1UHFA

Solution structure of the third sh3 domain of human intersectin 2(kiaa1256)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
GSSGSSGGEEYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVKPKDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERSECTIN 2
publication title Solution Structure of the third SH3 domain of human intersectin 2(KIAA1256)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uhfA00
2ABLA 1NG2A 1RLPC 1N5ZA 1HJDA 2FRYA 2RQRA 4JZ4A 2V1RA 3RBBB 2DF6A 2K9GA 1Z9ZA 2HBWA 3EG2A 4CC4B 2EGEA 3R6NA 1W6XA 1X6BA 1OPKA 3VS2A 2EYWA 3M0UA 1BBZA 1WYXA 1V1CA 2GQIA 1MV0B 1AWWA 4JJDA 4OMNA 1NYFA 2GBQA 1SHFA 1WXUA 2PNIA 3UATA 1WDXA 2SEMA 3ZL7C 2D1XA 2LZ6B 3H0FA 3QWXX 3VS0A 2EQIA 2J06A 3H0IA 2JT4A 1Y0MA 4AFQC 2BZXA 2NWMA 1JEGA 3CQTA 1GFDA 1IO6A 4F14A 2KRMA 4RTZA 1NLPC 2O2OA 2VVKA 3TSZA 2JS2A 1ZUKA 4RTTA 1RI9A 1M30A 3PVQA 2M51A 4RTYA 1U3OA 2M0YA 1WA7A 2DYBA 2BZ8A 1RLQC 4RTUA 4J9EA 1FYNA 2C0OA 1SHGA 3A98A 2YUNA 2XMFA 2LP5A 1I0CA 1KJWA 1CKBA 3EHQA 1ZBJA 2B86A 3TSWA 1AWJA 1UHCA 4DEXA 2PZ1A 2EYZA 1AEYA 2LCSA 1BB9A 3NPFA 4KRTA 2F2VA 4WCIA 4Z8AA 4E6RA 1QKXA 3I35A 2KNBB 3LH5A 2RPNA 1H8KA 4ZNXA 1GCQA 1T3SA 1J3TA 3REBB 3VS4A 1EFNA 2L3SA 2AKLA 2OI3A 2ROLA 2JTEA 2I0NA 2EGAA 2DNUA 2L0AA 3GBQA 2BTTA 3ULRB 5IXFA 3NMZC 4AFZC 1GCQC 1AWOA 2G6FX 4LUDA 4HVVA 1GL5A 2EPDA 5FW9A 1M3BA 1E6GA 1G2BA 2LMJA 4HCKA 4K11A 2X3XD 1ARKA 4J9GA 5ECAA 1JQQA 1M27C 1B3QA 1OPLA 1TUDA 2RF0A 2L3PA 4OMPA 1TUCA 1AVZC 2LQNA 2O31A 4OMMA 3VRYA 3PVLA 1K9AA 5GJWB 2LJ0A 1UHFA 3M0QA 2LJ1A 1AWXA 2EKHA 2LNHB 2YSQA 2YUOA 3M0SA 1AZGB 3EG0A 2P4RA 1OV3A 2BZYA 2JW4A 2FG0A 2FO0A 1GBRA 3UA7A 3EHRA 4J9CA 2KYBA 1Z9QA 2KRNA 3NGPA 1RUWA 3RNJA 1SEMA 1GRIA 1X27A 1W70A 1YNZA 1UJ0A 1K1ZA 2HCKA 3VS3A 1MV3A 1PRMC 1CKAA 2DBMA 4FSSA 2J6FA 1UECA 1QCFA 2C0IA 3M0TA 1ZLMA 4LUEA 3VS5A 1E6HA 2MCNA 2J6OA 2DL3A 2K6DA 1B07A 4F17A 1K4US 4AFSC 1QWFA 2AZSA 2EYXA 2V1QA 2JMCA 1WXTA 4F16A 2A08A 2DLPA 2K3BA 5IH2A 4RUGA 4R0KA 2W10A 2OAWA 1BK2A 1QKWA 2HEQA 2J6KA 2GGRA 1HD3A 2CT3A 1ABQA 2DRMA 2KXCA 1PNJA 1LCKA 4X1VA 2O88A 1E7OA 1MUZA 1T0HA 1Y57A 2ECZA 3O5ZA 3KFVA 2YDLA 2KE9A 5EC7A 1X69A 3H41A 1UG1A 4GBQA 3NHNA 2KT8A 4CC3A 3PE0A 1GFCA 4JZ3A 2GTJA 3UF4A 3M0PA 1M8MA 1WLPB 2OJ2A 2FRWA 1HSQA 2HSPA 1ABOA 2CT4A 2MIOA 1UGVA 3SHWA 2LQWA 1UE9A 4CC2A 2GTOA 2QDLA 1UTIA 2A36A 2K7AA 2KGTA 2O9SA 2CSQA 5IHNA 1AZEA 4AFUC 2LJ3A 4AG2C 1KFZA 4CC7A 4Z88A 1X2KA 5IHKA 2DRKA 1JU5C 1BU1A 2YT6A 3I5RA 1NYGA 3REAB 2AKKA 2H8HA 2CH4W 5I22A 4ORZA 2FPDA 2RQWA 1ZUYA 2EBPA 2O9VA 1PKTA 1VYTA 1ZX6A 3UA6A 1A0NB 2DL8A 4AG1C 1K0XA 1PHTA 1GCPA 1XOVA 2KBTA 1YWPA 2VWFA 2K2MA 4LN2A 2CSIA 4EIKA 2KROA 4D8DA 2FPFA 3I9QA 1T3LA 1X43A 1W1FA 2JXBA 1AD5A 5I11A 2MOXA 3M0RA 1UUEA 1UJYA 2SRCA 2KR3A 4Z89A 5FWBA 1SRMA 2AK5A 1VYVA 1PKSA 4OMOA 1PWTA 1M3CA 2JS0A 1UFFA 2RMOA 2X3WD 5L23A 2DL4A 3JV3A 2L2PA 5IXBA 5GJVB 2DM1A 1WIEA 4J9DA 2DILA 1WFWA 2CH4A 4J9FA 1U06A 1UDLA 2DVJA 2A28A 2DMOA 2DJQA 4A63B 1NEGA 3SEMA 2EW3A 3THKA 4J9BA 2F2WA 1QLYA 1YCSB 2KYMA 3EGUA 2KXDA 2A37A 2DL5A 2FEIA 4HVUA 4IIMA 1S1NA 2YUPA 2D0NA 2DX1A 2YUQA 4LNPA 5IHIA 2CUDA 1SRLA 4M4ZA 1NEBA 1T0JA 1JO8A 2W0ZA 2L3QA 2EYYA 2F2XA 1H3HA 1SPKA 2J7IA 4J9IA 3VS7A 2C0TA 1YN8A 1G83A 1X6GA 3IQLA 4DEYA 4LE9A 1CSKA 2DA9A 2CREA 2LX7A 2ED0A 2IIMA 2RNAA 1YP5A 1X2QA 2KEAA 1WX6A 1WXBA 2RQUA 1M3AA 4J9HA 3I5SA 4JJCA 3QWYA 2ROTA 2KRSA 2CDTA 2RQTA 3EG3A 3U23A 2JMAA 4RTWA 2HDAA 2DE0X 1QWEA 1YWOA 2E5KA 1I07A 1H92A 4JJBA 3C0CA 5FWCA 1KIKA 2K79A 1OEBA 2PTKA 4Y92A 5HCKA 1FMKA 3H0HA 2CUBA 1VYUA 2DBKA 1NLOC 1TG0A 3VS6A 3VS1A 1ZUUA 2RN8A 1GBQA 2D8HA 4OMQA 2JM8A 4RTVA 1VA7A 1PRLC 2ESWA 1AOJA 4OMLA 2J05A 4D8KA 2ENMA 4ESRA 2JM9A 2DL7A 1KSWA 4GLMA 4JPBW 1JXOA 2EGCA 1WI7A 1U5SA 2FPEA 4HXJA 3FJ5A 1K0SA 4HVWA 2RQVA 4IIOA 3TVTA 3EG1A 2ED1A 2VKNA 1NM7A 2EVRA 3VRZA 1ZSGA 4RTXA 4QT7A 1JXMA 1SSHA 2GNCA 2D8JA 2KT1A 2NUZA 1K76A 1OOTA 1I1JA 2AZVA
chains in the Genus database with same CATH superfamily
2ABLA 4QVCA 1UB4A 3MP8A 1ZSZC 2RM4A 4JRKA 1G3YA 4JZ4A 2EQUA 3RBBB 5CIUA 2GFUA 2XIDA 4ZGDB 2K4YA 4LDYA 2MPXC 2DERA 4M7AF 2DKGA 3LH0A 3CMAA 2HL3A 1VQ9Q 1Q81C 4A4GA 2NYSA 3OS1A 4PL6A 3QIIA 1D1CA 4FL6A 1QVFS 2XI9A 1K73C 4JJDA 5I21A 5CKDA 1M1FA 3CCLA 1VQ4A 3CC7Q 1WXUA 2SEMA 2LZ6B 3H0FA 3QYHB 3MEAA 2RHZA 4OF1A 4BY6C 3MCAB 5FLXE 3KXTA 4F14A 1JJ2P 3J80E 4RTZA 5GAMf 2CYZB 2HAXA 2VUBA 2VVKA 3TSZA 2JS2A 3EG9B 3AHUA 4RTYA 2M0YA 2QGFB 3JB9D 4DBHA 2BZ8A 1M90U 1YITQ 4IUQA 2MI6A 5HK3A 4X9CA 2C0OA 2CP3A 1SHGA 3T9NA 3CMAT 2YUNA 2RHIA 3EHQA 2MWPA 4C8QB 3HHTB 1VQ4Q 2B86A 5GANf 4JJNK 1AWJA 2KDSA 4F7UA 1MMDA 2CS7A 3CCLT 1BB9A 1Q81R 3NPFA 5LL6S 1S72A 4WCIA 4E6RA 3I35A 1N6AA 3QO3A 1IGUA 2E4HA 3DB4A 2NUTB 4ZNXA 3M57A 3EFSA 1M2VB 1VQPA 2EQMA 2KVQG 3VS4A 5GAN4 4M7DD 2L3SA 2XHCA 1K73R 1XTDA 5LJ3d 5FU7C 2ROLA 2F1LA 5GANg 1VQNQ 5CVIA 2EGAA 3TU4K 4GY5A 4BDZA 1YJWA 3NMZC 1BI2A 3GP8A 1ZSZA 4M75B 4LUDA 2E5QA 3BFMA 1VQKA 4K11A 1PD0A 1M90C 2Y4YA 4PLLA 4J9GA 2F69A 3CMEQ 2DXUA 1BCOA 3CCEA 2EJFA 3CCJQ 1N8RU 4OMPA 4UC4A 1AVZC 1PG5B 3CCUQ 1S72Q 3OYFA 4A4EA 5GJWB 2EKHA 4F7UE 2HZYA 3GLXA 1VQPQ 3OW2A 1IHWA 1QP3A 2VXFA 1X6OA 2JW4A 3FRNA 2CP0A 2FO0A 4C92F 4Q5WA 3JB9G 1RUWA 1V76A 1GRIA 3MEVA 1YNZA 4KGVB 1SKUB 1BI1A 2J6FA 3CC4T 4EMGA 1M1GA 4XU0A 4CI0C 4OB0B 1YJWT 3EGDB 1M4ZA 2XICA 1VQKQ 3TCJA 2J6OA 4J6YA 4DBFA 1Q95G 3OYIA 2COWA 3CCEQ 4M78E 3CCMQ 1K4US 4AFSC 2AZSA 2A08A 3OW2S 1WHGA 5IH2A 2L5QA 1BK2A 1QKWA 2HEQA 4DBQA 1U8RA 1ABQA 5LJ3h 3C12A 2JJ9A 2CP7A 1UGSB 1LCKA 4X1VA 3CCRQ 4M7DG 4LDWA 2O88A 1N8RC 1MUZA 1N9SA 2EYQA 2YDLA 2KE9A 5EC7A 1M90R 4LXCA 2JNGA 3M0PA 1M8MA 1WLPB 5AT1B 2HSPA 5KYXA 4DOWA 1UGVA 2LQWA 4CC2A 2GTOA 4IURA 2K7AA 2RB6A 2O9SA 3CC2A 4IUTA 3G6ET 1AZEA 3QXEB 2QYZA 4Z88A 4CC7A 2D6FA 2DPPB 1HK9A 1VQLT 2JOYA 2YT6A 7AT1B 1NYGA 4ZN1A 5FROA 4FW1A 2H8HA 2AHJB 1W2BA 4KT0E 4ORZA 2FPDA 3L1AA 4FIBA 1PKTA 2CKKA 1QVFP 3UA6A 4L6V5 3SD4A 1YJNA 2DL8A 2BUDA 3JCMV 1PHTA 5LJ5e 2CP6A 4MMKA 2VGMA 3HRUA 1RADB 1WJQA 2E65A 1K8AU 2KBTA 1LVKA 2M1HA 4PKCC 2CSIA 4OVAA 2KROA 3A8GB 1N8RR 4KBMB 4M77F 4WF2A 2QEXQ 4Z89A 3HSBA 5FWBA 1W2BS 1MMAA 3L2RA 4BI4A 3CC2T 1C6VX 3GOXA 1LPLA 