1M4ZA

Crystal structure of the n-terminal bah domain of orc1p
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
217
structure length
203
Chain Sequence
AMTMAKTLKDLQGWEIITTDEQGNITEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORIGIN RECOGNITION COMPLEX SUBUNIT 1
publication title Structure and function of the BAH-containing domain of Orc1p in epigenetic silencing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 54
structure length 203
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m4zA01
4DA4A 3PTAA 4KUIA 4DOWA 4KULA 2FVUA 4FT4A 4BB7A 4DOVA 2FL7A 1M4ZA 1ZHIA 3PT9A 4JJNK 1W4SA 1ZBXA 4FSXA 4LD9K 3TU4K 4KUDK 4FT2A
chains in the Genus database with same CATH superfamily
4E7JA 4A4EA 5KYXB 4HVUA 2RI2A 4M75G 5L8RE 2MPXC 2RHXA 4LE9A 3CCJT 1YJWQ 2EYWA 3PE0A 3TCJA 1OU9A 3QSUA 4DOVA 2FEIA 2LNHB 1N9RA 3BY7A 1D0ZA 2DXUA 4CC2A 4C0DB 4R56A 3OYDA 1D3BB 1PRLC 3DKMA 4QKUA 3QKJA 5EG2A 3OYMA 2O4XB 1V1CA 2GBQA 4M7DB 4E6RA 4LDWA 5LJ5e 1UJ0A 2DO3A 1V76A 2KYBA 2K9GA 4XU1A 3EHQA 2BUDA 2FVUA 2RPNA 2HQEA 1BKBA 3JCMg 2QQ9A 1OZ2A 3M55A 4C5IA 1K73C 1YFNA 3R6NA 3UA6A 4F7UB 1RI9A 2L0AA 3VKIA 3CCRT 1VQ7T 4MZMA 3CCQA 1X6BA 3AHUA 4XTZA 1BK2A 1G5VA 3QO3A 2HNIA 2PVDB 2MCNA 2KT1A 1Q7YU 2G3RA 5C0MA 4M78A 2FL7A 3JRZA 1HD3A 2K2VA 1OPKA 2E10A 3OS5A 2L3RA 3A8GB 1RAGB 5GANf 1H3HA 2EYZA 2RH2A 2F69A 3LW5E 3RKWA 3CC7T 1M5Q1 1YHQT 1VQ6A 1KIKA 1AEYA 3TEEA 4F04B 1M1KC 3M0RA 3P8DA 3CCVA 3LH0A 3VS1A 3MEVA 1V29B 1VQ9A 1HYOA 2LJ3A 3QJYA 1VYTA 2QI2A 1W2BP 1NG2A 3PMTA 3UT1A 4LXCA 4PJOB 1UGQB 3QHSA 3OYFA 1X01A 3BDLA 3JCMh 1N5ZA 1GL5A 2HL5C 3HKSA 1CKBA 1X6GA 2CP5A 2NLUA 3RUXA 2P84A 3RBBB 1BI1A 2K7AA 5EC7A 2X4WA 1X2QA 3HTRA 1VQLQ 2EWNA 2HDAA 2F2WA 3X26B 2C0IA 2EW3A 3M0PA 3EG2A 3CCMQ 1RAFB 2LCLA 3CCLQ 4M78G 1KG1A 3NGPA 2BTTA 4PJJA 4XTUA 2LJ0A 5GAOq 1KQSP 1GRIA 3INZA 1AD5A 3SFMA 4ORZA 3J81E 1Q95G 2DTIA 5GAN4 3LYIA 1RL2A 1X75C 2J05A 1ZBJA 5GANe 1YIJT 2Y4YA 1JJ2A 5IXFA 2DL3A 2OI3A 1VOMA 1ABOA 4E7KA 2D6FA 1MMGA 3OBYA 3QXEB 3J7AF 5KYXA 4AFSC 5ECAA 2RQVA 2RI3A 4OP0A 3OW2S 2MMPA 3H9NA 1NPRA 2LDMA 1NBEB 1IRXA 3I56Q 2HD0A 3QZ5B 4RCBA 4HVWA 3TREA 1AOJA 2FYKA 3OSSC 2GTJA 2YT6A 3M0UA 1D3BA 5L23A 4J6YA 4EDUA 2LCCA 2DPPB 2O4XA 4M7DA 3PNWC 4C92E 1G3WA 2F2VA 4KBMB 2NUPB 1NEGA 2D8JA 3CPWS 4R0KA 3U23A 3EG3A 3CCJQ 2DL4A 4M7AF 4C92D 4Z02A 3QZ9B 2A7YA 4X1VA 3NFCA 2KNBB 2BZYA 3L2WA 2E6ZA 3S3NA 3LWIA 4LDYA 3QPHA 4F7UA 4IUTA 1VQ8T 2HKQB 3PFSA 5GAMe 3A8OB 4JZ4A 1QP2A 1OX8A 1VQLA 2JM8A 4MZPA 1NYGA 4M78F 5GAN5 5IHKA 2KSSA 3I9QA 2HKNA 5I11A 3CCMA 1ZBXA 2AHJB 3CCLA 2GF7A 4NL2A 4M75C 4P5NA 2XMFA 1O9SA 2PVGB 2FZKB 4BE2A 2LTOA 1WYXA 3J80E 4FW2A 2CP3A 3HRSA 1OOTA 1M2VB 3CCRQ 4WCIA 1VQ7Q 3UPUA 1JEGA 3R6OA 5I22A 2X4JA 4C5GA 2D1XA 3L1AA 4QVDA 4M7DG 4PJLA 3MP8A 1WJRA 4OB3B 2J6KA 4PK4A 2QTVA 4BI8B 4ZGJB 2KRNA 2AZVA 1FMKA 1KD1R 4Q5WA 2QQBA 4PJOA 1N8RR 1FX7A 3TSZA 3QBYA 1YJ9T 1T0JA 1QCFA 2DRKA 2E70A 2M51A 3HP9A 3I56A 4FM4B 1M1GA 3X20B 3L2QA 3CC7Q 1WHMA 4KGZB 4DBRA 1YHQQ 4AFUC 3GPLA 1C6VX 1ZSZB 5IN1A 5A0DA 3TVTA 2YUQA 5AYFA 1JQQA 1Y71A 3JB9H 2J06A 4A54A 2GGRA 4F7UG 4R55A 3EGUA 2DILA 2PUKB 1BI2A 1AWOA 4X9DA 3CCJA 3PVLA 4HT9A 1GFDA 1I07A 1QKWA 1VYUA 1KD1U 4J8OA 3VRYA 1YITT 1N8RU 1M1FA 2EQJA 2AT1B 2LX9A 2RJCA 2LQKA 1WXTA 5GAN2 5I2MA 1M2OA 4C0ZA 1Z9ZA 4RKUE 1RACB 3OY9A 1WXBA 4JLIA 2FG0A 3Q1JA 3JB9D 3EH1A 2DLPA 2X3XD 2B86A 2LQNA 3EFOB 1UUEA 2AKLA 2DFUA 1JXMA 3SHWA 4J7FA 4N4HA 3CCRA 1VQ7A 1BIAA 4Z88A 4PJOG 1RAHB 2RK2A 1VUBA 2E1HA 2XK0A 5LL6S 1QCOA 2DERA 1YIJQ 1KFZA 1AHJB 2KI7A 1K9MR 2EYQA 4ZGEB 4LUDA 2L8DA 2NUPA 2X35A 3OYCA 1QCNA 1QVPA 4C8QC 4L6V5 3CCST 1Q86C 2BE7D 3AT1B 3HL8A 2V26A 2X9HA 2CS7A 1YJWT 2CZ6B 2WSEE 4LDUA 4PFZA 3HSBA 3CC7A 1RI0A 1PD1A 2XHCA 1YHQA 2L3PA 2RHIA 5GAOn 1PHTA 3KFVA 3EGXA 1A0NB 1MMNA 3QWYA 4ELYC 2FPDA 4D8DA 5LJ3e 5FU7C 2NYSA 4CC4B 2HL3A 1S1NA 2CDTA 3HFNA 3N5BB 2CP2A 1JO8A 4XTXA 3FDRA 1H641 3CC2T 4J6WA 1ZUYA 8AT1B 3JAME 1K9MU 1NYFA 4F17A 1I5OB 1D1AA 2QQRA 4E2FB 2BZ8A 4PFOA 4AG2C 3H6ZA 4MMKA 2VGMA 2YSQA 2COZA 2LMJA 5GAN8 1YBYA 3P8HA 1VQ8Q 1M2VA 2ZPBB 1VQMT 2CSIA 1FMVA 1XOVA 2ESWA 2ZCFB 4RMOA 2VGNA 1E7OA 1H92A 2EJ9A 3A5ZB 1OULA 4O5VA 1E6GA 3JCMQ 2E5KA 5D6WA 2QASA 3KBGA 1MMAA 4II1A 1Y7XA 2VASA 1WIEA 3OYYA 2KGTA 2QEXT 1ZSZA 2IPOB 1YIJA 3UF4A 2QTXA 4C8QB 3PIOA 4ME7A 4RTYA 5LJ5h 1ZX6A 1VQKT 1JBMA 2LT4A 3V8JA 1OX9A 2CUDA 1KJWA 1QLYA 3RDVA 2ZPIB 3OA6A 3OYHA 2DIGA 2OTJQ 4JRQA 1YJ9Q 3EH2A 3ME9A 3CPFA 2F2XA 1SHFA 2ROTA 1U5SA 2CH4A 2ENMA 2FHDA 2CP0A 3H0HA 3EG0A 1WQWA 1QVGS 1NE8A 1U1SA 1WX6A 3RMSA 3DLLA 3V8KA 2RB6A 4C0DC 2DEQA 1I81A 2HCKA 2MWPA 3L42A 3SD4A 3S3OA 1D1BA 3NTHA 3CBPA 3EFOA 1LVKA 2K6DA 1IGQA 4M7DC 4N0AA 3OB9A 1UHFA 2I2LA 3FB9A 4IIOA 3OYLA 3QUIA 1YITQ 1PC0A 5LJ5f 2H8HA 1NJIR 1VQ8A 1XNIA 4M7AE 1WZOA 4HT8A 3WVDB 3EG9B 3GLXA 1KSWA 4FT4A 1VQNT 2KR3A 1NZ9A 2PVOB 3G6ET 2JOYA 2EYYA 1AWJA 1G3YA 2KYMA 2DE0X 4IUQA 4J9DA 4ZTFA 2ECZA 1Q82R 3M58A 4BE1A 2NWMA 2O2OA 6AT1B 5GMKm 1RAAB 4QW2A 2VVKA 1TG0A 4JLGA 3OYJA 1NJIU 2HMAA 5GAN3 1M4ZA 3C12A 4XU0A 4IKFA 2YLBA 2QYZA 5IH2A 1OQKA 4RTWA 2CYZB 3M0TA 2EAYA 1QQJA 3CCSQ 3GOXA 3OYGA 3S3MA 5GAN7 2OTJA 1YJ9A 4OGCA 5CVIA 5DM7R 5IHIA 2RF0A 4DQ2A 4J9BA 1PKTA 1Q82U 2LQWA 1HSQA 3X25B 3OYIA 3VRZA 5CKHA 4FYXB 3VYHB 5GANh 4PJOC 2JXBA 1Q7YR 1MUZA 2MF2A 1W1FA 3CC2Q 4PKCC 2P4TA 3L2UA 4DBHA 1PCXA 1WHLA 2VB6A 1M3AA 2JS2A 3G1JA 3H8ZA 3GNGA 1YITA 5M9OA 2MYSA 5J26A 3FLGA 4LN2A 2QQSA 4OGEA 1RAIB 2NUTB 2K4YA 1VQMQ 4C8QA 2RQRA 3EAEA 3META 2DZCA 4C92C 1K76A 1JJ2P 1Y0MA 4EIKA 2CUBA 3C0CA 5DLQE 2XU8A 2K2MA 1VQ4T 4IIMA 3M0QA 1WXUA 3C4SA 3FJ5A 4OF1A 2JM9A 2DYBA 3A8MB 1WHKA 3DB4A 2DD5A 2QEXQ 2DIQA 4BACA 1FWZA 1TOVA 2V8IA 4BI4A 1IGUA 5LJ5j 1K8AR 5AT1B 2LJ1A 4K11A 2JS0A 4M75F 1VQKQ 3THKA 2QGFB 4E7SA 1P92A 4BD3A 3ULRB 1IHVA 3CCSA 2L3SA 1W2BS 4FYYB 1YJWA 3FJPA 2JNGA 4JZ3A 4N4GA 1GBRA 2AIRB 3NPFA 3CMET 5CKFA 1QWEA 2EGEA 1TWBA 5GMKl 2EKHA 4DEYA 1M9SA 3EG9A 1LPLA 2PNIA 1U06A 3NMZC 3CC2A 4M77E 1K8AU 1KC8U 2EQKA 4XTYA 4OB2B 4RCCA 3EFRA 1WNLA 4C8QG 1BI3A 1UGRB 3OYAA 4M77D 1K0XA 5GAMf 4RTTA 4J9EA 5CO7A 4HCBA 3RNJA 3I55T 4KULA 1KQSS 4C92B 1ABQA 2Y90A 3G71Q 2HBPA 2R5MA 1SRLA 3A1PA 2X3WD 4RTVA 2JT4A 1VQMA 2O31A 4NOYA 5D6XA 1VIEA 