2JZ2A

Solution nmr structure of ssl0352 protein from synechocystis sp. pcc 6803. northeast structural genomics consortium target sgr42
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
MIFPGATVRVTNVDDTYYRFEGLVQRVSDGKAAVLFENGNWDKLVTFRLSELEAVKPILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of Ssl0352 protein from Synechocystis sp.
rcsb
source organism Synechocystis sp.
molecule tags Structural genomics, unknown function
molecule keywords Ssl0352 protein
total genus 9
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11623 NdhS NAD(P)H dehydrogenase subunit S
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jz2A00
3BDLA 4C5EA 5KCOA 3META 4FL6A 4LD6A 2X35A 3OY9A 2MWOA 3FDRA 3MEVA 3P8HA 4BDZA 3L2RA 3QKJA 2K3YA 2VYTA 5KH6A 1G5VA 4IKFA 3EAEA 3L2WA 2JZ2A 3MEUA 5D6XA 3OYHA 2R5MA 4QQ6A 2X4XA 4GY5A 4PLIA 3OYCA 3NTKA 2DAQA 2YRVA 2XDPA 5D6WA 3QBYA 2RHXA 2RJFA 4II1A 3E9FA 2O4XB 1MHNA 3CEYA 3H8ZA 3H6ZA 4IUPA 4C5IA 5C6SA 2RJDA 2RJEA 5FROA 5J39A 3L42A 5J26A 2FHDA 3LX7A 1OZ3A 5FRNA 4A4GA 4BE2A 2BKDN 3FC3A 3S6WA 1RI0A 2L8DA 5CIUA 4ZTFA 3OYBA 4OVAA 2D9TA 1OYXA 3OYAA 3C4SA 3OYFA 4E7JA 4BDYA 4IUVA 2K3XA 2GFUA 3OYEA 2M0OA 3LH0A 2BUDA 2EQKA 2X4WA 2R57A 1OI1A 2DIGA 2EQMA 2E5QA 3O8VA 4EDUA 3OYIA 4IUTA 4IUUA 3MP6A 2E6NA 2HQEA 2R5AA 1WJQA 3UWNA 5KE2A 2L89A 3OYGA 4E7LA 4X34A 3OYKA 1OZ2A 3Q1JA 3PFSA 3PMIA 3S3OA 3S3NA 4BE0A 2NLUA 2B8AA 1XNIA 4N4GA 3S3MA 3ASKA 2EKOA 2RI2A 2LDMA 2RHUA 3LGLA 4UC4A 3DB4A 4C5HA 4FU6A 2QQRA 1WJRA 2M1HA 3M9QA 3OMCA 4QVZA 3ME9A 3OA6A 2RO0A 4N4IA 2IG0A 3DB3A 2RHYA 3P8DA 3PMTA 2WACA 5IN1A 4BACA 4Z02A 3OYJA 3MP1A 4BE1A 2M16A 2X4YA 4CRIA 4B9WA 3L2VA 3FEOA 2R58A 2L3RA 1KHCA 4Q5WA 3OMGA 2PQWA 2BIVA 2QQSA 2RJCA 3QIIA 4IURA 3OYDA 3GOXA 5KE3A 4ZTJA 2RI5A 4QQDA 4A4EA 3L2UA 4QQGA 5D6YA 3OS1A 2RHIA 3OYMA 5FRMA 2EQUA 4PL6A 5M9OA 2LRQA 3DLMA 4NS5A 3SD4A 3MO8A 3OQ5A 2O4XA 2P0KA 4BD3A 3OS2A 4E7KA 4N4HA 4L59A 3FLGA 1WJSA 4A4HA 2XK0A 4C5GA 2LCCA 2RI3A 3LGFA 3LLRA 1H3ZA 4HCZA 3OS0A 4E7IA 2LVMA 3E9GA 4PLLA 2CKKA 1SSFA 3UT1A 3MEAA 2G3RA 1WGSA 4A4FA 3OYNA 4RG2A 2GF7A 3PNWC 3L2QA 5C0MA 3MP8A 5IAYA 4E7HA 3F70A 3KUFA 3ZEHA 4B9XA 2JTFA 4IUQA 3OYLA 3NTHA 3NTIA 3MEWA 1N27A 2EQJA 2MWPA 4QW2A 2RHZA 5KCHA 2LTOA 2HQXA 3QJ6A 2GFAA 2DIQA 2F5KA 3LYIA 2EFIA 3OB9A
chains in the Genus database with same CATH superfamily
2XMFA 4C5EA 4L5GA 2MWOA 2ATCB 1N8RU 4OMLA 2KROA 5IHNA 4R56A 2X4XA 3CCVT 3JB9I 1G83A 4F14A 5IH2A 2DETA 3SDZA 2GTJA 1YIJT 1HK9A 2CREA 2RJDA 1JRIA 2BE9B 1R8OB 4HCKA 2AZVA 5CIUA 2D6FA 1WFWA 1RAGB 4LN2A 2D9TA 2RQRA 3VYGA 1U8RA 3LWIA 2QQAA 3VV0A 4M78F 5GJWB 3NFCA 2L3PA 2K9GA 4BI3A 5GAMj 3H41A 2DE0X 1EX4A 1AWWA 4M75C 4RUGA 1K8AR 3G4SA 4BY6C 4FU6A 3CC7T 2KRSA 1B34B 1SRLA 1OOTA 2XG8D 2QQBA 4IIOA 2HKQB 3QDRB 1VQKT 1KQ1A 5IHKA 1KQSP 3HRTA 2OTLQ 4JPBW 3G6ET 3A98A 3OYDA 3M53A 4ZNXA 3CCLA 5GAN3 1IB8A 4KH1B 5AYFA 2X51A 4X9CA 8ATCB 1VQ6Q 2RI3A 2IVWA 1JXMA 3CCST 1QKWA 4M7AF 4Y28E 4A4FA 3CCRT 1ZHIA 1QCOA 3KUFA 2JTFA 3CMET 2ED0A 1IGQA 4BI4A 2C0OA 1QWEA 1OQKA 4KBMB 2QTVA 2DIQA 2ZCFB 2F5KA 3M0UA 3JB9D 1QLYA 3MEVA 4JRKA 5EC7A 3JCMP 3CCLT 4J6YA 1IO6A 1MV0B 2NUPA 2Y4XA 4AFZC 3CCJQ 1I1JA 4QQ6A 3D7SB 2IIMA 3QSUA 3DKMA 5D6WA 2DYBA 2OX7A 3E9FA 2O4XB 3VU3C 2O88A 5FROA 3L42A 3CC7A 3JB9G 3FC3A 2L8DA 4A63B 1Q7YU 4ZTFA 1KC8C 2OI3A 1D1BA 3JCMh 1OYXA 4M75A 3FB9A 2QK0A 3LH0A 4DEYA 5A0GA 3M56A 2IPOB 4EDUA 5CK9A 4ZGJB 2MPXC 1TU0B 1T3SA 1UGRB 3HFNA 3HTRA 3VS1A 1GXIE 3P8BB 3M0RA 2L5QA 4PJOF 1UGSB 1XNIA 3VKIA 1WXBA 4LDVA 5IN1A 1KQSS 1VQ4Q 1GCQC 3M4YA 4FCYA 1GFCA 2FEIA 2YLCA 1KHCA 5A2QE 2VGNA 2OTLT 4KT0E 2DXTA 3GPLA 2DBKA 3M5AA 2LQ8A 2LRQA 3OQ5A 3A8GB 3H0HA 4DEXA 2HNIA 2VXFA 3BE3A 1QCNA 1YCSB 1PM3A 5D7UA 1SSFA 3REBB 2V8IA 4BI8B 2V1QA 5IAYA 1YI2A 1MMDA 2KI7A 5GAOm 4PJOC 3G6EQ 4ORZA 5GAOl 1J3TA 2KK4A 1Y7XA 3SHWA 5LJ3h 4RG8A 3FJPA 4FL6A 4WCIA 3PGGA 3P8HA 1SEMA 4IKFA 2RK1A 1ZBXA 1VQ8A 4LDWA 4OB1B 1SF9A 1QVPA 3QPHA 3A8OB 2PVDB 2VB6A 4J9DA 1WZOA 1VQLT 3CCET 1OEBA 2NUTB 1M1KU 4MZTA 2PZ1A 1UHFA 1MHNA 1QKXA 1WIEA 1X2KA 3KBGA 4HA8A 2KRMA 3TSZA 1PRMC 2GQVA 2O9SA 1FX7A 5CAIA 1UHCA 2BE7D 2BUDA 1PSEA 3M59A 1GRIA 1AD5A 2DO3A 3E2UA 3T9NA 3VJPA 1BIAA 5GMKj 4K11A 3OYGA 3I56T 3CCJT 4HVVA 3PMIA 3WXMB 1VQ8Q 2B8AA 1WLPB 1QVGA 2FG0A 1H8KA 3VS3A 3EGXB 2M1HA 2A37A 3OMCA 5LJ3d 4DBHA 1UG1A 4M7AC 2YHTA 1ZSZB 1VA7A 1ZA2B 5I22A 4BE1A 1NE8A 3EFRA 4AFUC 4ZN3A 2P4TA 3OMGA 1YCYA 1ACMB 3BFMA 2O9VA 3A8LB 4QQGA 1TUCA 4JRQA 3EG0A 3M54A 1QWFA 1M2VB 4A4HA 1WJSA 2EIFA 4XU0A 1RLPC 2MYSA 3VS4A 2OJ2A 4QT7A 3GBQA 3I56Q 2A7YA 4ESRA 4F7UB 4CI0C 2DPPB 4DOWA 2JT4A 2AIRB 2DTIA 2K2MA 3QUIA 5LJ5j 4M7DF 2VKNA 4OGCA 4C92A 1ARKA 3QZ9B 1WPYA 1E6HA 2MF2A 4PFOA 1NPPA 1NYGA 1SRMA 2K3YA 1NZ9A 4XTZA 5KH6A 2ABLA 3CXCP 1TG0A 1M3BA 3QG1A 2EQIA 4ZGDB 4F7UG 2CZ7B 1PRLC 2ZPIB 3JCMd 2H8HA 2YLBA 4E7SA 2FZGB 2EJFA 4N0AC 1MNEA 2VVKA 1GFDA 3FJ5A 4PJOE 2DFUA 2E41A 2RQTA 5GMKi 3CCQA 4BDYA 2JNGA 2X4WA 3CMAT 4RCBA 3OYIA 4F7UE 4M7DD 3J81E 3CXCA 1M1GA 4X34A 1OZ2A 4BE0A 4CC7A 5DLQE 3LGLA 1WJRA 3CD6T 1RAFB 4QVZA 1V76A 1D09B 2RNAA 3PMTA 2DBMA 3L2ZA 3RMQA 3G1JA 2QG9B 2DERA 2R58A 3VS6A 4M7DG 2EGCA 1Q82R 2HD0A 5KE3A 1W70A 5GAMe 5FU6B 3L2UA 1YP5A 2KT1A 2EJGA 2RHIA 4OB3B 3CCVQ 2EQUA 1NEGA 3JCMQ 1K9MU 3DLMA 1HXDA 2O4XA 2JJ9A 2KMTA 5LL6S 3HHTB 1R0CB 4PFPA 2P4RA 1RAAB 3E9GA 3HL8A 2DXUA 3CBPA 4KUIA 4EPCA 1QVGP 3CBMA 4JJBA 3OYNA 1QQJA 2AKKA 5C0MA 4ELZC 3J7AF 4GBQA 1RADB 3EG2A 1K8AU 2MIOA 2KGTA 2FVUA 1M27C 2CZ6B 3ME9A 2FRWA 2XIDA 3BDLA 4OB2B 5KCOA 4OB0B 2VWFA 1YITQ 3QWXX 4D8KA 4PJOG 4J9FA 1BI2A 2KXDA 2E3IA 1M90R 2LMJA 2DF6A 4VUBA 2JZ2A 1BIBA 2HAXA 2DA9A 2Z0WA 2DRKA 3OYCA 1QW1A 2J6KA 2QA4T 2HEQA 3URGA 2RHXA 3UA7A 1TXQA 1G3TA 2ZPHB 3MPUB 1NYFA 3CXCS 1UECA 4OVAA 1I8FA 5HK3A 3EG3A 4C8QB 2A3LA 3OYEA 1VQ5Q 4M77B 1OI1A 2JS2A 1S72Q 4RTVA 2MMPA 4N0AA 4FW1A 3MJXA 2FYKA 2ZPFB 1D3BA 1BYMA 3UPUA 3SWNA 3CMEA 2KYBA 2LDMA 2EYXA 2GGRA 3WVDB 4XTXA 4C92C 1Q7YC 1UGVA 1BU1A 1JBMA 1YIJA 1YJNA 3JAME 2I0NA 1G3SA 2LCLA 5DY9A 4M7AG 4RTWA 4M7DC 4JZ3A 4RTUA 3OYMA 4LE9A 3I55A 3IQLA 1G3WA 2CUBA 3VS7A 1C1AA 4R55A 4LDYA 2XK0A 4BB7A 2LCCA 2RH2A 1VOMA 1VQKA 2C0IA 2QEXQ 3HPWA 3JCMW 2LVMA 4C8QE 1H92A 2PUKB 1IREB 2GTOA 1BI1A 1SKUB 4KH0B 1K9MR 3PNWC 3L2QA 2EYQA 4E7HA 3G4ST 2NUPB 4BUGA 1O75A 1N27A 2YSQA 2I2LA 1U1SA 5LJ5d 3QWYA 1WHJA 5KYUA 4J9BA 4M77G 1YJWA 4OMOA 1SSHA 2FPEA 3X20B 2CDTA 2RD1A 4KGVB 5CKHA 1JU5C 4HT8A 2F69A 2KRNA 1RAHB 3PIOA 5DLOA 1VQPA 5FLXE 4ZGEB 1YIJQ 1PNJA 2YRVA 2O2OA 1ZA1B 2RJFA 4RCCA 4RMOA 1UJ0A 5J39A 2J6FA 2YUNA 2B86A 2LQNA 4LD9K 2VV5A 4NL3A 3OYBA 4PJOD 1Q86R 5CO7A 3C4SA 3OYFA 3CCUA 3PVLA 1N9SA 3CPFA 4M75B 5LJ3g 3CC2Q 3DLLA 5GMKe 5L23A 1YJWT 2EGAA 5FWBA 