5GMKl 4PJJA 2DEQA 2JS0A 5J3BA 2DM1A 5CK9A 1YJNQ 2D0QB 2DILA 1WFWA 1U06A 2LT1A 1UDLA 3A8HB 2A28A 1ZHIA 2DMOA 2EW3A 3THKA 4E47A 2DEUA 3EGUA 2A37A 4KH1B 2HKNA 3ME9A 2RD1A 2CUDA 1K8AC 1NEBA 1KC8U 3EFRA 5GAOr 3H8ZA 5KH6A 4Y91A 1G3SA 1SPKA 1R0CB 4BB7A 1LNXA 2C0TA 3LW5E 2E64A 2EJ9A 2IPOB 3KBGA 1CSKA 1JJ2A 3LWIA 3OB9A 2RNAA 3MJXA 1WXBA 2RQUA 1PCXA 4A4KA 4C8QE 2DXBA 2ROTA 1YCYA 1YJ9Q 1B7TA 3M4YA 5J39A 1YWOA 1I07A 2NUPB 8ATCB 4MZMA 3C0CA 3JB9F 5KE3A 3H0HA 1QVGA 1VYUA 2MF2A 2EJGA 1VQ6T 1TG0A 3VS6A 2JZ2A 1YHQA 3TEEA 4RCBA 3X24B 4NL3A 2ESWA 1AOJA 3RMSA 1KD1U 1TWBA 1JJ2S 2JM9A 2DL7A 1KSWA 1JXOA 3CCST 4M75E 4M7AB 2DVEA 1K0SA 1K8AR 4IIOA 2LDMA 3HKSA 4ELZC 1QVGS 4F7UG 4M7DF 3PMIA 2QTXA 2KSSA 2EQKA 4QT7A 3ZFJA 1JB0E 1SSHA 2FHDA 2D8JA 2KT1A 1IXDA 1BIAA 2NUZA 1K76A 3JB9I 1I1JA 2AZVA 4B9WA 1YHQQ 4Y28E 4E7LA 2RQRA 5C0MA 3WXMB 2V1RA 3JSCA 2XDBA 2DF6A 3NTHA 4HKEA 2HBWA 3JCMe 3JCMQ 1TXQA 4QW2A 3VV0A 1NPRA 2EAYA 2HQHA 4J83A 1U1TA 3C4SA 3R6NA 3KUFA 1W6XA 4M78G 3SWNB 1OPKA 1KD1C 2LT4A 3CCVA 3I56Q 3OYMA 2YLBA 1AWWA 4JUVA 4ZGJB 1NYFA 2IVWA 1GXIE 2F5TX 4PJOA 2MYSA 4BD3A 1WDXA 4FYVB 4JLGA 3VU3C 2D9TA 4OGEA 1KC8R 3VS0A 2K5FA 1KQ2A 1QP2A 4AFQC 1JEGA 1B34A 1KQSP 3OYHA 2YWWA 2O2OA 4ZGEB 1D09B 2RK1A 3OYGA 2DFUA 4RTTA 1M30A 1VQMQ 1U3OA 4OB3B 2E41A 1D1BA 5KYWA 3JCMX 4RTUA 2XDDA 1R77A 1FYNA 3BY7A 4HA8A 3CCVQ 1EZZB 2HBPA 3A98A 1I0CA 2ATCB 4LD9K 1W2BP 4EMKC 1KG1A 4DEXA 2EYZA 1TUGB 3OSVA 2LCSA 2E6NA 5A0LA 1ZA2B 2QASA 4E7HA 4KUDK 1M1KC 3CBPA 4PJOE 2KNBB 5IN1A 4CRIA 1KD1R 1H8KA 4BY6B 1GCQA 2PUKB 5CKBA 1T3SA 3X28B 1K9MU 1FMVA 1EFNA 1G3WA 5GMKj 5CKHA 1WJSA 4C92B 4PFPA 3NTIA 2I0NA 3M54A 2BTTA 3QPHA 3RR6A 1AWOA 5IAYA 4HVVA 2MWOA 3CC7A 2EPDA 1M3BA 1WHMA 1G2BA 2LMJA 1ARKA 5FU6B 5ECAA 2RJDA 4A53A 1B3QA 1AHJB 2RF0A 2RHXA 1RACB 4E7JA 4M78C 2OTLT 4XU1A 1Q82U 2FYKA 1K9AA 4ME7A 1Y96A 1YFNA 2E3HA 3UA7A 1Z9QA 2KRNA 5GAMj 1YITA 3RNJA 5M9OA 5I2SA 1W70A 1I5OB 3OYYA 1UGQB 1MV3A 1UEBA 1VQ9T 4F04B 4XTYA 1K9MC 4EMHA 1QCFA 4DOVA 3VKIA 1ZLMA 1SSFA 1E6HA 3OBWA 2A0FB 2DL3A 3PIOA 4E7KA 3JCMf 4E7SA 3X20B 2L3RA 3CC7T 1SG5A 2EYXA 1MGQA 5GANj 3FC3A 2QTVA 4R0KA 5D6WA 1RI0A 1VQOQ 3RKWA 1FWZA 2W10A 2FZGB 5AYFA 2J6KA 2MAMA 3RIRA 5KYYB 2CT3A 2DRMA 2KXCA 2QK0A 1OZ3A 4EMKA 2G3RA 2F5KA 4C8QG 1VQNA 1Q82C 4RG8A 4JS4A 3EGXB 3JCMg 3H41A 5GAN7 2RH2A 3OS2A 3M9QA 1M5Q1 1RABB 3A1PA 3JCMJ 1QVGP 4JRQA 1GFCA 2GTJA 2VGNA 1VOMA 1YITT 4DQ2A 1Q86C 5GAMg 1Q7YU 3CD6A 3QG1A 2VASA 1QQJA 2JN0A 3CMEA 5IT9E 1MHNA 3CCJA 2QDLA 2KGTA 2A36A 1VQ4T 3CCUA 1VQ8Q 4LDVA 3JCMP 2P0KA 1XJWB 2LJ3A 1VQ7Q 4M77B 3L2WA 1D3BA 3CBOA 4M75G 2DK3A 1K9MR 1TU0B 2AKKA 3N5BB 1MNDA 2CH4W 1ZUYA 2EBPA 4M7AE 1ZX6A 4M78A 4PNOA 2V8KA 2K57A 1A0NB 4B9XA 3META 1VQNT 1WHHA 1K0XA 4MDWA 3J7AF 2BIVA 1D0YA 3CD6Q 3RKYA 5D7UA 4YTLA 4C5EA 3QKJA 2VWFA 2DAQA 4LN2A 3CCMA 3HP9A 4FT4A 5GAOl 4RG2A 3Q1JA 1T3LA 1U1SA 2DD5A 2JXBA 1AD5A 3PGGA 1Q82R 5KCHA 3CMET 1UJYA 2SRCA 2DIQA 2ZZDA 1Q7YC 3R6OA 3CCJT 2P0QA 4LDUA 3M4GA 4C0DB 4XTUA 1OQKA 1VYVA 3CCRA 3CCUT 1S72T 3LYIA 1PWTA 2GFAA 1VQPT 2RMOA 1UFFA 1YBYA 2K5IA 2ZAEA 5IXBA 3CBMA 3E9GA 4L59A 2GCXA 1WIEA 4J9DA 3RMQA 2CH4A 2LX9A 4R56A 4A4HA 3MHXA 3QBYA 2DIGA 4LD6A 4J9BA 1M2OA 2DL5A 4C8QC 4XAXB 2KK4A 4HVUA 1VQKT 2YUPA 2HD0A 3DB3A 2QA4A 5IHIA 3CCET 3CCMT 2RI5A 1SRLA 4JDSA 3O8VA 4J7IA 3OYCA 2W0ZA 2L3QA 2F2XA 3PFSA 2RJCA 1H3HA 3VS7A 3CCRT 3QHSA 4LE9A 3HRSA 2DA9A 1KQSA 1YIJA 2ED0A 1Q7YR 2IIMA 3OQ5A 2KEAA 4M75C 4JJCA 3ASKA 4ANJA 3QWYA 1TS9A 4PJOG 4FU6A 4RTWA 3AT1B 2QEXA 2DE0X 2GQVA 2E5KA 2RO0A 2O01E 3HPWA 3A8OB 3MP1A 3S6WA 4M7DB 2CP2A 4FYXB 5FWCA 1KIKA 1XQHA 2QA4Q 2K79A 3V7RA 2E6ZA 3P8DA 3HL8A 3VS1A 1VQ5A 4JS5A 2D8HA 1OX8A 2JM8A 4RTVA 4L5GA 4OMLA 3RKXA 4D8KA 2RJFA 1KQSS 2VV5A 4ESRA 2CZ7B 4IUVA 4C92E 1G8XA 2ZCFB 3EH2A 1EX4A 1YIJQ 3ZBDA 3EFOB 1WHLA 3BDLA 2L89A 4EPCA 2FPEA 2YRCA 2O4XB 2CGHA 3RERA 1KHIA 3EG9A 3M53A 1ZSGA 1ACMB 1WHKA 1KHCA 5GAOn 1OOTA 1BI3A 2QEXT 2PVDB 2FL7A 4C5HA 3TQ7P 1N5ZA 1VQ5Q 4P5NA 4OP0A 2FRYA 4C8QA 5GAOm 1V29B 1HYOA 2K9GA 1Z9ZA 3LGLA 4DBRA 3UWNA 3E1SA 4CC4B 3CPFA 1X6BA 1YJNT 3M0UA 2Y90A 3G7ZA 1BBZA 1YJ9A 2BE7D 4NOYA 2NUTA 4HCBA 5GAOq 1M2VA 2GQIA 1MV0B 2AIRB 2P0PA 2GBQA 3SB2A 1I5LA 4O6JA 2RI2A 4FYYB 2PNIA 3UATA 3ZL7C 2OX7A 2QQBA 2RI3A 3QWXX 1ZBXA 2EQIA 3OYBA 2J06A 2ZPIB 3H0IA 2JT4A 4M75A 1OYXA 2BZXA 2NWMA 3CQTA 1QW1A 1IO6A 4A4FA 2XU8A 3I55Q 4PJOC 1KQ1A 1RI9A 5KYUB 3PVQA 3OYEA 4M78D 1WA7A 3VUBA 3CEYA 1RLQC 3VUZA 4XTXA 3V8LA 2CZ1B 1TH7A 2EKOA 2LP5A 3HTRA 4JRPA 1KJWA 4N4IA 1ZBJA 3F70A 1YJ9T 1OI1A 2OTJQ 2PZ1A 4M77E 3A8LB 1H3ZA 5DM7R 1H641 2AT1B 4JLIA 3CXCP 3M56A 2ZPGB 4M7AG 5GMKi 2I2LA 2YRVA 4Z8AA 1QKXA 3LH5A 5LJ5j 3EGDA 3REBB 3QSUA 2AKLA 5CKEA 4IKFA 4QQDA 2JTEA 1RAIB 4ZTJA 2L0AA 3GBQA 3ULRB 4C5GA 3I56A 2DTIA 4FT2A 1GCQC 3G1JA 3URGA 1Y7XA 4IUUA 1GL5A 2PVGB 3OYLA 4EDUA 4BI8B 5LJ5f 3MO8A 1M27C 3CPWS 3CCQA 1TUCA 1NE8A 3PVLA 3MEWA 2LJ0A 1UHFA 2LJ1A 3VYHB 4A54A 1YHQT 3M0SA 2P4RA 1VQMA 1OV3A 5GAMd 2BZYA 2FG0A 3EHRA 4X34A 2KYBA 1SEMA 1MMNA 4E7IA 4F7UB 5GMKm 1UJ0A 5LJ5g 1K1ZA 3VS3A 4J6XA 3M55A 1EIFA 4FSSA 3VJPA 4NS5A 1UECA 1M1KU 4BACA 1YI2A 2JTMA 2Z0WA 3NFCA 5C6SA 4MZTA 2HQEA 3I56T 1OULA 1UGRB 2MCNA 2K6DA 5GANd 1QWFA 2LC4A 4QVZA 3CCQQ 2V1QA 2JMCA 4F16A 3OYKA 2DLPA 2K3BA 4RUGA 3OA6A 2OAWA 4BE0A 5GMKh 1ZSZB 2GGRA 1HD3A 5GAN6 3CCQT 3QZ5B 1HXDA 1PNJA 3FIFA 1E7OA 2DD4A 1T0HA 1Y57A 2ECZA 4IUPA 1PC0A 2DETA 1VQMT 1UG1A 4GBQA 4CC3A 5HK0A 3PE0A 1MNEA 4M7AC 2DXCA 4JZ3A 2P4TA 2K3YA 1FXXA 5KE2A 1YI2Q 3A8MB 2M9UA 1OX9A 2FRWA 3L42A 1HSQA 3CCVT 2CT4A 2MIOA 1IREB 4M7DE 3G4SQ 4N4GA 1UTIA 3JCMh 2DJZA 4II1A 1ZA1B 4C92G 5IHNA 4AFUC 1JBMA 1IZ6A 1D0XA 4AG2C 4C0GA 5IHKA 3INZA 2ZPHB 4D6WA 5GAMh 1JU5C 4C8QD 3BDUA 2ZPFB 1WPYA 2QQAA 3FB9A 5I22A 5FRMA 2EIFA 1M8VA 2O9VA 4JRIA 3V7SA 4N4HA 4AG1C 1X01A 2EFIA 3L2ZA 2LCCA 2XG8D 5GANh 2K2MA 2DTOA 4EIKA 3LGFA 4E7ZA 4ZN3A 2ZPEB 2YXYA 1X43A 2OAUA 1W1FA 3VYGA 1VQOA 2MOXA 3M0RA 4TVRA 4MMLA 4FM4B 1SRMA 2AK5A 3C95A 4M75D 2E1HA 4OMOA 3EH1A 2COZA 1UGPB 4C0ZA 1Q86U 4B6MA 4MDXA 5KYXB 1M3CA 2NUPA 2NLUA 4GLKA 2JTFA 3H9NA 5FU7B 3RDVA 5L23A 1Y07A 4PJLA 3JV3A 1G3TA 2H3EB 1ZQ1A 4QQ6A 1OZ2A 5GJVB 3E19A 1M1KR 