2RHUA

Crystal structure of the 3-mbt repeats from human l3mbtl1 bound to dimethyl-lysine and in chimera with histone h3.3(28-34)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
325
structure length
323
Chain Sequence
SWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGGGGSAPSTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 323
sequence length 325
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhuA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhuA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhuA03
2M16A 4RG2A 2GFUA 2GF7A 3MEUA 3L2WA 3OS1A 4FL6A 4C5GA 3Q1JA 3OYMA 4A4GA 2LCCA 2DIGA 2EQMA 5IN1A 2RI2A 3M9QA 3META 3LGLA 3OYCA 1XNIA 3H8ZA 3GOXA 4IKFA 3PMTA 4QVZA 1N27A 4A4HA 5KE2A 2RJDA 3MEVA 4E7HA 4C5HA 3LX7A 3OYKA 4CRIA 2O4XA 3F70A 3FC3A 4ZTJA 2R58A 2LTOA 2XK0A 4N4GA 5IAYA 2RI3A 1SSFA 2RHZA 3QJ6A 4IUQA 3MP1A 3OB9A 1WJQA 2LRQA 5D6YA 5C0MA 3DLMA 5M9OA 3E9GA 2O4XB 4QQDA 3L2VA 4IUVA 3LH0A 3ME9A 4PLIA 4II1A 2JTFA 4BE2A 2DAQA 2RO0A 2XDPA 3LLRA 1WJRA 2RHXA 5KCOA 4B9WA 2RJCA 2GFAA 2X4WA 3OS2A 4BDYA 2BKDN 2L89A 2CKKA 3P8HA 5C6SA 2VYTA 2RHIA 3S6WA 4E7IA 5FRMA 3FEOA 2M0OA 2JZ2A 3FLGA 3OYLA 1OI1A 2G3RA 3LGFA 2R57A 1H3ZA 1RI0A 3FDRA 4L59A 3L2QA 2BUDA 2R5MA 2R5AA 3OA6A 4QQGA 3OYBA 4ZTFA 3ASKA 2RHUA 3L2UA 3PFSA 4LD6A 4OVAA 2EFIA 2RHYA 2LVMA 3LYIA 4E7LA 2DIQA 3BDLA 5D6WA 5J39A 1OZ2A 1WGSA 3PNWC 3QIIA 4IUPA 3CEYA 1OZ3A 3DB3A 3UT1A 3L42A 2E5QA 4QQ6A 3SD4A 3QBYA 2QQSA 3DB4A 2LDMA 4B9XA 2FHDA 3MEWA 1KHCA 2D9TA 4C5EA 5FRNA 3NTIA 3QKJA 3NTKA 4IUUA 2RI5A 4EDUA 3OY9A 3S3OA 5J26A 2F5KA 2P0KA 3S3NA 4N4IA 2IG0A 3MO8A 2RJFA 3KUFA 3EAEA 3MP8A 4UC4A 1MHNA 4E7JA 3OYGA 2HQXA 3OYNA 1G5VA 3OYHA 2EQUA 5D6XA 3S3MA 3OYJA 2EQKA 2L8DA 5KH6A 2HQEA 4QW2A 3OS0A 3OMGA 4BE0A 2K3XA 2PQWA 3C4SA 4PL6A 5KCHA 2K3YA 3MP6A 4X34A 3NTHA 3OYEA 3OQ5A 3O8VA 2EQJA 2X35A 2YRVA 2MWOA 3UWNA 4N4HA 3OYIA 3OYDA 4BACA 3P8DA 2L3RA 2BIVA 2E6NA 2EKOA 2NLUA 2RJEA 3H6ZA 4FU6A 3ZEHA 3L2RA 2X4XA 4IUTA 4BDZA 4BE1A 4GY5A 4A4FA 4PLLA 2MWPA 3OYAA 2M1HA 4C5IA 4HCZA 4Q5WA 5KE3A 1OYXA 2WACA 2X4YA 3MEAA 3E9FA 3OMCA 4IURA 5CIUA 4Z02A 4NS5A 1WJSA 4A4EA 4E7KA 3PMIA 5FROA 4BD3A 2QQRA 3OYFA 2B8AA
chains in the Genus database with same CATH superfamily
4J9CA 2QDLA 5LJ5h 3OS1A 3OW2P 3I56Q 1OX9A 2VKNA 3MEVA 3JCMQ 1I1JA 3OYKA 3G4ST 2DFUA 3UF4A 2DEQA 1Q95G 5ECAA 1K4US 1GCQA 2PZ1A 1WJQA 2D1XA 1K8AR 3OYYA 1E6GA 1KK7A 1B34A 1D0XA 1ABQA 5CO7A 3MKDA 4RMOA 2GFAA 3TSWA 2A37A 1KC8R 2YLCA 2AIRB 1Q86C 1VQ8Q 3D7SB 2D0QB 3FEOA 2XG8D 3JB9I 2COWA 3G6ET 1YWPA 2BTTA 5KYXA 1YJWA 1Q86U 1M8MA 4J9FA 2OTJT 3JB9H 2ZZDA 4RTVA 3X26B 1QP3A 2CZ6B 3CC2T 3LYIA 4M75E 2QASA 2LC4A 1WA7A 3PNWC 2J6OA 2MMPA 1NYFA 3KBGA 4PJOG 1YNZA 1BU1A 5FRNA 3EGXB 5GANd 2F5KA 2PVOB 2P0KA 4M4ZA 1HYOA 2VC8A 3T9NA 3C0CA 5IHNA 1UGVA 3SWNB 4E6RA 3M0RA 5IXFA 3CCEQ 4PJOC 1V76A 2FB7A 3OYEA 1WXUA 3OYDA 2JJ9A 2NLUA 1KSWA 3H6ZA 1RAHB 1TU0B 4ZGDB 4FW1A 3ZBDA 4JPBW 4MZMA 2RH2A 3KFVA 3ASKA 3HPWA 2GFUA 4FSXA 1BI3A 2A08A 2YLBA 5GAN8 2RI2A 3LGLA 3M53A 3H8ZA 5HCKA 2DZCA 4HVWA 5GANh 1W1FA 5GAN2 2PUKB 4RKUE 3GPLA 2QA4T 1YITA 2LJ0A 3F70A 2XKOC 1SRMA 5M9OA 4OB3B 4FYXB 1VUBA 4EMGA 5LL6S 4CI0C 5GAN6 3VUZA 2FPEA 1ZA1B 4EMKA 4XQ3A 5KYWB 3S6WA 1LNXA 4FYYB 1WHMA 1BI2A 3BFMA 2CGHA 2GQIA 2ZPIB 1JJ2S 2BZYA 2KRMA 3CC4T 2FYKA 3M56A 2EJ9A 2GBQA 4ZN1A 3VRYA 3CCLQ 5GMKe 2RQUA 5J39A 2MF2A 1U3OA 1EX4A 3JCMW 2RK1A 4J9BA 4E2FB 1N8RR 3JSCA 2QQSA 3DB4A 3SHWA 4PJOB 1ZBXA 1JO8A 4HA8A 4B9XA 5DM7R 3MEWA 1U1SA 1I5LA 5D7UA 1Q82C 2O9VA 1R0BG 4RTXA 4M7DG 2HQXA 2H8HA 1M27C 1E7OA 2Y4YA 2HL5C 1Q82U 2QAZA 2EPDA 3CCUA 2DILA 3MP6A 2DK3A 3OQ5A 1KG1A 2F5TX 1Q86R 1GFDA 1WXBA 1U1TA 3OYIA 3P8DA 3ZEHA 3RKWA 3DKMA 4OMQA 2VV5A 1VQPQ 2EBPA 2HSEB 4C5IA 4M7DC 1R0CB 3MEAA 1RLPC 1EZZB 3PIPA 3EG9B 1S72T 5GAMf 2VGNA 3JCMX 4A4GA 4N0AC 3CPWP 3OYCA 4M78D 2KT1A 2RJDA 4C5HA 2JVVA 3C12A 4HVVA 4PFZA 2A3LA 2ATCB 1AWOA 1YWOA 2L0AA 2JTFA 1WHJA 3M58A 3ZFJA 3OS2A 1T0HA 3M59A 2BKDN 1VQOA 2QEXT 4F04B 3RESA 1VQMA 2P4TA 1PG5B 4PJOF 4HXJA 2FPDA 2XI9A 1UEBA 3L2QA 4JJNK 2QQAA 1UGQB 4F16A 2MPXC 1VQ7T 1ZSGA 2LVMA 4E7LA 3BDLA 3CMEA 4Z88A 2V8JA 1WQ7A 3QIIA 5EG2A 3CCQT 3CEYA 1OV3A 3REBB 5GAMj 2E5QA 3NMZC 5KYUA 3A5ZB 4JJCA 3QBYA 2LDMA 1UHCA 2RK2A 3G71T 2BE9B 4RCBA 3QUIA 1K73C 1IRXA 1WLPB 3MO8A 3EFOB 2DA9A 3M54A 4ORZA 1NE8A 4M7DB 3X24B 3CMAQ 2ZPGB 1YI2T 4AG1C 1NBEB 5KH6A 1BBZA 3HHTB 5AYFA 1GRIA 3CC7T 2XDDA 4KGZB 3SDZA 2D8HA 4E47A 3VUBA 3JV3A 4FYWB 4RCCA 1VQKA 4Q5WA 3VU3C 2SEMA 1BKBA 2A7YA 4M75G 1VQMQ 2DLPA 4FCYA 2DM1A 2DBMA 3TEEA 4L5GA 1AT1B 3CCLT 2PNIA 6AT1B 1LCKA 2M51A 1ARKA 3MEUA 2QYZA 5GAMg 2CZ7B 1D1CA 1YJNT 4J9GA 3TQ7P 3TREA 3PMTA 5J3BA 2OAUA 2KROA 2LQNA 4M75C 1MGQA 4ZTJA 4KH0B 3CCRA 5GAMd 2J6KA 3CCJA 2V1RA 1Y96B 4OB2B 2DAQA 3LLRA 2RJCA 3QO3A 4Y28E 2QTXA 3A1PA 2KAFA 4JZ3A 3LWHA 1T0JA 1YFNA 3GP8A 1B07A 3JB9G 1VQPT 1TXQA 2G3RA 1SPKA 1Z9ZA 4PJJA 4F14A 1XJWB 3ZL7C 1SSHA 3OYBA 2LT1A 1H3HA 1QW1A 1E6HA 1BB9A 3I55A 2CP6A 1YIJA 2DL7A 1NZ9A 1HK9A 3HRTA 2HMAA 3L42A 5L8RE 2DJQA 2CP5A 2FHDA 2RNAA 1PRMC 4PFOA 1W70A 2EQIA 5A2QE 4IUUA 1AVZC 5J26A 2IVWA 4OB1B 5GAMh 1C0MA 4C0ZA 4KUIA 2DL5A 1K1ZA 3VS1A 1Y0MA 3CCRQ 5FU7C 1YHQT 3OS0A 1F1BB 2K3XA 3G1JA 5CR2A 3CCJQ 2DBKA 4ZN3A 1PCXA 2CP7A 3A98A 1G3SA 4OMFB 2XHCA 4ZNXA 3VJPA 3CC2A 1X75C 2Y90A 2X4XA 5I22A 1D3BB 3JCMV 5I2MA 1VQ9Q 3REAB 2O88A 3HTRA 4MZPA 4LDXA 3OMCA 4M75B 4A4EA 2YHTA 1TWBA 5CK9A 3H0HA 1K8AC 3V8JA 2HKQB 4CC3A 1VQLT 1FMKA 3SEMA 3WVEB 1K8AU 4JRIA 3G7ZA 1KC8C 1RI9A 1YIJQ 4A54A 1O9SA 1IGUA 1LJOA 3CBPA 1KC8U 4F7UF 4JRKA 4IUQA 3GNGA 1AEYA 2AKLA 2LMJA 1AD5A 4XTXA 3H9NA 3LH0A 3PGGA 4M78E 2YUNA 1X69A 2HSPA 1C1AA 3CCMQ 1KD1R 3RMSA 1M8VA 1BIAA 2F69A 1AOJA 4RTTA 3QZ5B 1TSFA 2EAYA 2RN8A 1EIFA 3O5ZA 3JCMf 2E1HA 3LGFA 1MMNA 1RI0A 2DD4A 3RMQA 3M55A 1R8OB 4M7AF 5FWCA 2RHUA 3BY7A 3L2UA 1U5SA 5CKBA 1S1NA 2C0TA 2COZA 2DXTA 5FLXE 1RAFB 2M9UA 2DTHA 2DRMA 1WDXA 4M77A 3L2ZA 1JXOA 4GLKA 5I2SA 4MZTA 4J5YA 4QQ6A 5FU7B 2K7AA 3TVTA 3VKIA 1JB0E 1W4SA 2KE9A 1PSEA 3H0IA 3X20B 1M3AA 1UHFA 4UC4A 3CCSA 3OYGA 4M75F 2LJ3A 2OJ2A 4IIMA 5GJVB 3OYHA 2EQKA 4J6WA 1UE9A 1QKXA 3VRZA 1WIEA 1EFNA 2A36A 2RB6A 2YUOA 2CYZB 4A53A 1ZLMA 5HK0A 2JTEA 1I81A 4AMCA 2AK5A 4XU3A 3OW2A 2RF0A 2KR3A 1TUCA 2P4RA 1IREB 4HKEA 4J8OA 1M2VA 1WHLA 2EJFA 1NLOC 5CAIA 1NM7A 3META 4XTZA 4PKCC 5IH2A 4F7UA 3LWIA 5GMKl 2LCSA 3JCMc 4JDSA 2HKNA 2LZ6B 1QVGP 2EVRA 3LX7A 2DRKA 1OQKA 1VQNA 3CQTA 1PM3A 3L2VA 1UGSB 3RKYA 1ZA2B 2K2VA 2XIDA 2OI3A 2E64A 1M3CA 3EHRA 2JOYA 2NUPB 3CCSQ 5HKCA 1I4K1 1MV0B 2CS7A 4BDYA 1J3TA 2E6ZA 3RNJA 1VQ4A 1ZSZA 2RHIA 3NFCA 1WQWA 1N8RC 1T3LA 4M7AA 1VQ9T 4DA4A 1N8RU 3JCMg 3E1SA 4L59A 3QSUA 2C06A 1YJ9A 