2X4JA

Crystal structure of orf137 from pyrobaculum spherical virus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
109
Chain Sequence
FFTNKIGCNVSSPLKHVDIVGEIVEEAVYNFLIDAGDKMCVGNKIGVWKVSRKSLYAKVPKGIGVTVYLANGRVQGRLIDIGVYEVLVEEVGDIIYIHKDLVYALCWPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Pyrobaculum spherical virus
molecule tags Viral protein
molecule keywords HYPOTHETICAL PROTEIN ORF137
total genus 27
structure length 109
sequence length 121
ec nomenclature
pdb deposition date 2010-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18355 DUF5607 Domain of unknown function (DUF5607)
A PF18356 DUF5608 Domain of unknown function (DUF5608)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.600 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2x4jA01
2X4JA
chains in the Genus database with same CATH superfamily
5IXBA 1VQ4Q 2WSCE 4C5HA 2QEXA 1RAIB 2LJ0A 1IHVA 5A0GA 1QVGS 1K0SA 4PFOA 2DL4A 2DL5A 2ECZA 2D0NA 4M7AC 4JJBA 2LX7A 2LP5A 2P0QA 1GCPA 2FEIA 2XK0A 3AT1B 4R0KA 2QASA 2HZYA 3VUZA 2FZKB 3QZ5B 5HY6A 1KQSP 3R6OA 3QDFA 3CCET 4F17A 4V2SA 1ZLMA 1X69A 3EFRA 2FPDA 2GFAA 2M0OA 1I07A 1VQ5T 1TS9A 2E5QA 1KD1U 4RTXA 4DQ2A 1TWBA 3V8LA 3CCST 2RHIA 2KGTA 2OJ2A 4O5VA 2BKDN 4Y28E 4LD9K 2PZ1A 4NS5A 1LNXA 3GOXA 2B8AA 2WSEE 2QQBA 1YITQ 3FJPA 4NL2A 4AT1B 4C8QD 5GAOm 2CH4W 2KYMA 2M16A 1FXXA 2F5KA 3KFVA 3CC4Q 1M27C 4N4GA 3E19A 1OPKA 1JJ2P 1RAAB 4OMQA 4PJMA 1XJWB 1Q82C 5CVIA 1OZ2A 2E6NA 3MHXA 3CCMQ 1I81A 2ABLA 1ZUKA 3X25B 2ZGWA 4J6YA 4M7AB 2FB7A 4HCBA 1N27A 3A5ZB 4J9IA 2K9GA 2KDSA 4P5NA 1YJWA 3M58A 4ORZA 2A0FB 5GMKi 1OEBA 4M78F 2C0TA 3TCJA 1VQ7A 1NE8A 2KR3A 1QWFA 1AEYA 2X51A 2B86A 2HKNA 2A36A 5CKFA 1BI0A 2F2XA 3UDCA 2YLBA 4LN2A 2ZPEB 4E47A 1XQHA 2EYQA 3I56A 3CCUA 1N8RC 2GGRA 1JJ2S 5KYXB 1VQKQ 3META 2DX1A 1T3LA 1FX7A 2DTIA 2J6FA 4HVWA 4AFSC 2DYBA 2RHUA 2NYSA 1B07A 3I5RA 1SG5A 2K3YA 1H92A 2C0OA 1W2BP 1U3OA 3V7CA 4EMGA 2HNIA 1HYOA 1PRLC 5J26A 4TVRA 1WHLA 2E10A 5I21A 1NG2A 2J05A 5EG2A 4HXJA 4JRQA 3C0CA 1KG1A 1IREB 2DL7A 3JCMJ 2RM4A 3QKJA 3VRYA 1C6VX 2EWNA 5FROA 1WZOA 3D7SB 1UHFA 4X9DA 3REBB 2NLUA 2XDBA 2PTKA 5IHNA 3OYBA 4PFPA 3CCQA 1VQOQ 2K5IA 4RTVA 1RAGB 4D6WA 1YJ9Q 5GANj 1W1FA 5D6XA 4AFQC 1JXOA 1QP3A 3G71T 2DIQA 4DBFA 2YUPA 1VIEA 2K4YA 2P4TA 4FIBA 1YJNQ 4IIOA 3REAB 4JRPA 1WFWA 4CC3A 1W70A 2RA2A 3MP6A 2DJQA 2AK5A 1IHWA 1A0NB 2RQRA 3JCMP 3SB2A 3OYNA 3IQLA 3CXCA 1RUWA 1V1CA 1VQ4T 3GIBA 4QQGA 2X4JA 5IAYA 5DY9A 3JB9D 4Z02A 5I22A 2Y90A 4FYWB 4C8QF 4CRIA 1VQLT 1LPLA 1X6GA 4RG2A 4LD6A 3VS2A 2RJFA 4IURA 2RHZA 4JJDA 5LJ5e 4EMHA 1M9SA 2JMAA 2VWFA 1R8OB 3M55A 4RTWA 5GMKh 5CR2A 3HP9A 4C5IA 3ER0A 3U23A 3OYLA 3UT1A 2FG0A 3M0RA 1Q81U 1HSQA 5LJ3h 2JM9A 2L3QA 1ABQA 3M5AA 5GJWB 3OYAA 1NJIR 4M7AA 2RN8A 4F7UB 1WJQA 2CUDA 2O9VA 5FLXE 4LNPA 2DA9A 5GAOp 3P8BB 3OYYA 3LYIA 4HCCA 3RR6A 2E12A 1TG0A 2YDLA 2BZYA 3CCJT 3EHQA 2EW3A 1EZZB 2E3IA 3FJ5A 2IVWA 3DKMA 1YITT 1QCOA 5A0DA 1GL5A 5KYXA 1IGUA 3OS1A 1YJ9T 4OP0A 1XNIA 2VGMA 3G6EA 1Y0MA 4M75E 2MMPA 4Y91A 2G6FX 5LJ3g 2CDTA 3PVQA 4J9HA 1D1BA 2JTEA 1KJWA 1YJNT 2RQVA 3CXCP 4IIMA 1RAHB 4J83A 4F14A 3QZ9B 4AG2C 3I35A 1E7OA 2FRWA 1M1GA 2MWOA 2QQAA 3G71A 4MZMA 3CCJA 4ZN1A 1O75A 2XIDA 3CCJQ 4HT9A 4JUVA 4LUDA 1I1JA 2K2MA 3OS0A 2AT1B 2HAXA 1T0HA 3M0SA 2DD4A 4OMPA 4OB3B 1M30A 2DXTA 3ZFJA 2RJDA 2CUBA 2EGAA 4PJOG 4XTZA 2CKKA 1D0XA 4M78D 1I0CA 1N8RR 2K7AA 4HVUA 1X6OA 4A4KA 2P0PA 2NUTB 1PRMC 5KYWB 4B9WA 1GFDA 3SHWA 3RKYA 2OTJT 4NOYA 3PFSA 1Q86U 4J9DA 2LCLA 3H0FA 3NMZC 3BW1A 2MYSA 2O2OA 2BE7D 4LDUA 1PSFA 2COWA 2M0YA 4A4EA 3BDLA 2KRMA 2XDPA 4JZ4A 3MP1A 1E6HA 3L42A 5CO7A 4CC4B 2A37A 1J3TA 2HL3A 3L2VA 2Y4XA 2QQ9A 1QP2A 2XDDA 2FPFA 2VASA 3P8DA 5GAN3 4LE9A 1UEBA 2RHYA 4HVVA 3C12A 4AFZC 1FWZA 4KGZB 1OU8A 2LJ3A 1AWXA 1HJDA 4FYXB 4PJOD 2J06A 1BK2A 3PT9A 2LMJA 4KBMB 3CCRA 1JXMA 1WJRA 4RTZA 1MNEA 5GMKm 3H0HA 2DBKA 2GFUA 4XU3A 4F7UA 5AT1B 5KE3A 4PJOE 4QQDA 4HCKA 1M1FA 4OB0B 1WIEA 4QVDA 1D1AA 4MZPA 1KSWA 3CCUQ 1QCNA 1VQ5Q 1VQ9T 1JQQA 1G3YA 1MUZA 2G3RA 5GANh 4KH1B 4RTTA 1MMGA 3A8MB 1UECA 1UGSB 2LVMA 3V7SA 1JJ2A 3OYHA 5AYFA 9ATCB 1K73C 4IUTA 1AHJB 2GTOA 4IUVA 2EQKA 2EKHA 4FW1A 1IGQA 4RCCA 2D9TA 4M77D 2V8IA 4JS5A 1GRIA 2AHJB 3X26B 3QDRB 2GNCA 1YNZA 2V1QA 1TOVA 2LJ1A 2E5KA 3UF4A 5CQXA 1ZSGA 1HD3A 4J6XA 5LJ3j 1K9MC 1UJ0A 1K0XA 5CKDA 5CIUA 2R5AA 1TXQA 2PVGB 2NWMA 4B9XA 2ENMA 3EGDB 2XU8A 1VQ7T 2CSQA 1UGQB 6AT1B 2DXUA 3E9GA 1SF9A 2M02A 4FSSA 3JCMW 2XICA 2LQNA 2NUTA 5KYWA 1H3HA 3QJYA 4HKEA 1N9SA 3FRNA 5I2SA 1TTHB 3CQTA 1QW1A 2F2WA 1YFNA 2XG8D 2KROA 4GY5A 3QYGB 2JUFA 2KSSA 4FSXA 3QWXX 1NBEB 4KGVB 3X28B 1VQ9A 3RUXA 1M90R 1D09B 4E7SA 1OQKA 1RACB 1PM3A 3MEAA 3CCLT 2X9HA 2KY9A 3HKSA 3CPWS 3LLRA 1BKBA 5GAMf 2KEAA 2QEXT 1K9AA 5GAMj 3CCQT 3QYHB 2CSIA 2LZ6B 2R57A 4QW2A 5CKEA 2RF0A 4BUGA 3EGXB 5CKBA 1WA7A 2CP7A 2QI2A 4IUPA 3RESA 3EFOB 1YITA 1CKBA 1VQ8A 1WHGA 2DVJA 2KQWA 3NTIA 1SRMA 2PUOB 1M2OA 2QQRA 3HHTB 1VQLQ 2L0AA 1KQ2A 5LJ5j 3OYKA 4M75B 2JM8A 2BIVA 2HD0A 1KHIA 3CC2A 3TVTA 1MMAA 2VGNA 3JV3A 3LX7A 4M7DE 2EYWA 2P4RA 4LDXA 2DZCA 3ZBDA 3MKDA 3CMAQ 2JN0A 3OMCA 2RNAA 2QA4A 3QXEB 2IIMA 1VQMQ 1X01A 3M53A 1YIJT 1KD1C 2ROTA 1ZHIA 4M77F 1VYVA 1KK7A 3NTKA 1MMDA 3LW5E 4WCIA 4ESRA 4RCBA 2L5QA 5LL6S 4PK4A 2F1LA 1WXBA 3TSWA 2RHXA 2LX9A 3VJPA 2VC8A 5KYYA 3RERA 4OVAA 2KRNA 2RI5A 1KQ1A 4X9CA 4BY6C 2MAMA 5KYNA 1AOJA 1M5Q1 4ZGEB 2CZ7B 2I2LA 1MV3A 4XTXA 3OYIA 1Y96B 3VS6A 2OTLQ 2KRSA 4L5GA 2X4YA 1YIJQ 3JB9J 4YTLA 3I55Q 1LCKA 2D6FA 1VQ8Q 1OPLA 1UFFA 4M75C 3I9QA 1PCXA 1IB8A 3EGDA 1M1KU 3JCMc 1P92A 3TEEA 1CKAA 2RQUA 1JO8A 2RMOA 4C8QG 1Q81C 3QWYA 3OYMA 4CC7A 1XTDA 2DF6A 1KC8C 1H3ZA 1KQSA 5GAOr 4F7UF 2J6OA 3OMGA 1X6BA 4M7AD 1M8VA 4M4ZA 1KC8R 5GAN7 4J7IA 1AZGB 2CP6A 2CZ6B 2JW4A 2FPEA 3NTHA 4OB1B 2DERA 4OF1A 5GAOq 5GJVB 1YJNA 2EKOA 5FW9A 2EJ9A 1QVFS 1VQMT 2QGGA 2EQJA 1PWTA 4A4FA 3PMIA 1N6AA 2K5LA 4M7AG 4BY6B 3CCEA 3OYGA 4XTVA 2A7YA 2HSPA 3EGXA 2QA4T 4XTYA 5ECAA 3JCMg 3EFOA 4RTUA 1JBMA 1RL2A 4CC2A 2AZVA 1KD1R 4J9CA 2QG9B 1RI0A 3HFOA 2VB6A 2YSQA 2RH2A 2QTVA 3OYJA 5I11A 1GBQA 4M75A 4X34A 3M0UA 3OSVA 1ABOA 5DM7R 2ZPBB 3LWIA 1BIBA 1N8RU 1NPPA 2KAFA 1JB0E 3E9FA 1G5VA 2YRVA 3L2WA 3BFMA 2RPNA 2VXFA 3T9NA 4GBQA 5KCHA 