4LNPA

The first sh3 domain from cap/ponsin in complex with proline rich peptide from vinculin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
EMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Sorbin and SH3 domain-containing protein 1
publication title Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4lnpA00
2C0TA 3M0QA 2BZ8A 1Z9QA 3REAB 2OI3A 5IHKA 1H3HA 1AWOA 1NEBA 4JZ3A 5I11A 5IH2A 1RI9A 1WX6A 2EPDA 1NEGA 1S1NA 1W1FA 2CH4W 2JXBA 1M3AA 2JM9A 4HVUA 1GCPA 1WFWA 1G2BA 4AG2C 1OV3A 4RTYA 2F2XA 2CREA 2V1QA 2KRMA 2X3WD 3SEMA 5IHNA 2DJQA 1CSKA 2K79A 3C0CA 2X3XD 1YP5A 2KGTA 1KFZA 1NM7A 1I07A 3EG3A 4Y92A 2ENMA 1NG2A 1NYGA 3SHWA 1M3CA 1YWOA 4RTTA 2JS0A 1ZUKA 4D8DA 1E6GA 4FSSA 2D8HA 3VRYA 4CC4B 1X43A 2VWFA 3PVQA 1PWTA 2HBWA 2BTTA 2M0YA 1UJYA 2XMFA 3NGPA 2LQWA 2J06A 1MV0B 2FRYA 4M4ZA 3VS0A 1LCKA 2D8JA 2KR3A 2QDLA 4KRTA 3M0RA 2W0ZA 1UHFA 1U3OA 2J7IA 1PKTA 4ORZA 5FWCA 1I0CA 1T0HA 2F2WA 1VYVA 2B86A 2AKLA 1E7OA 2HSPA 3FJ5A 2RNAA 2K2MA 2KNBB 3NHNA 2EYZA 3REBB 1QWFA 1FMKA 1T3SA 1U06A 4IIMA 1CKAA 2YUNA 2ECZA 2J6KA 3UA6A 3I35A 2DL8A 2DL5A 2DNUA 2BZXA 3M0TA 1M3BA 2EGEA 3M0PA 1QKWA 1K0SA 2IIMA 1K4US 2LMJA 3H41A 2RMOA 2KYMA 4J9BA 2FRWA 1JO8A 3LH5A 2CH4A 1IO6A 1JU5C 3JV3A 2JT4A 1X2QA 2KXDA 1UG1A 2PTKA 3VS6A 4QT7A 2K6DA 4J9DA 2LJ1A 3TSWA 1ABQA 1WXTA 4DEXA 2HDAA 2EGCA 1M27C 3O5ZA 2P4RA 1AWJA 4GBQA 1BB9A 4OMOA 4OMLA 3M0UA 3NPFA 1UTIA 2J6OA 1QKXA 2ED1A 1X6GA 3PVLA 1B3QA 3VS3A 2AZSA 1VYUA 3KFVA 1JXOA 1M8MA 4WCIA 1TUDA 2L3QA 3I9QA 1PHTA 1PNJA 2FG0A 5EC7A 2EVRA 4HXJA 1W6XA 3EG2A 2C0IA 1SEMA 1UHCA 1X69A 3EG1A 2LP5A 4CC3A 2KRNA 2E5KA 2A37A 3R6NA 4A63B 1PRMC 2CSIA 4LE9A 1JQQA 5HCKA 4JJDA 3ZL7C 2YT6A 3UF4A 1AWXA 5L23A 1AZGB 1GRIA 1VA7A 5ECAA 1CKBA 2DL4A 2RQWA 2DVJA 2LJ0A 4R0KA 5GJVB 1Y57A 1GFCA 2DYBA 2DMOA 2OJ2A 3H0IA 4Z8AA 3I5RA 1ZUYA 2KT8A 1FYNA 1QWEA 1SHFA 3VRZA 2JM8A 1Z9ZA 2GQIA 2KRSA 1AVZC 4AFZC 2MOXA 2RF0A 2RQTA 1WA7A 1RLPC 2RQRA 2G6FX 4IIOA 5FWBA 1X27A 2CSQA 1K0XA 1NYFA 1OEBA 2EGAA 1YWPA 4J9IA 1T0JA 1VYTA 1K9AA 4ESRA 2NUZA 2EYWA 3EHQA 3ULRB 1SSHA 2DA9A 1SHGA 2AKKA 2GBQA 1OPKA 2A36A 2M51A 1OOTA 4OMNA 1W70A 3QWXX 2YDLA 4Z89A 4HVWA 1GCQA 3TVTA 2VKNA 2ABLA 1TUCA 4J9EA 4OMMA 1JEGA 1UFFA 1KJWA 1ZBJA 1AOJA 1HSQA 4AFUC 2FPEA 2J6FA 4HCKA 2LX7A 2DF6A 2YUQA 2KEAA 4EIKA 2YUOA 1WLPB 4CC2A 4F17A 3VS1A 5GJWB 2NWMA 2KE9A 4X1VA 1N5ZA 4RTUA 1ZUUA 2I0NA 2DM1A 3M0SA 1AWWA 1YCSB 1ABOA 2O31A 4OMPA 3EGUA 2KYBA 2AK5A 2JMCA 2SEMA 4F16A 1RLQC 2C0OA 3PE0A 5I22A 2JS2A 1A0NB 2O9SA 4JJCA 4AFQC 2DL3A 1X6BA 2FPFA 2SRCA 2EBPA 1AD5A 2KT1A 2LJ3A 2CT4A 1X2KA 2L3SA 2ROTA 1WIEA 1UECA 2FPDA 2D1XA 2K7AA 3A98A 2V1RA 2DLPA 3QWYA 2FEIA 2RQUA 4RTZA 2YUPA 1OPLA 2O2OA 1G83A 1PKSA 1WXBA 1SRLA 2ED0A 2PNIA 1I1JA 2DILA 1KIKA 5IXBA 1ARKA 3I5SA 4RTXA 4HVVA 3IQLA 1K76A 3VS2A 5FW9A 4JPBW 2RN8A 2CDTA 1XOVA 2JMAA 2O88A 2L3PA 1GFDA 1PRLC 3TSZA 3UATA 2MCNA 1ZLMA 3VS7A 3THKA 1WXUA 2J05A 3NMZC 2VVKA 1K1ZA 2H8HA 1TG0A 3RNJA 2CT3A 4AFSC 1T3LA 2DX1A 3CQTA 2CUDA 4LN2A 1HJDA 5IXFA 2GNCA 4E6RA 2LCSA 1YN8A 1ZSGA 1GBQA 4LNPA 4F14A 1M30A 1QCFA 1J3TA 4OMQA 1H8KA 1BU1A 1H92A 4K11A 1GL5A 2YSQA 1RUWA 3EG0A 2GTOA 4D8KA 1WI7A 4RTWA 2D0NA 3EHRA 1SPKA 4J9CA 5IHIA 1UUEA 4J9GA 2OAWA 1UE9A 1UDLA 1WDXA 2DBMA 2RPNA 1GCQC 1QLYA 4AG1C 2KXCA 1WYXA 2DRKA 2O9VA 4J9HA 4LUEA 2A08A 2L2PA 2CUBA 3VS5A 2KROA 4ZNXA 2BZYA 3RBBB 3U23A 2LNHB 2A28A 1JXMA 2ESWA 4RUGA 1NLOC 1B07A 4Z88A 2HCKA 2RQVA 1MV3A 2AZVA 1KSWA 2PZ1A 1MUZA 4RTVA 2EKHA 2DE0X 1UGVA 4LUDA 4J9FA 3VS4A 3H0FA 3H0HA 3UA7A 4DEYA 4GLMA 1V1CA 1YNZA 4JZ4A 2JW4A 2DL7A 2MIOA 2EQIA 3GBQA 2K3BA 1SRMA 1UJ0A 1U5SA 2KBTA 2JTEA 2DBKA 1Y0MA 4CC7A 2FO0A 1NLPC 2K9GA 1BBZA 2DRMA 2LZ6B 2F2VA 2LQNA 1AEYA 4JJBA 2EW3A 2GGRA 2EYYA 2L0AA 1HD3A 2GTJA 1EFNA 1GBRA 1ZX6A 2ROLA 2EYXA 1BK2A 2HEQA 2W10A 1AZEA 1E6HA
chains in the Genus database with same CATH superfamily
1OQKA 3RKWA 5IHKA 5I11A 3CMAT 3PMIA 1VQPT 2RK2A 1R0BG 2HSEB 2JM9A 4FT2A 1G2BA 3M56A 1LPLA 4ZN1A 1OV3A 2V1QA 5CCAA 2XI9A 2DJQA 5IHNA 1CSKA 3EFOA 1X01A 3CPFA 3CCRT 2ZCFB 4FT4A 3EG3A 2ENMA 1FMWA 4BACA 1M3CA 1YWOA 4E7KA 5CR2A 4D8DA 4XU2A 5A0GA 3VRYA 2D6FA 4PLIA 4FYYB 5J39A 4QW2A 2R5MA 1TXQA 3CC2A 2EJGA 4J5YA 2M0YA 5GAMf 4FYWB 4M75G 2E65A 4M78C 4BB7A 1OZ2A 4PFOA 1IGUA 2PVOB 2FRYA 4DBQA 4C92F 1LCKA 3MJXA 4AMCA 4KULA 4ORZA 1YJNA 5FWCA 4M77B 2F2WA 1MGQA 2E4HA 1E7OA 2HSPA 7AT1B 5GAOq 3HSBA 1D3BA 2MAMA 1QMCA 2GCXA 2JUFA 3NHNA 5DY9A 3REBB 1HXDA 2ZPBB 1QWFA 3HFOA 4XU3A 4F7UG 3CCST 5LJ5h 5GAN4 5CK9A 2XHCA 4D6WA 4C5GA 2A3LA 2IIMA 1M90R 2QDYB 3HRTA 5GAOr 2FRWA 2QG9B 4XTXA 3LH5A 2CH4A 4WTOB 1YHQQ 2JT4A 2BIVA 2PTKA 4QT7A 2DERA 3RESA 1ZSZA 4QKUA 2A7YA 3LH0A 2HL5C 2HDAA 3TREA 1M27C 3O5ZA 3I56Q 3OBYA 4PJOD 5HK0A 3CCUA 1M90C 4PJLA 1AT1B 1BB9A 1BIAA 3M53A 4MZTA 1OYXA 1UTIA 2HQHA 3EG9B 2NUPB 1ZBXA 1JXOA 4WCIA 2DXBA 3RDVA 3QIIA 4HA8A 3QDFA 5IT9E 3TEEA 3EG1A 3ASKA 2C06A 4CC3A 3CC7Q 2KRNA 3EGXA 2E5KA 5LJ3e 3DB4A 1I8FA 3DLMA 2JOYA 1PRMC 4FL6A 2P84A 3VKIA 2OTLQ 1IREB 3ZL7C 1RADB 2DZ9A 1AZGB 1VA7A 3HL8A 2DL4A 3V7RA 4HT9A 2DVJA 1SG5A 5LL6S 4B6MA 1SKUB 1Y96A 3JCMb 5KYXA 4PFPA 3JCMc 4HT8A 1ZUYA 2DTIA 3V7SA 3G71T 3OB9A 1AVZC 4AFZC 4RG2A 4IIOA 5FWBA 4C8QC 1QP2A 4B9XA 2E70A 1BCOA 4IURA 2CZ0B 4PKCC 3WVDB 4CI0C 3JB9I 2NUZA 3EHQA 4ME7A 5LJ3g 2WSEE 2GBQA 4NOYA 1BCMA 4FW1A 2M51A 3S3MA 1C6VX 3CC2Q 2R5AA 1PCXA 3E9FA 3WXMB 3OW2P 1ACMB 1TUCA 3LLRA 2RH2A 3PGGA 4J9EA 4OMMA 1ZBJA 1YJWA 1JEGA 1AOJA 4M78B 2FPEA 1B34B 1VQ8A 4Y28E 4M7AC 2DF6A 2KEAA 4EDUA 4EIKA 1N9RA 2DXTA 4KGVB 5GANj 2QTXA 1YJ9T 1RL2A 1VQ6A 1M2VA 2I0NA 2DFUA 1YIJA 4OMPA 2JMCA 4F16A 6AT1B 2C0OA 2XU8A 1QVFP 2JS2A 1D1BA 3QG1A 1QW1A 4C92G 3UWNA 4AFQC 3EH1A 2DL3A 1X6BA 2QEXA 5GAN3 5KYUA 3OW2S 4C0DC 1VOMA 2ROTA 4DOWA 2LCLA 4M7DC 3UDCA 1M90U 3QWYA 1Y71A 4R56A 3PFSA 3CCLQ 5D6YA 5GAN6 5FU7C 1Y7XA 2E6NA 2O2OA 1U1SA 3GF5A 1WXBA 3GLXA 1I1JA 3QZ5B 4DQ2A 1WNLA 1D0YA 3M4YA 4RTXA 2KAFA 4HVVA 4TVRA 4E7SA 2V8JA 1FWZA 4E7LA 5FW9A 1QVFS 2NYSA 3UPUA 1KQ2A 3P8BB 4BI8B 2XICA 2L3PA 3VYHB 4J7FA 3G1JA 2MCNA 3MEWA 1YJNT 3THKA 1WXUA 4M77E 3NMZC 2VVKA 2M9UA 1VQ9T 2RJCA 1B7TA 2H8HA 4AFSC 2DX1A 4ZGJB 1HJDA 