3MCAB 2HSEB 5GAOr 4F16A 1R0CB 2K5LA 2ED0A 1VQNQ 4X34A 1WQ7A 1JB0E 1UTIA 3G6EQ 4ZN3A 2DL7A 5A0GA 3BFMA 3C94A 4A63B 2R5AA 2VC8A 3QIIA 4BE0A 3MEWA 3CCUT 1U1TA 2F5TX 2QEXA 2GCXA 3GF5A 3DLMA 4XK8E 1W70A 3OS1A 4ESRA 3TU4K 1KD1C 1N8RC 3JCMX 1CSKA 2VUBA 2KXCA 4EMGA 1VQKA 3CQTA 4DA4A 4ZTJA 2RJDA 3HPWA 5FRNA 1K73U 4AFZC 2J6FA 1SKUB 2XDBA 1ZSZC 1WJQA 2EYXA 2WACA 1IREB 2X4YA 1MV0B 1B7TA 4PJNA 2PQWA 3SB2A 4BY6C 5GANj 2MK5A 1Q81R 2NUTA 3PTAA 4C8QF 1UHCA 1OYXA 2YLCA 3RKYA 1PRMC 2GFUA 5KYYB 1M8VA 2YXYA 2YRDA 3RKXA 2J7IA 3I5RA 1M3CA 2KY9A 1IZ6A 1MNEA 3A8HB 2CZ0B 2OJ2A 4QT7A 2M9UA 4WTOB 5HY6A 2R58A 2DL8A 1R0BG 5GAOm 4KGVB 2PTKA 1OPLA 1WPYA 4CI0C 3MKDA 3BE3A 1HXDA 2RI5A 4MDWA 4J9HA 5LJ5d 2JZ2A 1VQNA 3GNFB 4LD6A 4QQGA 4N0AC 1VA7A 1Q81U 5A0LA 3SDZA 1AT1B 3G6EA 5GAN6 1SPKA 1SF9A 5FWCA 1UEBA 3A98A 2FPFA 4UC4A 3NTKA 2FO0A 3RR6A 3MO8A 4XU3A 1Y57A 1VQ4Q 2DX1A 1QKXA 2YWWA 1K9MC 2V8JA 2OTJT 5IXBA 2OTLT 3JCMe 4ANJA 3FIFA 3E2UA 4AG1C 3M54A 1XJWB 1D0YA 1BBZA 5FROA 4MDXA 1I4K1 5HCKA 3CD6Q 2XDPA 1R77A 1E6HA 4KH1B 2GNCA 5GJWB 4HKEA 2QXFA 2LC4A 4BY6B 5LJ3f 4NS5A 2DEUA 1PNJA 4AMCA 2A3LA 1RABB 4QVCA 3MHXA 4C92A 3CMEQ 5GAOp 2K57A 2M0OA 2LNVA 3JCMc 2G6FX 3UWNA 4J9FA 2KT8A 5IHNA 3CPWA 3VV0A 4IUVA 2P4RA 2X4XA 4C5HA 2LQ8A 3I55Q 4C5EA 1YI2T 3LH5A 4IUPA 4FSXA 4JUVA 1AVZC 1SEMA 1XQHA 2MI6A 2YUOA 2JMAA 3VUBA 2CP7A 4JRIA 1WLPB 3QDRB 1RAEB 5HK0A 3CBMA 4KUIA 1G3TA 4RTUA 3T9NA 2E4HA 1BCOA 4M7DF 4Z89A 1C1AA 2CT3A 1ZUUA 3CEYA 3SWNB 2JTMA 1VQ4A 4IURA 2DBMA 5D7UA 2BE9B 2ATCB 3CCET 4RG8A 2EVRA 3CCUQ 2E6NA 5GJVB 4E7ZA 2EFIA 2DF6A 5LJ5g 4EPCA 1BU1A 1EIFA 5GANd 4F7UF 1OV3A 4HCCA 3MP6A 2YUNA 2ZZDA 1AZEA 1PD0A 2E3IA 1EX4A 3TSWA 2ROLA 4C92G 2E65A 4KT0E 4Y92A 4J9GA 2QA4T 5KYYA 1GCQC 1WJSA 3QYHB 4J9IA 5CAIA 2CP6A 3URGA 2JW4A 4M75E 3JB9J 4CRIA 1QVFP 2KMTA 2NUZA 3M4GA 1BIBA 3CMEA 3E9GA 4LUEA 2V1QA 2FRYA 3VS5A 2JVVA 5CK9A 4RG2A 4ZNXA 2JTFA 2KXDA 3RESA 4L59A 1YWPA 3M53A 1U3OA 2KAFA 2CSQA 1C0MA 4TVRA 1UG1A 1WHGA 1NJIC 2DXCA 4FT2A 3HHTB 2EJFA 5GMKh 3JCMP 3LGFA 4HCKA 2XG8D 3I55A 4BI3A 1MHNA 4O6JA 4PJOF 1NEBA 2RA2A 4D6WA 5GAMd 5LJ3j 3ZFJA 1GXIE 2A08A 4ZN1A 3ER0A 4J6XA 4XQ3A 3GIBA 4GLKA 5CKDA 4GLMA 4JDSA 3L2RA 5FU6C 4M7AB 2P0QA 1AZGB 1IO6A 1AWXA 5CR2A 4JS4A 4OMPA 3CCUA 2OTLQ 2P0PA 4C92F 2O88A 4KUDK 4HVVA 9ATCB 5J39A 2L2PA 2EQMA 2JMCA 2D9TA 4OMMA 1SRMA 2SRCA 3ZL7C 3VUZA 1Z9QA 1X27A 4A4GA 2DVEA 4FSSA 3V7CA 1Q7YC 3JCMJ 2DTHA 4PNOA 3GP8A 1QVFA 2WSFE 1M90R 3M57A 1D09B 2RJEA 3JB9G 1I1JA 5GANg 5FRMA 3CXCP 3REBB 1B3QA 3G71T 1WA7A 5KCOA 2AK5A 1UB4A 1MMDA 4A4KA 5FLXE 1NM7A 2HQHA 1KHIA 3JV3A 1T3SA 5CQXA 3VS4A 4M7AD 3SWNA 1Y07A 1JRIA 3OMCA 2IIMA 2QDYB 2FPEA 2CZ7B 1VQ5T 1S72T 4M78E 3MP1A 1YI2Q 2O01E 2HQXA 2CZ1B 4E7IA 3O5ZA 1M90U 2OAUA 1YNZA 3V8LA 4JRKA 2EIFA 3CCQQ 4OB0B 5FU6B 2K3XA 2IG0A 4M78D 5KYUB 4M77C 2ZPGB 2RD1A 4LNPA 1M27C 2E41A 2QDLA 3JCMb 4BDYA 1QP3A 3ASKA 4BDZA 3TQ7P 2OTLA 3CCEQ 2GQIA 1UE9A 5GAMg 4JJBA 3JSCA 5KH6A 2GFAA 2VXEA 4LDXA 2DJQA 1BYMA 3RMQA 4A53A 1HJDA 3QDFA 2VWFA 1NLOC 2QA4Q 3NHNA 3E1SA 3UA7A 1IXDA 1VQPT 2ED1A 4XTWA 4E47A 3JB9F 2M0YA 4HA8A 2RNAA 2GTOA 4X9CA 1MNDA 3PIPA 2DRMA 2V1RA 2C0TA 5LJ3d 4QQ6A 2VYTA 3CXCA 1GCPA 8ATCB 1QVGA 2JUFA 2A37A 4PJMA 2XDDA 4L5GA 1RLQC 2HZYA 1KHCA 4OMLA 1YCSB 1JJ2S 5FWBA 4DOWA 2CT4A 5GMKj 2RM4A 3PMIA 4B6MA 4M7AA 4HCZA 3JB9I 3G7ZA 4DEXA 2V8KA 2B8AA 1YI2A 5KCHA 1ZUKA 4M77B 1WHHA 4IUUA 3OSVA 2QAZA 1VQOT 2K79A 1GCQA 4ELZC 3M0SA 5I21A 1SHGA 2EQUA 3ZBDA 2C0OA 4J9CA 5GAMh 4XU2A 7AT1B 2C06A 3I5SA 2KRMA 1JU5C 2DNUA 4C0GA 1UGVA 1YP5A 2DAQA 1KC8R 3CD6T 1TUDA 2JTEA 2EBPA 1ZA2B 2P0KA 3FEOA 1TXQA 1B34B 5IT9E 4M7DE 2L3QA 3H0IA 2LVMA 3WXMB 3CCEA 2KROA 4LDVA 4OMNA 4M7DD 3OQ5A 3OYBA 2KK4A 2PUOB 4C0FA 3QWXX 2QA4A 5KYWB 4NL3A 4QQDA 5A2QE 2VXFA 1K4US 4F7UE 2IVWA 4Y91A 2RQWA 1Q81C 2KVQG 3G4SQ 5DY9A 4CC7A 1LOJA 3I35A 2EPDA 4M7AG 3E19A 4MMLA 4XAXB 1T3LA 2EQIA 1PSFA 2QQAA 1R8OB 4OMFB 5CKEA 2M02A 1D1CA 4FYWB 4RUGA 5KYUA 4AT1B 1YJNQ 1K73R 4OMQA 2RO0A 1MGQA 2MOXA 2K5IA 1I0CA 1N9SA 3UATA 2AKKA 2YRVA 5D6YA 1G3SA 2XIDA 1VQ5Q 1WHJA 3P8BB 3A8LB 5LJ3g 1S72Q 3VYGA 3CC4T 2D0NA 3PT9A 4FIBA 2E64A 4XTVA 4KH0B 2MIOA 4PJOE 5CIUA 2Y4XA 2DXBA 2D0QB 3MEAA 2XICA 4EMKC 3CBOA 1K1ZA 4V2SA 2H3EB 1VIFA 1I8FA 3QG1A 3JCMf 4PJOD 1OI1A 1LNXA 3BW1A 2WSCE 3NTIA 1ACMB 2W0ZA 3LX7A 3OW2P 1M1KR 2E12A 2LRQA 5KE2A 2RHZA 1D0XA 1QWFA 2HSPA 1BCMA 2CREA 2FZCB 2EJGA 2A28A 1IB8A 1U8RA 3REAB 1NLPC 1PKSA 1VQPQ 3M59A 3G4SA 3CPWP 2KEAA 1W2BA 1GBQA 1TS9A 4JJNK 1M3BA 1W4SA 2K3BA 1TSFA 4FW1A 1M1KU 3EGXB 4M77A 3WVEB 3M5AA 2A36A 3G71A 3OYEA 2YRCA 3L2ZA 1K0SA 5LJ3h 1M8MA 1FXXA 4OVAA 1YJNA 3MJXA 3CMAT 4GY5A 2DBKA 2M16A 2F5KA 3VS3A 1B34A 2R57A 1VQ5A 1EZZB 1J3TA 5KYNA 1S72A 1UJYA 4CC3A 1G83A 2W10A 1WDXA 1KQSA 2SEMA 1YCYA 1KK7A 1UGPB 4EMKB 1VQOQ 3SWNC 5GAMj 3LGLA 1MV3A 4E7LA 2EGCA 4PL6A 5KYWA 1N6AA 2ZGWA 2LZ6B 4EMHA 1RADB 1VYVA 2CGHA 2DYIA 1H8KA 2LX7A 1T0HA 4HXJA 1O75A 3OW2A 2DETA 1SSFA 2DXTA 3OS2A 2KQWA 2X51A 1UECA 2DZ9A 2F1LA 1CKAA 1G8XA 4M77G 2ZAEA 1H3ZA 1VQPA 4RTXA 4J83A 4KRTA 3QYGB 5KE3A 4PLLA 4Z8AA 1UFFA 4WF2A 3HRUA 2DL5A 1TU0B 3D7SB 4ZGDB 2DJZA 2VKNA 1M30A 4JPBW 1WGSA 3X28B 1KQ1A 1X2KA 2DM1A 3FRNA 4GBQA 3UDCA 1OEBA 2RJFA 1G2BA 2EGAA 3CCQT 4M75B 2ZPHB 4E7HA 3MPUB 1K9AA 3QJ6A 2A0FB 1TTHB 1ZA1B 3IQLA 2DA9A 3ZEHA 2DTOA 3H41A 4A4FA 2LT1A 4FL6A 2RK1A 3CC4Q 1RUWA 4MZTA 1VQOA 5C6SA 1WI7A 4JJDA 2MAMA 2DD4A 2KBTA 3VU3C 4M7AC 1VQ6T 2RQUA 4BUGA 5GAOl 3OS0A 4JRPA 4ATOA 4BB7A 3CCVT 3CD6A 3M56A 2HBWA 1RLPC 1VQ9T 5J3BA 2E3HA 3OYKA 1EFNA 1XTDA 2BIVA 2J6OA 2KDSA 1QVFS 1ZSGA 4M78C 4M77F 1FYNA 2PU9B 5CCAA 3FC3A 1YN8A 1ZLMA 2E5QA 4M75D 3EFSA 2FZGB 1M90C 3EGDB 2GQVA 3GBQA 1Y96B 1B07A 1AWWA 2DMOA 3VS7A 2FB7A 1PM3A 3EHRA 4J7IA 3E9FA 4JJCA 1TUCA 2O9VA 3KXTA 3HRTA 1OZ3A 2OAWA 4YTLA 3DB3A 4N4IA 3S6WA 1SG5A 2QK0A 2Z0WA 4JS5A 2M1HA 1IHWA 1X6OA 1TUGB 2L89A 3V7SA 4B9XA 4EMKA 4FYVB 3RIRA 2YHTA 1F1BB 3H0FA 3V7RA 2COYA 4FCYA 2HEQA 3O8VA 2OX7A 2BZXA 1PWTA 2XD0A 1TH7A 2ABLA 1Q82C 3RERA 1X69A 4OB1B 4PFPA 5HKCA 3VS2A 3CMAQ 2RQTA 2MWOA 2QG9B 1WFWA 2RMOA 3C95A 1NPPA 4A4HA 1W6XA 1KQ2A 2RN8A 1HK9A 3JCMV 2VV5A 3HFOA 3CC4A 1QMCA 5I2SA 4FU6A 1LCKA 1ZHIA 1X43A 1ZQ1A 2CKKA 4LD9K 3OYNA 3KUFA 3M4YA 1Q86R 2JJ9A 2H3JA 3VS0A 1FMWA 2I0NA 3L2VA 4M78B 1N27A 3M9QA 2K5FA 2RHYA 4DBQA 3MEUA 2DVJA 2YUPA 1JXOA 4RTZA 5FU7B 1ARKA 2ZPFB 3PVQA 3JCMd 3G4ST 2YDLA 1UDLA 5IAYA 5GMKi 2D8HA 2XKOC 3EG1A 3X24B 3CXCS 3SEMA 2AZSA 1BB9A 1SSHA 3OMGA 2BKDN 1QVGP 1BI0A 4M75A 3OBWA 4VUBA 5HK3A 1Q86U 1VQLT 2CH4W 1YJNT 2PZ1A 2DKGA 2ZPEB 5FW9A 4C8QE 3CCMT 1LJOA 4J5YA 4M4ZA 3CCLT 3BDUA 4QVZA 2K3YA 4KGXB 2RHUA 4F14A 5CKBA 4DBFA 4D8KA 4C8QD 3F70A 3VJPA 4AFQC 3LLRA 2QGGA 2LCSA 5CQYA 3CMAA 2DK3A 2JN0A 2O9SA 3VS6A 1I5LA 4OMOA 2LP5A 2HAXA 2L5QA 1K8AC 3PGGA 2FRWA 2KRSA 1KC8C 1OU8A 2COWA 3JCMW 2EKOA 5DLOA 1PG5B 4PLIA 3I56T 2KE9A 1PSEA 1DJ7B 1GFCA 4B9WA 1VQ6Q 4Y28E 1YWOA 3CCVQ 2XI9A 3EGDA 1QW1A 1Y96A 1UGSB 3LWHA 1VQ9Q 5GMKe