1IZ6A 4J9BA 1WHMA 2LCSA 3G1JA 3E2UA 2CZ0B 3V7RA 1I5OB 4EIKA 2LNVA 2RQWA 4C5EA 3OYCA 1OV3A 1NJIU 5GAMd 3JCMe 2E65A 4A53A 4E2FB 5GANg 3A8GB 2GF7A 4DBQA 3CC7Q 5KYYB 8AT1B 2H3EB 3DB3A 3EG1A 3PIOA 3CXCS 1Q7YR 5GMKj 2X3XD 2V26A 1U5SA 2EAYA 2W10A 5A0LA 2VV5A 3OW2A 2MIOA 2DETA 1BYMA 2ESWA 1NEBA 3KUFA 1Y96A 4XU0A 2QAZA 2OTJQ 1WQ7A 2L8DA 4OMLA 4MMKA 1VQ6Q 1ZSZA 2GBQA 4HCZA 4M75F 3GBQA 1NJIC 1Y07A 4E7ZA 3RNJA 1SPKA 4ME7A 4PJLA 3GP8A 2KE9A 1YP5A 3A8OB 4PJJA 2NUZA 4FL6A 2K6DA 4ZGDB 1PD0A 2SEMA 4M77G 4BI3A 1IO6A 1WXUA 8ATCB 2YUNA 3WVEB 1VQLA 3OYFA 3H6ZA 1G3TA 1I4K1 1SRLA 2YT6A 4PJOF 1WDXA 3F70A 4M77B 2COZA 4MZTA 1D0YA 2CYZB 1VQ7Q 2CT4A 1PKTA 1VQPQ 3MEVA 3MO8A 4PKCC 5J39A 4KH0B 2EVRA 3H0IA 1G3WA 1PNJA 2DXCA 1WGSA 4LDWA 3NPFA 1LVKA 3ULRB 5FRNA 1YCYA 2K3XA 7AT1B 2BZ8A 1WNLA 1QVPA 1UHCA 2JS0A 1ZQ1A 2DNUA 1UGVA 2EGEA 3NGPA 2VVKA 5I2MA 2PNIA 4RUGA 2QDLA 3CCLQ 5LJ5h 3OB9A 3QG1A 1QWEA 3P8HA 1YWOA 3R6NA 1BI3A 2EYXA 4XU1A 1R0CB 3MEWA 4BB7A 5GAN6 2RQTA 5GMKl 2J6KA 2DYIA 1S72A 2DAQA 4OMFB 1GCQC 3JCMf 3VYGA 5GAN5 4C92B 3TQ7P 3RDVA 2M1HA 2DD5A 1K9MR 1Y57A 3EFSA 4LXCA 2KK4A 3CMAT 3VUBA 4FT2A 2HBWA 2L89A 3OW2S 4D8DA 1WQWA 5GAMg 4EMKA 2ZPHB 4M77C 3OA6A 3CMEA 3URGA 1K73U 1MNDA 3JCMX 1WI7A 1RAFB 4RKUE 2RO0A 4ELYC 2J7IA 4ZNXA 2AKLA 4KUDK 1K8AC 4MDXA 2MI6A 1S72T 1YHQQ 3RKWA 1DJ7B 1PSEA 1BB9A 5C0MA 5GMKe 4M78G 1X27A 1UB4A 2FO0A 2H3JA 4BE0A 3BDUA 4C0DC 2JZ2A 1S1NA 4FM4B 1RI9A 2LQWA 3L1AA 3C95A 3M0PA 3L2QA 2LRQA 2E3HA 5GANd 3CBPA 1WPYA 3SEMA 1YI2Q 1ZSZB 4JRKA 2ED0A 1CSKA 2QGFB 3OYDA 1PKSA 4RTYA 5CKHA 2EJFA 2E4HA 4XTWA 3O5ZA 2GQVA 1GCQA 1PD1A 1GFCA 2A28A 2EBPA 4FYVB 2EIFA 3S3MA 4JDSA 1ZA1B 2F69A 4C92C 2OAWA 1ZBJA 4C0ZA 5GAMe 1Q82R 1BIAA 3M9QA 2M9UA 3NFCA 2ED1A 2EQUA 2GQIA 4QT7A 1AT1B 3CD6T 1ZUYA 4M77A 1UGRB 2DRKA 1Z9ZA 1KFZA 2PVOB 2QTXA 4JZ3A 4L6V5 3CCRT 1K9MU 3A1PA 4WF2A 2XI9A 3CCVA 1K73R 3L2UA 2YRCA 4R56A 2DMOA 2OTLT 2ZAEA 2FHDA 2AIRB 2W0ZA 1TUCA 3X24B 4N4IA 2YHTA 3VYHB 3OS2A 2K79A 2MK5A 4XQ3A 2YUOA 5FU7B 3UATA 4PLIA 3MPUB 3LGFA 2RK1A 2PUKB 4C0DB 4F7UE 1QVGP 3A8HB 3JSCA 2X35A 2RJEA 1D3BB 2ZCFB 3KBGA 3RIRA 2HEQA 4A4HA 1SKUB 2CP2A 4FU6A 1YHQT 1ZSZC 1JU5C 3JCMQ 2KXDA 3JB9H 2A08A 2PVDB 3JAME 3PE0A 4DBRA 1MMNA 3CPWP 4MMLA 4C92A 4QVCA 3GF5A 2CH4A 3CCUT 4PL6A 3PMTA 2ZPGB 1UUEA 4DBHA 1ARKA 3BE3A 2D8HA 4EMKB 4OGEA 1F1BB 4CI0C 1VQOA 1RLQC 2D8JA 1TSFA 2YWWA 4C8QA 4JLIA 1IXDA 3LH5A 4FT4A 2LNHB 3SFMA 1ZX6A 2BTTA 3S3OA 3M0QA 4J6WA 2CREA 1M4ZA 2DXBA 1B3QA 1OX8A 2JOYA 1RAEB 5FU7C 3CC7T 1SSFA 2D0QB 1ZBXA 5LJ3d 2EYYA 3TU4K 1UG1A 1TUGB 3I56Q 1RADB 2VYTA 2CP3A 1NPRA 3EH2A 1Y71A 3SWNA 3M57A 2JMCA 3QJ6A 3DB4A 2JJ9A 2EGCA 4FCYA 2X4XA 4E6RA 2V1RA 3EG9B 2KI7A 2XKOC 3C4SA 4E7LA 3FEOA 4ANJA 2DEUA 1LJOA 1VUBA 1OZ3A 2RB6A 3FC3A 3FIFA 3JRZA 5CQYA 1OYXA 2MF2A 1U06A 3MCAB 2QDYB 2DTHA 2JVVA 2DBMA 4EMKC 4M7AF 1K8AR 1OULA 3JB9I 2QK0A 1WHKA 3JCMh 1Q86R 3O8VA 2JT4A 4C8QC 2EQIA 4KUIA 4VUBA 1Q7YC 5KYUB 3PNWC 1AZEA 3V8KA 2Y4YA 4J9FA 3CPFA 1NLOC 3VS3A 3EAEA 3OQ5A 1KC8U 1WHJA 2DRMA 2BZXA 2ZPFB 1VQOT 1AWOA 4E7KA 5GANe 1C0MA 2WACA 1SEMA 3OBYA 3BY7A 4GLMA 2C06A 1WLPB 1YCSB 4JRIA 1AVZC 1ACMB 1D3BA 2QYZA 1VQ9Q 1D1CA 4M78A 2R58A 1FYNA 4PJOA 1LOJA 2FZCB 1OU9A 3M59A 1WX6A 3EHRA 2MWPA 2KYBA 2OTJA 1WYXA 5IT9E 1VOMA 1VQPT 4N0AA 4Z88A 5GAN8 4OMMA 4IKFA 2D1XA 3QPHA 4M77E 3M54A 1VQ5A 3VV0A 1KQSS 2ROLA 2OI3A 5GANf 2PQWA 1MHNA 4JPBW 1B7TA 3OW2P 3CCQQ 1X75C 3OBWA 3UA7A 4F04B 2O4XA 3J80E 2K57A 2K5FA 4IUUA 4ZN3A 1M3BA 4JJCA 1VQMA 2DILA 1VQKT 1OX9A 4Y92A 5A2QE 3J81E 4EPCA 3OYEA 1VYUA 4C8QB 2DVEA 1K4US 3ASKA 4M7DG 4M78E 5FWCA 4XU2A 2KXCA 4RG8A 1EFNA 5IHIA 4BD3A 3HRTA 3L2ZA 3CC2T 1TUDA 2HQEA 3INZA 2HQXA 4OGCA 2AZSA 3QHSA 2PU9B 1QVFA 1R77A 2VUBA 1BU1A 1EIFA 1HK9A 3FB9A 3I5SA 3CD6A 2E70A 1VQNT 1U1TA 2LCCA 2R5MA 3OY9A 2RK2A 3UA6A 1EX4A 1N9RA 4ZTFA 1S72Q 4PJOC 2DTOA 2IG0A 3SWNB 3CMET 3AHUA 4C92E 3WVDB 4R55A 1X2QA 4KT0E 1YBYA 1Q86C 1NZ9A 1C1AA 1WXTA 3HSBA 4EDUA 4J9GA 4N0AC 1WHHA 5EC7A 3EG9A 3PVLA 4X1VA 4KGXB 4M75G 2EYZA 1FMWA 3EG0A 2P84A 2MPXC 1NYGA 1FMKA 2F2VA 1T3SA 2QEXQ 2HDAA 1M3CA 2OAUA 5GAOn 5GAN2 4ELZC 1YJWQ 4II1A 2QA4Q 2O88A 1W2BS 2HL5C 1QCFA 5J3BA 3JCMb 5KE2A 2GCXA 1OI1A 5L23A 4K11A 5KYUA 3JB9G 2M51A 1R0BG 2EJGA 1QKWA 3N5BB 1VQ8T 3HTRA 1PHTA 4PNOA 4BI4A 3GPLA 3DLLA 4WTOB 1VQPA 4FW2A 2KNBB 3Q1JA 4DA4A 1T0JA 3CMEQ 2LTOA 2EPDA 3VKIA 1KHCA 2NUPB 2YXYA 3HRUA 1QLYA 3L2RA 5KCOA 2LDMA 4M78B 5HCKA 4PJOB 3S6WA 1VIFA 2KT8A 1M3AA 3SWNC 3VS5A 1NEGA 2DM1A 2LQ8A 1W2BA 3UWNA 4E7IA 3GNFB 2OTLA 3SD4A 4FYYB 5CAIA 3OSSC 2RJCA 3VS4A 1VQNA 4BACA 2O01E 2DZ9A 2MCNA 2JXBA 3OS5A 2DJZA 4J7FA 2LT1A 5D6YA 1H8KA 2O4XB 2FRYA 3VS1A 3QIIA 4LDVA 1JRIA 1UE9A 1M90U 1G3SA 1B34A 2HCKA 2OX7A 1NM7A 3PIPA 4C92F 3CCSA 2HKQB 1G2BA 3CC4A 2LC4A 1YJ9A 3VRZA 4XTUA 2HBPA 1YWPA 4HT8A 1YI2T 5D6WA 1GBRA 4ZTJA 2O9SA 1M8MA 4O6JA 1MV0B 2HSEB 4M7DF 1GXIE 1AWJA 2K2VA 1G8XA 3M0TA 1YJWT 2DLPA 3MP8A 3MJXA 5DLOA 2ZPIB 3CBOA 5FWBA 4QQ6A 3CCMT 3JB9F 4QVZA 1U1SA 1D0ZA 1PG5B 4M78C 1UJYA 2FZGB 1M2VB 5HK3A 2HQHA 4F7UG 3LH0A 1ZUUA 1NLPC 2XHCA 2IPOB 3LWHA 3CC4T 4A54A 3FDRA 4ZGJB 3HL8A 3S3NA 1OOTA 3RBBB 2JTMA 3CCEQ 2VXEA 2MOXA 4HA8A 5FU6B 1Z9QA 1QQJA 1Q7YU 3V8JA 2DE0X 2LQKA 5GAMh 4AFUC 1VQ6A 4E7JA 5LJ5d 1TU0B 3EG2A 3ZL7C 2L3SA 5FRMA 1BI2A 3I56T 1YN8A 3QO3A 4Z8AA 1SHFA 4J8OA 1X43A 2VKNA 2FYKA 3VS7A 4PLLA 4XAXB 4BI8B 1KIKA 3M4YA 3TREA 4ATOA 2X4WA 3QSUA 4PFZA 4A63B 2BUDA 2V8KA 1XOVA 1ZA2B 4B6MA 2L3PA 4Z89A 2NUPA 2JTFA 3KXTA 3G6EQ 2HMAA 3C94A 3H9NA 5CCAA 3RMSA 2ATCB 3JCMd 3SDZA 1M1KR 3E1SA 3RMQA 4DEYA 4M7DB 3PTAA 4C8QE 1RABB 2SRCA 4DOWA 1UDLA 1K76A 1V76A 4LDYA 4M7AE 4C0FA 2DIGA 3GLXA 2I0NA 2KVQG 3G71Q 4BE2A 3H41A 3CC2Q 2X3WD 4PJNA 1W4SA 1QVFP 1NYFA 3EH1A 5KH6A 5FU6C 3VS0A 1QKXA 3CBMA 4J9EA 3G4ST 3I55A 3EG3A 3QBYA 2CS7A 3TSZA 3HPWA 3CCSQ 1WJSA 4AMCA 1I5LA 3FLGA 3CC7A 5M9OA 2LT4A 2L3RA 3A8LB 1B34B 1TH7A 4DOVA 1U8RA 2FL7A 4DEXA 3G6ET 3M56A 1Q82U 3HFNA 1VQ4A 1HXDA 1BCMA 2V8JA 1FMVA 3G7ZA 1I8FA 2YUQA 1W6XA 5IN1A 2CZ1B 4C5GA 1VQ6T 2KBTA 2E1HA 2JS2A 1AD5A 2COYA 4E7HA 2JNGA 5HK0A 3CCVQ 4KULA 5LJ3e 3A98A 2GTJA 1Q95G 5GAOl 4JS4A 1K8AU 4QKUA 5C6SA 1YHQA 3CMAA 1N5ZA 2DK3A 2DO3A 3LGLA 3M4GA 4JJNK 2YLCA 2CGHA 3PGGA 2A3LA 1BI1A 2RI2A 1MGQA 3MEUA 1SSHA 2DL8A 2ZZDA 3H8ZA 1M2VA 1QVGA 2DEQA 4M7DC 1BCOA 5DLQE 1JEGA 2E41A 3G4SQ 1VQKA 3THKA 3X20B 4C0GA 3EGUA 2KMTA 3DLMA 2YRDA 1BBZA 1Q81R 4C92G 4KRTA 4IUQA 5HKCA 3CEYA 2FVUA 3NHNA 4JLGA 4GLKA 5CK9A 3CCVT 4M7DD 3CCLA 2CP0A 2K3BA 1YIJA 1YI2A 5GAN4 2XD0A 5IH2A 4F16A 1UGPB 4N4HA 1H641 2BE9B 4J5YA 4MDWA 1V29B 4NL3A 1O9SA 4UC4A 2CT3A 1K1ZA 2WSFE 4OB2B 2QXFA 2EQMA 3ME9A 2C0IA 4D8KA 1M1KC 4C92D 2F5TX 1Y7XA 3I55T 3CCMA 4A4GA 4RMOA 2QQSA 4OMOA 4BDZA 1VQNQ 3VU3C 2O31A 4XK8E 1G83A 2RD1A 1RLPC 5LJ5g 2E64A 1SHGA 2L2PA 5IXFA 3WXMB 3HRSA 1UTIA 5L8RE 1QMCA 4AG1C 5LJ5f 2H8HA 2P0KA 1PC0A 3G4SA 5IHKA 2E6ZA 3CD6Q 3UPUA 1VA7A 2AKKA 2RI3A 4M7DA 2DKGA 2DL3A 5D7UA 3GNGA 2DPPB 4Q5WA 1M90C 4BDYA 1IRXA 2XMFA 2EFIA 3ZEHA 1AWWA 2Z0WA 2KT1A 1X2KA 4BE1A 5LJ3f 4OMNA 4L59A 3RKXA 4M75D 2DFUA 1VYTA 2CP5A 1E6GA 3QUIA 4LUEA 3JCMV 3CPWA 3CCRQ 3J7AF
