4ZN3A

Crystal structure of mjspt4:spt5 complex conformation b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
147
Chain Sequence
b'MIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTPKKIIENIEKGDVVEIIAGPFKGERAKVIRVDKHKEEVTLELENAAVPIPITLPVEGVKIVSKHKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor Spt5
publication title Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Transcription
total genus 33
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zn3A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 4zn3A01
1K9MU 1VQNT 3CCUA 1Q82U 1YIJA 5DLQE 4ZN1A 1VQ5T 1SSFA 1VQPT 1N8RC 1Q81C 1YJNA 2KDSA 3CCUT 3CC2A 5IAYA 1YIJT 3LGFA 1YHQA 2JOYA 1Q86C 2EIFA 2MWOA 1M1KU 3H7HB 3J7AF 1QVFA 3CXCS 1M1GA 3CMEA 3CCLA 1YJNT 3A5ZB 1M1HA 2MI6A 3HKSA 2QA4T 1S72A 3CC2T 1W2BS 1YHQT 1KD1U 1K9MC 3PIPA 4YTLA 1Q82C 3JAME 3CCEA 1QVGA 4TVRA 3CC7A 3CMET 3CCLT 1KC8U 2QEXA 1S72T 1VQ7A 1XNIA 2MWPA 3CCET 1IZ6A 1VQ9A 3CC7T 5HY6A 1EIFA 5DM7R 2QEXT 1M1KC 3DB4A 3I55A 3CD6A 1VQ7T 1NZ9A 1YJWA 3CCVA 2LQ8A 1VQ9T 2LCLA 2OTLA 3CPWS 3I56A 3G6EA 5LL6S 1KD1C 1VQOA 1KQSS 3I55T 3G4SA 3CD6T 2JVVA 2G3RA 1K73U 1KC8C 1KHIA 1VQLA 3CCVT 3CPFA 1VQMA 2OTLT 3OW2S 3G6ET 1NJIU 3CCQA 1VQOT 3G4ST 2L3RA 1VQKA 3CCMA 1QVGS 3ER0A 3LPEA 1X6OA 3CC4A 1JJ2S 1VQLT 1VQMT 5IT9E 3TREA 3CCQT 4ZN3A 1M90U 2IG0A 2K06A 3CXCA 1VQKT 3CCMT 3CMAA 3QQCD 1YBYA 2KVQG 3CC4T 3DB3A 2E6ZA 4CRIA 1YJ9A 1RL2A 1K73C 1NPPA 1VQ4A 2DO3A 2XHCA 2LVMA 3CCRA 1Q7YU 3CMAT 3KBGA 2CKKA 1NJIC 2OTJA 1NPRA 1QVFS 1YJ9T 3J81E 1YJWT 3P8BB 1K8AU 1VQ4T 1BKBA 4RG2A 3I56T 3G71A 3CCRT 2OTJT 4QQDA 1M90C 1YITA 1YI2A 1XTDA 2QA4A 3OYYA 1VQ8A 3CPWA 3G71T 3CCJA 1KQSA 5J26A 1N8RU 3LGLA 1Q81U 1YITT 3PIOA 2JUFA 5A2QE 1YI2T 1NZ8A 2EXUA 1W2BA 1Q7YC 3CCSA 4X34A 3J80E 1VQ6A 1VQ8T 2E70A 1Q86U 1UEBA 3OW2A 1VQNA 1K8AC 3CCJT 3DLLA 2JNGA 5FLXE 2OUGA 1VQ5A 5J3BA 3LH0A 1VQPA 3CCST 1JJ2A 3EWGA 1VQ6T
chains in the Genus database with same CATH superfamily
4XU1A 3RUXA 2J76E 3FEOA 2KBTA 1R77A 2ATLA 4YQWA 2CZ0B 3UO0A 1W70A 4HLBA 2XBPA 3SSRA 2YWWA 5KFCA 1WG4A 7FDRA 3HFKA 1RHUB 4DG1A 4DR6J 3E2EA 3CCRQ 3M58A 3ME9A 1IN0A 2BANB 4ZPAA 2MZQA 2Z0WA 2HHHF 4C3MA 2HQFA 1H2UX 1IBCB 3A13A 1AHJB 2JMAA 2JX2A 3DRYA 4RKUC 3OV7A 4K4WA 2MXYA 1T9VA 5LJ5f 1TK5A 2ROEA 3V6DB 2L9DA 4N41A 3WIUA 5E7OB 4GLMA 4YS2A 5L1KA 1N54B 1YIJS 3X25B 4KGMA 5K8PA 1K0VA 2RQ4A 1LXNA 2X3DA 3QG1A 2WOMA 2XMFA 3BGLA 2OPSB 4R8UA 1AROP 3OFFA 1T02A 4IH7A 1WOOA 3QT8A 3ZTOA 2F8MA 1PHTA 4RW9B 2RF2A 3EVMA 4XTUA 2WVCA 2CQ4A 2NLUA 3RW7A 4L5GA 3PW4A 2EC2A 1S1TA 1S7HA 2XULA 2C2ZB 2OUGA 3TZXA 2X4YA 