1SSHA

Crystal structure of the sh3 domain from a s. cerevisiae hypothetical 40.4 kda protein in complex with a peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
GSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region
publication title Yeast SH3 domain structural genomics
rcsb
source organism Saccharomyces cerevisiae
total genus 12
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2004-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1sshA00
4CC4B 1UECA 1M3CA 3H0FA 2BZYA 1WXTA 2E5KA 2HEQA 1GL5A 1UFFA 1BB9A 5ECAA 4LUEA 2LQWA 5GJWB 1PNJA 2D1XA 2ESWA 2F2VA 3SHWA 2F2WA 1K76A 2D0NA 1OPLA 2JM9A 1RUWA 2C0OA 2DA9A 1YP5A 1JO8A 2A37A 2J06A 4F16A 2FPEA 2F2XA 1AWXA 3IQLA 1M30A 1YWOA 2YUNA 1QKWA 2DL7A 1K4US 5IHIA 2KEAA 1SPKA 4RUGA 5FWCA 1RI9A 4CC7A 5HCKA 2O2OA 2CH4W 1JXMA 3REAB 4EIKA 4RTUA 1UG1A 2LJ0A 1KSWA 4OMMA 1U5SA 2SEMA 4J9DA 1I1JA 3NPFA 3QWXX 2PZ1A 3I35A 3VS7A 3LH5A 2AKLA 3PVLA 3I5RA 3VS3A 1WLPB 1MV3A 4RTYA 2DL5A 2KNBB 2FRWA 2JS0A 1SHFA 2C0TA 2DL3A 2EBPA 3RNJA 2GGRA 2A08A 2KGTA 2CH4A 2LMJA 1VYUA 1VA7A 2DL4A 4J9FA 4J9IA 1KJWA 4DEYA 2EYZA 2LZ6B 2VKNA 4D8KA 2FG0A 1JU5C 1CKBA 1HD3A 1PWTA 1PKSA 2YUQA 1G2BA 1BU1A 1Z9ZA 2ROTA 1FMKA 4HVWA 1AWOA 1VYVA 4OMQA 5IXFA 4D8DA 2CDTA 1NYGA 2DJQA 1AWWA 3VS2A 1ZLMA 1K9AA 1TG0A 4GBQA 1AZEA 2J7IA 3EGUA 1WXBA 2KE9A 4KRTA 1NYFA 1QLYA 2JM8A 1GBQA 3EG0A 1B3QA 1SHGA 1CKAA 2GTJA 5FW9A 1XOVA 2LX7A 2RN8A 2YSQA 1W70A 2QDLA 3EG2A 2CREA 1M8MA 2L3QA 4AFZC 2X3WD 2O9SA 2EYWA 2GNCA 4F17A 2CT4A 2KBTA 2CSIA 1JXOA 2RQVA 2VWFA 2XMFA 2DVJA 1ABOA 2KYBA 1S1NA 1Y57A 1T0HA 3C0CA 1X2KA 2J6OA 2CSQA 3QWYA 1Z9QA 4JPBW 3REBB 3ZL7C 3VS0A 2DF6A 1YNZA 2YT6A 2OI3A 2MOXA 1NLOC 2K2MA 2L0AA 4LN2A 4DEXA 2YDLA 2AKKA 1X2QA 4Z89A 2DBMA 3PVQA 4RTVA 4FSSA 2V1QA 2A28A 2NUZA 2JW4A 4Z8AA 3U23A 1JQQA 2EPDA 1SEMA 3VS1A 4GLMA 4ZNXA 2B86A 1QWEA 2EYYA 1K1ZA 2J05A 1X6GA 5EC7A 2DLPA 2DYBA 1H3HA 1AEYA 1WA7A 1YCSB 4OMLA 4J9CA 1AWJA 3ULRB 3NMZC 3UATA 1VYTA 1W1FA 1ZUKA 2JXBA 4JZ4A 1UGVA 2L2PA 2FPDA 4Y92A 2KR3A 1NEBA 1GCPA 4RTZA 1B07A 4QT7A 3JV3A 2G6FX 5IXBA 1PRLC 2PNIA 2W0ZA 1X69A 3EG3A 4LE9A 2EYXA 2M51A 1GBRA 3M0SA 2KROA 4RTTA 1ZUYA 1T3LA 3UA6A 1OPKA 1QCFA 2EGEA 2HDAA 4OMNA 2AK5A 2KXCA 1U06A 2GBQA 1WFWA 2FPFA 1SSHA 2P4RA 4R0KA 3NGPA 2L3PA 2GTOA 1WIEA 2ROLA 4ORZA 2MCNA 4JJCA 2ED0A 4OMOA 1U3OA 2KXDA 2K9GA 1AVZC 3FJ5A 3R6NA 5I22A 1TUCA 2FEIA 4RTWA 2FO0A 2BZ8A 2HBWA 2DX1A 2D8HA 2RQRA 1I07A 3H0HA 2LNHB 4M4ZA 2RQWA 3RBBB 1T0JA 1PHTA 2EGCA 1W6XA 3SEMA 2DILA 2OJ2A 2KRNA 2FRYA 2IIMA 4AFUC 2O9VA 1UJ0A 1E7OA 4J9GA 1QWFA 1J3TA 2DRMA 3NHNA 3VS6A 2KT1A 1QKXA 2BTTA 3M0TA 3VRYA 2EQIA 5FWBA 1JEGA 1WI7A 1ABQA 3EHQA 2AZVA 2MIOA 4J9BA 1GFDA 4RTXA 2M0YA 1UHCA 2JTEA 4ESRA 1E6GA 2AZSA 3THKA 4F14A 2J6FA 5GJVB 1M27C 1UE9A 2W10A 2KT8A 1G83A 2YUPA 1V1CA 4IIMA 1HJDA 2KRSA 1UTIA 2OAWA 4HCKA 4HXJA 4WCIA 1SRMA 4X1VA 1YN8A 3H0IA 2VVKA 2LJ1A 3M0UA 2LCSA 2ECZA 2LQNA 2ED1A 3CQTA 2O31A 4JZ3A 2HCKA 2RF0A 2D8JA 4HVVA 1NG2A 1X27A 2KYMA 1T3SA 4J9EA 1UUEA 1UDLA 1N5ZA 3M0PA 4CC2A 1RLPC 2ENMA 4AFQC 5IHNA 1WX6A 2RQTA 3EHRA 4K11A 3TSZA 1MUZA 2V1RA 2PTKA 1RLQC 1NEGA 4AFSC 1E6HA 2GQIA 1SRLA 2JMCA 2A36A 1IO6A 2DRKA 1H8KA 2DMOA 3VRZA 3VS5A 1KFZA 2O88A 2JT4A 1ZX6A 2LJ3A 2CUBA 2J6KA 3VS4A 5IH2A 1OV3A 1CSKA 2SRCA 2DE0X 1I0CA 2DBKA 4J9HA 2DM1A 1GRIA 2C0IA 1OEBA 4LUDA 3UA7A 4CC3A 4AG1C 4JJBA 1HSQA 2K6DA 1YWPA 4HVUA 2X3XD 5L23A 1UJYA 1MV0B 1OOTA 2CT3A 2DL8A 1GFCA 4OMPA 3O5ZA 1ZSGA 2JS2A 1ARKA 1PRMC 4LNPA 1WYXA 3H41A 1M3AA 1A0NB 2L3SA 2YUOA 4JJDA 3GBQA 1GCQA 2HSPA 4AG2C 4E6RA 5I11A 1ZBJA 1AD5A 1AOJA 3M0QA 1TUDA 2ABLA 1GCQC 1X43A 2K3BA 1M3BA 2I0NA 2LP5A 3TSWA 1H92A 1X6BA 1NM7A 2KRMA 2RPNA 3KFVA 2K7AA 3M0RA 2EVRA 1EFNA 3I9QA 2RMOA 1LCKA 1KIKA 3EG1A 2RQUA 1BBZA 2DNUA 4IIOA 1Y0MA 2H8HA 3PE0A 2RNAA 1AZGB 1NLPC 4A63B 1ZUUA 1PKTA 1WXUA 2EGAA 2JMAA 1FYNA 3TVTA 1BK2A 3UF4A 2EKHA 3I5SA 2K79A 5IHKA 2CUDA 2BZXA 1K0XA 3A98A 4Z88A 1UHFA 2EW3A 1K0SA 1WDXA 2NWMA
chains in the Genus database with same CATH superfamily
2BZYA 3VKIA 4E7KA 4C92A 2HEQA 2E65A 2R57A 5KYXB 4LDUA 5GJWB 4C92C 1YIJA 2D1XA 1MGQA 1YBYA 3EG9A 1G8XA 2QDYB 4E7ZA 1K8AR 2E12A 5KH6A 3QIIA 1N6AA 1VQKQ 3DLLA 1YP5A 4DA4A 4F16A 2CP5A 2QEXT 3FLGA 4A4KA 1PM3A 3N5BB 4M77B 3IQLA 1ZA2B 4IURA 1PSEA 4M7DG 1IREB 4OB3B 2KEAA 3A8LB 5FWCA 1RI9A 3BDUA 2LDMA 3S3MA 1X75C 4EIKA 5KYUB 4RTUA 1KSWA 4J9DA 1I1JA 3QWXX 5CK9A 1K9MC 3VS7A 3WXMB 1EIFA 2CP2A 4ZGDB 4PJOG 2AKLA 4F7UB 3OYLA 2QA4A 1M1KR 1TSFA 1EX4A 1VQ5T 1SG5A 2DL3A 5A2QE 3VUZA 3HTRA 3JB9D 4KT0E 4C92E 3CCQQ 4DOVA 2F1LA 1QVGA 1WHHA 2QQ9A 3OYEA 3UPUA 4DQ2A 4OF1A 1YIJT 2QQAA 4LD6A 1KJWA 5GAMd 2O01E 2EYZA 2CKKA 2DVEA 2R5AA 5D6YA 1JU5C 2DKGA 3BE3A 3J7AF 1G2BA 2RB6A 4C5GA 3G71A 1AWOA 4B6MA 1YJ9A 2G3RA 5IXFA 3VS2A 2FZCB 1WJRA 1AZEA 1KD1U 2J7IA 3M56A 3EFOA 2ZPHB 1QLYA 3OW2P 2DD4A 2FVUA 2E3HA 5CAIA 3EG0A 1SHGA 4BI4A 2QGFB 2YHTA 1XOVA 2RN8A 5D7UA 3CCUA 3HRTA 3OW2S 2DJZA 2FHDA 2L3QA 1FXXA 2QA4T 2D9TA 3X26B 4F17A 1KC8C 2H3JA 2CT4A 3SWNB 3ZBDA 1YJNQ 5GAN4 1JXOA 1QCNA 2EQKA 2KYBA 1KQ2A 2BE9B 1T0HA 2L89A 1X2KA 3CCJA 1Z9QA 3REBB 3PGGA 2HMAA 3OYYA 2DZ9A 2DF6A 1YJWQ 1G3TA 2OI3A 3WVEB 1O9SA 2RA2A 3JB9F 1I81A 3EFSA 1QVPA 2I2LA 1NLOC 2K3YA 2L0AA 2HAXA 2JN0A 4HCCA 3P8BB 1Q86R 4JLIA 2RHXA 2CZ0B 1TS9A 3G71T 3MCAB 5GAOm 2V1QA 1YJ9T 2A28A 4Z8AA 1D0YA 5LJ3g 1K73R 1TOVA 1VQ8A 3V7SA 2B86A 2EYYA 2WSFE 1K1ZA 2J05A 4OB2B 1H3HA 3CC7Q 3M5AA 4J9CA 1AWJA 1YITT 3ULRB 1PD1A 3CBPA 3SWNC 1W1FA 1ZUKA 1G5VA 1BIBA 3CCUT 3CC4T 2LNVA 4QT7A 1I5OB 3NTKA 4Y91A 5GANd 3G4ST 3CMEA 2ZCFB 2DTOA 1PD0A 5LJ3f 1GBRA 3DB3A 3OYNA 2DZCA 4RTTA 5FRNA 2QASA 1G3SA 1T3LA 3OSSC 2EGEA 1FMVA 1VQPA 2HDAA 2AK5A 3E9FA 3CCJT 1U06A 3OS5A 2FPFA 4Y28E 2YLCA 3PNWC 2P4RA 4R0KA 2L3PA 3VYHB 3TQ7P 3CCVQ 1YHQQ 3JB9H 1KQ1A 4JJCA 4MZPA 2KXDA 1AVZC 3FJ5A 1O75A 3R6NA 3JSCA 2COZA 2YRDA 4RTWA 5LJ3h 2BZ8A 4KUDK 5HY6A 1VQMA 4Z02A 5CIUA 3PMTA 4ZGEB 3OYHA 3H0HA 3X24B 4BD3A 2EGCA 4XU2A 1VQ8T 2DILA 2LRQA 2K2VA 2O9VA 3OSVA 4PK4A 2DRMA 1TH7A 3GNFB 2KT1A 2JUFA 5FU6B 1Q81C 3P8DA 3CCET 2EQIA 1ABQA 4LXCA 2AZVA 1QP2A 3BW1A 3GOXA 2BE7D 1ZQ1A 4BDZA 4ESRA 2AZSA 3CMET 2J6FA 5GJVB 1M27C 