2JZ2A

Solution nmr structure of ssl0352 protein from synechocystis sp. pcc 6803. northeast structural genomics consortium target sgr42
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
MIFPGATVRVTNVDDTYYRFEGLVQRVSDGKAAVLFENGNWDKLVTFRLSELEAVKPILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Ssl0352 protein
publication title Solution NMR structure of Ssl0352 protein from Synechocystis sp.
rcsb
source organism Synechocystis sp.
total genus 9
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11623 NdhS NAD(P)H dehydrogenase subunit S
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jz2A00
3L2WA 2LCCA 2X35A 3OYFA 4A4GA 4ZTJA 4GY5A 3OYCA 3DB3A 2GF7A 2RJDA 3OQ5A 5D6XA 2JTFA 3L2RA 3OYLA 3LX7A 4BDYA 3PMIA 5KCOA 4QW2A 4C5IA 3DLMA 3MP1A 4X34A 2RI5A 3CEYA 3C4SA 4BE1A 4E7IA 2D9TA 5KE3A 3OYKA 2M1HA 3OYBA 2RI2A 3OYHA 1OI1A 2EFIA 2BKDN 3EAEA 3OS2A 4NS5A 1MHNA 3OS1A 2XK0A 3NTHA 2R5AA 4RG2A 1N27A 1XNIA 4II1A 4E7HA 4E7JA 1WJSA 3OB9A 4C5GA 4N4HA 4OVAA 2FHDA 3UT1A 4EDUA 2EQMA 2HQEA 5KCHA 4PLLA 3FLGA 4IKFA 5IN1A 5FROA 4HCZA 2G3RA 1KHCA 2HQXA 3S3NA 3KUFA 3NTIA 3LGFA 3P8DA 3NTKA 2B8AA 2IG0A 3OA6A 3OYJA 1H3ZA 3SD4A 3PFSA 2RJFA 3L2UA 3S3MA 3OYDA 3MO8A 3MP6A 4BACA 2PQWA 2RJEA 3MEVA 2CKKA 3H8ZA 3QBYA 2EQKA 3QJ6A 4IUUA 2F5KA 3LGLA 4Z02A 2DIQA 3OMGA 3BDLA 3P8HA 3PMTA 4IUQA 4Q5WA 4B9WA 2EQUA 3FEOA 3MP8A 4QQDA 2JZ2A 2E6NA 4A4EA 3GOXA 3E9GA 1WGSA 2RHIA 4QVZA 4BE2A 2QQSA 3OMCA 3S3OA 2EQJA 2EKOA 4C5HA 2RHXA 4LD6A 2RHZA 2GFUA 2L8DA 2MWPA 2RI3A 2E5QA 2M16A 2XDPA 1WJRA 2X4WA 5CIUA 4BE0A 1OYXA 2RHYA 5C0MA 4B9XA 3FC3A 2GFAA 4IURA 3MEWA 2QQRA 2RHUA 4BDZA 5D6WA 3M9QA 5IAYA 5D6YA 5FRMA 3OYNA 3L2VA 2RO0A 2VYTA 4UC4A 2LTOA 3H6ZA 3QKJA 1RI0A 4QQ6A 4FL6A 3UWNA 3L42A 2O4XA 3OYIA 2WACA 4A4HA 3LLRA 1SSFA 4IUPA 4IUTA 2L89A 3LYIA 2LDMA 5KH6A 4CRIA 2DIGA 3OYMA 4L59A 5C6SA 4E7KA 4ZTFA 2DAQA 2R57A 4BD3A 2MWOA 3META 3ZEHA 3L2QA 3LH0A 3O8VA 2R5MA 3E9FA 3QIIA 3F70A 3OYAA 4QQGA 2L3RA 2X4YA 5M9OA 2K3YA 4PL6A 2BUDA 2LRQA 3FDRA 4N4IA 1G5VA 2BIVA 1WJQA 2K3XA 5J26A 2YRVA 3S6WA 1OZ3A 4C5EA 3OS0A 3OYEA 5J39A 2R58A 2O4XB 2M0OA 2X4XA 3OYGA 2LVMA 5KE2A 5FRNA 2RJCA 1OZ2A 3ME9A 4FU6A 3OY9A 2P0KA 3MEUA 4E7LA 3Q1JA 4PLIA 3DB4A 3PNWC 4A4FA 3ASKA 4N4GA 4IUVA 2NLUA 3MEAA
chains in the Genus database with same CATH superfamily
3GIBA 4C0DC 4A4GA 1JXOA 3DB3A 1UFFA 3ULRB 4HCBA 3JAME 3OYLA 4E7ZA 2VB6A 4HVVA 1O75A 3FJ5A 3CCLT 4IIMA 2RI5A 2CT3A 2HDAA 1WHKA 1UGVA 5CQYA 4M75B 1W2BS 3VS5A 4J9EA 1AWJA 1RAAB 1AEYA 3BFMA 3I56Q 1BK2A 2R5AA 1ZX6A 2M02A 3PVQA 4E7HA 2KR3A 1M3CA 5GAN5 3JB9D 4N0AA 2G3RA 4ORZA 4N0AC 5A0LA 4JLGA 1KQSP 2F2WA 1H8KA 2OX7A 2LX9A 3G4SA 2LZ6B 1W4SA 3EG0A 2E1HA 1VQMT 1QWEA 4J7FA 1OQKA 1M90R 2QQSA 2HQHA 5L23A 2DTIA 2RHXA 3VS7A 5GAOp 2ZCFB 2XDPA 2K9GA 3EG9A 2XMFA 3M0SA 5C0MA 4AFSC 2RD1A 5CVIA 2FG0A 3G6ET 4BDZA 2O9SA 2O01E 4C92F 4PJLA 3SFMA 1D3BB 3REBB 1YITA 2JN0A 3LYIA 3JB9J 3CD6Q 2LQKA 3ZEHA 3JB9I 3NMZC 4M77E 1HSQA 1B07A 1J3TA 4R55A 3EGXB 1S72T 3CCRQ 2BUDA 4FYXB 5CKHA 1YHQQ 1VQ7A 1ARKA 2COZA 4Z8AA 4KUIA 2X4XA 3RERA 1WZOA 1W1FA 4JJNK 2HNIA 5KE2A 2E6ZA 1K4US 2HL5C 2KK4A 3I55Q 3LWIA 1AWXA 2BE7D 1VYUA 1D3BA 1OI1A 2OTLT 4BI8B 3JCMP 3CCST 1UG1A 1Y96A 1QWFA 1SKUB 4VUBA 2DL3A 1XNIA 1RAGB 3OW2P 3E2UA 1Y07A 4MMKA 4MZMA 4DBRA 3V8LA 3VRZA 3QHSA 2X3WD 3EGXA 4Y91A 2JUFA 3H0HA 1ZBJA 3OA6A 1VQOQ 1YJNQ 2IVWA 3TU4K 2YUNA 3J81E 4BACA 2ZAEA 2QYZA 4DBHA 3FB9A 5GANd 1P92A 5LJ3j 4C92D 2HBWA 2NUZA 5LJ5j 4JRPA 3REAB 2LMJA 3RR6A 4IURA 4DBQA 3A8OB 2CUBA 4YTLA 3GP8A 3CC7T 3SEMA 1PSFA 2DYIA 2L3PA 5CCAA 3SDZA 4F7UE 3U23A 5KYNA 3OYMA 2AHJB 5CR2A 4L5GA 1QLYA 1SHGA 3META 1VQKA 1NEGA 3RBBB 4ZNXA 3M53A 1G5VA 1UGRB 2DEUA 4M7DG 2K5LA 1M90U 4OMPA 2P0KA 3MEUA 1Q86C 1PKSA 2RMOA 1SPKA 3CCQA 2JS0A 3CD6A 2EVRA 2RQWA 3CCET 3X25B 1R0BG 3NGPA 4BY6C 4QW2A 1X6BA 2JTEA 3C4SA 3M56A 3M5AA 2D9TA 2YSQA 1PG5B 1KQ2A 3OS1A 2J05A 1ZUKA 2EGAA 3EFRA 1QQJA 2RF0A 2XKOC 1M3BA 3X26B 1NBEB 5KCHA 1LOJA 3CCVT 1KG1A 1WYXA 1K8AR 2DZCA 2FL7A 5CKBA 1IXDA 1UEBA 1YIJT 3EH1A 3MP6A 2FEIA 2F5KA 2DIQA 1ZUUA 4XTYA 2RM4A 2COWA 1GFDA 2O2OA 2EJFA 2ATCB 3QDFA 1HXDA 4ZN3A 5GMKm 2MWPA 4CC4B 1PSEA 1VQ6Q 4XK8E 1UECA 3M9QA 1YJNA 3EHRA 3H6ZA 5HY6A 4FYVB 4Z88A 3CCJT 2O4XA 2KYMA 1HJDA 2Y4YA 2CYZB 3C0CA 1Q7YR 1AD5A 1RAEB 5C6SA 2RQVA 4EMKB 2BE9B 1W2BP 5CQXA 1BU1A 1BCOA 1OX8A 1LPLA 4N4IA 1G3WA 1C6VX 2EGCA 2MAMA 4JLIA 2JW4A 1NZ9A 1I5OB 3PGGA 3ME9A 3TQ7P 3VU3C 4HVUA 1PC0A 4PJOE 3CMEQ 2K6DA 1MNEA 1VYTA 2FRWA 1TS9A 2RJDA 2EJGA 4KUDK 3LX7A 1IGUA 2DNUA 4BB7A 1OU8A 1VA7A 2W10A 5LJ3f 4OB2B 2BZXA 3V8JA 4KH1B 1G3SA 5LJ5f 2LJ3A 5GAN3 4M75E 1BIAA 2XK0A 2BTTA 1JO8A 2QA4A 3EGDA 2KT8A 4WCIA 4EMKA 2ED0A 4OVAA 4EMKC 2L3QA 2E3IA 4F14A 5KYXA 2F2XA 1M8VA 1KHCA 2CSQA 5GAN2 1KC8R 1Q82C 4RTUA 4DEXA 2HKQB 1KQSA 2WSEE 2E6NA 1V1CA 2XU8A 3E9GA 3OMCA 2MIOA 1WDXA 2EKOA 2RK1A 2EJ9A 4LD6A 4M77A 2RI3A 5CIUA 4M77C 1M1KC 1C1AA 4C8QE 5GMKl 5KYYB 2LT1A 2MMPA 2RO0A 3JV3A 5LJ3d 3JCMX 3G1JA 2J7IA 5LJ3h 3G4ST 5LJ5h 1QVFA 3VV0A 3HTRA 1K8AU 4JZ3A 2ZPBB 3H9NA 3C12A 3WXMB 1VQ6A 3NPFA 2JMAA 2R5MA 2DETA 4OB1B 2EGEA 2D8HA 1S1NA 2K3YA 3PVLA 2CZ0B 3CC2Q 4M7DF 5J3BA 3VKIA 4NL3A 3BW1A 4RTXA 4F7UB 2E10A 2PTKA 3OYYA 1YITT 3KBGA 1PWTA 3M0QA 3Q1JA 1RADB 1T3SA 5KYYA 4OMNA 4C5IA 5EC7A 1QVGA 2ZPGB 3NHNA 5GMKj 3VS2A 3HP9A 2YLCA 4GLMA 1VQ7T 2DM1A 5GAMg 3M54A 2CP5A 1OX9A 3WVDB 5CAIA 2HQEA 3QWXX 3FLGA 5FROA 2NUPA 3RDVA 4RG8A 1VQ5T 4AFQC 4EMGA 5DY9A 1IZ6A 1FX7A 1E7OA 2RQUA 2HZYA 3C94A 2DD4A 4OMOA 2RN8A 4F7UA 1I4K1 2EQKA 3UPUA 2AKKA 4M77G 3I5RA 3OMGA 5HKCA 4B9WA 3FEOA 1T3LA 2RHIA 3S3OA 4OMLA 5A2QE 3RESA 2GBQA 1WXBA 1IRXA 1AZGB 3VUZA 1VQPA 4XU0A 3MEWA 2QQRA 1I8FA 1KHIA 1YJWQ 2EYZA 3QZ9B 2ABLA 1VQLQ 4UC4A 3MHXA 1GXIE 2J6KA 2AIRB 4FYYB 1BCMA 2BZYA 4D8KA 5DLOA 1DJ7B 2EQIA 2KYBA 4E2FB 4LDXA 4RTYA 4ZTFA 1XJWB 1YJ9A 2NUTA 5GAOr 1M90C 3E9FA 1KC8U 2RQRA 1Y0MA 1GBQA 2QGGA 2X4YA 4BUGA 5GAMe 1WJQA 1WXUA 1WI7A 2LCLA 2HCKA 1XOVA 2R58A 4FT2A 5IH2A 3URGA 1K9MC 1OPLA 2RJCA 2QG9B 1M4ZA 2C0TA 3DB4A 2MF2A 1JQQA 2X35A 4GY5A 3BY7A 5D6XA 1WFWA 2QQ9A 1UTIA 1VQKT 3CC2A 2ZPIB 5I2SA 1MHNA 1OULA 2M0YA 4PJOB 4RTVA 1WHGA 2L5QA 1UJ0A 1M30A 5FU6B 1WNLA 3RKXA 4KH0B 3T9NA 4ELYC 2XDDA 2FHDA 2I0NA 3FJPA 2DL5A 1I81A 1BB9A 3CCQT 3CD6T 3P8DA 2QK0A 3LGFA 4OB0B 1WX6A 1QCOA 2ENMA 2EW3A 2PVDB 3CCRT 4M78A 2CZ7B 4QT7A 4M7AB 1YHQT 1Z9ZA 4M78C 2DBKA 2JXBA 3LH5A 2E64A 2P0PA 4J9IA 3PTAA 4HCCA 2XICA 2DLPA 3SWNA 2FZKB 1I1JA 3SWNC 1WJRA 1K76A 3TSWA 2OTJQ 4J5YA 3I55T 4TVRA 2KSSA 5KYUB 4FCYA 2LTOA 2GGRA 2VXEA 3EG3A 3UWNA 2D0QB 3L42A 4PJOA 1NYGA 3OYIA 4PJOC 5GAOq 2QDLA 5FU6C 2H8HA 2LCSA 4C92E 1GRIA 4JUVA 4C8QB 1YI2Q 2YUOA 2V1RA 5I2MA 4LDVA 1YJWA 1W2BA 