4LNPA

The first sh3 domain from cap/ponsin in complex with proline rich peptide from vinculin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
b'EMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sorbin and SH3 domain-containing protein 1
molecule tags Signaling protein
source organism Homo sapiens
publication title Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin
pubmed doi rcsb
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2013-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4lnpA00
1SEMA 4J9FA 2BTTA 4JPBW 2VVKA 1M8MA 1SPKA 2YDLA 1K1ZA 1K9AA 3LH5A 3O5ZA 1KIKA 2D1XA 3M0SA 1IO6A 2LQWA 4AG1C 2BZ8A 1AWXA 2FRYA 1BBZA 1UHFA 1OPKA 2CT4A 2EVRA 1A0NB 1PKTA 2JS2A 2LJ1A 4Z88A 1E6HA 2EKHA 5GJWB 2GBQA 4OMNA 2YUPA 2FG0A 2MOXA 1M3AA 2J7IA 2AK5A 2KRMA 4F17A 1QKWA 1GBQA 1MV3A 2O31A 2JMAA 2YT6A 1Y57A 3M0QA 1S1NA 2L0AA 1X6BA 3TSZA 4OMOA 4IIOA 3RNJA 1YWOA 2LQNA 3EHQA 2M0YA 5HCKA 2E5KA 2MIOA 1PWTA 4RTYA 2HDAA 3UF4A 1K4US 2RQRA 1SSHA 2OAWA 1W6XA 2DYBA 4ESRA 5GJVB 4OMLA 2A08A 3UATA 1JQQA 2KEAA 1AEYA 2EGEA 1WXBA 2JW4A 4AG2C 5I22A 2DL4A 1PRMC 1X6GA 2A28A 3QWYA 3U23A 1VYUA 2ROTA 4F14A 1CKBA 1ZLMA 2DJQA 2DA9A 2NWMA 2GTOA 1KJWA 2K7AA 3VS6A 5IXBA 2O88A 1RI9A 2FPFA 2L3QA 4HVWA 1NM7A 1SRLA 2KYBA 2ROLA 2HBWA 1ZX6A 1JEGA 1G2BA 4AFSC 2RMOA 2CREA 2F2VA 2HCKA 3M0UA 2LP5A 3QWXX 1X27A 1XOVA 1GL5A 2G6FX 2F2WA 3REAB 1OPLA 3UA7A 1WDXA 2DMOA 1T0JA 2ABLA 2KE9A 1WX6A 5IHNA 2AKLA 4RTTA 1WLPB 2XMFA 1Z9QA 3EG0A 1U5SA 3NHNA 2DL5A 2GQIA 1UE9A 3THKA 3VS3A 4JJDA 3VS4A 4RUGA 3VS5A 2VWFA 1JO8A 2LNHB 4J9CA 4OMQA 2ESWA 2EYWA 2DILA 1CKAA 1I0CA 2FRWA 2F2XA 2V1RA 3I5SA 1ABQA 2AZVA 3IQLA 2HSPA 2X3XD 4J9HA 1PRLC 2CH4A 3H0HA 2JXBA 3NMZC 4Z8AA 1NLPC 1WIEA 1W1FA 5IXFA 3VRZA 2JM9A 1K0SA 1U06A 1UTIA 4J9GA 4IIMA 1HD3A 1BB9A 4J9EA 2CUDA 2KYMA 2LZ6B 3SHWA 1TUCA 4LUEA 1HSQA 1G83A 2QDLA 1BK2A 1AVZC 2KXCA 2EW3A 2PTKA 2DBMA 2ED0A 3VS0A 4OMMA 2LMJA 1SHGA 4RTXA 2CUBA 4OMPA 1GCQA 2RN8A 4EIKA 1RLPC 2CT3A 1ZUKA 4HVVA 2W0ZA 2EBPA 1AZEA 1KFZA 5FW9A 2YSQA 1X69A 1YN8A 4Z89A 1HJDA 1GCPA 3M0TA 2KT8A 3FJ5A 2L3PA 2RQWA 1QLYA 3I5RA 1VYTA 2KRNA 2A36A 4LE9A 3VRYA 2C0TA 4JZ4A 4Y92A 1M3BA 1GBRA 2EYZA 4QT7A 3H0IA 2RNAA 2RQUA 1I07A 1KSWA 1UJ0A 4RTWA 1T3LA 3PE0A 5ECAA 1AWOA 4M4ZA 1GFDA 1WXTA 1JU5C 3A98A 3C0CA 2DF6A 2EQIA 2JTEA 2D8JA 1B07A 2B86A 1TUDA 1X2KA 3JV3A 4J9DA 1H8KA 1Z9ZA 2MCNA 1UUEA 2KT1A 2K79A 1M3CA 1E6GA 1H3HA 4JJBA 2PNIA 1VYVA 2DX1A 3RBBB 2AKKA 2DBKA 5I11A 2YUQA 2KXDA 1OOTA 4GLMA 1WA7A 4JZ3A 2RF0A 2DM1A 4J9IA 4LUDA 3PVQA 3I35A 4LN2A 4AFZC 5EC7A 2RPNA 1NEGA 2DL3A 1X2QA 4AFQC 2ED1A 4X1VA 2L2PA 2DNUA 1SHFA 4CC2A 4DEYA 4GBQA 2H8HA 3H0FA 2DRKA 1W70A 2P4RA 1YP5A 1K76A 2DLPA 3VS2A 3TVTA 5IHIA 1JXOA 2EGAA 2VKNA 1Y0MA 2D8HA 2BZYA 1UJYA 2YUOA 1UDLA 3VS7A 2W10A 1UFFA 1AZGB 1M30A 2EYYA 1NLOC 1WFWA 3NPFA 2OI3A 3SEMA 1AOJA 2HEQA 2BZXA 4RTVA 1RLQC 4AFUC 2GTJA 3R6NA 4HVUA 3EGUA 4FSSA 1SRMA 1UGVA 1GCQC 1LCKA 4JJCA 1U3OA 2C0IA 1PNJA 2K2MA 4HXJA 3EG2A 1ZUYA 3M0PA 1T0HA 1N5ZA 2LJ3A 1J3TA 1PKSA 4WCIA 3EG3A 2V1QA 2M51A 4E6RA 3EG1A 3REBB 2CH4W 2FO0A 2K3BA 1BU1A 5FWBA 2AZSA 1FMKA 1QWFA 4D8KA 2C0OA 4R0KA 1ZUUA 1YNZA 1QCFA 3KFVA 2JS0A 2EGCA 1WI7A 3H41A 2CDTA 4J9BA 5IH2A 3NGPA 1E7OA 4A63B 3TSWA 4D8DA 1T3SA 1M27C 2EYXA 2I0NA 3EHRA 2GNCA 2FPEA 2NUZA 3CQTA 2O9VA 2LCSA 1TG0A 1FYNA 1WYXA 4CC7A 2DE0X 2OJ2A 2KRSA 3ULRB 1NYGA 1UG1A 1WXUA 1NEBA 2DVJA 1UECA 4LNPA 2RQTA 2LJ0A 4KRTA 2X3WD 4CC3A 1OEBA 1AD5A 2J6FA 2KBTA 1ARKA 2SEMA 2CSIA 1OV3A 2O2OA 1AWWA 1PHTA 4HCKA 2J6OA 2O9SA 1EFNA 3M0RA 5L23A 2J05A 1AWJA 1YWPA 2DRMA 4ORZA 1NYFA 2IIMA 3UA6A 1QKXA 1YCSB 1MUZA 2DL7A 2KNBB 2J6KA 3GBQA 2SRCA 1I1JA 4RTUA 2ENMA 2PZ1A 2GGRA 4RTZA 1GFCA 1GRIA 2FPDA 4F16A 1H92A 1ZBJA 2RQVA 4DEXA 4K11A 1JXMA 5FWCA 1K0XA 4ZNXA 2FEIA 1CSKA 1NG2A 1UHCA 2JM8A 2J06A 1VA7A 2YUNA 2CSQA 2K9GA 1MV0B 1QWEA 1X43A 1RUWA 2JMCA 1ABOA 3PVLA 2KROA 2A37A 2L3SA 2KR3A 1ZSGA 1V1CA 2K6DA 2LX7A 5IHKA 3I9QA 2D0NA 2ECZA 2JT4A 2DL8A 3VS1A 2EPDA 4CC4B 2KGTA 3ZL7C 1B3QA
chains in the Genus database with same CATH superfamily
5CO7A 4JLIA 3EFOA 2VVKA 3O5ZA 2A0FB 2D1XA 5GAOp 2QTXA 3QYGB 1IO6A 2HMAA 4AG1C 2CZ7B 2CGHA 1BBZA 3QDRB 1OPKA 1YJNA 1QVGS 2LTOA 2LJ1A 2EKHA 1OI1A 3TREA 1D09B 5CR2A 4EMGA 4OMNA 3CCMA 3JCMg 1M8VA 2J7IA 5LJ5e 4IUTA 2O31A 3OW2S 2MYSA 3M0QA 3G6EQ 1Q81R 1PD1A 1MNEA 3TSZA 3A1PA 4OMOA 3RNJA 3RKXA 2X35A 2HDAA 2ZAEA 4PJLA 1KHIA 2DTHA 3PFSA 1SSHA 4FW1A 2VV5A 4X9DA 4F7UB 4ESRA 4C8QD 4FIBA 1VQNQ 2KEAA 4A53A 3CC2A 2FYKA 2DL4A 4WF2A 2LRQA 3QWYA 3G6ET 1VYUA 1MMGA 3A8LB 1ZLMA 2HNIA 5HK0A 1I8FA 2GTOA 2X4JA 3PIOA 4PJOC 2HBPA 1G3WA 1YJ9Q 2PVGB 2MAMA 2L3QA 3M4GA 2YRCA 3KXTA 2ZPFB 1ZX6A 5LJ5h 4JRPA 1JEGA 1QMCA 2CREA 4VUBA 2LQ8A 4PJMA 4NL3A 2BE7D 1X27A 1GL5A 2F2WA 3REAB 1X01A 1OPLA 3X25B 1WDXA 2DMOA 4M77E 4AMCA 2KE9A 5IHNA 4RTTA 1X6OA 2CP5A 1R0CB 1M90R 3EG0A 4RG2A 1U5SA 5GMKj 3PMIA 3THKA 1X75C 3MEUA 3LWIA 4RUGA 3CMAT 2LNHB 2PUKB 2XG8D 4QVZA 4OGCA 2DPPB 1VQ4A 1PRLC 4HCZA 1XQHA 2JTMA 3NMZC 3WVEB 2BUDA 1W1FA 2XK0A 3OQ5A 5HY6A 2QTVA 3VRZA 2JM9A 2DYIA 1U06A 4BE2A 3CCEQ 1BI3A 4J9EA 3SHWA 4E2FB 3JCMP 1HSQA 2WACA 2A3LA 5KYXA 2RD1A 4C5IA 2LMJA 4RTXA 2CUBA 2KI7A 3CPWP 4BD3A 2CT3A 2E12A 5I21A 2EBPA 3CD6A 4M7DE 3CCET 5LJ5f 6AT1B 2KT8A 1VUBA 2L3PA 2RQWA 4KGZB 4M75C 4ATOA 2ZPHB 3CC7A 4JZ4A 4C92E 4R56A 1GBRA 3OYIA 3JCMQ 1VQKQ 3CEYA 1I07A 4QVDA 5IT9E 5ECAA 3CC7Q 4M4ZA 1I4K1 1WXTA 1JU5C 5L8RE 3A98A 5M9OA 2F5TX 3EH1A 2D8JA 2B86A 1YJNQ 2DXTA 1Z9ZA 4J7IA 4JRIA 1UUEA 2V26A 1VQ9A 1N27A 1KHCA 1M3CA 1Q86U 4JJNK 1H3HA 1VYVA 3MEVA 1R8OB 4E7JA 2JNGA 4GLMA 3ASKA 2QG9B 2DM1A 1QW1A 1Q95G 4C8QF 4EPCA 4Q5WA 4RCCA 1YBYA 2ED1A 4KH0B 3OYDA 1OX8A 1YJWA 1U8RA 4CC2A 2RHYA 4DEYA 4GBQA 2ZZDA 4M75E 5KYYB 3CC2T 2DRKA 2P4RA 4X9CA 1YP5A 4M7DG 2OTLQ 1TU0B 4C8QA 1B7TA 3JCMb 4C0ZA 4NL2A 2BZYA 1UDLA 3VS7A 2W10A 1UFFA 4E7SA 1VQ7A 1RACB 2HKNA 1W2BA 3OBWA 2DERA 3HRSA 2E70A 9ATCB 2KAFA 3JCMJ 3HKSA 1RLQC 4AFUC 2GTJA 5A2QE 3RMSA 1UGSB 2PVDB 4PFPA 1VQOT 2D0QB 1VQPT 1VIEA 1NBEB 1GCQC 1LCKA 2DTIA 5CKBA 2YLCA 2DVEA 4LXCA 1ZUYA 2LJ3A 1N5ZA 2O4XB 1W4SA 5A0DA 4HT8A 2V1QA 2M51A 2DO3A 4TVRA 4E6RA 3C94A 3OW2A 1Q7YC 