1UHFA

Solution structure of the third sh3 domain of human intersectin 2(kiaa1256)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
GSSGSSGGEEYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVKPKDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERSECTIN 2
publication title Solution Structure of the third SH3 domain of human intersectin 2(KIAA1256)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uhfA00
1KSWA 1W6XA 3IQLA 1M8MA 1A0NB 2DRMA 2GQIA 2KYBA 2ESWA 4DEXA 4CC7A 1M3AA 1AWWA 1K76A 4JJBA 1UFFA 1AWOA 1VA7A 2J6FA 1MV3A 1CKAA 3RBBB 4OMLA 1JU5C 2DX1A 2RQWA 1PKTA 2KT1A 1QKXA 1BK2A 1GRIA 4F14A 1H92A 2RMOA 1PNJA 2DF6A 1WXUA 2O9SA 4E6RA 2EBPA 1NLOC 1E6HA 2J6OA 3M0TA 4OMMA 1UHCA 2DL7A 4Z89A 1UUEA 2KXDA 1K9AA 4J9DA 4LNPA 1WX6A 2OAWA 1VYTA 4X1VA 2KRNA 2NUZA 2IIMA 1JXMA 1GBRA 1SRMA 2EGEA 3NPFA 1NYFA 2SEMA 1N5ZA 2FRYA 2GTOA 1PKSA 4M4ZA 4D8KA 2EYXA 2X3WD 2VWFA 5EC7A 4IIMA 5IHKA 1WYXA 3I5RA 2O31A 4HCKA 3KFVA 1UJ0A 2OJ2A 4K11A 3UF4A 1ZUYA 2NWMA 3UA6A 1T0JA 4Z88A 1OV3A 1OPKA 3EHRA 4GLMA 4HVWA 1BU1A 1G2BA 1NEGA 3PE0A 3EHQA 3THKA 2E5KA 2RPNA 1MUZA 2AK5A 2YUNA 1ZUUA 2HCKA 1X27A 1X6BA 3VRYA 1NLPC 4A63B 2JM9A 2CH4A 1JXOA 2I0NA 2K7AA 3VS5A 1ZUKA 2BZXA 1UHFA 1X6GA 2GBQA 4J9FA 2DMOA 2RQTA 4J9HA 2VVKA 1ZX6A 4HXJA 4AFQC 1SPKA 1AZGB 2MIOA 3UA7A 4HVUA 1B07A 2D8JA 1AZEA 2C0OA 1U06A 1ABOA 2AZSA 2W10A 3R6NA 1TG0A 1W1FA 4FSSA 1UE9A 1G83A 3SHWA 2DRKA 2ROLA 2M0YA 1SHFA 2GGRA 4LUEA 3VS7A 4RTVA 1IO6A 1YWPA 1BBZA 4J9EA 2PZ1A 1HJDA 2DBMA 1MV0B 1TUDA 1EFNA 2ECZA 3EG1A 5GJVB 1FYNA 5IHNA 4J9GA 2FPEA 2M51A 2K3BA 4OMPA 3C0CA 1AWJA 1VYVA 1GCQC 2EGCA 3PVLA 2CSIA 1U5SA 1AOJA 2L2PA 4JJCA 1X2QA 3VS0A 2EYWA 4KRTA 4AFSC 1K0SA 1ABQA 2KYMA 5IXFA 2HDAA 3M0SA 1GFDA 4RTTA 2FO0A 2KEAA 2V1QA 2EQIA 4EIKA 2LJ3A 4F17A 5ECAA 3U23A 3RNJA 2FRWA 2JTEA 3I9QA 1KFZA 2KRMA 3CQTA 3JV3A 1X43A 4ZNXA 5IXBA 4JPBW 2G6FX 1V1CA 2A08A 2RF0A 2CSQA 2ENMA 2ROTA 1PRMC 2BTTA 2D8HA 5L23A 2LJ0A 2L3PA 1KIKA 1TUCA 1NYGA 3VS4A 2EGAA 2AZVA 4RTXA 2SRCA 1VYUA 2DVJA 3QWYA 5FW9A 1M30A 2DLPA 2ED0A 1ZSGA 2HEQA 4Z8AA 1H8KA 2DL3A 1X2KA 2F2XA 2AKLA 2LNHB 1RLPC 4GBQA 1T0HA 4Y92A 1KJWA 3LH5A 2LQNA 2KRSA 3QWXX 4CC3A 1UG1A 1YP5A 2BZ8A 1UGVA 1QLYA 2K2MA 2YUPA 1AEYA 4RTUA 1NM7A 2KXCA 3ULRB 2DBKA 2DNUA 1WXTA 1M27C 4RTZA 5I11A 1UJYA 1OEBA 1WFWA 5IH2A 1ZBJA 1CSKA 1J3TA 1RI9A 3A98A 1W70A 1RLQC 2PTKA 2J06A 1PWTA 2FEIA 4D8DA 2RNAA 4ORZA 1GCPA 1M3CA 2YSQA 2YUQA 3ZL7C 4CC2A 2HBWA 4JZ4A 4J9BA 2O9VA 1UDLA 3FJ5A 1WI7A 2A37A 4ESRA 4RUGA 1PRLC 3I5SA 1Z9ZA 2XMFA 3UATA 5HCKA 2ED1A 2B86A 2J7IA 4J9IA 2CUBA 4QT7A 1H3HA 4JZ3A 1AWXA 2H8HA 2K6DA 5FWCA 2LMJA 1GCQA 2DM1A 1QWFA 2K79A 1X69A 4RTWA 2X3XD 3PVQA 1AD5A 1YCSB 1WLPB 1ARKA 1OOTA 2LCSA 3EGUA 3H0FA 2W0ZA 2DL8A 2RQVA 1WA7A 4OMQA 2YT6A 2RQUA 5IHIA 2RN8A 5FWBA 4OMOA 2ABLA 1B3QA 2PNIA 2D0NA 3M0UA 3TSZA 2DA9A 2MCNA 2MOXA 3M0QA 3REAB 2EKHA 2GNCA 3M0RA 2KROA 5GJWB 2YUOA 2O2OA 3VRZA 1BB9A 2VKNA 1I1JA 3EG2A 1JO8A 2DILA 1WIEA 2D1XA 4OMNA 1GFCA 2LX7A 3SEMA 2DL5A 2KT8A 3H0HA 2KGTA 1S1NA 1Z9QA 1XOVA 2J05A 2KBTA 2HSPA 2JW4A 4IIOA 2EW3A 1YWOA 1SEMA 1NG2A 1UECA 2CREA 2CDTA 2DJQA 2RQRA 2LP5A 1I0CA 1JQQA 4JJDA 1E6GA 1SSHA 2BZYA 2L0AA 1WDXA 2C0IA 4DEYA 1GBQA 3VS1A 1U3OA 4LUDA 1SRLA 1M3BA 2L3SA 2EPDA 2YDLA 1JEGA 2J6KA 1Y0MA 2DE0X 4RTYA 2JS2A 2JMAA 2CT4A 3VS6A 2JT4A 1OPLA 4AFUC 2QDLA 2L3QA 1ZLMA 2LJ1A 2FG0A 3VS3A 2O88A 1AVZC 3EG0A 2F2WA 1K4US 1QWEA 2GTJA 1YNZA 2FPFA 2LZ6B 2K9GA 2EYZA 3TSWA 1GL5A 1CKBA 3I35A 4F16A 4AG1C 3VS2A 3TVTA 2EVRA 2DL4A 2CT3A 2A36A 1Y57A 1UTIA 2CUDA 2KR3A 3NMZC 1RUWA 1WXBA 3NHNA 3H41A 1PHTA 3NGPA 4LE9A 4HVVA 4AFZC 1T3SA 2DYBA 1HD3A 3EG3A 1LCKA 1T3LA 2JS0A 5I22A 1QCFA 1E7OA 3GBQA 2LQWA 3REBB 2EYYA 3H0IA 4J9CA 2CH4W 4LN2A 2KNBB 2KE9A 2JM8A 1YN8A 1SHGA 3O5ZA 4AG2C 2OI3A 2C0TA 2F2VA 2JXBA 1HSQA 3M0PA 2A28A 1NEBA 1K1ZA 4R0KA 2JMCA 2P4RA 2AKKA 1QKWA 4WCIA 1K0XA 1FMKA 4CC4B 1I07A 2FPDA 2V1RA
chains in the Genus database with same CATH superfamily
1ZA1B 1W6XA 2VUBA 3E9FA 2ATCB 1A0NB 2KYBA 1D1CA 4M78D 1H3ZA 4DEXA 3OA6A 1K9MR 3CC2Q 4CC7A 1M3AA 3JB9D 1AWWA 2VB6A 3OB9A 4JJBA 5GMKl 1AWOA 1VA7A 4OF1A 1EIFA 1MV3A 4J6XA 3RBBB 3HSBA 1LNXA 4QKUA 4C8QD 4M77B 2KT1A 2RD1A 2CP6A 4FW1A 1BK2A 4F14A 2DF6A 1RACB 5KCHA 1E6HA 5D6YA 1OZ3A 2E4HA 3G71Q 2DL7A 1XNIA 4Z89A 2KXDA 3MP1A 1YJWQ 4J9DA 3JAME 4KUDK 4LNPA 9ATCB 1VYTA 3JRZA 4X1VA 1FMWA 4FM4B 2IIMA 3ME9A 1SRMA 3JCMW 2SEMA 3M57A 3I55A 5D6WA 4E7HA 2QQBA 4GLKA 1M5Q1 1EX4A 2IPOB 4JLIA 3CC7T 4V2SA 4IIMA 5GAMd 4C92C 1VQ9A 4HCKA 5GAN5 3RMQA 1YJ9A 4M78A 1ZUYA 2NWMA 5LJ3d 1VOMA 3P8DA 5KYWA 1NE8A 4ZTFA 3S3OA 3L2VA 4C8QA 1NEGA 3PE0A 1WQWA 3CMAQ 3MEVA 4N4GA 2RPNA 2AK5A 4BI3A 5KE2A 1WHLA 3G7ZA 1D09B 1NLPC 4CRIA 4A63B 1GXIE 2K7AA 2V8KA 3RKWA 2GBQA 3CCRQ 3QJYA 1ZA2B 2HQEA 3L2QA 1SPKA 2JVVA 1Y96B 4QVCA 3UA7A 1NJIC 4LDUA 2NUPB 1VQ8Q 1M1KU 1AZEA 4JRPA 2C0OA 1U06A 2E64A 2QTXA 3OYAA 3GNGA 4PJOD 1X01A 2JOYA 4II1A 2DRKA 2F1LA 2P84A 3EGDA 1JJ2A 1IO6A 1BBZA 3MJXA 4HKEA 2NUTB 4M7AB 3X25B 1VQNT 2DBMA 2CP3A 2VASA 5C6SA 2JZ2A 1TUDA 1KK7A 2E1HA 3HRUA 5GAOm 5GJVB 4BACA 4J9GA 2FPEA 1UGQB 1N6AA 5A0LA 3OSVA 4EMHA 5GMKi 4FL6A 1AOJA 1WGSA 2M1HA 3CCQQ 2HSEB 3L2ZA 4HCZA 2HNIA 1RI0A 2EYWA 3JCMJ 1SSFA 4KRTA 4AFSC 2HKNA 2Y4XA 5IXFA 4FSXA 1Q82C 4KGXB 4C92F 4PFZA 1IGUA 5LJ5h 1X75C 3RNJA 3JV3A 1X43A 3TU4K 2FVUA 4PJOA 2A3LA 2QQSA 4JPBW 2G6FX 3CC2A 2XDPA 3I56Q 2ROTA 2OTJT 1O9SA 3CD6Q 3CC4T 1K8AC 1KIKA 2QQRA 1YJNT 1IZ6A 2DXBA 2DVJA 3QWYA 1M30A 1IHWA 3G71A 2DLPA 4A4FA 2HEQA 4A4EA 1YJWA 3HHTB 1D0XA 3HRTA 2AKLA 1WJRA 3O8VA 4Y92A 1KJWA 3LH5A 2LQNA 4JJNK 1UG1A 2FHDA 5GANf 4FIBA 3HTRA 1TTHB 2DTOA 3EAEA 4RTUA 3JCMV 2KXCA 2DBKA 1G3TA 4ZGJB 2BKDN 1WXTA 4PJOE 3WVEB 2I2LA 2MYSA 3A8GB 4PLIA 3V7SA 2QI2A 4RCBA 1RI9A 1KHCA 1RLQC 2EIFA 1WHHA 2PTKA 1K73C 5GAOl 1PWTA 3META 4QVZA 1U1TA 2RJFA 4ME7A 4ORZA 5GANe 3S6WA 1KD1C 2HBWA 5KYUA 2PQWA 2RI3A 2A37A 3CMAA 3RR6A 5KYXB 5CKFA 3EFRA 4ESRA 1D3BA 4RUGA 3OYNA 1VQKT 2ED1A 1ZSZC 2B86A 2QEXQ 1H3HA 5GMKe 1Q86C 3TCJA 5FWCA 4BE1A 1GCQA 1VQLT 2EYQA 4FW2A 1IGQA 2DVEA 2WACA 1AD5A 4JDSA 1YCSB 2HQXA 1WLPB 3CCRA 3UDCA 3FJPA 3EGUA 3VUBA 2RQVA 2EQJA 1VQ8A 