KYMA 2EGAA 1T0JA 4EIKA 4J9BA 2KRNA 2L0AA 1H92A 1V1CA 1W6XA 1I07A 2BZYA 3RBBB 3EG1A 2DA9A 2EQIA 1QLYA 4RTZA 2K3BA 4A63B 2EGCA 2LCSA 2EGEA 5IHNA 4R0KA 2K79A 2D8HA 1ZBJA 1JO8A 3NPFA 3I5RA 2KRSA 5GJVB 2O88A 1B3QA 4Z89A 2FEIA 3FJ5A 2CDTA 4J9DA 2L3QA 1U06A 1AZEA 2KT1A 1TUCA 5FWBA 3O5ZA 2DYBA 3M0QA 1QCFA 2GTJA 2ED0A 4RTUA 1H8KA 1GCPA 2LQNA 1JEGA 1TG0A 2E5KA 1E7OA 2KBTA 4AFQC 4J9EA 3A98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSW A;  2RN8 A;  1OEB A;  1E6H A;  3UF4 A;  2W0Z A;  4RTW A;  2LNH B;  1G2B A;  1JU5 C;  2KR3 A;  1UE9 A;  3EG3 A;  2BTT A;  1UDL A;  1GFD A;  3I9Q A;  4HVU A;  2KT8 A;  2J6F A;  1CKB A;  2DRK A;  1CKA A;  1CSK A;  2CUD A;  1X6G A;  3M0R A;  3EHQ A;  1NLO C;  2FG0 A;  2W10 A;  2RNA A;  1ZX6 A;  1WFW A;  1PHT A;  1ZSG A;  1YWP A;  2CT4 A;  2DVJ A;  3TVT A;  3RNJ A;  2SRC A;  3M0P A;  1K76 A;  1GRI A;  4JJD A;  2LJ3 A;  1SRM A;  5ECA A;  1XOV A;  2L3S A;  4AFU C;  1K1Z A;  1M27 C;  2HSP A;  1M3A A;  4HVW A;  5GJW B;  2A36 A;  1M30 A;  4Y92 A;  1HSQ A;  2DBM A;  2FPE A;  2IIM A;  3UAT A;  1S1N A;  1UHC A;  1WXB A;  2GQI A;  2PTK A;  5IH2 A;  2V1Q A;  2F2X A;  1K0S A;  2ESW A;  2YUN A;  3ZL7 C;  1E6G A;  1AOJ A;  1UJY A;  1GBR A;  2HBW A;  2X3X D;  4OMQ A;  1GL5 A;  1NEG A;  2L2P A;  5FWC A;  1PRL C;  2KXD A;  1GFC A;  1PNJ A;  2K9G A;  1SHF A;  2DL8 A;  1AZG B;  2GBQ A;  2EVR A;  3VS1 A;  2ECZ A;  2LJ0 A;  1W70 A;  2O31 A;  1A0N B;  1NYG A;  5IXF A;  2AKK A;  1VYT A;  2LJ1 A;  4RUG A;  2OJ2 A;  4X1V A;  4CC7 A;  2JMC A;  2EYX A;  2A28 A;  2O9S A;  3VRY A;  1YCS B;  1AWW A;  1HJD A;  4OMP A;  1RI9 A;  3TSZ A;  1MV0 B;  3PVL A;  3VS6 A;  2M51 A;  1JQQ A;  1WXT A;  1WA7 A;  3EGU A;  1VYU A;  1UGV A;  2X3W D;  2DF6 A;  1X2Q A;  1KFZ A;  4OMO A;  1AEY A;  4IIM A;  4RTY A;  4OML A;  2C0I A;  3PVQ A;  2L3P A;  4AFZ C;  4ESR A;  2YSQ A;  1N5Z A;  1QKW A;  1J3T A;  3U23 A;  1K9A A;  2LZ6 B;  4Z8A A;  4LUD A;  3UA7 A;  2CT3 A;  1X6B A;  2C0T A;  2YDL A;  4D8K A;  2EKH A;  1HD3 A;  2B86 A;  2EPD A;  1NEB A;  3NMZ C;  2D1X A;  2DIL A;  2F2V A;  4AG1 C;  1WDX A;  4HCK A;  2FRY A;  2MIO A;  3EG0 A;  1I1J A;  2V1R A;  3QWY A;  4LUE A;  1M8M A;  2JS0 A;  1QWF A;  2AZS A;  1U5S A;  3IQL A;  1PRM C;  2J05 A;  3VS3 A;  1FMK A;  1OOT A;  1YNZ A;  1MUZ A;  1KJW A;  2JS2 A;  1X27 A;  1LCK A;  1YN8 A;  1KIK A;  2DMO A;  2DBK A;  3I35 A;  2JT4 A;  2DM1 A;  2GTO A;  4RTV A;  2JM9 A;  2AZV A;  1QWE A;  3VS7 A;  2KYB A;  1ZUU A;  1NM7 A;  2G6F X;  4JZ3 A;  1AWO A;  3VS2 A;  2DE0 X;  4HVV A;  3KFV A;  4JPB W;  2FRW A;  2DRM A;  1UHF A;  4CC4 B;  2KEA A;  1RUW A;  4D8D A;  4J9F A;  1RLQ C;  1UG1 A;  2YUO A;  4OMN A;  2AK5 A;  1K4U S;  1AVZ C;  1WXU A;  2VWF A;  1ZUK A;  2KGT A;  1VA7 A;  2KRM A;  1UFF A;  4AG2 C;  2KXC A;  4ORZ A;  1EFN A;  2K6D A;  2EBP A;  2FPD A;  4IIO A;  4J9C A;  1ZUY A;  3SHW A;  1H3H A;  3LH5 A;  3CQT A;  4RTT A;  1SRL A;  1WX6 A;  1QKX A;  2CRE A;  1ABQ A;  2I0N A;  1RLP C;  2J06 A;  2YUP A;  3EHR A;  3R6N A;  4HXJ A;  1ABO A;  1NYF A;  3I5S A;  2DLP A;  2P4R A;  2LP5 A;  3M0U A;  2AKL A;  2D0N A;  3EG2 A;  5L23 A;  1X2K A;  1WYX A;  3NGP A;  2QDL A;  2VKN A;  2NUZ A;  1Z9Z A;  1GCQ C;  1M3B A;  2CSI A;  2DL7 A;  2SEM A;  3H41 A;  1VYV A;  4CC3 A;  3VS5 A;  2J7I A;  3H0H A;  1M3C A;  1PKT A;  4QT7 A;  1WIE A;  4Z88 A;  3M0T A;  4LN2 A;  2M0Y A;  1OPL A;  1G83 A;  5IHI A;  2FO0 A;  1MV3 A;  2DL5 A;  1SSH A;  1Y0M A;  1UJ0 A;  2HEQ A;  2DL4 A;  1FYN A;  2EW3 A;  1YWO A;  5FW9 A;  1BB9 A;  2DX1 A;  4GBQ A;  2RPN A;  1GBQ A;  3PE0 A;  1GCQ A;  1T0H A;  4M4Z A;  1AWX A;  2ED1 A;  4GLM A;  2A37 A;  3C0C A;  1Y57 A;  4KRT A;  