1M4ZA

Crystal structure of the n-terminal bah domain of orc1p
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
217
structure length
203
Chain Sequence
AMTMAKTLKDLQGWEIITTDEQGNITEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords ORIGIN RECOGNITION COMPLEX SUBUNIT 1
publication title Structure and function of the BAH-containing domain of Orc1p in epigenetic silencing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 54
structure length 203
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m4zA01
4FT2A 4BB7A 4LD9K 4JJNK 4DOVA 2FVUA 4FSXA 4FT4A 3PTAA 2FL7A 1ZHIA 4KUIA 4DA4A 3TU4K 1W4SA 1M4ZA 3PT9A 4KULA 1ZBXA 4DOWA 4KUDK
chains in the Genus database with same CATH superfamily
3V7CA 4J7FA 3SFMA 5C6SA 3NTKA 2HKNA 3P8BB 4LDVA 1WX6A 3M56A 1NEGA 4VUBA 1MGQA 1VYUA 1WJQA 1GRIA 2JNGA 3H0IA 4KGVB 4MDWA 1NM7A 5J39A 4LUDA 1M3CA 2ED0A 3OQ5A 3BFMA 4C92A 4E7LA 4DBRA 2ZPEB 1KQSA 3OS0A 2D9TA 5LJ5f 1PM3A 4J83A 1ZSZB 2RMOA 4GBQA 4XQ3A 2LCSA 1SSFA 1YI2A 1OU9A 2L3SA 2V1QA 3GIBA 1U06A 1AEYA 2ZAEA 1N8RU 2LNVA 4P5NA 4KT0E 1YJ9A 3G6EA 5FWBA 2PU9B 1M9SA 1OU8A 3VUZA 2Y4YA 1ZSZC 2FYKA 4ZGDB 1W6XA 4ZN1A 4LD6A 2BZXA 1U1SA 5GMKe 1RI0A 4X1VA 4FL6A 2KXCA 4XU2A 5KYUB 3TSWA 2HAXA 2K79A 2A3LA 3PNWC 1N6AA 4FU6A 2EYZA 2Y90A 1GBRA 2J6OA 4J9IA 5KCOA 4RTWA 2CKKA 5J3BA 4F14A 3M4YA 1HK9A 5CK9A 1XJWB 4PK4A 2MAMA 2RHZA 2P4TA 2HQXA 4O6JA 1BIAA 2F2XA 4JLIA 1UEBA 3PMIA 5GMKm 2LJ0A 1WJRA 3QZ5B 1BIBA 4BI4A 2ROTA 1VQ7T 1VQ7Q 1Y96A 1OX9A 2CP3A 3KBGA 4M75A 5LJ3f 2DK3A 1V76A 1M8MA 2J05A 2X4JA 3META 1QVGS 5FW9A 1UGRB 2C0TA 1PD0A 1VQMA 2L3QA 2YUNA 3JCMh 2LTOA 1I1JA 5HK3A 3CCQT 5CKFA 3RKXA 3CMEQ 3CCQQ 4N4GA 4E7ZA 5GMKj 2VVKA 5IHKA 3DB4A 1R0CB 2EGEA 2ZPHB 1G5VA 3V8JA 4A4HA 1D3BB 3EFRA 2FVUA 2FG0A 1G3TA 1B34B 2JM8A 1IHWA 2E41A 3M0SA 1NJIC 2RNAA 4RTUA 4Y92A 2QA4Q 3KXTA 1A0NB 3I35A 2KXDA 5J26A 4IUVA 5GAOq 2HBPA 2RJCA 3V7RA 4FM4B 1PG5B 4C0GA 1RAGB 2NYSA 1QKXA 3MEWA 3M57A 5IHIA 5LJ5h 1U5SA 4CC3A 1K0SA 2D6FA 1EX4A 2YRCA 4X9DA 4C8QC 3V8KA 4Y28E 5D6WA 1KC8R 2RI3A 1I8FA 4N4HA 1WGSA 1PWTA 2KRMA 4N0AC 2DZCA 1VQ8T 1VQ4Q 1VQ8Q 1Z9QA 4LUEA 1PHTA 3CC7T 4BE0A 4C92B 3CC7Q 4JRPA 1K1ZA 2A37A 3G4ST 4RCCA 1M2VA 2H3EB 4DA4A 3VU3C 1OEBA 2YWWA 1QCOA 4C92C 5HCKA 3RKWA 5FLXE 3QPHA 5GAMh 2DILA 4D6WA 5GAN8 3HKSA 1QVFA 3L42A 3EAEA 5KYYA 3QZ9B 2VWFA 4L6V5 4F17A 3E9FA 3G71A 4M78C 2WSCE 1JJ2A 3H41A 4PJOD 3HRTA 2COYA 4HCBA 2ZZDA 2DBKA 2ZGWA 2F2WA 3CC2T 4M7DF 4J9DA 2NUTA 1GFDA 3HRUA 1KIKA 2E1HA 2RQTA 3UF4A 2MWPA 2ATCB 4EMKA 4IUQA 1JQQA 2QQSA 3C0CA 1H92A 4JUVA 4Z88A 3QDRB 2SEMA 4EMHA 1NPPA 3URGA 5I21A 4HKEA 1VQ9T 3JAME 1VQ9Q 4KUDK 4PJOG 1D1AA 1OULA 1UB4A 1M27C 1Q86C 3L2ZA 3M0TA 1VQLA 4BD3A 3OA6A 2DTOA 1RUWA 4D8DA 3OYEA 3ZL7C 1KC8U 3CMEA 3CCQA 2FZCB 4RKUE 2QEXA 1RAHB 4M75C 1WQ7A 3QWXX 4NOYA 4JRKA 2A28A 1WHHA 5CQXA 2CGHA 2ENMA 2YHTA 2QA4A 1NZ9A 5KYNA 5D6YA 2K6DA 4UC4A 5IHNA 3MHXA 2RJEA 3H6ZA 4HVUA 4QVZA 2GTOA 3QJYA 4FW2A 3JCMc 1QVGP 2FRYA 4RTTA 5GANg 2QTVA 3G1JA 3BY7A 1G83A 2A0FB 3DB3A 2P84A 4PJOB 4FSXA 4FT4A 4KGXB 4KGZB 2KROA 1WI7A 2LT4A 1VQ4A 1VQ8A 2EJFA 3CCMA 2JTEA 5GAOr 1UECA 1KHIA 4AG2C 4BY6B 2V8IA 3PVLA 1M3BA 4FT2A 4HCKA 1T0HA 2VGMA 3LGFA 5GAOn 4M7AD 4XK8E 1M2VB 2QASA 5CKHA 4F04B 2M16A 3M53A 3QWYA 2F5KA 2O2OA 1M90C 1JXOA 1O9SA 4DBHA 5EG2A 3LH5A 3E19A 3MP8A 1LCKA 3A8GB 1YCSB 3CBMA 2ZCFB 3BDLA 2C0IA 4PFZA 5KYYB 1Q95G 2EQJA 3DKMA 4LDYA 3CCJT 5FU7B 3CCJQ 4OMLA 2RI5A 4BDZA 5HY6A 1VQKT 1VQKQ 1HSQA 2QG9B 1ARKA 2JVVA 4M7AG 1M4ZA 2YRVA 4M7DA 1S1NA 2D0NA 4KRTA 1AWOA 2LJ1A 1WXUA 3JCMJ 2EJGA 2KGTA 1G8XA 2V8JA 2HL5C 2DYIA 3CCLA 4QKUA 4BE2A 3VRZA 3OYMA 4EMKB 1WQWA 4MZTA 2DXBA 1FMKA 1RL2A 2EKHA 2Z0WA 1YITT 1YITQ 2A36A 3X20B 4J9BA 1W4SA 1WHJA 4FW1A 3EH1A 4IURA 4EDUA 2PVOB 4EMKC 1PKTA 1VQ6Q 3ZEHA 5LJ5g 4NS5A 1PSEA 2DEQA 5CIUA 4PL6A 2DL5A 2PUKB 2KE9A 2K3XA 2LMJA 2D8HA 1NLOC 3S3MA 2DE0X 1HD3A 1YP5A 3RBBB 2E65A 2QDYB 1VQOT 2QGFB 3QUIA 1T3LA 1WFWA 2O4XA 1VQNQ 2BIVA 4M7AB 2C0OA 3S6WA 5GAOl 2AKLA 3DLLA 2RJDA 1X2KA 4N4IA 4FCYA 2DETA 2CH4A 2XKOC 2GGRA 1RLPC 2XDBA 4IUPA 2FHDA 5FWCA 1UGVA 2FO0A 2K57A 2XHCA 5GAMg 3VS2A 1SG5A 3OW2A 1K9AA 4E47A 1Y0MA 2EGAA 4IUTA 2DJQA 2OTLT 1QWEA 2OTLQ 1O75A 3SWNC 4J9HA 3OYCA 2ABLA 2DNUA 3E9GA 1TG0A 2FEIA 2LJ3A 3CEYA 4EPCA 1X6GA 1GCQC 1C0MA 2EVRA 4WCIA 4J6WA 2CZ7B 2ROLA 4RG8A 4JS4A 1YJWT 3QDFA 3V8LA 3OSSC 4V2SA 1VA7A 2HKQB 5IN1A 3EG2A 2IG0A 4Z02A 1I5OB 3I56Q 1C6VX 1IHVA 1AWWA 2BTTA 2K4YA 4BACA 3MCAB 1RI9A 4C5HA 2COWA 3H9NA 3O5ZA 3L2UA 4AG1C 2DA9A 3ME9A 4HA8A 2VXFA 1VQPQ 2EQIA 3CCJA 2HL3A 1QP2A 1YJNA 1ZUKA 4KUIA 2GTJA 3OYIA 1JJ2S 1KQSP 2JXBA 1ZUUA 2CZ1B 4Q5WA 1H8KA 4C8QE 1K8AU 4M7DB 2E3IA 1M1KR 3GBQA 5CO7A 4LDXA 2AIRB 1AZGB 1BI0A 3CCRA 2OTJT 2PZ1A 5CKEA 1MMDA 3FC3A 2RO0A 3EHRA 4CC4B 1YITA 1XTDA 2MF2A 1WHMA 4M7DC 1DJ7B 4PJOF 3VS3A 2PNIA 3EG9A 1Y71A 2O9VA 4ANJA 4J5YA 1BI2A 3JRZA 1VQ6A 4C92E 2M02A 5IAYA 1D1BA 1N9RA 2E70A 2HZYA 4C5GA 2WSFE 1TUDA 4BDYA 1JBMA 4M77D 2HD0A 2HQEA 2MMPA 1QMCA 2O9SA 1VQNA 2XU8A 2KYBA 2F5TX 3NGPA 4M78E 2RPNA 3J7AF 2O4XB 3SEMA 2F2VA 1BK2A 2CZ0B 2V26A 2J6KA 2JM9A 3RESA 3JCMW 1WA7A 1AD5A 5ECAA 3QKJA 3DLMA 1WLPB 4F7UG 4RG2A 5GANh 1ZX6A 3OYGA 5I22A 1MV3A 3INZA 3TU4K 1AWXA 2OX7A 2XIDA 2L3PA 2YDLA 4M77G 1E6HA 2ESWA 4JJBA 3CCET 2DRKA 3CXCA 4DEYA 3CCEQ 2FZKB 4C8QD 1Q7YC 5GMKh 2FPFA 2CUDA 3RR6A 1PCXA 5FU6B 1D1CA 4FYVB 1UFFA 1E7OA 2DL7A 3NFCA 4CRIA 5GAOm 3CMAA 1M1KU 1VOMA 1ZBXA 2LCCA 1UHCA 4M75E 4R55A 1HJDA 3OYBA 2QQBA 5FU6C 1KQ2A 3OYYA 3VS0A 2AZVA 3A1PA 3MEUA 2MYSA 1I4K1 4TVRA 3I56A 2XI9A 5FRNA 4RTYA 3CCVT 5GJWB 2L3RA 4C8QG 2KDSA 1D0YA 4OGCA 1B7TA 1RLQC 2VC8A 1Q82C 2EFIA 3JCMe 4A53A 1M1FA 3E2UA 1RAEB 1VQPA 2M1HA 4M77B 3S3NA 3R6NA 1X27A 2WSEE 4JJCA 1N27A 4B6MA 1JB0E 5KYWA 4M78D 4M7AF 4NL2A 2RB6A 3OBWA 1SKUB 4DBQA 2NUPB 3D7SB 3CD6T 3CD6Q 1KQ1A 2GFAA 4ZTJA 4RTVA 2VUBA 2DVJA 5CCAA 3JCMV 4JPBW 4AFUC 1QW1A 3L2VA 2ZPFB 3EGXB 2LQKA 4E7JA 1FYNA 1ZLMA 1K9MC 4PJNA 2EQKA 1R77A 3RMSA 3HP9A 3CBPA 1GBQA 2CT3A 4PJOA 1QVFP 2J6FA 4M78G 3EG9B 1RABB 1YBYA 4A54A 4PNOA 5CQYA 1WJSA 1UGQB 3HRSA 1YIJT 1JJ2P 1OYXA 2LNHB 3QG1A 4ESRA 1W2BS 1IGUA 4QVDA 1OPLA 2BE7D 1MUZA 2DYBA 3M54A 1NYGA 1RADB 1SSHA 5EC7A 3G4SQ 1Q82R 3QJ6A 1Y07A 1QLYA 