4JS4A 3AHUA 2YRCA 3R6NA 4M75A 1NPRA 3S6WA 1YJNT 4M75C 1RABB 4J9HA 2DZ9A 2RQTA 2KMTA 1QVFP 4DQ2A 5FRNA 1Y71A 1ZSZB 2RA2A 3JSCA 2EYWA 1TOVA 1NE8A 1VYVA 1SF9A 2DJZA 1QKWA 4PJNA 2AKLA 3DLMA 1WHLA 2DEQA 2HBPA 3QYGB 2X3XD 1YWPA 1B34B 2CT4A 3M4YA 1FMKA 1X2KA 1I5LA 5GANf 2IIMA 1ZBXA 4IIOA 4C0GA 4EDUA 4N4HA 4C8QA 1VQ5A 4LNPA 3V7SA 1V76A 1KJWA 3CCLQ 4C8QC 5GAN7 1KK7A 4O5VA 1QVGP 3UDCA 2EKHA 4M78G 2B8AA 2IG0A 5GMKh 4KULA 2KAFA 1JU5C 2CKKA 3PIOA 2MOXA 3M59A 4M77F 2CGHA 4FYWB 3RMQA 1Q81C 1BYMA 4EPCA 5LJ3e 4BE2A 2YUPA 1K9AA 1YP5A 5LJ5e 4ATOA 2P84A 2QA4T 2RHYA 1KFZA 3FC3A 2GFAA 2LQWA 4WTOB 2DD5A 2VWFA 4PJOG 3CC4Q 3OYNA 3SHWA 1K8AC 3VS0A 1D0YA 1PHTA 1M9SA 2CDTA 1O9SA 4P5NA 2D1XA 3TSZA 4DOWA 1N9SA 4J9GA 3I56A 2RNAA 1WHMA 3RUXA 5GANh 2CH4W 4FW2A 1WIEA 1UUEA 3QDRB 4BD3A 3G6EQ 4M75G 1X43A 2E70A 5GJVB 1NJIR 4BI3A 3ER0A 1NEBA 2LRQA 3OS0A 2X51A 2PVGB 3JB9H 4CC3A 2LVMA 5HK0A 3I9QA 4E7LA 4JJCA 1Y7XA 4PLIA 4A4FA 3RMSA 1MV3A 3BDUA 4AG1C 2CP0A 1AVZC 2HD0A 3MEAA 1KD1C 2K7AA 3P8BB 2ROTA 1VQ9Q 5FWCA 1M2VB 2JOYA 2HKNA 2PU9B 3MP1A 3JCMf 3EHQA 2HEQA 1VQ6T 5KE3A 3CMAQ 3OYBA 3O5ZA 3OYHA 2MCNA 1YCSB 4R56A 1ABQA 2ECZA 2RPNA 3VRYA 4OF1A 2X9HA 3G71Q 2DO3A 4E7JA 3OB9A 3UT1A 2JS2A 4GBQA 2E3HA 4PLLA 1MMNA 4M77D 2Y90A 1ZQ1A 2DL8A 4F7UF 2DVJA 1LCKA 3IQLA 1PRMC 3S3MA 3CCRA 4Z89A 4X9CA 5IXFA 2QDYB 1YHQA 2RJEA 4V2SA 1MNDA 3RKYA 3CCUQ 2CZ1B 2FZCB 1E6GA 1E6HA 3GOXA 1WGSA 2K79A 1X01A 3CMET 2X4WA 1BI0A 3I55A 2JNGA 4AG2C 3EFOB 2HSEB 3HKSA 5FRMA 3JCMd 1H92A 3JCMh 2KGTA 4HCKA 3OSVA 1F1BB 3M58A 4L59A 3DLLA 2L0AA 4DA4A 4A4KA 3MPUB 1B7TA 3LH0A 3M0UA 3CPWS 3QIIA 3CC4A 2FRYA 1HYOA 3D7SB 1VQOA 3CC7Q 1VQPT 5J26A 1W70A 3OYEA 5FU7B 3GF5A 3SB2A 1NG2A 2XHCA 4C92B 2QQBA 2X4JA 2ROLA 4GLKA 1MMGA 4L6V5 3J7AF 4ANJA 4RTZA 3OYCA 3L2RA 2GF7A 2PUKB 4XTWA 4F04B 2V8JA 1YJ9T 1N8RC 5A0DA 4OMMA 2MPXC 2A28A 1JJ2S 2RI2A 1TXQA 4O6JA 3HSBA 4ME7A 2CSIA 1CKBA 4XQ3A 5HK3A 2V8IA 4ZN1A 2XIDA 2OAWA 1VQ4Q 1M5Q1 2FYKA 2FZGB 1ACMB 2YT6A 1VQ9A 2P0QA 2PVOB 2QEXQ 2AZVA 2FPDA 4M78F 1NJIU 2LJ0A 3CMAA 4X9DA 1H3ZA 3OBYA 2W0ZA 1BBZA 3L2UA 4D6WA 3CXCS 3PIPA 2F69A 4XTZA 4LDYA 1I0CA 5FU7C 3X28B 3CC2T 2F5TX 2HL3A 3CCVQ 4M7AE 3G71A 2A36A 1WXTA 4RTWA 1UGQB 2RHZA 2L2PA 3VYHB 1YN8A 2CP7A 4J7IA 4PJOF 1YIJQ 5I22A 2CP3A 4NL2A 1SSHA 3C95A 2M51A 2DA9A 2DBMA 1H3HA 4KGVB 2JM8A 1SSFA 1FXXA 4IUTA 9ATCB 2DIGA 1AT1B 2E5KA 1BKBA 1GL5A 4Y92A 4LDWA 4M75F 1WQ7A 3L2QA 4R0KA 5FWBA 3HRUA 3CCJQ 2E41A 2Y4XA 6AT1B 1FMWA 2J6OA 1OOTA 2RB6A 2M0OA 1EIFA 4LUEA 2LQNA 3OY9A 1OEBA 4N4GA 4C0FA 2YLBA 1GCQA 4M7DE 5IHIA 4OMQA 2KNBB 3JCMb 2LT4A 4X34A 5D7UA 3CEYA 2M1HA 1YJWT 3A8MB 5GMKe 3EAEA 4C8QF 2FPFA 4M78D 1N27A 1IHVA 2DE0X 3VS3A 2C06A 1TUCA 4RKUE 2K2VA 2QASA 3PT9A 2JVVA 4HCZA 2C0IA 1FMVA 3JCMc 2MYSA 3KUFA 3OW2S 3OYJA 2FPEA 1Y57A 5GAN8 4OB3B 3CCMQ 3QXEB 4C0ZA 3H8ZA 3QJ6A 4Y28E 4FT4A 4PJOD 3VS4A 1C0MA 1W6XA 1Q7YU 3M55A 1TWBA 1PRLC 3MP8A 1VQ4A 4E7IA 2EWNA 4A4EA 1TTHB 1KSWA 4HA8A 3RKWA 3CMEA 3UATA 5GANe 2E5QA 4AFZC 2QQAA 2H3EB 4BE0A 3M0TA 2EBPA 2FO0A 2YXYA 5IAYA 3EH2A 3M0RA 4RCBA 1Z9QA 5DLQE 2D8JA 4A54A 1OV3A 4M75D 2HAXA 2WACA 4XTVA 3GNGA 4XU3A 1M1FA 1ZA2B 1NYFA 4J6YA 4PK4A 2E4HA 4AFUC 1Q82R 1UHCA 1R77A 2MK5A 4MDXA 3JRZA 1SRLA 2KEAA 3O8VA 2A08A 2L3RA 4PKCC 2YRVA 1SRMA 1NLOC 3DKMA 4RUGA 2PNIA 3M0PA 2OAUA 1BI3A 3OYGA 2XD0A 4JJBA 1M1KR 1ZLMA 2EPDA 4E47A 2Z0WA 3I56T 4CC2A 3V7CA 4C8QD 1UGPB 3RNJA 4LE9A 1WHJA 2QI2A 4XAXB 2EFIA 2HSPA 2BKDN 2KROA 1Q95G 2VGNA 1EFNA 2DXCA 1QCFA 4F16A 4ZGJB 4RG2A 2OI3A 2L3SA 1VQ8Q 3HL8A 1GCPA 3S3NA 1IGQA 3MKDA 1IO6A 1N6AA 4PFZA 3A8HB 3ZL7C 3INZA 1M27C 4PNOA 1RI9A 2YDLA 3CPWP 2VASA 2CP2A 1MUZA 4J9DA 2NYSA 1VQNQ 2K4YA 1TG0A 4C5HA 3V7RA 3VS6A 3HFOA 2DMOA 5D6WA 1VIEA 3QUIA 5GAMj 4EMHA 4F7UG 4DOVA 4F17A 2DXTA 3QKJA 1QP2A 2AT1B 2A7YA 3CCMA 4FL6A 3OS5A 5GJWB 3H0IA 5IXBA 3VJPA 2LDMA 2LP5A 1JJ2P 4E7KA 2ZGWA 2DAQA 3E19A 3EG9B 1LNXA 4JPBW 2O9VA 1NLPC 1PKTA 4FW1A 5CO7A 2JTMA 3N5BB 4C5EA 1VUBA 2KQWA 1WPYA 2B86A 2DERA 3X20B 3GPLA 3OSSC 1H641 1AOJA 2F1LA 1CKAA 1RAIB 3CXCP 4JZ4A 2LCCA 2JJ9A 1TUDA 5KCOA 3HFNA 2M9UA 5LJ3g 3QJYA 1VQLA 5LJ5g 3H41A 3CC4T 4ESRA 3RIRA 1G3YA 3VUBA 1MGQA 8AT1B 4M7AA 1VQOT 1WQWA 2KXCA 3X24B 5KYWB 4NS5A 3A1PA 4XU1A 1NJIC 1EZZB 2LX7A 4M7AC 1TUGB 3L2ZA 2KDSA 1MMDA 4DEYA 2DL7A 1Q82U 2WSFE 4M7DB 2EQMA 1K73R 1YCYA 3L1AA 3QG1A 4JJDA 5IN1A 1M8MA 4K11A 1VQKQ 2AK5A 2HQXA 2JM9A 5KYUA 1K9MR 1RAHB 1G3TA 2RJFA 4PFOA 3WVEB 3QBYA 4IUUA 1RUWA 1V29B 1Y96B 3THKA 4Z02A 1M1KU 3P8HA 4Q5WA 4DBFA 3CCQQ 5LL6S 1U8RA 1VQ8A 3R6OA 2FVUA 2LNVA 4FSSA 2EYXA 1T0HA 2KVQG 1VQ9T 2NWMA 1FWZA 4CC7A 1YNZA 2QTXA 1TSFA 1ZSGA 1D1AA 2O88A 4QQ6A 5KYWA 3CMAT 4LUDA 2DTHA 3CBMA 5DM7R 2KI7A 2RH2A 2DXBA 3HRTA 1ZSZA 4PJMA 2P4RA 3A5ZB 4M7DA 1U3OA 1VQNA 2DYBA 1ZSZC 4J6WA 4M7DC 1UE9A 1D1CA 2V26A 4JRIA 3VS1A 3G71T 1WLPB 3EFSA 4KGXB 2R57A 1QVPA 2K57A 2MWOA 3FIFA 2A3LA 2J6FA 4OGCA 4QKUA 4QQGA 4PL6A 3TEEA 2BIVA 1B34A 3UA6A 1VQMQ 3FRNA 1KQ1A 5AT1B 3CCUT 2EYYA 3VYGA 2NLUA 3SD4A 3OYFA 4ZGDB 2OTJA 2EAYA 3OQ5A 3QSUA 3TREA 3PMIA 1X2QA 4M7AG 2VXFA 5CKDA 4PJJA 1OPKA 3OS2A 5IHNA 3NTHA 4A53A 2KRMA 1R0CB 3A8GB 4C5GA 1RLQC 2EYQA 1JXMA 5GAMf 2SEMA 4MZPA 4BY6B 1X75C 1YI2A 1Q7YC 1BI1A 1D09B 4A63B 1S72Q 2V1QA 1XQHA 2LJ1A 1G83A 2DTOA 3PFSA 3MO8A 1UHFA 2XDBA 2PQWA 4WF2A 1KIKA 3PMTA 4C8QG 1R8OB 3KFVA 2EQUA 1B3QA 2DKGA 2GTJA 2YWWA 4B9XA 1MV0B 1GFCA 3TCJA 2E65A 4J8OA 2OTLQ 1HD3A 1JB0E 2I2LA 3CCSQ 8ATCB 1RI0A 3QYHB 1PD0A 3V8KA 3QO3A 5GAOm 1X69A 4A4HA 2QA4Q 1CSKA 4CRIA 1K73U 2GNCA 5A0GA 1AZEA 1VQ4T 1UJYA 3CCLA 5GAMd 1M2VA 3M57A 3NFCA 5GAMh 2QEXT 1K9MU 2QGFB 1U06A 1Q81R 4AT1B 3FDRA 2K3XA 1RLPC 3UF4A 4RTTA 1X6OA 5J39A 1EX4A 2D0NA 2O4XB 1KC8C 4RCCA 3PNWC 3ASKA 1ZHIA 2VKNA 3I35A 1IREB 4OP0A 1K1ZA 2CS7A 2XI9A 2GQVA 2YRDA 2K2MA 3OYKA 2K5IA 3HRSA 1VQMA 1MMAA 4B6MA 2K5FA 1QW1A 3JCMW 3J80E 3G7ZA 4XTXA 1AWOA 1IB8A 1A0NB 3EG1A 3G6EA 1G2BA 4D8DA 4JS5A 1M1GA 3EFOA 3NTKA 2EIFA 2YUQA 2KXDA 2H3JA 1LJOA 2G6FX 2DJQA 5L8RE 2DILA 3UA7A 1KD1R 3LGLA 4RMOA 3JB9G 3BDLA 4M78E 4QQDA 4XU2A 3ZBDA 2JZ2A 3CPWA 3EGDB 4QVZA 3CCEQ 2ZPFB 3BE3A 3HPWA 4FIBA 2M16A 5KYXB 1OYXA 1QKXA 4HKEA 1S72A 4J9FA 3L2VA 4LD9K 3JCMV 2GTOA 1QMCA 1Q86R 2E12A 1PCXA 2AZSA 3CBPA 3LLRA 3JCMQ 1QP3A 5IHKA 4C92A 3JCMJ 2KE9A 1PD1A 5KH6A 5GAOl 2DX1A 2CH4A 4C92C 1KQSS 1RAFB 1YWOA 1AWWA 2LQ8A 4M77B 2F2VA 4QVCA 1JJ2A 1U1SA 5CK9A 2OTLA 1JEGA 3CCSA 4KBMB 3F70A 3OYAA 4E7SA 2MI6A 5M9OA 2KBTA 3GLXA 2PUOB 3CCMT 4PFPA 5I21A 3CCUA 1OZ2A 4FU6A 4J83A 1D0XA 1RL2A 5HCKA 1WHHA 2KT1A 2OJ2A 1QVFS 2XG8D 3CXCA 4LN2A 4MZTA 4M7AF 1VQPQ 2CP6A 3QPHA 3AT1B 1XTDA 1AHJB 2JMCA 5GANg 2YHTA 1IHWA 3HHTB 2J06A 1YBYA 4II1A 2CREA 5EG2A 1WJSA 4HVWA 2JT4A 1FYNA 1YJ9Q 1D1BA 2KRSA 3MCAB 