4LNPA

The first sh3 domain from cap/ponsin in complex with proline rich peptide from vinculin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
EMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Sorbin and SH3 domain-containing protein 1
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4lnpA00
2FG0A 3QWXX 2EW3A 2LZ6B 2KR3A 3H0HA 2RNAA 4J9FA 1RI9A 3VS3A 1U06A 2DNUA 1SRMA 4OMPA 1VA7A 2B86A 2HCKA 1AOJA 2RQTA 4ESRA 4X1VA 1WDXA 4LNPA 2C0IA 2V1QA 3M0TA 2EQIA 4J9DA 3NHNA 2SEMA 1HD3A 1X27A 1UFFA 2KROA 2M0YA 1WIEA 2KT1A 4CC4B 3PVLA 3EG3A 1T3LA 1Y57A 1AWXA 1SEMA 4RTVA 2FEIA 1UUEA 1PRMC 1QLYA 4R0KA 2M51A 2DX1A 1AWWA 4CC2A 1WA7A 2KNBB 3KFVA 1JQQA 2GGRA 1BK2A 1UGVA 2O31A 2AZVA 4RTXA 1JXMA 2DL7A 3PE0A 1W1FA 2RF0A 5IXBA 1NM7A 1E6GA 2J06A 1QWEA 2RQUA 1H8KA 2AZSA 4GBQA 3GBQA 2JS0A 2CSQA 1FYNA 1JO8A 3M0RA 4CC7A 2YUQA 2CUDA 2RQWA 1CSKA 1YP5A 2ROTA 3NPFA 2GNCA 1QKWA 1ZX6A 3ULRB 1PKSA 2JMCA 4KRTA 1M3AA 5ECAA 1RLPC 3M0SA 2EYZA 2FPFA 3I5RA 3H41A 2YT6A 2O2OA 3PVQA 1RLQC 2LQWA 1GFDA 5IHNA 2CUBA 5GJWB 3VRZA 5FWBA 1JU5C 2KGTA 1NG2A 1WXUA 1UJYA 5GJVB 1OEBA 2EYXA 2MIOA 1M27C 3NMZC 3TSZA 4Z88A 2E5KA 1PKTA 4AFSC 4LN2A 2ED0A 1TG0A 2DMOA 2X3WD 2EVRA 2JMAA 1A0NB 3EGUA 4J9CA 2ENMA 2BZ8A 2I0NA 2VVKA 2FPDA 1JXOA 3LH5A 4RTUA 2L0AA 2LQNA 4D8DA 2ECZA 1WFWA 2YUPA 2K2MA 3FJ5A 1OPKA 2OJ2A 2PZ1A 1WYXA 4WCIA 1SRLA 4Z89A 2LNHB 5IHKA 2AKLA 2LJ0A 4J9BA 4F16A 2HDAA 2IIMA 1IO6A 4RUGA 3UF4A 2AK5A 2EKHA 1ZSGA 4E6RA 1UECA 1UDLA 3RNJA 2JTEA 5I22A 1M8MA 2F2WA 2PTKA 2KT8A 3REBB 3VS0A 5IXFA 1WXTA 1K0XA 2EGAA 1W6XA 4QT7A 4JJCA 4LUDA 2CSIA 2DLPA 4AG2C 5I11A 2NUZA 1AWOA 1G2BA 2JW4A 1PRLC 2DL4A 1VYTA 2GTJA 3IQLA 4OMMA 3H0FA 1BB9A 2AKKA 5FW9A 1WI7A 1GCPA 2DVJA 2KEAA 3JV3A 1YNZA 3TVTA 3VS1A 2D8HA 1HJDA 1YN8A 1B07A 1ZUUA 2V1RA 4IIMA 2G6FX 1MUZA 1VYVA 2MCNA 1K76A 3VS7A 2H8HA 4F14A 1J3TA 1QCFA 1H92A 2K6DA 4OMNA 2MOXA 1CKBA 1UHFA 1T0HA 2L3SA 2J6KA 2RQVA 3EHRA 4AFZC 1ZUYA 2DBKA 1ABOA 2ABLA 2A28A 4J9HA 2P4RA 4GLMA 1SPKA 2NWMA 1E7OA 1K9AA 1YWPA 2DE0X 1W70A 2XMFA 2SRCA 1V1CA 1N5ZA 1NEGA 1MV0B 1X6GA 1GL5A 4ZNXA 1I07A 1X69A 2LJ3A 4F17A 2CH4A 1M3CA 1M30A 5IH2A 1GBQA 2HSPA 4AFUC 1GCQA 1UE9A 2OI3A 2DYBA 2LP5A 1MV3A 2LJ1A 4M4ZA 2F2VA 2L3QA 1NLOC 4D8KA 2DRKA 2DF6A 3M0QA 2DJQA 2GTOA 1G83A 1Z9QA 1KFZA 1AWJA 3I9QA 5IHIA 1PHTA 3I5SA 3VS6A 3I35A 2RPNA 1NLPC 4AFQC 1KIKA 2DL8A 1ZBJA 2J6OA 3NGPA 3SHWA 2A08A 2GQIA 4A63B 2DL3A 2FRYA 1X6BA 4HCKA 1BU1A 1PWTA 1E6HA 2FPEA 4RTTA 3VRYA 2J05A 2W10A 3EHQA 3QWYA 4LUEA 3UA6A 2CH4W 4FSSA 2RMOA 4RTZA 4DEXA 1UHCA 2ROLA 1U3OA 2K7AA 4OMQA 4JPBW 3TSWA 1GBRA 1PNJA 4J9IA 1WLPB 2ESWA 4AG1C 3VS4A 1I0CA 2X3XD 2EYYA 3M0UA 1JEGA 2J6FA 1KJWA 4OMLA 3REAB 2F2XA 4HXJA 2RQRA 1SSHA 1K1ZA 2O88A 1WXBA 3ZL7C 1GCQC 1OOTA 1AZGB 5FWCA 2VKNA 2YUNA 1UTIA 1U5SA 1YWOA 3EG1A 1X43A 2K3BA 4LE9A 2KRSA 2CT3A 2KXDA 2K79A 4JJDA 4Y92A 1M3BA 2D1XA 4RTYA 1VYUA 2A36A 1HSQA 2HBWA 3EG0A 1QWFA 2FRWA 3CQTA 2CREA 2JM9A 1RUWA 2EGCA 3H0IA 2DM1A 4HVVA 1KSWA 1XOVA 1TUDA 1NEBA 2LMJA 4JZ3A 1AEYA 3VS2A 4IIOA 1OV3A 4RTWA 1NYFA 2C0TA 4Z8AA 2O9SA 2FO0A 2DA9A 2LCSA 2J7IA 2DILA 3R6NA 1AZEA 2JS2A 2KE9A 1CKAA 1ABQA 1I1JA 2EBPA 2KYBA 2RN8A 3EG2A 2D8JA 2EYWA 1T0JA 1H3HA 2A37A 1TUCA 1SHGA 3A98A 1NYGA 1FMKA 4OMOA 2KXCA 4EIKA 3U23A 3C0CA 2EGEA 2O9VA 1Z9ZA 2KYMA 2DBMA 1AD5A 1B3QA 2BTTA 2LX7A 3RBBB 4HVWA 2OAWA 2JM8A 3M0PA 1LCKA 2DRMA 1UJ0A 2VWFA 2W0ZA 2BZYA 3UA7A 2EPDA 2GBQA 1K0SA 2JXBA 5L23A 1X2KA 1GFCA 2KRMA 3VS5A 2BZXA 4JZ4A 1S1NA 4K11A 5HCKA 2YSQA 1GRIA 1BBZA 1T3SA 4CC3A 2ED1A 2L2PA 1ARKA 2DL5A 2K9GA 2PNIA 2JT4A 2C0OA 2CDTA 4HVUA 4J9GA 1UG1A 1QKXA 1K4US 2CT4A 2YDLA 4DEYA 1Y0MA 4J9EA 4ORZA 2KRNA 1AVZC 1X2QA 1OPLA 3O5ZA 3SEMA 2L3PA 1YCSB 2D0NA 2YUOA 1EFNA 3UATA 2QDLA 1WX6A 1ZLMA 1SHFA 3THKA 5EC7A 1ZUKA 4JJBA 2HEQA 2KBTA
chains in the Genus database with same CATH superfamily
2HKNA 2P0PA 2FG0A 1LJOA 2EW3A 2KR3A 4NL2A 4QQ6A 2OTJA 2EFIA 1G3YA 1VQKA 3VS3A 4C92F 2DNUA 3CCMA 1NPRA 1RL2A 2K5FA 2L3RA 3QO3A 3GIBA 4GY5A 2SEMA 1UFFA 1N9SA 3C95A 1UGQB 3QHSA 1T3LA 4QW2A 1SEMA 4RTVA 5A0LA 4FW1A 3CCRQ 2K5LA 3MP6A 4M7AD 3CCUQ 4KH0B 2NUTB 4EMKA 4RMOA 1QLYA 4FIBA 3MO8A 4IUPA 4CC2A 4ELYC 2KNBB 2QASA 8ATCB 3OYNA 4RTXA 4JDSA 2QK0A 2QA4T 5KCOA 2HMAA 2J06A 1QWEA 2RQUA 5GAOn 3GBQA 5L8RE 1JJ2A 1FYNA 1QP3A 1QP2A 4KULA 5LJ3f 5GAN6 4N0AA 4QVZA 3NPFA 3E9GA 3GLXA 1PD0A 3CC7Q 1M3AA 1YJNT 4PJOB 2EYZA 2DAQA 2HAXA 4MZTA 4M7AG 3H41A 1VQ8T 2O2OA 5IT9E 2LQWA 3JAME 2DD4A 4ZTJA 1Q81R 2M16A 2BE9B 2HQEA 5GJWB 3VRZA 3S3OA 2RK2A 1JU5C 1HXDA 2EQJA 2KGTA 4HT8A 1NG2A 5GJVB 1OEBA 4M77B 2AHJB 4QVCA 1BI3A 5KYWB 3MP1A 4J6YA 1YCYA 1GXIE 3UPUA 4LN2A 3V7CA 1TG0A 2DMOA 2EVRA 4XU0A 3VV0A 1UB4A 3CC7T 4J9CA 2ENMA 1N8RR 1JXOA 3LH5A 2L0AA 2LQNA 4M78D 1YIJA 1VQ9T 2YUPA 5AYFA 5GAOl 3CCRT 4LD9K 2OJ2A 2COWA 4Z89A 3S6WA 2M0OA 1YFNA 5HY6A 1Q82C 2DTIA 4E6RA 2YRVA 1LOJA 1Q81C 3CEYA 1KD1U 1H3ZA 2F2WA 2PTKA 3FJPA 4M78A 2QQBA 3MHXA 4BY6B 2HBPA 2P0QA 3KUFA 3DB3A 4QT7A 5CK9A 3F70A 1VQ9Q 1PRLC 2GTJA 3X26B 2E41A 2XDPA 2DVJA 1YNZA 4BACA 1O75A 1M8VA 4IIMA 2JTMA 1IHVA 5GMKj 4BE2A 3OYLA 1VQ8Q 2ZPBB 1WNLA 1YJ9A 4F04B 1QQJA 1TUGB 2H8HA 1J3TA 5CCAA 3EGDA 2K6DA 4OMNA 2MOXA 2RQVA 1S72A 4R55A 1WHKA 3OSVA 1TU0B 4M78C 1YJ9T 3CCLT 1N27A 1E7OA 1K9AA 3V8KA 3CCUA 5GAMh 2RA2A 3A8GB 1NEGA 4CRIA 4M77G 4BI8B 5GMKh 1U8RA 2RI2A 4MDWA 1JB0E 3CMAA 1RAIB 4MDXA 1MNDA 5IH2A 3CCST 1PCXA 1UE9A 1IREB 2QI2A 1M90C 2RM4A 2LJ1A 4M4ZA 5GAMd 3ZEHA 1TWBA 1IGQA 4A4FA 2DJQA 1U1SA 2GTOA 1Z9QA 2LT4A 3JCMV 3LGLA 3JRZA 1PHTA 3I5SA 4MMLA 3I35A 3CCMQ 2RPNA 4PFPA 4M77D 2QGFB 2RI3A 4L6V5 4AFQC 4KGZB 3CCJT 3NGPA 3SHWA 3M9QA 2DL3A 2FRYA 1BU1A 2K3YA 2FPEA 3L2UA 3NFCA 1IZ6A 3QYGB 3VRYA 2DIQA 4A4EA 3RUXA 4FSSA 2RMOA 3DLLA 2MK5A 5KYWA 4ATOA 2ROLA 3OYEA 4IUVA 3TSWA 4JPBW 2XD0A 4WF2A 3FB9A 1VQ4T 1BKBA 1VQ6T 1UGSB 2X3XD 4XTXA 2ATCB 2J6FA 2F69A 3M5AA 3EGDB 2F2XA 1VQLQ 2O88A 1WXBA 1OOTA 3SWNA 1K9MR 5FWCA 3MJXA 3DKMA 1VQ4A 2R57A 1UTIA 2KQWA 1VQPA 4LE9A 3G4SQ 2CT3A 2DD5A 2KXDA 4GLKA 2K79A 4E7JA 1QVFP 4II1A 2LVMA 4JJDA 1D3BB 4M7AB 4Y92A 4RTYA 5LJ5e 3EG0A 1AHJB 3EG9B 1M90U 1M1KR 2QQSA 3BW1A 1KSWA 3EFOB 1EIFA 