2R5AA 1VQ9Q 2ENMA 2A36A 1YJ9A 2COZA 1AWOA 2KE9A 4X1VA 4F04B 3PVQA 3VYHB 4F17A 1QCFA 3RMSA 1MMNA 2RO0A 4XK8E 2IG0A 2DL4A 1D1AA 2CP2A 2X4JA 3RERA 3L2VA 3FEOA 3TCJA 3A8HB 2K5IA 3CCUT 2QTXA 2JS0A 2DK3A 3TU4K 1KQSA 1OPLA 2D0QB 1WNLA 3OW2P 1RI9A 2D8JA 3JCMb 4JRPA 1RL2A 4NL2A 2AZSA 5GANh 2E1HA 9ATCB 1NLOC 1X6BA 4Z89A 2XDBA 1H3HA 1TOVA 1T0HA 1B3QA 5FWCA 1Y57A 2KDSA 3EG1A 3MP8A 4TVRA 3F70A 3EG9A 3RNJA 4B9XA 4M7AD 5I2MA 1N9RA 1K0XA 3MEWA 3G6EA 4M7AA 4M77C 3ZL7C 4PJLA 1Y96A 2DL3A 2DL5A 4JJNK 2PVOB 1VQ7A 1FYNA 4HVWA 2VYTA 2JUFA 4M78C 2HZYA 4BY6B 3ZBDA 1YJ9Q 1TTHB 3AHUA 1KJWA 4M7AB 2AKLA 4C8QD 2NUZA 4AMCA 3FRNA 2K79A 3CMEQ 1VIFA 4MMLA 1Z9ZA 1U5SA 3EHQA 1O9SA 3HP9A 3EG9B 1PSFA 2GBQA 2OTLA 4J6WA 4O5VA 2CT4A 4MZPA 2DZ9A 2K4YA 3RR6A 1IRXA 2V26A 2DIGA 4LDUA 1VIEA 4PNOA 1PD0A 3I35A 1GBRA 1HYOA 5FW9A 1WJQA 2EYYA 1M2VA 3GIBA 4FIBA 2CYZB 1KG1A 2ZPBB 3S3MA 3CQTA 4ZN1A 4C5HA 1VQ8T 1FMWA 1C6VX 3TVTA 1VQKQ 3DB3A 1U3OA 2PU9B 4Q5WA 3I5RA 3QIIA 4RTTA 2K3BA 1MMAA 1QMCA 1VQ7T 4DQ2A 1K9AA 2COYA 5IHIA 1YHQQ 4AFQC 2DVJA 2EBPA 1ZX6A 3OSVA 2JM9A 3KXTA 4PJOB 3V7SA 1H3ZA 4J7FA 1VQMT 1QVFA 2XU8A 1ZLMA 2CKKA 1CKAA 4DBFA 4OMPA 4D6WA 3I55Q 1RAIB 2DXCA 2JM8A 2MK5A 3EGUA 2V1RA 5IT9E 3CMAQ 3RKXA 5GAOp 2H3JA 2C0TA 1SHGA 2LTOA 1YN8A 3RESA 1Q95G 4FYVB 1JJ2P 1RUWA 7AT1B 1GBQA 3OW2A 2LNHB 1BBZA 3CCQT 5CQXA 1NG2A 2YUQA 5D6XA 3VS5A 2DILA 1EZZB 2FZCB 3NTKA 1KC8U 1VQMA 3QBYA 1KQ2A 4ELYC 1QVFP 3X28B 3X25B 2RN8A 3EFSA 1K8AC 1OZ3A 1UGPB 5LJ5e 5EG2A 1X27A 2DJQA 1AOJA 1NBEB 3EHRA 4IUVA 1KD1U 4LNPA 1W1FA 2E3HA 4KGZB 1JQQA 1M30A 5GANg 4MDWA 1VQNQ 3MP6A 2M51A 2HQEA 1KFZA 2OAUA 4C0GA 4A4KA 3Q1JA 3CCEA 2K7AA 3S3OA 1VQLA 1AWJA 2DL7A 1X43A 1Q86U 1PKTA 1YI2Q 1G8XA 2KSSA 2RQWA 3PT9A 3I5SA 4EMGA 2WSFE 3P8DA 2KYMA 4BACA 2Y4YA 3OBYA 5GAOr 1UJYA 2EVRA 3OYJA 5KYWA 1CSKA 2L3RA 3CPWA 2HL3A 4M78A 3JCMX 4FT4A 1V29B 1Q82C 2O31A 1OX8A 3MO8A 4M77D 2LJ1A 2LQWA 3FLGA 4XAXB 5GANj 4OP0A 2PTKA 3LLRA 3JB9F 1D0YA 1QP3A 2RQUA 3OS0A 4M77A 3R6OA 1VYTA 3GF5A 2QDLA 5GANe 3UATA 4KUDK 4DA4A 1NPRA 1GCPA 1VQOQ 1FWZA 4X9DA 2NYSA 1Y96B 3PE0A 3QJ6A 2GFAA 4M7DE 1JXOA 2KNBB 3VUZA 2JN0A 4BDZA 2DM1A 1DJ7B 1UDLA 2LT1A 3RIRA 4AG2C 3AT1B 5GAN6 1H641 2YRDA 2R5MA 2JMAA 4OGEA 3TQ7P 1WQWA 1UE9A 2XDPA 1W6XA 4EMKC 3CCMT 1B07A 2QA4Q 2QGFB 1MUZA 1ABQA 3JCMc 1W4SA 4XQ3A 5FRNA 3A5ZB 4Z88A 2BKDN 2JVVA 3RKYA 5HCKA 2KQWA 3ZFJA 1XOVA 4AG1C 2VGMA 2X9HA 3OYAA 4E7JA 5GAN7 2XD0A 5A0LA 3O8VA 4A54A 2VASA 5GMKh 2CP5A 2LJ0A 5KYYA 1N8RC 1WHLA 4F7UF 4LXCA 2GQIA 2JTEA 1S72T 3OYKA 4C92E 1I0CA 2J06A 2NLUA 3M9QA 4XTVA 2D8HA 4HKEA 1WXTA 4LUEA 2RHYA 5LJ3j 1T3LA 3CD6Q 1VUBA 2QA4A 1LOJA 2OAWA 5CQYA 2WSCE 4IURA 2ECZA 2EAYA 3GNGA 3RUXA 5M9OA 3C95A 4MZMA 4PJMA 2CT3A 4N4HA 4L59A 3X24B 4PJNA 1JO8A 4FSXA 4M4ZA 1FMKA 1JEGA 1YHQA 3FIFA 2KXCA 1AZGB 2CS7A 2XICA 2NWMA 3TSWA 2QQ9A 1ZUYA 2FRYA 2MOXA 4XTWA 2QEXA 1G3YA 4JS5A 1WXUA 2RQVA 4C8QG 1S1NA 1IHWA 4FM4B 4KRTA 3GP8A 3LYIA 3I9QA 3OB9A 2LX7A 2KR3A 2X35A 3MKDA 4EMKB 2DTHA 2G6FX 3NPFA 1LJOA 2A0FB 4CC3A 4J6XA 1CKBA 2AT1B 4MDXA 1YBYA 4KGXB 2CSIA 2ROLA 1M3CA 3CEYA 2D1XA 5C6SA 2F5TX 1KD1C 2FHDA 1KK7A 3OS5A 1M5Q1 1NJIU 1GL5A 1MGQA 3JCMf 1Q81R 3INZA 2F2VA 2K3XA 1IZ6A 2JTMA 5CCAA 2M0OA 3M58A 2EQKA 4FYWB 2R57A 1I4K1 1WHGA 3VUBA 4E7ZA 1HD3A 2EJ9A 4AT1B 2E6NA 1W2BA 4C0ZA 2E64A 3S3NA 1VQPT 3CC7Q 3H9NA 4WF2A 2EKOA 1TSFA 3OW2S 3PTAA 1Y71A 3TREA 1AHJB 4JJDA 3X26B 3OA6A 4M78D 4E2FB 5DM7R 4B9WA 2KAFA 4O6JA 1Z9QA 3LH5A 1X69A 4NS5A 4BD3A 1LPLA 1QP2A 1A0NB 1C0MA 1RLQC 3EGDB 2CSQA 5KYUB 4C5GA 1NM7A 2KEAA 1U06A 2LJ3A 1N5ZA 5GAOq 5GAMd 3MEAA 1K73C 1WGSA 3QDFA 2COWA 1OPKA 2E12A 3L1AA 3MCAB 1WHHA 3NMZC 3G4SQ 2E5KA 3G71A 4A53A 4HCCA 4XU2A 3META 3CCLQ 1YJNT 4OF1A 1PCXA 2XI9A 4ME7A 2K5FA 3CPWS 4CC4B 1LNXA 3JRZA 2V8KA 1EFNA 2ROTA 5GMKm 2RMOA 2FZKB 2LQKA 4CC2A 1SHFA 1XQHA 4A4GA 1W2BS 1R77A 2JW4A 1ZUKA 3S6WA 1D3BB 3CPWP 4C8QA 1ABOA 4NOYA 4ANJA 2X3WD 2E70A 4FW2A 3BDUA 2CH4W 3V8KA 3M0QA 2EQMA 5GAMh 2LC4A 1X6OA 4C0FA 4JLGA 2M02A 1RABB 2L89A 5GAMg 1SPKA 3SFMA 2HBWA 2RB6A 2L0AA 3CCJA 2QAZA 4Z8AA 4N4IA 2PNIA 1ZUUA 2HSPA 1ZSZC 2SEMA 2HL5C 2CUDA 2CZ0B 2DL8A 2W0ZA 1VQNA 4ZTJA 1I5OB 1E7OA 5D6YA 2OTJA 1YITA 3OS2A 1HJDA 2J7IA 2W10A 2A28A 2NUTA 1VQ5T 2YUPA 1YHQT 1YWOA 4KULA 8AT1B 2HSEB 2YUOA 1VQPQ 3GNFB 2YXYA 3OSSC 4J9CA 4V2SA 4FYYB 2EYZA 2G3RA 3M57A 3CC4T 1M2OA 2ZGWA 3SWNB 4IUQA 1M90U 3CCRQ 2DEUA 3I56A 2MWPA 1BKBA 2LCSA 1RAEB 5KCHA 5GAN4 2DVEA 2LNVA 5L8RE 4LD6A 2L3QA 3OY9A 1NLPC 2DKGA 1WHKA 2FPDA 3EAEA 4ATOA 3MEUA 3OYHA 1N6AA 2EGEA 1S72A 1UGQB 3M4GA 2QASA 2EYWA 3C94A 2ESWA 1OV3A 2RPNA 1Q82U 2K5LA 1OX9A 1M8MA 5IXFA 3EFOB 2DMOA 2QXFA 3ULRB 5GANd 1K73U 3E19A 3KFVA 2HKNA 1K9MC 1WI7A 1RACB 1AVZC 4IUTA 2KBTA 1WHMA 2JXBA 3UF4A 5GANf 5GJVB 3EGXA 2K2VA 3EFOA 3PFSA 1VQMQ 2EKHA 4C8QC 3CCSQ 3G71Q 4FYXB 2RI2A 5GAN2 2HBPA 4XTUA 3LW5E 4Z02A 1G2BA 3MP1A 3C12A 4L6V5 3TEEA 3CCVA 2DXBA 1B34A 2QQSA 1Q7YR 2QYZA 2FL7A 3M0PA 4OMQA 1Y0MA 2DZCA 2ZPGB 4A4EA 4PJJA 1OU9A 1M1FA 3CC4A 1I81A 4E47A 1BI0A 3M0SA 1WX6A 3UA6A 4J5YA 2DYIA 5KYYB 4J9HA 3V8JA 4HXJA 4HCZA 4E7IA 5CKEA 4M75E 4WTOB 2CP6A 3JCMJ 4RG2A 5GAN5 3ZEHA 4M7AE 3QHSA 1M3AA 4OMFB 4QVDA 3SEMA 1MV3A 4B6MA 1TWBA 1UUEA 3MHXA 1PKSA 1XTDA 2HQXA 2LT4A 2EFIA 2O01E 5I11A 1AWXA 3O5ZA 1Q81C 5I21A 4JS4A 3QKJA 1IXDA 3JSCA 6AT1B 1VQLQ 3CC2A 3CCEQ 2KVQG 3CBOA 4JRIA 5J3BA 1X01A 4PLIA 2DAQA 1JJ2A 1ZSZA 2EWNA 3CCSA 1YJ9T 2YRCA 3H8ZA 4C5IA 1VQ4A 5J26A 4BE2A 1NJIR 1Y07A 2OTJQ 1RI0A 2P84A 1E6GA 5AT1B 1VQ9A 4JUVA 4M78G 4HVUA 3VS2A 5LJ5g 2GFUA 1P92A 5ECAA 1SG5A 4YTLA 2C06A 2E5QA 5GMKl 2VXEA 3H0FA 4EIKA 2YT6A 5LJ3f 1K0SA 1EIFA 3J80E 2HQHA 4F7UA 4N4GA 1T0JA 2SRCA 3ASKA 2RHUA 3DB4A 3EH2A 4DOVA 2D0NA 5KYWB 2JMCA 4CRIA 2RM4A 3CMAA 1X6GA 1JJ2S 2K57A 2E65A 2PVGB 4RTXA 2VUBA 1B7TA 1WA7A 4P5NA 2Y90A 4JLIA 3SD4A 5GAOn 1YJWQ 1OULA 3BW1A 3JCMe 2GCXA 2F1LA 1K4US 3RKWA 2CH4A 2RK2A 3A1PA 1VYUA 5HK0A 4QKUA 3G71T 3QYGB 4PLLA 4C92G 1AEYA 1XJWB 4HT9A 1YI2T 1VYVA 1MMGA 3A8MB 2CP0A 3UDCA 1VQOT 3I55T 1D0XA 2DX1A 2J05A 4JZ4A 4DBRA 3REAB 4J9EA 3LWHA 1I5LA 4C92F 2FB7A 4RTYA 5CKDA 1W2BP 4XU3A 2KY9A 4C92D 1NEBA 2M9UA 2MI6A 4RTZA 1HSQA 4JDSA 5FU7C 1KHIA 4OMNA 1M9SA 1F1BB 1X2QA 5CKFA 3N5BB 1TH7A 3LX7A 2HMAA 4Y92A 2OTJT 2A08A 3SWNC 1LCKA 2E6ZA 3VS0A 3WVEB 1U1TA 1VQNT 2MAMA 4C0DC 4PJOA 4IUUA 2RF0A 3SB2A 1GCQA 2ZPEB 4FSSA 4J83A 5KE2A 1UFFA 4C92B 4J9GA 2DLPA 5KYNA 3JB9J 4M7DA 2AHJB 4AFSC 3CCQQ 1Q81U 4UC4A 2L3SA 4M77F 3PIPA 1VQ4T 3G7ZA 1YNZA 2QGGA 4EMKA 5LJ3e 2X4YA 3VRYA 1KSWA 2BIVA 1M90C 2RJCA 1VQ6A 4QQDA 1IGUA 2EW3A 3JV3A 2EPDA 4PL6A 4LDXA 4E6RA 1BCOA 4QVCA 3LGFA 1M4ZA 3THKA 3UT1A 4XU1A 1AZEA 1TUDA 3BY7A 3HRSA 3HRUA 1M1KC 1JB0E 2F2WA 3JCMV 3OYLA 2HCKA 3NTHA 2EQJA 