1HW8A 1KQKA 5J2QA 2VBZA 2ROTA 2FLNA 3V6HA 2JM9A 4I2PB 3VS4A 1H2TZ 3CC2A 5K14A 1HYSB 3DLBA 2EYWA 3AFGA 2QEXQ 1CBKA 2N3LA 2IA0A 2R7WA 2EBPA 5CZVA 3B4DA 4KHPF 4DF4A 2BEFA 3DGVA 2R2UA 2LDIA 1NCLA 4DR4J 1NU4A 2CQ3A 3M0TA 2RRNA 2VKRA 5ADZA 4RTVA 4EGLA 2K2MA 4E7HA 4RWXA 4RLEA 3I9V9 4X4OA 3PX0A 2P0KA 2CADA 2XGPA 4ERDA 2PVOB 4OV1A 1NEBA 2PSZA 1WC4A 2GA7A 2JL9A 3LH5A 4OMOA 5IN1A 5GAGU 3R97A 2J8AA 1RHJB 4KHRA 1N56A 2NR0A 5FU6B 2Z2MA 2RRBA 3MMBB 3JYTB 2R8HA 4Q45A 3GNGA 1VYTA 4DL3A 1M2OA 4E7IA 3D0IE 2NLWA 3R3TA 1ZYQA 4BD3A 4QW8A 2WTFA 2DEUA 2E5HA 4A46A 1N5YB 5CKFA 1NEGA 4DV5F 5KYWA 2QQSA 1DHMA 5AJ3F 3V81B 4RBUA 3JRZA 3ZO7A 5K8OA 4ZVQB 1JLQB 4A4KA 2X51A 3CULA 5GAN7 1IBMF 4LRBA 1UVKA 2MIOA 1WKLA 2AWZA 2RT3A 4OGEA 4UOFA 3PDNA 1V6HA 3GB0A 3SCIE 5C2GA 1U4BA 1W2BS 3J7YU 3TUJC 3QLHA 2LMIA 4LF8F 3E19A 2AJ2A 1HBMB 3HRUA 3MD3A 1H98A 3OA6A 2PUKB 2B43A 5AXMA 4MK9A 4M7DE 3G71Q 4FYYB 4B3RF 1W6XA 1EP4B 1KQFB 3H5XA 3VAMA 3UNGC 2YWFA 3O2IA 1VQMA 1VQNS 1FKPB 3MMAA 2V69A 4Q2MA 4IUQA 3I96A 1VQ5S 4K4YA 3L1AA 1EX4A 3FCVA 1SPKA 4RNNA 3NMAA 4ZVRB 1M90U 5H9EK 3QMQA 1SHFA 2ZJQQ 4C92G 2J9DA 3AODA 5ETPA 2D1XA 4JRKA 2ZH4A 2C3UA 3J81E 2RA2A 3RJMB 2RVJA 5C7PA 2ENMA 1WUUA 2BW7A 4MZPA 4JBCA 2MSTA 2BA9A 2PMHA 2HGLA 4W90B 3M0SA 1JJ2R 4OJHA 5DJBA 4JDSA 3QO9A 4JRPA 1JKHA 3QZ5B 5A2QE 1T7PA 5J2PA 5GMKe 1MUZA 4YY3F 3J80E 2E4HA 1RTHB 2RHIA 1MNEA 2F7VA 1X9WA 3M2VB 2RI5A 4UZBA 4M7DF 4BDZA 1V5VA 3SHWA 2M51A 1LPLA 4OFZA 1KD1T 4Z37A 2EFPA 3OLBA 2DYAA 4PG8A 2O4XA 1YJNT 4NLSA 2VG6A 1KQSP 4CI0B 2V8VA 2WZ1A 2LLZA 1YNZA 2QQAA 1FWKA 2RMLA 2OTJS 1SJ3P 1AEYA 2H54B 3E8OA 1HD0A 3N01A 4IQXA 2ILYA 2VPYB 1I6JA 3EHQA 2N82B 4RPFA 3QZ7A 5F9NA 3R2CJ 3OW2S 1E6HA 2AEFA 2CQCA 2U2FA 2YUNA 1G7CB 1SL0A 2CJBA 3EVWA 3TQ7P 4ZN3A 3P45B 4C9DA 3MM6A 1YN8A 4KJIA 3SMZA 1WTBA 4L73A 3VZHA 5KTQA 1K9AA 3CPWR 4X65J 2JN0A 1Q7YU 4YDDB 4UY85 2C2KB 5EDWA 4JI8F 1YBAA 2VXFA 5CAAA 1X43A 2YDLA 1C1BA 3SWNA 5JMNA 4A8KA 3OSNA 5J26A 2IDLA 4WK3A 4N77A 2IY5B 3JSCA 2D9TA 3M53A 4DR5J 2C42A 3EX7B 2M2BA 1QM9A 5GAHI 4KIAA 2DGWA 1UFWA 3RRGA 3JSMB 1X4GA 4I1TA 1X9MA 4TU8A 4RTYA 2HNIA 3W1YC 1M5SA 2DK3A 3FCHA 3KK1B 4IG0B 1VI7A 3LP1B 3TEGA 1R89A 2CQHA 1RKJA 4F2SA 2CKWA 3OYLA 2M5YA 2J6UA 2AW0A 4TN2A 4TVRA 2E7VA 2A18A 2GJ2A 1FA0A 2UUBJ 1RWVB 1OPLA 1TTHB 4Y92A 2HCKA 3M59A 5CZXA 1VRTB 4RTTA 1M5OC 2O1PA 1VQOT 1VBZA 4I68A 5KYUB 1VQKA 1IKVA 1WJSA 5LXYA 4RR5A 7AT1B 1N33J 3OYIA 3IO1A 3ZZZA 2GGPB 2WSEE 3CXCA 2ZBCA 3CC4T 2L9WA 2UUAF 1QVFS 3W64A 3TJAA 3VQTA 1YJWT 2CNKB 5L39A 1T05B 1KTVA 4N8NA 1JQQA 4ZIVA 4C0DC 2HBQB 3F73A 2V0NA 2EYZA 1VJWA 3UE2A 3V8LA 