1KQSP 2E3IA 2W10A 2YUPA 4PFPA 2KRSA 2PUOB 2OAWA 2JTMA 1VQPT 4JRIA 1BCOA 1YN8A 1KQSS 2OAUA 3H0IA 1VQ5Q 3CPWP 3T9NA 3GNGA 2ECZA 5CR2A 2ED1A 4JDSA 4MMKA 3CQTA 2PVGB 5LJ3d 5M9OA 2HSEB 2RF0A 4HVVA 3CPWS 2HKNA 3LX7A 1RACB 1T3SA 4J7IA 5LJ5j 1XQHA 5CQYA 2PUKB 1MMDA 3JAME 4M78B 2FZKB 3EHRA 3TSZA 1N8RU 1NEGA 3PIPA 1VIEA 4FYWB 4C8QG 1Q7YR 5FU6C 1IHVA 1SRLA 5I2MA 2LTOA 1IO6A 1G3YA 4M75G 2MWPA 5CKDA 3CMAA 4JRPA 1KFZA 2O88A 1H641 2LJ3A 5CVIA 2J6KA 5IH2A 3CEYA 2SRCA 2DERA 4J9HA 2C0IA 1OEBA 1F1BB 4C0FA 5L8RE 4M7DB 3C12A 3FB9A 3VUBA 1RABB 1ZA1B 2V26A 3FC3A 3I55Q 3A8OB 4O5VA 2HZYA 3RKYA 1UJYA 1V76A 2XI9A 4XTWA 2DL8A 2MWOA 1M2VA 2F5KA 3M54A 4M7AD 2IPOB 2ZPIB 1ARKA 1PRMC 2QA4Q 2JZ2A 2Y4XA 4PJOB 2KDSA 4JJDA 3GBQA 5IT9E 2HSPA 4E6RA 5I11A 2YXYA 3PFSA 3TSWA 5C0MA 5CKBA 4E2FB 2KAFA 2K57A 4C0ZA 5DLOA 2KRMA 3GP8A 2K7AA 1SSFA 2QQBA 3I9QA 2RMOA 1KIKA 2E6ZA 2DIGA 4NS5A 1AZGB 4N4HA 3AHUA 1PKTA 2QTXA 3M4YA 2DAQA 2JMAA 5GAOr 3G71Q 2P0PA 1D1BA 3I5SA 1YJ9Q 1UEBA 3QYHB 1K0XA 3A98A 1IRXA 1UHFA 2X4WA 1K0SA 5GAMe 1OULA 2E10A 4CC4B 1W2BA 3H0FA 2XDPA 4FYXB 3ER0A 3FRNA 3UWNA 4M7DF 1NZ9A 1GL5A 1IHWA 1BB9A 3OBWA 2K4YA 2ZAEA 1YITQ 4LDVA 2IVWA 1TWBA 2DXTA 3CCUQ 1Q82C 1Y96A 1M4ZA 3SHWA 4M7AA 1K76A 1M8VA 3CC4Q 3V8JA 2JM9A 3TEEA 3A8MB 1G3WA 2DA9A 3M58A 4C5HA 1K9MU 4M7AC 1VQOQ 1NE8A 2NUPA 3OYKA 3G4SQ 1JO8A 1M5Q1 2EQUA 2J06A 1AWXA 3TU4K 1M30A 1OI1A 1YWOA 2GFAA 3X20B 4R56A 4M7AF 2X9HA 4CC7A 5HCKA 2QQRA 3CCJQ 1JRIA 1JXMA 3REAB 4FU6A 5HK3A 3JCMP 1PC0A 1JJ2A 2X4YA 2LJ0A 1VQ7Q 4OMMA 1U5SA 3NPFA 3I35A 1QQJA 2MAMA 1W2BP 4RG2A 5KE2A 4AMCA 5A0GA 4PLLA 1RAEB 4RTYA 1RAGB 4FL6A 1I5LA 2KNBB 2YWWA 3J81E 4NOYA 2EBPA 3CCSA 1W2BS 3LGFA 2GGRA 2A08A 1MNDA 2K5LA 3S3NA 3JB9I 2KGTA 2M1HA 2QI2A 3Q1JA 1VQ8Q 4M7AE 3ASKA 1WHKA 1NBEB 2LMJA 4E7LA 2VC8A 4JJNK 3RIRA 1WJQA 4FYVB 1VOMA 3CCEQ 2L8DA 2LZ6B 3HPWA 2FG0A 2D0QB 3TCJA 1CKBA 1HD3A 1PWTA 2EJ9A 2YUQA 3HP9A 1JJ2P 1KHIA 4PKCC 4HVWA 2FZGB 2XDDA 4OMQA 1KC8U 1NYGA 2DJQA 5LL6S 4XU1A 1TG0A 1JJ2S 1WXBA 2DTIA 2FL7A 1YFNA 4KRTA 3OYCA 3A1PA 1GBQA 1VQ9Q 4C0DB 3M4GA 2LX7A 1D3BA 2RHZA 2QTVA 1OYXA 4N4IA 2QDLA 4BB7A 1M8MA 3HHTB 4AFZC 2X3WD 5CKFA 2O9SA 1S72T 1RAAB 2GNCA 3OMCA 2NUTA 4BUGA 2P84A 7AT1B 3A8HB 3MO8A 2CSIA 4MMLA 2M0OA 3H8ZA 3MEVA 2VGMA 4KUIA 2XMFA 4FM4B 1ABOA 3ZFJA 1WZOA 1QCOA 3C0CA 3OQ5A 4M77D 2JVVA 2PVDB 4NL2A 3OA6A 4XK8E 3KXTA 1RADB 5LJ5g 3JCMc 4MDXA 4OB1B 3DB4A 2COWA 5HK0A 5GMKl 1Y07A 4B9WA 1YI2Q 3PVQA 4RTVA 4FSSA 2NUZA 2JW4A 1KG1A 1KD1R 5KYYB 1JQQA 3VS1A 5LJ5f 4E47A 4J6XA 2KVQG 4KH1B 3FDRA 3VV0A 1AEYA 2DLPA 2M16A 4OMLA 1YCSB 4Q5WA 3CCLA 3MP6A 2OTLA 4MZMA 1WPYA 2COYA 2F5TX 3OW2A 3CCMA 4QQGA 2LX9A 2MMPA 1GCPA 4HCZA 3QSUA 3GIBA 1VQNA 3JCMg 5IXBA 3CC2A 1PRLC 2W0ZA 3EG3A 4LE9A 3QZ9B 2EYXA 2M51A 3H6ZA 1M90C 1WHMA 2EAYA 1QCFA 5LJ3e 4M77A 5LJ5h 4OMNA 4M77C 1WFWA 4X9DA 4J8OA 1KK7A 3NGPA 3MKDA 1YCYA 2ROLA 4C8QB 2MCNA 3JCMf 2HBPA 2EQMA 2K9GA 4M75B 4M77F 3HL8A 9ATCB 1VQ4Q 5GAOn 1C1AA 1Q81U 1XNIA 4F7UA 3P8HA 3OYIA 3QHSA 2CZ7B 1NPRA 4UC4A 3I56A 2KK4A 2LNHB 2M02A 3RBBB 1FMWA 2WSEE 3SEMA 4BY6B 4DBQA 2KRNA 2FRYA 2LT4A 2IIMA 4F7UF 4J9GA 4J5YA 4CI0C 3VS6A 3JCMh 2OTLT 1FWZA 4ZN3A 2BTTA 3M0TA 1HYOA 2FYKA 3CCMT 2AT1B 3EHQA 2PQWA 2M0YA 1OU9A 4PJJA 1VQNT 4M77E 5CKEA 2JTEA 4GY5A 1E6GA 3OYMA 3CC2T 4BDYA 1OZ3A 3QKJA 5DM7R 3G1JA 3C95A 3META 2KT8A 4ELYC 1OX9A 4IIMA 1MMNA 1HJDA 4HCKA 4HXJA 4X1VA 1SRMA 3OYGA 4M75C 4DOWA 3L2WA 2XU8A 2LCSA 3M9QA 4F7UE 1X01A 1NJIC 3NTIA 2D8JA 4M75F 4HKEA 2KYMA 2DFUA 4J9EA 3EGXB 1UUEA 1UDLA 3M0PA 3UT1A 1RLPC 3CBOA 4IUVA 3SWNA 3E1SA 3I56T 2RQTA 3G6EA 1MUZA 2PTKA 2DD5A 4E7HA 3MEAA 4AFSC 4BE2A 4BACA 2F69A 2DRKA 4C92G 4FT4A 2YRVA 1RAIB 2V8IA 1CSKA 4ELZC 4J83A 5KE3A 2EJFA 3FIFA 1PG5B 3NFCA 4QQ6A 4LUDA 4AG1C 5GAOq 2KI7A 3SDZA 1R8OB 2AIRB 1MV0B 1EZZB 2CT3A 2DYIA 4OMPA 3CCRQ 1KQSA 3C94A 5GAN8 1S72Q 1ZSZB 2CYZB 2E64A 3MEWA 1P92A 3V8LA 1ZBJA 3CPWA 4WF2A 1X43A 2K3BA 2JJ9A 1M3BA 2GFUA 4A54A 2I0NA 2LP5A 2VASA 3LWIA 2D6FA 2A0FB 4KGXB 4FW2A 5J26A 3KFVA 2VGNA 5DLQE 2RJCA 5GAN3 2P0QA 3FEOA 3EG1A 1N8RR 3HFOA 3QXEB 2QEXQ 1K8AC 1BBZA 2P0KA 4BE0A 4IIOA 1OU8A 3G6ET 1NLPC 2KMTA 1ZUUA 2LCLA 4XTXA 4EMKB 1Q82U 3V7RA 2OTJA 1WXUA 4KH0B 3OS0A 2QXFA 4ZN1A 1FYNA 1BK2A 2K79A 1VQKA 2BZXA 3BFMA 4Z88A 3OBYA 1WDXA 2NWMA 3GF5A 3GPLA 5I21A 1IXDA 2YRCA 2K5IA 4IKFA 2O4XB 4LUEA 3URGA 2VV5A 1PNJA 4DBHA 4HT8A 1M1KC 2F2VA 1BI2A 4AT1B 4C0GA 4E7JA 2QQSA 4M78D 2C0OA 3X25B 2LT1A 5AYFA 2F2XA 1WHGA 3QDFA 4XU0A 4ZTJA 2YUNA 3RKXA 1VQMT 1QKWA 3KUFA 3L42A 3HFNA 5IHIA 4RUGA 1YIJQ 3EH1A 3VU3C 4XTZA 2V8KA 1ACMB 1UG1A 3JB9G 1IGUA 3LGLA 4OVAA 4M7DD 2PZ1A 1R0BG 2DXCA 3PVLA 3VS3A 5GMKm 4B9XA 3RERA 2EWNA 1M1FA 2CP6A 4PJLA 1MV3A 3QZ5B 2JS0A 2OTJT 2RI5A 1HXDA 3RNJA 5KYWB 4V2SA 2MI6A 4PJOD 2CH4A 4QVZA 1VYUA 5KCHA 1QP3A 3SFMA 1M9SA 2P4TA 4IUPA 2LQKA 2HQXA 2RHYA 1K9MR 2VKNA 3JCMb 1MMAA 4LDWA 1VQNQ 4M78C 5GMKj 2ROTA 1FMKA 3CC2Q 3M55A 4D8DA 5GANj 4L59A 1AWWA 4J6WA 4GBQA 1BI0A 1QW1A 4M78F 2KE9A 3EGDB 1YJNA 4A53A 3JRZA 3LLRA 1CKAA 2GTJA 3E2UA 4JRKA 4M7DA 3CMAT 5KCOA 2RK1A 3S3OA 5A0DA 2YSQA 4M7DC 1W70A 1Q86C 2DIQA 2RHUA 3EG2A 2Y4YA 2X35A 2ZGWA 4EDUA 1IZ6A 2EYWA 2JOYA 2WSCE 2QYZA 2NYSA 4RG8A 3L2UA 4ANJA 2KBTA 1QVFP 1K73C 2RQVA 2VWFA 1D0XA 2YLBA 3I56Q 2XICA 4L5GA 4RKUE 1S1NA 2RD1A 1GXIE 1Y57A 1UGRB 2J6OA 3QYGB 4PJOC 3QWYA 4JPBW 2LCCA 1D0ZA 1QVFS 1YNZA 2YT6A 2AHJB 4DEXA 8AT1B 2YDLA 2AKKA 5EG2A 1ZBXA 4PJOF 4ZGJB 4Z89A 2K5FA 2EQJA 3DLMA 2JNGA 1FX7A 3O8VA 1WQ7A 1KC8R 3AT1B 3U23A 4M7DE 4LDXA 2JTFA 3OS2A 1M90U 4FT2A 1YJNT 2DYBA 2BKDN 2RJFA 3EH2A 3H9NA 3E9GA 3PMIA 1VYTA 4JZ4A 2JXBA 1UGVA 2L2PA 4Y92A 2KR3A 2CGHA 1B34B 5GAN7 1NEBA 3INZA 4RTZA 2QK0A 1OZ2A 1PSFA 2G6FX 3CCVA 1YHQA 2PNIA 3MEUA 3M0SA 2IG0A 3RDVA 3ZEHA 1U8RA 2NLUA 3G6EQ 4RCBA 2KXCA 4XTUA 4BE1A 1VUBA 4TVRA 1IB8A 4FSXA 3RMSA 2GQVA 3CMEQ 1BI1A 4OMOA 3J80E 1U3OA 2XHCA 2PU9B 3OY9A 1M1GA 4C92B 1VQ6A 1AHJB 2X4XA 4IUUA 1NPPA 4JLGA 3JCMe 2FO0A 2E1HA 1VQPQ 2HBWA 1PCXA 3EG9B 2DX1A 2D8HA 2RQRA 4MZTA 5GAMg 1I07A 3G7ZA 1U1SA 1W6XA 3HKSA 2OJ2A 1MNEA 4AFUC 1D1CA 1UJ0A 1J3TA 2EFIA 3OMGA 1VQMQ 4QQDA 1VQ5A 2RI3A 5HKCA 3CCST 4RTXA 4KBMB 2Y90A 1NJIU 4C5EA 1YHQT 3THKA 2RH2A 