2VB6A 5GAOp 2LMJA 2CKKA 2K2VA 1VQMT 1SSFA 2P4TA 1OV3A 4RTWA 2O9SA 4FT2A 1AZEA 1MMGA 4M77A 5CR2A 3RIRA 3X24B 5GAN8 3PIOA 3G4ST 1H3HA 5FU7C 2A37A 1TUCA 4DA4A 1YJWT 1VQMA 2RH2A 1SHGA 5LJ3h 3MCAB 3MEVA 3U23A 4EMKC 4FL6A 5HKCA 2O9VA 3QDRB 1YHQA 1AD5A 2BE7D 3TCJA 3NTKA 1PSFA 1BI1A 1NJIC 2M02A 1PG5B 4DBHA 4HVWA 3S3NA 2OAWA 2DERA 1C6VX 2VWFA 1VQ6Q 4C0DB 3UA7A 2ZPFB 5J3BA 2OTLA 1X2KA 3L2RA 3VS5A 3SWNB 1VQNT 2BZXA 2R58A 4RG2A 2E3HA 4OB1B 3L2QA 1G3TA 5HCKA 2YSQA 1GRIA 4JRKA 4BE1A 1T3SA 4A4GA 1NBEB 2ED1A 1ARKA 4KGXB 4OB0B 2DL5A 4E7IA 2RB6A 1VQNA 5FU7B 4ZN1A 1K73U 2JTFA 4PLIA 2QEXT 2YDLA 2CS7A 1M1KU 4PK4A 3PMTA 5LJ5j 4J9EA 4ORZA 2RJFA 1AVZC 4XTWA 3OS1A 1VQ5T 3OA6A 2YUOA 2GQVA 1EFNA 2FYKA 5KYXA 2KMTA 2DXCA 1XJWB 2QQRA 2RHUA 3QG1A 1ZUKA 5GANg 2QEXA 2HEQA 4J7FA 4ZGJB 1BYMA 2BIVA 1QVPA 5CVIA 4XU1A 1RAHB 1VQLA 1OX8A 3H0HA 3RKYA 1WHHA 5A0GA 1VA7A 3CXCP 3G71A 4E7SA 4LNPA 3CCQQ 3M0TA 4J9DA 4PKCC 3BDUA 1HD3A 3CCQA 2K57A 2M0YA 1WIEA 4CC4B 4CI0C 3EG3A 3QXEB 3DB4A 3G6ET 1UUEA 4C0ZA 1D1BA 4FW2A 2M51A 2DX1A 3FIFA 4DBRA 5LL6S 3EH1A 3M54A 3OS5A 4BY6C 1JQQA 4N4GA 5LJ3e 1BK2A 1KQ2A 1UGVA 5FROA 5FU6C 3QZ9B 4M78E 1W1FA 2RF0A 5IXBA 4M7DD 3HSBA 3V8LA 3AHUA 2Y4YA 2HL3A 2DIGA 2JS0A 5D6XA 2KDSA 1VQMQ 4CC7A 2DETA 3JCMc 1HYOA 2RQWA 4XTVA 2ROTA 4PJNA 2CGHA 2GNCA 2X35A 3GNFB 1B34B 3ULRB 1PKSA 2JMCA 2DXUA 4KRTA 2Y4XA 5GMKm 1V76A 2COYA 3MEAA 3PVQA 4LDVA 2CP6A 4B9WA 2JJ9A 1GFDA 5IHNA 1VQKT 3VUBA 3OSSC 2QA4Q 1WXUA 2QTXA 4VUBA 1KQ1A 1TOVA 2MIOA 2RJEA 1M27C 3NMZC 4PFZA 5A2QE 3QPHA 1S72T 1M2VA 2E1HA 1QMCA 4C0DC 2ZPGB 2ED0A 4D6WA 2JMAA 1NPPA 1ZHIA 2I0NA 5LJ3g 4RTUA 4N0AC 4E7KA 2ECZA 3OQ5A 2K2MA 4OB3B 3M55A 1OPKA 2EJ9A 3CMAQ 4DOWA 4M7DC 1MNEA 2LNHB 4Y91A 1BI0A 5CKBA 4NOYA 4IUUA 3OYGA 3CCEQ 1BCMA 1WJQA 5LJ3j 2IIMA 3OYJA 2WSFE 1QCNA 1D09B 1UECA 1X6OA 4LXCA 3CC2T 3CD6T 4ZGEB 1JRIA 3C12A 1M8MA 4OF1A 1YIJQ 1W6XA 4C92B 7AT1B 2CSIA 3SWNC 1WHMA 5GANf 4OMMA 1BB9A 2AKKA 5FW9A 3MEUA 1WI7A 1GCPA 4BI3A 4XU3A 2VUBA 4C5HA 2G6FX 5AT1B 1MUZA 2PVGB 1VYVA 1FXXA 5KYUA 4PJMA 2HQHA 1VQ6A 5GANe 3CBMA 2BKDN 1CKBA 2L3SA 3OB9A 5IN1A 3G1JA 2RJCA 4AFZC 1ZUYA 2DBKA 1Q82R 1ABOA 4M7DG 2ABLA 2JZ2A 4BI4A 2CZ6B 2E65A 1MHNA 2P4RA 4GLMA 4FSXA 1OZ2A 2GFAA 5CIUA 2RD1A 4M78B 1OX9A 2E6NA 1V1CA 1GL5A 2QXFA 1VOMA 2DJZA 1VQKQ 1I07A 3CXCS 4F17A 2YXYA 3RMQA 2LT1A 1Y71A 3CBOA 1G5VA 1GCQA 1C1AA 2QGGA 1IXDA 3ME9A 2XU8A 4X34A 4M7DE 2IG0A 5LJ5d 1KD1C 2DRKA 1Q81U 1B34A 1Q82U 1AWJA 5IHIA 1I5LA 3SD4A 1OI1A 1WQ7A 1NLPC 1KC8U 3JCMW 1OQKA 1ZBJA 3MPUB 2WSEE 2J6OA 4KUIA 1RABB 4R56A 4C0GA 3CC4A 4A63B 5M9OA 1PWTA 1YJWA 4RTTA 1ZA2B 3EHQA 2W10A 2XG8D 4FT4A 1TS9A 1YHQT 4OMQA 4J9IA 3ER0A 5GAN4 2A0FB 4AG1C 3FC3A 1KG1A 3M0UA 1D1AA 2RQRA 5FRNA 3A8HB 3VJPA 4M77F 2FHDA 4E7LA 1KQSP 3CCLA 5LJ5f 4XTYA 3JB9F 1K9MU 2DVEA 2YUNA 2QG9B 4C5IA 2KAFA 3CCUT 3EG1A 1YWOA 5D7UA 3CCVQ 5CQYA 2V26A 2EQKA 2ZCFB 3PT9A 3CMET 2E3IA 1VYUA 3CMAT 2HBWA 5GAMe 1QWFA 2FRWA 2CREA 3OW2S 1RUWA 1N8RC 3H0IA 1TTHB 4HVVA 4JZ3A 5GAOr 4IIOA 3WXMB 1YJ9Q 2CP0A 2JUFA 1VQOT 1NYFA 2C0TA 1OU9A 2FO0A 2DA9A 2YLCA 3R6NA 2KE9A 1VQ5A 1ABQA 1CKAA 1MGQA 3BDLA 3JCMh 4QVDA 2EBPA 2KYBA 2ZGWA 3EG2A 1ZQ1A 1T0JA 4RCCA 2EKOA 2LDMA 5CKFA 2KXCA 3M4YA 4EIKA 3CPWP 5KE3A 2K3XA 5I2MA 4M75E 2PQWA 1MMAA 2EQUA 2DBMA 3QUIA 1FX7A 3M0PA 1LCKA 2DRMA 3PMIA 3G71T 4P5NA 1UJ0A 2LTOA 4BDZA 4OGEA 2EPDA 2X51A 2XK0A 4F7UG 5C6SA 4M77E 2JXBA 4C92G 3P8BB 4LDXA 4ZN3A 2VC8A 2P0KA 2O01E 3HFOA 2XICA 2HSEB 4JZ4A 2V8JA 1VQPT 8AT1B 4M77C 2XHCA 4Q5WA 3NTHA 1VIEA 1XTDA 2FZCB 3AT1B 4PJOE 2CP3A 3L42A 5GAN7 3MKDA 2DK3A 3QDFA 2JT4A 1WGSA 4M75C 1QKXA 1QW1A 4A4HA 2CT4A 2D6FA 5CO7A 4EPCA 3UT1A 4DEYA 5GANd 4NL3A 3FDRA 5D6WA 3TU4K 1WZOA 1X2QA 3SEMA 1YCSB 4JS4A 1YJNQ 5LJ3d 3CCMT 2QDLA 1KHCA 2XKOC 2PUKB 3L1AA 1JJ2S 1BI2A 1SHFA 1SKUB 3VKIA 2KBTA 3X28B 3HHTB 3QWXX 2LZ6B 4C8QC 1N9RA 3JB9D 1WJRA 1R0CB 2RNAA 4JUVA 1VQ7A 1RI9A 3G7ZA 2DYIA 1SRMA 4OMPA 2MF2A 5FRMA 2PVOB 5J26A 2RQTA 4JS5A 1OZ3A 4OVAA 1WDXA 3OBYA 4KGVB 1AT1B 5CKDA 2C0IA 2V1QA 1C0MA 2EQIA 3JCMX 2X4JA 3NHNA 3BY7A 2DTOA 1X27A 2O4XA 2RK1A 2KI7A 2KROA 3ASKA 2KT1A 3OBWA 3NTIA 3PVLA 4DBQA 1Y57A 1W2BA 2G3RA 2EAYA 3QYHB 4LDYA 1PRMC 2VV5A 1IGUA 3GF5A 2LNVA 3KFVA 1NE8A 2GGRA 4LDWA 4AT1B 4IURA 3T9NA 2XDBA 3PE0A 1NM7A 1G8XA 4ANJA 1YJNA 3QSUA 4C8QB 3N5BB 2HQXA 1VQ8A 2CSQA 3RDVA 1EX4A 3M0RA 4XTZA 4JLIA 1CSKA 1YP5A 1DJ7B 5KYYA 1QKWA 1YI2Q 3VU3C 3A1PA 3HP9A 4C8QD 4LD6A 4B6MA 3URGA 1RLPC 3M0SA 4E47A 4J83A 3QKJA 3V7SA 3H9NA 2YT6A 1OU8A 2ZZDA 4XU2A 3P8HA 1RLQC 2K4YA 3LWHA 1VQ4Q 2E70A 2RO0A 1RADB 2F5TX 5FWBA 3OW2P 3H8ZA 2YHTA 2KSSA 2QQAA 3FEOA 1ZSZC 2EYXA 3OY9A 1VQ9A 1G3WA 4Z88A 5CQXA 4FCYA 2E5KA 1PKTA 2LCLA 3OYAA 4FYYB 3LX7A 3JCMQ 3CCQT 3JB9G 2FPDA 1VQNQ 3HKSA 1M1FA 2YRDA 3C4SA 2DFUA 2LX9A 4D8DA 3CCJQ 1WFWA 3EAEA 4PJJA 3FJ5A 1WYXA 4WCIA 1F1BB 2JNGA 4ELZC 1TXQA 2VGMA 1NZ9A 2RHYA 1IO6A 1BCOA 2L5QA 1S72Q 3EFOA 2AK5A 2HL5C 2RHXA 1ZSGA 1UDLA 4ME7A 3RNJA 5CAIA 3CCRA 2C06A 1QVFS 2JTEA 3OMGA 2DKGA 1Q7YC 2LQKA 1QVGS 2YLBA 5HK0A 2CP2A 4F7UB 3G6EQ 1WXTA 4V2SA 2EGAA 3QBYA 4JJCA 2QDYB 1VQ5Q 2DEQA 2RI5A 4AG2C 1AWOA 5I2SA 1G2BA 2DL4A 3IQLA 3TREA 5DLOA 5HK3A 2EJGA 4M7AC 3TVTA 3JV3A 1HJDA 3QZ5B 2E64A 2DXTA 5EG2A 3E1SA 4IUQA 2MCNA 1K76A 2A7YA 2X4XA 3QJ6A 2XI9A 3JSCA 4FU6A 5GAN3 2MWPA 4PJOA 4RCBA 5DY9A 1T0HA 3M59A 4M7AE 2ZAEA 4EMHA 3PIPA 2MMPA 4J9HA 5J39A 1SPKA 2NWMA 2R5MA 2YWWA 3OYMA 1Q95G 1YWPA 2DE0X 1W70A 2F5KA 3CMEQ 2SRCA 1UEBA 5GANh 1ACMB 4C8QE 4ZNXA 9ATCB 1M1KC 2LJ3A 4C8QA 1VIFA 2CH4A 2X4WA 1M30A 3V7RA 1WHLA 1GBQA 1YHQQ 4AFUC 1K73C 2OI3A 3RERA 1M5Q1 2DO3A 2DYBA 1X01A 2LP5A 3I55T 5D6YA 2BUDA 3ZBDA 3M0QA 3M57A 2K5IA 3VS6A 2Z0WA 1KIKA 3VUZA 2D0QB 2DL8A 1YJWQ 2GQIA 3QJYA 1K73R 4M75A 1X6BA 3I55A 4WTOB 2DZCA 3DLMA 3OW2A 3META 4M7AF 3EGXB 2J05A 4LUEA 1W2BP 4BB7A 4QKUA 4RTZA 2MPXC 1R0BG 3FLGA 1U3OA 3S3MA 2K7AA 3CCJA 1NJIU 3VS4A 3INZA 1I0CA 2FZKB 2B8AA 4OMLA 3REAB 2A3LA 1SSHA 5GMKe 4XK8E 3ZL7C 1XQHA 3MP8A 4FYWB 4FM4B 1G3SA 1WJSA 5GAMf 3LLRA 1U5SA 1VUBA 4F7UF 4M75B 2V8IA 3BE3A 3CC4Q 1KC8R 2KRSA 4J8OA 5CKEA 4PJOG 1IHWA 3LH0A 3KBGA 1M3BA 2D1XA 2A36A 1HSQA 3PGGA 4PL6A 4C92E 4C0FA 3CQTA 