4E6RA 2CP6A 1XTDA 3EGXB 1Q7YR 1DJ7B 5KYYA 2CP7A 5FU6C 1J3TA 4C5HA 3SWNC 2FZKB 1H8KA 4PJOA 2K3XA 3OYNA 1NE8A 2YSQA 5IN1A 2E64A 3CPWP 2DEUA 3LWHA 3QYHB 2L5QA 2HD0A 4J9CA 4QVDA 5IHIA 3URGA 4J9GA 1Y96B 2XDDA 2DXUA 1Q7YC 1OULA 3SB2A 1GCQC 4C8QB 3CD6T 2QQSA 5LJ5f 2A08A 1W2BP 3VS5A 3LGFA 2RB6A 4OVAA 1QVGP 3U23A 3OW2A 2LNHB 1JXMA 3GNGA 4RUGA 2QAZA 2F1LA 3M54A 2RQVA 4RTVA 1MUZA 1QP3A 1RACB 3H6ZA 3V8LA 2R58A 5A0LA 1YJWQ 4LUDA 3VS4A 3UA7A 1K8AC 2MK5A 4JZ4A 4O5VA 4M7AB 1I5LA 1VQ8Q 2LNVA 5FRNA 2YHTA 2VGMA 2ATCB 2K3BA 3CCMA 2RJDA 4LXCA 4CRIA 3FB9A 2DBKA 1Y0MA 1VQ6Q 4KBMB 4JRKA 2X4WA 2QK0A 1QVFA 2G3RA 4HCBA 3CCVT 4OF1A 2LZ6B 3OYBA 1VQ7A 2EYYA 3V8KA 4OB3B 3JCMW 1HD3A 4C92D 1KC8U 1ZX6A 3RERA 1WPYA 2QEXQ 1UGRB 1AZEA 3RUXA 1E6HA 4C0DB 4NL3A 2BZ8A 1Z9QA 5KYUB 3A8MB 4M75C 3OYAA 2OI3A 1D0XA 3QYGB 4LDVA 1H3HA 1I81A 4M7DB 5IH2A 1M1KR 3OYLA 1LJOA 2RI2A 1VQ5T 1M3AA 4HVUA 1BIBA 5KCOA 1GCPA 2V26A 2L3RA 5FU7B 4ZGEB 3OYFA 1RAAB 2DTOA 4FU6A 1MMAA 4KGZB 4KUDK 4PK4A 2F2XA 2CREA 2VV5A 2KRMA 2X3WD 2HNIA 3P8HA 3EAEA 4JLIA 3CCEA 1YP5A 1ZA2B 1D09B 1FXXA 2LVMA 2RI5A 1NM7A 1YI2Q 4F7UA 4M78E 1NG2A 1NYGA 2GF7A 1VQ4A 1M1KC 1ZUKA 3L2VA 5KYWA 4FSSA 2D8HA 5GMKm 3TCJA 3MCAB 1UJYA 3NGPA 1XNIA 3OYCA 4M77F 2J06A 2EQMA 1ZQ1A 1YIJT 3JCMV 4E47A 2EJFA 3OYHA 2PUKB 2QDLA 2YWWA 2H3JA 2J7IA 5FU6B 3QZ9B 3CCJT 3SWNB 5GAOn 2XK0A 3HHTB 3PT9A 1T0HA 1EX4A 4O6JA 3D7SB 1Q7YU 2RNAA 2DAQA 1BI2A 1RI0A 5GMKj 2E41A 1FMKA 1T3SA 3CC4T 4BE0A 4Y91A 1WHMA 2J6KA 1W2BA 2MI6A 1W4SA 2DNUA 3S3OA 2BZXA 5GANe 1VQPQ 2EGEA 1I4K1 1K0SA 3GIBA 1FX7A 1K4US 2PQWA 3M55A 2KYMA 4J9BA 3G4ST 1TOVA 1S72T 2QQ9A 4BI3A 1U8RA 3V8JA 1X2QA 1G8XA 2KXDA 1KQSP 4N4IA 1K8AU 4XTWA 2OAUA 2DZCA 1Q81C 4GY5A 2Y4XA 3TSWA 4DEXA 2EGCA 5M9OA 2ZAEA 2NUTA 3CC7A 2P4RA 1PM3A 5GAOm 4OMOA 3HRUA 3CCMQ 3M0UA 1QKXA 3VS3A 1X6GA 2EQUA 2AZSA 2QYZA 1VYUA 1VQMT 1G3TA 3FC3A 4MMLA 4PJNA 4C0GA 5GANd 2QGGA 1TUDA 3I9QA 2X9HA 2CP0A 3QBYA 2FG0A 2YLBA 3KUFA 3MPUB 4A4KA 1D0ZA 5AT1B 3GOXA 2M16A 1VQ7Q 2R57A 1R77A 4A63B 2RI3A 3META 2EWNA 1XJWB 5HCKA 1QVPA 5FRMA 5KH6A 4ELZC 1AWXA 3C94A 5L23A 5GMKl 4DA4A 2O4XB 5CQXA 4M75B 5GMKh 5CAIA 2RQWA 4C8QE 2DYBA 1GFCA 2DIQA 5CKEA 2OJ2A 2DEQA 4J8OA 3OYIA 2XD0A 3RKYA 2KT8A 4OP0A 1QWEA 1SHFA 1KHIA 1Z9ZA 3VJPA 2KRSA 1M1KU 2RF0A 1RLPC 2G6FX 5GAMd 3J80E 3L2RA 4QQ6A 3OYYA 1K0XA 3OYDA 3C12A 2LX9A 3MEAA 4GLKA 3CCEQ 2CZ7B 2EGAA 4XK8E 3X28B 1VQOT 1VQLA 4B9WA 4C92A 1VQNT 3HP9A 3E1SA 4PLLA 2H3EB 4M78F 1VQ4Q 1VQKT 4F7UB 4M7AE 2AKKA 2CYZB 2YRDA 5KYWB 1OOTA 1W70A 2YDLA 2BE9B 2RJEA 5C0MA 1K9MU 3MKDA 4BE2A 3JCMP 1UFFA 1PSFA 2EJ9A 4AFUC 2J6FA 2LX7A 3I55Q 3OMCA 4F17A 1WLPB 4JS4A 3VS1A 3CCQQ 1I5OB 2DVEA 3NFCA 4RTUA 3R6OA 3M0SA 4IUQA 1AWWA 2KQWA 1ABOA 2O31A 3EGUA 4KH0B 4M77G 3CCLA 2OX7A 3C95A 1BKBA 4M7DE 3M4GA 2O9SA 2P0KA 5GAOl 1ZSZC 2SRCA 2EBPA 3OS0A 1YITQ 1Q81U 2DETA 3HFNA 5I21A 2L3SA 1UECA 1RAEB 3A98A 2FZCB 2MPXC 5GAN5 3GPLA 1G83A 2JNGA 2ED0A 1M4ZA 1ARKA 2X4JA 3JCMe 2HMAA 2CDTA 3FEOA 1D1CA 1XOVA 2FZGB 3TSZA 1ZLMA 2RHUA 3OSSC 1UEBA 1YHQT 1K1ZA 2LT4A 2ZPIB 4C0ZA 3RNJA 4LN2A 5IXFA 3L1AA 4ANJA 2QQAA 1N8RR 2GNCA 2LDMA 1IZ6A 2GFAA 3HRSA 1WJQA 1GBQA 2DK3A 1SSFA 3EFOB 3I56T 4OMQA 1H92A 1YFNA 4K11A 2FYKA 3CXCP 4EMKA 4VUBA 1WQ7A 3G7ZA 3FDRA 1H641 3JCMd 3JCMg 4OB2B 3ZEHA 1N8RC 1UDLA 1F1BB 1WDXA 2HKQB 2DBMA 1QLYA 4OGCA 2KXCA 1AHJB 5LJ3f 2O9VA 1TUGB 2L2PA 1VQLQ 2V8KA 2CUBA 1UGPB 4RKUE 4ZNXA 2A28A 1LVKA 2OTLT 2ESWA 1Q95G 4HCCA 4M7AF 4Z88A 5GMKe 3JB9J 2AZVA 1KSWA 2PZ1A 2PVDB 2RM4A 1IRXA 1D3BB 2DE0X 1UGVA 2M0OA 3CXCS 4PJMA 4FSXA 4JDSA 3CMEA 4DEYA 4GLMA 1V1CA 2X4XA 2COZA 2EQIA 3GBQA 1WHGA 3G6EA 2OTJA 3BDLA 1IGQA 1SRMA 1UJ0A 1VIFA 2P4TA 4M78G 4UC4A 4R55A 1QCOA 1VQ9Q 2AIRB 1X75C 2JTEA 3NTIA 1NLPC 4E7JA 3CEYA 3MO8A 1NJIR 4M77D 3OYMA 2LQNA 4JRQA 4JJBA 4M75E 5GAMj 1IHWA 2GTJA 3OYEA 1ZSZB 3CC2T 2HEQA 2W10A 4EPCA 2C0TA 1YI2A 5HY6A 4PFZA 5FLXE 1RI9A 3OBWA 1NEGA 1S1NA 1W1FA 2CH4W 2JXBA 4BDZA 1C0MA 4AG2C 4F7UE 2VUBA 4BUGA 5GANh 2CP3A 4OB1B 2HBPA 1K73R 1KFZA 3BW1A 1I07A 4IUTA 3PMTA 3SHWA 4JRPA 4RTTA 4E7IA 1Q86R 3GNFB 3QO3A 2IPOB 8AT1B 1E6GA 1WHLA 2PU9B 3BFMA 5EG2A 2EYQA 4PJOC 2QA4A 1PWTA 2XMFA 2CKKA 2Z0WA 4F04B 4XTYA 4P5NA 1RAHB 4JUVA 4C0FA 5KYXB 1K73C 5A0DA 2P0QA 3CCLT 2KR3A 2JN0A 3CMAA 3CXCA 1VQPA 1RAIB 2W0ZA 1U3OA 2JTFA 1PKTA 1TTHB 1YBYA 5LJ5d 1N8RU 1I0CA 2B86A 3CCUT 3A8GB 2DKGA 3SFMA 3MP8A 3VYGA 2KNBB 3OMGA 3CCRA 2EYZA 1QQJA 2K3YA 2VB6A 1U06A 4IIMA 2D0QB 5CQYA 2YUNA 2ECZA 2FL7A 3I35A 2X4YA 3CPWS 3RR6A 1QKWA 4HCZA 5CKHA 2MF2A 2LMJA 3H41A 2RMOA 2QQRA 1JU5C 3JV3A 3JB9H 3VS6A 3JCMQ 1U1TA 1M2VB 2LJ1A 3OS1A 3EH2A 2QI2A 3MP6A 2COYA 1W2BS 1WXTA 2DTHA 3J81E 2K4YA 2B8AA 1C1AA 2GFUA 4MZMA 3CMEQ 2Y90A 1QVGS 4XTZA 1HK9A 2RHZA 3G6EQ 2CGHA 4OMLA 1VUBA 4M78D 2OTJQ 3NPFA 3L2ZA 5GMKi 2J6OA 3GP8A 4XAXB 1M8MA 5J3BA 3QDRB 3CCSA 4BD3A 1JBMA 1BYMA 2L3QA 3LX7A 5CVIA 1PHTA 1EZZB 5EC7A 4HXJA 2WACA 1W6XA 1SEMA 3EFSA 4X9DA 3VU3C 3L2UA 2A37A 5LJ3j 1JJ2P 1FMVA 1LNXA 2HAXA 3FIFA 3E2UA 1JQQA 4JJDA 2RHYA 1YJWT 2YT6A 5KCHA 4DBRA 5D6XA 3A8HB 3EFRA 1VQ8T 4J6YA 1MMGA 4R0KA 5DLOA 1Y57A 2DMOA 3X25B 1YCYA 3I5RA 3OQ5A 4L6V5 3FJPA 1FYNA 2DD5A 3A5ZB 3VRZA 2JM8A 1VQ6T 4JJNK 3WVEB 1P92A 4KH1B 5D7UA 2MOXA 2GQVA 2CSQA 4M77A 1ZHIA 2HQEA 2E3HA 1NYFA 4ATOA 1OEBA 3I55A 3E19A 4FYXB 1T0JA 1K9AA 2DPPB 4ESRA 3CCQA 3CPWA 1SSHA 5KYYB 3TU4K 1SHGA 4A54A 5FROA 1JJ2S 2QEXT 4PJOB 2A36A 2QA4Q 2VASA 1MHNA 3TVTA 2VKNA 2ZPFB 5GAN8 4OB0B 1KJWA 1HSQA 4FYVB 3MHXA 5A2QE 2HQXA 2YUQA 2ZPHB 3H8ZA 3JCMh 2YRVA 2YUOA 3JRZA 4CC2A 3CMAQ 2RO0A 4QVZA 1YITA 2XDPA 1QVGA 4A4GA 2KE9A 4X1VA 3G71A 2LRQA 2DM1A 4PNOA 2VYTA 2NLUA 3CBOA 2AK5A 2SEMA 1RLQC 4QVCA 3CCRQ 5I22A 4JLGA 3M9QA 4A4FA 1PD1A 3L42A 5I2SA 3RIRA 4JJCA 2YXYA 1V29B 3PTAA 1RAFB 3VV0A 3EG9A 2NUPA 3FLGA 2KT1A 3AHUA 4Z02A 2RHXA 1MNDA 3RKXA 2XG8D 4QQGA 3RMQA 2KI7A 2FPDA 2K7AA 1PD0A 2KY9A 3JB9F 2WSCE 4C8QD 1BI1A 2V1RA 2FHDA 1SF9A 2FEIA 5CKDA 5GAMe 1OI1A 1RAGB 2YUPA 1OPLA 5GANg 1PKSA 2I2LA 2HZYA 2E5QA 1SRLA 3DLLA 2DILA 5AYFA 1VQKQ 1KIKA 1YJ9A 5IXBA 4OMFB 3I5SA 3OYKA 2YRCA 1KQSS 3IQLA 5IAYA 1K76A 3VS2A 5LJ5j 8ATCB 3F70A 5GANf 4BI4A 4JPBW 4JRIA 5CO7A 1MMDA 