2RHUA

Crystal structure of the 3-mbt repeats from human l3mbtl1 bound to dimethyl-lysine and in chimera with histone h3.3(28-34)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
325
structure length
323
Chain Sequence
b'SWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGGGGSAPSTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
molecule tags Transcription
source organism Homo sapiens
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
total genus 83
structure length 323
sequence length 325
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhuA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhuA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhuA03
4N4GA 1WJRA 3OYHA 3NTKA 3OYLA 4BDZA 3E9GA 3Q1JA 2G3RA 3MEAA 3OYFA 4GY5A 4QQDA 3O8VA 2EQJA 3LH0A 4A4GA 4N4IA 4QQGA 2YRVA 3ME9A 3KUFA 3META 4II1A 2RO0A 3QKJA 4LD6A 2M1HA 2BIVA 4A4EA 4E7JA 3FLGA 1WGSA 2PQWA 3MP8A 1WJSA 5KCOA 3OY9A 3S3NA 3OS2A 4E7KA 4QW2A 4PL6A 2R5AA 3S6WA 4IUQA 3ZEHA 3OYJA 2L8DA 2RHYA 2QQSA 4UC4A 4E7IA 3OYDA 2RHUA 4ZTFA 3H8ZA 2GF7A 3DB4A 4PLLA 3FC3A 3LX7A 3LGLA 2EKOA 4BE0A 2XK0A 4IUTA 3DB3A 5D6YA 2P0KA 4L59A 2CKKA 2LVMA 4B9XA 4Z02A 3S3MA 1OZ2A 3BDLA 5FROA 2JTFA 1WJQA 2QQRA 3NTHA 4A4FA 3MP6A 2RHZA 5KH6A 2EQKA 2JZ2A 2HQXA 2EQMA 5D6XA 4FL6A 4C5GA 4B9WA 4IUUA 1OZ3A 3LYIA 4N4HA 3OA6A 2WACA 3OYBA 2DAQA 3OS0A 2E5QA 3OYIA 2XDPA 3FEOA 2RJEA 4BE2A 2K3XA 4PLIA 2D9TA 4IKFA 1G5VA 5FRNA 3OYGA 5KE3A 3L2VA 2IG0A 4C5HA 4C5IA 4A4HA 2MWOA 3OB9A 4IUPA 2X4YA 3PNWC 3UT1A 2NLUA 3MP1A 4BACA 2EQUA 4RG2A 3OYNA 2X35A 3MEWA 2X4WA 3OMCA 3OS1A 3QBYA 5CIUA 4EDUA 2HQEA 3OYAA 3PFSA 3MO8A 4HCZA 4X34A 2LTOA 3FDRA 3SD4A 3GOXA 2RJCA 5D6WA 2BUDA 2RI3A 3NTIA 4C5EA 3C4SA 2VYTA 2O4XA 2RHIA 4QVZA 2F5KA 2GFUA 3PMTA 4ZTJA 1KHCA 3OMGA 5IAYA 2M0OA 3E9FA 2M16A 2EFIA 1MHNA 2DIQA 2FHDA 3CEYA 3DLMA 3QJ6A 3L2WA 3P8HA 4Q5WA 2R57A 4NS5A 2RI2A 2LRQA 4BD3A 3P8DA 2GFAA 2DIGA 3UWNA 3M9QA 1OYXA 5J26A 2B8AA 2RJDA 3F70A 4IURA 5J39A 4QQ6A 3S3OA 2L3RA 5KE2A 1N27A 1OI1A 2R58A 3L42A 2RHXA 5M9OA 5IN1A 4E7LA 3PMIA 2R5MA 2K3YA 4CRIA 3OYEA 2LCCA 5FRMA 5C0MA 3LLRA 5KCHA 3ASKA 2MWPA 2RI5A 4IUVA 4OVAA 4BE1A 3LGFA 3OQ5A 3QIIA 4FU6A 5C6SA 2X4XA 2E6NA 3L2RA 4BDYA 3L2QA 3MEUA 3MEVA 2RJFA 4E7HA 3EAEA 3OYKA 1RI0A 2O4XB 2L89A 3OYMA 3OYCA 2LDMA 1H3ZA 1SSFA 1XNIA 2BKDN 3H6ZA 3L2UA
chains in the Genus database with same CATH superfamily
3EG9B 4E7ZA 2EPDA 4HCCA 1RAHB 4MZPA 3KFVA 3HL8A 1G83A 5I21A 2EQJA 1GXIE 4AFSC 5IT9E 2RO0A 1QVPA 2EGCA 2L3QA 4RTUA 1VQ8Q 1PM3A 4F7UA 3CC7T 3V8KA 1RAIB 1RAAB 3C94A 2DEUA 1X75C 1NBEB 1SHFA 5CK9A 4M4ZA 3RESA 1AWXA 1K0XA 4JDSA 5D6YA 3JV3A 4M75G 1M27C 2QK0A 3CC4A 4A4KA 1B07A 5FROA 3THKA 4A4FA 3FRNA 2MYSA 3A1PA 1GL5A 3LYIA 4RTZA 2J05A 3OYIA 2O88A 4IKFA 3SFMA 3KXTA 2HD0A 4LDXA 2KYMA 3X20B 3HFOA 4C5IA 1ZSZB 4M75E 1VQMQ 2ED1A 3G71A 4RG2A 3UA6A 1GFDA 2COZA 2RD1A 2CUBA 3OMCA 2KK4A 4QVCA 3CC7A 3I56T 2YT6A 1AZEA 1EIFA 4BI4A 1S72T 2ESWA 1VQ9A 2K6DA 2RPNA 3J7AF 2RNAA 3C4SA 3JRZA 3RKWA 5CAIA 1KHCA 4PJOG 3EHQA 2DEQA 2KEAA 3P8HA 3RDVA 2R57A 2D8JA 1NZ9A 3QXEB 4DEYA 5GJVB 1VOMA 3F70A 1HJDA 3NGPA 4IURA 2CGHA 4DQ2A 1PD0A 1M1FA 3GBQA 3SDZA 2JS0A 2OI3A 1YNZA 1K9AA 4C92B 3JB9G 3ASKA 1VQOT 5GAMd 1IHWA 4OGCA 2DX1A 2KGTA 2JT4A 3EGUA 1BI2A 1KQSP 1N8RC 1XTDA 4HA8A 4OMLA 4E2FB 1JJ2A 2DTOA 2AZVA 4N4GA 1UB4A 1Q7YU 1X2QA 3E9GA 1OULA 3OW2A 1VQ8T 4DBHA 2AIRB 3OSVA 3CC7Q 1SRMA 3TEEA 3JCMP 1D09B 3OY9A 1WNLA 4QW2A 2XD0A 4C8QF 4M7DB 3SWNA 1AEYA 3BW1A 1WHJA 1NPPA 1ARKA 3M54A 5HK3A 1C1AA 4J9IA 1GFCA 2YXYA 4OB2B 4OF1A 4HVVA 4M75A 5GMKl 2I2LA 4LUDA 4C92D 5A0DA 2EQKA 3I55A 2V26A 4LXCA 4FL6A 3NHNA 1M2VB 5CCAA 1VYUA 5GAMg 2DXTA 3CD6T 4ELYC 2BZ8A 3VV0A 2CS7A 4JS5A 2PVOB 4M7AC 2COYA 5CIUA 3QBYA 2RF0A 2VGNA 4M77B 3V7CA 1M90U 4M75F 1P92A 2O9SA 2RI3A 1LJOA 3NTIA 3MJXA 5D7UA 1JQQA 1TSFA 3PMTA 4M78A 1Q81R 1NJIU 1B3QA 4Q5WA 2OTLQ 1WXTA 4QVDA 1T0JA 1I0CA 3SWNC 1QP3A 4PJOD 2RQVA 2DPPB 2DZCA 2R5MA 2HCKA 2X3XD 1VQ7Q 1OX9A 2LQKA 1M1GA 5KCHA 2QEXQ 1ZUKA 2ZZDA 1JEGA 2LNHB 3MEVA 4E7HA 1IRXA 1SRLA 2HDAA 4MZMA 4X9CA 3OYMA 4GLKA 3V7SA 3M5AA 3G1JA 3Q1JA 1U3OA 3CMEA 2RA2A 4J9EA 3PIOA 2VV5A 1U1TA 5KYUA 4FM4B 4Y28E 1D0XA 2EJGA 1N8RR 4M7AA 2OAUA 1RABB 2OAWA 4HT8A 1G3WA 1TS9A 1K73U 1WIEA 4EMKB 4A53A 4M78C 3LWIA 4J8OA 1OZ2A 2PNIA 1YIJQ 2KAFA 3CPWP 2RHZA 1VQNT 5CKHA 4L6V5 3A8OB 1I8FA 2NUPB 3H0HA 1K8AR 4B9WA 5KYWA 3OS0A 1I5OB 2D9TA 3D7SB 1SKUB 1RI9A 1Y96A 4X9DA 4A4HA 5KYNA 5GAMh 1U8RA 4BACA 1Q86C 3M0RA 1QCOA 3M4YA 2GCXA 3CCQA 2VASA 1LCKA 4M7DE 3TCJA 3EFSA 1ZBJA 3G4SQ 4RCCA 4J7FA 5FW9A 4F7UG 3OBYA 3CCEQ 1FX7A 3QJ6A 5ECAA 2EJ9A 2JMAA 1FXXA 4FSXA 1D0ZA 1PD1A 1AWJA 1U06A 2DKGA 2GTOA 2K9GA 2RHXA 4E7LA 3PMIA 1T3SA 5GANd 2CZ1B 5FRMA 3UATA 1MUZA 4OVAA 2RM4A 2AHJB 2NYSA 1TH7A 4LDWA 1VQ5T 4Y91A 4PFOA 3EG1A 2O4XB 5GANf 3M53A 2PZ1A 1KD1R 2LDMA 2BKDN 3JCMJ 3JAME 2COWA 2HEQA 3CMAA 2OTLA 1YJ9T 2QYZA 3TREA 2QASA 3M0UA 5LJ5e 1D1BA 2GBQA 1K1ZA 2VB6A 4YTLA 4F14A 1EZZB 3RR6A 1ZUUA 3CCRA 3FLGA 3OYJA 3CXCA 2F5TX 3O5ZA 4F16A 1W2BA 1YIJT 2XK0A 1M90C 1QWEA 3VYHB 4PFZA 2E41A 1JO8A 2L2PA 2QGGA 3MPUB 3L2ZA 3G6EQ 2O2OA 3NTHA 1VQPQ 1RAFB 3QG1A 2OTJA 1UHFA 2QEXT 4Z88A 2BE7D 1YI2T 4J6YA 1G5VA 4RTXA 2XICA 2H8HA 4FCYA 1RADB 5DLOA 2LQWA 2VGMA 3PVQA 1Q81U 3JCMV 2LZ6B 2J6KA 2KYBA 2CP3A 4AFQC 4X1VA 1Y0MA 1K76A 2QGFB 3FDRA 4RUGA 2D0NA 2W10A 2QQAA 2DYIA 4F7UB 2VYTA 2EKHA 5AYFA 2PU9B 4MMKA 1BYMA 3QYGB 3I56Q 3E9FA 4M75C 4M77A 1S72Q 3E19A 3L2WA 3A8LB 2AK5A 1T0HA 2XHCA 4XQ3A 5GAN7 3SHWA 3ULRB 4QQ6A 4N0AC 2R58A 1J3TA 4M7AF 3CCLQ 2KR3A 3FJ5A 3QZ9B 2MOXA 3UF4A 1Q82R 2CP6A 4ZN3A 2A36A 4J5YA 4FU6A 2DXUA 3ZL7C 2DA9A 3AHUA 5LJ3f 1G3YA 3RMSA 4VUBA 1ABOA 2KRMA 4OMFB 2DF6A 3OYLA 3A5ZB 1UGVA 2AKKA 2JVVA 2F2VA 4PK4A 3QO3A 1BKBA 1B7TA 1VQ9T 2CP5A 2JTEA 1X01A 1OPLA 2L3SA 3DKMA 3CCMA 3SEMA 4L5GA 2QXFA 2YHTA 3L1AA 3S3NA 3MP8A 2KDSA 2LJ0A 3EGXA 2E10A 4PJOA 4IUQA 1QMCA 4UC4A 1TU0B 2EGEA 5KYUB 2LQ8A 1Q7YR 1M2OA 2HKNA 1HSQA 4HCBA 1VQMA 1F1BB 1G2BA 4AG2C 2V1QA 3IQLA 3CCLA 2QI2A 1M3CA 4JPBW 1Q86U 3JCMe 4KH1B 2HBPA 3NPFA 1NJIC 3CBMA 2DAQA 3FEOA 1S72A 2FZGB 2K4YA 3L2VA 3M58A 2E4HA 4E6RA 4XTWA 4JRQA 5KYWB 2EYYA 3P8BB 2Y4YA 2CP2A 2X4WA 2OTJT 1U1SA 5GANh 4AG1C 2LTOA 1K8AC 3A8HB 5D6WA 2AT1B 2F5KA 2LNVA 1SG5A 4M77G 3QJYA 1I1JA 4M7AE 1UECA 4FIBA 3CCLT 2LJ1A 3RKYA 2O31A 4R56A 2DJZA 4HVWA 4M7DG 4M78D 3CCVA 1TXQA 4D8DA 4ANJA 1JU5C 2CT4A 1YBYA 4R0KA 1AHJB 3CD6A 1VIEA 5LJ3g 1KK7A 3M57A 1UUEA 3TSZA 2QDYB 3QDFA 1BI1A 2KMTA 2IVWA 1QLYA 5GAMf 2E64A 3PT9A 1AOJA 3CMAQ 2YUQA 2E5KA 2GTJA 3EGDA 4A4GA 1VQLQ 4QQGA 2PVGB 4A4EA 4E7JA 2KE9A 2HZYA 2V1RA 3CCRQ 3MCAB 3OS2A 4E7KA 1YITA 4ZGJB 4XU0A 2VXEA 4ZTFA 1N9SA 2K5LA 2ROLA 1NEBA 1X2KA 