2JZ2A

Solution nmr structure of ssl0352 protein from synechocystis sp. pcc 6803. northeast structural genomics consortium target sgr42
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
MIFPGATVRVTNVDDTYYRFEGLVQRVSDGKAAVLFENGNWDKLVTFRLSELEAVKPILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ssl0352 protein
publication title Solution NMR structure of Ssl0352 protein from Synechocystis sp.
rcsb
source organism Synechocystis sp.
molecule tags Structural genomics, unknown function
total genus 9
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11623 NdhS NAD(P)H dehydrogenase subunit S
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jz2A00
3MEVA 3MEUA 4CRIA 2LDMA 3L2QA 5J39A 3FEOA 3OA6A 3S3OA 3OMCA 5KE3A 2VYTA 4FU6A 4NS5A 4EDUA 3OYAA 3L42A 3OQ5A 4N4GA 3OYGA 4N4HA 4A4GA 4A4EA 2K3XA 2K3YA 3UT1A 4QQGA 3OYEA 3ME9A 3CEYA 4OVAA 2O4XA 3M9QA 3META 5KCOA 1WJQA 1XNIA 2QQRA 2X4YA 4IUQA 4BE0A 5KH6A 2GFUA 4QQDA 2RHXA 3FDRA 3LH0A 2DAQA 5KCHA 2M16A 3L2RA 3QJ6A 4BE1A 2R58A 3E9GA 5J26A 2RHYA 3MP1A 3OYLA 3KUFA 4ZTFA 3C4SA 2RI5A 4GY5A 2GFAA 1G5VA 3O8VA 2MWOA 2RO0A 5D6WA 3S6WA 2CKKA 3LYIA 2E6NA 2XK0A 4L59A 4C5IA 2EQJA 4X34A 3UWNA 4IUUA 3OYBA 3OYIA 2XDPA 3MP8A 3NTIA 3LX7A 3MO8A 3OS0A 3OYFA 3OYMA 3L2VA 3DLMA 4Q5WA 4B9WA 2L89A 5IAYA 2IG0A 2P0KA 3OB9A 3OYJA 2NLUA 1RI0A 4BD3A 2F5KA 3OMGA 1H3ZA 1OZ3A 2RI2A 5FROA 1OZ2A 3OYHA 2EFIA 3DB4A 2RHIA 2DIQA 2E5QA 4BE2A 1OI1A 3NTHA 2RHZA 1OYXA 2R5MA 4PLIA 5D6YA 3OS1A 3QIIA 1WJSA 2X35A 2YRVA 4II1A 4C5GA 3S3NA 4LD6A 4HCZA 2HQEA 2R5AA 4IUTA 3F70A 3E9FA 4IURA 4PL6A 2LRQA 2JTFA 4E7KA 2D9TA 4B9XA 3NTKA 2MWPA 4IKFA 4A4FA 3FLGA 2B8AA 2PQWA 4N4IA 2JZ2A 3OYKA 5FRNA 4QQ6A 2WACA 3FC3A 3QKJA 2BUDA 2FHDA 1N27A 3OYDA 2X4WA 3PFSA 4E7HA 1WJRA 2L8DA 3LGLA 3P8DA 3MP6A 2RJEA 2DIGA 2M0OA 2QQSA 3L2WA 4ZTJA 3LLRA 3S3MA 4BACA 2BIVA 3PMIA 5FRMA 4PLLA 4RG2A 5D6XA 1SSFA 2LCCA 3LGFA 3QBYA 4C5EA 3OS2A 3L2UA 3PNWC 3PMTA 5M9OA 3EAEA 3MEAA 4QW2A 4BDYA 3ZEHA 3MEWA 4UC4A 1KHCA 3H8ZA 5CIUA 2RJFA 2EKOA 3H6ZA 3OYCA 4IUPA 2LVMA 2RI3A 2BKDN 3SD4A 5C0MA 5KE2A 2RHUA 2EQMA 3OY9A 2L3RA 5C6SA 4A4HA 4IUVA 2G3RA 4QVZA 4E7JA 4E7IA 3ASKA 3Q1JA 2M1HA 1WGSA 2O4XB 3DB3A 2EQKA 3BDLA 2LTOA 4FL6A 3P8HA 4E7LA 2GF7A 2HQXA 2X4XA 4BDZA 2R57A 3OYNA 2RJDA 5IN1A 3GOXA 4Z02A 2RJCA 4C5HA 2EQUA 1MHNA
chains in the Genus database with same CATH superfamily
2M02A 1QQJA 3QWXX 2JXBA 2JW4A 4FU6A 1M3CA 1D0XA 4JDSA 1VQMQ 3QO3A 3HSBA 1IRXA 3QJYA 4CC3A 3G6EQ 4MZPA 4NL2A 2HMAA 5KCHA 6AT1B 4GY5A 1M90C 2GBQA 1M2VB 1ZHIA 3CCLA 3TCJA 2CKKA 3LYIA 2XK0A 1K0SA 4C5IA 1SG5A 4X34A 3OBWA 3UWNA 4BUGA 1N9SA 2P84A 1M1FA 4JJDA 4DBRA 3I55Q 2XICA 1I4K1 1PSEA 2D8HA 4M7AG 1OX9A 2AKLA 1RI9A 3UPUA 2LRQA 2A28A 2K7AA 2MWPA 3CCEQ 4L6V5 2DL7A 2NUPB 3J80E 3JCMh 2LQNA 4JS4A 5GAOp 3ULRB 5A2QE 2X9HA 3JCMb 2O9VA 5GAOl 2KROA 2DKGA 4UC4A 1OX8A 2RJFA 2WSFE 4FT2A 2LVMA 4A54A 1JQQA 2XU8A 4ATOA 2H3JA 3U23A 1PD1A 1DJ7B 1VA7A 5C6SA 4J9HA 4XU1A 2EJFA 2DYIA 3CCJQ 3CXCS 1KD1U 4M77G 2ROTA 2RQTA 1PG5B 3V8LA 4F7UB 4Z02A 3CC7Q 1TU0B 1RAFB 2EJ9A 1PWTA 4MZMA 3CMET 1AHJB 2X4JA 1AWOA 2K3YA 1WA7A 1YJ9T 1N8RC 4OVAA 3EH1A 3RESA 4RG8A 2DAQA 3M0QA 4M78E 2RI5A 2CUDA 1MMNA 5GAN2 1R0BG 2XDPA 2EGEA 1WXUA 4KGVB 2M0YA 4M7AF 5KYNA 1YHQQ 3TSZA 2C0OA 4JLIA 2RI2A 5GANg 3J81E 1MV3A 2J6FA 2LC4A 1BK2A 4J5YA 1VQOT 1M3AA 1QVFA 1B07A 3E9FA 3LW5E 2JJ9A 4E7KA 1X01A 4X9CA 4OB3B 1BIAA 2HDAA 3WXMB 1IB8A 5GAOq 1M30A 1UB4A 3C12A 3FC3A 2BUDA 2VV5A 3H9NA 1JJ2S 2CREA 3KXTA 2PU9B 2QDYB 4ZNXA 1OOTA 3P8BB 2A7YA 2EGCA 2KY9A 2GGRA 4J8OA 4M7DG 2JM8A 4V2SA 3OBYA 1C1AA 4KRTA 3LGFA 5M9OA 3EGDA 1D3BB 4M77F 5GANh 5A0DA 1PSFA 1N5ZA 1AEYA 3BDLA 2LTOA 1NZ9A 1NG2A 3L2ZA 2CH4A 2RJDA 5IN1A 1KG1A 1PCXA 1RLQC 2KAFA 3FJPA 5CKBA 3QDFA 3CCVA 2VYTA 2F2VA 4EDUA 1I8FA 2FRYA 4Z88A 1CSKA 2AIRB 4A4EA 2VASA 1VQ6A 1BCOA 2O4XA 4C0ZA 3SFMA 5GAN8 2MF2A 2QAZA 3PVLA 3ZL7C 2P0PA 4ELZC 3CXCP 5J26A 3G1JA 2OTJA 1G3WA 4M4ZA 4XTZA 1VQ8Q 2MWOA 4OB0B 3E2UA 4AG1C 3CCVT 2E6NA 3REAB 1GBRA 4E6RA 2ED1A 3A8HB 1TUCA 2XI9A 1QP3A 4HT8A 2J7IA 3LX7A 3VS4A 3OYJA 4BD3A 2VB6A 5GAN6 3M56A 2NUZA 5FROA 3I56T 2Y4YA 1UHFA 2E41A 2EFIA 2A0FB 1LPLA 2CSQA 4PL6A 5DM7R 3R6OA 1BU1A 5CAIA 2D9TA 3R6NA 1K9MU 1UGRB 5CCAA 1I5LA 3OYYA 1KC8U 3OYKA 2ZPHB 1QP2A 1HK9A 3RERA 2LJ1A 5LJ3j 1RUWA 4J6XA 1YBYA 5KYWA 2P4TA 3OS2A 1WDXA 3BFMA 3HHTB 3OYCA 1JXOA 4PFPA 1RLPC 3EG9A 1VQMT 2KT8A 2CT3A 2CP7A 4E7IA 1JJ2P 2O4XB 3G6ET 1GCQA 2HD0A 5LJ5j 1FX7A 4BDZA 3CCLQ 4OB1B 3A8GB 2OTLA 2JS0A 1NLPC 4XU2A 3QXEB 1QKXA 1TTHB 1WZOA 4EPCA 2KGTA 1SKUB 5KE3A 2EKHA 3URGA 4X1VA 2NWMA 1Q86C 2K3XA 5FW9A 4HCCA 1M5Q1 3X24B 2QXFA 2E70A 1MNEA 3EG1A 2OTLT 1B34A 3VS6A 5KYXA 3L2RA 2M16A 3QJ6A 4M7AC 1PNJA 4ZGDB 3DLLA 1G5VA 3O8VA 2KMTA 4FCYA 1CKAA 5GAMe 1Q82C 3QSUA 1I5OB 1Y7XA 2EW3A 2FZCB 4FW2A 2DPPB 2E6ZA 1EX4A 3I9QA 2W10A 4LUEA 3H0FA 5GAMd 3E1SA 4M7AB 1S72T 3M0UA 5D6YA 5HCKA 2X35A 2Z0WA 2OI3A 3I35A 2VC8A 1KHIA 4C8QA 1NJIU 1XJWB 2DEUA 4D8DA 2QTVA 3M57A 2BZYA 3C0CA 2XDBA 2SRCA 2KXDA 1X6GA 1GL5A 1Y07A 2DYBA 4FSXA 5IXBA 4OP0A 2KYBA 1GFCA 2XD0A 3G4SA 2LCCA 1X69A 2DJZA 3CBMA 1G8XA 2A37A 2JS2A 5FU6C 1MMAA 1TSFA 1E7OA 5HY6A 3QZ5B 2DL3A 3OY9A 3CPFA 4DBHA 4ANJA 1S1NA 1UGVA 4C0FA 4M77B 1FMKA 3G4ST 1TG0A 3TVTA 2L2PA 4M7DD 2DNUA 3EHRA 3EG2A 2CYZB 2ZPEB 1HD3A 2LJ0A 1MHNA 4B6MA 3H41A 1YI2A 2QASA 3MEUA 1OULA 1QW1A 5CVIA 4M78F 4CRIA 2C0IA 2FL7A 1OU8A 4J7IA 3OSSC 3HL8A 5FU6B 2HQHA 3X25B 3PVQA 3GNGA 1WXBA 3M4GA 4PJOA 3GLXA 1IGUA 4DEYA 1YWOA 2ZPFB 3V7RA 2QQRA 4J9CA 4RKUE 1YCYA 1TOVA 3E9GA 2HKNA 5I2MA 1C6VX 1YI2T 1YFNA 2KXCA 2LQWA 3MCAB 2DEQA 2MIOA 4PFOA 2F5TX 2F2WA 1KJWA 1KQSA 4GLKA 1ZLMA 4F14A 3BY7A 4R56A 2V8IA 3WVEB 4M7DC 3QG1A 2E5QA 2AZVA 2HZYA 1OYXA 3M55A 2GQIA 1Q95G 3JB9G 1G3TA 2P4RA 4LD6A 3IQLA 5GAMh 4IIMA 2HAXA 3F70A 2CGHA 5EC7A 1YN8A 3HKSA 2E3IA 2JTFA 2JZ2A 1VQNT 2KYMA 2WACA 1M4ZA 2NUTB 3VS5A 3JV3A 2CP0A 4BI4A 2L8DA 4M7DB 2RNAA 2YRCA 3CBPA 2KRNA 2RJEA 1M90R 1QVGA 2FO0A 2RQVA 2EYZA 4KT0E 4C92A 1M2VA 3M58A 1Q7YC 1ZQ1A 3CCUA 3CCVQ 1T0HA 2LX9A 3T9NA 3GPLA 4C92D 1VQ6Q 2V1QA 4E7ZA 4C8QE 3OSVA 3KBGA 2DMOA 4PK4A 2COWA 4E7JA 4JUVA 2W0ZA 2K57A 4YTLA 3P8HA 1XQHA 2GF7A 2KR3A 1M1KC 1W2BA 3O5ZA 4C5HA 1VQ8T 3V7CA 3JCMc 1Y0MA 1M90U 4HVUA 2AKKA 4RMOA 3RDVA 1V76A 3L42A 5CO7A 3BE3A 1VQ9A 2AHJB 4N4HA 3UT1A 1ZBJA 2VWFA 4RTTA 4FSSA 1YIJA 3CD6A 5KCOA 1WJQA 2XDDA 2YT6A 1UE9A 5LJ3f 1VQ7A 1TS9A 2M9UA 1EFNA 1BYMA 4C92C 1TXQA 1MV0B 2FEIA 4MMLA 4ELYC 1SF9A 1VQ9T 2OAUA 5GANj 3L2VA 1IHVA 1YIJT 3JB9F 3CD6T 1FMVA 2RK1A 3FIFA 4RTVA 4DOWA 3OB9A 1K1ZA 5AT1B 4XU3A 2JUFA 5LJ5f 1HJDA 2E5KA 4PJOE 3OS1A 2QA4A 1WJSA 5KYYB 3HRTA 3M0PA 4C92B 4F7UA 4HCZA 1GCPA 2LCSA 4IURA 2D8JA 4OGCA 4XTXA 4R55A 