4M7AD 4JS5A 1KQ1A 2EAYA 3CCSQ 2M02A 2K5IA 2J05A 2RHIA 4BE1A 1JJ2A 1G3WA 4RMOA 2CT3A 2QGFB 3ER0A 3DKMA 3S6WA 4XU0A 3M59A 1NPRA 5CKBA 4ZN3A 1WHKA 2ZZDA 3PIPA 1YN8A 4PL6A 1Q82R 5J26A 4BDYA 2X35A 4KT0E 5GAMg 4LNPA 4F14A 1M30A 4L5GA 1BU1A 3CBPA 2K2VA 2XIDA 1GL5A 3TQ7P 1RUWA 4KGXB 2GTOA 4C92C 4AT1B 4RTWA 4E7ZA 4V2SA 4M78A 3OA6A 3EHRA 3CCMT 1SPKA 1B34A 4ZGDB 2OAWA 4M7DD 5D6WA 1RABB 1IXDA 1Q82C 3LWIA 4AG1C 2DRKA 3QHSA 2BUDA 1VQ7T 1TU0B 3BY7A 4MDXA 4RCCA 1VIEA 1VQ9A 1GXIE 2F69A 2M1HA 2KROA 2F5TX 3RBBB 1HYOA 1EIFA 1NZ9A 1NLOC 4N4GA 1JRIA 2CP2A 5I2MA 2EKHA 4LDUA 3FRNA 2EIFA 3M57A 3H0HA 4PJJA 1WJSA 1OU8A 2LQ8A 4X34A 2LT1A 2DL7A 1JB0E 2COWA 3QJYA 1U5SA 2KBTA 4RCBA 1KQSA 2QXFA 4NL2A 3G71Q 3UT1A 2KSSA 1OX8A 3CCET 2K9GA 3C4SA 3HTRA 1BBZA 3CD6A 2DRMA 1AEYA 2GGRA 1VQ4T 3QKJA 3H9NA 4FM4B 2L0AA 1WGSA 3CBMA 4J83A 1GBRA 2IG0A 3PNWC 1PG5B 2LTOA 1XQHA 1O9SA 2NUTB 2A0FB 4Q5WA 3M0QA 1G3YA 3M58A 3REAB 4II1A 4MZPA 3I55T 1AWOA 1NEBA 1IHVA 4JZ3A 3A1PA 1M1FA 1WX6A 2EPDA 2E1HA 2L8DA 3CCQT 3QUIA 3OYJA 1WFWA 1UB4A 2CS7A 3QSUA 1KHCA 4RTYA 2MYSA 2KDSA 3SEMA 4PJOE 3V7CA 1YJ9Q 2K79A 3X20B 1PC0A 3RMSA 3C0CA 2X3XD 2Y4YA 2KGTA 2E6ZA 3CCVA 2RD1A 4Y92A 3JB9G 4RG8A 2RJFA 2LC4A 4XTVA 2JS0A 2K5LA 1WQWA 2EKOA 4IUPA 3A8LB 3X26B 4CC4B 1X43A 1YITT 2VWFA 3PVQA 4EMKC 2HBWA 2BTTA 4C8QF 4E2FB 2RK1A 2YLCA 4C8QA 2LQWA 3BE3A 1O75A 3JAME 1MNEA 2QQBA 3S3NA 1MV0B 3DB3A 4M4ZA 4N0AA 3VS0A 4OGEA 2VGNA 4LDXA 5CKFA 2D8JA 2HKNA 3BDUA 4N4HA 4KRTA 1NBEB 3M0RA 4N0AC 1VQ5A 1UHFA 5LJ3d 5GAOp 2LQKA 4EMGA 4IUUA 3JCMf 3QPHA 3INZA 1UGSB 3CC7T 1VYVA 2EQJA 2AKLA 3FJ5A 1Q82U 2K2MA 4A4HA 4C92B 1Y07A 1M2OA 4C5EA 2QASA 2K5FA 3EGDA 4LD9K 4M75D 4M7AA 1UGQB 1R0CB 1CKAA 3UA6A 2DL8A 2DL5A 3M0TA 1M3BA 4FW2A 2VC8A 3M0PA 1YJNQ 2V8IA 4ZTJA 1JO8A 1IO6A 1UG1A 1KC8R 2JZ2A 2ZGWA 2D9TA 3N5BB 3SD4A 4NS5A 2K6DA 4J9DA 4YTLA 2X51A 1ABQA 1WJRA 2P0PA 3CCJA 3O8VA 2MMPA 2FVUA 1AWJA 4GBQA 2XDBA 4M7DF 5L8RE 4M7DA 2CZ1B 1KC8C 2ED1A 3PVLA 1B3QA 3CC4A 3ZFJA 2JTMA 3OS2A 3KFVA 3NTHA 3QXEB 1BI0A 2XKOC 1NJIC 1PNJA 1VQLT 3CD6Q 2DYIA 2EVRA 1TSFA 3EG2A 2C0IA 1UHCA 1X69A 4XTUA 3MP1A 3HKSA 2LP5A 3QJ6A 3OY9A 2DO3A 3G4SA 3E9GA 3CCUQ 1S72A 2K57A 3R6NA 5LJ5e 2CSIA 4LE9A 1WHHA 3L2WA 3UF4A 3OS5A 1KG1A 1GRIA 5ECAA 1CKBA 2LJ0A 5DLQE 5GJVB 1OZ3A 3VUBA 3H0IA 2KVQG 4Z8AA 4ZTFA 2CP5A 2GQIA 3OYGA 2RQTA 3LW5E 1WA7A 1OU9A 2RQRA 3SWNA 1VQMA 5KYNA 1X27A 1KD1R 2L89A 4PJOF 1G3SA 4DOVA 1PSEA 1YWPA 4J9IA 5DM7R 1VYTA 3CCVQ 3JB9D 5GAN2 1Q86C 4DBFA 2EYWA 3ULRB 2DA9A 4A53A 2KK4A 1ZA1B 3MEUA 2RA2A 5LJ5g 5GAMh 1OPKA 4X9CA 4OMNA 4FCYA 3QWXX 4Z89A 4HVWA 4EMKB 1GCQA 3MEVA 2ABLA 1KD1C 2E12A 4HCKA 4IUVA 5GAN7 1K8AR 4XQ3A 1M1GA 2EFIA 4BY6C 3J7AF 3OSVA 2O01E 3T9NA 1VQ5Q 5GJWB 2NWMA 3JCMX 1R8OB 2PVGB 1N5ZA 1ZUUA 4C8QG 1YCSB 2VXEA 1OX9A 1IB8A 2KYBA 4J6WA 3PE0A 1VQOA 3SDZA 1VQNA 3EGDB 3ZBDA 1A0NB 1VQKA 2LCCA 3AT1B 2FPFA 1TH7A 1AD5A 4J7IA 4MDWA 1MMNA 2LJ3A 2CT4A 1X2KA 1WIEA 2D1XA 2PUOB 3NTKA 1YIJQ 4M7AG 2DLPA 4RTZA 2RQUA 2DD4A 1KK7A 2PNIA 2FB7A 3CCJQ 4KUIA 4M75F 3JSCA 2O4XA 1NJIU 2MWPA 4M75A 4LDYA 1D1AA 4QQDA 1BI3A 3M5AA 2RN8A 2IVWA 2ZPGB 3CC4Q 2JMAA 2BE7D 3KXTA 2O88A 1GFDA 1X6OA 1PRLC 3UATA 2WSFE 3VS7A 1QCNA 4DBHA 1WZOA 4LD6A 2QTVA 1TG0A 1T3LA 3CQTA 2CUDA 4C92E 2DXCA 4M7DG 3G4SQ 4IKFA 1S72Q 4F7UF 2LCSA 1H3ZA 3P8DA 1M9SA 1ZSGA 1QCFA 2F5KA 1N9SA 4HKEA 3A8OB 5KE3A 4M77C 1K9MR 3CMET 2AHJB 3EG0A 2AT1B 9ATCB 4D8KA 2VXFA 1WI7A 3JCMJ 1K73U 2D0NA 2KMTA 3G6ET 2OTJT 1UUEA 3Q1JA 1Q86U 1UE9A 4FIBA 2RPNA 2JVVA 1VQMQ 4J6XA 2EQKA 1WYXA 2DJZA 1K9MC 4J9HA 4LUEA 2JJ9A 4LDWA 1WHJA 4ELYC 3ME9A 2CZ6B 5CIUA 4E7HA 1YHQA 1KD1U 3PIOA 1G5VA 2BZYA 1B07A 1M5Q1 2HCKA 1MV3A 2MWOA 5C6SA 1YI2T 1Q81R 5LJ3h 4L59A 4WF2A 1NPPA 1M8VA 3KBGA 1V76A 3I56A 5HK3A 4J9FA 3H0FA 4PJOG 1TWBA 5KE2A 2DIGA 2E10A 1YNZA 2HL3A 2JW4A 2MIOA 3VUZA 4XU1A 4BY6B 4MMKA 3LYIA 3HPWA 4A4EA 4CC7A 2FO0A 4C5IA 2BKDN 1N27A 2F2VA 2ZPEB 2E3IA 2EW3A 3LGLA 1VQOQ 1VQNQ 1EFNA 3L2QA 4EMHA 3X24B 2QA4T 2ROLA 2EYXA 1TS9A 2OTLA 5HKCA 1N6AA 1BK2A 1LOJA
chains in the Genus database with same CATH topology
2C0TA 3M0QA 2BZ8A 1Z9QA 3REAB 2OI3A 5IHKA 1H3HA 1AWOA 1NEBA 4JZ3A 5I11A 5IH2A 1RI9A 1WX6A 2EPDA 1NEGA 1S1NA 1W1FA 2CH4W 2JXBA 1M3AA 2JM9A 4HVUA 1GCPA 1WFWA 1G2BA 4AG2C 1OV3A 4RTYA 2F2XA 2CREA 2V1QA 2KRMA 2X3WD 3SEMA 5IHNA 2DJQA 1CSKA 2K79A 3C0CA 2X3XD 1YP5A 2KGTA 1KFZA 1NM7A 1I07A 3EG3A 4Y92A 2ENMA 1NG2A 1NYGA 3SHWA 1M3CA 1YWOA 4RTTA 2JS0A 1ZUKA 4D8DA 1E6GA 4FSSA 2D8HA 3VRYA 4CC4B 1X43A 2VWFA 3PVQA 1PWTA 2HBWA 2BTTA 2M0YA 1UJYA 2XMFA 3NGPA 2LQWA 2J06A 1MV0B 2FRYA 4M4ZA 3VS0A 1LCKA 2D8JA 2KR3A 2QDLA 4KRTA 3M0RA 2W0ZA 1UHFA 1U3OA 2J7IA 1PKTA 4ORZA 5FWCA 1I0CA 1T0HA 2F2WA 1VYVA 2B86A 2AKLA 1E7OA 2HSPA 3FJ5A 2RNAA 2K2MA 2KNBB 3NHNA 2EYZA 3REBB 1QWFA 1FMKA 1T3SA 1U06A 4IIMA 1CKAA 2YUNA 2ECZA 2J6KA 3UA6A 3I35A 2DL8A 2DL5A 2DNUA 2BZXA 3M0TA 1M3BA 2EGEA 3M0PA 1QKWA 1K0SA 2IIMA 1K4US 2LMJA 3H41A 2RMOA 2KYMA 4J9BA 2FRWA 1JO8A 3LH5A 2CH4A 1IO6A 1JU5C 3JV3A 2JT4A 1X2QA 2KXDA 1UG1A 2PTKA 3VS6A 4QT7A 2K6DA 4J9DA 2LJ1A 3TSWA 1ABQA 1WXTA 4DEXA 2HDAA 2EGCA 1M27C 3O5ZA 2P4RA 1AWJA 4GBQA 1BB9A 4OMOA 4OMLA 3M0UA 3NPFA 1UTIA 2J6OA 1QKXA 2ED1A 1X6GA 3PVLA 1B3QA 3VS3A 2AZSA 1VYUA 3KFVA 1JXOA 1M8MA 4WCIA 1TUDA 2L3QA 3I9QA 1PHTA 1PNJA 2FG0A 5EC7A 2EVRA 4HXJA 1W6XA 3EG2A 2C0IA 1SEMA 1UHCA 1X69A 3EG1A 2LP5A 4CC3A 2KRNA 2E5KA 2A37A 3R6NA 4A63B 1PRMC 2CSIA 4LE9A 1JQQA 5HCKA 4JJDA 3ZL7C 2YT6A 3UF4A 1AWXA 5L23A 1AZGB 1GRIA 1VA7A 5ECAA 1CKBA 2DL4A 2RQWA 2DVJA 2LJ0A 4R0KA 5GJVB 1Y57A 1GFCA 2DYBA 2DMOA 2OJ2A 3H0IA 4Z8AA 3I5RA 1ZUYA 2KT8A 1FYNA 1QWEA 1SHFA 3VRZA 2JM8A 1Z9ZA 2GQIA 2KRSA 1AVZC 4AFZC 2MOXA 2RF0A 2RQTA 1WA7A 1RLPC 2RQRA 2G6FX 4IIOA 5FWBA 1X27A 2CSQA 1K0XA 1NYFA 1OEBA 2EGAA 1YWPA 4J9IA 1T0JA 1VYTA 1K9AA 4ESRA 2NUZA 2EYWA 3EHQA 3ULRB 1SSHA 2DA9A 1SHGA 2AKKA 2GBQA 1OPKA 2A36A 2M51A 1OOTA 4OMNA 1W70A 3QWXX 2YDLA 4Z89A 4HVWA 1GCQA 3TVTA 2VKNA 2ABLA 1TUCA 4J9EA 4OMMA 1JEGA 1UFFA 1KJWA 1ZBJA 1AOJA 1HSQA 4AFUC 2FPEA 2J6FA 4HCKA 2LX7A 2DF6A 2YUQA 2KEAA 4EIKA 2YUOA 1WLPB 4CC2A 4F17A 3VS1A 5GJWB 2NWMA 2KE9A 4X1VA 1N5ZA 4RTUA 1ZUUA 2I0NA 2DM1A 3M0SA 