3TREA 1C1AA 2DYIA 4J9FA 2RHYA 2DVJA 2R57A 2DJQA 4A63B 4AT1B 1NEGA 2LTOA 2RHUA 1VQ8A 1PD1A 1QLYA 1YCSB 3GPLA 3QDFA 2FEIA 4QKUA 4IIMA 1S1NA 1VQ7A 1BYMA 2K5LA 4RCCA 3QUIA 4LNPA 1TOVA 5DLQE 3GNGA 2LQ8A 4M7AA 2V8JA 2KAFA 4M4ZA 4X9DA 5KCOA 1RL2A 1T0JA 1JO8A 2PVOB 3JCMb 2P84A 1VQOT 3M5AA 4F7UF 9ATCB 2J7IA 5GAN5 4J9IA 4XQ3A 3P8BB 1YN8A 3IQLA 3M58A 2HQXA 4C92C 2CREA 2LX7A 5GAN8 4M77G 2LQKA 1YP5A 2HNIA 3CMAQ 4PFOA 3GF5A 2HSEB 3CPWP 4BI3A 5A0GA 3DLLA 2ZPBB 2HL5C 4QVDA 3JB9J 2KRSA 2CDTA 2PUOB 2JMAA 2HDAA 1D1AA 1H92A 4JJBA 3L2QA 5FU6C 2L8DA 4M78F 1P92A 3CCLQ 1VQ8T 2PTKA 3SWNA 2XK0A 2DBKA 1NLOC 4VUBA 1VQ7T 2JVVA 4RMOA 1ZUUA 2RN8A 2R58A 1R0BG 1VA7A 1C0MA 1LJOA 3JCMc 3CXCA 2A7YA 3RUXA 3FJPA 4GLMA 4DA4A 2EGCA 1NZ9A 1U5SA 3CC4A 2DZ9A 2RQVA 3QJYA 4PJOD 2XD0A 3TVTA 5LJ3e 3CD6T 2QXFA 2DTHA 2QDYB 2C06A 3OMGA 2VKNA 1NM7A 5GAOp 3JB9H 2MMPA 1FX7A 4RTXA 1JXMA 2GNCA 2WACA 2WSFE 2WSCE 3JAME 4J7FA 3SFMA 2VC8A 1Q86R 1NG2A 1RLPC 2FVUA 1HJDA 3CXCS 4C0FA 4N0AC 2DXTA 3X25B 5CKFA 3EG2A 1MMGA 3LWHA 3OS5A 2EGEA 1WGSA 4XU3A 3X26B 2QQRA 3CC4Q 3MKDA 3VS2A 2EYWA 1OU8A 1WYXA 3C94A 1V1CA 2V26A 1YJWQ 2X4XA 5EG2A 4OMNA 1SHFA 3G6EA 4C92A 3MP6A 3WVEB 2D1XA 3HRTA 3M59A 4M77C 3L2UA 2X4WA 2CZ0B 1VQLA 4HT8A 1Y0MA 3OY9A 2B8AA 1VUBA 1GFDA 1VIEA 2KRMA 4C5IA 3QDRB 2EWNA 3PTAA 3P8HA 3V8JA 1NLPC 4HCCA 1KK7A 1ZUKA 1IGQA 2DZCA 2M51A 4OMFB 2DYBA 3FEOA 4J9EA 1NPPA 3MPUB 3UT1A 3GNFB 2X4YA 5J26A 3S3NA 2XMFA 3PMTA 5HY6A 1CKBA 4ZTFA 3TSWA 2M16A 6AT1B 3G6EQ 1UHCA 2QGGA 5CQXA 1AEYA 2QA4T 4NL2A 4Z02A 2VXEA 4C0DC 1VQLQ 4KRTA 3OBYA 2F2VA 5LJ5d 2KI7A 4KULA 2RPNA 5A2QE 1J3TA 3V7CA 2FZCB 1JRIA 1VIFA 2X9HA 4HCZA 2OI3A 4AMCA 3BE3A 4O5VA 4PJOB 2QQ9A 5LJ3j 1N9RA 3PIPA 2DNUA 4XK8E 4FCYA 1YIJT 5IXFA 3JRZA 5CQYA 4AFZC 4N0AA 1RAHB 5KYYA 2FB7A 2G6FX 2QQSA 1B34B 4BDYA 2KMTA 4C8QF 1IHVA 5FW9A 2RA2A 1E6GA 4HCKA 4KGXB 1PM3A 3NTKA 2X3XD 5D6YA 3V8KA 5A0DA 1JQQA 3EGXA 1BCMA 1OPLA 1TUDA 4BE2A 1WNLA 2L3PA 4M7AD 3GIBA 2LQNA 1I81A 2O31A 3CC2Q 4OMMA 5KYWB 3VRYA 3BW1A 2E3IA 3PNWC 3I55A 3M0QA 1AWXA 5LJ3f 3E9FA 2LNHB 1VQ5T 3OSSC 2YSQA 2YUOA 1AZGB 3EG0A 3UDCA 2H3JA 1W4SA 3OS0A 1GBRA 4J9CA 3NGPA 4KUIA 1X27A 4M77A 2HCKA 4M75F 1PRMC 4E2FB 4J8OA 1CKAA 2DBMA 3OMCA 2C0IA 3M0TA 2OTJA 5LJ3g 1O9SA 4LUEA 3VS5A 2R5MA 4J5YA 1IB8A 1B07A 4F17A 2XKOC 3JCMW 3OYAA 4M7DC 5LJ5h 4ELYC 3S3MA 1WXTA 1VQ6A 3A5ZB 2YLCA 5CR2A 3ER0A 4XU2A 2FZKB 4ATOA 1BIBA 1DJ7B 3I55T 3LX7A 3O5ZA 2X35A 3KFVA 4HT9A 1X69A 2PQWA 3S3OA 3CCSA 3NHNA 2KT8A 4XTZA 4KH0B 2KY9A 3UF4A 1NJIU 2OJ2A 4XTWA 3J81E 3UPUA 1R8OB 2R5AA 3PT9A 4V2SA 1ABOA 5KYNA 1Y96B 3SHWA 3D7SB 1O75A 1UE9A 3G71A 4J6WA 2QG9B 1RAAB 2OTJT 2CSQA 1PSEA 2A3LA 5HKCA 2YHTA 5GAN3 3CPWA 2QAZA 1VQ6Q 1KFZA 2X51A 1RAEB 1X2KA 2GF7A 2E10A 4OB1B 4PJMA 1QVPA 2DRKA 4FYWB 1BU1A 3I5RA 3REAB 4BUGA 5CCAA 1LOJA 2YRDA 1BKBA 2RQWA 4FW2A 1VYTA 3CCSQ 2K2VA 2LCLA 1F1BB 2ZGWA 1KC8C 1GCPA 2PU9B 3QJ6A 3DKMA 1XOVA 1N27A 1YWPA 2M0OA 5GMKe 4EMKB 3H6ZA 4C92D 3G71Q 4D8DA 2FPFA 2LRQA 3I9QA 2LNVA 3OW2P 3HFNA 3JCMd 1NJIC 1BI0A 5I11A 1UUEA 4KGZB 3FLGA 2KR3A 2X4JA 1X75C 3FDRA 1RAFB 3G71T 1PKSA 2JUFA 5FRNA 4PJOF 3L2VA 4PK4A 2COYA 2QI2A 3E2UA 2X3WD 4OB2B 4M7DA 2DL4A 2L2PA 4WTOB 3MEUA 3HFOA 1WJRA 1I8FA 1NBEB 8AT1B 3QYGB 3ZEHA 1M9SA 1D3BB 2HKQB 3G4SA 3SEMA 4PLIA 3DLMA 2HMAA 2F2WA 5GAMe 2KYMA 2KXDA 5DY9A 1QMCA 1OU9A 2D0NA 2DX1A 2YUQA 3EFOA 2MK5A 4M78B 4RKUE 2WSEE 2M02A 3EAEA 2EQJA 3LLRA 3RESA 2O4XA 4MZPA 2EYYA 3OYNA 1IRXA 2BKDN 5CAIA 3WVDB 2E12A 1XNIA 4PJNA 2VB6A 5GANe 1G5VA 1G83A 1X6GA 1D0ZA 4DEYA 1QCNA 5DLOA 1NJIR 1FMWA 1QCOA 4QQGA 4FSXA 4BE1A 1WZOA 1X2QA 5GAN2 1WX6A 1WHJA 1M3AA 1PSFA 4J9HA 1YI2T 3I5SA 4OGCA 2RQTA 3EG3A 5L8RE 2V8IA 3U23A 1QWEA 3SDZA 3G4ST 1AT1B 1OEBA 2RJEA 4Y92A 2OTLA 2DO3A 1FMKA 5HCKA 2CUBA 2VYTA 2LVMA 4R55A 2BE9B 1WQ7A 1TTHB 1GBQA 1Q81U 4OMQA 1TSFA 1PRLC 1Y71A 1RAGB 2J05A 2CP5A 2ENMA 2CZ6B 4LDXA 3SWNC 4JPBW 4PFZA 2KQWA 1K73U 2RK2A 1WI7A 4M77D 1VQ9A 2E70A 2K3XA 4HXJA 3FJ5A 4HVWA 2IG0A 5CO7A 3QZ9B 1WQWA 3EG1A 5D6XA 2ED1A 2EVRA 3VRZA 1SF9A 2XDPA 5KYUA 4XTVA 5I2MA 1I4K1 3OYJA 2OTLQ 1QVFA 3OYDA 2Y4XA
chains in the Genus database with same CATH topology
2ABLA 1NG2A 1RLPC 1N5ZA 1HJDA 2FRYA 2RQRA 4JZ4A 2V1RA 3RBBB 2DF6A 2K9GA 1Z9ZA 2HBWA 3EG2A 4CC4B 2EGEA 3R6NA 1W6XA 1X6BA 1OPKA 3VS2A 2EYWA 3M0UA 1BBZA 1WYXA 1V1CA 2GQIA 1MV0B 1AWWA 4JJDA 4OMNA 1NYFA 2GBQA 1SHFA 1WXUA 2PNIA 3UATA 1WDXA 2SEMA 3ZL7C 2D1XA 2LZ6B 3H0FA 3QWXX 3VS0A 2EQIA 2J06A 3H0IA 2JT4A 1Y0MA 4AFQC 2BZXA 2NWMA 1JEGA 3CQTA 1GFDA 1IO6A 4F14A 2KRMA 4RTZA 1NLPC 2O2OA 2VVKA 3TSZA 2JS2A 1ZUKA 4RTTA 1RI9A 1M30A 3PVQA 2M51A 4RTYA 1U3OA 2M0YA 1WA7A 2DYBA 2BZ8A 1RLQC 4RTUA 4J9EA 1FYNA 2C0OA 1SHGA 3A98A 2YUNA 2XMFA 2LP5A 1I0CA 1KJWA 1CKBA 3EHQA 1ZBJA 2B86A 3TSWA 1AWJA 1UHCA 4DEXA 2PZ1A 2EYZA 1AEYA 2LCSA 1BB9A 3NPFA 4KRTA 2F2VA 4WCIA 4Z8AA 4E6RA 1QKXA 3I35A 2KNBB 3LH5A 2RPNA 1H8KA 4ZNXA 1GCQA 1T3SA 1J3TA 3REBB 3VS4A 1EFNA 2L3SA 2AKLA 2OI3A 2ROLA 2JTEA 2I0NA 2EGAA 2DNUA 2L0AA 3GBQA 2BTTA 3ULRB 5IXFA 3NMZC 4AFZC 1GCQC 1AWOA 2G6FX 4LUDA 4HVVA 1GL5A 2EPDA 5FW9A 1M3BA 1E6GA 1G2BA 2LMJA 4HCKA 4K11A 2X3XD 1ARKA 4J9GA 5ECAA 1JQQA 1M27C 1B3QA 1OPLA 1TUDA 2RF0A 2L3PA 4OMPA 1TUCA 1AVZC 2LQNA 2O31A 4OMMA 3VRYA 3PVLA 1K9AA 5GJWB 2LJ0A 1UHFA 3M0QA 2LJ1A 1AWXA 2EKHA 2LNHB 2YSQA 2YUOA 3M0SA 1AZGB 3EG0A 2P4RA 1OV3A 2BZYA 2JW4A 2FG0A 2FO0A 1GBRA 3UA7A 3EHRA 4J9CA 2KYBA 1Z9QA 2KRNA 3NGPA 1RUWA 3RNJA 1SEMA 1GRIA 1X27A 1W70A 1YNZA 1UJ0A 1K1ZA 2HCKA 3VS3A 1MV3A 1PRMC 1CKAA 2DBMA 4FSSA 2J6FA 1UECA 1QCFA 2C0IA 3M0TA 1ZLMA 4LUEA 3VS5A 1E6HA 2MCNA 2J6OA 2DL3A 2K6DA 1B07A 4F17A 1K4US 4AFSC 1QWFA 2AZSA 2EYXA 2V1QA 2JMCA 1WXTA 4F16A 2A08A 2DLPA 2K3BA 5IH2A 4RUGA 4R0KA 2W10A 2OAWA 1BK2A 1QKWA 2HEQA 2J6KA 2GGRA 1HD3A 2CT3A 1ABQA 2DRMA 2KXCA 1PNJA 1LCKA 4X1VA 2O88A 1E7OA 1MUZA 1T0HA 1Y57A 2ECZA 3O5ZA 3KFVA 2YDLA 2KE9A 5EC7A 1X69A 3H41A 1UG1A 4GBQA 3NHNA 2KT8A 4CC3A 3PE0A 1GFCA 4JZ3A 2GTJA 3UF4A 3M0PA 1M8MA 1WLPB 2OJ2A 2FRWA 1HSQA 2HSPA 1ABOA 2CT4A 2MIOA 1UGVA 3SHWA 2LQWA 1UE9A 4CC2A 2GTOA 2QDLA 1UTIA 2A36A 2K7AA 2KGTA 2O9SA 2CSQA 5IHNA 1AZEA 4AFUC 2LJ3A 4AG2C 1KFZA 4CC7A 4Z88A 1X2KA 