chains in the Genus database with same CATH topology
4C92E 3WVDB 1YCYA 2K3XA 4R55A 4KT0E 1G3YA 1YBYA 1Q86C 1NZ9A 2WSCE 4C5HA 2QEXA 1WNLA 1QVPA 3HSBA 1ZQ1A 4EDUA 5A0GA 1QVGS 2G3RA 4N0AC 5GANh 3A8MB 1UGSB 2LVMA 4M7AC 4M75G 3V7SA 2P0QA 1JJ2A 3OYHA 5AYFA 5I2MA 2XK0A 1K73C 4IUTA 3VUZA 5LJ5h 1AHJB 3OB9A 3QG1A 3P8HA 3QZ5B 5HY6A 1BI3A 4XU1A 4IUVA 3R6OA 2OAUA 2EQKA 3MEWA 5GAOn 3CCET 4BB7A 5GAN2 4ELZC 4V2SA 4II1A 5GAN6 4RCCA 5GMKl 2D9TA 4M77D 2V8IA 4JS5A 1S72A 3EFRA 1W2BS 2DAQA 4OMFB 2AHJB 3X26B 3QDRB 3JCMf 5J3BA 3JCMb 2GFAA 5KE2A 2GCXA 3VYGA 5GAN5 1OI1A 2M0OA 4C92B 3JB9G 1VQ5T 2E5QA 2M1HA 2DD5A 1KD1U 2EJGA 5CQXA 3N5BB 1VQ8T 3EFSA 4DQ2A 2KK4A 4J6XA 3VUBA 5LJ3j 4FT2A 3V8LA 3CCST 3CMAT 2L89A 4PNOA 4BI4A 3GPLA 1WQWA 3OW2S 1K9MC 5GAMg 3DLLA 1VQPA 2RHIA 5CKDA 4EMKA 5CIUA 3Q1JA 2ZPHB 4DA4A 4O5VA 4M77C 2LTOA 2R5AA 2BKDN 4Y28E 4LD9K 3OA6A 3CMEA 3URGA 4NS5A 1K73U 3VKIA 1KHCA 2PVGB 1LNXA 3GOXA 2B8AA 3HRUA 2WSEE 4B9XA 3JCMX 2QQBA 4RKUE 3FJPA 2RO0A 4NL2A 4C8QD 4ELYC 5GAOm 3L2RA 2XU8A 5KCOA 2M16A 1VQ7T 2LDMA 1FXXA 2F5KA 4M78B 4PJOB 1UGQB 1VIFA 4N4GA 3S6WA 4KUDK 3E19A 2DXUA 3E9GA 3SWNC 1K8AC 2LQ8A 1W2BA 3JCMW 1Q82C 4MDXA 2XICA 2MI6A 1S72T 3UWNA 5CVIA 3RKWA 1OZ2A 1DJ7B 1PSEA 3GNFB 3QJYA 4E7IA 4HKEA 3SD4A 5C0MA 2E6NA 4M78G 5CAIA 1N9SA 3MHXA 5GMKe 3OSSC 2RJCA 1I81A 3FRNA 1UB4A 2H3JA 5I2SA 4BE0A 3BDUA 3X25B 4C0DC 1QW1A 1VQNA 2JZ2A 2ZGWA 4J6YA 4FM4B 4M7AB 2FB7A 4BACA 1N27A 2XG8D 4HCBA 3L1AA 3A5ZB 4GY5A 2O01E 3QYGB 2JUFA 2KSSA 2DZ9A 2KDSA 4FSXA 5LJ5g 3C95A 4P5NA 3L2QA 1YJWA 3M58A 2LRQA 3X28B 1VQ9A 3RUXA 3OS5A 2DJZA 4J7FA 2LT1A 5D6YA 2O4XB 5GMKi 3MEAA 3QIIA 3CBPA 4LDVA 5GANd 1JRIA 1WPYA 3CCLT 1G3SA 1B34A 1M90U 2KY9A 4M78F 3TCJA 4JRKA 1VQ7A 1NE8A 3PIPA 3OYDA 3HKSA 4C92F 3CPWS 5CKHA 3LLRA 3CCSA 1BKBA 5GAMf 2QEXT 2EJFA 4XTWA 5GAMj 3CCQT 3CC4A 2GQVA 3QYHB 2R57A 2LC4A 4QW2A 1YJ9A 5CKEA 2EIFA 1BI0A 5CKFA 3S3MA 4JDSA 3UDCA 2YLBA 2ZPEB 4XTUA 4E47A 2F69A 1XQHA 2EYQA 4C92C 3I56A 3CCUA 1N8RC 4BUGA 2HBPA 4C0ZA 5GAMe 1JJ2S 5CKBA 5D6WA 1YI2T 4HT8A 2QI2A 4IUPA 3RESA 4ZTJA 1BIAA 3M9QA 3META 4O6JA 2M9UA 1YITA 3NFCA 1FX7A 2DTIA 4M7DF 1VQ8A 1GXIE 2RHUA 2EQUA 2K2VA 2K3YA 3NTIA 2KQWA 1YJWT 3CD6T 4M77A 3V7CA 2PUOB 1UGRB 2QQRA 3HHTB 4EMGA 1KQ2A 2HNIA 3MP8A 5DLOA 2PVOB 2QTXA 4L6V5 5LJ5j 2ZPIB 3CCRT 3OYKA 1K9MU 4M75B 4WF2A 5J26A 2BIVA 2HD0A 2XI9A 1KHIA 3CBOA 3CC2A 4QQ6A 3CCMT 3CCVA 3JB9F 2VGNA 3L2UA 4QVZA 1U1SA 4TVRA 1VQPT 2E10A 4R56A 3LX7A 4M7DE 5I21A 4LDXA 4M78C 2OTLT 2DZCA 2FHDA 3ZBDA 5HK3A 2JN0A 3OMCA 5EG2A 4N4IA 3X24B 2YHTA 4F7UG 3LH0A 3VYHB 4JRQA 2QA4A 2XHCA 3OS2A 3LWHA 3QXEB 3CC4T 4A54A 4XQ3A 1KG1A 1X01A 1IREB 3FDRA 3M53A 5FU7B 4PLIA 4ZGJB 2RM4A 3JCMJ 3QKJA 3HL8A 1YIJT 2EWNA 1KD1C 5FROA 3LGFA 2RK1A 2PUKB 4C0DB 4F7UE 3S3NA 4X9DA 3A8HB 3JSCA 2NLUA 1ZHIA 2RJEA 2JTMA 2X35A 2XDBA 2VXEA 5FU6B 1D3BB 2ZCFB 4HA8A 4M77F 3OYBA 3CCQA 3KBGA 1Q7YU 2K5IA 3NTKA 3RIRA 4A4HA 3LW5E 3V8JA 4D6WA 2LQKA 5GAMh 5GANj 4RCBA 5D6XA 1VQ6A 2L5QA 5LL6S 4E7JA 5LJ5d 4FU6A 1QP3A 3G71T 2DIQA 1YHQT 3JCMQ 1VIEA 2RHXA 5FRMA 3JB9H 2LX9A 1BI2A 2K4YA 2VC8A 3VJPA 2PVDB 3I56T 1VQ5A 3RERA 3JAME 3QO3A 2P4TA 2OTLA 4FIBA 4OVAA 2RI5A 4J8OA 1KQ1A 4X9CA 4BY6C 2MAMA 4JRPA 2FYKA 4PLLA 1M5Q1 4MMLA 4C92A 2RA2A 3MP6A 4XAXB 4BI8B 4ZGEB 4QVCA 2CZ7B 2I2LA 3GF5A 3M4YA 4XTXA 3TREA 3JCMP 4ATOA 2X4WA 3QSUA 3CCUT 4PL6A 3SB2A 3PMTA 2BUDA 2ZPGB 3OYIA 1Y96B 2V8KA 3OYNA 4L5GA 2X4YA 3CXCA 4EMKB 1XOVA 1VQ4T 3JB9J 4OGEA 4QQGA 4YTLA 3GIBA 2X4JA 5IAYA 5DY9A 3JB9D 4Z02A 4CI0C 1VQOA 2Y90A 2D6FA 4C8QF 4CRIA 2JTFA 4M75C 3KXTA 4C8QA 4JLIA 3C94A 1VQLT 4FT4A 1M1KU 4RG2A 4LD6A 3JCMc 3SFMA 2RJFA 3RMSA 5CCAA 4IURA 2RHZA 3JCMd 1P92A 3SDZA 3E1SA 3RMQA 5LJ5e 4EMHA 3TEEA 4M7DB 3PTAA 1M9SA 4C8QE 3M55A 1R8OB 5GMKh 3S3OA 5CR2A 3HP9A 4C8QG 4J6WA 4DOWA 1Q81C 1M4ZA 2DXBA 3ER0A 4LDYA 4C5IA 4M7AE 3OYMA 2JOYA 4C0FA 3OYLA 5FU7C 2DIGA 3UT1A 3CC7T 1SSFA 2D0QB 3GLXA 1ZBXA 1XTDA 5LJ3d 1KC8C 1H3ZA 2KVQG 5GAOr 1Q81U 4F7UF 5LJ3h 1KQSA 4BE2A 3OMGA 3TU4K 4M7AD 3M5AA 3OYAA 1M8VA 4M7AA 1W4SA 5GAN7 4J7IA 4F7UB 5KH6A 1WJQA 2CZ6B 5FU6C 2VYTA 3CBMA 5FLXE 3NTHA 3G4ST 3I55A 1NPRA 3QBYA 4OB1B 2CS7A 1Y71A 3SWNA 3M57A 3HPWA 5GAOp 1WJSA 3P8BB 4OF1A 5GAOq 1YJNA 2EKOA 3FLGA 3CC7A 1I5LA 5M9OA 2LT4A 3OYYA 2L3RA 3QJ6A 3A8LB 2EJ9A 3DB4A 1B34B 3LYIA 1VQMT 1QVFS 1TH7A 4HCCA 4DOVA 2E12A 2EQJA 1U8RA 2FL7A 4A4FA 3PMIA 3CCJT 3G6ET 1N6AA 2X4XA 3M56A 2K5LA 2XKOC 3C4SA 4E7LA 3FEOA 3HFNA 1Q82U 1VQ4A 1LJOA 1HXDA 1VUBA 4M7AG 1OZ3A 2RB6A 2V8JA 4BY6B 3FC3A 3CCEA 2IVWA 3DKMA 3G7ZA 3FIFA 1YITT 3OYGA 1I8FA 4XTVA 3JRZA 5CQYA 5IN1A 1OYXA 2A7YA 2MF2A 2CZ1B 5A0DA 3MCAB 4C5GA 1VQ6T 2QA4T 3OS1A 2E1HA 4XTYA 3JCMg 4OP0A 1YJ9T 1XNIA 4E7HA 2VGMA 2JNGA 5HK0A 1JBMA 2QDYB 2DTHA 4KULA 1RL2A 5LJ3e 3G6EA 2JVVA 4M75E 4EMKC 4M7AF 5GAOl 2MMPA 4JS4A 1K8AU 5C6SA 1RI0A 3JB9I 1YHQA 4Y91A 3HFOA 3JCMh 3CMAA 5LJ3g 2RH2A 3OYJA 1YJNT 2DK3A 2DO3A 3O8VA 3LGLA 3M4GA 4J83A 4M75A 4X34A 4JJNK 2YLCA 2CGHA 3PGGA 3QZ9B 4KUIA 4C8QC 3OSVA 4VUBA 5DM7R 1Q7YC 2ZPBB 3LWIA 2A3LA 1BI1A 2RI2A 1MGQA 3PNWC 1BIBA 3MEUA 3V8KA 3H8ZA 2ZZDA 1N8RU 1M1GA 1NPPA 2KAFA 2MWOA 2QQAA 3G71A 2Y4YA 1JB0E 2DEQA 3CPFA 1QVGA 4M7DC 4MZMA 5DLQE 3CCJA 4ZN1A 2E41A 1O75A 2XIDA 3E9FA 1G5VA 4HT9A 3EAEA 3OQ5A 1KC8U 1VQKA 2YRVA 3L2WA 2ZPFB 1VQOT 3BFMA 4JUVA 3X20B 4C0GA 4E7KA 2KMTA 