1K73C 2EGCA 1AVZC 3PIPA 4JS5A 4OMQA 2O31A 5GAMe 3RMQA 4FIBA 1S72T 1YWOA 1JEGA 3M4GA 1KSWA 3MO8A 3FIFA 3NPFA 1IZ6A 1IXDA 1NJIR 1TS9A 4XU3A 2K2VA 2JOYA 4X9CA 3OBYA 1I81A 3CCEA 1G3YA 2DD4A 3OMCA 1R0BG 1IB8A 2DFUA 2EYXA 3CBOA 1ABOA 1PKSA 3CC2Q 3I55T 1K9MR 3I55Q 3JB9H 2OJ2A 1MNDA 4OB1B 2QAZA 2X4XA 2RA2A 4IIMA 1UGPB 4XTUA 1OX8A 2A08A 2EYYA 5LJ3h 1UUEA 4C5EA 2YUOA 2LVMA 3HFOA 2A7YA 2DKGA 3RDVA 1M3AA 3M0PA 1VQ7A 3JB9I 1YHQT 3KFVA 3JSCA 2JTFA 2KRSA 2E64A 3VYGA 2DVEA 2DO3A 1E6GA 4ZN3A 1F1BB 2XICA 2LQWA 1BI3A 1PNJA 2VKNA 8ATCB 1K73R 1SPKA 3VRYA 3CPWS 5GAMj 4GLMA 1VQ5A 5IH2A 3FDRA 4M4ZA 3UWNA 2KT1A 3QXEB 4M7AA 2J7IA 2JT4A 5KYWB 1T0JA 2KRNA 4OF1A 1TWBA 3C4SA 2YUPA 3LLRA 1TH7A 3MJXA 4DBFA 2KR3A 2L89A 4RUGA 5CKDA 2DL4A 4J7IA 1JO8A 3MPUB 4A4GA 2KMTA 3R6OA 3CQTA 2QTXA 2K3YA 3M58A 2HSEB 1X43A 3UPUA 5IXBA 3RIRA 3LX7A 3OMGA 1NJIU 2CSIA 4F16A 1LJOA 3CCUT 2LX9A 8AT1B 1JXMA 2KNBB 2XDPA 1SHFA 2JMAA 3EFOA 4RTXA 3QO3A 3UA7A 2JUFA 1UE9A 3FB9A 1FMWA 4FYWB 4O5VA 5DLOA 1M5Q1 4PJLA 1OPKA 3CC7A 1I0CA 3PFSA 1QWFA 5AT1B 3UDCA 3CC4T 4PJOC 1Q86R 3L2RA 2L0AA 2DXCA 1KQSS 3G4SA 4ZTFA 4E7KA 3NTIA 3OYHA 1H641 2DMOA 3A8LB 1YN8A 1BKBA 4L59A 3M9QA 3C94A 4PLLA 4BY6C 2NUZA 2KYMA 3X25B 4F7UF 1N9SA 2DJZA 4AFZC 1OV3A 4PFPA 1Q81C 2AHJB 3M59A 4M77F 5D6XA 4JJNK 3JB9D 4C0ZA 2W0ZA 2XDDA 4C0DB 2NWMA 3VS1A 5L8RE 2JS2A 4XU1A 3CCST 2EPDA 3CCSQ 3N5BB 4M7DE 2GNCA 1W2BP 1QVGA 3PVQA 1KD1C 3PIOA 2HSPA 3VS4A 3CC2A 2LCLA 4KULA 2KT8A 3CXCS 2MPXC 3OSVA 2DXTA 2RQVA 4FSSA 1U3OA 1VUBA 3OYLA 1NLPC 2EQUA 3MP6A 5FU7C 3M5AA 2X3WD 3WXMB 2P0KA 3JCMd 5CR2A 5GAN7 1D09B 2LRQA 2RHIA 1ZQ1A 2RQUA 4OP0A 3LWIA 3JB9G 2F69A 1KK7A 2CS7A 2LQNA 3WVEB 2B86A 2HNIA 1VQ9A 3LYIA 1X2QA 3ER0A 3OW2P 4AFQC 2VASA 6AT1B 2EIFA 1VQ5T 1VQ5Q 2AKKA 2PUOB 2RN8A 1X6BA 4ELYC 2C06A 5GMKi 3A8HB 4OMMA 3T9NA 1BB9A 5DLQE 3OYAA 2BZYA 4BUGA 1VQOQ 1ZBJA 5M9OA 1B07A 2GF7A 1M90R 1WXTA 4OMOA 3VV0A 1N8RC 5GAN3 1XOVA 3MEAA 1TU0B 1Q86U 1ACMB 1UGSB 4KH0B 1CKBA 3L1AA 1IGQA 2RK2A 2PVDB 4OMNA 1H3ZA 2CH4W 2DM1A 2K5LA 3V7SA 3PTAA 5I11A 1TXQA 1SHGA 1TOVA 2ZPGB 2FRWA 4M7AC 1YI2T 4J9EA 3S3OA 2EBPA 1YI2Q 2BUDA 2LDMA 3OYKA 4M78F 3CPWP 1YJ9T 3HPWA 3EG1A 3G6ET 1YJ9Q 3HTRA 2XMFA 4XU0A 2HCKA 5GAN5 2CP6A 5GMKl 5CAIA 3MKDA 2QDLA 2B8AA 3EFOB 4QVCA 2GQVA 5GAMd 4RMOA 1H3HA 4DQ2A 1AOJA 2G6FX 2E4HA 5LJ3g 1TSFA 1HYOA 1C1AA 7AT1B 1MHNA 2DX1A 4OB2B 3G7ZA 3J81E 2MCNA 2DAQA 1YJWQ 5DM7R 1I5LA 3TSZA 3QSUA 3THKA 4HVVA 2GFUA 4J9CA 3HSBA 4HCZA 4HT8A 3LWHA 3PT9A 4JZ4A 4F7UA 4J6XA 1Y7XA 2OAUA 2PTKA 1J3TA 2MIOA 5KE3A 4M77A 3TVTA 2EYWA 1QVFS 3CCSA 2M51A 1CSKA 2NUPA 1NE8A 3IQLA 1WPYA 1VQKA 3HL8A 1PD1A 2D1XA 5L23A 4LNPA 1EZZB 1RACB 1M90U 1YFNA 2RD1A 5IXFA 1VQMT 3UA6A 3GNGA 1FXXA 1WXBA 3EGXA 4NL3A 2OTJQ 2CP0A 5A0LA 2AT1B 4CI0C 1EFNA 5GAOp 2DL8A 2P0QA 3JCMP 2LC4A 4LE9A 1N5ZA 2E10A 3FJ5A 3EH2A 3JCMf 3OYFA 4ZGJB 1G3SA 1GFCA 4E7IA 3JV3A 3QYHB 2JS0A 4C8QA 4ME7A 2LP5A 3HFNA 4QQGA 1UDLA 4N0AA 2GBQA 3GNFB 3CXCP 4HT9A 3HHTB 3FJPA 2CREA 3C95A 3OB9A 1VQOA 1KJWA 2QXFA 4HVWA 4LXCA 1NG2A 2YRDA 2DXUA 5AYFA 5GAN6 2P0PA 1MMNA 1ZA1B 2Y4XA 1AT1B 4ELZC 9ATCB 2P4RA 1BBZA 2I2LA 1K4US 1JU5C 5GANe 2RHYA 1MMAA 2CP2A 2K2MA 3OYNA 1XNIA 3M0QA 2EQMA 2DRMA 4M78A 2H8HA 2G3RA 2OTLA 1OI1A 2MOXA 4XTWA 3EFSA 4PJMA 2E3HA 2VYTA 4A4FA 5LL6S 2L5QA 2JN0A 3JB9J 2QGGA 5D7UA 3VJPA 3G71T 4XTYA 3G71Q 1WHLA 2CZ6B 5GAMf 3RNJA 2BZ8A 2KK4A 4BE1A 4B9WA 2KEAA 3Q1JA 2NLUA 1YJWA 3TQ7P 5IT9E 3X28B 2CP5A 1UJ0A 4XTZA 2M0YA 1V29B 4QQDA 1WHKA 2EJ9A 3F70A 1YNZA 2DIQA 4OMPA 4C92D 1W1FA 3FLGA 1JRIA 2DTIA 3SD4A 3SDZA 3UATA 3CCVQ 3ULRB 1WYXA 4A4KA 4F7UB 1KC8C 3LH0A 4YTLA 1PC0A 2JJ9A 2YLBA 2O88A 3TEEA 3TREA 5C0MA 2KY9A 2IPOB 2WACA 5GANj 3FEOA 5GAN2 1VQLT 2J06A 1VQLQ 4QT7A 4KBMB 2XD0A 2COZA 2KI7A 2FZGB 4OB3B 5HKCA 4DEXA 4M77C 4RCBA 4C92G 3E1SA 3CMET 4WTOB 2CDTA 3VYHB 3EHQA 4BI3A 2OTJA 1YCYA 2QEXT 2DBMA 3JB9F 2QEXQ 4JZ3A 1VYVA 2RHXA 1Q7YR 4PJOE 4MZMA 3M55A 2K5IA 5LJ5e 2R58A 1LOJA 2QA4T 1FMVA 3ZFJA 3EGDA 2X4WA 2EYQA 2CUBA 2X4YA 3L2QA 5A0DA 1LVKA 4C8QB 1G2BA 2KVQG 1KFZA 5FRMA 5A2QE 4IUUA 2DF6A 2X51A 1YIJQ 2DPPB 2AZSA 1UHFA 4PLIA 2QQRA 2X35A 1QVPA 3VS5A 1RAFB 3BW1A 1WIEA 1ZHIA 1MNEA 1NEBA 2ECZA 4M75D 4E6RA 4MMKA 2CSQA 3RKYA 1CKAA 2DTHA 3M0UA 2E5KA 3CPFA 3OY9A 4MDXA 1VQ4T 1M1GA 2EWNA 3CCMT 3CCMQ 1QP3A 4QQ6A 2QI2A 1RAAB 1LNXA 1FWZA 3GOXA 1S72Q 1ZA2B 4LN2A 1UJYA 4BB7A 2VB6A 3I9QA 3PMTA 1QQJA 1BU1A 2SRCA 3REBB 1PRLC 1VIEA 4FYYB 1IREB 2DL3A 3PE0A 2ED1A 3OW2S 4B9XA 1X75C 3VS7A 1D0ZA 3C12A 4M78B 5A0GA 4EMGA 1K76A 4M75G 4BI8B 4Z89A 3VKIA 4J6YA 4K11A 1M30A 5LJ5j 1TTHB 2CP7A 2XK0A 4R56A 3X26B 5LJ3e 1D0XA 4IKFA 2HDAA 3MEVA 2BKDN 2KSSA 3RERA 2KAFA 4JLGA 2VV5A 2E12A 1WZOA 2HEQA 5GAN4 3OYDA 1Q7YU 3P8HA 1YHQQ 5I2MA 4RTZA 2R57A 4Z8AA 3LW5E 3CCLT 3CCLQ 1OZ3A 1ABQA 1PSFA 3CCVA 2E5QA 2JW4A 3P8DA 1XQHA 1GCPA 3QBYA 3I5SA 3WVDB 4M7AE 2K5FA 4HXJA 4J9FA 4CC2A 4OGEA 1ZUYA 1I07A 1Y96B 1Z9ZA 4X34A 2EAYA 4L5GA 4LD9K 4M75B 3CD6A 4JRIA 5KYXA 2LT1A 3RUXA 4GLKA 2FL7A 1Q82U 1X69A 2BE9B 2X3XD 1P92A 2QQ9A 3KUFA 1LPLA 3BE3A 3NTHA 2PVGB 2GCXA 2RQRA 2AK5A 1WNLA 4OVAA 2EKOA 2MWOA 1TUGB 5LJ3j 4JRQA 2MK5A 2JTMA 4XAXB 2YLCA 1HXDA 5FROA 2K3BA 2L8DA 2O01E 3PGGA 3SWNA 3GLXA 2YT6A 3CCUQ 1VIFA 3EGDB 1OOTA 2QYZA 1YIJA 4C5IA 2XG8D 1SRLA 4JDSA 3TCJA 3SHWA 1M8VA 4A63B 1M2OA 4DOWA 1K9MU 1KG1A 1GCQA 2D8JA 2ZPBB 1B3QA 5GANd 3CC4Q 3J80E 1BYMA 1AHJB 4ZGEB 2IIMA 2W10A 3EG0A 1VYTA 3SB2A 1S72A 1SF9A 2RK1A 1KHCA 3NHNA 2IVWA 2EW3A 2X9HA 3LGLA 5KCHA 3H8ZA 1W70A 2DZ9A 1G3WA 3EGUA 1QCNA 1QKWA 2RH2A 1BCMA 4WF2A 1K73U 2V8KA 3JCMX 1Y57A 5KH6A 2VGNA 2R5MA 3QHSA 4PFOA 3GPLA 1NBEB 3I55A 1K8AC 1YWPA 1GL5A 4II1A 2HBWA 2YSQA 4C0DC 1OQKA 2YUQA 3A8OB 3OS1A 3OS5A 1NPRA 3JCMg 1MV0B 2CYZB 1T3SA 2E6NA 2QK0A 2KQWA 1YJNT 1YJNQ 2DIGA 3ZBDA 1IO6A 4ORZA 1K0XA 3OYJA 1OZ2A 2NUTB 4HCCA 4MMLA 1YHQA 3AT1B 2L2PA 4C8QF 4MZPA 2LX7A 3CCRT 3CCRQ 3X24B 4CC7A 1U1TA 1WHGA 1QCFA 1AWJA 3GP8A 2FPDA 3JCMb 1VQ6T 1SEMA 2VXEA 1Q81R 5DY9A 2JMCA 2M9UA 2YXYA 5LJ5d 1W2BA 2M0OA 4C92F 3MP1A 2K7AA 3NMZC 5KYXB 2FPEA 1ZSZA 2RM4A 1KD1R 3H0HA 4ATOA 3REAB 3VS6A 1TUCA 1VQNT 1K8AR 2LQ8A 4R0KA 2ZPIB 2PQWA 3O8VA 2I0NA 1SRMA 4M7DD 1V1CA 3AHUA 3G6EQ 1FX7A 1PRMC 2QQAA 3A98A 4LDUA 3CCUA 3JCMQ 4D8KA 2HQHA 3SWNB 1EIFA 2DERA 5KYUA 1AZEA 4J9GA 1UTIA 2RF0A 1MMGA 1M1KC 3CC4A 2OI3A 4IIOA 1X6OA 4A4EA 4QW2A 1R8OB 4KH1B 5KE2A 4C0FA 4ZNXA 5GANf 4E7HA 1RAIB 3A8MB 4M7DG 4PKCC 2H3JA 2D0QB 4E7SA 4F7UE 2RI2A 2RJFA 2HMAA 1NYFA 3CMAT 1N8RR 4M77E 2DD5A 3CMAQ 2JZ2A 4AMCA 1BCOA 1U8RA 4AFSC 2LZ6B 5LJ3d 3GF5A 4LDWA 3M0RA 4GY5A 3QIIA 3I5RA 2KBTA 3ASKA 2R5AA 1GXIE 3OS2A 4M75F 2MI6A 3EG3A 3I56T 4J8OA 3CPWA 1UG1A 3U23A 2RHUA 2OAWA 3QYGB 4XTXA 5CVIA 4E2FB 1ZSGA 5I2SA 4JJDA 1VQMQ 3VUBA 3H0FA 4AT1B 1Q81U 2CT4A 4Y91A 4XTVA 1VQPT 2E6ZA 1WDXA 1X01A 2F1LA 3A5ZB 4DOVA 2V1RA 2DEUA 1D3BA 1IRXA 2GQIA 5HK0A 1B34A 4OB0B 1KD1U 4EIKA 2RQWA 2DLPA 3FRNA 5GJVB 4OMFB 3UT1A 2K9GA 4PJJA 1BI1A 4FYXB 3L2WA 5CKBA 3BDUA 2FB7A