2HCKA 1M3BA 4OVAA 3SFMA 3JCMP 4NL3A 2GNCA 2YRDA 4MMKA 2IIMA 5KYYB 5IHKA 1RUWA 1KFZA 2DETA 2X3WD 1GFCA 2OTLA 2NWMA 4HVUA 2H3EB 3NTKA 2HD0A 2YT6A 3OY9A 3HSBA 2EWNA 2HQHA 3QWXX 3V7RA 3CCVT 2JW4A 1BIBA 2F2VA 2XICA 2LQWA 1W2BS 3CCMT 1VQNQ 4GBQA 3C4SA 1KQSS 1PKSA 4OMMA 3M0TA 3CXCA 4C8QB 2EJGA 2L3RA 2QXFA 3R6OA 1VQ4Q 3OYAA 3TU4K 1PRLC 2KMTA 1XTDA 5KE3A 1ZUUA 4CC7A 3PTAA 2XU8A 5LJ3j 2YXYA 2DE0X 2B8AA 1MMGA 2HAXA 1YJ9Q 3G71A 4XTVA 1BK2A 2V8IA 1NG2A 2ZPBB 4C92A 1W6XA 5HK3A 2K6DA 2KVQG 1QWFA 2MAMA 3EHQA 4DOVA 2HEQA 4K11A 4BI8B 4EIKA 4MDWA 3THKA 2GCXA 1YJWQ 1M5Q1 2KXCA 1GXIE 5HY6A 4LDWA 2L89A 3P8HA 5KYUB 2X4JA 3MCAB 5GMKh 3OYLA 1VIFA 3JCMe 2FZCB 2R57A 3EGDB 1HD3A 1U06A 4CC4B 2R5MA 2XDBA 1ZX6A 2PVDB 3CXCS 1YJNA 2PUOB 2DL4A 4DQ2A 3I5RA 1GBQA 1WZOA 3ULRB 3EFSA 4C8QF 4C5EA 4JJBA 2LP5A 1FWZA 3S3OA 4VUBA 3AT1B 2JNGA 2CZ1B 4M78G 1D1BA 2RJFA 1JJ2P 2CT4A 3V7SA 4HCBA 2PVGB 1RL2A 4E7JA 1AWWA 1G5VA 1C6VX 2F2WA 2JUFA 3QHSA 5D6XA 3UDCA 3QJYA 2PQWA 5KCHA 4OMLA 4N4HA 4JS4A 3I56T 2EKOA 1HXDA 2C0OA 1KIKA 4XU1A 3RUXA 1D0ZA 3CPWA 4M78C 3CPFA 4IURA 1P92A 1UJYA 2FRWA 1YITQ 1UJ0A 3M4GA 2X51A 4LNPA 1X43A 2GGRA 1VQ5A 4FL6A 2AZVA 4C5GA 3DLLA 2CUDA 2DIGA 2P0QA 2CZ0B 3E2UA 1VQ8T 1Y57A 2QTVA 3QYGB 4J7FA 3R6NA 2D8JA 3VS6A 5IAYA 1R77A 1IXDA 1WPYA 2QQBA 3ME9A 4RG8A 1BI0A 3H41A 1I07A 2EGCA 4MMLA 4B9WA 7AT1B 1QCOA 2DL3A 4YTLA 4DEXA 1AWXA 4M77G 2COYA 2CH4A 3M4YA 3UATA 2PTKA 4O5VA 1QLYA 2M0OA 2RD1A 1PWTA 1OI1A 1M1GA 4AFZC 1VQLA 4ZTFA 2K2MA 2QK0A 5LJ3e 1JQQA 3PFSA 2F1LA 2DYBA 3VS7A 3EH1A 1JBMA 1NEGA 3VV0A 3CD6A 3CCET 4JJDA 2BZ8A 3EGXA 1VQ6A 1VQ5Q 2CSIA 3RR6A 1H8KA 3CCUQ 2CREA 4KRTA 3OBYA 3SWNA 2IG0A 4M78B 4D8KA 1GL5A 2OX7A 2ROTA 3FIFA 1N9RA 3EGUA 2C0IA 4XK8E 3OMGA 2P84A 1AZGB 4J9HA 1NLPC 1RAGB 2RJEA 1VOMA 1G3TA 3V8LA 4HT9A 2CDTA 4PLLA 1Q7YR 2W10A 4LDVA 1G3WA 2HL3A 2LCLA 4O6JA 1JRIA 2ZAEA 4Z8AA 4M77D 1WNLA 2M16A 2LT4A 2GF7A 2DVJA 3L2WA 1M9SA 1KD1C 1K9MC 2B86A 1BCMA 1ZUKA 3QYHB 3CD6Q 1KD1U 1K9MU 5IT9E 1OPLA 3OBWA 2J05A 1VQOQ 4JLIA 2R58A 2LTOA 2LX7A 1KQ2A 5C0MA 4ZGJB 1QVFA 2O4XB 2RMOA 4LXCA 3X25B 4R55A 2RO0A 1OULA 3J80E 1IO6A 5KYWA 2AZSA 1SF9A 4PJLA 2E3IA 3VS2A 3CMEQ 8ATCB 3LH5A 3P8BB 3UA6A 2KYBA 1YCSB 2KRSA 4HT8A 1GCQC 1HJDA 5CVIA 1YITT 4M78F 3FRNA 5A0DA 5FW9A 4TVRA 2KGTA 3L1AA 4OP0A 4PJOA 3IQLA 4QVCA 2AT1B 1O75A 2CP0A 5GAN7 1MNDA 4RTZA 2MOXA 2RQTA 3NTIA 4LN2A 4EDUA 3S3NA 2ZPHB 3GBQA 3KUFA 4JRQA 3M57A 4WF2A 4JLGA 4F17A 2GTOA 2VXEA 1VQKQ 2LX9A 1MUZA 3WVDB 4DBQA 4QW2A 4M7DF 1GCPA 1SKUB 1TTHB 3G4SA 3O8VA 4PNOA 4M7AD 1QVFS 1Y07A 1K0XA 2E6NA 4B6MA 2G6FX 3L2RA 2MK5A 4GY5A 2KBTA 4C92G 3J7AF 4PK4A 2VXFA 4FT2A 2FPFA 2E70A 5CIUA 2K5LA 2L3PA 1G8XA 3EG9A 4AFQC 4BD3A 4LE9A 1I0CA 2I0NA 2NUTB 2DPPB 1H641 2DJZA 3G6EA 3Q1JA 4R0KA 2OTJA 5DLOA 5GAOr 3GOXA 4A4HA 3QPHA 4E7HA 1XQHA 5LJ5f 3CBMA 4DEYA 4J9EA 4FW2A 2RHZA 4OMPA 2KSSA 3MP1A 5D6YA 3E9GA 4J9DA 4QQDA 4PFPA 9ATCB 1OOTA 4PLIA 4XU0A 2XDPA 4KUDK 5KCOA 2RQVA 4LDYA 1IGQA 1B34B 2VYTA 4IIOA 2CH4W 4BB7A 1I8FA 1ZHIA 4CC2A 3I55Q 2KI7A 4RTWA 1VIEA 5GAOn 3G4SQ 3I5SA 5KYXB 2E12A 3JCMb 3CMAT 1I5OB 3C95A 1K9MR 4EMKC 2JS2A 3GF5A 4NOYA 4C92D 3G6EQ 2D9TA 2OTJQ 2RI5A 3EFOA 1WFWA 1VQOT 5EC7A 3BE3A 5LJ5j 4M7DA 2YWWA 2JN0A 1VQMT 3CC2Q 1MHNA 4JS5A 3S3MA 2MIOA 2QA4A 5IHIA 1SHGA 1TG0A 4BE0A 5GMKm 3INZA 4N0AA 1M90R 3CMET 2BIVA 1JXMA 3VYHB 1YBYA 2DYIA 2HBWA 3A8HB 1QVGA 4JZ4A 1M4ZA 4BUGA 2ZGWA 2M02A 3PMIA 4OMOA 1LOJA 4EMHA 2RQRA 4ANJA 2KEAA 3HFOA 3HRUA 3M5AA 3X28B 3A8MB 2F2XA 3CC4A 2HBPA 4QVZA 4XU2A 4M77E 3MPUB 2RM4A 2K57A 5LJ5g 3HKSA 1Y96A 4FYVB 5A0GA 2CUBA 3HFNA 2RPNA 4IUVA 2GTJA 1WHHA 3I56A 2PU9B 2OAWA 1UUEA 3GIBA 4ZGEB 5FRMA 2QA4Q 4JRPA 3N5BB 4EMKB 2DEUA 1RAAB 2EYWA 3M0PA 1H3ZA 2QI2A 3OA6A 3JB9F 1CSKA 2JM9A 1QCFA 1SEMA 3CCRT 3I35A 3GNFB 4IUPA 2DXCA 4Z89A 3CCJT 3DB3A 3UT1A 2DNUA 5DY9A 3JRZA 1Y7XA 2ZCFB 3CC4Q 2JT4A 4F7UE 1PKTA 4LD9K 1S72A 1UB4A 5LJ3f 1V29B 1KQ1A 5GANj 1V1CA 3OW2S 1CKAA 3OYJA 1CKBA 2X9HA 1M1KC 2IPOB 2FZKB 3JCMd 4BACA 1D3BA 1FMVA 3JCMJ 1M1KU 2EYQA 3I55T 3RBBB 1YIJT 2DTIA 3PVLA 4M75A 3NGPA 5A0LA 4PJMA 1OYXA 2WACA 3CCEA 2WSEE 3OSSC 2JMCA 4DOWA 4M7AE 1WJSA 1UG1A 1GBRA 2A28A 2JTMA 2EYYA 4C8QD 5CKHA 2QEXA 4J6XA 5CKFA 1FYNA 8AT1B 3VS5A 1NYGA 2LCCA 2EQMA 1W2BP 1XNIA 5GMKi 1KQSP 1OPKA 5AT1B 1VQ7A 5LJ5e 4L6V5 4DBRA 3RERA 3QJ6A 3CCQA 2LRQA 2XD0A 4QKUA 5GANg 4WCIA 3VYGA 2DVEA 4C0FA 2VASA 1S72Q 4RTYA 3JCMh 4KGVB 5L23A 2X4WA 3M0QA 2YUPA 5I21A 2EIFA 2VUBA 2QGGA 1YI2A 1ZBJA 2FVUA 3A8OB 2OTLQ 1NPRA 1H92A 1M30A 1Y71A 2JM8A 1JJ2A 3OSVA 1M2OA 3CC7A 1OZ2A 1Q81R 2EYXA 1OZ3A 2GQVA 3KXTA 2QEXQ 1B7TA 2KY9A 5FWBA 1QP2A 1VYTA 3PIOA 3CCLA 4BI3A 2O9SA 2DXUA 4C0DC 1WX6A 2WSFE 1Q7YC 4XTYA 4C92E 1VQ7Q 5LJ3g 2EQUA 1Q7YU 2L8DA 4KBMB 2FEIA 2J06A 3CXCP 3CCQQ 4LUDA 4PL6A 3OS5A 2K3BA 2YRVA 2ECZA 4R56A 3UWNA 4FT4A 1FXXA 2CSQA 3TSZA 3G71Q 1YN8A 5LJ3d 1NPPA 3JB9J 2K79A 3E19A 3NPFA 2KYMA 4Z02A 1MMDA 4E7KA 5FROA 4A63B 1YI2Q 1BI1A 4PJOD 2QDYB 2HZYA 4RG2A 4AT1B 3CCST 1VQPA 1TH7A 2AKKA 2ZPEB 3M9QA 3CC7Q 1RADB 4A4KA 1UECA 1N27A 2ED0A 3RDVA 2KNBB 3EG3A 1MNEA 4ESRA 2ROLA 4XTUA 1N9SA 3HRSA 1WHGA 2RI3A 1RABB 2Z0WA 3EFRA 1TUDA 5GANe 2DX1A 2NUPA 3A8GB 4II1A 4FSSA 1WJRA 2RHXA 3VS3A 1G83A 2ED1A 1M1KR 1TS9A 1LPLA 1RACB 2K9GA 2L5QA 1YJNQ 5CQYA 1X6GA 1BYMA 2E65A 2BE7D 3VS0A 3UA7A 5LJ3h 3QXEB 2JZ2A 2VVKA 3UPUA 1T3SA 1X2KA 4X1VA 2BUDA 1RAIB 1XOVA 1YHQA 2MI6A 1QKWA 4LD6A 1PNJA 5KYYA 2FRYA 4C0DB 3URGA 1WGSA 1VQNT 4V2SA 3GLXA 2ABLA 4OMNA 5GAN3 4WTOB 4DBHA 2QGFB 4KULA 3QKJA 3EG2A 5CQXA 1IHWA 2AHJB 3V8KA 1VQ4T 3EH2A 4N4IA 5DLQE 3EAEA 4BY6C 4JUVA 2Y4XA 1QQJA 2ZPFB 3CPWS 4C8QA 4M77C 1YJ9T 3LW5E 1OU8A 2YDLA 2MYSA 1NJIC 4XAXB 2FZGB 3M0UA 2KQWA 2EYZA 3CMAA 4OGCA 1YP5A 4HCZA 1NJIU 1VA7A 3QDFA 2OTLT 4RTUA 1SRLA 2K5FA 2DERA 3WXMB 1YJWT 2QQRA 2YUQA 3OYFA 1YHQQ 1M1FA 3OYMA 1QMCA 4OF1A 5IN1A 1IB8A 2CT3A 2LQ8A 2JMAA 5GJWB 1X2QA 4IKFA 2K4YA 4F7UG 4C8QE 5KE2A 4E7SA 3PT9A 4M7DD 3QWYA 2CP2A 4BI4A 3FC3A 2DKGA 3M0SA 1OX8A 1RAEB 4P5NA 1MV3A 2J7IA 3QDRB 2KXDA 4J7IA 3PE0A 1VQLQ 1RLQC 1UFFA 2FG0A 2V8KA 3EG1A 5GAOp 1PD0A 3EGDA 3U23A 2E5KA 2X3XD 4HCCA 3FLGA 4M7AG 1PD1A 2RQWA 1VQ6Q 4DBFA 1UTIA 1K73U 1NEBA 2DO3A 2EFIA 1QCNA 3BW1A 5GAOm 2HNIA 4ELYC 2LJ1A 3EG0A 2XMFA 4BY6B 1U8RA 2ENMA 1ZSZC 2HDAA 5GAOq 3MJXA 4M7AC 4M77B 1OU9A 1M90C 2VWFA 2LNVA 5GAN4 2LQKA 1M90U 3TCJA 1WXTA 3MP8A 3J81E 1LVKA 4FM4B 4NL2A 3H0FA 2E41A 1JEGA 2EGAA 5I11A 3A8LB 2M0YA 4RUGA 4X34A 4GLMA 2DXBA 2JXBA 2QG9B 2X35A 4J6YA 1FMWA 4BE1A 2MWPA 2I2LA 4KGXB 3VS4A 3C94A 1Q82R 2KRNA 1M2VB 4KT0E 4HCKA 5GAOl 3QG1A 1VQ9A 1ACMB 4KH1B 1G2BA 4XTWA 1IZ6A 4F7UB 4PJOE 1IHVA 2WSCE 1QVFP 1ZUYA 2KT8A 2XK0A 4N4GA 3PVQA 4J9IA 3JAME 1SSFA 3I9QA 4BDZA 3HL8A 