1AD5 A;  2ENM A;  2YT6 A;  2KRO A;  3H0F A;  1Z9Q A;  2RMO A;  2K7A A;  1BK2 A;  2RQW A;  1OV3 A;  5HCK A;  4DEX A;  2MCN A;  2O9V A;  2C0O A;  2EYZ A;  1NLP C;  4LE9 A;  1ZLM A;  4AFS C;  2MOX A;  4K11 A;  1YP5 A;  1AWJ A;  1SHG A;  2LX7 A;  2RQV A;  4F17 A;  2K2M A;  4F16 A;  4ZNX A;  2EYW A;  4JJC A;  2JW4 A;  1BBZ A;  2H8H A;  4FSS A;  1PKS A;  1JXM A;  1B07 A;  4J9I A;  2A08 A;  3REB B;  1IO6 A;  3REA B;  4E6R A;  4LNP A;  4OMM A;  2BZX A;  2GNC A;  3ULR B;  3GBQ A;  2GGR A;  3SEM A;  4CC2 A;  5EC7 A;  1T3S A;  2JMA A;  1JXO A;  2EYY A;  1W1F A;  1UTI A;  1X69 A;  1UUE A;  2DL3 A;  2DNU A;  2RQU A;  2HCK A;  2CH4 W;  2DJQ A;  5I11 A;  2JXB A;  1WLP B;  2CSQ A;  2RF0 A;  2RQT A;  2XMF A;  1WI7 A;  2J6K A;  2BZ8 A;  4WCI A;  1I0C A;  3QWX X;  3H0I A;  3JV3 A;  1UEC A;  1X43 A;  2VVK A;  1ARK A;  1K0X A;  4RTX A;  3VS0 A;  2O2O A;  4F14 A;  2YUQ A;  2KNB B;  4JZ4 A;  1SEM A;  2ROL A;  4JJB A;  2JTE A;  3VS4 A;  2RQR A;  3THK A;  1PWT A;  4DEY A;  4J9G A;  2OI3 A;  2LQW A;  2HDA A;  1BU1 A;  3VRZ A;  2JM8 A;  5IXB A;  2J6O A;  2CUB A;  2PZ1 A;  2CH4 A;  1OPK A;  2F2W A;  3TSW A;  3UA6 A;  3M0S A;  2ABL A;  2LMJ A;  1SPK A;  1NG2 A;  3NHN A;  5I22 A;  2D8J A;  2FPF A;  2NWM A;  2PNI A;  1TUD A;  2ROT A;  1T3L A;  2KE9 A;  5IHK A;  1U3O A;  4J9H A;  2OAW A;  2KYM A;  2EGA A;  1T0J A;  4EIK A;  4J9B A;  2KRN A;  2L0A A;  1H92 A;  1V1C A;  1W6X A;  1I07 A;  2BZY A;  3RBB B;  3EG1 A;  2DA9 A;  2EQI A;  1QLY A;  4RTZ A;  2K3B A;  4A63 B;  2EGC A;  2LCS A;  2EGE A;  5IHN A;  4R0K A;  2K79 A;  2D8H A;  1ZBJ A;  1JO8 A;  3NPF A;  3I5R A;  2KRS A;  5GJV B;  2O88 A;  1B3Q A;  4Z89 A;  2FEI A;  3FJ5 A;  2CDT A;  4J9D A;  2L3Q A;  1U06 A;  1AZE A;  2KT1 A;  1TUC A;  5FWB A;  3O5Z A;  2DYB A;  3M0Q A;  1QCF A;  2GTJ A;  2ED0 A;  4RTU A;  1H8K A;  1GCP A;  2LQN A;  1JEG A;  1TG0 A;  2E5K A;  1E7O A;  2KBT A;  4AFQ C;  4J9E A;  3A98 A; 
#chains in the Genus database with same CATH topology
 2RN8 A;  1VQM Q;  3CME Q;  3C94 A;  1VQO Q;  2W0Z A;  4RTW A;  2LNH B;  1G2B A;  1JU5 C;  1BCO A;  3H9N A;  2BTT A;  2ZPF B;  1GFD A;  3I9Q A;  1QP3 A;  3OW2 S;  4E7I A;  1CKB A;  2LCC A;  4LDX A;  1YBY A;  2O01 E;  2E1H A;  3M0R A;  2RNA A;  2EJG A;  3GOX A;  2A7Y A;  1TOV A;  2RHX A;  1TU0 B;  4RMO A;  2EKO A;  4FT2 A;  3JCM h;  2A36 A;  1M30 A;  1QVG P;  2DBM A;  3HRT A;  1MHN A;  1S72 Q;  1UHC A;  4M75 G;  2GQI A;  4KGV B;  1VQN Q;  2C06 A;  3V8J A;  2ESW A;  1E6G A;  1UJY A;  1QCO A;  4C92 E;  2ZGW A;  5LL6 S;  2ZPE B;  3VYG A;  2ZCF B;  3EGX A;  3Q1J A;  4PK4 A;  5LJ3 h;  1GFC A;  3UT1 A;  3FLG A;  2BKD N;  1M2V A;  5GAO r;  2G3R A;  2ECZ A;  3NTK A;  3HKS A;  2LJ0 A;  2L5Q A;  2K4Y A;  1M1K R;  4M7D E;  4RG8 A;  5GMK e;  3A8G B;  2QTX A;  1TXQ A;  2LJ1 A;  2PUO B;  5CAI A;  2M02 A;  1G3T A;  4F7U E;  2QEX A;  1ZQ1 A;  2FZK B;  2P84 A;  1AWW A;  4QW2 A;  4OMP A;  1RAI B;  3JCM c;  3PVL A;  1Y71 A;  1GXI E;  1WXT A;  1WA7 A;  2X35 A;  1LPL A;  5CKB A;  3RMQ A;  3LWH A;  4E7Z A;  3OS1 A;  2DF6 A;  1VQM A;  5GMK j;  4A53 A;  1XNI A;  5IN1 A;  2C0I A;  1VQO A;  2VV5 A;  2VXF A;  3QDF A;  5AT1 B;  4PFZ A;  2JOY A;  2QGG A;  4OB2 B;  3OYC A;  1WHH A;  2DAQ A;  1K9A A;  4Z8A A;  1VQ9 T;  4JRQ A;  4LUD A;  1Q81 U;  4R56 A;  1X6B A;  4D8K A;  2V8I A;  2EKH A;  2B86 A;  3C4S A;  3G71 T;  3L1A A;  5LJ5 j;  1O75 A;  3EG0 A;  1K8A C;  1QVF S;  2GF7 A;  2AZS A;  5D6Y A;  4EPC A;  3EFO B;  1VQ6 A;  3X26 B;  1KJW A;  1BI1 A;  1S72 A;  1K8A U;  1LCK A;  3I56 A;  2DBK A;  1JBM A;  1VQN A;  5HK3 A;  4RTV A;  2EQM A;  1Y96 B;  1I5L A;  1NM7 A;  2EJ9 A;  3RR6 A;  3OYG A;  1UHF A;  