4LD9K 2DERA 1R0CB 5GAOn 1N8RR 3QYGB 3UA6A 2H8HA 4QQ6A 3QKJA 1WYXA 4M75G 1UJYA 2QGGA 2OTLQ 2YWWA 1K8AC 3A1PA 2LZ6B 1UEBA 2RK2A 3CCLT 2EBPA 4EMKA 2MPXC 2K79A 3L2UA 2RPNA 3M5AA 1PHTA 2RB6A 3PMTA 3L1AA 1ZSGA 1QCFA 5IT9E 2RI3A 2AK5A 1KD1R 1WX6A 5GANe 1FMWA 2CS7A 4QKUA 1S72Q 2J6KA 1N8RU 1SHGA 2CP2A 4VUBA 2ZGWA 2ZPIB 4J6WA 2ZAEA 3TU4K 3FDRA 5GANd 2BZXA 3V8JA 3VS0A 3L2QA 1AWXA 4P5NA 1N9RA 2JNGA 4QVDA 1TUGB 2ECZA 3SDZA 2COYA 3M0RA 2SEMA 4BE1A 1U06A 2CUBA 2GFAA 1UG1A 1M8VA 1ZUUA 3S6WA 4JRKA 4J6YA 1IXDA 2JN0A 4EMKC 4LN2A 1D3BA 1VQPA 1SEMA 1K9AA 1NEBA 4J9IA 2IVWA 8ATCB 1RAIB 2NLUA 1OEBA 2QDLA 2MMPA 2KDSA 3G4SQ 1QWFA 4E47A 4K11A 2L3PA 4M75F 4EMKB 3SEMA 2DK3A 3HFOA 3FLGA 3QHSA 3FRNA 3OW2A 1IREB 5IHNA 2VKNA 3JCMf 1V29B 1K73R 4FIBA 2F2XA 1H8KA 1QCOA 2DIGA 2LX7A 4OMNA 2BIVA 4FT4A 2K9GA 1YI2Q 2RF0A 2PVOB 4QW2A 4F7UE 3GIBA 1GBQA 3H6ZA 1YJNA 5C0MA 2CDTA 3I5RA 1IHWA 1BB9A 2YXYA 4E7LA 4PJLA 1ZSZC 2EIFA 3OYNA 2FPFA 1K73U 2K4YA 3V8KA 4KGZB 2CP3A 1AZGB 3FEOA 4KULA 4NS5A 3OQ5A 3JCMW 1VQNQ 2L3SA 2DZ9A 3UATA 2DXBA 3LH5A 3REBB 1ZUKA 1YCSB 1ZSZB 1JO8A 2WSEE 3CPWA 3JCMV 2JMAA 2L3QA 3OYBA 4IUUA 2X51A 2X3WD 3KFVA 2GCXA 3CQTA 2AT1B 3ZFJA 1M9SA 2LCLA 1VQ4A 4AFQC 1QVPA 1BBZA 2V8KA 1H3ZA 3MJXA 1ABOA 1TH7A 1K9MR 4PLIA 2O2OA 1KC8R 2HQEA 1X2QA 3JRZA 3CMAA 4MDXA 1VQ6T 4WTOB 3NPFA 5GMKi 1GXIE 2QQBA 3EHQA 2FHDA 1N27A 1OU9A 1WJRA 1NYFA 2QK0A 4J9GA 4C8QF 1M2OA 2OTJT 3HPWA 2O31A 1QVFP 4KUIA 2VXEA 3HRUA 3PNWC 1BI0A 2EYXA 2RM4A 3ZEHA 1VQ9Q 1WFWA 3H8ZA 2DRMA 4RTZA 1YIJQ 5CR2A 3CD6Q 2RHUA 2RQUA 1PKTA 4XTVA 4IUVA 1VQ7Q 4CC4B 1Q86U 1LJOA 3NGPA 1OQKA 1SSHA 4NL3A 4M7AA 3RMQA 1VQKA 2YRDA 2COZA 1Q81C 1KK7A 1B3QA 4AFSC 1BI2A 1T3SA 3VUZA 3A5ZB 5EG2A 3ER0A 5GAMj 2I0NA 4M7AD 2HKQB 2RO0A 5GJWB 2VXFA 1GRIA 2DA9A 2KQWA 5J39A 5DLQE 4J7FA 1QWEA 1UGSB 1UGPB 2DE0X 1Q82U 2I2LA 2VUBA 4FW1A 3EGXB 2KI7A 2QA4Q 2X4YA 2HCKA 3UF4A 2R58A 2CZ6B 2DL4A 1SHFA 4OMQA 2A08A 4RCCA 4PJOF 1IO6A 2EQJA 1X6OA 2KBTA 4BI3A 1P92A 1WIEA 2L5QA 4M75C 5CK9A 4A53A 4M77A 1NJIR 4M78G 4BE2A 2J06A 2RHZA 3BW1A 1W6XA 2LQ8A 2EYWA 4M77D 1JB0E 4LDYA 2D1XA 1KIKA 4DA4A 4HVVA 5CKDA 2DF6A 1T0JA 4NOYA 1YP5A 1PRMC 4M75B 2MOXA 1I81A 2PVGB 3LGLA 3QUIA 3MP6A 1RAEB 3CCQA 3JAME 1BIBA 4Y92A 4C5EA 7AT1B 4BDYA 1OPLA 2PUKB 4ZGEB 3M53A 1NYGA 2K3BA 4IUPA 1RACB 5IH2A 3NMZC 4XAXB 4RTYA 1RABB 3CCRA 3VRZA 2RH2A 3CCQT 1KQ1A 3M0SA 1UJ0A 3EFOB 4M77C 2LMJA 2ZCFB 1J3TA 1FWZA 5ECAA 3CC2A 4XK8E 1UHCA 3INZA 1JXMA 3GOXA 2YUOA 2XHCA 1NLOC 3MEVA 2AZSA 1LCKA 4D8KA 4JS5A 3CC7A 1YWPA 2LDMA 2DFUA 3OA6A 1Y96B 1WXTA 3M0TA 4N4GA 4EMGA 1ZA1B 4HXJA 2NUTA 3CCRT 4F17A 3CCSA 2FYKA 1NEGA 2ED0A 3M9QA 4M7DA 2JM9A 3CC2T 4ZTFA 2E3HA 1WHMA 4M7AE 4BI8B 2K2MA 2MK5A 1KQSS 5GMKm 5A0LA 1KSWA 1VQLA 1M3BA 3OYFA 1BKBA 3CC4A 3NFCA 4Q5WA 2RQRA 1G83A 3UDCA 1YHQA 1I0CA 5HKCA 3VJPA 2F1LA 4II1A 4F04B 2GQVA 3GF5A 1Z9QA 1HYOA 3VS1A 2BTTA 5LJ3g 1Q7YU 3D7SB 3AHUA 4N4IA 3X28B 3TREA 2ZPBB 5A0GA 1MMGA 1Y57A 2PUOB 2EYYA 1QVGS 2FRWA 2M0OA 5L23A 2YLBA 1NPPA 5DY9A 4CI0C 2RD1A 4AMCA 4BACA 4M77E 3C94A 1SSFA 4QT7A 4FYYB 2E4HA 2DBMA 2MCNA 1M1KU 3MEAA 5LJ5g 1BI3A 5CIUA 1ZA2B 3E19A 2C06A 3ASKA 2B86A 3Q1JA 1WHJA 2EQKA 2M51A 1W2BS 1WLPB 2HL3A 1K0XA 5KYYA 2R57A 3H0IA 2FPDA 2RJCA 5FRMA 1G3SA 3NTIA 4JJBA 2VGNA 2E1HA 1ZBXA 3VYGA 4O5VA 3CCMA 1VQ4Q 3RR6A 3OYAA 2HL5C 3JCMJ 3OYGA 4EMHA 1ZUYA 4JLGA 5GMKl 3LWIA 4ZN3A 4J9FA 2YLCA 2XG8D 2GFUA 3GNFB 2OTJQ 4JJNK 2LP5A 2RHYA 3KUFA 4PJNA 3C4SA 3SWNA 3CCUT 2V26A 3TEEA 4RUGA 4XTUA 1U8RA 2CP6A 1M8MA 2NYSA 2V8JA 3RMSA 2DL8A 1F1BB 2QYZA 3DLMA 5IAYA 2F5KA 4XU0A 2JTMA 3HP9A 1SRMA 2L0AA 2BZ8A 1YITA 2OAWA 4M7DE 4C5GA 5GAMf 4KGXB 4IUTA 1K8AU 2FB7A 1WPYA 3FJ5A 1MGQA 2OX7A 4XTWA 4RTWA 1KQSP 5GMKe 2QEXA 4LDVA 3EH2A 1K4US 1VQKQ 1QMCA 2P0QA 1VQ7T 1KFZA 1YITT 3VS3A 1U5SA 1YJWA 4M78D 2XKOC 2ATCB 4HCKA 3M54A 4DEXA 3SWNC 1JBMA 3DKMA 3JCMP 3HRSA 2QEXT 3H0HA 1M1GA 2EKOA 4QVCA 3G71A 5KE2A 5IHIA 1ZX6A 1VYTA 4MMKA 1SRLA 1UFFA 5J3BA 1YJWT 5IHKA 1OV3A 4BY6C 2QA4T 1QVGP 1IZ6A 3PT9A 2CT4A 2DILA 2HBWA 3VS7A 3RIRA 3WVDB 3JCMg 3SWNB 1ACMB 2HSPA 3OYMA 2BKDN 2FZKB 3HFNA 5GAN3 2DETA 3G71T 4PJMA 1VQ5A 1LNXA 2BE7D 4A4GA 1D1AA 4ESRA 4E7SA 3JB9H 4LDUA 3ZBDA 2DVJA 4BY6B 1W70A 2QTXA 4M78C 1W4SA 4OMFB 4BE0A 3LH0A 1W2BP 2DM1A 2E65A 2K6DA 1NE8A 2QI2A 1C0MA 1VQ5T 2DJQA 1I1JA 4C92E 2J6OA 1AT1B 4KH1B 5GAN7 4B9WA 2OJ2A 2IG0A 2RA2A 1RI0A 1PKSA 4PJJA 4M78B 3CCQQ 1OZ3A 2MI6A 2YHTA 3PE0A 2CZ1B 1OZ2A 1WHHA 4LE9A 3NTHA 2QG9B 3HTRA 3QIIA 1NM7A 2HNIA 4HA8A 2XMFA 2EVRA 1AD5A 4JJCA 3TQ7P 4RTXA 2O01E 1VYUA 3RBBB 4FYXB 3OW2S 5HK0A 4J9BA 4LDXA 2EAYA 3CMEA 2JOYA 3EFRA 2GNCA 3VKIA 3CCRQ 5FRNA 3QWYA 3VS2A 1M27C 2EGAA 2X4WA 2J05A 1YJ9A 2EPDA 4R0KA 1Z9ZA 1YNZA 4JRIA 3P8DA 3CC2Q 1ZSZA 4D6WA 2E64A 1QVFS 4PLLA 3QDRB 4RG2A 5D6XA 8AT1B 2EWNA 5GMKh 1X75C 1UECA 2IPOB 2MAMA 4ME7A 4WCIA 1VQPT 1MMDA 3MEWA 5IXFA 1WQ7A 3CCSQ 3VUBA 4JZ3A 4KBMB 2G3RA 2PVDB 4Z89A 2KE9A 4OMPA 4OB2B 5GJVB 4HKEA 3M59A 2DTOA 1PRLC 2D6FA 3CXCA 1B7TA 2KSSA 2DTHA 1UTIA 3JB9D 1PC0A 1VQLQ 2RN8A 1VQOA 1MNDA 3SB2A 3CC4Q 2PTKA 3S3OA 4C8QG 1VIEA 4LNPA 2LNVA 4RTUA 1TWBA 3EGUA 3ME9A 1KD1C 4OF1A 3A8OB 1FXXA 2DL5A 5KH6A 1WHKA 1AVZC 3CPWS 3JB9J 4GLMA 1IGQA 1SPKA 1X2KA 4LXCA 1R8OB 1X6BA 5KYUA 2O88A 1YJNT 3OS0A 1PM3A 4KH0B 2L89A 1Q81R 1PD0A 4XQ3A 1WNLA 4CC7A 1A0NB 3BDUA 5I2SA 4N0AA 3DB4A 2E12A 1OI1A 2GTOA 2BE9B 1D09B 1AWJA 3X20B 1Y71A 2LNHB 2R5AA 2ZZDA 3JCMQ 1VOMA 2KRMA 4O6JA 2JVVA 1R77A 3NTKA 5CKEA 4TVRA 9ATCB 3EG0A 1E6HA 1QCNA 5HK3A 3EGXA 2EJGA 2JMCA 3EFSA 4J83A 3RNJA 4PJOG 1JJ2A 3C95A 1X27A 3RUXA 3LWHA 3CCUQ 4AFUC 1Q81U 3CCMQ 3X26B 2FVUA 3CBOA 3OW2P 1Q86R 2ENMA 1VQ4T 4AFZC 5AYFA 3I5SA 1XTDA 2DO3A 2WSCE 2EQMA 2Y4XA 3PGGA 3V7SA 4HVWA 1I07A 4A4HA 1ABQA 1X43A 1NPRA 1G3YA 4FL6A 2LT1A 1K73C 5I21A 4MDWA 4FM4B 3I56A 1XOVA 4N0AC 4AG2C 3G7ZA 2EQUA 1Q82R 3JSCA 1WI7A 3CMAT 2HEQA 1LVKA 1WQWA 5KYUB 1RAHB 5GANf 1HSQA 2D0QB 2KVQG 4M75A 4QQGA 5L8RE 2K5IA 2DD4A 4DOVA 5CQYA 1K76A 1XNIA 3GBQA 1YITQ 1JRIA 3RKXA 4QQDA 4M75D 1VUBA 1UUEA 3MP1A 2VGMA 4C92G 4L59A 3EG3A 2QEXQ 3TSWA 4ORZA 4M7DF 3EGDB 3QYHB 4JPBW 4FYVB 2A36A 4IIOA 2DBKA 2X3XD 4J9EA 4OMMA 2YUNA 1YJWQ 1VQKT 3OMGA 1VQMA 3VRYA 3EFOA 1AOJA 1RAAB 2YUQA 2RHIA 3G6EA 4IKFA 2R5MA 3CPWP 2EYQA 1D0ZA 4Y91A 2QQ9A 2KEAA 2DVEA 2D0NA 2K5FA 2CZ7B 4A63B 1D1BA 3G71Q 1Y96A 2DZCA 2B8AA 3QZ9B 3PIPA 3THKA 1HXDA 2LJ3A 2DTIA 1QKWA 4JRQA 2MYSA 1UDLA 3JB9I 1U1SA 4E7HA 3RKYA 1NBEB 5FWBA 2ROLA 3MHXA 4ZTJA 3I55A 4PNOA 3S3MA 2XIDA 1K9MC 3PMIA 4Z8AA 2K5LA 2PZ1A 1KC8C 3QBYA 1VQ5Q 3AT1B 3M4YA 2DX1A 2DXTA 5FU7C 3SD4A 4HCBA 1U3OA 2YDLA 2HBPA 4DBFA 3CCEA 2L3RA 3A8MB 4DQ2A 4MZTA 1D1CA 4LUDA 2M1HA 3I55T 3DB3A 1OPKA 1JEGA 5LL6S 2HQXA 1S72A 5LJ3e 1E6GA 4X9DA 4F7UG 