1BQMB 2X3XD 4O0NA 2AJQA 2EW3A 2DGVA 1ABOA 1KK7A 1NSAA 4IG3A 5A0YA 2EK1A 2YUPA 4M78D 4E2FB 1IBKJ 2BOPA 2PFFB 2N4CA 1RHQB 4OI4A 2HGNA 1GRIA 3VR1A 1RDRA 2V68A 2LC4A 1MWYA 2HVZA 3AQPA 2P6SA 1FWPA 3PKYA 1R0AA 4XU0A 1S48A 1RSCA 5HBMB 3K7RA 4YTLA 3UVJB 4JOUA 2CYZB 2GTJA 3CO9A 1XR7A 1H3ZA 3KHRA 4K4UA 2IBOA 2DNQA 1B3QA 4MIBA 3IG1A 4LUDA 3GILA 1VOMA 5I21A 3ILLA 1N0VC 1UKUA 5F8LA 2KVQE 3M8PB 4ZA1A 1ZBXA 3A3NB 2FVSA 4QIVA 2AEMA 2RK2A 2ZKTA 3W5YA 4C48A 4DSLA 4LBIA 2VBWA 3M4XA 5KFTA 1WYXA 4CO2A 2ZOMA 2BR0A 3KBGA 1UVIA 1S77D 2KXHA 1XNRF 5IH2A 2RJZA 3T3FA 3VV2B 1TZ0A 1YJ7A 4DPUA 4WKRA 2MZ1A 2VODA 2BJ9A 1TL7A 2GVZA 1SI9A 3IWNC 3BDEA 4ZP8A 2FPDA 3R5CA 4ESRA 3MM8B 3RTVA 2VWFA 2CQ0A 1GX6A 4PJOB 3VGVA 1TL1A 2BE9B 1N36J 4GVBA 1DZ5A 2KVIA 5B0AA 2WB1D 1HBOA 2ILZA 3C2PA 4ATOA 1PAEX 1QCFA 2EQJA 2YNGA 3DOLA 1NG2A 3NPFA 2NPFA 2RMOA 2RQKA 3CC7Q 3W62A 2CZ4A 9RUBA 4GKJJ 4XAXB 4M78C 3H5YA 1IWAA 1U1QA 5HKCA 4U6PA 1REVB 2R3VA 3FGVA 5A0GA 2LEPA 2GJFA 3CMET 1NAQA 1Q95G 4I67A 3CDUA 5DDOC 2BQ3A 4RBVA 5D4PA 5DRKA 2C2DA 4N76A 1YJWA 2YWEA 4IKAA 3EG9B 3NOCA 2VIHA 1K0TA 2V26A 3LWLA 3H42A 2BKNA 4MKVA 1BCOA 1VQ6Q 1I8FA 3NG8A 2V9KA 3NCQA 3PW7A 1KFZA 2W9CB 4ECXA 3OFEA 4J6YA 4LF6F 2RQWA 3TZWA 1NK7A 5KE3A 1NLOC 1KHWA 2G1HA 2GHVC 4K59A 4QVCA 2RUGA 3CCRT 2XYPB 4E6RA 2F1FA 3GTYX 3H90A 2FHDA 4ITSA 3DU5A 1KN6A 2PTKA 2XSJB 1CKAA 1Q86T 3ZZPA 4DXLA 1K44A 4O3OA 3OSVA 1NKBA 4A8SA 2FC9A 3HF5A 2WVFA 4LQ9A 1GXTA 2KYMA 3W2VA 3MR2A 2YRVA 5KYYB 3VJPA 3M32B 3CCLQ 1HI0P 4MZTA 2APOA 2HBPA 1BMQB 2O9SA 3BDLA 4NEYA 3QYYA 3A8MB 4V19X 1T3NA 1WKKA 1KC8T 2OPRA 2IVYA 3FRZA 2J7UA 3I56Q 4ZVUB 1FXDA 3DB4A 3KHHA 2IYGA 2CH4W 2PA3A 2KR3A 3Q0AA 2EFOA 5DETA 3PTWA 5GVQA 1FD8A 4IDKB 1RTIA 4TQRA 4FPIA 1ACMB 4LE9A 3P49B 5DS7A 2X1FA 1TUCA 3HHKA 4DUYJ 1HQ2A 2EWNA 2DX1A 4I6WA 4XU3A 4CC7A 3CW2C 5J1EA 1YJ9A 3MZIA 2J9CA 1YJNS 2JOQA 1ZA1B 4FYDA 2XG8A 1IR1A 3NEKA 3L4BC 3G87A 5KFNA 1TKTA 4E7SA 2P8IA 3HJVA 3AH6A 1DURA 1HNIB 4GBQA 1KP6A 3OYYA 4FNHA 2FYKA 4KYZA 2H65B 2DR5A 2D9OA 3I9ZA 2J9DE 4Q8FA 3MFHA 1Q82T 2HPUA 1HNWJ 1WJRA 2QFJA 4LR9A 2YKMB 3VS5A 2BJDA 4P74A 1SKWA 4X62J 2YKNB 3NS6A 4USVA 2ZOGA 1KOOA 3KJNB 5GAMh 1K8AR 1K4US 4LF2A 4TLQA 4ZNXA 1VQ7Q 2COYA 1V76A 4PXCA 2YWHA 3PHEA 2Y0BB 5L8RC 2ZHAA 1KD1U 4KRTA 2NUTB 2K5FA 3NBPB 3DYAB 4A8YA 1I81A 4ZJLA 4LSLA 3BO3A 5KT5A 1FVSA 3SSQA 3VF0B 2CPEA 4NYPA 4YP3A 3DLKB 3SXLA 1C2PA 2ROLA 5IC6B 1QCOA 3L2WA 4CO1A 1W2BR 3HULA 2HMIA 4DMZA 4RW7A 2ZH7A 1C4CA 2P2CB 3NHNA 2KI2A 2DVIA 4F7UB 1N32F 3H9NA 2QQBA 3G6VA 4HXJA 1DTQB 2XG8D 4M77A 4LVOP 4ID8A 2OPQB 3F70A 4C5IA 2JRSA 4PPDA 4D6WA 