2JZ2A

Solution nmr structure of ssl0352 protein from synechocystis sp. pcc 6803. northeast structural genomics consortium target sgr42
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
b'MIFPGATVRVTNVDDTYYRFEGLVQRVSDGKAAVLFENGNWDKLVTFRLSELEAVKPILEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ssl0352 protein
publication title Solution NMR structure of Ssl0352 protein from Synechocystis sp.
rcsb
source organism Synechocystis sp.
molecule tags Structural genomics, unknown function
total genus 9
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11623 NdhS NAD(P)H dehydrogenase subunit S
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jz2A00
3L2QA 4N4GA 2R57A 4HCZA 3E9GA 5IAYA 5D6WA 4ZTJA 3NTIA 2RI2A 4IUPA 3OY9A 2QQRA 1XNIA 3Q1JA 3M9QA 5C0MA 4II1A 3ASKA 3LH0A 3OYCA 1WJSA 2O4XA 3OS1A 3FC3A 2EQMA 4C5EA 3OQ5A 3O8VA 4X34A 4EDUA 3DB3A 4N4HA 3PNWC 3OS0A 4IUVA 2XDPA 2WACA 2BUDA 3OYMA 4QQDA 4IKFA 4RG2A 3BDLA 4LD6A 4PLIA 3S3NA 2D9TA 2RJFA 3S6WA 3QJ6A 2E6NA 5D6YA 4E7KA 2QQSA 3MEUA 3ZEHA 3LLRA 3L2WA 1G5VA 2LDMA 5KE2A 1WGSA 2YRVA 5FRNA 3META 2L3RA 2RHIA 2EKOA 2L8DA 2RO0A 3PMTA 4E7JA 3QIIA 3NTHA 5KCOA 3DB4A 3PFSA 2VYTA 3CEYA 4FU6A 4OVAA 5FRMA 3MP6A 3L2VA 2G3RA 4BDYA 2K3XA 2RHUA 2RHYA 2B8AA 4QVZA 2IG0A 2LVMA 4PLLA 5CIUA 2BKDN 3F70A 4B9WA 2O4XB 3LYIA 2XK0A 4UC4A 3P8DA 4BD3A 3OYGA 3H6ZA 2EFIA 2LCCA 2M0OA 3UWNA 2R5MA 5IN1A 2L89A 3OYFA 2M1HA 4E7HA 3L2RA 2DIGA 3OYIA 3S3OA 5KCHA 2FHDA 3FEOA 4QW2A 2RHZA 3DLMA 2X4YA 3OYDA 4E7LA 4GY5A 2RJEA 3LGFA 1KHCA 3MEWA 4Q5WA 3OYKA 3OYEA 5J26A 2F5KA 3PMIA 4ZTFA 2HQEA 1MHNA 2EQKA 2X4WA 2RI3A 5KE3A 2X4XA 2K3YA 2MWPA 2RJCA 3FDRA 3OMCA 4A4GA 3OYAA 4BE0A 3P8HA 3L2UA 1N27A 2DAQA 4E7IA 1OZ3A 1OI1A 4IUQA 2JZ2A 3UT1A 5C6SA 5D6XA 4L59A 3H8ZA 2BIVA 4C5GA 1WJQA 3OA6A 3ME9A 1OZ2A 3GOXA 2M16A 1OYXA 3OYBA 2EQJA 4A4EA 3EAEA 4N4IA 2DIQA 1SSFA 3QBYA 3OMGA 2R5AA 3KUFA 4FL6A 4QQ6A 4B9XA 2E5QA 3OYJA 4CRIA 3MP8A 5J39A 2X35A 4BACA 4QQGA 3MO8A 2MWOA 3OS2A 2CKKA 3OYNA 4BDZA 4BE1A 4BE2A 2GFUA 2NLUA 2EQUA 4IUUA 5M9OA 2RJDA 3E9FA 4C5HA 2JTFA 3SD4A 3NTKA 4IURA 2RHXA 2HQXA 4Z02A 5KH6A 2P0KA 2LRQA 2R58A 3OYHA 1H3ZA 4A4HA 1RI0A 4IUTA 4C5IA 3OYLA 2LTOA 3LX7A 5FROA 3L42A 3MEVA 3MP1A 3QKJA 2PQWA 2GF7A 3C4SA 2GFAA 4PL6A 3OB9A 3LGLA 3FLGA 4NS5A 2RI5A 3S3MA 4A4FA 1WJRA 3MEAA
chains in the Genus database with same CATH superfamily
2JS2A 4RTZA 2YWWA 2XKOC 1T0JA 1S1NA 4C8QD 4KH1B 3Q1JA 1M90R 4II1A 2D1XA 3TSWA 4C0GA 4EMKC 1RAHB 2LT4A 4J9EA 2P4TA 2GQIA 1U1SA 2NWMA 4GLMA 1I0CA 4C92F 3SB2A 4M78G 4XTWA 3S3NA 5GANh 3JB9H 3CC7T 4FM4B 2LCSA 4F16A 1U8RA 5D6YA 3G4SA 2QQSA 2A36A 1N8RR 1WGSA 5FRNA 3META 3PMTA 2LQWA 1M2VB 4J6WA 4QVDA 2ZPHB 3CPWP 4HA8A 2E1HA 2O4XB 2MYSA 3D7SB 3A8OB 1WXTA 2LQNA 4RTVA 1KQ2A 2XMFA 1I81A 4JLIA 1YJNT 4KH0B 1PCXA 3EGDB 3J80E 3PVLA 3SHWA 2C0OA 5LJ5j 1D0YA 2EYQA 2RHZA 3QUIA 4Q5WA 1RAFB 3LGFA 4JS4A 3PMIA 2RI3A 4MMLA 1W1FA 2X4XA 8ATCB 5FU7C 4F7UG 2XDBA 3EFRA 1K73C 4M4ZA 5HK3A 1TWBA 2PVGB 2E12A 2QASA 3INZA 2KRNA 1G83A 4BB7A 1M9SA 4PFZA 4C5GA 1QVGP 1R8OB 5A0DA 1AWWA 1KJWA 4A4EA 3BW1A 3QBYA 4B9XA 1FYNA 2D8JA 1AEYA 2J6OA 3OS2A 4BE1A 5CKBA 3AHUA 1WHLA 2JM8A 4C5IA 3G7ZA 2DK3A 4RCBA 4M7AG 2GFAA 3OB9A 2QA4Q 2QEXT 1QVFP 4CI0C 3FLGA 2DL7A 3S3MA 4XTVA 2RD1A 2K6DA 1Q95G 5IAYA 2W10A 1OX9A 2K3BA 4ZTJA 3NTIA 3VUBA 2DMOA 5LJ3e 5KYNA 1KC8U 3O8VA 3CCET 4X34A 1PWTA 2EVRA 2WSEE 4M7DC 3UDCA 1X01A 3I55T 1VQOQ 2NUZA 3FJ5A 2JVVA 1VQ8A 4HCBA 4EIKA 3JRZA 4XK8E 1SG5A 4ZN3A 5I21A 3CPWA 2LJ0A 2E5KA 1YJNA 2KRMA 1H8KA 2C0IA 2CP5A 3QHSA 3QYHB 2DTIA 4HXJA 1YHQT 1EFNA 3HP9A 2Y4XA 3PGGA 4D8DA 4E7HA 2AIRB 2COWA 5CQXA 1VQ6Q 1VYUA 2FRYA 2FL7A 3RKYA 4ZTFA 1FWZA 1MHNA 1W6XA 1Q86R 1YJWT 4J9BA 1WPYA 3L2UA 3NHNA 1I4K1 3R6OA 2OTJA 3JV3A 3OS5A 1Y7XA 4MZMA 1G3WA 5IHKA 1KD1R 3HHTB 4FL6A 3MCAB 4M78C 3JAME 5EG2A 5LJ3h 3QG1A 3PVQA 3NTKA 2EPDA 3GLXA 1GRIA 4M77D 2LTOA 2D6FA 2HSEB 2RB6A 4RTXA 2LX9A 1QVFA 3NGPA 2PU9B 3CCEA 3CCRT 1IHWA 3L2QA 2KXDA 2F2XA 5I22A 4HCZA 5D6WA 5GMKj 4M75A 4J9IA 3OY9A 4M7DF 3I55A 2EQMA 3CCUQ 1SPKA 1YIJA 2DLPA 3UATA 4GBQA 4DBHA 3SEMA 2CP2A 1QP3A 2DKGA 2DETA 1IGUA 2ZAEA 1M1FA 1YHQA 3RUXA 3REBB 4FT4A 1AZGB 4FU6A 3LWIA 1BKBA 2FG0A 1PKSA 4OMFB 2K57A 2DTOA 4JRIA 1UGVA 2PUOB 2YT6A 3OSVA 1UE9A 1OV3A 4K11A 5GAMj 1VQMA 2CP7A 5CQYA 4ELZC 5GAOn 2LJ1A 2PVOB 5FLXE 2QK0A 4M7AC 2QAZA 1LPLA 2DEUA 1ZBJA 1FXXA 2JMCA 2K2VA 4DBRA 3AT1B 5GJWB 2K79A 1AD5A 2DO3A 2E4HA 2M16A 4M78F 1B07A 1JJ2S 4N0AC 4FW2A 1UEBA 3KUFA 4PFPA 2LMJA 4JJBA 2X35A 1NJIU 2V26A 2YDLA 1EX4A 5CVIA 4BE2A 4NL2A 3VYGA 2K9GA 4OF1A 9ATCB 4C92G 2YRCA 3H41A 3KXTA 3OYHA 1YI2A 2F5TX 3OSSC 2CP0A 3MEVA 3MKDA 2RNAA 3V7CA 5GMKm 3MEAA 2K4YA 4N4GA 2LP5A 3CMAA 3QZ5B 1ZUKA 2DJQA 1LJOA 3ZL7C 4C92D 3SDZA 2PVDB 3TREA 5KYUA 1RLPC 3C95A 3LW5E 1ARKA 2W0ZA 2DERA 1QKWA 1PRMC 2XG8D 4F7UF 1Q81C 5GAOm 3RMSA 2DJZA 4LDVA 2YLBA 4JZ3A 1TS9A 4BY6C 2RHIA 1N8RU 4JJDA 2K7AA 2A08A 4M75B 4PLLA 1RACB 1HYOA 1T3LA 3LYIA 4BD3A 4R56A 1TSFA 3CPFA 1WQ7A 2ROLA 3OYFA 1W2BP 1ZSGA 4M7AF 2CH4A 3M4YA 2MK5A 1T3SA 3M5AA 3OYEA 2LZ6B 4ELYC 4HKEA 1VQPQ 1WHGA 2CZ1B 4BE0A 4OMLA 1UFFA 5C6SA 2KYMA 2BIVA 1HD3A 3GOXA 1QVPA 1X2QA 2KEAA 3KBGA 1HXDA 1ZUYA 2HNIA 3HL8A 1WHHA 2COYA 2EYZA 3OYJA 4D8KA 1TH7A 4X9DA 1BI1A 1PRLC 4JJNK 5KYXA 1Q81R 1NYGA 4NL3A 2RQWA 3U23A 5FU6B 1G3YA 5IHIA 3LX7A 3OYLA 3JCMX 3C4SA 1ZA1B 2DYIA 3HKSA 1BI2A 2KGTA 2DD5A 1GXIE 5GAN2 1VQ7Q 2V8KA 2HSPA 4IUPA 2DTHA 3CCLQ 2FRWA 2HL5C 2QDYB 2JXBA 3FC3A 1I5OB 3QYGB 2QA4T 1ZX6A 3IQLA 1N5ZA 5IT9E 4L6V5 1QP2A 2D9TA 3CCVQ 4B6MA 4TVRA 3JB9J 4FYWB 2YUOA 3ZEHA 1MGQA 3CMEQ 3CCSQ 2FZKB 2RHUA 2BZ8A 3CXCS 1VQOT 5GAN6 5KYUB 3LH5A 4JRQA 1HK9A 1JXMA 4LUEA 3V8LA 4ZGEB 4PJOE 4OGCA 1MMNA 5LJ3d 1XOVA 2DE0X 3OW2S 2V1RA 4BI4A 1VQLA 3EG1A 1XQHA 1AWJA 2XD0A 4M7DE 1QQJA 3CBOA 3L1AA 1GCQA 1M90C 1VQ6T 1Q86U 1WHMA 2JZ2A 2F1LA 3UT1A 1FMWA 4J9CA 2P84A 2YUQA 5GANj 2EQJA 3VU3C 1S72A 1VQ9Q 2FPFA 1OQKA 2F2VA 1KD1U 1MNDA 2O9VA 4C5HA 4EMGA 4FSXA 4Z02A 1A0NB 2ESWA 4MMKA 2YLCA 3CCJQ 3VKIA 1VQNQ 1KQSA 4C8QE 1Q7YR 2ED0A 4KGZB 1NEBA 3EH2A 4EMHA 3X26B 2B86A 4CC7A 1GCPA 3CC2A 1X43A 1D1CA 2RN8A 1YJ9T 1LCKA 1YP5A 1BI0A 2VV5A 2D8HA 1YITT 5KYXB 1MV0B 4QT7A 2BUDA 1MUZA 1GL5A 4M78E 1VQOA 4DOWA 3VS4A 3CCUT 3FJPA 3CEYA 4XTXA 1RI9A 1H92A 1NPPA 1WHJA 2LCCA 5IN1A 2L89A 3X24B 3WVEB 3L2RA 4X9CA 4M75G 1VQ6A 1F1BB 1ABOA 2J6KA 5J26A 4LDUA 6AT1B 3CBPA 4M78D 2DL8A 3JCMg 3OYAA 4A53A 1BYMA 2A3LA 2CZ6B 4FW1A 4JJCA 4F7UE 2PZ1A 5GMKi 4BI3A 2DPPB 2M0YA 1NE8A 1D3BA 3DLLA 4N4IA 4AFZC 1QCFA 2GNCA 2E5QA 4BACA 5J39A 2ROTA 2OTLQ 1RUWA 3E1SA 1YFNA 3J81E 4LN2A 2P0PA 2NLUA 1NBEB 3QZ9B 4XTYA 1RI0A 2G6FX 4O6JA 3EFSA 3M0UA 1SEMA 2DL5A 2SRCA 2O88A 3RBBB 2DXUA 3RKWA 