3DLMA 5GANe 3OS0A 2WACA 2HAXA 4C92G 2VXFA 3OBYA 3T9NA 4IUQA 5KCHA 5HKCA 3CEYA 1IZ6A 2DD4A 3BY7A 2C06A 4OB3B 2DXTA 2FVUA 4JRIA 3ZFJA 2RJDA 1D3BA 2CZ0B 4JLGA 4GLKA 4PJOG 3V7RA 5CK9A 4M78A 2R58A 4XTZA 3CCVT 2CKKA 3CCLA 4M7DD 4PJOA 2LNVA 4C5EA 4M78D 3OYCA 1YIJA 1NJIU 1YI2A 5GAN4 1LOJA 1X6OA 5GAMd 4A4KA 2XD0A 3M59A 3JCMe 2E65A 4A53A 5GANg 2P0PA 3A8GB 1UGPB 2GF7A 2MWPA 4B9WA 2OTJA 5IT9E 4N4HA 1H641 4J5YA 3DB3A 3RKYA 4MDWA 1V29B 4NOYA 4NL3A 4N0AA 3PFSA 3PIOA 1O9SA 4UC4A 3CXCS 1Q86U 5GMKj 5GAN8 2WSFE 2EAYA 5A0LA 4IKFA 4OB2B 2LCLA 2EQMA 2QXFA 3ME9A 3QPHA 1M1KC 3BW1A 2VV5A 2F5TX 3M54A 1Y7XA 4M77E 4C92D 3OW2A 3VV0A 1KQSS 3I55T 3CCMA 4A4GA 1BYMA 4RMOA 2QQSA 4BDZA 5GANf 2PQWA 1MHNA 4LDUA 3VU3C 1PSFA 1X75C 3OBWA 3KUFA 4XK8E 2RD1A 2O4XA 4A4EA 3J80E 3BDLA 1Y96A 2E64A 2K57A 2K5FA 1WQ7A 2L8DA 2XDPA 3MP1A 4IUUA 4MMKA 4XU0A 3L42A 5CO7A 4ZN3A 4HCZA 4M75F 1NJIC 1Y07A 3WXMB 1VQMA 3HRSA 5L8RE 4ME7A 5LJ5f 3L2VA 1VQKT 2Y4XA 2P0KA 2QQ9A 3GP8A 1QP2A 5A2QE 3J81E 4EPCA 2XDDA 3OYEA 4C8QB 3P8DA 3A8OB 3G4SA 5GAN3 2E6ZA 2DVEA 1UEBA 2RHYA 3ASKA 3C12A 4M7DG 4FL6A 4M78E 1FWZA 4XU2A 4RG8A 4ZGDB 2OTJT 4BI3A 4M77G 4BD3A 3UPUA 2RI3A 3WVEB 1VQLA 4M7DA 3HRTA 2DKGA 3L2ZA 3CC2T 4PJOD 3OYFA 3H6ZA 3PT9A 4KBMB 1G3TA 3GNGA 1I4K1 3CCRA 2DPPB 4Q5WA 4PJOF 1WJRA 1M90C 2HQEA 3F70A 3INZA 4BDYA 2HQXA 4OGCA 4M77B 5GMKm 2EFIA 3QHSA 4MZTA 3ZEHA 2PU9B 1QVFA 2CYZB 2VUBA 1EIFA 1HK9A 3FB9A 2GFUA 4XU3A 4BE1A 5LJ3f 3CD6A 2E70A 3MEVA 3MO8A 4L59A 1U1TA 4M75D 2LCCA 3RKXA 4F7UA 1VQNT 4PKCC 5KE3A 5J39A 2R5MA 4PJOE 4QQDA 3OY9A 2RK2A 1M1FA 1N9RA 4OB0B 1G3WA 2DXCA 2DTOA 1WGSA 2IG0A 4MZPA 4QVDA 4ZTFA 4PJOC 3QUIA 3JCMV 3CPWA 3SWNB 4LDWA 1VQ9T 3J7AF 3CMET 3AHUA 5FRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X4J A; 
#chains in the Genus database with same CATH topology
 5IXB A;  1VQ4 Q;  2WSC E;  4C5H A;  2QEX A;  1RAI B;  2LJ0 A;  1IHV A;  5A0G A;  1QVG S;  1K0S A;  4PFO A;  2DL4 A;  2DL5 A;  2ECZ A;  2D0N A;  4M7A C;  4JJB A;  2LX7 A;  2LP5 A;  2P0Q A;  1GCP A;  2FEI A;  2XK0 A;  3AT1 B;  4R0K A;  2QAS A;  2HZY A;  3VUZ A;  2FZK B;  3QZ5 B;  5HY6 A;  1KQS P;  3R6O A;  3QDF A;  3CCE T;  4F17 A;  4V2S A;  1ZLM A;  1X69 A;  3EFR A;  2FPD A;  2GFA A;  2M0O A;  1I07 A;  1VQ5 T;  1TS9 A;  2E5Q A;  1KD1 U;  4RTX A;  4DQ2 A;  1TWB A;  3V8L A;  3CCS T;  2RHI A;  2KGT A;  2OJ2 A;  4O5V A;  2BKD N;  4Y28 E;  4LD9 K;  2PZ1 A;  4NS5 A;  1LNX A;  3GOX A;  2B8A A;  2WSE E;  2QQB A;  1YIT Q;  3FJP A;  4NL2 A;  4AT1 B;  4C8Q D;  5GAO m;  2CH4 W;  2KYM A;  2M16 A;  1FXX A;  2F5K A;  3KFV A;  3CC4 Q;  1M27 C;  4N4G A;  3E19 A;  1OPK A;  1JJ2 P;  1RAA B;  4OMQ A;  4PJM A;  1XJW B;  1Q82 C;  5CVI A;  1OZ2 A;  2E6N A;  3MHX A;  3CCM Q;  1I81 A;  2ABL A;  1ZUK A;  3X25 B;  2ZGW A;  4J6Y A;  4M7A B;  2FB7 A;  4HCB A;  1N27 A;  3A5Z B;  4J9I A;  2K9G A;  2KDS A;  4P5N A;  1YJW A;  3M58 A;  4ORZ A;  2A0F B;  5GMK i;  1OEB A;  4M78 F;  2C0T A;  3TCJ A;  1VQ7 A;  1NE8 A;  2KR3 A;  1QWF A;  1AEY A;  2X51 A;  2B86 A;  2HKN A;  2A36 A;  5CKF A;  1BI0 A;  2F2X A;  3UDC A;  2YLB A;  4LN2 A;  2ZPE B;  4E47 A;  1XQH A;  2EYQ A;  3I56 A;  3CCU A;  1N8R C;  2GGR A;  1JJ2 S;  5KYX B;  1VQK Q;  3MET A;  2DX1 A;  1T3L A;  1FX7 A;  2DTI A;  2J6F A;  4HVW A;  4AFS C;  2DYB A;  2RHU A;  2NYS A;  1B07 A;  3I5R A;  1SG5 A;  2K3Y A;  1H92 A;  2C0O A;  1W2B P;  1U3O A;  3V7C A;  4EMG A;  2HNI A;  1HYO A;  1PRL C;  5J26 A;  4TVR A;  1WHL A;  2E10 A;  5I21 A;  1NG2 A;  2J05 A;  5EG2 A;  4HXJ A;  4JRQ A;  3C0C A;  1KG1 A;  1IRE B;  2DL7 A;  3JCM J;  2RM4 A;  3QKJ A;  3VRY A;  1C6V X;  2EWN A;  5FRO A;  1WZO A;  3D7S B;  1UHF A;  4X9D A;  3REB B;  2NLU A;  2XDB A;  2PTK A;  5IHN A;  3OYB A;  4PFP A;  3CCQ A;  1VQO Q;  2K5I A;  4RTV A;  1RAG B;  4D6W A;  1YJ9 Q;  5GAN j;  1W1F A;  5D6X A;  4AFQ C;  1JXO A;  1QP3 A;  3G71 T;  2DIQ A;  4DBF A;  2YUP A;  1VIE A;  2K4Y A;  2P4T A;  4FIB A;  1YJN Q;  4IIO A;  3REA B;  4JRP A;  1WFW A;  4CC3 A;  1W70 A;  2RA2 A;  3MP6 A;  2DJQ A;  2AK5 A;  1IHW A;  1A0N B;  2RQR A;  3JCM P;  3SB2 A;  3OYN A;  3IQL A;  3CXC A;  1RUW A;  1V1C A;  1VQ4 T;  3GIB A;  4QQG A;  2X4J A;  5IAY A;  5DY9 A;  3JB9 D;  4Z02 A;  5I22 A;  2Y90 A;  4FYW B;  4C8Q F;  4CRI A;  1VQL T;  1LPL A;  1X6G A;  4RG2 A;  4LD6 A;  3VS2 A;  2RJF A;  4IUR A;  2RHZ A;  4JJD A;  5LJ5 e;  4EMH A;  1M9S A;  2JMA A;  2VWF A;  1R8O B;  3M55 A;  4RTW A;  5GMK h;  5CR2 A;  3HP9 A;  4C5I A;  3ER0 A;  3U23 A;  3OYL A;  3UT1 A;  2FG0 A;  3M0R A;  1Q81 U;  1HSQ A;  5LJ3 h;  2JM9 A;  2L3Q A;  1ABQ A;  3M5A A;  5GJW B;  3OYA A;  1NJI R;  4M7A A;  2RN8 A;  4F7U B;  1WJQ A;  2CUD A;  2O9V A;  5FLX E;  4LNP A;  2DA9 A;  5GAO p;  3P8B B;  3OYY A;  3LYI A;  4HCC A;  3RR6 A;  2E12 A;  1TG0 A;  2YDL A;  2BZY A;  3CCJ T;  3EHQ A;  2EW3 A;  1EZZ B;  2E3I A;  3FJ5 A;  2IVW A;  3DKM A;  1YIT T;  1QCO A;  5A0D A;  1GL5 A;  5KYX A;  1IGU A;  3OS1 A;  1YJ9 T;  4OP0 A;  1XNI A;  2VGM A;  3G6E A;  1Y0M A;  4M75 E;  2MMP A;  4Y91 A;  2G6F X;  5LJ3 g;  2CDT A;  3PVQ A;  4J9H A;  1D1B A;  2JTE A;  1KJW A;  1YJN T;  2RQV A;  3CXC P;  4IIM A;  1RAH B;  4J83 A;  4F14 A;  3QZ9 B;  4AG2 C;  3I35 A;  1E7O A;  2FRW A;  1M1G A;  2MWO A;  2QQA A;  3G71 A;  4MZM A;  3CCJ A;  4ZN1 A;  1O75 A;  2XID A;  3CCJ Q;  4HT9 A;  4JUV A;  4LUD A;  1I1J A;  2K2M A;  3OS0 A;  2AT1 B;  2HAX A;  1T0H A;  3M0S A;  2DD4 A;  4OMP A;  4OB3 B;  1M30 A;  2DXT A;  3ZFJ A;  2RJD A;  2CUB A;  2EGA A;  4PJO G;  4XTZ A;  2CKK A;  1D0X A;  4M78 D;  1I0C A;  1N8R R;  2K7A A;  4HVU A;  1X6O A;  4A4K A;  2P0P A;  2NUT B;  1PRM C;  5KYW B;  4B9W A;  1GFD A;  3SHW A;  3RKY A;  2OTJ T;  4NOY A;  3PFS A;  1Q86 U;  4J9D A;  2LCL A;  3H0F A;  3NMZ C;  3BW1 A;  2MYS A;  2O2O A;  2BE7 D;  4LDU A;  1PSF A;  2COW A;  2M0Y A;  4A4E A;  3BDL A;  2KRM A;  2XDP A;  4JZ4 A;  3MP1 A;  1E6H A;  3L42 A;  5CO7 A;  4CC4 B;  2A37 A;  1J3T A;  2HL3 A;  3L2V A;  2Y4X A;  2QQ9 A;  1QP2 A;  2XDD A;  2FPF A;  2VAS A;  3P8D A;  5GAN 3;  4LE9 A;  1UEB A;  2RHY A;  4HVV A;  3C12 A;  4AFZ C;  1FWZ A;  4KGZ B;  1OU8 A;  2LJ3 A;  1AWX A;  1HJD A;  4FYX B;  4PJO D;  