2VUBA 4XTYA 4NL3A 1G83A 1Q7YC 1UTIA 2BIVA 3CPFA 2OTJQ 2RJDA 3QO3A 1ZHIA 4JZ3A 2B8AA 4D6WA 2CP3A 1NG2A 1Q81R 4C0DC 1VQ6T 5GAMh 4C92F 4HA8A 4HT9A 4BI8B 2DPPB 2XK0A 1N5ZA 2ENMA 3SB2A 5IHNA 1WX6A 4J6YA 3M59A 3FJPA 2OX7A 1RLQC 3I55A 1E6HA 2GQIA 2JMCA 5FRMA 3C4SA 5KYXA 1H8KA 2DMOA 3D7SB 1TXQA 4QVCA 2CUBA 2MYSA 1OV3A 4E7SA 3EFOB 2DE0X 4QVDA 4OGCA 1WJSA 3QDRB 6AT1B 2KY9A 2DM1A 1GRIA 4M7AG 4C8QD 3UA7A 5CCAA 4M75D 4JJBA 1HSQA 2K6DA 3JCMV 1UGPB 1YWPA 4HVUA 4OGEA 2X3XD 5L23A 3CMAQ 2EJGA 1GFCA 5KYUA 5GANg 2JS2A 1K8AU 4LNPA 5KYYA 3QG1A 1D09B 1M3AA 2MK5A 5CQXA 1GCQA 1XTDA 4N0AA 1AD5A 4C5IA 1GCQC 1WHJA 3QUIA 5DY9A 4N0AC 2LC4A 3DKMA 1H92A 4IUTA 1X6BA 1NM7A 2DXUA 4X34A 4PLIA 1EFNA 3BDLA 5GANf 1LCKA 1N9SA 4A4GA 2DNUA 3CCLT 1BYMA 4PFOA 1Y0MA 1JB0E 3MPUB 2DK3A 1BI3A 3I55T 3CD6A 1YITA 3BY7A 2DEQA 3GLXA 1M1KU 1QVGP 4EMGA 2EGAA 2VB6A 2DXBA 3RKWA 4ME7A 3TVTA 3CC4A 1BKBA 3UF4A 5LJ5d 2EKHA 2R58A 5IHKA 4A4HA 1VQOA 3G4SA 2WACA 4DBRA 4C8QA 1QVGS 5GMKh 4M75A 1UECA 4C8QC 1M3CA 1DJ7B 1WXTA 3QJYA 2E5KA 1UFFA 5CKHA 1HK9A 5GANh 5ECAA 2LQWA 5IN1A 3NTHA 2ESWA 3F70A 4XU3A 2F2WA 5IAYA 3JCMQ 2D0NA 1OPLA 4EMHA 1RUWA 4C8QF 1VQ7A 1Y71A 1TUGB 2A37A 2A3LA 2FPEA 2RHIA 3EFRA 2MF2A 4BY6C 3KBGA 4II1A 3HRUA 4CRIA 2DL7A 1K4US 5FLXE 1SPKA 2O2OA 2CH4W 3JCMd 3L2ZA 1TTHB 4FCYA 1H3ZA 5C6SA 2C06A 2SEMA 3LH5A 3I5RA 3HRSA 4P5NA 2RO0A 1Q82R 1WLPB 2CZ1B 2RM4A 3CD6T 4C8QE 4PL6A 4JS4A 2DL5A 2FRWA 4M75E 3CCEA 1SHFA 2C0TA 2LVMA 1JBMA 1QMCA 3EAEA 4PJMA 1VQOT 4WTOB 2GCXA 3PIOA 1VA7A 4A4FA 1VQLA 3SD4A 2DL4A 2BUDA 3EGXA 2HQEA 4J9FA 4PFZA 4J9IA 1OQKA 3LW5E 4DEYA 3JCMW 1VIFA 4D8KA 3CCSQ 1VQ9A 1PKSA 1VQ7T 1WGSA 1BU1A 2EIFA 1Z9ZA 1Q86U 1XJWB 4JRQA 2V8JA 1VYVA 4J7FA 2HD0A 2CDTA 5GMKi 1K9AA 1RAFB 1ZLMA 3EGUA 2PVOB 2EYQA 1K73U 3L2RA 1NYFA 2JM8A 2QG9B 1AT1B 2DTHA 5FROA 1B3QA 5FW9A 5GAMj 3MP8A 4FIBA 2H3EB 2XDBA 2RK2A 4M77G 2CREA 3JB9J 3UDCA 1VQ6Q 2RI2A 5D6XA 5AT1B 1ZSZA 1KHCA 1KD1C 1UGQB 2MPXC 1ZSZC 2DVJA 3OB9A 4A4EA 2CSQA 1YI2A 4QKUA 3ZL7C 3VS0A 4F7UG 1R77A 2CZ6B 2HKQB 4KGVB 3X28B 1VQLT 2MOXA 3CXCA 2DO3A 3L2VA 1Y7XA 2K2MA 4LN2A 2GF7A 1UGSB 4N4GA 1X2QA 3A5ZB 1VQ9T 2KSSA 2CP0A 3OYDA 2CP7A 2DBMA 1B7TA 2R5MA 1M2VB 3V7CA 3CCQA 4EMKA 1WNLA 1UB4A 1TU0B 2VXFA 4GLKA 4EMKC 2EPDA 4YTLA 1SEMA 4GLMA 4ZNXA 1QWEA 5KYNA 1X6GA 2DEUA 5EC7A 1WA7A 5I2SA 3V8KA 4RMOA 1RL2A 4ATOA 3NMZC 3UATA 1SKUB 2XG8D 1V29B 2FPDA 3QBYA 2O4XA 2XD0A 1RAHB 1B07A 2Z0WA 3JV3A 1VQKT 2CS7A 1X69A 4X9CA 3CXCP 1LVKA 3LWHA 2KROA 2K3XA 4F04B 4KGZB 1ZUYA 1WQWA 2VYTA 3UA6A 1OPKA 5J3BA 4JS5A 1VQ4A 3CCLQ 2OTLQ 3CXCS 1YI2T 1QVFA 3A8GB 2GBQA 3CCMQ 4M78A 3OYBA 4OP0A 1SSHA 2VXEA 1SF9A 5GAN2 2L5QA 2GTOA 3QJ6A 1WIEA 4ORZA 4BI3A 2ED0A 3MHXA 1MMGA 3OYFA 5I22A 4XAXB 1LJOA 2ZZDA 1TUCA 2FEIA 4LD9K 1IGQA 2QGGA 3QPHA 1Y96B 4M7AB 1MHNA 3CCQT 4HCBA 1M90R 3VYGA 2NUPB 4M4ZA 2RQWA 2A7YA 5KYWA 1T0JA 1PHTA 5D6WA 3LH0A 2ZPFB 1YJWA 1Q7YU 5A0LA 1E7OA 1QWFA 3NHNA 3VJPA 2L3RA 2XIDA 1QKXA 2X51A 3VRYA 5FU7B 5FWBA 1JEGA 1WI7A 3R6OA 3PT9A 2MIOA 4J9BA 2E6NA 5GAN6 1GFDA 4PJOA 2E4HA 3JCMX 3MJXA 1UHCA 3OYAA 5CO7A 4F14A 4VUBA 1LPLA 1UE9A 4M78E 1V1CA 5GAOl 3OYJA 1VQ4T 4JUVA 4WCIA 4PJNA 1I4K1 3CC7A 4LDYA 4OB0B 3CD6Q 2VVKA 2LJ1A 3M0UA 1LNXA 2DETA 8ATCB 2LQNA 3EGDA 4O6JA 2FB7A 3M57A 2O31A 3E19A 2HCKA 4XQ3A 1X27A 5J39A 2LQ8A 2X4JA 4FW1A 1W4SA 1BCMA 4CC2A 3ME9A 3LYIA 1I8FA 2QAZA 4OMFB 4AFQC 5LJ5e 4QW2A 4IUQA 4K11A 2V1RA 2A36A 5FU7C 1YJWT 3VRZA 3VS5A 4EPCA 4PJOE 2JT4A 1ZX6A 5LJ3j 4XTVA 3CCRA 2HNIA 3VS4A 2ZPGB 3PTAA 1S72A 1I0CA 1C6VX 2DBKA 1NJIR 3MP1A 4RCCA 4CC3A 1M2OA 1D3BB 4FYYB 4C92D 2KQWA 2EKOA 1N8RC 2HQHA 3L2QA 2RJEA 3RESA 4E7IA 1D1AA 2ATCB 1RI0A 4R55A 1OOTA 2NUTB 3TREA 3O5ZA 1ZSGA 1U1TA 4L6V5 1N27A 3CC7T 1WYXA 3H41A 2QEXA 1Q95G 1A0NB 2L3SA 2YUOA 1N9RA 3RR6A 4AG2C 1C0MA 1AOJA 3M0QA 1TUDA 2ABLA 2E5QA 1B34A 3RUXA 2RPNA 5GAN5 2ZPBB 3OS1A 3CBMA 3L1AA 1VQLQ 2E70A 2EVRA 3M0RA 3S6WA 5GMKe 1LOJA 2RQUA 4DBFA 2HL5C 5GAOp 3HSBA 3RMQA 2H8HA 2E41A 3PE0A 2RNAA 5GANe 2HL3A 3JCMJ 2XKOC 4PNOA 4ZTFA 3WVDB 4A63B 2ZPEB 1BIAA 5GAMf 3CCVT 3CCRT 1R0CB 2CUDA 1WHLA 1X6OA 2M9UA 2EW3A 4KULA 4M78G 3M53A 1OX8A 4MDWA
chains in the Genus database with same CATH topology
4CC4B 1UECA 1M3CA 3H0FA 2BZYA 1WXTA 2E5KA 2HEQA 1GL5A 1UFFA 1BB9A 5ECAA 4LUEA 2LQWA 5GJWB 1PNJA 2D1XA 2ESWA 2F2VA 3SHWA 2F2WA 1K76A 2D0NA 1OPLA 2JM9A 1RUWA 2C0OA 2DA9A 1YP5A 1JO8A 2A37A 2J06A 4F16A 2FPEA 2F2XA 1AWXA 3IQLA 1M30A 1YWOA 2YUNA 1QKWA 2DL7A 1K4US 5IHIA 2KEAA 1SPKA 4RUGA 5FWCA 1RI9A 4CC7A 5HCKA 2O2OA 2CH4W 1JXMA 3REAB 4EIKA 4RTUA 1UG1A 2LJ0A 1KSWA 4OMMA 1U5SA 2SEMA 4J9DA 1I1JA 3NPFA 3QWXX 2PZ1A 3I35A 3VS7A 3LH5A 2AKLA 3PVLA 3I5RA 3VS3A 1WLPB 1MV3A 4RTYA 2DL5A 2KNBB 2FRWA 2JS0A 1SHFA 2C0TA 2DL3A 2EBPA 3RNJA 2GGRA 2A08A 2KGTA 2CH4A 2LMJA 1VYUA 1VA7A 2DL4A 4J9FA 4J9IA 1KJWA 4DEYA 2EYZA 2LZ6B 2VKNA 4D8KA 2FG0A 1JU5C 1CKBA 1HD3A 1PWTA 1PKSA 2YUQA 1G2BA 1BU1A 1Z9ZA 2ROTA 1FMKA 4HVWA 1AWOA 1VYVA 4OMQA 5IXFA 4D8DA 2CDTA 1NYGA 2DJQA 1AWWA 3VS2A 1ZLMA 1K9AA 1TG0A 4GBQA 1AZEA 2J7IA 3EGUA 1WXBA 2KE9A 4KRTA 1NYFA 1QLYA 2JM8A 1GBQA 3EG0A 1B3QA 1SHGA 1CKAA 2GTJA 5FW9A 1XOVA 2LX7A 2RN8A 2YSQA 1W70A 2QDLA 3EG2A 2CREA 1M8MA 2L3QA 4AFZC 2X3WD 2O9SA 2EYWA 2GNCA 4F17A 2CT4A 2KBTA 2CSIA 1JXOA 2RQVA 2VWFA 2XMFA 2DVJA 1ABOA 2KYBA 1S1NA 1Y57A 1T0HA 3C0CA 1X2KA 2J6OA 2CSQA 3QWYA 1Z9QA 4JPBW 3REBB 3ZL7C 3VS0A 2DF6A 1YNZA 2YT6A 2OI3A 2MOXA 1NLOC 2K2MA 2L0AA 4LN2A 4DEXA 2YDLA 2AKKA 1X2QA 4Z89A 2DBMA 3PVQA 4RTVA 4FSSA 2V1QA 2A28A 2NUZA 2JW4A 4Z8AA 3U23A 1JQQA 2EPDA 1SEMA 3VS1A 4GLMA 4ZNXA 2B86A 1QWEA 2EYYA 1K1ZA 2J05A 1X6GA 5EC7A 2DLPA 2DYBA 1H3HA 1AEYA 1WA7A 1YCSB 4OMLA 4J9CA 1AWJA 3ULRB 3NMZC 3UATA 1VYTA 1W1FA 1ZUKA 2JXBA 4JZ4A 1UGVA 2L2PA 2FPDA 4Y92A 2KR3A 1NEBA 1GCPA 4RTZA 1B07A 4QT7A 3JV3A 2G6FX 5IXBA 1PRLC 2PNIA 2W0ZA 1X69A 3EG3A 4LE9A 2EYXA 2M51A 1GBRA 3M0SA 2KROA 4RTTA 1ZUYA 1T3LA 3UA6A 1OPKA 1QCFA 2EGEA 2HDAA 4OMNA 2AK5A 2KXCA 1U06A 2GBQA 1WFWA 2FPFA 1SSHA 2P4RA 4R0KA 3NGPA 2L3PA 2GTOA 1WIEA 2ROLA 4ORZA 2MCNA 4JJCA 2ED0A 4OMOA 1U3OA 2KXDA 2K9GA 1AVZC 3FJ5A 3R6NA 5I22A 1TUCA 2FEIA 4RTWA 2FO0A 2BZ8A 2HBWA 2DX1A 2D8HA 2RQRA 1I07A 3H0HA 2LNHB 