1VQPA 2CH4W 2FO0A 2K3BA 1BU1A 3BW1A 1XNIA 4C5EA 5CKDA 1ZSZC 2RJDA 1VQ7Q 1UGPB 3BDUA 2C0OA 4R0KA 4C5HA 4RG8A 3CCEA 1YNZA 1RI0A 1M2VA 3JRZA 2K3YA 1IREB 4CRIA 2PQWA 1PSFA 2CDTA 3A5ZB 3URGA 1Q7YU 1N6AA 5GAN3 1D3BB 3OYFA 4OGEA 5CQYA 1WYXA 4CC7A 1FX7A 2DE0X 1BKBA 4NS5A 2LQKA 1UG1A 2ZGWA 3EGDB 2LJ0A 5GAN6 4KRTA 1Y07A 1OEBA 1AD5A 4KUIA 1VQ8Q 3N5BB 1VQOQ 4XQ3A 1ARKA 1VIFA 3OSVA 1Q82C 4XU2A 2CSIA 2PUOB 4C8QC 2C06A 1YI2Q 1AWWA 8AT1B 3FDRA 2O9SA 3M0RA 2MPXC 1AWJA 2RB6A 2AT1B 1K73R 1VQNT 5GANh 2CP3A 3CCST 5GAMe 2IIMA 5GAOq 4M75D 2RK1A 2IPOB 1YCSB 2DXCA 2X51A 1WPYA 2DL7A 5FU7C 4M7AG 3GBQA 2CZ6B 1JB0E 4M78A 2BIVA 1N9RA 1VQKA 4A4KA 1GRIA 5LJ3j 2E4HA 1BIAA 1NE8A 3AT1B 3CC7T 4PJOB 3LGLA 4ANJA 3OMCA 1YIJT 4K11A 3LW5E 4ZNXA 2FEIA 2XU8A 1IGQA 2JN0A 2Y4YA 4F04B 4GLKA 1VA7A 4M7AE 1GXIE 2E6ZA 2K9GA 1QWEA 4FW2A 4MZMA 3PVLA 2KROA 2X4XA 2FB7A 2L3SA 3G6EA 3I56A 2LT4A 5IAYA 2P84A 3CCLA 1WHKA 4QKUA 5GANe 4C0GA 5GAMh 4AT1B 2YLBA 4PFOA 1YITQ 2R58A 4JPBW 4ME7A 1BYMA 1K1ZA 1KIKA 3M0SA 2RK2A 2LQWA 5GAN4 1WHJA 1UHFA 1ACMB 2DXBA 4N4IA 2IG0A 5GMKi 5GMKl 1E6HA 4ZTJA 2GBQA 4UC4A 2KDSA 2MOXA 3DKMA 2KRMA 2K2VA 4D6WA 1M2OA 3HFOA 1GBQA 2KK4A 3HRUA 3CC4Q 5HK3A 1Y57A 5GMKh 1S1NA 1YITA 2L0AA 3CD6T 3M54A 2E10A 2ZPBB 4LD6A 4IIOA 3OYAA 4PLIA 5KE2A 4Y91A 1YWOA 1OU8A 2M0YA 5HCKA 2E5KA 2MIOA 2WSEE 3UF4A 2NYSA 1K4US 2RQRA 4OMLA 2K57A 2M16A 4OVAA 1AEYA 2EGEA 2V8KA 1LJOA 5I22A 2A28A 1U1SA 3OW2P 1PD0A 4F14A 1CKBA 4XTZA 3F70A 1KJWA 4M77F 2K7AA 4QQGA 3OS0A 1QP2A 4HVWA 1NM7A 3QXEB 1PM3A 2KYBA 5AYFA 2RMOA 1WNLA 5J39A 1YIJQ 3PTAA 4Z02A 2LP5A 2DFUA 1WZOA 4PJOF 3QWXX 2V8JA 3CXCP 1KQ1A 3FJPA 1FWZA 4BUGA 1T0JA 2RM4A 4B6MA 3PMTA 1WX6A 2AKLA 3UT1A 1JJ2P 1KQSS 5DM7R 2EQUA 2XMFA 2E1HA 3NHNA 2DL5A 1VQ6T 2XIDA 1Y96A 5GANg 3GNFB 4BDYA 3EFSA 2KMTA 3PNWC 2DJZA 2O01E 1I5OB 2VWFA 2ESWA 3RDVA 2DILA 1CKAA 1HK9A 1R77A 3IQLA 1M2VB 2AZVA 1PC0A 4KH1B 1VQ8T 2X3XD 4J9HA 2K5IA 2RI3A 1YJNT 3A8MB 2RO0A 2JXBA 4Z8AA 4LD9K 4WTOB 2RJFA 3G7ZA 5IXFA 1LNXA 3L2WA 3FRNA 3SWNA 4J9GA 4IIMA 1HD3A 1Q82U 2CUDA 2KYMA 3J7AF 2LZ6B 4PJOD 4LUEA 1OYXA 2QDLA 1PCXA 2KXCA 3VJPA 2ED0A 3VS0A 3I56Q 4OMMA 4O6JA 2B8AA 1SHGA 8ATCB 3CMEQ 2DEUA 1SF9A 4OMPA 3L42A 4N0AA 3OYGA 4BI4A 4HVVA 5A0LA 3CC2Q 5GAN5 1O75A 3RR6A 1MMDA 5FW9A 5J3BA 4ZN3A 1RL2A 4KULA 4Z89A 1HJDA 3OYMA 3M0TA 4KUDK 1LVKA 4XTYA 2CP6A 2COYA 3GNGA 3I5RA 5LJ3g 3VRYA 3MKDA 3GOXA 1HYOA 3OYKA 4Y92A 1BI0A 1M3BA 3VYGA 4QT7A 3H0IA 2RNAA 2RQUA 4FL6A 1ZBXA 5FLXE 1T3LA 2LCCA 3CPWA 1GFDA 4B9XA 4M7DA 3C0CA 1Q82R 3JB9F 1D3BA 3M4YA 1B07A 1TUDA 1X2KA 3JV3A 4J9DA 2LC4A 2QA4Q 2VUBA 3CMET 1M1KC 2F5KA 3CCUA 2P0PA 2P0QA 3E2UA 2FZKB 1YCYA 2RH2A 1HXDA 2RHIA 2DX1A 1SKUB 2AKKA 4EMKA 5I11A 2VASA 3M55A 4C0DB 3SD4A 4FT2A 1WHLA 1BCMA 3M59A 2RF0A 4OB1B 4J9IA 1RABB 2QAZA 1YHQQ 2KY9A 3LLRA 2RPNA 1NEGA 2DNUA 1SHFA 2H3EB 4ZN1A 3VUZA 3VKIA 4M7DD 3JB9D 2V8IA 3H0FA 1W70A 3OYEA 2HKQB 2QA4T 1K76A 1TTHB 4V2SA 3FB9A 4M77D 4M7AB 3QUIA 2Y4XA 3L2UA 3EH2A 3NTHA 5KH6A 2D8HA 1EZZB 1D1CA 3SB2A 2YUOA 1VQOA 3G4SA 1AZGB 3JB9G 3LH0A 1M30A 2EYYA 3OS1A 3CCJT 1VQ5A 1WFWA 3NPFA 5FRNA 3BY7A 4JRKA 2HEQA 3LWHA 1ZA1B 3ME9A 1QQJA 3JCMf 3FEOA 4HVUA 3EGUA 1PSEA 3TCJA 2ZPEB 4FSSA 4E7KA 1KQ2A 1UGVA 4JJCA 4M7DF 1U3OA 4DQ2A 4HXJA 1PKSA 3EG3A 4XU3A 1IHWA 4YTLA 3RIRA 1NJIR 2DETA 2Z0WA 1IZ6A 3REBB 3AHUA 5FWBA 2HAXA 1KC8U 3SDZA 5LJ3e 3CPWS 1FMKA 1TOVA 2NUTA 1QWFA 2E3HA 4D8KA 2EQKA 1ZUUA 1JJ2A 4IURA 4ELZC 4J6XA 2FVUA 1M1GA 3CCLQ 2JS0A 2EGCA 1WI7A 1NPPA 4J9BA 3NGPA 1TSFA 3ZFJA 4A63B 4D8DA 1T3SA 1M27C 3EHRA 2GNCA 2VXEA 3C95A 3V8LA 2XKOC 4Y28E 2KRSA 1MMAA 3A8GB 3ULRB 1D0YA 5GANj 1FMVA 1NEBA 5CQXA 1UECA 5FU7B 2HZYA 2BE9B 1C0MA 1UEBA 3P8DA 2J6FA 3OSSC 3T9NA 1F1BB 1K9MC 4EMKC 1Y96B 3CCVQ 1SSFA 3I55Q 5LJ3h 5KYUA 1K73U 1PHTA 3BDLA 4C5GA 5L23A 3NTIA 2BKDN 2J05A 2DKGA 1MMNA 2A7YA 2GF7A 5HKCA 1KD1C 3OB9A 1NJIC 1YWPA 4KGXB 3CCUQ 4PLLA 1NYFA 1WHMA 4OF1A 3V8JA 1I81A 1R0BG 2M1HA 2VGMA 2RA2A 1QKXA 1MUZA 5GAMf 2KNBB 2X4YA 4M7AF 4RTUA 2M02A 2VGNA 3MP8A 2ENMA 4IKFA 4BDZA 1WJQA 1BI2A 4M78D 2CP0A 5GAN2 3PT9A 3CXCA 1H92A 3OYJA 4IUUA 3CC4A 2RQVA 4NOYA 5FU6B 1JXMA 5FWCA 3G1JA 2VYTA 2ATCB 1RAGB 1UHCA 3CCRA 3DB3A 1TS9A 3ZEHA 1MV0B 1N8RC 1RUWA 1ABOA 3EAEA 2DZCA 2KR3A 5FROA 5GMKe 5D6XA 2LX7A 2D0NA 2ECZA 2JT4A 4LDVA 4QQ6A 4DOVA 3WXMB 4M7AC 1S72T 1WGSA 2PU9B 2KGTA 4PNOA 2DZ9A 3JCMc 4J9FA 1YHQT 1JRIA 1MGQA 5LJ3d 5J26A 2YDLA 3G4SQ 1K9AA 4N4HA 3LH5A 4M77B 4M7AD 2COWA 3CCRT 5GMKm 2BZ8A 1AWXA 4F7UE 5KYNA 2FRYA 3HP9A 2D9TA 2EQMA 4XU1A 2CT4A 3G71A 2FL7A 2L8DA 1PKTA 3JCMX 1UGQB 3DB4A 4X34A 5GJWB 2YUPA 4A4FA 2FG0A 3OYCA 3OBYA 2FZGB 4IUVA 2QGGA 1QKWA 1YJ9A 5KYWB 3ZBDA 5CCAA 4P5NA 2XDPA 2L89A 2AIRB 2M0OA 2YT6A 3EG9A 1TH7A 1VQ5Q 1X6BA 1Q86R 3X20B 1NZ9A 2RHUA 1C1AA 4M75G 1XJWB 3EHQA 4RTYA 4DBHA 3VV0A 3OY9A 2OAWA 1W6XA 2DYBA 1G3SA 1OZ3A 4XTWA 2A08A 1VQ8A 1IGUA 1WXBA 1M9SA 2JW4A 4LDYA 4AG2C 2EFIA 1VQLA 4PJOE 1PRMC 3U23A 2E41A 2ROTA 5GAOr 3DLLA 1YI2A 1BI1A 2DA9A 5CIUA 2O4XA 1VQKT 3VS6A 2Y90A 2O88A 4FYWB 3OMGA 1SRLA 1G2BA 1VQLT 3CCSQ 2F2VA 3OYBA 2HCKA 2QQBA 3M0UA 2MK5A 1VQ5T 2QQRA 2DXUA 2HD0A 1YHQA 3JCMV 2CP2A 4JS4A 4C92A 1IHVA 4DOWA 1WLPB 1K9MR 1RAEB 5GAOl 5D6YA 2OTJQ 1G3TA 2HQEA 2K4YA 4JJDA 3CCVT 3VS4A 4QW2A 1YJ9T 3VS5A 5CKEA 3JB9J 4OMQA 1KG1A 2EYWA 4HCCA 4OP0A 2F2XA 1VQMA 2RJEA 3I5SA 3M58A 1VQMT 2HSPA 3A8OB 2HQHA 5C0MA 3META 3V7RA 2CH4A 2JUFA 4E47A 3RESA 1NLPC 2P4TA 3HRTA 2H3JA 3CMEA 3MO8A 3CCJQ 1AHJB 2QK0A 1QVGP 1XTDA 2L3RA 4C92B 1BB9A 5KYUB 3L1AA 1KC8R 4M78E 5LJ5j 2OTJA 1G83A 2E5QA 1BK2A 5LJ5d 2EW3A 1S72A 2DTOA 2VC8A 5EG2A 2F1LA 4J83A 1OZ2A 4L6V5 2KVQG 3OA6A 2CZ0B 3HL8A 2I2LA 1RLPC 1ZUKA 1VQ9Q 3EGXB 1AZEA 1VQ4Q 1KFZA 4QVCA 4OB2B 2YSQA 1YN8A 3JCMd 5KYWA 2COZA 3FJ5A 2YRVA 1VYTA 4MZTA 2C0TA 1O9SA 4XTVA 1M90U 2EYZA 1Q81U 1UJ0A 3PE0A 2RJCA 5DY9A 3V8KA 2EQIA 4KBMB 2OTLT 2OTLA 1H8KA 3M57A 2MCNA 2CKKA 3J80E 1RADB 3X24B 3QG1A 3QO3A 2K79A 3GF5A 4MZPA 1MHNA 3BE3A 4JJBA 2PNIA 1BIBA 3UPUA 1D1AA 3RBBB 2HQXA 2DBKA 2YWWA 1VQLQ 3CBMA 1YJWQ 2KXDA 1OOTA 4JZ3A 1QVFS 4J8OA 1PG5B 4AFZC 1QP3A 2DL3A 1Q7YR 1X2QA 1RAHB 4AFQC 4X1VA 2L2PA 3SWNC 1NJIU 3MJXA 3JSCA 4PK4A 2G3RA 2H8HA 3OYHA 4LDXA 3I55A 