chains in the Genus database with same CATH topology
4E7JA 4A4EA 3JCMQ 4HKEA 2QXFA 2K5IA 2RI2A 4M75G 5L8RE 1N9SA 5D6WA 2RHXA 3CCJT 3KBGA 2LC4A 4II1A 2YRVA 4BY6B 1Y7XA 5D6YA 1G3SA 2XIDA 4NS5A 5LJ3f 3P8BB 3A8LB 3TCJA 5LJ3g 3QSUA 2A3LA 3VYGA 4DOVA 3CC4T 1N9RA 4QVCA 3BY7A 3MHXA 4C92A 2DXUA 4R56A 4C0DB 3OYDA 3PT9A 3OYYA 5GAOp 2K57A 2M0OA 2QEXT 2LNVA 1D3BB 4FIBA 2E64A 4XTVA 3JCMc 3DKMA 3QKJA 5EG2A 3OYMA 1YIJA 4PJOE 2O4XB 4M7DB 2QTXA 3UWNA 5CIUA 2Y4XA 4C8QB 3PIOA 4ME7A 2DXBA 5LJ5h 4LDWA 2D0QB 5LJ5e 3MEAA 2XICA 4EMKC 2DO3A 3CBOA 1VQKT 1JBMA 4V2SA 1VIFA 2LT4A 4XU1A 3V8JA 3CPWA 1I8FA 3QG1A 3VV0A 3JCMf 2BUDA 4PJOD 2ZPIB 1OI1A 1LNXA 2FVUA 3BW1A 3OYHA 2HQEA 1BKBA 3JCMg 2QQ9A 1OZ2A 2WSCE 3M55A 3NTIA 4IUVA 4C5IA 2DIGA 2X4XA 3LX7A 4C5HA 4JRQA 3ME9A 2E12A 2LRQA 3CPFA 2LQ8A 1K73C 5KE2A 2RHZA 4C5EA 1YI2T 4IUPA 4FSXA 4JUVA 4F7UB 1XQHA 2MI6A 2FHDA 3VKIA 5IT9E 3VUBA 3CCRT 2EJGA 4JRIA 1WQWA 4MZMA 3CCQA 3QDRB 1VQ7T 3AHUA 5HK0A 3CBMA 4XTZA 4KUIA 1U8RA 1G5VA 3QO3A 2HNIA 1G3TA 2PVDB 1QVGS 1NE8A 3T9NA 1Q7YU 4M7DF 2G3RA 1U1SA 3RMSA 3DLLA 5C0MA 4M78A 3V8KA 2RB6A 4C0DC 2FL7A 3CEYA 3M59A 3SWNB 3JRZA 2JTMA 2DEQA 1I81A 2MWPA 3G4SA 3L42A 4IURA 3SD4A 3S3OA 1VQ4A 1W2BA 3NTHA 2K2VA 4JJNK 2E10A 3CBPA 3OS5A 4M7DC 2L3RA 1W4SA 3A8GB 4N0AA 3OB9A 5GANf 2I2LA 3FB9A 3CCET 4RG8A 3OYLA 3QUIA 1M1KU 4M77A 3WVEB 2RH2A 3M5AA 2E6NA 2F69A 3LW5E 3RKWA 5LJ5f 1VQ8A 3G71A 3CC7T 2EFIA 1XNIA 1M5Q1 5LJ5g 4EPCA 3OYEA 1EIFA 1YHQT 1VQ6A 4HT8A 5GANd 3TEEA 4F7UF 3WVDB 3L2ZA 1M1KC 4HCCA 3MP6A 2ZZDA 3GLXA 3P8DA 5LJ3h 3CCVA 1FXXA 4OVAA 4FT4A 1YJNA 4C92G 3LH0A 1VQNT 2E65A 3MEVA 4KT0E 2QA4T 1V29B 1VQ9A 1NZ9A 2PVOB 3G6ET 3CMAT 4GY5A 1WJSA 3QYHB 2JOYA 5CAIA 2M16A 1G3YA 2F5KA 3QJYA 3URGA 1B34A 2QI2A 3PMTA 2R57A 4M75E 3UT1A 1VQ5A 4IUQA 3JB9J 4CRIA 4PJOB 1S72A 4ZTFA 2KMTA 3M4GA 1KQSA 3M58A 4BE1A 1BIBA 1UGQB 1YCYA 3QHSA 3E9GA 3OYFA 5GMKm 3CMEA 1UGPB 4QW2A 1X01A 3BDLA 3JCMh 4EMKB 3HKSA 3SWNC 2JVVA 5CK9A 4RG2A 4JLGA 3OYJA 2NLUA 2JTFA 3LGLA 3RESA 4L59A 3RUXA 5GAMj 1NJIU 1BI1A 3M53A 5GAN3 4E7LA 1M4ZA 3C12A 4PL6A 2KAFA 2X4WA 4XU0A 1N6AA 2ZGWA 4IKFA 4TVRA 2YLBA 1NJIC 2EWNA 2DXCA 4EMHA 2CYZB 4FT2A 3HHTB 2CGHA 2EJFA 5GMKh 3JCMP 2EAYA 3X26B 3GOXA 3OYGA 3S3MA 5GAN7 2OTJA 1YJ9A 3LGFA 2XG8D 4OGCA 5CVIA 5DM7R 2LCLA 1O75A 4M78G 3OW2A 1KG1A 1SSFA 2DXTA 4BI3A 1MHNA 3I55A 4O6JA 4PJOF 4DQ2A 4XTUA 5GAOq 2RA2A 4D6WA 3OS2A 2KQWA 1Q82U 5GAMd 3INZA 5LJ3j 2DZ9A 3SFMA 3X25B 3OYIA 3ZFJA 3J81E 1GXIE 2DTIA 5CKHA 3VYHB 4ZN1A 5GAN4 3LYIA 1RL2A 5GANh 4M77G 4PJOC 1X75C 3ER0A 5GANe 4J6XA 1YIJT 2Y4YA 4XQ3A 1JJ2A 3GIBA 2MF2A 1VQPA 1H3ZA 4GLKA 4J83A 2P4TA 3QYGB 4PKCC 3L2UA 4E7KA 5CKDA 2D6FA 5KE3A 3OBYA 4JDSA 3QXEB 3J7AF 4PLLA 4WF2A 3L2RA 3HRUA 5FU6C 4M7AB 2P0QA 2RI3A 4ZGDB 4OP0A 3H8ZA 3OW2S 2MMPA 5CR2A 3GNGA 4JS4A 1YITA 1NPRA 2DJZA 2LDMA 3CCUA 5M9OA 2P0PA 3FLGA 2HD0A 3QZ5B 4RCBA 5J26A 4C92F 2QQSA 3TREA 1WGSA 4OGEA 3X28B 2FYKA 3OSSC 4KUDK 1KQ1A 3FRNA 1D3BA 3UDCA 4J6YA 5J39A 2K4YA 2RJFA 2EQMA 2LCCA 2DPPB 2D9TA 2O4XA 4EDUA 3CCQT 4C8QA 4M75B 2ZPHB 4M7DA 3EAEA 3META 2DZCA 4C92C 4E7HA 3PNWC 4C92E 1G3WA 3QJ6A 4KBMB 3VUZA 4A4GA 2DVEA 5DLQE 3V7CA 3CPWS 2XU8A 1VQ4T 3ZEHA 2DTOA 1Q7YC 4A4FA 3JCMJ 4M7AF 2DTHA 4PNOA 3GP8A 2LT1A 4C92D 4Z02A 3QZ9B 4FL6A 2A7YA 2RK1A 3NFCA 1QVFA 3C4SA 2WSFE 3L2WA 2E6ZA 3M57A 4OF1A 3S3NA 4MZTA 2RJEA 3A8MB 3LWIA 3JB9G 1VQOA 4LDYA 5C6SA 5GANg 2MAMA 2DD4A 3DB4A 2DD5A 3QPHA 4F7UA 5FRMA 2DIQA 4BACA 3VU3C 4IUTA 1VQ8T 3G71T 4M7AC 1FWZA 3PFSA 5GAMe 5KCOA 1VQ6T 2V8IA 4BI4A 3A8OB 1QP2A 4BUGA 5LJ5j 5GAOl 3OS0A 4JRPA 4ATOA 1UB4A 4BB7A 4A4KA 3CCVT 1VQLA 3CD6A 5FLXE 4MZPA 3M56A 4M75F 4M78F 5GAN5 1P92A 1KHIA 4BD3A 1VQ9T 2KSSA 5CQXA 5J3BA 3CCSA 4M7AD 3SWNA 3OYKA 1Y07A 1JRIA 1XTDA 2BIVA 3CCMA 1ZBXA 3OMCA 2QDYB 2KDSA 2AHJB 1W2BS 3CCLA 2GF7A 4NL2A 1YJWA 4M75C 4P5NA 2CZ7B 1QVFS 1O9SA 2PVGB 3FJPA 4M78C 1VQ5T 2JNGA 1S72T 4M78E 4BE2A 4N4GA 3MP1A 4M77F 2LTOA 2O01E 2HQXA 2CZ1B 2PU9B 3J80E 3CMET 4E7IA 1M90U 2OAUA 5CKFA 3HRSA 5CCAA 3V8LA 4JRKA 2EIFA 5GMKl 4OB0B 3FC3A 1M9SA 3UPUA 2E5QA 4M75D 5FU6B 2K3XA 2IG0A 3EFSA 4M78D 3R6OA 1M90C 4M77C 2ZPGB 3CC2A 2GQVA 2RD1A 4M77E 1Y96B 1K8AU 2E41A 2X4JA 4C5GA 1KC8U 2EQKA 2FB7A 3L1AA 4XTYA 4OB2B 4QVDA 4RCCA 3EFRA 1WNLA 4M7DG 4J7IA 4C8QG 3E9FA 1BI3A 3MP8A 1WJRA 3KXTA 4OB3B 3JCMb 3HRTA 4BDYA 1OZ3A 1UGRB 4BI8B 4ZGJB 1QP3A 4M77D 3DB3A 4YTLA 4N4IA 3ASKA 3S6WA 4Q5WA 3OYAA 2QQBA 4BDZA 4PJOA 5GAMf 1FX7A 1YJ9T 3QBYA 2OTLA 2E70A 3HP9A 4JS5A 2M1HA 4FM4B 5GAMg 5CO7A 3I56A 4HCBA 3I55T 4KULA 1KQSS 1X6OA 2L89A 4C92B 3JSCA 1M1GA 2Y90A 3V7SA 3X20B 4B9XA 4EMKA 2HBPA 2R5MA 5KH6A 3L2QA 3RIRA 2GFAA 2VXEA 2YHTA 4LDXA 3GPLA 5IN1A 3V7RA 1VQMA 5A0DA 4NOYA 5D6XA 1BYMA 3RMQA 4A53A 1VIEA 3MCAB 3O8VA 5GAOr 5AYFA 2K5LA 2XD0A 1Y71A 1TH7A 4X34A 1Q82C 4A54A 3JB9H 3RERA 4F7UG 1WQ7A 3E1SA 4R55A 4OB1B 5HKCA 1JB0E 2PUKB 1VQPT 4ZN3A 2MWOA 1BI2A 4XTWA 3C95A 4X9DA 4E47A 1NPPA 4A4HA 3JB9F 5A0GA 3CCJA 1KQ2A 1HK9A 3BFMA 3JCMV 2VV5A 4HT9A 3OA6A 4HA8A 3HFOA 4X9CA 3C94A 2R5AA 3CC4A 2VC8A 5I2SA 3QIIA 3PIPA 4FU6A 1KD1U 4J8OA 4BE0A 3MEWA 1YITT 1N8RU 1ZHIA 3CCUT 5LJ3d 4QQ6A 1M1FA 1U1TA 2EQJA 2F5TX 2QEXA 2VYTA 2GCXA 3GF5A 2LX9A 3DLMA 3CXCA 1ZQ1A 4XK8E 2RJCA 3OS1A 2LQKA 2CKKA 4LD9K 5GAN2 3TU4K 3OYNA 3KUFA 1KD1C 1N8RC 3JCMX 1QVGA 5I2MA 2JUFA 4C0ZA 3M4YA 2VUBA 4RKUE 2XDDA 4L5GA 3OY9A 4JLIA 4EMGA 2H3JA 1VQKA 3Q1JA 3L2VA 2RJDA 3HPWA 4DA4A 3JB9D 4ZTJA 1K73U 1KHCA 4M78B 1JJ2S 5FRNA 1N27A 3M9QA 4DOWA 5GMKj 4M7AE 2K5FA 2RHYA 