5IHKA 2DRKA 1JU5C 1BU1A 2YT6A 3I5RA 1NYGA 3REAB 2AKKA 2H8HA 2CH4W 5I22A 4ORZA 2FPDA 2RQWA 1ZUYA 2EBPA 2O9VA 1PKTA 1VYTA 1ZX6A 3UA6A 1A0NB 2DL8A 4AG1C 1K0XA 1PHTA 1GCPA 1XOVA 2KBTA 1YWPA 2VWFA 2K2MA 4LN2A 2CSIA 4EIKA 2KROA 4D8DA 2FPFA 3I9QA 1T3LA 1X43A 1W1FA 2JXBA 1AD5A 5I11A 2MOXA 3M0RA 1UUEA 1UJYA 2SRCA 2KR3A 4Z89A 5FWBA 1SRMA 2AK5A 1VYVA 1PKSA 4OMOA 1PWTA 1M3CA 2JS0A 1UFFA 2RMOA 2X3WD 5L23A 2DL4A 3JV3A 2L2PA 5IXBA 5GJVB 2DM1A 1WIEA 4J9DA 2DILA 1WFWA 2CH4A 4J9FA 1U06A 1UDLA 2DVJA 2A28A 2DMOA 2DJQA 4A63B 1NEGA 3SEMA 2EW3A 3THKA 4J9BA 2F2WA 1QLYA 1YCSB 2KYMA 3EGUA 2KXDA 2A37A 2DL5A 2FEIA 4HVUA 4IIMA 1S1NA 2YUPA 2D0NA 2DX1A 2YUQA 4LNPA 5IHIA 2CUDA 1SRLA 4M4ZA 1NEBA 1T0JA 1JO8A 2W0ZA 2L3QA 2EYYA 2F2XA 1H3HA 1SPKA 2J7IA 4J9IA 3VS7A 2C0TA 1YN8A 1G83A 1X6GA 3IQLA 4DEYA 4LE9A 1CSKA 2DA9A 2CREA 2LX7A 2ED0A 2IIMA 2RNAA 1YP5A 1X2QA 2KEAA 1WX6A 1WXBA 2RQUA 1M3AA 4J9HA 3I5SA 4JJCA 3QWYA 2ROTA 2KRSA 2CDTA 2RQTA 3EG3A 3U23A 2JMAA 4RTWA 2HDAA 2DE0X 1QWEA 1YWOA 2E5KA 1I07A 1H92A 4JJBA 3C0CA 5FWCA 1KIKA 2K79A 1OEBA 2PTKA 4Y92A 5HCKA 1FMKA 3H0HA 2CUBA 1VYUA 2DBKA 1NLOC 1TG0A 3VS6A 3VS1A 1ZUUA 2RN8A 1GBQA 2D8HA 4OMQA 2JM8A 4RTVA 1VA7A 1PRLC 2ESWA 1AOJA 4OMLA 2J05A 4D8KA 2ENMA 4ESRA 2JM9A 2DL7A 1KSWA 4GLMA 4JPBW 1JXOA 2EGCA 1WI7A 1U5SA 2FPEA 4HXJA 3FJ5A 1K0SA 4HVWA 2RQVA 4IIOA 3TVTA 3EG1A 2ED1A 2VKNA 1NM7A 2EVRA 3VRZA 1ZSGA 4RTXA 4QT7A 1JXMA 1SSHA 2GNCA 2D8JA 2KT1A 2NUZA 1K76A 1OOTA 1I1JA 2AZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ABL A;  1NG2 A;  1RLP C;  1N5Z A;  1HJD A;  2FRY A;  2RQR A;  4JZ4 A;  2V1R A;  3RBB B;  2DF6 A;  2K9G A;  1Z9Z A;  2HBW A;  3EG2 A;  4CC4 B;  2EGE A;  3R6N A;  1W6X A;  1X6B A;  1OPK A;  3VS2 A;  2EYW A;  3M0U A;  1BBZ A;  1WYX A;  1V1C A;  2GQI A;  1MV0 B;  1AWW A;  4JJD A;  4OMN A;  1NYF A;  2GBQ A;  1SHF A;  1WXU A;  2PNI A;  3UAT A;  1WDX A;  2SEM A;  3ZL7 C;  2D1X A;  2LZ6 B;  3H0F A;  3QWX X;  3VS0 A;  2EQI A;  2J06 A;  3H0I A;  2JT4 A;  1Y0M A;  4AFQ C;  2BZX A;  2NWM A;  1JEG A;  3CQT A;  1GFD A;  1IO6 A;  4F14 A;  2KRM A;  4RTZ A;  1NLP C;  2O2O A;  2VVK A;  3TSZ A;  2JS2 A;  1ZUK A;  4RTT A;  1RI9 A;  1M30 A;  3PVQ A;  2M51 A;  4RTY A;  1U3O A;  2M0Y A;  1WA7 A;  2DYB A;  2BZ8 A;  1RLQ C;  4RTU A;  4J9E A;  1FYN A;  2C0O A;  1SHG A;  3A98 A;  2YUN A;  2XMF A;  2LP5 A;  1I0C A;  1KJW A;  1CKB A;  3EHQ A;  1ZBJ A;  2B86 A;  3TSW A;  1AWJ A;  1UHC A;  4DEX A;  2PZ1 A;  2EYZ A;  1AEY A;  2LCS A;  1BB9 A;  3NPF A;  4KRT A;  2F2V A;  4WCI A;  4Z8A A;  4E6R A;  1QKX A;  3I35 A;  2KNB B;  3LH5 A;  2RPN A;  1H8K A;  4ZNX A;  1GCQ A;  1T3S A;  1J3T A;  3REB B;  3VS4 A;  1EFN A;  2L3S A;  2AKL A;  2OI3 A;  2ROL A;  2JTE A;  2I0N A;  2EGA A;  2DNU A;  2L0A A;  3GBQ A;  2BTT A;  3ULR B;  5IXF A;  3NMZ C;  4AFZ C;  1GCQ C;  1AWO A;  2G6F X;  4LUD A;  4HVV A;  1GL5 A;  2EPD A;  5FW9 A;  1M3B A;  1E6G A;  1G2B A;  2LMJ A;  4HCK A;  4K11 A;  2X3X D;  1ARK A;  4J9G A;  5ECA A;  1JQQ A;  1M27 C;  1B3Q A;  1OPL A;  1TUD A;  2RF0 A;  2L3P A;  4OMP A;  1TUC A;  1AVZ C;  2LQN A;  2O31 A;  4OMM A;  3VRY A;  3PVL A;  1K9A A;  5GJW B;  2LJ0 A;  1UHF A;  3M0Q A;  2LJ1 A;  1AWX A;  2EKH A;  2LNH B;  2YSQ A;  2YUO A;  3M0S A;  1AZG B;  3EG0 A;  2P4R A;  1OV3 A;  2BZY A;  2JW4 A;  2FG0 A;  2FO0 A;  1GBR A;  3UA7 A;  3EHR A;  4J9C A;  2KYB A;  1Z9Q A;  2KRN A;  3NGP A;  1RUW A;  3RNJ A;  1SEM A;  1GRI A;  1X27 A;  1W70 A;  1YNZ A;  1UJ0 A;  1K1Z A;  2HCK A;  3VS3 A;  1MV3 A;  1PRM C;  1CKA A;  2DBM A;  4FSS A;  2J6F A;  1UEC A;  1QCF A;  2C0I A;  3M0T A;  1ZLM A;  4LUE A;  3VS5 A;  1E6H A;  2MCN A;  2J6O A;  2DL3 A;  2K6D A;  1B07 A;  4F17 A;  1K4U S;  4AFS C;  1QWF A;  2AZS A;  2EYX A;  2V1Q A;  2JMC A;  1WXT A;  4F16 A;  2A08 A;  2DLP A;  2K3B A;  5IH2 A;  4RUG A;  4R0K A;  2W10 A;  2OAW A;  1BK2 A;  1QKW A;  2HEQ A;  2J6K A;  2GGR A;  1HD3 A;  2CT3 A;  1ABQ A;  2DRM A;  2KXC A;  1PNJ A;  1LCK A;  4X1V A;  2O88 A;  1E7O A;  1MUZ A;  1T0H A;  1Y57 A;  2ECZ A;  3O5Z A;  3KFV A;  2YDL A;  2KE9 A;  5EC7 A;  1X69 A;  3H41 A;  1UG1 A;  4GBQ A;  3NHN A;  2KT8 A;  4CC3 A;  3PE0 A;  1GFC A;  4JZ3 A;  2GTJ A;  3UF4 A;  3M0P A;  1M8M A;  1WLP B;  2OJ2 A;  2FRW A;  1HSQ A;  2HSP A;  1ABO A;  2CT4 A;  2MIO A;  1UGV A;  3SHW A;  2LQW A;  1UE9 A;  4CC2 A;  2GTO A;  2QDL A;  1UTI A;  2A36 A;  2K7A A;  2KGT A;  2O9S A;  2CSQ A;  5IHN A;  1AZE A;  4AFU C;  2LJ3 A;  4AG2 C;  1KFZ A;  4CC7 A;  4Z88 A;  1X2K A;  5IHK A;  2DRK A;  1JU5 C;  1BU1 A;  2YT6 A;  3I5R A;  1NYG A;  3REA B;  2AKK A;  2H8H A;  2CH4 W;  5I22 A;  4ORZ A;  2FPD A;  2RQW A;  1ZUY A;  2EBP A;  2O9V A;  1PKT A;  1VYT A;  1ZX6 A;  3UA6 A;  1A0N B;  2DL8 A;  4AG1 C;  1K0X A;  1PHT A;  1GCP A;  1XOV A;  2KBT A;  1YWP A;  2VWF A;  2K2M A;  4LN2 A;  2CSI A;  4EIK A;  2KRO A;  4D8D A;  2FPF A;  3I9Q A;  1T3L A;  1X43 A;  1W1F A;  2JXB A;  1AD5 A;  5I11 A;  2MOX A;  3M0R A;  1UUE A;  1UJY A;  2SRC A;  2KR3 A;  4Z89 A;  5FWB A;  1SRM A;  2AK5 A;  1VYV A;  1PKS A;  4OMO A;  1PWT A;  1M3C A;  2JS0 A;  1UFF A;  2RMO A;  2X3W D;  5L23 A;  2DL4 A;  3JV3 A;  2L2P A;  5IXB A;  5GJV B;  2DM1 A;  1WIE A;  4J9D A;  2DIL A;  1WFW A;  2CH4 A;  4J9F A;  1U06 A;  1UDL A;  2DVJ A;  2A28 A;  2DMO A;  2DJQ A;  4A63 B;  1NEG A;  3SEM A;  2EW3 A;  3THK A;  4J9B A;  2F2W A;  1QLY A;  1YCS B;  2KYM A;  3EGU A;  2KXD A;  2A37 A;  2DL5 A;  2FEI A;  4HVU A;  4IIM A;  1S1N A;  2YUP A;  2D0N A;  2DX1 A;  2YUQ A;  4LNP A;  5IHI A;  2CUD A;  1SRL A;  4M4Z A;  1NEB A;  1T0J A;  1JO8 A;  2W0Z A;  2L3Q A;  2EYY A;  2F2X A;  1H3H A;  1SPK A;  2J7I A;  4J9I A;  3VS7 A;  2C0T A;  1YN8 A;  1G83 A;  1X6G A;  3IQL A;  4DEY A;  4LE9 A;  1CSK A;  2DA9 A;  2CRE A;  2LX7 A;  2ED0 A;  2IIM A;  2RNA A;  1YP5 A;  1X2Q A;  2KEA A;  1WX6 A;  1WXB A;  2RQU A;  1M3A A;  4J9H A;  3I5S A;  4JJC A;  3QWY A;  2ROT A;  2KRS A;  2CDT A;  2RQT A;  3EG3 A;  3U23 A;  2JMA A;  4RTW A;  2HDA A;  2DE0 X;  1QWE A;  1YWO A;  2E5K A;  1I07 A;  1H92 A;  4JJB A;  3C0C A;  5FWC A;  1KIK A;  2K79 A;  1OEB A;  2PTK A;  4Y92 A;  5HCK A;  1FMK A;  3H0H A;  2CUB A;  1VYU A;  2DBK A;  1NLO C;  1TG0 A;  3VS6 A;  3VS1 A;  1ZUU A;  2RN8 A;  1GBQ A;  2D8H A;  4OMQ A;  2JM8 A;  4RTV A;  1VA7 A;  1PRL C;  2ESW A;  1AOJ A;  4OML A;  2J05 A;  4D8K A;  2ENM A;  4ESR A;  2JM9 A;  2DL7 A;  1KSW A;  4GLM A;  4JPB W;  1JXO A;  2EGC A;  1WI7 A;  1U5S A;  2FPE A;  4HXJ A;  3FJ5 A;  1K0S A;  4HVW A;  2RQV A;  4IIO A;  3TVT A;  3EG1 A;  2ED1 A;  2VKN A;  1NM7 A;  2EVR A;  3VRZ A;  1ZSG A;  4RTX A;  4QT7 A;  1JXM A;  1SSH A;  2GNC A;  2D8J A;  2KT1 A;  2NUZ A;  1K76 A;  1OOT A;  1I1J A;  2AZV A; 