2JS0A 2YXYA 2JJ9A 3QWYA 1RABB 2K2MA 1OEBA 2CYZB 3M9QA 1BI3A 4HVVA 4HVWA 4Y92A 4EDUA 4D6WA 3A1PA 4IUVA 5IXFA 1Q86C 2VKNA 1T0HA 4LD6A 2RK2A 4XU3A 1J3TA 1G5VA 1WXUA 5KE2A 5KYYA 2MAMA 3CBMA 1M3CA 2CH4W 5KCOA 4J6YA 2DYBA 5FRMA 2VYTA 3CPWS 4Y28E 3CC7A 2L5QA 1KD1C 3CC4Q 5LJ3j 4M7AD 1PM3A 5GAN7 1W4SA 1QMCA 4WCIA 1K0XA 1ZSZA 2CZ0B 4DEXA 1D0XA 2QG9B 5I2SA 3O5ZA 1IHVA 1K8AR 4QW2A 2X4YA 4JUVA 2RJEA 5GAN8 3R6NA 2L0AA 4Z8AA 3THKA 1IXDA 8AT1B 2P0QA 1N27A 2KVQG 1M5Q1 5CAIA 4PJLA 1YCSB 3JCMP 2KYBA 4OP0A 3OYYA 3BY7A 1VQPT 1UGRB 2DIQA 2VVKA 1MMAA 3OMGA 4M77E 3H0IA 1TUDA 1RLQC 1K0SA 3C12A 3GP8A 5CKHA 2R58A 1Q81U 3T9NA 1VQ5Q 1QVFS 1QVGA 3M54A 3RERA 3JSCA 2QYZA 2JUFA 1RAAB 3I5RA 1D3BB 5KYWA 3LH0A 3JCMV 5LJ5g 3TSZA 1WFWA 1QW1A 2QEXA 1UTIA 4M75C 3VRYA 4N4HA 1UDLA 2KXCA 4C8QA 2BE9B 1RAEB 2CS7A 1YJ9Q 3M56A 1NLOC 3OYMA 1VQ7T 4LUDA 3CCLT 4Y91A 3TEEA 4J5YA 4GLKA 4E7KA 1YITQ 1LOJA 4ESRA 1VQ4Q 2LDMA 2IVWA 2EJGA 2O31A 4OB0B 3NTHA 3MP6A 2G3RA 1AOJA 2X3WD 4R0KA 3CCVT 1NYFA 3EG2A 4UC4A 2GCXA 2RH2A 3OYGA 2DA9A 2EFIA 4C0DB 2C06A 1Q82C 1GFDA 1JXOA 3CMET 5ECAA 3FIFA 3CCST 5GMKe 2FHDA 1OU9A 3MPUB 4GY5A 2OAUA 1Y07A 2VASA 5KYYB 3X25B 1VQKT 4LXCA 1AT1B 3ZFJA 3P8HA 5FU6C 2PNIA 2KY9A 3CQTA 1TUGB 1VYTA 3SWNA 5LL6S 1YJWA 1ZSZB 1IRXA 4MDXA 2E10A 3GPLA 2BZXA 1M1GA 4RTUA 2CKKA 1O9SA 2BTTA 2DD4A 2XHCA 5M9OA 1RAGB 3E9FA 2E41A 2KI7A 3CCQQ 3PIOA 4A4HA 1VQ9T 1K9AA 1SF9A 5AYFA 5GAMe 2FPEA 3MP1A 3UA6A 1E6GA 4C92E 1K4US 3I35A 2JOYA 1D1BA 1GBQA 4AFQC 3G6ET 1Q7YU 4MZPA 3X20B 4OB1B 2K5IA 4PJOB 1G3TA 2KK4A 3CCJT 4Z88A 4M75F 4RKUE 1VQNT 1VQ7A 2FZGB 2JT4A 1ZLMA 2A0FB 3ASKA 1VYVA 3G1JA 2FO0A 2RQRA 3CCRA 3PTAA 3DB3A 1Q82R 2XDDA 2AKKA 2FEIA 2DXTA 2E3HA 4C0ZA 4LNPA 3QJ6A 2DM1A 3CCVA 5L23A 2E70A 3JCMf 1PD0A 2EKOA 3EFOA 1IB8A 3CMEA 4FSSA 4OVAA 2XI9A 3GNFB 3CCSA 2LVMA 2EYWA 5KYWB 1YN8A 4HT8A 1ACMB 2BKDN 1M90U 3QSUA 5I11A 2XK0A 3P8DA 2HD0A 1AWXA 2ZPIB 3V7SA 2HKQB 2OTJQ 3CCMQ 4C8QB 2E64A 1JEGA 5GAOr 3VS7A 3QXEB 1BCOA 1KHCA 2EJFA 4E7ZA 5GAN5 1KHIA 2RQUA 3HPWA 2MIOA 1HSQA 1M27C 1QCOA 1ZHIA 2H3JA 4J9FA 1B3QA 1PC0A 3H8ZA 4DA4A 2ZPFB 1OZ2A 3BE3A 2KDSA 4DQ2A 4RTTA 1VQ9A 4QQ6A 1KC8R 4QQGA 2LNHB 3OYNA 2LCLA 2O2OA 2RJDA 3M53A 2JM9A 2HQXA 2AZSA 2CT4A 4YTLA 1KQ1A 2P4RA 5DLQE 4PJNA 4IUTA 3CCJA 1WNLA 5FWBA 4A63B 2KRSA 3JCMQ 2OTLT 4F04B 1WJRA 2DRKA 4M77A 5GAOl 2V8JA 4KGVB 3GBQA 5GAMg 2DX1A 3SWNB 3WXMB 2RI2A 2HMAA 3JB9G 1XNIA 1B34B 2OAWA 3H9NA 3OYCA 1IO6A 4ATOA 3QWXX 1PG5B 3CXCP 4DBQA 1TXQA 3PIPA 3EG9A 4JS5A 1LVKA 1VQMQ 3I5SA 4ORZA 2H8HA 2MMPA 3EG3A 3MEUA 1C1AA 2LX7A 3LLRA 2EYYA 1R77A 3OW2P 1WDXA 3RESA 4XU1A 1G3SA 1WQWA 4LE9A 3PFSA 2JN0A 3M0QA 1M3AA 3A8MB 3HTRA 3ER0A 1MMGA 3M57A 3SFMA 2RPNA 1FMVA 1N6AA 2WSCE 2SEMA 2HDAA 1OPLA 2VXFA 5KCHA 3CC4T 1Q7YC 2KQWA 2X9HA 1ZBXA 3MEWA 2GGRA 5CCAA 1K8AU 5IH2A 2HQEA 2QTXA 3VS5A 5KE3A 1YI2Q 3EFOB 1BIAA 1FX7A 2OX7A 2DILA 4DBFA 1W2BA 1UG1A 2ZCFB 3M0TA 5D6XA 1UHFA 1VQKQ 1GCQC 5LJ5f 3OYBA 4AG2C 3FB9A 3EAEA 1ZUUA 1VA7A 3JCMe 2GFUA 1WI7A 4MDWA 2AHJB 2VB6A 5KH6A 1NG2A 5A0LA 1KQSS 5CO7A 3QKJA 4XU0A 4ZN1A 4RTYA 1M8VA 3VUZA 2X3XD 2DRMA 1Y71A 1C6VX 1WLPB 2OJ2A 4OB3B 2QDLA 1VQ5T 3RR6A 3CXCA 3G6EQ 2ZGWA 4FT2A 3PNWC 1NLPC 4C92A 1CKBA 1M3BA 1UGPB 5GANe 3LWHA 3NMZC 4QQDA 2RQVA 3BDLA 4PLIA 1UGQB 2ED1A 3S6WA 3VS6A 4A54A 5CKDA 3QPHA 5IXBA 2QA4A 1M1KR 2RO0A 4J83A 4M77B 3RMQA 3VRZA 2CSIA 3L2VA 3JCMb 2B8AA 5CIUA 3CC4A 3HFOA 3QO3A 4B9WA 1IREB 4FYYB 4PKCC 1VQ4T 1M4ZA 3H6ZA 2M0OA 2LQ8A 2V8IA 3HFNA 2M51A 3EG9B 3ZBDA 3JB9I 2QQBA 2HKNA 1NJIR 2CREA 1X27A 2XICA 5CKFA 2CZ7B 2EAYA 3OYKA 1C0MA 4M75E 4RTWA 1V1CA 3KFVA 1OU8A 5HY6A 4KGXB 2MWPA 2GBQA 3EGXA 4OMQA 3V8KA 5DM7R 4E6RA 4WF2A 3REAB 2ATCB 1P92A 2JTMA 1D0ZA 1TU0B 2EYXA 1QWEA 2DF6A 2VWFA 1X6OA 1QWFA 2JW4A 1Z9ZA 2R5AA 2WSFE 3MP8A 1BBZA 3MO8A 2MWOA 1OPKA 2HBWA 4PFOA 2MPXC 1ABQA 2JTFA 2PUKB 4AFSC 1H641 3J7AF 1Y0MA 2COZA 4RMOA 3HSBA 3V7RA 5FW9A 4M75D 2VUBA 3FRNA 3P8BB 1VQ5A 2EIFA 4NS5A 1WIEA 2ENMA 4EMKA 3CCQT 1KSWA 4F14A 2QQRA 3I56Q 1K8AC 1XJWB 5IHNA 4KT0E 1VQ8T 4KRTA 1D1AA 1W70A 2D0QB 1X69A 3OS0A 2D0NA 1UGSB 4FIBA 4AG1C 2LC4A 1Q82U 1YJ9A 1AWOA 4C0DC 2AT1B 5LJ5e 1TUCA 1AVZC 3M0RA 4LD9K 2HCKA 4M7AE 1VQLQ 1YITA 1VQ4A 5GANg 1VIFA 4E7JA 1I1JA 2CGHA 2GTJA 1VIEA 1U1TA 5GAMd 2K3XA 2YRDA 4QVZA 2QQ9A 1R0CB 1BB9A 2XIDA 1N9RA 3CCUA 1WA7A 4OMMA 2OI3A 4HCCA 4R55A 2M1HA 2A28A 1S72Q 4C92B 2L3QA 1E7OA 1M2OA 2DXBA 1ZSZC 2EGAA 2LJ3A 3TU4K 1YBYA 1X6BA 1YWPA 2FB7A 2RA2A 2F5KA 2X4WA 3JCMJ 2OTJT 3CCMT 3JB9F 3FDRA 1SRLA 4KULA 2DNUA 1O75A 3VV0A 5GAMf 5L8RE 1PHTA 5EC7A 1WJQA 5D7UA 3TVTA 2ZPGB 3WVDB 4ZGDB 3CC2Q 1X75C 3G71Q 1H3HA 3NFCA 4PJOC 2KAFA 4OMOA 1ZA2B 2A37A 4IUUA 1UECA 1X6GA 1JO8A 2RHXA 3QJYA 1H3ZA 3CCQA 1MV3A 1MNEA 5FROA 1JB0E 3EGXB 1UHCA 1QVGS 2HBPA 1BCMA 4PL6A 3CD6Q 4PJOA 2CSQA 2RI5A 2MOXA 1YIJT 5LJ5h 2AK5A 1MMDA 1PKTA 2KNBB 1K9MC 1K73R 2IPOB 2JMAA 2CDTA 5C0MA 4RCCA 4M7DA 2NUTA 1JBMA 4VUBA 5AT1B 3OQ5A 4DOVA 4IIOA 4XAXB 2JNGA 1K1ZA 1E6HA 2MF2A 1YCYA 2VGNA 5GAN4 2RJFA 2J6FA 2O01E 4C8QC 3G4SQ 3M59A 3A5ZB 2CP6A 3UF4A 1NZ9A 1RL2A 2L8DA 4DEYA 1ZQ1A 2CUBA 3DB4A 1JRIA 4EMKB 1VQMT 4ZNXA 4CC2A 1V29B 1Y57A 3PT9A 5GAOp 2I2LA 2QQAA 1QKXA 1R0BG 5I2MA 4M77G 3CCMA 2DIGA 1YNZA 3S3OA 4JZ4A 2AZVA 1TOVA 2EGCA 1LNXA 4CC4B 1AZEA 1PSFA 3UA7A 2QTVA 4O5VA 4KUDK 4ZGJB 1RAIB 4OB2B 1OX8A 3RKXA 2DAQA 2HZYA 4E7IA 1OI1A 3NPFA 4QKUA 4PJOF 3OA6A 1K9MR 1UUEA 4M78A 1M8MA 2ZPEB 1YI2T 2L3PA 2MI6A 4JDSA 1D09B 1K76A 1JJ2P 2KBTA 1UJ0A 3SWNC 4BDZA 2NYSA 4QVCA 2EQUA 3M0PA 5FU7B 3L2ZA 2Z0WA 1UB4A 1KIKA 1VQPA 3CMAT 4IIMA 5LJ3g 3MHXA 2GF7A 2J06A 2JTEA 4KUIA 4JRKA 2QGGA 1B34A 3E9GA 1NPRA 3JCMc 3CC7Q 4PK4A 4E7SA 2BZYA 1WX6A 1AHJB 2DFUA 1SKUB 2KROA 5FWCA 4C8QF 2M9UA 5CK9A 4F7UA 1GFCA 2M02A 2GTOA 4RG2A 1FMKA 2K5FA 3JCMd 4ME7A 1VQ8Q 3C0CA 2CUDA 1WYXA 3L2WA 3C94A 3X28B 2YRVA 2L3RA 4ANJA 3PE0A 3QDFA 5J3BA 1M1KU 2K5LA 1PD1A 1YJNQ 3CCLA 4BDYA 2RHYA 4FYXB 1G2BA 2IG0A 1KC8C 1I07A 4M7DB 2QI2A 2NUTB 1BU1A 4OMPA 1PSEA 2X4JA 3H0HA 1Z9QA 2HL3A 4XTUA 2J7IA 1SRMA 4M7AA 1VOMA 2RQTA 5GAN3 3DLMA 5GMKh 3OYDA 4E7LA 1IGQA 3A8HB 2EW3A 2J05A 2DBKA 2Y90A 4FCYA 1WXBA 2DBMA 5GANd 2NUPA 4J8OA 1NEGA 2K3YA 1CSKA 2RF0A 4A4GA 2FVUA 4J7IA 4IUQA 4PJJA 4N0AA 3VS0A 3VS3A 3ME9A 3M55A 4J7FA 1VQKA 1QCNA 2GQVA 1U5SA 1JJ2A 2EJ9A 1X2KA 2FZCB 2QEXQ 3M0SA 2YHTA 3V8JA 1M30A 2DZCA 4C0FA 2KSSA 1SSHA 3UPUA 5HKCA 3EGUA 3MJXA 2CT3A 1PNJA 4J9GA 4OGEA 2E3IA 2DZ9A 5GANf 3GIBA 2PQWA 2QXFA 2E6ZA 3E2UA 5GAMh 2FYKA 2EGEA 3M58A 4JPBW 3CCEQ 1Y96A 4WTOB 1UJYA 4A4FA 2EBPA 4HCKA 1SHGA 5GMKl 4M78B 2VC8A 2H3EB 2F2WA 2RM4A 1U3OA 3TCJA 1EZZB 3I55Q 1WJSA 4M77C 3OS1A 1YIJQ 4CC3A 1EIFA 4RG8A 3G6EA 2EKHA 3QDRB 2WACA 1VQNA 3BDUA 1YWOA 4IKFA 2YUPA 1BIBA 1I8FA 4NOYA 