2L3QA 2MCNA 4ME7A 1D09B 2DMOA 1TUGB 2NYSA 1AZEA 1KHIA 1HSQA 1X01A 4LUEA 1NJIR 4C92C 3V7CA 3CCVA 4M75D 4QT7A 1K9AA 4M77F 1VQ5T 1ZSZB 1AHJB 2K5IA 3CCUT 4M7AB 3FDRA 4X9CA 2D6FA 1UGPB 3CCMA 2R5AA 1SHFA 5CKEA 1D1AA 2KDSA 4QVDA 2RHYA 4AG2C 1VYVA 3RIRA 3NHNA 1Z9QA 4OGEA 2L2PA 2V1QA 2VB6A 4AFSC 5FU6C 3ER0A 4M78A 1X27A 2O31A 4AFUC 1N6AA 3OYNA 1WI7A 2DTOA 2HQEA 4E7ZA 5GAMe 4FIBA 2E3HA 5CCAA 2K3YA 2L3SA 4D8DA 3JB9D 3FB9A 3BDUA 3QZ9B 2SRCA 4X9DA 2MWOA 2DF6A 4MDXA 4FU6A 3CD6T 4IUTA 4A4FA 1ABOA 2CP3A 1K73R 4EPCA 1FX7A 2X4YA 5IXBA 1VQ6T 3CCVQ 2QQ9A 5CKDA 1ZQ1A 2VGMA 2E4HA 2EKHA 3AHUA 1K76A 2BZXA 4Y92A 1K0SA 4ATOA 1X6OA 3SB2A 1PC0A 4CRIA 1X6BA 2O4XA 4C92B 1SG5A 1B3QA 3OB9A 3DLMA 2NUZA 2E10A 1G3YA 4BE2A 2W0ZA 4M7DE 1UDLA 2DD5A 1Q81C 4ELZC 2CKKA 5C6SA 4E7IA 2V26A 1KJWA 2DZ9A 1Q81U 2YRCA 3FJPA 1D0YA 5FU6B 2P0PA 4C0GA 4PJNA 4QQGA 2KK4A 3CBOA 2O2OA 5GANf 1N5ZA 2EGEA 2DIQA 2H3JA 5D6WA 1VQKT 3RKXA 1WYXA 2EW3A 4C8QG 1UGRB 1VYUA 3SD4A 1JU5C 5LJ5d 4Y91A 4OB0B 1KHCA 1PSFA 5GAN5 1DJ7B 2FL7A 1YCYA 1A0NB 1BCOA 1TOVA 1WHKA 2O01E 3FJ5A 4C8QC 1VQ8A 4J83A 2LNHB 3NTHA 2EQJA 1QVGS 2A0FB 1QVPA 2FO0A 2RA2A 3HP9A 2J6FA 1MMAA 1W2BA 3MHXA 2ESWA 2D0NA 4LDUA 1KQSA 2M1HA 2DL8A 4D6WA 2JS0A 3E9FA 3SWNC 4C92F 4NS5A 2NUTA 1QWEA 2YSQA 1PHTA 5GMKj 1AWJA 5KYNA 1OEBA
chains in the Genus database with same CATH topology
2M16A 4RG2A 2LT4A 2GF7A 1VQLT 3L2WA 5LJ5h 3OS1A 1M9SA 3WVEB 3CCST 1VQPA 1K8AU 1KD1C 1K9MC 1TH7A 4JRIA 2ZPEB 3M9QA 3G7ZA 4A4KA 3QYHB 1KC8C 1N27A 1KD1U 1K9MU 4A54A 3MEVA 3JCMQ 5IT9E 1O9SA 3OBWA 3OYKA 3G4ST 1LJOA 3CBPA 1KC8U 4XTUA 2DEQA 1N9SA 4JLIA 2R58A 2LTOA 3HRSA 4F7UF 2RI3A 4JRKA 4IUQA 3GNGA 1WJQA 5C0MA 4ZGJB 1KQ2A 1QVFA 3EFRA 2O4XB 4XTXA 5GANe 3OYYA 3X25B 3LH0A 3PGGA 4R55A 4M78E 1B34A 3A8GB 4II1A 2RO0A 3J80E 1WJRA 2RHXA 5CO7A 4RMOA 2GFAA 2L5QA 5CQYA 1BYMA 2YLCA 2E65A 3RMSA 1M8VA 1Q86C 1BIAA 2F69A 2D0QB 5LJ3h 3FEOA 2XG8D 3QXEB 3QZ5B 2JZ2A 3JB9I 3G6ET 3UPUA 3P8BB 2EAYA 1EIFA 3JCMf 1YJWA 1Q86U 2E1HA 3LGFA 2OTJT 1RI0A 2DD4A 2BUDA 3JB9H 4HT8A 2ZZDA 3X26B 1XOVA 3RMQA 3M55A 1QP3A 1R8OB 2MI6A 2CZ6B 5CVIA 1YHQA 4M7AF 3CC2T 2RHUA 3BY7A 3JB9D 3L2UA 4LD6A 1YITT 4M78F 3FRNA 3LYIA 5CKBA 4M75E 4TVRA 2DXTA 4C0DB 2LC4A 5A0DA 5FLXE 3URGA 2M9UA 1WGSA 3PNWC 2DTHA 1VQNT 3L1AA 4OP0A 4PJOA 4M77A 3L2ZA 4GLKA 5I2SA 4MZTA 4QVCA 4J5YA 2MMPA 3GLXA 1O75A 3KBGA 4QQ6A 4V2SA 5FU7B 4PJOG 5GAN7 3VKIA 5GAN3 1JB0E 4KULA 5FRNA 1W4SA 3NTIA 3QKJA 5GANd 5CQXA 4EDUA 2AHJB 3V8KA 1VQ4T 2F5KA 2PVOB 1PSEA 2P0KA 3S3NA 3X20B 2VC8A 2ZPHB 4N4IA 5DLQE 3KUFA 3T9NA 3EAEA 4UC4A 3CCSA 4JRQA 3M57A 4WF2A 3OYGA 4M75F 4JLGA 4BY6C 3OYHA 3SWNB 4JUVA 2VXEA 2EQKA 2LX9A 2Y4XA 4J6WA 2ZPFB 3WVDB 3CPWS 4QW2A 4C8QA 4M7DF 4PJOC 4M77C 2RB6A 1YJ9T 3LW5E 2FB7A 3OYEA 3G4SA 3O8VA 2CYZB 4PNOA 4A53A 5HK0A 4M7AD 1QVFS 1Y07A 3OYDA 1I81A 2E6NA 2NLUA 3H6ZA 1NJIC 4XAXB 4XU3A 3L2RA 3OW2A 2KQWA 4GY5A 1IREB 4C92G 3J7AF 3CMAA 2VXFA 4FT2A 4HKEA 4OGCA 4HCZA 4J8OA 1NJIU 4ZGDB 2E70A 3ZBDA 5CIUA 2OTLT 2K5LA 2EJFA 4MZMA 5CAIA 2K5FA 2RH2A 3WXMB 4BD3A 2QQRA 1YJWT 3OYFA 3ASKA 3META 4XTZA 3GPLA 2QA4T 4PKCC 2DPPB 1H641 3HPWA 2GFUA 2DJZA 3G6EA 4FSXA 1BI3A 3Q1JA 1M1FA 3OYMA 2OTJA 2YLBA 4F7UA 5DLOA 4OF1A 5IN1A 5GMKl 2RI2A 5GAN8 2LQ8A 3JCMc 3LGLA 3M53A 4JDSA 5GAOr 3H8ZA 3GOXA 4IKFA 2K4YA 2DZCA 5GANh 4A4HA 4C8QE 3QPHA 2PUKB 4RKUE 4F7UG 5KE2A 5GAN2 4E7HA 1YITA 3LX7A 3PT9A 1XQHA 5LJ5f 4M7DD 3F70A 3CBMA 4BI4A 3FC3A 2DKGA 2XKOC 2RHZA 1VQNA 2KSSA 3MP1A 5D6YA 3L2VA 5M9OA 3E9GA 4QQDA 4OB3B 1UGSB 3RKYA 4P5NA 1VUBA 4PLIA 4EMGA 3QDRB 4XU0A 2K2VA 2XDPA 5LL6S 4J7IA 2XIDA 4CI0C 2E64A 4LDYA 5KCOA 5GAN6 3VUZA 4KUDK 2JOYA 1VQMA 1B34B 1I4K1 2CS7A 5HKCA 4EMKA 4BDYA 2E6ZA 4XQ3A 2V8KA 1VQ4A 2VYTA 2RHIA 3NFCA 3S6WA 5GAOp 1LNXA 1WQWA 4BB7A 1I8FA 1ZHIA 1N8RC 4M7AA 1BI2A 3BFMA 5GAOn 1VIEA 2CGHA 3FLGA 2ZPIB 1VQ9T 1JJ2S 4HCCA 4M7AG 4DA4A 1N8RU 3JCMg 3E1SA 4L59A 3QSUA 3CC4T 2FYKA 2C06A 3M56A 1YJ9A 2EJ9A 1K73U 2E12A 3JCMb 4OVAA 4ZN1A 2DO3A 2EFIA 3BW1A 3SFMA 5GMKe 5GAOm 3JCMP 4NL3A 2HNIA 4ELYC 3CMAT 4MMKA 5J39A 2MF2A 3C95A 4BY6B 1U8RA 4EMKC 3JCMW 2RK1A 3GF5A 4NOYA 5GAOq 3JSCA 4C92D 2QQSA 3DB4A 4PJOB 1ZBXA 4HA8A 4M77B 4B9XA 5DM7R 4M7AC 2OTLA 1M90C 3MEWA 2LNVA 2D9TA 5GAN4 2LQKA 3NTKA 2HD0A 1U1SA 2RI5A 3OY9A 1I5LA 1VQOT 3HSBA 5LJ5j 2EWNA 1M90U 4M7DA 2JN0A 3TCJA 4M7DB 1VQMT 3MP8A 3V7RA 3CCVT 3J81E 1Q82C 4FM4B 1MHNA 4JS5A 4M7DG 1BIBA 2HQXA 4NL2A 2E41A 3S3MA 2XICA 2Y4YA 3A8LB 3CCMT 2QA4A 1W2BS 1Q82U 4BE0A 3C4SA 1KQSS 3CCUA 5GMKm 3MP6A 2DK3A 4X34A 3OQ5A 1KG1A 2F5TX 2DXBA 2X35A 3INZA 4J6YA 3CXCA 4N0AA 3OYIA 1U1TA 2EJGA 3P8DA 2L3RA 2BIVA 4C8QB 3CMET 3ZEHA 3RKWA 3DKMA 2QXFA 3VYHB 4BE1A 3R6OA 2VV5A 2MWPA 3OYAA 1YBYA 2I2LA 3TU4K 2KMTA 4C5IA 1XTDA 3C94A 3A8HB 5KE3A 4M7DC 3MEAA 1QVGA 1M4ZA 4BUGA 2ZGWA 3PTAA 2XU8A 3PMIA 5LJ3j 1LOJA 3PIPA 4KT0E 2B8AA 4EMHA 2HAXA 5GAOl 3G71A 1S72T 4XTVA 3QG1A 5GAMf 2V8IA 1VQ9A 3HFOA 3HRUA 2VGNA 3M5AA 3X28B 3JCMX 4A4GA 3A8MB 4N0AC 4XTWA 2ZPBB 1IZ6A 3OYCA 3CC4A 2HBPA 4QVZA 4C92A 4M78D 4XU2A 2RJDA 4F7UB 4C5HA 5HK3A 4PJOE 4M77E 2JVVA 3C12A 2WSCE 2KVQG 2MAMA 2RM4A 2K57A 4DOVA 5LJ5g 2XK0A 4N4GA 3HKSA 1Y96A 5A0GA 3JAME 1SSFA 2A3LA 4BDZA 4BI8B 3HFNA 4MDWA 2GCXA 3HL8A 4IUVA 1M5Q1 3I56A 2JTFA 1GXIE 2PU9B 5HY6A 3M58A 4LDWA 3ZFJA 4ME7A 3GIBA 3OS2A 3M59A 2BKDN 2L89A 4ZGEB 3P8HA 1VQOA 1KHIA 1X01A 2QEXT 5FRMA 4JRPA 3RESA 3V7CA 3N5BB 4C92C 2X4JA 2P4TA 4M75D 4EMKB 4PJOF 3MCAB 5GMKh 4M77F 3CCVA 1VQ5T 1AHJB 3OYLA 1VIFA 2K5IA 3JCMe 3CCUT 2XI9A 4M7AB 2R57A 1H3ZA 3FDRA 4X9CA 1UEBA 2QI2A 3L2QA 4JJNK 2D6FA 1UGPB 2R5MA 2XDBA 2PVDB 2R5AA 3OA6A 3CCMA 2QQAA 3JB9F 1UGQB 3CXCS 1YJNA 5CKEA 2PUOB 2KDSA 1VQ7T 4QVDA 2RHYA 2LVMA 4E7LA 3RIRA 3BDLA 3CMEA 2V8JA 4DQ2A 3CCRT 1WQ7A 3QIIA 5EG2A 3CCQT 3GNFB 3CEYA 4IUPA 2DXCA 4OGEA 3CCJT 3DB3A 3UT1A 5GAMj 2E5QA 3A5ZB 5DY9A 3QBYA 5FU6C 2LDMA 3EFSA 2RK2A 4C8QF 3JRZA 4C5EA 3G71T 3ER0A 4M78A 1FWZA 1Y7XA 4VUBA 2ZCFB 4RCBA 3S3OA 3QUIA 1K73C 2JNGA 4F7UE 2CZ1B 4M78G 4LD9K 3MO8A 2RJFA 1S72A 3V7SA 4HCBA 1N6AA 3M54A 2PVGB 1RL2A 1UB4A 5LJ3f 4E7JA 1NE8A 1KQ1A 1V29B 3OYNA 2JUFA 3UDCA 3QHSA 5D6XA 3X24B 5GANj 1WNLA 2ZPGB 1YI2T 3OW2S 3OYJA 2DTOA 5KH6A 2HQEA 3QJYA 5GAMe 2PQWA 4FIBA 5KCHA 1M1KC 5CCAA 2K3YA 3JCMd 3FB9A 3BDUA 3HHTB 3QZ9B 4X9DA 1D3BA 2MWOA 5AYFA 4N4HA 4JS4A 3I56T 4BACA 3JCMJ 3CC7T 4MDXA 2EKOA 2XDDA 1M1KU 1HXDA 2EYQA 4FU6A 3I55T 4XU1A 3RUXA 3SDZA 1YIJT 2DTIA 3CD6T 4IUTA 4E47A 4A4FA 4M78C 3CPWA 4M75A 3VUBA 3CPFA 4RCCA 4EPCA 1VQKA 5A0LA 4Q5WA 3VU3C 1BKBA 1OYXA 1FX7A 2A7YA 2WACA 2WSEE 2X4YA 3OSSC 4IURA 4M75G 4DOWA 2QQ9A 3CCEA 1VQ6T 4M7AE 1WJSA 1P92A 1ZQ1A 5CKDA 3TEEA 2JTMA 4L5GA 3CCLT 4C8QD 5CKHA 2VGMA 2QEXA 3M4GA 4J6XA 5CKFA 3MEUA 