2J06 A;  1BK2 A;  3PT9 A;  2LMJ A;  4KBM B;  3CCR A;  1JXM A;  1WJR A;  4RTZ A;  1MNE A;  5GMK m;  3H0H A;  2DBK A;  2GFU A;  4XU3 A;  4F7U A;  5AT1 B;  5KE3 A;  4PJO E;  4QQD A;  4HCK A;  1M1F A;  4OB0 B;  1WIE A;  4QVD A;  1D1A A;  4MZP A;  1KSW A;  3CCU Q;  1QCN A;  1VQ5 Q;  1VQ9 T;  1JQQ A;  1G3Y A;  1MUZ A;  2G3R A;  5GAN h;  4KH1 B;  4RTT A;  1MMG A;  3A8M B;  1UEC A;  1UGS B;  2LVM A;  3V7S A;  1JJ2 A;  3OYH A;  5AYF A;  9ATC B;  1K73 C;  4IUT A;  1AHJ B;  2GTO A;  4IUV A;  2EQK A;  2EKH A;  4FW1 A;  1IGQ A;  4RCC A;  2D9T A;  4M77 D;  2V8I A;  4JS5 A;  1GRI A;  2AHJ B;  3X26 B;  3QDR B;  2GNC A;  1YNZ A;  2V1Q A;  1TOV A;  2LJ1 A;  2E5K A;  3UF4 A;  5CQX A;  1ZSG A;  1HD3 A;  4J6X A;  5LJ3 j;  1K9M C;  1UJ0 A;  1K0X A;  5CKD A;  5CIU A;  2R5A A;  1TXQ A;  2PVG B;  2NWM A;  4B9X A;  2ENM A;  3EGD B;  2XU8 A;  1VQ7 T;  2CSQ A;  1UGQ B;  6AT1 B;  2DXU A;  3E9G A;  1SF9 A;  2M02 A;  4FSS A;  3JCM W;  2XIC A;  2LQN A;  2NUT A;  5KYW A;  1H3H A;  3QJY A;  4HKE A;  1N9S A;  3FRN A;  5I2S A;  1TTH B;  3CQT A;  1QW1 A;  2F2W A;  1YFN A;  2XG8 D;  2KRO A;  4GY5 A;  3QYG B;  2JUF A;  2KSS A;  4FSX A;  3QWX X;  1NBE B;  4KGV B;  3X28 B;  1VQ9 A;  3RUX A;  1M90 R;  1D09 B;  4E7S A;  1OQK A;  1RAC B;  1PM3 A;  3MEA A;  3CCL T;  2X9H A;  2KY9 A;  3HKS A;  3CPW S;  3LLR A;  1BKB A;  5GAM f;  2KEA A;  2QEX T;  1K9A A;  5GAM j;  3CCQ T;  3QYH B;  2CSI A;  2LZ6 B;  2R57 A;  4QW2 A;  5CKE A;  2RF0 A;  4BUG A;  3EGX B;  5CKB A;  1WA7 A;  2CP7 A;  2QI2 A;  4IUP A;  3RES A;  3EFO B;  1YIT A;  1CKB A;  1VQ8 A;  1WHG A;  2DVJ A;  2KQW A;  3NTI A;  1SRM A;  2PUO B;  1M2O A;  2QQR A;  3HHT B;  1VQL Q;  2L0A A;  1KQ2 A;  5LJ5 j;  3OYK A;  4M75 B;  2JM8 A;  2BIV A;  2HD0 A;  1KHI A;  3CC2 A;  3TVT A;  1MMA A;  2VGN A;  3JV3 A;  3LX7 A;  4M7D E;  2EYW A;  2P4R A;  4LDX A;  2DZC A;  3ZBD A;  3MKD A;  3CMA Q;  2JN0 A;  3OMC A;  2RNA A;  2QA4 A;  3QXE B;  2IIM A;  1VQM Q;  1X01 A;  3M53 A;  1YIJ T;  1KD1 C;  2ROT A;  1ZHI A;  4M77 F;  1VYV A;  1KK7 A;  3NTK A;  1MMD A;  3LW5 E;  4WCI A;  4ESR A;  4RCB A;  2L5Q A;  5LL6 S;  4PK4 A;  2F1L A;  1WXB A;  3TSW A;  2RHX A;  2LX9 A;  3VJP A;  2VC8 A;  5KYY A;  3RER A;  4OVA A;  2KRN A;  2RI5 A;  1KQ1 A;  4X9C A;  4BY6 C;  2MAM A;  5KYN A;  1AOJ A;  1M5Q 1;  4ZGE B;  2CZ7 B;  2I2L A;  1MV3 A;  4XTX A;  3OYI A;  1Y96 B;  3VS6 A;  2OTL Q;  2KRS A;  4L5G A;  2X4Y A;  1YIJ Q;  3JB9 J;  4YTL A;  3I55 Q;  1LCK A;  2D6F A;  1VQ8 Q;  1OPL A;  1UFF A;  4M75 C;  3I9Q A;  1PCX A;  1IB8 A;  3EGD A;  1M1K U;  3JCM c;  1P92 A;  3TEE A;  1CKA A;  2RQU A;  1JO8 A;  2RMO A;  4C8Q G;  1Q81 C;  3QWY A;  3OYM A;  4CC7 A;  1XTD A;  2DF6 A;  1KC8 C;  1H3Z A;  1KQS A;  5GAO r;  4F7U F;  2J6O A;  3OMG A;  1X6B A;  4M7A D;  1M8V A;  4M4Z A;  1KC8 R;  5GAN 7;  4J7I A;  1AZG B;  2CP6 A;  2CZ6 B;  2JW4 A;  2FPE A;  3NTH A;  4OB1 B;  2DER A;  4OF1 A;  5GAO q;  5GJV B;  1YJN A;  2EKO A;  5FW9 A;  2EJ9 A;  1QVF S;  1VQM T;  2QGG A;  2EQJ A;  1PWT A;  4A4F A;  3PMI A;  1N6A A;  2K5L A;  4M7A G;  4BY6 B;  3CCE A;  3OYG A;  4XTV A;  2A7Y A;  2HSP A;  3EGX A;  2QA4 T;  4XTY A;  5ECA A;  3JCM g;  3EFO A;  4RTU A;  1JBM A;  1RL2 A;  4CC2 A;  2AZV A;  1KD1 R;  4J9C A;  2QG9 B;  1RI0 A;  3HFO A;  2VB6 A;  2YSQ A;  2RH2 A;  2QTV A;  3OYJ A;  5I11 A;  1GBQ A;  4M75 A;  4X34 A;  3M0U A;  3OSV A;  1ABO A;  5DM7 R;  2ZPB B;  3LWI A;  1BIB A;  1N8R U;  1NPP A;  2KAF A;  1JB0 E;  3E9F A;  1G5V A;  2YRV A;  3L2W A;  3BFM A;  2RPN A;  2VXF A;  3T9N A;  4GBQ A;  5KCH A;  1IZ6 A;  4J9B A;  1WHM A;  2LCS A;  3G1J A;  3E2U A;  2CZ0 B;  3V7R A;  1I5O B;  4EIK A;  2LNV A;  2RQW A;  4C5E A;  3OYC A;  1OV3 A;  1NJI U;  5GAM d;  3JCM e;  2E65 A;  4A53 A;  4E2F B;  5GAN g;  3A8G B;  2GF7 A;  4DBQ A;  3CC7 Q;  5KYY B;  8AT1 B;  2H3E B;  3DB3 A;  3EG1 A;  3PIO A;  3CXC S;  1Q7Y R;  5GMK j;  2X3X D;  2V26 A;  1U5S A;  2EAY A;  2W10 A;  5A0L A;  2VV5 A;  3OW2 A;  2MIO A;  2DET A;  1BYM A;  2ESW A;  1NEB A;  3KUF A;  1Y96 A;  4XU0 A;  2QAZ A;  2OTJ Q;  1WQ7 A;  2L8D A;  4OML A;  4MMK A;  1VQ6 Q;  1ZSZ A;  2GBQ A;  4HCZ A;  4M75 F;  3GBQ A;  1NJI C;  1Y07 A;  4E7Z A;  3RNJ A;  1SPK A;  4ME7 A;  4PJL A;  3GP8 A;  2KE9 A;  1YP5 A;  3A8O B;  4PJJ A;  2NUZ A;  4FL6 A;  2K6D A;  4ZGD B;  1PD0 A;  2SEM A;  4M77 G;  4BI3 A;  1IO6 A;  1WXU A;  8ATC B;  2YUN A;  3WVE B;  1VQL A;  3OYF A;  3H6Z A;  1G3T A;  1I4K 1;  1SRL A;  2YT6 A;  4PJO F;  1WDX A;  3F70 A;  4M77 B;  2COZ A;  4MZT A;  1D0Y A;  2CYZ B;  1VQ7 Q;  2CT4 A;  1PKT A;  1VQP Q;  3MEV A;  3MO8 A;  4PKC C;  5J39 A;  4KH0 B;  2EVR A;  3H0I A;  1G3W A;  1PNJ A;  2DXC A;  1WGS A;  4LDW A;  3NPF A;  1LVK A;  3ULR B;  5FRN A;  1YCY A;  2K3X A;  7AT1 B;  2BZ8 A;  1WNL A;  1QVP A;  1UHC A;  2JS0 A;  1ZQ1 A;  2DNU A;  1UGV A;  2EGE A;  3NGP A;  2VVK A;  5I2M A;  2PNI A;  4RUG A;  2QDL A;  3CCL Q;  5LJ5 h;  3OB9 A;  3QG1 A;  1QWE A;  3P8H A;  1YWO A;  3R6N A;  1BI3 A;  2EYX A;  4XU1 A;  1R0C B;  3MEW A;  4BB7 A;  5GAN 6;  2RQT A;  5GMK l;  2J6K A;  2DYI A;  1S72 A;  2DAQ A;  4OMF B;  1GCQ C;  3JCM f;  3VYG A;  5GAN 5;  4C92 B;  3TQ7 P;  3RDV A;  2M1H A;  2DD5 A;  1K9M R;  1Y57 A;  3EFS A;  4LXC A;  2KK4 A;  3CMA T;  3VUB A;  4FT2 A;  2HBW A;  2L89 A;  3OW2 S;  4D8D A;  1WQW A;  5GAM g;  4EMK A;  2ZPH B;  4M77 C;  3OA6 A;  3CME A;  3URG A;  1K73 U;  1MND A;  3JCM X;  1WI7 A;  1RAF B;  4RKU E;  2RO0 A;  4ELY C;  2J7I A;  4ZNX A;  2AKL A;  4KUD K;  1K8A C;  4MDX A;  2MI6 A;  1S72 T;  1YHQ Q;  3RKW A;  1DJ7 B;  1PSE A;  1BB9 A;  5C0M A;  5GMK e;  4M78 G;  1X27 A;  1UB4 A;  2FO0 A;  2H3J A;  4BE0 A;  3BDU A;  4C0D C;  2JZ2 A;  1S1N A;  4FM4 B;  1RI9 A;  2LQW A;  3L1A A;  3C95 A;  3M0P A;  3L2Q A;  2LRQ A;  2E3H A;  5GAN d;  3CBP A;  1WPY A;  3SEM A;  1YI2 Q;  1ZSZ B;  4JRK A;  2ED0 A;  1CSK A;  2QGF B;  3OYD A;  1PKS A;  4RTY A;  5CKH A;  2EJF A;  2E4H A;  4XTW A;  3O5Z A;  2GQV A;  1GCQ A;  1PD1 A;  1GFC A;  2A28 A;  2EBP A;  4FYV B;  2EIF A;  3S3M A;  4JDS A;  1ZA1 B;  2F69 A;  4C92 C;  2OAW A;  1ZBJ A;  4C0Z A;  5GAM e;  1Q82 R;  1BIA A;  3M9Q A;  2M9U A;  