4M75D 2EGCA 2AT1B 4HCBA 2LQ8A 3CCSQ 1XOVA 1ZSZA 4KT0E 1TUDA 1X75C 4O6JA 4XQ3A 3CPFA 3CXCA 1AEYA 4A4KA 3I55Q 1D0XA 4EMKB 2DILA 2DZ9A 3M53A 3EFRA 3RMSA 3O8VA 1D1CA 5GAMg 2RN8A 3CC4T 3HRSA 2D8JA 2HZYA 1Y7XA 2EYWA 3EH2A 3BFMA 4RKUE 5KYNA 4HCCA 3RESA 1NYGA 4OMOA 3PTAA 3C0CA 2OTJT 2EGEA 1Z9ZA 2DEUA 3M4GA 2LX7A 2L89A 4O5VA 2JM8A 2RJDA 4MZPA 2BZYA 2Y90A 4L5GA 2QEXQ 2GBQA 4M75F 5GMKi 2QQ9A 5GAN2 3EFSA 1R77A 2FZGB 4OP0A 1R8OB 4C8QG 3E9FA 1B7TA 1K8AR 2XDDA 3LWIA 5KCHA 1ZA1B 3LYIA 4J5YA 3CMEA 3OYYA 5KE2A 1KK7A 2C0OA 2CDTA 4HVUA 2GCXA 1UG1A 4XTUA 4ZGDB 2HNIA 2V8KA 1D3BA 3J81E 2H3JA 2GF7A 1W2BS 4M75G 2E4HA 5I21A 1VQOA 5CKHA 3TQ7P 2VASA 3CBPA 2RHIA 4M7DB 2L3PA 4Z02A 1JJ2P 5IAYA 3OYDA 1VQPQ 1WX6A 2MI6A 3THKA 3VYGA 5EC7A 3OYFA 3GNGA 4JJBA 4X9CA 4E2FB 4QQGA 2OX7A 4X9DA 3JB9J 3A8OB 3OYHA 1I8FA 2LCCA 4TVRA 2NUPB 4J9FA 2ZPEB 3EGXA 1U06A 3JCMg 4C92C 3LGFA 2B86A 2HCKA 2CYZB 1AOJA 4ESRA 4N4IA 3HRUA 4X1VA 1QVGA 1RAEB 2ZPHB 2EJFA 2E6ZA 1NJIR 2CZ1B 3QIIA 2IVWA 3HTRA 1VQLT 1KHIA 3CC2Q 3CD6Q 3I56T 3L2WA 3WVEB 3JCMb 1AWXA 4PFOA 2FEIA 1RAAB 1YIJT 4OMFB 1HK9A 1RAGB 3A5ZB 1JBMA 4R0KA 1AWWA 2FB7A 2CZ7B 4XAXB 1WA7A 3J80E 4M7AA 2OAUA 3I56A 4Y28E 2M1HA 2O31A 2AZVA 4A54A 1JXMA 2DL7A 3SFMA 2MWOA 1BIBA 3G6EA 4C92A 1E6GA 1ZBXA 2AIRB 1V29B 4GBQA 1H8KA 2AZSA 4HKEA 2XIDA 1JO8A 2E10A 2YUQA 2CUDA 3UWNA 1YITT 2NYSA 3OYKA 1ZX6A 4M7DA 1EZZB 5ECAA 1QVGP 2KK4A 2FPFA 3I5RA 1Q86U 2HD0A 2KY9A 2LC4A 4C92D 4OGCA 2MYSA 4A53A 2EQMA 4QQDA 3A8LB 3C94A 3LW5E 2CUBA 1K9MC 1M2OA 5DLQE 1VQ7T 2EYQA 2OTJQ 1UJYA 4JRIA 5GAOq 3TSZA 1N6AA 2VXFA 2D9TA 4AMCA 4DQ2A 4AFSC 4EMGA 3GOXA 2X3WD 1YITQ 1A0NB 3EGUA 3OMCA 1RACB 1PC0A 1U1TA 1I5OB 2BZ8A 2VVKA 4KBMB 3JCMJ 1KQSS 3PFSA 4C5GA 4MMKA 2PZ1A 1SRLA 3X25B 5IHKA 2AKLA 1P92A 2LJ0A 3M56A 4J9BA 4F16A 2HDAA 1KC8C 1M9SA 3P8DA 4RUGA 3UF4A 2EKHA 3KXTA 2QA4A 1MMNA 1UGRB 1VQOQ 3HFNA 1YI2A 1IB8A 4FYVB 3J7AF 5I22A 2WSCE 2KT8A 3REBB 3VS0A 2CP5A 4PLLA 5IXFA 1K0XA 1RI0A 4LUDA 5C0MA 5KYXB 2DLPA 5I11A 3CCLQ 2NUZA 4HCZA 2JW4A 3VYHB 1VYTA 3H0FA 2L8DA 2KEAA 3EG9A 1BIAA 2GFUA 4J6WA 2D8HA 3VS1A 1YN8A 1YI2T 3CC2A 3CD6A 3FRNA 1B07A 1ZUUA 4C8QF 1SG5A 2V1RA 2NLUA 4BUGA 3HL8A 3VS7A 4F14A 1QCFA 1H92A 2VYTA 2QAZA 4JJNK 1UHFA 1QCOA 3X20B 1K8AC 1M1GA 2J6KA 3V8JA 3EHRA 4HA8A 3RKWA 3OYIA 2A28A 3GPLA 4YTLA 3JB9I 2JN0A 4M78F 4JRQA 3CC7A 3I56Q 5LJ5h 1M2VB 3R6OA 4F7UA 2XMFA 1TH7A 3JB9H 4ZTFA 2DTHA 1N5ZA 1MV0B 5GANj 4J6XA 1X6GA 1OULA 2LRQA 2HKQB 1VQ7Q 1X69A 4E7ZA 3M58A 1M3CA 1FWZA 2HSPA 4F7UE 2EIFA 1N8RU 1FMVA 4MZMA 1MV3A 5GAN5 2F2VA 2L3QA 1NLOC 4D8KA 3TEEA 3OS0A 3CCVA 4E7HA 2DF6A 4PJLA 1G83A 3G71Q 2NUPA 2NUTA 1KFZA 3E2UA 3I9QA 1Y96B 3CCEA 3HPWA 2IPOB 3OYBA 2ZPIB 2A08A 2RHZA 4RG8A 4UC4A 5GAOm 3G4SA 1YBYA 3L2VA 1LPLA 4HCKA 1E6HA 3ZFJA 3CCVT 3QWYA 6AT1B 3UA6A 2CH4W 4J7IA 4DEXA 4PJOF 3CCET 1UHCA 1D0YA 5A0DA 1KQSA 3OS2A 2WACA 4OB2B 4B9XA 1PNJA 1GBRA 1IRXA 1WLPB 3H6ZA 3RR6A 2ESWA 2FL7A 2EWNA 2EYYA 1K8AU 2X9HA 5KH6A 4JRPA 1WHGA 1JEGA 1KJWA 2VXEA 4HXJA 2COZA 2QYZA 1K1ZA 1GCQC 2OTLT 1AZGB 3E19A 2VKNA 4BD3A 2M9UA 3CPWA 1Y96A 2F1LA 4FYXB 4C5EA 1Q86R 5GMKl 1PD1A 1X43A 1W4SA 4PJOC 2K3BA 1WHJA 5FU6B 1M4ZA 3WVDB 5FLXE 2O4XB 1WQWA 1UGPB 1LVKA 2E5QA 3SB2A 1WPYA 3CCSA 3JCMf 2E12A 2JM9A 1SF9A 2DM1A 3CPWS 1NEBA 3VS2A 1Q7YR 4Z8AA 2LCSA 2J7IA 3L2ZA 4KH1B 2JS2A 3JCMP 1I1JA 2DPPB 3JCMe 4DBFA 5LJ5g 3UDCA 2JOYA 4IUTA 1OYXA 2PVDB 1I4K1 1D0ZA 2CP7A 3A98A 1FMKA 2DXBA 2MAMA 2KYMA 5KYUB 3Q1JA 4LDUA 1B3QA 2BTTA 2X4YA 1FMWA 3RBBB 4N4HA 5KYYB 1MMDA 2W0ZA 2CZ0B 4JLGA 2H3EB 1K0SA 5L23A 1GFCA 4HT9A 2OTLQ 2KRMA 1RAFB 1LNXA 1PM3A 1Q86C 2R5AA 4PJOD 1TSFA 1S1NA 4PNOA 5DM7R 4K11A 3PNWC 2YRCA 1BBZA 4CC3A 1O9SA 2KVQG 4BE0A 3RKXA 1Q7YU 2L2PA 2PUOB 1ZSZB 3A8MB 4DOVA 2K9GA 2PNIA 1KD1R 1PSEA 3HRTA 1M90R 4J9GA 3OYCA 1I81A 2VGNA 4IKFA 1K4US 2FVUA 4EDUA 3MEWA 1H641 1Y0MA 4NS5A 5GAMj 2KRNA 1XNIA 1OPLA 3O5ZA 2JVVA 2P84A 2QTVA 4BDYA 1YITA 2D0NA 4KUDK 1QVFA 3SDZA 2I2LA 3UATA 3D7SB 1ZLMA 3JCMd 4M7DF 2PU9B 3GP8A 4L59A 4M78G 1Y07A
chains in the Genus database with same CATH topology
2FG0A 3QWXX 2EW3A 2LZ6B 2KR3A 3H0HA 2RNAA 4J9FA 1RI9A 3VS3A 1U06A 2DNUA 1SRMA 4OMPA 1VA7A 2B86A 2HCKA 1AOJA 2RQTA 4ESRA 4X1VA 1WDXA 4LNPA 2C0IA 2V1QA 3M0TA 2EQIA 4J9DA 3NHNA 2SEMA 1HD3A 1X27A 1UFFA 2KROA 2M0YA 1WIEA 2KT1A 4CC4B 3PVLA 3EG3A 1T3LA 1Y57A 1AWXA 1SEMA 4RTVA 2FEIA 1UUEA 1PRMC 1QLYA 4R0KA 2M51A 2DX1A 1AWWA 4CC2A 1WA7A 2KNBB 3KFVA 1JQQA 2GGRA 1BK2A 1UGVA 2O31A 2AZVA 4RTXA 1JXMA 2DL7A 3PE0A 1W1FA 2RF0A 5IXBA 1NM7A 1E6GA 2J06A 1QWEA 2RQUA 1H8KA 2AZSA 4GBQA 3GBQA 2JS0A 2CSQA 1FYNA 1JO8A 3M0RA 4CC7A 2YUQA 2CUDA 2RQWA 1CSKA 1YP5A 2ROTA 3NPFA 2GNCA 1QKWA 1ZX6A 3ULRB 1PKSA 2JMCA 4KRTA 1M3AA 5ECAA 1RLPC 3M0SA 2EYZA 2FPFA 3I5RA 3H41A 2YT6A 2O2OA 3PVQA 1RLQC 2LQWA 1GFDA 5IHNA 2CUBA 5GJWB 3VRZA 5FWBA 1JU5C 2KGTA 1NG2A 1WXUA 1UJYA 5GJVB 1OEBA 2EYXA 2MIOA 1M27C 3NMZC 3TSZA 4Z88A 2E5KA 1PKTA 4AFSC 4LN2A 2ED0A 1TG0A 2DMOA 2X3WD 2EVRA 2JMAA 1A0NB 3EGUA 4J9CA 2ENMA 2BZ8A 2I0NA 2VVKA 2FPDA 1JXOA 3LH5A 4RTUA 2L0AA 2LQNA 4D8DA 2ECZA 1WFWA 2YUPA 2K2MA 3FJ5A 1OPKA 2OJ2A 2PZ1A 1WYXA 4WCIA 1SRLA 4Z89A 2LNHB 5IHKA 2AKLA 2LJ0A 4J9BA 4F16A 2HDAA 2IIMA 1IO6A 4RUGA 3UF4A 2AK5A 2EKHA 1ZSGA 4E6RA 1UECA 1UDLA 3RNJA 2JTEA 5I22A 1M8MA 2F2WA 2PTKA 2KT8A 3REBB 3VS0A 5IXFA 1WXTA 1K0XA 2EGAA 1W6XA 4QT7A 4JJCA 4LUDA 2CSIA 2DLPA 4AG2C 5I11A 2NUZA 1AWOA 1G2BA 2JW4A 1PRLC 2DL4A 1VYTA 2GTJA 3IQLA 4OMMA 3H0FA 1BB9A 2AKKA 5FW9A 1WI7A 1GCPA 2DVJA 2KEAA 3JV3A 1YNZA 3TVTA 3VS1A 2D8HA 1HJDA 1YN8A 1B07A 1ZUUA 2V1RA 4IIMA 2G6FX 1MUZA 1VYVA 2MCNA 1K76A 3VS7A 2H8HA 4F14A 1J3TA 1QCFA 1H92A 2K6DA 4OMNA 2MOXA 1CKBA 1UHFA 1T0HA 2L3SA 2J6KA 2RQVA 3EHRA 4AFZC 1ZUYA 2DBKA 1ABOA 2ABLA 2A28A 4J9HA 2P4RA 4GLMA 1SPKA 2NWMA 1E7OA 1K9AA 1YWPA 2DE0X 1W70A 2XMFA 2SRCA 1V1CA 1N5ZA 1NEGA 1MV0B 1X6GA 1GL5A 4ZNXA 1I07A 1X69A 2LJ3A 4F17A 2CH4A 1M3CA 1M30A 5IH2A 1GBQA 2HSPA 4AFUC 1GCQA 1UE9A 2OI3A 2DYBA 2LP5A 1MV3A 2LJ1A 4M4ZA 2F2VA 2L3QA 1NLOC 4D8KA 2DRKA 2DF6A 3M0QA 2DJQA 2GTOA 1G83A 1Z9QA 1KFZA 1AWJA 3I9QA 5IHIA 1PHTA 3I5SA 3VS6A 3I35A 2RPNA 1NLPC 4AFQC 1KIKA 2DL8A 1ZBJA 2J6OA 3NGPA 