5LJ5h 1PJ6A 1LW0B 1VRQC 2OSQA 2DIGA 1O6XA 4B3TF 1SG5A 3DKDA 4DV4J 3T1HF 4EFAC 1WHXA 4CTAA 2R5AA 2HZCA 4F4AA 2N4DA 4QW9A 1WEXA 3G71T 4WFBQ 3HVTB 3CCJA 5D0EA 3M56A 5SZTA 2FDNA 2DY1A 3CF5Q 2XHWA 3CDAA 3MAHA 4RX6A 2XIDA 2AX0A 1YRTA 2Z30B 2K3XA 1VQOS 1HKAA 3K57A 3RBEA 2OKQA 1D1BA 2G1DA 3GMGA 3CC4S 2ZAEA 2HFOA 4L6V5 2UP1A 3TAQA 2H3EB 4LF9J 3PGGA 2QTXA 4ZGDB 3GJSB 4OZLA 2LX7A 3VAFA 2ZHBA 2RDJA 4DL6A 5KFOA 1VC6A 2BJ3A 2QEXA 3CBPA 5CIUA 2XDBA 1VMBA 1N52B 4DF8A 2EQMA 2FVCA 4M78E 3CCET 1P1TA 1FDBA 5CCAA 1LWEB 5LJ5Y 3HSDA 3EFOB 1JK9B 3PVXA 3UF4A 5GMDA 3TP2A 4O3PA 2BMBA 5IT9U 1B0TA 4M77D 3TARA 2LT1A 2HL3A 2GHPA 3BGRA 3R6NA 4V19J 4TY9A 4C0HA 3H40A 5GANe 5GAMj 1J5OA 1SJRA 5CR2A 2M52A 3K2YA 2LYVA 4B9MA 2E64A 3T6JA 2YQ1A 4WYWA 4K2JA 2HVIA 4OMLA 3Q23A 1X01A 5FRNA 1QSYA 2WAQD 1M8MA 2KT5A 4EU0A 4UC4A 1UCNA 2ZVIA 1L3UA 4ZLJA 1RWWB 5J39A 1PM3A 2G2YA 4F0HA 4OGCA 3D2WA 1W2BA 1T9WA 1UPMB 1KFSA 2ZJRQ 3I55Q 3LYIA 4M78F 2XNRA 1HD3A 2CPZA 3VS2A 1RKIA 4JLIA 4YDXA 1FF2A 5A8KB 3Q89A 3EXYA 5DLQE 1QWEA 1T94A 4ALZA 4ED2A 4OYWA 2LU2A 5M9OA 4DPXA 3EG3A 1TVRA 5HMZA 3A8IA 4PEOA 1QKXA 2DNUA 2DNRA 3DGPB 4JI3F 2I1RA 5A6PA 4K0KF 3PM9A 3H0IA 4DCPB 1HNZJ 3AJ1A 3R1LA 3W3SA 1DBDA 4DN0A 1JXEA 1NNDA 1S4EA 1BI2A 1HARA 4F8RA 1RXOB 4C0DB 4JRIA 4Z89A 2CWXA 4WKYA 2IM1A 1HPZB 2PUOB 1LOJA 2UU9J 3FSXA 2BZYA 3HSJA 2ADBA 2K8GA 2YHTA 4NX9A 4LN2A 2HNZB 2OPPA 5KYNA 1D3WA 4BLGA 4DR6F 2FZCB 2JTFA 2RHYA 4X66J 4M75A 1KJWA 1ROFA 2DO3A 5J2NB 4O4GA 4JI5J 2EW9A 4DFPA 3AD9C 1IREB 1X5SA 3CMES 4ME7A 3JCMX 1YHQQ 2YX1A 4L3NA 2E1AA 2OLWA 3ELHA 5AXLA 5FU7C 5KG3A 1Y0MA 2ALYB 3G82B 4DSJA 4HYKA 1YI2T 2ECZA 3VS0A 2M9KA 5D6WA 2WCXA 1B34B 5LJ3e 4PG5A 4OHXA 2K1RA 2E9ZA 1ZUUA 3DI6A 1WC6A 2JDJA 2J0QD 4ZIWA 4OZ3A 1VBXA 1EJ7L 1PNJA 3PT9A 4LFAJ 4Y28C 4XTTA 2ROGA 1PC5A 4OHVA 3N79A 1DLOB 3CCRS 2H48B 5CABA 1F2HA 3MCNA 4IQMA 3T1AA 1PD1A 5E5NA 2HKQB 2QLWA 1S99A 3WVDB 2IC3A 4BE1A 1V1CA 2MLXA 2XI9A 2FHMA 3JB9G 1KG1A 2G4BA 1KHIA 1BQXA 3LW5E 2ERRA 1OU9A 3LWHA 4B9NA 1GQEA 5HP1A 2QDYB 2ZE2A 5E3AA 2DGQA 1TFYA 3BDUA 4M75D 4RTXA 4TU9A 4DR4F 2ZVSA 1VIOA 5I4MA 1UVJA 4UOCA 3S01A 2F1LA 2WBRA 1R0BG 2DL7A 3QGPA 5HJYA 3V7SA 4RW8A 4RUAA 1VRUB 1S97A 3CCSQ 4HA8A 2LCCA 1M90C 1G5VA 2ZM6F 2AHJB 5ETMA 1I51B 1CEZA 3CUNA 3ENVA 3M8QB 1JLEA 1Q86U 3PVQA 2VFTA 2J8SA 5KFFA 1UWBB 5DZ7A 1RT1B 3D28A 4ILRA 5CKBA 1GTHA 1XMOJ 2XZWA 4QU7A 3THVA 5FWBA 2C3MA 1PGZA 1M1KT 2ZC3A 1SH3A 1RAFB 3I9QA 2HRUA 5EUHA 1CS4B 1N0UA 4KPCA 3J7AF 3DRRA 2KRNA 1H641 3SCJE 3R7NB 5H1SV 1KC8U 4IFVA 1I4K1 2JFKA 3KLIB 3L3CA 2OTLQ 2DNZA 1Q81R 4M5JA 4PUOB 1YDLA 1ZSZA 4OMMA 4WTOB 