3MKD A;  4CC4 B;  5LJ5 g;  1RUW A;  4D8D A;  3VYH B;  4J9F A;  4DBR A;  1RLQ C;  1BKB A;  1UG1 A;  4MDX A;  6AT1 B;  1N9R A;  2EWN A;  4FYV B;  1WXU A;  4BDY A;  1YIJ Q;  1B7T A;  3BFM A;  1SF9 A;  3CCJ Q;  4AG2 C;  1LJO A;  4IIO A;  2FPD A;  5GAM d;  1Q81 R;  2YRD A;  1KQS P;  3SHW A;  4D6W A;  3LH5 A;  4XU0 A;  3QHS A;  3R6N A;  4BE0 A;  2DTH A;  1ABO A;  4QQD A;  2P4R A;  2M0O A;  2AKL A;  2HNI A;  3SWN C;  2RHZ A;  3CCE T;  2JJ9 A;  2ZPH B;  3CC7 Q;  1K8A R;  1Z9Z A;  5I2S A;  2MI6 A;  2CSI A;  2DL7 A;  2MWO A;  4PJO C;  3JCM e;  1MMN A;  2YLB A;  3MEV A;  3A8L B;  5FU7 C;  5KE3 A;  3LWI A;  2PU9 B;  1XTD A;  2Y4Y A;  3CCQ T;  2COW A;  4PJO D;  4QT7 A;  4LN2 A;  2NUT A;  1G83 A;  1SSH A;  3SWN A;  1Y0M A;  1UJ0 A;  2K3Y A;  2E4H A;  2YHT A;  1VQ7 T;  1FYN A;  3MEW A;  2NYS A;  1YWO A;  3A1P A;  1VQK T;  5DY9 A;  2DXU A;  2RA2 A;  5LJ3 e;  1GBQ A;  3BDU A;  4Z02 A;  1YI2 Q;  3CC2 T;  1VQP Q;  1T0H A;  1M90 R;  2XHC A;  1M1F A;  4PJO A;  1D1C A;  2ENM A;  2YT6 A;  2KRO A;  3H0F A;  1Z9Q A;  3HL8 A;  3RES A;  1KHI A;  4NS5 A;  4DEX A;  4JS5 A;  2CS7 A;  4LE9 A;  1IXD A;  1U1T A;  1NPP A;  1OQK A;  4F17 A;  5LJ3 j;  2K5F A;  2JW4 A;  1BBZ A;  4E47 A;  1B34 B;  4N0A C;  3RKY A;  2A08 A;  3JCM g;  3OYY A;  2HZY A;  4E6R A;  2KQW A;  4OMM A;  2GNC A;  3VV0 A;  1NE8 A;  3GBQ A;  4FYW B;  1WHK A;  4CC2 A;  1WQW A;  1BI3 A;  3M53 A;  5GAN d;  2ZAE A;  1X69 A;  4HCZ A;  2LDM A;  2XK0 A;  1D1A A;  1PCX A;  4ZTJ A;  3OYA A;  1WZO A;  1WLP B;  2JXB A;  3JRZ A;  2CSQ A;  2RQT A;  3OYH A;  2YXY A;  1I0C A;  5LJ3 g;  2HMA A;  3L2V A;  1UEC A;  3KBG A;  3WVD B;  2QDY B;  1ARK A;  4F7U F;  1YIT T;  2O2O A;  4F14 A;  2DER A;  2YUQ A;  1SEM A;  3OYM A;  3CC7 A;  3L42 A;  3VS4 A;  3P8D A;  2OI3 A;  8AT1 B;  4ZGE B;  1BU1 A;  2F5T X;  1YJW A;  2OTL A;  4M77 G;  3OYF A;  3X20 B;  2CH4 A;  4HKE A;  3OBW A;  4AMC A;  1OPK A;  4C5I A;  4ZGD B;  2ABL A;  4A4H A;  5J39 A;  2Y90 A;  3V8K A;  1SPK A;  4PLI A;  1QW1 A;  3R6O A;  2PNI A;  2E5Q A;  2LRQ A;  1YHQ Q;  3EGX B;  1YJN T;  1YI2 A;  1VQP A;  1RAD B;  3GP8 A;  2YRC A;  2X9H A;  3OYB A;  4PJO E;  1M2V B;  1Q95 G;  2OAU A;  3M5A A;  3TEE A;  5GMK l;  1NBE B;  3RBB B;  2EQU A;  2LT1 A;  1IRX A;  2EQI A;  2H3J A;  3GNG A;  4QKU A;  4L5G A;  2VB6 A;  1M1G A;  2XID A;  3EFS A;  2RH2 A;  1FX7 A;  2D8H A;  1JO8 A;  2DIQ A;  3NPF A;  3EAE A;  2COZ A;  3I5R A;  3O8V A;  2VAS A;  4LDV A;  5GJV B;  3P8H A;  3FC3 A;  1U1S A;  4J6W A;  2FEI A;  5DLO A;  3VUB A;  4A4K A;  3A5Z B;  4CI0 C;  2KT1 A;  1I81 A;  2QQA A;  1VIF A;  2CZ0 B;  2DPP B;  3LLR A;  4J8O A;  4DOV A;  1D0Z A;  4BAC A;  3GF5 A;  3MEU A;  1GCP A;  3QBY A;  3CCM T;  1KC8 C;  3UPU A;  1YJ9 T;  1HXD A;  1E7O A;  2KBT A;  4JDS A;  2JZ2 A;  3M56 A;  4J9E A;  1K9M C;  1KSW A;  2MYS A;  1OEB A;  1E6H A;  1KC8 U;  4E7H A;  1BI0 A;  3V7S A;  2PUK B;  1W2B A;  3X24 B;  1UE9 A;  3EG3 A;  4XTU A;  1UDL A;  5HY6 A;  2RHI A;  1Y7X A;  3CC4 Q;  2R5M A;  2DRK A;  2EYQ A;  5FRO A;  1AT1 B;  3N5B B;  1NLO C;  2FG0 A;  2W10 A;  1ZX6 A;  1WFW A;  1ZSG A;  2VGM A;  3OS2 A;  2DTO A;  2E3I A;  2R58 A;  3CPW A;  2LJ3 A;  4BE2 A;  4M77 E;  3L2U A;  3I55 T;  4C8Q G;  2DYI A;  2LT4 A;  1R8O B;  4IUP A;  4AFU C;  1K1Z A;  1MMG A;  2X4J A;  1YHQ A;  1M3A A;  4HCC A;  1EX4 A;  3L2Q A;  2CP5 A;  1KHC A;  2CP0 A;  3ASK A;  4OB0 B;  5KE2 A;  2PTK A;  3CCS T;  4C92 C;  3SD4 A;  2YUN A;  3ZL7 C;  1MND A;  4C92 D;  4OMQ A;  1JJ2 A;  1GL5 A;  5LJ5 h;  2DXB A;  1VQ8 A;  1NEG A;  2L2P A;  5M9O A;  4BUG A;  2D0Q B;  2KXD A;  2DD5 A;  2K9G A;  1QP2 A;  4FYX B;  3CME T;  2DL8 A;  2PVD B;  3EG9 A;  