1VQ5A 3AHUA 4FL6A 5GAMg 2CZ7B 4C5GA 1YJNT 3DLLA 2LCCA 2DIGA 2EQMA 2P0QA 2CZ0B 1XNIA 5GMKi 1VQ8T 4ATOA 3TREA 3PMTA 5J3BA 2OAUA 1X6OA 3QYGB 4J7FA 3SB2A 4M75C 1VQ7A 4CRIA 5LJ5e 1MGQA 2O4XA 4L6V5 4C92B 4ZTJA 3RERA 5IAYA 3CCRA 3QJ6A 5GAMd 3OB9A 3CCQA 1WPYA 2LRQA 3DLMA 2XD0A 3CCJA 2QQBA 5GANg 1Y96B 3ME9A 1BI0A 4RG8A 2E10A 1G3YA 4OB2B 2DAQA 4BE2A 3VYGA 2DVEA 3LLRA 4MMLA 4B9WA 4C0FA 4M7DE 2RJCA 3JCMh 1G5VA 3QO3A 4Y28E 2QTXA 2X4WA 2DD5A 2KAFA 4YTLA 1Q81C 4ELZC 4M77G 2CKKA 5C6SA 3M4YA 3LWHA 4E7IA 4O5VA 5I21A 2EIFA 2DZ9A 2M0OA 2RD1A 3GP8A 1Q81U 3JB9G 3FJPA 1VQPT 5FU6B 1OI1A 2G3RA 2VUBA 1M1GA 1YI2A 2P0PA 4C0GA 2FVUA 1VQLA 3LWIA 4QQGA 3OYBA 4ZTFA 3A8OB 2KK4A 2LT1A 1QW1A 1NPRA 5LJ3e 3CBOA 3PFSA 5GANf 1Y71A 2H3JA 2DIQA 1JJ2A 5D6WA 3OSVA 1JBMA 3CC7A 1VQKT 3VV0A 1OZ2A 3I55A 3RKXA 3CD6A 1YIJA 3CCET 1NZ9A 1HK9A 3HRTA 1OZ3A 3L42A 1UGRB 2GQVA 5L8RE 4C8QG 3KXTA 3SD4A 5LJ5d 4Y91A 2KY9A 4OB0B 1VQ6A 1QP2A 2FHDA 1KHCA 1PSFA 3PIOA 5GAN5 1DJ7B 2FL7A 4IUUA 5A2QE 4BI3A 3CCLA 5J26A 2IVWA 2DXUA 1YCYA 4OB1B 5GAMh 3OBYA 4C0DC 3SWNA 2IG0A 2WSFE 4M78B 4C0ZA 4XTYA 1Q7YC 4KUIA 4C92E 3FIFA 2O01E 1N9RA 5LJ3g 2EQUA 1Q7YU 5FU7C 2L8DA 4KBMB 4C8QC 1VQ8A 1YHQT 4J83A 4XK8E 3OMGA 3OS0A 5CR2A 2K3XA 4PL6A 4ZN3A 3NTHA 3OS5A 1G3SA 2EQJA 2YRVA 4OMFB 3UWNA 2XHCA 4FT4A 1FXXA 4R56A 1QVGS 2RJEA 3VJPA 1QVPA 3HP9A 2RA2A 1G3TA 3CC2A 1X75C 2Y90A 3V8LA 2X4XA 1W2BA 5LJ3d 3MHXA 1D3BB 4HT9A 3JCMV 4PLLA 1NPPA 4LDUA 5I2MA 3JB9J 1KQSA 2M1HA 3E19A 4MZPA 4LDXA 4D6WA 3OMCA 3E9FA 1G3WA 4LDVA 3SWNC 4M75B 4NS5A 4Z02A 4A4EA 2YHTA 4C92F 4E7KA 5FROA 2LCLA 4O6JA 5CK9A 1JRIA 1K8AC 3V8JA 5GMKj 1BI1A 4PJOD 4M77D 2QDYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M16 A;  4RG2 A;  2GFU A;  2GF7 A;  3MEU A;  3L2W A;  3OS1 A;  4FL6 A;  4C5G A;  3Q1J A;  3OYM A;  4A4G A;  2LCC A;  2DIG A;  2EQM A;  5IN1 A;  2RI2 A;  3M9Q A;  3MET A;  3LGL A;  3OYC A;  1XNI A;  3H8Z A;  3GOX A;  4IKF A;  3PMT A;  4QVZ A;  1N27 A;  4A4H A;  5KE2 A;  2RJD A;  3MEV A;  4E7H A;  4C5H A;  3LX7 A;  3OYK A;  4CRI A;  2O4X A;  3F70 A;  3FC3 A;  4ZTJ A;  2R58 A;  2LTO A;  2XK0 A;  4N4G A;  5IAY A;  2RI3 A;  1SSF A;  2RHZ A;  3QJ6 A;  4IUQ A;  3MP1 A;  3OB9 A;  1WJQ A;  2LRQ A;  5D6Y A;  5C0M A;  3DLM A;  5M9O A;  3E9G A;  2O4X B;  4QQD A;  3L2V A;  4IUV A;  3LH0 A;  3ME9 A;  4PLI A;  4II1 A;  2JTF A;  4BE2 A;  2DAQ A;  2RO0 A;  2XDP A;  3LLR A;  1WJR A;  2RHX A;  5KCO A;  4B9W A;  2RJC A;  2GFA A;  2X4W A;  3OS2 A;  4BDY A;  2BKD N;  2L89 A;  2CKK A;  3P8H A;  5C6S A;  2VYT A;  2RHI A;  3S6W A;  4E7I A;  5FRM A;  3FEO A;  2M0O A;  2JZ2 A;  3FLG A;  3OYL A;  1OI1 A;  2G3R A;  3LGF A;  2R57 A;  1H3Z A;  1RI0 A;  3FDR A;  4L59 A;  3L2Q A;  2BUD A;  2R5M A;  2R5A A;  3OA6 A;  4QQG A;  3OYB A;  4ZTF A;  3ASK A;  2RHU A;  3L2U A;  3PFS A;  4LD6 A;  4OVA A;  2EFI A;  2RHY A;  2LVM A;  3LYI A;  4E7L A;  2DIQ A;  3BDL A;  5D6W A;  5J39 A;  1OZ2 A;  1WGS A;  3PNW C;  3QII A;  4IUP A;  3CEY A;  1OZ3 A;  3DB3 A;  3UT1 A;  3L42 A;  2E5Q A;  4QQ6 A;  3SD4 A;  3QBY A;  2QQS A;  3DB4 A;  2LDM A;  4B9X A;  2FHD A;  3MEW A;  1KHC A;  2D9T A;  4C5E A;  5FRN A;  3NTI A;  3QKJ A;  3NTK A;  4IUU A;  2RI5 A;  4EDU A;  3OY9 A;  3S3O A;  5J26 A;  2F5K A;  2P0K A;  3S3N A;  4N4I A;  2IG0 A;  3MO8 A;  2RJF A;  3KUF A;  3EAE A;  3MP8 A;  4UC4 A;  1MHN A;  4E7J A;  3OYG A;  2HQX A;  3OYN A;  1G5V A;  3OYH A;  2EQU A;  5D6X A;  3S3M A;  3OYJ A;  2EQK A;  2L8D A;  5KH6 A;  2HQE A;  4QW2 A;  3OS0 A;  3OMG A;  4BE0 A;  2K3X A;  2PQW A;  3C4S A;  4PL6 A;  5KCH A;  2K3Y A;  3MP6 A;  4X34 A;  3NTH A;  3OYE A;  3OQ5 A;  3O8V A;  2EQJ A;  2X35 A;  2YRV A;  2MWO A;  3UWN A;  4N4H A;  3OYI A;  3OYD A;  4BAC A;  3P8D A;  2L3R A;  2BIV A;  2E6N A;  2EKO A;  2NLU A;  2RJE A;  3H6Z A;  4FU6 A;  3ZEH A;  3L2R A;  2X4X A;  4IUT A;  4BDZ A;  4BE1 A;  4GY5 A;  4A4F A;  4PLL A;  2MWP A;  3OYA A;  2M1H A;  4C5I A;  4HCZ A;  4Q5W A;  5KE3 A;  1OYX A;  2WAC A;  2X4Y A;  3MEA A;  3E9F A;  3OMC A;  4IUR A;  5CIU A;  4Z02 A;  4NS5 A;  1WJS A;  4A4E A;  4E7K A;  3PMI A;  5FRO A;  4BD3 A;  2QQR A;  3OYF A;  2B8A A; 
#chains in the Genus database with same CATH topology
 4J9C A;  2QDL A;  5LJ5 h;  3OS1 A;  3OW2 P;  3I56 Q;  1OX9 A;  2VKN A;  3MEV A;  3JCM Q;  1I1J A;  3OYK A;  3G4S T;  2DFU A;  3UF4 A;  2DEQ A;  1Q95 G;  5ECA A;  1K4U S;  1GCQ A;  2PZ1 A;  1WJQ A;  2D1X A;  1K8A R;  3OYY A;  1E6G A;  1KK7 A;  1B34 A;  1D0X A;  1ABQ A;  5CO7 A;  3MKD A;  4RMO A;  2GFA A;  3TSW A;  2A37 A;  1KC8 R;  2YLC A;  2AIR B;  1Q86 C;  1VQ8 Q;  3D7S B;  2D0Q B;  3FEO A;  2XG8 D;  3JB9 I;  2COW A;  3G6E T;  1YWP A;  2BTT A;  5KYX A;  1YJW A;  1Q86 U;  1M8M A;  4J9F A;  2OTJ T;  3JB9 H;  2ZZD A;  4RTV A;  3X26 B;  1QP3 A;  2CZ6 B;  3CC2 T;  3LYI A;  4M75 E;  2QAS A;  2LC4 A;  1WA7 A;  3PNW C;  2J6O A;  2MMP A;  1NYF A;  3KBG A;  4PJO G;  1YNZ A;  1BU1 A;  5FRN A;  3EGX B;  5GAN d;  2F5K A;  2PVO B;  2P0K A;  4M4Z A;  1HYO A;  2VC8 A;  3T9N A;  3C0C A;  5IHN A;  1UGV A;  3SWN B;  4E6R A;  3M0R A;  5IXF A;  3CCE Q;  4PJO C;  1V76 A;  2FB7 A;  3OYE A;  1WXU A;  3OYD A;  2JJ9 A;  2NLU A;  1KSW A;  3H6Z A;  1RAH B;  1TU0 B;  4ZGD B;  4FW1 A;  3ZBD A;  4JPB W;  4MZM A;  2RH2 A;  3KFV A;  3ASK A;  3HPW A;  2GFU A;  4FSX A;  1BI3 A;  2A08 A;  2YLB A;  5GAN 8;  2RI2 A;  3LGL A;  3M53 A;  3H8Z A;  5HCK A;  2DZC A;  4HVW A;  5GAN h;  1W1F A;  5GAN 2;  2PUK B;  4RKU E;  3GPL A;  2QA4 T;  1YIT A;  2LJ0 A;  3F70 A;  2XKO C;  1SRM A;  5M9O A;  4OB3 B;  4FYX B;  1VUB A;  4EMG A;  5LL6 S;  4CI0 C;  5GAN 6;  3VUZ A;  2FPE A;  1ZA1 B;  4EMK A;  4XQ3 A;  5KYW B;  3S6W A;  1LNX A;  4FYY B;  1WHM A;  1BI2 A;  3BFM A;  2CGH A;  2GQI A;  2ZPI B;  1JJ2 S;  2BZY A;  2KRM A;  3CC4 T;  2FYK A;  3M56 A;  2EJ9 A;  2GBQ A;  4ZN1 A;  3VRY A;  3CCL Q;  5GMK e;  2RQU A;  5J39 A;  2MF2 A;  1U3O A;  1EX4 A;  3JCM W;  2RK1 A;  4J9B A;  4E2F B;  1N8R R;  3JSC A;  2QQS A;  3DB4 A;  3SHW A;  4PJO B;  1ZBX A;  1JO8 A;  4HA8 A;  4B9X A;  5DM7 R;  3MEW A;  1U1S A;  1I5L A;  5D7U A;  1Q82 C;  2O9V A;  1R0B G;  4RTX A;  4M7D G;  2HQX A;  2H8H A;  1M27 C;  1E7O A;  2Y4Y A;  2HL5 C;  1Q82 U;  2QAZ A;  2EPD A;  3CCU A;  2DIL A;  3MP6 A;  2DK3 A;  3OQ5 A;  1KG1 A;  2F5T X;  1Q86 R;  1GFD A;  1WXB A;  1U1T A;  3OYI A;  3P8D A;  3ZEH A;  3RKW A;  3DKM A;  4OMQ A;  2VV5 A;  1VQP Q;  2EBP A;  2HSE B;  4C5I A;  4M7D C;  1R0C B;  3MEA A;  1RLP C;  1EZZ B;  3PIP A;  3EG9 B;  1S72 T;  5GAM f;  2VGN A;  3JCM X;  4A4G A;  4N0A C;  3CPW P;  3OYC A;  4M78 D;  2KT1 A;  2RJD A;  4C5H A;  2JVV A;  3C12 A;  4HVV A;  4PFZ A;  