3PY8A 2Z58B 1SC3B 1HQEA 1GX5A 4Q43A 2DXCA 3AJDA 3C6UA 2MLZA 1ZM3A 2GS8A 1U1OA 3B4MA 1FKAF 2AKKA 4NRUA 1RUSA 2WONA 4OLOA 5KFMA 1SIZA 4FL6A 3UD4P 3MKDA 3BGUA 1UEKA 3RBBB 1PBAA 1YK9A 1UVMA 4QZVB 2VV5A 1DTTB 1JLAA 1X4BA 4U8YA 5CQGA 4L6V3 3R6LB 1OYEA 3QRPA 3OTBA 1SVDA 4NLVA 1JNRB 5CYQA 3NFCA 1K76A 1FVQA 2BKPA 1YP5A 2ABLA 2HWHA 1N8RT 2QV6A 3RB0A 3P6YC 1H8KA 1HK9A 1K73R 2Z8QA 2HHTA 1R7IA 1Q7YC 3MEDA 2YH1A 3CVKA 1NK6A 3O44A 1VQ6T 1WJQA 4KGVB 1Q82U 1QAIA 5GJVB 1FKOB 1MMAA 3MEEA 2X1AA 3ISND 3GIKA 2RIJA 3LP0B 1VQSA 4DV2J 1VC0A 1TELA 4LQ3A 1D1CA 3JCMJ 2E9TA 2VGNA 4CP5A 4JB8B 2DHGA 4A54A 4QIEA 2D69A 4IUTA 4Z7YA 1R6VA 1Y5IB 4F14A 3G71S 4ECUA 1SQEA 4ED1A 4C92C 1JIHA 2X4WA 3M30B 4QQGA 4HACB 3ZZ0A 1TV6B 2B56A 4X84A 1R43A 1UP1A 1G3TA 2A1BA 2MQPA 1M3AA 2YXYA 4Z7CA 3NRBA 3DXSX 5GANd 5T14A 2OAWA 1GAOA 4GO7X 2YY3A 3OY9A 2VU5A 3S3NA 5GANg 1Q78A 2W9BB 2G0JA 2QT7A 3KKFA 3CDWA 3I56T 2AEJA 2FHOB 2VDHA 3CCES 1TP7A 3BYRA 2DXEA 3M1VB 3E1SA 2GFAA 3JTNA 4M77E 3NGPA 4DV1J 2AHOB 5HK3A 4B9VA 2LNHB 1KD1R 3T6BA 4GY5A 1UW4A 1NHKL 5H9EJ 5HROB 1IQTA 3LH0A 2X4JA 2KZMA 1VBYA 2LRQA 4CLSA 3CDBA 2CPDA 3HVAA 4X65F 2Z4PA 5IXBA 2RS8A 3CCMQ 2DTIA 3C4SA 1GCQC 2LJ0A 4J9EA 5AXKA 3GNFB 1ITPA 3CC7A 4AFSC 1PYTA 3DOKB 3LPYA 1V3SA 1T9YA 3AXKA 2DKOB 4WBFA 1ZZNA 1IXDA 4URSA 4F3QA 4CC3A 4A8QA 2EQIA 1LXJA 2YWGA 4DQQA 1LNQA 4NASA 3DU6A 4M77F 3QFWA 2OI3A 3MCOA 5I2MA 4NI2A 3QWUA 4RUHA 3BSNA 3HHTB 3O1LA 3CCQT 5B0GA 3UDEA 1E6YB 3META 5I3UA 5ETRA 3KLGA 2J6TA 2UUBF 3R5JB 2V4JB 4NA2A 5K9FA 4QU6A 1FDAA 5KT2A 3CMAT 1LEOA 3EVOA 1OOTA 3ZTSA 2I5JB 2V8DA 2EBGA 4DFKA 2I38A 1RI7A 2LA6A 3PIPQ 2LP4A 4HR2A 1VLYA 4FYXB 4IFYA 1TXQA 3JTOA 1N33F 1VC5A 3TQ1A 3MEAA 2ZOFA 3HSZA 5KFVA 1XR6A 2Z57B 4ZMMA 1E6VB 3V4IA 1SUQB 1BWEA 4N5SA 5LJ3d 3GZ7A 1NYFA 4FZVA 1S6PA 4ZVPB 4M8LA 5LJ3g 2FVRA 4F3MA 3RW6A 2B4UA 2D3O1 1TKDA 3CCLA 3FIFA 4PKCC 4E0DA 1BY9A 2XS5A 2MQOA 1TS9A 2JEGA 1R3NA 3BF4A 3MM9B 4C11B 2XSFA 2RD5C 3AB2B 4NXMJ 4LD9K 2E1PA 1IBKF 3BM7A 4ILMA 2DHHA 1F9FA 4GKKJ 2HHXA 2GV1A 1YI2S 3EPIA 2Y4XA 4Q44A 2WSFC 1VQ9T 3I56A 9ATCB 2QLBB 2YPZA 3RB3A 1MU2A 4ECQA 1SKSA 1N6AA 2C2RA 2RF0A 3EGXB 4CH7A 2HZVA 4DR7J 1Q16B 3H2UB 2OEKA 4MYTA 1PO6A 3G6XA 3TU4K 5FW9A 2NUZA 2XHCA 3BQ0A 5CD4A 1AD5A 2QA4Q 4DV7J 1VJQA 3FEZA 4I2QB 4JI2J 1M5Q1 2J7KA 2GVDA 5DDQC 2B51A 5KFWA 3CGIA 1IJEB 5KFLA 4N4HA 3GYGA 4JJDA 3TWZA 3KDOA 4M75E 1S1UA 4RNHA 1VQ8T 4EO6A 1WHWA 2FD2A 2V1RA 4J9QA 4L76A 4DWIA 3IGVA 1FK9B 4I7FB 2NUHA 5LMNJ 1FO1A 1W25A 1WHYA 3FFIB 5DGAA 2DZ9A 1S1XA 5K5MA 4XQ3A 5F3TA 1J5EJ 1LWXA 3OJSA 3B54A 3D66A 1SH0A 2OEJA 2U1AA 2L89A 2CQGA 1FFGB 