2DLPA 3VS2A 4RCBA 1QVPA 1IB8A 1JXOA 3CCQT 2EGAA 2VKNA 2EJ9A 1UJYA 4HA8A 2GCXA 1W2BS 3FLGA 3HTRA 3ER0A 4EDUA 2QQSA 2OI3A 3S6WA 3TU4K 1AOJA 2ZPIB 3TQ7P 3KUFA 2BZXA 4II1A 2DAQA 2JVVA 1OULA 2MMPA 3QIIA 3CBPA 1SRMA 3E9FA 4HT9A 3VYHB 2EAYA 4R55A 1PNJA 2K2MA 3M0PA 2QEXQ 2IVWA 2QQAA 4C0FA 3JB9I 4J6YA 2QQ9A 4M78B 4DA4A 1OX9A 3EG1A 2ZCFB 5CAIA 4MDWA 1G5VA 2XICA 4A4GA 2AZSA 4KT0E 3C4SA 1BCOA 4HCBA 3KFVA 3CCRQ 1WHHA 3CCJA 3QZ9B 4BY6B 3LYIA 4JUVA 4L5GA 1C6VX 3MEAA 4ZGEB 4J5YA 5GANf 5IH2A 1E7OA 3TSWA 2I0NA 4PJJA 3GPLA 4M77C 2WSFE 2O9VA 2LCSA 2GQVA 2R57A 3QZ5B 3CMAA 3JCMe 2ZPGB 1NYGA 2K5LA 4MDXA 1RAAB 1Y71A 4C92C 2F69A 3WVDB 2CYZB 5GANd 3CCMQ 3M53A 2RQTA 2X4WA 2JTFA 4M75B 1M1KR 4ZTFA 4MMKA 5GAOm 3EFRA 2QDYB 1V76A 2WSCE 1VQ7T 4HKEA 1OV3A 3RUXA 2O2OA 3CCLT 3RERA 3QJYA 4C8QG 2AHJB 4HCKA 4KGVB 2EYQA 1EFNA 2DIGA 4IUQA 4XK8E 2L5QA 2DRMA 4XTUA 3UA6A 5DLOA 1WJRA 4PKCC 1IRXA 5LJ5g 2P0KA 3H8ZA 2XHCA 2GGRA 4RTZA 1GFCA 3P8HA 1SG5A 1ZBJA 2GFUA 5GAMj 3JCMh 2DD4A 1IXDA 3OYYA 2EQJA 3I55T 3BFMA 1YI2T 2JM8A 2FHDA 4E7IA 2E3IA 2J06A 2YXYA 4M77G 4ZGDB 2LCLA 2CSQA 2JMCA 4F7UG 3X26B 2A37A 1ZSGA 1V1CA 3MP6A 2K6DA 2EKOA 5GAN7 5IHKA 2R5MA 3VS1A 2EPDA 2E6NA 1Q81C 4M78F 4FSXA 4FYVB 2VXFA 4C8QE 1B3QA 2D6FA 1SEMA 2LT1A 1VQ6Q 2BTTA 2XDBA 1M8MA 1SPKA 4M78C 3LGFA 3HPWA 3QJ6A 5D6WA 1D0ZA 5KCHA 4FYXB 4IUPA 3RKYA 1K8AU 4E7HA 4JDSA 1WJSA 2JJ9A 2EVRA 3QYHB 5A0GA 1A0NB 1S72Q 2JS2A 4Z88A 3FC3A 1VQMQ 5GAMg 1ZQ1A 2EWNA 2YHTA 4C92D 3X28B 1OU9A 1M3AA 2AK5A 4F17A 2M9UA 3OYNA 3E19A 2DIQA 3CCVA 1MV3A 2JMAA 3G71T 2QGFB 2XDDA 3S3MA 2NLUA 3M56A 3HFNA 1YITT 3KBGA 1KQSA 2QEXT 1B34B 2MWOA 2LQNA 1EIFA 1PWTA 2PVOB 2GFAA 1N8RR 2NUTB 3GLXA 5GJVB 3SWNB 1TUGB 3UATA 1M90C 1JQQA 3CXCS 2QEXA 3S3NA 5D7UA 2YRDA 1X6GA 2LVMA 2DJQA 1KK7A 2NWMA 1KQSP 3QKJA 5C6SA 5IXBA 1RI9A 2VB6A 1ZHIA 2FPFA 1QVGA 3CC4T 5FRMA 2ROLA 2HBWA 4A4EA 3FIFA 3V7SA 4AFSC 4C92F 4DBRA 5IN1A 1QCNA 4M77A 1Q86C 4BI8B 1XOVA 3MHXA 2G6FX 3UA7A 1Y7XA 2ABLA 4XU0A 3E9GA 2KSSA 2FZCB 2EIFA 3I56T 1Z9QA 4XAXB 1YJWT 2GQIA 4C0DC 1UE9A 4JS5A 3VS3A 3V7CA 4F7UF 1TXQA 2LNVA 1JO8A 4J9CA 3CCQA 1I0CA 2EJFA 2FRWA 2QXFA 1FMWA 1RAIB 2V1RA 2MI6A 1ABQA 1YIJA 1LOJA 1NPRA 3H0HA 2CS7A 4EMKB 3NFCA 1JJ2S 3CCSA 1WIEA 3VUBA 4QQDA 1K0SA 1UTIA 5KE3A 2QI2A 1D1BA 1TUCA 1H641 3UWNA 1AVZC 3L2RA 2PTKA 1WQ7A 2DBMA 4N4GA 4E7ZA 3DLMA 2KQWA 3EGDA 1FXXA 5CKHA 1GCQA 2RN8A 4O5VA 3MEWA 4EIKA 1RAFB 4BE1A 2W0ZA 4JRQA 4E7LA 2LDMA 2EJGA 2K3XA 3R6OA 1X69A 4OB3B 4OMFB 3NTKA 3MP1A 1GCPA 2RI2A 1KD1U 4L59A 2R5AA 1QLYA 1TWBA 2KRNA 3EFOB 2A36A 4LE9A 4BACA 3QBYA 3JB9H 1LPLA 3JAME 1KSWA 3OYLA 4RTWA 3SFMA 2NUPA 1OQKA 1AWOA 1WHGA 1ZA2B 2DF6A 2JTEA 5KYXB 3PGGA 1N8RU 3CBOA 3G4ST 2KT1A 1D0XA 4ELYC 4M7DB 2XD0A 4M75F 1E6GA 4JLGA 2E64A 2RI5A 2OTJT 3Q1JA 3CMAQ 5GAOn 2YUQA 1WA7A 5I2MA 4RKUE 2QASA 4LUDA 3PVQA 3I35A 4LN2A 5EC7A 3L2QA 5FU6C 3QSUA 2K5FA 1K8AC 2NUPB 3M5AA 1ZSZA 2LX9A 4BY6C 1UGRB 4EMHA 4FT4A 3P8BB 3TVTA 1U1TA 1WQWA 5IHIA 4CI0C 5I2SA 2X9HA 3EG9B 3C12A 1Y0MA 3JCMW 4PL6A 3CCUT 5CK9A 3GP8A 1I5LA 2RHXA 3OS2A 2HSEB 3MCAB 3HHTB 4BE0A 1NLOC 4M75A 3SEMA 3INZA 3H9NA 1M4ZA 4LDUA 4RTVA 4BI3A 3G71Q 3H6ZA 3R6NA 4J7FA 2OAUA 5GAN8 3QHSA 3CD6Q 4XTXA 7AT1B 2C0IA 5AT1B 3E1SA 1QCOA 3EG2A 3RKWA 4A4HA 1T0HA 1K8AR 4DBFA 1J3TA 4WCIA 4OB0B 4FCYA 3L2VA 3O8VA 3CCQQ 3GIBA 2DEQA 3RMQA 1M1KU 1EX4A 4C8QB 1UB4A 5CVIA 4PJNA 2CZ1B 3OS5A 1VQ9T 1QCFA 4PJOA 4GY5A 3J81E 1KC8C 3H41A 1N9SA 3L2ZA 1K73C 2EYXA 1ZSZB 2FPEA 5DLQE 1K9MU 2NUZA 3CQTA 5KYYA 2QA4A 2CP7A 2JZ2A 2JOYA 3HSBA 1H3ZA 3UDCA 1TG0A 1FYNA 4FYYB 1AT1B 1M5Q1 4M78G 2OJ2A 5KCOA 1VOMA 3PIPA 1WXUA 2HL3A 2DVJA 4M7DC 3MPUB 1G8XA 2RHZA 3LX7A 2HL5C 4LNPA 2MWPA 2X3WD 5CKFA 4CC3A 4FU6A 4J6WA 1B34A 5LL6S 2KBTA 4RMOA 2SEMA 3TEEA 3D7SB 1V29B 1KD1R 1DJ7B 2E65A 2J6OA 4F7UA 4ZGJB 1VQNA 1QVFP 4DBQA 4ORZA 4FM4B 1VQ6A 2OX7A 2XI9A 5LJ3f 3CPFA 4N0AC 2J6KA 2SRCA 1VQ4T 1I1JA 4C92G 3QPHA 2PZ1A 1M1FA 2FPDA 3QDFA 4LDWA 2MF2A 4PFZA 4F16A 1G3YA 3M9QA 2QYZA 4DEXA 3CCMT 3S3OA 4BB7A 1P92A 1K0XA 2DD5A 3VU3C 1QVFA 1CSKA 1NG2A 1W2BP 4MMLA 2YUNA 1VQPQ 4A54A 3A8HB 4B9WA 1X43A 1JBMA 1MNDA 3I9QA 1YFNA 2DL8A 2DK3A 4PJOG 4CC4B 3ZL7C 3EGXA 4M7AA 5GAMd
chains in the Genus database with same CATH topology
1SEMA 4J9FA 2BTTA 4JPBW 2VVKA 1M8MA 1SPKA 2YDLA 1K1ZA 1K9AA 3LH5A 3O5ZA 1KIKA 2D1XA 3M0SA 1IO6A 2LQWA 4AG1C 2BZ8A 1AWXA 2FRYA 1BBZA 1UHFA 1OPKA 2CT4A 2EVRA 1A0NB 1PKTA 2JS2A 2LJ1A 4Z88A 1E6HA 2EKHA 5GJWB 2GBQA 4OMNA 2YUPA 2FG0A 2MOXA 1M3AA 2J7IA 2AK5A 2KRMA 4F17A 1QKWA 1GBQA 1MV3A 2O31A 2JMAA 2YT6A 1Y57A 3M0QA 1S1NA 2L0AA 1X6BA 3TSZA 4OMOA 4IIOA 3RNJA 1YWOA 2LQNA 3EHQA 2M0YA 5HCKA 2E5KA 2MIOA 1PWTA 4RTYA 2HDAA 3UF4A 1K4US 2RQRA 1SSHA 2OAWA 1W6XA 2DYBA 4ESRA 5GJVB 4OMLA 2A08A 3UATA 1JQQA 2KEAA 1AEYA 2EGEA 1WXBA 2JW4A 4AG2C 5I22A 2DL4A 1PRMC 1X6GA 2A28A 3QWYA 3U23A 1VYUA 2ROTA 4F14A 1CKBA 1ZLMA 2DJQA 2DA9A 2NWMA 2GTOA 1KJWA 2K7AA 3VS6A 5IXBA 2O88A 1RI9A 2FPFA 2L3QA 4HVWA 1NM7A 1SRLA 2KYBA 2ROLA 2HBWA 1ZX6A 1JEGA 1G2BA 4AFSC 2RMOA 2CREA 2F2VA 2HCKA 3M0UA 2LP5A 3QWXX 1X27A 1XOVA 1GL5A 2G6FX 2F2WA 3REAB 1OPLA 3UA7A 1WDXA 2DMOA 1T0JA 2ABLA 2KE9A 1WX6A 5IHNA 2AKLA 4RTTA 1WLPB 2XMFA 1Z9QA 3EG0A 1U5SA 3NHNA 2DL5A 2GQIA 1UE9A 3THKA 3VS3A 4JJDA 3VS4A 4RUGA 3VS5A 2VWFA 1JO8A 2LNHB 4J9CA 4OMQA 2ESWA 2EYWA 2DILA 1CKAA 1I0CA 2FRWA 2F2XA 2V1RA 3I5SA 1ABQA 2AZVA 3IQLA 2HSPA 2X3XD 4J9HA 1PRLC 2CH4A 3H0HA 2JXBA 3NMZC 4Z8AA 1NLPC 1WIEA 1W1FA 5IXFA 3VRZA 2JM9A 1K0SA 1U06A 1UTIA 4J9GA 4IIMA 1HD3A 1BB9A 4J9EA 2CUDA 2KYMA 2LZ6B 3SHWA 1TUCA 4LUEA 1HSQA 1G83A 2QDLA 1BK2A 1AVZC 2KXCA 2EW3A 2PTKA 2DBMA 2ED0A 3VS0A 4OMMA 2LMJA 1SHGA 4RTXA 2CUBA 4OMPA 1GCQA 2RN8A 4EIKA 1RLPC 2CT3A 1ZUKA 4HVVA 2W0ZA 2EBPA 1AZEA 1KFZA 5FW9A 2YSQA 1X69A 1YN8A 4Z89A 1HJDA 1GCPA 3M0TA 2KT8A 3FJ5A 2L3PA 2RQWA 1QLYA 3I5RA 1VYTA 2KRNA 2A36A 4LE9A 3VRYA 2C0TA 4JZ4A 4Y92A 1M3BA 1GBRA 2EYZA 4QT7A 3H0IA 2RNAA 2RQUA 1I07A 1KSWA 1UJ0A 4RTWA 1T3LA 3PE0A 5ECAA 1AWOA 4M4ZA 1GFDA 1WXTA 1JU5C 3A98A 3C0CA 2DF6A 2EQIA 2JTEA 2D8JA 1B07A 2B86A 1TUDA 1X2KA 3JV3A 4J9DA 1H8KA 1Z9ZA 2MCNA 1UUEA 2KT1A 2K79A 1M3CA 1E6GA 1H3HA 4JJBA 2PNIA 1VYVA 2DX1A 3RBBB 2AKKA 2DBKA 