4HCBA 5CKBA 4QW2A 2VC8A 4M75G 1PD1A 2HDAA 2QI2A 2YWWA 2DNUA 3L2RA 1G5VA 1X75C 3CD6A 2CP7A 3L2WA 1VQ9T 2XDDA 2JOYA 4J8OA 2DRMA 4II1A 3H6ZA 1BI3A 3EH1A 2RJEA 5I2SA 2DEQA 3CC2T 5CR2A 2FPFA 2QDYB 3V7CA 1QVFS 1K1ZA 1ZBJA 2WSEE 3RBBB 3V8LA 1BB9A 3E1SA 2AK5A 2F2XA 4GLKA 1UEBA 3M55A 3UWNA 1PC0A 1MNDA 2YDLA 3ER0A 2CZ1B 2BZ8A 4PK4A 5HKCA 4M78E 1AT1B 1UB4A 4JJCA 2WACA 1UTIA 2M16A 3CCMQ 2CGHA 3CCUQ 2PQWA 2DD4A 3GOXA 3HKSA 4RKUE 2DJZA 1V1CA 2BTTA 1QVGS 3VRZA 4M7DB 5FRMA 1PG5B 1VQOA 3V7RA 4E7KA 3QJYA 2P0KA 4IIMA 2P0QA 1KC8R 1K76A 2ZAEA 4FT2A 1Q86C 1BCMA 3C0CA 2CP3A 4F16A 5LJ5f 5LJ5h 5CVIA 2XHCA 1N8RR 2MCNA 3QXEB 3JCMg 3NTIA 2M0YA 4R0KA 1FMVA 1BK2A 2H3EB 2RHZA 1I07A 2LZ6B 1VQ5A 3M0TA 4C8QF 1YFNA 3FDRA 3QO3A 1TUGB 4PFZA 1YITT 1R0BG 1YJNQ 2BZYA 1FXXA 2J6OA 4J7IA 2GNCA 1K73R 3JB9H 3CCRA 4GY5A 3U23A 5FU6C 1WYXA 2P0PA 5IXBA 3OYYA 3NHNA 1PWTA 3GLXA 3NGPA 3CCMA 4IUPA 4M75D 2E10A 4XTYA 4C0DB 1WDXA 2LP5A 2DTOA 2ED1A 4OMMA 1NJIC 1D1CA 4EMHA 5GAN8 2BZXA 2FO0A 2ZZDA 2PUOB 1ZSGA 1IHVA 3RDVA 4M77E 3HFOA 1VQ7Q 1D0ZA 1ZQ1A 3H0IA 3QYHB 1KIKA 3EGDA 4E7LA 2QEXT 1WQ7A 1YWPA 4J9IA 3R6NA 2QQRA 5A0DA 3QZ5B 2LX9A 4PKCC 2DD5A 1LVKA 1PHTA 5FU7B 2E4HA 5KYXB 2RI5A 2KT8A 4DBQA 3OS1A 2L2PA 2X3XD 5KYXA 4M78B 1VQ6T 1KD1R 3OBWA 3HSBA 2XKOC 1M1KR 4Y91A 4LUDA 4MMKA 1OU8A 2V8JA 2GF7A 4D8DA 4GLMA 3CC4Q 2K6DA 5GAMf 1M8VA 5HY6A 2RA2A 4M75F 1TS9A
chains in the Genus database with same CATH topology
2XIDA 3BDLA 4L5GA 4OB2B 4OB0B 4C5EA 5KCOA 4M7DE 3VUZA 2MWOA 4PJOG 2JN0A 4BDZA 1Q81C 1N8RU 5I21A 4JS4A 1BI2A 3QKJA 1DJ7B 3RIRA 2LT1A 4VUBA 2JZ2A 3JSCA 1BIBA 5GAN6 3CC2A 2HAXA 1H641 2KVQG 4R56A 3CBOA 2R5MA 4JRIA 2X4XA 5J3BA 1X01A 4PLIA 3CCVT 3OYCA 4OGEA 3JB9I 2DAQA 1QW1A 1JJ2A 2EWNA 1WQWA 2QA4T 2XDPA 3CCSA 3SDZA 1YJ9T 4EMKC 3URGA 2RHXA 1YIJT 1HK9A 3CCMT 3H8ZA 4C5IA 2RJDA 1VQ4A 1JRIA 5J26A 3JCMc 1W4SA 1G3TA 1R8OB 2ZPHB 4XQ3A 3CXCS 3A5ZB 4BE2A 1Y07A 5FRNA 2BKDN 1RI0A 5CIUA 2D6FA 2JVVA 1I8FA 4OVAA 3RKYA 2KQWA 3ZFJA 1XOVA 1VQ9A 2D9TA 2VGMA 4JUVA 4M78G 3OYAA 4E7JA 3VYGA 5HK3A 1U8RA 3LWIA 4C8QB 5GAN7 2A3LA 5LJ5g 2GFUA 3OYEA 1P92A 2QQAA 2XD0A 4M77B 3VV0A 5A0LA 1OI1A 3O8VA 4YTLA 2E5QA 4M78F 4A54A 5GMKl 2C06A 5GMKh 2VXEA 3NFCA 1N8RC 2MMPA 4N0AA 4BI3A 5GAMj 4F7UF 5LJ3f 2FYKA 1EIFA 2ZPFB 1D3BA 4C92E 3J80E 3OYKA 1S72T 1BYMA 3UPUA 4M75C 3SWNA 2NLUA 4F7UA 3CMEA 4N4GA 3G4SA 3ASKA 2LDMA 2RHUA 4BY6C 3DB4A 4FU6A 3M9QA 4XTVA 3WVDB 4DOVA 3CC7T 1B34B 4HKEA 4XTXA 4C92C 1Q7YC 2XG8D 2RHYA 1JBMA 5LJ3j 1VUBA 1YIJA 2QQBA 1YJNA 3QDRB 1VQKT 1KQ1A 2QA4A 1LOJA 4CRIA 3JAME 1G3SA 2LCLA 2RM4A 3HRTA 3CMAA 3G6ET 5CQYA 2WSCE 5DY9A 1JJ2S 2K57A 2E65A 3M53A 4IURA 3OYDA 4M7AG 2PVGB 4M7DC 2VUBA 3OYMA 4P5NA 3I55A 2EAYA 3GNGA 3CCLA 3RUXA 2Y90A 5GAN3 4JLIA 5M9OA 1G3WA 3SD4A 3C95A 4MZMA 5GAOn 5AYFA 3BW1A 4N4HA 3JCMe 4R55A 4LDYA 4L59A 2GCXA 3X24B 2XK0A 4X9CA 4BB7A 4FSXA 2LCCA 2RH2A 2RI3A 2IVWA 2RK2A 3RKWA 1VQKA 3HPWA 5HK0A 1YHQA 3JCMW 3FIFA 3CCST 2LVMA 4C8QE 3G71T 3QYGB 4PLLA 4C92G 4HT9A 2CS7A 2PUKB 1IREB 1YI2T 4Y28E 1BI1A 2XICA 4A4FA 4M7AF 3PNWC 3L2QA 1ZHIA 3CCRT 2EYQA 4E7HA 2QQ9A 3G4ST 3KUFA 3A8MB 2JTFA 3CMET 3UDCA 4XTWA 1VQOT 4BUGA 2QEXA 1G3YA 1O75A 3I55T 1N27A 2I2LA 4JS5A 4BI4A 1U1SA 5LJ5d 4C8QG 4KBMB 4M77G 2DIQA 2ZCFB 4FM4B 2F5KA 3LYIA 3GP8A 3JB9D 1YJWA 3OB9A 3X20B 3LWHA 2RD1A 2X35A 4EMKB 1I5LA 2DTHA 3MEVA 5CKHA 4C92F 2FB7A 4JRKA 5CKDA 3JCMP 1LJOA 4HT8A 3CCLT 4J6YA 4J6XA 2F69A 2KY9A 4XU3A 4C92D 2M9UA 2Y4XA 2MI6A 3PIOA 4QQ6A 5DLOA 1VQPA 5FLXE 4ZGEB 4JDSA 3QSUA 5FU7C 1KHIA 3DKMA 4MDXA 1M9SA 1YBYA 2YRVA 5D6WA 2RJFA 5CKFA 3E9FA 2O4XB 3CEYA 4RCCA 4RMOA 3VU3C 3N5BB 5C6SA 1TH7A 5J39A 2F5TX 5FROA 3L42A 3CC7A 2FHDA 3LX7A 1KD1C 3JB9G 3FC3A 3OS5A 4LD9K 2L8DA 2VV5A 1M5Q1 1Q7YU 4NL3A 3OYBA 4ZTFA 1KC8C 1NJIU 4PJOD 2OTJT 3JCMh 1MGQA 1OYXA 4M75A 3C4SA 5CO7A 2E6ZA 3SWNC 3JCMf 3OYFA 3CCUA 1N9SA 3CPFA 3FB9A 3WVEB 3INZA 2K3XA 4M75B 5LJ3g 1IZ6A 2JTMA 5CCAA 1U1TA 2M0OA 1VQNT 3LH0A 2EQKA 3M58A 5A0GA 3DLLA 2R57A 3M56A 2MAMA 1I4K1 3VUBA 4EDUA 4C0DC 4PJOA 5GMKe 5CK9A 2EJ9A 4IUUA 4ZGJB 1YJWT 1UGRB 3HFNA 3SB2A 2E6NA 2ZPEB 2R5AA 1W2BA 4J83A 5KE2A 1YJ9A 1GXIE 3P8BB 4C92B 4C0ZA 2L5QA 2E64A 4PJOF 3S3NA 1UGSB 3JB9J 4M7DA 1VQPT 4WF2A 1XNIA 2AHJB 3VKIA 3VYHB 1Q81U 2EKOA 3OW2S 4LDVA 4UC4A 3PTAA 4M77F 1Y71A 3PIPA 1VQ4T 3TREA 1AHJB 3RMSA 3X26B 2RO0A 4XK8E 4M78D 3OA6A 2IG0A 3G7ZA 5IN1A 5DM7R 2X4JA 1KQSS 3M4YA 4EMKA 5LJ3e 2X4YA 3RERA 4B9WA 3L2VA 2KAFA 3FEOA 2YLCA 1KHCA 3TCJA 5A2QE 3A8HB 2K5IA 4O6JA 2BIVA 1M90C 2RJCA 1VQ6A 2VGNA 4QQDA 4KT0E 2DXTA 3GPLA 3CCUT 2OTLT 2QTXA 3M5AA 2DK3A 2LQ8A 4PL6A 3TU4K 1KQSA 2D0QB 2LRQA 1WNLA 4NS5A 4BD3A 3OQ5A 1QP2A 3A8GB 4LDXA 3JCMb 4JRPA 1RL2A 2HNIA 4NL2A 2VXFA 5GANh 2E1HA 4C5GA 4QVCA 3LGFA 1M4ZA 2XDBA 5GAOq 5GAMd 1SSFA 3UT1A 3MEAA 4XU1A 1K73C 1WGSA 3BY7A 3HRSA 2V8IA 4BI8B 2KDSA 3HRUA 3MP8A 1JB0E 3F70A 4TVRA 5IAYA 1M1KC 4B9XA 2E12A 4M7AD 5I2MA 3L1AA 3JCMV 1YI2A 1N9RA 3OYLA 3NTHA 3MCAB 3MEWA 2EQJA 4HCBA 5CKBA 3G71A 4A53A 5GAOm 4QW2A 4PJOC 2VC8A 4M75G 3G6EA 5GAOl 2KK4A 4HCCA 1Y7XA 4M7AA 5LJ3h 4RG8A 2QI2A 4M77C 3FJPA 4XU2A 3META 4FL6A 1Y96A 3PGGA 1YJNT 4OF1A 3P8HA 2XI9A 4ME7A 4JJNK 2PVOB 3L2RA 2K5FA 1VQ7A 1G5VA 2VYTA 2JUFA 3CPWS 4IKFA 1X75C 2RK1A 1ZBXA 4M78C 3CD6A 3L2WA 1VQ8A 1VQ9T 4LDWA 4OB1B 2XDDA 1QVPA 3QPHA 4BY6B 3A8OB 3ZBDA 1LNXA 2PVDB 3JRZA 2JOYA 3AHUA 2V8KA 1VQLT 3CCET 4J8OA 1M1KU 4MZTA 5GMKm 4II1A 4M7AB 3H6ZA 1MHNA 1BI3A 4C8QD 2RJEA 2LQKA 3FRNA 1XQHA 1VIFA 5I2SA 3KBGA 4A4GA 1W2BS 4MMLA 4HA8A 3S6WA 2DEQA 1O9SA 1D3BB 3HP9A 3CC2T 1PSFA 4C8QA 2GQVA 4NOYA 5CR2A 1FX7A 2OTLA 4J6WA 2QDYB 5CAIA 4O5VA 4MZPA 3V7CA 2DZ9A 1QVFS 2E70A 2K4YA 2BUDA 3BDUA 3V8KA 1PSEA 3M59A 2DIGA 2DO3A 2EQMA 4LDUA 5GAMh 2WSEE 2LC4A 1VIEA 3T9NA 3V8LA 4PNOA 3VJPA 3E1SA 1X6OA 1BIAA 4C0FA 5GMKj 1WJQA 4GLKA 1UEBA 3M55A 4JLGA 3UWNA 2L89A 5GAMg 3OYGA 3I56T 3CCJT 3GIBA 3PMIA 4FIBA 3WXMB 3ER0A 2CYZB 2CZ1B 1KG1A 2B8AA 3SFMA 2ZPBB 3S3MA 1QVGA 4ZN1A 2RB6A 4C5HA 1VQ8T 2M1HA 5HKCA 3OMCA 5LJ3d 3CCJA 4M78E 1UB4A 4N4IA 3DB3A 4M7AC 2YHTA 2WACA 4BE1A 1NE8A 2M16A 3EFRA 2PU9B 4ZN3A 2CZ0B 2CGHA 4Q5WA 2P4TA 3OMGA 1VQNA 2PQWA 1YCYA 2DD4A 3QIIA 4ZTJA 3GOXA 3HKSA 2DJZA 3BFMA 4RKUE 1QVGS 3A8LB 4QQGA 5D6YA 4M7DB 5FRMA 4JRQA 1YITA 2OTJA 1VQOA 1VQ7T 3M54A 3V7RA 4E7KA 3QJYA 4DQ2A 2P0KA 3OS2A 2P0QA 4A4HA 1WJSA 1VQ5T 3OSVA 2EIFA 4XU0A 4FT2A 3KXTA 1YHQT 1Q86C 3V7SA 4PJOB 4KULA 4J7FA 1VQMT 1H3ZA 1QVFA 2XU8A 3GNFB 2CKKA 3OSSC 4V2SA 5LJ5f 2G3RA 5LJ5h 5CVIA 4D6WA 2XHCA 3M57A 2A7YA 3CC4T 2DXCA 2ZGWA 4F7UB 3SWNB 3QXEB 2DPPB 4IUQA 4DOWA 4CI0C 3JCMg 1M90U 3NTIA 2DTIA 5IT9E 3RKXA 2MWPA 3I56A 3QUIA 5GAOp 1BKBA 2H3JA 5LJ5j 2RHZA 5KCHA 4M7DF 2LTOA 5GAN4 2DVEA 3RESA 1VQ5A 4OGCA 4C92A 2LNVA 