5KCO A;  4FM4 B;  1VQO T;  4M7D C;  3VS1 A;  3BDL A;  1W70 A;  2O31 A;  1A0N B;  5GAM j;  4M7D D;  2A3L A;  2DFU A;  3GLX A;  4RCB A;  2X4Y A;  1VYT A;  4C92 A;  4RUG A;  4X1V A;  3HHT B;  4CC7 A;  1MMA A;  2JMC A;  2HQX A;  2P4T A;  3L2W A;  3VRY A;  4PJL A;  4ELY C;  4M7A G;  1YCS B;  2ZZD A;  1HJD A;  2E3H A;  2M1H A;  1RI9 A;  1MV0 B;  3QJ6 A;  1ACM B;  1OU8 A;  3VS6 A;  2NUT B;  2M51 A;  3CCR T;  1IHW A;  3EGU A;  1VYU A;  1UGV A;  4C0G A;  4E7J A;  1M8V A;  4XTW A;  1JJ2 S;  1KFZ A;  4M7D A;  3SWN B;  5CVI A;  4ZTF A;  4IIM A;  1P92 A;  5GAM g;  1S72 T;  1ZSZ C;  3QZ5 B;  4AFZ C;  1VQ5 Q;  2YSQ A;  1QKW A;  3TU4 K;  4C0D B;  4F7U A;  1VQN T;  3CC4 A;  1FMW A;  1TUG B;  3LH0 A;  4E7K A;  3CXC P;  1QVG A;  4PJO B;  3UA7 A;  4N4I A;  3OYL A;  5CKF A;  3X25 B;  2HBP A;  4E7S A;  4J5Y A;  3PMT A;  2D1X A;  2DIL A;  9ATC B;  2RI2 A;  4AG1 C;  4PLL A;  2FRY A;  2MIO A;  5GAN 5;  4OMF B;  2V1R A;  4LUE A;  1M8M A;  2OTJ T;  1QWF A;  1OZ3 A;  3VS3 A;  1FMK A;  3UWN A;  1OOT A;  4P5N A;  2FZC B;  1X75 C;  4DA4 A;  4C8Q E;  1DJ7 B;  4KUD K;  4PJO F;  3RDV A;  5GAN e;  3EFR A;  3E9F A;  2EAY A;  2GTO A;  2JM9 A;  1W4S A;  2AZV A;  2YWW A;  5CR2 A;  3VS7 A;  4JZ3 A;  2KYB A;  2X4X A;  4M75 C;  3VS2 A;  4HVV A;  4JPB W;  3CCL A;  4M78 G;  3JCM P;  5DLQ E;  4KT0 E;  3OW2 P;  2YUO A;  4LDY A;  1VQ6 Q;  4JLI A;  1K4U S;  3OS0 A;  2HAX A;  4KBM B;  2DO3 A;  3I56 Q;  2GFA A;  2XDB A;  3S3N A;  5GAN j;  4WTO B;  1UFF A;  4ORZ A;  2V26 A;  2O4X A;  1G3S A;  3FIF A;  3JB9 G;  1BI2 A;  3BW1 A;  4RTT A;  2QYZ A;  1WX6 A;  2CZ1 B;  1QKX A;  4VUB A;  2CRE A;  1ABQ A;  3CBO A;  1Q82 C;  3KXT A;  4JJN K;  2CP6 A;  2YUP A;  2IVW A;  7AT1 B;  1NYF A;  3I5S A;  5GAO m;  2LP5 A;  3F70 A;  1IGQ A;  2DTI A;  1Q82 U;  2D0N A;  3EG2 A;  1WHJ A;  5GAN g;  4M7A E;  2VUB A;  1VYV A;  2KSS A;  1VQ5 A;  3H0H A;  1PKT A;  4DBF A;  4Z88 A;  2XDP A;  2DL5 A;  3E2U A;  4OGE A;  5LJ5 e;  1YIJ T;  1VQL A;  4GBQ A;  5DM7 R;  2RPN A;  3FDR A;  3CCJ T;  3PE0 A;  4X9D A;  2CP3 A;  4KRT A;  4FL6 A;  3M9Q A;  5FLX E;  2RMO A;  2K7A A;  3CD6 A;  2C0O A;  2EYZ A;  3QO3 A;  4IKF A;  1NLP C;  1ZLM A;  4K11 A;  4LDW A;  3ER0 A;  1YP5 A;  4XU2 A;  1TS9 A;  5D7U A;  2VYT A;  4BI8 B;  2E64 A;  1R0C B;  4ZNX A;  1Q82 R;  1RAC B;  3JCM b;  1PSF A;  2DXT A;  5GMK i;  2DEU A;  2BZX A;  3ULR B;  2GGR A;  4KGZ B;  3PTA A;  4FCY A;  2A0F B;  4M78 E;  4L59 A;  3MP6 A;  1WGS A;  2RQU A;  1QCN A;  2CH4 W;  4Y28 E;  3GPL A;  1BCM A;  4M75 E;  2XIC A;  1QVF P;  5GAN 7;  5GAN 3;  3GNF B;  1D0Y A;  1FMV A;  3L2R A;  3JV3 A;  1ZHI A;  4EMG A;  3QPH A;  2VVK A;  4RTX A;  5IT9 E;  5GAO l;  3TQ7 P;  3JSC A;  3JCM f;  5CQY A;  2KNB B;  5KYY A;  4MZM A;  2JTE A;  5A0G A;  2LQW A;  4PL6 A;  2LC4 A;  2EIF A;  3HPW A;  2JM8 A;  3MHX A;  3OB9 A;  3VRZ A;  5CK9 A;  3OMC A;  5IXB A;  2J6O A;  2BIV A;  2R5A A;  3QII A;  2CUB A;  3RIR A;  2BE9 B;  1Y07 A;  3M0S A;  5LJ3 f;  2R57 A;  4Y91 A;  1EZZ B;  1QMC A;  5I22 A;  3QSU A;  2FPF A;  3MO8 A;  4KUI A;  2NWM A;  4PNO A;  3H6Z A;  1TUD A;  2OX7 A;  2XG8 D;  4HT8 A;  3LW5 E;  2DD4 A;  4NL2 A;  3EH1 A;  3G71 Q;  1YJW Q;  2OTL Q;  1T0J A;  2DK3 A;  3JCM V;  4JRK A;  3VKI A;  3EG9 B;  1M4Z A;  3CCV T;  3M55 A;  1N9S A;  2JTF A;  2BZY A;  2WSC E;  1VOM A;  1PSE A;  4OF1 A;  2K57 A;  1QLY A;  2XD0 A;  4C92 B;  2RK2 A;  4BDZ A;  2EGE A;  4R0K A;  2K79 A;  4BY6 C;  1B3Q A;  3OYJ A;  2HKN A;  1PD0 A;  2CDT A;  4M7D B;  3S3O A;  1TWB A;  2L3Q A;  2QG9 B;  3QDR B;  2RM4 A;  5KYX B;  2GQV A;  2GTJ A;  4C92 F;  4F7U B;  1BYM A;  2MPX C;  2K5I A;  1N27 A;  2L8D A;  2ZPB B;  2ATC B;  