1K4US

Solution structure of the c-terminal sh3 domain of p67phox complexed with the c-terminal tail region of p47phox
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
62
structure length
62
Chain Sequence
QLKKGSQVEALFSYEATQPEDLEFQEGDIILVLSKVNEEWLEGESKGKVGIFPKVFVEDSAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHAGOCYTE NADPH OXIDASE SUBUNIT P67PHOX
publication title Diverse recognition of non-PxxP peptide ligands by the SH3 domains from p67(phox), Grb2 and Pex13p.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 5
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2001-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1k4uS00
2ED0A 4AG2C 2KBTA 1NEGA 4JZ4A 1PKSA 1NM7A 2DM1A 2EPDA 2W10A 2A08A 2L2PA 2JS2A 4E6RA 1UJYA 2O2OA 4HXJA 3VS7A 1ABOA 1GCPA 4RTZA 2MOXA 1PKTA 1UFFA 2DILA 3EHQA 4LUDA 1MV0B 1VYVA 2CH4W 3GBQA 1K4US 2BZYA 1OPLA 2DL4A 2DRKA 3TSWA 1HD3A 1BB9A 1AD5A 1YN8A 4CC3A 1BBZA 3O5ZA 4WCIA 4A63B 1QWEA 5IXBA 1I0CA 1PHTA 3EG0A 3UA7A 4Z88A 2DX1A 2RF0A 2EW3A 1VA7A 1UE9A 2DL8A 3VS3A 2KE9A 1ZUUA 1G2BA 1YP5A 2DL5A 2JM9A 1X43A 2LQNA 1QLYA 4OMMA 4LNPA 1OOTA 2FRYA 2DL7A 1M3AA 1X6BA 2ENMA 4AFZC 4D8KA 1AWOA 1KIKA 4KRTA 1X2KA 1JXOA 1X27A 1HJDA 1U5SA 2DJQA 1G83A 1X6GA 2KRMA 5GJWB 2FEIA 1V1CA 3EHRA 2HCKA 4F14A 1JQQA 2HBWA 1W1FA 3EG3A 2GTOA 2L0AA 4LN2A 1X69A 2CH4A 4RUGA 1E7OA 1WI7A 1UG1A 2AK5A 2LP5A 2J6OA 2I0NA 2GTJA 1IO6A 2NUZA 3H0FA 1OV3A 2KNBB 2B86A 2AZSA 1W6XA 3NPFA 1EFNA 2ROTA 2SRCA 4EIKA 1CSKA 2RQRA 3SHWA 1QCFA 3UF4A 5FWCA 2CDTA 2O9SA 2QDLA 4FSSA 2RNAA 2EKHA 4HCKA 2MCNA 4F16A 1N5ZA 3PE0A 1K1ZA 2RQUA 4RTUA 1VYUA 1AVZC 1AWJA 4ZNXA 5ECAA 1YWOA 1FYNA 3EG2A 4CC4B 3VS4A 3JV3A 2EGAA 1UJ0A 4IIOA 2DLPA 4AFSC 1TUCA 5FWBA 2YUQA 1UDLA 2LJ1A 2AKLA 2O9VA 1U06A 1AZEA 2PTKA 4DEYA 2CT3A 2KRSA 1CKBA 3PVQA 3REBB 1GBRA 1WDXA 3CQTA 2RQTA 2LMJA 3KFVA 2KR3A 1UECA 2KRNA 3VS2A 2F2WA 1I1JA 2O88A 3VRYA 2D1XA 3EGUA 1Y0MA 1M3CA 4LE9A 1M30A 2K2MA 3I5SA 2ROLA 2GQIA 3VS6A 2LQWA 3ZL7C 2ECZA 1NG2A 4JJCA 2DE0X 4J9CA 1PRLC 2EGEA 3IQLA 1NLOC 1GCQC 3ULRB 3PVLA 1SPKA 2H8HA 2FG0A 2JMCA 1KJWA 2J7IA 1QWFA 1UHCA 4DEXA 1RI9A 2C0OA 2KXCA 2OI3A 2JS0A 1GCQA 2YDLA 2CSIA 4AFQC 3H41A 1M27C 1ZUKA 1FMKA 2K6DA 1WXUA 4RTWA 1B07A 1S1NA 1YNZA 1Z9ZA 1GFDA 2CSQA 5IH2A 2EVRA 2JT4A 1TUDA 3TSZA 4HVVA 2DMOA 3FJ5A 2DBKA 1ZUYA 2FRWA 1BK2A 4X1VA 2M51A 2V1RA 5IHKA 2VKNA 3M0QA 2LCSA 2JMAA 4JJDA 1T3LA 3I9QA 1WIEA 2DVJA 1WA7A 1BU1A 1VYTA 2CREA 4J9HA 1GRIA 4QT7A 4ORZA 1ABQA 2YT6A 1B3QA 1ZBJA 4OMPA 2EBPA 2YUPA 3VRZA 2L3SA 3M0RA 1WFWA 1RLPC 5L23A 1K0XA 2G6FX 1GBQA 2O31A 2EGCA 2V1QA 1E6HA 2KT8A 3C0CA 4M4ZA 4OMLA 1UGVA 2XMFA 2LX7A 2DL3A 4CC2A 2YUNA 1RUWA 1Y57A 2RQVA 3I5RA 2K3BA 1SEMA 2EQIA 1T3SA 1CKAA 2KT1A 2A36A 2KYMA 2HSPA 1AEYA 1AWXA 1U3OA 2D8JA 3NMZC 1H92A 2KXDA 2RQWA 2J05A 2KEAA 2JM8A 4OMOA 1SSHA 1KSWA 1LCKA 1NYGA 2GNCA 2K7AA 1E6GA 1K9AA 2EYXA 1WYXA 2FPFA 2W0ZA 4OMQA 3REAB 2FO0A 2J06A 3QWYA 1T0HA 2PNIA 1T0JA 2L3PA 4LUEA 2JXBA 1K0SA 1JU5C 2RPNA 4JZ3A 4OMNA 1PRMC 2A28A 1AOJA 2A37A 3QWXX 1WXTA 3A98A 2DA9A 5IHIA 3NHNA 1WX6A 2VVKA 2FPDA 2YUOA 2DNUA 1GL5A 4J9IA 1JEGA 4HVWA 1K76A 2FPEA 1PWTA 4Z89A 2AZVA 2P4RA 4RTVA 1XOVA 3THKA 3H0IA 1H8KA 4J9DA 2KGTA 1JO8A 4GLMA 2OAWA 2BZ8A 1MV3A 1YCSB 4AG1C 1MUZA 2ABLA 1M8MA 2C0TA 2EYYA 2RMOA 2D8HA 1JXMA 1PNJA 4Y92A 4F17A 2ESWA 2JW4A 2K9GA 2KROA 1Z9QA 4RTTA 2HDAA 3RNJA 4JJBA 2DF6A 2AKKA 4J9BA 1W70A 2HEQA 2C0IA 1TG0A 3VS0A 3RBBB 5I22A 2DBMA 2F2XA 3TVTA 1ZSGA 1RLQC 3EG1A 1UTIA 1YWPA 5IXFA 4J9GA 1WLPB 2GBQA 1A0NB 3LH5A 3UA6A 2MIOA 5IHNA 5I11A 2SEMA 2OJ2A 1HSQA 3M0TA 1SRMA 3NGPA 1QKWA 1SRLA 2LJ0A 1OEBA 1SHFA 2CUBA 3UATA 5GJVB 2K79A 1H3HA 1I07A 1J3TA 1ZLMA 4IIMA 5FW9A 3U23A 2CT4A 4HVUA 2JTEA 2X3XD 1ZX6A 3R6NA 2GGRA 5EC7A 2PZ1A 3VS5A 2LJ3A 4JPBW 2KYBA 1M3BA 1UHFA 2RN8A 1NLPC 2X3WD 3M0UA 3M0SA 1QKXA 1NYFA 1WXBA 3I35A 5HCKA 1NEBA 4K11A 1ARKA 1GFCA 4RTXA 3SEMA 2BZXA 2EYZA 1UUEA 2EYWA 2DYBA 2IIMA 4R0KA 3H0HA 2NWMA 2E5KA 2DRMA 2J6FA 2CUDA 3VS1A 4GBQA 2D0NA 2LNHB 2VWFA 2LZ6B 2J6KA 4CC7A 2L3QA 1SHGA 2BTTA 1KFZA 4AFUC 4J9FA 1X2QA 2M0YA 4RTYA 4Z8AA 4J9EA 2F2VA 1AWWA 4D8DA 4ESRA 3M0PA 1AZGB 2ED1A 2YSQA 1OPKA
chains in the Genus database with same CATH superfamily
2ED0A 1VIFA 4AG2C 2MAMA 3JB9J 3JCMQ 4N4HA 4JRPA 4BDZA 2Z0WA 1TOVA 4HXJA 1ZA2B 5CKEA 2O4XA 4PNOA 2RJEA 4M75D 1K73R 2RA2A 1W2BS 1IGUA 3L42A 4DOWA 2DZ9A 4LUDA 1KQSP 4A4EA 3BY7A 4VUBA 3MEAA 1D09B 5GAN4 2K5LA 3CEYA 3JCMh 1KC8C 4N0AC 3EAEA 1MGQA 4PJOD 3CXCP 4CC3A 3O5ZA 4A63B 2CP7A 3VKIA 3UA7A 2DX1A 5GAMf 3QDFA 2YWWA 3PIOA 2RJFA 1ZA1B 2IG0A 2P0QA 2CKKA 1JJ2P 1RAEB 4IUUA 1X43A 2LC4A 2LQNA 1QLYA 3CD6Q 3P8BB 3PIPA 2K3YA 1M3AA 3CPWP 3CD6A 1D0ZA 2H3EB 5CKDA 3GOXA 4D8KA 1X2KA 3VV0A 4OGEA 3G4SQ 3OW2P 4M75B 3LWHA 3G4SA 5GJWB 1YIJT 1C0MA 3EFRA 2HCKA 4F14A 2JNGA 2HBWA 1W1FA 2GTOA 2DPPB 1HK9A 1WI7A 3FEOA 1UG1A 4FCYA 3L2QA 2J6OA 1SF9A 5LJ5j 4M7AF 4OGCA 1CSKA 4LD6A 1QCFA 1MHNA 2X35A 2QDLA 4FSSA 3E19A 2RNAA 2EKHA 3QBYA 1VYUA 4C8QC 1AVZC 2K2VA 4PL6A 2EIFA 4BY6B 4GY5A 1YWOA 4LDYA 3EG2A 3GIBA 2EWNA 4NOYA 3VS4A 2V26A 3JV3A 2HZYA 4C0ZA 2DLPA 1VQ6T 2AHJB 2CGHA 2DETA 4KBMB 3HFNA 3KBGA 2YHTA 1VQOT 1BCMA 3CQTA 3VUBA 1D1AA 1YITQ 2LMJA 1NE8A 2AT1B 5LJ3d 5CVIA 3JCMe 2KRNA 1I1JA 1YITA 4Z02A 3EGUA 3QKJA 1Y0MA 1OZ2A 3G6EQ 2DKGA 2JVVA 2RB6A 4XTXA 3QJ6A 4BI3A 3G6EA 1NG2A 2DE0X 5KYWB 1PRLC 2Y90A 3KXTA 1QVFP 2H8HA 3AT1B 3CCSQ 1KG1A 1QWFA 2J7IA 4DEXA 4E7LA 2KXCA 3S3MA 1N27A 3CCSA 2EJGA 4QQGA 4MDWA 2QQAA 1Q82C 3CCMT 2M0OA 4C92E 1FMKA 1WXUA 5KYNA 1PG5B 1PC0A 4QVCA 2DZCA 2CSQA 4BI8B 2EVRA 4C8QG 1YIJQ 1YJ9Q 1Q7YC 1ZUYA 3FIFA 2ZGWA 3OYHA 4A53A 1YI2Q 3URGA 1YIJA 3FLGA 1YJ9A 1VQ5Q 4EMGA 4A4FA 1YI2A 1VQ5A 1Q86R 1BI1A 4J9HA 4M77C 4QT7A 2YT6A 2QEXT 1ZBJA 5KYXA 4OMPA 3VRZA 3C95A 3WVDB 1D0YA 3LX7A 3GP8A 2IVWA 4MZMA 1WZOA 4M7AA 4M7AE 2K57A 2G6FX 3V8KA 2O31A 2E6NA 3E1SA 2HQHA 3J7AF 3HL8A 3M55A 1NJIR 2XU8A 2DL3A 2QG9B 3T9NA 4C0DC 1Y57A 3JSCA 2RQVA 1VQ6Q 2K3BA 2IPOB 5FU7C 4C5GA 4DBFA 1VQ6A 2KT1A 3EGDB 2HSPA 5CR2A 1AEYA 3NMZC 1WHKA 2HSEB 2RHIA 3GF5A 3QXEB 4IUTA 3C4SA 3MKDA 4M78C 2LQKA 2RQWA 3N5BB 2JM8A 1NZ9A 2E6ZA 5FRMA 1NYGA 2GNCA 1IZ6A 2F5KA 1Q81R 3G71T 4F7UB 