4PLLA 1BCOA 4FT2A 1YCSB 2ED0A 2EW3A 4AMCA 3M0PA 4WTOB 4PJOB 2YUPA 3CCJQ 4JZ4A 4RG8A 1YJNQ 3EG3A 1QW1A 2VWFA 4ME7A 1H641 2LX7A 2WACA 1B34B 2XDPA 2ZPIB 4J83A 4PLIA 3SWNB 4CC4B 2K5FA 3VUBA 2ZAEA 4AFZC 2FB7A 4CC2A 4EMKC 4FSSA 3CCVQ 4J6WA 3VS4A 3RIRA 4RTWA 2MIOA 1UFFA 1VQ8A 2M51A 3RERA 1LPLA 1N9RA 2RHIA 4PJMA 3CXCP 4FYVB 2A7YA 3CEYA 3QSUA 1KQSS 4WCIA 5GANj 5A0GA 3CMEQ 5A2QE 2YLCA 3OYEA 1LOJA 4C8QE 2DERA 1VQ6A 1JBMA 4LDVA 2QQ9A 3QIIA 3OQ5A 3MEUA 1YP5A 2YSQA 3EAEA 1TWBA 3OYKA 3UA7A 1V76A 3JB9J 1QVGS 2MI6A 3CC2Q 1MGQA 3NTKA 1M3BA 4XTVA 5GAOn 4EMHA 1OX8A 3CCSQ 1Y7XA 4XU1A 5HKCA 3JB9I 2RQTA 1WQWA 3H0FA 3HFNA 3JCMW 1YJWA 5KCOA 1S1NA 5J3BA 2QA4A 1WI7A 3DB4A 4BE0A 3LGLA 1AWOA 1X27A 3JB9H 2F2XA 3VS5A 1JB0E 1ZA1B 2LVMA 2YDLA 1BB9A 4Z02A 4B9XA 2JTFA 2FPDA 1AVZC 2K7AA 1W2BS 2KXCA 3OBWA 1ZA2B 1W2BP 1NEGA 1M1KR 3EFOA 2EQMA 1W4SA 2GQIA 3CXCS 1C6VX 1KSWA 4M78F 1K8AU 4OB1B 2DBMA 1HK9A 3JCMf 3QHSA 2LP5A 3PNWC 2DL5A 3V7RA 2EQUA 2CSQA 1D0YA 3CPFA 2E65A 1R0BG 1W6XA 3CCJA 1QVFA 3SD4A 5CQXA 2BUDA 2L5QA 2IIMA 3HPWA 2JS2A 4FYYB 1JRIA 1MNEA 4C5EA 3JCMX 2DMOA 4ZTJA 5I2SA 3OMGA 1SHGA 1WQ7A 1N8RU 2KQWA 1VQOQ 4BD3A 2HSPA 2DIGA 1OV3A 1WFWA 3VYGA 5M9OA 5KYYB 1GRIA 4TVRA 2DBKA 2LCSA 5L8RE 2EYWA 5C6SA 1PHTA 3HHTB 3HSBA 1AT1B 2CZ0B 2JUFA 2KT1A 2KY9A 2L89A 4PJOF 2O01E 1D3BB 4KUDK 1XNIA 3FB9A 3TSWA 4FYWB 1AWWA 2DZ9A 1VQPT 1MMGA 1FWZA 4J9FA 3I5SA 2C0IA 3VS2A 3AT1B 2RK2A 2YRVA 3META 5GAMe 2BZYA 8AT1B 1M2VA 1WJSA 2YRCA 1NJIR 2V8KA 3X25B 2F1LA 2KBTA 3JCMc 4HXJA 3TQ7P 4C0ZA 1M90R 3M0QA 3A98A 2FEIA 2QTXA 2E1HA 4L59A 2CKKA 2DNUA 2VKNA 3JCMh 1NYGA 4OMQA 4MMLA 1QVFP 2LT4A 4CC7A 1YHQT 4F7UE 3HRSA 2DXBA 2JZ2A 2DVEA 1VQ7T 2CP7A 5GAN5 1FMKA 1OU8A 1CSKA 2RJEA 1Z9QA 4C8QG 1QCNA 4C8QB 4M7DF 4HT9A 5I22A 2X4YA 3UT1A 4EMGA 3MP1A 2KROA 4XTZA 1BU1A 1IREB 4C8QC 3CC4Q 2LT1A 1M8VA 1ZSZA 5GAN2 2RJCA 2KRSA 1MMAA 1ZBXA 4MDXA 1NLOC 4NL2A 2J6FA 2D6FA 3M59A 2PTKA 3UWNA 2B8AA 2FL7A 2L3RA 2DYBA 3RKXA 1N27A 1WHKA 5IN1A 2RH2A 3CCQQ 2KVQG 5CKFA 2RI5A 1M3AA 2NUTA 1Y71A 2P84A 1ZHIA 3QPHA 3QWXX 4PJJA 1O9SA 1VIFA 3OYCA 3JCMQ 1MMNA 4BY6B 3H6ZA 3L2UA 2SEMA 1V29B 3OYHA 1PG5B 2G3RA 3C95A 3RMQA 1WLPB 2BE9B 4II1A 2HKQB 4LD6A 3VRYA 9ATCB 4RMOA 3VUZA 4PL6A 2R5AA 1VQLT 2CH4A 2M9UA 3OYDA 4JRPA 1ZSZC 4E7SA 2B86A 4IUTA 2GGRA 3WXMB 4M7DA 5GAMj 2EYXA 4KBMB 4V2SA 2QG9B 4LDYA 5LJ5g 5GANg 2FG0A 5D6XA 2CDTA 4IUUA 3JCMd 2BTTA 4F7UF 1HYOA 4F17A 5GAN8 2JM8A 5GMKm 4PNOA 2MWOA 4EPCA 1RLQC 5CKDA 3ZBDA 1VQ7A 1YJ9Q 5FWBA 2EVRA 1UDLA 3ER0A 4ZGDB 4QT7A 1EX4A 3CCVT 2IPOB 1R77A 2C0OA 5IH2A 1YFNA 3HRUA 4QVZA 3CCMT 1LNXA 4GBQA 2GNCA 2Y4XA 3URGA 2LX9A 2KSSA 1Q81C 2HL3A 3M4GA 1D1CA 1LVKA 2K3YA 4CRIA 3CCET 2FO0A 4F04B 3G6ET 4IUVA 3CMET 3LGFA 1YHQQ 4BDYA 2ROTA 2RN8A 2VXFA 3WVDB 2JNGA 4K11A 1H3ZA 5IAYA 2CSIA 4ZN1A 1CKAA 1Q95G 2NUTB 5GAOp 1WHLA 2E70A 1JXOA 1KQ1A 4M7AD 1G3SA 2HBWA 3VKIA 2RQRA 1Y57A 3VJPA 2OX7A 3FIFA 2FPFA 2YUOA 3ME9A 3FJPA 1NLPC 3I9QA 1WGSA 3CCST 4JZ3A 3CD6Q 1GBQA 4LN2A 2GQVA 3CCUT 2GF7A 1PKTA 1WDXA 2J7IA 4A63B 4LD9K 1IB8A 2ZPBB 1VQLA 2XKOC 3CCQT 2JTMA 4B6MA 2LQNA 4M77E 2LCLA 2A08A 4BE2A 5I11A 1TOVA 2DO3A 1PC0A 4C5HA 1WHGA 3RNJA 3INZA 1KD1U 3GIBA 2DTIA 3JSCA 3MEWA 1I4K1 2DTHA 3NFCA 3PFSA 2X4JA 2XDBA 3GOXA 1IO6A 2KT8A 4XTXA 1ABQA 5LJ3j 4DOVA 1QKWA 2KRNA 3P8DA 2MCNA 2L0AA 4PJOC 4WF2A 1VQ4A 3G7ZA 4KGVB 1M1KC 4BI3A 4J7IA 1BCMA 2EQIA 5LJ3h 5C0MA 4XTUA 3L2RA 2X4XA 3EGXB 4OMNA 3QUIA 3LW5E 4J9DA 2ATCB 4C8QA 1SSFA 3H8ZA 2A3LA 2DL4A 5IXFA 2MF2A 4HVUA 4FT4A 4BDZA 2MMPA 5GMKj 4OMMA 1G8XA 1VQ6T 5GANe 1BI0A 4XTYA 2OTJQ 2EIFA 4CC3A 3KUFA 4LDUA 3I55Q 1M5Q1 2BIVA 3CCUQ 1QQJA 2CT3A 2LJ3A 1X6OA 1KIKA 5GMKi 5LJ5j 3BDUA 1JXMA 1NM7A 4A54A 1AD5A 3VS1A 2WSCE 2EKOA 1PWTA 3VU3C 2ABLA 3EG9A 2Y90A 2NUPA 2E3IA 5LJ5d 1YJWT 4KT0E 5KYYA 3CCSA 4NL3A 2EAYA 2QA4T 1Y96B 1X43A 2HQXA 5EG2A 4N4HA 4OMPA 1Y07A 1AZGB 3OYGA 4DBFA 5KE3A 2ENMA 5GAOl 2XU8A 1SEMA 4IUPA 1RUWA 1SF9A 1IHVA 2K2VA 3C12A 2X3WD 1OU9A 2EYZA 4Y92A 2FVUA 1ZX6A 5GAOm 3CMAT 1U5SA 1N5ZA 2PUOB 1GCQA 4JLIA 1H3HA 1Z9ZA 4C0DC 2DLPA 3A8MB 3CCRT 5GAN3 1PNJA 3HKSA 1JJ2S 2RQUA 1MNDA 3S3OA 4IIMA 3EGDB 4DEXA 4E47A 4C0DB 2HQHA 2VUBA 2G6FX 4DOWA 1UJ0A 2CZ7B 2F2WA 4KRTA 1VA7A 2RJFA 3C0CA 2J6OA 4OB3B 2MPXC 2K57A 1UG1A 5GJWB 3H41A 2LMJA 4ESRA 3UDCA 2HSEB 4CI0C 1WJRA 4MZTA 2EYQA 4M7AB 1WXBA 5CKBA 1I07A 2DVJA 2DL3A 1QCFA 3LH0A 5IHNA 1KQSA 4M77C 1K9MU 1H92A 1KC8C 1UGPB 4EMKA 3CCJT 4JS4A 1X6GA 4M75D 3VS0A 4Z89A 1W70A 2K5IA 2QQSA 2X9HA 3E2UA 1YITQ 1GCQC 1M1KU 3CPWA 2K3BA 1D3BA 4P5NA 3UPUA 2RK1A 3S3MA 3REBB 4OP0A 8ATCB 1FMWA 1PKSA 4C5GA 7AT1B 2M0YA 4LNPA 2E5QA 2HNIA 4JLGA 4GLMA 2CREA 5FRNA 3HRTA 1X6BA 2P4TA 3JCMg 4KUIA 2EBPA 2DXCA 1UTIA 1EFNA 1VQNA 1MMDA 3MKDA 5I2MA 2DE0X 1OOTA 2JN0A 4HCZA 2DFUA 2FZKB 1SPKA 5LJ3e 4C0GA 1RLPC 2DD5A 4RCBA 1YWOA 3H0IA 2GFUA 2W0ZA 2XI9A 2CP0A 3REAB 1MHNA 2DILA 5HK0A 2E6ZA 1XJWB 4NS5A 2LRQA 4KH0B 1NG2A 5KE2A 2QAZA 5FU7C 3BFMA 1PSFA 3VS6A 1UHCA 5GAOq 1YJWQ 2J06A 3M56A 3LLRA 2MWPA 4XU2A 1VQKT 1XQHA 2FRYA 1BIAA 1FMVA 1TTHB 3CBOA 4KULA 2I0NA 1BIBA 1WX6A 3BY7A 4HKEA 3M0TA 3I35A 1PSEA 5FU6B 4FW2A 3MEAA 4XU3A 1VQ5A 4QQDA 4ATOA 5GAN6 4O5VA 3VS7A 1YN8A 4J9HA 1TUCA 2JXBA 3OW2S 2QTVA 1PRLC 2OTLT 1BI3A 1HXDA 1PCXA 4C92G 3FC3A 3LX7A 1Q82U 2KNBB 2P4RA 1K4US 1RAEB 2XDDA 1UJYA 4OMOA 1O75A 1M9SA 1VQKA 3BDLA 5IXBA 4AFUC 1TG0A 3OYBA 1ZSGA 2XG8D 1IZ6A 4C92E 1UE9A 4R55A 4J6XA 3G4ST 1CKBA 1ZQ1A 3J80E 3QWYA 4XK8E 3OB9A 1VQNQ 5DLQE 2QDLA 1E7OA 1M4ZA 3V8JA 3OYNA 4C8QD 2DD4A 3J81E 5FU6C 3DLLA 5IHKA 2HQEA 3OYAA 2QEXA 2L3PA 4HCKA 1N6AA 1WPYA 4M77D 3CCUA 2D8HA 1I81A 1QVGP 1R8OB 5L23A 4QKUA 4FYXB 3WVEB 4DBQA 3QYHB 3G71T 1VQOA 5DY9A 4M7DD 2JOYA 4M78G 2RI2A 1YITT 2GFAA 3JB9D 3GF5A 1ZLMA 1OYXA 1OQKA 5J26A 2HAXA 4PKCC 1KJWA 1W1FA 5CVIA 3ZFJA 2FYKA 5CQYA 1DJ7B 4JJDA 1IGUA 4RTVA 3CPWS 2JM9A 1K0SA 1OPKA 3G4SA 1UGQB 2AZSA 3SB2A 1K73C 3U23A 1KFZA 2DJQA 3G6EA 3QZ5B 1VQ4Q 2E3HA 2A37A 4JRKA 1E6HA 2H3JA 1M30A 1RL2A 3GPLA 3QKJA 2M1HA 2ZPHB 2C06A 4M7AG 3S6WA 3QDRB 3I56A 1PRMC 2EWNA 3I55T 1FYNA 1WZOA 2RHUA 1UEBA 1Q86R 3CC2A 3EH1A 1YI2Q 2P0QA 1YCYA 1VYTA 4DBRA 1KC8U 2QQBA 1KQ2A 3JCMb 4J9BA 1KD1C 3MP6A 3I5RA 2MK5A 3OSSC 3TU4K 1HD3A 5GMKe 5DM7R 3OA6A 1VQMT 1M8MA 2K3XA 4RKUE 2QA4Q 5GMKh 1IGQA 2JMCA 3H9NA 2P0PA 2XMFA 1VUBA 4JJNK 1GBRA 3N5BB 1OEBA 1B34A 2KXDA 3OS1A 4PJLA 4D6WA 4EDUA 1RACB 2HL5C 4M78E 1UGSB 3X28B 4EIKA 2PUKB 1G3TA 3LWHA 2EGAA 2E12A 3CC2T 3CBPA 2M16A 2DIQA 4BUGA 1K9MR 2RB6A 2SRCA 5KYXA 5J39A 4JUVA 2V8IA 4M75B 1SSHA 4LE9A 2FZCB 4ELZC 1K73R 2ECZA 1WXUA 4M7DC 2ZCFB 1WHHA 2OJ2A 1VQ9Q 1WYXA 3GNFB 5HCKA 1RI0A 2YLBA 2VC8A 4C92F 2D1XA 1VYVA 4KGXB 1VQ4T 1QWFA 4RTTA 1Q82C 2BZXA 5EC7A 1QKXA 3M0SA 3OYFA 1T3LA 4M77F 4N4IA 