1AWWA 1YCSB 1ABOA 2O31A 4OMPA 3EGUA 2KYBA 2AK5A 2JMCA 2SEMA 4F16A 1RLQC 2C0OA 3PE0A 5I22A 2JS2A 1A0NB 2O9SA 4JJCA 4AFQC 2DL3A 1X6BA 2FPFA 2SRCA 2EBPA 1AD5A 2KT1A 2LJ3A 2CT4A 1X2KA 2L3SA 2ROTA 1WIEA 1UECA 2FPDA 2D1XA 2K7AA 3A98A 2V1RA 2DLPA 3QWYA 2FEIA 2RQUA 4RTZA 2YUPA 1OPLA 2O2OA 1G83A 1PKSA 1WXBA 1SRLA 2ED0A 2PNIA 1I1JA 2DILA 1KIKA 5IXBA 1ARKA 3I5SA 4RTXA 4HVVA 3IQLA 1K76A 3VS2A 5FW9A 4JPBW 2RN8A 2CDTA 1XOVA 2JMAA 2O88A 2L3PA 1GFDA 1PRLC 3TSZA 3UATA 2MCNA 1ZLMA 3VS7A 3THKA 1WXUA 2J05A 3NMZC 2VVKA 1K1ZA 2H8HA 1TG0A 3RNJA 2CT3A 4AFSC 1T3LA 2DX1A 3CQTA 2CUDA 4LN2A 1HJDA 5IXFA 2GNCA 4E6RA 2LCSA 1YN8A 1ZSGA 1GBQA 4LNPA 4F14A 1M30A 1QCFA 1J3TA 4OMQA 1H8KA 1BU1A 1H92A 4K11A 1GL5A 2YSQA 1RUWA 3EG0A 2GTOA 4D8KA 1WI7A 4RTWA 2D0NA 3EHRA 1SPKA 4J9CA 5IHIA 1UUEA 4J9GA 2OAWA 1UE9A 1UDLA 1WDXA 2DBMA 2RPNA 1GCQC 1QLYA 4AG1C 2KXCA 1WYXA 2DRKA 2O9VA 4J9HA 4LUEA 2A08A 2L2PA 2CUBA 3VS5A 2KROA 4ZNXA 2BZYA 3RBBB 3U23A 2LNHB 2A28A 1JXMA 2ESWA 4RUGA 1NLOC 1B07A 4Z88A 2HCKA 2RQVA 1MV3A 2AZVA 1KSWA 2PZ1A 1MUZA 4RTVA 2EKHA 2DE0X 1UGVA 4LUDA 4J9FA 3VS4A 3H0FA 3H0HA 3UA7A 4DEYA 4GLMA 1V1CA 1YNZA 4JZ4A 2JW4A 2DL7A 2MIOA 2EQIA 3GBQA 2K3BA 1SRMA 1UJ0A 1U5SA 2KBTA 2JTEA 2DBKA 1Y0MA 4CC7A 2FO0A 1NLPC 2K9GA 1BBZA 2DRMA 2LZ6B 2F2VA 2LQNA 1AEYA 4JJBA 2EW3A 2GGRA 2EYYA 2L0AA 1HD3A 2GTJA 1EFNA 1GBRA 1ZX6A 2ROLA 2EYXA 1BK2A 2HEQA 2W10A 1AZEA 1E6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0T A;  3M0Q A;  2BZ8 A;  1Z9Q A;  3REA B;  2OI3 A;  5IHK A;  1H3H A;  1AWO A;  1NEB A;  4JZ3 A;  5I11 A;  5IH2 A;  1RI9 A;  1WX6 A;  2EPD A;  1NEG A;  1S1N A;  1W1F A;  2CH4 W;  2JXB A;  1M3A A;  2JM9 A;  4HVU A;  1GCP A;  1WFW A;  1G2B A;  4AG2 C;  1OV3 A;  4RTY A;  2F2X A;  2CRE A;  2V1Q A;  2KRM A;  2X3W D;  3SEM A;  5IHN A;  2DJQ A;  1CSK A;  2K79 A;  3C0C A;  2X3X D;  1YP5 A;  2KGT A;  1KFZ A;  1NM7 A;  1I07 A;  3EG3 A;  4Y92 A;  2ENM A;  1NG2 A;  1NYG A;  3SHW A;  1M3C A;  1YWO A;  4RTT A;  2JS0 A;  1ZUK A;  4D8D A;  1E6G A;  4FSS A;  2D8H A;  3VRY A;  4CC4 B;  1X43 A;  2VWF A;  3PVQ A;  1PWT A;  2HBW A;  2BTT A;  2M0Y A;  1UJY A;  2XMF A;  3NGP A;  2LQW A;  2J06 A;  1MV0 B;  2FRY A;  4M4Z A;  3VS0 A;  1LCK A;  2D8J A;  2KR3 A;  2QDL A;  4KRT A;  3M0R A;  2W0Z A;  1UHF A;  1U3O A;  2J7I A;  1PKT A;  4ORZ A;  5FWC A;  1I0C A;  1T0H A;  2F2W A;  1VYV A;  2B86 A;  2AKL A;  1E7O A;  2HSP A;  3FJ5 A;  2RNA A;  2K2M A;  2KNB B;  3NHN A;  2EYZ A;  3REB B;  1QWF A;  1FMK A;  1T3S A;  1U06 A;  4IIM A;  1CKA A;  2YUN A;  2ECZ A;  2J6K A;  3UA6 A;  3I35 A;  2DL8 A;  2DL5 A;  2DNU A;  2BZX A;  3M0T A;  1M3B A;  2EGE A;  3M0P A;  1QKW A;  1K0S A;  2IIM A;  1K4U S;  2LMJ A;  3H41 A;  2RMO A;  2KYM A;  4J9B A;  2FRW A;  1JO8 A;  3LH5 A;  2CH4 A;  1IO6 A;  1JU5 C;  3JV3 A;  2JT4 A;  1X2Q A;  2KXD A;  1UG1 A;  2PTK A;  3VS6 A;  4QT7 A;  2K6D A;  4J9D A;  2LJ1 A;  3TSW A;  1ABQ A;  1WXT A;  4DEX A;  2HDA A;  2EGC A;  1M27 C;  3O5Z A;  2P4R A;  1AWJ A;  4GBQ A;  1BB9 A;  4OMO A;  4OML A;  3M0U A;  3NPF A;  1UTI A;  2J6O A;  1QKX A;  2ED1 A;  1X6G A;  3PVL A;  1B3Q A;  3VS3 A;  2AZS A;  1VYU A;  3KFV A;  1JXO A;  1M8M A;  4WCI A;  1TUD A;  2L3Q A;  3I9Q A;  1PHT A;  1PNJ A;  2FG0 A;  5EC7 A;  2EVR A;  4HXJ A;  1W6X A;  3EG2 A;  2C0I A;  1SEM A;  1UHC A;  1X69 A;  3EG1 A;  2LP5 A;  4CC3 A;  2KRN A;  2E5K A;  2A37 A;  3R6N A;  4A63 B;  1PRM C;  2CSI A;  4LE9 A;  1JQQ A;  5HCK A;  4JJD A;  3ZL7 C;  2YT6 A;  3UF4 A;  1AWX A;  5L23 A;  1AZG B;  1GRI A;  1VA7 A;  5ECA A;  1CKB A;  2DL4 A;  2RQW A;  2DVJ A;  2LJ0 A;  4R0K A;  5GJV B;  1Y57 A;  1GFC A;  2DYB A;  2DMO A;  2OJ2 A;  3H0I A;  4Z8A A;  3I5R A;  1ZUY A;  2KT8 A;  1FYN A;  1QWE A;  1SHF A;  3VRZ A;  2JM8 A;  1Z9Z A;  2GQI A;  2KRS A;  1AVZ C;  4AFZ C;  2MOX A;  2RF0 A;  2RQT A;  1WA7 A;  1RLP C;  2RQR A;  2G6F X;  4IIO A;  5FWB A;  1X27 A;  2CSQ A;  1K0X A;  1NYF A;  1OEB A;  2EGA A;  1YWP A;  4J9I A;  1T0J A;  1VYT A;  1K9A A;  4ESR A;  2NUZ A;  2EYW A;  3EHQ A;  3ULR B;  1SSH A;  2DA9 A;  1SHG A;  2AKK A;  2GBQ A;  1OPK A;  2A36 A;  2M51 A;  1OOT A;  4OMN A;  1W70 A;  3QWX X;  2YDL A;  4Z89 A;  4HVW A;  1GCQ A;  3TVT A;  2VKN A;  2ABL A;  1TUC A;  4J9E A;  4OMM A;  1JEG A;  1UFF A;  1KJW A;  1ZBJ A;  1AOJ A;  1HSQ A;  4AFU C;  2FPE A;  2J6F A;  4HCK A;  2LX7 A;  2DF6 A;  2YUQ A;  2KEA A;  4EIK A;  2YUO A;  1WLP B;  4CC2 A;  4F17 A;  3VS1 A;  5GJW B;  2NWM A;  2KE9 A;  4X1V A;  1N5Z A;  4RTU A;  1ZUU A;  2I0N A;  2DM1 A;  3M0S A;  1AWW A;  1YCS B;  1ABO A;  2O31 A;  4OMP A;  3EGU A;  2KYB A;  2AK5 A;  2JMC A;  2SEM A;  4F16 A;  1RLQ C;  2C0O A;  3PE0 A;  5I22 A;  2JS2 A;  1A0N B;  2O9S A;  4JJC A;  4AFQ C;  2DL3 A;  1X6B A;  2FPF A;  2SRC A;  2EBP A;  1AD5 A;  2KT1 A;  2LJ3 A;  2CT4 A;  1X2K A;  2L3S A;  2ROT A;  1WIE A;  1UEC A;  2FPD A;  2D1X A;  2K7A A;  3A98 A;  2V1R A;  2DLP A;  3QWY A;  2FEI A;  2RQU A;  4RTZ A;  2YUP A;  1OPL A;  2O2O A;  1G83 A;  1PKS A;  1WXB A;  1SRL A;  2ED0 A;  2PNI A;  1I1J A;  2DIL A;  1KIK A;  5IXB A;  1ARK A;  3I5S A;  4RTX A;  4HVV A;  3IQL A;  1K76 A;  3VS2 A;  5FW9 A;  4JPB W;  2RN8 A;  2CDT A;  1XOV A;  2JMA A;  2O88 A;  2L3P A;  1GFD A;  1PRL C;  3TSZ A;  3UAT A;  2MCN A;  1ZLM A;  3VS7 A;  3THK A;  1WXU A;  2J05 A;  3NMZ C;  2VVK A;  1K1Z A;  2H8H A;  1TG0 A;  3RNJ A;  2CT3 A;  4AFS C;  1T3L A;  2DX1 A;  3CQT A;  2CUD A;  4LN2 A;  1HJD A;  5IXF A;  2GNC A;  4E6R A;  2LCS A;  1YN8 A;  1ZSG A;  1GBQ A;  4LNP A;  4F14 A;  1M30 A;  1QCF A;  1J3T A;  4OMQ A;  1H8K A;  1BU1 A;  1H92 A;  4K11 A;  1GL5 A;  2YSQ A;  1RUW A;  3EG0 A;  2GTO A;  4D8K A;  1WI7 A;  4RTW A;  2D0N A;  3EHR A;  1SPK A;  4J9C A;  5IHI A;  1UUE A;  4J9G A;  2OAW A;  1UE9 A;  1UDL A;  1WDX A;  2DBM A;  2RPN A;  1GCQ C;  1QLY A;  4AG1 C;  2KXC A;  1WYX A;  2DRK A;  2O9V A;  4J9H A;  4LUE A;  2A08 A;  2L2P A;  2CUB A;  3VS5 A;  2KRO A;  4ZNX A;  2BZY A;  3RBB B;  3U23 A;  2LNH B;  2A28 A;  1JXM A;  2ESW A;  4RUG A;  1NLO C;  1B07 A;  4Z88 A;  2HCK A;  2RQV A;  1MV3 A;  2AZV A;  1KSW A;  2PZ1 A;  1MUZ A;  4RTV A;  2EKH A;  2DE0 X;  1UGV A;  4LUD A;  4J9F A;  3VS4 A;  3H0F A;  3H0H A;  3UA7 A;  4DEY A;  4GLM A;  1V1C A;  1YNZ A;  4JZ4 A;  2JW4 A;  2DL7 A;  2MIO A;  2EQI A;  3GBQ A;  2K3B A;  1SRM A;  1UJ0 A;  1U5S A;  2KBT A;  2JTE A;  2DBK A;  1Y0M A;  4CC7 A;  2FO0 A;  1NLP C;  2K9G A;  1BBZ A;  2DRM A;  2LZ6 B;  2F2V A;  2LQN A;  1AEY A;  4JJB A;  2EW3 A;  2GGR A;  2EYY A;  2L0A A;  1HD3 A;  2GTJ A;  1EFN A;  1GBR A;  1ZX6 A;  2ROL A;  2EYX A;  1BK2 A;  2HEQ A;  2W10 A;  1AZE A;  1E6H A; 