5I11A 2YUQA 2KXDA 1OOTA 4GLMA 1WA7A 4JZ3A 2RF0A 2DM1A 4J9IA 4LUDA 3PVQA 3I35A 4LN2A 4AFZC 5EC7A 2RPNA 1NEGA 2DL3A 1X2QA 4AFQC 2ED1A 4X1VA 2L2PA 2DNUA 1SHFA 4CC2A 4DEYA 4GBQA 2H8HA 3H0FA 2DRKA 1W70A 2P4RA 1YP5A 1K76A 2DLPA 3VS2A 3TVTA 5IHIA 1JXOA 2EGAA 2VKNA 1Y0MA 2D8HA 2BZYA 1UJYA 2YUOA 1UDLA 3VS7A 2W10A 1UFFA 1AZGB 1M30A 2EYYA 1NLOC 1WFWA 3NPFA 2OI3A 3SEMA 1AOJA 2HEQA 2BZXA 4RTVA 1RLQC 4AFUC 2GTJA 3R6NA 4HVUA 3EGUA 4FSSA 1SRMA 1UGVA 1GCQC 1LCKA 4JJCA 1U3OA 2C0IA 1PNJA 2K2MA 4HXJA 3EG2A 1ZUYA 3M0PA 1T0HA 1N5ZA 2LJ3A 1J3TA 1PKSA 4WCIA 3EG3A 2V1QA 2M51A 4E6RA 3EG1A 3REBB 2CH4W 2FO0A 2K3BA 1BU1A 5FWBA 2AZSA 1FMKA 1QWFA 4D8KA 2C0OA 4R0KA 1ZUUA 1YNZA 1QCFA 3KFVA 2JS0A 2EGCA 1WI7A 3H41A 2CDTA 4J9BA 5IH2A 3NGPA 1E7OA 4A63B 3TSWA 4D8DA 1T3SA 1M27C 2EYXA 2I0NA 3EHRA 2GNCA 2FPEA 2NUZA 3CQTA 2O9VA 2LCSA 1TG0A 1FYNA 1WYXA 4CC7A 2DE0X 2OJ2A 2KRSA 3ULRB 1NYGA 1UG1A 1WXUA 1NEBA 2DVJA 1UECA 4LNPA 2RQTA 2LJ0A 4KRTA 2X3WD 4CC3A 1OEBA 1AD5A 2J6FA 2KBTA 1ARKA 2SEMA 2CSIA 1OV3A 2O2OA 1AWWA 1PHTA 4HCKA 2J6OA 2O9SA 1EFNA 3M0RA 5L23A 2J05A 1AWJA 1YWPA 2DRMA 4ORZA 1NYFA 2IIMA 3UA6A 1QKXA 1YCSB 1MUZA 2DL7A 2KNBB 2J6KA 3GBQA 2SRCA 1I1JA 4RTUA 2ENMA 2PZ1A 2GGRA 4RTZA 1GFCA 1GRIA 2FPDA 4F16A 1H92A 1ZBJA 2RQVA 4DEXA 4K11A 1JXMA 5FWCA 1K0XA 4ZNXA 2FEIA 1CSKA 1NG2A 1UHCA 2JM8A 2J06A 1VA7A 2YUNA 2CSQA 2K9GA 1MV0B 1QWEA 1X43A 1RUWA 2JMCA 1ABOA 3PVLA 2KROA 2A37A 2L3SA 2KR3A 1ZSGA 1V1CA 2K6DA 2LX7A 5IHKA 3I9QA 2D0NA 2ECZA 2JT4A 2DL8A 3VS1A 2EPDA 4CC4B 2KGTA 3ZL7C 1B3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SEM A;  4J9F A;  2BTT A;  4JPB W;  2VVK A;  1M8M A;  1SPK A;  2YDL A;  1K1Z A;  1K9A A;  3LH5 A;  3O5Z A;  1KIK A;  2D1X A;  3M0S A;  1IO6 A;  2LQW A;  4AG1 C;  2BZ8 A;  1AWX A;  2FRY A;  1BBZ A;  1UHF A;  1OPK A;  2CT4 A;  2EVR A;  1A0N B;  1PKT A;  2JS2 A;  2LJ1 A;  4Z88 A;  1E6H A;  2EKH A;  5GJW B;  2GBQ A;  4OMN A;  2YUP A;  2FG0 A;  2MOX A;  1M3A A;  2J7I A;  2AK5 A;  2KRM A;  4F17 A;  1QKW A;  1GBQ A;  1MV3 A;  2O31 A;  2JMA A;  2YT6 A;  1Y57 A;  3M0Q A;  1S1N A;  2L0A A;  1X6B A;  3TSZ A;  4OMO A;  4IIO A;  3RNJ A;  1YWO A;  2LQN A;  3EHQ A;  2M0Y A;  5HCK A;  2E5K A;  2MIO A;  1PWT A;  4RTY A;  2HDA A;  3UF4 A;  1K4U S;  2RQR A;  1SSH A;  2OAW A;  1W6X A;  2DYB A;  4ESR A;  5GJV B;  4OML A;  2A08 A;  3UAT A;  1JQQ A;  2KEA A;  1AEY A;  2EGE A;  1WXB A;  2JW4 A;  4AG2 C;  5I22 A;  2DL4 A;  1PRM C;  1X6G A;  2A28 A;  3QWY A;  3U23 A;  1VYU A;  2ROT A;  4F14 A;  1CKB A;  1ZLM A;  2DJQ A;  2DA9 A;  2NWM A;  2GTO A;  1KJW A;  2K7A A;  3VS6 A;  5IXB A;  2O88 A;  1RI9 A;  2FPF A;  2L3Q A;  4HVW A;  1NM7 A;  1SRL A;  2KYB A;  2ROL A;  2HBW A;  1ZX6 A;  1JEG A;  1G2B A;  4AFS C;  2RMO A;  2CRE A;  2F2V A;  2HCK A;  3M0U A;  2LP5 A;  3QWX X;  1X27 A;  1XOV A;  1GL5 A;  2G6F X;  2F2W A;  3REA B;  1OPL A;  3UA7 A;  1WDX A;  2DMO A;  1T0J A;  2ABL A;  2KE9 A;  1WX6 A;  5IHN A;  2AKL A;  4RTT A;  1WLP B;  2XMF A;  1Z9Q A;  3EG0 A;  1U5S A;  3NHN A;  2DL5 A;  2GQI A;  1UE9 A;  3THK A;  3VS3 A;  4JJD A;  3VS4 A;  4RUG A;  3VS5 A;  2VWF A;  1JO8 A;  2LNH B;  4J9C A;  4OMQ A;  2ESW A;  2EYW A;  2DIL A;  1CKA A;  1I0C A;  2FRW A;  2F2X A;  2V1R A;  3I5S A;  1ABQ A;  2AZV A;  3IQL A;  2HSP A;  2X3X D;  4J9H A;  1PRL C;  2CH4 A;  3H0H A;  2JXB A;  3NMZ C;  4Z8A A;  1NLP C;  1WIE A;  1W1F A;  5IXF A;  3VRZ A;  2JM9 A;  1K0S A;  1U06 A;  1UTI A;  4J9G A;  4IIM A;  1HD3 A;  1BB9 A;  4J9E A;  2CUD A;  2KYM A;  2LZ6 B;  3SHW A;  1TUC A;  4LUE A;  1HSQ A;  1G83 A;  2QDL A;  1BK2 A;  1AVZ C;  2KXC A;  2EW3 A;  2PTK A;  2DBM A;  2ED0 A;  3VS0 A;  4OMM A;  2LMJ A;  1SHG A;  4RTX A;  2CUB A;  4OMP A;  1GCQ A;  2RN8 A;  4EIK A;  1RLP C;  2CT3 A;  1ZUK A;  4HVV A;  2W0Z A;  2EBP A;  1AZE A;  1KFZ A;  5FW9 A;  2YSQ A;  1X69 A;  1YN8 A;  4Z89 A;  1HJD A;  1GCP A;  3M0T A;  2KT8 A;  3FJ5 A;  2L3P A;  2RQW A;  1QLY A;  3I5R A;  1VYT A;  2KRN A;  2A36 A;  4LE9 A;  3VRY A;  2C0T A;  4JZ4 A;  4Y92 A;  1M3B A;  1GBR A;  2EYZ A;  4QT7 A;  3H0I A;  2RNA A;  2RQU A;  1I07 A;  1KSW A;  1UJ0 A;  4RTW A;  1T3L A;  3PE0 A;  5ECA A;  1AWO A;  4M4Z A;  1GFD A;  1WXT A;  1JU5 C;  3A98 A;  3C0C A;  2DF6 A;  2EQI A;  2JTE A;  2D8J A;  1B07 A;  2B86 A;  1TUD A;  1X2K A;  3JV3 A;  4J9D A;  1H8K A;  1Z9Z A;  2MCN A;  1UUE A;  2KT1 A;  2K79 A;  1M3C A;  1E6G A;  1H3H A;  4JJB A;  2PNI A;  1VYV A;  2DX1 A;  3RBB B;  2AKK A;  2DBK A;  5I11 A;  2YUQ A;  2KXD A;  1OOT A;  4GLM A;  1WA7 A;  4JZ3 A;  2RF0 A;  2DM1 A;  4J9I A;  4LUD A;  3PVQ A;  3I35 A;  4LN2 A;  4AFZ C;  5EC7 A;  2RPN A;  1NEG A;  2DL3 A;  1X2Q A;  4AFQ C;  2ED1 A;  4X1V A;  2L2P A;  2DNU A;  1SHF A;  4CC2 A;  4DEY A;  4GBQ A;  2H8H A;  3H0F A;  2DRK A;  1W70 A;  2P4R A;  1YP5 A;  1K76 A;  2DLP A;  3VS2 A;  3TVT A;  5IHI A;  1JXO A;  2EGA A;  2VKN A;  1Y0M A;  2D8H A;  2BZY A;  1UJY A;  2YUO A;  1UDL A;  3VS7 A;  2W10 A;  1UFF A;  1AZG B;  1M30 A;  2EYY A;  1NLO C;  1WFW A;  3NPF A;  2OI3 A;  3SEM A;  1AOJ A;  2HEQ A;  2BZX A;  4RTV A;  1RLQ C;  4AFU C;  2GTJ A;  3R6N A;  4HVU A;  3EGU A;  4FSS A;  1SRM A;  1UGV A;  1GCQ C;  1LCK A;  4JJC A;  1U3O A;  2C0I A;  1PNJ A;  2K2M A;  4HXJ A;  3EG2 A;  1ZUY A;  3M0P A;  1T0H A;  1N5Z A;  2LJ3 A;  1J3T A;  1PKS A;  4WCI A;  3EG3 A;  2V1Q A;  2M51 A;  4E6R A;  3EG1 A;  3REB B;  2CH4 W;  2FO0 A;  2K3B A;  1BU1 A;  5FWB A;  2AZS A;  1FMK A;  1QWF A;  4D8K A;  2C0O A;  4R0K A;  1ZUU A;  1YNZ A;  1QCF A;  3KFV A;  2JS0 A;  2EGC A;  1WI7 A;  3H41 A;  2CDT A;  4J9B A;  5IH2 A;  3NGP A;  1E7O A;  4A63 B;  3TSW A;  4D8D A;  1T3S A;  1M27 C;  2EYX A;  2I0N A;  3EHR A;  2GNC A;  2FPE A;  2NUZ A;  3CQT A;  2O9V A;  2LCS A;  1TG0 A;  1FYN A;  1WYX A;  4CC7 A;  2DE0 X;  2OJ2 A;  2KRS A;  3ULR B;  1NYG A;  1UG1 A;  1WXU A;  1NEB A;  2DVJ A;  1UEC A;  4LNP A;  2RQT A;  2LJ0 A;  4KRT A;  2X3W D;  4CC3 A;  1OEB A;  1AD5 A;  2J6F A;  2KBT A;  1ARK A;  2SEM A;  2CSI A;  1OV3 A;  2O2O A;  1AWW A;  1PHT A;  4HCK A;  2J6O A;  2O9S A;  1EFN A;  3M0R A;  5L23 A;  2J05 A;  1AWJ A;  1YWP A;  2DRM A;  4ORZ A;  1NYF A;  2IIM A;  3UA6 A;  1QKX A;  1YCS B;  1MUZ A;  2DL7 A;  2KNB B;  2J6K A;  3GBQ A;  2SRC A;  1I1J A;  4RTU A;  2ENM A;  2PZ1 A;  2GGR A;  4RTZ A;  1GFC A;  1GRI A;  2FPD A;  4F16 A;  1H92 A;  1ZBJ A;  2RQV A;  4DEX A;  4K11 A;  1JXM A;  5FWC A;  1K0X A;  4ZNX A;  2FEI A;  1CSK A;  1NG2 A;  1UHC A;  2JM8 A;  2J06 A;  1VA7 A;  2YUN A;  2CSQ A;  2K9G A;  1MV0 B;  1QWE A;  1X43 A;  1RUW A;  2JMC A;  1ABO A;  3PVL A;  2KRO A;  2A37 A;  2L3S A;  2KR3 A;  1ZSG A;  1V1C A;  2K6D A;  2LX7 A;  5IHK A;  3I9Q A;  2D0N A;  2ECZ A;  2JT4 A;  2DL8 A;  3VS1 A;  2EPD A;  4CC4 B;  2KGT A;  3ZL7 C;  1B3Q A; 