1Y96A 4OMQA 2FO0A 4LDUA 1PSFA 3JCMf 4M77G 1VQPT 4LUEA 1D0XA 2JXBA 4BB7A 1PRMC 4OMFB 4MDXA 2A28A 5LL6S 2DA9A 3EFSA 2C06A 3NHNA 2VVKA 2GFUA 2FPDA 2RHYA 3MCAB 3RKYA 3OBWA 1YJNQ 3AHUA 5KCOA 1JEGA 4XU2A 1OX8A 2LT4A 4Z89A 1XOVA 1YJNA 8ATCB 3H0IA 1H8KA 4PK4A 4XU0A 4HCZA 5GMKj 2F5TX 2HKNA 1IREB 2EFIA 2MPXC 2OAWA 2BZ8A 2QEXQ 4OB0B 1F1BB 4JRIA 4ELYC 4M7DC 2QEXA 4F17A 2JW4A 4EPCA 2KROA 3JB9F 4JJBA 4M78G 2EJFA 2HEQA 2CS7A 3VS0A 3EH1A 5I22A 2DBMA 3FC3A 2DERA 2E41A 2LNVA 4XK8E 1M9SA 1WLPB 1A0NB 2CP0A 1OU9A 3M9QA 3MPUB 3NGPA 2OTJT 1SRLA 3VYGA 1I8FA 2E3HA 1BIBA 3UATA 2LDMA 3PFSA 2K79A 5FROA 2DIGA 1J3TA 5FW9A 3MEVA 1I81A 2NLUA 4HVUA 2XDBA 2GGRA 5EC7A 3RKXA 5LJ3j 1M2OA 4FT4A 3S3NA 2X3WD 4ZGJB 1U1SA 4JLGA 1LJOA 1WGSA 1EIFA 1NYFA 3I35A 5HCKA 3G71Q 4K11A 1ARKA 1Q86U 4RTXA 2BZXA 3A8LB 4R0KA 3G71A 3H0HA 3X20B 1O75A 2NWMA 1VQPQ 2RHUA 2DYIA 4GBQA 2A7YA 2JOYA 2LCLA 1VQPA 4M7DG 2O4XB 5HK3A 2KDSA 1KFZA 4J9FA 3DLMA 1X2QA 2COWA 2M0YA 2E4HA 3L2UA 4J9EA 1VQ4A 4ESRA 1AZGB 2ED1A 5J3BA 1NJIU 1XTDA 2ZPBB 4EMKA 2XDPA 5KYYA 1Y71A 1W2BA 2KBTA 4PJOC 3JB9I 3M4YA 1KD1R 3G1JA 2JS2A 4E6RA 1UJYA 2O2OA 2JTMA 1YJWT 2FHDA 4XTYA 2QQRA 4N4IA 2K5IA 1OX9A 1ABOA 5FRNA 2DVEA 1NBEB 4RTZA 2MOXA 3ME9A 2VYTA 2DILA 3EHQA 1MV0B 5GMKh 4BACA 1M1FA 1VQNQ 1HXDA 2CH4W 1Q81U 1VQNA 2BZYA 3FRNA 2XG8D 2DRKA 1HD3A 4O5VA 1BBZA 1QWEA 1I0CA 2OTJQ 2HMAA 4TVRA 3RIRA 1XNIA 1QVGS 5KYUB 2EAYA 4FL6A 5I2MA 2OTJA 3NTKA 3VS3A 2BE7D 5KH6A 2KE9A 2GFAA 2XI9A 3BDLA 5GAMg 1G2BA 2L5QA 4E7KA 2DTIA 5HKCA 4OMMA 2E64A 3L1AA 3I55T 2FRYA 5IT9E 3HRTA 2DL7A 3H8ZA 2HQXA 3UDCA 3OYMA 2P84A 4PJOG 1AWOA 4XTZA 1KC8R 2M9UA 3PMTA 5FU6B 1BCOA 2QI2A 1IGQA 9ATCB 1JXOA 1Y7XA 3SWNA 1BI3A 1XJWB 3CCLQ 1V1CA 2V8JA 3CCLA 3EG3A 2L0AA 4LN2A 2Y4XA 1PD1A 2CH4A 1R0BG 5CKFA 3LH0A 2AK5A 3JCMV 4R55A 2GTJA 3H0FA 2ZZDA 2KI7A 1OV3A 2KNBB 2DTOA 4XAXB 3NPFA 3SDZA 2QQSA 4HKEA 5CK9A 2SRCA 3UF4A 2GF7A 3KUFA 5FWCA 2CDTA 3TU4K 4R56A 3OYJA 1YJWQ 4F16A 1N5ZA 2DK3A 4AT1B 4M7AD 4ZNXA 1VQMT 5ECAA 1YJWA 3CCVT 2YRVA 1M90R 4CC4B 3DB3A 3NTHA 5DLQE 4C8QE 3HPWA 1UJ0A 4FM4B 1VQ9T 2OTLT 5FWBA 5I2SA 2AKLA 1AZEA 4DEYA 5GMKe 2EYQA 3PVQA 2KRSA 2LX9A 3REBB 3L2RA 3R6OA 1WDXA 1XQHA 4C92B 3KFVA 1WHLA 2EJ9A 5GAMd 2AIRB 3VRYA 5GAN2 1RABB 1M30A 3M58A 4B9XA 3I5SA 2GQIA 2XK0A 2VV5A 3NTIA 2ECZA 4JJCA 2RJDA 4J9CA 3QIIA 4Q5WA 3OYEA 1NLOC 1GCQC 3HKSA 3I55Q 3ULRB 1N6AA 2BKDN 2JMCA 3CXCS 2P0KA 1UGSB 1KJWA 3OS5A 5KYXB 3I55A 2XD0A 2C0OA 3BDUA 1RAIB 3MP8A 4AFQC 3S6WA 4DBRA 2KAFA 4RTWA 1PD0A 3RUXA 4M7AB 2MWOA 1JJ2S 5C0MA 2NYSA 1KK7A 4HVVA 3FJ5A 4C92F 2M02A 4J83A 4X1VA 4E7JA 2VKNA 2QGGA 3CPWS 5GANh 1K8AU 4IUVA 3PGGA 1WA7A 4ELZC 1GRIA 4ZN3A 1B3QA 4CRIA 4M7DF 1FX7A 3OW2S 2R58A 4JUVA 5KYUA 1G5VA 2FYKA 1N8RU 2R5MA 1Q95G 4NL3A 2L3SA 3M0RA 4M77E 1WFWA 1Q82R 1W4SA 4IKFA 4X34A 3CMET 1U8RA 2YLBA 1NPRA 4Y91A 2V1QA 3CCVQ 1E6HA 4ZTFA 1TTHB 1X6OA 1Q7YR 1UGVA 4B9WA 4KGZB 2YUNA 3CCVA 1Y96B 1TSFA 2HBPA 2EQIA 4JRKA 2VXEA 2K3XA 2KYMA 2NUPA 5CKBA 1KC8U 1FMWA 1KQ2A 2PVOB 4A4GA 2KXDA 2HNIA 2J05A 4OVAA 1G3YA 4OMOA 3VYHB 1SSHA 5GAOp 3TEEA 2G3RA 1UB4A 2KVQG 4M78E 2DO3A 2ZCFB 3CC4T 1K9AA 1ACMB 2QDYB 4E7SA 1ZSZC 2VGMA 4XTUA 4MZTA 4YTLA 3REAB 2J06A 4QVZA 2RD1A 4LDWA 1T0JA 3Q1JA 2YLCA 1JU5C 4JZ3A 3JCMg 1HYOA 3EFOA 1G3TA 2E12A 3ASKA 4EDUA 4RKUE 4XU3A 2JTFA 3VU3C 3BE3A 1GL5A 1QVFS 1M90U 1IXDA 5A0GA 4RTVA 3JCMP 4P5NA 5GMKm 2CZ1B 4C92A 1N9RA 1YCSB 5GANe 2ABLA 1SG5A 2K4YA 1GXIE 1BIAA 2RMOA 1JXMA 1K73U 4Y92A 4RTTA 4IURA 3MEUA 3C12A 3CMEQ 1W70A 3M59A 4M7DA 4M7DE 2C0IA 4Y28E 3WVEB 3M4GA 3RBBB 1WJQA 3CMEA 2QTXA 3TVTA 5IXFA 3JB9D 3LH5A 3M53A 5IHNA 3SD4A 1QCNA 3M0TA 1QKWA 1BI0A 1B7TA 1V76A 3CCET 3FDRA 3FB9A 3VJPA 2XKOC 2CUBA 5GJVB 2QK0A 3M5AA 3SB2A 1H3HA 1B34B 5GAOr 5LJ5h 2JTEA 1ZX6A 3VS5A 1K9MC 2KYBA 2RN8A 1UHFA 1NLPC 1N9SA 2NUTB 1WXBA 4EMKB 5KYYB 4KH0B 4FW1A 1VQOQ 3LGLA 3JCMd 5FU6C 1UGQB 2KY9A 1VQOA 2F1LA 2X9HA 2J6FA 2KMTA 2EQMA 3VS1A 3JRZA 2LNHB 2VUBA 2LZ6B 4CC7A 3HFOA 3L2VA 2L3QA 3CCUT 1SHGA 2BTTA 2DXCA 4RTYA 4BUGA 5GAOq 3M0PA 2HAXA 2QAZA 4JLIA 2LRQA 1WNLA 3G7ZA 1Q7YU 4QKUA 2QASA 2QQ9A 5GAOm 3OYDA 1M1KR 1MNEA 1NEGA 2OX7A 4JZ4A 4J8OA 1NM7A 2EPDA 2W10A 3OYLA 3CCMQ 2L2PA 1D1BA 5I21A 4PJOE 1TU0B 4E7ZA 4ZN1A 3CCMA 1PSEA 2MI6A 4ANJA 2K5FA 2PU9B 1P92A 1UFFA 4XTWA 2X4JA 2CP6A 3I56T 3CC2T 2ZAEA 1VYVA 1QVGA 3GBQA 4PLIA 5GANf 4PFOA 2DL4A 3TSWA 2E10A 1QP3A 4E2FB 1AD5A 4C0FA 3QDRB 1YN8A 1OYXA 4PJMA 4WCIA 5IXBA 1PHTA 3GLXA 4OP0A 3SWNB 4ZGEB 2RF0A 1EZZB 5AT1B 2EW3A 1IRXA 1VA7A 1UE9A 2DL8A 4KUIA 2DFUA 3CMAT 1YP5A 2JM9A 2EQUA 4ATOA 4MMLA 4NL2A 3HSBA 4LNPA 1Y07A 3HRSA 4PLLA 5LJ5e 1DJ7B 1H641 1YHQT 2ENMA 2L89A 2DXTA 1S72T 4AFZC 1RADB 1KIKA 5LJ5g 4KRTA 1OZ3A 1OI1A 4KGXB 1MMAA 3D7SB 4WTOB 1YBYA 1VQ8T 1HJDA 2DJQA 1G83A 1X6GA 5GMKl 4E7HA 2KRMA 1UEBA 2CYZB 3A5ZB 1RI0A 3OSSC 3GPLA 3WXMB 4RUGA 3OQ5A 1E7OA 4O6JA 3EG9A 3L2WA 2LP5A 2NUZA 1IO6A 3INZA 4BE2A 1KHCA 4J5YA 2FZKB 1EFNA 3JCMb 3MP1A 5D7UA 3SHWA 2RQRA 5CCAA 4M75C 2RHXA 4J6XA 1B34A 4BE1A 4FYXB 4HCKA 3PE0A 5IN1A 4PKCC 1K1ZA 2RQUA 4RTUA 2WSFE 2D0QB 1FYNA 5M9OA 5KE2A 2NUTA 4QVDA 4KGVB 4ME7A 3I56Q 2EGAA 3CC2Q 4IIOA 4X9DA 2HL3A 3LWIA 1UDLA 4PFZA 2D9TA 1QMCA 3X26B 4QQ6A 2O9VA 3S3OA 1KQSA 1U06A 2PTKA 2CT3A 1RAAB 2XIDA 1O9SA 3SFMA 4C8QF 1GBRA 1JRIA 1RAGB 3E9GA 4V2SA 1VQKT 4A54A 1M2VB 1UECA 2RJCA 4BY6C 2DD5A 2O88A 1OU8A 3OS1A 8AT1B 3CXCA 2B8AA 1RAFB 3CC7T 3OS0A 2K2MA 2ROLA 3CPFA 3ER0A 3CMAQ 3V7CA 3VS6A 2LQWA 5CQXA 3ZL7C 1VQLT 4E47A 5GAOn 3CMAA 2EGEA 3IQLA 3V7SA 4DA4A 3V8JA 3PVLA 1JJ2A 1M1KU 4N0AA 1S72Q 3LGFA 1RACB 1GCQA 2YDLA 2CSIA 4M75G 1S72A 3QHSA 3CPWA 1M27C 1WHHA 2CP3A 3RERA 3EGXA 5GAOl 1B07A 1S1NA 3OSVA 1YNZA 1Z9ZA 2VXFA 5GAN7 3VUZA 1LPLA 5IH2A 3TSZA 5LJ5f 2DBKA 1I5LA 1BK2A 4OB2B 3OW2A 2M51A 2V1RA 2BUDA 2LCSA 2JMAA 4JJDA 1T3LA 4KT0E 3I9QA 1WIEA 3CCQT 1RL2A 2ATCB 3A8GB 3HHTB 3META 4B6MA 2CREA 1H3ZA 4ORZA 1ABQA 2PUOB 4C0DB 2NUPB 4C92D 2DJZA 2EBPA 4LXCA 5LJ3h 3ZFJA 5FU7B 1V29B 3MJXA 3OYNA 2RK2A 4D6WA 2COYA 1RLPC 5HY6A 2RI2A 5CAIA 3X28B 3DLLA 4BDYA 3TQ7P 1K0XA 4M77F 4M7DD 2O01E 1X75C 2EGCA 4M78B 3PNWC 2KT8A 4IUQA 2XMFA 2LX7A 4HT8A 1RUWA 4QW2A 3I5RA 3CD6T 1SEMA 4PJJA 1FXXA 1IHVA 2PUKB 2DEUA 1QVPA 4C5IA 4AMCA 