2RM4A 3PMIA 3MEUA 2XDBA 4HCZA 5FU7B 3G7ZA 3JB9I 4M7AA 2V8KA 1WJQA 2ZPFB 2B8AA 3JCMd 3G4ST 1YI2A 5IAYA 5GMKi 5KCHA 2XKOC 4M77B 2WACA 1IREB 2X4YA 3X24B 4IUUA 4J7FA 3OSVA 4N4HA 3CXCS 3CCRA 2PQWA 1VQOT 1BIAA 1VQ7A 3SB2A 4ELZC 4PJOG 2RK2A 4BY6C 5I21A 1VUBA 2EQUA 2E1HA 2XK0A 3OMGA 5LL6S 3ZBDA 3PTAA 5GANj 5GAMh 4C8QF 2BKDN 2YLCA 1OYXA 4XU2A 1BI0A 4M75A 3OBWA 2C06A 3RKYA 1AHJB 4VUBA 5HK3A 1Q86U 2EYQA 4C0GA 1VQLT 2GFUA 2DAQA 3CD6T 4ZGEB 1M8VA 3RKXA 1YJNT 2L8DA 2DKGA 2ZPEB 2KY9A 2X35A 3OYCA 2P0KA 3FEOA 1IZ6A 1B34B 1QVPA 3A8HB 4L6V5 2CZ0B 4C8QC 3CCST 4C8QE 2LVMA 3CCMT 1LJOA 1Q86C 4M7DE 2M9UA 4J5YA 3WXMB 3CCEA 3HL8A 3CCLT 3BDUA 5HY6A 2R58A 4QVZA 2K3YA 2CS7A 1YJWT 2CZ6B 2WSEE 4LDUA 4LDVA 5GAOm 2RHUA 3CC7A 3HSBA 1RI0A 2XHCA 5CKBA 1YHQA 2RHIA 1WPYA 5GAOn 4CI0C 4M7DD 3OQ5A 4C8QD 2KK4A 3F70A 3OYBA 4ELYC 5LJ3e 2PUOB 5FU7C 4C0FA 1HXDA 2RI5A 4MDWA 3VJPA 5LJ5d 2JZ2A 1VQNA 3HFNA 2QA4A 3GNFB 4LD6A 4QQGA 4N0AC 3LLRA 3N5BB 4NL3A 4QQDA 1Q81U 5A0LA 3SDZA 4XTXA 3FDRA 1H641 5CQYA 5GAN6 3G6EA 3CMAA 3CC2T 2DK3A 4J6WA 5A2QE 2VXFA 4F7UE 1UEBA 2IVWA 2JN0A 3JAME 1K9MU 4UC4A 3NTKA 4Y91A 1Q81C 1I5LA 2KVQG 2QQRA 3MO8A 4XU3A 2HAXA 2L5QA 1K8AC 3H6ZA 1K9MC 3PGGA 5DY9A 4MMKA 1KC8C 1LOJA 2V8JA 2OTJT 2VGMA 3JCMW 2OTLT 3JCMe 3FIFA 2EKOA 5DLOA 3I56T 4PLIA 4M7AG 3M54A 5GAN8 1YBYA 3E19A 3P8HA 4MMLA 1PSEA 4XAXB 1DJ7B 1PSFA 2QQAA 1R8OB 4OMFB 4B9WA 4Y28E 5CKEA 2ZPBB 5FROA 1VQMT 4MDXA 1I4K1 2XI9A 1XOVA 2ZCFB 2XDPA 4RMOA 1QW1A 2VGNA 1Y96A 1UGSB 2RO0A 2EJ9A 3A5ZB 3LWHA 4O5VA 1MGQA 5GMKe
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DA4 A;  3PTA A;  4KUI A;  4DOW A;  4KUL A;  2FVU A;  4FT4 A;  4BB7 A;  4DOV A;  2FL7 A;  1M4Z A;  1ZHI A;  3PT9 A;  4JJN K;  1W4S A;  1ZBX A;  4FSX A;  4LD9 K;  3TU4 K;  4KUD K;  4FT2 A; 
#chains in the Genus database with same CATH topology
 4E7J A;  4A4E A;  5KYX B;  4HVU A;  2RI2 A;  4M75 G;  5L8R E;  2MPX C;  2RHX A;  4LE9 A;  3CCJ T;  1YJW Q;  2EYW A;  3PE0 A;  3TCJ A;  1OU9 A;  3QSU A;  4DOV A;  2FEI A;  2LNH B;  1N9R A;  3BY7 A;  1D0Z A;  2DXU A;  4CC2 A;  4C0D B;  4R56 A;  3OYD A;  1D3B B;  1PRL C;  3DKM A;  4QKU A;  3QKJ A;  5EG2 A;  3OYM A;  2O4X B;  1V1C A;  2GBQ A;  4M7D B;  4E6R A;  4LDW A;  5LJ5 e;  1UJ0 A;  2DO3 A;  1V76 A;  2KYB A;  2K9G A;  4XU1 A;  3EHQ A;  2BUD A;  2FVU A;  2RPN A;  2HQE A;  1BKB A;  3JCM g;  2QQ9 A;  1OZ2 A;  3M55 A;  4C5I A;  1K73 C;  1YFN A;  3R6N A;  3UA6 A;  4F7U B;  1RI9 A;  2L0A A;  3VKI A;  3CCR T;  1VQ7 T;  4MZM A;  3CCQ A;  1X6B A;  3AHU A;  4XTZ A;  1BK2 A;  1G5V A;  3QO3 A;  2HNI A;  2PVD B;  2MCN A;  2KT1 A;  1Q7Y U;  2G3R A;  5C0M A;  4M78 A;  2FL7 A;  3JRZ A;  1HD3 A;  2K2V A;  1OPK A;  2E10 A;  3OS5 A;  2L3R A;  3A8G B;  1RAG B;  5GAN f;  1H3H A;  2EYZ A;  2RH2 A;  2F69 A;  3LW5 E;  3RKW A;  3CC7 T;  1M5Q 1;  1YHQ T;  1VQ6 A;  1KIK A;  1AEY A;  3TEE A;  4F04 B;  1M1K C;  3M0R A;  3P8D A;  3CCV A;  3LH0 A;  3VS1 A;  3MEV A;  1V29 B;  1VQ9 A;  1HYO A;  2LJ3 A;  3QJY A;  1VYT A;  2QI2 A;  1W2B P;  1NG2 A;  3PMT A;  3UT1 A;  4LXC A;  4PJO B;  1UGQ B;  3QHS A;  3OYF A;  1X01 A;  3BDL A;  3JCM h;  1N5Z A;  1GL5 A;  2HL5 C;  3HKS A;  1CKB A;  1X6G A;  2CP5 A;  2NLU A;  3RUX A;  2P84 A;  3RBB B;  1BI1 A;  2K7A A;  5EC7 A;  2X4W A;  1X2Q A;  3HTR A;  1VQL Q;  2EWN A;  2HDA A;  2F2W A;  3X26 B;  2C0I A;  2EW3 A;  3M0P A;  3EG2 A;  3CCM Q;  1RAF B;  2LCL A;  3CCL Q;  4M78 G;  1KG1 A;  3NGP A;  2BTT A;  4PJJ A;  4XTU A;  2LJ0 A;  5GAO q;  1KQS P;  1GRI A;  3INZ A;  1AD5 A;  3SFM A;  4ORZ A;  3J81 E;  1Q95 G;  2DTI A;  5GAN 4;  3LYI A;  1RL2 A;  1X75 C;  2J05 A;  1ZBJ A;  5GAN e;  1YIJ T;  2Y4Y A;  1JJ2 A;  5IXF A;  2DL3 A;  2OI3 A;  1VOM A;  1ABO A;  4E7K A;  2D6F A;  1MMG A;  3OBY A;  3QXE B;  3J7A F;  5KYX A;  4AFS C;  5ECA A;  2RQV A;  2RI3 A;  4OP0 A;  3OW2 S;  2MMP A;  3H9N A;  1NPR A;  2LDM A;  1NBE B;  1IRX A;  3I56 Q;  2HD0 A;  3QZ5 B;  4RCB A;  4HVW A;  3TRE A;  1AOJ A;  2FYK A;  3OSS C;  2GTJ A;  2YT6 A;  3M0U A;  1D3B A;  5L23 A;  4J6Y A;  4EDU A;  2LCC A;  2DPP B;  2O4X A;  4M7D A;  3PNW C;  4C92 E;  1G3W A;  2F2V A;  4KBM B;  2NUP B;  1NEG A;  2D8J A;  3CPW S;  4R0K A;  3U23 A;  3EG3 A;  3CCJ Q;  2DL4 A;  4M7A F;  4C92 D;  4Z02 A;  3QZ9 B;  2A7Y A;  4X1V A;  3NFC A;  2KNB B;  2BZY A;  3L2W A;  2E6Z A;  3S3N A;  3LWI A;  4LDY A;  3QPH A;  4F7U A;  4IUT A;  1VQ8 T;  2HKQ B;  3PFS A;  5GAM e;  3A8O B;  4JZ4 A;  1QP2 A;  1OX8 A;  1VQL A;  2JM8 A;  4MZP A;  1NYG A;  4M78 F;  5GAN 5;  5IHK A;  2KSS A;  3I9Q A;  2HKN A;  5I11 A;  3CCM A;  1ZBX A;  2AHJ B;  3CCL A;  2GF7 A;  4NL2 A;  4M75 C;  4P5N A;  2XMF A;  1O9S A;  2PVG B;  2FZK B;  4BE2 A;  2LTO A;  1WYX A;  3J80 E;  4FW2 A;  2CP3 A;  3HRS A;  1OOT A;  1M2V B;  3CCR Q;  4WCI A;  1VQ7 Q;  3UPU A;  1JEG A;  3R6O A;  5I22 A;  2X4J A;  4C5G A;  2D1X A;  3L1A A;  4QVD A;  4M7D G;  4PJL A;  3MP8 A;  1WJR A;  4OB3 B;  2J6K A;  4PK4 A;  2QTV A;  4BI8 B;  4ZGJ B;  2KRN A;  2AZV A;  1FMK A;  1KD1 R;  4Q5W A;  2QQB A;  4PJO A;  1N8R R;  1FX7 A;  3TSZ A;  3QBY A;  1YJ9 T;  1T0J A;  1QCF A;  2DRK A;  2E70 A;  2M51 A;  3HP9 A;  3I56 A;  4FM4 B;  1M1G A;  3X20 B;  3L2Q A;  3CC7 Q;  1WHM A;  4KGZ B;  4DBR A;  1YHQ Q;  4AFU C;  3GPL A;  1C6V X;  1ZSZ B;  5IN1 A;  5A0D A;  3TVT A;  2YUQ A;  5AYF A;  1JQQ A;  1Y71 A;  3JB9 H;  2J06 A;  4A54 A;  2GGR A;  4F7U G;  4R55 A;  3EGU A;  2DIL A;  2PUK B;  1BI2 A;  1AWO A;  4X9D A;  3CCJ A;  3PVL A;  4HT9 A;  1GFD A;  1I07 A;  1QKW A;  1VYU A;  1KD1 U;  4J8O A;  3VRY A;  1YIT T;  1N8R U;  1M1F A;  2EQJ A;  2AT1 B;  2LX9 A;  2RJC A;  2LQK A;  1WXT A;  5GAN 2;  5I2M A;  1M2O A;  4C0Z A;  1Z9Z A;  4RKU E;  1RAC B;  3OY9 A;  1WXB A;  4JLI A;  2FG0 A;  3Q1J A;  3JB9 D;  3EH1 A;  2DLP A;  2X3X D;  2B86 A;  2LQN A;  3EFO B;  1UUE A;  2AKL A;  2DFU A;  1JXM A;  3SHW A;  4J7F A;  4N4H A;  3CCR A;  1VQ7 A;  1BIA A;  4Z88 A;  4PJO G;  1RAH B;  2RK2 A;  1VUB A;  2E1H A;  2XK0 A;  5LL6 S;  1QCO A;  2DER A;  1YIJ Q;  1KFZ A;  1AHJ B;  2KI7 A;  1K9M R;  2EYQ A;  4ZGE B;  4LUD A;  2L8D A;  2NUP A;  2X35 A;  3OYC A;  1QCN A;  1QVP A;  4C8Q C;  4L6V 5;  3CCS T;  