chains in the Genus database with same CATH topology
3V7CA 4J7FA 3ZEHA 5LJ5g 3SFMA 5C6SA 4NS5A 1PSEA 2DEQA 2RHXA 3NTKA 4PJOE 5CIUA 4PL6A 4OF1A 4MZMA 2PUKB 3P8BB 2K3XA 3M55A 4LDVA 3C4SA 3LLRA 3M56A 2K5IA 4VUBA 1TH7A 5LJ5e 2R58A 3S3MA 4MDXA 1H3ZA 2L89A 1LOJA 1MGQA 2QA4T 2E65A 2QDYB 5CKDA 1VQOT 1WJQA 3ZFJA 3QUIA 2X4WA 2EYQA 2O4XA 4J7IA 2X4YA 3L2QA 4A4GA 4M7AA 5A0DA 2KMTA 4C8QB 2KVQG 2BIVA 2JNGA 3R6OA 4MDWA 5FRMA 4M7AB 5J39A 5A2QE 3S6WA 4IUUA 2QTXA 3OQ5A 2K3YA 3M58A 5GAOl 2DPPB 3DLLA 3BFMA 4C92A 4E7LA 2RJDA 2ZPEB 4N4IA 4PLIA 2QQRA 3UPUA 2X35A 3RIRA 1KQSA 1QVPA 3OS0A 3LX7A 2D9TA 3OMGA 2XKOC 2XDBA 1NJIU 5LJ5f 4IUPA 3BW1A 4J83A 4XQ3A 1LJOA 2FHDA 3CCUT 2LX9A 1ZHIA 2XDPA 4M75D 1SSFA 2K57A 4MMKA 1YI2A 2XHCA 5GAMg 3QO3A 3OW2A 3GIBA 2JUFA 3RKYA 2DTHA 3FB9A 1N8RU 4E47A 2LNVA 3CPFA 4O5VA 5DLOA 1M5Q1 4P5NA 3OY9A 4KT0E 1M1GA 1VQ4T 1YJ9A 2EWNA 3G6EA 4IUTA 3CC7A 2PU9B 3CCMT 3PFSA 3UDCA 1QP3A 4QQ6A 2QI2A 1M9SA 1LNXA 1FWZA 2OTLT 3VUZA 3GOXA 2Y4YA 3CC4T 4PJOC 4BB7A 1O75A 2FYKA 4ZGDB 3L2RA 3PMTA 4ZN1A 3SWNC 4LD6A 2DXCA 1U1SA 3G4SA 4ZTFA 1KQSS 4E7KA 5GMKe 1RI0A 3OYCA 3E9GA 3NTIA 4FL6A 3OYHA 1VIEA 1H641 4XU2A 1IREB 3A8LB 1BKBA 4L59A 2HAXA 3M9QA 2A3LA 3PNWC 3OW2S 4B9XA 1N6AA 3CEYA 4FU6A 1X75C 4EPCA 3C94A 4PLLA 2Y90A 4BY6C 4M78B 3C12A 5A0GA 4EMGA 3X25B 4F7UF 4M75G 1N9SA 2DJZA 4BI8B 5KCOA 3VKIA 2CKKA 4J6WA 4J6YA 2CZ7B 4RG8A 5J3BA 2AHJB 4JS4A 3M59A 5LJ5j 4M77F 3M4YA 1YJWT 5D6XA 3V8LA 2XK0A 4JJNK 2QEXT 3JB9D 4C0ZA 3X26B 1HK9A 3OSSC 5CK9A 4R56A 4C0DB 2XDDA 5LJ3e 4V2SA 4IKFA 2MAMA 5L8RE 4XU1A 3CCST 2RHZA 3MEVA 2P4TA 5IN1A 2HQXA 2IG0A 3N5BB 4O6JA 4M7DE 4PJOD 2BKDN 4Z02A 2KSSA 1QVGA 1BIAA 2KAFA 3RERA 4JLGA 1KD1C 3PIOA 1W2BA 3CC2A 2LCLA 4JLIA 4KULA 2VV5A 1UEBA 3CXCS 2E12A 2K4YA 3MCAB 3PMIA 4BACA 4C5HA 5GMKm 5GAN4 1WJRA 3OYDA 3L2UA 3QZ5B 1BIBA 4BI4A 3OSVA 1VQ7T 1Q7YU 2DXTA 3ME9A 3P8HA 3OYLA 1Y96A 4HA8A 1VUBA 2VXFA 5I2MA 2EQUA 3MP6A 2R57A 5FU7C 3KBGA 4M75A 5LJ3f 3LW5E 2DK3A 3M5AA 3CCJA 3CCLT 1OZ3A 1QP2A 3WXMB 1PSFA 3CCVA 2E5QA 2P0KA 3JCMd 1YJNA 5CR2A 5GAN7 2LRQA 4KUIA 2RHIA 1ZQ1A 2X4JA 1XQHA 3P8DA 3OYIA 1JJ2S 3META 4OP0A 3LWIA 3JB9G 1QVGS 1UGRB 2CZ1B 2F69A 4Q5WA 2CS7A 3QBYA 3QXEB 4C8QE 1VQMA 1K8AU 4M7DB 3WVEB 2HNIA 3JCMh 1VQ9A 2LTOA 3WVDB 4M7AE 5CO7A 3LYIA 4LDXA 2K5FA 5HK3A 3CCQT 3ER0A 5CKFA 3RKXA 4N4GA 1BI0A 4OGEA 3CCRA 5GMKj 2OTJT 2EIFA 1Y96B 1VQ5T 5CKEA 4X34A 3DB4A 3FC3A 2EAYA 4L5GA 4LD9K 2RO0A 2ZPHB 4M75B 3CD6A 1G5VA 3V8JA 4A4HA 2PUOB 1D3BB 1XTDA 2MF2A 1YITA 4JRIA 4ELYC 2LT1A 3EFRA 2FVUA 3RUXA 1G3TA 4GLKA 2C06A 1B34B 4M7DC 2FL7A 2E41A 1DJ7B 4PJOF 5GMKi 1Q82U 1NJIC 3A8HB 3T9NA 1Y71A 3OYAA 5DLQE 4BUGA 4J5YA 1P92A 2QQ9A 3KUFA 5M9OA 2GF7A 1BI2A 3JRZA 3KXTA 1VQ6A 5J26A 4C92E 3NTHA 2PVGB 2GCXA 3VV0A 1N8RC 4IUVA 5GAOq 5GAN3 1WNLA 2HBPA 2EKOA 4OVAA 5IAYA 1XOVA 1N9RA 2MWOA 2E70A 3MEAA 5LJ3j 4JRQA 1Q86U 2RJCA 3V7RA 4C5GA 1UGSB 4FM4B 4C0GA 2WSFE 2JTMA 3L1AA 4BDYA 2RK2A 3MEWA 1JBMA 2PVDB 2YLCA 1HXDA 2K5LA 4XAXB 5FROA 3M57A 4M77D 3V7SA 2HD0A 2L8DA 2HQEA 2O01E 2MMPA 3PGGA 3SWNA 5LJ5h 3PTAA 3GLXA 2D6FA 4X9DA 1VQNA 2XU8A 4C8QC 2F5TX 3V8KA 4Y28E 2ZPGB 4M78E 5D6WA 1VIFA 4M7AC 3J7AF 2RI3A 2O4XB 1YI2T 3S3OA 1I8FA 4N4HA 1WGSA 2XG8D 4C5IA 2BUDA 2LDMA 4JDSA 3TCJA 3OYKA 1YIJA 1M8VA 4N0AC 2DZCA 4M78F 1VQ8T 4DOWA 1K9MU 1YJ9T 3HPWA 1KG1A 3G6ET 3CC7T 4BE0A 2ZPBB 4XU0A 4C92B 2CZ0B 3RESA 5GAN5 4JRPA 3JCMW 5GANd 5GMKl 5CAIA 3QKJA 3J80E 3G4ST 4RCCA 1BYMA 3DLMA 2B8AA 4F7UG 4RG2A 5GANh 3OYGA 1AHJB 4ZGEB 4DA4A 3VU3C 3INZA 3TU4K 2XIDA 4QVCA 2GQVA 5GAMd 4M77G 4RMOA 4DQ2A 4C92C 3CCET 3RKWA 3SB2A 3CXCA 1S72A 5FLXE 2RK1A 3QPHA 1KHCA 5GAMh 4D6WA 5LJ3g 3HKSA 5GAN8 2IVWA 1MHNA 4OB2B 4C8QD 3G7ZA 3J81E 1QVFA 3L42A 3EAEA 3LGLA 5KCHA 3H8ZA 2DAQA 1Q7YC 2DZ9A 3QZ9B 5GMKh 5DM7R 1G3WA 1I5LA 4L6V5 2RH2A 3QSUA 4WF2A 5FU6B 3E9FA 3G71A 1K73U 2V8KA 4M78C 3JCMX 2WSCE 1JJ2A 2GFUA 4CRIA 3NFCA 5GAOm 5KH6A 2VGNA 2R5MA 3HRTA 4HCZA 3CMAA 3LWHA 3QHSA 3PT9A 1M1KU 4HT8A 4F7UA 3GPLA 4HCBA 3I55A 2ZZDA 2ZGWA 4J6XA 1Y7XA 1K8AC 1ZBXA 2LCCA 3CC2T 2OAUA 4M7DF 4II1A 3HRUA 4M75E 5KE3A 2E1HA 4M77A 4C0DC 4R55A 3OYBA 3A8OB 1QVFS 2QQBA 5FU6C 1KQ2A 2MWPA 3OYYA 3OS1A 3CCSA 4EMKA 3MEUA 3OS5A 1I4K1 1NPRA 4IUQA 4TVRA 3JCMg 3I56A 2XI9A 1NE8A 5FRNA 2QQSA 1WPYA 1VQKA 3HL8A 3CCVT 2CYZB 2L3RA 2E6NA 4C8QG 2KDSA 2KQWA 4JUVA 1YJNT 4OGCA 2DIGA 2VC8A 1Q82C 2EFIA 3ZBDA 3JCMe 3QDRB 4A53A 4EMHA 1M90U 1NPPA 1M1FA 2RD1A 3OYJA 1VQMT 1OZ2A 4HCCA 3URGA 4MMLA 5I21A 4HKEA 3GNGA 3JAME 1VQ9T 1YHQA 1VQPA 2M1HA 4M77B 3S3NA 4C8QF 4KUDK 2WSEE 1FXXA 4MZPA 4PJOG 1N27A 1JB0E 4M78D 3CCRT 4M7AF 4NL2A 4NL3A 1UB4A 2RB6A 3OBWA 3X24B 1Q86C 3L2ZA 5A0LA 1VQLA 4CI0C 3CD6T 1KQ1A 2GFAA 5GAOp 4ZTJA 1U1TA 2P0QA 2VUBA 4BD3A 3OA6A 3JCMP 2LC4A 2DTOA 2E10A 5CCAA 3JCMf 3OYEA 3JCMV 3OYFA 1KC8U 4ZGJB 1G3SA 3CMEA 3CCQA 4E7IA 4RKUE 1QW1A 3QYHB 4C8QA 2QEXA 3L2VA 3GP8A 4ME7A 3HFNA 3JCMb 2ZPFB 1WQ7A 2VXEA 4M75C 4QQGA 1VQ6T 4NOYA 2LQKA 4JRKA 5DY9A 4E7JA 2M9UA 4N0AA 1K9MC 3GNFB 4HT9A 2EQKA 3HHTB 3FJPA 3RMSA 2M0OA 1YCYA 3HP9A 3MP1A 5CQXA 4C92F 3CBPA 2CGHA 3C95A 3OB9A 4PJOA 2YHTA 2RM4A 2QA4A 1VQOA 4M78G 2QXFA 4ATOA 1NZ9A 5D6YA 1YBYA 4A54A 4PNOA 5CQYA 4UC4A 1VQNT 2LQ8A 1WJSA 1UGQB 2PQWA 2RJEA 2ZPIB 3H6ZA 3HRSA 3MHXA 3O8VA 4QVZA 2DXUA 3QJYA 5AYFA 5GAN6 1YIJT 3JCMc 2P0PA 1OYXA 3QG1A 2Y4XA 4M7DD 5GANg 4ELZC 3AHUA 3BY7A 1FX7A 3DB3A 1W2BS 2QQAA 4QVDA 3M54A 4PJOB 2I2LA 4LDUA 3CCUA 3JCMQ 4FSXA 4FT4A 5GANe 3SWNB 1EIFA 2RHYA 3OYNA 1XNIA 3QJ6A 1Y07A 2LT4A 