1GCQC 1JRIA 1Q81U 4KT0E 3NTIA 3QWYA 5FLXE 3CC7A 5FW9A 2IPOB 1VQLT 5LJ5d 4JDSA 4ELZC 1QVGS 1SG5A 1OU9A 2WSCE 1WA7A 2EQJA 1N8RR 5IT9E 4J6XA 2NUPB 5CKEA 4BI4A 5AYFA 4KGZB 5D6YA 2DF6A 3KXTA 3LW5E 4C92G 2DFUA 1VOMA 2CZ6B 3TVTA 1BIBA 2L89A 2CUDA 5ECAA 2ZZDA 3CCEA 2P4TA 4M4ZA 3CBOA 3OBWA 4OGEA 2QEXA 1UB4A 4LXCA 1VQ8T 3GNFB 1UGSB 1RACB 1M3AA 3H0FA 4X1VA 1KD1U 1VIFA 1OZ3A 4E6RA 4FM4B 4XTUA 1BI2A 4M7AD 1QCNA 3A98A 4MDWA 1K0XA 2DL4A 1UDLA 2GQIA 4CI0C 3CCVA 1K0SA 2K3BA 2DXUA 1HK9A 4MMLA 1NPPA 1U5SA 3L2WA 1VQNT 3OW2A 2QAZA 1D0ZA 4ZTJA 3EGUA 3JCMg 4BDYA 1U1TA 2JTFA 4NOYA 1N5ZA 2NUTB 2ED1A 1YIJA 4KRTA 2QXFA 4BE1A 1Q86U 1SHFA 1ZUYA 2V8KA 4HT8A 2DVEA 2DPPB 3G4SQ 4JRKA 4EIKA 2VC8A 1X6GA 3MJXA 1TH7A 1GBRA 5GANj 2DK3A 2LNHB 3QZ5B 4IKFA 2GCXA 2ESWA 5I11A 3A8LB 3CCJA 2OTJT 1X27A 2KY9A 5GAOn 3E1SA 1YFNA 3OYDA 4J9BA 3MEVA 1YITQ 3CQTA 2VGMA 1ABOA 3JB9F 2VVKA 1M2OA 4IUQA 2HMAA 5GAN4 2FB7A 3GBQA 2LC4A 2A37A 1NM7A 4QVDA 4M7DD 3I5SA 1T0JA 2GFUA 2L8DA 4C0DB 3EG2A 2COYA 3LWHA 2ZPHB 2RHUA 4AMCA 1LVKA 1YI2T 1K73C 4JRQA 3ZFJA 2D6FA 2VYTA 2BZ8A 2PZ1A 3M4GA 4J9CA 2RK2A 1VQ7Q 4M78B 3JCMe 4HT9A 4IUPA 2QTVA 2KRNA 3CPFA 5CKFA 4LDUA 5GAN6 3SWNB 2O31A 1VQ5Q 2VV5A 4HXJA 2A0FB 1ZA1B 1SEMA 2VUBA 4OMFB 1PNJA 2ZPEB 1G8XA 1PM3A 7AT1B 2DRMA 3PE0A 2DRKA 1JBMA 1I07A 5GMKi 1N9RA 4ZGEB 2SRCA 1N8RU 2C0OA 4IUVA 1TU0B 4FSXA
chains in the Genus database with same CATH topology
4L6V5 3OYFA 3J7AF 3GIBA 4C0DC 4A4GA 4ZGDB 3OYCA 2OTJA 2EAYA 2GF7A 2PUKB 3DB3A 3OQ5A 3JAME 3L2RA 4XTWA 3OYLA 3TREA 3PMIA 4HCBA 3QSUA 1O75A 2V8JA 4C5IA 3CCLT 4M7AG 2RI5A 1YJ9T 2VXFA 1N8RC 5A0DA 4E7IA 1QVGA 2ZPGB 1JJ2S 5CKDA 2RI2A 5CQYA 5GMKj 4M75B 4O6JA 3HSBA 4ME7A 1W2BS 3OS2A 3HP9A 2YLCA 4XQ3A 5HK3A 2V8IA 1VQ7T 4ZN1A 3BFMA 2XIDA 3NTHA 4A53A 2R5AA 5GAMg 4E7HA 3M54A 1M5Q1 2FYKA 3WVDB 3A8GB 4C5GA 5GAN5 2EYQA 5GAMf 2HQEA 5CAIA 1VQ9A 3FLGA 2P0QA 2PVOB 4MZPA 1X75C 4N0AA 5FROA 4BY6B 4RG8A 3JB9D 1YI2A 1Q7YC 1VQ5T 1BI1A 2G3RA 4EMGA 5DY9A 4M78F 4N0AC 1NJIU 1XQHA 5A0LA 4JLGA 1IZ6A 3CMAA 1FX7A 4X9DA 1H3ZA 2DTOA 3OBYA 3C94A 3PFSA 3L2UA 2DD4A 3MO8A 4D6WA 3CXCS 3PIPA 2F69A 4XTZA 2XDBA 2LX9A 2PQWA 4LDYA 3G4SA 4F7UA 4WF2A 5FU7C 1I4K1 2EQKA 3X28B 1W4SA 3CC2T 3UPUA 2E1HA 1VQMT 4M77G 3OMGA 3PMTA 5HKCA 4C8QG 1R8OB 4B9WA 2F5TX 2EQUA 3FEOA 4J7FA 2DKGA 3G71A 4M7AE 2RHIA 3S3OA 2QQSA 5A2QE 3RESA 2DTIA 1UGQB 2RHXA 5GAOp 2RHZA 2ZCFB 2XDPA 3VYHB 5C0MA 4B9XA 2RD1A 4J7IA 5CVIA 4PJOF 4XU0A 3VUZA 3MEWA 2QQRA 3TCJA 1I8FA 1KHIA 3G6ET 2E65A 4BDZA 4J8OA 3QZ9B 4NL2A 1JB0E 2I2LA 4UC4A 2O01E 3MHXA 4C92F 1RI0A 3QYHB 1GXIE 3C95A 1D3BB 3SFMA 3V8KA 3QO3A 5DLOA 1YITA 5GAOm 4A4HA 1DJ7B 2JN0A 1SSFA 1FXXA 4IUTA 3LYIA 4LDXA 4CRIA 2DIGA 1K73U 1BKBA 5A0GA 4ZTFA 1VQ4T 4LDWA 3JB9J 2LQKA 3CCLA 4M75F 1WQ7A 5GAMd 1YJ9A 3ZEHA 3JB9I 3L2QA 5GAOr 1M90C 3M57A 3E9FA 3NFCA 4M77E 5GAMh 2QEXT 1KC8U 1K9MU 3HRUA 4R55A 2X4YA 4BUGA 2E41A 5GAMe 1S72T 2BUDA 2Y4XA 3FDRA 5CKHA 1VQ7A 1WJQA 2K3XA 2LCLA 1X6OA 1XOVA 2R58A 5J39A 2RB6A 4KUIA 2O4XB 2M0OA 2X4XA 4FT2A 1EIFA 3RERA 3URGA 1K9MC 4JJNK 2HNIA 1KC8C 5KE2A 2RJCA 2E6ZA 3OY9A 1M4ZA 4RCCA 3DB4A 3PNWC 3ASKA 4N4GA 4C0FA 2MF2A 1ZHIA 2YLBA 1IREB 2X35A 4M7DE 4GY5A 4OP0A 2KK4A 3BY7A 5D6XA 2CS7A 2XI9A 3LWIA 2GQVA 3JCMb 1VQ4A 2LT4A 4X34A 2QQ9A 3CEYA 3OYKA 1D3BA 1VQKT 2M1HA 3CC2A 2K5IA 2ZPIB 3HRSA 1OI1A 1YJWT 2OTLT 4BI8B 1VQMA 3JCMP 3A8MB 5GMKe 3CCST 2K5FA 3EAEA 5I2SA 1Y96A 4C8QF 1MHNA 4M78D 4PJOB 1QW1A 2L5QA 3JCMW 4VUBA 5FU6B 1N27A 1XNIA 1WNLA 3RKXA 3J80E 3G7ZA 1Y07A 3T9NA 4ELYC 4XTXA 2XDDA 2C06A 2FHDA 4RKUE 4MMKA 2K2VA 4MZMA 3PT9A 3V8LA 2JVVA 3FJPA 3G6EA 1I81A 4JS5A 4HCZA 3CCQT 3CD6T 1M1GA 3QHSA 3JCMc 4Y91A 2JUFA 3KUFA 3LGFA 3P8DA 3NTKA 4OB0B 3OA6A 3OW2S 3OYJA 5GAN8 2IVWA 4OB3B 3TU4K 2EIFA 2H3JA 1LJOA 2PVDB 3QXEB 4C0ZA 3J81E 3CCRT 4BACA 3H8ZA 4M78A 2CZ7B 5L8RE 4M7AB 3QJ6A 4Y28E 4FT4A 1YHQT 3FB9A 3LGLA 4PJOD 4RMOA 4M78C 5GANd 3BDLA 3M55A 4M78E 1P92A 2E64A 5LJ3j 3JB9G 1Q7YU 3MP8A 4QQDA 4XU2A 2JZ2A 3ZBDA 2EWNA 2P0PA 4A4EA 4C92D 3PTAA 4HA8A 4QVZA 5LJ5j 3CPWA 4HCCA 3RKWA 2ZPFB 2XICA 3SWNA 3CMEA 4JRPA 3HPWA 4FIBA 5GANe 2E5QA 2M16A 3SWNC 1WJRA 2QQAA 4BE0A 1OYXA 4HKEA 4J5YA 1S72A 4IURA 3I55T 4TVRA 5IAYA 4RCBA 2KSSA 3L2VA 4LD9K 2LTOA 3A8OB 3JCMV 5DLQE 4YTLA 4A54A 2VXEA 3GP8A 2E12A 4M75D 3UWNA 2D0QB 3L42A 2HAXA 3CBPA 3CC7T 3OYIA 2WACA 4PJOA 1PSFA 3LLRA 4XTVA 3GNGA 4XU3A 1M1FA 3JCMQ 4PJOC 5GAOq 1QP3A 4C92A 5CCAA 3SDZA 4F7UE 3JCMJ 5KH6A 5GAOl 5FU6C 4J6YA 4C92C 3OYMA 1KQSS 2AHJB 4C92E 5CR2A 2LQ8A 4L5GA 4JUVA 4M77B 1JJ2A 4QVCA 3META 1U1SA 4C8QB 3JRZA 4MDXA 5I2MA 1VQKA 3O8VA 4LDVA 1YJWA 1W2BA 5CK9A 4JS4A 2OTLA 3CCSA 4KBMB 3F70A 3OYAA 2MI6A 2L3RA 3M53A 5M9OA 3AHUA 4M75A 3GLXA 1NPRA 1G5VA 2PUOB 4PKCC 2YRVA 3S6WA 1UGRB 1YJNT 3DKMA 4M75C 4M7DG 2K5LA 2DZ9A 3CCMT 2OAUA 1BI3A 2KMTA 5I21A 4DQ2A 3OYGA 3CCUA 2XD0A 1M90U 5FRNA 1Y71A 1OZ2A 4FU6A 2RA2A 2P0KA 3MEUA 4J83A 1RL2A 3JSCA 1Q86C 4E47A 3CCQA 3I56T 3CD6A 1NE8A 3V7CA 3CCET 3X25B 2DJZA 4C8QD 1QVFS 1UGPB 2XG8D 4BY6C 4MZTA 3CXCA 4M7AF 4QW2A 3DLMA 2DEQA 2QI2A 3C4SA 3M5AA 2D9TA 3M56A 2HBPA 3QPHA 4XAXB 1XTDA 1AHJB 3QYGB 2EFIA 2BKDN 5GANg 1B34B 2YHTA 3M4YA 2VGNA 1KQ2A 2DXCA 5GANf 3OS1A 1I5LA 3EFRA 4ZGJB 3HHTB 1YBYA 2XKOC 1ZBXA 4RG2A 3X26B 4II1A 5EG2A 1WJSA 4C0GA 4EDUA 4N4HA 5KCHA 1LOJA 3CCVT 4C8QA 1VQ5A 1KG1A 3V7SA 2DZCA 2FL7A 5CKBA 4C8QC 5GAN7 3HL8A 3MCAB 4O5VA 1JRIA 1UEBA 3S3NA 1Q81U 4KT0E 3NTIA 3UDCA 4M78G 2B8AA 2IG0A 5FLXE 1N6AA 3CC7A 3A8HB 5GMKh 1YIJT 4KULA 2KAFA 3INZA 4PNOA 3MP6A 1VQLT 2CKKA 5LJ5d 4JDSA 3PIOA 3M59A 2F5KA 4M77F 4ELZC 1QVGS 2DIQA 4XTYA 2CGHA 1Q81C 3RMQA 2RM4A 1BYMA 4EPCA 5LJ3e 2EJFA 4BE2A 2K4YA 2WSCE 1HXDA 2EQJA 4ZN3A 5LJ5e 4ATOA 2QA4T 4C5HA 5GMKm 5IT9E 2MWPA 3V7RA 1PSEA 2RHYA 4J6XA 5CKEA 2GFAA 3FC3A 3HFOA 4BI4A 2DD5A 5AYFA 4PJOG 4XK8E 5D6WA 3M9QA 1VIEA 3QUIA 5GAMj 4EMHA 5D6YA 4F7UG 3OYNA 1YJNA 4DOVA 1K8AC 3H6ZA 2DXTA 3QKJA 1QP2A 5HY6A 3KXTA 1M9SA 3LW5E 2A7YA 4C92G 3CCMA 3CCJT 1O9SA 4FL6A 3OS5A 4P5NA 2O4XA 4DOWA 1N9SA 2Y4YA 2CYZB 2CZ6B 1BIBA 2L89A 3VJPA 3I56A 2LDMA 2ZZDA 3CCEA 3RUXA 2P4TA 5GANh 5C6SA 4E7KA 4EMKB 2ZGWA 2DAQA 3CBOA 3OBWA 4BD3A 3QDRB 4OGEA 2QEXA 3E19A 1UB4A 4M75G 1LNXA 5CQXA 2E70A 1VQ8T 3GNFB 1UGSB 5CO7A 4BI3A 3ER0A 2JTMA 3N5BB 2LRQA 4N4IA 1G3WA 1KD1U 4C5EA 1VIFA 1OZ3A 3OS0A 1VUBA 2KQWA 2MAMA 4JLIA 1WPYA 1NZ9A 2PVGB 1BI2A 4FM4B 4XTUA 3JB9H 4MDWA 3X20B 3GPLA 4M7AD 3OSSC 1H641 2LVMA 4CI0C 3PGGA 3ME9A 3VU3C 3CCVA 5HK0A 2DXUA 4E7LA 4PJOE 1Y7XA 4PLIA 1HK9A 4A4FA 4MMLA 3RMSA 3BDUA 1NPPA 2HD0A 3MEAA 1KD1C 3L2WA 2LCCA 1VQNT 3P8BB 3OW2A 4ZTJA 3JCMg 4BDYA 2RJDA 1U1TA 2EJGA 2JTFA 2JOYA 4NOYA 3LX7A 4KUDK 5KCOA 3HFNA 2M9UA 1YIJA 2PU9B 3MP1A 3JCMf 5LJ3g 2QXFA 4BB7A 