4M4ZA 2RQWA 3RBBB 1T0JA 1PHTA 2EGCA 1W6XA 3SEMA 2DILA 2OJ2A 2KRNA 2FRYA 2IIMA 4AFUC 2O9VA 1UJ0A 1E7OA 4J9GA 1QWFA 1J3TA 2DRMA 3NHNA 3VS6A 2KT1A 1QKXA 2BTTA 3M0TA 3VRYA 2EQIA 5FWBA 1JEGA 1WI7A 1ABQA 3EHQA 2AZVA 2MIOA 4J9BA 1GFDA 4RTXA 2M0YA 1UHCA 2JTEA 4ESRA 1E6GA 2AZSA 3THKA 4F14A 2J6FA 5GJVB 1M27C 1UE9A 2W10A 2KT8A 1G83A 2YUPA 1V1CA 4IIMA 1HJDA 2KRSA 1UTIA 2OAWA 4HCKA 4HXJA 4WCIA 1SRMA 4X1VA 1YN8A 3H0IA 2VVKA 2LJ1A 3M0UA 2LCSA 2ECZA 2LQNA 2ED1A 3CQTA 2O31A 4JZ3A 2HCKA 2RF0A 2D8JA 4HVVA 1NG2A 1X27A 2KYMA 1T3SA 4J9EA 1UUEA 1UDLA 1N5ZA 3M0PA 4CC2A 1RLPC 2ENMA 4AFQC 5IHNA 1WX6A 2RQTA 3EHRA 4K11A 3TSZA 1MUZA 2V1RA 2PTKA 1RLQC 1NEGA 4AFSC 1E6HA 2GQIA 1SRLA 2JMCA 2A36A 1IO6A 2DRKA 1H8KA 2DMOA 3VRZA 3VS5A 1KFZA 2O88A 2JT4A 1ZX6A 2LJ3A 2CUBA 2J6KA 3VS4A 5IH2A 1OV3A 1CSKA 2SRCA 2DE0X 1I0CA 2DBKA 4J9HA 2DM1A 1GRIA 2C0IA 1OEBA 4LUDA 3UA7A 4CC3A 4AG1C 4JJBA 1HSQA 2K6DA 1YWPA 4HVUA 2X3XD 5L23A 1UJYA 1MV0B 1OOTA 2CT3A 2DL8A 1GFCA 4OMPA 3O5ZA 1ZSGA 2JS2A 1ARKA 1PRMC 4LNPA 1WYXA 3H41A 1M3AA 1A0NB 2L3SA 2YUOA 4JJDA 3GBQA 1GCQA 2HSPA 4AG2C 4E6RA 5I11A 1ZBJA 1AD5A 1AOJA 3M0QA 1TUDA 2ABLA 1GCQC 1X43A 2K3BA 1M3BA 2I0NA 2LP5A 3TSWA 1H92A 1X6BA 1NM7A 2KRMA 2RPNA 3KFVA 2K7AA 3M0RA 2EVRA 1EFNA 3I9QA 2RMOA 1LCKA 1KIKA 3EG1A 2RQUA 1BBZA 2DNUA 4IIOA 1Y0MA 2H8HA 3PE0A 2RNAA 1AZGB 1NLPC 4A63B 1ZUUA 1PKTA 1WXUA 2EGAA 2JMAA 1FYNA 3TVTA 1BK2A 3UF4A 2EKHA 3I5SA 2K79A 5IHKA 2CUDA 2BZXA 1K0XA 3A98A 4Z88A 1UHFA 2EW3A 1K0SA 1WDXA 2NWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CC4 B;  1UEC A;  1M3C A;  3H0F A;  2BZY A;  1WXT A;  2E5K A;  2HEQ A;  1GL5 A;  1UFF A;  1BB9 A;  5ECA A;  4LUE A;  2LQW A;  5GJW B;  1PNJ A;  2D1X A;  2ESW A;  2F2V A;  3SHW A;  2F2W A;  1K76 A;  2D0N A;  1OPL A;  2JM9 A;  1RUW A;  2C0O A;  2DA9 A;  1YP5 A;  1JO8 A;  2A37 A;  2J06 A;  4F16 A;  2FPE A;  2F2X A;  1AWX A;  3IQL A;  1M30 A;  1YWO A;  2YUN A;  1QKW A;  2DL7 A;  1K4U S;  5IHI A;  2KEA A;  1SPK A;  4RUG A;  5FWC A;  1RI9 A;  4CC7 A;  5HCK A;  2O2O A;  2CH4 W;  1JXM A;  3REA B;  4EIK A;  4RTU A;  1UG1 A;  2LJ0 A;  1KSW A;  4OMM A;  1U5S A;  2SEM A;  4J9D A;  1I1J A;  3NPF A;  3QWX X;  2PZ1 A;  3I35 A;  3VS7 A;  3LH5 A;  2AKL A;  3PVL A;  3I5R A;  3VS3 A;  1WLP B;  1MV3 A;  4RTY A;  2DL5 A;  2KNB B;  2FRW A;  2JS0 A;  1SHF A;  2C0T A;  2DL3 A;  2EBP A;  3RNJ A;  2GGR A;  2A08 A;  2KGT A;  2CH4 A;  2LMJ A;  1VYU A;  1VA7 A;  2DL4 A;  4J9F A;  4J9I A;  1KJW A;  4DEY A;  2EYZ A;  2LZ6 B;  2VKN A;  4D8K A;  2FG0 A;  1JU5 C;  1CKB A;  1HD3 A;  1PWT A;  1PKS A;  2YUQ A;  1G2B A;  1BU1 A;  1Z9Z A;  2ROT A;  1FMK A;  4HVW A;  1AWO A;  1VYV A;  4OMQ A;  5IXF A;  4D8D A;  2CDT A;  1NYG A;  2DJQ A;  1AWW A;  3VS2 A;  1ZLM A;  1K9A A;  1TG0 A;  4GBQ A;  1AZE A;  2J7I A;  3EGU A;  1WXB A;  2KE9 A;  4KRT A;  1NYF A;  1QLY A;  2JM8 A;  1GBQ A;  3EG0 A;  1B3Q A;  1SHG A;  1CKA A;  2GTJ A;  5FW9 A;  1XOV A;  2LX7 A;  2RN8 A;  2YSQ A;  1W70 A;  2QDL A;  3EG2 A;  2CRE A;  1M8M A;  2L3Q A;  4AFZ C;  2X3W D;  2O9S A;  2EYW A;  2GNC A;  4F17 A;  2CT4 A;  2KBT A;  2CSI A;  1JXO A;  2RQV A;  2VWF A;  2XMF A;  2DVJ A;  1ABO A;  2KYB A;  1S1N A;  1Y57 A;  1T0H A;  3C0C A;  1X2K A;  2J6O A;  2CSQ A;  3QWY A;  1Z9Q A;  4JPB W;  3REB B;  3ZL7 C;  3VS0 A;  2DF6 A;  1YNZ A;  2YT6 A;  2OI3 A;  2MOX A;  1NLO C;  2K2M A;  2L0A A;  4LN2 A;  4DEX A;  2YDL A;  2AKK A;  1X2Q A;  4Z89 A;  2DBM A;  3PVQ A;  4RTV A;  4FSS A;  2V1Q A;  2A28 A;  2NUZ A;  2JW4 A;  4Z8A A;  3U23 A;  1JQQ A;  2EPD A;  1SEM A;  3VS1 A;  4GLM A;  4ZNX A;  2B86 A;  1QWE A;  2EYY A;  1K1Z A;  2J05 A;  1X6G A;  5EC7 A;  2DLP A;  2DYB A;  1H3H A;  1AEY A;  1WA7 A;  1YCS B;  4OML A;  4J9C A;  1AWJ A;  3ULR B;  3NMZ C;  3UAT A;  1VYT A;  1W1F A;  1ZUK A;  2JXB A;  4JZ4 A;  1UGV A;  2L2P A;  2FPD A;  4Y92 A;  2KR3 A;  1NEB A;  1GCP A;  4RTZ A;  1B07 A;  4QT7 A;  3JV3 A;  2G6F X;  5IXB A;  1PRL C;  2PNI A;  2W0Z A;  1X69 A;  3EG3 A;  4LE9 A;  2EYX A;  2M51 A;  1GBR A;  3M0S A;  2KRO A;  4RTT A;  1ZUY A;  1T3L A;  3UA6 A;  1OPK A;  1QCF A;  2EGE A;  2HDA A;  4OMN A;  2AK5 A;  2KXC A;  1U06 A;  2GBQ A;  1WFW A;  2FPF A;  1SSH A;  2P4R A;  4R0K A;  3NGP A;  2L3P A;  2GTO A;  1WIE A;  2ROL A;  4ORZ A;  2MCN A;  4JJC A;  2ED0 A;  4OMO A;  1U3O A;  2KXD A;  2K9G A;  1AVZ C;  3FJ5 A;  3R6N A;  5I22 A;  1TUC A;  2FEI A;  4RTW A;  2FO0 A;  2BZ8 A;  2HBW A;  2DX1 A;  2D8H A;  2RQR A;  1I07 A;  3H0H A;  2LNH B;  4M4Z A;  2RQW A;  3RBB B;  1T0J A;  1PHT A;  2EGC A;  1W6X A;  3SEM A;  2DIL A;  2OJ2 A;  2KRN A;  2FRY A;  2IIM A;  4AFU C;  2O9V A;  1UJ0 A;  1E7O A;  4J9G A;  1QWF A;  1J3T A;  2DRM A;  3NHN A;  3VS6 A;  2KT1 A;  1QKX A;  2BTT A;  3M0T A;  3VRY A;  2EQI A;  5FWB A;  1JEG A;  1WI7 A;  1ABQ A;  3EHQ A;  2AZV A;  2MIO A;  4J9B A;  1GFD A;  4RTX A;  2M0Y A;  1UHC A;  2JTE A;  4ESR A;  1E6G A;  2AZS A;  3THK A;  4F14 A;  2J6F A;  5GJV B;  1M27 C;  1UE9 A;  2W10 A;  2KT8 A;  1G83 A;  2YUP A;  1V1C A;  4IIM A;  1HJD A;  2KRS A;  1UTI A;  2OAW A;  4HCK A;  4HXJ A;  4WCI A;  1SRM A;  4X1V A;  1YN8 A;  3H0I A;  2VVK A;  2LJ1 A;  3M0U A;  2LCS A;  2ECZ A;  2LQN A;  2ED1 A;  3CQT A;  2O31 A;  4JZ3 A;  2HCK A;  2RF0 A;  2D8J A;  4HVV A;  1NG2 A;  1X27 A;  2KYM A;  1T3S A;  4J9E A;  1UUE A;  1UDL A;  1N5Z A;  3M0P A;  4CC2 A;  1RLP C;  2ENM A;  4AFQ C;  5IHN A;  1WX6 A;  2RQT A;  3EHR A;  4K11 A;  3TSZ A;  1MUZ A;  2V1R A;  2PTK A;  1RLQ C;  1NEG A;  4AFS C;  1E6H A;  2GQI A;  1SRL A;  2JMC A;  2A36 A;  1IO6 A;  2DRK A;  1H8K A;  2DMO A;  3VRZ A;  3VS5 A;  1KFZ A;  2O88 A;  2JT4 A;  1ZX6 A;  2LJ3 A;  2CUB A;  2J6K A;  3VS4 A;  5IH2 A;  1OV3 A;  1CSK A;  2SRC A;  2DE0 X;  1I0C A;  2DBK A;  4J9H A;  2DM1 A;  1GRI A;  2C0I A;  1OEB A;  4LUD A;  3UA7 A;  4CC3 A;  4AG1 C;  4JJB A;  1HSQ A;  2K6D A;  1YWP A;  4HVU A;  2X3X D;  5L23 A;  1UJY A;  1MV0 B;  1OOT A;  2CT3 A;  2DL8 A;  1GFC A;  4OMP A;  3O5Z A;  1ZSG A;  2JS2 A;  1ARK A;  1PRM C;  4LNP A;  1WYX A;  3H41 A;  1M3A A;  1A0N B;  2L3S A;  2YUO A;  4JJD A;  3GBQ A;  1GCQ A;  2HSP A;  4AG2 C;  4E6R A;  5I11 A;  1ZBJ A;  1AD5 A;  1AOJ A;  3M0Q A;  1TUD A;  2ABL A;  1GCQ C;  1X43 A;  2K3B A;  1M3B A;  2I0N A;  2LP5 A;  3TSW A;  1H92 A;  1X6B A;  1NM7 A;  2KRM A;  2RPN A;  3KFV A;  2K7A A;  3M0R A;  2EVR A;  1EFN A;  3I9Q A;  2RMO A;  1LCK A;  1KIK A;  3EG1 A;  2RQU A;  1BBZ A;  2DNU A;  4IIO A;  1Y0M A;  2H8H A;  3PE0 A;  2RNA A;  1AZG B;  1NLP C;  4A63 B;  1ZUU A;  1PKT A;  1WXU A;  2EGA A;  2JMA A;  1FYN A;  3TVT A;  1BK2 A;  3UF4 A;  2EKH A;  3I5S A;  2K79 A;  5IHK A;  2CUD A;  2BZX A;  1K0X A;  3A98 A;  4Z88 A;  1UHF A;  2EW3 A;  1K0S A;  1WDX A;  2NWM A; 