1Q86 C;  2BE7 D;  3AT1 B;  3HL8 A;  2V26 A;  2X9H A;  2CS7 A;  1YJW T;  2CZ6 B;  2WSE E;  4LDU A;  4PFZ A;  3HSB A;  3CC7 A;  1RI0 A;  1PD1 A;  2XHC A;  1YHQ A;  2L3P A;  2RHI A;  5GAO n;  1PHT A;  3KFV A;  3EGX A;  1A0N B;  1MMN A;  3QWY A;  4ELY C;  2FPD A;  4D8D A;  5LJ3 e;  5FU7 C;  2NYS A;  4CC4 B;  2HL3 A;  1S1N A;  2CDT A;  3HFN A;  3N5B B;  2CP2 A;  1JO8 A;  4XTX A;  3FDR A;  1H64 1;  3CC2 T;  4J6W A;  1ZUY A;  8AT1 B;  3JAM E;  1K9M U;  1NYF A;  4F17 A;  1I5O B;  1D1A A;  2QQR A;  4E2F B;  2BZ8 A;  4PFO A;  4AG2 C;  3H6Z A;  4MMK A;  2VGM A;  2YSQ A;  2COZ A;  2LMJ A;  5GAN 8;  1YBY A;  3P8H A;  1VQ8 Q;  1M2V A;  2ZPB B;  1VQM T;  2CSI A;  1FMV A;  1XOV A;  2ESW A;  2ZCF B;  4RMO A;  2VGN A;  1E7O A;  1H92 A;  2EJ9 A;  3A5Z B;  1OUL A;  4O5V A;  1E6G A;  3JCM Q;  2E5K A;  5D6W A;  2QAS A;  3KBG A;  1MMA A;  4II1 A;  1Y7X A;  2VAS A;  1WIE A;  3OYY A;  2KGT A;  2QEX T;  1ZSZ A;  2IPO B;  1YIJ A;  3UF4 A;  2QTX A;  4C8Q B;  3PIO A;  4ME7 A;  4RTY A;  5LJ5 h;  1ZX6 A;  1VQK T;  1JBM A;  2LT4 A;  3V8J A;  1OX9 A;  2CUD A;  1KJW A;  1QLY A;  3RDV A;  2ZPI B;  3OA6 A;  3OYH A;  2DIG A;  2OTJ Q;  4JRQ A;  1YJ9 Q;  3EH2 A;  3ME9 A;  3CPF A;  2F2X A;  1SHF A;  2ROT A;  1U5S A;  2CH4 A;  2ENM A;  2FHD A;  2CP0 A;  3H0H A;  3EG0 A;  1WQW A;  1QVG S;  1NE8 A;  1U1S A;  1WX6 A;  3RMS A;  3DLL A;  3V8K A;  2RB6 A;  4C0D C;  2DEQ A;  1I81 A;  2HCK A;  2MWP A;  3L42 A;  3SD4 A;  3S3O A;  1D1B A;  3NTH A;  3CBP A;  3EFO A;  1LVK A;  2K6D A;  1IGQ A;  4M7D C;  4N0A A;  3OB9 A;  1UHF A;  2I2L A;  3FB9 A;  4IIO A;  3OYL A;  3QUI A;  1YIT Q;  1PC0 A;  5LJ5 f;  2H8H A;  1NJI R;  1VQ8 A;  1XNI A;  4M7A E;  1WZO A;  4HT8 A;  3WVD B;  3EG9 B;  3GLX A;  1KSW A;  4FT4 A;  1VQN T;  2KR3 A;  1NZ9 A;  2PVO B;  3G6E T;  2JOY A;  2EYY A;  1AWJ A;  1G3Y A;  2KYM A;  2DE0 X;  4IUQ A;  4J9D A;  4ZTF A;  2ECZ A;  1Q82 R;  3M58 A;  4BE1 A;  2NWM A;  2O2O A;  6AT1 B;  5GMK m;  1RAA B;  4QW2 A;  2VVK A;  1TG0 A;  4JLG A;  3OYJ A;  1NJI U;  2HMA A;  5GAN 3;  1M4Z A;  3C12 A;  4XU0 A;  4IKF A;  2YLB A;  2QYZ A;  5IH2 A;  1OQK A;  4RTW A;  2CYZ B;  3M0T A;  2EAY A;  1QQJ A;  3CCS Q;  3GOX A;  3OYG A;  3S3M A;  5GAN 7;  2OTJ A;  1YJ9 A;  4OGC A;  5CVI A;  5DM7 R;  5IHI A;  2RF0 A;  4DQ2 A;  4J9B A;  1PKT A;  1Q82 U;  2LQW A;  1HSQ A;  3X25 B;  3OYI A;  3VRZ A;  5CKH A;  4FYX B;  3VYH B;  5GAN h;  4PJO C;  2JXB A;  1Q7Y R;  1MUZ A;  2MF2 A;  1W1F A;  3CC2 Q;  4PKC C;  2P4T A;  3L2U A;  4DBH A;  1PCX A;  1WHL A;  2VB6 A;  1M3A A;  2JS2 A;  3G1J A;  3H8Z A;  3GNG A;  1YIT A;  5M9O A;  2MYS A;  5J26 A;  3FLG A;  4LN2 A;  2QQS A;  4OGE A;  1RAI B;  2NUT B;  2K4Y A;  1VQM Q;  4C8Q A;  2RQR A;  3EAE A;  3MET A;  2DZC A;  4C92 C;  1K76 A;  1JJ2 P;  1Y0M A;  4EIK A;  2CUB A;  3C0C A;  5DLQ E;  2XU8 A;  2K2M A;  1VQ4 T;  4IIM A;  3M0Q A;  1WXU A;  3C4S A;  3FJ5 A;  4OF1 A;  2JM9 A;  2DYB A;  3A8M B;  1WHK A;  3DB4 A;  2DD5 A;  2QEX Q;  2DIQ A;  4BAC A;  1FWZ A;  1TOV A;  2V8I A;  4BI4 A;  1IGU A;  5LJ5 j;  1K8A R;  5AT1 B;  2LJ1 A;  4K11 A;  2JS0 A;  4M75 F;  1VQK Q;  3THK A;  2QGF B;  4E7S A;  1P92 A;  4BD3 A;  3ULR B;  1IHV A;  3CCS A;  2L3S A;  1W2B S;  4FYY B;  1YJW A;  3FJP A;  2JNG A;  4JZ3 A;  4N4G A;  1GBR A;  2AIR B;  3NPF A;  3CME T;  5CKF A;  1QWE A;  2EGE A;  1TWB A;  5GMK l;  2EKH A;  4DEY A;  1M9S A;  3EG9 A;  1LPL A;  2PNI A;  1U06 A;  3NMZ C;  3CC2 A;  4M77 E;  1K8A U;  1KC8 U;  2EQK A;  4XTY A;  4OB2 B;  4RCC A;  3EFR A;  1WNL A;  4C8Q G;  1BI3 A;  1UGR B;  3OYA A;  4M77 D;  1K0X A;  5GAM f;  4RTT A;  4J9E A;  5CO7 A;  4HCB A;  3RNJ A;  3I55 T;  4KUL A;  1KQS S;  4C92 B;  1ABQ A;  2Y90 A;  3G71 Q;  2HBP A;  2R5M A;  1SRL A;  3A1P A;  2X3W D;  4RTV A;  2JT4 A;  1VQM A;  2O31 A;  4NOY A;  5D6X A;  1VIE A;  3MCA B;  2HSE B;  5GAO r;  4F16 A;  1R0C B;  2K5L A;  2ED0 A;  1VQN Q;  4X34 A;  1WQ7 A;  1JB0 E;  1UTI A;  3G6E Q;  4ZN3 A;  2DL7 A;  5A0G A;  3BFM A;  3C94 A;  4A63 B;  2R5A A;  2VC8 A;  3QII A;  4BE0 A;  3MEW A;  3CCU T;  1U1T A;  2F5T X;  2QEX A;  2GCX A;  3GF5 A;  3DLM A;  4XK8 E;  1W70 A;  3OS1 A;  4ESR A;  3TU4 K;  1KD1 C;  1N8R C;  3JCM X;  1CSK A;  2VUB A;  2KXC A;  4EMG A;  1VQK A;  3CQT A;  4DA4 A;  4ZTJ A;  2RJD A;  3HPW A;  5FRN A;  1K73 U;  4AFZ C;  2J6F A;  1SKU B;  2XDB A;  1ZSZ C;  1WJQ A;  2EYX A;  2WAC A;  1IRE B;  2X4Y A;  1MV0 B;  1B7T A;  4PJN A;  2PQW A;  3SB2 A;  4BY6 C;  5GAN j;  2MK5 A;  1Q81 R;  2NUT A;  3PTA A;  4C8Q F;  1UHC A;  1OYX A;  2YLC A;  3RKY A;  1PRM C;  2GFU A;  5KYY B;  1M8V A;  2YXY A;  2YRD A;  3RKX A;  2J7I A;  3I5R A;  1M3C A;  2KY9 A;  1IZ6 A;  1MNE A;  3A8H B;  2CZ0 B;  2OJ2 A;  4QT7 A;  2M9U A;  4WTO B;  5HY6 A;  2R58 A;  2DL8 A;  1R0B G;  5GAO m;  4KGV B;  2PTK A;  1OPL A;  1WPY A;  4CI0 C;  3MKD A;  3BE3 A;  1HXD A;  2RI5 A;  4MDW A;  4J9H A;  5LJ5 d;  2JZ2 A;  1VQN A;  3GNF B;  4LD6 A;  4QQG A;  4N0A C;  1VA7 A;  1Q81 U;  5A0L A;  3SDZ A;  1AT1 B;  3G6E A;  5GAN 6;  1SPK A;  1SF9 A;  5FWC A;  1UEB A;  3A98 A;  2FPF A;  4UC4 A;  3NTK A;  2FO0 A;  3RR6 A;  3MO8 A;  4XU3 A;  1Y57 A;  1VQ4 Q;  2DX1 A;  1QKX A;  2YWW A;  1K9M C;  2V8J A;  2OTJ T;  5IXB A;  2OTL T;  3JCM e;  4ANJ A;  3FIF A;  3E2U A;  4AG1 C;  3M54 A;  1XJW B;  1D0Y A;  1BBZ A;  5FRO A;  4MDX A;  1I4K 1;  5HCK A;  3CD6 Q;  2XDP A;  1R77 A;  1E6H A;  4KH1 B;  2GNC A;  5GJW B;  4HKE A;  2QXF A;  2LC4 A;  4BY6 B;  5LJ3 f;  4NS5 A;  2DEU A;  1PNJ A;  4AMC A;  2A3L A;  1RAB B;  4QVC A;  3MHX A;  4C92 A;  3CME Q;  5GAO p;  2K57 A;  2M0O A;  2LNV A;  3JCM c;  2G6F X;  3UWN A;  4J9F A;  2KT8 A;  5IHN A;  3CPW A;  3VV0 A;  4IUV A;  2P4R A;  2X4X A;  4C5H A;  2LQ8 A;  3I55 Q;  4C5E A;  1YI2 T;  3LH5 A;  4IUP A;  4FSX A;  4JUV A;  1AVZ C;  1SEM A;  1XQH A;  2MI6 A;  2YUO A;  2JMA A;  3VUB A;  2CP7 A;  4JRI A;  1WLP B;  3QDR B;  1RAE B;  5HK0 A;  3CBM A;  4KUI A;  1G3T A;  4RTU A;  3T9N A;  2E4H A;  1BCO A;  4M7D F;  4Z89 A;  1C1A A;  2CT3 A;  1ZUU A;  3CEY A;  3SWN B;  2JTM A;  1VQ4 A;  4IUR A;  2DBM A;  5D7U A;  2BE9 B;  2ATC B;  3CCE T;  4RG8 A;  2EVR A;  3CCU Q;  2E6N A;  5GJV