2M02A 4MH8A 1RISA 4CC2A 1VQ7A 1FWLA 2CQ1A 1UJ4A 4PJOG 1N36F 3P8DA 3M2RB 3EG0A 3OR1A 2GQIA 3PMTA 3C6TA 2MAMA 4BDPA 1KQSS 3I55T 4B9UA 2NUPA 2G3RA 3FLGA 3TNVA 4KO0B 1C1CA 4DOVA 3LP2B 4GKJF 5FU7B 3PIOQ 3CCZA 3X24B 4HT9A 1FCAA 2DEJA 2NXUA 2XICA 2FJBB 1RWPB 3J81Y 5KFYA 3JCMd 3RNJA 3ADAC 2OFGX 4E8UA 3N5BB 3O6QA 1CSKA 3C14B 4C2MA 5FDLB 2W7PA 1C1AA 3CCWA 1MHNA 1F6TA 3PHTA 4OI2A 5A2QY 2BZ2A 3PCOB 4J9RA 1MW7A 3J80Y 3TX0A 1HXDA 1WIEA 3MI7X 3CWJA 3UCUP 1KSPA 2W25A 1QD1A 4MIAA 4HHUA 4Y2IA 4OB2B 5AXNA 2ZPBB 1X0FA 1RTJA 1L3VA 2MJNA 4DBRA 4RW6A 4P6QA 1YZ6A 3MECA 5DDPC 3K0JA 5CYMB 1M1KU 1QJHA 4D3GA 1WI7A 4C8OA 1X4AA 4C92F 3ZZRA 3TCJA 1NHVA 2XY5A 4MYUA 1YHQT 3R7BB 2AJ4A 3FBEA 1XIQA 4C3LA 3CBMA 3TQEA 1C0TB 4JI7J 3CCVQ 4NPOA 1YJUA 3RG6A 3MEUA 2VQEJ 1S9FA 2M8HA 3EG2A 2FZKB 4ID5B 2B6AA 2P9CA 2MEWA 1DAXA 2LQ8A 1W1FA 1KD1C 1RHKB 2JVVA 3PNWC 1HSQA 5I3PA 1MROB 3MJXA 2H5IB 2DF6A 2UXDJ 1AZEA 1NK9A 3QYHB 1FXLA 5I42B 3MMCA 4A48A 4RTZA 2J6KA 2CG8A 2ZKUA 2OP5A 2XEXA 2YQ0A 2DD8S 2D3UA 1WDDA 4RTUA 2JSXA 1RZMA 3T9NA 2Y0SD 2IVFB 3DRPB 1VQ4T 3TO8A 1DY3A 4A4FA 4ZHRB 4USMA 2B8QA 1QP2A 4ZP7A 1ZQ1A 1PAUB 3PMIA 1N8RU 1WXUA 4QIWD 3SDEA 1RHMB 2W4PA 1U8SA 1Q8LA 4DUYF 2HAXA 1R6YA 4EMHA 3IS9B 3G6EQ 3MTJA 2HK3A 3VAHA 1TKXB 3FC3A 2XD0A 5CYJA 4NLOA 2LQWA 5ETQA 4BDYA 2ZPIB 5B08A 3VS7A 5M2UA 1M27C 2VFUA 3CD6Q 3NNHA 3KG1A 4Z02A 3Q8SB 3G1JA 5GAN4 5A0DA 4NYZA 1AWOA 1YFNA 4NLRA 2A2CA 3KG4A 3D7SB 4QYZK 2PI5A 3KLFA 5HN0A 1RLPC 2FLLA 2LQ9A 4XDDA 1XQHA 1G3WA 4X62F 2W4DA 2R2SA 1K1SA 4LVNP 5C24A 2C2MB 2GZOA 3TX8A 2VUGA 1FJCA 4ECTA 2B7CB 4DG1B 2A3JA 3EGZA 2HWTA 2WSFE 4AT1B 1RHRB 1VLOA 3MEGA 5ETTA 2DNHA 5E3QA 4LRCA 3DMJA 4MFBA 2E3IA 3KK3A 4F25A 3BFMA 1O51A 3PXGa 1Q82R 2IDEA 4RL1A 3ZTRA 5JVGQ 3DXBA 1D0XA 3ZNUA 3LWIA 1WC0A 5T7LA 3CIZA 4J5OA 3HDSA 1IKWA 2IPOB 4NLPA 3D3BJ 2NSBA 2KEAA 1QTNB 2VXEA 4F7UG 4X64J 4LRDA 4EK2A 3EG1A 1XWLA 4F3OA 1X4CA 2WOMB 5G0RA 2XS7A 4PCQA 4R8UB 1S72Q 3CCQS 3T1YJ 1IKYA 3JS9A 2CQPA 4DV4F 2H3JA 3GOXA 2RF2B 4J7FA 2KROA 4A4HA 3CMAS 1H73A 4OI0A 1MN9A 1Y5NB 4NLDA 1RT4A 1S1TB 3BSCA 3TW0A 1B0PA 3S7RA 5J2QB 4B17A 3RBXA 3CSKA 4R5PA 3ULRB 4BY6B 3IFEA 1I5OB 5K14B 1NJIT 3CO0P 2CJAA 1PCAA 2DXFA 2CZ7B 3V6DA 3BKFA 3U1NA 4DN9A 3FZ2A 4FT2A 1PC4A 5HJXA 3BKTA 4ZP6A 2YX7A 1NSPA 2BE7D 2LQJA 2DBMA 2CP6A 1MSWD 4LF1A 4AXJA 1PYSB 3KLHA 2BJ1A 2R8GA 3V2UC 2D7SA 1RT5A 3TANA 1XN9A 1NPRA 5K8NA 4LBHA 4PYDA 2P9GA 2UV8G 4A8MP 1QAXA 5KT4A 4WXOA 2LU1A 4QQDA 1X9SA 3RRKA 2FJEB 4GC6A 1Y0HA 5LT5A 3FJPA 4OZNA 1FNMA 1PKTA 1VQ9S 3CCUQ 2XCAA 4IH5A 3CCSA 3EZUA 3PEHA 2BABA 2HS4A 4OI1A 2KT8A 1SJ4P 4NL2A 3M5AA 