3RIRA 4OB3B 2VGNA 2HL5C 5IHIA 3EGXA 5CVIA 2QA4T 2CZ6B 2OX7A 2K4YA 2P4TA 2MCNA 2O01E 2CS7A 3FLGA 2P0QA 2PUKB 5GAN7 2EKHA 4KUIA 2RI5A 3M4GA 1I4K1 2E6NA 1TWBA 2XIDA 2DILA 1WIEA 2KI7A 2ZPBB 3GIBA 2D1XA 4C5EA 1GFCA 2LX7A 2K5FA 1BCMA 3L2RA 3CCQA 2KGTA 2YWWA 4Y28E 3EG9A 2QG9B 1YIJT 3PT9A 4C0DB 1BCOA 1NG2A 3GF5A 2CREA 3PTAA 5KYWB 3HRSA 3X24B 2LDMA 4JJDA 2L0AA 1WDXA 4CI0C 2C0IA 4AT1B 1RADB 4C8QB 2OAUA 1Q7YC 3E19A 3JCMf 1TSFA 3LGLA 1TU0B 3BW1A 3CCVT 3KUFA 3NTHA 2RO0A 2QDLA 1OX8A 2L3QA 3I56A 3OBYA 2O88A 1AVZC 2F2WA 4NS5A 3CD6A 4RG8A 2MK5A 5HK0A 3VJPA 3OYEA 2QTVA 2E6ZA 5L8RE 3JCMh 2EYZA 3BE3A 2XDBA 1MMAA 4XU2A 1GL5A 3JCMe 2QK0A 1XTDA 4F16A 2DL4A 2X4JA 2CT3A 1OU8A 1UGPB 1O75A 2KR3A 1RUWA 3JCMc 3SWNC 4PL6A 4AFZC 1S72T 1YITT 3EGDB 5GAMj 4XQ3A 2DYBA 4OGCA 3A8MB 1HD3A 3EG3A 2QGGA 5LJ3j 1KC8U 1E7OA 1OZ2A 3GBQA 1BI0A 2LQWA 2GF7A 2ZPEB 1XQHA 1SHGA 3O5ZA 4BDZA 4A4HA 2OI3A 2F2VA 1WPYA 2JXBA 4E7SA 1VQOT 4C92D 1VQ4T 2WSFE 4X9CA 4OGEA 2P4RA 2AKKA 3C4SA 4ZN3A 1HYOA 2KDSA 2LCLA 2X4YA 2KY9A 3C94A 3BDLA 3NFCA 4PNOA 1UGSB 5IN1A 3VYGA 3IQLA 1M8MA 3RKXA 2QEXA 2DRMA 2RHZA 2GQIA 5CIUA 2ESWA 1YI2Q 2ZPHB 1CKAA 4PJOB 4F7UE 5GAN4 3M53A 1PKTA 5HK3A 1H92A 2CP5A 4FT2A 1WXUA 2J6OA 1UHCA 3VV0A 4DBQA 2WSEE 3G6ET 1M90C 3RERA 3CBPA 2HKQB 3LW5E 3NPFA 2DK3A 1N5ZA 4C92A 2R57A 3QIIA 5KH6A 2EYXA 2VWFA 5EC7A 1LJOA 2KQWA 2GCXA 1RAFB 3VUZA 4M77C 5AT1B 3OYLA 3KFVA 1UJ0A 6AT1B 2OJ2A 4BB7A 1IXDA 4M77G 3UA6A 2RJDA 1U8RA 3A5ZB 3GOXA 4ELZC 1MHNA 1JRIA 4EDUA 1BU1A 2LTOA 3F70A 3THKA 3VKIA 1I8FA 2VV5A 2HCKA 4BUGA 1X27A 1KC8C 3CC7Q 5KYUB 4HCBA 4LDXA 2COWA 2VYTA 2Y90A 2OTLT 3V7CA 4M7DE 1D3BB 2X51A 4BI4A 5A2QE 3OYKA 1X6GA 2BIVA 2RQTA 4AFQC 3E9GA 3G4ST 3MPUB 2YRCA 4HVUA 1B07A 3N5BB 4DOVA 2ZCFB 5GAMf 2AZSA 5DY9A 2EQMA 1Q81C 4GY5A 1N8RR 4M75A 1W1FA 1UE9A 4KGVB 2A7YA 1G83A 3SHWA 4IUQA 3EGXB 8ATCB 1SHFA 2GGRA 4LUEA 2D9TA 4QQDA 4IUTA 1D0YA 2RB6A 3QSUA 1MNDA 1HJDA 1VIEA 1NJIU 2EJGA 2ECZA 2EQUA 2X4WA 4OMPA 5GAMh 3M54A 1AWJA 5GAMe 1VYVA 4F7UG 2CSIA 1RAIB 2DXUA 5LJ3h 2GFAA 4JJCA 1X2QA 1SF9A 2RJCA 4MDWA 3OS0A 4OB2B 4FYYB 1M2OA 3CCJT 3R6OA 4ATOA 1TH7A 1ABQA 5A0DA 2RI2A 3EG9B 3QYHB 4M75E 1GFDA 3DLMA 4EIKA 4M77F 2MAMA 5ECAA 4M7AC 2JTEA 4ZN1A 3L2UA 3CQTA 3EFOA 4M7AG 2K5IA 2QDYB 4ZNXA 1YI2A 2A08A 3EH2A 2RF0A 2ZAEA 4DA4A 3ZEHA 3NTIA 2RK1A 4BD3A 1Q82U 3DB3A 3H8ZA 1TUCA 1NYGA 2AZVA 4RTXA 2AT1B 3TQ7P 2SRCA 1VYUA 4LD6A 4OP0A 3HP9A 4Z8AA 1X2KA 2F2XA 2NYSA 2LNHB 1RLPC 1VQ7T 2KRSA 4CC3A 1UGRB 1YP5A 2BZ8A 1UGVA 1K8AU 5I21A 1AEYA 1C0MA 4B6MA 1NM7A 2OTJQ 4N0AA 3ULRB 4KH1B 4M7DG 3JCMb 3CC4Q 4PFPA 3G1JA 3NTKA 1YJNQ 4XAXB 3RDVA 5I11A 1OEBA 1WFWA 1VQ5T 5IT9E 4QW2A 1ZBJA 4A54A 3INZA 4J8OA 2V8JA 4RG2A 4F7UB 2MWPA 4R56A 4D8DA 2DPPB 4RMOA 3OYFA 3A1PA 2YSQA 4M78E 3PNWC 2LCCA 1ZSZA 4JZ4A 4IURA 1ZBXA 1PD1A 3CC7A 4C8QE 1PRLC 3DB4A 1K73U 1FXXA 2J7IA 4J9IA 4QT7A 4B9WA 3PMTA 4N4HA 2H8HA 2K6DA 4EPCA 3A8OB 1RAAB 4FYWB 2L8DA 2E10A 1KD1U 1QWFA 1VUBA 4L6V5 2X3XD 2FZCB 5LJ5f 2Y4YA 1ARKA 1DJ7B 2LCSA 3GNFB 3H0FA 2W0ZA 2O4XA 3OYDA 4M7AF 5CQYA 3GP8A 2DFUA 4N4IA 2E3HA 2RQUA 1Q86U 4E7KA 2RN8A 5FWBA 4A4KA 1VQKQ 2D0NA 3M0UA 2V26A 2DA9A 4PJNA 4PFOA 1QVFA 3M0QA 4EMGA 4J5YA 2KROA 1VQLQ 4IKFA 5GJWB 1R0BG 2O2OA 3VRZA 4XTZA 2COZA 1BB9A 1BIAA 1V29B 2K2VA 5LJ5e 3CPWS 4C92B 3CPFA 1I5LA 4M7DB 1D1BA 2HZYA 3OMCA 2QA4Q 2DL5A 2VXEA 3M4YA 3HL8A 2XKOC 3H0HA 5FROA 1S1NA 2RHXA 1Z9QA 4Q5WA 2HSPA 3SD4A 4IIOA 1YWOA 1SEMA 2K3XA 4JUVA 1ZQ1A 2DJQA 2LP5A 1I0CA 1JQQA 2M9UA 1RABB 2RK2A 3VS1A 1SRLA 3AT1B 2EPDA 2YDLA 1JEGA 3CCLT 4RCCA 2R5AA 2BE9B 1Y0MA 3FIFA 1G3SA 1ACMB 2CT4A 2JT4A 1OPLA 4AFUC 1ZLMA 2F69A 4EMKC 5GAOn 3JB9J 1QWEA 2DJZA 3J7AF 1D1AA 1Q7YU 3JCMP 2E12A 4NL3A 3LH0A 4C0DC 2LZ6B 2FB7A 1YBYA 4M78G 4XTYA 2L89A 2LC4A 1CKBA 4DBFA 2CP2A 4AG1C 3VS2A 4J6WA 1VQMT 3OYHA 1Y57A 4M75B 4C8QG 3NHNA 4Z02A 1PHTA 1LVKA 2E41A 2DXTA 3CC4A 1YJNA 2JS0A 1T3LA 4MDXA 2CH4W 3HPWA 4UC4A 2KE9A 2ZGWA 3LGFA 1B34A 2C0TA 2P0PA 5FU6C 1HSQA 3M0PA 1NEBA 2DZ9A 1S72Q 1YITQ 1QKWA 3OYIA 1FMKA 1C1AA 1I07A 2FPDA 3JCMX 1KSWA 3VYHB 2ZZDA 3E2UA 3C95A 3QO3A 2MPXC 2BUDA 1K76A 5C0MA 2J6FA 4BY6C 4LD9K 5AYFA 3P8HA 1WNLA 1N8RC 1JU5C 4BE2A 1VQOQ 4D6WA 1VQ4Q 5GANd 1GRIA 2RMOA 2O9SA 5HKCA 3OYGA 1LPLA 1UUEA 3OY9A 1VQKA 3A8HB 4KT0E 2PVGB 3OW2A 3CCET 4M78B 1I5OB 2B8AA 2K57A 1B7TA 1GBRA 3UPUA 5J26A 1VQLA 3QPHA 4WTOB 1K9MC 3OS1A 3CXCS 5KYNA 5HY6A 1VQ6T 3CCUT 4PJOC 3MEAA 5IHKA 3CCST 4PJOG 2XU8A 1M90U 4K11A 3UF4A 2QA4A 1PD0A 3LWIA 1M9SA 3LLRA 3G6EQ 3MP6A 1OV3A 3H9NA 4JRKA 3EHRA 4GLMA 4E7LA 1M2VA 4HVWA 1G2BA 5FU7B 4KGZB 1MUZA 3CXCP 1ZUUA 1X6OA 3VRYA 2PVDB 3OYYA 4HT9A 3S3NA 1VQPT 1OU9A 2DD4A 1M8VA 3MKDA 3GPLA 3PMIA 2BZXA 3L42A 1UHFA 4J9HA 2VVKA 4HXJA 5CKHA 3RMSA 1M1FA 1AZGB 1OYXA 2R5MA 2CZ7B 2D8JA 2PVOB 1ABOA 2W10A 3R6NA 1TG0A 2O4XB 2CZ1B 4FSSA 3JCMQ 1PSFA 1Y7XA 2ZPGB 2OTLQ 2ROLA 1YHQT 2M0YA 2XHCA 3LYIA 1PC0A 3UWNA 5KYYA 1SKUB 1YWPA 1Q82R 2PZ1A 2RHIA 4PJLA 1MV0B 3E1SA 1EFNA 1Q81U 3EG1A 3G4SQ 5LJ5g 7AT1B 3BFMA 2M51A 2K3BA 4E7JA 1GCQC 3PVLA 2JTMA 2L2PA 3FRNA 4A4GA 3OS5A 2DERA 1KQSS 5IAYA 1KG1A 2X9HA 2LX9A 2KMTA 3WVDB 3P8BB 2XICA 4NL2A 1K0SA 3FEOA 2KYMA 1WHMA 3PIOA 5DM7R 4PJOF 1S72A 4RTTA 3M56A 1YITA 2DIGA 2KVQG 2EQIA 4QVDA 4F17A 3L1AA 3CBMA 1KFZA 2DEQA 3CBOA 1OULA 5CAIA 3VU3C 4LXCA 3X26B 1V1CA 2FYKA 5M9OA 2ENMA 1KQSP 1D0ZA 1M1KR 3BY7A 3CCJQ 1M4ZA 4JS4A 2EQKA 2D8HA 2RHUA 1VQOA 1VQ4A 3VS4A 4C0FA 3CMET 2FZGB 1ZSGA 4FYVB 5GAOq 2DL3A 2LT4A 1T0HA 1KD1R 4PJJA 1WZOA 4AMCA 1EZZB 3QJ6A 5GANg 3UT1A 1BIBA 4PJMA 4C0ZA 1JB0E 3CCMT 2K2MA 4ELYC 4E7ZA 5I2SA 2YUPA 4PK4A 4C5IA 1QP2A 3LWHA 1QVGS 2DEUA 1JBMA 3T9NA 4JS5A 4XTXA 1NPRA 3CEYA 4C92E 1UJYA 4ANJA 5IH2A 1CSKA 3L2WA 2QXFA 3QBYA 3LX7A 1XJWB 2JJ9A 3A98A 1W70A 2YRVA 1QMCA 2J06A 1VQ7Q 2FEIA 3G6EA 2RNAA 1R8OB 2XDDA 2QQ9A 1M1GA 1M3CA 3ZL7C 2L5QA 1B34B 3H6ZA 1UDLA 3FJ5A 1WI7A 1QVGP 4XU0A 5LJ3f 2DD5A 3I5SA 2XMFA 1VQ5Q 4L5GA 4YTLA 4BI8B 4E47A 2DO3A 4JZ3A 5GAOp 2DM1A 3I55T 2K5LA 3PVQA 4HA8A 3HFOA 3QZ9B 3TREA 1PCXA 1WA7A 2LT1A 3DKMA 1VQ9T 5GAN3 1YJ9T 2C06A 5LJ3e 4OMOA 2ABLA 1N9SA 4O6JA 2X35A 3TSZA 3MO8A 4LDWA 1YFNA 5FLXE 1FX7A 2OTLA 2EFIA 2GNCA 3M0RA 1VQNQ 5CCAA 1MGQA 