3QJYA 4BE1A 1VQ6T 1VQLA 5KE3A 5LJ5g 1Q86U 3OYBA 3OYHA 5LJ3f 2V8KA 4OB2B 3CC4T 4HT8A 3V8JA 3RIRA 1G3YA 3VUBA 1MGQA 2DVEA 1G3SA 5LJ5f 1VQOT 4M7AA 1WQWA 2DPPB 3X24B 5GAN3 4M75E 1BIAA 4NS5A 4XU1A 1NJIC 4R56A 4M7AC 4JRKA 2XK0A 2VC8A 2KDSA 3L2ZA 2QA4A 4OF1A 1TH7A 4EMKA 1Q82U 2DO3A 4E7JA 2WSFE 4M7DB 5GANj 3OB9A 4OVAA 2DK3A 3UT1A 2EQMA 4EMKC 1YCYA 3L1AA 3QZ5B 4PLLA 4IKFA 3QG1A 4M77D 2Y90A 5IN1A 2GCXA 1M8VA 1ZQ1A 1KHCA 2HQXA 4F7UF 3A8LB 3CCJA 2OTJT 5GAN2 1Q82C 2KY9A 5GAOn 3S3MA 2RJFA 1G3TA 3E1SA 3OYDA 3CCRA 4X9CA 2QDYB 1YHQA 3WVEB 2RJEA 3MEVA 4V2SA 3QBYA 1KQSA 2VGMA 2WSEE 4IUUA 3JB9F 1V29B 1M1KU 1Y96B 3RKYA 4Z02A 4IUQA 2CZ1B 3P8HA 4Q5WA 5GAN4 2FB7A 2LC4A 3GOXA 2E6NA 4QVDA 2XU8A 1WGSA 3E9GA 4M7DD 3OMCA 2EKOA 2RK1A 2EJ9A 4LD6A 4M77A 2GFUA 1X01A 2L8DA 2RI3A 5LL6S 4C0DB 3CMET 2X4WA 5CIUA 3R6OA 1U8RA 1VQ8A 1BI0A 2FVUA 2LNVA 2JNGA 4M77C 3I55A 1M1KC 2KVQG 4C8QE 3LWHA 5GMKl 2ZPHB 2RHUA 3HKSA 1VQ9T 1FWZA 1YI2T 2QTXA 4JRQA 2LT1A 3ZFJA 3JCMd 1K73C 2MMPA 2RO0A 2VYTA 5FRMA 2D6FA 3M4GA 3JCMh 4QQ6A 5LJ3d 3CMAT 2RK2A 2DTHA 4M78B 3JCMX 3CBMA 5LJ3h 3JCMe 2RH2A 2DXBA 5DM7R 3HRTA 4IUPA 3OSVA 3G4ST 4HT9A 3A5ZB 3CPFA 5LJ5h 1VQNA 1QVFA 4M7DA 3M58A 4J6WA 3VV0A 4M7DC 5CKFA 4L59A 4LDUA 3DLLA 1K8AU 4DA4A 5GAN6 4JRIA 3SWNB 3G71T 3EFSA 2ZPBB 4A4KA 3C12A 2R57A 1QVPA 2K57A 2MWOA 2VV5A 3WXMB 3FIFA 3LH0A 3CPWS 1VQ6A 2VUBA 2R5MA 4OMFB 2A3LA 4OGCA 3QIIA 3CC4A 4OB1B 2ZPEB 1VQOA 4QQGA 2K3YA 4PL6A 1VQPT 3TEEA 2CZ0B 2BIVA 4M7DF 1B34A 5J26A 5J3BA 3OYEA 5FU7B 3VKIA 4NL3A 3BW1A 1JBMA 3GF5A 4F7UB 2E10A 3FRNA 3OYYA 1KQ1A 3SB2A 5GMKi 1N9RA 4ZGEB 1VQPA 1YITT 3KBGA 2XHCA 1N8RU 4C92B 3CCUT 2QQBA 3Q1JA 2X4JA 4GLKA 4IUVA 3VYGA 2NLUA 3SD4A 4FSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2W A;  2LCC A;  2X35 A;  3OYF A;  4A4G A;  4ZTJ A;  4GY5 A;  3OYC A;  3DB3 A;  2GF7 A;  2RJD A;  3OQ5 A;  5D6X A;  2JTF A;  3L2R A;  3OYL A;  3LX7 A;  4BDY A;  3PMI A;  5KCO A;  4QW2 A;  4C5I A;  3DLM A;  3MP1 A;  4X34 A;  2RI5 A;  3CEY A;  3C4S A;  4BE1 A;  4E7I A;  2D9T A;  5KE3 A;  3OYK A;  2M1H A;  3OYB A;  2RI2 A;  3OYH A;  1OI1 A;  2EFI A;  2BKD N;  3EAE A;  3OS2 A;  4NS5 A;  1MHN A;  3OS1 A;  2XK0 A;  3NTH A;  2R5A A;  4RG2 A;  1N27 A;  1XNI A;  4II1 A;  4E7H A;  4E7J A;  1WJS A;  3OB9 A;  4C5G A;  4N4H A;  4OVA A;  2FHD A;  3UT1 A;  4EDU A;  2EQM A;  2HQE A;  5KCH A;  4PLL A;  3FLG A;  4IKF A;  5IN1 A;  5FRO A;  4HCZ A;  2G3R A;  1KHC A;  2HQX A;  3S3N A;  3KUF A;  3NTI A;  3LGF A;  3P8D A;  3NTK A;  2B8A A;  2IG0 A;  3OA6 A;  3OYJ A;  1H3Z A;  3SD4 A;  3PFS A;  2RJF A;  3L2U A;  3S3M A;  3OYD A;  3MO8 A;  3MP6 A;  4BAC A;  2PQW A;  2RJE A;  3MEV A;  2CKK A;  3H8Z A;  3QBY A;  2EQK A;  3QJ6 A;  4IUU A;  2F5K A;  3LGL A;  4Z02 A;  2DIQ A;  3OMG A;  3BDL A;  3P8H A;  3PMT A;  4IUQ A;  4Q5W A;  4B9W A;  2EQU A;  3FEO A;  3MP8 A;  4QQD A;  2JZ2 A;  2E6N A;  4A4E A;  3GOX A;  3E9G A;  1WGS A;  2RHI A;  4QVZ A;  4BE2 A;  2QQS A;  3OMC A;  3S3O A;  2EQJ A;  2EKO A;  4C5H A;  2RHX A;  4LD6 A;  2RHZ A;  2GFU A;  2L8D A;  2MWP A;  2RI3 A;  2E5Q A;  2M16 A;  2XDP A;  1WJR A;  2X4W A;  5CIU A;  4BE0 A;  1OYX A;  2RHY A;  5C0M A;  4B9X A;  3FC3 A;  2GFA A;  4IUR A;  3MEW A;  2QQR A;  2RHU A;  4BDZ A;  5D6W A;  3M9Q A;  5IAY A;  5D6Y A;  5FRM A;  3OYN A;  3L2V A;  2RO0 A;  2VYT A;  4UC4 A;  2LTO A;  3H6Z A;  3QKJ A;  1RI0 A;  4QQ6 A;  4FL6 A;  3UWN A;  3L42 A;  2O4X A;  3OYI A;  2WAC A;  4A4H A;  3LLR A;  1SSF A;  4IUP A;  4IUT A;  2L89 A;  3LYI A;  2LDM A;  5KH6 A;  4CRI A;  2DIG A;  3OYM A;  4L59 A;  5C6S A;  4E7K A;  4ZTF A;  2DAQ A;  2R57 A;  4BD3 A;  2MWO A;  3MET A;  3ZEH A;  3L2Q A;  3LH0 A;  3O8V A;  2R5M A;  3E9F A;  3QII A;  3F70 A;  3OYA A;  4QQG A;  2L3R A;  2X4Y A;  5M9O A;  2K3Y A;  4PL6 A;  2BUD A;  2LRQ A;  3FDR A;  4N4I A;  1G5V A;  2BIV A;  1WJQ A;  2K3X A;  5J26 A;  2YRV A;  3S6W A;  1OZ3 A;  4C5E A;  3OS0 A;  3OYE A;  5J39 A;  2R58 A;  2O4X B;  2M0O A;  2X4X A;  3OYG A;  2LVM A;  5KE2 A;  5FRN A;  2RJC A;  1OZ2 A;  3ME9 A;  4FU6 A;  3OY9 A;  2P0K A;  3MEU A;  4E7L A;  3Q1J A;  4PLI A;  3DB4 A;  3PNW C;  4A4F A;  3ASK A;  4N4G A;  4IUV A;  2NLU A;  3MEA A; 
#chains in the Genus database with same CATH topology
 3GIB A;  4C0D C;  4A4G A;  1JXO A;  3DB3 A;  1UFF A;  3ULR B;  4HCB A;  3JAM E;  3OYL A;  4E7Z A;  2VB6 A;  4HVV A;  1O75 A;  3FJ5 A;  3CCL T;  4IIM A;  2RI5 A;  2CT3 A;  2HDA A;  1WHK A;  1UGV A;  5CQY A;  4M75 B;  1W2B S;  3VS5 A;  4J9E A;  1AWJ A;  1RAA B;  1AEY A;  3BFM A;  3I56 Q;  1BK2 A;  2R5A A;  1ZX6 A;  2M02 A;  3PVQ A;  4E7H A;  2KR3 A;  1M3C A;  5GAN 5;  3JB9 D;  4N0A A;  2G3R A;  4ORZ A;  4N0A C;  5A0L A;  4JLG A;  1KQS P;  2F2W A;  1H8K A;  2OX7 A;  2LX9 A;  3G4S A;  2LZ6 B;  1W4S A;  3EG0 A;  2E1H A;  1VQM T;  1QWE A;  4J7F A;  1OQK A;  1M90 R;  2QQS A;  2HQH A;  5L23 A;  2DTI A;  2RHX A;  3VS7 A;  5GAO p;  2ZCF B;  2XDP A;  2K9G A;  3EG9 A;  2XMF A;  3M0S A;  5C0M A;  4AFS C;  2RD1 A;  5CVI A;  2FG0 A;  3G6E T;  4BDZ A;  2O9S A;  2O01 E;  4C92 F;  4PJL A;  3SFM A;  1D3B B;  3REB B;  1YIT A;  2JN0 A;  3LYI A;  3JB9 J;  3CD6 Q;  2LQK A;  3ZEH A;  3JB9 I;  3NMZ C;  4M77 E;  1HSQ A;  1B07 A;  1J3T A;  4R55 A;  3EGX B;  1S72 T;  3CCR Q;  2BUD A;  4FYX B;  5CKH A;  1YHQ Q;  1VQ7 A;  1ARK A;  2COZ A;  4Z8A A;  4KUI A;  2X4X A;  3RER A;  1WZO A;  1W1F A;  4JJN K;  2HNI A;  5KE2 A;  2E6Z A;  1K4U S;  2HL5 C;  2KK4 A;  3I55 Q;  3LWI A;  1AWX A;  2BE7 D;  1VYU A;  1D3B A;  1OI1 A;  2OTL T;  4BI8 B;  3JCM P;  3CCS T;  1UG1 A;  1Y96 A;  1QWF A;  1SKU B;  4VUB A;  2DL3 A;  1XNI A;  1RAG B;  3OW2 P;  3E2U A;  1Y07 A;  4MMK A;  4MZM A;  4DBR A;  3V8L A;  3VRZ A;  3QHS A;  2X3W D;  3EGX A;  4Y91 A;  2JUF A;  3H0H A;  1ZBJ A;  3OA6 A;  1VQO Q;  1YJN Q;  2IVW A;  3TU4 K;  2YUN A;  3J81 E;  4BAC A;  2ZAE A;  2QYZ A;  4DBH A;  3FB9 A;  5GAN d;  1P92 A;  5LJ3 j;  4C92 D;  2HBW A;  2NUZ A;  5LJ5 j;  4JRP A;  3REA B;  2LMJ A;  3RR6 A;  4IUR A;  4DBQ A;  3A8O B;  2CUB A;  4YTL A;  3GP8 A;  3CC7 T;  3SEM A;  1PSF A;  2DYI A;  2L3P A;  5CCA A;  3SDZ A;  4F7U E;  3U23 A;  5KYN A;  3OYM A;  2AHJ B;  5CR2 A;  4L5G A;  1QLY A;  1SHG A;  3MET A;  1VQK A;  1NEG A;  3RBB B;  4ZNX A;  3M53 A;  1G5V A;  1UGR B;  2DEU A;  4M7D G;  2K5L A;  1M90 U;  4OMP A;  2P0K A;  3MEU A;  1Q86 C;  1PKS A;  2RMO A;  1SPK A;  3CCQ A;  2JS0 A;  3CD6 A;  2EVR A;  2RQW A;  3CCE T;  3X25 B;  1R0B G;  3NGP A;  4BY6 C;  4QW2 A;  1X6B A;  2JTE A;  3C4S A;  3M56 A;  3M5A A;  2D9T A;  2YSQ A;  1PG5 B;  1KQ2 A;  3OS1 A;  2J05 A;  1ZUK A;  2EGA A;  3EFR A;  1QQJ A;  2RF0 A;  2XKO C;  1M3B A;  