#chains in the Genus database with same CATH topology
 1OQK A;  3RKW A;  5IHK A;  5I11 A;  3CMA T;  3PMI A;  1VQP T;  2RK2 A;  1R0B G;  2HSE B;  2JM9 A;  4FT2 A;  1G2B A;  3M56 A;  1LPL A;  4ZN1 A;  1OV3 A;  2V1Q A;  5CCA A;  2XI9 A;  2DJQ A;  5IHN A;  1CSK A;  3EFO A;  1X01 A;  3CPF A;  3CCR T;  2ZCF B;  4FT4 A;  3EG3 A;  2ENM A;  1FMW A;  4BAC A;  1M3C A;  1YWO A;  4E7K A;  5CR2 A;  4D8D A;  4XU2 A;  5A0G A;  3VRY A;  2D6F A;  4PLI A;  4FYY B;  5J39 A;  4QW2 A;  2R5M A;  1TXQ A;  3CC2 A;  2EJG A;  4J5Y A;  2M0Y A;  5GAM f;  4FYW B;  4M75 G;  2E65 A;  4M78 C;  4BB7 A;  1OZ2 A;  4PFO A;  1IGU A;  2PVO B;  2FRY A;  4DBQ A;  4C92 F;  1LCK A;  3MJX A;  4AMC A;  4KUL A;  4ORZ A;  1YJN A;  5FWC A;  4M77 B;  2F2W A;  1MGQ A;  2E4H A;  1E7O A;  2HSP A;  7AT1 B;  5GAO q;  3HSB A;  1D3B A;  2MAM A;  1QMC A;  2GCX A;  2JUF A;  3NHN A;  5DY9 A;  3REB B;  1HXD A;  2ZPB B;  1QWF A;  3HFO A;  4XU3 A;  4F7U G;  3CCS T;  5LJ5 h;  5GAN 4;  5CK9 A;  2XHC A;  4D6W A;  4C5G A;  2A3L A;  2IIM A;  1M90 R;  2QDY B;  3HRT A;  5GAO r;  2FRW A;  2QG9 B;  4XTX A;  3LH5 A;  2CH4 A;  4WTO B;  1YHQ Q;  2JT4 A;  2BIV A;  2PTK A;  4QT7 A;  2DER A;  3RES A;  1ZSZ A;  4QKU A;  2A7Y A;  3LH0 A;  2HL5 C;  2HDA A;  3TRE A;  1M27 C;  3O5Z A;  3I56 Q;  3OBY A;  4PJO D;  5HK0 A;  3CCU A;  1M90 C;  4PJL A;  1AT1 B;  1BB9 A;  1BIA A;  3M53 A;  4MZT A;  1OYX A;  1UTI A;  2HQH A;  3EG9 B;  2NUP B;  1ZBX A;  1JXO A;  4WCI A;  2DXB A;  3RDV A;  3QII A;  4HA8 A;  3QDF A;  5IT9 E;  3TEE A;  3EG1 A;  3ASK A;  2C06 A;  4CC3 A;  3CC7 Q;  2KRN A;  3EGX A;  2E5K A;  5LJ3 e;  3DB4 A;  1I8F A;  3DLM A;  2JOY A;  1PRM C;  4FL6 A;  2P84 A;  3VKI A;  2OTL Q;  1IRE B;  3ZL7 C;  1RAD B;  2DZ9 A;  1AZG B;  1VA7 A;  3HL8 A;  2DL4 A;  3V7R A;  4HT9 A;  2DVJ A;  1SG5 A;  5LL6 S;  4B6M A;  1SKU B;  1Y96 A;  3JCM b;  5KYX A;  4PFP A;  3JCM c;  4HT8 A;  1ZUY A;  2DTI A;  3V7S A;  3G71 T;  3OB9 A;  1AVZ C;  4AFZ C;  4RG2 A;  4IIO A;  5FWB A;  4C8Q C;  1QP2 A;  4B9X A;  2E70 A;  1BCO A;  4IUR A;  2CZ0 B;  4PKC C;  3WVD B;  4CI0 C;  3JB9 I;  2NUZ A;  3EHQ A;  4ME7 A;  5LJ3 g;  2WSE E;  2GBQ A;  4NOY A;  1BCM A;  4FW1 A;  2M51 A;  3S3M A;  1C6V X;  3CC2 Q;  2R5A A;  1PCX A;  3E9F A;  3WXM B;  3OW2 P;  1ACM B;  1TUC A;  3LLR A;  2RH2 A;  3PGG A;  4J9E A;  4OMM A;  1ZBJ A;  1YJW A;  1JEG A;  1AOJ A;  4M78 B;  2FPE A;  1B34 B;  1VQ8 A;  4Y28 E;  4M7A C;  2DF6 A;  2KEA A;  4EDU A;  4EIK A;  1N9R A;  2DXT A;  4KGV B;  5GAN j;  2QTX A;  1YJ9 T;  1RL2 A;  1VQ6 A;  1M2V A;  2I0N A;  2DFU A;  1YIJ A;  4OMP A;  2JMC A;  4F16 A;  6AT1 B;  2C0O A;  2XU8 A;  1QVF P;  2JS2 A;  1D1B A;  3QG1 A;  1QW1 A;  4C92 G;  3UWN A;  4AFQ C;  3EH1 A;  2DL3 A;  1X6B A;  2QEX A;  5GAN 3;  5KYU A;  3OW2 S;  4C0D C;  1VOM A;  2ROT A;  4DOW A;  2LCL A;  4M7D C;  3UDC A;  1M90 U;  3QWY A;  1Y71 A;  4R56 A;  3PFS A;  3CCL Q;  5D6Y A;  5GAN 6;  5FU7 C;  1Y7X A;  2E6N A;  2O2O A;  1U1S A;  3GF5 A;  1WXB A;  3GLX A;  1I1J A;  3QZ5 B;  4DQ2 A;  1WNL A;  1D0Y A;  3M4Y A;  4RTX A;  2KAF A;  4HVV A;  4TVR A;  4E7S A;  2V8J A;  1FWZ A;  4E7L A;  5FW9 A;  1QVF S;  2NYS A;  3UPU A;  1KQ2 A;  3P8B B;  4BI8 B;  2XIC A;  2L3P A;  3VYH B;  4J7F A;  3G1J A;  2MCN A;  3MEW A;  1YJN T;  3THK A;  1WXU A;  4M77 E;  3NMZ C;  2VVK A;  2M9U A;  1VQ9 T;  2RJC A;  1B7T A;  2H8H A;  4AFS C;  2DX1 A;  4ZGJ B;  1HJD A;  4E6R A;  2CP6 A;  1XTD A;  3EGX B;  1Q7Y R;  1DJ7 B;  5KYY A;  2CP7 A;  5FU6 C;  1J3T A;  4C5H A;  3SWN C;  2FZK B;  1H8K A;  4PJO A;  2K3X A;  3OYN A;  1NE8 A;  2YSQ A;  5IN1 A;  2E64 A;  3CPW P;  2DEU A;  3LWH A;  3QYH B;  2L5Q A;  2HD0 A;  4J9C A;  4QVD A;  5IHI A;  3URG A;  4J9G A;  1Y96 B;  2XDD A;  2DXU A;  1Q7Y C;  1OUL A;  3SB2 A;  1GCQ C;  4C8Q B;  3CD6 T;  2QQS A;  5LJ5 f;  2A08 A;  1W2B P;  3VS5 A;  3LGF A;  2RB6 A;  4OVA A;  1QVG P;  3U23 A;  3OW2 A;  2LNH B;  1JXM A;  3GNG A;  4RUG A;  2QAZ A;  2F1L A;  3M54 A;  2RQV A;  4RTV A;  1MUZ A;  1QP3 A;  1RAC B;  3H6Z A;  3V8L A;  2R58 A;  5A0L A;  1YJW Q;  4LUD A;  3VS4 A;  3UA7 A;  1K8A C;  2MK5 A;  4JZ4 A;  4O5V A;  4M7A B;  1I5L A;  1VQ8 Q;  2LNV A;  5FRN A;  2YHT A;  2VGM A;  2ATC B;  2K3B A;  3CCM A;  2RJD A;  4LXC A;  4CRI A;  3FB9 A;  2DBK A;  1Y0M A;  1VQ6 Q;  4KBM B;  4JRK A;  2X4W A;  2QK0 A;  1QVF A;  2G3R A;  4HCB A;  3CCV T;  4OF1 A;  2LZ6 B;  3OYB A;  1VQ7 A;  2EYY A;  3V8K A;  4OB3 B;  3JCM W;  1HD3 A;  4C92 D;  1KC8 U;  1ZX6 A;  3RER A;  1WPY A;  2QEX Q;  1UGR B;  1AZE A;  3RUX A;  1E6H A;  4C0D B;  4NL3 A;  2BZ8 A;  1Z9Q A;  5KYU B;  3A8M B;  4M75 C;  3OYA A;  2OI3 A;  1D0X A;  3QYG B;  4LDV A;  1H3H A;  1I81 A;  4M7D B;  5IH2 A;  1M1K R;  3OYL A;  1LJO A;  2RI2 A;  1VQ5 T;  1M3A A;  4HVU A;  1BIB A;  5KCO A;  1GCP A;  2V26 A;  2L3R A;  5FU7 B;  4ZGE B;  3OYF A;  1RAA B;  2DTO A;  4FU6 A;  1MMA A;  4KGZ B;  4KUD K;  4PK4 A;  2F2X A;  2CRE A;  2VV5 A;  2KRM A;  2X3W D;  2HNI A;  3P8H A;  3EAE A;  4JLI A;  3CCE A;  1YP5 A;  1ZA2 B;  1D09 B;  1FXX A;  2LVM A;  2RI5 A;  1NM7 A;  1YI2 Q;  4F7U A;  4M78 E;  1NG2 A;  1NYG A;  2GF7 A;  1VQ4 A;  1M1K C;  1ZUK A;  3L2V A;  5KYW A;  4FSS A;  2D8H A;  5GMK m;  3TCJ A;  3MCA B;  1UJY A;  3NGP A;  1XNI A;  3OYC A;  4M77 F;  2J06 A;  2EQM A;  1ZQ1 A;  1YIJ T;  3JCM V;  4E47 A;  2EJF A;  3OYH A;  2PUK B;  2QDL A;  2YWW A;  2H3J A;  2J7I A;  5FU6 B;  3QZ9 B;  3CCJ T;  3SWN B;  5GAO n;  2XK0 A;  3HHT B;  3PT9 A;  1T0H A;  1EX4 A;  4O6J A;  3D7S B;  1Q7Y U;  2RNA A;  2DAQ A;  1BI2 A;  