#chains in the Genus database with same CATH topology
 5CO7 A;  4JLI A;  3EFO A;  2VVK A;  3O5Z A;  2A0F B;  2D1X A;  5GAO p;  2QTX A;  3QYG B;  1IO6 A;  2HMA A;  4AG1 C;  2CZ7 B;  2CGH A;  1BBZ A;  3QDR B;  1OPK A;  1YJN A;  1QVG S;  2LTO A;  2LJ1 A;  2EKH A;  1OI1 A;  3TRE A;  1D09 B;  5CR2 A;  4EMG A;  4OMN A;  3CCM A;  3JCM g;  1M8V A;  2J7I A;  5LJ5 e;  4IUT A;  2O31 A;  3OW2 S;  2MYS A;  3M0Q A;  3G6E Q;  1Q81 R;  1PD1 A;  1MNE A;  3TSZ A;  3A1P A;  4OMO A;  3RNJ A;  3RKX A;  2X35 A;  2HDA A;  2ZAE A;  4PJL A;  1KHI A;  2DTH A;  3PFS A;  1SSH A;  4FW1 A;  2VV5 A;  4X9D A;  4F7U B;  4ESR A;  4C8Q D;  4FIB A;  1VQN Q;  2KEA A;  4A53 A;  3CC2 A;  2FYK A;  2DL4 A;  4WF2 A;  2LRQ A;  3QWY A;  3G6E T;  1VYU A;  1MMG A;  3A8L B;  1ZLM A;  2HNI A;  5HK0 A;  1I8F A;  2GTO A;  2X4J A;  3PIO A;  4PJO C;  2HBP A;  1G3W A;  1YJ9 Q;  2PVG B;  2MAM A;  2L3Q A;  3M4G A;  2YRC A;  3KXT A;  2ZPF B;  1ZX6 A;  5LJ5 h;  4JRP A;  1JEG A;  1QMC A;  2CRE A;  4VUB A;  2LQ8 A;  4PJM A;  4NL3 A;  2BE7 D;  1X27 A;  1GL5 A;  2F2W A;  3REA B;  1X01 A;  1OPL A;  3X25 B;  1WDX A;  2DMO A;  4M77 E;  4AMC A;  2KE9 A;  5IHN A;  4RTT A;  1X6O A;  2CP5 A;  1R0C B;  1M90 R;  3EG0 A;  4RG2 A;  1U5S A;  5GMK j;  3PMI A;  3THK A;  1X75 C;  3MEU A;  3LWI A;  4RUG A;  3CMA T;  2LNH B;  2PUK B;  2XG8 D;  4QVZ A;  4OGC A;  2DPP B;  1VQ4 A;  1PRL C;  4HCZ A;  1XQH A;  2JTM A;  3NMZ C;  3WVE B;  2BUD A;  1W1F A;  2XK0 A;  3OQ5 A;  5HY6 A;  2QTV A;  3VRZ A;  2JM9 A;  2DYI A;  1U06 A;  4BE2 A;  3CCE Q;  1BI3 A;  4J9E A;  3SHW A;  4E2F B;  3JCM P;  1HSQ A;  2WAC A;  2A3L A;  5KYX A;  2RD1 A;  4C5I A;  2LMJ A;  4RTX A;  2CUB A;  2KI7 A;  3CPW P;  4BD3 A;  2CT3 A;  2E12 A;  5I21 A;  2EBP A;  3CD6 A;  4M7D E;  3CCE T;  5LJ5 f;  6AT1 B;  2KT8 A;  1VUB A;  2L3P A;  2RQW A;  4KGZ B;  4M75 C;  4ATO A;  2ZPH B;  3CC7 A;  4JZ4 A;  4C92 E;  4R56 A;  1GBR A;  3OYI A;  3JCM Q;  1VQK Q;  3CEY A;  1I07 A;  4QVD A;  5IT9 E;  5ECA A;  3CC7 Q;  4M4Z A;  1I4K 1;  1WXT A;  1JU5 C;  5L8R E;  3A98 A;  5M9O A;  2F5T X;  3EH1 A;  2D8J A;  2B86 A;  1YJN Q;  2DXT A;  1Z9Z A;  4J7I A;  4JRI A;  1UUE A;  2V26 A;  1VQ9 A;  1N27 A;  1KHC A;  1M3C A;  1Q86 U;  4JJN K;  1H3H A;  1VYV A;  3MEV A;  1R8O B;  4E7J A;  2JNG A;  4GLM A;  3ASK A;  2QG9 B;  2DM1 A;  1QW1 A;  1Q95 G;  4C8Q F;  4EPC A;  4Q5W A;  4RCC A;  1YBY A;  2ED1 A;  4KH0 B;  3OYD A;  1OX8 A;  1YJW A;  1U8R A;  4CC2 A;  2RHY A;  4DEY A;  4GBQ A;  2ZZD A;  4M75 E;  5KYY B;  3CC2 T;  2DRK A;  2P4R A;  4X9C A;  1YP5 A;  4M7D G;  2OTL Q;  1TU0 B;  4C8Q A;  1B7T A;  3JCM b;  4C0Z A;  4NL2 A;  2BZY A;  1UDL A;  3VS7 A;  2W10 A;  1UFF A;  4E7S A;  1VQ7 A;  1RAC B;  2HKN A;  1W2B A;  3OBW A;  2DER A;  3HRS A;  2E70 A;  9ATC B;  2KAF A;  3JCM J;  3HKS A;  1RLQ C;  4AFU C;  2GTJ A;  5A2Q E;  3RMS A;  1UGS B;  2PVD B;  4PFP A;  1VQO T;  2D0Q B;  1VQP T;  1VIE A;  1NBE B;  1GCQ C;  1LCK A;  2DTI A;  5CKB A;  2YLC A;  2DVE A;  4LXC A;  1ZUY A;  2LJ3 A;  1N5Z A;  2O4X B;  1W4S A;  5A0D A;  4HT8 A;  2V1Q A;  2M51 A;  2DO3 A;  4TVR A;  4E6R A;  3C94 A;  3OW2 A;  1Q7Y C;  1VQP A;  2CH4 W;  2FO0 A;  2K3B A;  1BU1 A;  3BW1 A;  1XNI A;  4C5E A;  5CKD A;  1ZSZ C;  2RJD A;  1VQ7 Q;  1UGP B;  3BDU A;  2C0O A;  4R0K A;  4C5H A;  4RG8 A;  3CCE A;  1YNZ A;  1RI0 A;  1M2V A;  3JRZ A;  2K3Y A;  1IRE B;  4CRI A;  2PQW A;  1PSF A;  2CDT A;  3A5Z B;  3URG A;  1Q7Y U;  1N6A A;  5GAN 3;  1D3B B;  3OYF A;  4OGE A;  5CQY A;  1WYX A;  4CC7 A;  1FX7 A;  2DE0 X;  1BKB A;  4NS5 A;  2LQK A;  1UG1 A;  2ZGW A;  3EGD B;  2LJ0 A;  5GAN 6;  4KRT A;  1Y07 A;  1OEB A;  1AD5 A;  4KUI A;  1VQ8 Q;  3N5B B;  1VQO Q;  4XQ3 A;  1ARK A;  1VIF A;  3OSV A;  1Q82 C;  4XU2 A;  2CSI A;  2PUO B;  4C8Q C;  2C06 A;  1YI2 Q;  1AWW A;  8AT1 B;  3FDR A;  2O9S A;  3M0R A;  2MPX C;  1AWJ A;  2RB6 A;  2AT1 B;  1K73 R;  1VQN T;  5GAN h;  2CP3 A;  3CCS T;  5GAM e;  2IIM A;  5GAO q;  4M75 D;  2RK1 A;  2IPO B;  1YCS B;  2DXC A;  2X51 A;  1WPY A;  2DL7 A;  5FU7 C;  4M7A G;  3GBQ A;  2CZ6 B;  1JB0 E;  4M78 A;  2BIV A;  1N9R A;  1VQK A;  4A4K A;  1GRI A;  5LJ3 j;  2E4H A;  1BIA A;  1NE8 A;  3AT1 B;  3CC7 T;  4PJO B;  3LGL A;  4ANJ A;  3OMC A;  1YIJ T;  4K11 A;  3LW5 E;  4ZNX A;  2FEI A;  2XU8 A;  1IGQ A;  2JN0 A;  2Y4Y A;  4F04 B;  4GLK A;  1VA7 A;  4M7A E;  1GXI E;  2E6Z A;  2K9G A;  1QWE A;  4FW2 A;  4MZM A;  3PVL A;  2KRO A;  2X4X A;  2FB7 A;  2L3S A;  3G6E A;  3I56 A;  2LT4 A;  5IAY A;  2P84 A;  3CCL A;  1WHK A;  4QKU A;  5GAN e;  4C0G A;  5GAM h;  4AT1 B;  2YLB A;  4PFO A;  1YIT Q;  2R58 A;  4JPB W;  4ME7 A;  1BYM A;  1K1Z A;  1KIK A;  3M0S A;  2RK2 A;  2LQW A;  5GAN 4;  1WHJ A;  1UHF A;  1ACM B;  2DXB A;  4N4I A;  2IG0 A;  5GMK i;  5GMK l;  1E6H A;  4ZTJ A;  2GBQ A;  4UC4 A;  2KDS A;  2MOX A;  3DKM A;  2KRM A;  2K2V A;  4D6W A;  1M2O A;  3HFO A;  1GBQ A;  2KK4 A;  3HRU A;  3CC4 Q;  5HK3 A;  1Y57 A;  5GMK h;  1S1N A;  1YIT A;  2L0A A;  3CD6 T;  3M54 A;  2E10 A;  2ZPB B;  4LD6 A;  4IIO A;  3OYA A;  4PLI A;  5KE2 A;  4Y91 A;  1YWO A;  1OU8 A;  2M0Y A;  5HCK A;  2E5K A;  2MIO A;  2WSE E;  3UF4 A;  2NYS A;  1K4U S;  2RQR A;  4OML A;  2K57 A;  2M16 A;  4OVA A;  1AEY A;  2EGE A;  2V8K A;  1LJO A;  5I22 A;  2A28 A;  1U1S A;  3OW2 P;  1PD0 A;  4F14 A;  1CKB A;  4XTZ A;  3F70 A;  1KJW A;  4M77 F;  2K7A A;  4QQG A;  3OS0 A;  1QP2 A;  4HVW A;  1NM7 A;  3QXE B;  1PM3 A;  2KYB A;  5AYF A;  2RMO A;  