2I9SA 5GADU 3BPDA 4QWAA 3CJ8A 4C8QA 1U8RA 1CJVA 1IVZA 2FEIA 5KFUA 1M1GA 4LDVA 3K8WA 5D6XA 2DJQA 4C0GA 4O3QA 4J6XA 2VJUA 1VS3A 4J9BA 4J9KA 3NGDA 2ASDA 4EMKA 1XNIA 1EIYB 2MCNA 2HHUA 2FQQB 4CT9A 2OJ3A 1RWUA 3IRWP 1JB0E 4J37A 3EFSA 4HCZA 4RWWA 2KJWA 1OZ3A 5AT1B 2OTLA 1VQ8S 5IT4A 2EI5A 1NK4A 1WQWA 3CCTA 1BXNA 1QMCA 1OV3A 4C7QA 3QLHB 2KXCA 2M3DA 2O67A 5DG9A 1P9QC 5IXUA 1WI6A 5IWAJ 4K4TA 4DR1F 2L0AA 1NSQA 4QOTA 3CCMT 1SC4B 3MAAA 1HNZF 2ZGWA 4WJBA 4TU7A 4D8DA 2Y8YA 3BGOP 2H5JB 4LR8A 3JB9H 1RCOB 5CXTA 5CQYA 3LA0A 2M0OA 1I1GA 3I82A 1A7GE 1YRUA 1TAQA 1H0HB 3V7RA 4LF7J 3HZEA 3OHBA 2JM8A 1WF2A 1I0CA 3OTEA 4YR3A 3NWGA 5I3QA 1U1PA 1CC7A 1U6ZA 4AG1C 4FIBA 3OMGA 3K58A 3KNGA 1M2VA 4DL0C 2UU9F 1X2QA 3GBQA 3CXCP 1R8OB 1UEBA 2K3KA 3SQGA 4ELYC 3MPYA 4KT0E 4X66F 5IV4A 5H9FK 1OI1A 3QWXX 2MZRA 4VUBA 4JYAF 4JI5F 2AK5A 1U25A 2GNKA 1VQMQ 1N5QA 2YTCA 2JOYA 1Q86C 2VICA 3QO9B 1WC5A 4JV1A 3W2WA 1EB0A 1JKHB 3EE3A 5J2PB 1HHSA 2EGAA 4ZTFA 2EGCA 1X31C 3Q86A 3AHUA 3SB2A 3TUIC 2E7XA 1B07A 2FG0A 3M8SA 4UW2A 1VQLQ 2IVWA 2RH3A 3P96A 1HFEL 4DSIA 1ZSGA 4C5HA 2MGZA 1HNXJ 3ETOA 1RT6A 2X1BA 3C8YA 1KC8C 2O4XB 1ULRA 2VG6B 1YTYA 3GE9A 3DOMA 4LFAF 1LCKA 4E7LA 1IKXA 1OQKA 2J7IA 3JCMV 2ZWPA 4KHMA 4Y2KA 4DR3J 1U2CA 2HRYA 4OQJA 1QP3A 3DB3A 2KSSA 3TA2A 4Q0BA 1WG1A 2IRXA 2LCSA 1YHQS 3U02A 4QR2A 1UTIA 1U0HA 2DNYA 2ZUGA 1WJ9A 1WHMA 1MV3A 2XMMA 1UGVA 3AD8C 3EM1A 1TAUA 1KS2A 2JEFA 1U8WA 3L2UA 1VUBA 1YJRA 3OQ5A 3MFIA 2D74B 5J3BA 2FB7A 4FCYA 2C3YA 4YB5A 5ETLA 2ZDOA 2AYEA 2Q43A 4NRTA 2EFNA 1R0CB 3FCWA 1C1BB 3SWNB 2K3YA 4DBHA 2SEMA 4HH1A 2PU9B 2FHJA 2QA4T 3JTPA 1WSRA 5DY9A 3FEYB 1Q82C 5DG8A 1VQ4S 1NH7A 4WF9Q 2O2OA 5GMKl 3UFCX 2L8DA 4C98A 3G86A 4ES2A 1N6QA 3EGVA 4ZPVR 5GAOm 3FMBA 1XMOF 4O44A 4CLPA 3OYCA 1Y4ZB 4S0MA 4LSNA 5LXRA 8ATCB 1EKRA 2GJIA 4P73A 3PYDA 1X4HA 2CPIA 2RB6A 4OMQA 1X4EA 2XZTB 2FY1A 3VAGA 2K7AA 2DPPB 2GQCA 4H4MA 3T5KA 2F65A 2BZXA 4U9RA 1NB2A 2E5IA 1SKRA 5FU6C 4KC5A 1KQSR 1JNZB 1G6BA 3EUNA 4RG2A 3FSIA 2AF6A 1V5IB 1M1KR 1IKVB 3K8VA 4M7AA 3NCRA 4WTYA 5D4LA 1C6VX 2QQ9A 2F4VJ 1NSKL 1WC1A 1XERA 3W63A 3CEDA 2KY9A 5L38A 3DC2A 1RTZA 1U1MA 1Q8KA 5KG5A 2ZZNA 2CGHA 2B86A 1P8GA 2M9UA 3A12A 2Y3YA 2EIFA 3D6FB 5KFJA 3RKYA 4IG3B 5A0YB 2XDPA 4QWBA 1PRMC 4LFCJ 3A1PA 2I8EA 5BYQA 3G4SQ 1KLMA 4DL5A 2RJCA 3C46A 2JW4A 4B9SA 4CLWA 1XMBA 1P1LA 2FJXA 2F2WA 2K7JA 2HQCA 3AOCA 4ZPWR 1RJJA 2RHXA 1R0AB 2BJEA 4DV2F 3KMSA 3REAB 3DLGA 1NK0A 1NJXA 2RILA 4CH0S 2JT4A 4ED3A 2KQWA 4R56A 4MMKA 2R8IA 4IIMA 4NXNF 2W2NP 3LPEA 2F9DA 3W66A 2GGPA 2DISA 1NYGA 1FNXH 2F9JA 2ALZA 3QQCD 1IRXA 2YNIA 3RU0A 3IG1B 1W7WA 