4J6YA 1RAGB 1Q7YR 2VKNA 5LL6S 3EG2A 2CKKA 3G4SA 4LDYA 1QCNA 1WQ7A 3SEMA 3M5AA 4HCCA 2XI9A 2KBTA 3M59A 2MF2A 3OQ5A 2CDTA 1P92A 2RQRA 4ZGDB 2IVWA 2BZYA 2EWNA 5GAN6 1GBQA 1M2VB 2ZPIB 4EMKA 3JCMg 1R77A 2L3SA 2P0KA 4XTUA 2DE0X 4RTYA 3SB2A 4MZPA 4M7DC 1RAHB 4MZMA 1PG5B 4FT4A 4C92G 5CKDA 3S3MA 5GANj 4C5GA 3D7SB 3CCJA 3OS2A 2GTJA 3Q1JA 1YNZA 1PSEA 2FPFA 2NLUA 1QP3A 2DIQA 4ZGEB 5KCOA 2K9GA 3V8KA 5GMKj 2GFUA 2HAXA 3I35A 3CCLQ 5D7UA 3TVTA 2QAZA 2M0OA 5J3BA 2CUDA 3NMZC 4F7UF 1WXBA 2PUOB 2MMPA 4JRIA 1RL2A 3MHXA 5KYYB 5CR2A 2VXFA 1LCKA 4IUUA 5I22A 3EH1A 4DBHA 2EYYA 4P5NA 4BE0A 3H0IA 4LN2A 3CC2T 2KNBB 2JM8A 3FC3A 3WXMB 4AG2C 1VQ7A 5GAN2 2JUFA 1C6VX 1VQMQ 2VC8A 1UB4A 1OX9A 1W2BS 4R0KA 1IREB 2F5KA 1K0XA 1V76A 4M75C 4CC4B 3G71T 3OSSC 2CYZB 3OYJA 2FL7A 2V1RA 2WSCE 1YJWT 4DOWA 1BI2A 1M90R 4M75G 5D6XA 1VQ5A 3QG1A 1KQ2A 1IB8A 1WJQA 3PFSA 3CXCA 3C12A 1UFFA 4LDVA 4PLLA 1WHGA 4QQGA 4OMLA 2DX1A 2MI6A 2RQWA 4A53A 1QKXA 2L3RA 4XK8E 1PNJA 1WHJA 1W2BP 4E6RA 2EBPA 1NLOC 4OMMA 3M0TA 1G3YA 2DZCA 1K9AA 5FRMA 3KXTA 3X20B 1WX6A 2OAWA 2EJFA 2KSSA 4M7DF 2KRNA 2NUZA 1JXMA 1ZHIA 3JSCA 4RKUE 3J81E 1N8RU 2EGEA 1VQNA 1NYFA 1RAEB 2FRYA 1KC8R 2GTOA 1PKSA 3CMAT 4M4ZA 2DAQA 4D8KA 3CPWP 2X3WD 3QDRB 3QKJA 3GLXA 4C5HA 1WYXA 2HD0A 3I5RA 2O31A 1SG5A 3RESA 3QZ5B 2H3JA 5J39A 1YIJQ 2X4XA 3QUIA 1T0JA 3CCEQ 1K9MU 4Z88A 3CCRT 1OPKA 4Y91A 3MEWA 3JB9H 1N27A 2YRDA 2YHTA 2DETA 4M78C 1Q81R 3EHQA 1VQ8T 2E5QA 2M16A 2E5KA 4OVAA 4DBRA 3V8JA 2YUNA 3JB9G 3SWNA 1VQ6Q 1X6BA 5LJ5d 3CCUQ 2E70A 3FDRA 3CCSQ 2XG8D 1M1KC 4C8QC 3CCVQ 4E2FB 1FWZA 2RH2A 1TOVA 2K3YA 4R55A 2JM9A 2CH4A 1JXOA 2I0NA 2VGMA 4N0AC 3VS5A 1ZUKA 4X34A 2OTJA 2CP0A 2QYZA 3J80E 4J9FA 2DMOA 5KE3A 1ZX6A 4M75F 5GANh 3MCAB 1AHJB 1BI3A 3HKSA 2MIOA 4QQ6A 1KQSA 5GAMg 3M55A 2EAYA 3CCQT 5FU7C 1VQPQ 5LJ3g 3CCLA 4M77D 5GMKh 3ER0A 2XK0A 2JTFA 3VS7A 5A0GA 4RTVA 1MMDA 1OI1A 4J9EA 4XTVA 4KH0B 4OMFB 3ASKA 2E3IA 1FYNA 1QVPA 5IHNA 3C0CA 2EGCA 1U5SA 3EFOB 1NBEB 1AT1B 5EG2A 3I56T 1YHQQ 3VS0A 1VQMA 3URGA 3CD6T 2JNGA 2CP7A 1NPPA 2HDAA 3SDZA 3M0SA 3X28B 2FO0A 2KEAA 2RJEA 2V1QA 3QXEB 1JJ2S 2LJ3A 1R0CB 3U23A 2FRWA 3I9QA 2KRMA 1PM3A 4MMLA 2YLBA 1QVGA 1NZ9A 2KK4A 1IRXA 5IXBA 4M77A 2EKOA 4EMKB 2CSQA 2PU9B 4M78F 1PRMC 4B9XA 2DTHA 2BTTA 3JB9F 5L23A 3RKYA 2LJ0A 3JB9I 2L3PA 1N9RA 2GQVA 2E65A 1WHKA 2EGAA 3QYGB 4C8QF 5FW9A 4HT8A 2ED0A 1JJ2P 1QVFS 4NOYA 5CKBA 3PGGA 4KBMB 1H8KA 3V8LA 5GAN8 2F5TX 4GBQA 2A0FB 1TS9A 1NJIR 3QWXX 4X9DA 3PIPA 2XD0A 1QLYA 3QHSA 2AIRB 2IG0A 2DTIA 1ZSZB 2DNUA 1M27C 1MMGA 4RTZA 4TVRA 3CMEQ 4M77E 2LRQA 5FRNA 2QEXT 1J3TA 2JN0A 1QVFP 2D0QB 3OYCA 4OB0B 2DXCA 1YIJA 4M7AD 5CQXA 5FU6B 3CCEA 4WF2A 4L59A 2H3EB 1FMVA 1GCPA 2LVMA 4J7FA 2YUQA 2QGFB 2RM4A 4CC2A 3CCMQ 1UEBA 4J9BA 2O9VA 3BDUA 3SFMA 2MWOA 1HXDA 2QQAA 1I81A 2COYA 2CZ0B 3KBGA 3V7RA 1MMNA 1VQ6A 3CCUA 1Z9ZA 4JLGA 3UATA 5HCKA 3CCSA 2CUBA 8AT1B 3CCVA 1OQKA 4F7UA 5CK9A 1AWXA 4BY6B 2LMJA 1QQJA 1Y96A 2K79A 1X69A 1KQ1A 4RTWA 2NUPA 3HFNA 4KULA 2YLCA 1OOTA 1F1BB 2DL8A 4OMQA 4M7DD 1MNEA 2YT6A 4J83A 1HK9A 2LNVA 4MZTA 3JCMd 1B3QA 2PNIA 1K8AR 1VQPA 2NUTA 4M7AA 2MOXA 2DKGA 4FYXB 3REAB 3DLLA 3M58A 2LQ8A 2Z0WA 3I55Q 1U1SA 2YUOA 4VUBA 1I1JA 3OBWA 1JO8A 1VQ9Q 1W4SA 1WJSA 2HL3A 3QDFA 1YJ9Q 4OMNA 1Q95G 2KT8A 3RUXA 4XU1A 5DLQE 1XOVA 1YHQA 2J05A 2JW4A 2EW3A 2V8IA 2D6FA 2AHJB 3A8LB 5GAOr 1KHIA 1UECA 4ZTJA 1K73R 1G8XA 4PKCC 1Y71A 1E6GA 2CGHA 1SSHA 2RA2A 2DYIA 2YXYA 5GMKm 3MEUA 4DEYA 4M7DA 4M7AE 1Y07A 3AHUA 1U3OA 4LUDA 1M3BA 2J6KA 2FZKB 3SWNB 2JS2A 2JMAA 2HMAA 4XU3A 1IHVA 1QCOA 3MP8A 1YCYA 3VS6A 4M75D 4DQ2A 2LJ1A 2FG0A 3VS3A 3EG0A 1Q86R 1K4US 3M9QA 2EJ9A 1BKBA 2M02A 2R58A 2HBPA 2QASA 1BI1A 3OW2S 1G3WA 3TSWA 4F04B 4C0GA 5DLOA 2BE7D 4MMKA 4OB1B 2HQHA 3ZBDA 4BDYA 5CO7A 2EVRA 1W2BA 1G5VA 3OYMA 2A36A 3OYBA 2G3RA 1UTIA 4FU6A 4O5VA 3H41A 1BYMA 1H641 2KAFA 3NGPA 4LE9A 4HVVA 1TUGB 1T3SA 5I2MA 4J7IA 5CKEA 3EFSA 1QW1A 4FCYA 2ZPFB 3ZFJA 3CMEA 1QCFA 4IUPA 3OMGA 3OW2P 1VIFA 2LQKA 3REBB 3CPWA 1YI2T 4J9CA 3TEEA 4JRQA 1YN8A 1TXQA 4E7IA 2RHYA 4XTWA 5KYXA 2A28A 1K1ZA 3CCMA 5LJ5j 2JMCA 1LOJA 4WCIA 3FB9A 4IUVA
chains in the Genus database with same CATH topology
1KSWA 1W6XA 3IQLA 1M8MA 1A0NB 2DRMA 2GQIA 2KYBA 2ESWA 4DEXA 4CC7A 1M3AA 1AWWA 1K76A 4JJBA 1UFFA 1AWOA 1VA7A 2J6FA 1MV3A 1CKAA 3RBBB 4OMLA 1JU5C 2DX1A 2RQWA 1PKTA 2KT1A 1QKXA 1BK2A 1GRIA 4F14A 1H92A 2RMOA 1PNJA 2DF6A 1WXUA 2O9SA 4E6RA 2EBPA 1NLOC 1E6HA 2J6OA 3M0TA 4OMMA 1UHCA 2DL7A 4Z89A 1UUEA 2KXDA 1K9AA 4J9DA 4LNPA 1WX6A 2OAWA 1VYTA 4X1VA 2KRNA 2NUZA 2IIMA 1JXMA 1GBRA 1SRMA 2EGEA 3NPFA 1NYFA 2SEMA 1N5ZA 2FRYA 2GTOA 1PKSA 4M4ZA 4D8KA 2EYXA 2X3WD 2VWFA 5EC7A 4IIMA 5IHKA 1WYXA 3I5RA 2O31A 4HCKA 3KFVA 1UJ0A 2OJ2A 4K11A 3UF4A 1ZUYA 2NWMA 3UA6A 1T0JA 4Z88A 1OV3A 1OPKA 3EHRA 4GLMA 4HVWA 1BU1A 1G2BA 1NEGA 3PE0A 3EHQA 3THKA 2E5KA 2RPNA 1MUZA 2AK5A 2YUNA 1ZUUA 2HCKA 1X27A 1X6BA 3VRYA 1NLPC 4A63B 2JM9A 2CH4A 1JXOA 2I0NA 2K7AA 3VS5A 1ZUKA 2BZXA 1UHFA 1X6GA 2GBQA 4J9FA 2DMOA 2RQTA 4J9HA 2VVKA 1ZX6A 4HXJA 4AFQC 1SPKA 1AZGB 2MIOA 3UA7A 4HVUA 1B07A 2D8JA 1AZEA 2C0OA 1U06A 1ABOA 2AZSA 2W10A 3R6NA 1TG0A 1W1FA 4FSSA 1UE9A 1G83A 3SHWA 2DRKA 2ROLA 2M0YA 1SHFA 2GGRA 4LUEA 3VS7A 4RTVA 1IO6A 1YWPA 1BBZA 4J9EA 2PZ1A 1HJDA 2DBMA 1MV0B 1TUDA 1EFNA 2ECZA 3EG1A 5GJVB 1FYNA 5IHNA 4J9GA 2FPEA 2M51A 2K3BA 4OMPA 3C0CA 1AWJA 1VYVA 1GCQC 2EGCA 3PVLA 2CSIA 1U5SA 1AOJA 2L2PA 4JJCA 1X2QA 3VS0A 2EYWA 4KRTA 4AFSC 1K0SA 1ABQA 2KYMA 5IXFA 2HDAA 3M0SA 1GFDA 4RTTA 2FO0A 2KEAA 2V1QA 2EQIA 4EIKA 2LJ3A 4F17A 5ECAA 3U23A 3RNJA 2FRWA 2JTEA 3I9QA 1KFZA 2KRMA 3CQTA 3JV3A 1X43A 4ZNXA 5IXBA 4JPBW 2G6FX 1V1CA 2A08A 2RF0A 2CSQA 2ENMA 2ROTA 1PRMC 2BTTA 2D8HA 5L23A 2LJ0A 2L3PA 1KIKA 1TUCA 1NYGA 3VS4A 2EGAA 2AZVA 4RTXA 2SRCA 1VYUA 2DVJA 3QWYA 5FW9A 1M30A 2DLPA 2ED0A 1ZSGA 2HEQA 4Z8AA 1H8KA 2DL3A 1X2KA 2F2XA 2AKLA 2LNHB 1RLPC 4GBQA 1T0HA 4Y92A 1KJWA 3LH5A 2LQNA 2KRSA 3QWXX 4CC3A 1UG1A 1YP5A 2BZ8A 1UGVA 1QLYA 2K2MA 2YUPA 1AEYA 4RTUA 1NM7A 2KXCA 3ULRB 2DBKA 2DNUA 1WXTA 1M27C 4RTZA 5I11A 1UJYA 1OEBA 1WFWA 5IH2A 1ZBJA 1CSKA 1J3TA 1RI9A 3A98A 1W70A 1RLQC 2PTKA 2J06A 1PWTA 2FEIA 4D8DA 2RNAA 4ORZA 1GCPA 1M3CA 2YSQA 