3SHWA 2A08A 2GQIA 4A63B 2DL3A 2FRYA 1X6BA 4HCKA 1BU1A 1PWTA 1E6HA 2FPEA 4RTTA 3VRYA 2J05A 2W10A 3EHQA 3QWYA 4LUEA 3UA6A 2CH4W 4FSSA 2RMOA 4RTZA 4DEXA 1UHCA 2ROLA 1U3OA 2K7AA 4OMQA 4JPBW 3TSWA 1GBRA 1PNJA 4J9IA 1WLPB 2ESWA 4AG1C 3VS4A 1I0CA 2X3XD 2EYYA 3M0UA 1JEGA 2J6FA 1KJWA 4OMLA 3REAB 2F2XA 4HXJA 2RQRA 1SSHA 1K1ZA 2O88A 1WXBA 3ZL7C 1GCQC 1OOTA 1AZGB 5FWCA 2VKNA 2YUNA 1UTIA 1U5SA 1YWOA 3EG1A 1X43A 2K3BA 4LE9A 2KRSA 2CT3A 2KXDA 2K79A 4JJDA 4Y92A 1M3BA 2D1XA 4RTYA 1VYUA 2A36A 1HSQA 2HBWA 3EG0A 1QWFA 2FRWA 3CQTA 2CREA 2JM9A 1RUWA 2EGCA 3H0IA 2DM1A 4HVVA 1KSWA 1XOVA 1TUDA 1NEBA 2LMJA 4JZ3A 1AEYA 3VS2A 4IIOA 1OV3A 4RTWA 1NYFA 2C0TA 4Z8AA 2O9SA 2FO0A 2DA9A 2LCSA 2J7IA 2DILA 3R6NA 1AZEA 2JS2A 2KE9A 1CKAA 1ABQA 1I1JA 2EBPA 2KYBA 2RN8A 3EG2A 2D8JA 2EYWA 1T0JA 1H3HA 2A37A 1TUCA 1SHGA 3A98A 1NYGA 1FMKA 4OMOA 2KXCA 4EIKA 3U23A 3C0CA 2EGEA 2O9VA 1Z9ZA 2KYMA 2DBMA 1AD5A 1B3QA 2BTTA 2LX7A 3RBBB 4HVWA 2OAWA 2JM8A 3M0PA 1LCKA 2DRMA 1UJ0A 2VWFA 2W0ZA 2BZYA 3UA7A 2EPDA 2GBQA 1K0SA 2JXBA 5L23A 1X2KA 1GFCA 2KRMA 3VS5A 2BZXA 4JZ4A 1S1NA 4K11A 5HCKA 2YSQA 1GRIA 1BBZA 1T3SA 4CC3A 2ED1A 2L2PA 1ARKA 2DL5A 2K9GA 2PNIA 2JT4A 2C0OA 2CDTA 4HVUA 4J9GA 1UG1A 1QKXA 1K4US 2CT4A 2YDLA 4DEYA 1Y0MA 4J9EA 4ORZA 2KRNA 1AVZC 1X2QA 1OPLA 3O5ZA 3SEMA 2L3PA 1YCSB 2D0NA 2YUOA 1EFNA 3UATA 2QDLA 1WX6A 1ZLMA 1SHFA 3THKA 5EC7A 1ZUKA 4JJBA 2HEQA 2KBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FG0 A;  3QWX X;  2EW3 A;  2LZ6 B;  2KR3 A;  3H0H A;  2RNA A;  4J9F A;  1RI9 A;  3VS3 A;  1U06 A;  2DNU A;  1SRM A;  4OMP A;  1VA7 A;  2B86 A;  2HCK A;  1AOJ A;  2RQT A;  4ESR A;  4X1V A;  1WDX A;  4LNP A;  2C0I A;  2V1Q A;  3M0T A;  2EQI A;  4J9D A;  3NHN A;  2SEM A;  1HD3 A;  1X27 A;  1UFF A;  2KRO A;  2M0Y A;  1WIE A;  2KT1 A;  4CC4 B;  3PVL A;  3EG3 A;  1T3L A;  1Y57 A;  1AWX A;  1SEM A;  4RTV A;  2FEI A;  1UUE A;  1PRM C;  1QLY A;  4R0K A;  2M51 A;  2DX1 A;  1AWW A;  4CC2 A;  1WA7 A;  2KNB B;  3KFV A;  1JQQ A;  2GGR A;  1BK2 A;  1UGV A;  2O31 A;  2AZV A;  4RTX A;  1JXM A;  2DL7 A;  3PE0 A;  1W1F A;  2RF0 A;  5IXB A;  1NM7 A;  1E6G A;  2J06 A;  1QWE A;  2RQU A;  1H8K A;  2AZS A;  4GBQ A;  3GBQ A;  2JS0 A;  2CSQ A;  1FYN A;  1JO8 A;  3M0R A;  4CC7 A;  2YUQ A;  2CUD A;  2RQW A;  1CSK A;  1YP5 A;  2ROT A;  3NPF A;  2GNC A;  1QKW A;  1ZX6 A;  3ULR B;  1PKS A;  2JMC A;  4KRT A;  1M3A A;  5ECA A;  1RLP C;  3M0S A;  2EYZ A;  2FPF A;  3I5R A;  3H41 A;  2YT6 A;  2O2O A;  3PVQ A;  1RLQ C;  2LQW A;  1GFD A;  5IHN A;  2CUB A;  5GJW B;  3VRZ A;  5FWB A;  1JU5 C;  2KGT A;  1NG2 A;  1WXU A;  1UJY A;  5GJV B;  1OEB A;  2EYX A;  2MIO A;  1M27 C;  3NMZ C;  3TSZ A;  4Z88 A;  2E5K A;  1PKT A;  4AFS C;  4LN2 A;  2ED0 A;  1TG0 A;  2DMO A;  2X3W D;  2EVR A;  2JMA A;  1A0N B;  3EGU A;  4J9C A;  2ENM A;  2BZ8 A;  2I0N A;  2VVK A;  2FPD A;  1JXO A;  3LH5 A;  4RTU A;  2L0A A;  2LQN A;  4D8D A;  2ECZ A;  1WFW A;  2YUP A;  2K2M A;  3FJ5 A;  1OPK A;  2OJ2 A;  2PZ1 A;  1WYX A;  4WCI A;  1SRL A;  4Z89 A;  2LNH B;  5IHK A;  2AKL A;  2LJ0 A;  4J9B A;  4F16 A;  2HDA A;  2IIM A;  1IO6 A;  4RUG A;  3UF4 A;  2AK5 A;  2EKH A;  1ZSG A;  4E6R A;  1UEC A;  1UDL A;  3RNJ A;  2JTE A;  5I22 A;  1M8M A;  2F2W A;  2PTK A;  2KT8 A;  3REB B;  3VS0 A;  5IXF A;  1WXT A;  1K0X A;  2EGA A;  1W6X A;  4QT7 A;  4JJC A;  4LUD A;  2CSI A;  2DLP A;  4AG2 C;  5I11 A;  2NUZ A;  1AWO A;  1G2B A;  2JW4 A;  1PRL C;  2DL4 A;  1VYT A;  2GTJ A;  3IQL A;  4OMM A;  3H0F A;  1BB9 A;  2AKK A;  5FW9 A;  1WI7 A;  1GCP A;  2DVJ A;  2KEA A;  3JV3 A;  1YNZ A;  3TVT A;  3VS1 A;  2D8H A;  1HJD A;  1YN8 A;  1B07 A;  1ZUU A;  2V1R A;  4IIM A;  2G6F X;  1MUZ A;  1VYV A;  2MCN A;  1K76 A;  3VS7 A;  2H8H A;  4F14 A;  1J3T A;  1QCF A;  1H92 A;  2K6D A;  4OMN A;  2MOX A;  1CKB A;  1UHF A;  1T0H A;  2L3S A;  2J6K A;  2RQV A;  3EHR A;  4AFZ C;  1ZUY A;  2DBK A;  1ABO A;  2ABL A;  2A28 A;  4J9H A;  2P4R A;  4GLM A;  1SPK A;  2NWM A;  1E7O A;  1K9A A;  1YWP A;  2DE0 X;  1W70 A;  2XMF A;  2SRC A;  1V1C A;  1N5Z A;  1NEG A;  1MV0 B;  1X6G A;  1GL5 A;  4ZNX A;  1I07 A;  1X69 A;  2LJ3 A;  4F17 A;  2CH4 A;  1M3C A;  1M30 A;  5IH2 A;  1GBQ A;  2HSP A;  4AFU C;  1GCQ A;  1UE9 A;  2OI3 A;  2DYB A;  2LP5 A;  1MV3 A;  2LJ1 A;  4M4Z A;  2F2V A;  2L3Q A;  1NLO C;  4D8K A;  2DRK A;  2DF6 A;  3M0Q A;  2DJQ A;  2GTO A;  1G83 A;  1Z9Q A;  1KFZ A;  1AWJ A;  3I9Q A;  5IHI A;  1PHT A;  3I5S A;  3VS6 A;  3I35 A;  2RPN A;  1NLP C;  4AFQ C;  1KIK A;  2DL8 A;  1ZBJ A;  2J6O A;  3NGP A;  3SHW A;  2A08 A;  2GQI A;  4A63 B;  2DL3 A;  2FRY A;  1X6B A;  4HCK A;  1BU1 A;  1PWT A;  1E6H A;  2FPE A;  4RTT A;  3VRY A;  2J05 A;  2W10 A;  3EHQ A;  3QWY A;  4LUE A;  3UA6 A;  2CH4 W;  4FSS A;  2RMO A;  4RTZ A;  4DEX A;  1UHC A;  2ROL A;  1U3O A;  2K7A A;  4OMQ A;  4JPB W;  3TSW A;  1GBR A;  1PNJ A;  4J9I A;  1WLP B;  2ESW A;  4AG1 C;  3VS4 A;  1I0C A;  2X3X D;  2EYY A;  3M0U A;  1JEG A;  2J6F A;  1KJW A;  4OML A;  3REA B;  2F2X A;  4HXJ A;  2RQR A;  1SSH A;  1K1Z A;  2O88 A;  1WXB A;  3ZL7 C;  1GCQ C;  1OOT A;  1AZG B;  5FWC A;  2VKN A;  2YUN A;  1UTI A;  1U5S A;  1YWO A;  3EG1 A;  1X43 A;  2K3B A;  4LE9 A;  2KRS A;  2CT3 A;  2KXD A;  2K79 A;  4JJD A;  4Y92 A;  1M3B A;  2D1X A;  4RTY A;  1VYU A;  2A36 A;  1HSQ A;  2HBW A;  3EG0 A;  1QWF A;  2FRW A;  3CQT A;  2CRE A;  2JM9 A;  1RUW A;  2EGC A;  3H0I A;  2DM1 A;  4HVV A;  1KSW A;  1XOV A;  1TUD A;  1NEB A;  2LMJ A;  4JZ3 A;  1AEY A;  3VS2 A;  4IIO A;  1OV3 A;  4RTW A;  1NYF A;  2C0T A;  4Z8A A;  2O9S A;  2FO0 A;  2DA9 A;  2LCS A;  2J7I A;  2DIL A;  3R6N A;  1AZE A;  2JS2 A;  2KE9 A;  1CKA A;  1ABQ A;  1I1J A;  2EBP A;  2KYB A;  2RN8 A;  3EG2 A;  2D8J A;  2EYW A;  1T0J A;  1H3H A;  2A37 A;  1TUC A;  1SHG A;  3A98 A;  1NYG A;  1FMK A;  4OMO A;  2KXC A;  4EIK A;  3U23 A;  3C0C A;  2EGE A;  2O9V A;  1Z9Z A;  2KYM A;  2DBM A;  1AD5 A;  1B3Q A;  2BTT A;  2LX7 A;  3RBB B;  4HVW A;  2OAW A;  2JM8 A;  3M0P A;  1LCK A;  2DRM A;  1UJ0 A;  2VWF A;  2W0Z A;  2BZY A;  3UA7 A;  2EPD A;  2GBQ A;  1K0S A;  2JXB A;  5L23 A;  1X2K A;  1GFC A;  2KRM A;  3VS5 A;  2BZX A;  4JZ4 A;  1S1N A;  4K11 A;  5HCK A;  2YSQ A;  1GRI A;  1BBZ A;  1T3S A;  4CC3 A;  2ED1 A;  2L2P A;  1ARK A;  2DL5 A;  2K9G A;  2PNI A;  2JT4 A;  2C0O A;  2CDT A;  4HVU A;  4J9G A;  1UG1 A;  1QKX A;  1K4U S;  2CT4 A;  2YDL A;  4DEY A;  1Y0M A;  4J9E A;  4ORZ A;  2KRN A;  1AVZ C;  1X2Q A;  1OPL A;  3O5Z A;  3SEM A;  2L3P A;  1YCS B;  2D0N A;  2YUO A;  1EFN A;  3UAT A;  2QDL A;  1WX6 A;  1ZLM A;  1SHF A;  3THK A;  5EC7 A;  1ZUK A;  4JJB A;  2HEQ A;  2KBT A; 