4C5HA 3OB9A 1U3OA 2D8JA 2R5AA 5CO7A 1M4ZA 3EFOB 2MYSA 3G4ST 2P0PA 3E2UA 2KEAA 4OF1A 4X9CA 1FMVA 4C8QA 4ZTJA 2A0FB 3CC7Q 3RESA 4FIBA 4J7FA 1BYMA 1WJSA 4FYVB 2EYXA 1VQLQ 1K8AC 4EMKC 2W0ZA 3HP9A 2DIQA 1T0HA 2QYZA 2PNIA 4J6YA 4M78F 2DXBA 2DEQA 1ZSZA 1D3BA 3DKMA 1QVFA 2RI5A 1K0SA 5DM7R 1N8RC 1KQSS 2X4WA 4OMNA 2A37A 1AOJA 3A8OB 2FB7A 2FZCB 2RK1A 1WXTA 2PVGB 4BD3A 3A98A 4M7DB 2I2LA 5EG2A 1WX6A 1W2BP 4J9IA 5CKHA 2DAQA 2KK4A 3V7RA 5GMKi 2FPEA 1PWTA 2QQBA 4E7IA 1QCOA 2ZPGB 1G8XA 3THKA 2PVDB 4J9DA 2KGTA 5IAYA 1TH7A 1I4K1 1KD1U 3CCQQ 4PJNA 1M2VA 1MV3A 4J6WA 4AG1C 3PMIA 1MUZA 3CCQA 1M8MA 2C0TA 2EYYA 2D8HA 1PNJA 1PM3A 2ESWA 2E65A 2K9GA 1YITT 1Z9QA 4IUPA 3TREA 3FJPA 4DBQA 3RKWA 3H6ZA 5LJ3e 5C6SA 2LQ8A 3G6ET 2WSCE 2E5QA 2F2XA 1ZSGA 5LJ3g 1RLQC 3RR6A 2V8IA 4HA8A 4JDSA 3CBPA 2R57A 5I11A 2SEMA 2OJ2A 1HSQA 2QXFA 3BFMA 4M77A 3CCST 1OULA 1SRMA 2VASA 1U1TA 4RMOA 4RCBA 1M1GA 3SWNC 1OEBA 1SHFA 4CI0C 2FVUA 1I07A 4LDVA 1VQMQ 3CBMA 1ZLMA 4IIMA 3U23A 2CT4A 1D1CA 2X3XD 4BI4A 4KUDK 3OBYA 2MK5A 1VQMA 2DXUA 1VQ9Q 2OTLQ 1M3BA 3MHXA 4F7UG 1YJ9T 2EQKA 1M90C 2VB6A 3CBOA 3M0UA 3A8MB 4L6V5 1VQ9A 1YI2T 2OTLA 3OYAA 3M0SA 1QKXA 3JB9G 1VQ5T 2CP5A 1GFCA 1VIEA 2DD4A 2EYZA 2DYBA 2MMPA 5J26A 6AT1B 2E5KA 2DRMA 4PJOB 3JCMJ 1SSFA 2CUDA 5D6XA 3OYBA 2VWFA 1K73C 2J6KA 5L8RE 3OMCA 4AFUC 4M78A 1BKBA 4Z8AA 3V8LA 3JB9H 5GAN3 1AWWA 4D8DA 3E9FA 5CQYA 1K9MR 2YSQA 1TWBA 4M75F 2VC8A 1PKSA 2DM1A 2A08A 2RHZA 3RDVA 4UC4A 1MMDA 3DB4A 4OB3B 3VS7A 1IHWA 3HRUA 1GCPA 2GCXA 1PKTA 3PT9A 1LOJA 4PJOF 3MP6A 1VQ7T 1MMGA 3GNGA 4HCCA 5CIUA 4FSXA 2A3LA 1K4US 2MF2A 1OPLA 3QG1A 1BB9A 2WACA 5GANg 3EG0A 2LCCA 5LJ3f 5A0DA 4Z88A 1G3WA 1R77A 7AT1B 2X4XA 1WHJA 1ZUUA 4J7IA 2HL5C 2DL5A 4RG8A 3L2ZA 5FLXE 3PTAA 4XU1A 1RAHB 3EG9B 1YJNT 1OOTA 2LT1A 3QZ9B 1X6BA 1EX4A 4FU6A 4WF2A 2F69A 3X25B 1X27A 2KSSA 2ZPEB 1U5SA 5GAMj 4NS5A 2FEIA 3M54A 5GAN6 3EHRA 1TXQA 1JQQA 3CC4Q 2JUFA 2E1HA 3ZBDA 5J39A 1X69A 2QGFB 4C5EA 4JS4A 3CC4A 2I0NA 2E70A 2B86A 2AZSA 1W6XA 2ROTA 4EIKA 1ZHIA 1Q82U 2O9SA 2MCNA 4M75A 4M75E 1IB8A 2ZPFB 1AWJA 1SKUB 4FW2A 5D6YA 3UT1A 3OYKA 1VQ7Q 3OMGA 4AFSC 1TUCA 2YUQA 2YRCA 2LJ1A 1VQ7A 1VOMA 5GANd 3QO3A 1WJRA 1WHGA 3F70A 3QSUA 4PJOA 1R0CB 1TS9A 1CKBA 3EH2A 3M57A 2KQWA 2E3IA 5AYFA 3OS2A 2RQTA 4KULA 3EGXB 3OY9A 2XHCA 4DBHA 2KR3A 3VS2A 1I5OB 2F2WA 1C1AA 2D1XA 2QTVA 3OYFA 1M3CA 4LE9A 2ZPHB 2CZ6B 3LYIA 4C8QD 1VQ4T 2PQWA 4FYYB 3QUIA 4XTVA 2EKOA 5GAN5 1Q86C 1MNDA 4MMKA 1K9MU 3CCJT 1FWZA 1SPKA 2FG0A 4C92C 4JJNK 1UHCA 1RI9A 2OI3A 2ZPIB 3CCEQ 1WQ7A 2JS0A 3JAME 3C94A 3H41A 3CCEA 3UPUA 1ZUKA 3X24B 2K6DA 4RCCA 4GLKA 4F7UF 2QA4T 5D6WA 1GFDA 4FT2A 2JT4A 1TUDA 2DMOA 1NJIC 2FRWA 5IHKA 3M0QA 3GNFB 2VGNA 5KYWA 1BI2A 5HK0A 3OYIA 1VQNT 3HTRA 1OQKA 4PJLA 4A4HA 2DVJA 1BU1A 1WQWA 1VYTA 3OYGA 5GAMh 4M7AC 2YUPA 3P8HA 3CCUQ 3CCUA 3QYGB 2DTHA 2M16A 5L23A 4C8QB 1GBQA 1M8VA 1Q81C 3MEWA 1KHIA 1X01A 3C0CA 1AT1B 4M4ZA 4OMLA 2X4YA 2FZGB 4CC2A 4PFPA 4KH1B 1M1KC 1T3SA 1ZSZB 1CKAA 4C92G 1D3BB 2RM4A 3P8DA 4M77D 2A36A 3OYCA 2HD0A 2LTOA 5GAN8 2WSEE 1AWXA 3J81E 1H92A 1M5Q1 4II1A 2HQEA 5A2QE 2L3RA 1C6VX 1YCYA 3CCLT 3A1PA 2EQJA 1G3SA 5A0LA 1KSWA 2OAUA 1LCKA 1VQ4Q 5DY9A 3I56A 2K7AA 1E6GA 2RO0A 3RMQA 3CC2A 5DLOA 1WYXA 2FPFA 4DOVA 3OYYA 3RMSA 2X51A 3QZ5B 4DQ2A 1MMNA 3O8VA 2YXYA 3UWNA 3CCJQ 3QWYA 4MZPA 3CCRT 1ZQ1A 2JJ9A 2L3PA 1WPYA 2L8DA 3CCJA 1JB0E 3EGDA 4FYWB 1QQJA 2RPNA 4M7AG 1TUGB 3QWXX 4N4GA 5IHIA 4M78D 2QA4Q 1LNXA 2XDDA 5LJ5d 2YUOA 4RG2A 2DNUA 4JRQA 3H9NA 1WHMA 4HVWA 2QA4A 2Y4YA 1K76A 3ZEHA 3QJYA 2BE9B 4LD9K 2AZVA 2P4RA 2M1HA 1YHQQ 5KCHA 1JO8A 4F7UA 4F7UE 4GLMA 4OB1B 1K8AR 1AHJB 1YHQA 2LVMA 4M77B 1YFNA 1VUBA 2V8KA 2CZ0B 2CP2A 2HKQB 2JN0A 2RI3A 3J80E 1VQ8Q 4L5GA 1UGPB 4F04B 4L59A 4EMHA 3M56A 1VQ8A 1N8RR 1NPPA 2CZ7B 3TCJA 3JCMX 3A8HB 2HDAA 3RNJA 4QQDA 2FL7A 5KE3A 3QYHB 1QVGP 2DF6A 2AKKA 4XQ3A 4J9BA 5GAMe 3MO8A 1TG0A 2D6FA 3EG1A 1UTIA 1YWPA 4J9GA 1JBMA 2GBQA 1KQ1A 3UA6A 2MIOA 3JCMc 1ZBXA 2XICA 2LJ0A 2GQVA 5GANj 4BE0A 3JCMW 4ZGDB 3R6NA 2PZ1A 2RH2A 1QW1A 2LJ3A 4HCBA 4JPBW 1LVKA 2COZA 2H3JA 2BIVA 2MWPA 3LLRA 1NEBA 1KD1C 3QPHA 3SEMA 2EYWA 1UUEA 2IIMA 4A4KA 3CCRQ 1VQKQ 1R8OB 1UGRB 2P4TA 3LW5E 3CCRA 1VQKA 2D0NA 1QP2A 4JS5A 3OA6A 3BW1A 2YRDA 2JZ2A 3CC7A 4HT9A 2F2VA 1PCXA 4C0GA 4LDXA 3NFCA 1VQLA 1OPKA
chains in the Genus database with same CATH topology
2ED0A 4AG2C 2KBTA 1NEGA 4JZ4A 1PKSA 1NM7A 2DM1A 2EPDA 2W10A 2A08A 2L2PA 2JS2A 4E6RA 1UJYA 2O2OA 4HXJA 3VS7A 1ABOA 1GCPA 4RTZA 2MOXA 1PKTA 1UFFA 2DILA 3EHQA 4LUDA 1MV0B 1VYVA 2CH4W 3GBQA 1K4US 2BZYA 1OPLA 2DL4A 2DRKA 3TSWA 1HD3A 1BB9A 1AD5A 1YN8A 4CC3A 1BBZA 3O5ZA 4WCIA 4A63B 1QWEA 5IXBA 1I0CA 1PHTA 3EG0A 3UA7A 4Z88A 2DX1A 2RF0A 2EW3A 1VA7A 1UE9A 2DL8A 3VS3A 2KE9A 1ZUUA 1G2BA 1YP5A 2DL5A 2JM9A 1X43A 2LQNA 1QLYA 4OMMA 4LNPA 1OOTA 2FRYA 2DL7A 1M3AA 1X6BA 2ENMA 4AFZC 4D8KA 1AWOA 1KIKA 4KRTA 1X2KA 1JXOA 1X27A 1HJDA 1U5SA 2DJQA 1G83A 1X6GA 2KRMA 5GJWB 2FEIA 1V1CA 3EHRA 2HCKA 4F14A 1JQQA 2HBWA 1W1FA 3EG3A 2GTOA 2L0AA 4LN2A 1X69A 2CH4A 4RUGA 1E7OA 1WI7A 1UG1A 2AK5A 2LP5A 2J6OA 2I0NA 2GTJA 1IO6A 2NUZA 3H0FA 1OV3A 2KNBB 2B86A 2AZSA 1W6XA 3NPFA 1EFNA 2ROTA 2SRCA 4EIKA 1CSKA 2RQRA 3SHWA 1QCFA 3UF4A 5FWCA 2CDTA 2O9SA 2QDLA 4FSSA 2RNAA 2EKHA 4HCKA 2MCNA 4F16A 1N5ZA 3PE0A 1K1ZA 2RQUA 4RTUA 1VYUA 1AVZC 1AWJA 4ZNXA 5ECAA 1YWOA 1FYNA 3EG2A 4CC4B 3VS4A 3JV3A 2EGAA 1UJ0A 4IIOA 2DLPA 4AFSC 1TUCA 5FWBA 2YUQA 1UDLA 2LJ1A 2AKLA 2O9VA 1U06A 1AZEA 2PTKA 4DEYA 2CT3A 2KRSA 1CKBA 3PVQA 3REBB 1GBRA 1WDXA 3CQTA 2RQTA 2LMJA 3KFVA 2KR3A 1UECA 2KRNA 3VS2A 2F2WA 1I1JA 2O88A 3VRYA 2D1XA 3EGUA 1Y0MA 1M3CA 4LE9A 1M30A 2K2MA 3I5SA 2ROLA 2GQIA 3VS6A 2LQWA 3ZL7C 2ECZA 1NG2A 4JJCA 2DE0X 4J9CA 1PRLC 2EGEA 3IQLA 1NLOC 1GCQC 3ULRB 3PVLA 1SPKA 2H8HA 2FG0A 2JMCA 1KJWA 2J7IA 1QWFA 1UHCA 4DEXA 1RI9A 2C0OA 2KXCA 2OI3A 2JS0A 1GCQA 2YDLA 2CSIA 4AFQC 3H41A 1M27C 1ZUKA 1FMKA 2K6DA 1WXUA 4RTWA 1B07A 1S1NA 1YNZA 1Z9ZA 1GFDA 2CSQA 5IH2A 2EVRA 2JT4A 1TUDA 3TSZA 4HVVA 2DMOA 3FJ5A 2DBKA 1ZUYA 2FRWA 1BK2A 4X1VA 2M51A 2V1RA 5IHKA 2VKNA 3M0QA 2LCSA 2JMAA 4JJDA 1T3LA 3I9QA 1WIEA 2DVJA 1WA7A 1BU1A 1VYTA 2CREA 4J9HA 1GRIA 4QT7A 4ORZA 1ABQA 2YT6A 1B3QA 1ZBJA 4OMPA 2EBPA 2YUPA 