4J83 A;  1YHQ T;  3L2Z A;  2BE7 D;  3UF4 A;  2MAM A;  3M4G A;  5GAM h;  2DJZ A;  4M7D F;  4OB1 B;  1TTH B;  2KR3 A;  1IZ6 A;  1TH7 A;  3GIB A;  2E10 A;  2J6F A;  4PFO A;  2XU8 A;  2CUD A;  2COY A;  3MEA A;  2HKQ B;  4N0A A;  1OX8 A;  1PHT A;  3FJP A;  1YWP A;  2DVJ A;  4OB3 B;  4UC4 A;  1HYO A;  4M77 C;  2RJE A;  2SRC A;  3PT9 A;  4JJD A;  4GY5 A;  5IAY A;  1MNE A;  1VQ9 A;  4EMK C;  2VC8 A;  4M77 D;  2QQR A;  1RAH B;  2L3S A;  2HSP A;  5FRN A;  4C0F A;  5KCH A;  3G71 A;  4HVW A;  5CIU A;  4Y92 A;  1HSQ A;  3VJP A;  1VQ7 Q;  3MJX A;  1I5O B;  2FPE A;  1KG1 A;  1RAA B;  1VQK Q;  2NUP A;  2LQ8 A;  2CZ7 B;  1D3B A;  5IH2 A;  1VIE A;  4WF2 A;  1RAE B;  3HRS A;  4X9C A;  1UGP B;  2O4X B;  4M77 A;  3OYN A;  2CKK A;  2HBW A;  4PJJ A;  3PFS A;  5CO7 A;  1C1A A;  1NZ9 A;  1PM3 A;  4LD6 A;  4XTZ A;  3OYE A;  2KI7 A;  3MPU B;  1I8F A;  1SHF A;  1N6A A;  5GAO p;  1I4K 1;  2EVR A;  8ATC B;  4XAX B;  2CP7 A;  4IUU A;  1ZA2 B;  4J7I A;  3OSS C;  2AKK A;  3CC4 T;  3QXE B;  2FYK A;  4BB7 A;  3CMA Q;  2KVQ G;  3CPF A;  2OJ2 A;  3M4Y A;  2E12 A;  3E1S A;  1H3Z A;  1VQ8 Q;  3A8O B;  3DKM A;  4M75 F;  3RUX A;  3TSZ A;  3NFC A;  2IG0 A;  1JQQ A;  2FVU A;  2X3W D;  3LGF A;  3INZ A;  1RAB B;  5GAN h;  4RTY A;  2QAZ A;  4OML A;  1YIT Q;  3QYH B;  3CCE A;  2L3P A;  5C0M A;  4ESR A;  4E7L A;  1N5Z A;  4KH0 B;  1J3T A;  4QQ6 A;  2LZ6 B;  2YDL A;  5J3B A;  4EMH A;  1VUB A;  1HD3 A;  3NMZ C;  4BE1 A;  3MP1 A;  2RK1 A;  3C12 A;  1R0B G;  4ANJ A;  3EH2 A;  2WAC A;  4IUT A;  2L3R A;  2JS0 A;  1K9M U;  1U5S A;  1PRM C;  2J05 A;  5KYW A;  1VQ7 A;  2RJF A;  4C8Q C;  2HSE B;  4N4G A;  1YNZ A;  4E2F B;  3QYG B;  1MUZ A;  1VQK A;  4KH1 B;  1X27 A;  1YN8 A;  2DMO A;  1OX9 A;  3CC2 A;  2X4W A;  3M54 A;  3E9G A;  4QQG A;  4C8Q D;  3A8M B;  2PVO B;  1NPR A;  3I35 A;  2JT4 A;  2DM1 A;  4C5H A;  1KK7 A;  3OSV A;  1QWE A;  4AT1 B;  1ZUU A;  2LCL A;  1AWO A;  2DE0 X;  5KH6 A;  3KFV A;  3EGD A;  2DRM A;  3V8L A;  1N8R C;  3H8Z A;  2KEA A;  2DIG A;  1N8R U;  2F5K A;  2VWF A;  3M59 A;  4C8Q A;  3OY9 A;  1ZUK A;  4TVR A;  3PNW C;  2KGT A;  4FW2 A;  2KRM A;  2RD1 A;  1W2B S;  3OMG A;  5KYY B;  1G5V A;  2KXC A;  2XI9 A;  3J7A F;  2Z0W A;  1EFN A;  2EBP A;  5GAM e;  3M58 A;  2QEX T;  1ZUY A;  3CMA A;  1HK9 A;  1UB4 A;  3RMS A;  3QUI A;  3CCL Q;  4MMK A;  1G3Y A;  2L89 A;  5AYF A;  3DLM A;  2I0N A;  2J06 A;  1KC8 R;  3EHR A;  2E70 A;  4HXJ A;  1D09 B;  1VQM T;  3CPW S;  3CXC A;  3M0U A;  3HTR A;  1K9M R;  4KUL A;  4M7A C;  1K73 C;  2FL7 A;  3G4S Q;  1WYX A;  3JB9 I;  1YJ9 Q;  1YIT A;  2QDL A;  5L8R E;  2VKN A;  2NUZ A;  1KQ1 A;  2Y4X A;  1ZBX A;  1GCQ C;  2M16 A;  4M7A D;  1M2O A;  3OYD A;  3ZFJ A;  3H41 A;  1K73 U;  3OYK A;  2CYZ B;  2J7I A;  4FU6 A;  1M3C A;  1UEB A;  4JRI A;  1PG5 B;  1WIE A;  2RB6 A;  1D1B A;  1MV3 A;  5FU6 C;  2HEQ A;  2WSF E;  4M7A A;  2LQK A;  2EW3 A;  1VQ6 T;  5KYX A;  5FW9 A;  3G7Z A;  1BB9 A;  3I56 T;  2DX1 A;  1UGS B;  3CCU Q;  1GCQ A;  1AWX A;  4ATO A;  4GLM A;  1Y57 A;  3KUF A;  1AD5 A;  3G6E Q;  3TRE A;  3OW2 A;  5FU7 B;  1V76 A;  1BK2 A;  2RQW A;  1OV3 A;  5HCK A;  4F7U G;  1RI0 A;  2MCN A;  1VQ4 Q;  2MOX A;  2BUD A;  3JCM J;  1RL2 A;  4B9X A;  1JJ2 P;  1MGQ A;  3SDZ A;  2K2M A;  4B6M A;  4F16 A;  1ZA1 B;  1VQL Q;  2HQH A;  1BIB A;  2JVV A;  4MDW A;  2H8H A;  4FSS A;  2F69 A;  1R77 A;  1B07 A;  4J9I A;  3REB B;  1ZSZ A;  4PKC C;  1IO6 A;  5J26 A;  2D9T A;  2RJC A;  1SSF A;  4M78 C;  4X34 A;  3D7S B;  1K73 R;  1G8X A;  2QA4 Q;  5EC7 A;  2FHD A;  2QXF A;  4RG2 A;  4A4F A;  4BY6 B;  2K2V A;  3HRU A;  4M78 D;  3CD6 Q;  2JMA A;  1JXO A;  4J6Y A;  5I21 A;  2EYY A;  