3NFC A;  2ED1 A;  2EQU A;  2GQI A;  4QT7 A;  1AT1 B;  3CD6 T;  1ZUY A;  4M77 A;  1UGR B;  2DRK A;  1Z9Z A;  1KFZ A;  2PVO B;  2QTX A;  4JZ3 A;  4L6V 5;  3CCR T;  1K9M U;  3A1P A;  4WF2 A;  2XI9 A;  3CCV A;  1K73 R;  3L2U A;  2YRC A;  4R56 A;  2DMO A;  2OTL T;  2ZAE A;  2FHD A;  2AIR B;  2W0Z A;  1TUC A;  3X24 B;  4N4I A;  2YHT A;  3VYH B;  3OS2 A;  2K79 A;  2MK5 A;  4XQ3 A;  2YUO A;  5FU7 B;  3UAT A;  4PLI A;  3MPU B;  3LGF A;  2RK1 A;  2PUK B;  4C0D B;  4F7U E;  1QVG P;  3A8H B;  3JSC A;  2X35 A;  2RJE A;  1D3B B;  2ZCF B;  3KBG A;  3RIR A;  2HEQ A;  4A4H A;  1SKU B;  2CP2 A;  4FU6 A;  1YHQ T;  1ZSZ C;  1JU5 C;  3JCM Q;  2KXD A;  3JB9 H;  2A08 A;  2PVD B;  3JAM E;  3PE0 A;  4DBR A;  1MMN A;  3CPW P;  4MML A;  4C92 A;  4QVC A;  3GF5 A;  2CH4 A;  3CCU T;  4PL6 A;  3PMT A;  2ZPG B;  1UUE A;  4DBH A;  1ARK A;  3BE3 A;  2D8H A;  4EMK B;  4OGE A;  1F1B B;  4CI0 C;  1VQO A;  1RLQ C;  2D8J A;  1TSF A;  2YWW A;  4C8Q A;  4JLI A;  1IXD A;  3LH5 A;  4FT4 A;  2LNH B;  3SFM A;  1ZX6 A;  2BTT A;  3S3O A;  3M0Q A;  4J6W A;  2CRE A;  1M4Z A;  2DXB A;  1B3Q A;  1OX8 A;  2JOY A;  1RAE B;  5FU7 C;  3CC7 T;  1SSF A;  2D0Q B;  1ZBX A;  5LJ3 d;  2EYY A;  3TU4 K;  1UG1 A;  1TUG B;  3I56 Q;  1RAD B;  2VYT A;  2CP3 A;  1NPR A;  3EH2 A;  1Y71 A;  3SWN A;  3M57 A;  2JMC A;  3QJ6 A;  3DB4 A;  2JJ9 A;  2EGC A;  4FCY A;  2X4X A;  4E6R A;  2V1R A;  3EG9 B;  2KI7 A;  2XKO C;  3C4S A;  4E7L A;  3FEO A;  4ANJ A;  2DEU A;  1LJO A;  1VUB A;  1OZ3 A;  2RB6 A;  3FC3 A;  3FIF A;  3JRZ A;  5CQY A;  1OYX A;  2MF2 A;  1U06 A;  3MCA B;  2QDY B;  2DTH A;  2JVV A;  2DBM A;  4EMK C;  4M7A F;  1K8A R;  1OUL A;  3JB9 I;  2QK0 A;  1WHK A;  3JCM h;  1Q86 R;  3O8V A;  2JT4 A;  4C8Q C;  2EQI A;  4KUI A;  4VUB A;  1Q7Y C;  5KYU B;  3PNW C;  1AZE A;  3V8K A;  2Y4Y A;  4J9F A;  3CPF A;  1NLO C;  3VS3 A;  3EAE A;  3OQ5 A;  1KC8 U;  1WHJ A;  2DRM A;  2BZX A;  2ZPF B;  1VQO T;  1AWO A;  4E7K A;  5GAN e;  1C0M A;  2WAC A;  1SEM A;  3OBY A;  3BY7 A;  4GLM A;  2C06 A;  1WLP B;  1YCS B;  4JRI A;  1AVZ C;  1ACM B;  1D3B A;  2QYZ A;  1VQ9 Q;  1D1C A;  4M78 A;  2R58 A;  1FYN A;  4PJO A;  1LOJ A;  2FZC B;  1OU9 A;  3M59 A;  1WX6 A;  3EHR A;  2MWP A;  2KYB A;  2OTJ A;  1WYX A;  5IT9 E;  1VOM A;  1VQP T;  4N0A A;  4Z88 A;  5GAN 8;  4OMM A;  4IKF A;  2D1X A;  3QPH A;  4M77 E;  3M54 A;  1VQ5 A;  3VV0 A;  1KQS S;  2ROL A;  2OI3 A;  5GAN f;  2PQW A;  1MHN A;  4JPB W;  1B7T A;  3OW2 P;  3CCQ Q;  1X75 C;  3OBW A;  3UA7 A;  4F04 B;  2O4X A;  3J80 E;  2K57 A;  2K5F A;  4IUU A;  4ZN3 A;  1M3B A;  4JJC A;  1VQM A;  2DIL A;  1VQK T;  1OX9 A;  4Y92 A;  5A2Q E;  3J81 E;  4EPC A;  3OYE A;  1VYU A;  4C8Q B;  2DVE A;  1K4U S;  3ASK A;  4M7D G;  4M78 E;  5FWC A;  4XU2 A;  2KXC A;  4RG8 A;  1EFN A;  5IHI A;  4BD3 A;  3HRT A;  3L2Z A;  3CC2 T;  1TUD A;  2HQE A;  3INZ A;  2HQX A;  4OGC A;  2AZS A;  3QHS A;  2PU9 B;  1QVF A;  1R77 A;  2VUB A;  1BU1 A;  1EIF A;  1HK9 A;  3FB9 A;  3I5S A;  3CD6 A;  2E70 A;  1VQN T;  1U1T A;  2LCC A;  2R5M A;  3OY9 A;  2RK2 A;  3UA6 A;  1EX4 A;  1N9R A;  4ZTF A;  1S72 Q;  4PJO C;  2DTO A;  2IG0 A;  3SWN B;  3CME T;  3AHU A;  4C92 E;  3WVD B;  4R55 A;  1X2Q A;  4KT0 E;  1YBY A;  1Q86 C;  1NZ9 A;  1C1A A;  1WXT A;  3HSB A;  4EDU A;  4J9G A;  4N0A C;  1WHH A;  5EC7 A;  3EG9 A;  3PVL A;  4X1V A;  4KGX B;  4M75 G;  2EYZ A;  1FMW A;  3EG0 A;  2P84 A;  2MPX C;  1NYG A;  1FMK A;  2F2V A;  1T3S A;  2QEX Q;  2HDA A;  1M3C A;  2OAU A;  5GAO n;  5GAN 2;  4ELZ C;  1YJW Q;  4II1 A;  2QA4 Q;  2O88 A;  1W2B S;  2HL5 C;  1QCF A;  5J3B A;  3JCM b;  5KE2 A;  2GCX A;  1OI1 A;  5L23 A;  4K11 A;  5KYU A;  3JB9 G;  2M51 A;  1R0B G;  2EJG A;  1QKW A;  3N5B B;  1VQ8 T;  3HTR A;  1PHT A;  4PNO A;  4BI4 A;  3GPL A;  3DLL A;  4WTO B;  1VQP A;  4FW2 A;  2KNB B;  3Q1J A;  4DA4 A;  1T0J A;  3CME Q;  2LTO A;  2EPD A;  3VKI A;  1KHC A;  2NUP B;  2YXY A;  3HRU A;  1QLY A;  3L2R A;  5KCO A;  2LDM A;  4M78 B;  5HCK A;  4PJO B;  3S6W A;  1VIF A;  2KT8 A;  1M3A A;  3SWN C;  3VS5 A;  1NEG A;  2DM1 A;  2LQ8 A;  1W2B A;  3UWN A;  4E7I A;  3GNF B;  2OTL A;  3SD4 A;  4FYY B;  5CAI A;  3OSS C;  2RJC A;  3VS4 A;  1VQN A;  4BAC A;  2O01 E;  2DZ9 A;  2MCN A;  2JXB A;  3OS5 A;  2DJZ A;  4J7F A;  2LT1 A;  5D6Y A;  1H8K A;  2O4X B;  2FRY A;  3VS1 A;  3QII A;  4LDV A;  1JRI A;  1UE9 A;  1M90 U;  1G3S A;  1B34 A;  2HCK A;  2OX7 A;  1NM7 A;  3PIP A;  4C92 F;  3CCS A;  2HKQ B;  1G2B A;  3CC4 A;  2LC4 A;  1YJ9 A;  3VRZ A;  4XTU A;  2HBP A;  1YWP A;  4HT8 A;  1YI2 T;  5D6W A;  1GBR A;  4ZTJ A;  2O9S A;  1M8M A;  4O6J A;  1MV0 B;  2HSE B;  4M7D F;  1GXI E;  1AWJ A;  2K2V A;  1G8X A;  3M0T A;  1YJW T;  2DLP A;  3MP8 A;  3MJX A;  5DLO A;  2ZPI B;  3CBO A;  5FWB A;  4QQ6 A;  3CCM T;  3JB9 F;  4QVZ A;  1U1S A;  1D0Z A;  1PG5 B;  4M78 C;  1UJY A;  2FZG B;  1M2V B;  5HK3 A;  2HQH A;  4F7U G;  3LH0 A;  1ZUU A;  1NLP C;  2XHC A;  2IPO B;  3LWH A;  3CC4 T;  4A54 A;  3FDR A;  4ZGJ B;  3HL8 A;  3S3N A;  1OOT A;  3RBB B;  2JTM A;  3CCE Q;  2VXE A;  2MOX A;  4HA8 A;  5FU6 B;  1Z9Q A;  1QQJ A;  1Q7Y U;  3V8J A;  2DE0 X;  2LQK A;  5GAM h;  4AFU C;  1VQ6 A;  4E7J A;  5LJ5 d;  1TU0 B;  3EG2 A;  3ZL7 C;  2L3S A;  5FRM A;  1BI2 A;  3I56 T;  1YN8 A;  3QO3 A;  4Z8A A;  1SHF A;  4J8O A;  1X43 A;  2VKN A;  2FYK A;  3VS7 A;  4PLL A;  4XAX B;  4BI8 B;  1KIK A;  3M4Y A;  3TRE A;  4ATO A;  2X4W A;  3QSU A;  4PFZ A;  4A63 B;  2BUD A;  2V8K A;  1XOV A;  1ZA2 B;  4B6M A;  2L3P A;  4Z89 A;  2NUP A;  2JTF A;  3KXT A;  3G6E Q;  2HMA A;  3C94 A;  3H9N A;  5CCA A;  3RMS A;  2ATC B;  3JCM d;  3SDZ A;  1M1K R;  3E1S A;  3RMQ A;  4DEY A;  4M7D B;  3PTA A;  4C8Q E;  1RAB B;  2SRC A;  4DOW A;  1UDL A;  1K76 A;  1V76 A;  4LDY A;  4M7A E;  4C0F A;  2DIG A;  3GLX A;  2I0N A;  2KVQ G;  3G71 Q;  4BE2 A;  3H41 A;  3CC2 Q;  2X3W D;  4PJN A;  1W4S A;  1QVF P;  1NYF A;  3EH1 A;  5KH6 A;  5FU6 C;  3VS0 A;  1QKX A;  3CBM A;  4J9E A;  3G4S T;  3I55 A;  3EG3 A;  3QBY A;  2CS7 A;  3TSZ A;  3HPW A;  3CCS Q;  1WJS A;  4AMC A;  1I5L A;  3FLG A;  3CC7 A;  5M9O A;  2LT4 A;  2L3R A;  3A8L B;  1B34 B;  1TH7 A;  4DOV