The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
147
|
structure length |
147
|
Chain Sequence |
MIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTPKKIIENIEKGDVVEIIAGPFKGERAKVIRVDKHKEEVTLELENAAVPIPITLPVEGVKIVSKHKD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Transcription elongation factor Spt5
|
publication title |
Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb |
source organism |
Methanocaldococcus jannaschii dsm 2661
|
molecule tags |
Transcription
|
total genus |
33
|
structure length |
147
|
sequence length |
147
|
ec nomenclature | |
pdb deposition date | 2015-05-04 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00467 | KOW | KOW motif |
A | PF03439 | Spt5-NGN | Early transcription elongation factor of RNA pol II, NGN section |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | SH3 type barrels. | SH3 type barrels. | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | NusG, N-terminal domain |