3VRZA 2L3SA 3M0RA 1WFWA 1RLPC 5L23A 1K0XA 2G6FX 1GBQA 2O31A 2EGCA 2V1QA 1E6HA 2KT8A 3C0CA 4M4ZA 4OMLA 1UGVA 2XMFA 2LX7A 2DL3A 4CC2A 2YUNA 1RUWA 1Y57A 2RQVA 3I5RA 2K3BA 1SEMA 2EQIA 1T3SA 1CKAA 2KT1A 2A36A 2KYMA 2HSPA 1AEYA 1AWXA 1U3OA 2D8JA 3NMZC 1H92A 2KXDA 2RQWA 2J05A 2KEAA 2JM8A 4OMOA 1SSHA 1KSWA 1LCKA 1NYGA 2GNCA 2K7AA 1E6GA 1K9AA 2EYXA 1WYXA 2FPFA 2W0ZA 4OMQA 3REAB 2FO0A 2J06A 3QWYA 1T0HA 2PNIA 1T0JA 2L3PA 4LUEA 2JXBA 1K0SA 1JU5C 2RPNA 4JZ3A 4OMNA 1PRMC 2A28A 1AOJA 2A37A 3QWXX 1WXTA 3A98A 2DA9A 5IHIA 3NHNA 1WX6A 2VVKA 2FPDA 2YUOA 2DNUA 1GL5A 4J9IA 1JEGA 4HVWA 1K76A 2FPEA 1PWTA 4Z89A 2AZVA 2P4RA 4RTVA 1XOVA 3THKA 3H0IA 1H8KA 4J9DA 2KGTA 1JO8A 4GLMA 2OAWA 2BZ8A 1MV3A 1YCSB 4AG1C 1MUZA 2ABLA 1M8MA 2C0TA 2EYYA 2RMOA 2D8HA 1JXMA 1PNJA 4Y92A 4F17A 2ESWA 2JW4A 2K9GA 2KROA 1Z9QA 4RTTA 2HDAA 3RNJA 4JJBA 2DF6A 2AKKA 4J9BA 1W70A 2HEQA 2C0IA 1TG0A 3VS0A 3RBBB 5I22A 2DBMA 2F2XA 3TVTA 1ZSGA 1RLQC 3EG1A 1UTIA 1YWPA 5IXFA 4J9GA 1WLPB 2GBQA 1A0NB 3LH5A 3UA6A 2MIOA 5IHNA 5I11A 2SEMA 2OJ2A 1HSQA 3M0TA 1SRMA 3NGPA 1QKWA 1SRLA 2LJ0A 1OEBA 1SHFA 2CUBA 3UATA 5GJVB 2K79A 1H3HA 1I07A 1J3TA 1ZLMA 4IIMA 5FW9A 3U23A 2CT4A 4HVUA 2JTEA 2X3XD 1ZX6A 3R6NA 2GGRA 5EC7A 2PZ1A 3VS5A 2LJ3A 4JPBW 2KYBA 1M3BA 1UHFA 2RN8A 1NLPC 2X3WD 3M0UA 3M0SA 1QKXA 1NYFA 1WXBA 3I35A 5HCKA 1NEBA 4K11A 1ARKA 1GFCA 4RTXA 3SEMA 2BZXA 2EYZA 1UUEA 2EYWA 2DYBA 2IIMA 4R0KA 3H0HA 2NWMA 2E5KA 2DRMA 2J6FA 2CUDA 3VS1A 4GBQA 2D0NA 2LNHB 2VWFA 2LZ6B 2J6KA 4CC7A 2L3QA 1SHGA 2BTTA 1KFZA 4AFUC 4J9FA 1X2QA 2M0YA 4RTYA 4Z8AA 4J9EA 2F2VA 1AWWA 4D8DA 4ESRA 3M0PA 1AZGB 2ED1A 2YSQA 1OPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ED0 A;  4AG2 C;  2KBT A;  1NEG A;  4JZ4 A;  1PKS A;  1NM7 A;  2DM1 A;  2EPD A;  2W10 A;  2A08 A;  2L2P A;  2JS2 A;  4E6R A;  1UJY A;  2O2O A;  4HXJ A;  3VS7 A;  1ABO A;  1GCP A;  4RTZ A;  2MOX A;  1PKT A;  1UFF A;  2DIL A;  3EHQ A;  4LUD A;  1MV0 B;  1VYV A;  2CH4 W;  3GBQ A;  1K4U S;  2BZY A;  1OPL A;  2DL4 A;  2DRK A;  3TSW A;  1HD3 A;  1BB9 A;  1AD5 A;  1YN8 A;  4CC3 A;  1BBZ A;  3O5Z A;  4WCI A;  4A63 B;  1QWE A;  5IXB A;  1I0C A;  1PHT A;  3EG0 A;  3UA7 A;  4Z88 A;  2DX1 A;  2RF0 A;  2EW3 A;  1VA7 A;  1UE9 A;  2DL8 A;  3VS3 A;  2KE9 A;  1ZUU A;  1G2B A;  1YP5 A;  2DL5 A;  2JM9 A;  1X43 A;  2LQN A;  1QLY A;  4OMM A;  4LNP A;  1OOT A;  2FRY A;  2DL7 A;  1M3A A;  1X6B A;  2ENM A;  4AFZ C;  4D8K A;  1AWO A;  1KIK A;  4KRT A;  1X2K A;  1JXO A;  1X27 A;  1HJD A;  1U5S A;  2DJQ A;  1G83 A;  1X6G A;  2KRM A;  5GJW B;  2FEI A;  1V1C A;  3EHR A;  2HCK A;  4F14 A;  1JQQ A;  2HBW A;  1W1F A;  3EG3 A;  2GTO A;  2L0A A;  4LN2 A;  1X69 A;  2CH4 A;  4RUG A;  1E7O A;  1WI7 A;  1UG1 A;  2AK5 A;  2LP5 A;  2J6O A;  2I0N A;  2GTJ A;  1IO6 A;  2NUZ A;  3H0F A;  1OV3 A;  2KNB B;  2B86 A;  2AZS A;  1W6X A;  3NPF A;  1EFN A;  2ROT A;  2SRC A;  4EIK A;  1CSK A;  2RQR A;  3SHW A;  1QCF A;  3UF4 A;  5FWC A;  2CDT A;  2O9S A;  2QDL A;  4FSS A;  2RNA A;  2EKH A;  4HCK A;  2MCN A;  4F16 A;  1N5Z A;  3PE0 A;  1K1Z A;  2RQU A;  4RTU A;  1VYU A;  1AVZ C;  1AWJ A;  4ZNX A;  5ECA A;  1YWO A;  1FYN A;  3EG2 A;  4CC4 B;  3VS4 A;  3JV3 A;  2EGA A;  1UJ0 A;  4IIO A;  2DLP A;  4AFS C;  1TUC A;  5FWB A;  2YUQ A;  1UDL A;  2LJ1 A;  2AKL A;  2O9V A;  1U06 A;  1AZE A;  2PTK A;  4DEY A;  2CT3 A;  2KRS A;  1CKB A;  3PVQ A;  3REB B;  1GBR A;  1WDX A;  3CQT A;  2RQT A;  2LMJ A;  3KFV A;  2KR3 A;  1UEC A;  2KRN A;  3VS2 A;  2F2W A;  1I1J A;  2O88 A;  3VRY A;  2D1X A;  3EGU A;  1Y0M A;  1M3C A;  4LE9 A;  1M30 A;  2K2M A;  3I5S A;  2ROL A;  2GQI A;  3VS6 A;  2LQW A;  3ZL7 C;  2ECZ A;  1NG2 A;  4JJC A;  2DE0 X;  4J9C A;  1PRL C;  2EGE A;  3IQL A;  1NLO C;  1GCQ C;  3ULR B;  3PVL A;  1SPK A;  2H8H A;  2FG0 A;  2JMC A;  1KJW A;  2J7I A;  1QWF A;  1UHC A;  4DEX A;  1RI9 A;  2C0O A;  2KXC A;  2OI3 A;  2JS0 A;  1GCQ A;  2YDL A;  2CSI A;  4AFQ C;  3H41 A;  1M27 C;  1ZUK A;  1FMK A;  2K6D A;  1WXU A;  4RTW A;  1B07 A;  1S1N A;  1YNZ A;  1Z9Z A;  1GFD A;  2CSQ A;  5IH2 A;  2EVR A;  2JT4 A;  1TUD A;  3TSZ A;  4HVV A;  2DMO A;  3FJ5 A;  2DBK A;  1ZUY A;  2FRW A;  1BK2 A;  4X1V A;  2M51 A;  2V1R A;  5IHK A;  2VKN A;  3M0Q A;  2LCS A;  2JMA A;  4JJD A;  1T3L A;  3I9Q A;  1WIE A;  2DVJ A;  1WA7 A;  1BU1 A;  1VYT A;  2CRE A;  4J9H A;  1GRI A;  4QT7 A;  4ORZ A;  1ABQ A;  2YT6 A;  1B3Q A;  1ZBJ A;  4OMP A;  2EBP A;  2YUP A;  3VRZ A;  2L3S A;  3M0R A;  1WFW A;  1RLP C;  5L23 A;  1K0X A;  2G6F X;  1GBQ A;  2O31 A;  2EGC A;  2V1Q A;  1E6H A;  2KT8 A;  3C0C A;  4M4Z A;  4OML A;  1UGV A;  2XMF A;  2LX7 A;  2DL3 A;  4CC2 A;  2YUN A;  1RUW A;  1Y57 A;  2RQV A;  3I5R A;  2K3B A;  1SEM A;  2EQI A;  1T3S A;  1CKA A;  2KT1 A;  2A36 A;  2KYM A;  2HSP A;  1AEY A;  1AWX A;  1U3O A;  2D8J A;  3NMZ C;  1H92 A;  2KXD A;  2RQW A;  2J05 A;  2KEA A;  2JM8 A;  4OMO A;  1SSH A;  1KSW A;  1LCK A;  1NYG A;  2GNC A;  2K7A A;  1E6G A;  1K9A A;  2EYX A;  1WYX A;  2FPF A;  2W0Z A;  4OMQ A;  3REA B;  2FO0 A;  2J06 A;  3QWY A;  1T0H A;  2PNI A;  1T0J A;  2L3P A;  4LUE A;  2JXB A;  1K0S A;  1JU5 C;  2RPN A;  4JZ3 A;  4OMN A;  1PRM C;  2A28 A;  1AOJ A;  2A37 A;  3QWX X;  1WXT A;  3A98 A;  2DA9 A;  5IHI A;  3NHN A;  1WX6 A;  2VVK A;  2FPD A;  2YUO A;  2DNU A;  1GL5 A;  4J9I A;  1JEG A;  4HVW A;  1K76 A;  2FPE A;  1PWT A;  4Z89 A;  2AZV A;  2P4R A;  4RTV A;  1XOV A;  3THK A;  3H0I A;  1H8K A;  4J9D A;  2KGT A;  1JO8 A;  4GLM A;  2OAW A;  2BZ8 A;  1MV3 A;  1YCS B;  4AG1 C;  1MUZ A;  2ABL A;  1M8M A;  2C0T A;  2EYY A;  2RMO A;  2D8H A;  1JXM A;  1PNJ A;  4Y92 A;  4F17 A;  2ESW A;  2JW4 A;  2K9G A;  2KRO A;  1Z9Q A;  4RTT A;  2HDA A;  3RNJ A;  4JJB A;  2DF6 A;  2AKK A;  4J9B A;  1W70 A;  2HEQ A;  2C0I A;  1TG0 A;  3VS0 A;  3RBB B;  5I22 A;  2DBM A;  2F2X A;  3TVT A;  1ZSG A;  1RLQ C;  3EG1 A;  1UTI A;  1YWP A;  5IXF A;  4J9G A;  1WLP B;  2GBQ A;  1A0N B;  3LH5 A;  3UA6 A;  2MIO A;  5IHN A;  5I11 A;  2SEM A;  2OJ2 A;  1HSQ A;  3M0T A;  1SRM A;  3NGP A;  1QKW A;  1SRL A;  2LJ0 A;  1OEB A;  1SHF A;  2CUB A;  3UAT A;  5GJV B;  2K79 A;  1H3H A;  1I07 A;  1J3T A;  1ZLM A;  4IIM A;  5FW9 A;  3U23 A;  2CT4 A;  4HVU A;  2JTE A;  2X3X D;  1ZX6 A;  3R6N A;  2GGR A;  5EC7 A;  2PZ1 A;  3VS5 A;  2LJ3 A;  4JPB W;  2KYB A;  1M3B A;  1UHF A;  2RN8 A;  1NLP C;  2X3W D;  3M0U A;  3M0S A;  1QKX A;  1NYF A;  1WXB A;  3I35 A;  5HCK A;  1NEB A;  4K11 A;  1ARK A;  1GFC A;  4RTX A;  3SEM A;  2BZX A;  2EYZ A;  1UUE A;  2EYW A;  2DYB A;  2IIM A;  4R0K A;  3H0H A;  2NWM A;  2E5K A;  2DRM A;  2J6F A;  2CUD A;  3VS1 A;  4GBQ A;  2D0N A;  2LNH B;  2VWF A;  2LZ6 B;  2J6K A;  4CC7 A;  2L3Q A;  1SHG A;  2BTT A;  1KFZ A;  4AFU C;  4J9F A;  1X2Q A;  2M0Y A;  4RTY A;  4Z8A A;  4J9E A;  2F2V A;  1AWW A;  4D8D A;  4ESR A;  3M0P A;  1AZG B;  2ED1 A;  2YSQ A;  1OPK A; 