#chains in the Genus database with same CATH topology
 2HKN A;  2P0P A;  2FG0 A;  1LJO A;  2EW3 A;  2KR3 A;  4NL2 A;  4QQ6 A;  2OTJ A;  2EFI A;  1G3Y A;  1VQK A;  3VS3 A;  4C92 F;  2DNU A;  3CCM A;  1NPR A;  1RL2 A;  2K5F A;  2L3R A;  3QO3 A;  3GIB A;  4GY5 A;  2SEM A;  1UFF A;  1N9S A;  3C95 A;  1UGQ B;  3QHS A;  1T3L A;  4QW2 A;  1SEM A;  4RTV A;  5A0L A;  4FW1 A;  3CCR Q;  2K5L A;  3MP6 A;  4M7A D;  3CCU Q;  4KH0 B;  2NUT B;  4EMK A;  4RMO A;  1QLY A;  4FIB A;  3MO8 A;  4IUP A;  4CC2 A;  4ELY C;  2KNB B;  2QAS A;  8ATC B;  3OYN A;  4RTX A;  4JDS A;  2QK0 A;  2QA4 T;  5KCO A;  2HMA A;  2J06 A;  1QWE A;  2RQU A;  5GAO n;  3GBQ A;  5L8R E;  1JJ2 A;  1FYN A;  1QP3 A;  1QP2 A;  4KUL A;  5LJ3 f;  5GAN 6;  4N0A A;  4QVZ A;  3NPF A;  3E9G A;  3GLX A;  1PD0 A;  3CC7 Q;  1M3A A;  1YJN T;  4PJO B;  2EYZ A;  2DAQ A;  2HAX A;  4MZT A;  4M7A G;  3H41 A;  1VQ8 T;  2O2O A;  5IT9 E;  2LQW A;  3JAM E;  2DD4 A;  4ZTJ A;  1Q81 R;  2M16 A;  2BE9 B;  2HQE A;  5GJW B;  3VRZ A;  3S3O A;  2RK2 A;  1JU5 C;  1HXD A;  2EQJ A;  2KGT A;  4HT8 A;  1NG2 A;  5GJV B;  1OEB A;  4M77 B;  2AHJ B;  4QVC A;  1BI3 A;  5KYW B;  3MP1 A;  4J6Y A;  1YCY A;  1GXI E;  3UPU A;  4LN2 A;  3V7C A;  1TG0 A;  2DMO A;  2EVR A;  4XU0 A;  3VV0 A;  1UB4 A;  3CC7 T;  4J9C A;  2ENM A;  1N8R R;  1JXO A;  3LH5 A;  2L0A A;  2LQN A;  4M78 D;  1YIJ A;  1VQ9 T;  2YUP A;  5AYF A;  5GAO l;  3CCR T;  4LD9 K;  2OJ2 A;  2COW A;  4Z89 A;  3S6W A;  2M0O A;  1YFN A;  5HY6 A;  1Q82 C;  2DTI A;  4E6R A;  2YRV A;  1LOJ A;  1Q81 C;  3CEY A;  1KD1 U;  1H3Z A;  2F2W A;  2PTK A;  3FJP A;  4M78 A;  2QQB A;  3MHX A;  4BY6 B;  2HBP A;  2P0Q A;  3KUF A;  3DB3 A;  4QT7 A;  5CK9 A;  3F70 A;  1VQ9 Q;  1PRL C;  2GTJ A;  3X26 B;  2E41 A;  2XDP A;  2DVJ A;  1YNZ A;  4BAC A;  1O75 A;  1M8V A;  4IIM A;  2JTM A;  1IHV A;  5GMK j;  4BE2 A;  3OYL A;  1VQ8 Q;  2ZPB B;  1WNL A;  1YJ9 A;  4F04 B;  1QQJ A;  1TUG B;  2H8H A;  1J3T A;  5CCA A;  3EGD A;  2K6D A;  4OMN A;  2MOX A;  2RQV A;  1S72 A;  4R55 A;  1WHK A;  3OSV A;  1TU0 B;  4M78 C;  1YJ9 T;  3CCL T;  1N27 A;  1E7O A;  1K9A A;  3V8K A;  3CCU A;  5GAM h;  2RA2 A;  3A8G B;  1NEG A;  4CRI A;  4M77 G;  4BI8 B;  5GMK h;  1U8R A;  2RI2 A;  4MDW A;  1JB0 E;  3CMA A;  1RAI B;  4MDX A;  1MND A;  5IH2 A;  3CCS T;  1PCX A;  1UE9 A;  1IRE B;  2QI2 A;  1M90 C;  2RM4 A;  2LJ1 A;  4M4Z A;  5GAM d;  3ZEH A;  1TWB A;  1IGQ A;  4A4F A;  2DJQ A;  1U1S A;  2GTO A;  1Z9Q A;  2LT4 A;  3JCM V;  3LGL A;  3JRZ A;  1PHT A;  3I5S A;  4MML A;  3I35 A;  3CCM Q;  2RPN A;  4PFP A;  4M77 D;  2QGF B;  2RI3 A;  4L6V 5;  4AFQ C;  4KGZ B;  3CCJ T;  3NGP A;  3SHW A;  3M9Q A;  2DL3 A;  2FRY A;  1BU1 A;  2K3Y A;  2FPE A;  3L2U A;  3NFC A;  1IZ6 A;  3QYG B;  3VRY A;  2DIQ A;  4A4E A;  3RUX A;  4FSS A;  2RMO A;  3DLL A;  2MK5 A;  5KYW A;  4ATO A;  2ROL A;  3OYE A;  4IUV A;  3TSW A;  4JPB W;  2XD0 A;  4WF2 A;  3FB9 A;  1VQ4 T;  1BKB A;  1VQ6 T;  1UGS B;  2X3X D;  4XTX A;  2ATC B;  2J6F A;  2F69 A;  3M5A A;  3EGD B;  2F2X A;  1VQL Q;  2O88 A;  1WXB A;  1OOT A;  3SWN A;  1K9M R;  5FWC A;  3MJX A;  3DKM A;  1VQ4 A;  2R57 A;  1UTI A;  2KQW A;  1VQP A;  4LE9 A;  3G4S Q;  2CT3 A;  2DD5 A;  2KXD A;  4GLK A;  2K79 A;  4E7J A;  1QVF P;  4II1 A;  2LVM A;  4JJD A;  1D3B B;  4M7A B;  4Y92 A;  4RTY A;  5LJ5 e;  3EG0 A;  1AHJ B;  3EG9 B;  1M90 U;  1M1K R;  2QQS A;  3BW1 A;  1KSW A;  3EFO B;  1EIF A;  2VB6 A;  5GAO p;  2LMJ A;  2CKK A;  2K2V A;  1VQM T;  1SSF A;  2P4T A;  1OV3 A;  4RTW A;  2O9S A;  4FT2 A;  1AZE A;  1MMG A;  4M77 A;  5CR2 A;  3RIR A;  3X24 B;  5GAN 8;  3PIO A;  3G4S T;  1H3H A;  5FU7 C;  2A37 A;  1TUC A;  4DA4 A;  1YJW T;  1VQM A;  2RH2 A;  1SHG A;  5LJ3 h;  3MCA B;  3MEV A;  3U23 A;  4EMK C;  4FL6 A;  5HKC A;  2O9V A;  3QDR B;  1YHQ A;  1AD5 A;  2BE7 D;  3TCJ A;  3NTK A;  1PSF A;  1BI1 A;  1NJI C;  2M02 A;  1PG5 B;  4DBH A;  4HVW A;  3S3N A;  2OAW A;  2DER A;  1C6V X;  2VWF A;  1VQ6 Q;  4C0D B;  3UA7 A;  2ZPF B;  5J3B A;  2OTL A;  1X2K A;  3L2R A;  3VS5 A;  3SWN B;  1VQN T;  2BZX A;  2R58 A;  4RG2 A;  2E3H A;  4OB1 B;  3L2Q A;  1G3T A;  5HCK A;  2YSQ A;  1GRI A;  4JRK A;  4BE1 A;  1T3S A;  4A4G A;  1NBE B;  2ED1 A;  1ARK A;  4KGX B;  4OB0 B;  2DL5 A;  4E7I A;  2RB6 A;  1VQN A;  5FU7 B;  4ZN1 A;  1K73 U;  2JTF A;  4PLI A;  2QEX T;  2YDL A;  2CS7 A;  1M1K U;  4PK4 A;  3PMT A;  5LJ5 j;  4J9E A;  4ORZ A;  2RJF A;  1AVZ C;  4XTW A;  3OS1 A;  1VQ5 T;  3OA6 A;  2YUO A;  2GQV A;  1EFN A;  2FYK A;  5KYX A;  2KMT A;  2DXC A;  1XJW B;  2QQR A;  2RHU A;  3QG1 A;  1ZUK A;  5GAN g;  2QEX A;  2HEQ A;  4J7F A;  4ZGJ B;  1BYM A;  2BIV A;  1QVP A;  5CVI A;  4XU1 A;  1RAH B;  1VQL A;  1OX8 A;  3H0H A;  3RKY A;  1WHH A;  5A0G A;  1VA7 A;  3CXC P;  3G71 A;  4E7S A;  4LNP A;  3CCQ Q;  3M0T A;  4J9D A;  4PKC C;  3BDU A;  1HD3 A;  3CCQ A;  2K57 A;  2M0Y A;  1WIE A;  4CC4 B;  4CI0 C;  3EG3 A;  3QXE B;  3DB4 A;  3G6E T;  1UUE A;  4C0Z A;  1D1B A;  4FW2 A;  2M51 A;  2DX1 A;  3FIF A;  4DBR A;  5LL6 S;  3EH1 A;  3M54 A;  3OS5 A;  4BY6 C;  1JQQ A;  4N4G A;  5LJ3 e;  1BK2 A;  1KQ2 A;  1UGV A;  5FRO A;  5FU6 C;  3QZ9 B;  4M78 E;  1W1F A;  2RF0 A;  5IXB A;  4M7D D;  3HSB A;  3V8L A;  3AHU A;  2Y4Y A;  2HL3 A;  2DIG A;  2JS0 A;  5D6X A;  2KDS A;  1VQM Q;  4CC7 A;  2DET A;  3JCM c;  1HYO A;  2RQW A;  4XTV A;  2ROT A;  4PJN A;  2CGH A;  2GNC A;  2X35 A;  3GNF B;  1B34 B;  3ULR B;  1PKS A;  2JMC A;  2DXU A;  4KRT A;  2Y4X A;  5GMK m;  1V76 A;  2COY A;  3MEA A;  3PVQ A;  4LDV A;  2CP6 A;  4B9W A;  