A;  1U8R A;  2FL7 A;  4DEX A;  3G6E T;  3M56 A;  1Q82 U;  3HFN A;  1VQ4 A;  1HXD A;  1BCM A;  2V8J A;  1FMV A;  3G7Z A;  1I8F A;  2YUQ A;  1W6X A;  5IN1 A;  2CZ1 B;  4C5G A;  1VQ6 T;  2KBT A;  2E1H A;  2JS2 A;  1AD5 A;  2COY A;  4E7H A;  2JNG A;  5HK0 A;  3CCV Q;  4KUL A;  5LJ3 e;  3A98 A;  2GTJ A;  1Q95 G;  5GAO l;  4JS4 A;  1K8A U;  4QKU A;  5C6S A;  1YHQ A;  3CMA A;  1N5Z A;  2DK3 A;  2DO3 A;  3LGL A;  3M4G A;  4JJN K;  2YLC A;  2CGH A;  3PGG A;  2A3L A;  1BI1 A;  2RI2 A;  1MGQ A;  3MEU A;  1SSH A;  2DL8 A;  2ZZD A;  3H8Z A;  1M2V A;  1QVG A;  2DEQ A;  4M7D C;  1BCO A;  5DLQ E;  1JEG A;  2E41 A;  3G4S Q;  1VQK A;  3THK A;  3X20 B;  4C0G A;  3EGU A;  2KMT A;  3DLM A;  2YRD A;  1BBZ A;  1Q81 R;  4C92 G;  4KRT A;  4IUQ A;  5HKC A;  3CEY A;  2FVU A;  3NHN A;  4JLG A;  4GLK A;  5CK9 A;  3CCV T;  4M7D D;  3CCL A;  2CP0 A;  2K3B A;  1YIJ A;  1YI2 A;  5GAN 4;  2XD0 A;  5IH2 A;  4F16 A;  1UGP B;  4N4H A;  1H64 1;  2BE9 B;  4J5Y A;  4MDW A;  1V29 B;  4NL3 A;  1O9S A;  4UC4 A;  2CT3 A;  1K1Z A;  2WSF E;  4OB2 B;  2QXF A;  2EQM A;  3ME9 A;  2C0I A;  4D8K A;  1M1K C;  4C92 D;  2F5T X;  1Y7X A;  3I55 T;  3CCM A;  4A4G A;  4RMO A;  2QQS A;  4OMO A;  4BDZ A;  1VQN Q;  3VU3 C;  2O31 A;  4XK8 E;  1G83 A;  2RD1 A;  1RLP C;  5LJ5 g;  2E64 A;  1SHG A;  2L2P A;  5IXF A;  3WXM B;  3HRS A;  1UTI A;  5L8R E;  1QMC A;  4AG1 C;  5LJ5 f;  2H8H A;  2P0K A;  1PC0 A;  3G4S A;  5IHK A;  2E6Z A;  3CD6 Q;  3UPU A;  1VA7 A;  2AKK A;  2RI3 A;  4M7D A;  2DKG A;  2DL3 A;  5D7U A;  3GNG A;  2DPP B;  4Q5W A;  1M90 C;  4BDY A;  1IRX A;  2XMF A;  2EFI A;  3ZEH A;  1AWW A;  2Z0W A;  2KT1 A;  1X2K A;  4BE1 A;  5LJ3 f;  4OMN A;  4L59 A;  3RKX A;  4M75 D;  2DFU A;  1VYT A;  2CP5 A;  1E6G A;  3QUI A;  4LUE A;  3JCM V;  3CPW A;  3CCR Q;  3J7A F; 
#chains in the Genus database with same CATH homology
 4C92 E;  3WVD B;  1YCY A;  2K3X A;  4R55 A;  4KT0 E;  1G3Y A;  1YBY A;  1Q86 C;  1NZ9 A;  2WSC E;  4C5H A;  2QEX A;  1WNL A;  1QVP A;  3HSB A;  1ZQ1 A;  4EDU A;  5A0G A;  1QVG S;  2G3R A;  4N0A C;  5GAN h;  3A8M B;  1UGS B;  2LVM A;  4M7A C;  4M75 G;  3V7S A;  2P0Q A;  1JJ2 A;  3OYH A;  5AYF A;  5I2M A;  2XK0 A;  1K73 C;  4IUT A;  3VUZ A;  5LJ5 h;  1AHJ B;  3OB9 A;  3QG1 A;  3P8H A;  3QZ5 B;  5HY6 A;  1BI3 A;  4XU1 A;  4IUV A;  3R6O A;  2OAU A;  2EQK A;  3MEW A;  5GAO n;  3CCE T;  4BB7 A;  5GAN 2;  4ELZ C;  4V2S A;  4II1 A;  5GAN 6;  4RCC A;  5GMK l;  2D9T A;  4M77 D;  2V8I A;  4JS5 A;  1S72 A;  3EFR A;  1W2B S;  2DAQ A;  4OMF B;  2AHJ B;  3X26 B;  3QDR B;  3JCM f;  5J3B A;  3JCM b;  2GFA A;  5KE2 A;  2GCX A;  3VYG A;  5GAN 5;  1OI1 A;  2M0O A;  4C92 B;  3JB9 G;  1VQ5 T;  2E5Q A;  2M1H A;  2DD5 A;  1KD1 U;  2EJG A;  5CQX A;  3N5B B;  1VQ8 T;  3EFS A;  4DQ2 A;  2KK4 A;  4J6X A;  3VUB A;  5LJ3 j;  4FT2 A;  3V8L A;  3CCS T;  3CMA T;  2L89 A;  4PNO A;  4BI4 A;  3GPL A;  1WQW A;  3OW2 S;  1K9M C;  5GAM g;  3DLL A;  1VQP A;  2RHI A;  5CKD A;  4EMK A;  5CIU A;  3Q1J A;  2ZPH B;  4DA4 A;  4O5V A;  4M77 C;  2LTO A;  2R5A A;  2BKD N;  4Y28 E;  4LD9 K;  3OA6 A;  3CME A;  3URG A;  4NS5 A;  1K73 U;  3VKI A;  1KHC A;  2PVG B;  1LNX A;  3GOX A;  2B8A A;  3HRU A;  2WSE E;  4B9X A;  3JCM X;  2QQB A;  4RKU E;  3FJP A;  2RO0 A;  4NL2 A;  4C8Q D;  4ELY C;  5GAO m;  3L2R A;  2XU8 A;  5KCO A;  2M16 A;  1VQ7 T;  2LDM A;  1FXX A;  2F5K A;  4M78 B;  4PJO B;  1UGQ B;  1VIF A;  4N4G A;  3S6W A;  4KUD K;  3E19 A;  2DXU A;  3E9G A;  3SWN C;  1K8A C;  2LQ8 A;  1W2B A;  3JCM W;  1Q82 C;  4MDX A;  2XIC A;  2MI6 A;  1S72 T;  3UWN A;  5CVI A;  3RKW A;  1OZ2 A;  1DJ7 B;  1PSE A;  3GNF B;  3QJY A;  4E7I A;  4HKE A;  3SD4 A;  5C0M A;  2E6N A;  4M78 G;  5CAI A;  1N9S A;  3MHX A;  5GMK e;  3OSS C;  2RJC A;  1I81 A;  3FRN A;  1UB4 A;  2H3J A;  5I2S A;  4BE0 A;  3BDU A;  3X25 B;  4C0D C;  1QW1 A;  1VQN A;  2JZ2 A;  2ZGW A;  4J6Y A;  4FM4 B;  4M7A B;  2FB7 A;  4BAC A;  1N27 A;  2XG8 D;  4HCB A;  3L1A A;  3A5Z B;  4GY5 A;  2O01 E;  3QYG B;  2JUF A;  2KSS A;  2DZ9 A;  2KDS A;  4FSX A;  5LJ5 g;  3C95 A;  4P5N A;  3L2Q A;  1YJW A;  3M58 A;  2LRQ A;  3X28 B;  1VQ9 A;  3RUX A;  3OS5 A;  2DJZ A;  4J7F A;  2LT1 A;  5D6Y A;  2O4X B;  5GMK i;  3MEA A;  3QII A;  3CBP A;  4LDV A;  5GAN d;  1JRI A;  1WPY A;  3CCL T;  1G3S A;  1B34 A;  1M90 U;  2KY9 A;  4M78 F;  3TCJ A;  4JRK A;  1VQ7 A;  1NE8 A;  3PIP A;  3OYD A;  3HKS A;  4C92 F;  3CPW S;  5CKH A;  3LLR A;  3CCS A;  1BKB A;  5GAM f;  2QEX T;  2EJF A;  4XTW A;  5GAM j;  3CCQ T;  3CC4 A;  2GQV A;  3QYH B;  2R57 A;  2LC4 A;  4QW2 A;  1YJ9 A;  5CKE A;  2EIF A;  1BI0 A;  5CKF A;  3S3M A;  4JDS A;  3UDC A;  2YLB A;  2ZPE B;  4XTU A;  4E47 A;  2F69 A;  1XQH A;  2EYQ A;  4C92 C;  3I56 A;  3CCU A;  1N8R C;  4BUG A;  2HBP A;  4C0Z A;  5GAM e;  1JJ2 S;  5CKB A;  5D6W A;  1YI2 T;  4HT8 A;  2QI2 A;  4IUP A;  3RES A;  4ZTJ A;  1BIA A;  3M9Q A;  3MET A;  4O6J A;  2M9U A;  1YIT A;  3NFC A;  1FX7 A;  2DTI A;  4M7D F;  1VQ8 A;  1GXI E;  2RHU A;  2EQU A;  2K2V A;  2K3Y A;  3NTI A;  2KQW A;  1YJW T;  3CD6 T;  4M77 A;  3V7C A;  2PUO B;  1UGR B;  2QQR A;  3HHT B;  4EMG A;  1KQ2 A;  2HNI A;  3MP8 A;  5DLO A;  2PVO B;  2QTX A;  4L6V 5;  5LJ5 j;  2ZPI B;  3CCR T;  3OYK A;  1K9M U;  4M75 B;  4WF2 A;  5J26 A;  2BIV A;  2HD0 A;  2XI9 A;  1KHI A;  3CBO A;  3CC2 A;  4QQ6 A;  3CCM T;  3CCV A;  3JB9 F;  2VGN A;  3L2U A;  4QVZ A;  1U1S A;  4TVR A;  1VQP T;  2E10 A;  4R56 A;  3LX7 A;  4M7D E;  5I21 A;  4LDX A;  4M78 C;  2OTL T;  2DZC A;  2FHD A;  3ZBD A;  5HK3 A;  2JN0 A;  3OMC A;  5EG2 A;  4N4I A;  3X24 B;  2YHT A;  4F7U G;  3LH0 A;  3VYH B;  4JRQ A;  2QA4 A;  2XHC A;  3OS2 A;  3LWH A;  3QXE B;  3CC4 T;  4A54 A;  4XQ3 A;  1KG1 A;  1X01 A;  1IRE B;  3FDR A;  3M53 A;  5FU7 B;  4PLI A;  4ZGJ B;  2RM4 A;  3JCM J;  3QKJ A;  3HL8 A;  1YIJ T;  2EWN A;  1KD1 C;  5FRO A;  3LGF A;  2RK1 A;  2PUK B;  4C0D B;  4F7U E;  3S3N A;  4X9D A;  3A8H B;  3JSC A;  2NLU A;  1ZHI A;  2RJE A;  2JTM A;  2X35 A;  2XDB A;  2VXE A;  5FU6 B;  1D3B B;  2ZCF B;  4HA8 A;  4M77 F;  3OYB A;  3CCQ A;  3KBG A;  1Q7Y U;  2K5I A;  3NTK A;  3RIR A;  4A4H A;  3LW5 E;  