1RI0 A;  5GMK j;  2E41 A;  1FMK A;  1T3S A;  3CC4 T;  4BE0 A;  4Y91 A;  1WHM A;  2J6K A;  1W2B A;  2MI6 A;  1W4S A;  2DNU A;  3S3O A;  2BZX A;  5GAN e;  1VQP Q;  2EGE A;  1I4K 1;  1K0S A;  3GIB A;  1FX7 A;  1K4U S;  2PQW A;  3M55 A;  2KYM A;  4J9B A;  3G4S T;  1TOV A;  1S72 T;  2QQ9 A;  4BI3 A;  1U8R A;  3V8J A;  1X2Q A;  1G8X A;  2KXD A;  1KQS P;  4N4I A;  1K8A U;  4XTW A;  2OAU A;  2DZC A;  1Q81 C;  4GY5 A;  2Y4X A;  3TSW A;  4DEX A;  2EGC A;  5M9O A;  2ZAE A;  2NUT A;  3CC7 A;  2P4R A;  1PM3 A;  5GAO m;  4OMO A;  3HRU A;  3CCM Q;  3M0U A;  1QKX A;  3VS3 A;  1X6G A;  2EQU A;  2AZS A;  2QYZ A;  1VYU A;  1VQM T;  1G3T A;  3FC3 A;  4MML A;  4PJN A;  4C0G A;  5GAN d;  2QGG A;  1TUD A;  3I9Q A;  2X9H A;  2CP0 A;  3QBY A;  2FG0 A;  2YLB A;  3KUF A;  3MPU B;  4A4K A;  1D0Z A;  5AT1 B;  3GOX A;  2M16 A;  1VQ7 Q;  2R57 A;  1R77 A;  4A63 B;  2RI3 A;  3MET A;  2EWN A;  1XJW B;  5HCK A;  1QVP A;  5FRM A;  5KH6 A;  4ELZ C;  1AWX A;  3C94 A;  5L23 A;  5GMK l;  4DA4 A;  2O4X B;  5CQX A;  4M75 B;  5GMK h;  5CAI A;  2RQW A;  4C8Q E;  2DYB A;  1GFC A;  2DIQ A;  5CKE A;  2OJ2 A;  2DEQ A;  4J8O A;  3OYI A;  2XD0 A;  3RKY A;  2KT8 A;  4OP0 A;  1QWE A;  1SHF A;  1KHI A;  1Z9Z A;  3VJP A;  2KRS A;  1M1K U;  2RF0 A;  1RLP C;  2G6F X;  5GAM d;  3J80 E;  3L2R A;  4QQ6 A;  3OYY A;  1K0X A;  3OYD A;  3C12 A;  2LX9 A;  3MEA A;  4GLK A;  3CCE Q;  2CZ7 B;  2EGA A;  4XK8 E;  3X28 B;  1VQO T;  1VQL A;  4B9W A;  4C92 A;  1VQN T;  3HP9 A;  3E1S A;  4PLL A;  2H3E B;  4M78 F;  1VQ4 Q;  1VQK T;  4F7U B;  4M7A E;  2AKK A;  2CYZ B;  2YRD A;  5KYW B;  1OOT A;  1W70 A;  2YDL A;  2BE9 B;  2RJE A;  5C0M A;  1K9M U;  3MKD A;  4BE2 A;  3JCM P;  1UFF A;  1PSF A;  2EJ9 A;  4AFU C;  2J6F A;  2LX7 A;  3I55 Q;  3OMC A;  4F17 A;  1WLP B;  4JS4 A;  3VS1 A;  3CCQ Q;  1I5O B;  2DVE A;  3NFC A;  4RTU A;  3R6O A;  3M0S A;  4IUQ A;  1AWW A;  2KQW A;  1ABO A;  2O31 A;  3EGU A;  4KH0 B;  4M77 G;  3CCL A;  2OX7 A;  3C95 A;  1BKB A;  4M7D E;  3M4G A;  2O9S A;  2P0K A;  5GAO l;  1ZSZ C;  2SRC A;  2EBP A;  3OS0 A;  1YIT Q;  1Q81 U;  2DET A;  3HFN A;  5I21 A;  2L3S A;  1UEC A;  1RAE B;  3A98 A;  2FZC B;  2MPX C;  5GAN 5;  3GPL A;  1G83 A;  2JNG A;  2ED0 A;  1M4Z A;  1ARK A;  2X4J A;  3JCM e;  2HMA A;  2CDT A;  3FEO A;  1D1C A;  1XOV A;  2FZG B;  3TSZ A;  1ZLM A;  2RHU A;  3OSS C;  1UEB A;  1YHQ T;  1K1Z A;  2LT4 A;  2ZPI B;  4C0Z A;  3RNJ A;  4LN2 A;  5IXF A;  3L1A A;  4ANJ A;  2QQA A;  1N8R R;  2GNC A;  2LDM A;  1IZ6 A;  2GFA A;  3HRS A;  1WJQ A;  1GBQ A;  2DK3 A;  1SSF A;  3EFO B;  3I56 T;  4OMQ A;  1H92 A;  1YFN A;  4K11 A;  2FYK A;  3CXC P;  4EMK A;  4VUB A;  1WQ7 A;  3G7Z A;  3FDR A;  1H64 1;  3JCM d;  3JCM g;  4OB2 B;  3ZEH A;  1N8R C;  1UDL A;  1F1B B;  1WDX A;  2HKQ B;  2DBM A;  1QLY A;  4OGC A;  2KXC A;  1AHJ B;  5LJ3 f;  2O9V A;  1TUG B;  2L2P A;  1VQL Q;  2V8K A;  2CUB A;  1UGP B;  4RKU E;  4ZNX A;  2A28 A;  1LVK A;  2OTL T;  2ESW A;  1Q95 G;  4HCC A;  4M7A F;  4Z88 A;  5GMK e;  3JB9 J;  2AZV A;  1KSW A;  2PZ1 A;  2PVD B;  2RM4 A;  1IRX A;  1D3B B;  2DE0 X;  1UGV A;  2M0O A;  3CXC S;  4PJM A;  4FSX A;  4JDS A;  3CME A;  4DEY A;  4GLM A;  1V1C A;  2X4X A;  2COZ A;  2EQI A;  3GBQ A;  1WHG A;  3G6E A;  2OTJ A;  3BDL A;  1IGQ A;  1SRM A;  1UJ0 A;  1VIF A;  2P4T A;  4M78 G;  4UC4 A;  4R55 A;  1QCO A;  1VQ9 Q;  2AIR B;  1X75 C;  2JTE A;  3NTI A;  1NLP C;  4E7J A;  3CEY A;  3MO8 A;  1NJI R;  4M77 D;  3OYM A;  2LQN A;  4JRQ A;  4JJB A;  4M75 E;  5GAM j;  1IHW A;  2GTJ A;  3OYE A;  1ZSZ B;  3CC2 T;  2HEQ A;  2W10 A;  4EPC A;  2C0T A;  1YI2 A;  5HY6 A;  4PFZ A;  5FLX E;  1RI9 A;  3OBW A;  1NEG A;  1S1N A;  1W1F A;  2CH4 W;  2JXB A;  4BDZ A;  1C0M A;  4AG2 C;  4F7U E;  2VUB A;  4BUG A;  5GAN h;  2CP3 A;  4OB1 B;  2HBP A;  1K73 R;  1KFZ A;  3BW1 A;  1I07 A;  4IUT A;  3PMT A;  3SHW A;  4JRP A;  4RTT A;  4E7I A;  1Q86 R;  3GNF B;  3QO3 A;  2IPO B;  8AT1 B;  1E6G A;  1WHL A;  2PU9 B;  3BFM A;  5EG2 A;  2EYQ A;  4PJO C;  2QA4 A;  1PWT A;  2XMF A;  2CKK A;  2Z0W A;  4F04 B;  4XTY A;  4P5N A;  1RAH B;  4JUV A;  4C0F A;  5KYX B;  1K73 C;  5A0D A;  2P0Q A;  3CCL T;  2KR3 A;  2JN0 A;  3CMA A;  3CXC A;  1VQP A;  1RAI B;  2W0Z A;  1U3O A;  2JTF A;  1PKT A;  1TTH B;  1YBY A;  5LJ5 d;  1N8R U;  1I0C A;  2B86 A;  3CCU T;  3A8G B;  2DKG A;  3SFM A;  3MP8 A;  3VYG A;  2KNB B;  3OMG A;  3CCR A;  2EYZ A;  1QQJ A;  2K3Y A;  2VB6 A;  1U06 A;  4IIM A;  2D0Q B;  5CQY A;  2YUN A;  2ECZ A;  2FL7 A;  3I35 A;  2X4Y A;  3CPW S;  3RR6 A;  1QKW A;  4HCZ A;  5CKH A;  2MF2 A;  2LMJ A;  3H41 A;  2RMO A;  2QQR A;  1JU5 C;  3JV3 A;  3JB9 H;  3VS6 A;  3JCM Q;  1U1T A;  1M2V B;  2LJ1 A;  3OS1 A;  3EH2 A;  2QI2 A;  3MP6 A;  2COY A;  1W2B S;  1WXT A;  2DTH A;  3J81 E;  2K4Y A;  2B8A A;  1C1A A;  2GFU A;  4MZM A;  3CME Q;  2Y90 A;  1QVG S;  4XTZ A;  1HK9 A;  2RHZ A;  3G6E Q;  2CGH A;  4OML A;  1VUB A;  4M78 D;  2OTJ Q;  3NPF A;  3L2Z A;  5GMK i;  2J6O A;  3GP8 A;  4XAX B;  1M8M A;  5J3B A;  3QDR B;  3CCS A;  4BD3 A;  1JBM A;  1BYM A;  2L3Q A;  3LX7 A;  5CVI A;  1PHT A;  1EZZ B;  5EC7 A;  4HXJ A;  2WAC A;  1W6X A;  1SEM A;  3EFS A;  4X9D A;  3VU3 C;  3L2U A;  2A37 A;  5LJ3 j;  1JJ2 P;  1FMV A;  1LNX A;  2HAX A;  3FIF A;  3E2U A;  1JQQ A;  4JJD A;  2RHY A;  1YJW T;  2YT6 A;  5KCH A;  4DBR A;  5D6X A;  3A8H B;  3EFR A;  1VQ8 T;  4J6Y A;  1MMG A;  4R0K A;  5DLO A;  1Y57 A;  2DMO A;  3X25 B;  1YCY A;  3I5R A;  3OQ5 A;  4L6V 5;  3FJP A;  1FYN A;  2DD5 A;  3A5Z B;  3VRZ A;  2JM8 A;  1VQ6 T;  4JJN K;  3WVE B;  1P92 A;  4KH1 B;  5D7U A;  2MOX A;  2GQV A;  2CSQ A;  4M77 A;  1ZHI A;  2HQE A;  2E3H A;  1NYF A;  4ATO A;  1OEB A;  3I55 A;  3E19 A;  4FYX B;  1T0J A;  1K9A A;  2DPP B;  4ESR A;  3CCQ A;  3CPW A;  1SSH A;  5KYY B;  3TU4 K;  1SHG A;  4A54 A;  5FRO A;  1JJ2 S;  2QEX T;  4PJO B;  2A36 A;  2QA4 Q;  2VAS A;  1MHN A;  3TVT A;  2VKN A;  2ZPF B;  5GAN 8;  4OB0 B;  1KJW A;  1HSQ A;  4FYV B;  3MHX A;  5A2Q E;  2HQX A;  2YUQ A;  2ZPH B;  3H8Z A;  3JCM h;  2YRV A;  2YUO A;  3JRZ A;  4CC2 A;  3CMA