#chains in the Genus database with same CATH topology
 2ABL A;  4QVC A;  1UB4 A;  3MP8 A;  1ZSZ C;  2RM4 A;  4JRK A;  1G3Y A;  4JZ4 A;  2EQU A;  3RBB B;  5CIU A;  2GFU A;  2XID A;  4ZGD B;  2K4Y A;  4LDY A;  2MPX C;  2DER A;  4M7A F;  2DKG A;  3LH0 A;  3CMA A;  2HL3 A;  1VQ9 Q;  1Q81 C;  4A4G A;  2NYS A;  3OS1 A;  4PL6 A;  3QII A;  1D1C A;  4FL6 A;  1QVF S;  2XI9 A;  1K73 C;  4JJD A;  5I21 A;  5CKD A;  1M1F A;  3CCL A;  1VQ4 A;  3CC7 Q;  1WXU A;  2SEM A;  2LZ6 B;  3H0F A;  3QYH B;  3MEA A;  2RHZ A;  4OF1 A;  4BY6 C;  3MCA B;  5FLX E;  3KXT A;  4F14 A;  1JJ2 P;  3J80 E;  4RTZ A;  5GAM f;  2CYZ B;  2HAX A;  2VUB A;  2VVK A;  3TSZ A;  2JS2 A;  3EG9 B;  3AHU A;  4RTY A;  2M0Y A;  2QGF B;  3JB9 D;  4DBH A;  2BZ8 A;  1M90 U;  1YIT Q;  4IUQ A;  2MI6 A;  5HK3 A;  4X9C A;  2C0O A;  2CP3 A;  1SHG A;  3T9N A;  3CMA T;  2YUN A;  2RHI A;  3EHQ A;  2MWP A;  4C8Q B;  3HHT B;  1VQ4 Q;  2B86 A;  5GAN f;  4JJN K;  1AWJ A;  2KDS A;  4F7U A;  1MMD A;  2CS7 A;  3CCL T;  1BB9 A;  1Q81 R;  3NPF A;  5LL6 S;  1S72 A;  4WCI A;  4E6R A;  3I35 A;  1N6A A;  3QO3 A;  1IGU A;  2E4H A;  3DB4 A;  2NUT B;  4ZNX A;  3M57 A;  3EFS A;  1M2V B;  1VQP A;  2EQM A;  2KVQ G;  3VS4 A;  5GAN 4;  4M7D D;  2L3S A;  2XHC A;  1K73 R;  1XTD A;  5LJ3 d;  5FU7 C;  2ROL A;  2F1L A;  5GAN g;  1VQN Q;  5CVI A;  2EGA A;  3TU4 K;  4GY5 A;  4BDZ A;  1YJW A;  3NMZ C;  1BI2 A;  3GP8 A;  1ZSZ A;  4M75 B;  4LUD A;  2E5Q A;  3BFM A;  1VQK A;  4K11 A;  1PD0 A;  1M90 C;  2Y4Y A;  4PLL A;  4J9G A;  2F69 A;  3CME Q;  2DXU A;  1BCO A;  3CCE A;  2EJF A;  3CCJ Q;  1N8R U;  4OMP A;  4UC4 A;  1AVZ C;  1PG5 B;  3CCU Q;  1S72 Q;  3OYF A;  4A4E A;  5GJW B;  2EKH A;  4F7U E;  2HZY A;  3GLX A;  1VQP Q;  3OW2 A;  1IHW A;  1QP3 A;  2VXF A;  1X6O A;  2JW4 A;  3FRN A;  2CP0 A;  2FO0 A;  4C92 F;  4Q5W A;  3JB9 G;  1RUW A;  1V76 A;  1GRI A;  3MEV A;  1YNZ A;  4KGV B;  1SKU B;  1BI1 A;  2J6F A;  3CC4 T;  4EMG A;  1M1G A;  4XU0 A;  4CI0 C;  4OB0 B;  1YJW T;  3EGD B;  1M4Z A;  2XIC A;  1VQK Q;  3TCJ A;  2J6O A;  4J6Y A;  4DBF A;  1Q95 G;  3OYI A;  2COW A;  3CCE Q;  4M78 E;  3CCM Q;  1K4U S;  4AFS C;  2AZS A;  2A08 A;  3OW2 S;  1WHG A;  5IH2 A;  2L5Q A;  1BK2 A;  1QKW A;  2HEQ A;  4DBQ A;  1U8R A;  1ABQ A;  5LJ3 h;  3C12 A;  2JJ9 A;  2CP7 A;  1UGS B;  1LCK A;  4X1V A;  3CCR Q;  4M7D G;  4LDW A;  2O88 A;  1N8R C;  1MUZ A;  1N9S A;  2EYQ A;  2YDL A;  2KE9 A;  5EC7 A;  1M90 R;  4LXC A;  2JNG A;  3M0P A;  1M8M A;  1WLP B;  5AT1 B;  2HSP A;  5KYX A;  4DOW A;  1UGV A;  2LQW A;  4CC2 A;  2GTO A;  4IUR A;  2K7A A;  2RB6 A;  2O9S A;  3CC2 A;  4IUT A;  3G6E T;  1AZE A;  3QXE B;  2QYZ A;  4Z88 A;  4CC7 A;  2D6F A;  2DPP B;  1HK9 A;  1VQL T;  2JOY A;  2YT6 A;  7AT1 B;  1NYG A;  4ZN1 A;  5FRO A;  4FW1 A;  2H8H A;  2AHJ B;  1W2B A;  4KT0 E;  4ORZ A;  2FPD A;  3L1A A;  4FIB A;  1PKT A;  2CKK A;  1QVF P;  3UA6 A;  4L6V 5;  3SD4 A;  1YJN A;  2DL8 A;  2BUD A;  3JCM V;  1PHT A;  5LJ5 e;  2CP6 A;  4MMK A;  2VGM A;  3HRU A;  1RAD B;  1WJQ A;  2E65 A;  1K8A U;  2KBT A;  1LVK A;  2M1H A;  4PKC C;  2CSI A;  4OVA A;  2KRO A;  3A8G B;  1N8R R;  4KBM B;  4M77 F;  4WF2 A;  2QEX Q;  4Z89 A;  3HSB A;  5FWB A;  1W2B S;  1MMA A;  3L2R A;  4BI4 A;  3CC2 T;  1C6V X;  3GOX A;  1LPL A;  5GMK l;  4PJJ A;  2DEQ A;  2JS0 A;  5J3B A;  2DM1 A;  5CK9 A;  1YJN Q;  2D0Q B;  2DIL A;  1WFW A;  1U06 A;  2LT1 A;  1UDL A;  3A8H B;  2A28 A;  1ZHI A;  2DMO A;  2EW3 A;  3THK A;  4E47 A;  2DEU A;  3EGU A;  2A37 A;  4KH1 B;  2HKN A;  3ME9 A;  2RD1 A;  2CUD A;  1K8A C;  1NEB A;  1KC8 U;  3EFR A;  5GAO r;  3H8Z A;  5KH6 A;  4Y91 A;  1G3S A;  1SPK A;  1R0C B;  4BB7 A;  1LNX A;  2C0T A;  3LW5 E;  2E64 A;  2EJ9 A;  2IPO B;  3KBG A;  1CSK A;  1JJ2 A;  3LWI A;  3OB9 A;  2RNA A;  3MJX A;  1WXB A;  2RQU A;  1PCX A;  4A4K A;  4C8Q E;  2DXB A;  2ROT A;  1YCY A;  1YJ9 Q;  1B7T A;  3M4Y A;  5J39 A;  1YWO A;  1I07 A;  2NUP B;  8ATC B;  4MZM A;  3C0C A;  3JB9 F;  5KE3 A;  3H0H A;  1QVG A;  1VYU A;  2MF2 A;  2EJG A;  1VQ6 T;  1TG0 A;  3VS6 A;  2JZ2 A;  1YHQ A;  3TEE A;  4RCB A;  3X24 B;  4NL3 A;  2ESW A;  1AOJ A;  3RMS A;  1KD1 U;  1TWB A;  1JJ2 S;  2JM9 A;  2DL7 A;  1KSW A;  1JXO A;  3CCS T;  4M75 E;  4M7A B;  2DVE A;  1K0S A;  1K8A R;  4IIO A;  2LDM A;  3HKS A;  4ELZ C;  1QVG S;  4F7U G;  4M7D F;  3PMI A;  2QTX A;  2KSS A;  2EQK A;  4QT7 A;  3ZFJ A;  1JB0 E;  1SSH A;  2FHD A;  2D8J A;  2KT1 A;  1IXD A;  1BIA A;  2NUZ A;  1K76 A;  3JB9 I;  1I1J A;  2AZV A;  4B9W A;  1YHQ Q;  4Y28 E;  4E7L A;  2RQR A;  5C0M A;  3WXM B;  2V1R A;  3JSC A;  2XDB A;  2DF6 A;  3NTH A;  4HKE A;  2HBW A;  3JCM e;  3JCM Q;  1TXQ A;  4QW2 A;  3VV0 A;  1NPR A;  2EAY A;  2HQH A;  4J83 A;  1U1T A;  3C4S A;  3R6N A;  3KUF A;  1W6X A;  4M78 G;  3SWN B;  1OPK A;  1KD1 C;  2LT4 A;  3CCV A;  3I56 Q;  3OYM A;  2YLB A;  1AWW A;  4JUV A;  4ZGJ B;  1NYF A;  2IVW A;  1GXI E;  2F5T X;  4PJO A;  2MYS A;  4BD3 A;  1WDX A;  4FYV B;  4JLG A;  3VU3 C;  2D9T A;  4OGE A;  1KC8 R;  3VS0 A;  2K5F A;  1KQ2 A;  1QP2 A;  4AFQ C;  1JEG A;  1B34 A;  1KQS P;  3OYH A;  2YWW A;  2O2O A;  4ZGE B;  1D09 B;  2RK1 A;  3OYG A;  2DFU A;  4RTT A;  1M30 A;  1VQM Q;  1U3O A;  4OB3 B;  2E41 A;  1D1B A;  5KYW A;  3JCM X;  4RTU A;  2XDD A;  1R77 A;  1FYN A;  3BY7 A;  4HA8 A;  3CCV Q;  1EZZ B;  2HBP A;  3A98 A;  1I0C A;  2ATC B;  4LD9 K;  1W2B P;  4EMK C;  1KG1 A;  4DEX A;  2EYZ A;  1TUG B;  3OSV A;  2LCS A;  2E6N A;  5A0L A;  1ZA2 B;  2QAS A;  4E7H A;  4KUD K;  