3FB9A 4WF2A 3OMCA 3CCET 5FU7B 1T3LA 1RADB 2ZPGB 1RL2A 2LT4A 4PKCC 5LJ3d 4C92F 3OYEA 4J9DA 2K2VA 4A4KA 3META 2H3EB 4IUQA 1H92A 2KK4A 1KQ2A 1EZZB 3OYLA 1GCQC 3A8LB 3CCJA 2KT1A 5LJ5e 1BCMA 1W1FA 5KYWB 1H3HA 2DRKA 3CMEQ 1VQPQ 1UGQB 3PTAA 3MO8A 4C8QD 1O9SA 3MPUB 1YJ9Q 1G2BA 3EG9B 5LJ5d 2FG0A 2P0KA 4DBQA 4M75E 4C0DC 4ZGJB 3OYHA 3CCJT 1H641 4ZN1A 3VV0A 1Q7YR 2YRVA 3S3NA 1FYNA 3CC7T 5GAN4 3QPHA 2A3LA 4B9XA 4A4FA 2PQWA 3CCST 2E10A 3N5BB 2CP5A 4AT1B 3OYDA 2ABLA 1GFDA 2IIMA 2DD5A 4C0DB 2C0TA 2DXCA 4CC2A 1M1KR 1B34B 5KYXB 4GBQA 5CQXA 1NJIC 3LLRA 2PNIA 1VQOQ 1N6AA 2Y90A 2JTEA 3EAEA 1VQLT 2CZ0B 4C8QC 1YJNQ 1KHCA 3CC4T 2O9SA 3RKWA 4C0GA 3VYHB 5GAMg 3VU3C 1YHQT 1LOJA 4F7UF 1WGSA 2FPEA 2KRSA 2FZGB 3JCMX 4PJOD 5D7UA 4E2FB 3UA7A 4C8QB 2RQWA 4OGEA 4FYWB 2GTJA 2EQIA 1D0YA 5CKHA 3CEYA 5GAOr 1VQNA 3GP8A 5FWCA 2QQAA 4F16A 4PFZA 2RHXA 4EIKA 5LJ3h 4L5GA 2DXUA 1QLYA 2G6FX 2CH4W 5D6WA 1MUZA 5GMKj 1RAGB 3OYIA 3MP8A 5FLXE 1AWWA 5GAN5 1WHLA 3A98A 2F69A 3NHNA 2KNBB 5CKFA 4PJOC 4OMOA 1K8AR 2YSQA 1V1CA 3JCMe 2DIQA 5LJ5h 5I11A 2JT4A 4JZ4A 1WHGA 1JU5C 1CKBA 4KUDK 3SHWA 2HSEB 3CMAQ 3CCMT 1VQ8A 3MKDA 3JCMd 2YUPA 1ARKA 1VYVA 4HT9A 5DLOA 4PJOB 3PFSA 2VVKA 3I56Q 2ESWA 2QQSA 3L2WA 2LQKA 3PIOA 1U1TA 4OMLA 2DLPA 4RCBA 1AZEA 5I22A 1O75A 3J7AF 1EIFA 2NUPA 4Y28E 5GAOm 4M78A 4QVZA 1BI1A 4LDWA 4JRPA 2V1RA 4XTYA 1TUDA 2X4XA 3OS5A 1VIFA 4BB7A 2RMOA 2QGFB 2CSIA
chains in the Genus database with same CATH topology
3JB9D 2VXFA 1YI2A 1VQOA 3MEUA 5CVIA 1QW1A 4CRIA 4M78F 2KQWA 2FL7A 3SB2A 5J39A 4J7IA 3S3OA 4C8QG 3OSSC 4J7FA 5DLQE 1VIEA 1UGSB 3HL8A 1UGPB 4FU6A 5FU6B 2LNVA 4JDSA 3X25B 3QO3A 1Q82U 3HSBA 3GNGA 2I2LA 1MHNA 3M4GA 3GLXA 3ME9A 2VUBA 3QJYA 1KD1C 4PJOA 4MZPA 4OF1A 2ZPFB 3V7RA 2X4YA 2QQRA 3A8OB 4NL2A 1FXXA 5KH6A 4RKUE 5KCHA 1YCYA 3CPWS 2R58A 3E9GA 5I2MA 3JB9J 2CZ6B 4GY5A 1YI2T 1M90C 1ZHIA 3MCAB 2DEQA 3TCJA 2CKKA 3CCLA 3LYIA 2XK0A 4RCCA 4PJOF 4C5IA 2EQJA 4X34A 3OBWA 3UWNA 1R8OB 1X6OA 4BUGA 2F5TX 1N9SA 4BI3A 1YJNT 1KQSA 1M1FA 3OS0A 1P92A 4GLKA 2L89A 2L5QA 4M75C 5CK9A 4A53A 3BY7A 4XQ3A 4M77A 2XICA 4R56A 1WNLA 2V8IA 3BDUA 3WVEB 5I2SA 4M78G 3QG1A 4N0AA 4M7DC 3DB4A 2E12A 1I4K1 2E5QA 4BE2A 1OI1A 1PSEA 1OYXA 2RHZA 3M55A 4M7AG 3BW1A 3JB9G 3X20B 1G3TA 2LQ8A 1Y71A 4M77D 4LD6A 1JB0E 5GAMh 3UPUA 2R5AA 2ZZDA 2HAXA 3F70A 4LDYA 3JCMQ 2CGHA 2LRQA 3HKSA 2JTFA 4O6JA 2JVVA 3NTKA 2MWPA 4DA4A 5CKDA 5CKEA 4NOYA 4TVRA 4L6V5 2JZ2A 1VQNT 2WACA 4M75B 1M4ZA 3J80E 1I81A 3JCMh 5HK3A 4JS4A 2EJGA 4BI4A 5GAOp 2L8DA 2PVGB 3EFSA 3LGLA 4J83A 3CBPA 3QUIA 4PJOG 5A2QE 1JJ2A 4M7DB 3MP6A 3C95A 2RJEA 3JCMb 3CCQA 4C92A 4KT0E 3RUXA 1QVGA 5GAOl 3JAME 3LWHA 1BIBA 3M58A 1Q7YC 1ZQ1A 4C5EA 3CCUA 1Q81U 2LX9A 3T9NA 3X26B 3GPLA 4BDYA 4C92D 2FVUA 3CBOA 2PUKB 2DKGA 4ZGEB 4UC4A 3M53A 2RJFA 2WSFE 4FT2A 1VQ4T 4IUPA 4C8QE 2LVMA 4A54A 2XU8A 3OSVA 3KBGA 5AYFA 2H3JA 4ATOA 1XTDA 1DJ7B 2DO3A 2EQMA 2WSCE 2Y4XA 3PGGA 3V7SA 4XAXB 5C6SA 4A4HA 4E7JA 3CCRA 4XU1A 2RH2A 4JUVA 1NPRA 1G3YA 1KQ1A 4FL6A 3CCQT 2EJFA 2K57A 4YTLA 2LT1A 3P8HA 1XQHA 3CXCS 4M77C 1K73C 5I21A 4M77G 1KD1U 2ZCFB 2GF7A 4MDWA 4FM4B 3I56A 1FWZA 1W2BA 1XOVA 4N0AC 4XK8E 1M1KC 3CC2A 3INZA 3GOXA 3G7ZA 3V8LA 4Z02A 4F7UB 2XHCA 4C5HA 2EQUA 1VQ8T 3MEVA 2EJ9A 3JSCA 4JS5A 3CMAT 3CC7A 3V7CA 3JCMc 2LDMA 4MZMA 3OA6A 3CMET 1M90U 1AHJB 4RMOA 1WQWA 1Y96B 3L42A 2X4JA 5CO7A 5GANf 4N4GA 4EMGA 2D0QB 1VQ9A 2AHJB 2KVQG 4M75A 4N4HA 2K3YA 3UT1A 3CCRT 4QQGA 5L8RE 1YJ9T 2K5IA 4OVAA 1N8RC 2DD4A 3CCSA 1YIJA 2FYKA 4DOVA 3RESA 3M9QA 5CQYA 5KCOA 3CD6A 1WJQA 1XNIA 4RG8A 2XDDA 4M7DA 3CC2T 1JRIA 5LJ3f 4QQDA 3RKXA 4M75D 2DAQA 1VQ7A 1VUBA 4M78E 4ZTFA 3MP1A 2M9UA 2RI5A 1BYMA 4C92C 4M7AE 2VGMA 4C92G 5GAN2 4L59A 4BI8B 4MMLA 4ELYC 1VQ9T 1KQSS 2XDPA 5GMKm 4M7DF 5A0LA 1VQLA 2OAUA 5GANj 3OYFA 4M7AF 3QYHB 3L2VA 3JB9F 1YIJT 1BKBA 3CC4A 3CD6T 2RK1A 3FIFA 3NFCA 4Q5WA 4DOWA 3OB9A 3UDCA 1YHQA 1VQKT 3OMGA 1VQMA 5HKCA 4JLIA 2RI2A 3VJPA 4XU3A 2JUFA 5LJ5f 4IKFA 2RHIA 5GANg 3G6EA 4PJOE 2R5MA 3J81E 3OS1A 2EYQA 2LC4A 2QA4A 1WJSA 4II1A 4Y91A 2QQ9A 3HRTA 4C92B 4F7UA 4J5YA 4HCZA 1VQOT 2GQVA 1QVFA 3GF5A 3E9FA 3LW5E 4IURA 2DVEA 2K5FA 5LJ3g 4E7KA 1X01A 2CZ7B 4OGCA 4X9CA 4OB3B 4XTXA 4R55A 1BIAA 1Y96A 1Q7YU 4LD9K 3WXMB 3AHUA 5GAOn 2DZCA 2B8AA 3QZ9B 4N4IA 3X28B 5GAOq 3PIPA 3QYGB 1UB4A 3C12A 4QQ6A 1HXDA 3FC3A 3QKJA 2BUDA 2VV5A 2DTIA 2ZPBB 3TREA 5A0GA 4JRQA 3JB9I 1JJ2S 4M75G 3KXTA 2PUOB 1U1SA 4E7HA 2PU9B 2QDYB 3P8BB 1QVGS 2A7YA 2KY9A 3RKYA 1K8AC 3MHXA 4J8OA 2M0OA 3I55A 4ZTJA 4M7DG 2YLBA 1NPPA 1UEBA 4PNOA 5DY9A 2RK2A 4CI0C 2RD1A 2XIDA 4BACA 3S3MA 1K9MC 4M77E 3PMIA 3CCLT 2K5LA 3OBYA 4V2SA 3C94A 4EMKA 1SSFA 1KC8C 3LGFA 3QBYA 3M5AA 3L2UA 2RB6A 3PMTA 5M9OA 1M1KU 3L1AA 3MEAA 5LJ5g 1BI3A 3M4YA 5CIUA 2DXTA 1D3BB 4M77F 5GANh 5FU7C 5A0DA 5IT9E 2RI3A 3SD4A 3E19A 4HCBA 2HBPA 3CCEA 2C06A 1PSFA 2L3RA 3A8MB 4DQ2A 5GANe 4MZTA 3ASKA 3Q1JA 2M1HA 3I55T 3DB3A 2EQKA 2CS7A 2LTOA 1NZ9A 3BDLA 5LL6S 1W2BS 1N8RU 4VUBA 3L2ZA 2ZGWA 2HQXA 2ZPIB 2R57A 4J6WA 1S72A 2RJDA 5IN1A 5LJ3e 1KG1A 4X9DA 2RJCA 5FRMA 1G3SA 3TU4K 3FDRA 3NTIA 4F7UG 3FB9A 2KAFA 5GANd 3V8JA 2VGNA 3FJPA 2E1HA 5CKBA 1ZBXA 3VYGA 3L2QA 4O5VA 4WF2A 3CCVA 3OMCA 3CCMA 2VYTA 4EDUA 5FU7B 1I8FA 4P5NA 1N9RA 3OYAA 2ZPGB 3JCMJ 3CCET 3OYGA 4EMHA 1RL2A 2LT4A 4A4EA 4PKCC 1VQ6A 2JNGA 5LJ3d 4C92F 4QVDA 3OYEA 4JLGA 3SDZA 2O4XA 5GMKl 4C0ZA 2K2VA 3SFMA 5GAN8 4A4KA 4ZN3A 2MF2A 3META 3LWIA 2YLCA 4IUQA 2XG8D 2KK4A 2GFUA 3GNFB 4BE1A 2P0PA 4ELZC 4JJNK 1KQ2A 5J26A 2RHYA 3A8LB 3OYLA 3KUFA 2OTJA 3C4SA 1G3WA 3SWNA 4XTZA 2GFAA 3CCJA 3CCUT 5LJ5e 1M8VA 2MWOA 4OB0B 3S6WA 3TEEA 4JRKA 4XTUA 3CCVT 4J6YA 1U8RA 2E6NA 2JN0A 4EMKC 1UGQB 2V8JA 3A8HB 2XI9A 1D3BA 1QP3A 3RMSA 4HT8A 1VQPA 3LX7A 3PTAA 3MO8A 4C8QD 1O9SA 3DLMA 2IVWA 5IAYA 5LJ5d 2P0KA 3OYJA 2NLUA 4BD3A 2F5KA 4XU0A 5GAN6 2MMPA 3M56A 4M75E 5FROA 2KDSA 4C0DC 4ZGJB 2JTMA 2Y4YA 2E41A 1H641 2EFIA 3HP9A 4ZN1A 3OYHA 3I56T 3CCJT 3VV0A 4E47A 1YITA 2YRVA 4M7DE 4C5GA 5GAMf 3S3NA 3CC7T 4IUTA 1K8AU 4PL6A 5GAN4 3QPHA 2A3LA 4M75F 4EMKB 5DM7R 2FB7A 3R6OA 5CAIA 2D9TA 1WPYA 4B9XA 1K9MU 1MGQA 1UGRB 4XTWA 5CCAA 1I5LA 2DK3A 3OYYA 4A4FA 5GMKe 3HFOA 1KC8U 3FLGA 3QHSA 2PQWA 3FRNA 2QEXA 1IREB 3OW2A 4LDVA 3OYKA 3CCST 2E10A 3N5BB 2ZPHB 1QP2A 3JCMf 3OYDA 1HK9A 2P0QA 1V29B 1VQ7T 3RERA 2DD5A 4FIBA 4C0DB 1YITT 2DXCA 5LJ3j 1B34B 2DIGA 1YJWA 4J6XA 5CQXA 1NJIC 3LLRA 4M78D 2XKOC 1YBYA 2BIVA 4FT4A 3M54A 1N6AA 3SWNC 1JBMA 2P4TA 3OS2A 3DKMA 2Y90A 3JCMP 3HRSA 3EAEA 2PVOB 4QW2A 1VQLT 2CZ0B 4C8QC 2QEXT 4F7UE 1M1GA 3GIBA 1KHCA 3CC4T 2EKOA 3BFMA 3H6ZA 3HHTB 3RKWA 4QVCA 3OYCA 4C0GA 3VYHB 5GAMg 1YJNA 3G71A 5C0MA 5KE2A 3VU3C 1YHQT 1LOJA 4MMKA 1VQMT 5J3BA 4F7UF 4E7IA 1YJWT 1WGSA 2O4XB 3G6ET 4BY6C 2QA4T 3JCMX 1IZ6A 