3X26 B;  1NBE B;  5KCH A;  1LOJ A;  3CCV T;  1KG1 A;  1WYX A;  1K8A R;  2DZC A;  2FL7 A;  5CKB A;  1IXD A;  1UEB A;  1YIJ T;  3EH1 A;  3MP6 A;  2FEI A;  2F5K A;  2DIQ A;  1ZUU A;  4XTY A;  2RM4 A;  2COW A;  1GFD A;  2O2O A;  2EJF A;  2ATC B;  3QDF A;  1HXD A;  4ZN3 A;  5GMK m;  2MWP A;  4CC4 B;  1PSE A;  1VQ6 Q;  4XK8 E;  1UEC A;  3M9Q A;  1YJN A;  3EHR A;  3H6Z A;  5HY6 A;  4FYV B;  4Z88 A;  3CCJ T;  2O4X A;  2KYM A;  1HJD A;  2Y4Y A;  2CYZ B;  3C0C A;  1Q7Y R;  1AD5 A;  1RAE B;  5C6S A;  2RQV A;  4EMK B;  2BE9 B;  1W2B P;  5CQX A;  1BU1 A;  1BCO A;  1OX8 A;  1LPL A;  4N4I A;  1G3W A;  1C6V X;  2EGC A;  2MAM A;  4JLI A;  2JW4 A;  1NZ9 A;  1I5O B;  3PGG A;  3ME9 A;  3TQ7 P;  3VU3 C;  4HVU A;  1PC0 A;  4PJO E;  3CME Q;  2K6D A;  1MNE A;  1VYT A;  2FRW A;  1TS9 A;  2RJD A;  2EJG A;  4KUD K;  3LX7 A;  1IGU A;  2DNU A;  4BB7 A;  1OU8 A;  1VA7 A;  2W10 A;  5LJ3 f;  4OB2 B;  2BZX A;  3V8J A;  4KH1 B;  1G3S A;  5LJ5 f;  2LJ3 A;  5GAN 3;  4M75 E;  1BIA A;  2XK0 A;  2BTT A;  1JO8 A;  2QA4 A;  3EGD A;  2KT8 A;  4WCI A;  4EMK A;  2ED0 A;  4OVA A;  4EMK C;  2L3Q A;  2E3I A;  4F14 A;  5KYX A;  2F2X A;  1M8V A;  1KHC A;  2CSQ A;  5GAN 2;  1KC8 R;  1Q82 C;  4RTU A;  4DEX A;  2HKQ B;  1KQS A;  2WSE E;  2E6N A;  1V1C A;  2XU8 A;  3E9G A;  3OMC A;  2MIO A;  1WDX A;  2EKO A;  2RK1 A;  2EJ9 A;  4LD6 A;  4M77 A;  2RI3 A;  5CIU A;  4M77 C;  1M1K C;  1C1A A;  4C8Q E;  5GMK l;  5KYY B;  2LT1 A;  2MMP A;  2RO0 A;  3JV3 A;  5LJ3 d;  3JCM X;  3G1J A;  2J7I A;  5LJ3 h;  3G4S T;  5LJ5 h;  1QVF A;  3VV0 A;  3HTR A;  1K8A U;  4JZ3 A;  2ZPB B;  3H9N A;  3C12 A;  3WXM B;  1VQ6 A;  3NPF A;  2JMA A;  2R5M A;  2DET A;  4OB1 B;  2EGE A;  2D8H A;  1S1N A;  2K3Y A;  3PVL A;  2CZ0 B;  3CC2 Q;  4M7D F;  5J3B A;  3VKI A;  4NL3 A;  3BW1 A;  4RTX A;  4F7U B;  2E10 A;  2PTK A;  3OYY A;  1YIT T;  3KBG A;  1PWT A;  3M0Q A;  3Q1J A;  1RAD B;  1T3S A;  5KYY A;  4OMN A;  4C5I A;  5EC7 A;  1QVG A;  2ZPG B;  3NHN A;  5GMK j;  3VS2 A;  3HP9 A;  2YLC A;  4GLM A;  1VQ7 T;  2DM1 A;  5GAM g;  3M54 A;  2CP5 A;  1OX9 A;  3WVD B;  5CAI A;  2HQE A;  3QWX X;  3FLG A;  5FRO A;  2NUP A;  3RDV A;  4RG8 A;  1VQ5 T;  4AFQ C;  4EMG A;  5DY9 A;  1IZ6 A;  1FX7 A;  1E7O A;  2RQU A;  2HZY A;  3C94 A;  2DD4 A;  4OMO A;  2RN8 A;  4F7U A;  1I4K 1;  2EQK A;  3UPU A;  2AKK A;  4M77 G;  3I5R A;  3OMG A;  5HKC A;  4B9W A;  3FEO A;  1T3L A;  2RHI A;  3S3O A;  4OML A;  5A2Q E;  3RES A;  2GBQ A;  1WXB A;  1IRX A;  1AZG B;  3VUZ A;  1VQP A;  4XU0 A;  3MEW A;  2QQR A;  1I8F A;  1KHI A;  1YJW Q;  2EYZ A;  3QZ9 B;  2ABL A;  1VQL Q;  4UC4 A;  3MHX A;  1GXI E;  2J6K A;  2AIR B;  4FYY B;  1BCM A;  2BZY A;  4D8K A;  5DLO A;  1DJ7 B;  2EQI A;  2KYB A;  4E2F B;  4LDX A;  4RTY A;  4ZTF A;  1XJW B;  1YJ9 A;  2NUT A;  5GAO r;  1M90 C;  3E9F A;  1KC8 U;  2RQR A;  1Y0M A;  1GBQ A;  2QGG A;  2X4Y A;  4BUG A;  5GAM e;  1WJQ A;  1WXU A;  1WI7 A;  2LCL A;  2HCK A;  1XOV A;  2R58 A;  4FT2 A;  5IH2 A;  3URG A;  1K9M C;  1OPL A;  2RJC A;  2QG9 B;  1M4Z A;  2C0T A;  3DB4 A;  2MF2 A;  1JQQ A;  2X35 A;  4GY5 A;  3BY7 A;  5D6X A;  1WFW A;  2QQ9 A;  1UTI A;  1VQK T;  3CC2 A;  2ZPI B;  5I2S A;  1MHN A;  1OUL A;  2M0Y A;  4PJO B;  4RTV A;  1WHG A;  2L5Q A;  1UJ0 A;  1M30 A;  5FU6 B;  1WNL A;  3RKX A;  4KH0 B;  3T9N A;  4ELY C;  2XDD A;  2FHD A;  2I0N A;  3FJP A;  2DL5 A;  1I81 A;  1BB9 A;  3CCQ T;  3CD6 T;  3P8D A;  2QK0 A;  3LGF A;  4OB0 B;  1WX6 A;  1QCO A;  2ENM A;  2EW3 A;  2PVD B;  3CCR T;  4M78 A;  2CZ7 B;  4QT7 A;  4M7A B;  1YHQ T;  1Z9Z A;  4M78 C;  2DBK A;  2JXB A;  3LH5 A;  2E64 A;  2P0P A;  4J9I A;  3PTA A;  4HCC A;  2XIC A;  2DLP A;  3SWN A;  2FZK B;  1I1J A;  3SWN C;  1WJR A;  1K76 A;  3TSW A;  2OTJ Q;  4J5Y A;  3I55 T;  4TVR A;  2KSS A;  5KYU B;  4FCY A;  2LTO A;  2GGR A;  2VXE A;  3EG3 A;  3UWN A;  2D0Q B;  3L42 A;  4PJO A;  1NYG A;  3OYI A;  4PJO C;  5GAO q;  2QDL A;  5FU6 C;  2H8H A;  2LCS A;  4C92 E;  1GRI A;  4JUV A;  4C8Q B;  1YI2 Q;  2YUO A;  2V1R A;  5I2M A;  4LDV A;  1YJW A;  1W2B A;  4JS4 A;  3AHU A;  2YRC A;  3R6N A;  4M75 A;  1NPR A;  3S6W A;  1YJN T;  4M75 C;  1RAB B;  4J9H A;  2DZ9 A;  2RQT A;  2KMT A;  1QVF P;  4DQ2 A;  5FRN A;  1Y71 A;  1ZSZ B;  2RA2 A;  3JSC A;  2EYW A;  1TOV A;  1NE8 A;  1VYV A;  1SF9 A;  2DJZ A;  1QKW A;  4PJN A;  2AKL A;  3DLM A;  1WHL A;  2DEQ A;  2HBP A;  3QYG B;  2X3X D;  1YWP A;  1B34 B;  2CT4 A;  3M4Y A;  1FMK A;  1X2K A;  1I5L A;  5GAN f;  2IIM A;  1ZBX A;  4IIO A;  4C0G A;  4EDU A;  4N4H A;  4C8Q A;  1VQ5 A;  4LNP A;  3V7S A;  1V76 A;  1KJW A;  3CCL Q;  4C8Q C;  5GAN 7;  1KK7 A;  4O5V A;  1QVG P;  3UDC A;  2EKH A;  4M78 G;  2B8A A;  2IG0 A;  5GMK h;  4KUL A;  2KAF A;  1JU5 C;  2CKK A;  3PIO A;  2MOX A;  3M59 A;  4M77 F;  2CGH A;  4FYW B;  3RMQ A;  1Q81 C;  1BYM A;  4EPC A;  5LJ3 e;  4BE2 A;  2YUP A;  1K9A A;  1YP5 A;  5LJ5 e;  4ATO A;  2P84 A;  2QA4 T;  2RHY A;  1KFZ A;  3FC3 A;  2GFA A;  2LQW A;  4WTO B;  2DD5 A;  2VWF A;  4PJO G;  3CC4 Q;  3OYN A;  3SHW A;  1K8A C;  3VS0 A;  1D0Y A;  1PHT A;  1M9S A;  2CDT A;  1O9S A;  4P5N A;  2D1X A;  3TSZ A;  4DOW A;  1N9S A;  4J9G A;  3I56 A;  2RNA A;  1WHM A;  3RUX A;  5GAN h;  2CH4 W;  4FW2 A;  1WIE A;  1UUE A;  3QDR B;  4BD3 A;  3G6E Q;  4M75 G;  1X43 A;  2E70 A;  5GJV B;  1NJI R;  4BI3 A;  3ER0 A;  1NEB A;  2LRQ A;  3OS0 A;  2X51 A;  2PVG B;  3JB9 H;  4CC3 A;  2LVM A;  5HK0 A;  3I9Q A;  4E7L A;  4JJC A;  1Y7X A;  4PLI A;  4A4F A;  3RMS A;  1MV3 A;  3BDU A;  4AG1 C;  2CP0 A;  1AVZ C;  2HD0 A;  3MEA A;  1KD1 C;  2K7A A;  3P8B B;  2ROT A;  1VQ9 Q;  5FWC A;  1M2V B;  2JOY A;  2HKN A;  2PU9 B;  3MP1 A;  3JCM f;  3EHQ A;  2HEQ A;  1VQ6 T;  5KE3 A;  3CMA Q;  3OYB A;  3O5Z A;  3OYH A;  2MCN A;  1YCS B;  4R56 A;  1ABQ A;  2ECZ A;  2RPN A;  3VRY A;  4OF1 A;  2X9H A;  3G71 Q;  2DO3 A;  4E7J A;  3OB9 A;  3UT1 A;  2JS2 A;  4GBQ A;  2E3H A;  4PLL A;  1MMN A;  4M77 D;  2Y90 A;  1ZQ1 A;  2DL8 A;  4F7U F;  2DVJ A;  1LCK A;  3IQL A;  1PRM C;  3S3M A;  3CCR A;  4Z89 A;  4X9C A;  5IXF A;  2QDY B;  1YHQ A;  2RJE A;  4V2S A;  1MND A;  3RKY A;  3CCU Q;  2CZ1 B;  2FZC B;  1E6G A;  1E6H A;  3GOX A;  1WGS A;  2K79 A;  1X01 A;  3CME T;  2X4W A;  1BI0 A;  3I55 A;  2JNG A;  4AG2 C;  3EFO B;  2HSE B;  3HKS A;  5FRM A;  3JCM d;  1H92 A;  3JCM h;  2KGT A;  4HCK A;  3OSV A;  1F1B B;  3M58 A;  4L59 A;  3DLL A;  2L0A A;  4DA4 A;  4A4K A;  3MPU B;  1B7T A;  3LH0 A;  3M0U A;  3CPW S;  3QII A;  3CC4 A;  2FRY A;  1HYO A;  3D7S B;  1VQO A;  3CC7 Q;  1VQP T;  5J26 A;  1W70 A;  3OYE A;  5FU7 B;  3GF5 A;  3SB2 A;  1NG2 A;  2XHC A;  4C92 B;  2QQB A;  