3I56T 2ECZA 2L3SA 1YHQQ 3RNJA 4X1VA 1OULA 2KT1A 4J6XA 4FYVB 4P5NA 4E2FB 2LT1A 1WZOA 2Y4YA 2L2PA 2XU8A 1G8XA 5HCKA 1VQLT 1I5LA 2KE9A 1WHKA 4AFUC 1YJWQ 5GJVB 4F7UB 5A0GA 3OYIA 3JB9D 1XTDA 3VYHB 3VS2A 3FEOA 7AT1B 4PNOA 3HRUA 4XQ3A 1KFZA 1CKAA 4EPCA 1GBRA 2HAXA 2EQKA 1IZ6A 2ZPBB 2IIMA 3OMCA 1S72T 5DLOA 1TG0A 2LQKA 5LJ5d 2DL3A 4AMCA 1OZ3A 4LDWA 1W2BS 1KQSP 5A2QE 2E65A 4L59A 4LDYA 4MZTA 1JU5C 4RUGA 4M7AB 1KK7A 3OBYA 3CCRQ 1M1KC 4IURA 2YUNA 4E47A 1KG1A 3ULRB 4Z89A 2KT8A 5GAOq 2HEQA 3CC2T 2NUPB 3VJPA 2ABLA 1N9SA 2DXCA 2YSQA 3G71T 3E19A 2KR3A 2I0NA 2LNVA 3F70A 3VS1A 3GF5A 2X51A 3CMAQ 3A8LB 2RMOA 4M77F 4L5GA 3DKMA 1M2VA 2CP3A 2R57A 3HRSA 4OMNA 3EG0A 1NJIC 3GNGA 2O4XA 3N5BB 4J9DA 2OTLA 3HRTA 4C5EA 3I56A 1K73U 3CD6T 1U06A 4F17A 2XDPA 3EGDA 3A8GB 4XU2A 4LDXA 1NM7A 2EWNA 2E6NA 4C92C 1VUBA 1Y96B 4HVUA 3EHQA 2EQIA 2KMTA 3QIIA 2RK1A 2QGFB 4A4KA 3G4ST 2C0TA 2DEQA 1SHFA 3RDVA 2PTKA 4PJOG 3UWNA 2R5MA 1V76A 5CKEA 2BE7D 1QLYA 3URGA 4KBMB 4BI8B 1JQQA 1TTHB 4BUGA 2F69A 3H0FA 3EHRA 4BY6B 3OW2A 4M7DG 2HQHA 2VXEA 2DVEA 5LJ3f 1N8RC 2FPDA 4XTZA 4PJOD 1RADB 2RJCA 2O9SA 1B7TA 3OBWA 1HJDA 1BK2A 5DY9A 4AT1B 2A7YA 4J9HA 4M7DD 5CR2A 2DL4A 1DJ7B 1OYXA 3TQ7P 4HT9A 3JCMW 2ZZDA 1SSFA 1K9MU 2DVJA 4JRPA 2VGMA 4CRIA 4PJMA 3RIRA 3G71A 3JCMh 3BFMA 4V2SA 3M4GA 2AKLA 3SD4A 4C8QG 5HK0A 2P0KA 3EH1A 2LRQA 1OOTA 2V1QA 3L42A 4JLGA 2MCNA 3I9QA 3LGLA 3CD6A 3A98A
chains in the Genus database with same CATH topology
4MZPA 5LJ5h 3X20B 4OB1B 2K5IA 2XKOC 4PJOB 1BI2A 1G3TA 2KK4A 2DD5A 1GXIE 1K9MC 3CCJT 4C8QD 5GAN2 2V8KA 4M75F 4RKUE 1VQNT 4IUPA 2DTHA 1VQ7A 3Q1JA 5C0MA 4II1A 3ASKA 2QDYB 4RCCA 4M7DA 3FC3A 4C0GA 4EMKC 1JBMA 3QYGB 4VUBA 3OQ5A 2QA4T 3CCRA 2LT4A 3PTAA 2P4TA 4DOVA 3DB3A 4XAXB 1U1SA 2JNGA 2XDDA 4C92F 3SB2A 5IT9E 4M78G 2MF2A 4XTWA 4L6V5 1YCYA 3S3NA 5GANh 2VGNA 3CC7T 2DXTA 4C0ZA 1QP2A 2D9TA 4FM4B 2RJFA 5GAN4 2O01E 1Q7YU 4C8QC 3QJ6A 1U8RA 3M59A 4TVRA 3CCVA 3JB9J 5D6YA 3A5ZB 3G4SA 2QQSA 3ZEHA 2E70A 1WGSA 3JCMf 5FRNA 1NZ9A 3META 1RL2A 1MGQA 2EKOA 2L8DA 3PMTA 1ZQ1A 3DB4A 1JRIA 4EMKB 3CMEA 4OVAA 1VQMT 2XI9A 4J6WA 2RHUA 3GNFB 3CCSA 4QVDA 2LVMA 3CXCS 2ZPHB 4HA8A 1VQOT 5GAN6 4HT8A 2BKDN 3QSUA 2E1HA 1M90U 2O4XB 1V29B 3PT9A 3A8OB 2XK0A 3P8DA 2HD0A 5GAOp 2I2LA 2ZPIB 3V7SA 4JRQA 1KQ2A 2QQAA 5I2MA 1HK9A 1I81A 4M77G 4C8QB 4JLIA 3CCMA 2DIGA 2E64A 3V8LA 4ZGEB 1YJNT 4PJOE 4OGCA 5GAOr 5LJ3d 3S3OA 3J80E 1XOVA 5LJ5j 3OW2S 1LNXA 2EYQA 2RHZA 3QUIA 3QXEB 4BI4A 4Q5WA 3LGFA 1VQLA 1KHCA 1PSFA 2EJFA 4JS4A 3PMIA 5GAN5 1XQHA 2XD0A 2RI3A 1KHIA 4MMLA 4O5VA 4M7DE 2X4XA 4KUDK 3CBOA 4ZGJB 5FU7C 4F7UG 2XDBA 3EFRA 3HPWA 3L1AA 1K73C 4OB2B 5HK3A 1M90C 1VQ6T 2PVGB 3RKXA 2DAQA 1Q86U 4E7IA 1OI1A 1ZHIA 2JZ2A 2E12A 2H3JA 3INZA 3UT1A 4BB7A 3H8ZA 1M9SA 4C5GA 4PJOF 1R8OB 2ZPFB 3OA6A 1OZ2A 5A0DA 4DA4A 5GANj 4M78A 2ZPEB 2EQJA 2KDSA 3VU3C 4A4EA 3BW1A 1S72A 1YI2T 2MI6A 4DQ2A 4JDSA 3QBYA 1VQ9A 4QQ6A 4B9XA 4QQGA 3OS2A 3SWNC 3OYNA 4BDZA 4BE1A 1KD1U 4QVCA 2EQUA 2LCLA 5FU7B 2RJDA 3M53A 3L2ZA 5CKBA 4C5HA 4EMGA 3AHUA 4FSXA 4Z02A 2HQXA 1UB4A 2YLCA 4MMKA 1KQ1A 4YTLA 1VQPA 3CMAT 5DLQE 3VKIA 4IUTA 4C5IA 3G7ZA 3CCJA 3CD6A 1WNLA 2DK3A 4RCBA 1KQSA 5LJ3g 4C8QE 4M7AG 3JCMQ 3MHXA 2GF7A 2GFAA 2OTLT 3OB9A 2QEXT 4CI0C 4KUIA 3FLGA 3S3MA 4XTVA 2RD1A 1WJRA 4JRKA 4M77A 4EMHA 2V8JA 5GAOl 3X26B 5IAYA 1B34A 3E9GA 4ZTJA 5GAMg 3SWNB 3NTIA 1NPRA 3JCMc 3WXMB 3VUBA 2RI2A 3CC2A 3JB9G 1XNIA 1YJ9T 1B34B 5LJ3e 3OYCA 1BI0A 2VV5A 1KC8U 3O8VA 3CCET 4ATOA 1AHJB 4X34A 1YITT 3PIPA 4C8QF 2WSEE 2M9UA 5CK9A 4M7DC 4F7UA 4JS5A 2BUDA 4RG2A 2K5FA 3JCMd 3UDCA 4ME7A 1X01A 3I55T 4HCBA 2JVVA 1VQ8A 2MMPA 4M78E 1VQOA 4DOWA 3CCUT 3MEUA 3L2WA 3JRZA 3C94A 3LLRA 3X28B 2YRVA 4XK8E 2L3RA 4XU1A 3RESA 1G3SA 1WQWA 3FJPA 4ZN3A 5J3BA 1M1KU 2K5LA 5I21A 3PFSA 2JN0A 3CEYA 3CPWA 3CCLA 4BDYA 1YJNA 2RHYA 2IG0A 1KC8C 3A8MB 4XTXA 4M7DB 2QI2A 3QHSA 3ER0A 1NPPA 3M57A 3SFMA 3QYHB 2DTIA 1YHQT 1PSEA 2X4JA 2LCCA 1N6AA 2Y4XA 3HP9A 3PGGA 2WSCE 2L89A 5IN1A 3X24B 4XTUA 3WVEB 4E7HA 3L2RA 5CQXA 4M7AA 2VXFA 4X9CA 5KCHA 4M75G 3CC4T 1Q7YC 5GAN3 1VQ6A 2KQWA 3DLMA 1ZBXA 5GMKh 2FL7A 3OYDA 4E7LA 3A8HB 3MEWA 5CCAA 3RKYA 5J26A 1K8AU 4ZTFA 2HQEA 1FWZA 2Y90A 1MHNA 4LDUA 2QTXA 5GANd 4J8OA 5KE3A 1YJWT 2K3YA 1BIAA 3CBPA 4M78D 4A4GA 2FVUA 1FX7A 1WPYA 3JCMg 3OYAA 3L2UA 4A53A 4J7IA 1BYMA 2A3LA 2CZ6B 4IUQA 4F7UE 4N0AA 1W2BA 2ZCFB 5D6XA 5GMKi 4BI3A 1I4K1 3R6OA 2DPPB 3M55A 3ME9A 4J7FA 1VQKA 2OTJA 5LJ5f 3OS5A 1NE8A 3OYBA 1D3BA 1Y7XA 2GQVA 3FB9A 3EAEA 4MZMA 4N4IA 3DLLA 1G3WA 1JJ2A 2EJ9A 3HHTB 4FL6A 3JCMe 3MCAB 2E5QA 4BACA 5J39A 3E1SA 4M78C 3JAME 5EG2A 3J81E 2GFUA 2P0PA 2NLUA 2YHTA 3QG1A 5LJ3h 3V8JA 2DZCA 4C0FA 2KSSA 4MDWA 3NTKA 2AHJB 3UPUA 5KH6A 5HKCA 3GLXA 3QZ9B 4XTYA 4M77D 1RI0A 4O6JA 4OGEA 3EFSA 2LTOA 5A0LA 2D6FA 1KQSS 2DZ9A 5CO7A 2RB6A 1QVFA 2LX9A 3QKJA 4XU0A 2PQWA 2QXFA 2PU9B 2E6ZA 4ZN1A 5GAMh 5GANf 2FYKA 2OTLA 3M58A 1M8VA 1Y96A 3VUZA 3CCEA 4A4FA 2DXUA 3RKWA 3CCRT 3L2QA 1Y71A 5GMKl 4HCZA 5D6WA 4M78B 2VC8A 5GMKj 4M75A 2CYZB 2RM4A 3TCJA 3OY9A 3M9QA 4OB3B 1BI3A 4M7DF 1VQ5T 1WJSA 3I55A 4M77C 3OS1A 2EQMA 3CXCA 1EIFA 2ZGWA 1YIJA 4RG8A 3G6EA 4EDUA 4D6WA 4FT2A 3PNWC 4IUVA 3QDRB 4C92A 2WACA 1UGPB 1QP3A 5GANe 3LWHA 1Q86C 1VQNA 4QQDA 2DKGA 3BDUA 4IKFA 3BDLA 4LD6A 4PLIA 1BIBA 1UGQB 2RK2A 4XU3A 3S6WA 1I8FA 4NOYA 4A54A 5CKDA 3I56T 3QPHA 2QA4A 1M1FA 1G5VA 5KE2A 1YHQA 2MAMA 3RUXA 2RO0A 3CBMA 4FT4A 4J83A 5KCOA 4M77B 3RMQA 4J6YA 4J6XA 5FRMA 2VYTA 4FU6A 4P5NA 3LWIA 4Y28E 3L2VA 3CPWS 3JCMb 2L5QA 3CC7A 1KD1C 5LJ3j 2B8AA 1BKBA 2LT1A 5CIUA 4M7AD 3CC4A 3HFOA 2Y4YA 2XU8A 1W4SA 3QO3A 4B9WA 5GAN7 4OMFB 2K57A 1IREB 2DTOA 4JRIA 4PKCC 1VQ4T 1I5LA 1VQLT 1M4ZA 3H6ZA 2M0OA 2PUOB 2LQ8A 2V8IA 3HFNA 3OSVA 2CZ0B 3ZBDA 3JB9I 2QQBA 5GAMj 1VQMA 4F7UB 5A0GA 5I2SA 3OYIA 5CQYA 3JB9D 4ELZC 1XTDA 5GAOn 3VYHB 3FEOA 4QW2A 2XICA 5CKFA 2X4YA 2CZ7B 2EAYA 2PVOB 2RJEA 4JUVA 4PNOA 3OYKA 5FLXE 5GAN8 3HRUA 4M7AC 4M75E 4XQ3A 4EPCA 2HAXA 2EQKA 1IZ6A 5HY6A 1FXXA 2ZPBB 3OMCA 2MWPA 3V8KA 5DM7R 1S72T 5DLOA 2K2VA 2LQKA 2P0QA 1N27A 5LJ5d 2KVQG 4WF2A 1OZ3A 4LDWA 1M5Q1 1W2BS 5CAIA 5A2QE 2E65A 4L59A 1P92A 2JTMA 2DO3A 3JCMP 4OP0A 2M16A 3OYYA 4M78F 4LDYA 3BY7A 4MZTA 1VQPT 1X6OA 1UGRB 1JJ2S 2DIQA 4N0AC 1UEBA 2R5AA 3KUFA 3OMGA 4M77E 4M7AB 3OBYA 2WSFE 3MP8A 2X35A 3MO8A 1NJIU 2MWOA 5CVIA 4BE2A 3C12A 4NL2A 1M1KC 3VYGA 3GP8A 2JTFA 4IURA 2PUKB 4OF1A 5CKHA 4E47A 1KG1A 1H641 4C92G 3J7AF 5GAOq 2R58A 3OYHA 3KXTA 1YI2A 4RMOA 2F5TX 3HSBA 3CC2T 3V7RA 3VJPA 1N9SA 2DXCA 3OSSC 1Q81U 3T9NA 3MEVA 3G71T 4M75D 2VUBA 1QVFS 1QVGA 3FRNA 3E19A 3M54A 3P8BB 3V7CA 1VQ5A 3RERA 2EIFA 3JSCA 2LNVA 4NS5A 3F70A 5GMKm 3GF5A 3MEAA 2K4YA 3A8LB 4M77F 2JUFA 4L5GA 4N4GA 3DKMA 3QZ5B 2R57A 4EMKA 3CMAA 3CCQT 3HRSA 