#chains in the Genus database with same CATH topology
 2ED0 A;  1VIF A;  4AG2 C;  2MAM A;  3JB9 J;  3JCM Q;  4N4H A;  4JRP A;  4BDZ A;  2Z0W A;  1TOV A;  4HXJ A;  1ZA2 B;  5CKE A;  2O4X A;  4PNO A;  2RJE A;  4M75 D;  1K73 R;  2RA2 A;  1W2B S;  1IGU A;  3L42 A;  4DOW A;  2DZ9 A;  4LUD A;  1KQS P;  4A4E A;  3BY7 A;  4VUB A;  3MEA A;  1D09 B;  5GAN 4;  2K5L A;  3CEY A;  3JCM h;  1KC8 C;  4N0A C;  3EAE A;  1MGQ A;  4PJO D;  3CXC P;  4CC3 A;  3O5Z A;  4A63 B;  2CP7 A;  3VKI A;  3UA7 A;  2DX1 A;  5GAM f;  3QDF A;  2YWW A;  3PIO A;  2RJF A;  1ZA1 B;  2IG0 A;  2P0Q A;  2CKK A;  1JJ2 P;  1RAE B;  4IUU A;  1X43 A;  2LC4 A;  2LQN A;  1QLY A;  3CD6 Q;  3P8B B;  3PIP A;  2K3Y A;  1M3A A;  3CPW P;  3CD6 A;  1D0Z A;  2H3E B;  5CKD A;  3GOX A;  4D8K A;  1X2K A;  3VV0 A;  4OGE A;  3G4S Q;  3OW2 P;  4M75 B;  3LWH A;  3G4S A;  5GJW B;  1YIJ T;  1C0M A;  3EFR A;  2HCK A;  4F14 A;  2JNG A;  2HBW A;  1W1F A;  2GTO A;  2DPP B;  1HK9 A;  1WI7 A;  3FEO A;  1UG1 A;  4FCY A;  3L2Q A;  2J6O A;  1SF9 A;  5LJ5 j;  4M7A F;  4OGC A;  1CSK A;  4LD6 A;  1QCF A;  1MHN A;  2X35 A;  2QDL A;  4FSS A;  3E19 A;  2RNA A;  2EKH A;  3QBY A;  1VYU A;  4C8Q C;  1AVZ C;  2K2V A;  4PL6 A;  2EIF A;  4BY6 B;  4GY5 A;  1YWO A;  4LDY A;  3EG2 A;  3GIB A;  2EWN A;  4NOY A;  3VS4 A;  2V26 A;  3JV3 A;  2HZY A;  4C0Z A;  2DLP A;  1VQ6 T;  2AHJ B;  2CGH A;  2DET A;  4KBM B;  3HFN A;  3KBG A;  2YHT A;  1VQO T;  1BCM A;  3CQT A;  3VUB A;  1D1A A;  1YIT Q;  2LMJ A;  1NE8 A;  2AT1 B;  5LJ3 d;  5CVI A;  3JCM e;  2KRN A;  1I1J A;  1YIT A;  4Z02 A;  3EGU A;  3QKJ A;  1Y0M A;  1OZ2 A;  3G6E Q;  2DKG A;  2JVV A;  2RB6 A;  4XTX A;  3QJ6 A;  4BI3 A;  3G6E A;  1NG2 A;  2DE0 X;  5KYW B;  1PRL C;  2Y90 A;  3KXT A;  1QVF P;  2H8H A;  3AT1 B;  3CCS Q;  1KG1 A;  1QWF A;  2J7I A;  4DEX A;  4E7L A;  2KXC A;  3S3M A;  1N27 A;  3CCS A;  2EJG A;  4QQG A;  4MDW A;  2QQA A;  1Q82 C;  3CCM T;  2M0O A;  4C92 E;  1FMK A;  1WXU A;  5KYN A;  1PG5 B;  1PC0 A;  4QVC A;  2DZC A;  2CSQ A;  4BI8 B;  2EVR A;  4C8Q G;  1YIJ Q;  1YJ9 Q;  1Q7Y C;  1ZUY A;  3FIF A;  2ZGW A;  3OYH A;  4A53 A;  1YI2 Q;  3URG A;  1YIJ A;  3FLG A;  1YJ9 A;  1VQ5 Q;  4EMG A;  4A4F A;  1YI2 A;  1VQ5 A;  1Q86 R;  1BI1 A;  4J9H A;  4M77 C;  4QT7 A;  2YT6 A;  2QEX T;  1ZBJ A;  5KYX A;  4OMP A;  3VRZ A;  3C95 A;  3WVD B;  1D0Y A;  3LX7 A;  3GP8 A;  2IVW A;  4MZM A;  1WZO A;  4M7A A;  4M7A E;  2K57 A;  2G6F X;  3V8K A;  2O31 A;  2E6N A;  3E1S A;  2HQH A;  3J7A F;  3HL8 A;  3M55 A;  1NJI R;  2XU8 A;  2DL3 A;  2QG9 B;  3T9N A;  4C0D C;  1Y57 A;  3JSC A;  2RQV A;  1VQ6 Q;  2K3B A;  2IPO B;  5FU7 C;  4C5G A;  4DBF A;  1VQ6 A;  2KT1 A;  3EGD B;  2HSP A;  5CR2 A;  1AEY A;  3NMZ C;  1WHK A;  2HSE B;  2RHI A;  3GF5 A;  3QXE B;  4IUT A;  3C4S A;  3MKD A;  4M78 C;  2LQK A;  2RQW A;  3N5B B;  2JM8 A;  1NZ9 A;  2E6Z A;  5FRM A;  1NYG A;  2GNC A;  1IZ6 A;  2F5K A;  1Q81 R;  3G71 T;  4F7U B;  1Y96 A;  4OMQ A;  2FO0 A;  4LDU A;  1PSF A;  3JCM f;  4M77 G;  1VQP T;  4LUE A;  1D0X A;  2JXB A;  4BB7 A;  1PRM C;  4OMF B;  4MDX A;  2A28 A;  5LL6 S;  2DA9 A;  3EFS A;  2C06 A;  3NHN A;  2VVK A;  2GFU A;  2FPD A;  2RHY A;  3MCA B;  3RKY A;  3OBW A;  1YJN Q;  3AHU A;  5KCO A;  1JEG A;  4XU2 A;  1OX8 A;  2LT4 A;  4Z89 A;  1XOV A;  1YJN A;  8ATC B;  3H0I A;  1H8K A;  4PK4 A;  4XU0 A;  4HCZ A;  5GMK j;  2F5T X;  2HKN A;  1IRE B;  2EFI A;  2MPX C;  2OAW A;  2BZ8 A;  2QEX Q;  4OB0 B;  1F1B B;  4JRI A;  4ELY C;  4M7D C;  2QEX A;  4F17 A;  2JW4 A;  4EPC A;  2KRO A;  3JB9 F;  4JJB A;  4M78 G;  2EJF A;  2HEQ A;  2CS7 A;  3VS0 A;  3EH1 A;  5I22 A;  2DBM A;  3FC3 A;  2DER A;  2E41 A;  2LNV A;  4XK8 E;  1M9S A;  1WLP B;  1A0N B;  2CP0 A;  1OU9 A;  3M9Q A;  3MPU B;  3NGP A;  2OTJ T;  1SRL A;  3VYG A;  1I8F A;  2E3H A;  1BIB A;  3UAT A;  2LDM A;  3PFS A;  2K79 A;  5FRO A;  2DIG A;  1J3T A;  5FW9 A;  3MEV A;  1I81 A;  2NLU A;  4HVU A;  2XDB A;  2GGR A;  5EC7 A;  3RKX A;  5LJ3 j;  1M2O A;  4FT4 A;  3S3N A;  2X3W D;  4ZGJ B;  1U1S A;  4JLG A;  1LJO A;  1WGS A;  1EIF A;  1NYF A;  3I35 A;  5HCK A;  3G71 Q;  4K11 A;  1ARK A;  1Q86 U;  4RTX A;  2BZX A;  3A8L B;  4R0K A;  3G71 A;  3H0H A;  3X20 B;  1O75 A;  2NWM A;  1VQP Q;  2RHU A;  2DYI A;  4GBQ A;  2A7Y A;  2JOY A;  2LCL A;  1VQP A;  4M7D G;  2O4X B;  5HK3 A;  2KDS A;  1KFZ A;  4J9F A;  3DLM A;  1X2Q A;  2COW A;  2M0Y A;  2E4H A;  3L2U A;  4J9E A;  1VQ4 A;  4ESR A;  1AZG B;  2ED1 A;  5J3B A;  1NJI U;  1XTD A;  2ZPB B;  4EMK A;  2XDP A;  5KYY A;  1Y71 A;  1W2B A;  2KBT A;  4PJO C;  3JB9 I;  3M4Y A;  1KD1 R;  3G1J A;  2JS2 A;  4E6R A;  1UJY A;  2O2O A;  2JTM A;  1YJW T;  2FHD A;  4XTY A;  2QQR A;  4N4I A;  2K5I A;  1OX9 A;  1ABO A;  5FRN A;  2DVE A;  1NBE B;  4RTZ A;  2MOX A;  3ME9 A;  2VYT A;  2DIL A;  3EHQ A;  1MV0 B;  5GMK h;  4BAC A;  1M1F A;  1VQN Q;  1HXD A;  2CH4 W;  1Q81 U;  1VQN A;  2BZY A;  3FRN A;  2XG8 D;  2DRK A;  1HD3 A;  4O5V A;  1BBZ A;  1QWE A;  1I0C A;  2OTJ Q;  2HMA A;  4TVR A;  3RIR A;  1XNI A;  1QVG S;  5KYU B;  2EAY A;  4FL6 A;  5I2M A;  2OTJ A;  3NTK A;  3VS3 A;  2BE7 D;  5KH6 A;  2KE9 A;  2GFA A;  2XI9 A;  3BDL A;  5GAM g;  1G2B A;  2L5Q A;  4E7K A;  2DTI A;  5HKC A;  4OMM A;  2E64 A;  3L1A A;  3I55 T;  2FRY A;  5IT9 E;  3HRT A;  2DL7 A;  3H8Z A;  2HQX A;  3UDC A;  3OYM A;  2P84 A;  4PJO G;  1AWO A;  4XTZ A;  1KC8 R;  2M9U A;  3PMT A;  5FU6 B;  1BCO