2X4J A;  2ROL A;  4GLK A;  1MMG A;  4L6V 5;  3J7A F;  4ANJ A;  4RTZ A;  3OYC A;  3L2R A;  2GF7 A;  2PUK B;  4XTW A;  4F04 B;  2V8J A;  1YJ9 T;  1N8R C;  5A0D A;  4OMM A;  2MPX C;  2A28 A;  1JJ2 S;  2RI2 A;  1TXQ A;  4O6J A;  3HSB A;  4ME7 A;  2CSI A;  1CKB A;  4XQ3 A;  5HK3 A;  2V8I A;  4ZN1 A;  2XID A;  2OAW A;  1VQ4 Q;  1M5Q 1;  2FYK A;  2FZG B;  1ACM B;  2YT6 A;  1VQ9 A;  2P0Q A;  2PVO B;  2QEX Q;  2AZV A;  2FPD A;  4M78 F;  1NJI U;  2LJ0 A;  3CMA A;  4X9D A;  1H3Z A;  3OBY A;  2W0Z A;  1BBZ A;  3L2U A;  4D6W A;  3CXC S;  3PIP A;  2F69 A;  4XTZ A;  4LDY A;  1I0C A;  5FU7 C;  3X28 B;  3CC2 T;  2F5T X;  2HL3 A;  3CCV Q;  4M7A E;  3G71 A;  2A36 A;  1WXT A;  4RTW A;  1UGQ B;  2RHZ A;  2L2P A;  3VYH B;  1YN8 A;  2CP7 A;  4J7I A;  4PJO F;  1YIJ Q;  5I22 A;  2CP3 A;  4NL2 A;  1SSH A;  3C95 A;  2M51 A;  2DA9 A;  2DBM A;  1H3H A;  4KGV B;  2JM8 A;  1SSF A;  1FXX A;  4IUT A;  9ATC B;  2DIG A;  1AT1 B;  2E5K A;  1BKB A;  1GL5 A;  4Y92 A;  4LDW A;  4M75 F;  1WQ7 A;  3L2Q A;  4R0K A;  5FWB A;  3HRU A;  3CCJ Q;  2E41 A;  2Y4X A;  6AT1 B;  1FMW A;  2J6O A;  1OOT A;  2RB6 A;  2M0O A;  1EIF A;  4LUE A;  2LQN A;  3OY9 A;  1OEB A;  4N4G A;  4C0F A;  2YLB A;  1GCQ A;  4M7D E;  5IHI A;  4OMQ A;  2KNB B;  3JCM b;  2LT4 A;  4X34 A;  5D7U A;  3CEY A;  2M1H A;  1YJW T;  3A8M B;  5GMK e;  3EAE A;  4C8Q F;  2FPF A;  4M78 D;  1N27 A;  1IHV A;  2DE0 X;  3VS3 A;  2C06 A;  1TUC A;  4RKU E;  2K2V A;  2QAS A;  3PT9 A;  2JVV A;  4HCZ A;  2C0I A;  1FMV A;  3JCM c;  2MYS A;  3KUF A;  3OW2 S;  3OYJ A;  2FPE A;  1Y57 A;  5GAN 8;  4OB3 B;  3CCM Q;  3QXE B;  4C0Z A;  3H8Z A;  3QJ6 A;  4Y28 E;  4FT4 A;  4PJO D;  3VS4 A;  1C0M A;  1W6X A;  1Q7Y U;  3M55 A;  1TWB A;  1PRL C;  3MP8 A;  1VQ4 A;  4E7I A;  2EWN A;  4A4E A;  1TTH B;  1KSW A;  4HA8 A;  3RKW A;  3CME A;  3UAT A;  5GAN e;  2E5Q A;  4AFZ C;  2QQA A;  2H3E B;  4BE0 A;  3M0T A;  2EBP A;  2FO0 A;  2YXY A;  5IAY A;  3EH2 A;  3M0R A;  4RCB A;  1Z9Q A;  5DLQ E;  2D8J A;  4A54 A;  1OV3 A;  4M75 D;  2HAX A;  2WAC A;  4XTV A;  3GNG A;  4XU3 A;  1M1F A;  1ZA2 B;  1NYF A;  4J6Y A;  4PK4 A;  2E4H A;  4AFU C;  1Q82 R;  1UHC A;  1R77 A;  2MK5 A;  4MDX A;  3JRZ A;  1SRL A;  2KEA A;  3O8V A;  2A08 A;  2L3R A;  4PKC C;  2YRV A;  1SRM A;  1NLO C;  3DKM A;  4RUG A;  2PNI A;  3M0P A;  2OAU A;  1BI3 A;  3OYG A;  2XD0 A;  4JJB A;  1M1K R;  1ZLM A;  2EPD A;  4E47 A;  2Z0W A;  3I56 T;  4CC2 A;  3V7C A;  4C8Q D;  1UGP B;  3RNJ A;  4LE9 A;  1WHJ A;  2QI2 A;  4XAX B;  2EFI A;  2HSP A;  2BKD N;  2KRO A;  1Q95 G;  2VGN A;  1EFN A;  2DXC A;  1QCF A;  4F16 A;  4ZGJ B;  4RG2 A;  2OI3 A;  2L3S A;  1VQ8 Q;  3HL8 A;  1GCP A;  3S3N A;  1IGQ A;  3MKD A;  1IO6 A;  1N6A A;  4PFZ A;  3A8H B;  3ZL7 C;  3INZ A;  1M27 C;  4PNO A;  1RI9 A;  2YDL A;  3CPW P;  2VAS A;  2CP2 A;  1MUZ A;  4J9D A;  2NYS A;  1VQN Q;  2K4Y A;  1TG0 A;  4C5H A;  3V7R A;  3VS6 A;  3HFO A;  2DMO A;  5D6W A;  1VIE A;  3QUI A;  5GAM j;  4EMH A;  4F7U G;  4DOV A;  4F17 A;  2DXT A;  3QKJ A;  1QP2 A;  2AT1 B;  2A7Y A;  3CCM A;  4FL6 A;  3OS5 A;  5GJW B;  3H0I A;  5IXB A;  3VJP A;  2LDM A;  2LP5 A;  1JJ2 P;  4E7K A;  2ZGW A;  2DAQ A;  3E19 A;  3EG9 B;  1LNX A;  4JPB W;  2O9V A;  1NLP C;  1PKT A;  4FW1 A;  5CO7 A;  2JTM A;  3N5B B;  4C5E A;  1VUB A;  2KQW A;  1WPY A;  2B86 A;  2DER A;  3X20 B;  3GPL A;  3OSS C;  1H64 1;  1AOJ A;  2F1L A;  1CKA A;  1RAI B;  3CXC P;  4JZ4 A;  2LCC A;  2JJ9 A;  1TUD A;  5KCO A;  3HFN A;  2M9U A;  5LJ3 g;  3QJY A;  1VQL A;  5LJ5 g;  3H41 A;  3CC4 T;  4ESR A;  3RIR A;  1G3Y A;  3VUB A;  1MGQ A;  8AT1 B;  4M7A A;  1VQO T;  1WQW A;  2KXC A;  3X24 B;  5KYW B;  4NS5 A;  3A1P A;  4XU1 A;  1NJI C;  1EZZ B;  2LX7 A;  4M7A C;  1TUG B;  3L2Z A;  2KDS A;  1MMD A;  4DEY A;  2DL7 A;  1Q82 U;  2WSF E;  4M7D B;  2EQM A;  1K73 R;  1YCY A;  3L1A A;  3QG1 A;  4JJD A;  5IN1 A;  1M8M A;  4K11 A;  1VQK Q;  2AK5 A;  2HQX A;  2JM9 A;  5KYU A;  1K9M R;  1RAH B;  1G3T A;  2RJF A;  4PFO A;  3WVE B;  3QBY A;  4IUU A;  1RUW A;  1V29 B;  1Y96 B;  3THK A;  4Z02 A;  1M1K U;  3P8H A;  4Q5W A;  4DBF A;  3CCQ Q;  5LL6 S;  1U8R A;  1VQ8 A;  3R6O A;  2FVU A;  2LNV A;  4FSS A;  2EYX A;  1T0H A;  2KVQ G;  1VQ9 T;  2NWM A;  1FWZ A;  4CC7 A;  1YNZ A;  2QTX A;  1TSF A;  1ZSG A;  1D1A A;  2O88 A;  4QQ6 A;  5KYW A;  3CMA T;  4LUD A;  2DTH A;  3CBM A;  5DM7 R;  2KI7 A;  2RH2 A;  2DXB A;  3HRT A;  1ZSZ A;  4PJM A;  2P4R A;  3A5Z B;  4M7D A;  1U3O A;  1VQN A;  2DYB A;  1ZSZ C;  4J6W A;  4M7D C;  1UE9 A;  1D1C A;  2V26 A;  4JRI A;  3VS1 A;  3G71 T;  1WLP B;  3EFS A;  4KGX B;  2R57 A;  1QVP A;  2K57 A;  2MWO A;  3FIF A;  2A3L A;  2J6F A;  4OGC A;  4QKU A;  4QQG A;  4PL6 A;  3TEE A;  2BIV A;  1B34 A;  3UA6 A;  1VQM Q;  3FRN A;  1KQ1 A;  5AT1 B;  3CCU T;  2EYY A;  3VYG A;  2NLU A;  3SD4 A;  3OYF A;  4ZGD B;  2OTJ A;  2EAY A;  3OQ5 A;  3QSU A;  3TRE A;  3PMI A;  1X2Q A;  4M7A G;  2VXF A;  5CKD A;  4PJJ A;  1OPK A;  3OS2 A;  5IHN A;  3NTH A;  4A53 A;  2KRM A;  1R0C B;  3A8G B;  4C5G A;  1RLQ C;  2EYQ A;  1JXM A;  5GAM f;  2SEM A;  4MZP A;  4BY6 B;  1X75 C;  1YI2 A;  1Q7Y C;  1BI1 A;  1D09 B;  4A63 B;  1S72 Q;  2V1Q A;  1XQH A;  2LJ1 A;  1G83 A;  2DTO A;  3PFS A;  3MO8 A;  1UHF A;  2XDB A;  2PQW A;  4WF2 A;  1KIK A;  3PMT A;  4C8Q G;  1R8O B;  3KFV A;  2EQU A;  1B3Q A;  2DKG A;  2GTJ A;  2YWW A;  4B9X A;  1MV0 B;  1GFC A;  3TCJ A;  2E65 A;  4J8O A;  2OTL Q;  1HD3 A;  1JB0 E;  2I2L A;  3CCS Q;  8ATC B;  1RI0 A;  3QYH B;  1PD0 A;  3V8K A;  3QO3 A;  5GAO m;  1X69 A;  4A4H A;  2QA4 Q;  1CSK A;  4CRI A;  1K73 U;  2GNC A;  5A0G A;  1AZE A;  1VQ4 T;  1UJY A;  3CCL A;  5GAM d;  1M2V A;  3M57 A;  3NFC A;  5GAM h;  2QEX T;  1K9M U;  2QGF B;  1U06 A;  1Q81 R;  4AT1 B;  3FDR A;  2K3X A;  1RLP C;  3UF4 A;  4RTT A;  1X6O A;  5J39 A;  1EX4 A;  2D0N A;  2O4X B;  1KC8 C;  4RCC A;  3PNW C;  3ASK A;  1ZHI A;  2VKN A;  3I35 A;  1IRE B;  4OP0 A;  1K1Z A;  2CS7 A;  2XI9 A;  2GQV A;  2YRD A;  2K2M A;  3OYK A;  2K5I A;  3HRS A;  1VQM A;  1MMA A;  4B6M A;  2K5F A;  1QW1 A;  3JCM W;  3J80 E;  3G7Z A;  4XTX A;  1AWO A;  1IB8 A;  1A0N B;  3EG1 A;  3G6E A;  1G2B A;  4D8D A;  4JS5 A;  1M1G A;  3EFO A;  3NTK A;  2EIF A;  2YUQ A;  2KXD A;  2H3J A;  1LJO A;  2G6F X;  2DJQ A;  5L8R E;  2DIL A;  3UA7 A;  1KD1 R;  3LGL A;  4RMO A;  3JB9 G;  3BDL A;  4M78 E;  4QQD A;  4XU2 A;  3ZBD A;  2JZ2 A;  3CPW A;  3EGD B;  4QVZ A;  3CCE Q;  2ZPF B;  3BE3 A;  3HPW A;  4FIB A;  2M16 A;  5KYX B;  1OYX A;  1QKX A;  4HKE A;  1S72 A;  4J9F A;  3L2V A;  4LD9 K;  3JCM V;  2GTO A;  1QMC A;  1Q86 R;  2E12 A;  1PCX A;  2AZS A;  3CBP