3VRZA 2FPEA 2DL8A 2DETA 3X26B 3MHXA 2DK3A 1R0CB 4C92C 4OB0B 1ZUYA 1YHQA 3ZEHA 1IXDA 4E7IA 5CKEA 4N0AA 3JB9F 4J9CA 3G71Q 3PE0A 3PTAA 3EG0A 1TUDA 2HMAA 2K79A 4PFPA 2YWWA 3EFOB 1GCPA 4BI8B 5FU7B 1YJNA 6AT1B 2NUZA 4KGZB 2RMOA 1WJQA 2QQRA 4JJCA 3EFRA 3V8LA 5KH6A 2DRMA 3EH2A 5HY6A 4JJBA 1K9MC 2A28A 4AT1B 1OZ3A 2CZ6B 5CO7A 3KBGA 4PJOE 2IG0A 1JJ2P 5LJ5f 3T9NA 5CR2A 1QVGA 2NLUA 1RAGB 2DM1A 1A0NB 1BK2A 2X35A 3RBBB 1VQPA 4BB7A 1MV0B 3HP9A 5LL6S 2RQWA 3E1SA 4LUEA 2Z0WA 4RTYA 2O4XA 1BBZA 5GAOr 2EFIA 2FHDA 4D8KA 3M55A 4C0FA 1KG1A 4C92A 3M9QA 1NYFA 1MV3A 2RJDA 3GP8A 3GLXA 2LC4A 3CCMQ 5LJ3d 1XOVA 1D1AA 1H8KA 1C0MA 2V8JA 5KYXB 1NE8A 2ZPGB 2E6NA 2H3EB 2ZPFB 2WSFE 1WHMA 2ZPEB 4IIOA 1I5LA 2WSEE 4OGEA 4O6JA 3VS3A 4GY5A 2A0FB 4JRIA 2EJFA 3O8VA 2KI7A 4DA4A 2PQWA 2JJ9A 1KHIA 1V1CA 1YWPA 1KC8R 4M78B 2L8DA 2RHYA 1E6GA 2CYZB 1X69A 2M02A 1WA7A 2DRKA 4ZGEB 2DL7A 2MAMA 1Q7YC 3DB3A 2F69A 2P0KA 1TUGB 5AT1B 3OS5A 2YRDA 5LJ5h 5FWCA 1NPRA 1QVFS 4MDWA 4ORZA 2YUNA 4FW1A 3OYYA 1YJNT 4XAXB 2XIDA 2ZGWA 4NOYA 3X24B 3HTRA 3LH5A 1VQKQ 4PJNA 1YJ9A 5A0LA 3MO8A 4X34A 2O9VA 2VVKA 5IHIA 3CCEA 2D0QB 5GAN4 2CH4W 2M0OA 3A8GB 2PVDB 3DLMA 3PGGA 3EG2A 3PIPA 2CUDA 3RUXA 3NMZC 1OI1A 3BE3A 3L42A 4ZNXA 1VQ5Q 3GNGA 1YIJA 5FLXE 2JW4A 4BY6C 2LCCA 1ACMB 2K2MA 3EHRA 3CC4T 3PVLA 4Z8AA 4BE1A 4J9GA 3R6NA 3R6OA 3L2QA 1VQ6Q 2X51A 3OW2P 1QP2A 1UGRB 2FRWA 2C0TA 3TVTA 2NWMA 2AKLA 1YI2A 3CQTA
chains in the Genus database with same CATH topology
3BY7A 1V29B 4OMFB 4HKEA 3OYHA 3OYLA 4HCCA 3A5ZB 5FU6B 1PSEA 2JVVA 4MZPA 2G3RA 3QO3A 3MEAA 1BKBA 3HL8A 1VQ9T 4XU3A 3C95A 5I21A 1VQ5A 1X01A 4QQDA 2EQJA 3RMQA 1GXIE 4ATOA 5GAN6 3DKMA 5IT9E 4II1A 4LD6A 2RO0A 1QVPA 4O5VA 3CCMA 4L5GA 4RMOA 2QXFA 2YHTA 3L1AA 3S3NA 3MP8A 2KDSA 4F7UA 3CC7T 3V8KA 3VUZA 2E10A 4PL6A 2R5AA 3OW2S 4IUQA 1VQLT 4PJOA 4UC4A 2OTLT 3C94A 2M9UA 3OYDA 4JRPA 2LQ8A 1BI3A 1HXDA 1X75C 4C92G 5CK9A 4HCBA 3FC3A 3RESA 3LX7A 1VQMA 1Q82U 4IUTA 4JDSA 5D6YA 2XDDA 4M75G 3WXMB 4M7DA 3CC4A 1O75A 1M9SA 5GAMj 4A4KA 1VQKA 3CCLA 3BDLA 5FROA 2QI2A 4KBMB 4A4FA 1Q86U 4V2SA 3FRNA 4LDYA 5LJ5g 3JCMe 5GANg 1YJWT 5D6XA 2HBPA 4IUUA 3LYIA 3JCMd 1NJIC 4F7UF 3CBMA 3OYBA 2DAQA 2XG8D 3OYIA 3FEOA 4IKFA 3SFMA 1S72A 1IZ6A 5GAN8 3KXTA 4C92E 2HD0A 4LDXA 3X20B 5GMKm 4J6XA 4R55A 2K4YA 3L2VA 3M58A 3HFOA 4PNOA 3G4ST 1ZQ1A 3J80E 4XK8E 4C5IA 2MWOA 3OB9A 4M75E 4XTWA 5DLQE 4EPCA 5CKDA 3G71A 4JRQA 3ZBDA 1M4ZA 4RG2A 3RMSA 3V8JA 2RD1A 3P8BB 2Y4YA 3OYNA 4C8QD 2DD4A 2X4WA 3OMCA 3J81E 1U1SA 5GANh 5FU6C 3DLLA 1VQ7A 2KK4A 4QVCA 2HQEA 3OYAA 2QEXA 3CC7A 1N6AA 3ER0A 1WPYA 3I56T 2LTOA 4ZGDB 4M77D 1EIFA 3A8HB 4BI4A 1S72T 1K8AC 1VQ9A 3CCUA 1I81A 5D6WA 3CCVT 3J7AF 1R8OB 3C4SA 3HRUA 3JRZA 3WVEB 4QVZA 2F5KA 3RKWA 3QYHB 5CAIA 3CCMT 1KHCA 4PJOG 3G71T 2LNVA 1LNXA 5DY9A 1VQOA 4M7DD 2DEQA 2JOYA 2Y4XA 4M78G 3P8HA 3URGA 2R57A 4M77G 3QJYA 2RI2A 2LX9A 1NZ9A 3QXEB 1YITT 4M7AE 2GFAA 4FIBA 3GF5A 3CCLT 3JB9D 2KSSA 1OYXA 5J26A 3F70A 1Q81C 2HAXA 4IURA 4PKCC 3RKYA 3M4GA 2CGHA 4R56A 2DJZA 4DQ2A 4M7DG 1M1FA 4M78D 3CCVA 3SDZA 5CVIA 2K3YA 3ZFJA 2FYKA 4CRIA 3CCET 5CQYA 1DJ7B 4C92B 3JB9G 3ASKA 3G6ET 1YBYA 4IUVA 3CMET 3CPWS 3LGFA 1VQOT 1AHJB 4BDYA 3CD6A 5GAMd 1VIEA 3G4SA 1UGQB 2VXFA 4OGCA 5LJ3g 3WVDB 2JNGA 3M57A 2QDYB 1BI2A 1BI1A 2KMTA 1H3ZA 1N8RC 1XTDA 4HA8A 5IAYA 3SB2A 4ZN1A 1K73C 2IVWA 1JJ2A 2DTOA 4N4GA 5GAOp 2E70A 5GAMf 1UB4A 1Q7YU 2E64A 3PT9A 1KQ1A 3E9GA 4M7AD 1G3SA 3OW2A 3G6EA 3VKIA 3QZ5B 1VQ8T 3OSVA 4JRKA 3VJPA 2H3JA 4A4GA 3FIFA 1RL2A 4QQGA 3GPLA 3ME9A 2PVGB 3FJPA 3TEEA 3QKJA 3JCMP 4A4EA 2M1HA 4E7JA 2ZPHB 1WGSA 3OY9A 3CCST 3MCAB 3OS2A 4E7KA 2C06A 4M7AG 1WNLA 4QW2A 2XD0A 3S6WA 4C8QF 3QDRB 3SWNA 4ZGJB 3I56A 1YITA 4M7DB 2EWNA 3BW1A 3I55T 1NPPA 2GQVA 4XU0A 3CCUT 2VXEA 2RHUA 4ZTFA 1N9SA 2K5LA 2GF7A 3M54A 1UEBA 4PLLA 5HK3A 4FT2A 3CC2A 2P0QA 1YCYA 4LD9K 4OB2B 4OF1A 4PJOB 4M75A 1KC8U 5GMKl 2QQBA 2I2LA 4RG8A 1KQ2A 3JCMb 2ZPBB 4C92D 1KD1C 5A0DA 3MP6A 1VQLA 2EQKA 2XKOC 3I55A 3CCQT 2JTMA 3OSSC 1QW1A 3TU4K 5GMKe 4FL6A 4ME7A 1H641 5DM7R 4M77E 2LCLA 2WACA 3OA6A 5CCAA 1VQMT 1B34B 2XDPA 2ZPIB 4BE2A 5GAMg 2K3XA 4J83A 4PLIA 4RKUE 3SWNB 2DXTA 2OTJT 3CD6T 5GMKh 2K5FA 4ELYC 3VV0A 2DO3A 3VUBA 4C5HA 2CS7A 2P0PA 3INZA 1KD1U 1VUBA 4JJNK 4JS5A 3GIBA 2DTIA 3JSCA 2FB7A 3N5BB 1B34A 2PVOB 4M7AC 4EMKC 3MEWA 3OS1A 4D6WA 1I4K1 2DTHA 3NFCA 3QBYA 4J6WA 4M78E 5CIUA 3RIRA 4EDUA 3PFSA 2VGNA 1UGSB 2X4JA 4M77B 2XDBA 3X28B 3GOXA 2PUKB 3V7CA 1VQ8A 1M90U 4M75F 1P92A 4XTXA 1G3TA 2RI3A 5LJ3j 1LJOA 3NTIA 3RERA 4DOVA 3LWHA 1N9RA 2RHIA 2E12A 3CC2T 3CBPA 3PMTA 4M78A 1NJIU 2M16A 2A7YA 2DIQA 3CEYA 4BUGA 4Q5WA 3QSUA 2RB6A 4QVDA 3P8DA 1KQSS 5GANj 4PJOC 3SWNC 5J39A 4JUVA 2V8IA 5A0GA 1QP3A 4WF2A 1VQ4A 4M75B 4PJOD 3G7ZA 5A2QE 2DPPB 2DZCA 2R5MA 2YLCA 1M1KC 4BI3A 3OYEA 4J7IA 1LOJA 5LJ3h 2LQKA 4C8QE 4ELZC 5C0MA 1M1GA 4XTUA 5KCHA 1VQ6A 1JBMA 4LDVA 2QQ9A 3OQ5A 3QIIA 3L2RA 2X4XA 4M7DC 2ZCFB 2ZZDA 3MEUA 3QUIA 3MEVA 4E7HA 3LW5E 3EAEA 3GNFB 4MZMA 3OYKA 1RI0A 2YLBA 2VC8A 4X9CA 3OYMA 4C92F 4C8QA 3JB9J 1QVGS 1SSFA 3H8ZA 2MI6A 4GLKA 1VQ4T 2A3LA 3V7SA 1MGQA 1Q82C 2MF2A 3M5AA 3NTKA 4XTVA 5GAOn 4FT4A 4BDZA 2MMPA 4EMHA 5GMKj 3Q1JA 1VQ6T 3CMEA 2RA2A 5GANe 3OYFA 1Y7XA 1BI0A 4XTYA 4XU1A 5HKCA 3JB9I 2VV5A 3PIOA 4M77F 1WQWA 3HFNA 1U1TA 2EIFA 4N4IA 3KUFA 4LDUA 3X26B 3MHXA 1M5Q1 4FM4B 3JCMW 2BIVA 4Y28E 1YJWA 2EJGA 4M7AA 5KCOA 2OAUA 2DK3A 4C92C 1X6OA 4OB0B 1YHQA 5GMKi 5J3BA 3ZEHA 4E7IA 5CKEA 2QA4A 5LJ5j 4N0AA 4HT8A 3BDUA 4A54A 1G3WA 3JB9F 1K73U 3DB4A 2WSCE 3PTAA 3LGLA 2EKOA 4BE0A 3VU3C 4EMKB 3JB9H 2Y90A 4A53A 1JB0E 4M78C 5LJ5d 2LVMA 4KT0E 4Z02A 4J8OA 5FU7B 4B9XA 4BI8B 3LWIA 1OZ2A 1YJNA 3CCSA 2JTFA 1WJQA 2QQRA 4NL3A 2KAFA 2EAYA 1W2BS 3EFRA 2RHZA 3V8LA 5KH6A 5CKHA 3OBWA 1VQNT 4L6V5 3A8OB 5HY6A 2QA4T 1K9MC 1I8FA 1Y96B 2HQXA 2EQMA 1W4SA 5EG2A 4B9WA 1OZ3A 2CZ6B 4N4HA 3CXCS 1Y07A 3OS0A 5CO7A 2D9TA 4M78F 1K8AU 3KBGA 3OYGA 4PJOE 4OB1B 5KE3A 5GAOl 2XU8A 2IG0A 1HK9A 1Y96A 3JCMf 3QHSA 4X9DA 4A4HA 5LJ5f 4IUPA 3T9NA 3PNWC 5CR2A 2NLUA 5GAMh 3V7RA 4BACA 1U8RA 2EQUA 1Q86C 2K2VA 3C12A 3CPFA 3M4YA 2GCXA 2E65A 2X35A 3CCQA 2FVUA 5GAOm 3CMAT 3CCJA 4M7DE 1QVFA 2PUOB 3TCJA 3SD4A 4BB7A 3EFSA 1VQPA 3HP9A 5LL6S 4JLIA 3E1SA 5CQXA 2BUDA 2L5QA 3HPWA 4RCCA 4C5EA 3JCMX 1JRIA 4C0DC 4J7FA 3A8MB 2O4XA 4F7UG 3CCRT 4ZTJA 5I2SA 3OMGA 5GAOr 3OBYA 2EFIA 2FHDA 1WQ7A 1N8RU 1FX7A 2KQWA 3M55A 3QJ6A 5GAN3 2EJ9A 3HKSA 4C0FA 1JJ2S 4BD3A 1KG1A 4C92A 1FXXA 4FSXA 2DIGA 3M9QA 2RJDA 3VYGA 2DKGA 3S3OA 4E47A 3GP8A 3GLXA 4C0DB 2LC4A 2RHXA 2VUBA 5M9OA 4E7LA 3PMIA 5LJ3d 1XOVA 5GANd 2CZ1B 4DOWA 5FRMA 4TVRA 2V8JA 2CZ7B 4OVAA 2RM4A 2AHJB 4LDWA 1TH7A 5L8RE 1NE8A 2ZPGB 5C6SA 2E6NA 1VQ5T 3HHTB 3HSBA 2ZPFB 2CZ0B 4Y91A 2WSFE 2RJFA 2JUFA 4OB3B 