5L8RE 4C8QF 4LD6A 3QZ9B 1WPYA 3OY9A 2MF2A 3FDRA 2DKGA 3QO3A 1NPPA 2K3YA 5KH6A 1YITT 1NZ9A 4XTZA 3EAEA 3OW2A 3CCQT 1FXXA 4ATOA 5CQXA 3MEUA 4J7IA 5D6XA 3JB9H 3OYHA 1N6AA 3CCRA 3QG1A 4GY5A 4ZGDB 5FU6C 3NTKA 2P0PA 4F7UG 3OYYA 1S72A 1UGQB 2CZ7B 1KC8U 1VQMA 3QBYA 2ZPIB 4ELYC 1KQ2A 3M4GA 3GLXA 3CCMA 3X28B 4IUPA 3X25B 4M75D 3JCMd 3EFSA 2YLBA 2E10A 1K8AC 2EJFA 3C94A 4N0AC 1OZ3A 1Q82U 1UGPB 2K5LA 4XTYA 5EG2A 4C0DB 5LJ5e 2DTOA 1NJIC 4EMHA 4PJOE 5GAN8 2QXFA 2E41A 5GMKi 3CCQA 5GANd 4BDYA 1K73U 2ZZDA 4IUVA 3E19A 1KD1U 2PUOB 4M77E 1K9MC 2JNGA 3HFOA 2X4WA 3CMAT 4RCBA 3OYIA 4IUTA 4F7UE 4M7DD 5GANg 1ZQ1A 4MDWA 3MP6A 5GANf 3J81E 2HQEA 3QYHB 3CXCA 2OAUA 1M1GA 4C0GA 4E7LA 4X34A 4A4KA 1OZ2A 3Q1JA 2K2VA 3PFSA 2QEXT 3CCEA 3S3OA 4BE0A 1VQLA 1WQ7A 4C8QC 2RI2A 5DLQE 3LGLA 1Q86U 5GAN2 2QQRA 1WJRA 5A0DA 3CD6T 2HBPA 4QVZA 2KSSA 3PT9A 3QZ5B 4EMGA 3PMTA 2WSFE 3L2ZA 3P8DA 3RMQA 2Y4YA 4XTUA 3LW5E 3OBYA 4Z02A 2LX9A 4BACA 5GAOr 4PKCC 3OYJA 3MP1A 3C12A 4L6V5 3TEEA 2R58A 2L3RA 3CCVA 3CPWA 2DXBA 1B34A 2DD5A 4M7DG 2QQSA 4M78A 2HD0A 5FU7B 5KE3A 2FL7A 2RI5A 5FU6B 5GAMe 2DZCA 4A4EA 2ZPGB 4FT4A 3JCMX 3OS1A 1V29B 2EJGA 2RHIA 3L2UA 4OB3B 1Q82C 2EQUA 3JCMQ 1K9MU 1M1FA 3DLMA 1HXDA 3MO8A 2O4XA 1I81A 4M77D 4M78B 4E47A 3CC4A 1VQ6T 3OBWA 1BI0A 2KMTA 3HSBA 4XAXB 3FLGA 2XKOC 5LL6S 4J5YA 5GANj 3HHTB 4OP0A 3LLRA 3V8JA 3JB9F 1QP3A 4HCZA 4Y91A 3OS0A 5CKEA 3R6OA 4M75E 3E9GA 3HL8A 4M77A 3GF5A 4E7IA 2DXUA 3CBPA 4MMKA 4KUIA 4EPCA 3CBMA 2V8JA 3OYNA 4RG2A 2GF7A 5GANe 5GAN5 3JCMJ 5C0MA 4ELZC 4KUDK 3ZEHA 3J7AF 4M7AE 3QHSA 4DA4A 1NPRA 5GAMf 4OMFB 4QVDA 1M8VA 1K8AU 1FWZA 3MHXA 4X9DA 1XTDA 1Y96B 2HQXA 2FVUA 3QJ6A 2LT4A 2EFIA 2CZ6B 2GFAA 5HY6A 3ME9A 2O01E 2RA2A 4M75F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDL A;  4C5E A;  5KCO A;  3MET A;  4FL6 A;  4LD6 A;  2X35 A;  3OY9 A;  2MWO A;  3FDR A;  3MEV A;  3P8H A;  4BDZ A;  3L2R A;  3QKJ A;  2K3Y A;  2VYT A;  5KH6 A;  1G5V A;  4IKF A;  3EAE A;  3L2W A;  2JZ2 A;  3MEU A;  5D6X A;  3OYH A;  2R5M A;  4QQ6 A;  2X4X A;  4GY5 A;  4PLI A;  3OYC A;  3NTK A;  2DAQ A;  2YRV A;  2XDP A;  5D6W A;  3QBY A;  2RHX A;  2RJF A;  4II1 A;  3E9F A;  2O4X B;  1MHN A;  3CEY A;  3H8Z A;  3H6Z A;  4IUP A;  4C5I A;  5C6S A;  2RJD A;  2RJE A;  5FRO A;  5J39 A;  3L42 A;  5J26 A;  2FHD A;  3LX7 A;  1OZ3 A;  5FRN A;  4A4G A;  4BE2 A;  2BKD N;  3FC3 A;  3S6W A;  1RI0 A;  2L8D A;  5CIU A;  4ZTF A;  3OYB A;  4OVA A;  2D9T A;  1OYX A;  3OYA A;  3C4S A;  3OYF A;  4E7J A;  4BDY A;  4IUV A;  2K3X A;  2GFU A;  3OYE A;  2M0O A;  3LH0 A;  2BUD A;  2EQK A;  2X4W A;  2R57 A;  1OI1 A;  2DIG A;  2EQM A;  2E5Q A;  3O8V A;  4EDU A;  3OYI A;  4IUT A;  4IUU A;  3MP6 A;  2E6N A;  2HQE A;  2R5A A;  1WJQ A;  3UWN A;  5KE2 A;  2L89 A;  3OYG A;  4E7L A;  4X34 A;  3OYK A;  1OZ2 A;  3Q1J A;  3PFS A;  3PMI A;  3S3O A;  3S3N A;  4BE0 A;  2NLU A;  2B8A A;  1XNI A;  4N4G A;  3S3M A;  3ASK A;  2EKO A;  2RI2 A;  2LDM A;  2RHU A;  3LGL A;  4UC4 A;  3DB4 A;  4C5H A;  4FU6 A;  2QQR A;  1WJR A;  2M1H A;  3M9Q A;  3OMC A;  4QVZ A;  3ME9 A;  3OA6 A;  2RO0 A;  4N4I A;  2IG0 A;  3DB3 A;  2RHY A;  3P8D A;  3PMT A;  2WAC A;  5IN1 A;  4BAC A;  4Z02 A;  3OYJ A;  3MP1 A;  4BE1 A;  2M16 A;  2X4Y A;  4CRI A;  4B9W A;  3L2V A;  3FEO A;  2R58 A;  2L3R A;  1KHC A;  4Q5W A;  3OMG A;  2PQW A;  2BIV A;  2QQS A;  2RJC A;  3QII A;  4IUR A;  3OYD A;  3GOX A;  5KE3 A;  4ZTJ A;  2RI5 A;  4QQD A;  4A4E A;  3L2U A;  4QQG A;  5D6Y A;  3OS1 A;  2RHI A;  3OYM A;  5FRM A;  2EQU A;  4PL6 A;  5M9O A;  2LRQ A;  3DLM A;  4NS5 A;  3SD4 A;  3MO8 A;  3OQ5 A;  2O4X A;  2P0K A;  4BD3 A;  3OS2 A;  4E7K A;  4N4H A;  4L59 A;  3FLG A;  1WJS A;  4A4H A;  2XK0 A;  4C5G A;  2LCC A;  2RI3 A;  3LGF A;  3LLR A;  1H3Z A;  4HCZ A;  3OS0 A;  4E7I A;  2LVM A;  3E9G A;  4PLL A;  2CKK A;  1SSF A;  3UT1 A;  3MEA A;  2G3R A;  1WGS A;  4A4F A;  3OYN A;  4RG2 A;  2GF7 A;  3PNW C;  3L2Q A;  5C0M A;  3MP8 A;  5IAY A;  4E7H A;  3F70 A;  3KUF A;  3ZEH A;  4B9X A;  2JTF A;  4IUQ A;  3OYL A;  3NTH A;  3NTI A;  3MEW A;  1N27 A;  2EQJ A;  2MWP A;  4QW2 A;  2RHZ A;  5KCH A;  2LTO A;  2HQX A;  3QJ6 A;  2GFA A;  2DIQ A;  2F5K A;  3LYI A;  2EFI A;  3OB9 A; 
#chains in the Genus database with same CATH topology
 2XMF A;  4C5E A;  4L5G A;  2MWO A;  2ATC B;  1N8R U;  4OML A;  2KRO A;  5IHN A;  4R56 A;  2X4X A;  3CCV T;  3JB9 I;  1G83 A;  4F14 A;  5IH2 A;  2DET A;  3SDZ A;  2GTJ A;  1YIJ T;  1HK9 A;  2CRE A;  2RJD A;  1JRI A;  2BE9 B;  1R8O B;  4HCK A;  2AZV A;  5CIU A;  2D6F A;  1WFW A;  1RAG B;  4LN2 A;  2D9T A;  2RQR A;  3VYG A;  1U8R A;  3LWI A;  2QQA A;  3VV0 A;  4M78 F;  5GJW B;  3NFC A;  2L3P A;  2K9G A;  4BI3 A;  5GAM j;  3H41 A;  2DE0 X;  1EX4 A;  1AWW A;  4M75 C;  4RUG A;  1K8A R;  3G4S A;  4BY6 C;  4FU6 A;  3CC7 T;  2KRS A;  1B34 B;  1SRL A;  1OOT A;  2XG8 D;  2QQB A;  4IIO A;  2HKQ B;  3QDR B;  1VQK T;  1KQ1 A;  5IHK A;  1KQS P;  3HRT A;  2OTL Q;  4JPB W;  3G6E T;  3A98 A;  3OYD A;  3M53 A;  4ZNX A;  3CCL A;  5GAN 3;  1IB8 A;  4KH1 B;  5AYF A;  2X51 A;  4X9C A;  8ATC B;  1VQ6 Q;  2RI3 A;  2IVW A;  1JXM A;  3CCS T;  1QKW A;  4M7A F;  4Y28 E;  4A4F A;  3CCR T;  1ZHI A;  1QCO A;  3KUF A;  2JTF A;  3CME T;  2ED0 A;  1IGQ A;  4BI4 A;  2C0O A;  1QWE A;  1OQK A;  4KBM B;  2QTV A;  2DIQ A;  2ZCF B;  2F5K A;  3M0U A;  3JB9 D;  1QLY A;  3MEV A;  4JRK A;  5EC7 A;  3JCM P;  3CCL T;  4J6Y A;  1IO6 A;  1MV0 B;  2NUP A;  2Y4X A;  4AFZ C;  3CCJ Q;  1I1J A;  4QQ6 A;  3D7S B;  2IIM A;  3QSU A;  3DKM A;  5D6W A;  2DYB A;  2OX7 A;  3E9F A;  2O4X B;  3VU3 C;  2O88 A;  5FRO A;  3L42 A;  3CC7 A;  3JB9 G;  3FC3 A;  2L8D A;  4A63 B;  1Q7Y U;  4ZTF A;  1KC8 C;  2OI3 A;  1D1B A;  3JCM h;  1OYX A;  4M75 A;  3FB9 A;  2QK0 A;  3LH0 A;  4DEY A;  5A0G A;  3M56 A;  2IPO B;  4EDU A;  5CK9 A;  4ZGJ B;  2MPX C;  1TU0 B;  1T3S A;  1UGR B;  3HFN A;  3HTR A;  3VS1 A;  1GXI E;  3P8B B;  3M0R A;  2L5Q A;  4PJO F;  1UGS B;  1XNI A;  3VKI A;  1WXB A;  4LDV A;  5IN1 A;  1KQS S;  1VQ4 Q;  1GCQ C;  3M4Y A;  4FCY A;  1GFC A;  2FEI A;  2YLC A;  1KHC A;  5A2Q E;  2VGN A;  2OTL T;  4KT0 E;  2DXT A;  3GPL A;  2DBK A;  3M5A A;  2LQ8 A;  2LRQ A;  3OQ5 A;  3A8G B;  3H0H A;  4DEX A;  2HNI A;  2VXF A;  3BE3 A;  1QCN A;  1YCS B;  1PM3 A;  5D7U A;  1SSF A;  3REB B;  2V8I A;  4BI8 B;  2V1Q A;  5IAY A;  1YI2 A;  1MMD A;  2KI7 A;  5GAO m;  4PJO C;  3G6E Q;  4ORZ A;  5GAO l;  1J3T A;  2KK4 A;  1Y7X A;  3SHW A;  5LJ3 h;  4RG8 A;  3FJP A;  4FL6 A;  4WCI A;  3PGG A;  3P8H A;  1SEM A;  4IKF A;  2RK1 A;  1ZBX A;  1VQ8 A;  4LDW A;  4OB1 B;  1SF9 A;  1QVP A;  3QPH A;  3A8O B;  2PVD B;  2VB6 A;  4J9D