2A3L A;  2ATC B;  1AWO A;  1YWO A;  2L0A A;  2JTF A;  1WHJ A;  3M58 A;  3ZFJ A;  3OS2 A;  1T0H A;  3M59 A;  2BKD N;  1VQO A;  2QEX T;  4F04 B;  3RES A;  1VQM A;  2P4T A;  1PG5 B;  4PJO F;  4HXJ A;  2FPD A;  2XI9 A;  1UEB A;  3L2Q A;  4JJN K;  2QQA A;  1UGQ B;  4F16 A;  2MPX C;  1VQ7 T;  1ZSG A;  2LVM A;  4E7L A;  3BDL A;  3CME A;  4Z88 A;  2V8J A;  1WQ7 A;  3QII A;  5EG2 A;  3CCQ T;  3CEY A;  1OV3 A;  3REB B;  5GAM j;  2E5Q A;  3NMZ C;  5KYU A;  3A5Z B;  4JJC A;  3QBY A;  2LDM A;  1UHC A;  2RK2 A;  3G71 T;  2BE9 B;  4RCB A;  3QUI A;  1K73 C;  1IRX A;  1WLP B;  3MO8 A;  3EFO B;  2DA9 A;  3M54 A;  4ORZ A;  1NE8 A;  4M7D B;  3X24 B;  3CMA Q;  2ZPG B;  1YI2 T;  4AG1 C;  1NBE B;  5KH6 A;  1BBZ A;  3HHT B;  5AYF A;  1GRI A;  3CC7 T;  2XDD A;  4KGZ B;  3SDZ A;  2D8H A;  4E47 A;  3VUB A;  3JV3 A;  4FYW B;  4RCC A;  1VQK A;  4Q5W A;  3VU3 C;  2SEM A;  1BKB A;  2A7Y A;  4M75 G;  1VQM Q;  2DLP A;  4FCY A;  2DM1 A;  2DBM A;  3TEE A;  4L5G A;  1AT1 B;  3CCL T;  2PNI A;  6AT1 B;  1LCK A;  2M51 A;  1ARK A;  3MEU A;  2QYZ A;  5GAM g;  2CZ7 B;  1D1C A;  1YJN T;  4J9G A;  3TQ7 P;  3TRE A;  3PMT A;  5J3B A;  2OAU A;  2KRO A;  2LQN A;  4M75 C;  1MGQ A;  4ZTJ A;  4KH0 B;  3CCR A;  5GAM d;  2J6K A;  3CCJ A;  2V1R A;  1Y96 B;  4OB2 B;  2DAQ A;  3LLR A;  2RJC A;  3QO3 A;  4Y28 E;  2QTX A;  3A1P A;  2KAF A;  4JZ3 A;  3LWH A;  1T0J A;  1YFN A;  3GP8 A;  1B07 A;  3JB9 G;  1VQP T;  1TXQ A;  2G3R A;  1SPK A;  1Z9Z A;  4PJJ A;  4F14 A;  1XJW B;  3ZL7 C;  1SSH A;  3OYB A;  2LT1 A;  1H3H A;  1QW1 A;  1E6H A;  1BB9 A;  3I55 A;  2CP6 A;  1YIJ A;  2DL7 A;  1NZ9 A;  1HK9 A;  3HRT A;  2HMA A;  3L42 A;  5L8R E;  2DJQ A;  2CP5 A;  2FHD A;  2RNA A;  1PRM C;  4PFO A;  1W70 A;  2EQI A;  5A2Q E;  4IUU A;  1AVZ C;  5J26 A;  2IVW A;  4OB1 B;  5GAM h;  1C0M A;  4C0Z A;  4KUI A;  2DL5 A;  1K1Z A;  3VS1 A;  1Y0M A;  3CCR Q;  5FU7 C;  1YHQ T;  3OS0 A;  1F1B B;  2K3X A;  3G1J A;  5CR2 A;  3CCJ Q;  2DBK A;  4ZN3 A;  1PCX A;  2CP7 A;  3A98 A;  1G3S A;  4OMF B;  2XHC A;  4ZNX A;  3VJP A;  3CC2 A;  1X75 C;  2Y90 A;  2X4X A;  5I22 A;  1D3B B;  3JCM V;  5I2M A;  1VQ9 Q;  3REA B;  2O88 A;  3HTR A;  4MZP A;  4LDX A;  3OMC A;  4M75 B;  4A4E A;  2YHT A;  1TWB A;  5CK9 A;  3H0H A;  1K8A C;  3V8J A;  2HKQ B;  4CC3 A;  1VQL T;  1FMK A;  3SEM A;  3WVE B;  1K8A U;  4JRI A;  3G7Z A;  1KC8 C;  1RI9 A;  1YIJ Q;  4A54 A;  1O9S A;  1IGU A;  1LJO A;  3CBP A;  1KC8 U;  4F7U F;  4JRK A;  4IUQ A;  3GNG A;  1AEY A;  2AKL A;  2LMJ A;  1AD5 A;  4XTX A;  3H9N A;  3LH0 A;  3PGG A;  4M78 E;  2YUN A;  1X69 A;  2HSP A;  1C1A A;  3CCM Q;  1KD1 R;  3RMS A;  1M8V A;  1BIA A;  2F69 A;  1AOJ A;  4RTT A;  3QZ5 B;  1TSF A;  2EAY A;  2RN8 A;  1EIF A;  3O5Z A;  3JCM f;  2E1H A;  3LGF A;  1MMN A;  1RI0 A;  2DD4 A;  3RMQ A;  3M55 A;  1R8O B;  4M7A F;  5FWC A;  2RHU A;  3BY7 A;  3L2U A;  1U5S A;  5CKB A;  1S1N A;  2C0T A;  2COZ A;  2DXT A;  5FLX E;  1RAF B;  2M9U A;  2DTH A;  2DRM A;  1WDX A;  4M77 A;  3L2Z A;  1JXO A;  4GLK A;  5I2S A;  4MZT A;  4J5Y A;  4QQ6 A;  5FU7 B;  2K7A A;  3TVT A;  3VKI A;  1JB0 E;  1W4S A;  2KE9 A;  1PSE A;  3H0I A;  3X20 B;  1M3A A;  1UHF A;  4UC4 A;  3CCS A;  3OYG A;  4M75 F;  2LJ3 A;  2OJ2 A;  4IIM A;  5GJV B;  3OYH A;  2EQK A;  4J6W A;  1UE9 A;  1QKX A;  3VRZ A;  1WIE A;  1EFN A;  2A36 A;  2RB6 A;  2YUO A;  2CYZ B;  4A53 A;  1ZLM A;  5HK0 A;  2JTE A;  1I81 A;  4AMC A;  2AK5 A;  4XU3 A;  3OW2 A;  2RF0 A;  2KR3 A;  1TUC A;  2P4R A;  1IRE B;  4HKE A;  4J8O A;  1M2V A;  1WHL A;  2EJF A;  1NLO C;  5CAI A;  1NM7 A;  3MET A;  4XTZ A;  4PKC C;  5IH2 A;  4F7U A;  3LWI A;  5GMK l;  2LCS A;  3JCM c;  4JDS A;  2HKN A;  2LZ6 B;  1QVG P;  2EVR A;  3LX7 A;  2DRK A;  1OQK A;  1VQN A;  3CQT A;  1PM3 A;  3L2V A;  1UGS B;  3RKY A;  1ZA2 B;  2K2V A;  2XID A;  2OI3 A;  2E64 A;  1M3C A;  3EHR A;  2JOY A;  2NUP B;  3CCS Q;  5HKC A;  1I4K 1;  1MV0 B;  2CS7 A;  4BDY A;  1J3T A;  2E6Z A;  3RNJ A;  1VQ4 A;  1ZSZ A;  2RHI A;  3NFC A;  1WQW A;  1N8R C;  1T3L A;  4M7A A;  1VQ9 T;  4DA4 A;  1N8R U;  3JCM g;  3E1S A;  4L59 A;  3QSU A;  2C06 A;  1YJ9 A;  2HCK A;  1M3B A;  4OVA A;  3SFM A;  3JCM P;  4NL3 A;  2GNC A;  2YRD A;  4MMK A;  2IIM A;  5KYY B;  5IHK A;  1RUW A;  1KFZ A;  2DET A;  2X3W D;  1GFC A;  2OTL A;  2NWM A;  4HVU A;  2H3E B;  3NTK A;  2HD0 A;  2YT6 A;  3OY9 A;  3HSB A;  2EWN A;  2HQH A;  3QWX X;  3V7R A;  3CCV T;  2JW4 A;  1BIB A;  2F2V A;  2XIC A;  2LQW A;  1W2B S;  3CCM T;  1VQN Q;  4GBQ A;  3C4S A;  1KQS S;  1PKS A;  4OMM A;  3M0T A;  3CXC A;  4C8Q B;  2EJG A;  2L3R A;  2QXF A;  3R6O A;  1VQ4 Q;  3OYA A;  3TU4 K;  1PRL C;  2KMT A;  1XTD A;  5KE3 A;  1ZUU A;  4CC7 A;  3PTA A;  2XU8 A;  5LJ3 j;  2YXY A;  2DE0 X;  2B8A A;  1MMG A;  2HAX A;  1YJ9 Q;  3G71 A;  4XTV A;  1BK2 A;  2V8I A;  1NG2 A;  2ZPB B;  4C92 A;  1W6X A;  5HK3 A;  2K6D A;  2KVQ G;  1QWF A;  2MAM A;  3EHQ A;  4DOV A;  2HEQ A;  4K11 A;  4BI8 B;  4EIK A;  4MDW A;  3THK A;  2GCX A;  1YJW Q;  1M5Q 1;  2KXC A;  1GXI E;  5HY6 A;  4LDW A;  2L89 A;  3P8H A;  5KYU B;  2X4J A;  3MCA B;  5GMK h;  3OYL A;  1VIF A;  3JCM e;  2FZC B;  2R57 A;  3EGD B;  1HD3 A;  1U06 A;  4CC4 B;  2R5M A;  2XDB A;  1ZX6 A;  2PVD B;  3CXC S;  1YJN A;  2PUO B;  2DL4 A;  4DQ2 A;  3I5R A;  1GBQ A;  1WZO A;  3ULR B;  3EFS A;  4C8Q F;  4C5E A;  4JJB A;  2LP5 A;  1FWZ A;  3S3O A;  4VUB A;  3AT1 B;  2JNG A;  2CZ1 B;  4M78 G;  1D1B A;  2RJF A;  1JJ2 P;  2CT4 A;  3V7S A;  4HCB A;  2PVG B;  1RL2 A;  4E7J A;  1AWW A;  1G5V A;  1C6V X;  2F2W A;  2JUF A;  3QHS A;  5D6X A;  3UDC A;  3QJY A;  2PQW A;  5KCH A;  4OML A;  4N4H A;  4JS4 A;  3I56 T;  2EKO A;  1HXD A;  2C0O A;  1KIK A;  4XU1 A;  3RUX A;  1D0Z A;  3CPW A;  4M78 C;  3CPF A;  4IUR A;  1P92 A;  1UJY A;  2FRW A;  1YIT Q;  1UJ0 A;  3M4G A;  2X51 A;  4LNP A;  1X43 A;  2GGR A;  1VQ5 A;  4FL6 A;  2AZV A;  4C5G A;  3DLL A;  2CUD A;  2DIG A;  2P0Q A;  2CZ0 B;  3E2U A;  1VQ8 T;  1Y57 A;  2QTV A;  3QYG B;  4J7F A;  3R6N A;  2D8J A;  3VS6 A;  5IAY A;  1R77 A;  1IXD A;  1WPY A;  2QQB A;  3ME9 A;  4RG8 A;  1BI0 A;  3H41 A;  1I07 A;  2EGC A;  4MML A;  4B9W A;  7AT1 B;  1QCO A;  2DL3 A;  4YTL A;  4DEX A;  1AWX A;  4M77 G;  2COY A;  2CH4 A;  3M4Y A;  3UAT A;  2PTK A;  4O5V A;  1QLY A;  2M0O A;  2RD1 A;  1PWT A;  1OI1 A;  1M1G A;  4AFZ C;  1VQL A;  4ZTF A;  2K2M A;  2QK0 A;  5LJ3 e;  1JQQ A;  3PFS A;  2F1L A;  2DYB A;  3VS7 A;  3EH1 A;  1JBM A;  1NEG A;  3VV0 A;  3CD6 A;  3CCE T;  4JJD A;  2BZ8 A;  3EGX A;  1VQ6 A;  1VQ5 Q;  2CSI A;  3RR6 A;  1H8K A;  3CCU Q;  2CRE A;  4KRT A;  3OBY A;  3SWN A;  2IG0 A;  4M78 B;  