2ZPEB 2KY9A 2O4XB 5GANf 3M53A 2L89A 2K57A 2O01E 2LDMA 1D3BB 4PJOF 4KUDK 2BKDN 1XNIA 3FB9A 3JCMJ 3UDCA 3JAME 1I5LA 4CI0C 1WJRA 2WSEE 2DZ9A 4MZTA 3CMAA 2OTLA 2EYQA 4M7AB 1YJ9T 5CKBA 4OGEA 1VQPT 3TREA 1QVGA 1FWZA 4O6JA 5LJ5e 4GY5A 2EJFA 4JRIA 3O8VA 3LH0A 2RK2A 4YTLA 2YRVA 1KQSA 3META 4M77C 3CCRA 5GAMe 1K9MU 4DA4A 3FLGA 1KC8C 1UGPB 2PQWA 4EMKA 1WJSA 3CCJT 2V8KA 4JS4A 3X25B 4M75D 1KHIA 2K5IA 4M78B 2L8DA 2RHYA 2QQSA 3JCMc 2CYZB 3OYJA 3CXCA 4C0ZA 2F5TX 1M1KU 3CPWA 4ZGEB 1D3BA 4P5NA 2MAMA 1W2BA 1YIJT 2XK0A 2QTXA 3VYHB 3DB3A 2E1HA 1Q7YC 2F69A 1M90C 2P0KA 3UPUA 4L59A 2CKKA 2RK1A 3OS5A 2E41A 5LJ5h 3JCMh 3S3MA 4OP0A 3L2ZA 1NPRA 4MMLA 3NTHA 2LT4A 1YHQT 4F7UE 3HRSA 2DXBA 2JZ2A 2DVEA 3QG1A 5GAN5 1VQ7T 1QVFS 4MDWA 2OTJA 4C5GA 2QEXT 1YI2T 2E5QA 2HNIA 4J6YA 3OYYA 2RJEA 4C8QG 4JLGA 1G5VA 4C8QB 5FRNA 4M7DF 3HRTA 2P4TA 5DLOA 4XAXB 2XIDA 2VGMA 3JCMg 4KUIA 1YJNT 4HT9A 2X4YA 3UT1A 4EMGA 3MP1A 2DXCA 4XTZA 1Q81U 2ZGWA 3JCMV 1VQNA 1IREB 4C8QC 4NOYA 3X24B 5I2MA 2LT1A 2JN0A 1YJ9A 5A0LA 3MO8A 4HCZA 4X34A 1M8VA 3FDRA 5LJ3e 5GAN2 2RJCA 4C0GA 2QQAA 2DD5A 4RCBA 4F7UB 3CCEA 2VYTA 1ZBXA 5AYFA 2GFUA 2D0QB 2PU9B 2XI9A 3QYGB 4MMKA 5GAN4 4MDXA 1BYMA 2M0OA 3E9FA 4M75C 1MHNA 4M77A 3A8GB 2PVDB 3DLMA 3E19A 3PGGA 4NL2A 5HK0A 3A8LB 2E6ZA 3L2WA 4NS5A 2LRQA 3PIPA 2D6FA 3M59A 3UWNA 2XHCA 2B8AA 4XQ3A 3RUXA 5GAN7 2FL7A 4QQ6A 2L3RA 5KE2A 4N0AC 1N27A 1OI1A 2R58A 3BFMA 3L42A 1PSFA 5FU7C 3RKXA 4M7AF 3GNGA 5IN1A 1YIJA 5FLXE 2RH2A 5GAOq 4BY6C 2KVQG 2LCCA 3M56A 5CKFA 3QZ9B 3LLRA 3CC4T 2RI5A 2MWPA 1Y71A 3QPHA 4ZN3A 1ZHIA 4XU2A 4BE1A 4J5YA 4FU6A 1VQKT 2DXUA 1XQHA 3R6OA 3L2QA 1BIAA 3AHUA 1YI2A 1O9SA 1QP2A 1UGRB 5LJ3f 1VIFA 3OYCA 3CBOA 4KULA 3JCMQ 1G3YA 1BIBA 4VUBA 4BY6B 3H6ZA 3L2UA 2XICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4G A;  1WJR A;  3OYH A;  3NTK A;  3OYL A;  4BDZ A;  3E9G A;  3Q1J A;  2G3R A;  3MEA A;  3OYF A;  4GY5 A;  4QQD A;  3O8V A;  2EQJ A;  3LH0 A;  4A4G A;  4N4I A;  4QQG A;  2YRV A;  3ME9 A;  3KUF A;  3MET A;  4II1 A;  2RO0 A;  3QKJ A;  4LD6 A;  2M1H A;  2BIV A;  4A4E A;  4E7J A;  3FLG A;  1WGS A;  2PQW A;  3MP8 A;  1WJS A;  5KCO A;  3OY9 A;  3S3N A;  3OS2 A;  4E7K A;  4QW2 A;  4PL6 A;  2R5A A;  3S6W A;  4IUQ A;  3ZEH A;  3OYJ A;  2L8D A;  2RHY A;  2QQS A;  4UC4 A;  4E7I A;  3OYD A;  2RHU A;  4ZTF A;  3H8Z A;  2GF7 A;  3DB4 A;  4PLL A;  3FC3 A;  3LX7 A;  3LGL A;  2EKO A;  4BE0 A;  2XK0 A;  4IUT A;  3DB3 A;  5D6Y A;  2P0K A;  4L59 A;  2CKK A;  2LVM A;  4B9X A;  4Z02 A;  3S3M A;  1OZ2 A;  3BDL A;  5FRO A;  2JTF A;  1WJQ A;  2QQR A;  3NTH A;  4A4F A;  3MP6 A;  2RHZ A;  5KH6 A;  2EQK A;  2JZ2 A;  2HQX A;  2EQM A;  5D6X A;  4FL6 A;  4C5G A;  4B9W A;  4IUU A;  1OZ3 A;  3LYI A;  4N4H A;  3OA6 A;  2WAC A;  3OYB A;  2DAQ A;  3OS0 A;  2E5Q A;  3OYI A;  2XDP A;  3FEO A;  2RJE A;  4BE2 A;  2K3X A;  4PLI A;  2D9T A;  4IKF A;  1G5V A;  5FRN A;  3OYG A;  5KE3 A;  3L2V A;  2IG0 A;  4C5H A;  4C5I A;  4A4H A;  2MWO A;  3OB9 A;  4IUP A;  2X4Y A;  3PNW C;  3UT1 A;  2NLU A;  3MP1 A;  4BAC A;  2EQU A;  4RG2 A;  3OYN A;  2X35 A;  3MEW A;  2X4W A;  3OMC A;  3OS1 A;  3QBY A;  5CIU A;  4EDU A;  2HQE A;  3OYA A;  3PFS A;  3MO8 A;  4HCZ A;  4X34 A;  2LTO A;  3FDR A;  3SD4 A;  3GOX A;  2RJC A;  5D6W A;  2BUD A;  2RI3 A;  3NTI A;  4C5E A;  3C4S A;  2VYT A;  2O4X A;  2RHI A;  4QVZ A;  2F5K A;  2GFU A;  3PMT A;  4ZTJ A;  1KHC A;  3OMG A;  5IAY A;  2M0O A;  3E9F A;  2M16 A;  2EFI A;  1MHN A;  2DIQ A;  2FHD A;  3CEY A;  3DLM A;  3QJ6 A;  3L2W A;  3P8H A;  4Q5W A;  2R57 A;  4NS5 A;  2RI2 A;  2LRQ A;  4BD3 A;  3P8D A;  2GFA A;  2DIG A;  3UWN A;  3M9Q A;  1OYX A;  5J26 A;  2B8A A;  2RJD A;  3F70 A;  4IUR A;  5J39 A;  4QQ6 A;  3S3O A;  2L3R A;  5KE2 A;  1N27 A;  1OI1 A;  2R58 A;  3L42 A;  2RHX A;  5M9O A;  5IN1 A;  4E7L A;  3PMI A;  2R5M A;  2K3Y A;  4CRI A;  3OYE A;  2LCC A;  5FRM A;  5C0M A;  3LLR A;  5KCH A;  3ASK A;  2MWP A;  2RI5 A;  4IUV A;  4OVA A;  4BE1 A;  3LGF A;  3OQ5 A;  3QII A;  4FU6 A;  5C6S A;  2X4X A;  2E6N A;  3L2R A;  4BDY A;  3L2Q A;  3MEU A;  3MEV A;  2RJF A;  4E7H A;  3EAE A;  3OYK A;  1RI0 A;  2O4X B;  2L89 A;  3OYM A;  3OYC A;  2LDM A;  1H3Z A;  1SSF A;  1XNI A;  2BKD N;  3H6Z A;  3L2U A; 
#chains in the Genus database with same CATH topology
 3EG9 B;  4E7Z A;  2EPD A;  4HCC A;  1RAH B;  4MZP A;  3KFV A;  3HL8 A;  1G83 A;  5I21 A;  2EQJ A;  1GXI E;  4AFS C;  5IT9 E;  2RO0 A;  1QVP A;  2EGC A;  2L3Q A;  4RTU A;  1VQ8 Q;  1PM3 A;  4F7U A;  3CC7 T;  3V8K A;  1RAI B;  1RAA B;  3C94 A;  2DEU A;  1X75 C;  1NBE B;  1SHF A;  5CK9 A;  4M4Z A;  3RES A;  1AWX A;  1K0X A;  4JDS A;  5D6Y A;  3JV3 A;  4M75 G;  1M27 C;  2QK0 A;  3CC4 A;  4A4K A;  1B07 A;  5FRO A;  3THK A;  4A4F A;  3FRN A;  2MYS A;  3A1P A;  1GL5 A;  3LYI A;  4RTZ A;  2J05 A;  3OYI A;  2O88 A;  4IKF A;  3SFM A;  3KXT A;  2HD0 A;  4LDX A;  2KYM A;  3X20 B;  3HFO A;  4C5I A;  1ZSZ B;  4M75 E;  1VQM Q;  2ED1 A;  3G71 A;  4RG2 A;  3UA6 A;  1GFD A;  2COZ A;  2RD1 A;  2CUB A;  3OMC A;  2KK4 A;  4QVC A;  3CC7 A;  3I56 T;  2YT6 A;  1AZE A;  1EIF A;  4BI4 A;  1S72 T;  2ESW A;  1VQ9 A;  2K6D A;  2RPN A;  3J7A F;  2RNA A;  3C4S A;  3JRZ A;  3RKW A;  5CAI A;  1KHC A;  4PJO G;  3EHQ A;  2DEQ A;  2KEA A;  3P8H A;  3RDV A;  2R57 A;  2D8J A;  1NZ9 A;  3QXE B;  4DEY A;  5GJV B;  1VOM A;  3F70 A;  1HJD A;  3NGP A;  4IUR A;  2CGH A;  4DQ2 A;  1PD0 A;  1M1F A;  3GBQ A;  3SDZ A;  2JS0 A;  2OI3 A;  1YNZ A;  1K9A A;  4C92 B;  3JB9 G;  3ASK A;  1VQO T;  5GAM d;  1IHW A;  4OGC A;  2DX1 A;  2KGT A;  2JT4 A;  3EGU A;  1BI2 A;  1KQS P;  1N8R C;  1XTD A;  4HA8 A;  4OML A;  4E2F B;  1JJ2 A;  2DTO A;  2AZV A;  4N4G A;  1UB4 A;  1Q7Y U;  1X2Q A;  3E9G A;  1OUL A;  3OW2 A;  1VQ8 T;  4DBH A;  2AIR B;  3OSV A;  3CC7 Q;  1SRM A;  3TEE A;  3JCM P;  1D09 B;  3OY9 A;  1WNL A;  4QW2 A;  2XD0 A;  4C8Q F;  4M7D B;  3SWN A;  1AEY A;  3BW1 A;  1WHJ A;  1NPP A;  1ARK A;  3M54 A;  5HK3 A;  1C1A A;  4J9I A;  1GFC A;  2YXY A;  4OB2 B;  4OF1 A;  4HVV A;  4M75 A;  5GMK l;  2I2L A;  4LUD A;  4C92 D;  5A0D A;  2EQK A;  3I55 A;  2V26 A;  4LXC A;  4FL6 A;  3NHN A;  1M2V B;  5CCA A;  1VYU A;  5GAM g;  2DXT A;  3CD6 T;  4ELY C;  2BZ8 A;  3VV0 A;  2CS7 A;  4JS5 A;  2PVO B;  4M7A C;  2COY A;  5CIU A;  3QBY A;  2RF0 A;  2VGN A;  4M77 B;  3V7C A;  1M90 U;  4M75 F;  1P92 A;  2O9S A;  2RI3 A;  1LJO A;  3NTI A;  3MJX A;  5D7U A;  1JQQ A;  1TSF A;  3PMT A;  4M78 A;  1Q81 R;  1NJI U;  1B3Q A;  4Q5W A;  2OTL Q;  1WXT A;  4QVD A;  1T0J A;  1I0C A;  3SWN C;  1QP3 A;  4PJO D;  2RQV A;  2DPP B;  2DZC A;  2R5M A;  2HCK A;  2X3X D;  1VQ7 Q;  1OX9 A;  2LQK A;  1M1G A;  