A;  1WZO A;  1VQL T;  3CCE T;  1OEB A;  2NUT B;  1M1K U;  4MZT A;  2PZ1 A;  1UHF A;  1MHN A;  1QKX A;  1WIE A;  1X2K A;  3KBG A;  4HA8 A;  2KRM A;  3TSZ A;  1PRM C;  2GQV A;  2O9S A;  1FX7 A;  5CAI A;  1UHC A;  2BE7 D;  2BUD A;  1PSE A;  3M59 A;  1GRI A;  1AD5 A;  2DO3 A;  3E2U A;  3T9N A;  3VJP A;  1BIA A;  5GMK j;  4K11 A;  3OYG A;  3I56 T;  3CCJ T;  4HVV A;  3PMI A;  3WXM B;  1VQ8 Q;  2B8A A;  1WLP B;  1QVG A;  2FG0 A;  1H8K A;  3VS3 A;  3EGX B;  2M1H A;  2A37 A;  3OMC A;  5LJ3 d;  4DBH A;  1UG1 A;  4M7A C;  2YHT A;  1ZSZ B;  1VA7 A;  1ZA2 B;  5I22 A;  4BE1 A;  1NE8 A;  3EFR A;  4AFU C;  4ZN3 A;  2P4T A;  3OMG A;  1YCY A;  1ACM B;  3BFM A;  2O9V A;  3A8L B;  4QQG A;  1TUC A;  4JRQ A;  3EG0 A;  3M54 A;  1QWF A;  1M2V B;  4A4H A;  1WJS A;  2EIF A;  4XU0 A;  1RLP C;  2MYS A;  3VS4 A;  2OJ2 A;  4QT7 A;  3GBQ A;  3I56 Q;  2A7Y A;  4ESR A;  4F7U B;  4CI0 C;  2DPP B;  4DOW A;  2JT4 A;  2AIR B;  2DTI A;  2K2M A;  3QUI A;  5LJ5 j;  4M7D F;  2VKN A;  4OGC A;  4C92 A;  1ARK A;  3QZ9 B;  1WPY A;  1E6H A;  2MF2 A;  4PFO A;  1NPP A;  1NYG A;  1SRM A;  2K3Y A;  1NZ9 A;  4XTZ A;  5KH6 A;  2ABL A;  3CXC P;  1TG0 A;  1M3B A;  3QG1 A;  2EQI A;  4ZGD B;  4F7U G;  2CZ7 B;  1PRL C;  2ZPI B;  3JCM d;  2H8H A;  2YLB A;  4E7S A;  2FZG B;  2EJF A;  4N0A C;  1MNE A;  2VVK A;  1GFD A;  3FJ5 A;  4PJO E;  2DFU A;  2E41 A;  2RQT A;  5GMK i;  3CCQ A;  4BDY A;  2JNG A;  2X4W A;  3CMA T;  4RCB A;  3OYI A;  4F7U E;  4M7D D;  3J81 E;  3CXC A;  1M1G A;  4X34 A;  1OZ2 A;  4BE0 A;  4CC7 A;  5DLQ E;  3LGL A;  1WJR A;  3CD6 T;  1RAF B;  4QVZ A;  1V76 A;  1D09 B;  2RNA A;  3PMT A;  2DBM A;  3L2Z A;  3RMQ A;  3G1J A;  2QG9 B;  2DER A;  2R58 A;  3VS6 A;  4M7D G;  2EGC A;  1Q82 R;  2HD0 A;  5KE3 A;  1W70 A;  5GAM e;  5FU6 B;  3L2U A;  1YP5 A;  2KT1 A;  2EJG A;  2RHI A;  4OB3 B;  3CCV Q;  2EQU A;  1NEG A;  3JCM Q;  1K9M U;  3DLM A;  1HXD A;  2O4X A;  2JJ9 A;  2KMT A;  5LL6 S;  3HHT B;  1R0C B;  4PFP A;  2P4R A;  1RAA B;  3E9G A;  3HL8 A;  2DXU A;  3CBP A;  4KUI A;  4EPC A;  1QVG P;  3CBM A;  4JJB A;  3OYN A;  1QQJ A;  2AKK A;  5C0M A;  4ELZ C;  3J7A F;  4GBQ A;  1RAD B;  3EG2 A;  1K8A U;  2MIO A;  2KGT A;  2FVU A;  1M27 C;  2CZ6 B;  3ME9 A;  2FRW A;  2XID A;  3BDL A;  4OB2 B;  5KCO A;  4OB0 B;  2VWF A;  1YIT Q;  3QWX X;  4D8K A;  4PJO G;  4J9F A;  1BI2 A;  2KXD A;  2E3I A;  1M90 R;  2LMJ A;  2DF6 A;  4VUB A;  2JZ2 A;  1BIB A;  2HAX A;  2DA9 A;  2Z0W A;  2DRK A;  3OYC A;  1QW1 A;  2J6K A;  2QA4 T;  2HEQ A;  3URG A;  2RHX A;  3UA7 A;  1TXQ A;  1G3T A;  2ZPH B;  3MPU B;  1NYF A;  3CXC S;  1UEC A;  4OVA A;  1I8F A;  5HK3 A;  3EG3 A;  4C8Q B;  2A3L A;  3OYE A;  1VQ5 Q;  4M77 B;  1OI1 A;  2JS2 A;  1S72 Q;  4RTV A;  2MMP A;  4N0A A;  4FW1 A;  3MJX A;  2FYK A;  2ZPF B;  1D3B A;  1BYM A;  3UPU A;  3SWN A;  3CME A;  2KYB A;  2LDM A;  2EYX A;  2GGR A;  3WVD B;  4XTX A;  4C92 C;  1Q7Y C;  1UGV A;  1BU1 A;  1JBM A;  1YIJ A;  1YJN A;  3JAM E;  2I0N A;  1G3S A;  2LCL A;  5DY9 A;  4M7A G;  4RTW A;  4M7D C;  4JZ3 A;  4RTU A;  3OYM A;  4LE9 A;  3I55 A;  3IQL A;  1G3W A;  2CUB A;  3VS7 A;  1C1A A;  4R55 A;  4LDY A;  2XK0 A;  4BB7 A;  2LCC A;  2RH2 A;  1VOM A;  1VQK A;  2C0I A;  2QEX Q;  3HPW A;  3JCM W;  2LVM A;  4C8Q E;  1H92 A;  2PUK B;  1IRE B;  2GTO A;  1BI1 A;  1SKU B;  4KH0 B;  1K9M R;  3PNW C;  3L2Q A;  2EYQ A;  4E7H A;  3G4S T;  2NUP B;  4BUG A;  1O75 A;  1N27 A;  2YSQ A;  2I2L A;  1U1S A;  5LJ5 d;  3QWY A;  1WHJ A;  5KYU A;  4J9B A;  4M77 G;  1YJW A;  4OMO A;  1SSH A;  2FPE A;  3X20 B;  2CDT A;  2RD1 A;  4KGV B;  5CKH A;  1JU5 C;  4HT8 A;  2F69 A;  2KRN A;  1RAH B;  3PIO A;  5DLO A;  1VQP A;  5FLX E;  4ZGE B;  1YIJ Q;  1PNJ A;  2YRV A;  2O2O A;  1ZA1 B;  2RJF A;  4RCC A;  4RMO A;  1UJ0 A;  5J39 A;  2J6F A;  2YUN A;  2B86 A;  2LQN A;  4LD9 K;  2VV5 A;  4NL3 A;  3OYB A;  4PJO D;  1Q86 R;  5CO7 A;  3C4S A;  3OYF A;  3CCU A;  3PVL A;  1N9S A;  3CPF A;  4M75 B;  5LJ3 g;  3CC2 Q;  3DLL A;  5GMK e;  5L23 A;  1YJW T;  2EGA A;  5FWB A;  2R5A A;  1VQ9 Q;  2ENM A;  2A36 A;  1YJ9 A;  2COZ A;  1AWO A;  2KE9 A;  4X1V A;  4F04 B;  3PVQ A;  3VYH B;  4F17 A;  1QCF A;  3RMS A;  1MMN A;  2RO0 A;  4XK8 E;  2IG0 A;  2DL4 A;  1D1A A;  2CP2 A;  2X4J A;  3RER A;  3L2V A;  3FEO A;  3TCJ A;  3A8H B;  2K5I A;  3CCU T;  2QTX A;  2JS0 A;  2DK3 A;  3TU4 K;  1KQS A;  1OPL A;  2D0Q B;  1WNL A;  3OW2 P;  1RI9 A;  2D8J A;  3JCM b;  4JRP A;  1RL2 A;  4NL2 A;  2AZS A;  5GAN h;  2E1H A;  9ATC B;  1NLO C;  1X6B A;  4Z89 A;  2XDB A;  1H3H A;  1TOV A;  1T0H A;  1B3Q A;  5FWC A;  1Y57 A;  2KDS A;  3EG1 A;  3MP8 A;  4TVR A;  3F70 A;  3EG9 A;  3RNJ A;  4B9X A;  4M7A D;  5I2M A;  1N9R A;  1K0X A;  3MEW A;  3G6E A;  4M7A A;  4M77 C;  3ZL7 C;  4PJL A;  1Y96 A;  2DL3 A;  2DL5 A;  4JJN K;  2PVO B;  1VQ7 A;  1FYN A;  4HVW A;  2VYT A;  2JUF A;  4M78 C;  2HZY A;  4BY6 B;  3ZBD A;  1YJ9 Q;  1TTH B;  3AHU A;  1KJW A;  4M7A B;  2AKL A;  4C8Q D;  2NUZ A;  4AMC A;  3FRN A;  2K79 A;  3CME Q;  1VIF A;  4MML A;  1Z9Z A;  1U5S A;  3EHQ A;  1O9S A;  3HP9 A;  3EG9 B;  1PSF A;  2GBQ A;  2OTL A;  4J6W A;  4O5V A;  2CT4 A;  4MZP A;  2DZ9 A;  2K4Y A;  3RR6 A;  1IRX A;  2V26 A;  2DIG A;  4LDU A;  1VIE A;  4PNO A;  1PD0 A;  3I35 A;  1GBR A;  1HYO A;  5FW9 A;  1WJQ A;  2EYY A;  1M2V A;  3GIB A;  4FIB A;  2CYZ B;  1KG1 A;  2ZPB B;  3S3M A;  3CQT A;  4ZN1 A;  4C5H A;  1VQ8 T;  1FMW A;  1C6V X;  3TVT A;  1VQK Q;  3DB3 A;  1U3O A;  2PU9 B;  4Q5W A;  3I5R A;  3QII A;  4RTT A;  2K3B A;  1MMA A;  1QMC A;  1VQ7 T;  4DQ2 A;  1K9A A;  2COY A;  5IHI A;  1YHQ Q;  4AFQ C;  2DVJ A;  2EBP A;  1ZX6 A;  3OSV A;  2JM9 A;  3KXT A;  4PJO B;  3V7S A;  1H3Z A;  4J7F A;  1VQM T;  1QVF A;  2XU8 A;  1ZLM A;  2CKK A;  1CKA A;  4DBF A;  4OMP A;  4D6W A;  3I55 Q;  1RAI B;  2DXC A;  2JM8 A;  2MK5 A;  3EGU A;  2V1R A;  5IT9 E;  3CMA Q;  3RKX A;  5GAO p;  2H3J A;  2C0T A;  1SHG A;  2LTO A;  1YN8 A;  3RES A;  1Q95 G;  4FYV B;  1JJ2 P;  1RUW A;  7AT1 B;  1GBQ A;  3OW2 A;  2LNH B;  1BBZ A;  3CCQ T;  5CQX A;  1NG2 A;  2YUQ A;  5D6X A;  3VS5 A;  2DIL A;  1EZZ B;  2FZC B;  3NTK A;  1KC8 U;  1VQM A;  3QBY A;  1KQ2 A;  4ELY C;  1QVF P;  3X28 B;  3X25 B;  2RN8 A;  3EFS A;  1K8A C;  1OZ3 A;  1UGP B;  5LJ5 e;  5EG2 A;  1X27 A;  2DJQ A;  1AOJ A;  1NBE B;  3EHR A;  4IUV A;  1KD1 U;  4LNP A;  1W1F A;  2E3H A;  4KGZ B;  1JQQ A;  1M30 A;  5GAN g;  4MDW A;  1VQN Q;  3MP6 A;  2M51 A;  2HQE A;  1KFZ A;  2OAU A;  4C0G A;  4A4K A;  3Q1J A;  3CCE A;  2K7A A;  3S3O A;  1VQL A;  1AWJ A;  2DL7 A;  1X43 A;  1Q86 U;  1PKT A;  1YI2 Q;  1G8X A;  2KSS A;  2RQW A;  3PT9 A;  3I5S