3PT9A 2HD0A 5LJ5j 4E7LA 4PJOD 1FX7A 4BDZA 4OB1B 3A8GB 2EIFA 3RIRA 3OYNA 2OTLA 3WVDB 3JCMg 4XU2A 3SWNB 3QXEB 3OYMA 2BKDN 1K73U 2K4YA 3V8KA 4C8QB 4EPCA 3HFNA 5GAN3 4KULA 3FEOA 4OGEA 3G71T 5KE3A 4NS5A 1VQ5A 3URGA 1LNXA 3OQ5A 3JCMW 1Q86C 4A4GA 5CKHA 2K3XA 2DZ9A 3JB9H 3CEYA 5GAOr 2DXBA 4LDUA 3ZBDA 1VQNA 4HCCA 1M5Q1 3X24B 3GP8A 2QXFA 2QTXA 4M78C 4BY6B 1W4SA 2QQAA 4OMFB 2E70A 4BE0A 2OTLT 1B34A 2RHXA 3LH0A 5LJ3h 3L2RA 2M16A 3QJ6A 2DXUA 4L5GA 4M7AC 4ZGDB 2WSEE 3CPWA 2E65A 3DLLA 1G5VA 1NE8A 3JCMV 3O8VA 5D6WA 2QI2A 2KMTA 5GMKj 1VQ5T 5GAMe 1Q82C 4C92E 3OYBA 4IUUA 1Y7XA 3OYIA 3QSUA 3MP8A 5FLXE 2GCXA 5GAN5 2DPPB 2E6ZA 2F69A 3ZFJA 5GAN7 1M9SA 2LCLA 4B9WA 1VQ4A 2IG0A 2RA2A 1QVPA 1RI0A 4M78B 2V8KA 5CKFA 4PJOC 1H3ZA 1OZ3A 2MI6A 2YHTA 2CZ1B 5GAMd 1OZ2A 3E1SA 3JCMe 4M7AB 1S72T 1TH7A 2DIQA 5LJ5h 3NTHA 5D6YA 4PLIA 3QIIA 2X35A 2HNIA 4HA8A 2HQEA 4KUDK 2VC8A 1KHIA 4C8QA 1NJIU 3CCMT 3JRZA 1VQ8A 2O01E 3CMAA 3OW2S 3M57A 5HK0A 4MDXA 3JCMd 1VQ6T 4LDXA 2EAYA 3CMEA 2XDBA 2JOYA 3EFRA 5GMKi 3VKIA 5FRNA 4HT9A 1GXIE 2QQBA 2FHDA 1N27A 1Y07A 4FSXA 2X4WA 5DLOA 4PJOB 3PFSA 1YJ9A 1WJRA 4JRIA 3P8DA 4C8QF 4OP0A 2OTJT 3HPWA 4D6WA 2E64A 2QQSA 3L2WA 2LQKA 1QVFS 2XD0A 4PLLA 3QDRB 4KUIA 4RG2A 1U1TA 2VXEA 5D6XA 2LCCA 3PIOA 2EWNA 3HRUA 3G4SA 3PNWC 1BI0A 5GMKh 2DJZA 1X75C 2MAMA 4ME7A 3CBMA 4RCBA 2RM4A 3ZEHA 1VQPT 1O75A 3MEWA 3H8ZA 3J7AF 1WQ7A 1EIFA 5FU6C 3VUBA 5CR2A 5HY6A 2RHUA 4XTVA 3QZ5B 3OY9A 4Y28E 3CPFA 5GAOm 4IUVA 2G3RA 2PVDB 1BI1A 4KBMB 4LDWA 4M78A 4QVZA 4C0FA 4JRPA 4OB2B 1LJOA 4M77B 1Q86U 4NL3A 4M7AA 3RMQA 1VQKA 4XTYA 1Q81C 4HKEA 3M59A 3G4ST 2DTOA 2X4XA 3OS5A 1VIFA 2D6FA 1BI2A 3CXCA 4M7DD 3VUZA 4BB7A 2KSSA 3A5ZB 5EG2A 3ER0A 2DTHA 5GAMj 2CYZB 2ZPEB 4M7AD 2RO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEV A;  3MEU A;  4CRI A;  2LDM A;  3L2Q A;  5J39 A;  3FEO A;  3OA6 A;  3S3O A;  3OMC A;  5KE3 A;  2VYT A;  4FU6 A;  4NS5 A;  4EDU A;  3OYA A;  3L42 A;  3OQ5 A;  4N4G A;  3OYG A;  4N4H A;  4A4G A;  4A4E A;  2K3X A;  2K3Y A;  3UT1 A;  4QQG A;  3OYE A;  3ME9 A;  3CEY A;  4OVA A;  2O4X A;  3M9Q A;  3MET A;  5KCO A;  1WJQ A;  1XNI A;  2QQR A;  2X4Y A;  4IUQ A;  4BE0 A;  5KH6 A;  2GFU A;  4QQD A;  2RHX A;  3FDR A;  3LH0 A;  2DAQ A;  5KCH A;  2M16 A;  3L2R A;  3QJ6 A;  4BE1 A;  2R58 A;  3E9G A;  5J26 A;  2RHY A;  3MP1 A;  3OYL A;  3KUF A;  4ZTF A;  3C4S A;  2RI5 A;  4GY5 A;  2GFA A;  1G5V A;  3O8V A;  2MWO A;  2RO0 A;  5D6W A;  3S6W A;  2CKK A;  3LYI A;  2E6N A;  2XK0 A;  4L59 A;  4C5I A;  2EQJ A;  4X34 A;  3UWN A;  4IUU A;  3OYB A;  3OYI A;  2XDP A;  3MP8 A;  3NTI A;  3LX7 A;  3MO8 A;  3OS0 A;  3OYF A;  3OYM A;  3L2V A;  3DLM A;  4Q5W A;  4B9W A;  2L89 A;  5IAY A;  2IG0 A;  2P0K A;  3OB9 A;  3OYJ A;  2NLU A;  1RI0 A;  4BD3 A;  2F5K A;  3OMG A;  1H3Z A;  1OZ3 A;  2RI2 A;  5FRO A;  1OZ2 A;  3OYH A;  2EFI A;  3DB4 A;  2RHI A;  2DIQ A;  2E5Q A;  4BE2 A;  1OI1 A;  3NTH A;  2RHZ A;  1OYX A;  2R5M A;  4PLI A;  5D6Y A;  3OS1 A;  3QII A;  1WJS A;  2X35 A;  2YRV A;  4II1 A;  4C5G A;  3S3N A;  4LD6 A;  4HCZ A;  2HQE A;  2R5A A;  4IUT A;  3F70 A;  3E9F A;  4IUR A;  4PL6 A;  2LRQ A;  2JTF A;  4E7K A;  2D9T A;  4B9X A;  3NTK A;  2MWP A;  4IKF A;  4A4F A;  3FLG A;  2B8A A;  2PQW A;  4N4I A;  2JZ2 A;  3OYK A;  5FRN A;  4QQ6 A;  2WAC A;  3FC3 A;  3QKJ A;  2BUD A;  2FHD A;  1N27 A;  3OYD A;  2X4W A;  3PFS A;  4E7H A;  1WJR A;  2L8D A;  3LGL A;  3P8D A;  3MP6 A;  2RJE A;  2DIG A;  2M0O A;  2QQS A;  3L2W A;  4ZTJ A;  3LLR A;  3S3M A;  4BAC A;  2BIV A;  3PMI A;  5FRM A;  4PLL A;  4RG2 A;  5D6X A;  1SSF A;  2LCC A;  3LGF A;  3QBY A;  4C5E A;  3OS2 A;  3L2U A;  3PNW C;  3PMT A;  5M9O A;  3EAE A;  3MEA A;  4QW2 A;  4BDY A;  3ZEH A;  3MEW A;  4UC4 A;  1KHC A;  3H8Z A;  5CIU A;  2RJF A;  2EKO A;  3H6Z A;  3OYC A;  4IUP A;  2LVM A;  2RI3 A;  2BKD N;  3SD4 A;  5C0M A;  5KE2 A;  2RHU A;  2EQM A;  3OY9 A;  2L3R A;  5C6S A;  4A4H A;  4IUV A;  2G3R A;  4QVZ A;  4E7J A;  4E7I A;  3ASK A;  3Q1J A;  2M1H A;  1WGS A;  2O4X B;  3DB3 A;  2EQK A;  3BDL A;  2LTO A;  4FL6 A;  3P8H A;  4E7L A;  2GF7 A;  2HQX A;  2X4X A;  4BDZ A;  2R57 A;  3OYN A;  2RJD A;  5IN1 A;  3GOX A;  4Z02 A;  2RJC A;  4C5H A;  2EQU A;  1MHN A; 
#chains in the Genus database with same CATH topology
 2M02 A;  1QQJ A;  3QWX X;  2JXB A;  2JW4 A;  4FU6 A;  1M3C A;  1D0X A;  4JDS A;  1VQM Q;  3QO3 A;  3HSB A;  1IRX A;  3QJY A;  4CC3 A;  3G6E Q;  4MZP A;  4NL2 A;  2HMA A;  5KCH A;  6AT1 B;  4GY5 A;  1M90 C;  2GBQ A;  1M2V B;  1ZHI A;  3CCL A;  3TCJ A;  2CKK A;  3LYI A;  2XK0 A;  1K0S A;  4C5I A;  1SG5 A;  4X34 A;  3OBW A;  3UWN A;  4BUG A;  1N9S A;  2P84 A;  1M1F A;  4JJD A;  4DBR A;  3I55 Q;  2XIC A;  1I4K 1;  1PSE A;  2D8H A;  4M7A G;  1OX9 A;  2AKL A;  1RI9 A;  3UPU A;  2LRQ A;  2A28 A;  2K7A A;  2MWP A;  3CCE Q;  4L6V 5;  2DL7 A;  2NUP B;  3J80 E;  3JCM h;  2LQN A;  4JS4 A;  5GAO p;  3ULR B;  5A2Q E;  2X9H A;  3JCM b;  2O9V A;  5GAO l;  2KRO A;  2DKG A;  4UC4 A;  1OX8 A;  2RJF A;  2WSF E;  4FT2 A;  2LVM A;  4A54 A;  1JQQ A;  2XU8 A;  4ATO A;  2H3J A;  3U23 A;  1PD1 A;  1DJ7 B;  1VA7 A;  5C6S A;  4J9H A;  4XU1 A;  2EJF A;  2DYI A;  3CCJ Q;  3CXC S;  1KD1 U;  4M77 G;  2ROT A;  2RQT A;  1PG5 B;  3V8L A;  4F7U B;  4Z02 A;  3CC7 Q;  1TU0 B;  1RAF B;  2EJ9 A;  1PWT A;  4MZM A;  3CME T;  1AHJ B;  2X4J A;  1AWO A;  2K3Y A;  1WA7 A;  1YJ9 T;  1N8R C;  4OVA A;  3EH1 A;  3RES A;  4RG8 A;  2DAQ A;  3M0Q A;  4M78 E;  2RI5 A;  2CUD A;  1MMN A;  5GAN 2;  1R0B G;  2XDP A;  2EGE A;  1WXU A;  4KGV B;  2M0Y A;  4M7A F;  5KYN A;  1YHQ Q;  3TSZ A;  2C0O A;  4JLI A;  2RI2 A;  5GAN g;  3J81 E;  1MV3 A;  2J6F A;  2LC4 A;  1BK2 A;  4J5Y A;  1VQO T;  1M3A A;  1QVF A;  1B07 A;  3E9F A;  3LW5 E;  2JJ9 A;  4E7K A;  1X01 A;  4X9C A;  4OB3 B;  1BIA A;  2HDA A;  3WXM B;  1IB8 A;  5GAO q;  1M30 A;  1UB4 A;  3C12 A;  3FC3 A;  2BUD A;  2VV5 A;  3H9N A;  1JJ2 S;  2CRE A;  3KXT A;  2PU9 B;  2QDY B;  4ZNX A;  1OOT A;  3P8B B;  2A7Y A;  2EGC A;  2KY9 A;  2GGR A;  4J8O A;  4M7D G;  2JM8 A;  4V2S A;  3OBY A;  1C1A A;  4KRT A;  3LGF A;  5M9O A;  3EGD A;  1D3B B;  4M77 F;  5GAN h;  5A0D A;  1PSF A;  1N5Z A;  1AEY A;  3BDL A;  2LTO A;  1NZ9 A;  1NG2 A;  3L2Z A;  2CH4 A;  2RJD A;  5IN1 A;  1KG1 A;  1PCX A;  1RLQ C;  2KAF A;  3FJP A;  5CKB A;  3QDF A;  3CCV A;  2VYT A;  2F2V A;  4EDU A;  1I8F A;  2FRY A;  4Z88 A;  1CSK A;  2AIR B;  4A4E A;  2VAS A;  1VQ6 A;  1BCO A;  2O4X A;  4C0Z A;  3SFM A;  5GAN 8;  2MF2 A;  2QAZ A;  3PVL A;  3ZL7 C;  2P0P A;  4ELZ C;  3CXC P;  5J26 A;  3G1J A;  2OTJ A;  1G3W A;  4M4Z A;  4XTZ A;  1VQ8 Q;  2MWO A;  4OB0 B;  3E2U A;  4AG1 C;  