1KD1 C;  1M1K C;  2E65 A;  4DBH A;  2DL3 A;  2DNU A;  2HCK A;  2DJQ A;  2RI3 A;  1PD1 A;  1C0M A;  5I11 A;  1QVG S;  5GAN 8;  2RF0 A;  1KD1 U;  1M1K U;  2QQS A;  4M75 D;  4WCI A;  4XU1 A;  1K0X A;  4LXC A;  3VUZ A;  3VS0 A;  3BE3 A;  3JB9 D;  4M78 A;  4XTX A;  3CCM A;  4NOY A;  3G4S A;  1YJ9 A;  3NTI A;  3CCR Q;  4DEY A;  4J9G A;  1IHV A;  2QAS A;  4M75 A;  1SG5 A;  4OP0 A;  4HA8 A;  1YFN A;  2NUP B;  5LJ5 f;  5GAN 6;  2F2W A;  3TSW A;  5KYU B;  4C5E A;  2LMJ A;  1D3B B;  5KYN A;  4JS4 A;  4M77 B;  2ROT A;  1T3L A;  2KE9 A;  2E6Z A;  4ME7 A;  2DXC A;  4KGX B;  4MML A;  4J9H A;  4EMK B;  3JB9 J;  1M9S A;  5CKH A;  3CCU A;  4FW1 A;  3I55 A;  5CKE A;  4J9B A;  2H3E B;  3V7C A;  3G6E A;  2OTJ Q;  2RO0 A;  2QQB A;  2L0A A;  1H92 A;  1KD1 R;  1W6X A;  3EG1 A;  1VQ4 A;  5CQX A;  4ZN1 A;  4OGC A;  4RTZ A;  2EGC A;  3CCS A;  4M77 F;  2HQE A;  5IHN A;  2XDD A;  2KRS A;  1QVF A;  4JLG A;  3HSB A;  4LD9 K;  2M9U A;  2QA4 A;  3WVE B;  3CME A;  4MZP A;  4IUQ A;  4LDU A;  3LX7 A;  1AZE A;  2K3X A;  3HFO A;  1Q81 C;  3O5Z A;  2DYB A;  3M0Q A;  1KQS A;  2ED0 A;  5A0L A;  1O9S A;  4RTU A;  3AHU A;  1H8K A;  2F1L A;  2LQN A;  3CC7 T;  1JEG A;  3C95 A;  4AFQ C;  2FB7 A;  2FZG B;  2LTO A;  1YJW T;  2OTL T;  1SKU B;  3CCR A;  4DBQ A;  1BIA A;  1JRI A;  1FWZ A;  1LVK A;  3RKW A;  4HVU A;  2KT8 A;  5KYW B;  1CKA A;  1CSK A;  2V8K A;  1X6G A;  2PQW A;  3RKX A;  3EHQ A;  3TVT A;  2CT4 A;  3RNJ A;  3M0P A;  1K76 A;  1GRI A;  4C0Z A;  5CKD A;  1KQS S;  1YI2 T;  1SRM A;  3WXM B;  3JAM E;  1VQP T;  5ECA A;  1WQ7 A;  1XOV A;  1QQJ A;  1WJQ A;  1AHJ B;  1M27 C;  3EGD B;  2HD0 A;  5GJW B;  3T9N A;  4GLK A;  1Q86 C;  1H64 1;  3URG A;  5CCA A;  4RKU E;  1M90 C;  2IIM A;  1C6V X;  3UAT A;  2OTJ A;  1S1N A;  4O5V A;  1EIF A;  1WXB A;  4C8Q B;  2V1Q A;  2CP2 A;  2F2X A;  1Q86 U;  1K0S A;  1M90 U;  4PJM A;  1RAF B;  4XU3 A;  1VQ9 Q;  1AOJ A;  3NTH A;  4BI4 A;  4J6X A;  1GBR A;  5GAO n;  2X3X D;  1V29 B;  5FWC A;  1PRL C;  2ZPG B;  1PNJ A;  2E6N A;  2EQK A;  1U8R A;  1MMD A;  1AZG B;  2GBQ A;  1IRE B;  2E41 A;  2I2L A;  1LNX A;  2B8A A;  3S3M A;  1NYG A;  5IXF A;  3J80 E;  4O6J A;  2WSE E;  3G1J A;  4C8Q F;  3RER A;  1YCY A;  4C0D C;  3LGL A;  2JTM A;  2QQ9 A;  5A0D A;  2EYX A;  1IGU A;  1KQ2 A;  4QVZ A;  2A28 A;  1XQH A;  2O9S A;  1QVP A;  5GAN 4;  2NLU A;  2XKO C;  4F04 B;  3BY7 A;  3TCJ A;  2RHU A;  1FXX A;  2YRV A;  4RCC A;  1X2Q A;  4PJO G;  4OMO A;  1AEY A;  1WHM A;  2KY9 A;  5D6X A;  4M7A B;  1JB0 E;  3PVQ A;  1Q86 R;  3U23 A;  3X28 B;  5GMK m;  1F1B B;  2CT3 A;  2C0T A;  2V8J A;  2KMT A;  2AHJ B;  2EQJ A;  2EPD A;  1UGQ B;  5FRM A;  1NEB A;  3VU3 C;  3CEY A;  2K5L A;  2F2V A;  3V7R A;  1WDX A;  4HCK A;  4IUV A;  4JRP A;  5FU6 B;  3FB9 A;  1I1J A;  3QWY A;  3OQ5 A;  3CCE Q;  4PJN A;  4M7A F;  3IQL A;  2QK0 A;  3DB4 A;  4A4E A;  1ZSZ B;  2JS2 A;  1YIJ A;  5C6S A;  3CMA T;  1KIK A;  2JNG A;  4FSX A;  3CCJ A;  1XJW B;  5A2Q E;  1VQ8 T;  3LYI A;  3AT1 B;  1Q7Y C;  3DB3 A;  3CCQ Q;  3QKJ A;  2G6F X;  2P0P A;  3CCV Q;  3MP8 A;  2FRW A;  1Q7Y U;  1OYX A;  3QZ9 B;  4DOW A;  2QGF B;  3ZEH A;  4OMN A;  2AK5 A;  2KK4 A;  1AVZ C;  4ZGJ B;  2QTV A;  5KYU A;  3CC2 Q;  1VA7 A;  2DET A;  4M78 B;  1RAG B;  1TSF A;  3OA6 A;  2K6D A;  2GCX A;  4J9C A;  2PVG B;  2LNV A;  2VGN A;  3QJY A;  1H3H A;  3CQT A;  4EMK A;  1SRL A;  4EDU A;  4M75 B;  3JCM X;  2LX9 A;  1RLP C;  1OU9 A;  3P8B B;  2DLP A;  4XK8 E;  2DZC A;  3OBY A;  2AIR B;  5L23 A;  1X2K A;  3JCM W;  3NGP A;  4M78 F;  1IB8 A;  5I2M A;  3FRN A;  3DLL A;  1M3B A;  3SFM A;  2SEM A;  3CBM A;  4CC3 A;  3VS5 A;  2GFU A;  4ZN3 A;  1G3W A;  