1M1K C;  3CBP A;  4PJO E;  2KNB B;  5IN1 A;  4CRI A;  1KD1 R;  1H8K A;  4BY6 B;  1GCQ A;  2PUK B;  5CKB A;  1T3S A;  3X28 B;  1K9M U;  1FMV A;  1EFN A;  1G3W A;  5GMK j;  5CKH A;  1WJS A;  4C92 B;  4PFP A;  3NTI A;  2I0N A;  3M54 A;  2BTT A;  3QPH A;  3RR6 A;  1AWO A;  5IAY A;  4HVV A;  2MWO A;  3CC7 A;  2EPD A;  1M3B A;  1WHM A;  1G2B A;  2LMJ A;  1ARK A;  5FU6 B;  5ECA A;  2RJD A;  4A53 A;  1B3Q A;  1AHJ B;  2RF0 A;  2RHX A;  1RAC B;  4E7J A;  4M78 C;  2OTL T;  4XU1 A;  1Q82 U;  2FYK A;  1K9A A;  4ME7 A;  1Y96 A;  1YFN A;  2E3H A;  3UA7 A;  1Z9Q A;  2KRN A;  5GAM j;  1YIT A;  3RNJ A;  5M9O A;  5I2S A;  1W70 A;  1I5O B;  3OYY A;  1UGQ B;  1MV3 A;  1UEB A;  1VQ9 T;  4F04 B;  4XTY A;  1K9M C;  4EMH A;  1QCF A;  4DOV A;  3VKI A;  1ZLM A;  1SSF A;  1E6H A;  3OBW A;  2A0F B;  2DL3 A;  3PIO A;  4E7K A;  3JCM f;  4E7S A;  3X20 B;  2L3R A;  3CC7 T;  1SG5 A;  2EYX A;  1MGQ A;  5GAN j;  3FC3 A;  2QTV A;  4R0K A;  5D6W A;  1RI0 A;  1VQO Q;  3RKW A;  1FWZ A;  2W10 A;  2FZG B;  5AYF A;  2J6K A;  2MAM A;  3RIR A;  5KYY B;  2CT3 A;  2DRM A;  2KXC A;  2QK0 A;  1OZ3 A;  4EMK A;  2G3R A;  2F5K A;  4C8Q G;  1VQN A;  1Q82 C;  4RG8 A;  4JS4 A;  3EGX B;  3JCM g;  3H41 A;  5GAN 7;  2RH2 A;  3OS2 A;  3M9Q A;  1M5Q 1;  1RAB B;  3A1P A;  3JCM J;  1QVG P;  4JRQ A;  1GFC A;  2GTJ A;  2VGN A;  1VOM A;  1YIT T;  4DQ2 A;  1Q86 C;  5GAM g;  1Q7Y U;  3CD6 A;  3QG1 A;  2VAS A;  1QQJ A;  2JN0 A;  3CME A;  5IT9 E;  1MHN A;  3CCJ A;  2QDL A;  2KGT A;  2A36 A;  1VQ4 T;  3CCU A;  1VQ8 Q;  4LDV A;  3JCM P;  2P0K A;  1XJW B;  2LJ3 A;  1VQ7 Q;  4M77 B;  3L2W A;  1D3B A;  3CBO A;  4M75 G;  2DK3 A;  1K9M R;  1TU0 B;  2AKK A;  3N5B B;  1MND A;  2CH4 W;  1ZUY A;  2EBP A;  4M7A E;  1ZX6 A;  4M78 A;  4PNO A;  2V8K A;  2K57 A;  1A0N B;  4B9X A;  3MET A;  1VQN T;  1WHH A;  1K0X A;  4MDW A;  3J7A F;  2BIV A;  1D0Y A;  3CD6 Q;  3RKY A;  5D7U A;  4YTL A;  4C5E A;  3QKJ A;  2VWF A;  2DAQ A;  4LN2 A;  3CCM A;  3HP9 A;  4FT4 A;  5GAO l;  4RG2 A;  3Q1J A;  1T3L A;  1U1S A;  2DD5 A;  2JXB A;  1AD5 A;  3PGG A;  1Q82 R;  5KCH A;  3CME T;  1UJY A;  2SRC A;  2DIQ A;  2ZZD A;  1Q7Y C;  3R6O A;  3CCJ T;  2P0Q A;  4LDU A;  3M4G A;  4C0D B;  4XTU A;  1OQK A;  1VYV A;  3CCR A;  3CCU T;  1S72 T;  3LYI A;  1PWT A;  2GFA A;  1VQP T;  2RMO A;  1UFF A;  1YBY A;  2K5I A;  2ZAE A;  5IXB A;  3CBM A;  3E9G A;  4L59 A;  2GCX A;  1WIE A;  4J9D A;  3RMQ A;  2CH4 A;  2LX9 A;  4R56 A;  4A4H A;  3MHX A;  3QBY A;  2DIG A;  4LD6 A;  4J9B A;  1M2O A;  2DL5 A;  4C8Q C;  4XAX B;  2KK4 A;  4HVU A;  1VQK T;  2YUP A;  2HD0 A;  3DB3 A;  2QA4 A;  5IHI A;  3CCE T;  3CCM T;  2RI5 A;  1SRL A;  4JDS A;  3O8V A;  4J7I A;  3OYC A;  2W0Z A;  2L3Q A;  2F2X A;  3PFS A;  2RJC A;  1H3H A;  3VS7 A;  3CCR T;  3QHS A;  4LE9 A;  3HRS A;  2DA9 A;  1KQS A;  1YIJ A;  2ED0 A;  1Q7Y R;  2IIM A;  3OQ5 A;  2KEA A;  4M75 C;  4JJC A;  3ASK A;  4ANJ A;  3QWY A;  1TS9 A;  4PJO G;  4FU6 A;  4RTW A;  3AT1 B;  2QEX A;  2DE0 X;  2GQV A;  2E5K A;  2RO0 A;  2O01 E;  3HPW A;  3A8O B;  3MP1 A;  3S6W A;  4M7D B;  2CP2 A;  4FYX B;  5FWC A;  1KIK A;  1XQH A;  2QA4 Q;  2K79 A;  3V7R A;  2E6Z A;  3P8D A;  3HL8 A;  3VS1 A;  1VQ5 A;  4JS5 A;  2D8H A;  1OX8 A;  2JM8 A;  4RTV A;  4L5G A;  4OML A;  3RKX A;  4D8K A;  2RJF A;  1KQS S;  2VV5 A;  4ESR A;  2CZ7 B;  4IUV A;  4C92 E;  1G8X A;  2ZCF B;  3EH2 A;  1EX4 A;  1YIJ Q;  3ZBD A;  3EFO B;  1WHL A;  3BDL A;  2L89 A;  4EPC A;  2FPE A;  2YRC A;  2O4X B;  2CGH A;  3RER A;  1KHI A;  3EG9 A;  3M53 A;  1ZSG A;  1ACM B;  1WHK A;  1KHC A;  5GAO n;  1OOT A;  1BI3 A;  2QEX T;  2PVD B;  2FL7 A;  4C5H A;  3TQ7 P;  1N5Z A;  1VQ5 Q;  4P5N A;  4OP0 A;  2FRY A;  4C8Q A;  5GAO m;  1V29 B;  1HYO A;  2K9G A;  1Z9Z A;  3LGL A;  4DBR A;  3UWN A;  3E1S A;  4CC4 B;  3CPF A;  1X6B A;  1YJN T;  3M0U A;  2Y90 A;  3G7Z A;  1BBZ A;  1YJ9 A;  2BE7 D;  4NOY A;  2NUT A;  4HCB A;  5GAO q;  1M2V A;  2GQI A;  1MV0 B;  2AIR B;  2P0P A;  2GBQ A;  3SB2 A;  1I5L A;  4O6J A;  2RI2 A;  4FYY B;  2PNI A;  3UAT A;  3ZL7 C;  2OX7 A;  2QQB A;  2RI3 A;  3QWX X;  1ZBX A;  2EQI A;  3OYB A;  2J06 A;  2ZPI B;  3H0I A;  2JT4 A;  4M75 A;  1OYX A;  2BZX A;  2NWM A;  3CQT A;  1QW1 A;  1IO6 A;  4A4F A;  2XU8 A;  3I55 Q;  4PJO C;  1KQ1 A;  1RI9 A;  5KYU B;  3PVQ A;  3OYE A;  4M78 D;  1WA7 A;  3VUB A;  3CEY A;  1RLQ C;  3VUZ A;  4XTX A;  3V8L A;  2CZ1 B;  1TH7 A;  2EKO A;  2LP5 A;  3HTR A;  4JRP A;  1KJW A;  4N4I A;  1ZBJ A;  3F70 A;  1YJ9 T;  1OI1 A;  2OTJ Q;  2PZ1 A;  4M77 E;  3A8L B;  1H3Z A;  5DM7 R;  1H64 1;  2AT1 B;  4JLI A;  3CXC P;  3M56 A;  2ZPG B;  4M7A G;  5GMK i;  2I2L A;  2YRV A;  4Z8A A;  1QKX A;  3LH5 A;  5LJ5 j;  3EGD A;  3REB B;  3QSU A;  2AKL A;  5CKE A;  4IKF A;  4QQD A;  2JTE A;  1RAI B;  4ZTJ A;  2L0A A;  3GBQ A;  3ULR B;  4C5G A;  3I56 A;  2DTI A;  4FT2 A;  1GCQ C;  3G1J A;  3URG A;  1Y7X A;  4IUU A;  1GL5 A;  2PVG B;  3OYL A;  4EDU A;  4BI8 B;  5LJ5 f;  3MO8 A;  1M27 C;  3CPW S;  3CCQ A;  1TUC A;  1NE8 A;  3PVL A;  3MEW A;  2LJ0 A;  1UHF A;  2LJ1 A;  3VYH B;  4A54 A;  1YHQ T;  3M0S A;  2P4R A;  1VQM A;  1OV3 A;  5GAM d;  2BZY A;  2FG0 A;  3EHR A;  4X34 A;  2KYB A;  1SEM A;  1MMN A;  4E7I A;  4F7U B;  5GMK m;  1UJ0 A;  5LJ5 g;  1K1Z A;  3VS3 A;  4J6X A;  3M55 A;  1EIF A;  4FSS A;  3VJP A;  4NS5 A;  1UEC A;  1M1K U;  4BAC A;  1YI2 A;  2JTM A;  2Z0W A;  3NFC A;  5C6S A;  4MZT A;  2HQE A;  3I56 T;  1OUL A;  1UGR B;  2MCN A;  2K6D A;  5GAN d;  1QWF A;  2LC4 A;  4QVZ A;  3CCQ Q;  2V1Q A;  2JMC A;  4F16 A;  3OYK A;  2DLP A;  2K3B A;  4RUG A;  3OA6 A;  2OAW A;  4BE0 A;  5GMK h;  1ZSZ B;  2GGR A;  1HD3 A;  5GAN 6;  3CCQ T;  3QZ5 B;  1HXD A;  1PNJ A;  3FIF A;  1E7O A;  2DD4 A;  1T0H A;  1Y57 A;  2ECZ A;  4IUP A;  1PC0 A;  2DET A;  1VQM T;  1UG1 A;  4GBQ A;  4CC3 A;  5HK0 A;  3PE0 A;  1MNE A;  4M7A C;  2DXC A;  4JZ3 A;  2P4T A;  2K3Y A;  1FXX A;  5KE2 A;  1YI2 Q;  3A8M B;  2M9U A;  1OX9 A;  2FRW A;  3L42 A;  1HSQ A;  3CCV T;  2CT4 A;  2MIO A;  1IRE B;  4M7D E;  3G4S Q;  4N4G A;  1UTI A;  3JCM h;  2DJZ A;  4II1 A;  1ZA1 B;  