2YUQA 3ZL7C 4CC2A 2HBWA 4JZ4A 4J9BA 2O9VA 1UDLA 3FJ5A 1WI7A 2A37A 4ESRA 4RUGA 1PRLC 3I5SA 1Z9ZA 2XMFA 3UATA 5HCKA 2ED1A 2B86A 2J7IA 4J9IA 2CUBA 4QT7A 1H3HA 4JZ3A 1AWXA 2H8HA 2K6DA 5FWCA 2LMJA 1GCQA 2DM1A 1QWFA 2K79A 1X69A 4RTWA 2X3XD 3PVQA 1AD5A 1YCSB 1WLPB 1ARKA 1OOTA 2LCSA 3EGUA 3H0FA 2W0ZA 2DL8A 2RQVA 1WA7A 4OMQA 2YT6A 2RQUA 5IHIA 2RN8A 5FWBA 4OMOA 2ABLA 1B3QA 2PNIA 2D0NA 3M0UA 3TSZA 2DA9A 2MCNA 2MOXA 3M0QA 3REAB 2EKHA 2GNCA 3M0RA 2KROA 5GJWB 2YUOA 2O2OA 3VRZA 1BB9A 2VKNA 1I1JA 3EG2A 1JO8A 2DILA 1WIEA 2D1XA 4OMNA 1GFCA 2LX7A 3SEMA 2DL5A 2KT8A 3H0HA 2KGTA 1S1NA 1Z9QA 1XOVA 2J05A 2KBTA 2HSPA 2JW4A 4IIOA 2EW3A 1YWOA 1SEMA 1NG2A 1UECA 2CREA 2CDTA 2DJQA 2RQRA 2LP5A 1I0CA 1JQQA 4JJDA 1E6GA 1SSHA 2BZYA 2L0AA 1WDXA 2C0IA 4DEYA 1GBQA 3VS1A 1U3OA 4LUDA 1SRLA 1M3BA 2L3SA 2EPDA 2YDLA 1JEGA 2J6KA 1Y0MA 2DE0X 4RTYA 2JS2A 2JMAA 2CT4A 3VS6A 2JT4A 1OPLA 4AFUC 2QDLA 2L3QA 1ZLMA 2LJ1A 2FG0A 3VS3A 2O88A 1AVZC 3EG0A 2F2WA 1K4US 1QWEA 2GTJA 1YNZA 2FPFA 2LZ6B 2K9GA 2EYZA 3TSWA 1GL5A 1CKBA 3I35A 4F16A 4AG1C 3VS2A 3TVTA 2EVRA 2DL4A 2CT3A 2A36A 1Y57A 1UTIA 2CUDA 2KR3A 3NMZC 1RUWA 1WXBA 3NHNA 3H41A 1PHTA 3NGPA 4LE9A 4HVVA 4AFZC 1T3SA 2DYBA 1HD3A 3EG3A 1LCKA 1T3LA 2JS0A 5I22A 1QCFA 1E7OA 3GBQA 2LQWA 3REBB 2EYYA 3H0IA 4J9CA 2CH4W 4LN2A 2KNBB 2KE9A 2JM8A 1YN8A 1SHGA 3O5ZA 4AG2C 2OI3A 2C0TA 2F2VA 2JXBA 1HSQA 3M0PA 2A28A 1NEBA 1K1ZA 4R0KA 2JMCA 2P4RA 2AKKA 1QKWA 4WCIA 1K0XA 1FMKA 4CC4B 1I07A 2FPDA 2V1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSW A;  1W6X A;  3IQL A;  1M8M A;  1A0N B;  2DRM A;  2GQI A;  2KYB A;  2ESW A;  4DEX A;  4CC7 A;  1M3A A;  1AWW A;  1K76 A;  4JJB A;  1UFF A;  1AWO A;  1VA7 A;  2J6F A;  1MV3 A;  1CKA A;  3RBB B;  4OML A;  1JU5 C;  2DX1 A;  2RQW A;  1PKT A;  2KT1 A;  1QKX A;  1BK2 A;  1GRI A;  4F14 A;  1H92 A;  2RMO A;  1PNJ A;  2DF6 A;  1WXU A;  2O9S A;  4E6R A;  2EBP A;  1NLO C;  1E6H A;  2J6O A;  3M0T A;  4OMM A;  1UHC A;  2DL7 A;  4Z89 A;  1UUE A;  2KXD A;  1K9A A;  4J9D A;  4LNP A;  1WX6 A;  2OAW A;  1VYT A;  4X1V A;  2KRN A;  2NUZ A;  2IIM A;  1JXM A;  1GBR A;  1SRM A;  2EGE A;  3NPF A;  1NYF A;  2SEM A;  1N5Z A;  2FRY A;  2GTO A;  1PKS A;  4M4Z A;  4D8K A;  2EYX A;  2X3W D;  2VWF A;  5EC7 A;  4IIM A;  5IHK A;  1WYX A;  3I5R A;  2O31 A;  4HCK A;  3KFV A;  1UJ0 A;  2OJ2 A;  4K11 A;  3UF4 A;  1ZUY A;  2NWM A;  3UA6 A;  1T0J A;  4Z88 A;  1OV3 A;  1OPK A;  3EHR A;  4GLM A;  4HVW A;  1BU1 A;  1G2B A;  1NEG A;  3PE0 A;  3EHQ A;  3THK A;  2E5K A;  2RPN A;  1MUZ A;  2AK5 A;  2YUN A;  1ZUU A;  2HCK A;  1X27 A;  1X6B A;  3VRY A;  1NLP C;  4A63 B;  2JM9 A;  2CH4 A;  1JXO A;  2I0N A;  2K7A A;  3VS5 A;  1ZUK A;  2BZX A;  1UHF A;  1X6G A;  2GBQ A;  4J9F A;  2DMO A;  2RQT A;  4J9H A;  2VVK A;  1ZX6 A;  4HXJ A;  4AFQ C;  1SPK A;  1AZG B;  2MIO A;  3UA7 A;  4HVU A;  1B07 A;  2D8J A;  1AZE A;  2C0O A;  1U06 A;  1ABO A;  2AZS A;  2W10 A;  3R6N A;  1TG0 A;  1W1F A;  4FSS A;  1UE9 A;  1G83 A;  3SHW A;  2DRK A;  2ROL A;  2M0Y A;  1SHF A;  2GGR A;  4LUE A;  3VS7 A;  4RTV A;  1IO6 A;  1YWP A;  1BBZ A;  4J9E A;  2PZ1 A;  1HJD A;  2DBM A;  1MV0 B;  1TUD A;  1EFN A;  2ECZ A;  3EG1 A;  5GJV B;  1FYN A;  5IHN A;  4J9G A;  2FPE A;  2M51 A;  2K3B A;  4OMP A;  3C0C A;  1AWJ A;  1VYV A;  1GCQ C;  2EGC A;  3PVL A;  2CSI A;  1U5S A;  1AOJ A;  2L2P A;  4JJC A;  1X2Q A;  3VS0 A;  2EYW A;  4KRT A;  4AFS C;  1K0S A;  1ABQ A;  2KYM A;  5IXF A;  2HDA A;  3M0S A;  1GFD A;  4RTT A;  2FO0 A;  2KEA A;  2V1Q A;  2EQI A;  4EIK A;  2LJ3 A;  4F17 A;  5ECA A;  3U23 A;  3RNJ A;  2FRW A;  2JTE A;  3I9Q A;  1KFZ A;  2KRM A;  3CQT A;  3JV3 A;  1X43 A;  4ZNX A;  5IXB A;  4JPB W;  2G6F X;  1V1C A;  2A08 A;  2RF0 A;  2CSQ A;  2ENM A;  2ROT A;  1PRM C;  2BTT A;  2D8H A;  5L23 A;  2LJ0 A;  2L3P A;  1KIK A;  1TUC A;  1NYG A;  3VS4 A;  2EGA A;  2AZV A;  4RTX A;  2SRC A;  1VYU A;  2DVJ A;  3QWY A;  5FW9 A;  1M30 A;  2DLP A;  2ED0 A;  1ZSG A;  2HEQ A;  4Z8A A;  1H8K A;  2DL3 A;  1X2K A;  2F2X A;  2AKL A;  2LNH B;  1RLP C;  4GBQ A;  1T0H A;  4Y92 A;  1KJW A;  3LH5 A;  2LQN A;  2KRS A;  3QWX X;  4CC3 A;  1UG1 A;  1YP5 A;  2BZ8 A;  1UGV A;  1QLY A;  2K2M A;  2YUP A;  1AEY A;  4RTU A;  1NM7 A;  2KXC A;  3ULR B;  2DBK A;  2DNU A;  1WXT A;  1M27 C;  4RTZ A;  5I11 A;  1UJY A;  1OEB A;  1WFW A;  5IH2 A;  1ZBJ A;  1CSK A;  1J3T A;  1RI9 A;  3A98 A;  1W70 A;  1RLQ C;  2PTK A;  2J06 A;  1PWT A;  2FEI A;  4D8D A;  2RNA A;  4ORZ A;  1GCP A;  1M3C A;  2YSQ A;  2YUQ A;  3ZL7 C;  4CC2 A;  2HBW A;  4JZ4 A;  4J9B A;  2O9V A;  1UDL A;  3FJ5 A;  1WI7 A;  2A37 A;  4ESR A;  4RUG A;  1PRL C;  3I5S A;  1Z9Z A;  2XMF A;  3UAT A;  5HCK A;  2ED1 A;  2B86 A;  2J7I A;  4J9I A;  2CUB A;  4QT7 A;  1H3H A;  4JZ3 A;  1AWX A;  2H8H A;  2K6D A;  5FWC A;  2LMJ A;  1GCQ A;  2DM1 A;  1QWF A;  2K79 A;  1X69 A;  4RTW A;  2X3X D;  3PVQ A;  1AD5 A;  1YCS B;  1WLP B;  1ARK A;  1OOT A;  2LCS A;  3EGU A;  3H0F A;  2W0Z A;  2DL8 A;  2RQV A;  1WA7 A;  4OMQ A;  2YT6 A;  2RQU A;  5IHI A;  2RN8 A;  5FWB A;  4OMO A;  2ABL A;  1B3Q A;  2PNI A;  2D0N A;  3M0U A;  3TSZ A;  2DA9 A;  2MCN A;  2MOX A;  3M0Q A;  3REA B;  2EKH A;  2GNC A;  3M0R A;  2KRO A;  5GJW B;  2YUO A;  2O2O A;  3VRZ A;  1BB9 A;  2VKN A;  1I1J A;  3EG2 A;  1JO8 A;  2DIL A;  1WIE A;  2D1X A;  4OMN A;  1GFC A;  2LX7 A;  3SEM A;  2DL5 A;  2KT8 A;  3H0H A;  2KGT A;  1S1N A;  1Z9Q A;  1XOV A;  2J05 A;  2KBT A;  2HSP A;  2JW4 A;  4IIO A;  2EW3 A;  1YWO A;  1SEM A;  1NG2 A;  1UEC A;  2CRE A;  2CDT A;  2DJQ A;  2RQR A;  2LP5 A;  1I0C A;  1JQQ A;  4JJD A;  1E6G A;  1SSH A;  2BZY A;  2L0A A;  1WDX A;  2C0I A;  4DEY A;  1GBQ A;  3VS1 A;  1U3O A;  4LUD A;  1SRL A;  1M3B A;  2L3S A;  2EPD A;  2YDL A;  1JEG A;  2J6K A;  1Y0M A;  2DE0 X;  4RTY A;  2JS2 A;  2JMA A;  2CT4 A;  3VS6 A;  2JT4 A;  1OPL A;  4AFU C;  2QDL A;  2L3Q A;  1ZLM A;  2LJ1 A;  2FG0 A;  3VS3 A;  2O88 A;  1AVZ C;  3EG0 A;  2F2W A;  1K4U S;  1QWE A;  2GTJ A;  1YNZ A;  2FPF A;  2LZ6 B;  2K9G A;  2EYZ A;  3TSW A;  1GL5 A;  1CKB A;  3I35 A;  4F16 A;  4AG1 C;  3VS2 A;  3TVT A;  2EVR A;  2DL4 A;  2CT3 A;  2A36 A;  1Y57 A;  1UTI A;  2CUD A;  2KR3 A;  3NMZ C;  1RUW A;  1WXB A;  3NHN A;  3H41 A;  1PHT A;  3NGP A;  4LE9 A;  4HVV A;  4AFZ C;  1T3S A;  2DYB A;  1HD3 A;  3EG3 A;  1LCK A;  1T3L A;  2JS0 A;  5I22 A;  1QCF A;  1E7O A;  3GBQ A;  2LQW A;  3REB B;  2EYY A;  3H0I A;  4J9C A;  2CH4 W;  4LN2 A;  2KNB B;  2KE9 A;  2JM8 A;  1YN8 A;  1SHG A;  3O5Z A;  4AG2 C;  2OI3 A;  2C0T A;  2F2V A;  2JXB A;  1HSQ A;  3M0P A;  2A28 A;  1NEB A;  1K1Z A;  4R0K A;  2JMC A;  2P4R A;  2AKK A;  1QKW A;  4WCI A;  1K0X A;  1FMK A;  4CC4 B;  1I07 A;  2FPD A;  2V1R A; 