4D8K A;  1GL5 A;  2OX7 A;  2ROT A;  3FIF A;  1N9R A;  3EGU A;  2C0I A;  4XK8 E;  3OMG A;  2P84 A;  1AZG B;  4J9H A;  1NLP C;  1RAG B;  2RJE A;  1VOM A;  1G3T A;  3V8L A;  4HT9 A;  2CDT A;  4PLL A;  1Q7Y R;  2W10 A;  4LDV A;  1G3W A;  2HL3 A;  2LCL A;  4O6J A;  1JRI A;  2ZAE A;  4Z8A A;  4M77 D;  1WNL A;  2M16 A;  2LT4 A;  2GF7 A;  2DVJ A;  3L2W A;  1M9S A;  1KD1 C;  1K9M C;  2B86 A;  1BCM A;  1ZUK A;  3QYH B;  3CD6 Q;  1KD1 U;  1K9M U;  5IT9 E;  1OPL A;  3OBW A;  2J05 A;  1VQO Q;  4JLI A;  2R58 A;  2LTO A;  2LX7 A;  1KQ2 A;  5C0M A;  4ZGJ B;  1QVF A;  2O4X B;  2RMO A;  4LXC A;  3X25 B;  4R55 A;  2RO0 A;  1OUL A;  3J80 E;  1IO6 A;  5KYW A;  2AZS A;  1SF9 A;  4PJL A;  2E3I A;  3VS2 A;  3CME Q;  8ATC B;  3LH5 A;  3P8B B;  3UA6 A;  2KYB A;  1YCS B;  2KRS A;  4HT8 A;  1GCQ C;  1HJD A;  5CVI A;  1YIT T;  4M78 F;  3FRN A;  5A0D A;  5FW9 A;  4TVR A;  2KGT A;  3L1A A;  4OP0 A;  4PJO A;  3IQL A;  4QVC A;  2AT1 B;  1O75 A;  2CP0 A;  5GAN 7;  1MND A;  4RTZ A;  2MOX A;  2RQT A;  3NTI A;  4LN2 A;  4EDU A;  3S3N A;  2ZPH B;  3GBQ A;  3KUF A;  4JRQ A;  3M57 A;  4WF2 A;  4JLG A;  4F17 A;  2GTO A;  2VXE A;  1VQK Q;  2LX9 A;  1MUZ A;  3WVD B;  4DBQ A;  4QW2 A;  4M7D F;  1GCP A;  1SKU B;  1TTH B;  3G4S A;  3O8V A;  4PNO A;  4M7A D;  1QVF S;  1Y07 A;  1K0X A;  2E6N A;  4B6M A;  2G6F X;  3L2R A;  2MK5 A;  4GY5 A;  2KBT A;  4C92 G;  3J7A F;  4PK4 A;  2VXF A;  4FT2 A;  2FPF A;  2E70 A;  5CIU A;  2K5L A;  2L3P A;  1G8X A;  3EG9 A;  4AFQ C;  4BD3 A;  4LE9 A;  1I0C A;  2I0N A;  2NUT B;  2DPP B;  1H64 1;  2DJZ A;  3G6E A;  3Q1J A;  4R0K A;  2OTJ A;  5DLO A;  5GAO r;  3GOX A;  4A4H A;  3QPH A;  4E7H A;  1XQH A;  5LJ5 f;  3CBM A;  4DEY A;  4J9E A;  4FW2 A;  2RHZ A;  4OMP A;  2KSS A;  3MP1 A;  5D6Y A;  3E9G A;  4J9D A;  4QQD A;  4PFP A;  9ATC B;  1OOT A;  4PLI A;  4XU0 A;  2XDP A;  4KUD K;  5KCO A;  2RQV A;  4LDY A;  1IGQ A;  1B34 B;  2VYT A;  4IIO A;  2CH4 W;  4BB7 A;  1I8F A;  1ZHI A;  4CC2 A;  3I55 Q;  2KI7 A;  4RTW A;  1VIE A;  5GAO n;  3G4S Q;  3I5S A;  5KYX B;  2E12 A;  3JCM b;  3CMA T;  1I5O B;  3C95 A;  1K9M R;  4EMK C;  2JS2 A;  3GF5 A;  4NOY A;  4C92 D;  3G6E Q;  2D9T A;  2OTJ Q;  2RI5 A;  3EFO A;  1WFW A;  1VQO T;  5EC7 A;  3BE3 A;  5LJ5 j;  4M7D A;  2YWW A;  2JN0 A;  1VQM T;  3CC2 Q;  1MHN A;  4JS5 A;  3S3M A;  2MIO A;  2QA4 A;  5IHI A;  1SHG A;  1TG0 A;  4BE0 A;  5GMK m;  3INZ A;  4N0A A;  1M90 R;  3CME T;  2BIV A;  1JXM A;  3VYH B;  1YBY A;  2DYI A;  2HBW A;  3A8H B;  1QVG A;  4JZ4 A;  1M4Z A;  4BUG A;  2ZGW A;  2M02 A;  3PMI A;  4OMO A;  1LOJ A;  4EMH A;  2RQR A;  4ANJ A;  2KEA A;  3HFO A;  3HRU A;  3M5A A;  3X28 B;  3A8M B;  2F2X A;  3CC4 A;  2HBP A;  4QVZ A;  4XU2 A;  4M77 E;  3MPU B;  2RM4 A;  2K57 A;  5LJ5 g;  3HKS A;  1Y96 A;  4FYV B;  5A0G A;  2CUB A;  3HFN A;  2RPN A;  4IUV A;  2GTJ A;  1WHH A;  3I56 A;  2PU9 B;  2OAW A;  1UUE A;  3GIB A;  4ZGE B;  5FRM A;  2QA4 Q;  4JRP A;  3N5B B;  4EMK B;  2DEU A;  1RAA B;  2EYW A;  3M0P A;  1H3Z A;  2QI2 A;  3OA6 A;  3JB9 F;  1CSK A;  2JM9 A;  1QCF A;  1SEM A;  3CCR T;  3I35 A;  3GNF B;  4IUP A;  2DXC A;  4Z89 A;  3CCJ T;  3DB3 A;  3UT1 A;  2DNU A;  5DY9 A;  3JRZ A;  1Y7X A;  2ZCF B;  3CC4 Q;  2JT4 A;  4F7U E;  1PKT A;  4LD9 K;  1S72 A;  1UB4 A;  5LJ3 f;  1V29 B;  1KQ1 A;  5GAN j;  1V1C A;  3OW2 S;  1CKA A;  3OYJ A;  1CKB A;  2X9H A;  1M1K C;  2IPO B;  2FZK B;  3JCM d;  4BAC A;  1D3B A;  1FMV A;  3JCM J;  1M1K U;  2EYQ A;  3I55 T;  3RBB B;  1YIJ T;  2DTI A;  3PVL A;  4M75 A;  3NGP A;  5A0L A;  4PJM A;  1OYX A;  2WAC A;  3CCE A;  2WSE E;  3OSS C;  2JMC A;  4DOW A;  4M7A E;  1WJS A;  1UG1 A;  1GBR A;  2A28 A;  2JTM A;  2EYY A;  4C8Q D;  5CKH A;  2QEX A;  4J6X A;  5CKF A;  1FYN A;  8AT1 B;  3VS5 A;  1NYG A;  2LCC A;  2EQM A;  1W2B P;  1XNI A;  5GMK i;  1KQS P;  1OPK A;  5AT1 B;  1VQ7 A;  5LJ5 e;  4L6V 5;  4DBR A;  3RER A;  3QJ6 A;  3CCQ A;  2LRQ A;  2XD0 A;  4QKU A;  5GAN g;  4WCI A;  3VYG A;  2DVE A;  4C0F A;  2VAS A;  1S72 Q;  4RTY A;  3JCM h;  4KGV B;  5L23 A;  2X4W A;  3M0Q A;  2YUP A;  5I21 A;  2EIF A;  2VUB A;  2QGG A;  1YI2 A;  1ZBJ A;  2FVU A;  3A8O B;  2OTL Q;  1NPR A;  1H92 A;  1M30 A;  1Y71 A;  2JM8 A;  1JJ2 A;  3OSV A;  1M2O A;  3CC7 A;  1OZ2 A;  1Q81 R;  2EYX A;  1OZ3 A;  2GQV A;  3KXT A;  2QEX Q;  1B7T A;  2KY9 A;  5FWB A;  1QP2 A;  1VYT A;  3PIO A;  3CCL A;  4BI3 A;  2O9S A;  2DXU A;  4C0D C;  1WX6 A;  2WSF E;  1Q7Y C;  4XTY A;  4C92 E;  1VQ7 Q;  5LJ3 g;  2EQU A;  1Q7Y U;  2L8D A;  4KBM B;  2FEI A;  2J06 A;  3CXC P;  3CCQ Q;  4LUD A;  4PL6 A;  3OS5 A;  2K3B A;  2YRV A;  2ECZ A;  4R56 A;  3UWN A;  4FT4 A;  1FXX A;  2CSQ A;  3TSZ A;  3G71 Q;  1YN8 A;  5LJ3 d;  1NPP A;  3JB9 J;  2K79 A;  3E19 A;  3NPF A;  2KYM A;  4Z02 A;  1MMD A;  4E7K A;  5FRO A;  4A63 B;  1YI2 Q;  1BI1 A;  4PJO D;  2QDY B;  2HZY A;  4RG2 A;  4AT1 B;  3CCS T;  1VQP A;  1TH7 A;  2AKK A;  2ZPE B;  3M9Q A;  3CC7 Q;  1RAD B;  4A4K A;  1UEC A;  1N27 A;  2ED0 A;  3RDV A;  2KNB B;  3EG3 A;  1MNE A;  4ESR A;  2ROL A;  4XTU A;  1N9S A;  3HRS A;  1WHG A;  2RI3 A;  1RAB B;  2Z0W A;  3EFR A;  1TUD A;  5GAN e;  2DX1 A;  2NUP A;  3A8G B;  4II1 A;  4FSS A;  1WJR A;  2RHX A;  3VS3 A;  1G83 A;  2ED1 A;  1M1K R;  1TS9 A;  1LPL A;  1RAC B;  2K9G A;  2L5Q A;  1YJN Q;  5CQY A;  1X6G A;  1BYM A;  2E65 A;  2BE7 D;  3VS0 A;  3UA7 A;  5LJ3 h;  3QXE B;  2JZ2 A;  2VVK A;  3UPU A;  1T3S A;  1X2K A;  4X1V A;  2BUD A;  1RAI B;  1XOV A;  1YHQ A;  2MI6 A;  1QKW A;  4LD6 A;  1PNJ A;  5KYY A;  2FRY A;  4C0D B;  3URG A;  1WGS A;  1VQN T;  4V2S A;  3GLX A;  2ABL A;  4OMN A;  5GAN 3;  4WTO B;  4DBH A;  2QGF B;  4KUL A;  3QKJ A;  3EG2 A;  5CQX A;  1IHW A;  2AHJ B;  3V8K A;  1VQ4 T;  3EH2 A;  4N4I A;  5DLQ E;  3EAE A;  4BY6 C;  4JUV A;  2Y4X A;  1QQJ A;  2ZPF B;  3CPW S;  4C8Q A;  4M77 C;  1YJ9 T;  3LW5 E;  1OU8 A;  2YDL A;  2MYS A;  1NJI C;  4XAX B;  2FZG B;  3M0U A;  2KQW A;  2EYZ A;  3CMA A;  4OGC A;  1YP5 A;  4HCZ A;  1NJI U;  1VA7 A;  3QDF A;  2OTL T;  4RTU A;  1SRL A;  2K5F A;  2DER A;  3WXM B;  1YJW T;  2QQR A;  2YUQ A;  3OYF A;  1YHQ Q;  1M1F A;  3OYM A;  1QMC A;  4OF1 A;  5IN1 A;  1IB8 A;  2CT3 A;  2LQ8 A;  2JMA A;  5GJW B;  1X2Q A;  4IKF A;  2K4Y A;  4F7U G;  4C8Q E;  5KE2 A;  4E7S A;  3PT9 A;  4M7D D;  3QWY A;  2CP2 A;  4BI4 A;  3FC3 A;  2DKG A;  3M0S A;  1OX8 A;  1RAE B;  4P5N A;  1MV3 A;  2J7I A;  3QDR B;  2KXD A;  4J7I A;  3PE0 A;  1VQL Q;  1RLQ C;  1UFF A;  2FG0 A;  2V8K A;  3EG1 A;  5GAO p;  1PD0 A;  3EGD A;  3U23 A;  2E5K A;  2X3X D;  4HCC A;  3FLG A;  4M7A G;  1PD1 A;  2RQW A;  1VQ6 Q;  4DBF A;  1UTI