#chains in the Genus database with same CATH topology
 2BZY A;  3VKI A;  4E7K A;  4C92 A;  2HEQ A;  2E65 A;  2R57 A;  5KYX B;  4LDU A;  5GJW B;  4C92 C;  1YIJ A;  2D1X A;  1MGQ A;  1YBY A;  3EG9 A;  1G8X A;  2QDY B;  4E7Z A;  1K8A R;  2E12 A;  5KH6 A;  3QII A;  1N6A A;  1VQK Q;  3DLL A;  1YP5 A;  4DA4 A;  4F16 A;  2CP5 A;  2QEX T;  3FLG A;  4A4K A;  1PM3 A;  3N5B B;  4M77 B;  3IQL A;  1ZA2 B;  4IUR A;  1PSE A;  4M7D G;  1IRE B;  4OB3 B;  2KEA A;  3A8L B;  5FWC A;  1RI9 A;  3BDU A;  2LDM A;  3S3M A;  1X75 C;  4EIK A;  5KYU B;  4RTU A;  1KSW A;  4J9D A;  1I1J A;  3QWX X;  5CK9 A;  1K9M C;  3VS7 A;  3WXM B;  1EIF A;  2CP2 A;  4ZGD B;  4PJO G;  2AKL A;  4F7U B;  3OYL A;  2QA4 A;  1M1K R;  1TSF A;  1EX4 A;  1VQ5 T;  1SG5 A;  2DL3 A;  5A2Q E;  3VUZ A;  3HTR A;  3JB9 D;  4KT0 E;  4C92 E;  3CCQ Q;  4DOV A;  2F1L A;  1QVG A;  1WHH A;  2QQ9 A;  3OYE A;  3UPU A;  4DQ2 A;  4OF1 A;  1YIJ T;  2QQA A;  4LD6 A;  1KJW A;  5GAM d;  2O01 E;  2EYZ A;  2CKK A;  2DVE A;  2R5A A;  5D6Y A;  1JU5 C;  2DKG A;  3BE3 A;  3J7A F;  1G2B A;  2RB6 A;  4C5G A;  3G71 A;  1AWO A;  4B6M A;  1YJ9 A;  2G3R A;  5IXF A;  3VS2 A;  2FZC B;  1WJR A;  1AZE A;  1KD1 U;  2J7I A;  3M56 A;  3EFO A;  2ZPH B;  1QLY A;  3OW2 P;  2DD4 A;  2FVU A;  2E3H A;  5CAI A;  3EG0 A;  1SHG A;  4BI4 A;  2QGF B;  2YHT A;  1XOV A;  2RN8 A;  5D7U A;  3CCU A;  3HRT A;  3OW2 S;  2DJZ A;  2FHD A;  2L3Q A;  1FXX A;  2QA4 T;  2D9T A;  3X26 B;  4F17 A;  1KC8 C;  2H3J A;  2CT4 A;  3SWN B;  3ZBD A;  1YJN Q;  5GAN 4;  1JXO A;  1QCN A;  2EQK A;  2KYB A;  1KQ2 A;  2BE9 B;  1T0H A;  2L89 A;  1X2K A;  3CCJ A;  1Z9Q A;  3REB B;  3PGG A;  2HMA A;  3OYY A;  2DZ9 A;  2DF6 A;  1YJW Q;  1G3T A;  2OI3 A;  3WVE B;  1O9S A;  2RA2 A;  3JB9 F;  1I81 A;  3EFS A;  1QVP A;  2I2L A;  1NLO C;  2K3Y A;  2L0A A;  2HAX A;  2JN0 A;  4HCC A;  3P8B B;  1Q86 R;  4JLI A;  2RHX A;  2CZ0 B;  1TS9 A;  3G71 T;  3MCA B;  5GAO m;  2V1Q A;  1YJ9 T;  2A28 A;  4Z8A A;  1D0Y A;  5LJ3 g;  1K73 R;  1TOV A;  1VQ8 A;  3V7S A;  2B86 A;  2EYY A;  2WSF E;  1K1Z A;  2J05 A;  4OB2 B;  1H3H A;  3CC7 Q;  3M5A A;  4J9C A;  1AWJ A;  1YIT T;  3ULR B;  1PD1 A;  3CBP A;  3SWN C;  1W1F A;  1ZUK A;  1G5V A;  1BIB A;  3CCU T;  3CC4 T;  2LNV A;  4QT7 A;  1I5O B;  3NTK A;  4Y91 A;  5GAN d;  3G4S T;  3CME A;  2ZCF B;  2DTO A;  1PD0 A;  5LJ3 f;  1GBR A;  3DB3 A;  3OYN A;  2DZC A;  4RTT A;  5FRN A;  2QAS A;  1G3S A;  1T3L A;  3OSS C;  2EGE A;  1FMV A;  1VQP A;  2HDA A;  2AK5 A;  3E9F A;  3CCJ T;  1U06 A;  3OS5 A;  2FPF A;  4Y28 E;  2YLC A;  3PNW C;  2P4R A;  4R0K A;  2L3P A;  3VYH B;  3TQ7 P;  3CCV Q;  1YHQ Q;  3JB9 H;  1KQ1 A;  4JJC A;  4MZP A;  2KXD A;  1AVZ C;  3FJ5 A;  1O75 A;  3R6N A;  3JSC A;  2COZ A;  2YRD A;  4RTW A;  5LJ3 h;  2BZ8 A;  4KUD K;  5HY6 A;  1VQM A;  4Z02 A;  5CIU A;  3PMT A;  4ZGE B;  3OYH A;  3H0H A;  3X24 B;  4BD3 A;  2EGC A;  4XU2 A;  1VQ8 T;  2DIL A;  2LRQ A;  2K2V A;  2O9V A;  3OSV A;  4PK4 A;  2DRM A;  1TH7 A;  3GNF B;  2KT1 A;  2JUF A;  5FU6 B;  1Q81 C;  3P8D A;  3CCE T;  2EQI A;  1ABQ A;  4LXC A;  2AZV A;  1QP2 A;  3BW1 A;  3GOX A;  2BE7 D;  1ZQ1 A;  4BDZ A;  4ESR A;  2AZS A;  3CME T;  2J6F A;  5GJV B;  1M27 C;  1KQS P;  2E3I A;  2W10 A;  2YUP A;  4PFP A;  2KRS A;  2PUO B;  2OAW A;  2JTM A;  1VQP T;  4JRI A;  1BCO A;  1YN8 A;  1KQS S;  2OAU A;  3H0I A;  1VQ5 Q;  3CPW P;  3T9N A;  3GNG A;  2ECZ A;  5CR2 A;  2ED1 A;  4JDS A;  4MMK A;  3CQT A;  2PVG B;  5LJ3 d;  5M9O A;  2HSE B;  2RF0 A;  4HVV A;  3CPW S;  2HKN A;  3LX7 A;  1RAC B;  1T3S A;  4J7I A;  5LJ5 j;  1XQH A;  5CQY A;  2PUK B;  1MMD A;  3JAM E;  4M78 B;  2FZK B;  3EHR A;  3TSZ A;  1N8R U;  1NEG A;  3PIP A;  1VIE A;  4FYW B;  4C8Q G;  1Q7Y R;  5FU6 C;  1IHV A;  1SRL A;  5I2M A;  2LTO A;  1IO6 A;  1G3Y A;  4M75 G;  2MWP A;  5CKD A;  3CMA A;  4JRP A;  1KFZ A;  2O88 A;  1H64 1;  2LJ3 A;  5CVI A;  2J6K A;  5IH2 A;  3CEY A;  2SRC A;  2DER A;  4J9H A;  2C0I A;  1OEB A;  1F1B B;  4C0F A;  5L8R E;  4M7D B;  3C12 A;  3FB9 A;  3VUB A;  1RAB B;  1ZA1 B;  2V26 A;  3FC3 A;  3I55 Q;  3A8O B;  4O5V A;  2HZY A;  3RKY A;  1UJY A;  1V76 A;  2XI9 A;  4XTW A;  2DL8 A;  2MWO A;  1M2V A;  2F5K A;  3M54 A;  4M7A D;  2IPO B;  2ZPI B;  1ARK A;  1PRM C;  2QA4 Q;  2JZ2 A;  2Y4X A;  4PJO B;  2KDS A;  4JJD A;  3GBQ A;  5IT9 E;  2HSP A;  4E6R A;  5I11 A;  2YXY A;  3PFS A;  3TSW A;  5C0M A;  5CKB A;  4E2F B;  2KAF A;  2K57 A;  4C0Z A;  5DLO A;  2KRM A;  3GP8 A;  2K7A A;  1SSF A;  2QQB A;  3I9Q A;  2RMO A;  1KIK A;  2E6Z A;  2DIG A;  4NS5 A;  1AZG B;  4N4H A;  3AHU A;  1PKT A;  2QTX A;  3M4Y A;  2DAQ A;  2JMA A;  5GAO r;  3G71 Q;  2P0P A;  1D1B A;  3I5S A;  1YJ9 Q;  1UEB A;  3QYH B;  1K0X A;  3A98 A;  1IRX A;  1UHF A;  2X4W A;  1K0S A;  5GAM e;  1OUL A;  2E10 A;  4CC4 B;  1W2B A;  3H0F A;  2XDP A;  4FYX B;  3ER0 A;  3FRN A;  3UWN A;  4M7D F;  1NZ9 A;  1GL5 A;  1IHW A;  1BB9 A;  3OBW A;  2K4Y A;  2ZAE A;  1YIT Q;  4LDV A;  2IVW A;  1TWB A;  2DXT A;  3CCU Q;  1Q82 C;  1Y96 A;  1M4Z A;  3SHW A;  4M7A A;  1K76 A;  1M8V A;  3CC4 Q;  3V8J A;  2JM9 A;  3TEE A;  3A8M B;  1G3W A;  2DA9 A;  3M58 A;  4C5H A;  1K9M U;  4M7A C;  1VQO Q;  1NE8 A;  2NUP A;  3OYK A;  3G4S Q;  1JO8 A;  1M5Q 1;  2EQU A;  2J06 A;  1AWX A;  3TU4 K;  1M30 A;  1OI1 A;  1YWO A;  2GFA A;  3X20 B;  4R56 A;  4M7A F;  2X9H A;  4CC7 A;  5HCK A;  2QQR A;  3CCJ Q;  1JRI A;  1JXM A;  3REA B;  4FU6 A;  5HK3 A;  3JCM P;  1PC0 A;  1JJ2 A;  2X4Y A;  2LJ0 A;  1VQ7 