1LJOA 4C92D 1D3BB 2QQRA 1NJIC 3SDZA 2PVDB 3LH0A 3JB9H 3JCMV 3GNGA 2O4XA 3N5BB 3TREA 5LJ5g 1K8AC 1QW1A 3C95A 3LW5E 3HRTA 4C5EA 4KT0E 3I56A 2QEXA 1K73U 1VQ8T 3CD6T 4M75C 2D0QB 4N4HA 2XG8D 4C8QA 3OS0A 2XDPA 4F7UF 2CS7A 3M56A 1UGSB 4FIBA 3OYMA 3A8GB 2LC4A 4XU2A 1Q81C 1Q82U 1YJ9A 1VQ7T 4LDXA 2EWNA 3CCLT 4Y91A 4C0DC 5GAOm 3TEEA 3RMSA 2DJZA 4J5YA 4LDVA 5LJ5e 4LD9K 2E6NA 2YLBA 4GLKA 1VUBA 4C92C 4E7KA 4M7AE 1LOJA 1YITA 2LDMA 2IVWA 2EJGA 1Y96B 1VQ4A 4BY6C 4OB0B 5GANg 1VIFA 2RHIA 4E7JA 2KMTA 3NTHA 2CGHA 3QIIA 1N8RU 2RK1A 1VIEA 1U1TA 3MP6A 2G3RA 5GAMd 2K3XA 4A4KA 4M75B 4QVZA 4PLLA 2QQ9A 3CCVT 2XIDA 3G4ST 1N9RA 3CCUA 3LYIA 2DEQA 4UC4A 4BD3A 2GCXA 2RH2A 4R56A 3OYGA 3CPFA 4PJOG 2EFIA 3UWNA 4HCCA 1WQ7A 2R5MA 4R55A 5CKEA 4C0DB 2M1HA 3OYFA 2C06A 1Q82C 3URGA 3CMET 4KBMB 4C92B 4M7AF 4BI8B 3FIFA 3CCST 5GMKe 4BUGA 2FHDA 2F69A 4BY6B 3OW2A 2DXBA 3M4YA 4M7DG 4GY5A 3TU4K 1YBYA 3M5AA 2FB7A 2OAUA 2RA2A 2VXEA 3OYEA 2F5KA 1Y07A 2DVEA 5LJ3f 1N8RC 2X4WA 3JCMJ 3X25B 1VQKT 2OTJT 4XTZA 4ELYC 4HKEA 3CCMT 4PJOD 3JB9F 2RJCA 3FDRA 2CZ1B 4KULA 3ZFJA 4BE0A 3P8HA 3OBWA 1O75A 3GIBA 5DY9A 3VV0A 5FU6C 2A7YA 5GAMf 5C6SA 2KY9A 5L8RE 4M7DD 5CR2A 2BIVA 1WJQA 3GOXA 1DJ7B 1QVPA 2ZPGB 3KBGA 1OYXA 1HXDA 3SWNA 5LL6S 3WVDB 1YJWA 4ZGDB 3HL8A 2HNIA 4HT9A 3JCMW 2ZZDA 1SSFA 1K9MU 1X75C 4MDXA 2E10A 3NFCA 3OYJA 3GPLA 2VGMA 4CRIA 2KAFA 3RIRA 3G71A 4JRPA 4PJOC 1M1GA 3JCMh 1TH7A 2CKKA 3BFMA 4X9DA 4V2SA 3M4GA 1O9SA 2DD4A 2XHCA 1BI1A 4IUUA 5M9OA 4JJNK 3E9FA 2E41A 3SD4A 2RHXA 4C8QG 5HK0A 2P0KA 3QJYA 2LRQA 4NL3A 3PIOA 1H3ZA 4A4HA 3CCQA 5FU6B 1G3YA 3OYLA 3LX7A 1VQ9T 5FROA 1JB0E 5AYFA 5GAMe 3L42A 3MP1A 1QVGS 2HBPA 4C92E 3JCMX 4JLGA 2JOYA 3C4SA 4PL6A 3LGLA 4PJOA 3HKSA 2RI5A 1YIJT 3G6ET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2Q A;  4N4G A;  2R57 A;  4HCZ A;  3E9G A;  5IAY A;  5D6W A;  4ZTJ A;  3NTI A;  2RI2 A;  4IUP A;  3OY9 A;  2QQR A;  1XNI A;  3Q1J A;  3M9Q A;  5C0M A;  4II1 A;  3ASK A;  3LH0 A;  3OYC A;  1WJS A;  2O4X A;  3OS1 A;  3FC3 A;  2EQM A;  4C5E A;  3OQ5 A;  3O8V A;  4X34 A;  4EDU A;  3DB3 A;  4N4H A;  3PNW C;  3OS0 A;  4IUV A;  2XDP A;  2WAC A;  2BUD A;  3OYM A;  4QQD A;  4IKF A;  4RG2 A;  3BDL A;  4LD6 A;  4PLI A;  3S3N A;  2D9T A;  2RJF A;  3S6W A;  3QJ6 A;  2E6N A;  5D6Y A;  4E7K A;  2QQS A;  3MEU A;  3ZEH A;  3LLR A;  3L2W A;  1G5V A;  2LDM A;  5KE2 A;  1WGS A;  2YRV A;  5FRN A;  3MET A;  2L3R A;  2RHI A;  2EKO A;  2L8D A;  2RO0 A;  3PMT A;  4E7J A;  3QII A;  3NTH A;  5KCO A;  3DB4 A;  3PFS A;  2VYT A;  3CEY A;  4FU6 A;  4OVA A;  5FRM A;  3MP6 A;  3L2V A;  2G3R A;  4BDY A;  2K3X A;  2RHU A;  2RHY A;  2B8A A;  4QVZ A;  2IG0 A;  2LVM A;  4PLL A;  5CIU A;  2BKD N;  3F70 A;  4B9W A;  2O4X B;  3LYI A;  2XK0 A;  4UC4 A;  3P8D A;  4BD3 A;  3OYG A;  3H6Z A;  2EFI A;  2LCC A;  2M0O A;  3UWN A;  2R5M A;  5IN1 A;  2L89 A;  3OYF A;  2M1H A;  4E7H A;  3L2R A;  2DIG A;  3OYI A;  3S3O A;  5KCH A;  2FHD A;  3FEO A;  4QW2 A;  2RHZ A;  3DLM A;  2X4Y A;  3OYD A;  4E7L A;  4GY5 A;  2RJE A;  3LGF A;  1KHC A;  3MEW A;  4Q5W A;  3OYK A;  3OYE A;  5J26 A;  2F5K A;  3PMI A;  4ZTF A;  2HQE A;  1MHN A;  2EQK A;  2X4W A;  2RI3 A;  5KE3 A;  2X4X A;  2K3Y A;  2MWP A;  2RJC A;  3FDR A;  3OMC A;  4A4G A;  3OYA A;  4BE0 A;  3P8H A;  3L2U A;  1N27 A;  2DAQ A;  4E7I A;  1OZ3 A;  1OI1 A;  4IUQ A;  2JZ2 A;  3UT1 A;  5C6S A;  5D6X A;  4L59 A;  3H8Z A;  2BIV A;  4C5G A;  1WJQ A;  3OA6 A;  3ME9 A;  1OZ2 A;  3GOX A;  2M16 A;  1OYX A;  3OYB A;  2EQJ A;  4A4E A;  3EAE A;  4N4I A;  2DIQ A;  1SSF A;  3QBY A;  3OMG A;  2R5A A;  3KUF A;  4FL6 A;  4QQ6 A;  4B9X A;  2E5Q A;  3OYJ A;  4CRI A;  3MP8 A;  5J39 A;  2X35 A;  4BAC A;  4QQG A;  3MO8 A;  2MWO A;  3OS2 A;  2CKK A;  3OYN A;  4BDZ A;  4BE1 A;  4BE2 A;  2GFU A;  2NLU A;  2EQU A;  4IUU A;  5M9O A;  2RJD A;  3E9F A;  4C5H A;  2JTF A;  3SD4 A;  3NTK A;  4IUR A;  2RHX A;  2HQX A;  4Z02 A;  5KH6 A;  2P0K A;  2LRQ A;  2R58 A;  3OYH A;  1H3Z A;  4A4H A;  1RI0 A;  4IUT A;  4C5I A;  3OYL A;  2LTO A;  3LX7 A;  5FRO A;  3L42 A;  3MEV A;  3MP1 A;  3QKJ A;  2PQW A;  2GF7 A;  3C4S A;  2GFA A;  4PL6 A;  3OB9 A;  3LGL A;  3FLG A;  4NS5 A;  2RI5 A;  3S3M A;  4A4F A;  1WJR A;  3MEA A; 
#chains in the Genus database with same CATH topology
 2JS2 A;  4RTZ A;  2YWW A;  2XKO C;  1T0J A;  1S1N A;  4C8Q D;  4KH1 B;  3Q1J A;  1M90 R;  4II1 A;  2D1X A;  3TSW A;  4C0G A;  4EMK C;  1RAH B;  2LT4 A;  4J9E A;  2P4T A;  2GQI A;  1U1S A;  2NWM A;  4GLM A;  1I0C A;  4C92 F;  3SB2 A;  4M78 G;  4XTW A;  3S3N A;  5GAN h;  3JB9 H;  3CC7 T;  4FM4 B;  2LCS A;  4F16 A;  1U8R A;  5D6Y A;  3G4S A;  2QQS A;  2A36 A;  1N8R R;  1WGS A;  5FRN A;  3MET A;  3PMT A;  2LQW A;  1M2V B;  4J6W A;  4QVD A;  2ZPH B;  3CPW P;  4HA8 A;  2E1H A;  2O4X B;  2MYS A;  3D7S B;  3A8O B;  1WXT A;  2LQN A;  4RTV A;  1KQ2 A;  2XMF A;  1I81 A;  4JLI A;  1YJN T;  4KH0 B;  1PCX A;  3EGD B;  3J80 E;  3PVL A;  3SHW A;  2C0O A;  5LJ5 j;  1D0Y A;  2EYQ A;  2RHZ A;  3QUI A;  4Q5W A;  1RAF B;  3LGF A;  4JS4 A;  3PMI A;  2RI3 A;  4MML A;  1W1F A;  2X4X A;  8ATC B;  5FU7 C;  4F7U G;  2XDB A;  3EFR A;  1K73 C;  4M4Z A;  5HK3 A;  1TWB A;  2PVG B;  2E12 A;  2QAS A;  3INZ A;  2KRN A;  1G83 A;  4BB7 A;  1M9S A;  4PFZ A;  4C5G A;  1QVG P;  1R8O B;  5A0D A;  1AWW A;  1KJW A;  4A4E A;  3BW1 A;  3QBY A;  4B9X A;  1FYN A;  2D8J A;  1AEY A;  2J6O A;  3OS2 A;  4BE1 A;  5CKB A;  3AHU A;  1WHL A;  2JM8 A;  4C5I A;  3G7Z A;  2DK3 A;  4RCB A;  4M7A G;  2GFA A;  3OB9 A;  2QA4 Q;  2QEX T;  1QVF P;  4CI0 C;  3FLG A;  2DL7 A;  3S3M A;  4XTV A;  2RD1 A;  2K6D A;  1Q95 G;  5IAY A;  2W10 A;  1OX9 A;  2K3B A;  4ZTJ A;  3NTI A;  3VUB A;  2DMO A;  5LJ3 e;  5KYN A;  1KC8 U;  3O8V A;  3CCE T;  4X34 A;  1PWT A;  2EVR A;  2WSE E;  4M7D C;  3UDC A;  1X01 A;  3I55 T;  1VQO Q;  2NUZ A;  3FJ5 A;  2JVV A;  1VQ8 A;  4HCB A;  4EIK A;  3JRZ A;  4XK8 E;  1SG5 A;  4ZN3 A;  5I21 A;  3CPW A;  2LJ0 A;  2E5K A;  1YJN A;  2KRM A;  1H8K A;  2C0I A;  2CP5 A;  3QHS A;  3QYH B;  2DTI A;  4HXJ A;  1YHQ T;  1EFN A;  3HP9 A;  2Y4X A;  3PGG A;  4D8D A;  4E7H A;  2AIR B;  2COW A;  5CQX A;  1VQ6 Q;  1VYU A;  2FRY A;  2FL7 A;  3RKY A;  4ZTF A;  1FWZ A;  1MHN A;  1W6X A;  1Q86 R;  1YJW T;  4J9B A;  1WPY A;  3L2U A;  3NHN A;  1I4K 1;  3R6O A;  2OTJ A;  3JV3 A;  3OS5 A;  1Y7X A;  4MZM A;  1G3W A;  5IHK A;  1KD1 R;  3HHT B;  4FL6 A;  3MCA B;  4M78 C;  3JAM E;  5EG2 A;  5LJ3 h;  3QG1 A;  3PVQ A;  3NTK A;  2EPD A;  3GLX A;  1GRI A;  4M77 D;  2LTO A;  2D6F A;  2HSE B;  2RB6 A;  4RTX A;  2LX9 A;  1QVF A;  3NGP A;  2PU9 B;  3CCE A;  3CCR T;  1IHW A;  3L2Q A;  2KXD A;  2F2X A;  