4C92 G;  5IHN A;  4AFU C;  1JBM A;  1IZ6 A;  1D0X A;  4AG2 C;  4C0G A;  5IHK A;  3INZ A;  2ZPH B;  4D6W A;  5GAM h;  1JU5 C;  4C8Q D;  3BDU A;  2ZPF B;  1WPY A;  2QQA A;  3FB9 A;  5I22 A;  5FRM A;  2EIF A;  1M8V A;  2O9V A;  4JRI A;  3V7S A;  4N4H A;  4AG1 C;  1X01 A;  2EFI A;  3L2Z A;  2LCC A;  2XG8 D;  5GAN h;  2K2M A;  2DTO A;  4EIK A;  3LGF A;  4E7Z A;  4ZN3 A;  2ZPE B;  2YXY A;  1X43 A;  2OAU A;  1W1F A;  3VYG A;  1VQO A;  2MOX A;  3M0R A;  4TVR A;  4MML A;  4FM4 B;  1SRM A;  2AK5 A;  3C95 A;  4M75 D;  2E1H A;  4OMO A;  3EH1 A;  2COZ A;  1UGP B;  4C0Z A;  1Q86 U;  4B6M A;  4MDX A;  5KYX B;  1M3C A;  2NUP A;  2NLU A;  4GLK A;  2JTF A;  3H9N A;  5FU7 B;  3RDV A;  5L23 A;  1Y07 A;  4PJL A;  3JV3 A;  1G3T A;  2H3E B;  1ZQ1 A;  4QQ6 A;  1OZ2 A;  5GJV B;  3E19 A;  1M1K R;  3TRE A;  1C1A A;  2DYI A;  4J9F A;  2RHY A;  2DVJ A;  2R57 A;  2DJQ A;  4A63 B;  4AT1 B;  1NEG A;  2LTO A;  2RHU A;  1VQ8 A;  1PD1 A;  1QLY A;  1YCS B;  3GPL A;  3QDF A;  2FEI A;  4QKU A;  4IIM A;  1S1N A;  1VQ7 A;  1BYM A;  2K5L A;  4RCC A;  3QUI A;  4LNP A;  1TOV A;  5DLQ E;  3GNG A;  2LQ8 A;  4M7A A;  2V8J A;  2KAF A;  4M4Z A;  4X9D A;  5KCO A;  1RL2 A;  1T0J A;  1JO8 A;  2PVO B;  3JCM b;  2P84 A;  1VQO T;  3M5A A;  4F7U F;  9ATC B;  2J7I A;  5GAN 5;  4J9I A;  4XQ3 A;  3P8B B;  1YN8 A;  3IQL A;  3M58 A;  2HQX A;  4C92 C;  2CRE A;  2LX7 A;  5GAN 8;  4M77 G;  2LQK A;  1YP5 A;  2HNI A;  3CMA Q;  4PFO A;  3GF5 A;  2HSE B;  3CPW P;  4BI3 A;  5A0G A;  3DLL A;  2ZPB B;  2HL5 C;  4QVD A;  3JB9 J;  2KRS A;  2CDT A;  2PUO B;  2JMA A;  2HDA A;  1D1A A;  1H92 A;  4JJB A;  3L2Q A;  5FU6 C;  2L8D A;  4M78 F;  1P92 A;  3CCL Q;  1VQ8 T;  2PTK A;  3SWN A;  2XK0 A;  2DBK A;  1NLO C;  4VUB A;  1VQ7 T;  2JVV A;  4RMO A;  1ZUU A;  2RN8 A;  2R58 A;  1R0B G;  1VA7 A;  1C0M A;  1LJO A;  3JCM c;  3CXC A;  2A7Y A;  3RUX A;  3FJP A;  4GLM A;  4DA4 A;  2EGC A;  1NZ9 A;  1U5S A;  3CC4 A;  2DZ9 A;  2RQV A;  3QJY A;  4PJO D;  2XD0 A;  3TVT A;  5LJ3 e;  3CD6 T;  2QXF A;  2DTH A;  2QDY B;  2C06 A;  3OMG A;  2VKN A;  1NM7 A;  5GAO p;  3JB9 H;  2MMP A;  1FX7 A;  4RTX A;  1JXM A;  2GNC A;  2WAC A;  2WSF E;  2WSC E;  3JAM E;  4J7F A;  3SFM A;  2VC8 A;  1Q86 R;  1NG2 A;  1RLP C;  2FVU A;  1HJD A;  3CXC S;  4C0F A;  4N0A C;  2DXT A;  3X25 B;  5CKF A;  3EG2 A;  1MMG A;  3LWH A;  3OS5 A;  2EGE A;  1WGS A;  4XU3 A;  3X26 B;  2QQR A;  3CC4 Q;  3MKD A;  3VS2 A;  2EYW A;  1OU8 A;  1WYX A;  3C94 A;  1V1C A;  2V26 A;  1YJW Q;  2X4X A;  5EG2 A;  4OMN A;  1SHF A;  3G6E A;  4C92 A;  3MP6 A;  3WVE B;  2D1X A;  3HRT A;  3M59 A;  4M77 C;  3L2U A;  2X4W A;  2CZ0 B;  1VQL A;  4HT8 A;  1Y0M A;  3OY9 A;  2B8A A;  1VUB A;  1GFD A;  1VIE A;  2KRM A;  4C5I A;  3QDR B;  2EWN A;  3PTA A;  3P8H A;  3V8J A;  1NLP C;  4HCC A;  1KK7 A;  1ZUK A;  1IGQ A;  2DZC A;  2M51 A;  4OMF B;  2DYB A;  3FEO A;  4J9E A;  1NPP A;  3MPU B;  3UT1 A;  3GNF B;  2X4Y A;  5J26 A;  3S3N A;  2XMF A;  3PMT A;  5HY6 A;  1CKB A;  4ZTF A;  3TSW A;  2M16 A;  6AT1 B;  3G6E Q;  1UHC A;  2QGG A;  5CQX A;  1AEY A;  2QA4 T;  4NL2 A;  4Z02 A;  2VXE A;  4C0D C;  1VQL Q;  4KRT A;  3OBY A;  2F2V A;  5LJ5 d;  2KI7 A;  4KUL A;  2RPN A;  5A2Q E;  1J3T A;  3V7C A;  2FZC B;  1JRI A;  1VIF A;  2X9H A;  4HCZ A;  2OI3 A;  4AMC A;  3BE3 A;  4O5V A;  4PJO B;  2QQ9 A;  5LJ3 j;  1N9R A;  3PIP A;  2DNU A;  4XK8 E;  4FCY A;  1YIJ T;  5IXF A;  3JRZ A;  5CQY A;  4AFZ C;  4N0A A;  1RAH B;  5KYY A;  2FB7 A;  2G6F X;  2QQS A;  1B34 B;  4BDY A;  2KMT A;  4C8Q F;  1IHV A;  5FW9 A;  2RA2 A;  1E6G A;  4HCK A;  4KGX B;  1PM3 A;  3NTK A;  2X3X D;  5D6Y A;  3V8K A;  5A0D A;  1JQQ A;  3EGX A;  1BCM A;  1OPL A;  1TUD A;  4BE2 A;  1WNL A;  2L3P A;  4M7A D;  3GIB A;  2LQN A;  1I81 A;  2O31 A;  3CC2 Q;  4OMM A;  5KYW B;  3VRY A;  3BW1 A;  2E3I A;  3PNW C;  3I55 A;  3M0Q A;  1AWX A;  5LJ3 f;  3E9F A;  2LNH B;  1VQ5 T;  3OSS C;  2YSQ A;  2YUO A;  1AZG B;  3EG0 A;  3UDC A;  2H3J A;  1W4S A;  3OS0 A;  1GBR A;  4J9C A;  3NGP A;  4KUI A;  1X27 A;  4M77 A;  2HCK A;  4M75 F;  1PRM C;  4E2F B;  4J8O A;  1CKA A;  2DBM A;  3OMC A;  2C0I A;  3M0T A;  2OTJ A;  5LJ3 g;  1O9S A;  4LUE A;  3VS5 A;  2R5M A;  4J5Y A;  1IB8 A;  1B07 A;  4F17 A;  2XKO C;  3JCM W;  3OYA A;  4M7D C;  5LJ5 h;  4ELY C;  3S3M A;  1WXT A;  1VQ6 A;  3A5Z B;  2YLC A;  5CR2 A;  3ER0 A;  4XU2 A;  2FZK B;  4ATO A;  1BIB A;  1DJ7 B;  3I55 T;  3LX7 A;  3O5Z A;  2X35 A;  3KFV A;  4HT9 A;  1X69 A;  2PQW A;  3S3O A;  3CCS A;  3NHN A;  2KT8 A;  4XTZ A;  4KH0 B;  2KY9 A;  3UF4 A;  1NJI U;  2OJ2 A;  4XTW A;  3J81 E;  3UPU A;  1R8O B;  2R5A A;  3PT9 A;  4V2S A;  1ABO A;  5KYN A;  1Y96 B;  3SHW A;  3D7S B;  1O75 A;  1UE9 A;  3G71 A;  4J6W A;  2QG9 B;  1RAA B;  2OTJ T;  2CSQ A;  1PSE A;  2A3L A;  5HKC A;  2YHT A;  5GAN 3;  3CPW A;  2QAZ A;  1VQ6 Q;  1KFZ A;  2X51 A;  1RAE B;  1X2K A;  2GF7 A;  2E10 A;  4OB1 B;  4PJM A;  1QVP A;  2DRK A;  4FYW B;  1BU1 A;  3I5R A;  3REA B;  4BUG A;  5CCA A;  1LOJ A;  2YRD A;  1BKB A;  2RQW A;  4FW2 A;  1VYT A;  3CCS Q;  2K2V A;  2LCL A;  1F1B B;  2ZGW A;  1KC8 C;  1GCP A;  2PU9 B;  3QJ6 A;  3DKM A;  1XOV A;  1N27 A;  1YWP A;  2M0O A;  5GMK e;  4EMK B;  3H6Z A;  4C92 D;  3G71 Q;  4D8D A;  2FPF A;  2LRQ A;  3I9Q A;  2LNV A;  3OW2 P;  3HFN A;  3JCM d;  1NJI C;  1BI0 A;  5I11 A;  1UUE A;  4KGZ B;  3FLG A;  2KR3 A;  2X4J A;  1X75 C;  3FDR A;  1RAF B;  3G71 T;  1PKS A;  2JUF A;  5FRN A;  4PJO F;  3L2V A;  4PK4 A;  2COY A;  2QI2 A;  3E2U A;  2X3W D;  4OB2 B;  4M7D A;  2DL4 A;  2L2P A;  4WTO B;  3MEU A;  3HFO A;  1WJR A;  1I8F A;  1NBE B;  8AT1 B;  3QYG B;  3ZEH A;  1M9S A;  1D3B B;  2HKQ B;  3G4S A;  3SEM A;  4PLI A;  3DLM A;  2HMA A;  2F2W A;  5GAM e;  2KYM A;  2KXD A;  5DY9 A;  1QMC A;  1OU9 A;  2D0N A;  2DX1 A;  2YUQ A;  3EFO A;  2MK5 A;  4M78 B;  4RKU E;  2WSE E;  2M02 A;  3EAE A;  2EQJ A;  3LLR A;  3RES A;  2O4X A;  4MZP A;  2EYY A;  3OYN A;  1IRX A;  2BKD N;  5CAI A;  3WVD B;  2E12 A;  1XNI A;  4PJN A;  2VB6 A;  5GAN e;  1G5V A;  1G83 A;  1X6G A;  1D0Z A;  4DEY A;  1QCN A;  5DLO A;  1NJI R;  1FMW A;  1QCO A;  4QQG A;  4FSX A;  4BE1 A;  1WZO A;  1X2Q A;  5GAN 2;  1WX6 A;  1WHJ A;  1M3A A;  1PSF A;  4J9H A;  1YI2 T;  3I5S A;  4OGC A;  2RQT A;  3EG3 A;  5L8R E;  2V8I A;  3U23 A;  1QWE A;  3SDZ A;  3G4S T;  1AT1 B;  1OEB A;  2RJE A;  4Y92 A;  2OTL A;  2DO3 A;  1FMK A;  5HCK A;  2CUB A;  2VYT A;  2LVM A;  4R55 A;  2BE9 B;  1WQ7 A;  1TTH B;  1GBQ A;  1Q81 U;  4OMQ A;  1TSF A;  1PRL C;  1Y71 A;  1RAG B;  2J05 A;  2CP5 A;  2ENM A;  2CZ6 B;  4LDX A;  3SWN C;  4JPB W;  4PFZ A;  2KQW A;  1K73 U;  2RK2 A;  1WI7 A;  4M77 D;  1VQ9 A;  2E70 A;  2K3X A;  4HXJ A;  3FJ5 A;  4HVW A;  2IG0 A;  5CO7 A;  3QZ9 B;  1WQW A;  3EG1 A;  5D6X A;  2ED1 A;  2EVR A;  3VRZ A;  1SF9 A;  2XDP A;  5KYU A;  4XTV A;  5I2M A;  1I4K 1;  3OYJ A;  2OTL Q;  1QVF A;  3OYD A;  2Y4X A; 