Q;  4OMM A;  1U5S A;  3NPF A;  3I35 A;  1QQJ A;  2MAM A;  1W2B P;  4RG2 A;  5KE2 A;  4AMC A;  5A0G A;  4PLL A;  1RAE B;  4RTY A;  1RAG B;  4FL6 A;  1I5L A;  2KNB B;  2YWW A;  3J81 E;  4NOY A;  2EBP A;  3CCS A;  1W2B S;  3LGF A;  2GGR A;  2A08 A;  1MND A;  2K5L A;  3S3N A;  3JB9 I;  2KGT A;  2M1H A;  2QI2 A;  3Q1J A;  1VQ8 Q;  4M7A E;  3ASK A;  1WHK A;  1NBE B;  2LMJ A;  4E7L A;  2VC8 A;  4JJN K;  3RIR A;  1WJQ A;  4FYV B;  1VOM A;  3CCE Q;  2L8D A;  2LZ6 B;  3HPW A;  2FG0 A;  2D0Q B;  3TCJ A;  1CKB A;  1HD3 A;  1PWT A;  2EJ9 A;  2YUQ A;  3HP9 A;  1JJ2 P;  1KHI A;  4PKC C;  4HVW A;  2FZG B;  2XDD A;  4OMQ A;  1KC8 U;  1NYG A;  2DJQ A;  5LL6 S;  4XU1 A;  1TG0 A;  1JJ2 S;  1WXB A;  2DTI A;  2FL7 A;  1YFN A;  4KRT A;  3OYC A;  3A1P A;  1GBQ A;  1VQ9 Q;  4C0D B;  3M4G A;  2LX7 A;  1D3B A;  2RHZ A;  2QTV A;  1OYX A;  4N4I A;  2QDL A;  4BB7 A;  1M8M A;  3HHT B;  4AFZ C;  2X3W D;  5CKF A;  2O9S A;  1S72 T;  1RAA B;  2GNC A;  3OMC A;  2NUT A;  4BUG A;  2P84 A;  7AT1 B;  3A8H B;  3MO8 A;  2CSI A;  4MML A;  2M0O A;  3H8Z A;  3MEV A;  2VGM A;  4KUI A;  2XMF A;  4FM4 B;  1ABO A;  3ZFJ A;  1WZO A;  1QCO A;  3C0C A;  3OQ5 A;  4M77 D;  2JVV A;  2PVD B;  4NL2 A;  3OA6 A;  4XK8 E;  3KXT A;  1RAD B;  5LJ5 g;  3JCM c;  4MDX A;  4OB1 B;  3DB4 A;  2COW A;  5HK0 A;  5GMK l;  1Y07 A;  4B9W A;  1YI2 Q;  3PVQ A;  4RTV A;  4FSS A;  2NUZ A;  2JW4 A;  1KG1 A;  1KD1 R;  5KYY B;  1JQQ A;  3VS1 A;  5LJ5 f;  4E47 A;  4J6X A;  2KVQ G;  4KH1 B;  3FDR A;  3VV0 A;  1AEY A;  2DLP A;  2M16 A;  4OML A;  1YCS B;  4Q5W A;  3CCL A;  3MP6 A;  2OTL A;  4MZM A;  1WPY A;  2COY A;  2F5T X;  3OW2 A;  3CCM A;  4QQG A;  2LX9 A;  2MMP A;  1GCP A;  4HCZ A;  3QSU A;  3GIB A;  1VQN A;  3JCM g;  5IXB A;  3CC2 A;  1PRL C;  2W0Z A;  3EG3 A;  4LE9 A;  3QZ9 B;  2EYX A;  2M51 A;  3H6Z A;  1M90 C;  1WHM A;  2EAY A;  1QCF A;  5LJ3 e;  4M77 A;  5LJ5 h;  4OMN A;  4M77 C;  1WFW A;  4X9D A;  4J8O A;  1KK7 A;  3NGP A;  3MKD A;  1YCY A;  2ROL A;  4C8Q B;  2MCN A;  3JCM f;  2HBP A;  2EQM A;  2K9G A;  4M75 B;  4M77 F;  3HL8 A;  9ATC B;  1VQ4 Q;  5GAO n;  1C1A A;  1Q81 U;  1XNI A;  4F7U A;  3P8H A;  3OYI A;  3QHS A;  2CZ7 B;  1NPR A;  4UC4 A;  3I56 A;  2KK4 A;  2LNH B;  2M02 A;  3RBB B;  1FMW A;  2WSE E;  3SEM A;  4BY6 B;  4DBQ A;  2KRN A;  2FRY A;  2LT4 A;  2IIM A;  4F7U F;  4J9G A;  4J5Y A;  4CI0 C;  3VS6 A;  3JCM h;  2OTL T;  1FWZ A;  4ZN3 A;  2BTT A;  3M0T A;  1HYO A;  2FYK A;  3CCM T;  2AT1 B;  3EHQ A;  2PQW A;  2M0Y A;  1OU9 A;  4PJJ A;  1VQN T;  4M77 E;  5CKE A;  2JTE A;  4GY5 A;  1E6G A;  3OYM A;  3CC2 T;  4BDY A;  1OZ3 A;  3QKJ A;  5DM7 R;  3G1J A;  3C95 A;  3MET A;  2KT8 A;  4ELY C;  1OX9 A;  4IIM A;  1MMN A;  1HJD A;  4HCK A;  4HXJ A;  4X1V A;  1SRM A;  3OYG A;  4M75 C;  4DOW A;  3L2W A;  2XU8 A;  2LCS A;  3M9Q A;  4F7U E;  1X01 A;  1NJI C;  3NTI A;  2D8J A;  4M75 F;  4HKE A;  2KYM A;  2DFU A;  4J9E A;  3EGX B;  1UUE A;  1UDL A;  3M0P A;  3UT1 A;  1RLP C;  3CBO A;  4IUV A;  3SWN A;  3E1S A;  3I56 T;  2RQT A;  3G6E A;  1MUZ A;  2PTK A;  2DD5 A;  4E7H A;  3MEA A;  4AFS C;  4BE2 A;  4BAC A;  2F69 A;  2DRK A;  4C92 G;  4FT4 A;  2YRV A;  1RAI B;  2V8I A;  1CSK A;  4ELZ C;  4J83 A;  5KE3 A;  2EJF A;  3FIF A;  1PG5 B;  3NFC A;  4QQ6 A;  4LUD A;  4AG1 C;  5GAO q;  2KI7 A;  3SDZ A;  1R8O B;  2AIR B;  1MV0 B;  1EZZ B;  2CT3 A;  2DYI A;  4OMP A;  3CCR Q;  1KQS A;  3C94 A;  5GAN 8;  1S72 Q;  1ZSZ B;  2CYZ B;  2E64 A;  3MEW A;  1P92 A;  3V8L A;  1ZBJ A;  3CPW A;  4WF2 A;  1X43 A;  2K3B A;  2JJ9 A;  1M3B A;  2GFU A;  4A54 A;  2I0N A;  2LP5 A;  2VAS A;  3LWI A;  2D6F A;  2A0F B;  4KGX B;  4FW2 A;  5J26 A;  3KFV A;  2VGN A;  5DLQ E;  2RJC A;  5GAN 3;  2P0Q A;  3FEO A;  3EG1 A;  1N8R R;  3HFO A;  3QXE B;  2QEX Q;  1K8A C;  1BBZ A;  2P0K A;  4BE0 A;  4IIO A;  1OU8 A;  3G6E T;  1NLP C;  2KMT A;  1ZUU A;  2LCL A;  4XTX A;  4EMK B;  1Q82 U;  3V7R A;  2OTJ A;  1WXU A;  4KH0 B;  3OS0 A;  2QXF A;  4ZN1 A;  1FYN A;  1BK2 A;  2K79 A;  1VQK A;  2BZX A;  3BFM A;  4Z88 A;  3OBY A;  1WDX A;  2NWM A;  3GF5 A;  3GPL A;  5I21 A;  1IXD A;  2YRC A;  2K5I A;  4IKF A;  2O4X B;  4LUE A;  3URG A;  2VV5 A;  1PNJ A;  4DBH A;  4HT8 A;  1M1K C;  2F2V A;  1BI2 A;  4AT1 B;  4C0G A;  4E7J A;  2QQS A;  4M78 D;  2C0O A;  3X25 B;  2LT1 A;  5AYF A;  2F2X A;  1WHG A;  3QDF A;  4XU0 A;  4ZTJ A;  2YUN A;  3RKX A;  1VQM T;  1QKW A;  3KUF A;  3L42 A;  3HFN A;  5IHI A;  4RUG A;  1YIJ Q;  3EH1 A;  3VU3 C;  4XTZ A;  2V8K A;  1ACM B;  1UG1 A;  3JB9 G;  1IGU A;  3LGL A;  4OVA A;  4M7D D;  2PZ1 A;  1R0B G;  2DXC A;  3PVL A;  3VS3 A;  5GMK m;  4B9X A;  3RER A;  2EWN A;  1M1F A;  2CP6 A;  4PJL A;  1MV3 A;  3QZ5 B;  2JS0 A;  2OTJ T;  2RI5 A;  1HXD A;  3RNJ A;  5KYW B;  4V2S A;  2MI6 A;  4PJO D;  2CH4 A;  4QVZ A;  1VYU A;  5KCH A;  1QP3 A;  3SFM A;  1M9S A;  2P4T A;  4IUP A;  2LQK A;  2HQX A;  2RHY A;  1K9M R;  2VKN A;  3JCM b;  1MMA A;  4LDW A;  1VQN Q;  4M78 C;  5GMK j;  2ROT A;  1FMK A;  3CC2 Q;  3M55 A;  4D8D A;  5GAN j;  4L59 A;  1AWW A;  4J6W A;  4GBQ A;  1BI0 A;  1QW1 A;  4M78 F;  2KE9 A;  3EGD B;  1YJN A;  4A53 A;  3JRZ A;  3LLR A;  1CKA A;  2GTJ A;  3E2U A;  4JRK A;  4M7D A;  3CMA T;  5KCO A;  2RK1 A;  3S3O A;  5A0D A;  2YSQ A;  4M7D C;  1W70 A;  1Q86 C;  2DIQ A;  2RHU A;  3EG2 A;  2Y4Y A;  2X35 A;  2ZGW A;  4EDU A;  1IZ6 A;  2EYW A;  2JOY A;  2WSC E;  2QYZ A;  2NYS A;  4RG8 A;  3L2U A;  4ANJ A;  2KBT A;  1QVF P;  1K73 C;  2RQV A;  2VWF A;  1D0X A;  2YLB A;  3I56 Q;  2XIC A;  4L5G A;  4RKU E;  1S1N A;  2RD1 A;  1GXI E;  1Y57 A;  1UGR B;  2J6O A;  3QYG B;  4PJO C;  3QWY A;  4JPB W;  2LCC A;  1D0Z A;  1QVF S;  1YNZ A;  2YT6 A;  2AHJ B;  4DEX A;  8AT1 B;  2YDL A;  2AKK A;  5EG2 A;  1ZBX A;  4PJO F;  4ZGJ B;  4Z89 A;  2K5F A;  2EQJ A;  3DLM A;  2JNG A;  1FX7 A;  3O8V A;  1WQ7 A;  1KC8 R;  3AT1 B;  3U23 A;  4M7D E;  4LDX A;  2JTF A;  3OS2 A;  1M90 U;  4FT2 A;  1YJN T;  2DYB A;  2BKD N;  2RJF A;  3EH2 A;  3H9N A;  3E9G A;  3PMI A;  1VYT A;  4JZ4 A;  2JXB A;  1UGV A;  2L2P A;  4Y92 A;  2KR3 A;  2CGH A;  1B34 B;  5GAN 