A;  2QI2 A;  1IGQ A;  9ATC B;  1JXO A;  1Y7X A;  3SWN A;  1BI3 A;  1XJW B;  3CCL Q;  1V1C A;  2V8J A;  3CCL A;  3EG3 A;  2L0A A;  4LN2 A;  2Y4X A;  1PD1 A;  2CH4 A;  1R0B G;  5CKF A;  3LH0 A;  2AK5 A;  3JCM V;  4R55 A;  2GTJ A;  3H0F A;  2ZZD A;  2KI7 A;  1OV3 A;  2KNB B;  2DTO A;  4XAX B;  3NPF A;  3SDZ A;  2QQS A;  4HKE A;  5CK9 A;  2SRC A;  3UF4 A;  2GF7 A;  3KUF A;  5FWC A;  2CDT A;  3TU4 K;  4R56 A;  3OYJ A;  1YJW Q;  4F16 A;  1N5Z A;  2DK3 A;  4AT1 B;  4M7A D;  4ZNX A;  1VQM T;  5ECA A;  1YJW A;  3CCV T;  2YRV A;  1M90 R;  4CC4 B;  3DB3 A;  3NTH A;  5DLQ E;  4C8Q E;  3HPW A;  1UJ0 A;  4FM4 B;  1VQ9 T;  2OTL T;  5FWB A;  5I2S A;  2AKL A;  1AZE A;  4DEY A;  5GMK e;  2EYQ A;  3PVQ A;  2KRS A;  2LX9 A;  3REB B;  3L2R A;  3R6O A;  1WDX A;  1XQH A;  4C92 B;  3KFV A;  1WHL A;  2EJ9 A;  5GAM d;  2AIR B;  3VRY A;  5GAN 2;  1RAB B;  1M30 A;  3M58 A;  4B9X A;  3I5S A;  2GQI A;  2XK0 A;  2VV5 A;  3NTI A;  2ECZ A;  4JJC A;  2RJD A;  4J9C A;  3QII A;  4Q5W A;  3OYE A;  1NLO C;  1GCQ C;  3HKS A;  3I55 Q;  3ULR B;  1N6A A;  2BKD N;  2JMC A;  3CXC S;  2P0K A;  1UGS B;  1KJW A;  3OS5 A;  5KYX B;  3I55 A;  2XD0 A;  2C0O A;  3BDU A;  1RAI B;  3MP8 A;  4AFQ C;  3S6W A;  4DBR A;  2KAF A;  4RTW A;  1PD0 A;  3RUX A;  4M7A B;  2MWO A;  1JJ2 S;  5C0M A;  2NYS A;  1KK7 A;  4HVV A;  3FJ5 A;  4C92 F;  2M02 A;  4J83 A;  4X1V A;  4E7J A;  2VKN A;  2QGG A;  3CPW S;  5GAN h;  1K8A U;  4IUV A;  3PGG A;  1WA7 A;  4ELZ C;  1GRI A;  4ZN3 A;  1B3Q A;  4CRI A;  4M7D F;  1FX7 A;  3OW2 S;  2R58 A;  4JUV A;  5KYU A;  1G5V A;  2FYK A;  1N8R U;  2R5M A;  1Q95 G;  4NL3 A;  2L3S A;  3M0R A;  4M77 E;  1WFW A;  1Q82 R;  1W4S A;  4IKF A;  4X34 A;  3CME T;  1U8R A;  2YLB A;  1NPR A;  4Y91 A;  2V1Q A;  3CCV Q;  1E6H A;  4ZTF A;  1TTH B;  1X6O A;  1Q7Y R;  1UGV A;  4B9W A;  4KGZ B;  2YUN A;  3CCV A;  1Y96 B;  1TSF A;  2HBP A;  2EQI A;  4JRK A;  2VXE A;  2K3X A;  2KYM A;  2NUP A;  5CKB A;  1KC8 U;  1FMW A;  1KQ2 A;  2PVO B;  4A4G A;  2KXD A;  2HNI A;  2J05 A;  4OVA A;  1G3Y A;  4OMO A;  3VYH B;  1SSH A;  5GAO p;  3TEE A;  2G3R A;  1UB4 A;  2KVQ G;  4M78 E;  2DO3 A;  2ZCF B;  3CC4 T;  1K9A A;  1ACM B;  2QDY B;  4E7S A;  1ZSZ C;  2VGM A;  4XTU A;  4MZT A;  4YTL A;  3REA B;  2J06 A;  4QVZ A;  2RD1 A;  4LDW A;  1T0J A;  3Q1J A;  2YLC A;  1JU5 C;  4JZ3 A;  3JCM g;  1HYO A;  3EFO A;  1G3T A;  2E12 A;  3ASK A;  4EDU A;  4RKU E;  4XU3 A;  2JTF A;  3VU3 C;  3BE3 A;  1GL5 A;  1QVF S;  1M90 U;  1IXD A;  5A0G A;  4RTV A;  3JCM P;  4P5N A;  5GMK m;  2CZ1 B;  4C92 A;  1N9R A;  1YCS B;  5GAN e;  2ABL A;  1SG5 A;  2K4Y A;  1GXI E;  1BIA A;  2RMO A;  1JXM A;  1K73 U;  4Y92 A;  4RTT A;  4IUR A;  3MEU A;  3C12 A;  3CME Q;  1W70 A;  3M59 A;  4M7D A;  4M7D E;  2C0I A;  4Y28 E;  3WVE B;  3M4G A;  3RBB B;  1WJQ A;  3CME A;  2QTX A;  3TVT A;  5IXF A;  3JB9 D;  3LH5 A;  3M53 A;  5IHN A;  3SD4 A;  1QCN A;  3M0T A;  1QKW A;  1BI0 A;  1B7T A;  1V76 A;  3CCE T;  3FDR A;  3FB9 A;  3VJP A;  2XKO C;  2CUB A;  5GJV B;  2QK0 A;  3M5A A;  3SB2 A;  1H3H A;  1B34 B;  5GAO r;  5LJ5 h;  2JTE A;  1ZX6 A;  3VS5 A;  1K9M C;  2KYB A;  2RN8 A;  1UHF A;  1NLP C;  1N9S A;  2NUT B;  1WXB A;  4EMK B;  5KYY B;  4KH0 B;  4FW1 A;  1VQO Q;  3LGL A;  3JCM d;  5FU6 C;  1UGQ B;  2KY9 A;  1VQO A;  2F1L A;  2X9H A;  2J6F A;  2KMT A;  2EQM A;  3VS1 A;  3JRZ A;  2LNH B;  2VUB A;  2LZ6 B;  4CC7 A;  3HFO A;  3L2V A;  2L3Q A;  3CCU T;  1SHG A;  2BTT A;  2DXC A;  4RTY A;  4BUG A;  5GAO q;  3M0P A;  2HAX A;  2QAZ A;  4JLI A;  2LRQ A;  1WNL A;  3G7Z A;  1Q7Y U;  4QKU A;  2QAS A;  2QQ9 A;  5GAO m;  3OYD A;  1M1K R;  1MNE A;  1NEG A;  2OX7 A;  4JZ4 A;  4J8O A;  1NM7 A;  2EPD A;  2W10 A;  3OYL A;  3CCM Q;  2L2P A;  1D1B A;  5I21 A;  4PJO E;  1TU0 B;  4E7Z A;  4ZN1 A;  3CCM A;  1PSE A;  2MI6 A;  4ANJ A;  2K5F A;  2PU9 B;  1P92 A;  1UFF A;  4XTW A;  2X4J A;  2CP6 A;  3I56 T;  3CC2 T;  2ZAE A;  1VYV A;  1QVG A;  3GBQ A;  4PLI A;  5GAN f;  4PFO A;  2DL4 A;  3TSW A;  2E10 A;  1QP3 A;  4E2F B;  1AD5 A;  4C0F A;  3QDR B;  1YN8 A;  1OYX A;  4PJM A;  4WCI A;  5IXB A;  1PHT A;  3GLX A;  4OP0 A;  3SWN B;  4ZGE B;  2RF0 A;  1EZZ B;  5AT1 B;  2EW3 A;  1IRX A;  1VA7 A;  1UE9 A;  2DL8 A;  4KUI A;  2DFU A;  3CMA T;  1YP5 A;  2JM9 A;  2EQU A;  4ATO A;  4MML A;  4NL2 A;  3HSB A;  4LNP A;  1Y07 A;  3HRS A;  4PLL A;  5LJ5 e;  1DJ7 B;  1H64 1;  1YHQ T;  2ENM A;  2L89 A;  2DXT A;  1S72 T;  4AFZ C;  1RAD B;  1KIK A;  5LJ5 g;  4KRT A;  1OZ3 A;  1OI1 A;  4KGX B;  1MMA A;  3D7S B;  4WTO B;  1YBY A;  1VQ8 T;  1HJD A;  2DJQ A;  1G83 A;  1X6G A;  5GMK l;  4E7H A;  2KRM A;  1UEB A;  2CYZ B;  3A5Z B;  1RI0 A;  3OSS C;  3GPL A;  3WXM B;  4RUG A;  3OQ5 A;  1E7O A;  4O6J A;  3EG9 A;  3L2W A;  2LP5 A;  2NUZ A;  1IO6 A;  3INZ A;  4BE2 A;  1KHC A;  4J5Y A;  2FZK B;  1EFN A;  3JCM b;  3MP1 A;  5D7U A;  3SHW A;  2RQR A;  5CCA A;  4M75 C;  2RHX A;  4J6X A;  1B34 A;  4BE1 A;  4FYX B;  4HCK A;  3PE0 A;  5IN1 A;  4PKC C;  1K1Z A;  2RQU A;  4RTU A;  2WSF E;  2D0Q B;  1FYN A;  5M9O A;  5KE2 A;  2NUT A;  4QVD A;  4KGV B;  4ME7 A;  3I56 Q;  2EGA A;  3CC2 Q;  4IIO A;  4X9D A;  2HL3 A;  3LWI A;  1UDL A;  4PFZ A;  2D9T A;  1QMC A;  3X26 B;  4QQ6 A;  2O9V A;  3S3O A;  1KQS A;  1U06 A;  2PTK A;  2CT3 A;  1RAA B;  2XID A;  1O9S A;  3SFM A;  4C8Q F;  1GBR A;  1JRI A;  1RAG B;  3E9G A;  4V2S A;  1VQK T;  4A54 A;  1M2V B;  1UEC A;  2RJC A;  4BY6 C;  2DD5 A;  2O88 A;  1OU8 A;  3OS1 A;  8AT1 B;  3CXC A;  2B8A A;  1RAF B;  3CC7 T;  3OS0 A;  2K2M A;  2ROL A;  3CPF A;  3ER0 A;  3CMA Q;  3V7C A;  3VS6 A;  2LQW A;  5CQX A;  3ZL7 C;  1VQL T;  4E47 A;  5GAO n;  3CMA A;  2EGE A;  3IQL A;  3V7S A;  4DA4 A;  3V8J A;  3PVL A;  1JJ2 A;  1M1K U;  4N0A A;  1S72 Q;  3LGF A;  1RAC B;  1GCQ A;  2YDL A;  2CSI A;  4M75 G;  1S72 A;  3QHS A;  3CPW A;  1M27 C;  1WHH A;  2CP3 A;  3RER A;  3EGX A;  5GAO l;  1B07 A;  1S1N A;  3OSV A;  1YNZ A;  1Z9Z A;  2VXF A;  5GAN 7;  3VUZ A;  1LPL A;  5IH2 A;  3TSZ A;  5LJ5 f;  2DBK A;  1I5L A;  1BK2 A;  4OB2 B;  3OW2 A;  2M51 A;  2V1R A;  2BUD A;  2LCS A;  2JMA A;  4JJD A;  1T3L