1K73C 2EQMA 1VQ4A 1VQ8A 3PIPA 2EJFA 4M78A 3CCMA 4JS5A 1M1KC 2G3RA 5GAMe 5GAOr 2OTLA 3RMQA 4FIBA 3CC4A 1KHIA 1S72T 4BY6B 2V8IA 1X6OA 1OI1A 4A4EA 4FT2A 4QW2A 4XTWA 1R8OB 3M4GA 2VGMA 3EFSA 3LGFA 3MO8A 5KE2A 5GAOn 4M7AD 3FIFA 4C0FA 2VYTA 5GANf 1IZ6A 4E7HA 3A8MB 4A4FA 4M7DG 5LL6S 2L5QA 4PKCC 4XK8E 5CKHA 2H3JA 2D0QB 2JN0A 4XU3A 2K2VA 2JOYA 4X9CA 3JB9J 4F7UE 2M16A 3OBYA 1I81A 2RI2A 1G3YA 2RJFA 3M53A 3VJPA 2DD4A 2F5KA 3G71T 3CCEA 3OMCA 4XTYA 3CBOA 3CMAT 2CZ6B 4M77E 2DD5A 5GAMf 1M90C 1O9SA 2JZ2A 4BE1A 2KK4A 3I55T 4B9WA 3Q1JA 5EG2A 1U8RA 3E19A 2NLUA 1YJWA 3MP8A 3JB9H 5IT9E 5LJ3d 3A8GB 3GF5A 4OB1B 3CBMA 4XTZA 2ZCFB 3X28B 3BDLA 2X4XA 4LDWA 4GY5A 2RA2A 3QIIA 1V29B 1UGPB 4QQDA 4XTUA 3ASKA 2EJ9A 2EQJA 2R5AA 3DKMA 3F70A 2DIQA 3OS2A 4M75F 1GXIE 2MI6A 4LDYA 5LJ3h 4C92D 3CCJT 5FU7B 3HSBA 3I56T 3FLGA 1JRIA 2DTIA 4J8OA 2RI5A 4C5EA 3SD4A 3SDZA 5HY6A 4BDZA 3CPWA 1Q81C 1VQKT 2RHUA 2JVVA 2LVMA 4M7AG 1M4ZA 2YRVA 4A4KA 4M7DA 3HFOA 3QYGB 4XTXA 4F7UB 5CVIA 1KC8C 3LH0A 2A7YA 2DKGA 4YTLA 5I2SA 3JCMJ 2EJGA 3VUBA 2YLBA 1VQ7A 3JB9I 1Q81U 3TEEA 3TREA 5C0MA 4Y91A 2KY9A 1YHQT 3JSCA 2JTFA 2V8JA 4XTVA 2E6ZA 2WACA 1VQPT 5GANj 3CCLA 2E64A 1X01A 3FEOA 4BE2A 3A5ZB 4DOVA 3OYMA 1D3BA 3VYGA 2DVEA 1WQWA 4MZTA 4EMKB 2DXBA 5GAN2 2DO3A 1RL2A 4ZN3A 1VQLT 5HK0A 2XICA 1B34A 4OB0B 1YITT 1BI3A 1KD1U 4KBMB 2XD0A 3X20B 3CPWS 4OB3B 3FRNA 5GAMj 4OMFB 1W4SA 3UT1A 5HKCA 5LJ5d 1VQ5A 4M77C 4RCBA 1BI1A 4C92G 3E1SA 3CMET 3FDRA 3L2WA 3VYHB 4IURA 5CKBA 3UWNA 4BI3A 4EDUA 2OTJA 3BDUA 2PVOB 2FB7A 4EMKC 3JB9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FT2 A;  4BB7 A;  4LD9 K;  4JJN K;  4DOV A;  2FVU A;  4FSX A;  4FT4 A;  3PTA A;  2FL7 A;  1ZHI A;  4KUI A;  4DA4 A;  3TU4 K;  1W4S A;  1M4Z A;  3PT9 A;  4KUL A;  1ZBX A;  4DOW A;  4KUD K; 
#chains in the Genus database with same CATH topology
 3V7C A;  4J7F A;  3SFM A;  5C6S A;  3NTK A;  2HKN A;  3P8B B;  4LDV A;  1WX6 A;  3M56 A;  1NEG A;  4VUB A;  1MGQ A;  1VYU A;  1WJQ A;  1GRI A;  2JNG A;  3H0I A;  4KGV B;  4MDW A;  1NM7 A;  5J39 A;  4LUD A;  1M3C A;  2ED0 A;  3OQ5 A;  3BFM A;  4C92 A;  4E7L A;  4DBR A;  2ZPE B;  1KQS A;  3OS0 A;  2D9T A;  5LJ5 f;  1PM3 A;  4J83 A;  1ZSZ B;  2RMO A;  4GBQ A;  4XQ3 A;  2LCS A;  1SSF A;  1YI2 A;  1OU9 A;  2L3S A;  2V1Q A;  3GIB A;  1U06 A;  1AEY A;  2ZAE A;  1N8R U;  2LNV A;  4P5N A;  4KT0 E;  1YJ9 A;  3G6E A;  5FWB A;  2PU9 B;  1M9S A;  1OU8 A;  3VUZ A;  2Y4Y A;  1ZSZ C;  2FYK A;  4ZGD B;  1W6X A;  4ZN1 A;  4LD6 A;  2BZX A;  1U1S A;  5GMK e;  1RI0 A;  4X1V A;  4FL6 A;  2KXC A;  4XU2 A;  5KYU B;  3TSW A;  2HAX A;  2K79 A;  2A3L A;  3PNW C;  1N6A A;  4FU6 A;  2EYZ A;  2Y90 A;  1GBR A;  2J6O A;  4J9I A;  5KCO A;  4RTW A;  2CKK A;  5J3B A;  4F14 A;  3M4Y A;  1HK9 A;  5CK9 A;  1XJW B;  4PK4 A;  2MAM A;  2RHZ A;  2P4T A;  2HQX A;  4O6J A;  1BIA A;  2F2X A;  4JLI A;  1UEB A;  3PMI A;  5GMK m;  2LJ0 A;  1WJR A;  3QZ5 B;  1BIB A;  4BI4 A;  2ROT A;  1VQ7 T;  1VQ7 Q;  1Y96 A;  1OX9 A;  2CP3 A;  3KBG A;  4M75 A;  5LJ3 f;  2DK3 A;  1V76 A;  1M8M A;  2J05 A;  2X4J A;  3MET A;  1QVG S;  5FW9 A;  1UGR B;  2C0T A;  1PD0 A;  1VQM A;  2L3Q A;  2YUN A;  3JCM h;  2LTO A;  1I1J A;  5HK3 A;  3CCQ T;  5CKF A;  3RKX A;  3CME Q;  3CCQ Q;  4N4G A;  4E7Z A;  5GMK j;  2VVK A;  5IHK A;  3DB4 A;  1R0C B;  2EGE A;  2ZPH B;  1G5V A;  3V8J A;  4A4H A;  1D3B B;  3EFR A;  2FVU A;  2FG0 A;  1G3T A;  1B34 B;  2JM8 A;  1IHW A;  2E41 A;  3M0S A;  1NJI C;  2RNA A;  4RTU A;  4Y92 A;  2QA4 Q;  3KXT A;  1A0N B;  3I35 A;  2KXD A;  5J26 A;  4IUV A;  5GAO q;  2HBP A;  2RJC A;  3V7R A;  4FM4 B;  1PG5 B;  4C0G A;  1RAG B;  2NYS A;  1QKX A;  3MEW A;  3M57 A;  5IHI A;  5LJ5 h;  1U5S A;  4CC3 A;  1K0S A;  2D6F A;  1EX4 A;  2YRC A;  4X9D A;  4C8Q C;  3V8K A;  4Y28 E;  5D6W A;  1KC8 R;  2RI3 A;  1I8F A;  4N4H A;  1WGS A;  1PWT A;  2KRM A;  4N0A C;  2DZC A;  1VQ8 T;  1VQ4 Q;  1VQ8 Q;  1Z9Q A;  4LUE A;  1PHT A;  3CC7 T;  4BE0 A;  4C92 B;  3CC7 Q;  4JRP A;  1K1Z A;  2A37 A;  3G4S T;  4RCC A;  1M2V A;  2H3E B;  4DA4 A;  3VU3 C;  1OEB A;  2YWW A;  1QCO A;  4C92 C;  5HCK A;  3RKW A;  5FLX E;  3QPH A;  5GAM h;  2DIL A;  4D6W A;  5GAN 8;  3HKS A;  1QVF A;  3L42 A;  3EAE A;  5KYY A;  3QZ9 B;  2VWF A;  4L6V 5;  4F17 A;  3E9F A;  3G71 A;  4M78 C;  2WSC E;  1JJ2 A;  3H41 A;  4PJO D;  3HRT A;  2COY A;  4HCB A;  2ZZD A;  2DBK A;  2ZGW A;  2F2W A;  3CC2 T;  4M7D F;  4J9D A;  2NUT A;  1GFD A;  3HRU A;  1KIK A;  2E1H A;  2RQT A;  3UF4 A;  2MWP A;  2ATC B;  4EMK A;  4IUQ A;  1JQQ A;  2QQS A;  3C0C A;  1H92 A;  4JUV A;  4Z88 A;  3QDR B;  2SEM A;  4EMH A;  1NPP A;  3URG A;  5I21 A;  4HKE A;  1VQ9 T;  3JAM E;  1VQ9 Q;  4KUD K;  4PJO G;  1D1A A;  1OUL A;  1UB4 A;  1M27 C;  1Q86 C;  3L2Z A;  3M0T A;  1VQL A;  4BD3 A;  3OA6 A;  2DTO A;  1RUW A;  4D8D A;  3OYE A;  3ZL7 C;  1KC8 U;  3CME A;  3CCQ A;  2FZC B;  4RKU E;  2QEX A;  1RAH B;  4M75 C;  1WQ7 A;  3QWX X;  4NOY A;  4JRK A;  2A28 A;  1WHH A;  5CQX A;  2CGH A;  2ENM A;  2YHT A;  2QA4 A;  1NZ9 A;  5KYN A;  5D6Y A;  2K6D A;  4UC4 A;  5IHN A;  3MHX A;  2RJE A;  3H6Z A;  4HVU A;  4QVZ A;  2GTO A;  3QJY A;  4FW2 A;  3JCM c;  1QVG P;  2FRY A;  4RTT A;  5GAN g;  2QTV A;  3G1J A;  3BY7 A;  1G83 A;  2A0F B;  3DB3 A;  2P84 A;  4PJO B;  4FSX A;  4FT4 A;  4KGX B;  4KGZ B;  2KRO A;  1WI7 A;  2LT4 A;  1VQ4 A;  1VQ8 A;  2EJF A;  3CCM A;  2JTE A;  5GAO r;  1UEC A;  1KHI A;  4AG2 C;  4BY6 B;  2V8I A;  3PVL A;  1M3B A;  4FT2 A;  4HCK A;  1T0H A;  2VGM A;  3LGF A;  5GAO n;  4M7A D;  4XK8 E;  1M2V B;  2QAS A;  5CKH A;  4F04 B;  2M16 A;  3M53 A;  3QWY A;  2F5K A;  2O2O A;  1M90 C;  1JXO A;  1O9S A;  4DBH A;  5EG2 A;  3LH5 A;  3E19 A;  3MP8 A;  1LCK A;  3A8G B;  1YCS B;  3CBM A;  2ZCF B;  3BDL A;  2C0I A;  4PFZ A;  5KYY B;  1Q95 G;  2EQJ A;  3DKM A;  4LDY A;  3CCJ T;  5FU7 B;  3CCJ Q;  4OML A;  2RI5 A;  4BDZ A;  5HY6 A;  1VQK T;  1VQK Q;  1HSQ A;  2QG9 B;  1ARK A;  2JVV A;  4M7A G;  1M4Z A;  2YRV A;  4M7D A;  1S1N A;  2D0N A;  4KRT A;  1AWO A;  2LJ1 A;  1WXU A;  3JCM J;  2EJG A;  2KGT A;  1G8X A;  2V8J A;  2HL5 C;  2DYI A;  3CCL A;  4QKU A;  4BE2 A;  3VRZ A;  3OYM A;  4EMK B;  