2JJ9 A;  1GFD A;  5IHN A;  1VQK T;  3VUB A;  3OSS C;  2QA4 Q;  1WXU A;  2QTX A;  4VUB A;  1KQ1 A;  1TOV A;  2MIO A;  2RJE A;  1M27 C;  3NMZ C;  4PFZ A;  5A2Q E;  3QPH A;  1S72 T;  1M2V A;  2E1H A;  1QMC A;  4C0D C;  2ZPG B;  2ED0 A;  4D6W A;  2JMA A;  1NPP A;  1ZHI A;  2I0N A;  5LJ3 g;  4RTU A;  4N0A C;  4E7K A;  2ECZ A;  3OQ5 A;  2K2M A;  4OB3 B;  3M55 A;  1OPK A;  2EJ9 A;  3CMA Q;  4DOW A;  4M7D C;  1MNE A;  2LNH B;  4Y91 A;  1BI0 A;  5CKB A;  4NOY A;  4IUU A;  3OYG A;  3CCE Q;  1BCM A;  1WJQ A;  5LJ3 j;  2IIM A;  3OYJ A;  2WSF E;  1QCN A;  1D09 B;  1UEC A;  1X6O A;  4LXC A;  3CC2 T;  3CD6 T;  4ZGE B;  1JRI A;  3C12 A;  1M8M A;  4OF1 A;  1YIJ Q;  1W6X A;  4C92 B;  7AT1 B;  2CSI A;  3SWN C;  1WHM A;  5GAN f;  4OMM A;  1BB9 A;  2AKK A;  5FW9 A;  3MEU A;  1WI7 A;  1GCP A;  4BI3 A;  4XU3 A;  2VUB A;  4C5H A;  2G6F X;  5AT1 B;  1MUZ A;  2PVG B;  1VYV A;  1FXX A;  5KYU A;  4PJM A;  2HQH A;  1VQ6 A;  5GAN e;  3CBM A;  2BKD N;  1CKB A;  2L3S A;  3OB9 A;  5IN1 A;  3G1J A;  2RJC A;  4AFZ C;  1ZUY A;  2DBK A;  1Q82 R;  1ABO A;  4M7D G;  2ABL A;  2JZ2 A;  4BI4 A;  2CZ6 B;  2E65 A;  1MHN A;  2P4R A;  4GLM A;  4FSX A;  1OZ2 A;  2GFA A;  5CIU A;  2RD1 A;  4M78 B;  1OX9 A;  2E6N A;  1V1C A;  1GL5 A;  2QXF A;  1VOM A;  2DJZ A;  1VQK Q;  1I07 A;  3CXC S;  4F17 A;  2YXY A;  3RMQ A;  2LT1 A;  1Y71 A;  3CBO A;  1G5V A;  1GCQ A;  1C1A A;  2QGG A;  1IXD A;  3ME9 A;  2XU8 A;  4X34 A;  4M7D E;  2IG0 A;  5LJ5 d;  1KD1 C;  2DRK A;  1Q81 U;  1B34 A;  1Q82 U;  1AWJ A;  5IHI A;  1I5L A;  3SD4 A;  1OI1 A;  1WQ7 A;  1NLP C;  1KC8 U;  3JCM W;  1OQK A;  1ZBJ A;  3MPU B;  2WSE E;  2J6O A;  4KUI A;  1RAB B;  4R56 A;  4C0G A;  3CC4 A;  4A63 B;  5M9O A;  1PWT A;  1YJW A;  4RTT A;  1ZA2 B;  3EHQ A;  2W10 A;  2XG8 D;  4FT4 A;  1TS9 A;  1YHQ T;  4OMQ A;  4J9I A;  3ER0 A;  5GAN 4;  2A0F B;  4AG1 C;  3FC3 A;  1KG1 A;  3M0U A;  1D1A A;  2RQR A;  5FRN A;  3A8H B;  3VJP A;  4M77 F;  2FHD A;  4E7L A;  1KQS P;  3CCL A;  5LJ5 f;  4XTY A;  3JB9 F;  1K9M U;  2DVE A;  2YUN A;  2QG9 B;  4C5I A;  2KAF A;  3CCU T;  3EG1 A;  1YWO A;  5D7U A;  3CCV Q;  5CQY A;  2V26 A;  2EQK A;  2ZCF B;  3PT9 A;  3CME T;  2E3I A;  1VYU A;  3CMA T;  2HBW A;  5GAM e;  1QWF A;  2FRW A;  2CRE A;  3OW2 S;  1RUW A;  1N8R C;  3H0I A;  1TTH B;  4HVV A;  4JZ3 A;  5GAO r;  4IIO A;  3WXM B;  1YJ9 Q;  2CP0 A;  2JUF A;  1VQO T;  1NYF A;  2C0T A;  1OU9 A;  2FO0 A;  2DA9 A;  2YLC A;  3R6N A;  2KE9 A;  1VQ5 A;  1ABQ A;  1CKA A;  1MGQ A;  3BDL A;  3JCM h;  4QVD A;  2EBP A;  2KYB A;  2ZGW A;  3EG2 A;  1ZQ1 A;  1T0J A;  4RCC A;  2EKO A;  2LDM A;  5CKF A;  2KXC A;  3M4Y A;  4EIK A;  3CPW P;  5KE3 A;  2K3X A;  5I2M A;  4M75 E;  2PQW A;  1MMA A;  2EQU A;  2DBM A;  3QUI A;  1FX7 A;  3M0P A;  1LCK A;  2DRM A;  3PMI A;  3G71 T;  4P5N A;  1UJ0 A;  2LTO A;  4BDZ A;  4OGE A;  2EPD A;  2X51 A;  2XK0 A;  4F7U G;  5C6S A;  4M77 E;  2JXB A;  4C92 G;  3P8B B;  4LDX A;  4ZN3 A;  2VC8 A;  2P0K A;  2O01 E;  3HFO A;  2XIC A;  2HSE B;  4JZ4 A;  2V8J A;  1VQP T;  8AT1 B;  4M77 C;  2XHC A;  4Q5W A;  3NTH A;  1VIE A;  1XTD A;  2FZC B;  3AT1 B;  4PJO E;  2CP3 A;  3L42 A;  5GAN 7;  3MKD A;  2DK3 A;  3QDF A;  2JT4 A;  1WGS A;  4M75 C;  1QKX A;  1QW1 A;  4A4H A;  2CT4 A;  2D6F A;  5CO7 A;  4EPC A;  3UT1 A;  4DEY A;  5GAN d;  4NL3 A;  3FDR A;  5D6W A;  3TU4 K;  1WZO A;  1X2Q A;  3SEM A;  1YCS B;  4JS4 A;  1YJN Q;  5LJ3 d;  3CCM T;  2QDL A;  1KHC A;  2XKO C;  2PUK B;  3L1A A;  1JJ2 S;  1BI2 A;  1SHF A;  1SKU B;  3VKI A;  2KBT A;  3X28 B;  3HHT B;  3QWX X;  2LZ6 B;  4C8Q C;  1N9R A;  3JB9 D;  1WJR A;  1R0C B;  2RNA A;  4JUV A;  1VQ7 A;  1RI9 A;  3G7Z A;  2DYI A;  1SRM A;  4OMP A;  2MF2 A;  5FRM A;  2PVO B;  5J26 A;  2RQT A;  4JS5 A;  1OZ3 A;  4OVA A;  1WDX A;  3OBY A;  4KGV B;  1AT1 B;  5CKD A;  2C0I A;  2V1Q A;  1C0M A;  2EQI A;  3JCM X;  2X4J A;  3NHN A;  3BY7 A;  2DTO A;  1X27 A;  2O4X A;  2RK1 A;  2KI7 A;  2KRO A;  3ASK A;  2KT1 A;  3OBW A;  3NTI A;  3PVL A;  4DBQ A;  1Y57 A;  1W2B A;  2G3R A;  2EAY A;  3QYH B;  4LDY A;  1PRM C;  2VV5 A;  1IGU A;  3GF5 A;  2LNV A;  3KFV A;  1NE8 A;  2GGR A;  4LDW A;  4AT1 B;  4IUR A;  3T9N A;  2XDB A;  3PE0 A;  1NM7 A;  1G8X A;  4ANJ A;  1YJN A;  3QSU A;  4C8Q B;  3N5B B;  2HQX A;  1VQ8 A;  2CSQ A;  3RDV A;  1EX4 A;  3M0R A;  4XTZ A;  4JLI A;  1CSK A;  1YP5 A;  1DJ7 B;  5KYY A;  1QKW A;  1YI2 Q;  3VU3 C;  3A1P A;  3HP9 A;  4C8Q D;  4LD6 A;  4B6M A;  3URG A;  1RLP C;  3M0S A;  4E47 A;  4J83 A;  3QKJ A;  3V7S A;  3H9N A;  2YT6 A;  1OU8 A;  2ZZD A;  4XU2 A;  3P8H A;  1RLQ C;  2K4Y A;  3LWH A;  1VQ4 Q;  2E70 A;  2RO0 A;  1RAD B;  2F5T X;  5FWB A;  3OW2 P;  3H8Z A;  2YHT A;  2KSS A;  2QQA A;  3FEO A;  1ZSZ C;  2EYX A;  3OY9 A;  1VQ9 A;  1G3W A;  4Z88 A;  5CQX A;  4FCY A;  2E5K A;  1PKT A;  2LCL A;  3OYA A;  4FYY B;  3LX7 A;  3JCM Q;  3CCQ T;  3JB9 G;  2FPD A;  1VQN Q;  3HKS A;  1M1F A;  2YRD A;  3C4S A;  2DFU A;  2LX9 A;  4D8D A;  3CCJ Q;  1WFW A;  3EAE A;  4PJJ A;  3FJ5 A;  1WYX A;  4WCI A;  1F1B B;  2JNG A;  4ELZ C;  1TXQ A;  2VGM A;  1NZ9 A;  2RHY A;  1IO6 A;  1BCO A;  2L5Q A;  1S72 Q;  3EFO A;  2AK5 A;  2HL5 C;  2RHX A;  1ZSG A;  1UDL A;  4ME7 A;  3RNJ A;  5CAI A;  3CCR A;  2C06 A;  1QVF S;  2JTE A;  3OMG A;  2DKG A;  1Q7Y C;  2LQK A;  1QVG S;  2YLB A;  5HK0 A;  2CP2 A;  4F7U B;  3G6E Q;  1WXT A;  4V2S A;  2EGA A;  3QBY A;  4JJC A;  2QDY B;  1VQ5 Q;  2DEQ A;  2RI5 A;  4AG2 C;  1AWO A;  5I2S A;  1G2B A;  2DL4 A;  3IQL A;  3TRE A;  5DLO A;  5HK3 A;  2EJG A;  4M7A C;  3TVT A;  3JV3 A;  1HJD A;  3QZ5 B;  2E64 A;  2DXT A;  5EG2 A;  3E1S A;  4IUQ A;  2MCN A;  1K76 A;  2A7Y A;  2X4X A;  3QJ6 A;  2XI9 A;  3JSC A;  4FU6 A;  5GAN 3;  2MWP A;  4PJO A;  4RCB A;  5DY9 A;  1T0H A;  3M59 A;  4M7A E;  2ZAE A;  4EMH A;  3PIP A;  2MMP A;  4J9H A;  5J39 A;  1SPK A;  2NWM A;  2R5M A;  2YWW A;  3OYM A;  1Q95 G;  1YWP A;  2DE0 X;  1W70 A;  2F5K A;  3CME Q;  2SRC A;  1UEB A;  5GAN h;  1ACM B;  4C8Q E;  4ZNX A;  9ATC B;  1M1K C;  2LJ3 A;  4C8Q A;  1VIF A;  2CH4 A;  2X4W A;  1M30 A;  