A;  3LLR A;  3JCM Q;  1QP3 A;  5IHK A;  4C92 A;  3JCM J;  2KE9 A;  1PD1 A;  5KH6 A;  5GAO l;  2DX1 A;  2CH4 A;  4C92 C;  1KQS S;  1RAF B;  1YWO A;  1AWW A;  2LQ8 A;  4M77 B;  2F2V A;  4QVC A;  1JJ2 A;  1U1S A;  5CK9 A;  2OTL A;  1JEG A;  3CCS A;  4KBM B;  3F70 A;  3OYA A;  4E7S A;  2MI6 A;  5M9O A;  2KBT A;  3GLX A;  2PUO B;  3CCM T;  4PFP A;  5I21 A;  3CCU A;  1OZ2 A;  4FU6 A;  4J83 A;  1D0X A;  1RL2 A;  5HCK A;  1WHH A;  2KT1 A;  2OJ2 A;  1QVF S;  2XG8 D;  3CXC A;  4LN2 A;  4MZT A;  4M7A F;  1VQP Q;  2CP6 A;  3QPH A;  3AT1 B;  1XTD A;  1AHJ B;  2JMC A;  5GAN g;  2YHT A;  1IHW A;  3HHT B;  2J06 A;  1YBY A;  4II1 A;  2CRE A;  5EG2 A;  1WJS A;  4HVW A;  2JT4 A;  1FYN A;  1YJ9 Q;  1D1B A;  2KRS A;  3MCA B;  1GCQ C;  1JRI A;  1Q81 U;  4KT0 E;  3NTI A;  3QWY A;  5FLX E;  3CC7 A;  5FW9 A;  2IPO B;  1VQL T;  5LJ5 d;  4JDS A;  4ELZ C;  1QVG S;  1SG5 A;  1OU9 A;  2WSC E;  1WA7 A;  2EQJ A;  1N8R R;  5IT9 E;  4J6X A;  2NUP B;  5CKE A;  4BI4 A;  5AYF A;  4KGZ B;  5D6Y A;  2DF6 A;  3KXT A;  3LW5 E;  4C92 G;  2DFU A;  1VOM A;  2CZ6 B;  3TVT A;  1BIB A;  2L89 A;  2CUD A;  5ECA A;  2ZZD A;  3CCE A;  2P4T A;  4M4Z A;  3CBO A;  3OBW A;  4OGE A;  2QEX A;  1UB4 A;  4LXC A;  1VQ8 T;  3GNF B;  1UGS B;  1RAC B;  1M3A A;  3H0F A;  4X1V A;  1KD1 U;  1VIF A;  1OZ3 A;  4E6R A;  4FM4 B;  4XTU A;  1BI2 A;  4M7A D;  1QCN A;  3A98 A;  4MDW A;  1K0X A;  2DL4 A;  1UDL A;  2GQI A;  4CI0 C;  3CCV A;  1K0S A;  2K3B A;  2DXU A;  1HK9 A;  4MML A;  1NPP A;  1U5S A;  3L2W A;  1VQN T;  3OW2 A;  2QAZ A;  1D0Z A;  4ZTJ A;  3EGU A;  3JCM g;  4BDY A;  1U1T A;  2JTF A;  4NOY A;  1N5Z A;  2NUT B;  2ED1 A;  1YIJ A;  4KRT A;  2QXF A;  4BE1 A;  1Q86 U;  1SHF A;  1ZUY A;  2V8K A;  4HT8 A;  2DVE A;  2DPP B;  3G4S Q;  4JRK A;  4EIK A;  2VC8 A;  1X6G A;  3MJX A;  1TH7 A;  1GBR A;  5GAN j;  2DK3 A;  2LNH B;  3QZ5 B;  4IKF A;  2GCX A;  2ESW A;  5I11 A;  3A8L B;  3CCJ A;  2OTJ T;  1X27 A;  2KY9 A;  5GAO n;  3E1S A;  1YFN A;  3OYD A;  4J9B A;  3MEV A;  1YIT Q;  3CQT A;  2VGM A;  1ABO A;  3JB9 F;  2VVK A;  1M2O A;  4IUQ A;  2HMA A;  5GAN 4;  2FB7 A;  3GBQ A;  2LC4 A;  2A37 A;  1NM7 A;  4QVD A;  4M7D D;  3I5S A;  1T0J A;  2GFU A;  2L8D A;  4C0D B;  3EG2 A;  2COY A;  3LWH A;  2ZPH B;  2RHU A;  4AMC A;  1LVK A;  1YI2 T;  1K73 C;  4JRQ A;  3ZFJ A;  2D6F A;  2VYT A;  2BZ8 A;  2PZ1 A;  3M4G A;  4J9C A;  2RK2 A;  1VQ7 Q;  4M78 B;  3JCM e;  4HT9 A;  4IUP A;  2QTV A;  2KRN A;  3CPF A;  5CKF A;  4LDU A;  5GAN 6;  3SWN B;  2O31 A;  1VQ5 Q;  2VV5 A;  4HXJ A;  2A0F B;  1ZA1 B;  1SEM A;  2VUB A;  4OMF B;  1PNJ A;  2ZPE B;  1G8X A;  1PM3 A;  7AT1 B;  2DRM A;  3PE0 A;  2DRK A;  1JBM A;  1I07 A;  5GMK i;  1N9R A;  4ZGE B;  2SRC A;  1N8R U;  2C0O A;  4IUV A;  1TU0 B;  4FSX A; 
#chains in the Genus database with same CATH homology
 4L6V 5;  3OYF A;  3J7A F;  3GIB A;  4C0D C;  4A4G A;  4ZGD B;  3OYC A;  2OTJ A;  2EAY A;  2GF7 A;  2PUK B;  3DB3 A;  3OQ5 A;  3JAM E;  3L2R A;  4XTW A;  3OYL A;  3TRE A;  3PMI A;  4HCB A;  3QSU A;  1O75 A;  2V8J A;  4C5I A;  3CCL T;  4M7A G;  2RI5 A;  1YJ9 T;  2VXF A;  1N8R C;  5A0D A;  4E7I A;  1QVG A;  2ZPG B;  1JJ2 S;  5CKD A;  2RI2 A;  5CQY A;  5GMK j;  4M75 B;  4O6J A;  3HSB A;  4ME7 A;  1W2B S;  3OS2 A;  3HP9 A;  2YLC A;  4XQ3 A;  5HK3 A;  2V8I A;  1VQ7 T;  4ZN1 A;  3BFM A;  2XID A;  3NTH A;  4A53 A;  2R5A A;  5GAM g;  4E7H A;  3M54 A;  1M5Q 1;  2FYK A;  3WVD B;  3A8G B;  4C5G A;  5GAN 5;  2EYQ A;  5GAM f;  2HQE A;  5CAI A;  1VQ9 A;  3FLG A;  2P0Q A;  2PVO B;  4MZP A;  1X75 C;  4N0A A;  5FRO A;  4BY6 B;  4RG8 A;  3JB9 D;  1YI2 A;  1Q7Y C;  1VQ5 T;  1BI1 A;  2G3R A;  4EMG A;  5DY9 A;  4M78 F;  4N0A C;  1NJI U;  1XQH A;  5A0L A;  4JLG A;  1IZ6 A;  3CMA A;  1FX7 A;  4X9D A;  1H3Z A;  2DTO A;  3OBY A;  3C94 A;  3PFS A;  3L2U A;  2DD4 A;  3MO8 A;  4D6W A;  3CXC S;  3PIP A;  2F69 A;  4XTZ A;  2XDB A;  2LX9 A;  2PQW A;  4LDY A;  3G4S A;  4F7U A;  4WF2 A;  5FU7 C;  1I4K 1;  2EQK A;  3X28 B;  1W4S A;  3CC2 T;  3UPU A;  2E1H A;  1VQM T;  4M77 G;  3OMG A;  3PMT A;  5HKC A;  4C8Q G;  1R8O B;  4B9W A;  2F5T X;  2EQU A;  3FEO A;  4J7F A;  2DKG A;  3G71 A;  4M7A E;  2RHI A;  3S3O A;  2QQS A;  5A2Q E;  3RES A;  2DTI A;  1UGQ B;  2RHX A;  5GAO p;  2RHZ A;  2ZCF B;  2XDP A;  3VYH B;  5C0M A;  4B9X A;  2RD1 A;  4J7I A;  5CVI A;  4PJO F;  4XU0 A;  3VUZ A;  3MEW A;  2QQR A;  3TCJ A;  1I8F A;  1KHI A;  3G6E T;  2E65 A;  4BDZ A;  4J8O A;  3QZ9 B;  4NL2 A;  1JB0 E;  2I2L A;  4UC4 A;  2O01 E;  3MHX A;  4C92 F;  1RI0 A;  3QYH B;  1GXI E;  3C95 A;  1D3B B;  3SFM A;  3V8K A;  3QO3 A;  5DLO A;  1YIT A;  5GAO m;  4A4H A;  1DJ7 B;  2JN0 A;  1SSF A;  1FXX A;  4IUT A;  3LYI A;  4LDX A;  4CRI A;  2DIG A;  1K73 U;  1BKB A;  5A0G A;  4ZTF A;  1VQ4 T;  4LDW A;  3JB9 J;  2LQK A;  3CCL A;  4M75 F;  1WQ7 A;  5GAM d;  1YJ9 A;  3ZEH A;  3JB9 I;  3L2Q A;  5GAO r;  1M90 C;  3M57 A;  3E9F A;  3NFC A;  4M77 E;  5GAM h;  2QEX T;  1KC8 U;  1K9M U;  3HRU A;  4R55 A;  2X4Y A;  4BUG A;  2E41 A;  5GAM e;  1S72 T;  2BUD A;  2Y4X A;  3FDR A;  5CKH A;  1VQ7 A;  1WJQ A;  2K3X A;  2LCL A;  1X6O A;  1XOV A;  2R58 A;  5J39 A;  2RB6 A;  4KUI A;  2O4X B;  2M0O A;  2X4X A;  4FT2 A;  1EIF A;  3RER A;  3URG A;  1K9M C;  4JJN K;  2HNI A;  1KC8 C;  5KE2 A;  2RJC A;  2E6Z A;  3OY9 A;  1M4Z A;  4RCC A;  3DB4 A;  3PNW C;  3ASK A;  4N4G A;  4C0F A;  2MF2 A;  1ZHI A;  2YLB A;  1IRE B;  2X35 A;  4M7D E;  4GY5 A;  4OP0 A;  2KK4 A;  3BY7 A;  5D6X A;  2CS7 A;  2XI9 A;  3LWI A;  2GQV A;  3JCM b;  1VQ4 A;  2LT4 A;  4X34 A;  2QQ9 A;  3CEY A;  3OYK A;  1D3B A;  1VQK T;  2M1H A;  3CC2 A;  2K5I A;  2ZPI B;  3HRS A;  1OI1 A;  1YJW T;  2OTL T;  4BI8 B;  1VQM A;  3JCM P;  3A8M B;  5GMK e;  3CCS T;  2K5F A;  3EAE A;  5I2S A;  1Y96 A;  4C8Q F;  1MHN A;  4M78 D;  4PJO B;  1QW1 A;  2L5Q A;  3JCM W;  4VUB A;  5FU6 B;  1N27 A;  1XNI A;  1WNL A;  3RKX A;  3J80 E;  3G7Z A;  1Y07 A;  3T9N A;  4ELY C;  4XTX A;  2XDD A;  2C06 A;  2FHD A;  4RKU E;  4MMK A;  2K2V A;  4MZM A;  3PT9 A;  3V8L A;  2JVV A;  3FJP A;  3G6E A;  1I81 A;  4JS5 A;  4HCZ A;  3CCQ T;  3CD6 T;  1M1G A;  3QHS A;  3JCM c;  4Y91 A;  2JUF A;  3KUF A;  3LGF A;  3P8D A;  3NTK A;  4OB0 B;  3OA6 A;  3OW2 S;  3OYJ A;  5GAN 8;  2IVW A;  4OB3 B;  3TU4 K;  2EIF A;  2H3J A;  1LJO A;  2PVD B;  3QXE B;  4C0Z A;  3J81 E;  3CCR T;  4BAC A;  3H8Z A;  4M78 A;  2CZ7 B;  5L8R E;  4M7A B;  3QJ6 A;  4Y28 E;  4FT4 A;  1YHQ T;  3FB9 A;  3LGL A;  4PJO D;  4RMO A;  4M78 C;  5GAN d;  3BDL A;  3M55 A;  4M78 E;  1P92 A;  2E64 A;  5LJ3 j;  3JB9 G;  1Q7Y U;  3MP8 A;  4QQD A;  4XU2 A;  2JZ2 A;  