5I22 A;  4HCZ A;  5D6W A;  5GMK j;  4M75 A;  4J9I A;  3OY9 A;  4M7D F;  3I55 A;  2EQM A;  3CCU Q;  1SPK A;  1YIJ A;  2DLP A;  3UAT A;  4GBQ A;  4DBH A;  3SEM A;  2CP2 A;  1QP3 A;  2DKG A;  2DET A;  1IGU A;  2ZAE A;  1M1F A;  1YHQ A;  3RUX A;  3REB B;  4FT4 A;  1AZG B;  4FU6 A;  3LWI A;  1BKB A;  2FG0 A;  1PKS A;  4OMF B;  2K57 A;  2DTO A;  4JRI A;  1UGV A;  2PUO B;  2YT6 A;  3OSV A;  1UE9 A;  1OV3 A;  4K11 A;  5GAM j;  1VQM A;  2CP7 A;  5CQY A;  4ELZ C;  5GAO n;  2LJ1 A;  2PVO B;  5FLX E;  2QK0 A;  4M7A C;  2QAZ A;  1LPL A;  2DEU A;  1ZBJ A;  1FXX A;  2JMC A;  2K2V A;  4DBR A;  3AT1 B;  5GJW B;  2K79 A;  1AD5 A;  2DO3 A;  2E4H A;  2M16 A;  4M78 F;  1B07 A;  1JJ2 S;  4N0A C;  4FW2 A;  1UEB A;  3KUF A;  4PFP A;  2LMJ A;  4JJB A;  2X35 A;  1NJI U;  2V26 A;  2YDL A;  1EX4 A;  5CVI A;  4BE2 A;  4NL2 A;  3VYG A;  2K9G A;  4OF1 A;  9ATC B;  4C92 G;  2YRC A;  3H41 A;  3KXT A;  3OYH A;  1YI2 A;  2F5T X;  3OSS C;  2CP0 A;  3MEV A;  3MKD A;  2RNA A;  3V7C A;  5GMK m;  3MEA A;  2K4Y A;  4N4G A;  2LP5 A;  3CMA A;  3QZ5 B;  1ZUK A;  2DJQ A;  1LJO A;  3ZL7 C;  4C92 D;  3SDZ A;  2PVD B;  3TRE A;  5KYU A;  1RLP C;  3C95 A;  3LW5 E;  1ARK A;  2W0Z A;  2DER A;  1QKW A;  1PRM C;  2XG8 D;  4F7U F;  1Q81 C;  5GAO m;  3RMS A;  2DJZ A;  4LDV A;  2YLB A;  4JZ3 A;  1TS9 A;  4BY6 C;  2RHI A;  1N8R U;  4JJD A;  2K7A A;  2A08 A;  4M75 B;  4PLL A;  1RAC B;  1HYO A;  1T3L A;  3LYI A;  4BD3 A;  4R56 A;  1TSF A;  3CPF A;  1WQ7 A;  2ROL A;  3OYF A;  1W2B P;  1ZSG A;  4M7A F;  2CH4 A;  3M4Y A;  2MK5 A;  1T3S A;  3M5A A;  3OYE A;  2LZ6 B;  4ELY C;  4HKE A;  1VQP Q;  1WHG A;  2CZ1 B;  4BE0 A;  4OML A;  1UFF A;  5C6S A;  2KYM A;  2BIV A;  1HD3 A;  3GOX A;  1QVP A;  1X2Q A;  2KEA A;  3KBG A;  1HXD A;  1ZUY A;  2HNI A;  3HL8 A;  1WHH A;  2COY A;  2EYZ A;  3OYJ A;  4D8K A;  1TH7 A;  4X9D A;  1BI1 A;  1PRL C;  4JJN K;  5KYX A;  1Q81 R;  1NYG A;  4NL3 A;  2RQW A;  3U23 A;  5FU6 B;  1G3Y A;  5IHI A;  3LX7 A;  3OYL A;  3JCM X;  3C4S A;  1ZA1 B;  2DYI A;  3HKS A;  1BI2 A;  2KGT A;  2DD5 A;  1GXI E;  5GAN 2;  1VQ7 Q;  2V8K A;  2HSP A;  4IUP A;  2DTH A;  3CCL Q;  2FRW A;  2HL5 C;  2QDY B;  2JXB A;  3FC3 A;  1I5O B;  3QYG B;  2QA4 T;  1ZX6 A;  3IQL A;  1N5Z A;  5IT9 E;  4L6V 5;  1QP2 A;  2D9T A;  3CCV Q;  4B6M A;  4TVR A;  3JB9 J;  4FYW B;  2YUO A;  3ZEH A;  1MGQ A;  3CME Q;  3CCS Q;  2FZK B;  2RHU A;  2BZ8 A;  3CXC S;  1VQO T;  5GAN 6;  5KYU B;  3LH5 A;  4JRQ A;  1HK9 A;  1JXM A;  4LUE A;  3V8L A;  4ZGE B;  4PJO E;  4OGC A;  1MMN A;  5LJ3 d;  1XOV A;  2DE0 X;  3OW2 S;  2V1R A;  4BI4 A;  1VQL A;  3EG1 A;  1XQH A;  1AWJ A;  2XD0 A;  4M7D E;  1QQJ A;  3CBO A;  3L1A A;  1GCQ A;  1M90 C;  1VQ6 T;  1Q86 U;  1WHM A;  2JZ2 A;  2F1L A;  3UT1 A;  1FMW A;  4J9C A;  2P84 A;  2YUQ A;  5GAN j;  2EQJ A;  3VU3 C;  1S72 A;  1VQ9 Q;  2FPF A;  1OQK A;  2F2V A;  1KD1 U;  1MND A;  2O9V A;  4C5H A;  4EMG A;  4FSX A;  4Z02 A;  1A0N B;  2ESW A;  4MMK A;  2YLC A;  3CCJ Q;  3VKI A;  1VQN Q;  1KQS A;  4C8Q E;  1Q7Y R;  2ED0 A;  4KGZ B;  1NEB A;  3EH2 A;  4EMH A;  3X26 B;  2B86 A;  4CC7 A;  1GCP A;  3CC2 A;  1X43 A;  1D1C A;  2RN8 A;  1YJ9 T;  1LCK A;  1YP5 A;  1BI0 A;  2VV5 A;  2D8H A;  1YIT T;  5KYX B;  1MV0 B;  4QT7 A;  2BUD A;  1MUZ A;  1GL5 A;  4M78 E;  1VQO A;  4DOW A;  3VS4 A;  3CCU T;  3FJP A;  3CEY A;  4XTX A;  1RI9 A;  1H92 A;  1NPP A;  1WHJ A;  2LCC A;  5IN1 A;  2L89 A;  3X24 B;  3WVE B;  3L2R A;  4X9C A;  4M75 G;  1VQ6 A;  1F1B B;  1ABO A;  2J6K A;  5J26 A;  4LDU A;  6AT1 B;  3CBP A;  4M78 D;  2DL8 A;  3JCM g;  3OYA A;  4A53 A;  1BYM A;  2A3L A;  2CZ6 B;  4FW1 A;  4JJC A;  4F7U E;  2PZ1 A;  5GMK i;  4BI3 A;  2DPP B;  2M0Y A;  1NE8 A;  1D3B A;  3DLL A;  4N4I A;  4AFZ C;  1QCF A;  2GNC A;  2E5Q A;  4BAC A;  5J39 A;  2ROT A;  2OTL Q;  1RUW A;  3E1S A;  1YFN A;  3J81 E;  4LN2 A;  2P0P A;  2NLU A;  1NBE B;  3QZ9 B;  4XTY A;  1RI0 A;  2G6F X;  4O6J A;  3EFS A;  3M0U A;  1SEM A;  2DL5 A;  2SRC A;  2O88 A;  3RBB B;  2DXU A;  3RKW A;  2JS0 A;  2YXY A;  2JJ9 A;  3QWY A;  1RAB B;  2K2M A;  1OEB A;  2CYZ B;  3M9Q A;  1BI3 A;  4HVV A;  4HVW A;  4Y92 A;  4EDU A;  4D6W A;  3A1P A;  4IUV A;  5IXF A;  1Q86 C;  2VKN A;  1T0H A;  4LD6 A;  2RK2 A;  4XU3 A;  1J3T A;  1G5V A;  1WXU A;  5KE2 A;  5KYY A;  2MAM A;  3CBM A;  1M3C A;  2CH4 W;  5KCO A;  4J6Y A;  2DYB A;  5FRM A;  2VYT A;  3CPW S;  4Y28 E;  3CC7 A;  2L5Q A;  1KD1 C;  3CC4 Q;  5LJ3 j;  4M7A D;  1PM3 A;  5GAN 7;  1W4S A;  1QMC A;  4WCI A;  1K0X A;  1ZSZ A;  2CZ0 B;  4DEX A;  1D0X A;  2QG9 B;  5I2S A;  3O5Z A;  1IHV A;  1K8A R;  4QW2 A;  2X4Y A;  4JUV A;  2RJE A;  5GAN 8;  3R6N A;  2L0A A;  4Z8A A;  3THK A;  1IXD A;  8AT1 B;  2P0Q A;  1N27 A;  2KVQ G;  1M5Q 1;  5CAI A;  4PJL A;  1YCS B;  3JCM P;  2KYB A;  4OP0 A;  3OYY A;  3BY7 A;  1VQP T;  1UGR B;  2DIQ A;  2VVK A;  1MMA A;  3OMG A;  4M77 E;  3H0I A;  1TUD A;  1RLQ C;  1K0S A;  3C12 A;  3GP8 A;  5CKH A;  2R58 A;  1Q81 U;  3T9N A;  1VQ5 Q;  1QVF S;  1QVG A;  3M54 A;  3RER A;  3JSC A;  2QYZ A;  2JUF A;  1RAA B;  3I5R A;  1D3B B;  5KYW A;  3LH0 A;  3JCM V;  5LJ5 g;  3TSZ A;  1WFW A;  1QW1 A;  2QEX A;  1UTI A;  4M75 C;  3VRY A;  4N4H A;  1UDL A;  2KXC A;  4C8Q A;  2BE9 B;  1RAE B;  2CS7 A;  1YJ9 Q;  3M56 A;  1NLO C;  3OYM A;  1VQ7 T;  4LUD A;  3CCL T;  4Y91 A;  3TEE A;  4J5Y A;  4GLK A;  4E7K A;  1YIT Q;  1LOJ A;  4ESR A;  1VQ4 Q;  2LDM A;  2IVW A;  2EJG A;  2O31 A;  4OB0 B;  3NTH A;  3MP6 A;  2G3R A;  1AOJ A;  2X3W D;  4R0K A;  3CCV T;  1NYF A;  3EG2 A;  4UC4 A;  2GCX A;  2RH2 A;  3OYG A;  2DA9 A;  2EFI A;  4C0D B;  2C06 A;  1Q82 C;  1GFD A;  1JXO A;  3CME T;  5ECA A;  3FIF A;  3CCS T;  5GMK e;  2FHD A;  1OU9 A;  3MPU B;  4GY5 A;  2OAU A;  1Y07 A;  2VAS A;  5KYY B;  3X25 B;  1VQK T;  4LXC A;  1AT1 B;  3ZFJ A;  3P8H A;  5FU6 C;  2PNI A;  2KY9 A;  3CQT A;  1TUG B;  1VYT A;  3SWN A;  5LL6 S;  1YJW A;  1ZSZ B;  1IRX A;  4MDX A;  2E10 A;  3GPL A;  2BZX A;  1M1G A;  4RTU A;  2CKK A;  1O9S A;  2BTT A;  2DD4 A;  2XHC A;  5M9O A;  1RAG B;  3E9F A;  2E41 A;  2KI7 A;  3CCQ Q;  3PIO A;  4A4H A;  1VQ9 T;  1K9A A;  1SF9 A;  5AYF A;  5GAM e;  2FPE A;  3MP1 A;  3UA6 A;  1E6G A;  4C92 E;  1K4U S;  3I35 A;  2JOY A;  1D1B A;  1GBQ A;  4AFQ C;  3G6E T;  1Q7Y U;  4MZP A;  3X20 B;  4OB1 B;  2K5I A;  4PJO B;  1G3T A;  2KK4 A;  3CCJ T;  4Z88 A;  4M75 F;  4RKU E;  1VQN T;  1VQ7 A;  2FZG B;  2JT4 A;  1ZLM A;  2A0F B;  3ASK A;  1VYV A;  3G1J A;  2FO0 A;  2RQR A;  3CCR A;  3PTA A;  3DB3 A;  1Q82 R;  2XDD A;  2AKK A;  2FEI A;  2DXT A;  2E3H A;  4C0Z A;  4LNP A;  3QJ6 A;  2DM1 A;  3CCV A;  5L23 A;  2E70 A;  3JCM