3CCV T;  2E6N A;  3REA B;  1GBR A;  4E6R A;  2ED1 A;  3A8H B;  1TUC A;  2XI9 A;  1QP3 A;  4HT8 A;  2J7I A;  3LX7 A;  3VS4 A;  3OYJ A;  4BD3 A;  2VB6 A;  5GAN 6;  3M56 A;  2NUZ A;  5FRO A;  3I56 T;  2Y4Y A;  1UHF A;  2E41 A;  2EFI A;  2A0F B;  1LPL A;  2CSQ A;  4PL6 A;  5DM7 R;  3R6O A;  1BU1 A;  5CAI A;  2D9T A;  3R6N A;  1K9M U;  1UGR B;  5CCA A;  1I5L A;  3OYY A;  1KC8 U;  3OYK A;  2ZPH B;  1QP2 A;  1HK9 A;  3RER A;  2LJ1 A;  5LJ3 j;  1RUW A;  4J6X A;  1YBY A;  5KYW A;  2P4T A;  3OS2 A;  1WDX A;  3BFM A;  3HHT B;  3OYC A;  1JXO A;  4PFP A;  1RLP C;  3EG9 A;  1VQM T;  2KT8 A;  2CT3 A;  2CP7 A;  4E7I A;  1JJ2 P;  2O4X B;  3G6E T;  1GCQ A;  2HD0 A;  5LJ5 j;  1FX7 A;  4BDZ A;  3CCL Q;  4OB1 B;  3A8G B;  2OTL A;  2JS0 A;  1NLP C;  4XU2 A;  3QXE B;  1QKX A;  1TTH B;  1WZO A;  4EPC A;  2KGT A;  1SKU B;  5KE3 A;  2EKH A;  3URG A;  4X1V A;  2NWM A;  1Q86 C;  2K3X A;  5FW9 A;  4HCC A;  1M5Q 1;  3X24 B;  2QXF A;  2E70 A;  1MNE A;  3EG1 A;  2OTL T;  1B34 A;  3VS6 A;  5KYX A;  3L2R A;  2M16 A;  3QJ6 A;  4M7A C;  1PNJ A;  4ZGD B;  3DLL A;  1G5V A;  3O8V A;  2KMT A;  4FCY A;  1CKA A;  5GAM e;  1Q82 C;  3QSU A;  1I5O B;  1Y7X A;  2EW3 A;  2FZC B;  4FW2 A;  2DPP B;  2E6Z A;  1EX4 A;  3I9Q A;  2W10 A;  4LUE A;  3H0F A;  5GAM d;  3E1S A;  4M7A B;  1S72 T;  3M0U A;  5D6Y A;  5HCK A;  2X35 A;  2Z0W A;  2OI3 A;  3I35 A;  2VC8 A;  1KHI A;  4C8Q A;  1NJI U;  1XJW B;  2DEU A;  4D8D A;  2QTV A;  3M57 A;  2BZY A;  3C0C A;  2XDB A;  2SRC A;  2KXD A;  1X6G A;  1GL5 A;  1Y07 A;  2DYB A;  4FSX A;  5IXB A;  4OP0 A;  2KYB A;  1GFC A;  2XD0 A;  3G4S A;  2LCC A;  1X69 A;  2DJZ A;  3CBM A;  1G8X A;  2A37 A;  2JS2 A;  5FU6 C;  1MMA A;  1TSF A;  1E7O A;  5HY6 A;  3QZ5 B;  2DL3 A;  3OY9 A;  3CPF A;  4DBH A;  4ANJ A;  1S1N A;  1UGV A;  4C0F A;  4M77 B;  1FMK A;  3G4S T;  1TG0 A;  3TVT A;  2L2P A;  4M7D D;  2DNU A;  3EHR A;  3EG2 A;  2CYZ B;  2ZPE B;  1HD3 A;  2LJ0 A;  1MHN A;  4B6M A;  3H41 A;  1YI2 A;  2QAS A;  3MEU A;  1OUL A;  1QW1 A;  5CVI A;  4M78 F;  4CRI A;  2C0I A;  2FL7 A;  1OU8 A;  4J7I A;  3OSS C;  3HL8 A;  5FU6 B;  2HQH A;  3X25 B;  3PVQ A;  3GNG A;  1WXB A;  3M4G A;  4PJO A;  3GLX A;  1IGU A;  4DEY A;  1YWO A;  2ZPF B;  3V7R A;  2QQR A;  4J9C A;  4RKU E;  1YCY A;  1TOV A;  3E9G A;  2HKN A;  5I2M A;  1C6V X;  1YI2 T;  1YFN A;  2KXC A;  2LQW A;  3MCA B;  2DEQ A;  2MIO A;  4PFO A;  2F5T X;  2F2W A;  1KJW A;  1KQS A;  4GLK A;  1ZLM A;  4F14 A;  3BY7 A;  4R56 A;  2V8I A;  3WVE B;  4M7D C;  3QG1 A;  2E5Q A;  2AZV A;  2HZY A;  1OYX A;  3M55 A;  2GQI A;  1Q95 G;  3JB9 G;  1G3T A;  2P4R A;  4LD6 A;  3IQL A;  5GAM h;  4IIM A;  2HAX A;  3F70 A;  2CGH A;  5EC7 A;  1YN8 A;  3HKS A;  2E3I A;  2JTF A;  2JZ2 A;  1VQN T;  2KYM A;  2WAC A;  1M4Z A;  2NUT B;  3VS5 A;  3JV3 A;  2CP0 A;  4BI4 A;  2L8D A;  4M7D B;  2RNA A;  2YRC A;  3CBP A;  2KRN A;  2RJE A;  1M90 R;  1QVG A;  2FO0 A;  2RQV A;  2EYZ A;  4KT0 E;  4C92 A;  1M2V A;  3M58 A;  1Q7Y C;  1ZQ1 A;  3CCU A;  3CCV Q;  1T0H A;  2LX9 A;  3T9N A;  3GPL A;  4C92 D;  1VQ6 Q;  2V1Q A;  4E7Z A;  4C8Q E;  3OSV A;  3KBG A;  2DMO A;  4PK4 A;  2COW A;  4E7J A;  4JUV A;  2W0Z A;  2K57 A;  4YTL A;  3P8H A;  1XQH A;  2GF7 A;  2KR3 A;  1M1K C;  1W2B A;  3O5Z A;  4C5H A;  1VQ8 T;  3V7C A;  3JCM c;  1Y0M A;  1M90 U;  4HVU A;  2AKK A;  4RMO A;  3RDV A;  1V76 A;  3L42 A;  5CO7 A;  3BE3 A;  1VQ9 A;  2AHJ B;  4N4H A;  3UT1 A;  1ZBJ A;  2VWF A;  4RTT A;  4FSS A;  1YIJ A;  3CD6 A;  5KCO A;  1WJQ A;  2XDD A;  2YT6 A;  1UE9 A;  5LJ3 f;  1VQ7 A;  1TS9 A;  2M9U A;  1EFN A;  1BYM A;  4C92 C;  1TXQ A;  1MV0 B;  2FEI A;  4MML A;  4ELY C;  1SF9 A;  1VQ9 T;  2OAU A;  5GAN j;  3L2V A;  1IHV A;  1YIJ T;  3JB9 F;  3CD6 T;  1FMV A;  2RK1 A;  3FIF A;  4RTV A;  4DOW A;  3OB9 A;  1K1Z A;  5AT1 B;  4XU3 A;  2JUF A;  5LJ5 f;  1HJD A;  2E5K A;  4PJO E;  3OS1 A;  2QA4 A;  1WJS A;  5KYY B;  3HRT A;  3M0P A;  4C92 B;  4F7U A;  4HCZ A;  1GCP A;  2LCS A;  4IUR A;  2D8J A;  4OGC A;  4XTX A;  4R55 A;  4LD9 K;  2DER A;  1R0C B;  5GAO n;  1N8R R;  3QYG B;  3UA6 A;  2H8H A;  4QQ6 A;  3QKJ A;  1WYX A;  4M75 G;  1UJY A;  2QGG A;  2OTL Q;  2YWW A;  1K8A C;  3A1P A;  2LZ6 B;  1UEB A;  2RK2 A;  3CCL T;  2EBP A;  4EMK A;  2MPX C;  2K79 A;  3L2U A;  2RPN A;  3M5A A;  1PHT A;  2RB6 A;  3PMT A;  3L1A A;  1ZSG A;  1QCF A;  5IT9 E;  2RI3 A;  2AK5 A;  1KD1 R;  1WX6 A;  5GAN e;  1FMW A;  2CS7 A;  4QKU A;  1S72 Q;  2J6K A;  1N8R U;  1SHG A;  2CP2 A;  4VUB A;  2ZGW A;  2ZPI B;  4J6W A;  2ZAE A;  3TU4 K;  3FDR A;  5GAN d;  2BZX A;  3V8J A;  3VS0 A;  3L2Q A;  1AWX A;  4P5N A;  1N9R A;  2JNG A;  4QVD A;  1TUG B;  2ECZ A;  3SDZ A;  2COY A;  3M0R A;  2SEM A;  4BE1 A;  1U06 A;  2CUB A;  2GFA A;  1UG1 A;  1M8V A;  1ZUU A;  3S6W A;  4JRK A;  4J6Y A;  1IXD A;  2JN0 A;  4EMK C;  4LN2 A;  1D3B A;  1VQP A;  1SEM A;  1K9A A;  1NEB A;  4J9I A;  2IVW A;  8ATC B;  1RAI B;  2NLU A;  1OEB A;  2QDL A;  2MMP A;  2KDS A;  3G4S Q;  1QWF A;  4E47 A;  4K11 A;  2L3P A;  4M75 F;  4EMK B;  3SEM A;  2DK3 A;  3HFO A;  3FLG A;  3QHS A;  3FRN A;  3OW2 A;  1IRE B;  5IHN A;  2VKN A;  3JCM f;  1V29 B;  1K73 R;  4FIB A;  2F2X A;  1H8K A;  1QCO A;  2DIG A;  2LX7 A;  4OMN A;  2BIV A;  4FT4 A;  2K9G A;  1YI2 Q;  2RF0 A;  2PVO B;  4QW2 A;  4F7U E;  3GIB A;  1GBQ A;  3H6Z A;  1YJN A;  5C0M A;  2CDT A;  3I5R A;  1IHW A;  1BB9 A;  2YXY A;  4E7L A;  4PJL A;  1ZSZ C;  2EIF A;  3OYN A;  2FPF A;  1K73 U;  2K4Y A;  3V8K A;  4KGZ B;  2CP3 A;  1AZG B;  3FEO A;  4KUL A;  4NS5 A;  3OQ5 A;  3JCM W;  1VQN Q;  2L3S A;  2DZ9 A;  3UAT A;  2DXB A;  3LH5 A;  3REB B;  1ZUK A;  1YCS B;  1ZSZ B;  1JO8 A;  2WSE E;  3CPW A;  3JCM V;  2JMA A;  2L3Q A;  3OYB A;  4IUU A;  2X51 A;  2X3W D;  3KFV A;  2GCX A;  3CQT A;  2AT1 B;  3ZFJ A;  1M9S A;  2LCL A;  1VQ4 A;  4AFQ C;  1QVP A;  1BBZ A;  2V8K A;  1H3Z A;  3MJX A;  1ABO A;  1TH7 A;  1K9M R;  4PLI A;  2O2O A;  1KC8 R;  2HQE A;  1X2Q A;  3JRZ A;  3CMA A;  4MDX A;  1VQ6 T;  4WTO B;  3NPF A;  5GMK i;  1GXI E;  2QQB A;  3EHQ A;  2FHD A;  1N27 A;  1OU9 A;  1WJR A;  1NYF A;  2QK0 A;  4J9G A;  4C8Q F;  1M2O A;  2OTJ T;  3HPW A;  2O31 A;  1QVF P;  4KUI A;  2VXE A;  3HRU A;  3PNW C;  1BI0 A;  2EYX A;  2RM4 A;  3ZEH A;  1VQ9 Q;  1WFW A;  3H8Z A;  2DRM A;  4RTZ A;  1YIJ Q;  5CR2 A;  3CD6 Q;  2RHU A;  2RQU A;  1PKT A;  4XTV A;  4IUV A;  1VQ7 Q;  4CC4 B;  1Q86 U;  1LJO A;  3NGP A;  1OQK A;  1SSH A;  4NL3 A;  4M7A A;  3RMQ A;  1VQK A;  2YRD A;  2COZ A;  1Q81 C;  1KK7 A;  1B3Q A;  4AFS C;  1BI2 A;  1T3S A;  3VUZ A;  3A5Z B;  5EG2 A;  3ER0 A;  5GAM j;  2I0N A;  4M7A D;  2HKQ B;  2RO0 A;  5GJW