3V8J A;  4D6W A;  2LQK A;  5GAM h;  5GAN j;  4RCB A;  5D6X A;  1VQ6 A;  2L5Q A;  5LL6 S;  4E7J A;  5LJ5 d;  4FU6 A;  1QP3 A;  3G71 T;  2DIQ A;  1YHQ T;  3JCM Q;  1VIE A;  2RHX A;  5FRM A;  3JB9 H;  2LX9 A;  1BI2 A;  2K4Y A;  2VC8 A;  3VJP A;  2PVD B;  3I56 T;  1VQ5 A;  3RER A;  3JAM E;  3QO3 A;  2P4T A;  2OTL A;  4FIB A;  4OVA A;  2RI5 A;  4J8O A;  1KQ1 A;  4X9C A;  4BY6 C;  2MAM A;  4JRP A;  2FYK A;  4PLL A;  1M5Q 1;  4MML A;  4C92 A;  2RA2 A;  3MP6 A;  4XAX B;  4BI8 B;  4ZGE B;  4QVC A;  2CZ7 B;  2I2L A;  3GF5 A;  3M4Y A;  4XTX A;  3TRE A;  3JCM P;  4ATO A;  2X4W A;  3QSU A;  3CCU T;  4PL6 A;  3SB2 A;  3PMT A;  2BUD A;  2ZPG B;  3OYI A;  1Y96 B;  2V8K A;  3OYN A;  4L5G A;  2X4Y A;  3CXC A;  4EMK B;  1XOV A;  1VQ4 T;  3JB9 J;  4OGE A;  4QQG A;  4YTL A;  3GIB A;  2X4J A;  5IAY A;  5DY9 A;  3JB9 D;  4Z02 A;  4CI0 C;  1VQO A;  2Y90 A;  2D6F A;  4C8Q F;  4CRI A;  2JTF A;  4M75 C;  3KXT A;  4C8Q A;  4JLI A;  3C94 A;  1VQL T;  4FT4 A;  1M1K U;  4RG2 A;  4LD6 A;  3JCM c;  3SFM A;  2RJF A;  3RMS A;  5CCA A;  4IUR A;  2RHZ A;  3JCM d;  1P92 A;  3SDZ A;  3E1S A;  3RMQ A;  5LJ5 e;  4EMH A;  3TEE A;  4M7D B;  3PTA A;  1M9S A;  4C8Q E;  3M55 A;  1R8O B;  5GMK h;  3S3O A;  5CR2 A;  3HP9 A;  4C8Q G;  4J6W A;  4DOW A;  1Q81 C;  1M4Z A;  2DXB A;  3ER0 A;  4LDY A;  4C5I A;  4M7A E;  3OYM A;  2JOY A;  4C0F A;  3OYL A;  5FU7 C;  2DIG A;  3UT1 A;  3CC7 T;  1SSF A;  2D0Q B;  3GLX A;  1ZBX A;  1XTD A;  5LJ3 d;  1KC8 C;  1H3Z A;  2KVQ G;  5GAO r;  1Q81 U;  4F7U F;  5LJ3 h;  1KQS A;  4BE2 A;  3OMG A;  3TU4 K;  4M7A D;  3M5A A;  3OYA A;  1M8V A;  4M7A A;  1W4S A;  5GAN 7;  4J7I A;  4F7U B;  5KH6 A;  1WJQ A;  2CZ6 B;  5FU6 C;  2VYT A;  3CBM A;  5FLX E;  3NTH A;  3G4S T;  3I55 A;  1NPR A;  3QBY A;  4OB1 B;  2CS7 A;  1Y71 A;  3SWN A;  3M57 A;  3HPW A;  5GAO p;  1WJS A;  3P8B B;  4OF1 A;  5GAO q;  1YJN A;  2EKO A;  3FLG A;  3CC7 A;  1I5L A;  5M9O A;  2LT4 A;  3OYY A;  2L3R A;  3QJ6 A;  3A8L B;  2EJ9 A;  3DB4 A;  1B34 B;  3LYI A;  1VQM T;  1QVF S;  1TH7 A;  4HCC A;  4DOV A;  2E12 A;  2EQJ A;  1U8R A;  2FL7 A;  4A4F A;  3PMI A;  3CCJ T;  3G6E T;  1N6A A;  2X4X A;  3M56 A;  2K5L A;  2XKO C;  3C4S A;  4E7L A;  3FEO A;  3HFN A;  1Q82 U;  1VQ4 A;  1LJO A;  1HXD A;  1VUB A;  4M7A G;  1OZ3 A;  2RB6 A;  2V8J A;  4BY6 B;  3FC3 A;  3CCE A;  2IVW A;  3DKM A;  3G7Z A;  3FIF A;  1YIT T;  3OYG A;  1I8F A;  4XTV A;  3JRZ A;  5CQY A;  5IN1 A;  1OYX A;  2A7Y A;  2MF2 A;  2CZ1 B;  5A0D A;  3MCA B;  4C5G A;  1VQ6 T;  2QA4 T;  3OS1 A;  2E1H A;  4XTY A;  3JCM g;  4OP0 A;  1YJ9 T;  1XNI A;  4E7H A;  2VGM A;  2JNG A;  5HK0 A;  1JBM A;  2QDY B;  2DTH A;  4KUL A;  1RL2 A;  5LJ3 e;  3G6E A;  2JVV A;  4M75 E;  4EMK C;  4M7A F;  5GAO l;  2MMP A;  4JS4 A;  1K8A U;  5C6S A;  1RI0 A;  3JB9 I;  1YHQ A;  4Y91 A;  3HFO A;  3JCM h;  3CMA A;  5LJ3 g;  2RH2 A;  3OYJ A;  1YJN T;  2DK3 A;  2DO3 A;  3O8V A;  3LGL A;  3M4G A;  4J83 A;  4M75 A;  4X34 A;  4JJN K;  2YLC A;  2CGH A;  3PGG A;  3QZ9 B;  4KUI A;  4C8Q C;  3OSV A;  4VUB A;  5DM7 R;  1Q7Y C;  2ZPB B;  3LWI A;  2A3L A;  1BI1 A;  2RI2 A;  1MGQ A;  3PNW C;  1BIB A;  3MEU A;  3V8K A;  3H8Z A;  2ZZD A;  1N8R U;  1M1G A;  1NPP A;  2KAF A;  2MWO A;  2QQA A;  3G71 A;  2Y4Y A;  1JB0 E;  2DEQ A;  3CPF A;  1QVG A;  4M7D C;  4MZM A;  5DLQ E;  3CCJ A;  4ZN1 A;  2E41 A;  1O75 A;  2XID A;  3E9F A;  1G5V A;  4HT9 A;  3EAE A;  3OQ5 A;  1KC8 U;  1VQK A;  2YRV A;  3L2W A;  2ZPF B;  1VQO T;  3BFM A;  4JUV A;  3X20 B;  4C0G A;  4E7K A;  2KMT A;  3DLM A;  5GAN e;  3OS0 A;  2WAC A;  2HAX A;  4C92 G;  2VXF A;  3OBY A;  3T9N A;  4IUQ A;  5KCH A;  5HKC A;  3CEY A;  1IZ6 A;  2DD4 A;  3BY7 A;  2C06 A;  4OB3 B;  2DXT A;  2FVU A;  4JRI A;  3ZFJ A;  2RJD A;  1D3B A;  2CZ0 B;  4JLG A;  4GLK A;  4PJO G;  3V7R A;  5CK9 A;  4M78 A;  2R58 A;  4XTZ A;  3CCV T;  2CKK A;  3CCL A;  4M7D D;  4PJO A;  2LNV A;  4C5E A;  4M78 D;  3OYC A;  1YIJ A;  1NJI U;  1YI2 A;  5GAN 4;  1LOJ A;  1X6O A;  5GAM d;  4A4K A;  2XD0 A;  3M59 A;  3JCM e;  2E65 A;  4A53 A;  5GAN g;  2P0P A;  3A8G B;  1UGP B;  2GF7 A;  2MWP A;  4B9W A;  2OTJ A;  5IT9 E;  4N4H A;  1H64 1;  4J5Y A;  3DB3 A;  3RKY A;  4MDW A;  1V29 B;  4NOY A;  4NL3 A;  4N0A A;  3PFS A;  3PIO A;  1O9S A;  4UC4 A;  3CXC S;  1Q86 U;  5GMK j;  5GAN 8;  2WSF E;  2EAY A;  5A0L A;  4IKF A;  4OB2 B;  2LCL A;  2EQM A;  2QXF A;  3ME9 A;  3QPH A;  1M1K C;  3BW1 A;  2VV5 A;  2F5T X;  3M54 A;  1Y7X A;  4M77 E;  4C92 D;  3OW2 A;  3VV0 A;  1KQS S;  3I55 T;  3CCM A;  4A4G A;  1BYM A;  4RMO A;  2QQS A;  4BDZ A;  5GAN f;  2PQW A;  1MHN A;  4LDU A;  3VU3 C;  1PSF A;  1X75 C;  3OBW A;  3KUF A;  4XK8 E;  2RD1 A;  2O4X A;  4A4E A;  3J80 E;  3BDL A;  1Y96 A;  2E64 A;  2K57 A;  2K5F A;  1WQ7 A;  2L8D A;  2XDP A;  3MP1 A;  4IUU A;  4MMK A;  4XU0 A;  3L42 A;  5CO7 A;  4ZN3 A;  4HCZ A;  4M75 F;  1NJI C;  1Y07 A;  3WXM B;  1VQM A;  3HRS A;  5L8R E;  4ME7 A;  5LJ5 f;  3L2V A;  1VQK T;  2Y4X A;  2P0K A;  2QQ9 A;  3GP8 A;  1QP2 A;  5A2Q E;  3J81 E;  4EPC A;  2XDD A;  3OYE A;  4C8Q B;  3P8D A;  3A8O B;  3G4S A;  5GAN 3;  2E6Z A;  2DVE A;  1UEB A;  2RHY A;  3ASK A;  3C12 A;  4M7D G;  4FL6 A;  4M78 E;  1FWZ A;  4XU2 A;  4RG8 A;  4ZGD B;  2OTJ T;  4BI3 A;  4M77 G;  4BD3 A;  3UPU A;  2RI3 A;  3WVE B;  1VQL A;  4M7D A;  3HRT A;  2DKG A;  3L2Z A;  3CC2 T;  4PJO D;  3OYF A;  3H6Z A;  3PT9 A;  4KBM B;  1G3T A;  3GNG A;  1I4K 1;  3CCR A;  2DPP B;  4Q5W A;  4PJO F;  1WJR A;  1M90 C;  2HQE A;  3F70 A;  3INZ A;  4BDY A;  2HQX A;  4OGC A;  4M77 B;  5GMK m;  2EFI A;  3QHS A;  4MZT A;  3ZEH A;  2PU9 B;  1QVF A;  2CYZ B;  2VUB A;  1EIF A;  1HK9 A;  3FB9 A;  2GFU A;  4XU3 A;  4BE1 A;  5LJ3 f;  3CD6 A;  2E70 A;  3MEV A;  3MO8 A;  4L59 A;  1U1T A;  4M75 D;  2LCC A;  3RKX A;  4F7U A;  1VQN T;  4PKC C;  5KE3 A;  5J39 A;  2R5M A;  4PJO E;  4QQD A;  3OY9 A;  2RK2 A;  1M1F A;  1N9R A;  4OB0 B;  1G3W A;  2DXC A;  2DTO A;  1WGS A;  2IG0 A;  4MZP A;  4QVD A;  4ZTF A;  4PJO C;  3QUI A;  3JCM V;  3CPW A;  3SWN B;  4LDW A;  1VQ9 T;  3J7A F;  3CME T;  3AHU A;  5FRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...