A;  4KT0 E;  3I9Q A;  1WIE A;  3CCQ T;  1RL2 A;  2ATC B;  3A8G B;  3HHT B;  3MET A;  4B6M A;  2CRE A;  1H3Z A;  4ORZ A;  1ABQ A;  2PUO B;  4C0D B;  2NUP B;  4C92 D;  2DJZ A;  2EBP A;  4LXC A;  5LJ3 h;  3ZFJ A;  5FU7 B;  1V29 B;  3MJX A;  3OYN A;  2RK2 A;  4D6W A;  2COY A;  1RLP C;  5HY6 A;  2RI2 A;  5CAI A;  3X28 B;  3DLL A;  4BDY A;  3TQ7 P;  1K0X A;  4M77 F;  4M7D D;  2O01 E;  1X75 C;  2EGC A;  4M78 B;  3PNW C;  2KT8 A;  4IUQ A;  2XMF A;  2LX7 A;  4HT8 A;  1RUW A;  4QW2 A;  3I5R A;  3CD6 T;  1SEM A;  4PJJ A;  1FXX A;  1IHV A;  2PUK B;  2DEU A;  1QVP A;  4C5I A;  4AMC A;  4C5H A;  3OB9 A;  1U3O A;  2D8J A;  2R5A A;  5CO7 A;  1M4Z A;  3EFO B;  2MYS A;  3G4S T;  2P0P A;  3E2U A;  2KEA A;  4OF1 A;  4X9C A;  1FMV A;  4C8Q A;  4ZTJ A;  2A0F B;  3CC7 Q;  3RES A;  4FIB A;  4J7F A;  1BYM A;  1WJS A;  4FYV B;  2EYX A;  1VQL Q;  1K8A C;  4EMK C;  2W0Z A;  3HP9 A;  2DIQ A;  1T0H A;  2QYZ A;  2PNI A;  4J6Y A;  4M78 F;  2DXB A;  2DEQ A;  1ZSZ A;  1D3B A;  3DKM A;  1QVF A;  2RI5 A;  1K0S A;  5DM7 R;  1N8R C;  1KQS S;  2X4W A;  4OMN A;  2A37 A;  1AOJ A;  3A8O B;  2FB7 A;  2FZC B;  2RK1 A;  1WXT A;  2PVG B;  4BD3 A;  3A98 A;  4M7D B;  2I2L A;  5EG2 A;  1WX6 A;  1W2B P;  4J9I A;  5CKH A;  2DAQ A;  2KK4 A;  3V7R A;  5GMK i;  2FPE A;  1PWT A;  2QQB A;  4E7I A;  1QCO A;  2ZPG B;  1G8X A;  3THK A;  2PVD B;  4J9D A;  2KGT A;  5IAY A;  1TH7 A;  1I4K 1;  1KD1 U;  3CCQ Q;  4PJN A;  1M2V A;  1MV3 A;  4J6W A;  4AG1 C;  3PMI A;  1MUZ A;  3CCQ A;  1M8M A;  2C0T A;  2EYY A;  2D8H A;  1PNJ A;  1PM3 A;  2ESW A;  2E65 A;  2K9G A;  1YIT T;  1Z9Q A;  4IUP A;  3TRE A;  3FJP A;  4DBQ A;  3RKW A;  3H6Z A;  5LJ3 e;  5C6S A;  2LQ8 A;  3G6E T;  2WSC E;  2E5Q A;  2F2X A;  1ZSG A;  5LJ3 g;  1RLQ C;  3RR6 A;  2V8I A;  4HA8 A;  4JDS A;  3CBP A;  2R57 A;  5I11 A;  2SEM A;  2OJ2 A;  1HSQ A;  2QXF A;  3BFM A;  4M77 A;  3CCS T;  1OUL A;  1SRM A;  2VAS A;  1U1T A;  4RMO A;  4RCB A;  1M1G A;  3SWN C;  1OEB A;  1SHF A;  4CI0 C;  2FVU A;  1I07 A;  4LDV A;  1VQM Q;  3CBM A;  1ZLM A;  4IIM A;  3U23 A;  2CT4 A;  1D1C A;  2X3X D;  4BI4 A;  4KUD K;  3OBY A;  2MK5 A;  1VQM A;  2DXU A;  1VQ9 Q;  2OTL Q;  1M3B A;  3MHX A;  4F7U G;  1YJ9 T;  2EQK A;  1M90 C;  2VB6 A;  3CBO A;  3M0U A;  3A8M B;  4L6V 5;  1VQ9 A;  1YI2 T;  2OTL A;  3OYA A;  3M0S A;  1QKX A;  3JB9 G;  1VQ5 T;  2CP5 A;  1GFC A;  1VIE A;  2DD4 A;  2EYZ A;  2DYB A;  2MMP A;  5J26 A;  6AT1 B;  2E5K A;  2DRM A;  4PJO B;  3JCM J;  1SSF A;  2CUD A;  5D6X A;  3OYB A;  2VWF A;  1K73 C;  2J6K A;  5L8R E;  3OMC A;  4AFU C;  4M78 A;  1BKB A;  4Z8A A;  3V8L A;  3JB9 H;  5GAN 3;  1AWW A;  4D8D A;  3E9F A;  5CQY A;  1K9M R;  2YSQ A;  1TWB A;  4M75 F;  2VC8 A;  1PKS A;  2DM1 A;  2A08 A;  2RHZ A;  3RDV A;  4UC4 A;  1MMD A;  3DB4 A;  4OB3 B;  3VS7 A;  1IHW A;  3HRU A;  1GCP A;  2GCX A;  1PKT A;  3PT9 A;  1LOJ A;  4PJO F;  3MP6 A;  1VQ7 T;  1MMG A;  3GNG A;  4HCC A;  5CIU A;  4FSX A;  2A3L A;  1K4U S;  2MF2 A;  1OPL A;  3QG1 A;  1BB9 A;  2WAC A;  5GAN g;  3EG0 A;  2LCC A;  5LJ3 f;  5A0D A;  4Z88 A;  1G3W A;  1R77 A;  7AT1 B;  2X4X A;  1WHJ A;  1ZUU A;  4J7I A;  2HL5 C;  2DL5 A;  4RG8 A;  3L2Z A;  5FLX E;  3PTA A;  4XU1 A;  1RAH B;  3EG9 B;  1YJN T;  1OOT A;  2LT1 A;  3QZ9 B;  1X6B A;  1EX4 A;  4FU6 A;  4WF2 A;  2F69 A;  3X25 B;  1X27 A;  2KSS A;  2ZPE B;  1U5S A;  5GAM j;  4NS5 A;  2FEI A;  3M54 A;  5GAN 6;  3EHR A;  1TXQ A;  1JQQ A;  3CC4 Q;  2JUF A;  2E1H A;  3ZBD A;  5J39 A;  1X69 A;  2QGF B;  4C5E A;  4JS4 A;  3CC4 A;  2I0N A;  2E70 A;  2B86 A;  2AZS A;  1W6X A;  2ROT A;  4EIK A;  1ZHI A;  1Q82 U;  2O9S A;  2MCN A;  4M75 A;  4M75 E;  1IB8 A;  2ZPF B;  1AWJ A;  1SKU B;  4FW2 A;  5D6Y A;  3UT1 A;  3OYK A;  1VQ7 Q;  3OMG A;  4AFS C;  1TUC A;  2YUQ A;  2YRC A;  2LJ1 A;  1VQ7 A;  1VOM A;  5GAN d;  3QO3 A;  1WJR A;  1WHG A;  3F70 A;  3QSU A;  4PJO A;  1R0C B;  1TS9 A;  1CKB A;  3EH2 A;  3M57 A;  2KQW A;  2E3I A;  5AYF A;  3OS2 A;  2RQT A;  4KUL A;  3EGX B;  3OY9 A;  2XHC A;  4DBH A;  2KR3 A;  3VS2 A;  1I5O B;  2F2W A;  1C1A A;  2D1X A;  2QTV A;  3OYF A;  1M3C A;  4LE9 A;  2ZPH B;  2CZ6 B;  3LYI A;  4C8Q D;  1VQ4 T;  2PQW A;  4FYY B;  3QUI A;  4XTV A;  2EKO A;  5GAN 5;  1Q86 C;  1MND A;  4MMK A;  1K9M U;  3CCJ T;  1FWZ A;  1SPK A;  2FG0 A;  4C92 C;  4JJN K;  1UHC A;  1RI9 A;  2OI3 A;  2ZPI B;  3CCE Q;  1WQ7 A;  2JS0 A;  3JAM E;  3C94 A;  3H41 A;  3CCE A;  3UPU A;  1ZUK A;  3X24 B;  2K6D A;  4RCC A;  4GLK A;  4F7U F;  2QA4 T;  5D6W A;  1GFD A;  4FT2 A;  2JT4 A;  1TUD A;  2DMO A;  1NJI C;  2FRW A;  5IHK A;  3M0Q A;  3GNF B;  2VGN A;  5KYW A;  1BI2 A;  5HK0 A;  3OYI A;  1VQN T;  3HTR A;  1OQK A;  4PJL A;  4A4H A;  2DVJ A;  1BU1 A;  1WQW A;  1VYT A;  3OYG A;  5GAM h;  4M7A C;  2YUP A;  3P8H A;  3CCU Q;  3CCU A;  3QYG B;  2DTH A;  2M16 A;  5L23 A;  4C8Q B;  1GBQ A;  1M8V A;  1Q81 C;  3MEW A;  1KHI A;  1X01 A;  3C0C A;  1AT1 B;  4M4Z A;  4OML A;  2X4Y A;  2FZG B;  4CC2 A;  4PFP A;  4KH1 B;  1M1K C;  1T3S A;  1ZSZ B;  1CKA A;  4C92 G;  1D3B B;  2RM4 A;  3P8D A;  4M77 D;  2A36 A;  3OYC A;  2HD0 A;  2LTO A;  5GAN 8;  2WSE E;  1AWX A;  3J81 E;  1H92 A;  1M5Q 1;  4II1 A;  2HQE A;  5A2Q E;  2L3R A;  1C6V X;  1YCY A;  3CCL T;  3A1P A;  2EQJ A;  1G3S A;  5A0L A;  1KSW A;  2OAU A;  1LCK A;  1VQ4 Q;  5DY9 A;  3I56 A;  2K7A A;  1E6G A;  2RO0 A;  3RMQ A;  3CC2 A;  5DLO A;  1WYX A;  2FPF A;  4DOV A;  3OYY A;  3RMS A;  2X51 A;  3QZ5 B;  4DQ2 A;  1MMN A;  3O8V A;  2YXY A;  3UWN A;  3CCJ Q;  3QWY A;  4MZP A;  3CCR T;  1ZQ1 A;  2JJ9 A;  2L3P A;  1WPY A;  2L8D A;  3CCJ A;  1JB0 E;  3EGD A;  4FYW B;  1QQJ A;  2RPN A;  4M7A G;  1TUG B;  3QWX X;  4N4G A;  5IHI A;  4M78 D;  2QA4 Q;  1LNX A;  2XDD A;  5LJ5 d;  2YUO A;  4RG2 A;  2DNU A;  4JRQ A;  3H9N A;  1WHM A;  4HVW A;  2QA4 A;  2Y4Y A;  1K76 A;  3ZEH A;  3QJY A;  2BE9 B;  4LD9 K;  2AZV A;  2P4R A;  2M1H A;  1YHQ Q;  5KCH A;  1JO8 A;  4F7U A;  4F7U E;  4GLM A;  4OB1 B;  1K8A R;  1AHJ B;  1YHQ A;  2LVM A;  4M77 B;  1YFN A;  1VUB A;  2V8K A;  2CZ0 B;  2CP2 A;  2HKQ B;  2JN0 A;  2RI3 A;  3J80 E;  1VQ8 Q;  4L5G A;  1UGP B;  4F04 B;  4L59 A;  4EMH A;  3M56 A;  1VQ8 A;  1N8R R;  1NPP A;  2CZ7 B;  3TCJ A;  3JCM X;  3A8H B;  2HDA A;  3RNJ A;  4QQD A;  2FL7 A;  5KE3 A;  3QYH B;  1QVG P;  2DF6 A;  2AKK A;  4XQ3 A;  4J9B A;  5GAM e;  3MO8 A;  1TG0 A;  2D6F A;  3EG1 A;  1UTI A;  1YWP A;  4J9G A;  1JBM A;  2GBQ A;  1KQ1 A;  3UA6 A;  2MIO A;  3JCM c;  1ZBX A;  2XIC A;  2LJ0 A;  2GQV A;  5GAN j;  4BE0 A;  3JCM W;  4ZGD B;  3R6N A;  2PZ1 A;  2RH2 A;  1QW1 A;  2LJ3 A;  4HCB A;  4JPB W;  1LVK A;  2COZ A;  2H3J A;  2BIV A;  2MWP A;  3LLR A;  1NEB A;  1KD1 C;  3QPH A;  3SEM A;  2EYW A;  1UUE A;  2IIM A;  4A4K A;  3CCR Q;  1VQK Q;  1R8O B;  1UGR B;  2P4T A;  3LW5 E;  3CCR A;  1VQK A;  2D0N A;  1QP2 A;  4JS5 A;  3OA6 A;  3BW1 A;  2YRD A;  2JZ2 A;  3CC7 A;  4HT9 A;  2F2V A;  1PCX A;  4C0G A;  4LDX A;  3NFC A;  1VQL A;  1OPK A; 