3V7R A;  1WHL A;  1GBQ A;  1YHQ Q;  4AFU C;  1K73 C;  2OI3 A;  3RER A;  1M5Q 1;  2DO3 A;  2DYB A;  1X01 A;  2LP5 A;  3I55 T;  5D6Y A;  2BUD A;  3ZBD A;  3M0Q A;  3M57 A;  2K5I A;  3VS6 A;  2Z0W A;  1KIK A;  3VUZ A;  2D0Q B;  2DL8 A;  1YJW Q;  2GQI A;  3QJY A;  1K73 R;  4M75 A;  1X6B A;  3I55 A;  4WTO B;  2DZC A;  3DLM A;  3OW2 A;  3MET A;  4M7A F;  3EGX B;  2J05 A;  4LUE A;  1W2B P;  4BB7 A;  4QKU A;  4RTZ A;  2MPX C;  1R0B G;  3FLG A;  1U3O A;  3S3M A;  2K7A A;  3CCJ A;  1NJI U;  3VS4 A;  3INZ A;  1I0C A;  2FZK B;  2B8A A;  4OML A;  3REA B;  2A3L A;  1SSH A;  5GMK e;  4XK8 E;  3ZL7 C;  1XQH A;  3MP8 A;  4FYW B;  4FM4 B;  1G3S A;  1WJS A;  5GAM f;  3LLR A;  1U5S A;  1VUB A;  4F7U F;  4M75 B;  2V8I A;  3BE3 A;  3CC4 Q;  1KC8 R;  2KRS A;  4J8O A;  5CKE A;  4PJO G;  1IHW A;  3LH0 A;  3KBG A;  1M3B A;  2D1X A;  2A36 A;  1HSQ A;  3PGG A;  4PL6 A;  4C92 E;  4C0F A;  3CQT A;  4M75 D;  2EGC A;  2AT1 B;  4HCB A;  2LQ8 A;  3CCS Q;  1XOV A;  1ZSZ A;  4KT0 E;  1TUD A;  1X75 C;  4O6J A;  4XQ3 A;  3CPF A;  3CXC A;  1AEY A;  4A4K A;  3I55 Q;  1D0X A;  4EMK B;  2DIL A;  2DZ9 A;  3M53 A;  3EFR A;  3RMS A;  3O8V A;  1D1C A;  5GAM g;  2RN8 A;  3CC4 T;  3HRS A;  2D8J A;  2HZY A;  1Y7X A;  2EYW A;  3EH2 A;  3BFM A;  4RKU E;  5KYN A;  4HCC A;  3RES A;  1NYG A;  4OMO A;  3PTA A;  3C0C A;  2OTJ T;  2EGE A;  1Z9Z A;  2DEU A;  3M4G A;  2LX7 A;  2L89 A;  4O5V A;  2JM8 A;  2RJD A;  4MZP A;  2BZY A;  2Y90 A;  4L5G A;  2QEX Q;  2GBQ A;  4M75 F;  5GMK i;  2QQ9 A;  5GAN 2;  3EFS A;  1R77 A;  2FZG B;  4OP0 A;  1R8O B;  4C8Q G;  3E9F A;  1B7T A;  1K8A R;  2XDD A;  3LWI A;  5KCH A;  1ZA1 B;  3LYI A;  4J5Y A;  3CME A;  3OYY A;  5KE2 A;  1KK7 A;  2C0O A;  2CDT A;  4HVU A;  2GCX A;  1UG1 A;  4XTU A;  4ZGD B;  2HNI A;  2V8K A;  1D3B A;  3J81 E;  2H3J A;  2GF7 A;  1W2B S;  4M75 G;  2E4H A;  5I21 A;  1VQO A;  5CKH A;  3TQ7 P;  2VAS A;  3CBP A;  2RHI A;  4M7D B;  2L3P A;  4Z02 A;  1JJ2 P;  5IAY A;  3OYD A;  1VQP Q;  1WX6 A;  2MI6 A;  3THK A;  3VYG A;  5EC7 A;  3OYF A;  3GNG A;  4JJB A;  4X9C A;  4E2F B;  4QQG A;  2OX7 A;  4X9D A;  3JB9 J;  3A8O B;  3OYH A;  1I8F A;  2LCC A;  4TVR A;  2NUP B;  4J9F A;  2ZPE B;  3EGX A;  1U06 A;  3JCM g;  4C92 C;  3LGF A;  2B86 A;  2HCK A;  2CYZ B;  1AOJ A;  4ESR A;  4N4I A;  3HRU A;  4X1V A;  1QVG A;  1RAE B;  2ZPH B;  2EJF A;  2E6Z A;  1NJI R;  2CZ1 B;  3QII A;  2IVW A;  3HTR A;  1VQL T;  1KHI A;  3CC2 Q;  3CD6 Q;  3I56 T;  3L2W A;  3WVE B;  3JCM b;  1AWX A;  4PFO A;  2FEI A;  1RAA B;  1YIJ T;  4OMF B;  1HK9 A;  1RAG B;  3A5Z B;  1JBM A;  4R0K A;  1AWW A;  2FB7 A;  2CZ7 B;  4XAX B;  1WA7 A;  3J80 E;  4M7A A;  2OAU A;  3I56 A;  4Y28 E;  2M1H A;  2O31 A;  2AZV A;  4A54 A;  1JXM A;  2DL7 A;  3SFM A;  2MWO A;  1BIB A;  3G6E A;  4C92 A;  1E6G A;  1ZBX A;  2AIR B;  1V29 B;  4GBQ A;  1H8K A;  2AZS A;  4HKE A;  2XID A;  1JO8 A;  2E10 A;  2YUQ A;  2CUD A;  3UWN A;  1YIT T;  2NYS A;  3OYK A;  1ZX6 A;  4M7D A;  1EZZ B;  5ECA A;  1QVG P;  2KK4 A;  2FPF A;  3I5R A;  1Q86 U;  2HD0 A;  2KY9 A;  2LC4 A;  4C92 D;  4OGC A;  2MYS A;  4A53 A;  2EQM A;  4QQD A;  3A8L B;  3C94 A;  3LW5 E;  2CUB A;  1K9M C;  1M2O A;  5DLQ E;  1VQ7 T;  2EYQ A;  2OTJ Q;  1UJY A;  4JRI A;  5GAO q;  3TSZ A;  1N6A A;  2VXF A;  2D9T A;  4AMC A;  4DQ2 A;  4AFS C;  4EMG A;  3GOX A;  2X3W D;  1YIT Q;  1A0N B;  3EGU A;  3OMC A;  1RAC B;  1PC0 A;  1U1T A;  1I5O B;  2BZ8 A;  2VVK A;  4KBM B;  3JCM J;  1KQS S;  3PFS A;  4C5G A;  4MMK A;  2PZ1 A;  1SRL A;  3X25 B;  5IHK A;  2AKL A;  1P92 A;  2LJ0 A;  3M56 A;  4J9B A;  4F16 A;  2HDA A;  1KC8 C;  1M9S A;  3P8D A;  4RUG A;  3UF4 A;  2EKH A;  3KXT A;  2QA4 A;  1MMN A;  1UGR B;  1VQO Q;  3HFN A;  1YI2 A;  1IB8 A;  4FYV B;  3J7A F;  5I22 A;  2WSC E;  2KT8 A;  3REB B;  3VS0 A;  2CP5 A;  4PLL A;  5IXF A;  1K0X A;  1RI0 A;  4LUD A;  5C0M A;  5KYX B;  2DLP A;  5I11 A;  3CCL Q;  2NUZ A;  4HCZ A;  2JW4 A;  3VYH B;  1VYT A;  3H0F A;  2L8D A;  2KEA A;  3EG9 A;  1BIA A;  2GFU A;  4J6W A;  2D8H A;  3VS1 A;  1YN8 A;  1YI2 T;  3CC2 A;  3CD6 A;  3FRN A;  1B07 A;  1ZUU A;  4C8Q F;  1SG5 A;  2V1R A;  2NLU A;  4BUG A;  3HL8 A;  3VS7 A;  4F14 A;  1QCF A;  1H92 A;  2VYT A;  2QAZ A;  4JJN K;  1UHF A;  1QCO A;  3X20 B;  1K8A C;  1M1G A;  2J6K A;  3V8J A;  3EHR A;  4HA8 A;  3RKW A;  3OYI A;  2A28 A;  3GPL A;  4YTL A;  3JB9 I;  2JN0 A;  4M78 F;  4JRQ A;  3CC7 A;  3I56 Q;  5LJ5 h;  1M2V B;  3R6O A;  4F7U A;  2XMF A;  1TH7 A;  3JB9 H;  4ZTF A;  2DTH A;  1N5Z A;  1MV0 B;  5GAN j;  4J6X A;  1X6G A;  1OUL A;  2LRQ A;  2HKQ B;  1VQ7 Q;  1X69 A;  4E7Z A;  3M58 A;  1M3C A;  1FWZ A;  2HSP A;  4F7U E;  2EIF A;  1N8R U;  1FMV A;  4MZM A;  1MV3 A;  5GAN 5;  2F2V A;  2L3Q A;  1NLO C;  4D8K A;  3TEE A;  3OS0 A;  3CCV A;  4E7H A;  2DF6 A;  4PJL A;  1G83 A;  3G71 Q;  2NUP A;  2NUT A;  1KFZ A;  3E2U A;  3I9Q A;  1Y96 B;  3CCE A;  3HPW A;  2IPO B;  3OYB A;  2ZPI B;  2A08 A;  2RHZ A;  4RG8 A;  4UC4 A;  5GAO m;  3G4S A;  1YBY A;  3L2V A;  1LPL A;  4HCK A;  1E6H A;  3ZFJ A;  3CCV T;  3QWY A;  6AT1 B;  3UA6 A;  2CH4 W;  4J7I A;  4DEX A;  4PJO F;  3CCE T;  1UHC A;  1D0Y A;  5A0D A;  1KQS A;  3OS2 A;  2WAC A;  4OB2 B;  4B9X A;  1PNJ A;  1GBR A;  1IRX A;  1WLP B;  3H6Z A;  3RR6 A;  2ESW A;  2FL7 A;  2EWN A;  2EYY A;  1K8A U;  2X9H A;  5KH6 A;  4JRP A;  1WHG A;  1JEG A;  1KJW A;  2VXE A;  4HXJ A;  2COZ A;  2QYZ A;  1K1Z A;  1GCQ C;  2OTL T;  1AZG B;  3E19 A;  2VKN A;  4BD3 A;  2M9U A;  3CPW A;  1Y96 A;  2F1L A;  4FYX B;  4C5E A;  1Q86 R;  5GMK l;  1PD1 A;  1X43 A;  1W4S A;  4PJO C;  2K3B A;  1WHJ A;  5FU6 B;  1M4Z A;  3WVD B;  5FLX E;  2O4X B;  1WQW A;  1UGP B;  1LVK A;  2E5Q A;  3SB2 A;  1WPY A;  3CCS A;  3JCM f;  2E12 A;  2JM9 A;  1SF9 A;  2DM1 A;  3CPW S;  1NEB A;  3VS2 A;  1Q7Y R;  4Z8A A;  2LCS A;  2J7I A;  3L2Z A;  4KH1 B;  2JS2 A;  3JCM P;  1I1J A;  2DPP B;  3JCM e;  4DBF A;  5LJ5 g;  3UDC A;  2JOY A;  4IUT A;  1OYX A;  2PVD B;  1I4K 1;  1D0Z A;  2CP7 A;  3A98 A;  1FMK A;  2DXB A;  2MAM A;  2KYM A;  5KYU B;  3Q1J A;  4LDU A;  1B3Q A;  2BTT A;  2X4Y A;  1FMW A;  3RBB B;  4N4H A;  5KYY B;  1MMD A;  2W0Z A;  2CZ0 B;  4JLG A;  2H3E B;  1K0S A;  5L23 A;  1GFC A;  4HT9 A;  2OTL Q;  2KRM A;  1RAF B;  1LNX A;  1PM3 A;  1Q86 C;  2R5A A;  4PJO D;  1TSF A;  1S1N A;  4PNO A;  5DM7 R;  4K11 A;  3PNW C;  2YRC A;  1BBZ A;  4CC3 A;  1O9S A;  2KVQ G;  4BE0 A;  3RKX A;  1Q7Y U;  2L2P A;  2PUO B;  1ZSZ B;  3A8M B;  4DOV A;  2K9G A;  2PNI A;  1KD1 R;  1PSE A;  3HRT A;  1M90 R;  4J9G A;  3OYC A;  1I81 A;  2VGN A;  4IKF A;  1K4U S;  2FVU A;  4EDU A;  3MEW A;  1H64 1;  1Y0M A;  4NS5 A;  5GAM j;  2KRN A;  1XNI A;  1OPL A;  3O5Z A;  2JVV A;  2P84 A;  2QTV A;  4BDY A;  1YIT A;  2D0N A;  4KUD K;  1QVF A;  3SDZ A;  2I2L A;  3UAT A;  3D7S B;  1ZLM A;  3JCM d;  4M7D F;  2PU9 B;  3GP8 A;  4L59 A;  4M78 G;  1Y07 A; 