#chains in the Genus database with same CATH topology
 1ZA1 B;  1W6X A;  2VUB A;  3E9F A;  2ATC B;  1A0N B;  2KYB A;  1D1C A;  4M78 D;  1H3Z A;  4DEX A;  3OA6 A;  1K9M R;  3CC2 Q;  4CC7 A;  1M3A A;  3JB9 D;  1AWW A;  2VB6 A;  3OB9 A;  4JJB A;  5GMK l;  1AWO A;  1VA7 A;  4OF1 A;  1EIF A;  1MV3 A;  4J6X A;  3RBB B;  3HSB A;  1LNX A;  4QKU A;  4C8Q D;  4M77 B;  2KT1 A;  2RD1 A;  2CP6 A;  4FW1 A;  1BK2 A;  4F14 A;  2DF6 A;  1RAC B;  5KCH A;  1E6H A;  5D6Y A;  1OZ3 A;  2E4H A;  3G71 Q;  2DL7 A;  1XNI A;  4Z89 A;  2KXD A;  3MP1 A;  1YJW Q;  4J9D A;  3JAM E;  4KUD K;  4LNP A;  9ATC B;  1VYT A;  3JRZ A;  4X1V A;  1FMW A;  4FM4 B;  2IIM A;  3ME9 A;  1SRM A;  3JCM W;  2SEM A;  3M57 A;  3I55 A;  5D6W A;  4E7H A;  2QQB A;  4GLK A;  1M5Q 1;  1EX4 A;  2IPO B;  4JLI A;  3CC7 T;  4V2S A;  4IIM A;  5GAM d;  4C92 C;  1VQ9 A;  4HCK A;  5GAN 5;  3RMQ A;  1YJ9 A;  4M78 A;  1ZUY A;  2NWM A;  5LJ3 d;  1VOM A;  3P8D A;  5KYW A;  1NE8 A;  4ZTF A;  3S3O A;  3L2V A;  4C8Q A;  1NEG A;  3PE0 A;  1WQW A;  3CMA Q;  3MEV A;  4N4G A;  2RPN A;  2AK5 A;  4BI3 A;  5KE2 A;  1WHL A;  3G7Z A;  1D09 B;  1NLP C;  4CRI A;  4A63 B;  1GXI E;  2K7A A;  2V8K A;  3RKW A;  2GBQ A;  3CCR Q;  3QJY A;  1ZA2 B;  2HQE A;  3L2Q A;  1SPK A;  2JVV A;  1Y96 B;  4QVC A;  3UA7 A;  1NJI C;  4LDU A;  2NUP B;  1VQ8 Q;  1M1K U;  1AZE A;  4JRP A;  2C0O A;  1U06 A;  2E64 A;  2QTX A;  3OYA A;  3GNG A;  4PJO D;  1X01 A;  2JOY A;  4II1 A;  2DRK A;  2F1L A;  2P84 A;  3EGD A;  1JJ2 A;  1IO6 A;  1BBZ A;  3MJX A;  4HKE A;  2NUT B;  4M7A B;  3X25 B;  1VQN T;  2DBM A;  2CP3 A;  2VAS A;  5C6S A;  2JZ2 A;  1TUD A;  1KK7 A;  2E1H A;  3HRU A;  5GAO m;  5GJV B;  4BAC A;  4J9G A;  2FPE A;  1UGQ B;  1N6A A;  5A0L A;  3OSV A;  4EMH A;  5GMK i;  4FL6 A;  1AOJ A;  1WGS A;  2M1H A;  3CCQ Q;  2HSE B;  3L2Z A;  4HCZ A;  2HNI A;  1RI0 A;  2EYW A;  3JCM J;  1SSF A;  4KRT A;  4AFS C;  2HKN A;  2Y4X A;  5IXF A;  4FSX A;  1Q82 C;  4KGX B;  4C92 F;  4PFZ A;  1IGU A;  5LJ5 h;  1X75 C;  3RNJ A;  3JV3 A;  1X43 A;  3TU4 K;  2FVU A;  4PJO A;  2A3L A;  2QQS A;  4JPB W;  2G6F X;  3CC2 A;  2XDP A;  3I56 Q;  2ROT A;  2OTJ T;  1O9S A;  3CD6 Q;  3CC4 T;  1K8A C;  1KIK A;  2QQR A;  1YJN T;  1IZ6 A;  2DXB A;  2DVJ A;  3QWY A;  1M30 A;  1IHW A;  3G71 A;  2DLP A;  4A4F A;  2HEQ A;  4A4E A;  1YJW A;  3HHT B;  1D0X A;  3HRT A;  2AKL A;  1WJR A;  3O8V A;  4Y92 A;  1KJW A;  3LH5 A;  2LQN A;  4JJN K;  1UG1 A;  2FHD A;  5GAN f;  4FIB A;  3HTR A;  1TTH B;  2DTO A;  3EAE A;  4RTU A;  3JCM V;  2KXC A;  2DBK A;  1G3T A;  4ZGJ B;  2BKD N;  1WXT A;  4PJO E;  3WVE B;  2I2L A;  2MYS A;  3A8G B;  4PLI A;  3V7S A;  2QI2 A;  4RCB A;  1RI9 A;  1KHC A;  1RLQ C;  2EIF A;  1WHH A;  2PTK A;  1K73 C;  5GAO l;  1PWT A;  3MET A;  4QVZ A;  1U1T A;  2RJF A;  4ME7 A;  4ORZ A;  5GAN e;  3S6W A;  1KD1 C;  2HBW A;  5KYU A;  2PQW A;  2RI3 A;  2A37 A;  3CMA A;  3RR6 A;  5KYX B;  5CKF A;  3EFR A;  4ESR A;  1D3B A;  4RUG A;  3OYN A;  1VQK T;  2ED1 A;  1ZSZ C;  2B86 A;  2QEX Q;  1H3H A;  5GMK e;  1Q86 C;  3TCJ A;  5FWC A;  4BE1 A;  1GCQ A;  1VQL T;  2EYQ A;  4FW2 A;  1IGQ A;  2DVE A;  2WAC A;  1AD5 A;  4JDS A;  1YCS B;  2HQX A;  1WLP B;  3CCR A;  3UDC A;  3FJP A;  3EGU A;  3VUB A;  2RQV A;  2EQJ A;  1VQ8 A;  3RIR A;  4OB3 B;  2VGN A;  2HL5 C;  5IHI A;  3EGX A;  5CVI A;  2QA4 T;  2CZ6 B;  2OX7 A;  2K4Y A;  2P4T A;  2MCN A;  2O01 E;  2CS7 A;  3FLG A;  2P0Q A;  2PUK B;  5GAN 7;  2EKH A;  4KUI A;  2RI5 A;  3M4G A;  1I4K 1;  2E6N A;  1TWB A;  2XID A;  2DIL A;  1WIE A;  2KI7 A;  2ZPB B;  3GIB A;  2D1X A;  4C5E A;  1GFC A;  2LX7 A;  2K5F A;  1BCM A;  3L2R A;  3CCQ A;  2KGT A;  2YWW A;  4Y28 E;  3EG9 A;  2QG9 B;  1YIJ T;  3PT9 A;  4C0D B;  1BCO A;  1NG2 A;  3GF5 A;  2CRE A;  3PTA A;  5KYW B;  3HRS A;  3X24 B;  2LDM A;  4JJD A;  2L0A A;  1WDX A;  4CI0 C;  2C0I A;  4AT1 B;  1RAD B;  4C8Q B;  2OAU A;  1Q7Y C;  3E19 A;  3JCM f;  1TSF A;  3LGL A;  1TU0 B;  3BW1 A;  3CCV T;  3KUF A;  3NTH A;  2RO0 A;  2QDL A;  1OX8 A;  2L3Q A;  3I56 A;  3OBY A;  2O88 A;  1AVZ C;  2F2W A;  4NS5 A;  3CD6 A;  4RG8 A;  2MK5 A;  5HK0 A;  3VJP A;  3OYE A;  2QTV A;  2E6Z A;  5L8R E;  3JCM h;  2EYZ A;  3BE3 A;  2XDB A;  1MMA A;  4XU2 A;  1GL5 A;  3JCM e;  2QK0 A;  1XTD A;  4F16 A;  2DL4 A;  2X4J A;  2CT3 A;  1OU8 A;  1UGP B;  1O75 A;  2KR3 A;  1RUW A;  3JCM c;  3SWN C;  4PL6 A;  4AFZ C;  1S72 T;  1YIT T;  3EGD B;  5GAM j;  4XQ3 A;  2DYB A;  4OGC A;  3A8M B;  1HD3 A;  3EG3 A;  2QGG A;  5LJ3 j;  1KC8 U;  1E7O A;  1OZ2 A;  3GBQ A;  1BI0 A;  2LQW A;  2GF7 A;  2ZPE B;  1XQH A;  1SHG A;  3O5Z A;  4BDZ A;  4A4H A;  2OI3 A;  2F2V A;  1WPY A;  2JXB A;  4E7S A;  1VQO T;  4C92 D;  1VQ4 T;  2WSF E;  4X9C A;  4OGE A;  2P4R A;  2AKK A;  3C4S A;  4ZN3 A;  1HYO A;  2KDS A;  2LCL A;  2X4Y A;  2KY9 A;  3C94 A;  3BDL A;  3NFC A;  4PNO A;  1UGS B;  5IN1 A;  3VYG A;  3IQL A;  1M8M A;  3RKX A;  2QEX A;  2DRM A;  2RHZ A;  2GQI A;  5CIU A;  2ESW A;  1YI2 Q;  2ZPH B;  1CKA A;  4PJO B;  4F7U E;  5GAN 4;  3M53 A;  1PKT A;  5HK3 A;  1H92 A;  2CP5 A;  4FT2 A;  1WXU A;  2J6O A;  1UHC A;  3VV0 A;  4DBQ A;  2WSE E;  3G6E T;  1M90 C;  3RER A;  3CBP A;  2HKQ B;  3LW5 E;  3NPF A;  2DK3 A;  1N5Z A;  4C92 A;  2R57 A;  3QII A;  5KH6 A;  2EYX A;  2VWF A;  5EC7 A;  1LJO A;  2KQW A;  2GCX A;  1RAF B;  3VUZ A;  4M77 C;  5AT1 B;  3OYL A;  3KFV A;  1UJ0 A;  6AT1 B;  2OJ2 A;  4BB7 A;  1IXD A;  4M77 G;  3UA6 A;  2RJD A;  1U8R A;  3A5Z B;  3GOX A;  4ELZ C;  1MHN A;  