f;  1PD0 A;  2EKO A;  3EFO A;  1IB8 A;  3CME A;  4FSS A;  4OVA A;  2XI9 A;  3GNF B;  3CCS A;  2LVM A;  2EYW A;  5KYW B;  1YN8 A;  4HT8 A;  1ACM B;  2BKD N;  1M90 U;  3QSU A;  5I11 A;  2XK0 A;  3P8D A;  2HD0 A;  1AWX A;  2ZPI B;  3V7S A;  2HKQ B;  2OTJ Q;  3CCM Q;  4C8Q B;  2E64 A;  1JEG A;  5GAO r;  3VS7 A;  3QXE B;  1BCO A;  1KHC A;  2EJF A;  4E7Z A;  5GAN 5;  1KHI A;  2RQU A;  3HPW A;  2MIO A;  1HSQ A;  1M27 C;  1QCO A;  1ZHI A;  2H3J A;  4J9F A;  1B3Q A;  1PC0 A;  3H8Z A;  4DA4 A;  2ZPF B;  1OZ2 A;  3BE3 A;  2KDS A;  4DQ2 A;  4RTT A;  1VQ9 A;  4QQ6 A;  1KC8 R;  4QQG A;  2LNH B;  3OYN A;  2LCL A;  2O2O A;  2RJD A;  3M53 A;  2JM9 A;  2HQX A;  2AZS A;  2CT4 A;  4YTL A;  1KQ1 A;  2P4R A;  5DLQ E;  4PJN A;  4IUT A;  3CCJ A;  1WNL A;  5FWB A;  4A63 B;  2KRS A;  3JCM Q;  2OTL T;  4F04 B;  1WJR A;  2DRK A;  4M77 A;  5GAO l;  2V8J A;  4KGV B;  3GBQ A;  5GAM g;  2DX1 A;  3SWN B;  3WXM B;  2RI2 A;  2HMA A;  3JB9 G;  1XNI A;  1B34 B;  2OAW A;  3H9N A;  3OYC A;  1IO6 A;  4ATO A;  3QWX X;  1PG5 B;  3CXC P;  4DBQ A;  1TXQ A;  3PIP A;  3EG9 A;  4JS5 A;  1LVK A;  1VQM Q;  3I5S A;  4ORZ A;  2H8H A;  2MMP A;  3EG3 A;  3MEU A;  1C1A A;  2LX7 A;  3LLR A;  2EYY A;  1R77 A;  3OW2 P;  1WDX A;  3RES A;  4XU1 A;  1G3S A;  1WQW A;  4LE9 A;  3PFS A;  2JN0 A;  3M0Q A;  1M3A A;  3A8M B;  3HTR A;  3ER0 A;  1MMG A;  3M57 A;  3SFM A;  2RPN A;  1FMV A;  1N6A A;  2WSC E;  2SEM A;  2HDA A;  1OPL A;  2VXF A;  5KCH A;  3CC4 T;  1Q7Y C;  2KQW A;  2X9H A;  1ZBX A;  3MEW A;  2GGR A;  5CCA A;  1K8A U;  5IH2 A;  2HQE A;  2QTX A;  3VS5 A;  5KE3 A;  1YI2 Q;  3EFO B;  1BIA A;  1FX7 A;  2OX7 A;  2DIL A;  4DBF A;  1W2B A;  1UG1 A;  2ZCF B;  3M0T A;  5D6X A;  1UHF A;  1VQK Q;  1GCQ C;  5LJ5 f;  3OYB A;  4AG2 C;  3FB9 A;  3EAE A;  1ZUU A;  1VA7 A;  3JCM e;  2GFU A;  1WI7 A;  4MDW A;  2AHJ B;  2VB6 A;  5KH6 A;  1NG2 A;  5A0L A;  1KQS S;  5CO7 A;  3QKJ A;  4XU0 A;  4ZN1 A;  4RTY A;  1M8V A;  3VUZ A;  2X3X D;  2DRM A;  1Y71 A;  1C6V X;  1WLP B;  2OJ2 A;  4OB3 B;  2QDL A;  1VQ5 T;  3RR6 A;  3CXC A;  3G6E Q;  2ZGW A;  4FT2 A;  3PNW C;  1NLP C;  4C92 A;  1CKB A;  1M3B A;  1UGP B;  5GAN e;  3LWH A;  3NMZ C;  4QQD A;  2RQV A;  3BDL A;  4PLI A;  1UGQ B;  2ED1 A;  3S6W A;  3VS6 A;  4A54 A;  5CKD A;  3QPH A;  5IXB A;  2QA4 A;  1M1K R;  2RO0 A;  4J83 A;  4M77 B;  3RMQ A;  3VRZ A;  2CSI A;  3L2V A;  3JCM b;  2B8A A;  5CIU A;  3CC4 A;  3HFO A;  3QO3 A;  4B9W A;  1IRE B;  4FYY B;  4PKC C;  1VQ4 T;  1M4Z A;  3H6Z A;  2M0O A;  2LQ8 A;  2V8I A;  3HFN A;  2M51 A;  3EG9 B;  3ZBD A;  3JB9 I;  2QQB A;  2HKN A;  1NJI R;  2CRE A;  1X27 A;  2XIC A;  5CKF A;  2CZ7 B;  2EAY A;  3OYK A;  1C0M A;  4M75 E;  4RTW A;  1V1C A;  3KFV A;  1OU8 A;  5HY6 A;  4KGX B;  2MWP A;  2GBQ A;  3EGX A;  4OMQ A;  3V8K A;  5DM7 R;  4E6R A;  4WF2 A;  3REA B;  2ATC B;  1P92 A;  2JTM A;  1D0Z A;  1TU0 B;  2EYX A;  1QWE A;  2DF6 A;  2VWF A;  1X6O A;  1QWF A;  2JW4 A;  1Z9Z A;  2R5A A;  2WSF E;  3MP8 A;  1BBZ A;  3MO8 A;  2MWO A;  1OPK A;  2HBW A;  4PFO A;  2MPX C;  1ABQ A;  2JTF A;  2PUK B;  4AFS C;  1H64 1;  3J7A F;  1Y0M A;  2COZ A;  4RMO A;  3HSB A;  3V7R A;  5FW9 A;  4M75 D;  2VUB A;  3FRN A;  3P8B B;  1VQ5 A;  2EIF A;  4NS5 A;  1WIE A;  2ENM A;  4EMK A;  3CCQ T;  1KSW A;  4F14 A;  2QQR A;  3I56 Q;  1K8A C;  1XJW B;  5IHN A;  4KT0 E;  1VQ8 T;  4KRT A;  1D1A A;  1W70 A;  2D0Q B;  1X69 A;  3OS0 A;  2D0N A;  1UGS B;  4FIB A;  4AG1 C;  2LC4 A;  1Q82 U;  1YJ9 A;  1AWO A;  4C0D C;  2AT1 B;  5LJ5 e;  1TUC A;  1AVZ C;  3M0R A;  4LD9 K;  2HCK A;  4M7A E;  1VQL Q;  1YIT A;  1VQ4 A;  5GAN g;  1VIF A;  4E7J A;  1I1J A;  2CGH A;  2GTJ A;  1VIE A;  1U1T A;  5GAM d;  2K3X A;  2YRD A;  4QVZ A;  2QQ9 A;  1R0C B;  1BB9 A;  2XID A;  1N9R A;  3CCU A;  1WA7 A;  4OMM A;  2OI3 A;  4HCC A;  4R55 A;  2M1H A;  2A28 A;  1S72 Q;  4C92 B;  2L3Q A;  1E7O A;  1M2O A;  2DXB A;  1ZSZ C;  2EGA A;  2LJ3 A;  3TU4 K;  1YBY A;  1X6B A;  1YWP A;  2FB7 A;  2RA2 A;  2F5K A;  2X4W A;  3JCM J;  2OTJ T;  3CCM T;  3JB9 F;  3FDR A;  1SRL A;  4KUL A;  2DNU A;  1O75 A;  3VV0 A;  5GAM f;  5L8R E;  1PHT A;  5EC7 A;  1WJQ A;  5D7U A;  3TVT A;  2ZPG B;  3WVD B;  4ZGD B;  3CC2 Q;  1X75 C;  3G71 Q;  1H3H A;  3NFC A;  4PJO C;  2KAF A;  4OMO A;  1ZA2 B;  2A37 A;  4IUU A;  1UEC A;  1X6G A;  1JO8 A;  2RHX A;  3QJY A;  1H3Z A;  3CCQ A;  1MV3 A;  1MNE A;  5FRO A;  1JB0 E;  3EGX B;  1UHC A;  1QVG S;  2HBP A;  1BCM A;  4PL6 A;  3CD6 Q;  4PJO A;  2CSQ A;  2RI5 A;  2MOX A;  1YIJ T;  5LJ5 h;  2AK5 A;  1MMD A;  1PKT A;  2KNB B;  1K9M C;  1K73 R;  2IPO B;  2JMA A;  2CDT A;  5C0M A;  4RCC A;  4M7D A;  2NUT A;  1JBM A;  4VUB A;  5AT1 B;  3OQ5 A;  4DOV A;  4IIO A;  4XAX B;  2JNG A;  1K1Z A;  1E6H A;  2MF2 A;  1YCY A;  2VGN A;  5GAN 4;  2RJF A;  2J6F A;  2O01 E;  4C8Q C;  3G4S Q;  3M59 A;  3A5Z B;  2CP6 A;  3UF4 A;  1NZ9 A;  1RL2 A;  2L8D A;  4DEY A;  1ZQ1 A;  2CUB A;  3DB4 A;  1JRI A;  4EMK B;  1VQM T;  4ZNX A;  4CC2 A;  1V29 B;  1Y57 A;  3PT9 A;  5GAO p;  2I2L A;  2QQA A;  1QKX A;  1R0B G;  5I2M A;  4M77 G;  3CCM A;  2DIG A;  1YNZ A;  3S3O A;  4JZ4 A;  2AZV A;  1TOV A;  2EGC A;  1LNX A;  4CC4 B;  1AZE A;  1PSF A;  3UA7 A;  2QTV A;  4O5V A;  4KUD K;  4ZGJ B;  1RAI B;  4OB2 B;  1OX8 A;  3RKX A;  2DAQ A;  2HZY A;  4E7I A;  1OI1 A;  3NPF A;  4QKU A;  4PJO F;  3OA6 A;  1K9M R;  1UUE A;  4M78 A;  1M8M A;  2ZPE B;  1YI2 T;  2L3P A;  2MI6 A;  4JDS A;  1D09 B;  1K76 A;  1JJ2 P;  2KBT A;  1UJ0 A;  3SWN C;  4BDZ A;  2NYS A;  4QVC A;  2EQU A;  3M0P A;  5FU7 B;  3L2Z A;  2Z0W A;  1UB4 A;  1KIK A;  1VQP A;  3CMA T;  4IIM A;  5LJ3 g;  3MHX A;  2GF7 A;  2J06 A;  2JTE A;  4KUI A;  4JRK A;  2QGG A;  1B34 A;  3E9G A;  1NPR A;  3JCM c;  3CC7 Q;  4PK4 A;  4E7S A;  2BZY A;  1WX6 A;  1AHJ B;  2DFU A;  1SKU B;  2KRO A;  5FWC A;  4C8Q F;  2M9U A;  5CK9 A;  4F7U A;  1GFC A;  2M02 A;  2GTO A;  4RG2 A;  1FMK A;  2K5F A;  3JCM d;  4ME7 A;  1VQ8 Q;  3C0C A;  2CUD A;  1WYX A;  3L2W A;  3C94 A;  3X28 B;  2YRV A;  2L3R A;  4ANJ A;  3PE0 A;  3QDF A;  5J3B A;  1M1K U;  2K5L A;  1PD1 A;  1YJN Q;  3CCL A;  4BDY A;  2RHY A;  4FYX B;  1G2B A;  2IG0 A;  1KC8 C;  1I07 A;  4M7D B;  2QI2 A;  2NUT B;  1BU1 A;  4OMP A;  1PSE A;  2X4J A;  3H0H A;  1Z9Q A;  2HL3 A;  4XTU A;  2J7I A;  1SRM A;  4M7A A;  1VOM A;  2RQT A;  5GAN 3;  3DLM A;  5GMK h;  3OYD A;  4E7L A;  1IGQ A;  3A8H B;  2EW3 A;  2J05 A;  2DBK A;  2Y90 A;  4FCY A;  1WXB A;  2DBM A;  5GAN d;  2NUP A;  4J8O A;  1NEG A;  2K3Y A;  1CSK A;  2RF0 A;  4A4G A;  2FVU A;  4J7I A;  4IUQ A;  4PJJ A;  4N0A A;  3VS0 A;  3VS3 A;  3ME9 A;  3M55 A;  4J7F A;  1VQK A;  