B;  4E7Z A;  2EFI A;  2DF6 A;  5LJ5 g;  4EPC A;  1BU1 A;  1EIF A;  5GAN d;  4F7U F;  1OV3 A;  4HCC A;  3MP6 A;  2YUN A;  2ZZD A;  1AZE A;  1PD0 A;  2E3I A;  1EX4 A;  3TSW A;  2ROL A;  4C92 G;  2E65 A;  4KT0 E;  4Y92 A;  4J9G A;  2QA4 T;  5KYY A;  1GCQ C;  1WJS A;  3QYH B;  4J9I A;  5CAI A;  2CP6 A;  3URG A;  2JW4 A;  4M75 E;  3JB9 J;  4CRI A;  1QVF P;  2KMT A;  2NUZ A;  3M4G A;  1BIB A;  3CME A;  3E9G A;  4LUE A;  2V1Q A;  2FRY A;  3VS5 A;  2JVV A;  5CK9 A;  4RG2 A;  4ZNX A;  2JTF A;  2KXD A;  3RES A;  4L59 A;  1YWP A;  3M53 A;  1U3O A;  2KAF A;  2CSQ A;  1C0M A;  4TVR A;  1UG1 A;  1WHG A;  1NJI C;  2DXC A;  4FT2 A;  3HHT B;  2EJF A;  5GMK h;  3JCM P;  3LGF A;  4HCK A;  2XG8 D;  3I55 A;  4BI3 A;  1MHN A;  4O6J A;  4PJO F;  1NEB A;  2RA2 A;  4D6W A;  5GAM d;  5LJ3 j;  3ZFJ A;  1GXI E;  2A08 A;  4ZN1 A;  3ER0 A;  4J6X A;  4XQ3 A;  3GIB A;  4GLK A;  5CKD A;  4GLM A;  4JDS A;  3L2R A;  5FU6 C;  4M7A B;  2P0Q A;  1AZG B;  1IO6 A;  1AWX A;  5CR2 A;  4JS4 A;  4OMP A;  3CCU A;  2OTL Q;  2P0P A;  4C92 F;  2O88 A;  4KUD K;  4HVV A;  9ATC B;  5J39 A;  2L2P A;  2EQM A;  2JMC A;  2D9T A;  4OMM A;  1SRM A;  2SRC A;  3ZL7 C;  3VUZ A;  1Z9Q A;  1X27 A;  4A4G A;  2DVE A;  4FSS A;  3V7C A;  1Q7Y C;  3JCM J;  2DTH A;  4PNO A;  3GP8 A;  1QVF A;  2WSF E;  1M90 R;  3M57 A;  1D09 B;  2RJE A;  3JB9 G;  1I1J A;  5GAN g;  5FRM A;  3CXC P;  3REB B;  1B3Q A;  3G71 T;  1WA7 A;  5KCO A;  2AK5 A;  1UB4 A;  1MMD A;  4A4K A;  5FLX E;  1NM7 A;  2HQH A;  1KHI A;  3JV3 A;  1T3S A;  5CQX A;  3VS4 A;  4M7A D;  3SWN A;  1Y07 A;  1JRI A;  3OMC A;  2IIM A;  2QDY B;  2FPE A;  2CZ7 B;  1VQ5 T;  1S72 T;  4M78 E;  3MP1 A;  1YI2 Q;  2O01 E;  2HQX A;  2CZ1 B;  4E7I A;  3O5Z A;  1M90 U;  2OAU A;  1YNZ A;  3V8L A;  4JRK A;  2EIF A;  3CCQ Q;  4OB0 B;  5FU6 B;  2K3X A;  2IG0 A;  4M78 D;  5KYU B;  4M77 C;  2ZPG B;  2RD1 A;  4LNP A;  1M27 C;  2E41 A;  2QDL A;  3JCM b;  4BDY A;  1QP3 A;  3ASK A;  4BDZ A;  3TQ7 P;  2OTL A;  3CCE Q;  2GQI A;  1UE9 A;  5GAM g;  4JJB A;  3JSC A;  5KH6 A;  2GFA A;  2VXE A;  4LDX A;  2DJQ A;  1BYM A;  3RMQ A;  4A53 A;  1HJD A;  3QDF A;  2VWF A;  1NLO C;  2QA4 Q;  3NHN A;  3E1S A;  3UA7 A;  1IXD A;  1VQP T;  2ED1 A;  4XTW A;  4E47 A;  3JB9 F;  2M0Y A;  4HA8 A;  2RNA A;  2GTO A;  4X9C A;  1MND A;  3PIP A;  2DRM A;  2V1R A;  2C0T A;  5LJ3 d;  4QQ6 A;  2VYT A;  3CXC A;  1GCP A;  8ATC B;  1QVG A;  2JUF A;  2A37 A;  4PJM A;  2XDD A;  4L5G A;  1RLQ C;  2HZY A;  1KHC A;  4OML A;  1YCS B;  1JJ2 S;  5FWB A;  4DOW A;  2CT4 A;  5GMK j;  2RM4 A;  3PMI A;  4B6M A;  4M7A A;  4HCZ A;  3JB9 I;  3G7Z A;  4DEX A;  2V8K A;  2B8A A;  1YI2 A;  5KCH A;  1ZUK A;  4M77 B;  1WHH A;  4IUU A;  3OSV A;  2QAZ A;  1VQO T;  2K79 A;  1GCQ A;  4ELZ C;  3M0S A;  5I21 A;  1SHG A;  2EQU A;  3ZBD A;  2C0O A;  4J9C A;  5GAM h;  4XU2 A;  7AT1 B;  2C06 A;  3I5S A;  2KRM A;  1JU5 C;  2DNU A;  4C0G A;  1UGV A;  1YP5 A;  2DAQ A;  1KC8 R;  3CD6 T;  1TUD A;  2JTE A;  2EBP A;  1ZA2 B;  2P0K A;  3FEO A;  1TXQ A;  1B34 B;  5IT9 E;  4M7D E;  2L3Q A;  3H0I A;  2LVM A;  3WXM B;  3CCE A;  2KRO A;  4LDV A;  4OMN A;  4M7D D;  3OQ5 A;  3OYB A;  2KK4 A;  2PUO B;  4C0F A;  3QWX X;  2QA4 A;  5KYW B;  4NL3 A;  4QQD A;  5A2Q E;  2VXF A;  1K4U S;  4F7U E;  2IVW A;  4Y91 A;  2RQW A;  1Q81 C;  2KVQ G;  3G4S Q;  5DY9 A;  4CC7 A;  1LOJ A;  3I35 A;  2EPD A;  4M7A G;  3E19 A;  4MML A;  4XAX B;  1T3L A;  2EQI A;  1PSF A;  2QQA A;  1R8O B;  4OMF B;  5CKE A;  2M02 A;  1D1C A;  4FYW B;  4RUG A;  5KYU A;  4AT1 B;  1YJN Q;  1K73 R;  4OMQ A;  2RO0 A;  1MGQ A;  2MOX A;  2K5I A;  1I0C A;  1N9S A;  3UAT A;  2AKK A;  2YRV A;  5D6Y A;  1G3S A;  2XID A;  1VQ5 Q;  1WHJ A;  3P8B B;  3A8L B;  5LJ3 g;  1S72 Q;  3VYG A;  3CC4 T;  2D0N A;  3PT9 A;  4FIB A;  2E64 A;  4XTV A;  4KH0 B;  2MIO A;  4PJO E;  5CIU A;  2Y4X A;  2DXB A;  2D0Q B;  3MEA A;  2XIC A;  4EMK C;  3CBO A;  1K1Z A;  4V2S A;  2H3E B;  1VIF A;  1I8F A;  3QG1 A;  3JCM f;  4PJO D;  1OI1 A;  1LNX A;  3BW1 A;  2WSC E;  3NTI A;  1ACM B;  2W0Z A;  3LX7 A;  3OW2 P;  1M1K R;  2E12 A;  2LRQ A;  5KE2 A;  2RHZ A;  1D0X A;  1QWF A;  2HSP A;  1BCM A;  2CRE A;  2FZC B;  2EJG A;  2A28 A;  1IB8 A;  1U8R A;  3REA B;  1NLP C;  1PKS A;  1VQP Q;  3M59 A;  3G4S A;  3CPW P;  2KEA A;  1W2B A;  1GBQ A;  1TS9 A;  4JJN K;  1M3B A;  1W4S A;  2K3B A;  1TSF A;  4FW1 A;  1M1K U;  3EGX B;  4M77 A;  3WVE B;  3M5A A;  2A36 A;  3G71 A;  3OYE A;  2YRC A;  3L2Z A;  1K0S A;  5LJ3 h;  1M8M A;  1FXX A;  4OVA A;  1YJN A;  3MJX A;  3CMA T;  4GY5 A;  2DBK A;  2M16 A;  2F5K A;  3VS3 A;  1B34 A;  2R57 A;  1VQ5 A;  1EZZ B;  1J3T A;  5KYN A;  1S72 A;  1UJY A;  4CC3 A;  1G83 A;  2W10 A;  1WDX A;  1KQS A;  2SEM A;  1YCY A;  1KK7 A;  1UGP B;  4EMK B;  1VQO Q;  3SWN C;  5GAM j;  3LGL A;  1MV3 A;  4E7L A;  2EGC A;  4PL6 A;  5KYW A;  1N6A A;  2ZGW A;  2LZ6 B;  4EMH A;  1RAD B;  1VYV A;  2CGH A;  2DYI A;  1H8K A;  2LX7 A;  1T0H A;  4HXJ A;  1O75 A;  3OW2 A;  2DET A;  1SSF A;  2DXT A;  3OS2 A;  2KQW A;  2X51 A;  1UEC A;  2DZ9 A;  2F1L A;  1CKA A;  1G8X A;  4M77 G;  2ZAE A;  1H3Z A;  1VQP A;  4RTX A;  4J83 A;  4KRT A;  3QYG B;  5KE3 A;  4PLL A;  4Z8A A;  1UFF A;  4WF2 A;  3HRU A;  2DL5 A;  1TU0 B;  3D7S B;  4ZGD B;  2DJZ A;  2VKN A;  1M30 A;  4JPB W;  1WGS A;  3X28 B;  1KQ1 A;  1X2K A;  2DM1 A;  3FRN A;  4GBQ A;  3UDC A;  1OEB A;  2RJF A;  1G2B A;  2EGA A;  3CCQ T;  4M75 B;  2ZPH B;  4E7H A;  3MPU B;  1K9A A;  3QJ6 A;  2A0F B;  1TTH B;  1ZA1 B;  3IQL A;  2DA9 A;  3ZEH A;  2DTO A;  3H41 A;  4A4F A;  2LT1 A;  4FL6 A;  2RK1 A;  3CC4 Q;  1RUW A;  4MZT A;  1VQO A;  5C6S A;  1WI7 A;  4JJD A;  2MAM A;  2DD4 A;  2KBT A;  3VU3 C;  4M7A C;  1VQ6 T;  2RQU A;  4BUG A;  5GAO l;  3OS0 A;  4JRP A;  4ATO A;  4BB7 A;  3CCV T;  3CD6 A;  3M56 A;  2HBW A;  1RLP C;  1VQ9 T;  5J3B A;  2E3H A;  3OYK A;  1EFN A;  1XTD A;  2BIV A;  2J6O A;  2KDS A;  1QVF S;  1ZSG A;  4M78 C;  4M77 F;  1FYN A;  2PU9 B;  5CCA A;  3FC3 A;  1YN8 A;  1ZLM A;  2E5Q A;  4M75 D;  3EFS A;  2FZG B;  1M90 C;  3EGD B;  2GQV A;  3GBQ A;  1Y96 B;  1B07 A;  1AWW A;  2DMO A;  3VS7 A;  2FB7 A;  1PM3 A;  3EHR