1WNL A;  5J39 A;  1YIJ Q;  3PTA A;  4Z02 A;  2LP5 A;  2DFU A;  1WZO A;  4PJO F;  3QWX X;  2V8J A;  3CXC P;  1KQ1 A;  3FJP A;  1FWZ A;  4BUG A;  1T0J A;  2RM4 A;  4B6M A;  3PMT A;  1WX6 A;  2AKL A;  3UT1 A;  1JJ2 P;  1KQS S;  5DM7 R;  2EQU A;  2XMF A;  2E1H A;  3NHN A;  2DL5 A;  1VQ6 T;  2XID A;  1Y96 A;  5GAN g;  3GNF B;  4BDY A;  3EFS A;  2KMT A;  3PNW C;  2DJZ A;  2O01 E;  1I5O B;  2VWF A;  2ESW A;  3RDV A;  2DIL A;  1CKA A;  1HK9 A;  1R77 A;  3IQL A;  1M2V B;  2AZV A;  1PC0 A;  4KH1 B;  1VQ8 T;  2X3X D;  4J9H A;  2K5I A;  2RI3 A;  1YJN T;  3A8M B;  2RO0 A;  2JXB A;  4Z8A A;  4LD9 K;  4WTO B;  2RJF A;  3G7Z A;  5IXF A;  1LNX A;  3L2W A;  3FRN A;  3SWN A;  4J9G A;  4IIM A;  1HD3 A;  1Q82 U;  2CUD A;  2KYM A;  3J7A F;  2LZ6 B;  4PJO D;  4LUE A;  1OYX A;  2QDL A;  1PCX A;  2KXC A;  3VJP A;  2ED0 A;  3VS0 A;  3I56 Q;  4OMM A;  4O6J A;  2B8A A;  1SHG A;  8ATC B;  3CME Q;  2DEU A;  1SF9 A;  4OMP A;  3L42 A;  4N0A A;  3OYG A;  4BI4 A;  4HVV A;  5A0L A;  3CC2 Q;  5GAN 5;  1O75 A;  3RR6 A;  1MMD A;  5FW9 A;  5J3B A;  4ZN3 A;  1RL2 A;  4KUL A;  4Z89 A;  1HJD A;  3OYM A;  3M0T A;  4KUD K;  1LVK A;  4XTY A;  2CP6 A;  2COY A;  3GNG A;  3I5R A;  5LJ3 g;  3VRY A;  3MKD A;  3GOX A;  1HYO A;  3OYK A;  4Y92 A;  1BI0 A;  1M3B A;  3VYG A;  4QT7 A;  3H0I A;  2RNA A;  2RQU A;  4FL6 A;  1ZBX A;  5FLX E;  1T3L A;  2LCC A;  3CPW A;  1GFD A;  4B9X A;  4M7D A;  3C0C A;  1Q82 R;  3JB9 F;  1D3B A;  3M4Y A;  1B07 A;  1TUD A;  1X2K A;  3JV3 A;  4J9D A;  2LC4 A;  2QA4 Q;  2VUB A;  3CME T;  1M1K C;  2F5K A;  3CCU A;  2P0P A;  2P0Q A;  3E2U A;  2FZK B;  1YCY A;  2RH2 A;  1HXD A;  2RHI A;  2DX1 A;  1SKU B;  2AKK A;  4EMK A;  5I11 A;  2VAS A;  3M55 A;  4C0D B;  3SD4 A;  4FT2 A;  1WHL A;  1BCM A;  3M59 A;  2RF0 A;  4OB1 B;  4J9I A;  1RAB B;  2QAZ A;  1YHQ Q;  2KY9 A;  3LLR A;  2RPN A;  1NEG A;  2DNU A;  1SHF A;  2H3E B;  4ZN1 A;  3VUZ A;  3VKI A;  4M7D D;  3JB9 D;  2V8I A;  3H0F A;  1W70 A;  3OYE A;  2HKQ B;  2QA4 T;  1K76 A;  1TTH B;  4V2S A;  3FB9 A;  4M77 D;  4M7A B;  3QUI A;  2Y4X A;  3L2U A;  3EH2 A;  3NTH A;  5KH6 A;  2D8H A;  1EZZ B;  1D1C A;  3SB2 A;  2YUO A;  1VQO A;  3G4S A;  1AZG B;  3JB9 G;  3LH0 A;  1M30 A;  2EYY A;  3OS1 A;  3CCJ T;  1VQ5 A;  1WFW A;  3NPF A;  5FRN A;  3BY7 A;  4JRK A;  2HEQ A;  3LWH A;  1ZA1 B;  3ME9 A;  1QQJ A;  3JCM f;  3FEO A;  4HVU A;  3EGU A;  1PSE A;  3TCJ A;  2ZPE B;  4FSS A;  4E7K A;  1KQ2 A;  1UGV A;  4JJC A;  4M7D F;  1U3O A;  4DQ2 A;  4HXJ A;  1PKS A;  3EG3 A;  4XU3 A;  1IHW A;  4YTL A;  3RIR A;  1NJI R;  2DET A;  2Z0W A;  1IZ6 A;  3REB B;  3AHU A;  5FWB A;  2HAX A;  1KC8 U;  3SDZ A;  5LJ3 e;  3CPW S;  1FMK A;  1TOV A;  2NUT A;  1QWF A;  2E3H A;  4D8K A;  2EQK A;  1ZUU A;  1JJ2 A;  4IUR A;  4ELZ C;  4J6X A;  2FVU A;  1M1G A;  3CCL Q;  2JS0 A;  2EGC A;  1WI7 A;  1NPP A;  4J9B A;  3NGP A;  1TSF A;  3ZFJ A;  4A63 B;  4D8D A;  1T3S A;  1M27 C;  3EHR A;  2GNC A;  2VXE A;  3C95 A;  3V8L A;  2XKO C;  4Y28 E;  2KRS A;  1MMA A;  3A8G B;  3ULR B;  1D0Y A;  5GAN j;  1FMV A;  1NEB A;  5CQX A;  1UEC A;  5FU7 B;  2HZY A;  2BE9 B;  1C0M A;  1UEB A;  3P8D A;  2J6F A;  3OSS C;  3T9N A;  1F1B B;  1K9M C;  4EMK C;  1Y96 B;  3CCV Q;  1SSF A;  3I55 Q;  5LJ3 h;  5KYU A;  1K73 U;  1PHT A;  3BDL A;  4C5G A;  5L23 A;  3NTI A;  2BKD N;  2J05 A;  2DKG A;  1MMN A;  2A7Y A;  2GF7 A;  5HKC A;  1KD1 C;  3OB9 A;  1NJI C;  1YWP A;  4KGX B;  3CCU Q;  4PLL A;  1NYF A;  1WHM A;  4OF1 A;  3V8J A;  1I81 A;  1R0B G;  2M1H A;  2VGM A;  2RA2 A;  1QKX A;  1MUZ A;  5GAM f;  2KNB B;  2X4Y A;  4M7A F;  4RTU A;  2M02 A;  2VGN A;  3MP8 A;  2ENM A;  4IKF A;  4BDZ A;  1WJQ A;  1BI2 A;  4M78 D;  2CP0 A;  5GAN 2;  3PT9 A;  3CXC A;  1H92 A;  3OYJ A;  4IUU A;  3CC4 A;  2RQV A;  4NOY A;  5FU6 B;  1JXM A;  5FWC A;  3G1J A;  2VYT A;  2ATC B;  1RAG B;  1UHC A;  3CCR A;  3DB3 A;  1TS9 A;  3ZEH A;  1MV0 B;  1N8R C;  1RUW A;  1ABO A;  3EAE A;  2DZC A;  2KR3 A;  5FRO A;  5GMK e;  5D6X A;  2LX7 A;  2D0N A;  2ECZ A;  2JT4 A;  4LDV A;  4QQ6 A;  4DOV A;  3WXM B;  4M7A C;  1S72 T;  1WGS A;  2PU9 B;  2KGT A;  4PNO A;  2DZ9 A;  3JCM c;  4J9F A;  1YHQ T;  1JRI A;  1MGQ A;  5LJ3 d;  5J26 A;  2YDL A;  3G4S Q;  1K9A A;  4N4H A;  3LH5 A;  4M77 B;  4M7A D;  2COW A;  3CCR T;  5GMK m;  2BZ8 A;  1AWX A;  4F7U E;  5KYN A;  2FRY A;  3HP9 A;  2D9T A;  2EQM A;  4XU1 A;  2CT4 A;  3G71 A;  2FL7 A;  2L8D A;  1PKT A;  3JCM X;  1UGQ B;  3DB4 A;  4X34 A;  5GJW B;  2YUP A;  4A4F A;  2FG0 A;  3OYC A;  3OBY A;  2FZG B;  4IUV A;  2QGG A;  1QKW A;  1YJ9 A;  5KYW B;  3ZBD A;  5CCA A;  4P5N A;  2XDP A;  2L89 A;  2AIR B;  2M0O A;  2YT6 A;  3EG9 A;  1TH7 A;  1VQ5 Q;  1X6B A;  1Q86 R;  3X20 B;  1NZ9 A;  2RHU A;  1C1A A;  4M75 G;  1XJW B;  3EHQ A;  4RTY A;  4DBH A;  3VV0 A;  3OY9 A;  2OAW A;  1W6X A;  2DYB A;  1G3S A;  1OZ3 A;  4XTW A;  2A08 A;  1VQ8 A;  1IGU A;  1WXB A;  1M9S A;  2JW4 A;  4LDY A;  4AG2 C;  2EFI A;  1VQL A;  4PJO E;  1PRM C;  3U23 A;  2E41 A;  2ROT A;  5GAO r;  3DLL A;  1YI2 A;  1BI1 A;  2DA9 A;  5CIU A;  2O4X A;  1VQK T;  3VS6 A;  2Y90 A;  2O88 A;  4FYW B;  3OMG A;  1SRL A;  1G2B A;  1VQL T;  3CCS Q;  2F2V A;  3OYB A;  2HCK A;  2QQB A;  3M0U A;  2MK5 A;  1VQ5 T;  2QQR A;  2DXU A;  2HD0 A;  1YHQ A;  3JCM V;  2CP2 A;  4JS4 A;  4C92 A;  1IHV A;  4DOW A;  1WLP B;  1K9M R;  1RAE B;  5GAO l;  5D6Y A;  2OTJ Q;  1G3T A;  2HQE A;  2K4Y A;  4JJD A;  3CCV T;  3VS4 A;  4QW2 A;  1YJ9 T;  3VS5 A;  5CKE A;  3JB9 J;  4OMQ A;  1KG1 A;  2EYW A;  4HCC A;  4OP0 A;  2F2X A;  1VQM A;  2RJE A;  3I5S A;  3M58 A;  1VQM T;  2HSP A;  3A8O B;  2HQH A;  5C0M A;  3MET A;  3V7R A;  2CH4 A;  2JUF A;  4E47 A;  3RES A;  1NLP C;  2P4T A;  3HRT A;  2H3J A;  3CME A;  3MO8 A;  3CCJ Q;  1AHJ B;  2QK0 A;  1QVG P;  1XTD A;  2L3R A;  4C92 B;  1BB9 A;  5KYU B;  3L1A A;  1KC8 R;  4M78 E;  5LJ5 j;  2OTJ A;  1G83 A;  2E5Q A;  1BK2 A;  5LJ5 d;  2EW3 A;  1S72 A;  2DTO A;  2VC8 A;  5EG2 A;  2F1L A;  4J83 A;  1OZ2 A;  4L6V 5;  2KVQ G;  3OA6 A;  2CZ0 B;  3HL8 A;  2I2L A;  1RLP C;  1ZUK A;  1VQ9 Q;  3EGX B;  1AZE A;  1VQ4 Q;  1KFZ A;  4QVC A;  4OB2 B;  2YSQ A;  1YN8 A;  3JCM d;  5KYW A;  2COZ A;  3FJ5 A;  2YRV A;  1VYT A;  4MZT A;  2C0T A;  1O9S A;  4XTV A;  1M90 U;  2EYZ A;  1Q81 U;  1UJ0 A;  3PE0 A;  2RJC A;  5DY9 A;  3V8K A;  2EQI A;  4KBM B;  2OTL T;  2OTL A;  1H8K A;  3M57 A;  2MCN A;  2CKK A;  3J80 E;  1RAD B;  3X24 B;  3QG1 A;  3QO3 A;  2K79 A;  3GF5 A;  4MZP A;  1MHN A;  3BE3 A;  4JJB A;  2PNI A;  1BIB A;  3UPU A;  1D1A A;  3RBB B;  2HQX A;  2DBK A;  2YWW A;  1VQL Q;  3CBM A;  1YJW Q;  2KXD A;  1OOT A;  4JZ3 A;  1QVF S;  4J8O A;  1PG5 B;  4AFZ C;  1QP3 A;  2DL3 A;  1Q7Y R;  1X2Q A;  1RAH B;  4AFQ C;  4X1V A;  2L2P A;  3SWN C;  1NJI U;  3MJX A;  3JSC A;  4PK4 A;  2G3R A;  2H8H A;  3OYH A;  4LDX A;  3I55 A;  2DLP A;  3VS2 A;  4RCB A;  1QVP A;  1IB8 A;  1JXO A;  3CCQ T;  2EGA A;  2VKN A;  2EJ9 A;  1UJY A;  4HA8 A;  2GCX A;  1W2B S;  3FLG A;  3HTR A;  3ER0 A;  4EDU A;  2QQS A;  2OI3 A;  3S6W A;  3TU4 K;  1AOJ A;  2ZPI B;  3TQ7 P;  3KUF A;  2BZX A;  4II1 A;  2DAQ A;  2JVV A;  1OUL A;  2MMP A;  3QII A;  3CBP A;  1SRM A;  3E9F A;  4HT9 A;  3VYH B;  2EAY A;  4R55 A;  1PNJ A;  2K2M A;  3M0P A;  2QEX Q;  2IVW A;  2QQA A;  4C0F A;  3JB9 I;  4J6Y A;  2QQ9 A;  4M78 B;  4DA4 A;  1OX9 A;  3EG1 A;  2ZCF B;  5CAI A;  4MDW A;  1G5V A;  2XIC A;  4A4G A;  2AZS A;  4KT0 E;  3C4S A;  1BCO A;  4HCB A;  3KFV A;  3CCR Q;  1WHH A;  3CCJ A;  3QZ9 B;  4BY6 B;  3LYI A;  4JUV A;  4L5G A;  1C6V X;  3MEA A;  4ZGE B;  4J5Y A;  5GAN f;  5IH2 A;  1E7O A;  3TSW A;  2I0N A;  4PJJ A;  3GPL A;  4M77 C;  2WSF E;  2O9V A;  2LCS A;  2GQV A;  2R57 A;  3QZ5 B;  3CMA A;  3JCM e;  2ZPG B;  1NYG A;  2K5L A;  4MDX A;  1RAA B;  1Y71 A;  4C92 C;  2F69 A;  3WVD B;  2CYZ B;  5GAN d;  3CCM Q;  3M53 A;  2RQT A;  2X4W A;  2JTF A;  4M75 B;  1M1K R;  4ZTF A;  4MMK A;  5GAO m;  3EFR A;  2QDY B;  1V76 A;  2WSC E;  1VQ7 T;  4HKE A;  1OV3 A;  3RUX A;  2O2O A;  3CCL T;  3RER A;  3QJY A;  4C8Q G;  2AHJ B;  4HCK A;  4KGV B;  2EYQ A;  1EFN A;  2DIG A;  4IUQ A;  4XK8 E;  2L5Q A;  2DRM A;  4XTU A;  3UA6 A;  5DLO A;  1WJR A;  4PKC C;  1IRX A;  5LJ5 g;  2P0K A;  3H8Z A;  2XHC A;  2GGR A;  4RTZ A;  1GFC A;  3P8H A;  1SG5 A;  1ZBJ A;  2GFU A;  5GAM j;  3JCM h;  2DD4 A;  1IXD A;  3OYY A;  2EQJ A;  3I55 T;  3BFM A;  1YI2 T;  2JM8 A;  2FHD A;  4E7I A;  2E3I A;  2J06 A;  2YXY A;  4M77 G;  4ZGD B;  2LCL A;  2CSQ A;  2JMC A;  4F7U G;  3X26 B;  2A37 A;  1ZSG A;  1V1C A;  3MP6 A;  2K6D A;  2EKO A;  5GAN 7;  5IHK A;  2R5M A;  3VS1 A;  2EPD A;  2E6N A;  1Q81 C;  4M78 F;  4FSX A;  4FYV B;  2VXF A;  4C8Q E;  1B3Q A;  2D6F A;  1SEM A;  2LT1 A;  1VQ6 Q;  2BTT A;  2XDB A;  1M8M A;  1SPK A;  4M78 C;  3LGF A;  3HPW A;  3QJ6 A;  5D6W A;  1D0Z A;  5KCH A;  4FYX B;  4IUP A;  3RKY A;  1K8A U;  4E7H A;  4JDS A;  1WJS A;  2JJ9 A;  2EVR A;  3QYH B;  5A0G A;  1A0N B;  1S72 Q;  2JS2 A;  4Z88 A;  3FC3 A;  1VQM Q;  5GAM g;  1ZQ1 A;  2EWN A;  2YHT A;  4C92 D;  3X28 B;  1OU9 A;  1M3A A;  2AK5 A;  4F17 A;  2M9U A;  3OYN A;  3E19 A;  2DIQ A;  3CCV A;  1MV3 A;  2JMA A;  3G71 T;  2QGF B;  2XDD A;  3S3M A;  2NLU A;  3M56 A;  3HFN A;  1YIT T;  3KBG A;  1KQS A;  2QEX T;  1B34 B;  2MWO A;  2LQN A;  1EIF A;  1PWT A;  2PVO B;  2GFA A;  1N8R R;  2NUT B;  3GLX A;  5GJV B;  3SWN B;  1TUG B;  3UAT A;  1M90 C;  1JQQ A;  3CXC S;  2QEX A;  3S3N A;  5D7U A;  2YRD A;  1X6G A;  2LVM A;  2DJQ A;  1KK7 A;  2NWM A;  1KQS P;  3QKJ A;  5C6S A;  5IXB A;  1RI9 A;  2VB6 A;  1ZHI A;  2FPF A;  1QVG A;  3CC4 T;  5FRM A;  2ROL A;  2HBW A;  4A4E A;  3FIF A;  3V7S A;  4AFS C;  4C92 F;  4DBR A;  5IN1 A;  1QCN A;  4M77 A;  1Q86 C;  4BI8 B;  1XOV A;  3MHX A;  2G6F X;  3UA7 A;  1Y7X A;  2ABL A;  4XU0 A;  3E9G A;  2KSS A;  2FZC B;  2EIF A;  3I56 T;  1Z9Q A;  4XAX B;  1YJW T;  2GQI A;  4C0D C;  1UE9 A;  4JS5 A;  3VS3 A;  3V7C A;  4F7U F;  1TXQ A;  2LNV A;  1JO8 A;  4J9C A;  3CCQ A;  1I0C A;  2EJF A;  2FRW A;  2QXF A;  1FMW A;  1RAI B;  2V1R A;  2MI6 A;  1ABQ A;  1YIJ A;  1LOJ A;  1NPR A;  3H0H A;  2CS7 A;  4EMK B;  3NFC A;  1JJ2 S;  3CCS A;  1WIE A;  3VUB A;  4QQD A;  1K0S A;  1UTI A;  5KE3 A;  2QI2 A;  1D1B A;  1TUC A;  1H64 1;  3UWN A;  1AVZ C;  3L2R A;  2PTK A;  1WQ7 A;  2DBM A;  4N4G A;  4E7Z A;  3DLM A;  2KQW A;  3EGD A;  1FXX A;  5CKH A;  1GCQ A;  2RN8 A;  4O5V A;  3MEW A;  4EIK A;  1RAF B;  4BE1 A;  2W0Z A;  4JRQ A;  4E7L A;  2LDM A;  2EJG A;  2K3X A;  3R6O A;  1X69 A;  4OB3 B;  4OMF B;  3NTK A;  3MP1 A;  1GCP A;  2RI2 A;  1KD1 U;  4L59 A;  2R5A A;  1QLY A;  1TWB A;  2KRN A;  3EFO B;  2A36 A;  4LE9 A;  4BAC A;  3QBY A;  3JB9 H;  1LPL A;  3JAM E;  1KSW A;  3OYL A;  4RTW A;  3SFM A;  2NUP A;  1OQK A;  1AWO A;  1WHG A;  1ZA2 B;  2DF6 A;  2JTE A;  5KYX B;  3PGG A;  1N8R U;  3CBO A;  3G4S T;  2KT1 A;  1D0X A;  4ELY C;  4M7D B;  2XD0 A;  4M75 F;  1E6G A;  4JLG A;  2E64 A;  2RI5 A;  2OTJ T;  3Q1J A;  3CMA Q;  5GAO n;  2YUQ A;  1WA7 A;  5I2M A;  4RKU E;  2QAS A;  4LUD A;  3PVQ A;  3I35 A;  4LN2 A;  5EC7 A;  3L2Q A;  5FU6 C;  3QSU A;  2K5F A;  1K8A C;  2NUP B;  3M5A A;  1ZSZ A;  2LX9 A;  4BY6 C;  1UGR B;  4EMH A;  4FT4 A;  3P8B B;  3TVT A;  1U1T A;  1WQW A;  5IHI A;  4CI0 C;  5I2S A;  2X9H A;  3EG9 B;  3C12 A;  1Y0M A;  3JCM W;  4PL6 A;  3CCU T;  5CK9 A;  3GP8 A;  1I5L A;  2RHX A;  3OS2 A;  2HSE B;  3MCA B;  3HHT B;  4BE0 A;  1NLO C;  4M75 A;  3SEM A;  3INZ A;  3H9N A;  1M4Z A;  4LDU A;  4RTV A;  4BI3 A;  3G71 Q;  3H6Z A;  3R6N A;  4J7F A;  2OAU A;  5GAN 8;  3QHS A;  3CD6 Q;  4XTX A;  7AT1 B;  2C0I A;  5AT1 B;  3E1S A;  1QCO A;  3EG2 A;  3RKW A;  4A4H A;  1T0H A;  1K8A R;  4DBF A;  1J3T A;  4WCI A;  4OB0 B;  4FCY A;  3L2V A;  3O8V A;  3CCQ Q;  3GIB A;  2DEQ A;  3RMQ A;  1M1K U;  1EX4 A;  4C8Q B;  1UB4 A;  5CVI A;  4PJN A;  2CZ1 B;  3OS5 A;  1VQ9 T;  1QCF A;  4PJO A;  4GY5 A;  3J81 E;  1KC8 C;  3H41 A;  1N9S A;  3L2Z A;  1K73 C;  2EYX A;  1ZSZ B;  2FPE A;  5DLQ E;  1K9M U;  2NUZ A;  3CQT A;  5KYY A;  2QA4 A;  2CP7 A;  2JZ2 A;  2JOY A;  3HSB A;  1H3Z A;  3UDC A;  1TG0 A;  1FYN A;  4FYY B;  1AT1 B;  1M5Q 1;  4M78 G;  2OJ2 A;  5KCO A;  1VOM A;  3PIP A;  1WXU A;  2HL3 A;  2DVJ A;  4M7D C;  3MPU B;  1G8X A;  2RHZ A;  3LX7 A;  2HL5 C;  4LNP A;  2MWP A;  2X3W D;  5CKF A;  4CC3 A;  4FU6 A;  4J6W A;  1B34 A;  5LL6 S;  2KBT A;  4RMO A;  2SEM A;  3TEE A;  3D7S B;  1V29 B;  1KD1 R;  1DJ7 B;  2E65 A;  2J6O A;  4F7U A;  4ZGJ B;  1VQN A;  1QVF P;  4DBQ A;  4ORZ A;  4FM4 B;  1VQ6 A;  2OX7 A;  2XI9 A;  5LJ3 f;  3CPF A;  4N0A C;  2J6K A;  2SRC A;  1VQ4 T;  1I1J A;  4C92 G;  3QPH A;  2PZ1 A;  1M1F A;  2FPD A;  3QDF A;  4LDW A;  2MF2 A;  4PFZ A;  4F16 A;  1G3Y A;  3M9Q A;  2QYZ A;  4DEX A;  3CCM T;  3S3O A;  4BB7 A;  1P92 A;  1K0X A;  2DD5 A;  3VU3 C;  1QVF A;  1CSK A;  1NG2 A;  1W2B P;  4MML A;  2YUN A;  1VQP Q;  4A54 A;  3A8H B;  4B9W A;  1X43 A;  1JBM A;  1MND A;  3I9Q A;  1YFN A;  2DL8 A;  2DK3 A;  4PJO G;  4CC4 B;  3ZL7 C;  3EGX A;  4M7A A;  5GAM d; 