A;  4EMG A;  2WSF E;  3P8D A;  2KYM A;  4BAC A;  2Y4Y A;  3OBY A;  5GAO r;  1UJY A;  2EVR A;  3OYJ A;  5KYW A;  1CSK A;  2L3R A;  3CPW A;  2HL3 A;  4M78 A;  3JCM X;  4FT4 A;  1V29 B;  1Q82 C;  2O31 A;  1OX8 A;  3MO8 A;  4M77 D;  2LJ1 A;  2LQW A;  3FLG A;  4XAX B;  5GAN j;  4OP0 A;  2PTK A;  3LLR A;  3JB9 F;  1D0Y A;  1QP3 A;  2RQU A;  3OS0 A;  4M77 A;  3R6O A;  1VYT A;  3GF5 A;  2QDL A;  5GAN e;  3UAT A;  4KUD K;  4DA4 A;  1NPR A;  1GCP A;  1VQO Q;  1FWZ A;  4X9D A;  2NYS A;  1Y96 B;  3PE0 A;  3QJ6 A;  2GFA A;  4M7D E;  1JXO A;  2KNB B;  3VUZ A;  2JN0 A;  4BDZ A;  2DM1 A;  1DJ7 B;  1UDL A;  2LT1 A;  3RIR A;  4AG2 C;  3AT1 B;  5GAN 6;  1H64 1;  2YRD A;  2R5M A;  2JMA A;  4OGE A;  3TQ7 P;  1WQW A;  1UE9 A;  2XDP A;  1W6X A;  4EMK C;  3CCM T;  1B07 A;  2QA4 Q;  2QGF B;  1MUZ A;  1ABQ A;  3JCM c;  1W4S A;  4XQ3 A;  5FRN A;  3A5Z B;  4Z88 A;  2BKD N;  2JVV A;  3RKY A;  5HCK A;  2KQW A;  3ZFJ A;  1XOV A;  4AG1 C;  2VGM A;  2X9H A;  3OYA A;  4E7J A;  5GAN 7;  2XD0 A;  5A0L A;  3O8V A;  4A54 A;  2VAS A;  5GMK h;  2CP5 A;  2LJ0 A;  5KYY A;  1N8R C;  1WHL A;  4F7U F;  4LXC A;  2GQI A;  2JTE A;  1S72 T;  3OYK A;  4C92 E;  1I0C A;  2J06 A;  2NLU A;  3M9Q A;  4XTV A;  2D8H A;  4HKE A;  1WXT A;  4LUE A;  2RHY A;  5LJ3 j;  1T3L A;  3CD6 Q;  1VUB A;  2QA4 A;  1LOJ A;  2OAW A;  5CQY A;  2WSC E;  4IUR A;  2ECZ A;  2EAY A;  3GNG A;  3RUX A;  5M9O A;  3C95 A;  4MZM A;  4PJM A;  2CT3 A;  4N4H A;  4L59 A;  3X24 B;  4PJN A;  1JO8 A;  4FSX A;  4M4Z A;  1FMK A;  1JEG A;  1YHQ A;  3FIF A;  2KXC A;  1AZG B;  2CS7 A;  2XIC A;  2NWM A;  3TSW A;  2QQ9 A;  1ZUY A;  2FRY A;  2MOX A;  4XTW A;  2QEX A;  1G3Y A;  4JS5 A;  1WXU A;  2RQV A;  4C8Q G;  1S1N A;  1IHW A;  4FM4 B;  4KRT A;  3GP8 A;  3LYI A;  3I9Q A;  3OB9 A;  2LX7 A;  2KR3 A;  2X35 A;  3MKD A;  4EMK B;  2DTH A;  2G6F X;  3NPF A;  1LJO A;  2A0F B;  4CC3 A;  4J6X A;  1CKB A;  2AT1 B;  4MDX A;  1YBY A;  4KGX B;  2CSI A;  2ROL A;  1M3C A;  3CEY A;  2D1X A;  5C6S A;  2F5T X;  1KD1 C;  2FHD A;  1KK7 A;  3OS5 A;  1M5Q 1;  1NJI U;  1GL5 A;  1MGQ A;  3JCM f;  1Q81 R;  3INZ A;  2F2V A;  2K3X A;  1IZ6 A;  2JTM A;  5CCA A;  2M0O A;  3M58 A;  2EQK A;  4FYW B;  2R57 A;  1I4K 1;  1WHG A;  3VUB A;  4E7Z A;  1HD3 A;  2EJ9 A;  4AT1 B;  2E6N A;  1W2B A;  4C0Z A;  2E64 A;  3S3N A;  1VQP T;  3CC7 Q;  3H9N A;  4WF2 A;  2EKO A;  1TSF A;  3OW2 S;  3PTA A;  1Y71 A;  3TRE A;  1AHJ B;  4JJD A;  3X26 B;  3OA6 A;  4M78 D;  4E2F B;  5DM7 R;  4B9W A;  2KAF A;  4O6J A;  1Z9Q A;  3LH5 A;  1X69 A;  4NS5 A;  4BD3 A;  1LPL A;  1QP2 A;  1A0N B;  1C0M A;  1RLQ C;  3EGD B;  2CSQ A;  5KYU B;  4C5G A;  1NM7 A;  2KEA A;  1U06 A;  2LJ3 A;  1N5Z A;  5GAO q;  5GAM d;  3MEA A;  1K73 C;  1WGS A;  3QDF A;  2COW A;  1OPK A;  2E12 A;  3L1A A;  3MCA B;  1WHH A;  3NMZ C;  3G4S Q;  2E5K A;  3G71 A;  4A53 A;  4HCC A;  4XU2 A;  3MET A;  3CCL Q;  1YJN T;  4OF1 A;  1PCX A;  2XI9 A;  4ME7 A;  2K5F A;  3CPW S;  4CC4 B;  1LNX A;  3JRZ A;  2V8K A;  1EFN A;  2ROT A;  5GMK m;  2RMO A;  2FZK B;  2LQK A;  4CC2 A;  1SHF A;  1XQH A;  4A4G A;  1W2B S;  1R77 A;  2JW4 A;  1ZUK A;  3S6W A;  1D3B B;  3CPW P;  4C8Q A;  1ABO A;  4NOY A;  4ANJ A;  2X3W D;  2E70 A;  4FW2 A;  3BDU A;  2CH4 W;  3V8K A;  3M0Q A;  2EQM A;  5GAM h;  2LC4 A;  1X6O A;  4C0F A;  4JLG A;  2M02 A;  1RAB B;  2L89 A;  5GAM g;  1SPK A;  3SFM A;  2HBW A;  2RB6 A;  2L0A A;  3CCJ A;  2QAZ A;  4Z8A A;  4N4I A;  2PNI A;  1ZUU A;  2HSP A;  1ZSZ C;  2SEM A;  2HL5 C;  2CUD A;  2CZ0 B;  2DL8 A;  2W0Z A;  1VQN A;  4ZTJ A;  1I5O B;  1E7O A;  5D6Y A;  2OTJ A;  1YIT A;  3OS2 A;  1HJD A;  2J7I A;  2W10 A;  2A28 A;  2NUT A;  1VQ5 T;  2YUP A;  1YHQ T;  1YWO A;  4KUL A;  8AT1 B;  2HSE B;  2YUO A;  1VQP Q;  3GNF B;  2YXY A;  3OSS C;  4J9C A;  4V2S A;  4FYY B;  2EYZ A;  2G3R A;  3M57 A;  3CC4 T;  1M2O A;  2ZGW A;  3SWN B;  4IUQ A;  1M90 U;  3CCR Q;  2DEU A;  3I56 A;  2MWP A;  1BKB A;  2LCS A;  1RAE B;  5KCH A;  5GAN 4;  2DVE A;  2LNV A;  5L8R E;  4LD6 A;  2L3Q A;  3OY9 A;  1NLP C;  2DKG A;  1WHK A;  2FPD A;  3EAE A;  4ATO A;  3MEU A;  3OYH A;  1N6A A;  2EGE A;  1S72 A;  1UGQ B;  3M4G A;  2QAS A;  2EYW A;  3C94 A;  2ESW A;  1OV3 A;  2RPN A;  1Q82 U;  2K5L A;  1OX9 A;  1M8M A;  5IXF A;  3EFO B;  2DMO A;  2QXF A;  3ULR B;  5GAN d;  1K73 U;  3E19 A;  3KFV A;  2HKN A;  1K9M C;  1WI7 A;  1RAC B;  1AVZ C;  4IUT A;  2KBT A;  1WHM A;  2JXB A;  3UF4 A;  5GAN f;  5GJV B;  3EGX A;  2K2V A;  3EFO A;  3PFS A;  1VQM Q;  2EKH A;  4C8Q C;  3CCS Q;  3G71 Q;  4FYX B;  2RI2 A;  5GAN 2;  2HBP A;  4XTU A;  3LW5 E;  4Z02 A;  1G2B A;  3MP1 A;  3C12 A;  4L6V 5;  3TEE A;  3CCV A;  2DXB A;  1B34 A;  2QQS A;  1Q7Y R;  2QYZ A;  2FL7 A;  3M0P A;  4OMQ A;  1Y0M A;  2DZC A;  2ZPG B;  4A4E A;  4PJJ A;  1OU9 A;  1M1F A;  3CC4 A;  1I81 A;  4E47 A;  1BI0 A;  3M0S A;  1WX6 A;  3UA6 A;  4J5Y A;  2DYI A;  5KYY B;  4J9H A;  3V8J A;  4HXJ A;  4HCZ A;  4E7I A;  5CKE A;  4M75 E;  4WTO B;  2CP6 A;  3JCM J;  4RG2 A;  5GAN 5;  3ZEH A;  4M7A E;  3QHS A;  1M3A A;  4OMF B;  4QVD A;  3SEM A;  1MV3 A;  4B6M A;  1TWB A;  1UUE A;  3MHX A;  1PKS A;  1XTD A;  2HQX A;  2LT4 A;  2EFI A;  2O01 E;  5I11 A;  1AWX A;  3O5Z A;  1Q81 C;  5I21 A;  4JS4 A;  3QKJ A;  1IXD A;  3JSC A;  6AT1 B;  1VQL Q;  3CC2 A;  3CCE Q;  2KVQ G;  3CBO A;  4JRI A;  5J3B A;  1X01 A;  4PLI A;  2DAQ A;  1JJ2 A;  1ZSZ A;  2EWN A;  3CCS A;  1YJ9 T;  2YRC A;  3H8Z A;  4C5I A;  1VQ4 A;  5J26 A;  4BE2 A;  1NJI R;  1Y07 A;  2OTJ Q;  1RI0 A;  2P84 A;  1E6G A;  5AT1 B;  1VQ9 A;  4JUV A;  4M78 G;  4HVU A;  3VS2 A;  5LJ5 g;  2GFU A;  1P92 A;  5ECA A;  1SG5 A;  4YTL A;  2C06 A;  2E5Q A;  5GMK l;  2VXE A;  3H0F A;  4EIK A;  2YT6 A;  5LJ3 f;  1K0S A;  1EIF A;  3J80 E;  2HQH A;  4F7U A;  4N4G A;  1T0J A;  2SRC A;  3ASK A;  2RHU A;  3DB4 A;  3EH2 A;  4DOV A;  2D0N A;  5KYW B;  2JMC A;  4CRI A;  2RM4 A;  3CMA A;  1X6G A;  1JJ2 S;  2K57 A;  2E65 A;  2PVG B;  4RTX A;  2VUB A;  1B7T A;  1WA7 A;  4P5N A;  2Y90 A;  4JLI A;  3SD4 A;  5GAO n;  1YJW Q;  1OUL A;  3BW1 A;  3JCM e;  2GCX A;  2F1L A;  1K4U S;  3RKW A;  2CH4 A;  2RK2 A;  3A1P A;  1VYU A;  5HK0 A;  4QKU A;  3G71 T;  3QYG B;  4PLL A;  4C92 G;  1AEY A;  1XJW B;  4HT9 A;  1YI2 T;  1VYV A;  1MMG A;  3A8M B;  2CP0 A;  3UDC A;  1VQO T;  3I55 T;  1D0X A;  2DX1 A;  2J05 A;  4JZ4 A;  4DBR A;  3REA B;  4J9E A;  3LWH A;  1I5L A;  4C92 F;  2FB7 A;  4RTY A;  5CKD A;  1W2B P;  4XU3 A;  2KY9 A;  4C92 D;  1NEB A;  2M9U A;  2MI6 A;  4RTZ A;  1HSQ A;  4JDS A;  5FU7 C;  1KHI A;  4OMN A;  1M9S A;  1F1B B;  1X2Q A;  5CKF A;  3N5B B;  1TH7 A;  3LX7 A;  2HMA A;  4Y92 A;  2OTJ T;  2A08 A;  3SWN C;  1LCK A;  2E6Z A;  3VS0 A;  3WVE B;  1U1T A;  1VQN T;  2MAM A;  4C0D C;  4PJO A;  4IUU A;  2RF0 A;  3SB2 A;  1GCQ A;  2ZPE B;  4FSS A;  4J83 A;  5KE2 A;  1UFF A;  4C92 B;  4J9G A;  2DLP A;  5KYN A;  3JB9 J;  4M7D A;  2AHJ B;  4AFS C;  3CCQ Q;  1Q81 U;  4UC4 A;  2L3S A;  4M77 F;  3PIP A;  1VQ4 T;  3G7Z A;  1YNZ A;  2QGG A;  4EMK A;  5LJ3 e;  2X4Y A;  3VRY A;  1KSW A;  2BIV A;  1M90 C;  2RJC A;  1VQ6 A;  4QQD A;  1IGU A;  2EW3 A;  3JV3 A;  2EPD A;  4PL6 A;  4LDX A;  4E6R A;  1BCO A;  4QVC A;  3LGF A;  1M4Z A;  3THK A;  3UT1 A;  4XU1 A;  1AZE A;  1TUD A;  3BY7 A;  3HRS A;  3HRU A;  1M1K C;  1JB0 E;  2F2W A;  3JCM V;  3OYL A;  2HCK A;  3NTH A;  2EQJ A;  4HCB A;  5CKB A;  4QW2 A;  2VC8 A;  4M75 G;  1PD1 A;  2HDA A;  2QI2 A;  2YWW A;  2DNU A;  3L2R A;  1G5V A;  1X75 C;  3CD6 A;  2CP7 A;  3L2W A;  1VQ9 T;  2XDD A;  2JOY A;  4J8O A;  2DRM A;  4II1 A;  3H6Z A;  1BI3 A;  3EH1 A;  2RJE A;  5I2S A;  2DEQ A;  3CC2 T;  5CR2 A;  2FPF A;  2QDY B;  3V7C A;  1QVF S;  1K1Z A;  1ZBJ A;  2WSE E;  3RBB B;  3V8L A;  1BB9 A;  3E1S A;  2AK5 A;  2F2X A;  4GLK A;  1UEB A;  3M55 A;  3UWN A;  1PC0 A;  1MND A;  2YDL A;  3ER0 A;  2CZ1 B;  2BZ8 A;  4PK4 A;  5HKC A;  4M78 E;  1AT1 B;  1UB4 A;  4JJC A;  2WAC A;  1UTI A;  2M16 A;  3CCM Q;  2CGH A;  3CCU Q;  2PQW A;  2DD4 A;  3GOX A;  3HKS A;  4RKU E;  2DJZ A;  1V1C A;  2BTT A;  1QVG S;  3VRZ A;  4M7D B;  5FRM A;  1PG5 B;  1VQO A;  3V7R A;  4E7K A;  3QJY A;  2P0K A;  4IIM A;  2P0Q A;  1KC8 R;  1K76 A;  2ZAE A;  4FT2 A;  1Q86 C;  1BCM A;  3C0C A;  2CP3 A;  4F16 A;  5LJ5 f;  5LJ5 h;  5CVI A;  2XHC A;  1N8R R;  2MCN A;  3QXE B;  3JCM g;  3NTI A;  2M0Y A;  4R0K A;  1FMV A;  1BK2 A;  2H3E B;  2RHZ A;  1I07 A;  2LZ6 B;  1VQ5 A;  3M0T A;  4C8Q F;  1YFN A;  3FDR A;  3QO3 A;  1TUG B;  4PFZ A;  1YIT T;  1R0B G;  1YJN Q;  2BZY A;  1FXX A;  2J6O A;  4J7I A;  2GNC A;  1K73 R;  3JB9 H;  3CCR A;  4GY5 A;  3U23 A;  5FU6 C;  1WYX A;  2P0P A;  5IXB A;  3OYY A;  3NHN A;  1PWT A;  3GLX A;  3NGP A;  3CCM A;  4IUP A;  4M75 D;  2E10 A;  4XTY A;  4C0D B;  1WDX A;  2LP5 A;  2DTO A;  2ED1 A;  4OMM A;  1NJI C;  1D1C A;  4EMH A;  5GAN 8;  2BZX A;  2FO0 A;  2ZZD A;  2PUO B;  1ZSG A;  1IHV A;  3RDV A;  4M77 E;  3HFO A;  1VQ7 Q;  1D0Z A;  1ZQ1 A;  3H0I A;  3QYH B;  1KIK A;  3EGD A;  4E7L A;  2QEX T;  1WQ7 A;  1YWP A;  4J9I A;  3R6N A;  2QQR A;  5A0D A;  3QZ5 B;  2LX9 A;  4PKC C;  2DD5 A;  1LVK A;  1PHT A;  5FU7 B;  2E4H A;  5KYX B;  2RI5 A;  2KT8 A;  4DBQ A;  3OS1 A;  2L2P A;  2X3X D;  5KYX A;  4M78 B;  1VQ6 T;  1KD1 R;  3OBW A;  3HSB A;  2XKO C;  1M1K R;  4Y91 A;  4LUD A;  4MMK A;  1OU8 A;  2V8J A;  2GF7 A;  4D8D A;  4GLM A;  3CC4 Q;  2K6D A;  5GAM f;  1M8V A;  5HY6 A;  2RA2 A;  4M75 F;  1TS9 A; 
#chains in the Genus database with same CATH homology
 2XID A;  3BDL A;  4L5G A;  4OB2 B;  4OB0 B;  4C5E A;  5KCO A;  4M7D E;  3VUZ A;  2MWO A;  4PJO G;  2JN0 A;  4BDZ A;  1Q81 C;  1N8R U;  5I21 A;  4JS4 A;  1BI2 A;  3QKJ A;  1DJ7 B;  3RIR A;  2LT1 A;  4VUB A;  2JZ2 A;  3JSC A;  1BIB A;  5GAN 6;  3CC2 A;  2HAX A;  1H64 1;  2KVQ G;  4R56 A;  3CBO A;  2R5M A;  4JRI A;  2X4X A;  5J3B A;  1X01 A;  4PLI A;  3CCV T;  3OYC A;  4OGE A;  3JB9 I;  2DAQ A;  1QW1 A;  1JJ2 A;  2EWN A;  1WQW A;  2QA4 T;  2XDP A;  3CCS A;  3SDZ A;  1YJ9 T;  4EMK C;  3URG A;  2RHX A;  1YIJ T;  1HK9 A;  3CCM T;  3H8Z A;  4C5I A;  2RJD A;  1VQ4 A;  1JRI A;  5J26 A;  3JCM c;  1W4S A;  1G3T A;  1R8O B;  2ZPH B;  4XQ3 A;  3CXC S;  3A5Z B;  4BE2 A;  1Y07 A;  5FRN A;  2BKD N;  1RI0 A;  5CIU A;  2D6F A;  2JVV A;  1I8F A;  4OVA A;  3RKY A;  2KQW A;  3ZFJ A;  1XOV A;  1VQ9 A;  2D9T A;  2VGM A;  4JUV A;  4M78 G;  3OYA A;  4E7J A;  3VYG A;  5HK3 A;  1U8R A;  3LWI A;  4C8Q B;  5GAN 7;  2A3L A;  5LJ5 g;  2GFU A;  3OYE A;  1P92 A;  2QQA A;  2XD0 A;  4M77 B;  3VV0 A;  5A0L A;  1OI1 A;  3O8V A;  4YTL A;  2E5Q A;  4M78 F;  4A54 A;  5GMK l;  2C06 A;  5GMK h;  2VXE A;  3NFC A;  1N8R C;  2MMP A;  4N0A A;  4BI3 A;  5GAM j;  4F7U F;  5LJ3 f;  2FYK A;  1EIF A;  2ZPF B;  1D3B A;  4C92 E;  3J80 E;  3OYK A;  1S72 T;  1BYM A;  3UPU A;  4M75 C;  3SWN A;  2NLU A;  4F7U A;  3CME A;  4N4G A;  3G4S A;  3ASK A;  2LDM A;  2RHU A;  4BY6 C;  3DB4 A;  4FU6 A;  3M9Q A;  4XTV A;  3WVD B;  4DOV A;  3CC7 T;  1B34 B;  4HKE A;  4XTX A;  4C92 C;  1Q7Y C;  2XG8 D;  2RHY A;  1JBM A;  5LJ3 j;  1VUB A;  1YIJ A;  2QQB A;  1YJN A;  3QDR B;  1VQK T;  1KQ1 A;  2QA4 A;  1LOJ A;  4CRI A;  3JAM E;  1G3S A;  2LCL A;  2RM4 A;  3HRT A;  3CMA A;  3G6E T;  5CQY A;  2WSC E;  5DY9 A;  1JJ2 S;  2K57 A;  2E65 A;  3M53 A;  4IUR A;  3OYD A;  4M7A G;  2PVG B;  4M7D C;  2VUB A;  3OYM A;  4P5N A;  3I55 A;  2EAY A;  3GNG A;  3CCL A;  3RUX A;  2Y90 A;  5GAN 3;  4JLI A;  5M9O A;  1G3W A;  3SD4 A;  3C95 A;  4MZM A;  5GAO n;  5AYF A;  3BW1 A;  4N4H A;  3JCM e;  4R55 A;  4LDY A;  4L59 A;  2GCX A;  3X24 B;  2XK0 A;  4X9C A;  4BB7 A;  4FSX A;  2LCC A;  2RH2 A;  2RI3 A;  2IVW A;  2RK2 A;  3RKW A;  1VQK A;  3HPW A;  5HK0 A;  1YHQ A;  3JCM W;  3FIF A;  3CCS T;  2LVM A;  4C8Q E;  3G71 T;  3QYG B;  4PLL A;  4C92 G;  4HT9 A;  2CS7 A;  2PUK B;  1IRE B;  1YI2 T;  4Y28 E;  1BI1 A;  2XIC A;  4A4F A;  4M7A F;  3PNW C;  3L2Q A;  1ZHI A;  3CCR T;  2EYQ A;  4E7H A;  2QQ9 A;  3G4S T;  3KUF A;  3A8M B;  2JTF A;  3CME T;  3UDC A;  4XTW A;  1VQO T;  4BUG A;  2QEX A;  1G3Y A;  1O75 A;  3I55 T;  1N27 A;  2I2L A;  4JS5 A;  4BI4 A;  1U1S A;  5LJ5 d;  4C8Q G;  4KBM B;  4M77 G;  2DIQ A;  2ZCF B;  4FM4 B;  2F5K A;  3LYI A;  3GP8 A;  3JB9 D;  1YJW A;  3OB9 A;  3X20 B;  3LWH A;  2RD1 A;  2X35 A;  4EMK B;  1I5L A;  2DTH A;  3MEV A;  5CKH A;  4C92 F;  2FB7 A;  4JRK A;  5CKD A;  3JCM P;  1LJO A;  4HT8 A;  3CCL T;  4J6Y A;  4J6X A;  2F69 A;  2KY9 A;  4XU3 A;  4C92 D;  2M9U A;  2Y4X A;  2MI6 A;  3PIO A;  4QQ6 A;  5DLO A;  1VQP A;  5FLX E;  4ZGE B;  4JDS A;  3QSU A;  5FU7 C;  1KHI A;  3DKM A;  4MDX A;  1M9S A;  1YBY A;  2YRV A;  5D6W A;  2RJF A;  5CKF A;  3E9F A;  2O4X B;  3CEY A;  4RCC A;  4RMO A;  3VU3 C;  3N5B B;  5C6S A;  1TH7 A;  5J39 A;  2F5T X;  5FRO A;  3L42 A;  3CC7 A;  2FHD A;  3LX7 A;  1KD1 C;  3JB9 G;  3FC3 A;  3OS5 A;  4LD9 K;  2L8D A;  2VV5 A;  1M5Q 1;  1Q7Y U;  4NL3 A;  3OYB A;  4ZTF A;  1KC8 C;  1NJI U;  4PJO D;  2OTJ T;  3JCM h;  1MGQ A;  1OYX A;  4M75 A;  3C4S A;  5CO7 A;  2E6Z A;  3SWN C;  3JCM f;  3OYF A;  3CCU A;  1N9S A;  3CPF A;  3FB9 A;  3WVE B;  3INZ A;  2K3X A;  4M75 B;  5LJ3 g;  1IZ6 A;  2JTM A;  5CCA A;  1U1T A;  2M0O A;  1VQN T;  3LH0 A;  2EQK A;  3M58 A;  5A0G A;  3DLL A;  2R57 A;  3M56 A;  2MAM A;  1I4K 