1JRI A;  4EDU A;  1BU1 A;  2LTO A;  3F70 A;  3THK A;  3VKI A;  1I8F A;  2VV5 A;  2HCK A;  4BUG A;  1X27 A;  1KC8 C;  3CC7 Q;  5KYU B;  4HCB A;  4LDX A;  2COW A;  2VYT A;  2Y90 A;  2OTL T;  3V7C A;  4M7D E;  1D3B B;  2X51 A;  4BI4 A;  5A2Q E;  3OYK A;  1X6G A;  2BIV A;  2RQT A;  4AFQ C;  3E9G A;  3G4S T;  3MPU B;  2YRC A;  4HVU A;  1B07 A;  3N5B B;  4DOV A;  2ZCF B;  5GAM f;  2AZS A;  5DY9 A;  2EQM A;  1Q81 C;  4GY5 A;  1N8R R;  4M75 A;  1W1F A;  1UE9 A;  4KGV B;  2A7Y A;  1G83 A;  3SHW A;  4IUQ A;  3EGX B;  8ATC B;  1SHF A;  2GGR A;  4LUE A;  2D9T A;  4QQD A;  4IUT A;  1D0Y A;  2RB6 A;  3QSU A;  1MND A;  1HJD A;  1VIE A;  1NJI U;  2EJG A;  2ECZ A;  2EQU A;  2X4W A;  4OMP A;  5GAM h;  3M54 A;  1AWJ A;  5GAM e;  1VYV A;  4F7U G;  2CSI A;  1RAI B;  2DXU A;  5LJ3 h;  2GFA A;  4JJC A;  1X2Q A;  1SF9 A;  2RJC A;  4MDW A;  3OS0 A;  4OB2 B;  4FYY B;  1M2O A;  3CCJ T;  3R6O A;  4ATO A;  1TH7 A;  1ABQ A;  5A0D A;  2RI2 A;  3EG9 B;  3QYH B;  4M75 E;  1GFD A;  3DLM A;  4EIK A;  4M77 F;  2MAM A;  5ECA A;  4M7A C;  2JTE A;  4ZN1 A;  3L2U A;  3CQT A;  3EFO A;  4M7A G;  2K5I A;  2QDY B;  4ZNX A;  1YI2 A;  2A08 A;  3EH2 A;  2RF0 A;  2ZAE A;  4DA4 A;  3ZEH A;  3NTI A;  2RK1 A;  4BD3 A;  1Q82 U;  3DB3 A;  3H8Z A;  1TUC A;  1NYG A;  2AZV A;  4RTX A;  2AT1 B;  3TQ7 P;  2SRC A;  1VYU A;  4LD6 A;  4OP0 A;  3HP9 A;  4Z8A A;  1X2K A;  2F2X A;  2NYS A;  2LNH B;  1RLP C;  1VQ7 T;  2KRS A;  4CC3 A;  1UGR B;  1YP5 A;  2BZ8 A;  1UGV A;  1K8A U;  5I21 A;  1AEY A;  1C0M A;  4B6M A;  1NM7 A;  2OTJ Q;  4N0A A;  3ULR B;  4KH1 B;  4M7D G;  3JCM b;  3CC4 Q;  4PFP A;  3G1J A;  3NTK A;  1YJN Q;  4XAX B;  3RDV A;  5I11 A;  1OEB A;  1WFW A;  1VQ5 T;  5IT9 E;  4QW2 A;  1ZBJ A;  4A54 A;  3INZ A;  4J8O A;  2V8J A;  4RG2 A;  4F7U B;  2MWP A;  4R56 A;  4D8D A;  2DPP B;  4RMO A;  3OYF A;  3A1P A;  2YSQ A;  4M78 E;  3PNW C;  2LCC A;  1ZSZ A;  4JZ4 A;  4IUR A;  1ZBX A;  1PD1 A;  3CC7 A;  4C8Q E;  1PRL C;  3DB4 A;  1K73 U;  1FXX A;  2J7I A;  4J9I A;  4QT7 A;  4B9W A;  3PMT A;  4N4H A;  2H8H A;  2K6D A;  4EPC A;  3A8O B;  1RAA B;  4FYW B;  2L8D A;  2E10 A;  1KD1 U;  1QWF A;  1VUB A;  4L6V 5;  2X3X D;  2FZC B;  5LJ5 f;  2Y4Y A;  1ARK A;  1DJ7 B;  2LCS A;  3GNF B;  3H0F A;  2W0Z A;  2O4X A;  3OYD A;  4M7A F;  5CQY A;  3GP8 A;  2DFU A;  4N4I A;  2E3H A;  2RQU A;  1Q86 U;  4E7K A;  2RN8 A;  5FWB A;  4A4K A;  1VQK Q;  2D0N A;  3M0U A;  2V26 A;  2DA9 A;  4PJN A;  4PFO A;  1QVF A;  3M0Q A;  4EMG A;  4J5Y A;  2KRO A;  1VQL Q;  4IKF A;  5GJW B;  1R0B G;  2O2O A;  3VRZ A;  4XTZ A;  2COZ A;  1BB9 A;  1BIA A;  1V29 B;  2K2V A;  5LJ5 e;  3CPW S;  4C92 B;  3CPF A;  1I5L A;  4M7D B;  1D1B A;  2HZY A;  3OMC A;  2QA4 Q;  2DL5 A;  2VXE A;  3M4Y A;  3HL8 A;  2XKO C;  3H0H A;  5FRO A;  1S1N A;  2RHX A;  1Z9Q A;  4Q5W A;  2HSP A;  3SD4 A;  4IIO A;  1YWO A;  1SEM A;  2K3X A;  4JUV A;  1ZQ1 A;  2DJQ A;  2LP5 A;  1I0C A;  1JQQ A;  2M9U A;  1RAB B;  2RK2 A;  3VS1 A;  1SRL A;  3AT1 B;  2EPD A;  2YDL A;  1JEG A;  3CCL T;  4RCC A;  2R5A A;  2BE9 B;  1Y0M A;  3FIF A;  1G3S A;  1ACM B;  2CT4 A;  2JT4 A;  1OPL A;  4AFU C;  1ZLM A;  2F69 A;  4EMK C;  5GAO n;  3JB9 J;  1QWE A;  2DJZ A;  3J7A F;  1D1A A;  1Q7Y U;  3JCM P;  2E12 A;  4NL3 A;  3LH0 A;  4C0D C;  2LZ6 B;  2FB7 A;  1YBY A;  4M78 G;  4XTY A;  2L89 A;  2LC4 A;  1CKB A;  4DBF A;  2CP2 A;  4AG1 C;  3VS2 A;  4J6W A;  1VQM T;  3OYH A;  1Y57 A;  4M75 B;  4C8Q G;  3NHN A;  4Z02 A;  1PHT A;  1LVK A;  2E41 A;  2DXT A;  3CC4 A;  1YJN A;  2JS0 A;  1T3L A;  4MDX A;  2CH4 W;  3HPW A;  4UC4 A;  2KE9 A;  2ZGW A;  3LGF A;  1B34 A;  2C0T A;  2P0P A;  5FU6 C;  1HSQ A;  3M0P A;  1NEB A;  2DZ9 A;  1S72 Q;  1YIT Q;  1QKW A;  3OYI A;  1FMK A;  1C1A A;  1I07 A;  2FPD A;  3JCM X;  1KSW A;  3VYH B;  2ZZD A;  3E2U A;  3C95 A;  3QO3 A;  2MPX C;  2BUD A;  1K76 A;  5C0M A;  2J6F A;  4BY6 C;  4LD9 K;  5AYF A;  3P8H A;  1WNL A;  1N8R C;  1JU5 C;  4BE2 A;  1VQO Q;  4D6W A;  1VQ4 Q;  5GAN d;  1GRI A;  2RMO A;  2O9S A;  5HKC A;  3OYG A;  1LPL A;  1UUE A;  3OY9 A;  1VQK A;  3A8H B;  4KT0 E;  2PVG B;  3OW2 A;  3CCE T;  4M78 B;  1I5O B;  2B8A A;  2K57 A;  1B7T A;  1GBR A;  3UPU A;  5J26 A;  1VQL A;  3QPH A;  4WTO B;  1K9M C;  3OS1 A;  3CXC S;  5KYN A;  5HY6 A;  1VQ6 T;  3CCU T;  4PJO C;  3MEA A;  5IHK A;  3CCS T;  4PJO G;  2XU8 A;  1M90 U;  4K11 A;  3UF4 A;  2QA4 A;  1PD0 A;  3LWI A;  1M9S A;  3LLR A;  3G6E Q;  3MP6 A;  1OV3 A;  3H9N A;  4JRK A;  3EHR A;  4GLM A;  4E7L A;  1M2V A;  4HVW A;  1G2B A;  5FU7 B;  4KGZ B;  1MUZ A;  3CXC P;  1ZUU A;  1X6O A;  3VRY A;  2PVD B;  3OYY A;  4HT9 A;  3S3N A;  1VQP T;  1OU9 A;  2DD4 A;  1M8V A;  3MKD A;  3GPL A;  3PMI A;  2BZX A;  3L42 A;  1UHF A;  4J9H A;  2VVK A;  4HXJ A;  5CKH A;  3RMS A;  1M1F A;  1AZG B;  1OYX A;  2R5M A;  2CZ7 B;  2D8J A;  2PVO B;  1ABO A;  2W10 A;  3R6N A;  1TG0 A;  2O4X B;  2CZ1 B;  4FSS A;  3JCM Q;  1PSF A;  1Y7X A;  2ZPG B;  2OTL Q;  2ROL A;  1YHQ T;  2M0Y A;  2XHC A;  3LYI A;  1PC0 A;  3UWN A;  5KYY A;  1SKU B;  1YWP A;  1Q82 R;  2PZ1 A;  2RHI A;  4PJL A;  1MV0 B;  3E1S A;  1EFN A;  1Q81 U;  3EG1 A;  3G4S Q;  5LJ5 g;  7AT1 B;  3BFM A;  2M51 A;  2K3B A;  4E7J A;  1GCQ C;  3PVL A;  2JTM A;  2L2P A;  3FRN A;  4A4G A;  3OS5 A;  2DER A;  1KQS S;  5IAY A;  1KG1 A;  2X9H A;  2LX9 A;  2KMT A;  3WVD B;  3P8B B;  2XIC A;  4NL2 A;  1K0S A;  3FEO A;  2KYM A;  1WHM A;  3PIO A;  5DM7 R;  4PJO F;  1S72 A;  4RTT A;  3M56 A;  1YIT A;  2DIG A;  2KVQ G;  2EQI A;  4QVD A;  4F17 A;  3L1A A;  3CBM A;  1KFZ A;  2DEQ A;  3CBO A;  1OUL A;  5CAI A;  3VU3 C;  4LXC A;  3X26 B;  1V1C A;  2FYK A;  5M9O A;  2ENM A;  1KQS P;  1D0Z A;  1M1K R;  3BY7 A;  3CCJ Q;  1M4Z A;  4JS4 A;  2EQK A;  2D8H A;  2RHU A;  1VQO A;  1VQ4 A;  3VS4 A;  4C0F A;  3CME T;  2FZG B;  1ZSG A;  4FYV B;  5GAO q;  2DL3 A;  2LT4 A;  1T0H A;  1KD1 R;  4PJJ A;  1WZO A;  4AMC A;  1EZZ B;  3QJ6 A;  5GAN g;  3UT1 A;  1BIB A;  4PJM A;  4C0Z A;  1JB0 E;  3CCM T;  2K2M A;  4ELY C;  4E7Z A;  5I2S A;  2YUP A;  4PK4 A;  4C5I A;  1QP2 A;  3LWH A;  1QVG S;  2DEU A;  