5KCH A;  2QEX Q;  1ZUK A;  2ZZD A;  1JEG A;  2LNH B;  3MEV A;  4E7H A;  1IRX A;  1SRL A;  2HDA A;  4MZM A;  4X9C A;  3OYM A;  4GLK A;  3V7S A;  3M5A A;  3G1J A;  3Q1J A;  1U3O A;  3CME A;  2RA2 A;  4J9E A;  3PIO A;  2VV5 A;  1U1T A;  5KYU A;  4FM4 B;  4Y28 E;  1D0X A;  2EJG A;  1N8R R;  4M7A A;  2OAU A;  1RAB B;  2OAW A;  4HT8 A;  1G3W A;  1TS9 A;  1K73 U;  1WIE A;  4EMK B;  4A53 A;  4M78 C;  3LWI A;  4J8O A;  1OZ2 A;  2PNI A;  1YIJ Q;  2KAF A;  3CPW P;  2RHZ A;  1VQN T;  5CKH A;  4L6V 5;  3A8O B;  1I8F A;  2NUP B;  3H0H A;  1K8A R;  4B9W A;  5KYW A;  3OS0 A;  1I5O B;  2D9T A;  3D7S B;  1SKU B;  1RI9 A;  1Y96 A;  4X9D A;  4A4H A;  5KYN A;  5GAM h;  1U8R A;  4BAC A;  1Q86 C;  3M0R A;  1QCO A;  3M4Y A;  2GCX A;  3CCQ A;  2VAS A;  1LCK A;  4M7D E;  3TCJ A;  3EFS A;  1ZBJ A;  3G4S Q;  4RCC A;  4J7F A;  5FW9 A;  4F7U G;  3OBY A;  3CCE Q;  1FX7 A;  3QJ6 A;  5ECA A;  2EJ9 A;  2JMA A;  1FXX A;  4FSX A;  1D0Z A;  1PD1 A;  1AWJ A;  1U06 A;  2DKG A;  2GTO A;  2K9G A;  2RHX A;  4E7L A;  3PMI A;  1T3S A;  5GAN d;  2CZ1 B;  5FRM A;  3UAT A;  1MUZ A;  4OVA A;  2RM4 A;  2AHJ B;  2NYS A;  1TH7 A;  4LDW A;  1VQ5 T;  4Y91 A;  4PFO A;  3EG1 A;  2O4X B;  5GAN f;  3M53 A;  2PZ1 A;  1KD1 R;  2LDM A;  2BKD N;  3JCM J;  3JAM E;  2COW A;  2HEQ A;  3CMA A;  2OTL A;  1YJ9 T;  2QYZ A;  3TRE A;  2QAS A;  3M0U A;  5LJ5 e;  1D1B A;  2GBQ A;  1K1Z A;  2VB6 A;  4YTL A;  4F14 A;  1EZZ B;  3RR6 A;  1ZUU A;  3CCR A;  3FLG A;  3OYJ A;  3CXC A;  2F5T X;  3O5Z A;  4F16 A;  1W2B A;  1YIJ T;  2XK0 A;  1M90 C;  1QWE A;  3VYH B;  4PFZ A;  2E41 A;  1JO8 A;  2L2P A;  2QGG A;  3MPU B;  3L2Z A;  3G6E Q;  2O2O A;  3NTH A;  1VQP Q;  1RAF B;  3QG1 A;  2OTJ A;  1UHF A;  2QEX T;  4Z88 A;  2BE7 D;  1YI2 T;  4J6Y A;  1G5V A;  4RTX A;  2XIC A;  2H8H A;  4FCY A;  1RAD B;  5DLO A;  2LQW A;  2VGM A;  3PVQ A;  1Q81 U;  3JCM V;  2LZ6 B;  2J6K A;  2KYB A;  2CP3 A;  4AFQ C;  4X1V A;  1Y0M A;  1K76 A;  2QGF B;  3FDR A;  4RUG A;  2D0N A;  2W10 A;  2QQA A;  2DYI A;  4F7U B;  2VYT A;  2EKH A;  5AYF A;  2PU9 B;  4MMK A;  1BYM A;  3QYG B;  3I56 Q;  3E9F A;  4M75 C;  4M77 A;  1S72 Q;  3E19 A;  3L2W A;  3A8L B;  2AK5 A;  1T0H A;  2XHC A;  4XQ3 A;  5GAN 7;  3SHW A;  3ULR B;  4QQ6 A;  4N0A C;  2R58 A;  1J3T A;  4M7A F;  3CCL Q;  2KR3 A;  3FJ5 A;  3QZ9 B;  2MOX A;  3UF4 A;  1Q82 R;  2CP6 A;  4ZN3 A;  2A36 A;  4J5Y A;  4FU6 A;  2DXU A;  3ZL7 C;  2DA9 A;  3AHU A;  5LJ3 f;  1G3Y A;  3RMS A;  4VUB A;  1ABO A;  2KRM A;  4OMF B;  2DF6 A;  3OYL A;  3A5Z B;  1UGV A;  2AKK A;  2JVV A;  2F2V A;  4PK4 A;  3QO3 A;  1BKB A;  1B7T A;  1VQ9 T;  2CP5 A;  2JTE A;  1X01 A;  1OPL A;  2L3S A;  3DKM A;  3CCM A;  3SEM A;  4L5G A;  2QXF A;  2YHT A;  3L1A A;  3S3N A;  3MP8 A;  2KDS A;  2LJ0 A;  3EGX A;  2E10 A;  4PJO A;  4IUQ A;  1QMC A;  4UC4 A;  1TU0 B;  2EGE A;  5KYU B;  2LQ8 A;  1Q7Y R;  1M2O A;  2HKN A;  1HSQ A;  4HCB A;  1VQM A;  1F1B B;  1G2B A;  4AG2 C;  2V1Q A;  3IQL A;  3CCL A;  2QI2 A;  1M3C A;  4JPB W;  1Q86 U;  3JCM e;  4KH1 B;  2HBP A;  3NPF A;  1NJI C;  3CBM A;  2DAQ A;  3FEO A;  1S72 A;  2FZG B;  2K4Y A;  3L2V A;  3M58 A;  2E4H A;  4E6R A;  4XTW A;  4JRQ A;  5KYW B;  2EYY A;  3P8B B;  2Y4Y A;  2CP2 A;  2X4W A;  2OTJ T;  1U1S A;  5GAN h;  4AG1 C;  2LTO A;  1K8A C;  3A8H B;  5D6W A;  2AT1 B;  2F5K A;  2LNV A;  1SG5 A;  4M77 G;  3QJY A;  1I1J A;  4M7A E;  1UEC A;  4FIB A;  3CCL T;  2LJ1 A;  3RKY A;  2O31 A;  4R56 A;  2DJZ A;  4HVW A;  4M7D G;  4M78 D;  3CCV A;  1TXQ A;  4D8D A;  4ANJ A;  1JU5 C;  2CT4 A;  1YBY A;  4R0K A;  1AHJ B;  3CD6 A;  1VIE A;  5LJ3 g;  1KK7 A;  3M57 A;  1UUE A;  3TSZ A;  2QDY B;  3QDF A;  1BI1 A;  2KMT A;  2IVW A;  1QLY A;  5GAM f;  2E64 A;  3PT9 A;  1AOJ A;  3CMA Q;  2YUQ A;  2E5K A;  2GTJ A;  3EGD A;  4A4G A;  1VQL Q;  4QQG A;  2PVG B;  4A4E A;  4E7J A;  2KE9 A;  2HZY A;  2V1R A;  3CCR Q;  3MCA B;  3OS2 A;  4E7K A;  1YIT A;  4ZGJ B;  4XU0 A;  2VXE A;  4ZTF A;  1N9S A;  2K5L A;  2ROL A;  1NEB A;  1X2K A;  4PLL A;  1BCO A;  4FT2 A;  1YCS B;  2ED0 A;  2EW3 A;  4AMC A;  3M0P A;  4WTO B;  4PJO B;  2YUP A;  3CCJ Q;  4JZ4 A;  4RG8 A;  1YJN Q;  3EG3 A;  1QW1 A;  2VWF A;  4ME7 A;  1H64 1;  2LX7 A;  2WAC A;  1B34 B;  2XDP A;  2ZPI B;  4J83 A;  4PLI A;  3SWN B;  4CC4 B;  2K5F A;  3VUB A;  2ZAE A;  4AFZ C;  2FB7 A;  4CC2 A;  4EMK C;  4FSS A;  3CCV Q;  4J6W A;  3VS4 A;  3RIR A;  4RTW A;  2MIO A;  1UFF A;  1VQ8 A;  2M51 A;  3RER A;  1LPL A;  1N9R A;  2RHI A;  4PJM A;  3CXC P;  4FYV B;  2A7Y A;  3CEY A;  3QSU A;  1KQS S;  4WCI A;  5GAN j;  5A0G A;  3CME Q;  5A2Q E;  2YLC A;  3OYE A;  1LOJ A;  4C8Q E;  2DER A;  1VQ6 A;  1JBM A;  4LDV A;  2QQ9 A;  3QII A;  3OQ5 A;  3MEU A;  1YP5 A;  2YSQ A;  3EAE A;  1TWB A;  3OYK A;  3UA7 A;  1V76 A;  3JB9 J;  1QVG S;  2MI6 A;  3CC2 Q;  1MGQ A;  3NTK A;  1M3B A;  4XTV A;  5GAO n;  4EMH A;  1OX8 A;  3CCS Q;  1Y7X A;  4XU1 A;  5HKC A;  3JB9 I;  2RQT A;  1WQW A;  3H0F A;  3HFN A;  3JCM W;  1YJW A;  5KCO A;  1S1N A;  5J3B A;  2QA4 A;  1WI7 A;  3DB4 A;  4BE0 A;  3LGL A;  1AWO A;  1X27 A;  3JB9 H;  2F2X A;  3VS5 A;  1JB0 E;  1ZA1 B;  2LVM A;  2YDL A;  1BB9 A;  4Z02 A;  4B9X A;  2JTF A;  2FPD A;  1AVZ C;  2K7A A;  1W2B S;  2KXC A;  3OBW A;  1ZA2 B;  1W2B P;  1NEG A;  1M1K R;  3EFO A;  2EQM A;  1W4S A;  2GQI A;  3CXC S;  1C6V X;  1KSW A;  4M78 F;  1K8A U;  4OB1 B;  2DBM A;  1HK9 A;  3JCM f;  3QHS A;  2LP5 A;  3PNW C;  2DL5 A;  3V7R A;  2EQU A;  2CSQ A;  1D0Y A;  3CPF A;  2E65 A;  1R0B G;  1W6X A;  3CCJ A;  1QVF A;  3SD4 A;  5CQX A;  2BUD A;  2L5Q A;  2IIM A;  3HPW A;  2JS2 A;  4FYY B;  1JRI A;  1MNE A;  4C5E A;  3JCM X;  2DMO A;  4ZTJ A;  5I2S A;  3OMG A;  1SHG A;  1WQ7 A;  1N8R U;  2KQW A;  1VQO Q;  4BD3 A;  2HSP A;  2DIG A;  1OV3 A;  1WFW A;  3VYG A;  5M9O A;  5KYY B;  1GRI A;  4TVR A;  2DBK A;  2LCS A;  5L8R E;  2EYW A;  5C6S A;  1PHT A;  3HHT B;  3HSB A;  1AT1 B;  2CZ0 B;  2JUF A;  2KT1 A;  2KY9 A;  2L89 A;  4PJO F;  2O01 E;  1D3B B;  4KUD K;  1XNI A;  3FB9 A;  3TSW A;  4FYW B;  1AWW A;  2DZ9 A;  1VQP T;  1MMG A;  1FWZ A;  4J9F A;  3I5S A;  2C0I A;  3VS2 A;  3AT1 B;  2RK2 A;  2YRV A;  3MET A;  5GAM e;  2BZY A;  8AT1 B;  1M2V A;  1WJS A;  2YRC A;  1NJI R;  2V8K A;  3X25 B;  2F1L A;  2KBT A;  3JCM c;  4HXJ A;  3TQ7 P;  4C0Z A;  1M90 R;  3M0Q A;  3A98 A;  2FEI A;  2QTX A;  2E1H A;  4L59 A;  2CKK A;  2DNU A;  2VKN A;  3JCM h;  1NYG A;  4OMQ A;  4MML A;  1QVF P;  2LT4 A;  4CC7 A;  1YHQ T;  4F7U E;  3HRS A;  2DXB A;  2JZ2 A;  2DVE A;  1VQ7 T;  2CP7 A;  5GAN 5;  1FMK A;  1OU8 A;  1CSK A;  2RJE A;  1Z9Q A;  4C8Q G;  1QCN A;  4C8Q B;  4M7D F;  4HT9 A;  5I22 A;  