A;  1K73 U;  1NEB A;  2DO3 A;  2EFI A;  1QCN A;  3BW1 A;  5GAO m;  2HNI A;  4ELY C;  2LJ1 A;  3EG0 A;  2XMF A;  4BY6 B;  1U8R A;  2ENM A;  1ZSZ C;  2HDA A;  5GAO q;  3MJX A;  4M7A C;  4M77 B;  1OU9 A;  1M90 C;  2VWF A;  2LNV A;  5GAN 4;  2LQK A;  1M90 U;  3TCJ A;  1WXT A;  3MP8 A;  3J81 E;  1LVK A;  4FM4 B;  4NL2 A;  3H0F A;  2E41 A;  1JEG A;  2EGA A;  5I11 A;  3A8L B;  2M0Y A;  4RUG A;  4X34 A;  4GLM A;  2DXB A;  2JXB A;  2QG9 B;  2X35 A;  4J6Y A;  1FMW A;  4BE1 A;  2MWP A;  2I2L A;  4KGX B;  3VS4 A;  3C94 A;  1Q82 R;  2KRN A;  1M2V B;  4KT0 E;  4HCK A;  5GAO l;  3QG1 A;  1VQ9 A;  1ACM B;  4KH1 B;  1G2B A;  4XTW A;  1IZ6 A;  4F7U B;  4PJO E;  1IHV A;  2WSC E;  1QVF P;  1ZUY A;  2KT8 A;  2XK0 A;  4N4G A;  3PVQ A;  4J9I A;  3JAM E;  1SSF A;  3I9Q A;  4BDZ A;  3HL8 A;  2L3Q A;  2MCN A;  4ME7 A;  1D09 B;  2DMO A;  1TUG B;  2NYS A;  1AZE A;  1KHI A;  1HSQ A;  1X01 A;  4LUE A;  1NJI R;  4C92 C;  3V7C A;  3CCV A;  4M75 D;  4QT7 A;  1K9A A;  4M77 F;  1VQ5 T;  1ZSZ B;  1AHJ B;  2K5I A;  3CCU T;  4M7A B;  3FDR A;  4X9C A;  2D6F A;  1UGP B;  3CCM A;  2R5A A;  1SHF A;  5CKE A;  1D1A A;  2KDS A;  4QVD A;  2RHY A;  4AG2 C;  1VYV A;  3RIR A;  3NHN A;  1Z9Q A;  4OGE A;  2L2P A;  2V1Q A;  2VB6 A;  4AFS C;  5FU6 C;  3ER0 A;  4M78 A;  1X27 A;  2O31 A;  4AFU C;  1N6A A;  3OYN A;  1WI7 A;  2DTO A;  2HQE A;  4E7Z A;  5GAM e;  4FIB A;  2E3H A;  5CCA A;  2K3Y A;  2L3S A;  4D8D A;  3JB9 D;  3FB9 A;  3BDU A;  3QZ9 B;  2SRC A;  4X9D A;  2MWO A;  2DF6 A;  4MDX A;  4FU6 A;  3CD6 T;  4IUT A;  4A4F A;  1ABO A;  2CP3 A;  1K73 R;  4EPC A;  1FX7 A;  2X4Y A;  5IXB A;  1VQ6 T;  3CCV Q;  2QQ9 A;  5CKD A;  1ZQ1 A;  2VGM A;  2E4H A;  2EKH A;  3AHU A;  1K76 A;  2BZX A;  4Y92 A;  1K0S A;  4ATO A;  1X6O A;  3SB2 A;  1PC0 A;  4CRI A;  1X6B A;  2O4X A;  4C92 B;  1SG5 A;  1B3Q A;  3OB9 A;  3DLM A;  2NUZ A;  2E10 A;  1G3Y A;  4BE2 A;  2W0Z A;  4M7D E;  1UDL A;  2DD5 A;  1Q81 C;  4ELZ C;  2CKK A;  5C6S A;  4E7I A;  2V26 A;  1KJW A;  2DZ9 A;  1Q81 U;  2YRC A;  3FJP A;  1D0Y A;  5FU6 B;  2P0P A;  4C0G A;  4PJN A;  4QQG A;  2KK4 A;  3CBO A;  2O2O A;  5GAN f;  1N5Z A;  2EGE A;  2DIQ A;  2H3J A;  5D6W A;  1VQK T;  3RKX A;  1WYX A;  2EW3 A;  4C8Q G;  1UGR B;  1VYU A;  3SD4 A;  1JU5 C;  5LJ5 d;  4Y91 A;  4OB0 B;  1KHC A;  1PSF A;  5GAN 5;  1DJ7 B;  2FL7 A;  1YCY A;  1A0N B;  1BCO A;  1TOV A;  1WHK A;  2O01 E;  3FJ5 A;  4C8Q C;  1VQ8 A;  4J83 A;  2LNH B;  3NTH A;  2EQJ A;  1QVG S;  2A0F B;  1QVP A;  2FO0 A;  2RA2 A;  3HP9 A;  2J6F A;  1MMA A;  1W2B A;  3MHX A;  2ESW A;  2D0N A;  4LDU A;  1KQS A;  2M1H A;  2DL8 A;  4D6W A;  2JS0 A;  3E9F A;  3SWN C;  4C92 F;  4NS5 A;  2NUT A;  1QWE A;  2YSQ A;  1PHT A;  5GMK j;  1AWJ A;  5KYN A;  1OEB A; 
#chains in the Genus database with same CATH homology
 2M16 A;  4RG2 A;  2LT4 A;  2GF7 A;  1VQL T;  3L2W A;  5LJ5 h;  3OS1 A;  1M9S A;  3WVE B;  3CCS T;  1VQP A;  1K8A U;  1KD1 C;  1K9M C;  1TH7 A;  4JRI A;  2ZPE B;  3M9Q A;  3G7Z A;  4A4K A;  3QYH B;  1KC8 C;  1N27 A;  1KD1 U;  1K9M U;  4A54 A;  3MEV A;  3JCM Q;  5IT9 E;  1O9S A;  3OBW A;  3OYK A;  3G4S T;  1LJO A;  3CBP A;  1KC8 U;  4XTU A;  2DEQ A;  1N9S A;  4JLI A;  2R58 A;  2LTO A;  3HRS A;  4F7U F;  2RI3 A;  4JRK A;  4IUQ A;  3GNG A;  1WJQ A;  5C0M A;  4ZGJ B;  1KQ2 A;  1QVF A;  3EFR A;  2O4X B;  4XTX A;  5GAN e;  3OYY A;  3X25 B;  3LH0 A;  3PGG A;  4R55 A;  4M78 E;  1B34 A;  3A8G B;  4II1 A;  2RO0 A;  3J80 E;  1WJR A;  2RHX A;  5CO7 A;  4RMO A;  2GFA A;  2L5Q A;  5CQY A;  1BYM A;  2YLC A;  2E65 A;  3RMS A;  1M8V A;  1Q86 C;  1BIA A;  2F69 A;  2D0Q B;  5LJ3 h;  3FEO A;  2XG8 D;  3QXE B;  3QZ5 B;  2JZ2 A;  3JB9 I;  3G6E T;  3UPU A;  3P8B B;  2EAY A;  1EIF A;  3JCM f;  1YJW A;  1Q86 U;  2E1H A;  3LGF A;  2OTJ T;  1RI0 A;  2DD4 A;  2BUD A;  3JB9 H;  4HT8 A;  2ZZD A;  3X26 B;  1XOV A;  3RMQ A;  3M55 A;  1QP3 A;  1R8O B;  2MI6 A;  2CZ6 B;  5CVI A;  1YHQ A;  4M7A F;  3CC2 T;  2RHU A;  3BY7 A;  3JB9 D;  3L2U A;  4LD6 A;  1YIT T;  4M78 F;  3FRN A;  3LYI A;  5CKB A;  4M75 E;  4TVR A;  2DXT A;  4C0D B;  2LC4 A;  5A0D A;  5FLX E;  3URG A;  2M9U A;  1WGS A;  3PNW C;  2DTH A;  1VQN T;  3L1A A;  4OP0 A;  4PJO A;  4M77 A;  3L2Z A;  4GLK A;  5I2S A;  4MZT A;  4QVC A;  4J5Y A;  2MMP A;  3GLX A;  1O75 A;  3KBG A;  4QQ6 A;  4V2S A;  5FU7 B;  4PJO G;  5GAN 7;  3VKI A;  5GAN 3;  1JB0 E;  4KUL A;  5FRN A;  1W4S A;  3NTI A;  3QKJ A;  5GAN d;  5CQX A;  4EDU A;  2AHJ B;  3V8K A;  1VQ4 T;  2F5K A;  2PVO B;  1PSE A;  2P0K A;  3S3N A;  3X20 B;  2VC8 A;  2ZPH B;  4N4I A;  5DLQ E;  3KUF A;  3T9N A;  3EAE A;  4UC4 A;  3CCS A;  4JRQ A;  3M57 A;  4WF2 A;  3OYG A;  4M75 F;  4JLG A;  4BY6 C;  3OYH A;  3SWN B;  4JUV A;  2VXE A;  2EQK A;  2LX9 A;  2Y4X A;  4J6W A;  2ZPF B;  3WVD B;  3CPW S;  4QW2 A;  4C8Q A;  4M7D F;  4PJO C;  4M77 C;  2RB6 A;  1YJ9 T;  3LW5 E;  2FB7 A;  3OYE A;  3G4S A;  3O8V A;  2CYZ B;  4PNO A;  4A53 A;  5HK0 A;  4M7A D;  1QVF S;  1Y07 A;  3OYD A;  1I81 A;  2E6N A;  2NLU A;  3H6Z A;  1NJI C;  4XAX B;  4XU3 A;  3L2R A;  3OW2 A;  2KQW A;  4GY5 A;  1IRE B;  4C92 G;  3J7A F;  3CMA A;  2VXF A;  4FT2 A;  4HKE A;  4OGC A;  4HCZ A;  4J8O A;  1NJI U;  4ZGD B;  2E70 A;  3ZBD A;  5CIU A;  2OTL T;  2K5L A;  2EJF A;  4MZM A;  5CAI A;  2K5F A;  2RH2 A;  3WXM B;  4BD3 A;  2QQR A;  1YJW T;  3OYF A;  3ASK A;  3MET A;  4XTZ A;  3GPL A;  2QA4 T;  4PKC C;  2DPP B;  1H64 1;  3HPW A;  2GFU A;  2DJZ A;  3G6E A;  4FSX A;  1BI3 A;  3Q1J A;  1M1F A;  3OYM A;  2OTJ A;  2YLB A;  4F7U A;  5DLO A;  4OF1 A;  5IN1 A;  5GMK l;  2RI2 A;  5GAN 8;  2LQ8 A;  3JCM c;  3LGL A;  3M53 A;  4JDS A;  5GAO r;  3H8Z A;  3GOX A;  4IKF A;  2K4Y A;  2DZC A;  5GAN h;  4A4H A;  4C8Q E;  3QPH A;  2PUK B;  4RKU E;  4F7U G;  5KE2 A;  5GAN 2;  4E7H A;  1YIT A;  3LX7 A;  3PT9 A;  1XQH A;  5LJ5 f;  4M7D D;  3F70 A;  3CBM A;  4BI4 A;  3FC3 A;  2DKG A;  2XKO C;  2RHZ A;  1VQN A;  2KSS A;  3MP1 A;  5D6Y A;  3L2V A;  5M9O A;  3E9G A;  4QQD A;  4OB3 B;  1UGS B;  3RKY A;  4P5N A;  1VUB A;  4PLI A;  4EMG A;  3QDR B;  4XU0 A;  2K2V A;  2XDP A;  5LL6 S;  4J7I A;  2XID A;  4CI0 C;  2E64 A;  4LDY A;  5KCO A;  5GAN 6;  3VUZ A;  4KUD K;  2JOY A;  1VQM A;  1B34 B;  1I4K 1;  2CS7 A;  5HKC A;  4EMK A;  4BDY A;  2E6Z A;  4XQ3 A;  2V8K A;  1VQ4 A;  2VYT A;  2RHI A;  3NFC A;  3S6W A;  5GAO p;  1LNX A;  1WQW A;  4BB7 A;  1I8F A;  1ZHI A;  1N8R C;  4M7A A;  1BI2 A;  3BFM A;  5GAO n;  1VIE A;  2CGH A;  3FLG A;  2ZPI B;  1VQ9 T;  1JJ2 S;  4HCC A;  4M7A G;  4DA4 A;  1N8R U;  3JCM g;  3E1S A;  4L59 A;  3QSU A;  3CC4 T;  2FYK A;  2C06 A;  3M56 A;  