7;  1NEB A;  3INZ A;  4RTZ A;  2QK0 A;  1OZ2 A;  1PSF A;  2G6F X;  3CCV A;  1YHQ A;  2PNI A;  3MEU A;  3M0S A;  2IG0 A;  3RDV A;  3ZEH A;  1U8R A;  2NLU A;  3G6E Q;  4RCB A;  2KXC A;  4XTU A;  4BE1 A;  1VUB A;  4TVR A;  1IB8 A;  4FSX A;  3RMS A;  2GQV A;  3CME Q;  1BI1 A;  4OMO A;  3J80 E;  1U3O A;  2XHC A;  2PU9 B;  3OY9 A;  1M1G A;  4C92 B;  1VQ6 A;  1AHJ B;  2X4X A;  4IUU A;  1NPP A;  4JLG A;  3JCM e;  2FO0 A;  2E1H A;  1VQP Q;  2HBW A;  1PCX A;  3EG9 B;  2DX1 A;  2D8H A;  2RQR A;  4MZT A;  5GAM g;  1I07 A;  3G7Z A;  1U1S A;  1W6X A;  3HKS A;  2OJ2 A;  1MNE A;  4AFU C;  1D1C A;  1UJ0 A;  1J3T A;  2EFI A;  3OMG A;  1VQM Q;  4QQD A;  1VQ5 A;  2RI3 A;  5HKC A;  3CCS T;  4RTX A;  4KBM B;  2Y90 A;  1NJI U;  4C5E A;  1YHQ T;  3THK A;  2RH2 A;  2VUB A;  4XTY A;  4NL3 A;  1G83 A;  1Q7Y C;  1UTI A;  2BIV A;  3CPF A;  2OTJ Q;  2RJD A;  3QO3 A;  1ZHI A;  4JZ3 A;  2B8A A;  4D6W A;  2CP3 A;  1NG2 A;  1Q81 R;  4C0D C;  1VQ6 T;  5GAM h;  4C92 F;  4HA8 A;  4HT9 A;  4BI8 B;  2DPP B;  2XK0 A;  1N5Z A;  2ENM A;  3SB2 A;  5IHN A;  1WX6 A;  4J6Y A;  3M59 A;  3FJP A;  2OX7 A;  1RLQ C;  3I55 A;  1E6H A;  2GQI A;  2JMC A;  5FRM A;  3C4S A;  5KYX A;  1H8K A;  2DMO A;  3D7S B;  1TXQ A;  4QVC A;  2CUB A;  2MYS A;  1OV3 A;  4E7S A;  3EFO B;  2DE0 X;  4QVD A;  4OGC A;  1WJS A;  3QDR B;  6AT1 B;  2KY9 A;  2DM1 A;  1GRI A;  4M7A G;  4C8Q D;  3UA7 A;  5CCA A;  4M75 D;  4JJB A;  1HSQ A;  2K6D A;  3JCM V;  1UGP B;  1YWP A;  4HVU A;  4OGE A;  2X3X D;  5L23 A;  3CMA Q;  2EJG A;  1GFC A;  5KYU A;  5GAN g;  2JS2 A;  1K8A U;  4LNP A;  5KYY A;  3QG1 A;  1D09 B;  1M3A A;  2MK5 A;  5CQX A;  1GCQ A;  1XTD A;  4N0A A;  1AD5 A;  4C5I A;  1GCQ C;  1WHJ A;  3QUI A;  5DY9 A;  4N0A C;  2LC4 A;  3DKM A;  1H92 A;  4IUT A;  1X6B A;  1NM7 A;  2DXU A;  4X34 A;  4PLI A;  1EFN A;  3BDL A;  5GAN f;  1LCK A;  1N9S A;  4A4G A;  2DNU A;  3CCL T;  1BYM A;  4PFO A;  1Y0M A;  1JB0 E;  3MPU B;  2DK3 A;  1BI3 A;  3I55 T;  3CD6 A;  1YIT A;  3BY7 A;  2DEQ A;  3GLX A;  1M1K U;  1QVG P;  4EMG A;  2EGA A;  2VB6 A;  2DXB A;  3RKW A;  4ME7 A;  3TVT A;  3CC4 A;  1BKB A;  3UF4 A;  5LJ5 d;  2EKH A;  2R58 A;  5IHK A;  4A4H A;  1VQO A;  3G4S A;  2WAC A;  4DBR A;  4C8Q A;  1QVG S;  5GMK h;  4M75 A;  1UEC A;  4C8Q C;  1M3C A;  1DJ7 B;  1WXT A;  3QJY A;  2E5K A;  1UFF A;  5CKH A;  1HK9 A;  5GAN h;  5ECA A;  2LQW A;  5IN1 A;  3NTH A;  2ESW A;  3F70 A;  4XU3 A;  2F2W A;  5IAY A;  3JCM Q;  2D0N A;  1OPL A;  4EMH A;  1RUW A;  4C8Q F;  1VQ7 A;  1Y71 A;  1TUG B;  2A37 A;  2A3L A;  2FPE A;  2RHI A;  3EFR A;  2MF2 A;  4BY6 C;  3KBG A;  4II1 A;  3HRU A;  4CRI A;  2DL7 A;  1K4U S;  5FLX E;  1SPK A;  2O2O A;  2CH4 W;  3JCM d;  3L2Z A;  1TTH B;  4FCY A;  1H3Z A;  5C6S A;  2C06 A;  2SEM A;  3LH5 A;  3I5R A;  3HRS A;  4P5N A;  2RO0 A;  1Q82 R;  1WLP B;  2CZ1 B;  2RM4 A;  3CD6 T;  4C8Q E;  4PL6 A;  4JS4 A;  2DL5 A;  2FRW A;  4M75 E;  3CCE A;  1SHF A;  2C0T A;  2LVM A;  1JBM A;  1QMC A;  3EAE A;  4PJM A;  1VQO T;  4WTO B;  2GCX A;  3PIO A;  1VA7 A;  4A4F A;  1VQL A;  3SD4 A;  2DL4 A;  2BUD A;  3EGX A;  2HQE A;  4J9F A;  4PFZ A;  4J9I A;  1OQK A;  3LW5 E;  4DEY A;  3JCM W;  1VIF A;  4D8K A;  3CCS Q;  1VQ9 A;  1PKS A;  1VQ7 T;  1WGS A;  1BU1 A;  2EIF A;  1Z9Z A;  1Q86 U;  1XJW B;  4JRQ A;  2V8J A;  1VYV A;  4J7F A;  2HD0 A;  2CDT A;  5GMK i;  1K9A A;  1RAF B;  1ZLM A;  3EGU A;  2PVO B;  2EYQ A;  1K73 U;  3L2R A;  1NYF A;  2JM8 A;  2QG9 B;  1AT1 B;  2DTH A;  5FRO A;  1B3Q A;  5FW9 A;  5GAM j;  3MP8 A;  4FIB A;  2H3E B;  2XDB A;  2RK2 A;  4M77 G;  2CRE A;  3JB9 J;  3UDC A;  1VQ6 Q;  2RI2 A;  5D6X A;  5AT1 B;  1ZSZ A;  1KHC A;  1KD1 C;  1UGQ B;  2MPX C;  1ZSZ C;  2DVJ A;  3OB9 A;  4A4E A;  2CSQ A;  1YI2 A;  4QKU A;  3ZL7 C;  3VS0 A;  4F7U G;  1R77 A;  2CZ6 B;  2HKQ B;  4KGV B;  3X28 B;  1VQL T;  2MOX A;  3CXC A;  2DO3 A;  3L2V A;  1Y7X A;  2K2M A;  4LN2 A;  2GF7 A;  1UGS B;  4N4G A;  1X2Q A;  3A5Z B;  1VQ9 T;  2KSS A;  2CP0 A;  3OYD A;  2CP7 A;  2DBM A;  1B7T A;  2R5M A;  1M2V B;  3V7C A;  3CCQ A;  4EMK A;  1WNL A;  1UB4 A;  1TU0 B;  2VXF A;  4GLK A;  4EMK C;  2EPD A;  4YTL A;  1SEM A;  4GLM A;  4ZNX A;  1QWE A;  5KYN A;  1X6G A;  2DEU A;  5EC7 A;  1WA7 A;  5I2S A;  3V8K A;  4RMO A;  1RL2 A;  4ATO A;  3NMZ C;  3UAT A;  1SKU B;  2XG8 D;  1V29 B;  2FPD A;  3QBY A;  2O4X A;  2XD0 A;  1RAH B;  1B07 A;  2Z0W A;  3JV3 A;  1VQK T;  2CS7 A;  1X69 A;  4X9C A;  3CXC P;  1LVK A;  3LWH A;  2KRO A;  2K3X A;  4F04 B;  4KGZ B;  1ZUY A;  1WQW A;  2VYT A;  3UA6 A;  1OPK A;  5J3B A;  4JS5 A;  1VQ4 A;  3CCL Q;  2OTL Q;  3CXC S;  1YI2 T;  1QVF A;  3A8G B;  2GBQ A;  3CCM Q;  4M78 A;  3OYB A;  4OP0 A;  1SSH A;  2VXE A;  1SF9 A;  5GAN 2;  2L5Q A;  2GTO A;  3QJ6 A;  1WIE A;  4ORZ A;  4BI3 A;  2ED0 A;  3MHX A;  1MMG A;  3OYF A;  5I22 A;  4XAX B;  1LJO A;  2ZZD A;  1TUC A;  2FEI A;  4LD9 K;  1IGQ A;  2QGG A;  3QPH A;  1Y96 B;  4M7A B;  1MHN A;  3CCQ T;  4HCB A;  1M90 R;  3VYG A;  2NUP B;  4M4Z A;  2RQW A;  2A7Y A;  5KYW A;  1T0J A;  1PHT A;  5D6W A;  3LH0 A;  2ZPF B;  1YJW A;  1Q7Y U;  5A0L A;  1E7O A;  1QWF A;  3NHN A;  3VJP A;  2L3R A;  2XID A;  1QKX A;  2X51 A;  3VRY A;  5FU7 B;  5FWB A;  1JEG A;  1WI7 A;  3R6O A;  3PT9 A;  2MIO A;  4J9B A;  2E6N A;  5GAN 6;  1GFD A;  4PJO A;  2E4H A;  3JCM X;  3MJX A;  1UHC A;  3OYA A;  5CO7 A;  4F14 A;  4VUB A;  1LPL A;  1UE9 A;  4M78 E;  1V1C A;  5GAO l;  3OYJ A;  1VQ4 T;  4JUV A;  4WCI A;  4PJN A;  1I4K 1;  3CC7 A;  4LDY A;  4OB0 B;  3CD6 Q;  2VVK A;  2LJ1 A;  3M0U A;  1LNX A;  2DET A;  8ATC B;  2LQN A;  3EGD A;  4O6J A;  2FB7 A;  3M57 A;  2O31 A;  3E19 A;  2HCK A;  4XQ3 A;  1X27 A;  5J39 A;  2LQ8 A;  2X4J A;  4FW1 A;  1W4S A;  1BCM A;  4CC2 A;  3ME9 A;  3LYI A;  1I8F A;  2QAZ A;  4OMF B;  4AFQ C;  5LJ5 e;  4QW2 A;  4IUQ A;  4K11 A;  2V1R A;  2A36 A;  5FU7 C;  1YJW T;  3VRZ A;  3VS5 A;  4EPC A;  4PJO E;  2JT4 A;  1ZX6 A;  5LJ3 j;  4XTV A;  3CCR A;  2HNI A;  3VS4 A;  2ZPG B;  3PTA A;  1S72 A;  1I0C A;  1C6V X;  2DBK A;  1NJI R;  3MP1 A;  4RCC A;  4CC3 A;  1M2O A;  1D3B B;  4FYY B;  4C92 D;  2KQW A;  2EKO A;  1N8R C;  2HQH A;  3L2Q A;  2RJE A;  3RES A;  4E7I A;  1D1A A;  2ATC B;  1RI0 A;  4R55 A;  1OOT A;  2NUT B;  3TRE A;  3O5Z A;  1ZSG A;  1U1T A;  4L6V 5;  1N27 A;  3CC7 T;  1WYX A;  3H41 A;  2QEX A;  1Q95 G;  1A0N B;  2L3S A;  2YUO A;  1N9R A;  3RR6 A;  4AG2 C;  1C0M A;  1AOJ A;  3M0Q A;  1TUD A;  2ABL A;  2E5Q A;  1B34 A;  3RUX A;  2RPN A;  5GAN 5;  2ZPB B;  3OS1 A;  3CBM A;  3L1A A;  1VQL Q;  2E70 A;  2EVR A;  3M0R A;  3S6W A;  5GMK e;  1LOJ A;  2RQU A;  4DBF A;  2HL5 C;  5GAO p;  3HSB A;  3RMQ A;  2H8H A;  2E41 A;  3PE0 A;  2RNA A;  5GAN e;  2HL3 A;  3JCM J;  2XKO C;  4PNO A;  4ZTF A;  3WVD B;  4A63 B;  2ZPE B;  1BIA A;  5GAM f;  3CCV T;  3CCR T;  1R0C B;  2CUD A;  1WHL A;  1X6O A;  2M9U A;  2EW3 A;  4KUL A;  4M78 G;  3M53 A;  1OX8 A;  4MDW A; 