1WQW A;  4MZT A;  2DXB A;  1FMK A;  1RL2 A;  2EKH A;  2Z0W A;  1YIT T;  1YIT Q;  2A36 A;  3X20 B;  4J9B A;  1W4S A;  1WHJ A;  4FW1 A;  3EH1 A;  4IUR A;  4EDU A;  2PVO B;  4EMK C;  1PKT A;  1VQ6 Q;  3ZEH A;  5LJ5 g;  4NS5 A;  1PSE A;  2DEQ A;  5CIU A;  4PL6 A;  2DL5 A;  2PUK B;  2KE9 A;  2K3X A;  2LMJ A;  2D8H A;  1NLO C;  3S3M A;  2DE0 X;  1HD3 A;  1YP5 A;  3RBB B;  2E65 A;  2QDY B;  1VQO T;  2QGF B;  3QUI A;  1T3L A;  1WFW A;  2O4X A;  1VQN Q;  2BIV A;  4M7A B;  2C0O A;  3S6W A;  5GAO l;  2AKL A;  3DLL A;  2RJD A;  1X2K A;  4N4I A;  4FCY A;  2DET A;  2CH4 A;  2XKO C;  2GGR A;  1RLP C;  2XDB A;  4IUP A;  2FHD A;  5FWC A;  1UGV A;  2FO0 A;  2K57 A;  2XHC A;  5GAM g;  3VS2 A;  1SG5 A;  3OW2 A;  1K9A A;  4E47 A;  1Y0M A;  2EGA A;  4IUT A;  2DJQ A;  2OTL T;  1QWE A;  2OTL Q;  1O75 A;  3SWN C;  4J9H A;  3OYC A;  2ABL A;  2DNU A;  3E9G A;  1TG0 A;  2FEI A;  2LJ3 A;  3CEY A;  4EPC A;  1X6G A;  1GCQ C;  1C0M A;  2EVR A;  4WCI A;  4J6W A;  2CZ7 B;  2ROL A;  4RG8 A;  4JS4 A;  1YJW T;  3QDF A;  3V8L A;  3OSS C;  4V2S A;  1VA7 A;  2HKQ B;  5IN1 A;  3EG2 A;  2IG0 A;  4Z02 A;  1I5O B;  3I56 Q;  1C6V X;  1IHV A;  1AWW A;  2BTT A;  2K4Y A;  4BAC A;  3MCA B;  1RI9 A;  4C5H A;  2COW A;  3H9N A;  3O5Z A;  3L2U A;  4AG1 C;  2DA9 A;  3ME9 A;  4HA8 A;  2VXF A;  1VQP Q;  2EQI A;  3CCJ A;  2HL3 A;  1QP2 A;  1YJN A;  1ZUK A;  4KUI A;  2GTJ A;  3OYI A;  1JJ2 S;  1KQS P;  2JXB A;  1ZUU A;  2CZ1 B;  4Q5W A;  1H8K A;  4C8Q E;  1K8A U;  4M7D B;  2E3I A;  1M1K R;  3GBQ A;  5CO7 A;  4LDX A;  2AIR B;  1AZG B;  1BI0 A;  3CCR A;  2OTJ T;  2PZ1 A;  5CKE A;  1MMD A;  3FC3 A;  2RO0 A;  3EHR A;  4CC4 B;  1YIT A;  1XTD A;  2MF2 A;  1WHM A;  4M7D C;  1DJ7 B;  4PJO F;  3VS3 A;  2PNI A;  3EG9 A;  1Y71 A;  2O9V A;  4ANJ A;  4J5Y A;  1BI2 A;  3JRZ A;  1VQ6 A;  4C92 E;  2M02 A;  5IAY A;  1D1B A;  1N9R A;  2E70 A;  2HZY A;  4C5G A;  2WSF E;  1TUD A;  4BDY A;  1JBM A;  4M77 D;  2HD0 A;  2HQE A;  2MMP A;  1QMC A;  2O9S A;  1VQN A;  2XU8 A;  2KYB A;  2F5T X;  3NGP A;  4M78 E;  2RPN A;  3J7A F;  2O4X B;  3SEM A;  2F2V A;  1BK2 A;  2CZ0 B;  2V26 A;  2J6K A;  2JM9 A;  3RES A;  3JCM W;  1WA7 A;  1AD5 A;  5ECA A;  3QKJ A;  3DLM A;  1WLP B;  4F7U G;  4RG2 A;  5GAN h;  1ZX6 A;  3OYG A;  5I22 A;  1MV3 A;  3INZ A;  3TU4 K;  1AWX A;  2OX7 A;  2XID A;  2L3P A;  2YDL A;  4M77 G;  1E6H A;  2ESW A;  4JJB A;  3CCE T;  2DRK A;  3CXC A;  4DEY A;  3CCE Q;  2FZK B;  4C8Q D;  1Q7Y C;  5GMK h;  2FPF A;  2CUD A;  3RR6 A;  1PCX A;  5FU6 B;  1D1C A;  4FYV B;  1UFF A;  1E7O A;  2DL7 A;  3NFC A;  4CRI A;  5GAO m;  3CMA A;  1M1K U;  1VOM A;  1ZBX A;  2LCC A;  1UHC A;  4M75 E;  4R55 A;  1HJD A;  3OYB A;  2QQB A;  5FU6 C;  1KQ2 A;  3OYY A;  3VS0 A;  2AZV A;  3A1P A;  3MEU A;  2MYS A;  1I4K 1;  4TVR A;  3I56 A;  2XI9 A;  5FRN A;  4RTY A;  3CCV T;  5GJW B;  2L3R A;  4C8Q G;  2KDS A;  1D0Y A;  4OGC A;  1B7T A;  1RLQ C;  2VC8 A;  1Q82 C;  2EFI A;  3JCM e;  4A53 A;  1M1F A;  3E2U A;  1RAE B;  1VQP A;  2M1H A;  4M77 B;  3S3N A;  3R6N A;  1X27 A;  2WSE E;  4JJC A;  1N27 A;  4B6M A;  1JB0 E;  5KYW A;  4M78 D;  4M7A F;  4NL2 A;  2RB6 A;  3OBW A;  1SKU B;  4DBQ A;  2NUP B;  3D7S B;  3CD6 T;  3CD6 Q;  1KQ1 A;  2GFA A;  4ZTJ A;  4RTV A;  2VUB A;  2DVJ A;  5CCA A;  3JCM V;  4JPB W;  4AFU C;  1QW1 A;  3L2V A;  2ZPF B;  3EGX B;  2LQK A;  4E7J A;  1FYN A;  1ZLM A;  1K9M C;  4PJN A;  2EQK A;  1R77 A;  3RMS A;  3HP9 A;  3CBP A;  1GBQ A;  2CT3 A;  4PJO A;  1QVF P;  2J6F A;  4M78 G;  3EG9 B;  1RAB B;  1YBY A;  4A54 A;  4PNO A;  5CQY A;  1WJS A;  1UGQ B;  3HRS A;  1YIJ T;  1JJ2 P;  1OYX A;  2LNH B;  3QG1 A;  4ESR A;  1W2B S;  1IGU A;  4QVD A;  1OPL A;  2BE7 D;  1MUZ A;  2DYB A;  3M54 A;  1NYG A;  1RAD B;  1SSH A;  5EC7 A;  3G4S Q;  1Q82 R;  3QJ6 A;  1Y07 A;  1QLY A;  1K73 C;  2EGC A;  1AVZ C;  3PIP A;  4JS5 A;  4OMQ A;  2O31 A;  5GAM e;  3RMQ A;  4FIB A;  1S72 T;  1YWO A;  1JEG A;  3M4G A;  1KSW A;  3MO8 A;  3FIF A;  3NPF A;  1IZ6 A;  1IXD A;  1NJI R;  1TS9 A;  4XU3 A;  2K2V A;  2JOY A;  4X9C A;  3OBY A;  1I81 A;  3CCE A;  1G3Y A;  2DD4 A;  3OMC A;  1R0B G;  1IB8 A;  2DFU A;  2EYX A;  3CBO A;  1ABO A;  1PKS A;  3CC2 Q;  3I55 T;  1K9M R;  3I55 Q;  3JB9 H;  2OJ2 A;  1MND A;  4OB1 B;  2QAZ A;  2X4X A;  2RA2 A;  4IIM A;  1UGP B;  4XTU A;  1OX8 A;  2A08 A;  2EYY A;  5LJ3 h;  1UUE A;  4C5E A;  2YUO A;  2LVM A;  3HFO A;  2A7Y A;  2DKG A;  3RDV A;  1M3A A;  3M0P A;  1VQ7 A;  3JB9 I;  1YHQ T;  3KFV A;  3JSC A;  2JTF A;  2KRS A;  2E64 A;  3VYG A;  2DVE A;  2DO3 A;  1E6G A;  4ZN3 A;  1F1B B;  2XIC A;  2LQW A;  1BI3 A;  1PNJ A;  2VKN A;  8ATC B;  1K73 R;  1SPK A;  3VRY A;  3CPW S;  5GAM j;  4GLM A;  1VQ5 A;  5IH2 A;  3FDR A;  4M4Z A;  3UWN A;  2KT1 A;  3QXE B;  4M7A A;  2J7I A;  2JT4 A;  5KYW B;  1T0J A;  2KRN A;  4OF1 A;  1TWB A;  3C4S A;  2YUP A;  3LLR A;  1TH7 A;  3MJX A;  4DBF A;  2KR3 A;  2L89 A;  4RUG A;  5CKD A;  2DL4 A;  4J7I A;  1JO8 A;  3MPU B;  4A4G A;  2KMT A;  3R6O A;  3CQT A;  2QTX A;  2K3Y A;  3M58 A;  2HSE B;  1X43 A;  3UPU A;  5IXB A;  3RIR A;  3LX7 A;  3OMG A;  1NJI U;  2CSI A;  4F16 A;  1LJO A;  3CCU T;  2LX9 A;  8AT1 B;  1JXM A;  2KNB B;  2XDP A;  1SHF A;  2JMA A;  3EFO A;  4RTX A;  3QO3 A;  3UA7 A;  2JUF A;  1UE9 A;  3FB9 A;  1FMW A;  4FYW B;  4O5V A;  5DLO A;  1M5Q 1;  4PJL A;  1OPK A;  3CC7 A;  1I0C A;  3PFS A;  1QWF A;  5AT1 B;  3UDC A;  3CC4 T;  4PJO C;  1Q86 R;  3L2R A;  2L0A A;  2DXC A;  1KQS S;  3G4S A;  4ZTF A;  4E7K A;  3NTI A;  3OYH A;  1H64 1;  2DMO A;  3A8L B;  1YN8 A;  1BKB A;  4L59 A;  3M9Q A;  3C94 A;  4PLL A;  4BY6 C;  2NUZ A;  2KYM A;  3X25 B;  4F7U F;  1N9S A;  2DJZ A;  4AFZ C;  1OV3 A;  4PFP A;  1Q81 C;  2AHJ B;  3M59 A;  4M77 F;  5D6X A;  4JJN K;  3JB9 D;  4C0Z A;  2W0Z A;  2XDD A;  4C0D B;  2NWM A;  3VS1 A;  5L8R E;  2JS2 A;  4XU1 A;  3CCS T;  2EPD A;  3CCS Q;  3N5B B;  4M7D E;  2GNC A;  1W2B P;  1QVG A;  3PVQ A;  1KD1 C;  3PIO A;  2HSP A;  3VS4 A;  3CC2 A;  2LCL A;  4KUL A;  2KT8 A;  3CXC S;  2MPX C;  3OSV A;  2DXT A;  2RQV A;  4FSS A;  1U3O A;  1VUB A;  3OYL A;  1NLP C;  2EQU A;  3MP6 A;  5FU7 C;  3M5A A;  2X3W D;  