1YJ9 A;  2EJ9 A;  1K73 U;  2E12 A;  3JCM b;  4OVA A;  4ZN1 A;  2DO3 A;  2EFI A;  3BW1 A;  3SFM A;  5GMK e;  5GAO m;  3JCM P;  4NL3 A;  2HNI A;  4ELY C;  3CMA T;  4MMK A;  5J39 A;  2MF2 A;  3C95 A;  4BY6 B;  1U8R A;  4EMK C;  3JCM W;  2RK1 A;  3GF5 A;  4NOY A;  5GAO q;  3JSC A;  4C92 D;  2QQS A;  3DB4 A;  4PJO B;  1ZBX A;  4HA8 A;  4M77 B;  4B9X A;  5DM7 R;  4M7A C;  2OTL A;  1M90 C;  3MEW A;  2LNV A;  2D9T A;  5GAN 4;  2LQK A;  3NTK A;  2HD0 A;  1U1S A;  2RI5 A;  3OY9 A;  1I5L A;  1VQO T;  3HSB A;  5LJ5 j;  2EWN A;  1M90 U;  4M7D A;  2JN0 A;  3TCJ A;  4M7D B;  1VQM T;  3MP8 A;  3V7R A;  3CCV T;  3J81 E;  1Q82 C;  4FM4 B;  1MHN A;  4JS5 A;  4M7D G;  1BIB A;  2HQX A;  4NL2 A;  2E41 A;  3S3M A;  2XIC A;  2Y4Y A;  3A8L B;  3CCM T;  2QA4 A;  1W2B S;  1Q82 U;  4BE0 A;  3C4S A;  1KQS S;  3CCU A;  5GMK m;  3MP6 A;  2DK3 A;  4X34 A;  3OQ5 A;  1KG1 A;  2F5T X;  2DXB A;  2X35 A;  3INZ A;  4J6Y A;  3CXC A;  4N0A A;  3OYI A;  1U1T A;  2EJG A;  3P8D A;  2L3R A;  2BIV A;  4C8Q B;  3CME T;  3ZEH A;  3RKW A;  3DKM A;  2QXF A;  3VYH B;  4BE1 A;  3R6O A;  2VV5 A;  2MWP A;  3OYA A;  1YBY A;  2I2L A;  3TU4 K;  2KMT A;  4C5I A;  1XTD A;  3C94 A;  3A8H B;  5KE3 A;  4M7D C;  3MEA A;  1QVG A;  1M4Z A;  4BUG A;  2ZGW A;  3PTA A;  2XU8 A;  3PMI A;  5LJ3 j;  1LOJ A;  3PIP A;  4KT0 E;  2B8A A;  4EMH A;  2HAX A;  5GAO l;  3G71 A;  1S72 T;  4XTV A;  3QG1 A;  5GAM f;  2V8I A;  1VQ9 A;  3HFO A;  3HRU A;  2VGN A;  3M5A A;  3X28 B;  3JCM X;  4A4G A;  3A8M B;  4N0A C;  4XTW A;  2ZPB B;  1IZ6 A;  3OYC A;  3CC4 A;  2HBP A;  4QVZ A;  4C92 A;  4M78 D;  4XU2 A;  2RJD A;  4F7U B;  4C5H A;  5HK3 A;  4PJO E;  4M77 E;  2JVV A;  3C12 A;  2WSC E;  2KVQ G;  2MAM A;  2RM4 A;  2K57 A;  4DOV A;  5LJ5 g;  2XK0 A;  4N4G A;  3HKS A;  1Y96 A;  5A0G A;  3JAM E;  1SSF A;  2A3L A;  4BDZ A;  4BI8 B;  3HFN A;  4MDW A;  2GCX A;  3HL8 A;  4IUV A;  1M5Q 1;  3I56 A;  2JTF A;  1GXI E;  2PU9 B;  5HY6 A;  3M58 A;  4LDW A;  3ZFJ A;  4ME7 A;  3GIB A;  3OS2 A;  3M59 A;  2BKD N;  2L89 A;  4ZGE B;  3P8H A;  1VQO A;  1KHI A;  1X01 A;  2QEX T;  5FRM A;  4JRP A;  3RES A;  3V7C A;  3N5B B;  4C92 C;  2X4J A;  2P4T A;  4M75 D;  4EMK B;  4PJO F;  3MCA B;  5GMK h;  4M77 F;  3CCV A;  1VQ5 T;  1AHJ B;  3OYL A;  1VIF A;  2K5I A;  3JCM e;  3CCU T;  2XI9 A;  4M7A B;  2R57 A;  1H3Z A;  3FDR A;  4X9C A;  1UEB A;  2QI2 A;  3L2Q A;  4JJN K;  2D6F A;  1UGP B;  2R5M A;  2XDB A;  2PVD B;  2R5A A;  3OA6 A;  3CCM A;  2QQA A;  3JB9 F;  1UGQ B;  3CXC S;  1YJN A;  5CKE A;  2PUO B;  2KDS A;  1VQ7 T;  4QVD A;  2RHY A;  2LVM A;  4E7L A;  3RIR A;  3BDL A;  3CME A;  2V8J A;  4DQ2 A;  3CCR T;  1WQ7 A;  3QII A;  5EG2 A;  3CCQ T;  3GNF B;  3CEY A;  4IUP A;  2DXC A;  4OGE A;  3CCJ T;  3DB3 A;  3UT1 A;  5GAM j;  2E5Q A;  3A5Z B;  5DY9 A;  3QBY A;  5FU6 C;  2LDM A;  3EFS A;  2RK2 A;  4C8Q F;  3JRZ A;  4C5E A;  3G71 T;  3ER0 A;  4M78 A;  1FWZ A;  1Y7X A;  4VUB A;  2ZCF B;  4RCB A;  3S3O A;  3QUI A;  1K73 C;  2JNG A;  4F7U E;  2CZ1 B;  4M78 G;  4LD9 K;  3MO8 A;  2RJF A;  1S72 A;  3V7S A;  4HCB A;  1N6A A;  3M54 A;  2PVG B;  1RL2 A;  1UB4 A;  5LJ3 f;  4E7J A;  1NE8 A;  1KQ1 A;  1V29 B;  3OYN A;  2JUF A;  3UDC A;  3QHS A;  5D6X A;  3X24 B;  5GAN j;  1WNL A;  2ZPG B;  1YI2 T;  3OW2 S;  3OYJ A;  2DTO A;  5KH6 A;  2HQE A;  3QJY A;  5GAM e;  2PQW A;  4FIB A;  5KCH A;  1M1K C;  5CCA A;  2K3Y A;  3JCM d;  3FB9 A;  3BDU A;  3HHT B;  3QZ9 B;  4X9D A;  1D3B A;  2MWO A;  5AYF A;  4N4H A;  4JS4 A;  3I56 T;  4BAC A;  3JCM J;  3CC7 T;  4MDX A;  2EKO A;  2XDD A;  1M1K U;  1HXD A;  2EYQ A;  4FU6 A;  3I55 T;  4XU1 A;  3RUX A;  3SDZ A;  1YIJ T;  2DTI A;  3CD6 T;  4IUT A;  4E47 A;  4A4F A;  4M78 C;  3CPW A;  4M75 A;  3VUB A;  3CPF A;  4RCC A;  4EPC A;  1VQK A;  5A0L A;  4Q5W A;  3VU3 C;  1BKB A;  1OYX A;  1FX7 A;  2A7Y A;  2WAC A;  2WSE E;  2X4Y A;  3OSS C;  4IUR A;  4M75 G;  4DOW A;  2QQ9 A;  3CCE A;  1VQ6 T;  4M7A E;  1WJS A;  1P92 A;  1ZQ1 A;  5CKD A;  3TEE A;  2JTM A;  4L5G A;  3CCL T;  4C8Q D;  5CKH A;  2VGM A;  2QEX A;  3M4G A;  4J6X A;  5CKF A;  3MEU A;  1VQ5 A;  3AHU A;  4FL6 A;  5GAM g;  2CZ7 B;  4C5G A;  1YJN T;  3DLL A;  2LCC A;  2DIG A;  2EQM A;  2P0Q A;  2CZ0 B;  1XNI A;  5GMK i;  1VQ8 T;  4ATO A;  3TRE A;  3PMT A;  5J3B A;  2OAU A;  1X6O A;  3QYG B;  4J7F A;  3SB2 A;  4M75 C;  1VQ7 A;  4CRI A;  5LJ5 e;  1MGQ A;  2O4X A;  4L6V 5;  4C92 B;  4ZTJ A;  3RER A;  5IAY A;  3CCR A;  3QJ6 A;  5GAM d;  3OB9 A;  3CCQ A;  1WPY A;  2LRQ A;  3DLM A;  2XD0 A;  3CCJ A;  2QQB A;  5GAN g;  1Y96 B;  3ME9 A;  1BI0 A;  4RG8 A;  2E10 A;  1G3Y A;  4OB2 B;  2DAQ A;  4BE2 A;  3VYG A;  2DVE A;  3LLR A;  4MML A;  4B9W A;  4C0F A;  4M7D E;  2RJC A;  3JCM h;  1G5V A;  3QO3 A;  4Y28 E;  2QTX A;  2X4W A;  2DD5 A;  2KAF A;  4YTL A;  1Q81 C;  4ELZ C;  4M77 G;  2CKK A;  5C6S A;  3M4Y A;  3LWH A;  4E7I A;  4O5V A;  5I21 A;  2EIF A;  2DZ9 A;  2M0O A;  2RD1 A;  3GP8 A;  1Q81 U;  3JB9 G;  3FJP A;  1VQP T;  5FU6 B;  1OI1 A;  2G3R A;  2VUB A;  1M1G A;  1YI2 A;  2P0P A;  4C0G A;  2FVU A;  1VQL A;  3LWI A;  4QQG A;  3OYB A;  4ZTF A;  3A8O B;  2KK4 A;  2LT1 A;  1QW1 A;  1NPR A;  5LJ3 e;  3CBO A;  3PFS A;  5GAN f;  1Y71 A;  2H3J A;  2DIQ A;  1JJ2 A;  5D6W A;  3OSV A;  1JBM A;  3CC7 A;  1VQK T;  3VV0 A;  1OZ2 A;  3I55 A;  3RKX A;  3CD6 A;  1YIJ A;  3CCE T;  1NZ9 A;  1HK9 A;  3HRT A;  1OZ3 A;  3L42 A;  1UGR B;  2GQV A;  5L8R E;  4C8Q G;  3KXT A;  3SD4 A;  5LJ5 d;  4Y91 A;  2KY9 A;  4OB0 B;  1VQ6 A;  1QP2 A;  2FHD A;  1KHC A;  1PSF A;  3PIO A;  5GAN 5;  1DJ7 B;  2FL7 A;  4IUU A;  5A2Q E;  4BI3 A;  3CCL A;  5J26 A;  2IVW A;  2DXU A;  1YCY A;  4OB1 B;  5GAM h;  3OBY A;  4C0D C;  3SWN A;  2IG0 A;  2WSF E;  4M78 B;  4C0Z A;  4XTY A;  1Q7Y C;  4KUI A;  4C92 E;  3FIF A;  2O01 E;  1N9R A;  5LJ3 g;  2EQU A;  1Q7Y U;  5FU7 C;  2L8D A;  4KBM B;  4C8Q C;  1VQ8 A;  1YHQ T;  4J83 A;  4XK8 E;  3OMG A;  3OS0 A;  5CR2 A;  2K3X A;  4PL6 A;  4ZN3 A;  3NTH A;  3OS5 A;  1G3S A;  2EQJ A;  2YRV A;  4OMF B;  3UWN A;  2XHC A;  4FT4 A;  1FXX A;  4R56 A;  1QVG S;  2RJE A;  3VJP A;  1QVP A;  3HP9 A;  2RA2 A;  1G3T A;  3CC2 A;  1X75 C;  2Y90 A;  3V8L A;  2X4X A;  1W2B A;  5LJ3 d;  3MHX A;  1D3B B;  4HT9 A;  3JCM V;  4PLL A;  1NPP A;  4LDU A;  5I2M A;  3JB9 J;  1KQS A;  2M1H A;  3E19 A;  4MZP A;  4LDX A;  4D6W A;  3OMC A;  3E9F A;  1G3W A;  4LDV A;  3SWN C;  4M75 B;  4NS5 A;  4Z02 A;  4A4E A;  2YHT A;  4C92 F;  4E7K A;  5FRO A;  2LCL A;  4O6J A;  5CK9 A;  1JRI A;  1K8A C;  3V8J A;  5GMK j;  1BI1 A;  4PJO D;  4M77 D;  2QDY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...