#chains in the Genus database with same CATH homology
 1SEM A;  4J9F A;  2BTT A;  4JPB W;  2VVK A;  1M8M A;  1SPK A;  2YDL A;  1K1Z A;  1K9A A;  3LH5 A;  3O5Z A;  1KIK A;  2D1X A;  3M0S A;  1IO6 A;  2LQW A;  4AG1 C;  2BZ8 A;  1AWX A;  2FRY A;  1BBZ A;  1UHF A;  1OPK A;  2CT4 A;  2EVR A;  1A0N B;  1PKT A;  2JS2 A;  2LJ1 A;  4Z88 A;  1E6H A;  2EKH A;  5GJW B;  2GBQ A;  4OMN A;  2YUP A;  2FG0 A;  2MOX A;  1M3A A;  2J7I A;  2AK5 A;  2KRM A;  4F17 A;  1QKW A;  1GBQ A;  1MV3 A;  2O31 A;  2JMA A;  2YT6 A;  1Y57 A;  3M0Q A;  1S1N A;  2L0A A;  1X6B A;  3TSZ A;  4OMO A;  4IIO A;  3RNJ A;  1YWO A;  2LQN A;  3EHQ A;  2M0Y A;  5HCK A;  2E5K A;  2MIO A;  1PWT A;  4RTY A;  2HDA A;  3UF4 A;  1K4U S;  2RQR A;  1SSH A;  2OAW A;  1W6X A;  2DYB A;  4ESR A;  5GJV B;  4OML A;  2A08 A;  3UAT A;  1JQQ A;  2KEA A;  1AEY A;  2EGE A;  1WXB A;  2JW4 A;  4AG2 C;  5I22 A;  2DL4 A;  1PRM C;  1X6G A;  2A28 A;  3QWY A;  3U23 A;  1VYU A;  2ROT A;  4F14 A;  1CKB A;  1ZLM A;  2DJQ A;  2DA9 A;  2NWM A;  2GTO A;  1KJW A;  2K7A A;  3VS6 A;  5IXB A;  2O88 A;  1RI9 A;  2FPF A;  2L3Q A;  4HVW A;  1NM7 A;  1SRL A;  2KYB A;  2ROL A;  2HBW A;  1ZX6 A;  1JEG A;  1G2B A;  4AFS C;  2RMO A;  2CRE A;  2F2V A;  2HCK A;  3M0U A;  2LP5 A;  3QWX X;  1X27 A;  1XOV A;  1GL5 A;  2G6F X;  2F2W A;  3REA B;  1OPL A;  3UA7 A;  1WDX A;  2DMO A;  1T0J A;  2ABL A;  2KE9 A;  1WX6 A;  5IHN A;  2AKL A;  4RTT A;  1WLP B;  2XMF A;  1Z9Q A;  3EG0 A;  1U5S A;  3NHN A;  2DL5 A;  2GQI A;  1UE9 A;  3THK A;  3VS3 A;  4JJD A;  3VS4 A;  4RUG A;  3VS5 A;  2VWF A;  1JO8 A;  2LNH B;  4J9C A;  4OMQ A;  2ESW A;  2EYW A;  2DIL A;  1CKA A;  1I0C A;  2FRW A;  2F2X A;  2V1R A;  3I5S A;  1ABQ A;  2AZV A;  3IQL A;  2HSP A;  2X3X D;  4J9H A;  1PRL C;  2CH4 A;  3H0H A;  2JXB A;  3NMZ C;  4Z8A A;  1NLP C;  1WIE A;  1W1F A;  5IXF A;  3VRZ A;  2JM9 A;  1K0S A;  1U06 A;  1UTI A;  4J9G A;  4IIM A;  1HD3 A;  1BB9 A;  4J9E A;  2CUD A;  2KYM A;  2LZ6 B;  3SHW A;  1TUC A;  4LUE A;  1HSQ A;  1G83 A;  2QDL A;  1BK2 A;  1AVZ C;  2KXC A;  2EW3 A;  2PTK A;  2DBM A;  2ED0 A;  3VS0 A;  4OMM A;  2LMJ A;  1SHG A;  4RTX A;  2CUB A;  4OMP A;  1GCQ A;  2RN8 A;  4EIK A;  1RLP C;  2CT3 A;  1ZUK A;  4HVV A;  2W0Z A;  2EBP A;  1AZE A;  1KFZ A;  5FW9 A;  2YSQ A;  1X69 A;  1YN8 A;  4Z89 A;  1HJD A;  1GCP A;  3M0T A;  2KT8 A;  3FJ5 A;  2L3P A;  2RQW A;  1QLY A;  3I5R A;  1VYT A;  2KRN A;  2A36 A;  4LE9 A;  3VRY A;  2C0T A;  4JZ4 A;  4Y92 A;  1M3B A;  1GBR A;  2EYZ A;  4QT7 A;  3H0I A;  2RNA A;  2RQU A;  1I07 A;  1KSW A;  1UJ0 A;  4RTW A;  1T3L A;  3PE0 A;  5ECA A;  1AWO A;  4M4Z A;  1GFD A;  1WXT A;  1JU5 C;  3A98 A;  3C0C A;  2DF6 A;  2EQI A;  2JTE A;  2D8J A;  1B07 A;  2B86 A;  1TUD A;  1X2K A;  3JV3 A;  4J9D A;  1H8K A;  1Z9Z A;  2MCN A;  1UUE A;  2KT1 A;  2K79 A;  1M3C A;  1E6G A;  1H3H A;  4JJB A;  2PNI A;  1VYV A;  2DX1 A;  3RBB B;  2AKK A;  2DBK A;  5I11 A;  2YUQ A;  2KXD A;  1OOT A;  4GLM A;  1WA7 A;  4JZ3 A;  2RF0 A;  2DM1 A;  4J9I A;  4LUD A;  3PVQ A;  3I35 A;  4LN2 A;  4AFZ C;  5EC7 A;  2RPN A;  1NEG A;  2DL3 A;  1X2Q A;  4AFQ C;  2ED1 A;  4X1V A;  2L2P A;  2DNU A;  1SHF A;  4CC2 A;  4DEY A;  4GBQ A;  2H8H A;  3H0F A;  2DRK A;  1W70 A;  2P4R A;  1YP5 A;  1K76 A;  2DLP A;  3VS2 A;  3TVT A;  5IHI A;  1JXO A;  2EGA A;  2VKN A;  1Y0M A;  2D8H A;  2BZY A;  1UJY A;  2YUO A;  1UDL A;  3VS7 A;  2W10 A;  1UFF A;  1AZG B;  1M30 A;  2EYY A;  1NLO C;  1WFW A;  3NPF A;  2OI3 A;  3SEM A;  1AOJ A;  2HEQ A;  2BZX A;  4RTV A;  1RLQ C;  4AFU C;  2GTJ A;  3R6N A;  4HVU A;  3EGU A;  4FSS A;  1SRM A;  1UGV A;  1GCQ C;  1LCK A;  4JJC A;  1U3O A;  2C0I A;  1PNJ A;  2K2M A;  4HXJ A;  3EG2 A;  1ZUY A;  3M0P A;  1T0H A;  1N5Z A;  2LJ3 A;  1J3T A;  1PKS A;  4WCI A;  3EG3 A;  2V1Q A;  2M51 A;  4E6R A;  3EG1 A;  3REB B;  2CH4 W;  2FO0 A;  2K3B A;  1BU1 A;  5FWB A;  2AZS A;  1FMK A;  1QWF A;  4D8K A;  2C0O A;  4R0K A;  1ZUU A;  1YNZ A;  1QCF A;  3KFV A;  2JS0 A;  2EGC A;  1WI7 A;  3H41 A;  2CDT A;  4J9B A;  5IH2 A;  3NGP A;  1E7O A;  4A63 B;  3TSW A;  4D8D A;  1T3S A;  1M27 C;  2EYX A;  2I0N A;  3EHR A;  2GNC A;  2FPE A;  2NUZ A;  3CQT A;  2O9V A;  2LCS A;  1TG0 A;  1FYN A;  1WYX A;  4CC7 A;  2DE0 X;  2OJ2 A;  2KRS A;  3ULR B;  1NYG A;  1UG1 A;  1WXU A;  1NEB A;  2DVJ A;  1UEC A;  4LNP A;  2RQT A;  2LJ0 A;  4KRT A;  2X3W D;  4CC3 A;  1OEB A;  1AD5 A;  2J6F A;  2KBT A;  1ARK A;  2SEM A;  2CSI A;  1OV3 A;  2O2O A;  1AWW A;  1PHT A;  4HCK A;  2J6O A;  2O9S A;  1EFN A;  3M0R A;  5L23 A;  2J05 A;  1AWJ A;  1YWP A;  2DRM A;  4ORZ A;  1NYF A;  2IIM A;  3UA6 A;  1QKX A;  1YCS B;  1MUZ A;  2DL7 A;  2KNB B;  2J6K A;  3GBQ A;  2SRC A;  1I1J A;  4RTU A;  2ENM A;  2PZ1 A;  2GGR A;  4RTZ A;  1GFC A;  1GRI A;  2FPD A;  4F16 A;  1H92 A;  1ZBJ A;  2RQV A;  4DEX A;  4K11 A;  1JXM A;  5FWC A;  1K0X A;  4ZNX A;  2FEI A;  1CSK A;  1NG2 A;  1UHC A;  2JM8 A;  2J06 A;  1VA7 A;  2YUN A;  2CSQ A;  2K9G A;  1MV0 B;  1QWE A;  1X43 A;  1RUW A;  2JMC A;  1ABO A;  3PVL A;  2KRO A;  2A37 A;  2L3S A;  2KR3 A;  1ZSG A;  1V1C A;  2K6D A;  2LX7 A;  5IHK A;  3I9Q A;  2D0N A;  2ECZ A;  2JT4 A;  2DL8 A;  3VS1 A;  2EPD A;  4CC4 B;  2KGT A;  3ZL7 C;  1B3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...