3WXM B;  2P0K A;  3JCM d;  5CR2 A;  5GAN 7;  1D09 B;  2LRQ A;  2RHI A;  1ZQ1 A;  2RQU A;  4OP0 A;  3LWI A;  3JB9 G;  2F69 A;  1KK7 A;  2CS7 A;  2LQN A;  3WVE B;  2B86 A;  2HNI A;  1VQ9 A;  3LYI A;  1X2Q A;  3ER0 A;  3OW2 P;  4AFQ C;  2VAS A;  6AT1 B;  2EIF A;  1VQ5 T;  1VQ5 Q;  2AKK A;  2PUO B;  2RN8 A;  1X6B A;  4ELY C;  2C06 A;  5GMK i;  3A8H B;  4OMM A;  3T9N A;  1BB9 A;  5DLQ E;  3OYA A;  2BZY A;  4BUG A;  1VQO Q;  1ZBJ A;  5M9O A;  1B07 A;  2GF7 A;  1M90 R;  1WXT A;  4OMO A;  3VV0 A;  1N8R C;  5GAN 3;  1XOV A;  3MEA A;  1TU0 B;  1Q86 U;  1ACM B;  1UGS B;  4KH0 B;  1CKB A;  3L1A A;  1IGQ A;  2RK2 A;  2PVD B;  4OMN A;  1H3Z A;  2CH4 W;  2DM1 A;  2K5L A;  3V7S A;  3PTA A;  5I11 A;  1TXQ A;  1SHG A;  1TOV A;  2ZPG B;  2FRW A;  4M7A C;  1YI2 T;  4J9E A;  3S3O A;  2EBP A;  1YI2 Q;  2BUD A;  2LDM A;  3OYK A;  4M78 F;  3CPW P;  1YJ9 T;  3HPW A;  3EG1 A;  3G6E T;  1YJ9 Q;  3HTR A;  2XMF A;  4XU0 A;  2HCK A;  5GAN 5;  2CP6 A;  5GMK l;  5CAI A;  3MKD A;  2QDL A;  2B8A A;  3EFO B;  4QVC A;  2GQV A;  5GAM d;  4RMO A;  1H3H A;  4DQ2 A;  1AOJ A;  2G6F X;  2E4H A;  5LJ3 g;  1TSF A;  1HYO A;  1C1A A;  7AT1 B;  1MHN A;  2DX1 A;  4OB2 B;  3G7Z A;  3J81 E;  2MCN A;  2DAQ A;  1YJW Q;  5DM7 R;  1I5L A;  3TSZ A;  3QSU A;  3THK A;  4HVV A;  2GFU A;  4J9C A;  3HSB A;  4HCZ A;  4HT8 A;  3LWH A;  3PT9 A;  4JZ4 A;  4F7U A;  4J6X A;  1Y7X A;  2OAU A;  2PTK A;  1J3T A;  2MIO A;  5KE3 A;  4M77 A;  3TVT A;  2EYW A;  1QVF S;  3CCS A;  2M51 A;  1CSK A;  2NUP A;  1NE8 A;  3IQL A;  1WPY A;  1VQK A;  3HL8 A;  1PD1 A;  2D1X A;  5L23 A;  4LNP A;  1EZZ B;  1RAC B;  1M90 U;  1YFN A;  2RD1 A;  5IXF A;  1VQM T;  3UA6 A;  3GNG A;  1FXX A;  1WXB A;  3EGX A;  4NL3 A;  2OTJ Q;  2CP0 A;  5A0L A;  2AT1 B;  4CI0 C;  1EFN A;  5GAO p;  2DL8 A;  2P0Q A;  3JCM P;  2LC4 A;  4LE9 A;  1N5Z A;  2E10 A;  3FJ5 A;  3EH2 A;  3JCM f;  3OYF A;  4ZGJ B;  1G3S A;  1GFC A;  4E7I A;  3JV3 A;  3QYH B;  2JS0 A;  4C8Q A;  4ME7 A;  2LP5 A;  3HFN A;  4QQG A;  1UDL A;  4N0A A;  2GBQ A;  3GNF B;  3CXC P;  4HT9 A;  3HHT B;  3FJP A;  2CRE A;  3C95 A;  3OB9 A;  1VQO A;  1KJW A;  2QXF A;  4HVW A;  4LXC A;  1NG2 A;  2YRD A;  2DXU A;  5AYF A;  5GAN 6;  2P0P A;  1MMN A;  1ZA1 B;  2Y4X A;  1AT1 B;  4ELZ C;  9ATC B;  2P4R A;  1BBZ A;  2I2L A;  1K4U S;  1JU5 C;  5GAN e;  2RHY A;  1MMA A;  2CP2 A;  2K2M A;  3OYN A;  1XNI A;  3M0Q A;  2EQM A;  2DRM A;  4M78 A;  2H8H A;  2G3R A;  2OTL A;  1OI1 A;  2MOX A;  4XTW A;  3EFS A;  4PJM A;  2E3H A;  2VYT A;  4A4F A;  5LL6 S;  2L5Q A;  2JN0 A;  3JB9 J;  2QGG A;  5D7U A;  3VJP A;  3G71 T;  4XTY A;  3G71 Q;  1WHL A;  2CZ6 B;  5GAM f;  3RNJ A;  2BZ8 A;  2KK4 A;  4BE1 A;  4B9W A;  2KEA A;  3Q1J A;  2NLU A;  1YJW A;  3TQ7 P;  5IT9 E;  3X28 B;  2CP5 A;  1UJ0 A;  4XTZ A;  2M0Y A;  1V29 B;  4QQD A;  1WHK A;  2EJ9 A;  3F70 A;  1YNZ A;  2DIQ A;  4OMP A;  4C92 D;  1W1F A;  3FLG A;  1JRI A;  2DTI A;  3SD4 A;  3SDZ A;  3UAT A;  3CCV Q;  3ULR B;  1WYX A;  4A4K A;  4F7U B;  1KC8 C;  3LH0 A;  4YTL A;  1PC0 A;  2JJ9 A;  2YLB A;  2O88 A;  3TEE A;  3TRE A;  5C0M A;  2KY9 A;  2IPO B;  2WAC A;  5GAN j;  3FEO A;  5GAN 2;  1VQL T;  2J06 A;  1VQL Q;  4QT7 A;  4KBM B;  2XD0 A;  2COZ A;  2KI7 A;  2FZG B;  4OB3 B;  5HKC A;  4DEX A;  4M77 C;  4RCB A;  4C92 G;  3E1S A;  3CME T;  4WTO B;  2CDT A;  3VYH B;  3EHQ A;  4BI3 A;  2OTJ A;  1YCY A;  2QEX T;  2DBM A;  3JB9 F;  2QEX Q;  4JZ3 A;  1VYV A;  2RHX A;  1Q7Y R;  4PJO E;  4MZM A;  3M55 A;  2K5I A;  5LJ5 e;  2R58 A;  1LOJ A;  2QA4 T;  1FMV A;  3ZFJ A;  3EGD A;  2X4W A;  2EYQ A;  2CUB A;  2X4Y A;  3L2Q A;  5A0D A;  1LVK A;  4C8Q B;  1G2B A;  2KVQ G;  1KFZ A;  5FRM A;  5A2Q E;  4IUU A;  2DF6 A;  2X51 A;  1YIJ Q;  2DPP B;  2AZS A;  1UHF A;  4PLI A;  2QQR A;  2X35 A;  1QVP A;  3VS5 A;  1RAF B;  3BW1 A;  1WIE A;  1ZHI A;  1MNE A;  1NEB A;  2ECZ A;  4M75 D;  4E6R A;  4MMK A;  2CSQ A;  3RKY A;  1CKA A;  2DTH A;  3M0U A;  2E5K A;  3CPF A;  3OY9 A;  4MDX A;  1VQ4 T;  1M1G A;  2EWN A;  3CCM T;  3CCM Q;  1QP3 A;  4QQ6 A;  2QI2 A;  1RAA B;  1LNX A;  1FWZ A;  3GOX A;  1S72 Q;  1ZA2 B;  4LN2 A;  1UJY A;  4BB7 A;  2VB6 A;  3I9Q A;  3PMT A;  1QQJ A;  1BU1 A;  2SRC A;  3REB B;  1PRL C;  1VIE A;  4FYY B;  1IRE B;  2DL3 A;  3PE0 A;  2ED1 A;  3OW2 S;  4B9X A;  1X75 C;  3VS7 A;  1D0Z A;  3C12 A;  4M78 B;  5A0G A;  4EMG A;  1K76 A;  4M75 G;  4BI8 B;  4Z89 A;  3VKI A;  4J6Y A;  4K11 A;  1M30 A;  5LJ5 j;  1TTH B;  2CP7 A;  2XK0 A;  4R56 A;  3X26 B;  5LJ3 e;  1D0X A;  4IKF A;  2HDA A;  3MEV A;  2BKD N;  2KSS A;  3RER A;  2KAF A;  4JLG A;  2VV5 A;  2E12 A;  1WZO A;  2HEQ A;  5GAN 4;  3OYD A;  1Q7Y U;  3P8H A;  1YHQ Q;  5I2M A;  4RTZ A;  2R57 A;  4Z8A A;  3LW5 E;  3CCL T;  3CCL Q;  1OZ3 A;  1ABQ A;  1PSF A;  3CCV A;  2E5Q A;  2JW4 A;  3P8D A;  1XQH A;  1GCP A;  3QBY A;  3I5S A;  3WVD B;  4M7A E;  2K5F A;  4HXJ A;  4J9F A;  4CC2 A;  4OGE A;  1ZUY A;  1I07 A;  1Y96 B;  1Z9Z A;  4X34 A;  2EAY A;  4L5G A;  4LD9 K;  4M75 B;  3CD6 A;  4JRI A;  5KYX A;  2LT1 A;  3RUX A;  4GLK A;  2FL7 A;  1Q82 U;  1X69 A;  2BE9 B;  2X3X D;  1P92 A;  2QQ9 A;  3KUF A;  1LPL A;  3BE3 A;  3NTH A;  2PVG B;  2GCX A;  2RQR A;  2AK5 A;  1WNL A;  4OVA A;  2EKO A;  2MWO A;  1TUG B;  5LJ3 j;  4JRQ A;  2MK5 A;  2JTM A;  4XAX B;  2YLC A;  1HXD A;  5FRO A;  2K3B A;  2L8D A;  2O01 E;  3PGG A;  3SWN A;  3GLX A;  2YT6 A;  3CCU Q;  1VIF A;  3EGD B;  1OOT A;  2QYZ A;  1YIJ A;  4C5I A;  2XG8 D;  1SRL A;  4JDS A;  3TCJ A;  3SHW A;  1M8V A;  4A63 B;  1M2O A;  4DOW A;  1K9M U;  1KG1 A;  1GCQ A;  2D8J A;  2ZPB B;  1B3Q A;  5GAN d;  3CC4 Q;  3J80 E;  1BYM A;  1AHJ B;  4ZGE B;  2IIM A;  2W10 A;  3EG0 A;  1VYT A;  3SB2 A;  1S72 A;  1SF9 A;  2RK1 A;  1KHC A;  3NHN A;  2IVW A;  2EW3 A;  2X9H A;  3LGL A;  5KCH A;  3H8Z A;  1W70 A;  2DZ9 A;  1G3W A;  3EGU A;  1QCN A;  1QKW A;  2RH2 A;  1BCM A;  4WF2 A;  1K73 U;  2V8K A;  3JCM X;  1Y57 A;  5KH6 A;  2VGN A;  2R5M A;  3QHS A;  4PFO A;  3GPL A;  1NBE B;  3I55 A;  1K8A C;  1YWP A;  1GL5 A;  4II1 A;  2HBW A;  2YSQ A;  4C0D C;  1OQK A;  2YUQ A;  3A8O B;  3OS1 A;  3OS5 A;  1NPR A;  3JCM g;  1MV0 B;  2CYZ B;  1T3S