3SB2 A;  2KAF A;  3M0T A;  2M0Y A;  1OPL A;  3MCA B;  5IHI A;  2FO0 A;  1Q7Y R;  5GAN 2;  4QVC A;  3OYI A;  4XTV A;  3A8H B;  3PIO A;  1WNL A;  2EJF A;  3JB9 F;  2DL4 A;  2DEQ A;  1OUL A;  2LVM A;  4FIB A;  5HK0 A;  5LJ5 d;  4IUR A;  2RHY A;  4M4Z A;  2ED1 A;  2A37 A;  2CGH A;  3C0C A;  4ELZ C;  3CCL T;  2EFI A;  4HT9 A;  2O9V A;  4J7F A;  4AFS C;  3CCQ A;  4BI3 A;  1M5Q 1;  2QI2 A;  4JUV A;  1AWJ A;  1SHG A;  2LX7 A;  3FEO A;  3CCV A;  4OVA A;  2RQV A;  2HL5 C;  2EYW A;  4JJC A;  1WJS A;  3EFO A;  1PKS A;  1JXM A;  3PIP A;  3JCM Q;  5GAM f;  2KDS A;  3REA B;  3G4S T;  5HKC A;  4LNP A;  1WHL A;  4HCB A;  1UGR B;  1YJN Q;  1X01 A;  3E19 A;  3SEM A;  4NL3 A;  1T3S A;  1Y96 A;  1W1F A;  1UTI A;  1OI1 A;  1LOJ A;  4QVD A;  1UUE A;  4Q5W A;  2P0K A;  3PMI A;  3CBP A;  3OS5 A;  2XMF A;  1WI7 A;  2J6K A;  2BZ8 A;  4XTY A;  4V2S A;  4A4G A;  3QWX X;  3H0I A;  2MK5 A;  1X43 A;  3HFN A;  4R55 A;  2ZPI B;  1NJI C;  1WHG A;  4JZ4 A;  3MET A;  2CZ6 B;  2ROL A;  4N4H A;  4JJB A;  1VQ5 T;  4BD3 A;  3CCU T;  4B9W A;  1NJI U;  5GMK h;  2RQR A;  3J81 E;  3THK A;  1PWT A;  2RI5 A;  3G6E T;  2HDA A;  2DZ9 A;  4FT4 A;  1VQ4 T;  1X6O A;  2PZ1 A;  4PFP A;  3UA6 A;  1VQL T;  1NG2 A;  3NHN A;  2D8J A;  2HL3 A;  4C5G A;  3CCM Q;  1W2B P;  3UDC A;  5IHK A;  1D0X A;  2JUF A;  1U3O A;  3M57 A;  2YLC A;  5D6W A;  2OAW A;  2KYM A;  3S6W A;  2QA4 T;  2EGA A;  3JCM d;  2VXE A;  3ME9 A;  3CD6 T;  4EIK A;  4C92 G;  2P0Q A;  1WJR A;  2KRN A;  4YTL A;  1V1C A;  3CPW P;  5EG2 A;  1I07 A;  3HP9 A;  1OZ2 A;  4MZT A;  2DA9 A;  4A54 A;  2MMP A;  2K3B A;  4A63 B;  1N8R R;  2X51 A;  2DKG A;  4M7D G;  2LCS A;  5GAN f;  3CXC S;  5LJ3 d;  3JB9 H;  3I55 Q;  1ZBJ A;  1NJI R;  4II1 A;  2O88 A;  5GAO q;  1YJN A;  4Z89 A;  2AT1 B;  2RJD A;  2JN0 A;  3ZBD A;  3FJ5 A;  4J9D A;  4L6V 5;  1U06 A;  2MWP A;  1PC0 A;  1TUC A;  2IPO B;  5FWB A;  3CCS Q;  1QCF A;  2MF2 A;  1B34 A;  2DVE A;  2D6F A;  2QEX Q;  4CRI A;  1WPY A;  3PGG A;  3QG1 A;  4XQ3 A;  4FYY B;  1TG0 A;  2E5K A;  4DQ2 A;  3A98 A; 
#chains in the Genus database with same CATH homology
 1KSW A;  2RN8 A;  1OEB A;  1E6H A;  3UF4 A;  2W0Z A;  4RTW A;  2LNH B;  1G2B A;  1JU5 C;  2KR3 A;  1UE9 A;  3EG3 A;  2BTT A;  1UDL A;  1GFD A;  3I9Q A;  4HVU A;  2KT8 A;  2J6F A;  1CKB A;  2DRK A;  1CKA A;  1CSK A;  2CUD A;  1X6G A;  3M0R A;  3EHQ A;  1NLO C;  2FG0 A;  2W10 A;  2RNA A;  1ZX6 A;  1WFW A;  1PHT A;  1ZSG A;  1YWP A;  2CT4 A;  2DVJ A;  3TVT A;  3RNJ A;  2SRC A;  3M0P A;  1K76 A;  1GRI A;  4JJD A;  2LJ3 A;  1SRM A;  5ECA A;  1XOV A;  2L3S A;  4AFU C;  1K1Z A;  1M27 C;  2HSP A;  1M3A A;  4HVW A;  5GJW B;  2A36 A;  1M30 A;  4Y92 A;  1HSQ A;  2DBM A;  2FPE A;  2IIM A;  3UAT A;  1S1N A;  1UHC A;  1WXB A;  2GQI A;  2PTK A;  5IH2 A;  2V1Q A;  2F2X A;  1K0S A;  2ESW A;  2YUN A;  3ZL7 C;  1E6G A;  1AOJ A;  1UJY A;  1GBR A;  2HBW A;  2X3X D;  4OMQ A;  1GL5 A;  1NEG A;  2L2P A;  5FWC A;  1PRL C;  2KXD A;  1GFC A;  1PNJ A;  2K9G A;  1SHF A;  2DL8 A;  1AZG B;  2GBQ A;  2EVR A;  3VS1 A;  2ECZ A;  2LJ0 A;  1W70 A;  2O31 A;  1A0N B;  1NYG A;  5IXF A;  2AKK A;  1VYT A;  2LJ1 A;  4RUG A;  2OJ2 A;  4X1V A;  4CC7 A;  2JMC A;  2EYX A;  2A28 A;  2O9S A;  3VRY A;  1YCS B;  1AWW A;  1HJD A;  4OMP A;  1RI9 A;  3TSZ A;  1MV0 B;  3PVL A;  3VS6 A;  2M51 A;  1JQQ A;  1WXT A;  1WA7 A;  3EGU A;  1VYU A;  1UGV A;  2X3W D;  2DF6 A;  1X2Q A;  1KFZ A;  4OMO A;  1AEY A;  4IIM A;  4RTY A;  4OML A;  2C0I A;  3PVQ A;  2L3P A;  4AFZ C;  4ESR A;  2YSQ A;  1N5Z A;  1QKW A;  1J3T A;  3U23 A;  1K9A A;  2LZ6 B;  4Z8A A;  4LUD A;  3UA7 A;  2CT3 A;  1X6B A;  2C0T A;  2YDL A;  4D8K