1QCN A;  2GQV A;  1U5S A;  1JJ2 A;  2EJ9 A;  1X2K A;  2FZC B;  2QEX Q;  3M0S A;  2YHT A;  3V8J A;  1M30 A;  2DZC A;  4C0F A;  2KSS A;  1SSH A;  3UPU A;  5HKC A;  3EGU A;  3MJX A;  2CT3 A;  1PNJ A;  4J9G A;  4OGE A;  2E3I A;  2DZ9 A;  5GAN f;  3GIB A;  2PQW A;  2QXF A;  2E6Z A;  3E2U A;  5GAM h;  2FYK A;  2EGE A;  3M58 A;  4JPB W;  3CCE Q;  1Y96 A;  4WTO B;  1UJY A;  4A4F A;  2EBP A;  4HCK A;  1SHG A;  5GMK l;  4M78 B;  2VC8 A;  2H3E B;  2F2W A;  2RM4 A;  1U3O A;  3TCJ A;  1EZZ B;  3I55 Q;  1WJS A;  4M77 C;  3OS1 A;  1YIJ Q;  4CC3 A;  1EIF A;  4RG8 A;  3G6E A;  2EKH A;  3QDR B;  2WAC A;  1VQN A;  3BDU A;  1YWO A;  4IKF A;  2YUP A;  1BIB A;  1I8F A;  4NOY A;  3I56 T;  2ECZ A;  2L3S A;  1YHQ Q;  3RNJ A;  4X1V A;  1OUL A;  2KT1 A;  4J6X A;  4FYV B;  4P5N A;  4E2F B;  2LT1 A;  1WZO A;  2Y4Y A;  2L2P A;  2XU8 A;  1G8X A;  5HCK A;  1VQL T;  1I5L A;  2KE9 A;  1WHK A;  4AFU C;  1YJW Q;  5GJV B;  4F7U B;  5A0G A;  3OYI A;  3JB9 D;  1XTD A;  3VYH B;  3VS2 A;  3FEO A;  7AT1 B;  4PNO A;  3HRU A;  4XQ3 A;  1KFZ A;  1CKA A;  4EPC A;  1GBR A;  2HAX A;  2EQK A;  1IZ6 A;  2ZPB B;  2IIM A;  3OMC A;  1S72 T;  5DLO A;  1TG0 A;  2LQK A;  5LJ5 d;  2DL3 A;  4AMC A;  1OZ3 A;  4LDW A;  1W2B S;  1KQS P;  5A2Q E;  2E65 A;  4L59 A;  4LDY A;  4MZT A;  1JU5 C;  4RUG A;  4M7A B;  1KK7 A;  3OBY A;  3CCR Q;  1M1K C;  4IUR A;  2YUN A;  4E47 A;  1KG1 A;  3ULR B;  4Z89 A;  2KT8 A;  5GAO q;  2HEQ A;  3CC2 T;  2NUP B;  3VJP A;  2ABL A;  1N9S A;  2DXC A;  2YSQ A;  3G71 T;  3E19 A;  2KR3 A;  2I0N A;  2LNV A;  3F70 A;  3VS1 A;  3GF5 A;  2X51 A;  3CMA Q;  3A8L B;  2RMO A;  4M77 F;  4L5G A;  3DKM A;  1M2V A;  2CP3 A;  2R57 A;  3HRS A;  4OMN A;  3EG0 A;  1NJI C;  3GNG A;  2O4X A;  3N5B B;  4J9D A;  2OTL A;  3HRT A;  4C5E A;  3I56 A;  1K73 U;  3CD6 T;  1U06 A;  4F17 A;  2XDP A;  3EGD A;  3A8G B;  4XU2 A;  4LDX A;  1NM7 A;  2EWN A;  2E6N A;  4C92 C;  1VUB A;  1Y96 B;  4HVU A;  3EHQ A;  2EQI A;  2KMT A;  3QII A;  2RK1 A;  2QGF B;  4A4K A;  3G4S T;  2C0T A;  2DEQ A;  1SHF A;  3RDV A;  2PTK A;  4PJO G;  3UWN A;  2R5M A;  1V76 A;  5CKE A;  2BE7 D;  1QLY A;  3URG A;  4KBM B;  4BI8 B;  1JQQ A;  1TTH B;  4BUG A;  2F69 A;  3H0F A;  3EHR A;  4BY6 B;  3OW2 A;  4M7D G;  2HQH A;  2VXE A;  2DVE A;  5LJ3 f;  1N8R C;  2FPD A;  4XTZ A;  4PJO D;  1RAD B;  2RJC A;  2O9S A;  1B7T A;  3OBW A;  1HJD A;  1BK2 A;  5DY9 A;  4AT1 B;  2A7Y A;  4J9H A;  4M7D D;  5CR2 A;  2DL4 A;  1DJ7 B;  1OYX A;  3TQ7 P;  4HT9 A;  3JCM W;  2ZZD A;  1SSF A;  1K9M U;  2DVJ A;  4JRP A;  2VGM A;  4CRI A;  4PJM A;  3RIR A;  3G71 A;  3JCM h;  3BFM A;  4V2S A;  3M4G A;  2AKL A;  3SD4 A;  4C8Q G;  5HK0 A;  2P0K A;  3EH1 A;  2LRQ A;  1OOT A;  2V1Q A;  3L42 A;  4JLG A;  2MCN A;  3I9Q A;  3LGL A;  3CD6 A;  3A98 A; 
#chains in the Genus database with same CATH homology
 4MZP A;  5LJ5 h;  3X20 B;  4OB1 B;  2K5I A;  2XKO C;  4PJO B;  1BI2 A;  1G3T A;  2KK4 A;  2DD5 A;  1GXI E;  1K9M C;  3CCJ T;  4C8Q D;  5GAN 2;  2V8K A;  4M75 F;  4RKU E;  1VQN T;  4IUP A;  2DTH A;  1VQ7 A;  3Q1J A;  5C0M A;  4II1 A;  3ASK A;  2QDY B;  4RCC A;  4M7D A;  3FC3 A;  4C0G A;  4EMK C;  1JBM A;  3QYG B;  4VUB A;  3OQ5 A;  2QA4 T;  3CCR A;  2LT4 A;  3PTA A;  2P4T A;  4DOV A;  3DB3 A;  4XAX B;  1U1S A;  2JNG A;  2XDD A;  4C92 F;  3SB2 A;  5IT9 E;  4M78 G;  2MF2 A;  4XTW A;  4L6V 5;  1YCY A;  3S3N A;  5GAN h;  2VGN A;  3CC7 T;  2DXT A;  4C0Z A;  1QP2 A;  2D9T A;  4FM4 B;  2RJF A;  5GAN 4;  2O01 E;  1Q7Y U;  4C8Q C;  3QJ6 A;  1U8R A;  3M59 A;  4TVR A;  3CCV A;  3JB9 J;  5D6Y A;  3A5Z B;  3G4S A;  2QQS A;  3ZEH A;  2E70 A;  1WGS A;  3JCM f;  5FRN A;  1NZ9 A;  3MET A;  1RL2 A;  1MGQ A;  2EKO A;  2L8D A;  3PMT A;  1ZQ1 A;  3DB4 A;  1JRI A;  4EMK B;  3CME A;  4OVA A;  1VQM T;  2XI9 A;  4J6W A;  2RHU A;  3GNF B;  3CCS A;  4QVD A;  2LVM A;  3CXC S;  2ZPH B;  4HA8 A;  1VQO T;  5GAN 6;  4HT8 A;  2BKD N;  3QSU A;  2E1H A;  1M90 U;  2O4X B;  1V29 B;  3PT9 A;  3A8O B;  2XK0 A;  3P8D A;  2HD0 A;  5GAO p;  2I2L A;  2ZPI B;  3V7S A;  4JRQ A;  1KQ2 A;  2QQA A;  5I2M A;  1HK9 A;  1I81 A;  4M77 G;  4C8Q B;  4JLI A;  3CCM A;  2DIG A;  2E64 A;  3V8L A;  4ZGE B;  1YJN T;  4PJO E;  4OGC A;  5GAO r;  5LJ3 d;  3S3O A;  3J80 E;  1XOV A;  5LJ5 j;  3OW2 S;  1LNX A;  2EYQ A;  2RHZ A;  3QUI A;  3QXE B;  4BI4 A;  4Q5W A;  3LGF A;  1VQL A;  1KHC A;  1PSF A;  2EJF A;  4JS4 A;  3PMI A;  5GAN 5;  1XQH A;  2XD0 A;  2RI3 A;  1KHI A;  4MML A;  4O5V A;  4M7D E;  2X4X A;  4KUD K;  3CBO A;  4ZGJ B;  5FU7 C;  4F7U G;  2XDB A;  3EFR A;  3HPW A;  3L1A A;  1K73 C;  4OB2 B;  5HK3 A;  1M90 C;  1VQ6 T;  2PVG B;  3RKX A;  2DAQ A;  1Q86 U;  4E7I A;  1OI1 A;  1ZHI A;  2JZ2 A;  2E12 A;  2H3J A;  3INZ A;  3UT1 A;  4BB7 A;  3H8Z A;  1M9S A;  4C5G A;  4PJO F;  1R8O B;  2ZPF B;  3OA6 A;  1OZ2 A;  5A0D A;  4DA4 A;  5GAN j;  4M78 A;  2ZPE B;  2EQJ A;  2KDS A;  3VU3 C;  4A4E A;  3BW1 A;  1S72 A;  1YI2 T;  2MI6 A;  4DQ2 A;  4JDS A;  3QBY A;  1VQ9 A;  4QQ6 A;  4B9X A;  4QQG A;  3OS2 A;  3SWN C;  3OYN A;  4BDZ A;  4BE1 A;  1KD1 U;  4QVC A;  2EQU A;  2LCL A;  5FU7 B;  2RJD A;  3M53 A;  3L2Z A;  5CKB A;  4C5H A;  4EMG A;  3AHU A;  4FSX A;  4Z02 A;  2HQX A;  1UB4 A;  2YLC A;  4MMK A;  1KQ1 A;  4YTL A;  1VQP A;  3CMA T;  5DLQ E;  3VKI A;  4IUT A;  4C5I A;  3G7Z A;  3CCJ A;  3CD6 A;  1WNL A;  2DK3 A;  4RCB A;  1KQS A;  5LJ3 g;  4C8Q E;  4M7A G;  3JCM Q;  3MHX A;  2GF7 A;  2GFA A;  2OTL T;  3OB9 A;  2QEX T;  4CI0 C;  4KUI A;  3FLG A;  3S3M A;  4XTV A;  2RD1 A;  1WJR A;  4JRK A;  4M77 A;  4EMH A;  2V8J A;  5GAO l;  3X26 B;  5IAY A;  1B34 A;  3E9G A;  4ZTJ A;  5GAM g;  3SWN B;  3NTI A;  1NPR A;  3JCM c;  3WXM B;  3VUB A;  2RI2 A;  3CC2 A;  3JB9 G;  1XNI A;  1YJ9 T;  1B34 B;  5LJ3 e;  3OYC A;  1BI0 A;  2VV5 A;  1KC8 U;  3O8V A;  3CCE T;  4ATO A;  1AHJ B;  4X34 A;  1YIT T;  3PIP A;  4C8Q F;  2WSE E;  2M9U A;  5CK9 A;  4M7D C;  4F7U A;  4JS5 A;  2BUD A;  4RG2 A;  2K5F A;  3JCM d;  3UDC A;  4ME7 A;  1X01 A;  3I55 T;  4HCB A;  2JVV A;  1VQ8 A;  2MMP A;  4M78 E;  1VQO A;  4DOW A;  3CCU T;  3MEU A;  3L2W A;  3JRZ A;  3C94 A;  3LLR A;  3X28 B;  2YRV A;  4XK8 E;  2L3R A;  4XU1 A;  3RES A;  1G3S A;  1WQW A;  3FJP A;  4ZN3 A;  5J3B A;  1M1K U;  2K5L A;  5I21 A;  3PFS A;  2JN0 A;  3CEY A;  3CPW A;  3CCL A;  4BDY A;  1YJN A;  2RHY A;  2IG0 A;  1KC8 C;  3A8M B;  4XTX A;  4M7D B;  2QI2 A;  3QHS A;  3ER0 A;  1NPP A;  3M57 A;  3SFM A;  3QYH B;  2DTI A;  1YHQ T;  1PSE A;  2X4J A;  2LCC A;  1N6A A;  2Y4X A;  3HP9 A;  3PGG A;  2WSC E;  2L89 A;  5IN1 A;  3X24 B;  4XTU A;  3WVE B;  4E7H A;  3L2R A;  5CQX A;  4M7A A;  2VXF