A;  4J7I A;  3E9F A;  4JJC A;  1TUC A;  2O9V A;  3KXT A;  3HRT A;  1OZ3 A;  2OAW A;  4YTL A;  3DB3 A;  4N4I A;  3S6W A;  1SG5 A;  2QK0 A;  2Z0W A;  4JS5 A;  2M1H A;  1IHW A;  1X6O A;  1TUG B;  2L89 A;  3V7S A;  4B9X A;  4EMK A;  4FYV B;  3RIR A;  2YHT A;  1F1B B;  3H0F A;  3V7R A;  2COY A;  4FCY A;  2HEQ A;  3O8V A;  2OX7 A;  2BZX A;  1PWT A;  2XD0 A;  1TH7 A;  2ABL A;  1Q82 C;  3RER A;  1X69 A;  4OB1 B;  4PFP A;  5HKC A;  3VS2 A;  3CMA Q;  2RQT A;  2MWO A;  2QG9 B;  1WFW A;  2RMO A;  3C95 A;  1NPP A;  4A4H A;  1W6X A;  1KQ2 A;  2RN8 A;  1HK9 A;  3JCM V;  2VV5 A;  3HFO A;  3CC4 A;  1QMC A;  5I2S A;  4FU6 A;  1LCK A;  1ZHI A;  1X43 A;  1ZQ1 A;  2CKK A;  4LD9 K;  3OYN A;  3KUF A;  3M4Y A;  1Q86 R;  2JJ9 A;  2H3J A;  3VS0 A;  1FMW A;  2I0N A;  3L2V A;  4M78 B;  1N27 A;  3M9Q A;  2K5F A;  2RHY A;  4DBQ A;  3MEU A;  2DVJ A;  2YUP A;  1JXO A;  4RTZ A;  5FU7 B;  1ARK A;  2ZPF B;  3PVQ A;  3JCM d;  3G4S T;  2YDL A;  1UDL A;  5IAY A;  5GMK i;  2D8H A;  2XKO C;  3EG1 A;  3X24 B;  3CXC S;  3SEM A;  2AZS A;  1BB9 A;  1SSH A;  3OMG A;  2BKD N;  1QVG P;  1BI0 A;  4M75 A;  3OBW A;  4VUB A;  5HK3 A;  1Q86 U;  1VQL T;  2CH4 W;  1YJN T;  2PZ1 A;  2DKG A;  2ZPE B;  5FW9 A;  4C8Q E;  3CCM T;  1LJO A;  4J5Y A;  4M4Z A;  3CCL T;  3BDU A;  4QVZ A;  2K3Y A;  4KGX B;  2RHU A;  4F14 A;  5CKB A;  4DBF A;  4D8K A;  4C8Q D;  3F70 A;  3VJP A;  4AFQ C;  3LLR A;  2QGG A;  2LCS A;  5CQY A;  3CMA A;  2DK3 A;  2JN0 A;  2O9S A;  3VS6 A;  1I5L A;  4OMO A;  2LP5 A;  2HAX A;  2L5Q A;  1K8A C;  3PGG A;  2FRW A;  2KRS A;  1KC8 C;  1OU8 A;  2COW A;  3JCM W;  2EKO A;  5DLO A;  1PG5 B;  4PLI A;  3I56 T;  2KE9 A;  1PSE A;  1DJ7 B;  1GFC A;  4B9W A;  1VQ6 Q;  4Y28 E;  1YWO A;  3CCV Q;  2XI9 A;  3EGD A;  1QW1 A;  1Y96 A;  1UGS B;  3LWH A;  1VQ9 Q;  5GMK e; 
#chains in the Genus database with same CATH homology
 4E7J A;  4A4E A;  3JCM Q;  4HKE A;  2QXF A;  2K5I A;  2RI2 A;  4M75 G;  5L8R E;  1N9S A;  5D6W A;  2RHX A;  3CCJ T;  3KBG A;  2LC4 A;  4II1 A;  2YRV A;  4BY6 B;  1Y7X A;  5D6Y A;  1G3S A;  2XID A;  4NS5 A;  5LJ3 f;  3P8B B;  3A8L B;  3TCJ A;  5LJ3 g;  3QSU A;  2A3L A;  3VYG A;  4DOV A;  3CC4 T;  1N9R A;  4QVC A;  3BY7 A;  3MHX A;  4C92 A;  2DXU A;  4R56 A;  4C0D B;  3OYD A;  3PT9 A;  3OYY A;  5GAO p;  2K57 A;  2M0O A;  2QEX T;  2LNV A;  1D3B B;  4FIB A;  2E64 A;  4XTV A;  3JCM c;  3DKM A;  3QKJ A;  5EG2 A;  3OYM A;  1YIJ A;  4PJO E;  2O4X B;  4M7D B;  2QTX A;  3UWN A;  5CIU A;  2Y4X A;  4C8Q B;  3PIO A;  4ME7 A;  2DXB A;  5LJ5 h;  4LDW A;  2D0Q B;  5LJ5 e;  3MEA A;  2XIC A;  4EMK C;  2DO3 A;  3CBO A;  1VQK T;  1JBM A;  4V2S A;  1VIF A;  2LT4 A;  4XU1 A;  3V8J A;  3CPW A;  1I8F A;  3QG1 A;  3VV0 A;  3JCM f;  2BUD A;  4PJO D;  2ZPI B;  1OI1 A;  1LNX A;  2FVU A;  3BW1 A;  3OYH A;  2HQE A;  1BKB A;  3JCM g;  2QQ9 A;  1OZ2 A;  2WSC E;  3M55 A;  3NTI A;  4IUV A;  4C5I A;  2DIG A;  2X4X A;  3LX7 A;  4C5H A;  4JRQ A;  3ME9 A;  2E12 A;  2LRQ A;  3CPF A;  2LQ8 A;  1K73 C;  5KE2 A;  2RHZ A;  4C5E A;  1YI2 T;  4IUP A;  4FSX A;  4JUV A;  4F7U B;  1XQH A;  2MI6 A;  2FHD A;  3VKI A;  5IT9 E;  3VUB A;  3CCR T;  2EJG A;  4JRI A;  1WQW A;  4MZM A;  3CCQ A;  3QDR B;  1VQ7 T;  3AHU A;  5HK0 A;  3CBM A;  4XTZ A;  4KUI A;  1U8R A;  1G5V A;  3QO3 A;  2HNI A;  1G3T A;  2PVD B;  1QVG S;  1NE8 A;  3T9N A;  1Q7Y U;  4M7D F;  2G3R A;  1U1S A;  3RMS A;  3DLL A;  5C0M A;  4M78 A;  3V8K A;  2RB6 A;  4C0D C;  2FL7 A;  3CEY A;  3M59 A;  3SWN B;  3JRZ A;  2JTM A;  2DEQ A;  1I81 A;  2MWP A;  3G4S A;  3L42 A;  4IUR A;  3SD4 A;  3S3O A;  1VQ4 A;  1W2B A;  3NTH A;  2K2V A;  4JJN K;  2E10 A;  3CBP A;  3OS5 A;  4M7D C;  2L3R A;  1W4S A;  3A8G B;  4N0A A;  3OB9 A;  5GAN f;  2I2L A;  3FB9 A;  3CCE T;  4RG8 A;  3OYL A;  3QUI A;  1M1K U;  4M77 A;  3WVE B;  2RH2 A;  3M5A A;  2E6N A;  2F69 A;  3LW5 E;  3RKW A;  5LJ5 f;  1VQ8 A;  3G71 A;  3CC7 T;  2EFI A;  1XNI A;  1M5Q 1;  5LJ5 g;  4EPC A;  3OYE A;  1EIF A;  1YHQ T;  1VQ6 A;  4HT8 A;  5GAN d;  3TEE A;  4F7U F;  3WVD B;  3L2Z A;  1M1K C;  4HCC A;  3MP6 A;  2ZZD A;  3GLX A;  3P8D A;  5LJ3 h;  3CCV A;  1FXX A;  4OVA A;  4FT4 A;  1YJN A;  4C92 G;  3LH0 A;  1VQN T;  2E65 A;  3MEV A;  4KT0 E;  2QA4 T;  1V29 B;  1VQ9 A;  1NZ9 A;  2PVO B;  3G6E T;  3CMA T;  4GY5 A;  1WJS A;  3QYH B;  2JOY A;  5CAI A;  2M16 A;  1G3Y A;  2F5K A;  3QJY A;  3URG A;  1B34 A;  2QI2 A;  3PMT A;  2R57 A;  4M75 E;  3UT1 A;  1VQ5 A;  4IUQ A;  3JB9 J;  4CRI A;  4PJO B;  1S72 A;  4ZTF A;  2KMT A;  3M4G A;  1KQS A;  3M58 A;  4BE1 A;  1BIB A;  1UGQ B;  1YCY A;  3QHS A;  3E9G A;  3OYF A;  5GMK m;  3CME A;  1UGP B;  4QW2 A;  1X01 A;  3BDL A;  3JCM h;  4EMK B;  3HKS A;  3SWN C;  2JVV A;  5CK9 A;  4RG2 A;  4JLG A;  3OYJ A;  2NLU A;  2JTF A;  3LGL A;  3RES A;  4L59 A;  3RUX A;  5GAM j;  1NJI U;  1BI1 A;  3M53 A;  5GAN 3;  4E7L A;  1M4Z A;  3C12 A;  4PL6 A;  2KAF A;  2X4W A;  4XU0 A;  1N6A A;  2ZGW A;  4IKF A;  4TVR A;  2YLB A;  1NJI C;  2EWN A;  2DXC A;  4EMH A;  2CYZ B;  4FT2 A;  3HHT B;  2CGH A;  2EJF A;  5GMK h;  3JCM P;  2EAY A;  3X26 B;  3GOX A;  3OYG A;  3S3M A;  5GAN 7;  2OTJ A;  1YJ9 A;  3LGF A;  2XG8 D;  4OGC A;  5CVI A;  5DM7 R;  2LCL A;  1O75 A;  4M78 G;  3OW2 A;  1KG1 A;  1SSF A;  2DXT A;  4BI3 A;  1MHN A;  3I55 A;  4O6J A;  4PJO F;  4DQ2 A;  4XTU A;  5GAO q;  2RA2 A;  4D6W A;  3OS2 A;  2KQW A;  1Q82 U;  5GAM d;  3INZ A;  5LJ3 j;  2DZ9 A;  3SFM A;  3X25 B;  3OYI A;  3ZFJ A;  3J81 E;  1GXI E;  2DTI A;  5CKH A;  3VYH B;  4ZN1 A;  5GAN 4;  3LYI A;  1RL2 A;  5GAN h;  4M77 G;  4PJO C;  1X75 C;  3ER0 A;  5GAN e;  4J6X A;  1YIJ T;  2Y4Y A;  4XQ3 A;  1JJ2 A;  3GIB A;  2MF2 A;  1VQP A;  1H3Z A;  4GLK A;  4J83 A;  2P4T A;  3QYG B;  4PKC C;  3L2U A;  4E7K A;  5CKD A;  2D6F A;  5KE3 A;  3OBY A;  4JDS A;  3QXE B;  3J7A F;  4PLL A;  4WF2 A;  3L2R A;  3HRU A;  5FU6 C;  4M7A B;  2P0Q A;  2RI3 A;  4ZGD B;  4OP0 A;  3H8Z A;  3OW2 S;  2MMP A;  5CR2 A;  3GNG A;  4JS4 A;  1YIT A;  1NPR A;  2DJZ A;  2LDM A;  3CCU A;  5M9O A;  2P0P A;  3FLG A;  2HD0 A;  3QZ5 B;  4RCB A;  5J26 A;  4C92 F;  2QQS A;  3TRE A;  1WGS A;  4OGE A;  3X28 B;  2FYK