#chains in the Genus database with same CATH homology
 2ABL A;  1NG2 A;  1RLP C;  1N5Z A;  1HJD A;  2FRY A;  2RQR A;  4JZ4 A;  2V1R A;  3RBB B;  2DF6 A;  2K9G A;  1Z9Z A;  2HBW A;  3EG2 A;  4CC4 B;  2EGE A;  3R6N A;  1W6X A;  1X6B A;  1OPK A;  3VS2 A;  2EYW A;  3M0U A;  1BBZ A;  1WYX A;  1V1C A;  2GQI A;  1MV0 B;  1AWW A;  4JJD A;  4OMN A;  1NYF A;  2GBQ A;  1SHF A;  1WXU A;  2PNI A;  3UAT A;  1WDX A;  2SEM A;  3ZL7 C;  2D1X A;  2LZ6 B;  3H0F A;  3QWX X;  3VS0 A;  2EQI A;  2J06 A;  3H0I A;  2JT4 A;  1Y0M A;  4AFQ C;  2BZX A;  2NWM A;  1JEG A;  3CQT A;  1GFD A;  1IO6 A;  4F14 A;  2KRM A;  4RTZ A;  1NLP C;  2O2O A;  2VVK A;  3TSZ A;  2JS2 A;  1ZUK A;  4RTT A;  1RI9 A;  1M30 A;  3PVQ A;  2M51 A;  4RTY A;  1U3O A;  2M0Y A;  1WA7 A;  2DYB A;  2BZ8 A;  1RLQ C;  4RTU A;  4J9E A;  1FYN A;  2C0O A;  1SHG A;  3A98 A;  2YUN A;  2XMF A;  2LP5 A;  1I0C A;  1KJW A;  1CKB A;  3EHQ A;  1ZBJ A;  2B86 A;  3TSW A;  1AWJ A;  1UHC A;  4DEX A;  2PZ1 A;  2EYZ A;  1AEY A;  2LCS A;  1BB9 A;  3NPF A;  4KRT A;  2F2V A;  4WCI A;  4Z8A A;  4E6R A;  1QKX A;  3I35 A;  2KNB B;  3LH5 A;  2RPN A;  1H8K A;  4ZNX A;  1GCQ A;  1T3S A;  1J3T A;  3REB B;  3VS4 A;  1EFN A;  2L3S A;  2AKL A;  2OI3 A;  2ROL A;  2JTE A;  2I0N A;  2EGA A;  2DNU A;  2L0A A;  3GBQ A;  2BTT A;  3ULR B;  5IXF A;  3NMZ C;  4AFZ C;  1GCQ C;  1AWO A;  2G6F X;  4LUD A;  4HVV A;  1GL5 A;  2EPD A;  5FW9 A;  1M3B A;  1E6G A;  1G2B A;  2LMJ A;  4HCK A;  4K11 A;  2X3X D;  1ARK A;  4J9G A;  5ECA A;  1JQQ A;  1M27 C;  1B3Q A;  1OPL A;  1TUD A;  2RF0 A;  2L3P A;  4OMP A;  1TUC A;  1AVZ C;  2LQN A;  2O31 A;  4OMM A;  3VRY A;  3PVL A;  1K9A A;  5GJW B;  2LJ0 A;  1UHF A;  3M0Q A;  2LJ1 A;  1AWX A;  2EKH A;  2LNH B;  2YSQ A;  2YUO A;  3M0S A;  1AZG B;  3EG0 A;  2P4R A;  1OV3 A;  2BZY A;  2JW4 A;  2FG0 A;  2FO0 A;  1GBR A;  3UA7 A;  3EHR A;  4J9C A;  2KYB A;  1Z9Q A;  2KRN A;  3NGP A;  1RUW A;  3RNJ A;  1SEM A;  1GRI A;  1X27 A;  1W70 A;  1YNZ A;  1UJ0 A;  1K1Z A;  2HCK A;  3VS3 A;  1MV3 A;  1PRM C;  1CKA A;  2DBM A;  4FSS A;  2J6F A;  1UEC A;  1QCF A;  2C0I A;  3M0T A;  1ZLM A;  4LUE A;  3VS5 A;  1E6H A;  2MCN A;  2J6O A;  2DL3 A;  2K6D A;  1B07 A;  4F17 A;  1K4U S;  4AFS C;  1QWF A;  2AZS A;  2EYX A;  2V1Q A;  2JMC A;  1WXT A;  4F16 A;  2A08 A;  2DLP A;  2K3B A;  5IH2 A;  4RUG A;  4R0K A;  2W10 A;  2OAW A;  1BK2 A;  1QKW A;  2HEQ A;  2J6K A;  2GGR A;  1HD3 A;  2CT3 A;  1ABQ A;  2DRM A;  2KXC A;  1PNJ A;  1LCK A;  4X1V A;  2O88 A;  1E7O A;  1MUZ A;  1T0H A;  1Y57 A;  2ECZ A;  3O5Z A;  3KFV A;  2YDL A;  2KE9 A;  5EC7 A;  1X69 A;  3H41 A;  1UG1 A;  4GBQ A;  3NHN A;  2KT8 A;  4CC3 A;  3PE0 A;  1GFC A;  4JZ3 A;  2GTJ A;  3UF4 A;  3M0P A;  1M8M A;  1WLP B;  2OJ2 A;  2FRW A;  1HSQ A;  2HSP A;  1ABO A;  2CT4 A;  2MIO A;  1UGV A;  3SHW A;  2LQW A;  1UE9 A;  4CC2 A;  2GTO A;  2QDL A;  1UTI A;  2A36 A;  2K7A A;  2KGT A;  2O9S A;  2CSQ A;  5IHN A;  1AZE A;  4AFU C;  2LJ3 A;  4AG2 C;  1KFZ A;  4CC7 A;  4Z88 A;  1X2K A;  5IHK A;  2DRK A;  1JU5 C;  1BU1 A;  2YT6 A;  3I5R A;  1NYG A;  3REA B;  2AKK A;  2H8H A;  2CH4 W;  5I22 A;  4ORZ A;  2FPD A;  2RQW A;  1ZUY A;  2EBP A;  2O9V A;  1PKT A;  1VYT A;  1ZX6 A;  3UA6 A;  1A0N B;  2DL8 A;  4AG1 C;  1K0X A;  1PHT A;  1GCP A;  1XOV A;  2KBT A;  1YWP A;  2VWF A;  2K2M A;  4LN2 A;  2CSI A;  4EIK A;  2KRO A;  4D8D A;  2FPF A;  3I9Q A;  1T3L A;  1X43 A;  1W1F A;  2JXB A;  1AD5 A;  5I11 A;  2MOX A;  3M0R A;  1UUE A;  1UJY A;  2SRC A;  2KR3 A;  4Z89 A;  5FWB A;  1SRM A;  2AK5 A;  1VYV A;  1PKS A;  4OMO A;  1PWT A;  1M3C A;  2JS0 A;  1UFF A;  2RMO A;  2X3W D;  5L23 A;  2DL4 A;  3JV3 A;  2L2P A;  5IXB A;  5GJV B;  2DM1 A;  1WIE A;  4J9D A;  2DIL A;  1WFW A;  2CH4 A;  4J9F A;  1U06 A;  1UDL A;  2DVJ A;  2A28 A;  2DMO A;  2DJQ A;  4A63 B;  1NEG A;  3SEM A;  2EW3 A;  3THK A;  4J9B A;  2F2W A;  1QLY A;  1YCS B;  2KYM A;  3EGU A;  2KXD A;  2A37 A;  2DL5 A;  2FEI A;  4HVU A;  4IIM A;  1S1N A;  2YUP A;  2D0N A;  2DX1 A;  2YUQ A;  4LNP A;  5IHI A;  2CUD A;  1SRL A;  4M4Z A;  1NEB A;  1T0J A;  1JO8 A;  2W0Z A;  2L3Q A;  2EYY A;  2F2X A;  1H3H A;  1SPK A;  2J7I A;  4J9I A;  3VS7 A;  2C0T A;  1YN8 A;  1G83 A;  1X6G A;  3IQL A;  4DEY A;  4LE9 A;  1CSK A;  2DA9 A;  2CRE A;  2LX7 A;  2ED0 A;  2IIM A;  2RNA A;  1YP5 A;  1X2Q A;  2KEA A;  1WX6 A;  1WXB A;  2RQU A;  1M3A A;  4J9H A;  3I5S A;  4JJC A;  3QWY A;  2ROT A;  2KRS A;  2CDT A;  2RQT A;  3EG3 A;  3U23 A;  2JMA A;  4RTW A;  2HDA A;  2DE0 X;  1QWE A;  1YWO A;  2E5K A;  1I07 A;  1H92 A;  4JJB A;  3C0C A;  5FWC A;  1KIK A;  2K79 A;  1OEB A;  2PTK A;  4Y92 A;  5HCK A;  1FMK A;  3H0H A;  2CUB A;  1VYU A;  2DBK A;  1NLO C;  1TG0 A;  3VS6 A;  3VS1 A;  1ZUU A;  2RN8 A;  1GBQ A;  2D8H A;  4OMQ A;  2JM8 A;  4RTV A;  1VA7 A;  1PRL C;  2ESW A;  1AOJ A;  4OML A;  2J05 A;  4D8K A;  2ENM A;  4ESR A;  2JM9 A;  2DL7 A;  1KSW A;  4GLM A;  4JPB W;  1JXO A;  2EGC A;  1WI7 A;  1U5S A;  2FPE A;  4HXJ A;  3FJ5 A;  1K0S A;  4HVW A;  2RQV A;  4IIO A;  3TVT A;  3EG1 A;  2ED1 A;  2VKN A;  1NM7 A;  2EVR A;  3VRZ A;  1ZSG A;  4RTX A;  4QT7 A;  1JXM A;  1SSH A;  2GNC A;  2D8J A;  2KT1 A;  2NUZ A;  1K76 A;  1OOT A;  1I1J A;  2AZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...