Q;  2RO0 A;  4QVZ A;  1YIT A;  2XDP A;  1QVG A;  4A4G A;  2KE9 A;  4X1V A;  3G71 A;  2LRQ A;  2DM1 A;  4PNO A;  2VYT A;  2NLU A;  3CBO A;  2AK5 A;  2SEM A;  1RLQ C;  4QVC A;  3CCR Q;  5I22 A;  4JLG A;  3M9Q A;  4A4F A;  1PD1 A;  3L42 A;  5I2S A;  3RIR A;  4JJC A;  2YXY A;  1V29 B;  3PTA A;  1RAF B;  3VV0 A;  3EG9 A;  2NUP A;  3FLG A;  2KT1 A;  3AHU A;  4Z02 A;  2RHX A;  1MND A;  3RKX A;  2XG8 D;  4QQG A;  3RMQ A;  2KI7 A;  2FPD A;  2K7A A;  1PD0 A;  2KY9 A;  3JB9 F;  2WSC E;  4C8Q D;  1BI1 A;  2V1R A;  2FHD A;  1SF9 A;  2FEI A;  5CKD A;  5GAM e;  1OI1 A;  1RAG B;  2YUP A;  1OPL A;  5GAN g;  1PKS A;  2I2L A;  2HZY A;  2E5Q A;  1SRL A;  3DLL A;  2DIL A;  5AYF A;  1VQK Q;  1KIK A;  1YJ9 A;  5IXB A;  4OMF B;  3I5S A;  3OYK A;  2YRC A;  1KQS S;  3IQL A;  5IAY A;  1K76 A;  3VS2 A;  5LJ5 j;  8ATC B;  3F70 A;  5GAN f;  4BI4 A;  4JPB W;  4JRI A;  5CO7 A;  1MMD A;  4M7A D;  4JS5 A;  1KQ1 A;  2EAY A;  3CCS Q;  2M02 A;  2K5I A;  2J05 A;  2RHI A;  4BE1 A;  1JJ2 A;  1G3W A;  4RMO A;  2CT3 A;  2QGF B;  3ER0 A;  3DKM A;  3S6W A;  4XU0 A;  3M59 A;  1NPR A;  5CKB A;  4ZN3 A;  1WHK A;  2ZZD A;  3PIP A;  1YN8 A;  4PL6 A;  1Q82 R;  5J26 A;  4BDY A;  2X35 A;  4KT0 E;  5GAM g;  4LNP A;  4F14 A;  1M30 A;  4L5G A;  1BU1 A;  3CBP A;  2K2V A;  2XID A;  1GL5 A;  3TQ7 P;  1RUW A;  4KGX B;  2GTO A;  4C92 C;  4AT1 B;  4RTW A;  4E7Z A;  4V2S A;  4M78 A;  3OA6 A;  3EHR A;  3CCM T;  1SPK A;  1B34 A;  4ZGD B;  2OAW A;  4M7D D;  5D6W A;  1RAB B;  1IXD A;  1Q82 C;  3LWI A;  4AG1 C;  2DRK A;  3QHS A;  2BUD A;  1VQ7 T;  1TU0 B;  3BY7 A;  4MDX A;  4RCC A;  1VIE A;  1VQ9 A;  1GXI E;  2F69 A;  2M1H A;  2KRO A;  2F5T X;  3RBB B;  1HYO A;  1EIF A;  1NZ9 A;  1NLO C;  4N4G A;  1JRI A;  2CP2 A;  5I2M A;  2EKH A;  4LDU A;  3FRN A;  2EIF A;  3M57 A;  3H0H A;  4PJJ A;  1WJS A;  1OU8 A;  2LQ8 A;  4X34 A;  2LT1 A;  2DL7 A;  1JB0 E;  2COW A;  3QJY A;  1U5S A;  2KBT A;  4RCB A;  1KQS A;  2QXF A;  4NL2 A;  3G71 Q;  3UT1 A;  2KSS A;  1OX8 A;  3CCE T;  2K9G A;  3C4S A;  3HTR A;  1BBZ A;  3CD6 A;  2DRM A;  1AEY A;  2GGR A;  1VQ4 T;  3QKJ A;  3H9N A;  4FM4 B;  2L0A A;  1WGS A;  3CBM A;  4J83 A;  1GBR A;  2IG0 A;  3PNW C;  1PG5 B;  2LTO A;  1XQH A;  1O9S A;  2NUT B;  2A0F B;  4Q5W A;  3M0Q A;  1G3Y A;  3M58 A;  3REA B;  4II1 A;  4MZP A;  3I55 T;  1AWO A;  1NEB A;  1IHV A;  4JZ3 A;  3A1P A;  1M1F A;  1WX6 A;  2EPD A;  2E1H A;  2L8D A;  3CCQ T;  3QUI A;  3OYJ A;  1WFW A;  1UB4 A;  2CS7 A;  3QSU A;  1KHC A;  4RTY A;  2MYS A;  2KDS A;  3SEM A;  4PJO E;  3V7C A;  1YJ9 Q;  2K79 A;  3X20 B;  1PC0 A;  3RMS A;  3C0C A;  2X3X D;  2Y4Y A;  2KGT A;  2E6Z A;  3CCV A;  2RD1 A;  4Y92 A;  3JB9 G;  4RG8 A;  2RJF A;  2LC4 A;  4XTV A;  2JS0 A;  2K5L A;  1WQW A;  2EKO A;  4IUP A;  3A8L B;  3X26 B;  4CC4 B;  1X43 A;  1YIT T;  2VWF A;  3PVQ A;  4EMK C;  2HBW A;  2BTT A;  4C8Q F;  4E2F B;  2RK1 A;  2YLC A;  4C8Q A;  2LQW A;  3BE3 A;  1O75 A;  3JAM E;  1MNE A;  2QQB A;  3S3N A;  1MV0 B;  3DB3 A;  4M4Z A;  4N0A A;  3VS0 A;  4OGE A;  2VGN A;  4LDX A;  5CKF A;  2D8J A;  2HKN A;  3BDU A;  4N4H A;  4KRT A;  1NBE B;  3M0R A;  4N0A C;  1VQ5 A;  1UHF A;  5LJ3 d;  5GAO p;  2LQK A;  4EMG A;  4IUU A;  3JCM f;  3QPH A;  3INZ A;  1UGS B;  3CC7 T;  1VYV A;  2EQJ A;  2AKL A;  3FJ5 A;  1Q82 U;  2K2M A;  4A4H A;  4C92 B;  1Y07 A;  1M2O A;  4C5E A;  2QAS A;  2K5F A;  3EGD A;  4LD9 K;  4M75 D;  4M7A A;  1UGQ B;  1R0C B;  1CKA A;  3UA6 A;  2DL8 A;  2DL5 A;  3M0T A;  1M3B A;  4FW2 A;  2VC8 A;  3M0P A;  1YJN Q;  2V8I A;  4ZTJ A;  1JO8 A;  1IO6 A;  1UG1 A;  1KC8 R;  2JZ2 A;  2ZGW A;  2D9T A;  3N5B B;  3SD4 A;  4NS5 A;  2K6D A;  4J9D A;  4YTL A;  2X51 A;  1ABQ A;  1WJR A;  2P0P A;  3CCJ A;  3O8V A;  2MMP A;  2FVU A;  1AWJ A;  4GBQ A;  2XDB A;  4M7D F;  5L8R E;  4M7D A;  2CZ1 B;  1KC8 C;  2ED1 A;  3PVL A;  1B3Q A;  3CC4 A;  3ZFJ A;  2JTM A;  3OS2 A;  3KFV A;  3NTH A;  3QXE B;  1BI0 A;  2XKO C;  1NJI C;  1PNJ A;  1VQL T;  3CD6 Q;  2DYI A;  2EVR A;  1TSF A;  3EG2 A;  2C0I A;  1UHC A;  1X69 A;  4XTU A;  3MP1 A;  3HKS A;  2LP5 A;  3QJ6 A;  3OY9 A;  2DO3 A;  3G4S A;  3E9G A;  3CCU Q;  1S72 A;  2K57 A;  3R6N A;  5LJ5 e;  2CSI A;  4LE9 A;  1WHH A;  3L2W A;  3UF4 A;  3OS5 A;  1KG1 A;  1GRI A;  5ECA A;  1CKB A;  2LJ0 A;  5DLQ E;  5GJV B;  1OZ3 A;  3VUB A;  3H0I A;  2KVQ G;  4Z8A A;  4ZTF A;  2CP5 A;  2GQI A;  3OYG A;  2RQT A;  3LW5 E;  1WA7 A;  1OU9 A;  2RQR A;  3SWN A;  1VQM A;  5KYN A;  1X27 A;  1KD1 R;  2L89 A;  4PJO F;  1G3S A;  4DOV A;  1PSE A;  1YWP A;  4J9I A;  5DM7 R;  1VYT A;  3CCV Q;  3JB9 D;  5GAN 2;  1Q86 C;  4DBF A;  2EYW A;  3ULR B;  2DA9 A;  4A53 A;  2KK4 A;  1ZA1 B;  3MEU A;  2RA2 A;  5LJ5 g;  5GAM h;  1OPK A;  4X9C A;  4OMN A;  4FCY A;  3QWX X;  4Z89 A;  4HVW A;  4EMK B;  1GCQ A;  3MEV A;  2ABL A;  1KD1 C;  2E12 A;  4HCK A;  4IUV A;  5GAN 7;  1K8A R;  4XQ3 A;  1M1G A;  2EFI A;  4BY6 C;  3J7A F;  3OSV A;  2O01 E;  3T9N A;  1VQ5 Q;  5GJW B;  2NWM A;  3JCM X;  1R8O B;  2PVG B;  1N5Z A;  1ZUU A;  4C8Q G;  1YCS B;  2VXE A;  1OX9 A;  1IB8 A;  2KYB A;  4J6W A;  3PE0 A;  1VQO A;  3SDZ A;  1VQN A;  3EGD B;  3ZBD A;  1A0N B;  1VQK A;  2LCC A;  3AT1 B;  2FPF A;  1TH7 A;  1AD5 A;  4J7I A;  4MDW A;  1MMN A;  2LJ3 A;  2CT4 A;  1X2K A;  1WIE A;  2D1X A;  2PUO B;  3NTK A;  1YIJ Q;  4M7A G;  2DLP A;  4RTZ A;  2RQU A;  2DD4 A;  1KK7 A;  2PNI A;  2FB7 A;  3CCJ Q;  4KUI A;  4M75 F;  3JSC A;  2O4X A;  1NJI U;  2MWP A;  4M75 A;  4LDY A;  1D1A A;  4QQD A;  1BI3 A;  3M5A A;  2RN8 A;  2IVW A;  2ZPG B;  3CC4 Q;  2JMA A;  2BE7 D;  3KXT A;  2O88 A;  1GFD A;  1X6O A;  1PRL C;  3UAT A;  2WSF E;  3VS7 A;  1QCN A;  4DBH A;  1WZO A;  4LD6 A;  2QTV A;  1TG0 A;  1T3L A;  3CQT A;  2CUD A;  4C92 E;  2DXC A;  4M7D G;  3G4S Q;  4IKF A;  1S72 Q;  4F7U F;  2LCS A;  1H3Z A;  3P8D A;  1M9S A;  1ZSG A;  1QCF A;  2F5K A;  1N9S A;  4HKE A;  3A8O B;  5KE3 A;  4M77 C;  1K9M R;  3CME T;  2AHJ B;  3EG0 A;  2AT1 B;  9ATC B;  4D8K A;  2VXF A;  1WI7 A;  3JCM J;  1K73 U;  2D0N A;  2KMT A;  3G6E T;  2OTJ T;  1UUE A;  3Q1J A;  1Q86 U;  1UE9 A;  4FIB A;  2RPN A;  2JVV A;  1VQM Q;  4J6X A;  2EQK A;  1WYX A;  2DJZ A;  1K9M C;  4J9H A;  4LUE A;  2JJ9 A;  4LDW A;  1WHJ A;  4ELY C;  3ME9 A;  2CZ6 B;  5CIU A;  4E7H A;  1YHQ A;  1KD1 U;  3PIO A;  1G5V A;  2BZY A;  1B07 A;  1M5Q 1;  2HCK A;  1MV3 A;  2MWO A;  5C6S A;  1YI2 T;  1Q81 R;  5LJ3 h;  4L59 A;  4WF2 A;  1NPP A;  1M8V A;  3KBG A;  1V76 A;  3I56 A;  5HK3 A;  4J9F A;  3H0F A;  4PJO G;  1TWB A;  5KE2 A;  2DIG A;  2E10 A;  1YNZ A;  2HL3 A;  2JW4 A;  2MIO A;  3VUZ A;  4XU1 A;  4BY6 B;  4MMK A;  3LYI A;  3HPW A;  4A4E A;  4CC7 A;  2FO0 A;  4C5I A;  2BKD N;  1N27 A;  2F2V A;  2ZPE B;  2E3I A;  2EW3 A;  3LGL A;  1VQO Q;  1VQN Q;  1EFN A;  3L2Q A;  4EMH A;  3X24 B;  2QA4 T;  2ROL A;  2EYX A;  1TS9 A;  2OTL A;  5HKC A;  1N6A A;  1BK2 A;  1LOJ A; 