#chains in the Genus database with same CATH homology
 4CC4 B;  1UEC A;  1M3C A;  3H0F A;  2BZY A;  1WXT A;  2E5K A;  2HEQ A;  1GL5 A;  1UFF A;  1BB9 A;  5ECA A;  4LUE A;  2LQW A;  5GJW B;  1PNJ A;  2D1X A;  2ESW A;  2F2V A;  3SHW A;  2F2W A;  1K76 A;  2D0N A;  1OPL A;  2JM9 A;  1RUW A;  2C0O A;  2DA9 A;  1YP5 A;  1JO8 A;  2A37 A;  2J06 A;  4F16 A;  2FPE A;  2F2X A;  1AWX A;  3IQL A;  1M30 A;  1YWO A;  2YUN A;  1QKW A;  2DL7 A;  1K4U S;  5IHI A;  2KEA A;  1SPK A;  4RUG A;  5FWC A;  1RI9 A;  4CC7 A;  5HCK A;  2O2O A;  2CH4 W;  1JXM A;  3REA B;  4EIK A;  4RTU A;  1UG1 A;  2LJ0 A;  1KSW A;  4OMM A;  1U5S A;  2SEM A;  4J9D A;  1I1J A;  3NPF A;  3QWX X;  2PZ1 A;  3I35 A;  3VS7 A;  3LH5 A;  2AKL A;  3PVL A;  3I5R A;  3VS3 A;  1WLP B;  1MV3 A;  4RTY A;  2DL5 A;  2KNB B;  2FRW A;  2JS0 A;  1SHF A;  2C0T A;  2DL3 A;  2EBP A;  3RNJ A;  2GGR A;  2A08 A;  2KGT A;  2CH4 A;  2LMJ A;  1VYU A;  1VA7 A;  2DL4 A;  4J9F A;  4J9I A;  1KJW A;  4DEY A;  2EYZ A;  2LZ6 B;  2VKN A;  4D8K A;  2FG0 A;  1JU5 C;  1CKB A;  1HD3 A;  1PWT A;  1PKS A;  2YUQ A;  1G2B A;  1BU1 A;  1Z9Z A;  2ROT A;  1FMK A;  4HVW A;  1AWO A;  1VYV A;  4OMQ A;  5IXF A;  4D8D A;  2CDT A;  1NYG A;  2DJQ A;  1AWW A;  3VS2 A;  1ZLM A;  1K9A A;  1TG0 A;  4GBQ A;  1AZE A;  2J7I A;  3EGU A;  1WXB A;  2KE9 A;  4KRT A;  1NYF A;  1QLY A;  2JM8 A;  1GBQ A;  3EG0 A;  1B3Q A;  1SHG A;  1CKA A;  2GTJ A;  5FW9 A;  1XOV A;  2LX7 A;  2RN8 A;  2YSQ A;  1W70 A;  2QDL A;  3EG2 A;  2CRE A;  1M8M A;  2L3Q A;  4AFZ C;  2X3W D;  2O9S A;  2EYW A;  2GNC A;  4F17 A;  2CT4 A;  2KBT A;  2CSI A;  1JXO A;  2RQV A;  2VWF A;  2XMF A;  2DVJ A;  1ABO A;  2KYB A;  1S1N A;  1Y57 A;  1T0H A;  3C0C A;  1X2K A;  2J6O A;  2CSQ A;  3QWY A;  1Z9Q A;  4JPB W;  3REB B;  3ZL7 C;  3VS0 A;  2DF6 A;  1YNZ A;  2YT6 A;  2OI3 A;  2MOX A;  1NLO C;  2K2M A;  2L0A A;  4LN2 A;  4DEX A;  2YDL A;  2AKK A;  1X2Q A;  4Z89 A;  2DBM A;  3PVQ A;  4RTV A;  4FSS A;  2V1Q A;  2A28 A;  2NUZ A;  2JW4 A;  4Z8A A;  3U23 A;  1JQQ A;  2EPD A;  1SEM A;  3VS1 A;  4GLM A;  4ZNX A;  2B86 A;  1QWE A;  2EYY A;  1K1Z A;  2J05 A;  1X6G A;  5EC7 A;  2DLP A;  2DYB A;  1H3H A;  1AEY A;  1WA7 A;  1YCS B;  4OML A;  4J9C A;  1AWJ A;  3ULR B;  3NMZ C;  3UAT A;  1VYT A;  1W1F A;  1ZUK A;  2JXB A;  4JZ4 A;  1UGV A;  2L2P A;  2FPD A;  4Y92 A;  2KR3 A;  1NEB A;  1GCP A;  4RTZ A;  1B07 A;  4QT7 A;  3JV3 A;  2G6F X;  5IXB A;  1PRL C;  2PNI A;  2W0Z A;  1X69 A;  3EG3 A;  4LE9 A;  2EYX A;  2M51 A;  1GBR A;  3M0S A;  2KRO A;  4RTT A;  1ZUY A;  1T3L A;  3UA6 A;  1OPK A;  1QCF A;  2EGE A;  2HDA A;  4OMN A;  2AK5 A;  2KXC A;  1U06 A;  2GBQ A;  1WFW A;  2FPF A;  1SSH A;  2P4R A;  4R0K A;  3NGP A;  2L3P A;  2GTO A;  1WIE A;  2ROL A;  4ORZ A;  2MCN A;  4JJC A;  2ED0 A;  4OMO A;  1U3O A;  2KXD A;  2K9G A;  1AVZ C;  3FJ5 A;  3R6N A;  5I22 A;  1TUC A;  2FEI A;  4RTW A;  2FO0 A;  2BZ8 A;  2HBW A;  2DX1 A;  2D8H A;  2RQR A;  1I07 A;  3H0H A;  2LNH B;  4M4Z A;  2RQW A;  3RBB B;  1T0J A;  1PHT A;  2EGC A;  1W6X A;  3SEM A;  2DIL A;  2OJ2 A;  2KRN A;  2FRY A;  2IIM A;  4AFU C;  2O9V A;  1UJ0 A;  1E7O A;  4J9G A;  1QWF A;  1J3T A;  2DRM A;  3NHN A;  3VS6 A;  2KT1 A;  1QKX A;  2BTT A;  3M0T A;  3VRY A;  2EQI A;  5FWB A;  1JEG A;  1WI7 A;  1ABQ A;  3EHQ A;  2AZV A;  2MIO A;  4J9B A;  1GFD A;  4RTX A;  2M0Y A;  1UHC A;  2JTE A;  4ESR A;  1E6G A;  2AZS A;  3THK A;  4F14 A;  2J6F A;  5GJV B;  1M27 C;  1UE9 A;  2W10 A;  2KT8 A;  1G83 A;  2YUP A;  1V1C A;  4IIM A;  1HJD A;  2KRS A;  1UTI A;  2OAW A;  4HCK A;  4HXJ A;  4WCI A;  1SRM A;  4X1V A;  1YN8 A;  3H0I A;  2VVK A;  2LJ1 A;  3M0U A;  2LCS A;  2ECZ A;  2LQN A;  2ED1 A;  3CQT A;  2O31 A;  4JZ3 A;  2HCK A;  2RF0 A;  2D8J A;  4HVV A;  1NG2 A;  1X27 A;  2KYM A;  1T3S A;  4J9E A;  1UUE A;  1UDL A;  1N5Z A;  3M0P A;  4CC2 A;  1RLP C;  2ENM A;  4AFQ C;  5IHN A;  1WX6 A;  2RQT A;  3EHR A;  4K11 A;  3TSZ A;  1MUZ A;  2V1R A;  2PTK A;  1RLQ C;  1NEG A;  4AFS C;  1E6H A;  2GQI A;  1SRL A;  2JMC A;  2A36 A;  1IO6 A;  2DRK A;  1H8K A;  2DMO A;  3VRZ A;  3VS5 A;  1KFZ A;  2O88 A;  2JT4 A;  1ZX6 A;  2LJ3 A;  2CUB A;  2J6K A;  3VS4 A;  5IH2 A;  1OV3 A;  1CSK A;  2SRC A;  2DE0 X;  1I0C A;  2DBK A;  4J9H A;  2DM1 A;  1GRI A;  2C0I A;  1OEB A;  4LUD A;  3UA7 A;  4CC3 A;  4AG1 C;  4JJB A;  1HSQ A;  2K6D A;  1YWP A;  4HVU A;  2X3X D;  5L23 A;  1UJY A;  1MV0 B;  1OOT A;  2CT3 A;  2DL8 A;  1GFC A;  4OMP A;  3O5Z A;  1ZSG A;  2JS2 A;  1ARK A;  1PRM C;  4LNP A;  1WYX A;  3H41 A;  1M3A A;  1A0N B;  2L3S A;  2YUO A;  4JJD A;  3GBQ A;  1GCQ A;  2HSP A;  4AG2 C;  4E6R A;  5I11 A;  1ZBJ A;  1AD5 A;  1AOJ A;  3M0Q A;  1TUD A;  2ABL A;  1GCQ C;  1X43 A;  2K3B A;  1M3B A;  2I0N A;  2LP5 A;  3TSW A;  1H92 A;  1X6B A;  1NM7 A;  2KRM A;  2RPN A;  3KFV A;  2K7A A;  3M0R A;  2EVR A;  1EFN A;  3I9Q A;  2RMO A;  1LCK A;  1KIK A;  3EG1 A;  2RQU A;  1BBZ A;  2DNU A;  4IIO A;  1Y0M A;  2H8H A;  3PE0 A;  2RNA A;  1AZG B;  1NLP C;  4A63 B;  1ZUU A;  1PKT A;  1WXU A;  2EGA A;  2JMA A;  1FYN A;  3TVT A;  1BK2 A;  3UF4 A;  2EKH A;  3I5S A;  2K79 A;  5IHK A;  2CUD A;  2BZX A;  1K0X A;  3A98 A;  4Z88 A;  1UHF A;  2EW3 A;  1K0S A;  1WDX A;  2NWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...