A;  4X9C A;  5KCH A;  4M75 G;  3CC4 T;  1Q7Y C;  5GAN 3;  1VQ6 A;  2KQW A;  3DLM A;  1ZBX A;  5GMK h;  2FL7 A;  3OYD A;  4E7L A;  3A8H B;  3MEW A;  5CCA A;  3RKY A;  5J26 A;  1K8A U;  4ZTF A;  2HQE A;  1FWZ A;  2Y90 A;  1MHN A;  4LDU A;  2QTX A;  5GAN d;  4J8O A;  5KE3 A;  1YJW T;  2K3Y A;  1BIA A;  3CBP A;  4M78 D;  4A4G A;  2FVU A;  1FX7 A;  1WPY A;  3JCM g;  3OYA A;  3L2U A;  4A53 A;  4J7I A;  1BYM A;  2A3L A;  2CZ6 B;  4IUQ A;  4F7U E;  4N0A A;  1W2B A;  2ZCF B;  5D6X A;  5GMK i;  4BI3 A;  1I4K 1;  3R6O A;  2DPP B;  3M55 A;  3ME9 A;  4J7F A;  1VQK A;  2OTJ A;  5LJ5 f;  3OS5 A;  1NE8 A;  3OYB A;  1D3B A;  1Y7X A;  2GQV A;  3FB9 A;  3EAE A;  4MZM A;  4N4I A;  3DLL A;  1G3W A;  1JJ2 A;  2EJ9 A;  3HHT B;  4FL6 A;  3JCM e;  3MCA B;  2E5Q A;  4BAC A;  5J39 A;  3E1S A;  4M78 C;  3JAM E;  5EG2 A;  3J81 E;  2GFU A;  2P0P A;  2NLU A;  2YHT A;  3QG1 A;  5LJ3 h;  3V8J A;  2DZC A;  4C0F A;  2KSS A;  4MDW A;  3NTK A;  2AHJ B;  3UPU A;  5KH6 A;  5HKC A;  3GLX A;  3QZ9 B;  4XTY A;  4M77 D;  1RI0 A;  4O6J A;  4OGE A;  3EFS A;  2LTO A;  5A0L A;  2D6F A;  1KQS S;  2DZ9 A;  5CO7 A;  2RB6 A;  1QVF A;  2LX9 A;  3QKJ A;  4XU0 A;  2PQW A;  2QXF A;  2PU9 B;  2E6Z A;  4ZN1 A;  5GAM h;  5GAN f;  2FYK A;  2OTL A;  3M58 A;  1M8V A;  1Y96 A;  3VUZ A;  3CCE A;  4A4F A;  2DXU A;  3RKW A;  3CCR T;  3L2Q A;  1Y71 A;  5GMK l;  4HCZ A;  5D6W A;  4M78 B;  2VC8 A;  5GMK j;  4M75 A;  2CYZ B;  2RM4 A;  3TCJ A;  3OY9 A;  3M9Q A;  4OB3 B;  1BI3 A;  4M7D F;  1VQ5 T;  1WJS A;  3I55 A;  4M77 C;  3OS1 A;  2EQM A;  3CXC A;  1EIF A;  2ZGW A;  1YIJ A;  4RG8 A;  3G6E A;  4EDU A;  4D6W A;  4FT2 A;  3PNW C;  4IUV A;  3QDR B;  4C92 A;  2WAC A;  1UGP B;  1QP3 A;  5GAN e;  3LWH A;  1Q86 C;  1VQN A;  4QQD A;  2DKG A;  3BDU A;  4IKF A;  3BDL A;  4LD6 A;  4PLI A;  1BIB A;  1UGQ B;  2RK2 A;  4XU3 A;  3S6W A;  1I8F A;  4NOY A;  4A54 A;  5CKD A;  3I56 T;  3QPH A;  2QA4 A;  1M1F A;  1G5V A;  5KE2 A;  1YHQ A;  2MAM A;  3RUX A;  2RO0 A;  3CBM A;  4FT4 A;  4J83 A;  5KCO A;  4M77 B;  3RMQ A;  4J6Y A;  4J6X A;  5FRM A;  2VYT A;  4FU6 A;  4P5N A;  3LWI A;  4Y28 E;  3L2V A;  3CPW S;  3JCM b;  2L5Q A;  3CC7 A;  1KD1 C;  5LJ3 j;  2B8A A;  1BKB A;  2LT1 A;  5CIU A;  4M7A D;  3CC4 A;  3HFO A;  2Y4Y A;  2XU8 A;  1W4S A;  3QO3 A;  4B9W A;  5GAN 7;  4OMF B;  2K57 A;  1IRE B;  2DTO A;  4JRI A;  4PKC C;  1VQ4 T;  1I5L A;  1VQL T;  1M4Z A;  3H6Z A;  2M0O A;  2PUO B;  2LQ8 A;  2V8I A;  3HFN A;  3OSV A;  2CZ0 B;  3ZBD A;  3JB9 I;  2QQB A;  5GAM j;  1VQM A;  4F7U B;  5A0G A;  5I2S A;  3OYI A;  5CQY A;  3JB9 D;  4ELZ C;  1XTD A;  5GAO n;  3VYH B;  3FEO A;  4QW2 A;  2XIC A;  5CKF A;  2X4Y A;  2CZ7 B;  2EAY A;  2PVO B;  2RJE A;  4JUV A;  4PNO A;  3OYK A;  5FLX E;  5GAN 8;  3HRU A;  4M7A C;  4M75 E;  4XQ3 A;  4EPC A;  2HAX A;  2EQK A;  1IZ6 A;  5HY6 A;  1FXX A;  2ZPB B;  3OMC A;  2MWP A;  3V8K A;  5DM7 R;  1S72 T;  5DLO A;  2K2V A;  2LQK A;  2P0Q A;  1N27 A;  5LJ5 d;  2KVQ G;  4WF2 A;  1OZ3 A;  4LDW A;  1M5Q 1;  1W2B S;  5CAI A;  5A2Q E;  2E65 A;  4L59 A;  1P92 A;  2JTM A;  2DO3 A;  3JCM P;  4OP0 A;  2M16 A;  3OYY A;  4M78 F;  4LDY A;  3BY7 A;  4MZT A;  1VQP T;  1X6O A;  1UGR B;  1JJ2 S;  2DIQ A;  4N0A C;  1UEB A;  2R5A A;  3KUF A;  3OMG A;  4M77 E;  4M7A B;  3OBY A;  2WSF E;  3MP8 A;  2X35 A;  3MO8 A;  1NJI U;  2MWO A;  5CVI A;  4BE2 A;  3C12 A;  4NL2 A;  1M1K C;  3VYG A;  3GP8 A;  2JTF A;  4IUR A;  2PUK B;  4OF1 A;  5CKH A;  4E47 A;  1KG1 A;  1H64 1;  4C92 G;  3J7A F;  5GAO q;  2R58 A;  3OYH A;  3KXT A;  1YI2 A;  4RMO A;  2F5T X;  3HSB A;  3CC2 T;  3V7R A;  3VJP A;  1N9S A;  2DXC A;  3OSS C;  1Q81 U;  3T9N A;  3MEV A;  3G71 T;  4M75 D;  2VUB A;  1QVF S;  1QVG A;  3FRN A;  3E19 A;  3M54 A;  3P8B B;  3V7C A;  1VQ5 A;  3RER A;  2EIF A;  3JSC A;  2LNV A;  4NS5 A;  3F70 A;  5GMK m;  3GF5 A;  3MEA A;  2K4Y A;  3A8L B;  4M77 F;  2JUF A;  4L5G A;  4N4G A;  3DKM A;  3QZ5 B;  2R57 A;  4EMK A;  3CMA A;  3CCQ T;  3HRS A;  1LJO A;  4C92 D;  1D3B B;  2QQR A;  1NJI C;  3SDZ A;  2PVD B;  3LH0 A;  3JB9 H;  3JCM V;  3GNG A;  2O4X A;  3N5B B;  3TRE A;  5LJ5 g;  1K8A C;  1QW1 A;  3C95 A;  3LW5 E;  3HRT A;  4C5E A;  4KT0 E;  3I56 A;  2QEX A;  1K73 U;  1VQ8 T;  3CD6 T;  4M75 C;  2D0Q B;  4N4H A;  2XG8 D;  4C8Q A;  3OS0 A;  2XDP A;  4F7U F;  2CS7 A;  3M56 A;  1UGS B;  4FIB A;  3OYM A;  3A8G B;  2LC4 A;  4XU2 A;  1Q81 C;  1Q82 U;  1YJ9 A;  1VQ7 T;  4LDX A;  2EWN A;  3CCL T;  4Y91 A;  4C0D C;  5GAO m;  3TEE A;  3RMS A;  2DJZ A;  4J5Y A;  4LDV A;  5LJ5 e;  4LD9 K;  2E6N A;  2YLB A;  4GLK A;  1VUB A;  4C92 C;  4E7K A;  4M7A E;  1LOJ A;  1YIT A;  2LDM A;  2IVW A;  2EJG A;  1Y96 B;  1VQ4 A;  4BY6 C;  4OB0 B;  5GAN g;  1VIF A;  2RHI A;  4E7J A;  2KMT A;  3NTH A;  2CGH A;  3QII A;  1N8R U;  2RK1 A;  1VIE A;  1U1T A;  3MP6 A;  2G3R A;  5GAM d;  2K3X A;  4A4K A;  4M75 B;  4QVZ A;  4PLL A;  2QQ9 A;  3CCV T;  2XID A;  3G4S T;  1N9R A;  3CCU A;  3LYI A;  2DEQ A;  4UC4 A;  4BD3 A;  2GCX A;  2RH2 A;  4R56 A;  3OYG A;  3CPF A;  4PJO G;  2EFI A;  3UWN A;  4HCC A;  1WQ7 A;  2R5M A;  4R55 A;  5CKE A;  4C0D B;  2M1H A;  3OYF A;  2C06 A;  1Q82 C;  3URG A;  3CME T;  4KBM B;  4C92 B;  4M7A F;  4BI8 B;  3FIF A;  3CCS T;  5GMK e;  4BUG A;  2FHD A;  2F69 A;  4BY6 B;  3OW2 A;  2DXB A;  3M4Y A;  4M7D G;  4GY5 A;  3TU4 K;  1YBY A;  3M5A A;  2FB7 A;  2OAU A;  2RA2 A;  2VXE A;  3OYE A;  2F5K A;  1Y07 A;  2DVE A;  5LJ3 f;  1N8R C;  2X4W A;  3JCM J;  3X25 B;  1VQK T;  2OTJ T;  4XTZ A;  4ELY C;  4HKE A;  3CCM T;  4PJO D;  3JB9 F;  2RJC A;  3FDR A;  2CZ1 B;  4KUL A;  3ZFJ A;  4BE0 A;  3P8H A;  3OBW A;  1O75 A;  3GIB A;  5DY9 A;  3VV0 A;  5FU6 C;  2A7Y A;  5GAM f;  5C6S A;  2KY9 A;  5L8R E;  4M7D D;  5CR2 A;  2BIV A;  1WJQ A;  3GOX A;  1DJ7 B;  1QVP A;  2ZPG B;  3KBG A;  1OYX A;  1HXD A;  3SWN A;  5LL6 S;  3WVD B;  1YJW A;  4ZGD B;  3HL8 A;  2HNI A;  4HT9 A;  3JCM W;  2ZZD A;  1SSF A;  1K9M U;  1X75 C;  4MDX A;  2E10 A;  3NFC A;  3OYJ A;  3GPL A;  2VGM A;  4CRI A;  2KAF A;  3RIR A;  3G71 A;  4JRP A;  4PJO C;  1M1G A;  3JCM h;  1TH7 A;  2CKK A;  3BFM A;  4X9D A;  4V2S A;  3M4G A;  1O9S A;  2DD4 A;  2XHC A;  1BI1 A;  4IUU A;  5M9O A;  4JJN K;  3E9F A;  2E41 A;  3SD4 A;  2RHX A;  4C8Q G;  5HK0 A;  2P0K A;  3QJY A;  2LRQ A;  4NL3 A;  3PIO A;  1H3Z A;  4A4H A;  3CCQ A;  5FU6 B;  1G3Y A;  3OYL A;  3LX7 A;  1VQ9 T;  5FRO A;  1JB0 E;  5AYF A;  5GAM e;  3L42 A;  3MP1 A;  1QVG S;  2HBP A;  4C92 E;  3JCM X;  4JLG A;  2JOY A;  3C4S A;  4PL6 A;  3LGL A;  4PJO A;  3HKS A;  2RI5 A;  1YIJ T;  3G6E T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...