1JBM A;  3T9N A;  4JS5 A;  4XTX A;  1NPR A;  3CEY A;  4C92 E;  1UJY A;  4ANJ A;  5IH2 A;  1CSK A;  3L2W A;  2QXF A;  3QBY A;  3LX7 A;  1XJW B;  2JJ9 A;  3A98 A;  1W70 A;  2YRV A;  1QMC A;  2J06 A;  1VQ7 Q;  2FEI A;  3G6E A;  2RNA A;  1R8O B;  2XDD A;  2QQ9 A;  1M1G A;  1M3C A;  3ZL7 C;  2L5Q A;  1B34 B;  3H6Z A;  1UDL A;  3FJ5 A;  1WI7 A;  1QVG P;  4XU0 A;  5LJ3 f;  2DD5 A;  3I5S A;  2XMF A;  1VQ5 Q;  4L5G A;  4YTL A;  4BI8 B;  4E47 A;  2DO3 A;  4JZ3 A;  5GAO p;  2DM1 A;  3I55 T;  2K5L A;  3PVQ A;  4HA8 A;  3HFO A;  3QZ9 B;  3TRE A;  1PCX A;  1WA7 A;  2LT1 A;  3DKM A;  1VQ9 T;  5GAN 3;  1YJ9 T;  2C06 A;  5LJ3 e;  4OMO A;  2ABL A;  1N9S A;  4O6J A;  2X35 A;  3TSZ A;  3MO8 A;  4LDW A;  1YFN A;  5FLX E;  1FX7 A;  2OTL A;  2EFI A;  2GNC A;  3M0R A;  1VQN Q;  5CCA A;  1MGQ A;  4J6Y A;  1RAG B;  1Q7Y R;  2VKN A;  5LL6 S;  3EG2 A;  2CKK A;  3G4S A;  4LDY A;  1QCN A;  1WQ7 A;  3SEM A;  3M5A A;  4HCC A;  2XI9 A;  2KBT A;  3M59 A;  2MF2 A;  3OQ5 A;  2CDT A;  1P92 A;  2RQR A;  4ZGD B;  2IVW A;  2BZY A;  2EWN A;  5GAN 6;  1GBQ A;  1M2V B;  2ZPI B;  4EMK A;  3JCM g;  1R77 A;  2L3S A;  2P0K A;  4XTU A;  2DE0 X;  4RTY A;  3SB2 A;  4MZP A;  4M7D C;  1RAH B;  4MZM A;  1PG5 B;  4FT4 A;  4C92 G;  5CKD A;  3S3M A;  5GAN j;  4C5G A;  3D7S B;  3CCJ A;  3OS2 A;  2GTJ A;  3Q1J A;  1YNZ A;  1PSE A;  2FPF A;  2NLU A;  1QP3 A;  2DIQ A;  4ZGE B;  5KCO A;  2K9G A;  3V8K A;  5GMK j;  2GFU A;  2HAX A;  3I35 A;  3CCL Q;  5D7U A;  3TVT A;  2QAZ A;  2M0O A;  5J3B A;  2CUD A;  3NMZ C;  4F7U F;  1WXB A;  2PUO B;  2MMP A;  4JRI A;  1RL2 A;  3MHX A;  5KYY B;  5CR2 A;  2VXF A;  1LCK A;  4IUU A;  5I22 A;  3EH1 A;  4DBH A;  2EYY A;  4P5N A;  4BE0 A;  3H0I A;  4LN2 A;  3CC2 T;  2KNB B;  2JM8 A;  3FC3 A;  3WXM B;  4AG2 C;  1VQ7 A;  5GAN 2;  2JUF A;  1C6V X;  1VQM Q;  2VC8 A;  1UB4 A;  1OX9 A;  1W2B S;  4R0K A;  1IRE B;  2F5K A;  1K0X A;  1V76 A;  4M75 C;  4CC4 B;  3G71 T;  3OSS C;  2CYZ B;  3OYJ A;  2FL7 A;  2V1R A;  2WSC E;  1YJW T;  4DOW A;  1BI2 A;  1M90 R;  4M75 G;  5D6X A;  1VQ5 A;  3QG1 A;  1KQ2 A;  1IB8 A;  1WJQ A;  3PFS A;  3CXC A;  3C12 A;  1UFF A;  4LDV A;  4PLL A;  1WHG A;  4QQG A;  4OML A;  2DX1 A;  2MI6 A;  2RQW A;  4A53 A;  1QKX A;  2L3R A;  4XK8 E;  1PNJ A;  1WHJ A;  1W2B P;  4E6R A;  2EBP A;  1NLO C;  4OMM A;  3M0T A;  1G3Y A;  2DZC A;  1K9A A;  5FRM A;  3KXT A;  3X20 B;  1WX6 A;  2OAW A;  2EJF A;  2KSS A;  4M7D F;  2KRN A;  2NUZ A;  1JXM A;  1ZHI A;  3JSC A;  4RKU E;  3J81 E;  1N8R U;  2EGE A;  1VQN A;  1NYF A;  1RAE B;  2FRY A;  1KC8 R;  2GTO A;  1PKS A;  3CMA T;  4M4Z A;  2DAQ A;  4D8K A;  3CPW P;  2X3W D;  3QDR B;  3QKJ A;  3GLX A;  4C5H A;  1WYX A;  2HD0 A;  3I5R A;  2O31 A;  1SG5 A;  3RES A;  3QZ5 B;  2H3J A;  5J39 A;  1YIJ Q;  2X4X A;  3QUI A;  1T0J A;  3CCE Q;  1K9M U;  4Z88 A;  3CCR T;  1OPK A;  4Y91 A;  3MEW A;  3JB9 H;  1N27 A;  2YRD A;  2YHT A;  2DET A;  4M78 C;  1Q81 R;  3EHQ A;  1VQ8 T;  2E5Q A;  2M16 A;  2E5K A;  4OVA A;  4DBR A;  3V8J A;  2YUN A;  3JB9 G;  3SWN A;  1VQ6 Q;  1X6B A;  5LJ5 d;  3CCU Q;  2E70 A;  3FDR A;  3CCS Q;  2XG8 D;  1M1K C;  4C8Q C;  3CCV Q;  4E2F B;  1FWZ A;  2RH2 A;  1TOV A;  2K3Y A;  4R55 A;  2JM9 A;  2CH4 A;  1JXO A;  2I0N A;  2VGM A;  4N0A C;  3VS5 A;  1ZUK A;  4X34 A;  2OTJ A;  2CP0 A;  2QYZ A;  3J80 E;  4J9F A;  2DMO A;  5KE3 A;  1ZX6 A;  4M75 F;  5GAN h;  3MCA B;  1AHJ B;  1BI3 A;  3HKS A;  2MIO A;  4QQ6 A;  1KQS A;  5GAM g;  3M55 A;  2EAY A;  3CCQ T;  5FU7 C;  1VQP Q;  5LJ3 g;  3CCL A;  4M77 D;  5GMK h;  3ER0 A;  2XK0 A;  2JTF A;  3VS7 A;  5A0G A;  4RTV A;  1MMD A;  1OI1 A;  4J9E A;  4XTV A;  4KH0 B;  4OMF B;  3ASK A;  2E3I A;  1FYN A;  1QVP A;  5IHN A;  3C0C A;  2EGC A;  1U5S A;  3EFO B;  1NBE B;  1AT1 B;  5EG2 A;  3I56 T;  1YHQ Q;  3VS0 A;  1VQM A;  3URG A;  3CD6 T;  2JNG A;  2CP7 A;  1NPP A;  2HDA A;  3SDZ A;  3M0S A;  3X28 B;  2FO0 A;  2KEA A;  2RJE A;  2V1Q A;  3QXE B;  1JJ2 S;  2LJ3 A;  1R0C B;  3U23 A;  2FRW A;  3I9Q A;  2KRM A;  1PM3 A;  4MML A;  2YLB A;  1QVG A;  1NZ9 A;  2KK4 A;  1IRX A;  5IXB A;  4M77 A;  2EKO A;  4EMK B;  2CSQ A;  2PU9 B;  4M78 F;  1PRM C;  4B9X A;  2DTH A;  2BTT A;  3JB9 F;  5L23 A;  3RKY A;  2LJ0 A;  3JB9 I;  2L3P A;  1N9R A;  2GQV A;  2E65 A;  1WHK A;  2EGA A;  3QYG B;  4C8Q F;  5FW9 A;  4HT8 A;  2ED0 A;  1JJ2 P;  1QVF S;  4NOY A;  5CKB A;  3PGG A;  4KBM B;  1H8K A;  3V8L A;  5GAN 8;  2F5T X;  4GBQ A;  2A0F B;  1TS9 A;  1NJI R;  3QWX X;  4X9D A;  3PIP A;  2XD0 A;  1QLY A;  3QHS A;  2AIR B;  2IG0 A;  2DTI A;  1ZSZ B;  2DNU A;  1M27 C;  1MMG A;  4RTZ A;  4TVR A;  3CME Q;  4M77 E;  2LRQ A;  5FRN A;  2QEX T;  1J3T A;  2JN0 A;  1QVF P;  2D0Q B;  3OYC A;  4OB0 B;  2DXC A;  1YIJ A;  4M7A D;  5CQX A;  5FU6 B;  3CCE A;  4WF2 A;  4L59 A;  2H3E B;  1FMV A;  1GCP A;  2LVM A;  4J7F A;  2YUQ A;  2QGF B;  2RM4 A;  4CC2 A;  3CCM Q;  1UEB A;  4J9B A;  2O9V A;  3BDU A;  3SFM A;  2MWO A;  1HXD A;  2QQA A;  1I81 A;  2COY A;  2CZ0 B;  3KBG A;  3V7R A;  1MMN A;  1VQ6 A;  3CCU A;  1Z9Z A;  4JLG A;  3UAT A;  5HCK A;  3CCS A;  2CUB A;  8AT1 B;  3CCV A;  1OQK A;  4F7U A;  5CK9 A;  1AWX A;  4BY6 B;  2LMJ A;  1QQJ A;  1Y96 A;  2K79 A;  1X69 A;  1KQ1 A;  4RTW A;  2NUP A;  3HFN A;  4KUL A;  2YLC A;  1OOT A;  1F1B B;  2DL8 A;  4OMQ A;  4M7D D;  1MNE A;  2YT6 A;  4J83 A;  1HK9 A;  2LNV A;  4MZT A;  3JCM d;  1B3Q A;  2PNI A;  1K8A R;  1VQP A;  2NUT A;  4M7A A;  2MOX A;  2DKG A;  4FYX B;  3REA B;  3DLL A;  3M58 A;  2LQ8 A;  2Z0W A;  3I55 Q;  1U1S A;  2YUO A;  4VUB A;  1I1J A;  3OBW A;  1JO8 A;  1VQ9 Q;  1W4S A;  1WJS A;  2HL3 A;  3QDF A;  1YJ9 Q;  4OMN A;  1Q95 G;  2KT8 A;  3RUX A;  4XU1 A;  5DLQ E;  1XOV A;  1YHQ A;  2J05 A;  2JW4 A;  2EW3 A;  2V8I A;  2D6F A;  2AHJ B;  3A8L B;  5GAO r;  1KHI A;  1UEC A;  4ZTJ A;  1K73 R;  1G8X A;  4PKC C;  1Y71 A;  1E6G A;  2CGH A;  1SSH A;  2RA2 A;  2DYI A;  2YXY A;  5GMK m;  3MEU A;  4DEY A;  4M7D A;  4M7A E;  1Y07 A;  3AHU A;  1U3O A;  4LUD A;  1M3B A;  2J6K A;  2FZK B;  3SWN B;  2JS2 A;  2JMA A;  2HMA A;  4XU3 A;  1IHV A;  1QCO A;  3MP8 A;  1YCY A;  3VS6 A;  4M75 D;  4DQ2 A;  2LJ1 A;  2FG0 A;  3VS3 A;  3EG0 A;  1Q86 R;  1K4U S;  3M9Q A;  2EJ9 A;  1BKB A;  2M02 A;  2R58 A;  2HBP A;  2QAS A;  1BI1 A;  3OW2 S;  1G3W A;  3TSW A;  4F04 B;  4C0G A;  5DLO A;  2BE7 D;  4MMK A;  4OB1 B;  2HQH A;  3ZBD A;  4BDY A;  5CO7 A;  2EVR A;  1W2B A;  1G5V A;  3OYM A;  2A36 A;  3OYB A;  2G3R A;  1UTI A;  4FU6 A;  4O5V A;  3H41 A;  1BYM A;  1H64 1;  2KAF A;  3NGP A;  4LE9 A;  4HVV A;  1TUG B;  1T3S A;  5I2M A;  4J7I A;  5CKE A;  3EFS A;  1QW1 A;  4FCY A;  2ZPF B;  3ZFJ A;  3CME A;  1QCF A;  4IUP A;  3OMG A;  3OW2 P;  1VIF A;  2LQK A;  3REB B;  3CPW A;  1YI2 T;  4J9C A;  3TEE A;  4JRQ A;  1YN8 A;  1TXQ A;  4E7I A;  2RHY A;  4XTW A;  5KYX A;  2A28 A;  1K1Z A;  3CCM A;  5LJ5 j;  2JMC A;  1LOJ A;  4WCI A;  3FB9 A;  4IUV A; 