1;  3VUB A;  4EDU A;  4C0D C;  4PJO A;  5GMK e;  5CK9 A;  2EJ9 A;  4IUU A;  4ZGJ B;  1YJW T;  1UGR B;  3HFN A;  3SB2 A;  2E6N A;  2ZPE B;  2R5A A;  1W2B A;  4J83 A;  5KE2 A;  1YJ9 A;  1GXI E;  3P8B B;  4C92 B;  4C0Z A;  2L5Q A;  2E64 A;  4PJO F;  3S3N A;  1UGS B;  3JB9 J;  4M7D A;  1VQP T;  4WF2 A;  1XNI A;  2AHJ B;  3VKI A;  3VYH B;  1Q81 U;  2EKO A;  3OW2 S;  4LDV A;  4UC4 A;  3PTA A;  4M77 F;  1Y71 A;  3PIP A;  1VQ4 T;  3TRE A;  1AHJ B;  3RMS A;  3X26 B;  2RO0 A;  4XK8 E;  4M78 D;  3OA6 A;  2IG0 A;  3G7Z A;  5IN1 A;  5DM7 R;  2X4J A;  1KQS S;  3M4Y A;  4EMK A;  5LJ3 e;  2X4Y A;  3RER A;  4B9W A;  3L2V A;  2KAF A;  3FEO A;  2YLC A;  1KHC A;  3TCJ A;  5A2Q E;  3A8H B;  2K5I A;  4O6J A;  2BIV A;  1M90 C;  2RJC A;  1VQ6 A;  2VGN A;  4QQD A;  4KT0 E;  2DXT A;  3GPL A;  3CCU T;  2OTL T;  2QTX A;  3M5A A;  2DK3 A;  2LQ8 A;  4PL6 A;  3TU4 K;  1KQS A;  2D0Q B;  2LRQ A;  1WNL A;  4NS5 A;  4BD3 A;  3OQ5 A;  1QP2 A;  3A8G B;  4LDX A;  3JCM b;  4JRP A;  1RL2 A;  2HNI A;  4NL2 A;  2VXF A;  5GAN h;  2E1H A;  4C5G A;  4QVC A;  3LGF A;  1M4Z A;  2XDB A;  5GAO q;  5GAM d;  1SSF A;  3UT1 A;  3MEA A;  4XU1 A;  1K73 C;  1WGS A;  3BY7 A;  3HRS A;  2V8I A;  4BI8 B;  2KDS A;  3HRU A;  3MP8 A;  1JB0 E;  3F70 A;  4TVR A;  5IAY A;  1M1K C;  4B9X A;  2E12 A;  4M7A D;  5I2M A;  3L1A A;  3JCM V;  1YI2 A;  1N9R A;  3OYL A;  3NTH A;  3MCA B;  3MEW A;  2EQJ A;  4HCB A;  5CKB A;  3G71 A;  4A53 A;  5GAO m;  4QW2 A;  4PJO C;  2VC8 A;  4M75 G;  3G6E A;  5GAO l;  2KK4 A;  4HCC A;  1Y7X A;  4M7A A;  5LJ3 h;  4RG8 A;  2QI2 A;  4M77 C;  3FJP A;  4XU2 A;  3MET A;  4FL6 A;  1Y96 A;  3PGG A;  1YJN T;  4OF1 A;  3P8H A;  2XI9 A;  4ME7 A;  4JJN K;  2PVO B;  3L2R A;  2K5F A;  1VQ7 A;  1G5V A;  2VYT A;  2JUF A;  3CPW S;  4IKF A;  1X75 C;  2RK1 A;  1ZBX A;  4M78 C;  3CD6 A;  3L2W A;  1VQ8 A;  1VQ9 T;  4LDW A;  4OB1 B;  2XDD A;  1QVP A;  3QPH A;  4BY6 B;  3A8O B;  3ZBD A;  1LNX A;  2PVD B;  3JRZ A;  2JOY A;  3AHU A;  2V8K A;  1VQL T;  3CCE T;  4J8O A;  1M1K U;  4MZT A;  5GMK m;  4II1 A;  4M7A B;  3H6Z A;  1MHN A;  1BI3 A;  4C8Q D;  2RJE A;  2LQK A;  3FRN A;  1XQH A;  1VIF A;  5I2S A;  3KBG A;  4A4G A;  1W2B S;  4MML A;  4HA8 A;  3S6W A;  2DEQ A;  1O9S A;  1D3B B;  3HP9 A;  3CC2 T;  1PSF A;  4C8Q A;  2GQV A;  4NOY A;  5CR2 A;  1FX7 A;  2OTL A;  4J6W A;  2QDY B;  5CAI A;  4O5V A;  4MZP A;  3V7C A;  2DZ9 A;  1QVF S;  2E70 A;  2K4Y A;  2BUD A;  3BDU A;  3V8K A;  1PSE A;  3M59 A;  2DIG A;  2DO3 A;  2EQM A;  4LDU A;  5GAM h;  2WSE E;  2LC4 A;  1VIE A;  3T9N A;  3V8L A;  4PNO A;  3VJP A;  3E1S A;  1X6O A;  1BIA A;  4C0F A;  5GMK j;  1WJQ A;  4GLK A;  1UEB A;  3M55 A;  4JLG A;  3UWN A;  2L89 A;  5GAM g;  3OYG A;  3I56 T;  3CCJ T;  3GIB A;  3PMI A;  4FIB A;  3WXM B;  3ER0 A;  2CYZ B;  2CZ1 B;  1KG1 A;  2B8A A;  3SFM A;  2ZPB B;  3S3M A;  1QVG A;  4ZN1 A;  2RB6 A;  4C5H A;  1VQ8 T;  2M1H A;  5HKC A;  3OMC A;  5LJ3 d;  3CCJ A;  4M78 E;  1UB4 A;  4N4I A;  3DB3 A;  4M7A C;  2YHT A;  2WAC A;  4BE1 A;  1NE8 A;  2M16 A;  3EFR A;  2PU9 B;  4ZN3 A;  2CZ0 B;  2CGH A;  4Q5W A;  2P4T A;  3OMG A;  1VQN A;  2PQW A;  1YCY A;  2DD4 A;  3QII A;  4ZTJ A;  3GOX A;  3HKS A;  2DJZ A;  3BFM A;  4RKU E;  1QVG S;  3A8L B;  4QQG A;  5D6Y A;  4M7D B;  5FRM A;  4JRQ A;  1YIT A;  2OTJ A;  1VQO A;  1VQ7 T;  3M54 A;  3V7R A;  4E7K A;  3QJY A;  4DQ2 A;  2P0K A;  3OS2 A;  2P0Q A;  4A4H A;  1WJS A;  1VQ5 T;  3OSV A;  2EIF A;  4XU0 A;  4FT2 A;  3KXT A;  1YHQ T;  1Q86 C;  3V7S A;  4PJO B;  4KUL A;  4J7F A;  1VQM T;  1H3Z A;  1QVF A;  2XU8 A;  3GNF B;  2CKK A;  3OSS C;  4V2S A;  5LJ5 f;  2G3R A;  5LJ5 h;  5CVI A;  4D6W A;  2XHC A;  3M57 A;  2A7Y A;  3CC4 T;  2DXC A;  2ZGW A;  4F7U B;  3SWN B;  3QXE B;  2DPP B;  4IUQ A;  4DOW A;  4CI0 C;  3JCM g;  1M90 U;  3NTI A;  2DTI A;  5IT9 E;  3RKX A;  2MWP A;  3I56 A;  3QUI A;  5GAO p;  1BKB A;  2H3J A;  5LJ5 j;  2RHZ A;  5KCH A;  4M7D F;  2LTO A;  5GAN 4;  2DVE A;  3RES A;  1VQ5 A;  4OGC A;  4C92 A;  2LNV A;  5L8R E;  4C8Q F;  4LD6 A;  3QZ9 B;  1WPY A;  3OY9 A;  2MF2 A;  3FDR A;  2DKG A;  3QO3 A;  1NPP A;  2K3Y A;  5KH6 A;  1YIT T;  1NZ9 A;  4XTZ A;  3EAE A;  3OW2 A;  3CCQ T;  1FXX A;  4ATO A;  5CQX A;  3MEU A;  4J7I A;  5D6X A;  3JB9 H;  3OYH A;  1N6A A;  3CCR A;  3QG1 A;  4GY5 A;  4ZGD B;  5FU6 C;  3NTK A;  2P0P A;  4F7U G;  3OYY A;  1S72 A;  1UGQ B;  2CZ7 B;  1KC8 U;  1VQM A;  3QBY A;  2ZPI B;  4ELY C;  1KQ2 A;  3M4G A;  3GLX A;  3CCM A;  3X28 B;  4IUP A;  3X25 B;  4M75 D;  3JCM d;  3EFS A;  2YLB A;  2E10 A;  1K8A C;  2EJF A;  3C94 A;  4N0A C;  1OZ3 A;  1Q82 U;  1UGP B;  2K5L A;  4XTY A;  5EG2 A;  4C0D B;  5LJ5 e;  2DTO A;  1NJI C;  4EMH A;  4PJO E;  5GAN 8;  2QXF A;  2E41 A;  5GMK i;  3CCQ A;  5GAN d;  4BDY A;  1K73 U;  2ZZD A;  4IUV A;  3E19 A;  1KD1 U;  2PUO B;  4M77 E;  1K9M C;  2JNG A;  3HFO A;  2X4W A;  3CMA T;  4RCB A;  3OYI A;  4IUT A;  4F7U E;  4M7D D;  5GAN g;  1ZQ1 A;  4MDW A;  3MP6 A;  5GAN f;  3J81 E;  2HQE A;  3QYH B;  3CXC A;  2OAU A;  1M1G A;  4C0G A;  4E7L A;  4X34 A;  4A4K A;  1OZ2 A;  3Q1J A;  2K2V A;  3PFS A;  2QEX T;  3CCE A;  3S3O A;  4BE0 A;  1VQL A;  1WQ7 A;  4C8Q C;  2RI2 A;  5DLQ E;  3LGL A;  1Q86 U;  5GAN 2;  2QQR A;  1WJR A;  5A0D A;  3CD6 T;  2HBP A;  4QVZ A;  2KSS A;  3PT9 A;  3QZ5 B;  4EMG A;  3PMT A;  2WSF E;  3L2Z A;  3P8D A;  3RMQ A;  2Y4Y A;  4XTU A;  3LW5 E;  3OBY A;  4Z02 A;  2LX9 A;  4BAC A;  5GAO r;  4PKC C;  3OYJ A;  3MP1 A;  3C12 A;  4L6V 5;  3TEE A;  2R58 A;  2L3R A;  3CCV A;  3CPW A;  2DXB A;  1B34 A;  2DD5 A;  4M7D G;  2QQS A;  4M78 A;  2HD0 A;  5FU7 B;  5KE3 A;  2FL7 A;  2RI5 A;  5FU6 B;  5GAM e;  2DZC A;  4A4E A;  2ZPG B;  4FT4 A;  3JCM X;  3OS1 A;  1V29 B;  2EJG A;  2RHI A;  3L2U A;  4OB3 B;  1Q82 C;  2EQU A;  3JCM Q;  1K9M U;  1M1F A;  3DLM A;  1HXD A;  3MO8 A;  2O4X A;  1I81 A;  4M77 D;  4M78 B;  4E47 A;  3CC4 A;  1VQ6 T;  3OBW A;  1BI0 A;  2KMT A;  3HSB A;  4XAX B;  3FLG A;  2XKO C;  5LL6 S;  4J5Y A;  5GAN j;  3HHT B;  4OP0 A;  3LLR A;  3V8J A;  3JB9 F;  1QP3 A;  4HCZ A;  4Y91 A;  3OS0 A;  5CKE A;  3R6O A;  4M75 E;  3E9G A;  3HL8 A;  4M77 A;  3GF5 A;  4E7I A;  2DXU A;  3CBP A;  4MMK A;  4KUI A;  4EPC A;  3CBM A;  2V8J A;  3OYN A;  4RG2 A;  2GF7 A;  5GAN e;  5GAN 5;  3JCM J;  5C0M A;  4ELZ C;  4KUD K;  3ZEH A;  3J7A F;  4M7A E;  3QHS A;  4DA4 A;  1NPR A;  5GAM f;  4OMF B;  4QVD A;  1M8V A;  1K8A U;  1FWZ A;  3MHX A;  4X9D A;  1XTD A;  1Y96 B;  2HQX A;  2FVU A;  3QJ6 A;  2LT4 A;  2EFI A;  2CZ6 B;  2GFA A;  5HY6 A;  3ME9 A;  2O01 E;  2RA2 A;  4M75 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...