2X4Y A;  3UT1 A;  4EMG A;  3MP1 A;  2KRO A;  4XTZ A;  1BU1 A;  1IRE B;  4C8Q C;  3CC4 Q;  2LT1 A;  1M8V A;  1ZSZ A;  5GAN 2;  2RJC A;  2KRS A;  1MMA A;  1ZBX A;  4MDX A;  1NLO C;  4NL2 A;  2J6F A;  2D6F A;  3M59 A;  2PTK A;  3UWN A;  2B8A A;  2FL7 A;  2L3R A;  2DYB A;  3RKX A;  1N27 A;  1WHK A;  5IN1 A;  2RH2 A;  3CCQ Q;  2KVQ G;  5CKF A;  2RI5 A;  1M3A A;  2NUT A;  1Y71 A;  2P84 A;  1ZHI A;  3QPH A;  3QWX X;  4PJJ A;  1O9S A;  1VIF A;  3OYC A;  3JCM Q;  1MMN A;  4BY6 B;  3H6Z A;  3L2U A;  2SEM A;  1V29 B;  3OYH A;  1PG5 B;  2G3R A;  3C95 A;  3RMQ A;  1WLP B;  2BE9 B;  4II1 A;  2HKQ B;  4LD6 A;  3VRY A;  9ATC B;  4RMO A;  3VUZ A;  4PL6 A;  2R5A A;  1VQL T;  2CH4 A;  2M9U A;  3OYD A;  4JRP A;  1ZSZ C;  4E7S A;  2B86 A;  4IUT A;  2GGR A;  3WXM B;  4M7D A;  5GAM j;  2EYX A;  4KBM B;  4V2S A;  2QG9 B;  4LDY A;  5LJ5 g;  5GAN g;  2FG0 A;  5D6X A;  2CDT A;  4IUU A;  3JCM d;  2BTT A;  4F7U F;  1HYO A;  4F17 A;  5GAN 8;  2JM8 A;  5GMK m;  4PNO A;  2MWO A;  4EPC A;  1RLQ C;  5CKD A;  3ZBD A;  1VQ7 A;  1YJ9 Q;  5FWB A;  2EVR A;  1UDL A;  3ER0 A;  4ZGD B;  4QT7 A;  1EX4 A;  3CCV T;  2IPO B;  1R77 A;  2C0O A;  5IH2 A;  1YFN A;  3HRU A;  4QVZ A;  3CCM T;  1LNX A;  4GBQ A;  2GNC A;  2Y4X A;  3URG A;  2LX9 A;  2KSS A;  1Q81 C;  2HL3 A;  3M4G A;  1D1C A;  1LVK A;  2K3Y A;  4CRI A;  3CCE T;  2FO0 A;  4F04 B;  3G6E T;  4IUV A;  3CME T;  3LGF A;  1YHQ Q;  4BDY A;  2ROT A;  2RN8 A;  2VXF A;  3WVD B;  2JNG A;  4K11 A;  1H3Z A;  5IAY A;  2CSI A;  4ZN1 A;  1CKA A;  1Q95 G;  2NUT B;  5GAO p;  1WHL A;  2E70 A;  1JXO A;  1KQ1 A;  4M7A D;  1G3S A;  2HBW A;  3VKI A;  2RQR A;  1Y57 A;  3VJP A;  2OX7 A;  3FIF A;  2FPF A;  2YUO A;  3ME9 A;  3FJP A;  1NLP C;  3I9Q A;  1WGS A;  3CCS T;  4JZ3 A;  3CD6 Q;  1GBQ A;  4LN2 A;  2GQV A;  3CCU T;  2GF7 A;  1PKT A;  1WDX A;  2J7I A;  4A63 B;  4LD9 K;  1IB8 A;  2ZPB B;  1VQL A;  2XKO C;  3CCQ T;  2JTM A;  4B6M A;  2LQN A;  4M77 E;  2LCL A;  2A08 A;  4BE2 A;  5I11 A;  1TOV A;  2DO3 A;  1PC0 A;  4C5H A;  1WHG A;  3RNJ A;  3INZ A;  1KD1 U;  3GIB A;  2DTI A;  3JSC A;  3MEW A;  1I4K 1;  2DTH A;  3NFC A;  3PFS A;  2X4J A;  2XDB A;  3GOX A;  1IO6 A;  2KT8 A;  4XTX A;  1ABQ A;  5LJ3 j;  4DOV A;  1QKW A;  2KRN A;  3P8D A;  2MCN A;  2L0A A;  4PJO C;  4WF2 A;  1VQ4 A;  3G7Z A;  4KGV B;  1M1K C;  4BI3 A;  4J7I A;  1BCM A;  2EQI A;  5LJ3 h;  5C0M A;  4XTU A;  3L2R A;  2X4X A;  3EGX B;  4OMN A;  3QUI A;  3LW5 E;  4J9D A;  2ATC B;  4C8Q A;  1SSF A;  3H8Z A;  2A3L A;  2DL4 A;  5IXF A;  2MF2 A;  4HVU A;  4FT4 A;  4BDZ A;  2MMP A;  5GMK j;  4OMM A;  1G8X A;  1VQ6 T;  5GAN e;  1BI0 A;  4XTY A;  2OTJ Q;  2EIF A;  4CC3 A;  3KUF A;  4LDU A;  3I55 Q;  1M5Q 1;  2BIV A;  3CCU Q;  1QQJ A;  2CT3 A;  2LJ3 A;  1X6O A;  1KIK A;  5GMK i;  5LJ5 j;  3BDU A;  1JXM A;  1NM7 A;  4A54 A;  1AD5 A;  3VS1 A;  2WSC E;  2EKO A;  1PWT A;  3VU3 C;  2ABL A;  3EG9 A;  2Y90 A;  2NUP A;  2E3I A;  5LJ5 d;  1YJW T;  4KT0 E;  5KYY A;  3CCS A;  4NL3 A;  2EAY A;  2QA4 T;  1Y96 B;  1X43 A;  2HQX A;  5EG2 A;  4N4H A;  4OMP A;  1Y07 A;  1AZG B;  3OYG A;  4DBF A;  5KE3 A;  2ENM A;  5GAO l;  2XU8 A;  1SEM A;  4IUP A;  1RUW A;  1SF9 A;  1IHV A;  2K2V A;  3C12 A;  2X3W D;  1OU9 A;  2EYZ A;  4Y92 A;  2FVU A;  1ZX6 A;  5GAO m;  3CMA T;  1U5S A;  1N5Z A;  2PUO B;  1GCQ A;  4JLI A;  1H3H A;  1Z9Z A;  4C0D C;  2DLP A;  3A8M B;  3CCR T;  5GAN 3;  1PNJ A;  3HKS A;  1JJ2 S;  2RQU A;  1MND A;  3S3O A;  4IIM A;  3EGD B;  4DEX A;  4E47 A;  4C0D B;  2HQH A;  2VUB A;  2G6F X;  4DOW A;  1UJ0 A;  2CZ7 B;  2F2W A;  4KRT A;  1VA7 A;  2RJF A;  3C0C A;  2J6O A;  4OB3 B;  2MPX C;  2K57 A;  1UG1 A;  5GJW B;  3H41 A;  2LMJ A;  4ESR A;  3UDC A;  2HSE B;  4CI0 C;  1WJR A;  4MZT A;  2EYQ A;  4M7A B;  1WXB A;  5CKB A;  1I07 A;  2DVJ A;  2DL3 A;  1QCF A;  3LH0 A;  5IHN A;  1KQS A;  4M77 C;  1K9M U;  1H92 A;  1KC8 C;  1UGP B;  4EMK A;  3CCJ T;  4JS4 A;  1X6G A;  4M75 D;  3VS0 A;  4Z89 A;  1W70 A;  2K5I A;  2QQS A;  2X9H A;  3E2U A;  1YIT Q;  1GCQ C;  1M1K U;  3CPW A;  2K3B A;  1D3B A;  4P5N A;  3UPU A;  2RK1 A;  3S3M A;  3REB B;  4OP0 A;  8ATC B;  1FMW A;  1PKS A;  4C5G A;  7AT1 B;  2M0Y A;  4LNP A;  2E5Q A;  2HNI A;  4JLG A;  4GLM A;  2CRE A;  5FRN A;  3HRT A;  1X6B A;  2P4T A;  3JCM g;  4KUI A;  2EBP A;  2DXC A;  1UTI A;  1EFN A;  1VQN A;  1MMD A;  3MKD A;  5I2M A;  2DE0 X;  1OOT A;  2JN0 A;  4HCZ A;  2DFU A;  2FZK B;  1SPK A;  5LJ3 e;  4C0G A;  1RLP C;  2DD5 A;  4RCB A;  1YWO A;  3H0I A;  2GFU A;  2W0Z A;  2XI9 A;  2CP0 A;  3REA B;  1MHN A;  2DIL A;  5HK0 A;  2E6Z A;  1XJW B;  4NS5 A;  2LRQ A;  4KH0 B;  1NG2 A;  5KE2 A;  2QAZ A;  5FU7 C;  3BFM A;  1PSF A;  3VS6 A;  1UHC A;  5GAO q;  1YJW Q;  2J06 A;  3M56 A;  3LLR A;  2MWP A;  4XU2 A;  1VQK T;  1XQH A;  2FRY A;  1BIA A;  1FMV A;  1TTH B;  3CBO A;  4KUL A;  2I0N A;  1BIB A;  1WX6 A;  3BY7 A;  4HKE A;  3M0T A;  3I35 A;  1PSE A;  5FU6 B;  4FW2 A;  3MEA A;  4XU3 A;  1VQ5 A;  4QQD A;  4ATO A;  5GAN 6;  4O5V A;  3VS7 A;  1YN8 A;  4J9H A;  1TUC A;  2JXB A;  3OW2 S;  2QTV A;  1PRL C;  2OTL T;  1BI3 A;  1HXD A;  1PCX A;  4C92 G;  3FC3 A;  3LX7 A;  1Q82 U;  2KNB B;  2P4R A;  1K4U S;  1RAE B;  2XDD A;  1UJY A;  4OMO A;  1O75 A;  1M9S A;  1VQK A;  3BDL A;  5IXB A;  4AFU C;  1TG0 A;  3OYB A;  1ZSG A;  2XG8 D;  1IZ6 A;  4C92 E;  1UE9 A;  4R55 A;  4J6X A;  3G4S T;  1CKB A;  1ZQ1 A;  3J80 E;  3QWY A;  4XK8 E;  3OB9 A;  1VQN Q;  5DLQ E;  2QDL A;  1E7O A;  1M4Z A;  3V8J A;  3OYN A;  4C8Q D;  2DD4 A;  3J81 E;  5FU6 C;  3DLL A;  5IHK A;  2HQE A;  3OYA A;  2QEX A;  2L3P A;  4HCK A;  1N6A A;  1WPY A;  4M77 D;  3CCU A;  2D8H A;  1I81 A;  1QVG P;  1R8O B;  5L23 A;  4QKU A;  4FYX B;  3WVE B;  4DBQ A;  3QYH B;  3G71 T;  1VQO A;  5DY9 A;  4M7D D;  2JOY A;  4M78 G;  2RI2 A;  1YIT T;  2GFA A;  3JB9 D;  3GF5 A;  1ZLM A;  1OYX A;  1OQK A;  5J26 A;  2HAX A;  4PKC C;  1KJW A;  1W1F A;  5CVI A;  3ZFJ A;  2FYK A;  5CQY A;  1DJ7 B;  4JJD A;  1IGU A;  4RTV A;  3CPW S;  2JM9 A;  1K0S A;  1OPK A;  3G4S A;  1UGQ B;  2AZS A;  3SB2 A;  1K73 C;  3U23 A;  1KFZ A;  2DJQ A;  3G6E A;  3QZ5 B;  1VQ4 Q;  2E3H A;  2A37 A;  4JRK A;  1E6H A;  2H3J A;  1M30 A;  1RL2 A;  3GPL A;  3QKJ A;  2M1H A;  2ZPH B;  2C06 A;  4M7A G;  3S6W A;  3QDR B;  3I56 A;  1PRM C;  2EWN A;  3I55 T;  1FYN A;  1WZO A;  2RHU A;  1UEB A;  1Q86 R;  3CC2 A;  3EH1 A;  1YI2 Q;  2P0Q A;  1YCY A;  1VYT A;  4DBR A;  1KC8 U;  2QQB A;  1KQ2 A;  3JCM b;  4J9B A;  1KD1 C;  3MP6 A;  3I5R A;  2MK5 A;  3OSS C;  3TU4 K;  1HD3 A;  5GMK e;  5DM7 R;  3OA6 A;  1VQM T;  1M8M A;  2K3X A;  4RKU E;  2QA4 Q;  5GMK h;  1IGQ A;  2JMC