A;  2EKH A;  1HD3 A;  2B86 A;  2EPD A;  1NEB A;  3NMZ C;  2D1X A;  2DIL A;  2F2V A;  4AG1 C;  1WDX A;  4HCK A;  2FRY A;  2MIO A;  3EG0 A;  1I1J A;  2V1R A;  3QWY A;  4LUE A;  1M8M A;  2JS0 A;  1QWF A;  2AZS A;  1U5S A;  3IQL A;  1PRM C;  2J05 A;  3VS3 A;  1FMK A;  1OOT A;  1YNZ A;  1MUZ A;  1KJW A;  2JS2 A;  1X27 A;  1LCK A;  1YN8 A;  1KIK A;  2DMO A;  2DBK A;  3I35 A;  2JT4 A;  2DM1 A;  2GTO A;  4RTV A;  2JM9 A;  2AZV A;  1QWE A;  3VS7 A;  2KYB A;  1ZUU A;  1NM7 A;  2G6F X;  4JZ3 A;  1AWO A;  3VS2 A;  2DE0 X;  4HVV A;  3KFV A;  4JPB W;  2FRW A;  2DRM A;  1UHF A;  4CC4 B;  2KEA A;  1RUW A;  4D8D A;  4J9F A;  1RLQ C;  1UG1 A;  2YUO A;  4OMN A;  2AK5 A;  1K4U S;  1AVZ C;  1WXU A;  2VWF A;  1ZUK A;  2KGT A;  1VA7 A;  2KRM A;  1UFF A;  4AG2 C;  2KXC A;  4ORZ A;  1EFN A;  2K6D A;  2EBP A;  2FPD A;  4IIO A;  4J9C A;  1ZUY A;  3SHW A;  1H3H A;  3LH5 A;  3CQT A;  4RTT A;  1SRL A;  1WX6 A;  1QKX A;  2CRE A;  1ABQ A;  2I0N A;  1RLP C;  2J06 A;  2YUP A;  3EHR A;  3R6N A;  4HXJ A;  1ABO A;  1NYF A;  3I5S A;  2DLP A;  2P4R A;  2LP5 A;  3M0U A;  2AKL A;  2D0N A;  3EG2 A;  5L23 A;  1X2K A;  1WYX A;  3NGP A;  2QDL A;  2VKN A;  2NUZ A;  1Z9Z A;  1GCQ C;  1M3B A;  2CSI A;  2DL7 A;  2SEM A;  3H41 A;  1VYV A;  4CC3 A;  3VS5 A;  2J7I A;  3H0H A;  1M3C A;  1PKT A;  4QT7 A;  1WIE A;  4Z88 A;  3M0T A;  4LN2 A;  2M0Y A;  1OPL A;  1G83 A;  5IHI A;  2FO0 A;  1MV3 A;  2DL5 A;  1SSH A;  1Y0M A;  1UJ0 A;  2HEQ A;  2DL4 A;  1FYN A;  2EW3 A;  1YWO A;  5FW9 A;  1BB9 A;  2DX1 A;  4GBQ A;  2RPN A;  1GBQ A;  3PE0 A;  1GCQ A;  1T0H A;  4M4Z A;  1AWX A;  2ED1 A;  4GLM A;  2A37 A;  3C0C A;  1Y57 A;  4KRT A;  1AD5 A;  2ENM A;  2YT6 A;  2KRO A;  3H0F A;  1Z9Q A;  2RMO A;  2K7A A;  1BK2 A;  2RQW A;  1OV3 A;  5HCK A;  4DEX A;  2MCN A;  2O9V A;  2C0O A;  2EYZ A;  1NLP C;  4LE9 A;  1ZLM A;  4AFS C;  2MOX A;  4K11 A;  1YP5 A;  1AWJ A;  1SHG A;  2LX7 A;  2RQV A;  4F17 A;  2K2M A;  4F16 A;  4ZNX A;  2EYW A;  4JJC A;  2JW4 A;  1BBZ A;  2H8H A;  4FSS A;  1PKS A;  1JXM A;  1B07 A;  4J9I A;  2A08 A;  3REB B;  1IO6 A;  3REA B;  4E6R A;  4LNP A;  4OMM A;  2BZX A;  2GNC A;  3ULR B;  3GBQ A;  2GGR A;  3SEM A;  4CC2 A;  5EC7 A;  1T3S A;  2JMA A;  1JXO A;  2EYY A;  1W1F A;  1UTI A;  1X69 A;  1UUE A;  2DL3 A;  2DNU A;  2RQU A;  2HCK A;  2CH4 W;  2DJQ A;  5I11 A;  2JXB A;  1WLP B;  2CSQ A;  2RF0 A;  2RQT A;  2XMF A;  1WI7 A;  2J6K A;  2BZ8 A;  4WCI A;  1I0C A;  3QWX X;  3H0I A;  3JV3 A;  1UEC A;  1X43 A;  2VVK A;  1ARK A;  1K0X A;  4RTX A;  3VS0 A;  2O2O A;  4F14 A;  2YUQ A;  2KNB B;  4JZ4 A;  1SEM A;  2ROL A;  4JJB A;  2JTE A;  3VS4 A;  2RQR A;  3THK A;  1PWT A;  4DEY A;  4J9G A;  2OI3 A;  2LQW A;  2HDA A;  1BU1 A;  3VRZ A;  2JM8 A;  5IXB A;  2J6O A;  2CUB A;  2PZ1 A;  2CH4 A;  1OPK A;  2F2W A;  3TSW A;  3UA6 A;  3M0S A;  2ABL A;  2LMJ A;  1SPK A;  1NG2 A;  3NHN A;  5I22 A;  2D8J A;  2FPF A;  2NWM A;  2PNI A;  1TUD A;  2ROT A;  1T3L A;  2KE9 A;  5IHK A;  1U3O A;  4J9H A;  2OAW A;  2KYM A;  2EGA A;  1T0J A;  4EIK A;  4J9B A;  2KRN A;  2L0A A;  1H92 A;  1V1C A;  1W6X A;  1I07 A;  2BZY A;  3RBB B;  3EG1 A;  2DA9 A;  2EQI A;  1QLY A;  4RTZ A;  2K3B A;  4A63 B;  2EGC A;  2LCS A;  2EGE A;  5IHN A;  4R0K A;  2K79 A;  2D8H A;  1ZBJ A;  1JO8 A;  3NPF A;  3I5R A;  2KRS A;  5GJV B;  2O88 A;  1B3Q A;  4Z89 A;  2FEI A;  3FJ5 A;  2CDT A;  4J9D A;  2L3Q A;  1U06 A;  1AZE A;  2KT1 A;  1TUC A;  5FWB A;  3O5Z A;  2DYB A;  3M0Q A;  1QCF A;  2GTJ A;  2ED0 A;  4RTU A;  1H8K A;  1GCP A;  2LQN A;  1JEG A;  1TG0 A;  2E5K A;  1E7O A;  2KBT A;  4AFQ C;  4J9E A;  3A98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...