A;  2E6N A;  2QK0 A;  2KQW A;  1YJN T;  1YJN Q;  2DIG A;  3ZBD A;  1IO6 A;  4ORZ A;  1K0X A;  3OYJ A;  1OZ2 A;  2NUT B;  4HCC A;  4MML A;  1YHQ A;  3AT1 B;  2L2P A;  4C8Q F;  4MZP A;  2LX7 A;  3CCR T;  3CCR Q;  3X24 B;  4CC7 A;  1U1T A;  1WHG A;  1QCF A;  1AWJ A;  3GP8 A;  2FPD A;  3JCM b;  1VQ6 T;  1SEM A;  2VXE A;  1Q81 R;  5DY9 A;  2JMC A;  2M9U A;  2YXY A;  5LJ5 d;  1W2B A;  2M0O A;  4C92 F;  3MP1 A;  2K7A A;  3NMZ C;  5KYX B;  2FPE A;  1ZSZ A;  2RM4 A;  1KD1 R;  3H0H A;  4ATO A;  3REA B;  3VS6 A;  1TUC A;  1VQN T;  1K8A R;  2LQ8 A;  4R0K A;  2ZPI B;  2PQW A;  3O8V A;  2I0N A;  1SRM A;  4M7D D;  1V1C A;  3AHU A;  3G6E Q;  1FX7 A;  1PRM C;  2QQA A;  3A98 A;  4LDU A;  3CCU A;  3JCM Q;  4D8K A;  2HQH A;  3SWN B;  1EIF A;  2DER A;  5KYU A;  1AZE A;  4J9G A;  1UTI A;  2RF0 A;  1MMG A;  1M1K C;  3CC4 A;  2OI3 A;  4IIO A;  1X6O A;  4A4E A;  4QW2 A;  1R8O B;  4KH1 B;  5KE2 A;  4C0F A;  4ZNX A;  5GAN f;  4E7H A;  1RAI B;  3A8M B;  4M7D G;  4PKC C;  2H3J A;  2D0Q B;  4E7S A;  4F7U E;  2RI2 A;  2RJF A;  2HMA A;  1NYF A;  3CMA T;  1N8R R;  4M77 E;  2DD5 A;  3CMA Q;  2JZ2 A;  4AMC A;  1BCO A;  1U8R A;  4AFS C;  2LZ6 B;  5LJ3 d;  3GF5 A;  4LDW A;  3M0R A;  4GY5 A;  3QII A;  3I5R A;  2KBT A;  3ASK A;  2R5A A;  1GXI E;  3OS2 A;  4M75 F;  2MI6 A;  3EG3 A;  3I56 T;  4J8O A;  3CPW A;  1UG1 A;  3U23 A;  2RHU A;  2OAW A;  3QYG B;  4XTX A;  5CVI A;  4E2F B;  1ZSG A;  5I2S A;  4JJD A;  1VQM Q;  3VUB A;  3H0F A;  4AT1 B;  1Q81 U;  2CT4 A;  4Y91 A;  4XTV A;  1VQP T;  2E6Z A;  1WDX A;  1X01 A;  2F1L A;  3A5Z B;  4DOV A;  2V1R A;  2DEU A;  1D3B A;  1IRX A;  2GQI A;  5HK0 A;  1B34 A;  4OB0 B;  1KD1 U;  4EIK A;  2RQW A;  2DLP A;  3FRN A;  5GJV B;  4OMF B;  3UT1 A;  2K9G A;  4PJJ A;  1BI1 A;  4FYX B;  3L2W A;  5CKB A;  3BDU A;  2FB7 A; 
#chains in the Genus database with same CATH homology
 3V7C A;  4J7F A;  3ZEH A;  5LJ5 g;  3SFM A;  5C6S A;  4NS5 A;  1PSE A;  2DEQ A;  2RHX A;  3NTK A;  4PJO E;  5CIU A;  4PL6 A;  4OF1 A;  4MZM A;  2PUK B;  3P8B B;  2K3X A;  3M55 A;  4LDV A;  3C4S A;  3LLR A;  3M56 A;  2K5I A;  4VUB A;  1TH7 A;  5LJ5 e;  2R58 A;  3S3M A;  4MDX A;  1H3Z A;  2L89 A;  1LOJ A;  1MGQ A;  2QA4 T;  2E65 A;  2QDY B;  5CKD A;  1VQO T;  1WJQ A;  3ZFJ A;  3QUI A;  2X4W A;  2EYQ A;  2O4X A;  4J7I A;  2X4Y A;  3L2Q A;  4A4G A;  4M7A A;  5A0D A;  2KMT A;  4C8Q B;  2KVQ G;  2BIV A;  2JNG A;  3R6O A;  4MDW A;  5FRM A;  4M7A B;  5J39 A;  5A2Q E;  3S6W A;  4IUU A;  2QTX A;  3OQ5 A;  2K3Y A;  3M58 A;  5GAO l;  2DPP B;  3DLL A;  3BFM A;  4C92 A;  4E7L A;  2RJD A;  2ZPE B;  4N4I A;  4PLI A;  2QQR A;  3UPU A;  2X35 A;  3RIR A;  1KQS A;  1QVP A;  3OS0 A;  3LX7 A;  2D9T A;  3OMG A;  2XKO C;  2XDB A;  1NJI U;  5LJ5 f;  4IUP A;  3BW1 A;  4J83 A;  4XQ3 A;  1LJO A;  2FHD A;  3CCU T;  2LX9 A;  1ZHI A;  2XDP A;  4M75 D;  1SSF A;  2K57 A;  4MMK A;  1YI2 A;  2XHC A;  5GAM g;  3QO3 A;  3OW2 A;  3GIB A;  2JUF A;  3RKY A;  2DTH A;  3FB9 A;  1N8R U;  4E47 A;  2LNV A;  3CPF A;  4O5V A;  5DLO A;  1M5Q 1;  4P5N A;  3OY9 A;  4KT0 E;  1M1G A;  1VQ4 T;  1YJ9 A;  2EWN A;  3G6E A;  4IUT A;  3CC7 A;  2PU9 B;  3CCM T;  3PFS A;  3UDC A;  1QP3 A;  4QQ6 A;  2QI2 A;  1M9S A;  1LNX A;  1FWZ A;  2OTL T;  3VUZ A;  3GOX A;  2Y4Y A;  3CC4 T;  4PJO C;  4BB7 A;  1O75 A;  2FYK A;  4ZGD B;  3L2R A;  3PMT A;  4ZN1 A;  3SWN C;  4LD6 A;  2DXC A;  1U1S A;  3G4S A;  4ZTF A;  1KQS S;  4E7K A;  5GMK e;  1RI0 A;  3OYC A;  3E9G A;  3NTI A;  4FL6 A;  3OYH A;  1VIE A;  1H64 1;  4XU2 A;  1IRE B;  3A8L B;  1BKB A;  4L59 A;  2HAX A;  3M9Q A;  2A3L A;  3PNW C;  3OW2 S;  4B9X A;  1N6A A;  3CEY A;  4FU6 A;  1X75 C;  4EPC A;  3C94 A;  4PLL A;  2Y90 A;  4BY6 C;  4M78 B;  3C12 A;  5A0G A;  4EMG A;  3X25 B;  4F7U F;  4M75 G;  1N9S A;  2DJZ A;  4BI8 B;  5KCO A;  3VKI A;  2CKK A;  4J6W A;  4J6Y A;  2CZ7 B;  4RG8 A;  5J3B A;  2AHJ B;  4JS4 A;  3M59 A;  5LJ5 j;  4M77 F;  3M4Y A;  1YJW T;  5D6X A;  3V8L A;  2XK0 A;  4JJN K;  2QEX T;  3JB9 D;  4C0Z A;  3X26 B;  1HK9 A;  3OSS C;  5CK9 A;  4R56 A;  4C0D B;  2XDD A;  5LJ3 e;  4V2S A;  4IKF A;  2MAM A;  5L8R E;  4XU1 A;  3CCS T;  2RHZ A;  3MEV A;  2P4T A;  5IN1 A;  2HQX A;  2IG0 A;  3N5B B;  4O6J A;  4M7D E;  4PJO D;  2BKD N;  4Z02 A;  2KSS A;  1QVG A;  1BIA A;  2KAF A;  3RER A;  4JLG A;  1KD1 C;  3PIO A;  1W2B A;  3CC2 A;  2LCL A;  4JLI A;  4KUL A;  2VV5 A;  1UEB A;  3CXC S;  2E12 A;  2K4Y A;  3MCA B;  3PMI A;  4BAC A;  4C5H A;  5GMK m;  5GAN 4;  1WJR A;  3OYD A;  3L2U A;  3QZ5 B;  1BIB A;  4BI4 A;  3OSV A;  1VQ7 T;  1Q7Y U;  2DXT A;  3ME9 A;  3P8H A;  3OYL A;  1Y96 A;  4HA8 A;  1VUB A;  2VXF A;  5I2M A;  2EQU A;  3MP6 A;  2R57 A;  5FU7 C;  3KBG A;  4M75 A;  5LJ3 f;  3LW5 E;  2DK3 A;  3M5A A;  3CCJ A;  3CCL T;  1OZ3 A;  1QP2 A;  3WXM B;  1PSF A;  3CCV A;  2E5Q A;  2P0K A;  3JCM d;  1YJN A;  5CR2 A;  5GAN 7;  2LRQ A;  4KUI A;  2RHI A;  1ZQ1 A;  2X4J A;  1XQH A;  3P8D A;  3OYI A;  1JJ2 S;  3MET A;  4OP0 A;  3LWI A;  3JB9 G;  1QVG S;  1UGR B;  2CZ1 B;  2F69 A;  4Q5W A;  2CS7 A;  3QBY A;  3QXE B;  4C8Q E;  1VQM A;  1K8A U;  4M7D B;  3WVE B;  2HNI A;  3JCM h;  1VQ9 A;  2LTO A;  3WVD B;  4M7A E;  5CO7 A;  3LYI A;  4LDX A;  2K5F A;  5HK3 A;  3CCQ T;  3ER0 A;  5CKF A;  3RKX A;  4N4G A;  1BI0 A;  4OGE A;  3CCR A;  5GMK j;  2OTJ T;  2EIF A;  1Y96 B;  1VQ5 T;  5CKE A;  4X34 A;  3DB4 A;  3FC3 A;  2EAY A;  4L5G A;  4LD9 K;  2RO0 A;  2ZPH B;  4M75 B;  3CD6 A;  1G5V A;  3V8J A;  4A4H A;  2PUO B;  1D3B B;  1XTD A;  2MF2 A;  1YIT A;  4JRI A;  4ELY C;  2LT1 A;  3EFR A;  2FVU A;  3RUX A;  1G3T A;  4GLK A;  2C06 A;  1B34 B;  4M7D C;  2FL7 A;  2E41 A;  1DJ7 B;  4PJO F;  5GMK i;  1Q82 U;  1NJI C;  3A8H B;  3T9N A;  1Y71 A;  3OYA A;  5DLQ E;  4BUG A;  4J5Y A;  1P92 A;  2QQ9 A;  3KUF A;  5M9O A;  2GF7 A;  1BI2 A;  3JRZ A;  3KXT A;  1VQ6 A;  5J26 A;  4C92 E;  3NTH A;  2PVG B;  2GCX A;  3VV0 A;  1N8R C;  4IUV A;  5GAO q;  5GAN 3;  1WNL A;  2HBP A;  2EKO A;  4OVA A;  5IAY A;  1XOV A;  1N9R A;  2MWO A;  2E70 A;  3MEA A;  5LJ3 j;  4JRQ A;  1Q86 U;  2RJC A;  3V7R A;  4C5G A;  1UGS B;  4FM4 B;  4C0G A;  2WSF E;  2JTM A;  3L1A