B;  2VXF A;  1GRI A;  2DA9 A;  2KQW A;  5J39 A;  5DLQ E;  4J7F A;  1QWE A;  1UGS B;  1UGP B;  2DE0 X;  1Q82 U;  2I2L A;  2VUB A;  4FW1 A;  3EGX B;  2KI7 A;  2QA4 Q;  2X4Y A;  2HCK A;  3UF4 A;  2R58 A;  2CZ6 B;  2DL4 A;  1SHF A;  4OMQ A;  2A08 A;  4RCC A;  4PJO F;  1IO6 A;  2EQJ A;  1X6O A;  2KBT A;  4BI3 A;  1P92 A;  1WIE A;  2L5Q A;  4M75 C;  5CK9 A;  4A53 A;  4M77 A;  1NJI R;  4M78 G;  4BE2 A;  2J06 A;  2RHZ A;  3BW1 A;  1W6X A;  2LQ8 A;  2EYW A;  4M77 D;  1JB0 E;  4LDY A;  2D1X A;  1KIK A;  4DA4 A;  4HVV A;  5CKD A;  2DF6 A;  1T0J A;  4NOY A;  1YP5 A;  1PRM C;  4M75 B;  2MOX A;  1I81 A;  2PVG B;  3LGL A;  3QUI A;  3MP6 A;  1RAE B;  3CCQ A;  3JAM E;  1BIB A;  4Y92 A;  4C5E A;  7AT1 B;  4BDY A;  1OPL A;  2PUK B;  4ZGE B;  3M53 A;  1NYG A;  2K3B A;  4IUP A;  1RAC B;  5IH2 A;  3NMZ C;  4XAX B;  4RTY A;  1RAB B;  3CCR A;  3VRZ A;  2RH2 A;  3CCQ T;  1KQ1 A;  3M0S A;  1UJ0 A;  3EFO B;  4M77 C;  2LMJ A;  2ZCF B;  1J3T A;  1FWZ A;  5ECA A;  3CC2 A;  4XK8 E;  1UHC A;  3INZ A;  1JXM A;  3GOX A;  2YUO A;  2XHC A;  1NLO C;  3MEV A;  2AZS A;  1LCK A;  4D8K A;  4JS5 A;  3CC7 A;  1YWP A;  2LDM A;  2DFU A;  3OA6 A;  1Y96 B;  1WXT A;  3M0T A;  4N4G A;  4EMG A;  1ZA1 B;  4HXJ A;  2NUT A;  3CCR T;  4F17 A;  3CCS A;  2FYK A;  1NEG A;  2ED0 A;  3M9Q A;  4M7D A;  2JM9 A;  3CC2 T;  4ZTF A;  2E3H A;  1WHM A;  4M7A E;  4BI8 B;  2K2M A;  2MK5 A;  1KQS S;  5GMK m;  5A0L A;  1KSW A;  1VQL A;  1M3B A;  3OYF A;  1BKB A;  3CC4 A;  3NFC A;  4Q5W A;  2RQR A;  1G83 A;  3UDC A;  1YHQ A;  1I0C A;  5HKC A;  3VJP A;  2F1L A;  4II1 A;  4F04 B;  2GQV A;  3GF5 A;  1Z9Q A;  1HYO A;  3VS1 A;  2BTT A;  5LJ3 g;  1Q7Y U;  3D7S B;  3AHU A;  4N4I A;  3X28 B;  3TRE A;  2ZPB B;  5A0G A;  1MMG A;  1Y57 A;  2PUO B;  2EYY A;  1QVG S;  2FRW A;  2M0O A;  5L23 A;  2YLB A;  1NPP A;  5DY9 A;  4CI0 C;  2RD1 A;  4AMC A;  4BAC A;  4M77 E;  3C94 A;  1SSF A;  4QT7 A;  4FYY B;  2E4H A;  2DBM A;  2MCN A;  1M1K U;  3MEA A;  5LJ5 g;  1BI3 A;  5CIU A;  1ZA2 B;  3E19 A;  2C06 A;  3ASK A;  2B86 A;  3Q1J A;  1WHJ A;  2EQK A;  2M51 A;  1W2B S;  1WLP B;  2HL3 A;  1K0X A;  5KYY A;  2R57 A;  3H0I A;  2FPD A;  2RJC A;  5FRM A;  1G3S A;  3NTI A;  4JJB A;  2VGN A;  2E1H A;  1ZBX A;  3VYG A;  4O5V A;  3CCM A;  1VQ4 Q;  3RR6 A;  3OYA A;  2HL5 C;  3JCM J;  3OYG A;  4EMH A;  1ZUY A;  4JLG A;  5GMK l;  3LWI A;  4ZN3 A;  4J9F A;  2YLC A;  2XG8 D;  2GFU A;  3GNF B;  2OTJ Q;  4JJN K;  2LP5 A;  2RHY A;  3KUF A;  4PJN A;  3C4S A;  3SWN A;  3CCU T;  2V26 A;  3TEE A;  4RUG A;  4XTU A;  1U8R A;  2CP6 A;  1M8M A;  2NYS A;  2V8J A;  3RMS A;  2DL8 A;  1F1B B;  2QYZ A;  3DLM A;  5IAY A;  2F5K A;  4XU0 A;  2JTM A;  3HP9 A;  1SRM A;  2L0A A;  2BZ8 A;  1YIT A;  2OAW A;  4M7D E;  4C5G A;  5GAM f;  4KGX B;  4IUT A;  1K8A U;  2FB7 A;  1WPY A;  3FJ5 A;  1MGQ A;  2OX7 A;  4XTW A;  4RTW A;  1KQS P;  5GMK e;  2QEX A;  4LDV A;  3EH2 A;  1K4U S;  1VQK Q;  1QMC A;  2P0Q A;  1VQ7 T;  1KFZ A;  1YIT T;  3VS3 A;  1U5S A;  1YJW A;  4M78 D;  2XKO C;  2ATC B;  4HCK A;  3M54 A;  4DEX A;  3SWN C;  1JBM A;  3DKM A;  3JCM P;  3HRS A;  2QEX T;  3H0H A;  1M1G A;  2EKO A;  4QVC A;  3G71 A;  5KE2 A;  5IHI A;  1ZX6 A;  1VYT A;  4MMK A;  1SRL A;  1UFF A;  5J3B A;  1YJW T;  5IHK A;  1OV3 A;  4BY6 C;  2QA4 T;  1QVG P;  1IZ6 A;  3PT9 A;  2CT4 A;  2DIL A;  2HBW A;  3VS7 A;  3RIR A;  3WVD B;  3JCM g;  3SWN B;  1ACM B;  2HSP A;  3OYM A;  2BKD N;  2FZK B;  3HFN A;  5GAN 3;  2DET A;  3G71 T;  4PJM A;  1VQ5 A;  1LNX A;  2BE7 D;  4A4G A;  1D1A A;  4ESR A;  4E7S A;  3JB9 H;  4LDU A;  3ZBD A;  2DVJ A;  4BY6 B;  1W70 A;  2QTX A;  4M78 C;  1W4S A;  4OMF B;  4BE0 A;  3LH0 A;  1W2B P;  2DM1 A;  2E65 A;  2K6D A;  1NE8 A;  2QI2 A;  1C0M A;  1VQ5 T;  2DJQ A;  1I1J A;  4C92 E;  2J6O A;  1AT1 B;  4KH1 B;  5GAN 7;  4B9W A;  2OJ2 A;  2IG0 A;  2RA2 A;  1RI0 A;  1PKS A;  4PJJ A;  4M78 B;  3CCQ Q;  1OZ3 A;  2MI6 A;  2YHT A;  3PE0 A;  2CZ1 B;  1OZ2 A;  1WHH A;  4LE9 A;  3NTH A;  2QG9 B;  3HTR A;  3QII A;  1NM7 A;  2HNI A;  4HA8 A;  2XMF A;  2EVR A;  1AD5 A;  4JJC A;  3TQ7 P;  4RTX A;  2O01 E;  1VYU A;  3RBB B;  4FYX B;  3OW2 S;  5HK0 A;  4J9B A;  4LDX A;  2EAY A;  3CME A;  2JOY A;  3EFR A;  2GNC A;  3VKI A;  3CCR Q;  5FRN A;  3QWY A;  3VS2 A;  1M27 C;  2EGA A;  2X4W A;  2J05 A;  1YJ9 A;  2EPD A;  4R0K A;  1Z9Z A;  1YNZ A;  4JRI A;  3P8D A;  3CC2 Q;  1ZSZ A;  4D6W A;  2E64 A;  1QVF S;  4PLL A;  3QDR B;  4RG2 A;  5D6X A;  8AT1 B;  2EWN A;  5GMK h;  1X75 C;  1UEC A;  2IPO B;  2MAM A;  4ME7 A;  4WCI A;  1VQP T;  1MMD A;  3MEW A;  5IXF A;  1WQ7 A;  3CCS Q;  3VUB A;  4JZ3 A;  4KBM B;  2G3R A;  2PVD B;  4Z89 A;  2KE9 A;  4OMP A;  4OB2 B;  5GJV B;  4HKE A;  3M59 A;  2DTO A;  1PRL C;  2D6F A;  3CXC A;  1B7T A;  2KSS A;  2DTH A;  1UTI A;  3JB9 D;  1PC0 A;  1VQL Q;  2RN8 A;  1VQO A;  1MND A;  3SB2 A;  3CC4 Q;  2PTK A;  3S3O A;  4C8Q G;  1VIE A;  4LNP A;  2LNV A;  4RTU A;  1TWB A;  3EGU A;  3ME9 A;  1KD1 C;  4OF1 A;  3A8O B;  1FXX A;  2DL5 A;  5KH6 A;  1WHK A;  1AVZ C;  3CPW S;  3JB9 J;  4GLM A;  1IGQ A;  1SPK A;  1X2K A;  4LXC A;  1R8O B;  1X6B A;  5KYU A;  2O88 A;  1YJN T;  3OS0 A;  1PM3 A;  4KH0 B;  2L89 A;  1Q81 R;  1PD0 A;  4XQ3 A;  1WNL A;  4CC7 A;  1A0N B;  3BDU A;  5I2S A;  4N0A A;  3DB4 A;  2E12 A;  1OI1 A;  2GTO A;  2BE9 B;  1D09 B;  1AWJ A;  3X20 B;  1Y71 A;  2LNH B;  2R5A A;  2ZZD A;  3JCM Q;  1VOM A;  2KRM A;  4O6J A;  2JVV A;  1R77 A;  3NTK A;  5CKE A;  4TVR A;  9ATC B;  3EG0 A;  1E6H A;  1QCN A;  5HK3 A;  3EGX A;  2EJG A;  2JMC A;  3EFS A;  4J83 A;  3RNJ A;  4PJO G;  1JJ2 A;  3C95 A;  1X27 A;  3RUX A;  3LWH A;  3CCU Q;  4AFU C;  1Q81 U;  3CCM Q;  3X26 B;  2FVU A;  3CBO A;  3OW2 P;  1Q86 R;  2ENM A;  1VQ4 T;  4AFZ C;  5AYF A;  3I5S A;  1XTD A;  2DO3 A;  2WSC E;  2EQM A;  2Y4X A;  3PGG A;  3V7S A;  4HVW A;  1I07 A;  4A4H A;  1ABQ A;  1X43 A;  1NPR A;  1G3Y A;  4FL6 A;  2LT1 A;  1K73 C;  5I21 A;  4MDW A;  4FM4 B;  3I56 A;  1XOV A;  4N0A C;  4AG2 C;  3G7Z A;  2EQU A;  1Q82 R;  3JSC A;  1WI7 A;  3CMA T;  2HEQ A;  1LVK A;  1WQW A;  5KYU B;  1RAH B;  5GAN f;  1HSQ A;  2D0Q B;  2KVQ G;  4M75 A;  4QQG A;  5L8R E;  2K5I A;  2DD4 A;  4DOV A;  5CQY A;  1K76 A;  1XNI A;  3GBQ A;  1YIT Q;  1JRI A;  3RKX A;  4QQD A;  4M75 D;  1VUB A;  1UUE A;  3MP1 A;  2VGM A;  4C92 G;  4L59 A;  3EG3 A;  2QEX Q;  3TSW A;  4ORZ A;  4M7D F;  3EGD B;  3QYH B;  4JPB W;  4FYV B;  2A36 A;  4IIO A;  2DBK A;  2X3X D;  4J9E A;  4OMM A;  2YUN A;  1YJW Q;  1VQK T;  3OMG A;  1VQM A;  3VRY A;  3EFO A;  1AOJ A;  1RAA B;  2YUQ A;  2RHI A;  3G6E A;  4IKF A;  2R5M A;  3CPW P;  2EYQ A;  1D0Z A;  