#chains in the Genus database with same CATH homology
 2C0T A;  3M0Q A;  2BZ8 A;  1Z9Q A;  3REA B;  2OI3 A;  5IHK A;  1H3H A;  1AWO A;  1NEB A;  4JZ3 A;  5I11 A;  5IH2 A;  1RI9 A;  1WX6 A;  2EPD A;  1NEG A;  1S1N A;  1W1F A;  2CH4 W;  2JXB A;  1M3A A;  2JM9 A;  4HVU A;  1GCP A;  1WFW A;  1G2B A;  4AG2 C;  1OV3 A;  4RTY A;  2F2X A;  2CRE A;  2V1Q A;  2KRM A;  2X3W D;  3SEM A;  5IHN A;  2DJQ A;  1CSK A;  2K79 A;  3C0C A;  2X3X D;  1YP5 A;  2KGT A;  1KFZ A;  1NM7 A;  1I07 A;  3EG3 A;  4Y92 A;  2ENM A;  1NG2 A;  1NYG A;  3SHW A;  1M3C A;  1YWO A;  4RTT A;  2JS0 A;  1ZUK A;  4D8D A;  1E6G A;  4FSS A;  2D8H A;  3VRY A;  4CC4 B;  1X43 A;  2VWF A;  3PVQ A;  1PWT A;  2HBW A;  2BTT A;  2M0Y A;  1UJY A;  2XMF A;  3NGP A;  2LQW A;  2J06 A;  1MV0 B;  2FRY A;  4M4Z A;  3VS0 A;  1LCK A;  2D8J A;  2KR3 A;  2QDL A;  4KRT A;  3M0R A;  2W0Z A;  1UHF A;  1U3O A;  2J7I A;  1PKT A;  4ORZ A;  5FWC A;  1I0C A;  1T0H A;  2F2W A;  1VYV A;  2B86 A;  2AKL A;  1E7O A;  2HSP A;  3FJ5 A;  2RNA A;  2K2M A;  2KNB B;  3NHN A;  2EYZ A;  3REB B;  1QWF A;  1FMK A;  1T3S A;  1U06 A;  4IIM A;  1CKA A;  2YUN A;  2ECZ A;  2J6K A;  3UA6 A;  3I35 A;  2DL8 A;  2DL5 A;  2DNU A;  2BZX A;  3M0T A;  1M3B A;  2EGE A;  3M0P A;  1QKW A;  1K0S A;  2IIM A;  1K4U S;  2LMJ A;  3H41 A;  2RMO A;  2KYM A;  4J9B A;  2FRW A;  1JO8 A;  3LH5 A;  2CH4 A;  1IO6 A;  1JU5 C;  3JV3 A;  2JT4 A;  1X2Q A;  2KXD A;  1UG1 A;  2PTK A;  3VS6 A;  4QT7 A;  2K6D A;  4J9D A;  2LJ1 A;  3TSW A;  1ABQ A;  1WXT A;  4DEX A;  2HDA A;  2EGC A;  1M27 C;  3O5Z A;  2P4R A;  1AWJ A;  4GBQ A;  1BB9 A;  4OMO A;  4OML A;  3M0U A;  3NPF A;  1UTI A;  2J6O A;  1QKX A;  2ED1 A;  1X6G A;  3PVL A;  1B3Q A;  3VS3 A;  2AZS A;  1VYU A;  3KFV A;  1JXO A;  1M8M A;  4WCI A;  1TUD A;  2L3Q A;  3I9Q A;  1PHT A;  1PNJ A;  2FG0 A;  5EC7 A;  2EVR A;  4HXJ A;  1W6X A;  3EG2 A;  2C0I A;  1SEM A;  1UHC A;  1X69 A;  3EG1 A;  2LP5 A;  4CC3 A;  2KRN A;  2E5K A;  2A37 A;  3R6N A;  4A63 B;  1PRM C;  2CSI A;  4LE9 A;  1JQQ A;  5HCK A;  4JJD A;  3ZL7 C;  2YT6 A;  3UF4 A;  1AWX A;  5L23 A;  1AZG B;  1GRI A;  1VA7 A;  5ECA A;  1CKB A;  2DL4 A;  2RQW A;  2DVJ A;  2LJ0 A;  4R0K A;  5GJV B;  1Y57 A;  1GFC A;  2DYB A;  2DMO A;  2OJ2 A;  3H0I A;  4Z8A A;  3I5R A;  1ZUY A;  2KT8 A;  1FYN A;  1QWE A;  1SHF A;  3VRZ A;  2JM8 A;  1Z9Z A;  2GQI A;  2KRS A;  1AVZ C;  4AFZ C;  2MOX A;  2RF0 A;  2RQT A;  1WA7 A;  1RLP C;  2RQR A;  2G6F X;  4IIO A;  5FWB A;  1X27 A;  2CSQ A;  1K0X A;  1NYF A;  1OEB A;  2EGA A;  1YWP A;  4J9I A;  1T0J A;  1VYT A;  1K9A A;  4ESR A;  2NUZ A;  2EYW A;  3EHQ A;  3ULR B;  1SSH A;  2DA9 A;  1SHG A;  2AKK A;  2GBQ A;  1OPK A;  2A36 A;  2M51 A;  1OOT A;  4OMN A;  1W70 A;  3QWX X;  2YDL A;  4Z89 A;  4HVW A;  1GCQ A;  3TVT A;  2VKN A;  2ABL A;  1TUC A;  4J9E A;  4OMM A;  1JEG A;  1UFF A;  1KJW A;  1ZBJ A;  1AOJ A;  1HSQ A;  4AFU C;  2FPE A;  2J6F A;  4HCK A;  2LX7 A;  2DF6 A;  2YUQ A;  2KEA A;  4EIK A;  2YUO A;  1WLP B;  4CC2 A;  4F17 A;  3VS1 A;  5GJW B;  2NWM A;  2KE9 A;  4X1V A;  1N5Z A;  4RTU A;  1ZUU A;  2I0N A;  2DM1 A;  3M0S A;  1AWW A;  1YCS B;  1ABO A;  2O31 A;  4OMP A;  3EGU A;  2KYB A;  2AK5 A;  2JMC A;  2SEM A;  4F16 A;  1RLQ C;  2C0O A;  3PE0 A;  5I22 A;  2JS2 A;  1A0N B;  2O9S A;  4JJC A;  4AFQ C;  2DL3 A;  1X6B A;  2FPF A;  2SRC A;  2EBP A;  1AD5 A;  2KT1 A;  2LJ3 A;  2CT4 A;  1X2K A;  2L3S A;  2ROT A;  1WIE A;  1UEC A;  2FPD A;  2D1X A;  2K7A A;  3A98 A;  2V1R A;  2DLP A;  3QWY A;  2FEI A;  2RQU A;  4RTZ A;  2YUP A;  1OPL A;  2O2O A;  1G83 A;  1PKS A;  1WXB A;  1SRL A;  2ED0 A;  2PNI A;  1I1J A;  2DIL A;  1KIK A;  5IXB A;  1ARK A;  3I5S A;  4RTX A;  4HVV A;  3IQL A;  1K76 A;  3VS2 A;  5FW9 A;  4JPB W;  2RN8 A;  2CDT A;  1XOV A;  2JMA A;  2O88 A;  2L3P A;  1GFD A;  1PRL C;  3TSZ A;  3UAT A;  2MCN A;  1ZLM A;  3VS7 A;  3THK A;  1WXU A;  2J05 A;  3NMZ C;  2VVK A;  1K1Z A;  2H8H A;  1TG0 A;  3RNJ A;  2CT3 A;  4AFS C;  1T3L A;  2DX1 A;  3CQT A;  2CUD A;  4LN2 A;  1HJD A;  5IXF A;  2GNC A;  4E6R A;  2LCS A;  1YN8 A;  1ZSG A;  1GBQ A;  4LNP A;  4F14 A;  1M30 A;  1QCF A;  1J3T A;  4OMQ A;  1H8K A;  1BU1 A;  1H92 A;  4K11 A;  1GL5 A;  2YSQ A;  1RUW A;  3EG0 A;  2GTO A;  4D8K A;  1WI7 A;  4RTW A;  2D0N A;  3EHR A;  1SPK A;  4J9C A;  5IHI A;  1UUE A;  4J9G A;  2OAW A;  1UE9 A;  1UDL A;  1WDX A;  2DBM A;  2RPN A;  1GCQ C;  1QLY A;  4AG1 C;  2KXC A;  1WYX A;  2DRK A;  2O9V A;  4J9H A;  4LUE A;  2A08 A;  2L2P A;  2CUB A;  3VS5 A;  2KRO A;  4ZNX A;  2BZY A;  3RBB B;  3U23 A;  2LNH B;  2A28 A;  1JXM A;  2ESW A;  4RUG A;  1NLO C;  1B07 A;  4Z88 A;  2HCK A;  2RQV A;  1MV3 A;  2AZV A;  1KSW A;  2PZ1 A;  1MUZ A;  4RTV A;  2EKH A;  2DE0 X;  1UGV A;  4LUD A;  4J9F A;  3VS4 A;  3H0F A;  3H0H A;  3UA7 A;  4DEY A;  4GLM A;  1V1C A;  1YNZ A;  4JZ4 A;  2JW4 A;  2DL7 A;  2MIO A;  2EQI A;  3GBQ A;  2K3B A;  1SRM A;  1UJ0 A;  1U5S A;  2KBT A;  2JTE A;  2DBK A;  1Y0M A;  4CC7 A;  2FO0 A;  1NLP C;  2K9G A;  1BBZ A;  2DRM A;  2LZ6 B;  2F2V A;  2LQN A;  1AEY A;  4JJB A;  2EW3 A;  2GGR A;  2EYY A;  2L0A A;  1HD3 A;  2GTJ A;  1EFN A;  1GBR A;  1ZX6 A;  2ROL A;  2EYX A;  1BK2 A;  2HEQ A;  2W10 A;  1AZE A;  1E6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...