3ZBD A;  2EWN A;  2P0P A;  4A4E A;  4C92 D;  3PTA A;  4HA8 A;  4QVZ A;  5LJ5 j;  3CPW A;  4HCC A;  3RKW A;  2ZPF B;  2XIC A;  3SWN A;  3CME A;  4JRP A;  3HPW A;  4FIB A;  5GAN e;  2E5Q A;  2M16 A;  3SWN C;  1WJR A;  2QQA A;  4BE0 A;  1OYX A;  4HKE A;  4J5Y A;  1S72 A;  4IUR A;  3I55 T;  4TVR A;  5IAY A;  4RCB A;  2KSS A;  3L2V A;  4LD9 K;  2LTO A;  3A8O B;  3JCM V;  5DLQ E;  4YTL A;  4A54 A;  2VXE A;  3GP8 A;  2E12 A;  4M75 D;  3UWN A;  2D0Q B;  3L42 A;  2HAX A;  3CBP A;  3CC7 T;  3OYI A;  2WAC A;  4PJO A;  1PSF A;  3LLR A;  4XTV A;  3GNG A;  4XU3 A;  1M1F A;  3JCM Q;  4PJO C;  5GAO q;  1QP3 A;  4C92 A;  5CCA A;  3SDZ A;  4F7U E;  3JCM J;  5KH6 A;  5GAO l;  5FU6 C;  4J6Y A;  4C92 C;  3OYM A;  1KQS S;  2AHJ B;  4C92 E;  5CR2 A;  2LQ8 A;  4L5G A;  4JUV A;  4M77 B;  1JJ2 A;  4QVC A;  3MET A;  1U1S A;  4C8Q B;  3JRZ A;  4MDX A;  5I2M A;  1VQK A;  3O8V A;  4LDV A;  1YJW A;  1W2B A;  5CK9 A;  4JS4 A;  2OTL A;  3CCS A;  4KBM B;  3F70 A;  3OYA A;  2MI6 A;  2L3R A;  3M53 A;  5M9O A;  3AHU A;  4M75 A;  3GLX A;  1NPR A;  1G5V A;  2PUO B;  4PKC C;  2YRV A;  3S6W A;  1UGR B;  1YJN T;  3DKM A;  4M75 C;  4M7D G;  2K5L A;  2DZ9 A;  3CCM T;  2OAU A;  1BI3 A;  2KMT A;  5I21 A;  4DQ2 A;  3OYG A;  3CCU A;  2XD0 A;  1M90 U;  5FRN A;  1Y71 A;  1OZ2 A;  4FU6 A;  2RA2 A;  2P0K A;  3MEU A;  4J83 A;  1RL2 A;  3JSC A;  1Q86 C;  4E47 A;  3CCQ A;  3I56 T;  3CD6 A;  1NE8 A;  3V7C A;  3CCE T;  3X25 B;  2DJZ A;  4C8Q D;  1QVF S;  1UGP B;  2XG8 D;  4BY6 C;  4MZT A;  3CXC A;  4M7A F;  4QW2 A;  3DLM A;  2DEQ A;  2QI2 A;  3C4S A;  3M5A A;  2D9T A;  3M56 A;  2HBP A;  3QPH A;  4XAX B;  1XTD A;  1AHJ B;  3QYG B;  2EFI A;  2BKD N;  5GAN g;  1B34 B;  2YHT A;  3M4Y A;  2VGN A;  1KQ2 A;  2DXC A;  5GAN f;  3OS1 A;  1I5L A;  3EFR A;  4ZGJ B;  3HHT B;  1YBY A;  2XKO C;  1ZBX A;  4RG2 A;  3X26 B;  4II1 A;  5EG2 A;  1WJS A;  4C0G A;  4EDU A;  4N4H A;  5KCH A;  1LOJ A;  3CCV T;  4C8Q A;  1VQ5 A;  1KG1 A;  3V7S A;  2DZC A;  2FL7 A;  5CKB A;  4C8Q C;  5GAN 7;  3HL8 A;  3MCA B;  4O5V A;  1JRI A;  1UEB A;  3S3N A;  1Q81 U;  4KT0 E;  3NTI A;  3UDC A;  4M78 G;  2B8A A;  2IG0 A;  5FLX E;  1N6A A;  3CC7 A;  3A8H B;  5GMK h;  1YIJ T;  4KUL A;  2KAF A;  3INZ A;  4PNO A;  3MP6 A;  1VQL T;  2CKK A;  5LJ5 d;  4JDS A;  3PIO A;  3M59 A;  2F5K A;  4M77 F;  4ELZ C;  1QVG S;  2DIQ A;  4XTY A;  2CGH A;  1Q81 C;  3RMQ A;  2RM4 A;  1BYM A;  4EPC A;  5LJ3 e;  2EJF A;  4BE2 A;  2K4Y A;  2WSC E;  1HXD A;  2EQJ A;  4ZN3 A;  5LJ5 e;  4ATO A;  2QA4 T;  4C5H A;  5GMK m;  5IT9 E;  2MWP A;  3V7R A;  1PSE A;  2RHY A;  4J6X A;  5CKE A;  2GFA A;  3FC3 A;  3HFO A;  4BI4 A;  2DD5 A;  5AYF A;  4PJO G;  4XK8 E;  5D6W A;  3M9Q A;  1VIE A;  3QUI A;  5GAM j;  4EMH A;  5D6Y A;  4F7U G;  3OYN A;  1YJN A;  4DOV A;  1K8A C;  3H6Z A;  2DXT A;  3QKJ A;  1QP2 A;  5HY6 A;  3KXT A;  1M9S A;  3LW5 E;  2A7Y A;  4C92 G;  3CCM A;  3CCJ T;  1O9S A;  4FL6 A;  3OS5 A;  4P5N A;  2O4X A;  4DOW A;  1N9S A;  2Y4Y A;  2CYZ B;  2CZ6 B;  1BIB A;  2L89 A;  3VJP A;  3I56 A;  2LDM A;  2ZZD A;  3CCE A;  3RUX A;  2P4T A;  5GAN h;  5C6S A;  4E7K A;  4EMK B;  2ZGW A;  2DAQ A;  3CBO A;  3OBW A;  4BD3 A;  3QDR B;  4OGE A;  2QEX A;  3E19 A;  1UB4 A;  4M75 G;  1LNX A;  5CQX A;  2E70 A;  1VQ8 T;  3GNF B;  1UGS B;  5CO7 A;  4BI3 A;  3ER0 A;  2JTM A;  3N5B B;  2LRQ A;  4N4I A;  1G3W A;  1KD1 U;  4C5E A;  1VIF A;  1OZ3 A;  3OS0 A;  1VUB A;  2KQW A;  2MAM A;  4JLI A;  1WPY A;  1NZ9 A;  2PVG B;  1BI2 A;  4FM4 B;  4XTU A;  3JB9 H;  4MDW A;  3X20 B;  3GPL A;  4M7A D;  3OSS C;  1H64 1;  2LVM A;  4CI0 C;  3PGG A;  3ME9 A;  3VU3 C;  3CCV A;  5HK0 A;  2DXU A;  4E7L A;  4PJO E;  1Y7X A;  4PLI A;  1HK9 A;  4A4F A;  4MML A;  3RMS A;  3BDU A;  1NPP A;  2HD0 A;  3MEA A;  1KD1 C;  3L2W A;  2LCC A;  1VQN T;  3P8B B;  3OW2 A;  4ZTJ A;  3JCM g;  4BDY A;  2RJD A;  1U1T A;  2EJG A;  2JTF A;  2JOY A;  4NOY A;  3LX7 A;  4KUD K;  5KCO A;  3HFN A;  2M9U A;  1YIJ A;  2PU9 B;  3MP1 A;  3JCM f;  5LJ3 g;  2QXF A;  4BB7 A;  3QJY A;  4BE1 A;  1VQ6 T;  1VQL A;  5KE3 A;  5LJ5 g;  1Q86 U;  3OYB A;  3OYH A;  5LJ3 f;  2V8K A;  4OB2 B;  3CC4 T;  4HT8 A;  3V8J A;  3RIR A;  1G3Y A;  3VUB A;  1MGQ A;  2DVE A;  1G3S A;  5LJ5 f;  1VQO T;  4M7A A;  1WQW A;  2DPP B;  3X24 B;  5GAN 3;  4M75 E;  1BIA A;  4NS5 A;  4XU1 A;  1NJI C;  4R56 A;  4M7A C;  4JRK A;  2XK0 A;  2VC8 A;  2KDS A;  3L2Z A;  2QA4 A;  4OF1 A;  1TH7 A;  4EMK A;  1Q82 U;  2DO3 A;  4E7J A;  2WSF E;  4M7D B;  5GAN j;  3OB9 A;  4OVA A;  2DK3 A;  3UT1 A;  2EQM A;  4EMK C;  1YCY A;  3L1A A;  3QZ5 B;  4PLL A;  4IKF A;  3QG1 A;  4M77 D;  2Y90 A;  5IN1 A;  2GCX A;  1M8V A;  1ZQ1 A;  1KHC A;  2HQX A;  4F7U F;  3A8L B;  3CCJ A;  2OTJ T;  5GAN 2;  1Q82 C;  2KY9 A;  5GAO n;  3S3M A;  2RJF A;  1G3T A;  3E1S A;  3OYD A;  3CCR A;  4X9C A;  2QDY B;  1YHQ A;  3WVE B;  2RJE A;  3MEV A;  4V2S A;  3QBY A;  1KQS A;  2VGM A;  2WSE E;  4IUU A;  3JB9 F;  1V29 B;  1M1K U;  1Y96 B;  3RKY A;  4Z02 A;  4IUQ A;  2CZ1 B;  3P8H A;  4Q5W A;  5GAN 4;  2FB7 A;  2LC4 A;  3GOX A;  2E6N A;  4QVD A;  2XU8 A;  1WGS A;  3E9G A;  4M7D D;  3OMC A;  2EKO A;  2RK1 A;  2EJ9 A;  4LD6 A;  4M77 A;  2GFU A;  1X01 A;  2L8D A;  2RI3 A;  5LL6 S;  4C0D B;  3CME T;  2X4W A;  5CIU A;  3R6O A;  1U8R A;  1VQ8 A;  1BI0 A;  2FVU A;  2LNV A;  2JNG A;  4M77 C;  3I55 A;  1M1K C;  2KVQ G;  4C8Q E;  3LWH A;  5GMK l;  2ZPH B;  2RHU A;  3HKS A;  1VQ9 T;  1FWZ A;  1YI2 T;  2QTX A;  4JRQ A;  2LT1 A;  3ZFJ A;  3JCM d;  1K73 C;  2MMP A;  2RO0 A;  2VYT A;  5FRM A;  2D6F A;  3M4G A;  3JCM h;  4QQ6 A;  5LJ3 d;  3CMA T;  2RK2 A;  2DTH A;  4M78 B;  3JCM X;  3CBM A;  5LJ3 h;  3JCM e;  2RH2 A;  2DXB A;  5DM7 R;  3HRT A;  4IUP A;  3OSV A;  3G4S T;  4HT9 A;  3A5Z B;  3CPF A;  5LJ5 h;  1VQN A;  1QVF A;  4M7D A;  3M58 A;  4J6W A;  3VV0 A;  4M7D C;  5CKF A;  4L59 A;  4LDU A;  3DLL A;  1K8A U;  4DA4 A;  5GAN 6;  4JRI A;  3SWN B;  3G71 T;  3EFS A;  2ZPB B;  4A4K A;  3C12 A;  2R57 A;  1QVP A;  2K57 A;  2MWO A;  2VV5 A;  3WXM B;  3FIF A;  3LH0 A;  3CPW S;  1VQ6 A;  2VUB A;  2R5M A;  4OMF B;  2A3L A;  4OGC A;  3QII A;  3CC4 A;  4OB1 B;  2ZPE B;  1VQO A;  4QQG A;  2K3Y A;  4PL6 A;  1VQP T;  3TEE A;  2CZ0 B;  2BIV A;  4M7D F;  1B34 A;  5J26 A;  5J3B A;  3OYE A;  5FU7 B;  3VKI A;  4NL3 A;  3BW1 A;  1JBM A;  3GF5 A;  4F7U B;  2E10 A;  3FRN A;  3OYY A;  1KQ1 A;  3SB2 A;  5GMK i;  1N9R A;  4ZGE B;  1VQP A;  1YIT T;  3KBG A;  2XHC A;  1N8R U;  4C92 B;  3CCU T;  2QQB A;  3Q1J A;  2X4J A;  4GLK A;  4IUV A;  3VYG A;  2NLU A;  3SD4 A;  4FSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...