4Y91 A;  2QQ9 A;  2KEA A;  2DVE A;  2D0N A;  2K5F A;  2CZ7 B;  4A63 B;  1D1B A;  3G71 Q;  1Y96 A;  2DZC A;  2B8A A;  3QZ9 B;  3PIP A;  3THK A;  1HXD A;  2LJ3 A;  2DTI A;  1QKW A;  4JRQ A;  2MYS A;  1UDL A;  3JB9 I;  1U1S A;  4E7H A;  3RKY A;  1NBE B;  5FWB A;  2ROL A;  3MHX A;  4ZTJ A;  3I55 A;  4PNO A;  3S3M A;  2XID A;  1K9M C;  3PMI A;  4Z8A A;  2K5L A;  2PZ1 A;  1KC8 C;  3QBY A;  1VQ5 Q;  3AT1 B;  3M4Y A;  2DX1 A;  2DXT A;  5FU7 C;  3SD4 A;  4HCB A;  1U3O A;  2YDL A;  2HBP A;  4DBF A;  3CCE A;  2L3R A;  3A8M B;  4DQ2 A;  4MZT A;  1D1C A;  4LUD A;  2M1H A;  3I55 T;  3DB3 A;  1OPK A;  1JEG A;  5LL6 S;  2HQX A;  1S72 A;  5LJ3 e;  1E6G A;  4X9D A;  4F7U G;  3FB9 A;  4WF2 A;  3OMC A;  3CCE T;  5FU7 B;  1T3L A;  1RAD B;  2ZPG B;  1RL2 A;  2LT4 A;  4PKC C;  5LJ3 d;  4C92 F;  3OYE A;  4J9D A;  2K2V A;  4A4K A;  3MET A;  2H3E B;  4IUQ A;  1H92 A;  2KK4 A;  1KQ2 A;  1EZZ B;  3OYL A;  1GCQ C;  3A8L B;  3CCJ A;  2KT1 A;  5LJ5 e;  1BCM A;  1W1F A;  5KYW B;  1H3H A;  2DRK A;  3CME Q;  1VQP Q;  1UGQ B;  3PTA A;  3MO8 A;  4C8Q D;  1O9S A;  3MPU B;  1YJ9 Q;  1G2B A;  3EG9 B;  5LJ5 d;  2FG0 A;  2P0K A;  4DBQ A;  4M75 E;  4C0D C;  4ZGJ B;  3OYH A;  3CCJ T;  1H64 1;  4ZN1 A;  3VV0 A;  1Q7Y R;  2YRV A;  3S3N A;  1FYN A;  3CC7 T;  5GAN 4;  3QPH A;  2A3L A;  4B9X A;  4A4F A;  2PQW A;  3CCS T;  2E10 A;  3N5B B;  2CP5 A;  4AT1 B;  3OYD A;  2ABL A;  1GFD A;  2IIM A;  2DD5 A;  4C0D B;  2C0T A;  2DXC A;  4CC2 A;  1M1K R;  1B34 B;  5KYX B;  4GBQ A;  5CQX A;  1NJI C;  3LLR A;  2PNI A;  1VQO Q;  1N6A A;  2Y90 A;  2JTE A;  3EAE A;  1VQL T;  2CZ0 B;  4C8Q C;  1YJN Q;  1KHC A;  3CC4 T;  2O9S A;  3RKW A;  4C0G A;  3VYH B;  5GAM g;  3VU3 C;  1YHQ T;  1LOJ A;  4F7U F;  1WGS A;  2FPE A;  2KRS A;  2FZG B;  3JCM X;  4PJO D;  5D7U A;  4E2F B;  3UA7 A;  4C8Q B;  2RQW A;  4OGE A;  4FYW B;  2GTJ A;  2EQI A;  1D0Y A;  5CKH A;  3CEY A;  5GAO r;  1VQN A;  3GP8 A;  5FWC A;  2QQA A;  4F16 A;  4PFZ A;  2RHX A;  4EIK A;  5LJ3 h;  4L5G A;  2DXU A;  1QLY A;  2G6F X;  2CH4 W;  5D6W A;  1MUZ A;  5GMK j;  1RAG B;  3OYI A;  3MP8 A;  5FLX E;  1AWW A;  5GAN 5;  1WHL A;  3A98 A;  2F69 A;  3NHN A;  2KNB B;  5CKF A;  4PJO C;  4OMO A;  1K8A R;  2YSQ A;  1V1C A;  3JCM e;  2DIQ A;  5LJ5 h;  5I11 A;  2JT4 A;  4JZ4 A;  1WHG A;  1JU5 C;  1CKB A;  4KUD K;  3SHW A;  2HSE B;  3CMA Q;  3CCM T;  1VQ8 A;  3MKD A;  3JCM d;  2YUP A;  1ARK A;  1VYV A;  4HT9 A;  5DLO A;  4PJO B;  3PFS A;  2VVK A;  3I56 Q;  2ESW A;  2QQS A;  3L2W A;  2LQK A;  3PIO A;  1U1T A;  4OML A;  2DLP A;  4RCB A;  1AZE A;  5I22 A;  1O75 A;  3J7A F;  1EIF A;  2NUP A;  4Y28 E;  5GAO m;  4M78 A;  4QVZ A;  1BI1 A;  4LDW A;  4JRP A;  2V1R A;  4XTY A;  1TUD A;  2X4X A;  3OS5 A;  1VIF A;  4BB7 A;  2RMO A;  2QGF B;  2CSI A; 
#chains in the Genus database with same CATH homology
 3JB9 D;  2VXF A;  1YI2 A;  1VQO A;  3MEU A;  5CVI A;  1QW1 A;  4CRI A;  4M78 F;  2KQW A;  2FL7 A;  3SB2 A;  5J39 A;  4J7I A;  3S3O A;  4C8Q G;  3OSS C;  4J7F A;  5DLQ E;  1VIE A;  1UGS B;  3HL8 A;  1UGP B;  4FU6 A;  5FU6 B;  2LNV A;  4JDS A;  3X25 B;  3QO3 A;  1Q82 U;  3HSB A;  3GNG A;  2I2L A;  1MHN A;  3M4G A;  3GLX A;  3ME9 A;  2VUB A;  3QJY A;  1KD1 C;  4PJO A;  4MZP A;  4OF1 A;  2ZPF B;  3V7R A;  2X4Y A;  2QQR A;  3A8O B;  4NL2 A;  1FXX A;  5KH6 A;  4RKU E;  5KCH A;  1YCY A;  3CPW S;  2R58 A;  3E9G A;  5I2M A;  3JB9 J;  2CZ6 B;  4GY5 A;  1YI2 T;  1M90 C;  1ZHI A;  3MCA B;  2DEQ A;  3TCJ A;  2CKK A;  3CCL A;  3LYI A;  2XK0 A;  4RCC A;  4PJO F;  4C5I A;  2EQJ A;  4X34 A;  3OBW A;  3UWN A;  1R8O B;  1X6O A;  4BUG A;  2F5T X;  1N9S A;  4BI3 A;  1YJN T;  1KQS A;  1M1F A;  3OS0 A;  1P92 A;  4GLK A;  2L89 A;  2L5Q A;  4M75 C;  5CK9 A;  4A53 A;  3BY7 A;  4XQ3 A;  4M77 A;  2XIC A;  4R56 A;  1WNL A;  2V8I A;  3BDU A;  3WVE B;  5I2S A;  4M78 G;  3QG1 A;  4N0A A;  4M7D C;  3DB4 A;  2E12 A;  1I4K 1;  2E5Q A;  4BE2 A;  1OI1 A;  1PSE A;  1OYX A;  2RHZ A;  3M55 A;  4M7A G;  3BW1 A;  3JB9 G;  3X20 B;  1G3T A;  2LQ8 A;  1Y71 A;  4M77 D;  4LD6 A;  1JB0 E;  5GAM h;  3UPU A;  2R5A A;  2ZZD A;  2HAX A;  3F70 A;  4LDY A;  3JCM Q;  2CGH A;  2LRQ A;  3HKS A;  2JTF A;  4O6J A;  2JVV A;  3NTK A;  2MWP A;  4DA4 A;  5CKD A;  5CKE A;  4NOY A;  4TVR A;  4L6V 5;  2JZ2 A;  1VQN T;  2WAC A;  4M75 B;  1M4Z A;  3J80 E;  1I81 A;  3JCM h;  5HK3 A;  4JS4 A;  2EJG A;  4BI4 A;  5GAO p;  2L8D A;  2PVG B;  3EFS A;  3LGL A;  4J83 A;  3CBP A;  3QUI A;  4PJO G;  5A2Q E;  1JJ2 A;  4M7D B;  3MP6 A;  3C95 A;  2RJE A;  3JCM b;  3CCQ A;  4C92 A;  4KT0 E;  3RUX A;  1QVG A;  5GAO l;  3JAM E;  3LWH A;  1BIB A;  3M58 A;  1Q7Y C;  1ZQ1 A;  4C5E A;  3CCU A;  1Q81 U;  2LX9 A;  3T9N A;  3X26 B;  3GPL A;  4BDY A;  4C92 D;  2FVU A;  3CBO A;  2PUK B;  2DKG A;  4ZGE B;  4UC4 A;  3M53 A;  2RJF A;  2WSF E;  4FT2 A;  1VQ4 T;  4IUP A;  4C8Q E;  2LVM A;  4A54 A;  2XU8 A;  3OSV A;  3KBG A;  5AYF A;  2H3J A;  4ATO A;  1XTD A;  1DJ7 B;  2DO3 A;  2EQM A;  2WSC E;  2Y4X A;  3PGG A;  3V7S A;  4XAX B;  5C6S A;  4A4H A;  4E7J A;  3CCR A;  4XU1 A;  2RH2 A;  4JUV A;  1NPR A;  1G3Y A;  1KQ1 A;  4FL6 A;  3CCQ T;  2EJF A;  2K57 A;  4YTL A;  2LT1 A;  3P8H A;  1XQH A;  3CXC S;  4M77 C;  1K73 C;  5I21 A;  4M77 G;  1KD1 U;  2ZCF B;  2GF7 A;  4MDW A;  4FM4 B;  3I56 A;  1FWZ A;  1W2B A;  1XOV A;  4N0A C;  4XK8 E;  1M1K C;  3CC2 A;  3INZ A;  3GOX A;  3G7Z A;  3V8L A;  4Z02 A;  4F7U B;  2XHC A;  4C5H A;  2EQU A;  1VQ8 T;  3MEV A;  2EJ9 A;  3JSC A;  4JS5 A;  3CMA T;  3CC7 A;  3V7C A;  3JCM c;  2LDM A;  4MZM A;  3OA6 A;  3CME T;  1M90 U;  1AHJ B;  4RMO A;  1WQW A;  1Y96 B;  3L42 A;  2X4J A;  5CO7 A;  5GAN f;  4N4G A;  4EMG A;  2D0Q B;  1VQ9 A;  2AHJ B;  2KVQ G;  4M75 A;  4N4H A;  2K3Y A;  3UT1 A;  3CCR T;  4QQG A;  5L8R E;  1YJ9 T;  2K5I A;  4OVA A;  1N8R C;  2DD4 A;  3CCS A;  1YIJ A;  2FYK A;  4DOV A;  3RES A;  3M9Q A;  5CQY A;  5KCO A;  3CD6 A;  1WJQ A;  1XNI A;  4RG8 A;  2XDD A;  4M7D A;  3CC2 T;  1JRI A;  5LJ3 f;  4QQD A;  3RKX A;  4M75 D;  2DAQ A;  1VQ7 A;  1VUB A;  4M78 E;  4ZTF A;  3MP1 A;  2M9U A;  2RI5 A;  1BYM A;  4C92 C;  4M7A E;  2VGM A;  4C92 G;  5GAN 2;  4L59 A;  4BI8 B;  4MML A;  4ELY C;  1VQ9 T;  1KQS S;  2XDP A;  5GMK m;  4M7D F;  5A0L A;  1VQL A;  2OAU A;  5GAN j;  3OYF A;  4M7A F;  3QYH B;  3L2V A;  3JB9 F;  1YIJ T;  1BKB A;  3CC4 A;  3CD6 T;  2RK1 A;  3FIF A;  3NFC A;  4Q5W A;  4DOW A;  3OB9 A;  3UDC A;  1YHQ A;  1VQK T;  3OMG A;  1VQM A;  5HKC A;  4JLI A;  2RI2 A;  3VJP A;  4XU3 A;  2JUF A;  5LJ5 f;  4IKF A;  2RHI A;  5GAN g;  3G6E A;  4PJO E;  2R5M A;  3J81 E;  3OS1 A;  2EYQ A;  2LC4 A;  2QA4 A;  