#chains in the Genus database with same CATH homology
 2FG0 A;  3QWX X;  2EW3 A;  2LZ6 B;  2KR3 A;  3H0H A;  2RNA A;  4J9F A;  1RI9 A;  3VS3 A;  1U06 A;  2DNU A;  1SRM A;  4OMP A;  1VA7 A;  2B86 A;  2HCK A;  1AOJ A;  2RQT A;  4ESR A;  4X1V A;  1WDX A;  4LNP A;  2C0I A;  2V1Q A;  3M0T A;  2EQI A;  4J9D A;  3NHN A;  2SEM A;  1HD3 A;  1X27 A;  1UFF A;  2KRO A;  2M0Y A;  1WIE A;  2KT1 A;  4CC4 B;  3PVL A;  3EG3 A;  1T3L A;  1Y57 A;  1AWX A;  1SEM A;  4RTV A;  2FEI A;  1UUE A;  1PRM C;  1QLY A;  4R0K A;  2M51 A;  2DX1 A;  1AWW A;  4CC2 A;  1WA7 A;  2KNB B;  3KFV A;  1JQQ A;  2GGR A;  1BK2 A;  1UGV A;  2O31 A;  2AZV A;  4RTX A;  1JXM A;  2DL7 A;  3PE0 A;  1W1F A;  2RF0 A;  5IXB A;  1NM7 A;  1E6G A;  2J06 A;  1QWE A;  2RQU A;  1H8K A;  2AZS A;  4GBQ A;  3GBQ A;  2JS0 A;  2CSQ A;  1FYN A;  1JO8 A;  3M0R A;  4CC7 A;  2YUQ A;  2CUD A;  2RQW A;  1CSK A;  1YP5 A;  2ROT A;  3NPF A;  2GNC A;  1QKW A;  1ZX6 A;  3ULR B;  1PKS A;  2JMC A;  4KRT A;  1M3A A;  5ECA A;  1RLP C;  3M0S A;  2EYZ A;  2FPF A;  3I5R A;  3H41 A;  2YT6 A;  2O2O A;  3PVQ A;  1RLQ C;  2LQW A;  1GFD A;  5IHN A;  2CUB A;  5GJW B;  3VRZ A;  5FWB A;  1JU5 C;  2KGT A;  1NG2 A;  1WXU A;  1UJY A;  5GJV B;  1OEB A;  2EYX A;  2MIO A;  1M27 C;  3NMZ C;  3TSZ A;  4Z88 A;  2E5K A;  1PKT A;  4AFS C;  4LN2 A;  2ED0 A;  1TG0 A;  2DMO A;  2X3W D;  2EVR A;  2JMA A;  1A0N B;  3EGU A;  4J9C A;  2ENM A;  2BZ8 A;  2I0N A;  2VVK A;  2FPD A;  1JXO A;  3LH5 A;  4RTU A;  2L0A A;  2LQN A;  4D8D A;  2ECZ A;  1WFW A;  2YUP A;  2K2M A;  3FJ5 A;  1OPK A;  2OJ2 A;  2PZ1 A;  1WYX A;  4WCI A;  1SRL A;  4Z89 A;  2LNH B;  5IHK A;  2AKL A;  2LJ0 A;  4J9B A;  4F16 A;  2HDA A;  2IIM A;  1IO6 A;  4RUG A;  3UF4 A;  2AK5 A;  2EKH A;  1ZSG A;  4E6R A;  1UEC A;  1UDL A;  3RNJ A;  2JTE A;  5I22 A;  1M8M A;  2F2W A;  2PTK A;  2KT8 A;  3REB B;  3VS0 A;  5IXF A;  1WXT A;  1K0X A;  2EGA A;  1W6X A;  4QT7 A;  4JJC A;  4LUD A;  2CSI A;  2DLP A;  4AG2 C;  5I11 A;  2NUZ A;  1AWO A;  1G2B A;  2JW4 A;  1PRL C;  2DL4 A;  1VYT A;  2GTJ A;  3IQL A;  4OMM A;  3H0F A;  1BB9 A;  2AKK A;  5FW9 A;  1WI7 A;  1GCP A;  2DVJ A;  2KEA A;  3JV3 A;  1YNZ A;  3TVT A;  3VS1 A;  2D8H A;  1HJD A;  1YN8 A;  1B07 A;  1ZUU A;  2V1R A;  4IIM A;  2G6F X;  1MUZ A;  1VYV A;  2MCN A;  1K76 A;  3VS7 A;  2H8H A;  4F14 A;  1J3T A;  1QCF A;  1H92 A;  2K6D A;  4OMN A;  2MOX A;  1CKB A;  1UHF A;  1T0H A;  2L3S A;  2J6K A;  2RQV A;  3EHR A;  4AFZ C;  1ZUY A;  2DBK A;  1ABO A;  2ABL A;  2A28 A;  4J9H A;  2P4R A;  4GLM A;  1SPK A;  2NWM A;  1E7O A;  1K9A A;  1YWP A;  2DE0 X;  1W70 A;  2XMF A;  2SRC A;  1V1C A;  1N5Z A;  1NEG A;  1MV0 B;  1X6G A;  1GL5 A;  4ZNX A;  1I07 A;  1X69 A;  2LJ3 A;  4F17 A;  2CH4 A;  1M3C A;  1M30 A;  5IH2 A;  1GBQ A;  2HSP A;  4AFU C;  1GCQ A;  1UE9 A;  2OI3 A;  2DYB A;  2LP5 A;  1MV3 A;  2LJ1 A;  4M4Z A;  2F2V A;  2L3Q A;  1NLO C;  4D8K A;  2DRK A;  2DF6 A;  3M0Q A;  2DJQ A;  2GTO A;  1G83 A;  1Z9Q A;  1KFZ A;  1AWJ A;  3I9Q A;  5IHI A;  1PHT A;  3I5S A;  3VS6 A;  3I35 A;  2RPN A;  1NLP C;  4AFQ C;  1KIK A;  2DL8 A;  1ZBJ A;  2J6O A;  3NGP A;  3SHW A;  2A08 A;  2GQI A;  4A63 B;  2DL3 A;  2FRY A;  1X6B A;  4HCK A;  1BU1 A;  1PWT A;  1E6H A;  2FPE A;  4RTT A;  3VRY A;  2J05 A;  2W10 A;  3EHQ A;  3QWY A;  4LUE A;  3UA6 A;  2CH4 W;  4FSS A;  2RMO A;  4RTZ A;  4DEX A;  1UHC A;  2ROL A;  1U3O A;  2K7A A;  4OMQ A;  4JPB W;  3TSW A;  1GBR A;  1PNJ A;  4J9I A;  1WLP B;  2ESW A;  4AG1 C;  3VS4 A;  1I0C A;  2X3X D;  2EYY A;  3M0U A;  1JEG A;  2J6F A;  1KJW A;  4OML A;  3REA B;  2F2X A;  4HXJ A;  2RQR A;  1SSH A;  1K1Z A;  2O88 A;  1WXB A;  3ZL7 C;  1GCQ C;  1OOT A;  1AZG B;  5FWC A;  2VKN A;  2YUN A;  1UTI A;  1U5S A;  1YWO A;  3EG1 A;  1X43 A;  2K3B A;  4LE9 A;  2KRS A;  2CT3 A;  2KXD A;  2K79 A;  4JJD A;  4Y92 A;  1M3B A;  2D1X A;  4RTY A;  1VYU A;  2A36 A;  1HSQ A;  2HBW A;  3EG0 A;  1QWF A;  2FRW A;  3CQT A;  2CRE A;  2JM9 A;  1RUW A;  2EGC A;  3H0I A;  2DM1 A;  4HVV A;  1KSW A;  1XOV A;  1TUD A;  1NEB A;  2LMJ A;  4JZ3 A;  1AEY A;  3VS2 A;  4IIO A;  1OV3 A;  4RTW A;  1NYF A;  2C0T A;  4Z8A A;  2O9S A;  2FO0 A;  2DA9 A;  2LCS A;  2J7I A;  2DIL A;  3R6N A;  1AZE A;  2JS2 A;  2KE9 A;  1CKA A;  1ABQ A;  1I1J A;  2EBP A;  2KYB A;  2RN8 A;  3EG2 A;  2D8J A;  2EYW A;  1T0J A;  1H3H A;  2A37 A;  1TUC A;  1SHG A;  3A98 A;  1NYG A;  1FMK A;  4OMO A;  2KXC A;  4EIK A;  3U23 A;  3C0C A;  2EGE A;  2O9V A;  1Z9Z A;  2KYM A;  2DBM A;  1AD5 A;  1B3Q A;  2BTT A;  2LX7 A;  3RBB B;  4HVW A;  2OAW A;  2JM8 A;  3M0P A;  1LCK A;  2DRM A;  1UJ0 A;  2VWF A;  2W0Z A;  2BZY A;  3UA7 A;  2EPD A;  2GBQ A;  1K0S A;  2JXB A;  5L23 A;  1X2K A;  1GFC A;  2KRM A;  3VS5 A;  2BZX A;  4JZ4 A;  1S1N A;  4K11 A;  5HCK A;  2YSQ A;  1GRI A;  1BBZ A;  1T3S A;  4CC3 A;  2ED1 A;  2L2P A;  1ARK A;  2DL5 A;  2K9G A;  2PNI A;  2JT4 A;  2C0O A;  2CDT A;  4HVU A;  4J9G A;  1UG1 A;  1QKX A;  1K4U S;  2CT4 A;  2YDL A;  4DEY A;  1Y0M A;  4J9E A;  4ORZ A;  2KRN A;  1AVZ C;  1X2Q A;  1OPL A;  3O5Z A;  3SEM A;  2L3P A;  1YCS B;  2D0N A;  2YUO A;  1EFN A;  3UAT A;  2QDL A;  1WX6 A;  1ZLM A;  1SHF A;  3THK A;  5EC7 A;  1ZUK A;  4JJB A;  2HEQ A;  2KBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...