#chains in the Genus database with same CATH homology
 2ED0 A;  4AG2 C;  2KBT A;  1NEG A;  4JZ4 A;  1PKS A;  1NM7 A;  2DM1 A;  2EPD A;  2W10 A;  2A08 A;  2L2P A;  2JS2 A;  4E6R A;  1UJY A;  2O2O A;  4HXJ A;  3VS7 A;  1ABO A;  1GCP A;  4RTZ A;  2MOX A;  1PKT A;  1UFF A;  2DIL A;  3EHQ A;  4LUD A;  1MV0 B;  1VYV A;  2CH4 W;  3GBQ A;  1K4U S;  2BZY A;  1OPL A;  2DL4 A;  2DRK A;  3TSW A;  1HD3 A;  1BB9 A;  1AD5 A;  1YN8 A;  4CC3 A;  1BBZ A;  3O5Z A;  4WCI A;  4A63 B;  1QWE A;  5IXB A;  1I0C A;  1PHT A;  3EG0 A;  3UA7 A;  4Z88 A;  2DX1 A;  2RF0 A;  2EW3 A;  1VA7 A;  1UE9 A;  2DL8 A;  3VS3 A;  2KE9 A;  1ZUU A;  1G2B A;  1YP5 A;  2DL5 A;  2JM9 A;  1X43 A;  2LQN A;  1QLY A;  4OMM A;  4LNP A;  1OOT A;  2FRY A;  2DL7 A;  1M3A A;  1X6B A;  2ENM A;  4AFZ C;  4D8K A;  1AWO A;  1KIK A;  4KRT A;  1X2K A;  1JXO A;  1X27 A;  1HJD A;  1U5S A;  2DJQ A;  1G83 A;  1X6G A;  2KRM A;  5GJW B;  2FEI A;  1V1C A;  3EHR A;  2HCK A;  4F14 A;  1JQQ A;  2HBW A;  1W1F A;  3EG3 A;  2GTO A;  2L0A A;  4LN2 A;  1X69 A;  2CH4 A;  4RUG A;  1E7O A;  1WI7 A;  1UG1 A;  2AK5 A;  2LP5 A;  2J6O A;  2I0N A;  2GTJ A;  1IO6 A;  2NUZ A;  3H0F A;  1OV3 A;  2KNB B;  2B86 A;  2AZS A;  1W6X A;  3NPF A;  1EFN A;  2ROT A;  2SRC A;  4EIK A;  1CSK A;  2RQR A;  3SHW A;  1QCF A;  3UF4 A;  5FWC A;  2CDT A;  2O9S A;  2QDL A;  4FSS A;  2RNA A;  2EKH A;  4HCK A;  2MCN A;  4F16 A;  1N5Z A;  3PE0 A;  1K1Z A;  2RQU A;  4RTU A;  1VYU A;  1AVZ C;  1AWJ A;  4ZNX A;  5ECA A;  1YWO A;  1FYN A;  3EG2 A;  4CC4 B;  3VS4 A;  3JV3 A;  2EGA A;  1UJ0 A;  4IIO A;  2DLP A;  4AFS C;  1TUC A;  5FWB A;  2YUQ A;  1UDL A;  2LJ1 A;  2AKL A;  2O9V A;  1U06 A;  1AZE A;  2PTK A;  4DEY A;  2CT3 A;  2KRS A;  1CKB A;  3PVQ A;  3REB B;  1GBR A;  1WDX A;  3CQT A;  2RQT A;  2LMJ A;  3KFV A;  2KR3 A;  1UEC A;  2KRN A;  3VS2 A;  2F2W A;  1I1J A;  2O88 A;  3VRY A;  2D1X A;  3EGU A;  1Y0M A;  1M3C A;  4LE9 A;  1M30 A;  2K2M A;  3I5S A;  2ROL A;  2GQI A;  3VS6 A;  2LQW A;  3ZL7 C;  2ECZ A;  1NG2 A;  4JJC A;  2DE0 X;  4J9C A;  1PRL C;  2EGE A;  3IQL A;  1NLO C;  1GCQ C;  3ULR B;  3PVL A;  1SPK A;  2H8H A;  2FG0 A;  2JMC A;  1KJW A;  2J7I A;  1QWF A;  1UHC A;  4DEX A;  1RI9 A;  2C0O A;  2KXC A;  2OI3 A;  2JS0 A;  1GCQ A;  2YDL A;  2CSI A;  4AFQ C;  3H41 A;  1M27 C;  1ZUK A;  1FMK A;  2K6D A;  1WXU A;  4RTW A;  1B07 A;  1S1N A;  1YNZ A;  1Z9Z A;  1GFD A;  2CSQ A;  5IH2 A;  2EVR A;  2JT4 A;  1TUD A;  3TSZ A;  4HVV A;  2DMO A;  3FJ5 A;  2DBK A;  1ZUY A;  2FRW A;  1BK2 A;  4X1V A;  2M51 A;  2V1R A;  5IHK A;  2VKN A;  3M0Q A;  2LCS A;  2JMA A;  4JJD A;  1T3L A;  3I9Q A;  1WIE A;  2DVJ A;  1WA7 A;  1BU1 A;  1VYT A;  2CRE A;  4J9H A;  1GRI A;  4QT7 A;  4ORZ A;  1ABQ A;  2YT6 A;  1B3Q A;  1ZBJ A;  4OMP A;  2EBP A;  2YUP A;  3VRZ A;  2L3S A;  3M0R A;  1WFW A;  1RLP C;  5L23 A;  1K0X A;  2G6F X;  1GBQ A;  2O31 A;  2EGC A;  2V1Q A;  1E6H A;  2KT8 A;  3C0C A;  4M4Z A;  4OML A;  1UGV A;  2XMF A;  2LX7 A;  2DL3 A;  4CC2 A;  2YUN A;  1RUW A;  1Y57 A;  2RQV A;  3I5R A;  2K3B A;  1SEM A;  2EQI A;  1T3S A;  1CKA A;  2KT1 A;  2A36 A;  2KYM A;  2HSP A;  1AEY A;  1AWX A;  1U3O A;  2D8J A;  3NMZ C;  1H92 A;  2KXD A;  2RQW A;  2J05 A;  2KEA A;  2JM8 A;  4OMO A;  1SSH A;  1KSW A;  1LCK A;  1NYG A;  2GNC A;  2K7A A;  1E6G A;  1K9A A;  2EYX A;  1WYX A;  2FPF A;  2W0Z A;  4OMQ A;  3REA B;  2FO0 A;  2J06 A;  3QWY A;  1T0H A;  2PNI A;  1T0J A;  2L3P A;  4LUE A;  2JXB A;  1K0S A;  1JU5 C;  2RPN A;  4JZ3 A;  4OMN A;  1PRM C;  2A28 A;  1AOJ A;  2A37 A;  3QWX X;  1WXT A;  3A98 A;  2DA9 A;  5IHI A;  3NHN A;  1WX6 A;  2VVK A;  2FPD A;  2YUO A;  2DNU A;  1GL5 A;  4J9I A;  1JEG A;  4HVW A;  1K76 A;  2FPE A;  1PWT A;  4Z89 A;  2AZV A;  2P4R A;  4RTV A;  1XOV A;  3THK A;  3H0I A;  1H8K A;  4J9D A;  2KGT A;  1JO8 A;  4GLM A;  2OAW A;  2BZ8 A;  1MV3 A;  1YCS B;  4AG1 C;  1MUZ A;  2ABL A;  1M8M A;  2C0T A;  2EYY A;  2RMO A;  2D8H A;  1JXM A;  1PNJ A;  4Y92 A;  4F17 A;  2ESW A;  2JW4 A;  2K9G A;  2KRO A;  1Z9Q A;  4RTT A;  2HDA A;  3RNJ A;  4JJB A;  2DF6 A;  2AKK A;  4J9B A;  1W70 A;  2HEQ A;  2C0I A;  1TG0 A;  3VS0 A;  3RBB B;  5I22 A;  2DBM A;  2F2X A;  3TVT A;  1ZSG A;  1RLQ C;  3EG1 A;  1UTI A;  1YWP A;  5IXF A;  4J9G A;  1WLP B;  2GBQ A;  1A0N B;  3LH5 A;  3UA6 A;  2MIO A;  5IHN A;  5I11 A;  2SEM A;  2OJ2 A;  1HSQ A;  3M0T A;  1SRM A;  3NGP A;  1QKW A;  1SRL A;  2LJ0 A;  1OEB A;  1SHF A;  2CUB A;  3UAT A;  5GJV B;  2K79 A;  1H3H A;  1I07 A;  1J3T A;  1ZLM A;  4IIM A;  5FW9 A;  3U23 A;  2CT4 A;  4HVU A;  2JTE A;  2X3X D;  1ZX6 A;  3R6N A;  2GGR A;  5EC7 A;  2PZ1 A;  3VS5 A;  2LJ3 A;  4JPB W;  2KYB A;  1M3B A;  1UHF A;  2RN8 A;  1NLP C;  2X3W D;  3M0U A;  3M0S A;  1QKX A;  1NYF A;  1WXB A;  3I35 A;  5HCK A;  1NEB A;  4K11 A;  1ARK A;  1GFC A;  4RTX A;  3SEM A;  2BZX A;  2EYZ A;  1UUE A;  2EYW A;  2DYB A;  2IIM A;  4R0K A;  3H0H A;  2NWM A;  2E5K A;  2DRM A;  2J6F A;  2CUD A;  3VS1 A;  4GBQ A;  2D0N A;  2LNH B;  2VWF A;  2LZ6 B;  2J6K A;  4CC7 A;  2L3Q A;  1SHG A;  2BTT A;  1KFZ A;  4AFU C;  4J9F A;  1X2Q A;  2M0Y A;  4RTY A;  4Z8A A;  4J9E A;  2F2V A;  1AWW A;  4D8D A;  4ESR A;  3M0P A;  1AZG B;  2ED1 A;  2YSQ A;  1OPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...