A;  3H9N A;  2P0P A;  2XMF A;  1VUB A;  4JJN K;  1GBR A;  3N5B B;  1OEB A;  1B34 A;  2KXD A;  3OS1 A;  4PJL A;  4D6W A;  4EDU A;  1RAC B;  2HL5 C;  4M78 E;  1UGS B;  3X28 B;  4EIK A;  2PUK B;  1G3T A;  3LWH A;  2EGA A;  2E12 A;  3CC2 T;  3CBP A;  2M16 A;  2DIQ A;  4BUG A;  1K9M R;  2RB6 A;  2SRC A;  5KYX A;  5J39 A;  4JUV A;  2V8I A;  4M75 B;  1SSH A;  4LE9 A;  2FZC B;  4ELZ C;  1K73 R;  2ECZ A;  1WXU A;  4M7D C;  2ZCF B;  1WHH A;  2OJ2 A;  1VQ9 Q;  1WYX A;  3GNF B;  5HCK A;  1RI0 A;  2YLB A;  2VC8 A;  4C92 F;  2D1X A;  1VYV A;  4KGX B;  1VQ4 T;  1QWF A;  4RTT A;  1Q82 C;  2BZX A;  5EC7 A;  1QKX A;  3M0S A;  3OYF A;  1T3L A;  4M77 F;  4N4I A;  3VRZ A;  2FPE A;  2DL8 A;  2DET A;  3X26 B;  3MHX A;  2DK3 A;  1R0C B;  4C92 C;  4OB0 B;  1ZUY A;  1YHQ A;  3ZEH A;  1IXD A;  4E7I A;  5CKE A;  4N0A A;  3JB9 F;  4J9C A;  3G71 Q;  3PE0 A;  3PTA A;  3EG0 A;  1TUD A;  2HMA A;  2K79 A;  4PFP A;  2YWW A;  3EFO B;  1GCP A;  4BI8 B;  5FU7 B;  1YJN A;  6AT1 B;  2NUZ A;  4KGZ B;  2RMO A;  1WJQ A;  2QQR A;  4JJC A;  3EFR A;  3V8L A;  5KH6 A;  2DRM A;  3EH2 A;  5HY6 A;  4JJB A;  1K9M C;  2A28 A;  4AT1 B;  1OZ3 A;  2CZ6 B;  5CO7 A;  3KBG A;  4PJO E;  2IG0 A;  1JJ2 P;  5LJ5 f;  3T9N A;  5CR2 A;  1QVG A;  2NLU A;  1RAG B;  2DM1 A;  1A0N B;  1BK2 A;  2X35 A;  3RBB B;  1VQP A;  4BB7 A;  1MV0 B;  3HP9 A;  5LL6 S;  2RQW A;  3E1S A;  4LUE A;  2Z0W A;  4RTY A;  2O4X A;  1BBZ A;  5GAO r;  2EFI A;  2FHD A;  4D8K A;  3M55 A;  4C0F A;  1KG1 A;  4C92 A;  3M9Q A;  1NYF A;  1MV3 A;  2RJD A;  3GP8 A;  3GLX A;  2LC4 A;  3CCM Q;  5LJ3 d;  1XOV A;  1D1A A;  1H8K A;  1C0M A;  2V8J A;  5KYX B;  1NE8 A;  2ZPG B;  2E6N A;  2H3E B;  2ZPF B;  2WSF E;  1WHM A;  2ZPE B;  4IIO A;  1I5L A;  2WSE E;  4OGE A;  4O6J A;  3VS3 A;  4GY5 A;  2A0F B;  4JRI A;  2EJF A;  3O8V A;  2KI7 A;  4DA4 A;  2PQW A;  2JJ9 A;  1KHI A;  1V1C A;  1YWP A;  1KC8 R;  4M78 B;  2L8D A;  2RHY A;  1E6G A;  2CYZ B;  1X69 A;  2M02 A;  1WA7 A;  2DRK A;  4ZGE B;  2DL7 A;  2MAM A;  1Q7Y C;  3DB3 A;  2F69 A;  2P0K A;  1TUG B;  5AT1 B;  3OS5 A;  2YRD A;  5LJ5 h;  5FWC A;  1NPR A;  1QVF S;  4MDW A;  4ORZ A;  2YUN A;  4FW1 A;  3OYY A;  1YJN T;  4XAX B;  2XID A;  2ZGW A;  4NOY A;  3X24 B;  3HTR A;  3LH5 A;  1VQK Q;  4PJN A;  1YJ9 A;  5A0L A;  3MO8 A;  4X34 A;  2O9V A;  2VVK A;  5IHI A;  3CCE A;  2D0Q B;  5GAN 4;  2CH4 W;  2M0O A;  3A8G B;  2PVD B;  3DLM A;  3PGG A;  3EG2 A;  3PIP A;  2CUD A;  3RUX A;  3NMZ C;  1OI1 A;  3BE3 A;  3L42 A;  4ZNX A;  1VQ5 Q;  3GNG A;  1YIJ A;  5FLX E;  2JW4 A;  4BY6 C;  2LCC A;  1ACM B;  2K2M A;  3EHR A;  3CC4 T;  3PVL A;  4Z8A A;  4BE1 A;  4J9G A;  3R6N A;  3R6O A;  3L2Q A;  1VQ6 Q;  2X51 A;  3OW2 P;  1QP2 A;  1UGR B;  2FRW A;  2C0T A;  3TVT A;  2NWM A;  2AKL A;  1YI2 A;  3CQT A; 
#chains in the Genus database with same CATH homology
 3BY7 A;  1V29 B;  4OMF B;  4HKE A;  3OYH A;  3OYL A;  4HCC A;  3A5Z B;  5FU6 B;  1PSE A;  2JVV A;  4MZP A;  2G3R A;  3QO3 A;  3MEA A;  1BKB A;  3HL8 A;  1VQ9 T;  4XU3 A;  3C95 A;  5I21 A;  1VQ5 A;  1X01 A;  4QQD A;  2EQJ A;  3RMQ A;  1GXI E;  4ATO A;  5GAN 6;  3DKM A;  5IT9 E;  4II1 A;  4LD6 A;  2RO0 A;  1QVP A;  4O5V A;  3CCM A;  4L5G A;  4RMO A;  2QXF A;  2YHT A;  3L1A A;  3S3N A;  3MP8 A;  2KDS A;  4F7U A;  3CC7 T;  3V8K A;  3VUZ A;  2E10 A;  4PL6 A;  2R5A A;  3OW2 S;  4IUQ A;  1VQL T;  4PJO A;  4UC4 A;  2OTL T;  3C94 A;  2M9U A;  3OYD A;  4JRP A;  2LQ8 A;  1BI3 A;  1HXD A;  1X75 C;  4C92 G;  5CK9 A;  4HCB A;  3FC3 A;  3RES A;  3LX7 A;  1VQM A;  1Q82 U;  4IUT A;  4JDS A;  5D6Y A;  2XDD A;  4M75 G;  3WXM B;  4M7D A;  3CC4 A;  1O75 A;  1M9S A;  5GAM j;  4A4K A;  1VQK A;  3CCL A;  3BDL A;  5FRO A;  2QI2 A;  4KBM B;  4A4F A;  1Q86 U;  4V2S A;  3FRN A;  4LDY A;  5LJ5 g;  3JCM e;  5GAN g;  1YJW T;  5D6X A;  2HBP A;  4IUU A;  3LYI A;  3JCM d;  1NJI C;  4F7U F;  3CBM A;  3OYB A;  2DAQ A;  2XG8 D;  3OYI A;  3FEO A;  4IKF A;  3SFM A;  1S72 A;  1IZ6 A;  5GAN 8;  3KXT A;  4C92 E;  2HD0 A;  4LDX A;  3X20 B;  5GMK m;  4J6X A;  4R55 A;  2K4Y A;  3L2V A;  3M58 A;  3HFO A;  4PNO A;  3G4S T;  1ZQ1 A;  3J80 E;  4XK8 E;  4C5I A;  2MWO A;  3OB9 A;  4M75 E;  4XTW A;  5DLQ E;  4EPC A;  5CKD A;  3G71 A;  4JRQ A;  3ZBD A;  1M4Z A;  4RG2 A;  3RMS A;  3V8J A;  2RD1 A;  3P8B B;  2Y4Y A;  3OYN A;  4C8Q D;  2DD4 A;  2X4W A;  3OMC A;  3J81 E;  1U1S A;  5GAN h;  5FU6 C;  3DLL A;  1VQ7 A;  2KK4 A;  4QVC A;  2HQE A;  3OYA A;  2QEX A;  3CC7 A;  1N6A A;  3ER0 A;  1WPY A;  3I56 T;  2LTO A;  4ZGD B;  4M77 D;  1EIF A;  3A8H B;  4BI4 A;  1S72 T;  1K8A C;  1VQ9 A;  3CCU A;  1I81 A;  5D6W A;  3CCV T;  3J7A F;  1R8O B;  3C4S A;  3HRU A;  3JRZ A;  3WVE B;  4QVZ A;  2F5K A;  3RKW A;  3QYH B;  5CAI A;  3CCM T;  1KHC A;  4PJO G;  3G71 T;  2LNV A;  1LNX A;  5DY9 A;  1VQO A;  4M7D D;  2DEQ A;  2JOY A;  2Y4X A;  4M78 G;  3P8H A;  3URG A;  2R57 A;  4M77 G;  3QJY A;  2RI2 A;  2LX9 A;  1NZ9 A;  3QXE B;  1YIT T;  4M7A E;  2GFA A;  4FIB A;  3GF5 A;  3CCL T;  3JB9 D;  2KSS A;  1OYX A;  5J26 A;  3F70 A;  1Q81 C;  2HAX A;  4IUR A;  4PKC C;  3RKY A;  3M4G A;  2CGH A;  4R56 A;  2DJZ A;  4DQ2 A;  4M7D G;  1M1F A;  4M78 D;  3CCV A;  3SDZ A;  5CVI A;  2K3Y A;  3ZFJ A;  2FYK A;  4CRI A;  3CCE T;  5CQY A;  1DJ7 B;  4C92 B;  3JB9 G;  3ASK A;  3G6E T;  1YBY A;  4IUV A;  3CME T;  3CPW S;  3LGF A;  1VQO T;  1AHJ B;  4BDY A;  3CD6 A;  5GAM d;  1VIE A;  3G4S A;  1UGQ B;  2VXF A;  4OGC A;  5LJ3 g;  3WVD B;  2JNG A;  3M57 A;  2QDY B;  1BI2 A;  1BI1 A;  2KMT A;  1H3Z A;  1N8R C;  1XTD A;  4HA8 A;  5IAY A;  3SB2 A;  4ZN1 A;  1K73 C;  2IVW A;  1JJ2 A;  2DTO A;  4N4G A;  5GAO p;  2E70 A;  5GAM f;  1UB4 A;  1Q7Y U;  2E64 A;  3PT9 A;  1KQ1 A;  3E9G A;  4M7A D;  1G3S A;  3OW2 A;  3G6E A;  3VKI A;  3QZ5 B;  1VQ8 T;  3OSV A;  4JRK A;  3VJP A;  2H3J A;  4A4G A;  3FIF A;  1RL2 A;  4QQG A;  3GPL A;  3ME9 A;  2PVG B;  3FJP A;  3TEE A;  3QKJ A;  3JCM P;  4A4E A;  2M1H A;  4E7J A;  2ZPH B;  1WGS A;  3OY9 A;  3CCS T;  3MCA B;  3OS2 A;  4E7K A;  2C06 A;  4M7A G;  1WNL A;  4QW2 A;  2XD0 A;  3S6W A;  4C8Q F;  3QDR B;  3SWN A;  4ZGJ B;  3I56 A;  1YIT A;  4M7D B;  2EWN A;  3BW1 A;  3I55 T;  1NPP A;  2GQV A;  4XU0 A;  3CCU T;  2VXE A;  2RHU A;  4ZTF A;  1N9S A;  2K5L A;  2GF7 A;  3M54 A;  1UEB A;  4PLL A;  5HK3 A;  4FT2 A;  3CC2 A;  2P0Q A;  1YCY A;  4LD9 K;  4OB2 B;  4OF1 A;  4PJO B;  4M75 A;  1KC8 U;  5GMK l;  2QQB A;  2I2L A;  4RG8 A;  1KQ2 A;  3JCM b;  2ZPB B;  4C92 D;  1KD1 C;  5A0D A;  3MP6 A;  1VQL A;  2EQK A;  2XKO C;  3I55 A;  3CCQ T;  2JTM A;  3OSS C;  1QW1 A;  3TU4 K;  5GMK e;  4FL6 A;  4ME7 A;  1H64 1;  5DM7 R;  