A;  3OSS C;  4KUD K;  1KQ1 A;  3FRN A;  1D3B A;  3UDC A;  4J6Y A;  5J39 A;  2K4Y A;  2RJF A;  2EQM A;  2LCC A;  2DPP B;  2D9T A;  2O4X A;  4EDU A;  3CCQ T;  4C8Q A;  4M75 B;  2ZPH B;  4M7D A;  3EAE A;  3MET A;  2DZC A;  4C92 C;  4E7H A;  3PNW C;  4C92 E;  1G3W A;  3QJ6 A;  4KBM B;  3VUZ A;  4A4G A;  2DVE A;  5DLQ E;  3V7C A;  3CPW S;  2XU8 A;  1VQ4 T;  3ZEH A;  2DTO A;  1Q7Y C;  4A4F A;  3JCM J;  4M7A F;  2DTH A;  4PNO A;  3GP8 A;  2LT1 A;  4C92 D;  4Z02 A;  3QZ9 B;  4FL6 A;  2A7Y A;  2RK1 A;  3NFC A;  1QVF A;  3C4S A;  2WSF E;  3L2W A;  2E6Z A;  3M57 A;  4OF1 A;  3S3N A;  4MZT A;  2RJE A;  3A8M B;  3LWI A;  3JB9 G;  1VQO A;  4LDY A;  5C6S A;  5GAN g;  2MAM A;  2DD4 A;  3DB4 A;  2DD5 A;  3QPH A;  4F7U A;  5FRM A;  2DIQ A;  4BAC A;  3VU3 C;  4IUT A;  1VQ8 T;  3G71 T;  4M7A C;  1FWZ A;  3PFS A;  5GAM e;  5KCO A;  1VQ6 T;  2V8I A;  4BI4 A;  3A8O B;  1QP2 A;  4BUG A;  5LJ5 j;  5GAO l;  3OS0 A;  4JRP A;  4ATO A;  1UB4 A;  4BB7 A;  4A4K A;  3CCV T;  1VQL A;  3CD6 A;  5FLX E;  4MZP A;  3M56 A;  4M75 F;  4M78 F;  5GAN 5;  1P92 A;  1KHI A;  4BD3 A;  1VQ9 T;  2KSS A;  5CQX A;  5J3B A;  3CCS A;  4M7A D;  3SWN A;  3OYK A;  1Y07 A;  1JRI A;  1XTD A;  2BIV A;  3CCM A;  1ZBX A;  3OMC A;  2QDY B;  2KDS A;  2AHJ B;  1W2B S;  3CCL A;  2GF7 A;  4NL2 A;  1YJW A;  4M75 C;  4P5N A;  2CZ7 B;  1QVF S;  1O9S A;  2PVG B;  3FJP A;  4M78 C;  1VQ5 T;  2JNG A;  1S72 T;  4M78 E;  4BE2 A;  4N4G A;  3MP1 A;  4M77 F;  2LTO A;  2O01 E;  2HQX A;  2CZ1 B;  2PU9 B;  3J80 E;  3CME T;  4E7I A;  1M90 U;  2OAU A;  5CKF A;  3HRS A;  5CCA A;  3V8L A;  4JRK A;  2EIF A;  5GMK l;  4OB0 B;  3FC3 A;  1M9S A;  3UPU A;  2E5Q A;  4M75 D;  5FU6 B;  2K3X A;  2IG0 A;  3EFS A;  4M78 D;  3R6O A;  1M90 C;  4M77 C;  2ZPG B;  3CC2 A;  2GQV A;  2RD1 A;  4M77 E;  1Y96 B;  1K8A U;  2E41 A;  2X4J A;  4C5G A;  1KC8 U;  2EQK A;  2FB7 A;  3L1A A;  4XTY A;  4OB2 B;  4QVD A;  4RCC A;  3EFR A;  1WNL A;  4M7D G;  4J7I A;  4C8Q G;  3E9F A;  1BI3 A;  3MP8 A;  1WJR A;  3KXT A;  4OB3 B;  3JCM b;  3HRT A;  4BDY A;  1OZ3 A;  1UGR B;  4BI8 B;  4ZGJ B;  1QP3 A;  4M77 D;  3DB3 A;  4YTL A;  4N4I A;  3ASK A;  3S6W A;  4Q5W A;  3OYA A;  2QQB A;  4BDZ A;  4PJO A;  5GAM f;  1FX7 A;  1YJ9 T;  3QBY A;  2OTL A;  2E70 A;  3HP9 A;  4JS5 A;  2M1H A;  4FM4 B;  5GAM g;  5CO7 A;  3I56 A;  4HCB A;  3I55 T;  4KUL A;  1KQS S;  1X6O A;  2L89 A;  4C92 B;  3JSC A;  1M1G A;  2Y90 A;  3V7S A;  3X20 B;  4B9X A;  4EMK A;  2HBP A;  2R5M A;  5KH6 A;  3L2Q A;  3RIR A;  2GFA A;  2VXE A;  2YHT A;  4LDX A;  3GPL A;  5IN1 A;  3V7R A;  1VQM A;  5A0D A;  4NOY A;  5D6X A;  1BYM A;  3RMQ A;  4A53 A;  1VIE A;  3MCA B;  3O8V A;  5GAO r;  5AYF A;  2K5L A;  2XD0 A;  1Y71 A;  1TH7 A;  4X34 A;  1Q82 C;  4A54 A;  3JB9 H;  3RER A;  4F7U G;  1WQ7 A;  3E1S A;  4R55 A;  4OB1 B;  5HKC A;  1JB0 E;  2PUK B;  1VQP T;  4ZN3 A;  2MWO A;  1BI2 A;  4XTW A;  3C95 A;  4X9D A;  4E47 A;  1NPP A;  4A4H A;  3JB9 F;  5A0G A;  3CCJ A;  1KQ2 A;  1HK9 A;  3BFM A;  3JCM V;  2VV5 A;  4HT9 A;  3OA6 A;  4HA8 A;  3HFO A;  4X9C A;  3C94 A;  2R5A A;  3CC4 A;  2VC8 A;  5I2S A;  3QII A;  3PIP A;  4FU6 A;  1KD1 U;  4J8O A;  4BE0 A;  3MEW A;  1YIT T;  1N8R U;  1ZHI A;  3CCU T;  5LJ3 d;  4QQ6 A;  1M1F A;  1U1T A;  2EQJ A;  2F5T X;  2QEX A;  2VYT A;  2GCX A;  3GF5 A;  2LX9 A;  3DLM A;  3CXC A;  1ZQ1 A;  4XK8 E;  2RJC A;  3OS1 A;  2LQK A;  2CKK A;  4LD9 K;  5GAN 2;  3TU4 K;  3OYN A;  3KUF A;  1KD1 C;  1N8R C;  3JCM X;  1QVG A;  5I2M A;  2JUF A;  4C0Z A;  3M4Y A;  2VUB A;  4RKU E;  2XDD A;  4L5G A;  3OY9 A;  4JLI A;  4EMG A;  2H3J A;  1VQK A;  3Q1J A;  3L2V A;  2RJD A;  3HPW A;  4DA4 A;  3JB9 D;  4ZTJ A;  1K73 U;  1KHC A;  4M78 B;  1JJ2 S;  5FRN A;  1N27 A;  3M9Q A;  4DOW A;  5GMK j;  4M7A E;  2K5F A;  2RHY A;  2RM4 A;  3PMI A;  3MEU A;  2XDB A;  4HCZ A;  5FU7 B;  3G7Z A;  3JB9 I;  4M7A A;  2V8K A;  1WJQ A;  2ZPF B;  2B8A A;  3JCM d;  3G4S T;  1YI2 A;  5IAY A;  5GMK i;  5KCH A;  2XKO C;  4M77 B;  2WAC A;  1IRE B;  2X4Y A;  3X24 B;  4IUU A;  4J7F A;  3OSV A;  4N4H A;  3CXC S;  3CCR A;  2PQW A;  1VQO T;  1BIA A;  1VQ7 A;  3SB2 A;  4ELZ C;  4PJO G;  2RK2 A;  4BY6 C;  5I21 A;  1VUB A;  2EQU A;  2E1H A;  2XK0 A;  3OMG A;  5LL6 S;  3ZBD A;  3PTA A;  5GAN j;  5GAM h;  4C8Q F;  2BKD N;  2YLC A;  1OYX A;  4XU2 A;  1BI0 A;  4M75 A;  3OBW A;  2C06 A;  3RKY A;  1AHJ B;  4VUB A;  5HK3 A;  1Q86 U;  2EYQ A;  4C0G A;  1VQL T;  2GFU A;  2DAQ A;  3CD6 T;  4ZGE B;  1M8V A;  3RKX A;  1YJN T;  2L8D A;  2DKG A;  2ZPE B;  2KY9 A;  2X35 A;  3OYC A;  2P0K A;  3FEO A;  1IZ6 A;  1B34 B;  1QVP A;  3A8H B;  4L6V 5;  2CZ0 B;  4C8Q C;  3CCS T;  4C8Q E;  2LVM A;  3CCM T;  1LJO A;  1Q86 C;  4M7D E;  2M9U A;  4J5Y A;  3WXM B;  3CCE A;  3HL8 A;  3CCL T;  3BDU A;  5HY6 A;  2R58 A;  4QVZ A;  2K3Y A;  2CS7 A;  1YJW T;  2CZ6 B;  2WSE E;  4LDU A;  4LDV A;  5GAO m;  2RHU A;  3CC7 A;  3HSB A;  1RI0 A;  2XHC A;  5CKB A;  1YHQ A;  2RHI A;  1WPY A;  5GAO n;  4CI0 C;  4M7D D;  3OQ5 A;  4C8Q D;  2KK4 A;  3F70 A;  3OYB A;  4ELY C;  5LJ3 e;  2PUO B;  5FU7 C;  4C0F A;  1HXD A;  2RI5 A;  4MDW A;  3VJP A;  5LJ5 d;  2JZ2 A;  1VQN A;  3HFN A;  2QA4 A;  3GNF B;  4LD6 A;  4QQG A;  4N0A C;  3LLR A;  3N5B B;  4NL3 A;  4QQD A;  1Q81 U;  5A0L A;  3SDZ A;  4XTX A;  3FDR A;  1H64 1;  5CQY A;  5GAN 6;  3G6E A;  3CMA A;  3CC2 T;  2DK3 A;  4J6W A;  5A2Q E;  2VXF A;  4F7U E;  1UEB A;  2IVW A;  2JN0 A;  3JAM E;  1K9M U;  4UC4 A;  3NTK A;  4Y91 A;  1Q81 C;  1I5L A;  2KVQ G;  2QQR A;  3MO8 A;  4XU3 A;  2HAX A;  2L5Q A;  1K8A C;  3H6Z A;  1K9M C;  3PGG A;  5DY9 A;  4MMK A;  1KC8 C;  1LOJ A;  2V8J A;  2OTJ T;  2VGM A;  3JCM W;  2OTL T;  3JCM e;  3FIF A;  2EKO A;  5DLO A;  3I56 T;  4PLI A;  4M7A G;  3M54 A;  5GAN 8;  1YBY A;  3E19 A;  3P8H A;  4MML A;  1PSE A;  4XAX B;  1DJ7 B;  1PSF A;  2QQA A;  1R8O B;  4OMF B;  4B9W A;  4Y28 E;  5CKE A;  2ZPB B;  5FRO A;  1VQM T;  4MDX A;  1I4K 1;  2XI9 A;  1XOV A;  2ZCF B;  2XDP A;  4RMO A;  1QW1 A;  2VGN A;  1Y96 A;  1UGS B;  2RO0 A;  2EJ9 A;  3A5Z B;  3LWH A;  4O5V A;  1MGQ A;  5GMK e; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...