A;  4BDY A;  2RK2 A;  3MEW A;  1JBM A;  2PVD B;  2YLC A;  1HXD A;  2K5L A;  4XAX B;  5FRO A;  3M57 A;  4M77 D;  3V7S A;  2HD0 A;  2L8D A;  2HQE A;  2O01 E;  2MMP A;  3PGG A;  3SWN A;  5LJ5 h;  3PTA A;  3GLX A;  2D6F A;  4X9D A;  1VQN A;  2XU8 A;  4C8Q C;  2F5T X;  3V8K A;  4Y28 E;  2ZPG B;  4M78 E;  5D6W A;  1VIF A;  4M7A C;  3J7A F;  2RI3 A;  2O4X B;  1YI2 T;  3S3O A;  1I8F A;  4N4H A;  1WGS A;  2XG8 D;  4C5I A;  2BUD A;  2LDM A;  4JDS A;  3TCJ A;  3OYK A;  1YIJ A;  1M8V A;  4N0A C;  2DZC A;  4M78 F;  1VQ8 T;  4DOW A;  1K9M U;  1YJ9 T;  3HPW A;  1KG1 A;  3G6E T;  3CC7 T;  4BE0 A;  2ZPB B;  4XU0 A;  4C92 B;  2CZ0 B;  3RES A;  5GAN 5;  4JRP A;  3JCM W;  5GAN d;  5GMK l;  5CAI A;  3QKJ A;  3J80 E;  3G4S T;  4RCC A;  1BYM A;  3DLM A;  2B8A A;  4F7U G;  4RG2 A;  5GAN h;  3OYG A;  1AHJ B;  4ZGE B;  4DA4 A;  3VU3 C;  3INZ A;  3TU4 K;  2XID A;  4QVC A;  2GQV A;  5GAM d;  4M77 G;  4RMO A;  4DQ2 A;  4C92 C;  3CCE T;  3RKW A;  3SB2 A;  3CXC A;  1S72 A;  5FLX E;  2RK1 A;  3QPH A;  1KHC A;  5GAM h;  4D6W A;  5LJ3 g;  3HKS A;  5GAN 8;  2IVW A;  1MHN A;  4OB2 B;  4C8Q D;  3G7Z A;  3J81 E;  1QVF A;  3L42 A;  3EAE A;  3LGL A;  5KCH A;  3H8Z A;  2DAQ A;  1Q7Y C;  2DZ9 A;  3QZ9 B;  5GMK h;  5DM7 R;  1G3W A;  1I5L A;  4L6V 5;  2RH2 A;  3QSU A;  4WF2 A;  5FU6 B;  3E9F A;  3G71 A;  1K73 U;  2V8K A;  4M78 C;  3JCM X;  2WSC E;  1JJ2 A;  2GFU A;  4CRI A;  3NFC A;  5GAO m;  5KH6 A;  2VGN A;  2R5M A;  3HRT A;  4HCZ A;  3CMA A;  3LWH A;  3QHS A;  3PT9 A;  1M1K U;  4HT8 A;  4F7U A;  3GPL A;  4HCB A;  3I55 A;  2ZZD A;  2ZGW A;  4J6X A;  1Y7X A;  1K8A C;  1ZBX A;  2LCC A;  3CC2 T;  2OAU A;  4M7D F;  4II1 A;  3HRU A;  4M75 E;  5KE3 A;  2E1H A;  4M77 A;  4C0D C;  4R55 A;  3OYB A;  3A8O B;  1QVF S;  2QQB A;  5FU6 C;  1KQ2 A;  2MWP A;  3OYY A;  3OS1 A;  3CCS A;  4EMK A;  3MEU A;  3OS5 A;  1I4K 1;  1NPR A;  4IUQ A;  4TVR A;  3JCM g;  3I56 A;  2XI9 A;  1NE8 A;  5FRN A;  2QQS A;  1WPY A;  1VQK A;  3HL8 A;  3CCV T;  2CYZ B;  2L3R A;  2E6N A;  4C8Q G;  2KDS A;  2KQW A;  4JUV A;  1YJN T;  4OGC A;  2DIG A;  2VC8 A;  1Q82 C;  2EFI A;  3ZBD A;  3JCM e;  3QDR B;  4A53 A;  4EMH A;  1M90 U;  1NPP A;  1M1F A;  2RD1 A;  3OYJ A;  1VQM T;  1OZ2 A;  4HCC A;  3URG A;  4MML A;  5I21 A;  4HKE A;  3GNG A;  3JAM E;  1VQ9 T;  1YHQ A;  1VQP A;  2M1H A;  4M77 B;  3S3N A;  4C8Q F;  4KUD K;  2WSE E;  1FXX A;  4MZP A;  4PJO G;  1N27 A;  1JB0 E;  4M78 D;  3CCR T;  4M7A F;  4NL2 A;  4NL3 A;  1UB4 A;  2RB6 A;  3OBW A;  3X24 B;  1Q86 C;  3L2Z A;  5A0L A;  1VQL A;  4CI0 C;  3CD6 T;  1KQ1 A;  2GFA A;  5GAO p;  4ZTJ A;  1U1T A;  2P0Q A;  2VUB A;  4BD3 A;  3OA6 A;  3JCM P;  2LC4 A;  2DTO A;  2E10 A;  5CCA A;  3JCM f;  3OYE A;  3JCM V;  3OYF A;  1KC8 U;  4ZGJ B;  1G3S A;  3CME A;  3CCQ A;  4E7I A;  4RKU E;  1QW1 A;  3QYH B;  4C8Q A;  2QEX A;  3L2V A;  3GP8 A;  4ME7 A;  3HFN A;  3JCM b;  2ZPF B;  1WQ7 A;  2VXE A;  4M75 C;  4QQG A;  1VQ6 T;  4NOY A;  2LQK A;  4JRK A;  5DY9 A;  4E7J A;  2M9U A;  4N0A A;  1K9M C;  3GNF B;  4HT9 A;  2EQK A;  3HHT B;  3FJP A;  3RMS A;  2M0O A;  1YCY A;  3HP9 A;  3MP1 A;  5CQX A;  4C92 F;  3CBP A;  2CGH A;  3C95 A;  3OB9 A;  4PJO A;  2YHT A;  2RM4 A;  2QA4 A;  1VQO A;  4M78 G;  2QXF A;  4ATO A;  1NZ9 A;  5D6Y A;  1YBY A;  4A54 A;  4PNO A;  5CQY A;  4UC4 A;  1VQN T;  2LQ8 A;  1WJS A;  1UGQ B;  2PQW A;  2RJE A;  2ZPI B;  3H6Z A;  3HRS A;  3MHX A;  3O8V A;  4QVZ A;  2DXU A;  3QJY A;  5AYF A;  5GAN 6;  1YIJ T;  3JCM c;  2P0P A;  1OYX A;  3QG1 A;  2Y4X A;  4M7D D;  5GAN g;  4ELZ C;  3AHU A;  3BY7 A;  1FX7 A;  3DB3 A;  1W2B S;  2QQA A;  4QVD A;  3M54 A;  4PJO B;  2I2L A;  4LDU A;  3CCU A;  3JCM Q;  4FSX A;  4FT4 A;  5GAN e;  3SWN B;  1EIF A;  2RHY A;  3OYN A;  1XNI A;  3QJ6 A;  1Y07 A;  2LT4 A;  1K73 C;  2EQM A;  1VQ4 A;  1VQ8 A;  3PIP A;  2EJF A;  4M78 A;  3CCM A;  4JS5 A;  1M1K C;  2G3R A;  5GAM e;  5GAO r;  2OTL A;  3RMQ A;  4FIB A;  3CC4 A;  1KHI A;  1S72 T;  4BY6 B;  2V8I A;  1X6O A;  1OI1 A;  4A4E A;  4FT2 A;  4QW2 A;  4XTW A;  1R8O B;  3M4G A;  2VGM A;  3EFS A;  3LGF A;  3MO8 A;  5KE2 A;  5GAO n;  4M7A D;  3FIF A;  4C0F A;  2VYT A;  5GAN f;  1IZ6 A;  4E7H A;  3A8M B;  4A4F A;  4M7D G;  5LL6 S;  2L5Q A;  4PKC C;  4XK8 E;  5CKH A;  2H3J A;  2D0Q B;  2JN0 A;  4XU3 A;  2K2V A;  2JOY A;  4X9C A;  3JB9 J;  4F7U E;  2M16 A;  3OBY A;  1I81 A;  2RI2 A;  1G3Y A;  2RJF A;  3M53 A;  3VJP A;  2DD4 A;  2F5K A;  3G71 T;  3CCE A;  3OMC A;  4XTY A;  3CBO A;  3CMA T;  2CZ6 B;  4M77 E;  2DD5 A;  5GAM f;  1M90 C;  1O9S A;  2JZ2 A;  4BE1 A;  2KK4 A;  3I55 T;  4B9W A;  3Q1J A;  5EG2 A;  1U8R A;  3E19 A;  2NLU A;  1YJW A;  3MP8 A;  3JB9 H;  5IT9 E;  5LJ3 d;  3A8G B;  3GF5 A;  4OB1 B;  3CBM A;  4XTZ A;  2ZCF B;  3X28 B;  3BDL A;  2X4X A;  4LDW A;  4GY5 A;  2RA2 A;  3QII A;  1V29 B;  1UGP B;  4QQD A;  4XTU A;  3ASK A;  2EJ9 A;  2EQJ A;  2R5A A;  3DKM A;  3F70 A;  2DIQ A;  3OS2 A;  4M75 F;  1GXI E;  2MI6 A;  4LDY A;  5LJ3 h;  4C92 D;  3CCJ T;  5FU7 B;  3HSB A;  3I56 T;  3FLG A;  1JRI A;  2DTI A;  4J8O A;  2RI5 A;  4C5E A;  3SD4 A;  3SDZ A;  5HY6 A;  4BDZ A;  3CPW A;  1Q81 C;  1VQK T;  2RHU A;  2JVV A;  2LVM A;  4M7A G;  1M4Z A;  2YRV A;  4A4K A;  4M7D A;  3HFO A;  3QYG B;  4XTX A;  4F7U B;  5CVI A;  1KC8 C;  3LH0 A;  2A7Y A;  2DKG A;  4YTL A;  5I2S A;  3JCM J;  2EJG A;  3VUB A;  2YLB A;  1VQ7 A;  3JB9 I;  1Q81 U;  3TEE A;  3TRE A;  5C0M A;  4Y91 A;  2KY9 A;  1YHQ T;  3JSC A;  2JTF A;  2V8J A;  4XTV A;  2E6Z A;  2WAC A;  1VQP T;  5GAN j;  3CCL A;  2E64 A;  1X01 A;  3FEO A;  4BE2 A;  3A5Z B;  4DOV A;  3OYM A;  1D3B A;  3VYG A;  2DVE A;  1WQW A;  4MZT A;  4EMK B;  2DXB A;  5GAN 2;  2DO3 A;  1RL2 A;  4ZN3 A;  1VQL T;  5HK0 A;  2XIC A;  1B34 A;  4OB0 B;  1YIT T;  1BI3 A;  1KD1 U;  4KBM B;  2XD0 A;  3X20 B;  3CPW S;  4OB3 B;  3FRN A;  5GAM j;  4OMF B;  1W4S A;  3UT1 A;  5HKC A;  5LJ5 d;  1VQ5 A;  4M77 C;  4RCB A;  1BI1 A;  4C92 G;  3E1S A;  3CME T;  3FDR A;  3L2W A;  3VYH B;  4IUR A;  5CKB A;  3UWN A;  4BI3 A;  4EDU A;  2OTJ A;  3BDU A;  2PVO B;  2FB7 A;  4EMK C;  3JB9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...