4M77 E;  2LCL A;  2WAC A;  3OA6 A;  5CCA A;  1VQM T;  1B34 B;  2XDP A;  2ZPI B;  4BE2 A;  5GAM g;  2K3X A;  4J83 A;  4PLI A;  4RKU E;  3SWN B;  2DXT A;  2OTJ T;  3CD6 T;  5GMK h;  2K5F A;  4ELY C;  3VV0 A;  2DO3 A;  3VUB A;  4C5H A;  2CS7 A;  2P0P A;  3INZ A;  1KD1 U;  1VUB A;  4JJN K;  4JS5 A;  3GIB A;  2DTI A;  3JSC A;  2FB7 A;  3N5B B;  1B34 A;  2PVO B;  4M7A C;  4EMK C;  3MEW A;  3OS1 A;  4D6W A;  1I4K 1;  2DTH A;  3NFC A;  3QBY A;  4J6W A;  4M78 E;  5CIU A;  3RIR A;  4EDU A;  3PFS A;  2VGN A;  1UGS B;  2X4J A;  4M77 B;  2XDB A;  3X28 B;  3GOX A;  2PUK B;  3V7C A;  1VQ8 A;  1M90 U;  4M75 F;  1P92 A;  4XTX A;  1G3T A;  2RI3 A;  5LJ3 j;  1LJO A;  3NTI A;  3RER A;  4DOV A;  3LWH A;  1N9R A;  2RHI A;  2E12 A;  3CC2 T;  3CBP A;  3PMT A;  4M78 A;  1NJI U;  2M16 A;  2A7Y A;  2DIQ A;  3CEY A;  4BUG A;  4Q5W A;  3QSU A;  2RB6 A;  4QVD A;  3P8D A;  1KQS S;  5GAN j;  4PJO C;  3SWN C;  5J39 A;  4JUV A;  2V8I A;  5A0G A;  1QP3 A;  4WF2 A;  1VQ4 A;  4M75 B;  4PJO D;  3G7Z A;  5A2Q E;  2DPP B;  2DZC A;  2R5M A;  2YLC A;  1M1K C;  4BI3 A;  3OYE A;  4J7I A;  1LOJ A;  5LJ3 h;  2LQK A;  4C8Q E;  4ELZ C;  5C0M A;  1M1G A;  4XTU A;  5KCH A;  1VQ6 A;  1JBM A;  4LDV A;  2QQ9 A;  3OQ5 A;  3QII A;  3L2R A;  2X4X A;  4M7D C;  2ZCF B;  2ZZD A;  3MEU A;  3QUI A;  3MEV A;  4E7H A;  3LW5 E;  3EAE A;  3GNF B;  4MZM A;  3OYK A;  1RI0 A;  2YLB A;  2VC8 A;  4X9C A;  3OYM A;  4C92 F;  4C8Q A;  3JB9 J;  1QVG S;  1SSF A;  3H8Z A;  2MI6 A;  4GLK A;  1VQ4 T;  2A3L A;  3V7S A;  1MGQ A;  1Q82 C;  2MF2 A;  3M5A A;  3NTK A;  4XTV A;  5GAO n;  4FT4 A;  4BDZ A;  2MMP A;  4EMH A;  5GMK j;  3Q1J A;  1VQ6 T;  3CME A;  2RA2 A;  5GAN e;  3OYF A;  1Y7X A;  1BI0 A;  4XTY A;  4XU1 A;  5HKC A;  3JB9 I;  2VV5 A;  3PIO A;  4M77 F;  1WQW A;  3HFN A;  1U1T A;  2EIF A;  4N4I A;  3KUF A;  4LDU A;  3X26 B;  3MHX A;  1M5Q 1;  4FM4 B;  3JCM W;  2BIV A;  4Y28 E;  1YJW A;  2EJG A;  4M7A A;  5KCO A;  2OAU A;  2DK3 A;  4C92 C;  1X6O A;  4OB0 B;  1YHQ A;  5GMK i;  5J3B A;  3ZEH A;  4E7I A;  5CKE A;  2QA4 A;  5LJ5 j;  4N0A A;  4HT8 A;  3BDU A;  4A54 A;  1G3W A;  3JB9 F;  1K73 U;  3DB4 A;  2WSC E;  3PTA A;  3LGL A;  2EKO A;  4BE0 A;  3VU3 C;  4EMK B;  3JB9 H;  2Y90 A;  4A53 A;  1JB0 E;  4M78 C;  5LJ5 d;  2LVM A;  4KT0 E;  4Z02 A;  4J8O A;  5FU7 B;  4B9X A;  4BI8 B;  3LWI A;  1OZ2 A;  1YJN A;  3CCS A;  2JTF A;  1WJQ A;  2QQR A;  4NL3 A;  2KAF A;  2EAY A;  1W2B S;  3EFR A;  2RHZ A;  3V8L A;  5KH6 A;  5CKH A;  3OBW A;  1VQN T;  4L6V 5;  3A8O B;  5HY6 A;  2QA4 T;  1K9M C;  1I8F A;  1Y96 B;  2HQX A;  2EQM A;  1W4S A;  5EG2 A;  4B9W A;  1OZ3 A;  2CZ6 B;  4N4H A;  3CXC S;  1Y07 A;  3OS0 A;  5CO7 A;  2D9T A;  4M78 F;  1K8A U;  3KBG A;  3OYG A;  4PJO E;  4OB1 B;  5KE3 A;  5GAO l;  2XU8 A;  2IG0 A;  1HK9 A;  1Y96 A;  3JCM f;  3QHS A;  4X9D A;  4A4H A;  5LJ5 f;  4IUP A;  3T9N A;  3PNW C;  5CR2 A;  2NLU A;  5GAM h;  3V7R A;  4BAC A;  1U8R A;  2EQU A;  1Q86 C;  2K2V A;  3C12 A;  3CPF A;  3M4Y A;  2GCX A;  2E65 A;  2X35 A;  3CCQ A;  2FVU A;  5GAO m;  3CMA T;  3CCJ A;  4M7D E;  1QVF A;  2PUO B;  3TCJ A;  3SD4 A;  4BB7 A;  3EFS A;  1VQP A;  3HP9 A;  5LL6 S;  4JLI A;  3E1S A;  5CQX A;  2BUD A;  2L5Q A;  3HPW A;  4RCC A;  4C5E A;  3JCM X;  1JRI A;  4C0D C;  4J7F A;  3A8M B;  2O4X A;  4F7U G;  3CCR T;  4ZTJ A;  5I2S A;  3OMG A;  5GAO r;  3OBY A;  2EFI A;  2FHD A;  1WQ7 A;  1N8R U;  1FX7 A;  2KQW A;  3M55 A;  3QJ6 A;  5GAN 3;  2EJ9 A;  3HKS A;  4C0F A;  1JJ2 S;  4BD3 A;  1KG1 A;  4C92 A;  1FXX A;  4FSX A;  2DIG A;  3M9Q A;  2RJD A;  3VYG A;  2DKG A;  3S3O A;  4E47 A;  3GP8 A;  3GLX A;  4C0D B;  2LC4 A;  2RHX A;  2VUB A;  5M9O A;  4E7L A;  3PMI A;  5LJ3 d;  1XOV A;  5GAN d;  2CZ1 B;  4DOW A;  5FRM A;  4TVR A;  2V8J A;  2CZ7 B;  4OVA A;  2RM4 A;  2AHJ B;  4LDW A;  1TH7 A;  5L8R E;  1NE8 A;  2ZPG B;  5C6S A;  2E6N A;  1VQ5 T;  3HHT B;  3HSB A;  2ZPF B;  2CZ0 B;  4Y91 A;  2WSF E;  2RJF A;  2JUF A;  4OB3 B;  2ZPE B;  2KY9 A;  2O4X B;  5GAN f;  3M53 A;  2L89 A;  2K57 A;  2O01 E;  2LDM A;  1D3B B;  4PJO F;  4KUD K;  2BKD N;  1XNI A;  3FB9 A;  3JCM J;  3UDC A;  3JAM E;  1I5L A;  4CI0 C;  1WJR A;  2WSE E;  2DZ9 A;  4MZT A;  3CMA A;  2OTL A;  2EYQ A;  4M7A B;  1YJ9 T;  5CKB A;  4OGE A;  1VQP T;  3TRE A;  1QVG A;  1FWZ A;  4O6J A;  5LJ5 e;  4GY5 A;  2EJF A;  4JRI A;  3O8V A;  3LH0 A;  2RK2 A;  4YTL A;  2YRV A;  1KQS A;  3MET A;  4M77 C;  3CCR A;  5GAM e;  1K9M U;  4DA4 A;  3FLG A;  1KC8 C;  1UGP B;  2PQW A;  4EMK A;  1WJS A;  3CCJ T;  2V8K A;  4JS4 A;  3X25 B;  4M75 D;  1KHI A;  2K5I A;  4M78 B;  2L8D A;  2RHY A;  2QQS A;  3JCM c;  2CYZ B;  3OYJ A;  3CXC A;  4C0Z A;  2F5T X;  1M1K U;  3CPW A;  4ZGE B;  1D3B A;  4P5N A;  2MAM A;  1W2B A;  1YIJ T;  2XK0 A;  2QTX A;  3VYH B;  3DB3 A;  2E1H A;  1Q7Y C;  2F69 A;  1M90 C;  2P0K A;  3UPU A;  4L59 A;  2CKK A;  2RK1 A;  3OS5 A;  2E41 A;  5LJ5 h;  3JCM h;  3S3M A;  4OP0 A;  3L2Z A;  1NPR A;  4MML A;  3NTH A;  2LT4 A;  1YHQ T;  4F7U E;  3HRS A;  2DXB A;  2JZ2 A;  2DVE A;  3QG1 A;  5GAN 5;  1VQ7 T;  1QVF S;  4MDW A;  2OTJ A;  4C5G A;  2QEX T;  1YI2 T;  2E5Q A;  2HNI A;  4J6Y A;  3OYY A;  2RJE A;  4C8Q G;  4JLG A;  1G5V A;  4C8Q B;  5FRN A;  4M7D F;  3HRT A;  2P4T A;  5DLO A;  4XAX B;  2XID A;  2VGM A;  3JCM g;  4KUI A;  1YJN T;  4HT9 A;  2X4Y A;  3UT1 A;  4EMG A;  3MP1 A;  2DXC A;  4XTZ A;  1Q81 U;  2ZGW A;  3JCM V;  1VQN A;  1IRE B;  4C8Q C;  4NOY A;  3X24 B;  5I2M A;  2LT1 A;  2JN0 A;  1YJ9 A;  5A0L A;  3MO8 A;  4HCZ A;  4X34 A;  1M8V A;  3FDR A;  5LJ3 e;  5GAN 2;  2RJC A;  4C0G A;  2QQA A;  2DD5 A;  4RCB A;  4F7U B;  3CCE A;  2VYT A;  1ZBX A;  5AYF A;  2GFU A;  2D0Q B;  2PU9 B;  2XI9 A;  3QYG B;  4MMK A;  5GAN 4;  4MDX A;  1BYM A;  2M0O A;  3E9F A;  4M75 C;  1MHN A;  4M77 A;  3A8G B;  2PVD B;  3DLM A;  3E19 A;  3PGG A;  4NL2 A;  5HK0 A;  3A8L B;  2E6Z A;  3L2W A;  4NS5 A;  2LRQ A;  3PIP A;  2D6F A;  3M59 A;  3UWN A;  2XHC A;  2B8A A;  4XQ3 A;  3RUX A;  5GAN 7;  2FL7 A;  4QQ6 A;  2L3R A;  5KE2 A;  4N0A C;  1N27 A;  1OI1 A;  2R58 A;  3BFM A;  3L42 A;  1PSF A;  5FU7 C;  3RKX A;  4M7A F;  3GNG A;  5IN1 A;  1YIJ A;  5FLX E;  2RH2 A;  5GAO q;  4BY6 C;  2KVQ G;  2LCC A;  3M56 A;  5CKF A;  3QZ9 B;  3LLR A;  3CC4 T;  2RI5 A;  2MWP A;  1Y71 A;  3QPH A;  4ZN3 A;  1ZHI A;  4XU2 A;  4BE1 A;  4J5Y A;  4FU6 A;  1VQK T;  2DXU A;  1XQH A;  3R6O A;  3L2Q A;  1BIA A;  3AHU A;  1YI2 A;  1O9S A;  1QP2 A;  1UGR B;  5LJ3 f;  1VIF A;  3OYC A;  3CBO A;  4KUL A;  3JCM Q;  1G3Y A;  1BIB A;  4VUB A;  4BY6 B;  3H6Z A;  3L2U A;  2XIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...