#chains in the Genus database with same CATH homology
 1KSW A;  1W6X A;  3IQL A;  1M8M A;  1A0N B;  2DRM A;  2GQI A;  2KYB A;  2ESW A;  4DEX A;  4CC7 A;  1M3A A;  1AWW A;  1K76 A;  4JJB A;  1UFF A;  1AWO A;  1VA7 A;  2J6F A;  1MV3 A;  1CKA A;  3RBB B;  4OML A;  1JU5 C;  2DX1 A;  2RQW A;  1PKT A;  2KT1 A;  1QKX A;  1BK2 A;  1GRI A;  4F14 A;  1H92 A;  2RMO A;  1PNJ A;  2DF6 A;  1WXU A;  2O9S A;  4E6R A;  2EBP A;  1NLO C;  1E6H A;  2J6O A;  3M0T A;  4OMM A;  1UHC A;  2DL7 A;  4Z89 A;  1UUE A;  2KXD A;  1K9A A;  4J9D A;  4LNP A;  1WX6 A;  2OAW A;  1VYT A;  4X1V A;  2KRN A;  2NUZ A;  2IIM A;  1JXM A;  1GBR A;  1SRM A;  2EGE A;  3NPF A;  1NYF A;  2SEM A;  1N5Z A;  2FRY A;  2GTO A;  1PKS A;  4M4Z A;  4D8K A;  2EYX A;  2X3W D;  2VWF A;  5EC7 A;  4IIM A;  5IHK A;  1WYX A;  3I5R A;  2O31 A;  4HCK A;  3KFV A;  1UJ0 A;  2OJ2 A;  4K11 A;  3UF4 A;  1ZUY A;  2NWM A;  3UA6 A;  1T0J A;  4Z88 A;  1OV3 A;  1OPK A;  3EHR A;  4GLM A;  4HVW A;  1BU1 A;  1G2B A;  1NEG A;  3PE0 A;  3EHQ A;  3THK A;  2E5K A;  2RPN A;  1MUZ A;  2AK5 A;  2YUN A;  1ZUU A;  2HCK A;  1X27 A;  1X6B A;  3VRY A;  1NLP C;  4A63 B;  2JM9 A;  2CH4 A;  1JXO A;  2I0N A;  2K7A A;  3VS5 A;  1ZUK A;  2BZX A;  1UHF A;  1X6G A;  2GBQ A;  4J9F A;  2DMO A;  2RQT A;  4J9H A;  2VVK A;  1ZX6 A;  4HXJ A;  4AFQ C;  1SPK A;  1AZG B;  2MIO A;  3UA7 A;  4HVU A;  1B07 A;  2D8J A;  1AZE A;  2C0O A;  1U06 A;  1ABO A;  2AZS A;  2W10 A;  3R6N A;  1TG0 A;  1W1F A;  4FSS A;  1UE9 A;  1G83 A;  3SHW A;  2DRK A;  2ROL A;  2M0Y A;  1SHF A;  2GGR A;  4LUE A;  3VS7 A;  4RTV A;  1IO6 A;  1YWP A;  1BBZ A;  4J9E A;  2PZ1 A;  1HJD A;  2DBM A;  1MV0 B;  1TUD A;  1EFN A;  2ECZ A;  3EG1 A;  5GJV B;  1FYN A;  5IHN A;  4J9G A;  2FPE A;  2M51 A;  2K3B A;  4OMP A;  3C0C A;  1AWJ A;  1VYV A;  1GCQ C;  2EGC A;  3PVL A;  2CSI A;  1U5S A;  1AOJ A;  2L2P A;  4JJC A;  1X2Q A;  3VS0 A;  2EYW A;  4KRT A;  4AFS C;  1K0S A;  1ABQ A;  2KYM A;  5IXF A;  2HDA A;  3M0S A;  1GFD A;  4RTT A;  2FO0 A;  2KEA A;  2V1Q A;  2EQI A;  4EIK A;  2LJ3 A;  4F17 A;  5ECA A;  3U23 A;  3RNJ A;  2FRW A;  2JTE A;  3I9Q A;  1KFZ A;  2KRM A;  3CQT A;  3JV3 A;  1X43 A;  4ZNX A;  5IXB A;  4JPB W;  2G6F X;  1V1C A;  2A08 A;  2RF0 A;  2CSQ A;  2ENM A;  2ROT A;  1PRM C;  2BTT A;  2D8H A;  5L23 A;  2LJ0 A;  2L3P A;  1KIK A;  1TUC A;  1NYG A;  3VS4 A;  2EGA A;  2AZV A;  4RTX A;  2SRC A;  1VYU A;  2DVJ A;  3QWY A;  5FW9 A;  1M30 A;  2DLP A;  2ED0 A;  1ZSG A;  2HEQ A;  4Z8A A;  1H8K A;  2DL3 A;  1X2K A;  2F2X A;  2AKL A;  2LNH B;  1RLP C;  4GBQ A;  1T0H A;  4Y92 A;  1KJW A;  3LH5 A;  2LQN A;  2KRS A;  3QWX X;  4CC3 A;  1UG1 A;  1YP5 A;  2BZ8 A;  1UGV A;  1QLY A;  2K2M A;  2YUP A;  1AEY A;  4RTU A;  1NM7 A;  2KXC A;  3ULR B;  2DBK A;  2DNU A;  1WXT A;  1M27 C;  4RTZ A;  5I11 A;  1UJY A;  1OEB A;  1WFW A;  5IH2 A;  1ZBJ A;  1CSK A;  1J3T A;  1RI9 A;  3A98 A;  1W70 A;  1RLQ C;  2PTK A;  2J06 A;  1PWT A;  2FEI A;  4D8D A;  2RNA A;  4ORZ A;  1GCP A;  1M3C A;  2YSQ A;  2YUQ A;  3ZL7 C;  4CC2 A;  2HBW A;  4JZ4 A;  4J9B A;  2O9V A;  1UDL A;  3FJ5 A;  1WI7 A;  2A37 A;  4ESR A;  4RUG A;  1PRL C;  3I5S A;  1Z9Z A;  2XMF A;  3UAT A;  5HCK A;  2ED1 A;  2B86 A;  2J7I A;  4J9I A;  2CUB A;  4QT7 A;  1H3H A;  4JZ3 A;  1AWX A;  2H8H A;  2K6D A;  5FWC A;  2LMJ A;  1GCQ A;  2DM1 A;  1QWF A;  2K79 A;  1X69 A;  4RTW A;  2X3X D;  3PVQ A;  1AD5 A;  1YCS B;  1WLP B;  1ARK A;  1OOT A;  2LCS A;  3EGU A;  3H0F A;  2W0Z A;  2DL8 A;  2RQV A;  1WA7 A;  4OMQ A;  2YT6 A;  2RQU A;  5IHI A;  2RN8 A;  5FWB A;  4OMO A;  2ABL A;  1B3Q A;  2PNI A;  2D0N A;  3M0U A;  3TSZ A;  2DA9 A;  2MCN A;  2MOX A;  3M0Q A;  3REA B;  2EKH A;  2GNC A;  3M0R A;  2KRO A;  5GJW B;  2YUO A;  2O2O A;  3VRZ A;  1BB9 A;  2VKN A;  1I1J A;  3EG2 A;  1JO8 A;  2DIL A;  1WIE A;  2D1X A;  4OMN A;  1GFC A;  2LX7 A;  3SEM A;  2DL5 A;  2KT8 A;  3H0H A;  2KGT A;  1S1N A;  1Z9Q A;  1XOV A;  2J05 A;  2KBT A;  2HSP A;  2JW4 A;  4IIO A;  2EW3 A;  1YWO A;  1SEM A;  1NG2 A;  1UEC A;  2CRE A;  2CDT A;  2DJQ A;  2RQR A;  2LP5 A;  1I0C A;  1JQQ A;  4JJD A;  1E6G A;  1SSH A;  2BZY A;  2L0A A;  1WDX A;  2C0I A;  4DEY A;  1GBQ A;  3VS1 A;  1U3O A;  4LUD A;  1SRL A;  1M3B A;  2L3S A;  2EPD A;  2YDL A;  1JEG A;  2J6K A;  1Y0M A;  2DE0 X;  4RTY A;  2JS2 A;  2JMA A;  2CT4 A;  3VS6 A;  2JT4 A;  1OPL A;  4AFU C;  2QDL A;  2L3Q A;  1ZLM A;  2LJ1 A;  2FG0 A;  3VS3 A;  2O88 A;  1AVZ C;  3EG0 A;  2F2W A;  1K4U S;  1QWE A;  2GTJ A;  1YNZ A;  2FPF A;  2LZ6 B;  2K9G A;  2EYZ A;  3TSW A;  1GL5 A;  1CKB A;  3I35 A;  4F16 A;  4AG1 C;  3VS2 A;  3TVT A;  2EVR A;  2DL4 A;  2CT3 A;  2A36 A;  1Y57 A;  1UTI A;  2CUD A;  2KR3 A;  3NMZ C;  1RUW A;  1WXB A;  3NHN A;  3H41 A;  1PHT A;  3NGP A;  4LE9 A;  4HVV A;  4AFZ C;  1T3S A;  2DYB A;  1HD3 A;  3EG3 A;  1LCK A;  1T3L A;  2JS0 A;  5I22 A;  1QCF A;  1E7O A;  3GBQ A;  2LQW A;  3REB B;  2EYY A;  3H0I A;  4J9C A;  2CH4 W;  4LN2 A;  2KNB B;  2KE9 A;  2JM8 A;  1YN8 A;  1SHG A;  3O5Z A;  4AG2 C;  2OI3 A;  2C0T A;  2F2V A;  2JXB A;  1HSQ A;  3M0P A;  2A28 A;  1NEB A;  1K1Z A;  4R0K A;  2JMC A;  2P4R A;  2AKK A;  1QKW A;  4WCI A;  1K0X A;  1FMK A;  4CC4 B;  1I07 A;  2FPD A;  2V1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...