1WJS A;  4II1 A;  4Y91 A;  2QQ9 A;  3HRT A;  4C92 B;  4F7U A;  4J5Y A;  4HCZ A;  1VQO T;  2GQV A;  1QVF A;  3GF5 A;  3E9F A;  3LW5 E;  4IUR A;  2DVE A;  2K5F A;  5LJ3 g;  4E7K A;  1X01 A;  2CZ7 B;  4OGC A;  4X9C A;  4OB3 B;  4XTX A;  4R55 A;  1BIA A;  1Y96 A;  1Q7Y U;  4LD9 K;  3WXM B;  3AHU A;  5GAO n;  2DZC A;  2B8A A;  3QZ9 B;  4N4I A;  3X28 B;  5GAO q;  3PIP A;  3QYG B;  1UB4 A;  3C12 A;  4QQ6 A;  1HXD A;  3FC3 A;  3QKJ A;  2BUD A;  2VV5 A;  2DTI A;  2ZPB B;  3TRE A;  5A0G A;  4JRQ A;  3JB9 I;  1JJ2 S;  4M75 G;  3KXT A;  2PUO B;  1U1S A;  4E7H A;  2PU9 B;  2QDY B;  3P8B B;  1QVG S;  2A7Y A;  2KY9 A;  3RKY A;  1K8A C;  3MHX A;  4J8O A;  2M0O A;  3I55 A;  4ZTJ A;  4M7D G;  2YLB A;  1NPP A;  1UEB A;  4PNO A;  5DY9 A;  2RK2 A;  4CI0 C;  2RD1 A;  2XID A;  4BAC A;  3S3M A;  1K9M C;  4M77 E;  3PMI A;  3CCL T;  2K5L A;  3OBY A;  4V2S A;  3C94 A;  4EMK A;  1SSF A;  1KC8 C;  3LGF A;  3QBY A;  3M5A A;  3L2U A;  2RB6 A;  3PMT A;  5M9O A;  1M1K U;  3L1A A;  3MEA A;  5LJ5 g;  1BI3 A;  3M4Y A;  5CIU A;  2DXT A;  1D3B B;  4M77 F;  5GAN h;  5FU7 C;  5A0D A;  5IT9 E;  2RI3 A;  3SD4 A;  3E19 A;  4HCB A;  2HBP A;  3CCE A;  2C06 A;  1PSF A;  2L3R A;  3A8M B;  4DQ2 A;  5GAN e;  4MZT A;  3ASK A;  3Q1J A;  2M1H A;  3I55 T;  3DB3 A;  2EQK A;  2CS7 A;  2LTO A;  1NZ9 A;  3BDL A;  5LL6 S;  1W2B S;  1N8R U;  4VUB A;  3L2Z A;  2ZGW A;  2HQX A;  2ZPI B;  2R57 A;  4J6W A;  1S72 A;  2RJD A;  5IN1 A;  5LJ3 e;  1KG1 A;  4X9D A;  2RJC A;  5FRM A;  1G3S A;  3TU4 K;  3FDR A;  3NTI A;  4F7U G;  3FB9 A;  2KAF A;  5GAN d;  3V8J A;  2VGN A;  3FJP A;  2E1H A;  5CKB A;  1ZBX A;  3VYG A;  3L2Q A;  4O5V A;  4WF2 A;  3CCV A;  3OMC A;  3CCM A;  2VYT A;  4EDU A;  5FU7 B;  1I8F A;  4P5N A;  1N9R A;  3OYA A;  2ZPG B;  3JCM J;  3CCE T;  3OYG A;  4EMH A;  1RL2 A;  2LT4 A;  4A4E A;  4PKC C;  1VQ6 A;  2JNG A;  5LJ3 d;  4C92 F;  4QVD A;  3OYE A;  4JLG A;  3SDZ A;  2O4X A;  5GMK l;  4C0Z A;  2K2V A;  3SFM A;  5GAN 8;  4A4K A;  4ZN3 A;  2MF2 A;  3MET A;  3LWI A;  2YLC A;  4IUQ A;  2XG8 D;  2KK4 A;  2GFU A;  3GNF B;  4BE1 A;  2P0P A;  4ELZ C;  4JJN K;  1KQ2 A;  5J26 A;  2RHY A;  3A8L B;  3OYL A;  3KUF A;  2OTJ A;  3C4S A;  1G3W A;  3SWN A;  4XTZ A;  2GFA A;  3CCJ A;  3CCU T;  5LJ5 e;  1M8V A;  2MWO A;  4OB0 B;  3S6W A;  3TEE A;  4JRK A;  4XTU A;  3CCV T;  4J6Y A;  1U8R A;  2E6N A;  2JN0 A;  4EMK C;  1UGQ B;  2V8J A;  3A8H B;  2XI9 A;  1D3B A;  1QP3 A;  3RMS A;  4HT8 A;  1VQP A;  3LX7 A;  3PTA A;  3MO8 A;  4C8Q D;  1O9S A;  3DLM A;  2IVW A;  5IAY A;  5LJ5 d;  2P0K A;  3OYJ A;  2NLU A;  4BD3 A;  2F5K A;  4XU0 A;  5GAN 6;  2MMP A;  3M56 A;  4M75 E;  5FRO A;  2KDS A;  4C0D C;  4ZGJ B;  2JTM A;  2Y4Y A;  2E41 A;  1H64 1;  2EFI A;  3HP9 A;  4ZN1 A;  3OYH A;  3I56 T;  3CCJ T;  3VV0 A;  4E47 A;  1YIT A;  2YRV A;  4M7D E;  4C5G A;  5GAM f;  3S3N A;  3CC7 T;  4IUT A;  1K8A U;  4PL6 A;  5GAN 4;  3QPH A;  2A3L A;  4M75 F;  4EMK B;  5DM7 R;  2FB7 A;  3R6O A;  5CAI A;  2D9T A;  1WPY A;  4B9X A;  1K9M U;  1MGQ A;  1UGR B;  4XTW A;  5CCA A;  1I5L A;  2DK3 A;  3OYY A;  4A4F A;  5GMK e;  3HFO A;  1KC8 U;  3FLG A;  3QHS A;  2PQW A;  3FRN A;  2QEX A;  1IRE B;  3OW2 A;  4LDV A;  3OYK A;  3CCS T;  2E10 A;  3N5B B;  2ZPH B;  1QP2 A;  3JCM f;  3OYD A;  1HK9 A;  2P0Q A;  1V29 B;  1VQ7 T;  3RER A;  2DD5 A;  4FIB A;  4C0D B;  1YIT T;  2DXC A;  5LJ3 j;  1B34 B;  2DIG A;  1YJW A;  4J6X A;  5CQX A;  1NJI C;  3LLR A;  4M78 D;  2XKO C;  1YBY A;  2BIV A;  4FT4 A;  3M54 A;  1N6A A;  3SWN C;  1JBM A;  2P4T A;  3OS2 A;  3DKM A;  2Y90 A;  3JCM P;  3HRS A;  3EAE A;  2PVO B;  4QW2 A;  1VQL T;  2CZ0 B;  4C8Q C;  2QEX T;  4F7U E;  1M1G A;  3GIB A;  1KHC A;  3CC4 T;  2EKO A;  3BFM A;  3H6Z A;  3HHT B;  3RKW A;  4QVC A;  3OYC A;  4C0G A;  3VYH B;  5GAM g;  1YJN A;  3G71 A;  5C0M A;  5KE2 A;  3VU3 C;  1YHQ T;  1LOJ A;  4MMK A;  1VQM T;  5J3B A;  4F7U F;  4E7I A;  1YJW T;  1WGS A;  2O4X B;  3G6E T;  4BY6 C;  2QA4 T;  3JCM X;  1IZ6 A;  3PT9 A;  2HD0 A;  5LJ5 j;  4E7L A;  4PJO D;  1FX7 A;  4BDZ A;  4OB1 B;  3A8G B;  2EIF A;  3RIR A;  3OYN A;  2OTL A;  3WVD B;  3JCM g;  4XU2 A;  3SWN B;  3QXE B;  3OYM A;  2BKD N;  1K73 U;  2K4Y A;  3V8K A;  4C8Q B;  4EPC A;  3HFN A;  5GAN 3;  4KUL A;  3FEO A;  4OGE A;  3G71 T;  5KE3 A;  4NS5 A;  1VQ5 A;  3URG A;  1LNX A;  3OQ5 A;  3JCM W;  1Q86 C;  4A4G A;  5CKH A;  2K3X A;  2DZ9 A;  3JB9 H;  3CEY A;  5GAO r;  2DXB A;  4LDU A;  3ZBD A;  1VQN A;  4HCC A;  1M5Q 1;  3X24 B;  3GP8 A;  2QXF A;  2QTX A;  4M78 C;  4BY6 B;  1W4S A;  2QQA A;  4OMF B;  2E70 A;  4BE0 A;  2OTL T;  1B34 A;  2RHX A;  3LH0 A;  5LJ3 h;  3L2R A;  2M16 A;  3QJ6 A;  2DXU A;  4L5G A;  4M7A C;  4ZGD B;  2WSE E;  3CPW A;  2E65 A;  3DLL A;  1G5V A;  1NE8 A;  3JCM V;  3O8V A;  5D6W A;  2QI2 A;  2KMT A;  5GMK j;  1VQ5 T;  5GAM e;  1Q82 C;  4C92 E;  3OYB A;  4IUU A;  1Y7X A;  3OYI A;  3QSU A;  3MP8 A;  5FLX E;  2GCX A;  5GAN 5;  2DPP B;  2E6Z A;  2F69 A;  3ZFJ A;  5GAN 7;  1M9S A;  2LCL A;  4B9W A;  1VQ4 A;  2IG0 A;  2RA2 A;  1QVP A;  1RI0 A;  4M78 B;  2V8K A;  5CKF A;  4PJO C;  1H3Z A;  1OZ3 A;  2MI6 A;  2YHT A;  2CZ1 B;  5GAM d;  1OZ2 A;  3E1S A;  3JCM e;  4M7A B;  1S72 T;  1TH7 A;  2DIQ A;  5LJ5 h;  3NTH A;  5D6Y A;  4PLI A;  3QII A;  2X35 A;  2HNI A;  4HA8 A;  2HQE A;  4KUD K;  2VC8 A;  1KHI A;  4C8Q A;  1NJI U;  3CCM T;  3JRZ A;  1VQ8 A;  2O01 E;  3CMA A;  3OW2 S;  3M57 A;  5HK0 A;  4MDX A;  3JCM d;  1VQ6 T;  4LDX A;  2EAY A;  3CME A;  2XDB A;  2JOY A;  3EFR A;  5GMK i;  3VKI A;  5FRN A;  4HT9 A;  1GXI E;  2QQB A;  2FHD A;  1N27 A;  1Y07 A;  4FSX A;  2X4W A;  5DLO A;  4PJO B;  3PFS A;  1YJ9 A;  1WJR A;  4JRI A;  3P8D A;  4C8Q F;  4OP0 A;  2OTJ T;  3HPW A;  4D6W A;  2E64 A;  2QQS A;  3L2W A;  2LQK A;  1QVF S;  2XD0 A;  4PLL A;  3QDR B;  4KUI A;  4RG2 A;  1U1T A;  2VXE A;  5D6X A;  2LCC A;  3PIO A;  2EWN A;  3HRU A;  3G4S A;  3PNW C;  1BI0 A;  5GMK h;  2DJZ A;  1X75 C;  2MAM A;  4ME7 A;  3CBM A;  4RCB A;  2RM4 A;  3ZEH A;  1VQP T;  1O75 A;  3MEW A;  3H8Z A;  3J7A F;  1WQ7 A;  1EIF A;  5FU6 C;  3VUB A;  5CR2 A;  5HY6 A;  2RHU A;  4XTV A;  3QZ5 B;  3OY9 A;  4Y28 E;  3CPF A;  5GAO m;  4IUV A;  2G3R A;  2PVD B;  1BI1 A;  4KBM B;  4LDW A;  4M78 A;  4QVZ A;  4C0F A;  4JRP A;  4OB2 B;  1LJO A;  4M77 B;  1Q86 U;  4NL3 A;  4M7A A;  3RMQ A;  1VQK A;  4XTY A;  1Q81 C;  4HKE A;  3M59 A;  3G4S T;  2DTO A;  2X4X A;  3OS5 A;  1VIF A;  2D6F A;  1BI2 A;  3CXC A;  4M7D D;  3VUZ A;  4BB7 A;  2KSS A;  3A5Z B;  5EG2 A;  3ER0 A;  2DTH A;  5GAM j;  2CYZ B;  2ZPE B;  4M7A D;  2RO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...