1U1LA 3UDCA 1KKHA 3PO5A 3HO1A 1RQ0A 2MKHA 4M7AD 4B3SJ 2K2VA 1MWQA 3BBCA 1JX4A 2BW2A 2L2PA 1GXUA 4B3MF 1N9SA 3EGDB 2QA4A 4M7DA 4CIOA 2HNDA 1UA0A 1WHGA 1QKWA 4KH0B 4Y0FA 3TSZA 4IRCA 4TY8A 4QIFA 4QBUA 2EGEA 5D77A 4Q8EA 2VPXB 2GQ2A 4ILLA 3E51A 1JJ4A 2DH9A 2GHWA 1BIAA 3NY0A 2LEAA 1UAWA 3ZFVA 2C22A 4NMXA 4FF2A 3OBIA 1URRA 2MZJA 1TL7B 2GVZB 2AQ4A 1I5LA 1M1HA 3H59A 5L46A 3QAEA 3UVJA 1JQGA 4ZPDA 1SBRA 4RCBA 4DV1F 1Y10A 4P72A 2FO0A 1TL1B 2BM1A 4F04B 1GMUA 4GVBB 4CI0C 1FRKA 1HBOB 3SD4A 3RB4A 2YNGB 5ETOA 1RYSA 3DOLB 2QA2A 1X4DA 1Z9ZA 5HATA 3OVSA 3KUFA 2XI3A 1X27A 1ZA2B 3GLXA 2AJ1A 3G6ET 1NJIU 3BDPA 2BQRA 6FDRA 4ED6A 3VWSA 3OYGA 3HFZB 1LNXA 1OY9A 4USKA 1S1VA 1V29B 1DQ9A 3UA7A 4CLTA 1BU1A 4AL7A 1D0ZA 4J5YA 5D8HB 4JLGA 2GW8A 5KT3A 1G1XA 1FX2A 5F8JA 1DQAA 1XNQJ 4ANCA 2DNPA 3DKMA 3VU3C 2OAUA 4BCAA 5KOXA 4PFOA 2VC1A 5BR8J 4J8OA 2M8DB 2BV3A 4XTWA 2MLYA 3IBCB 1X5OA 3WX8A 4DUZJ 1X5PA 1Z1ZA 1K9MU 3JSRA 1BBZA 3IWLA 3BBFA 4NL5A 1Z4UA 3OYBA 3HHLC 3LO3A 4OI3A 4QIGA 4G1PA 2HBRB 3F44A 4DPTA 2L3PA 2KO1A 4LF5F 2CZVC 1KONA 3Q83A 3AA9A 1ELOA 1U2RA 1P6TA 2KT1A 1X5TA 4QQ6A 3W2VB 3NGRA 2K7KA 5DM7R 3OVAA 3EG9A 3CCVA 5GAOp 3RR7A 2UUCJ 1NO8A 1NLKL 2QTVA 2OPRB 2MPXC 2EBEA 4HVVA 3OQ2A 4XDCA 2PFDA 2YLCA 1ZPVA 2GAHC 3HP6A 1WHJA 4WE1A 3VZIA 3W7BA 2RQCA 2XDDA 3EDQB 4NXMF 2HW3A 3QSIA 1HR0J 3K5PA 4MDXA 1Q1KA 2QA4G 1SV5A 1RTIB 3RAQA 2XSJA 2DR8A 3THKA 2DPIA 4PJOD 2KTQA 4C97A 2KKHA 1AFJA 2ZPEB 2O01C 4FKYA 2Z2LA 4G1QA 4P71A 5EHHA 4DR7F 5J1EB 2VFRA 4KUDK 2UXCJ 3S3MA 1RABB 2L5QA 3GG0A 1UE9A 5GAMd 2FLOA 2HKEA 4J83A 4DS5A 1OIAA 4LFBJ 1TKTB 2YVSA 4DV7F 2DTHA 4CWBA 1R8PA 2B9XA 4K4SA 2E9RX 1APSA 5K20B 3A5ZB 1ZM4A 3CC2T 3C16A 4TKTA 1Y7PA 2QE5A 3TUPA 1W2BP 3A8EA 3D1HA 5LJ3f 1J27A 2NCKL 5A6WA 3M9NB 5GMKi 1NMEB 1OPIA 3OTOJ 1M1KC 5JXSA 3CD6A 1SQGA 2W2MP 5GMKh 2MKSA 5LMNF 1S6OA 5DQIA 2E5LJ 4J6WA 1MWZA 1H3HA 1C0UA 2YNFA 2LXIA 3BJYA 4R25A 1J5EF 3GV5B 4RNFA 3MF5A 2JEJA 2NSCA 4LSLB 3CJKA 2QXFA 4E7JA 4F4XA 4B9TA 5HLFA 2WSCE 2HS3A 2VG5A 1JWWA 4Y2MA 5CO7A 4K5SA 1KQGB 2W2QP 1G83A 1U09A 4XU2A 4Z2XA 2HMIB 2RK1A 4RW7B 1AFIA 3M8RA 1X69A 1WXTA 3BBBA 5F0UA 3SQOP 1VQYA 3HT3A 5CD4H 2FTRA 3PR4A 2KU7A 2EG1A 4BBYA 1GEHA 1S0MA 1QSLA 2LJ1A 2HVHA 1IWGA 4F7VA 2KMTA 2A6OA 2FGOA 4WK1A 3UN2A 4PJOC 2RJEA 4HCKA 4WZMA 4FF3A 4L75A 3HVWA 2R4FA 2CDRB 4WXWA 1N8RC 4N47A 2CSIA 1WOSA 4GLKA 2PC6A 3ZZTA 3ISZA 4KRWA 4K5RA 1S72A 1YBUA 2Z2ZA 2XY6A 2XMTA 4ECSA 1HMVA 2KG0A 2ZUAA 1SSHA 3H4DA 1FRHA 1QVGP 5B0EA 4L59A 4JUVA 4OB3B 2MQ8A 2E10A 5M2RA 4M1KA 1UJYA 4IUUA 2ED0A 1QE1A 3CCJQ 1Y9OA 3V6KA 2Q6CA 3F0NA 4Q5VA 1TKZA 4AD6A 3NGSA 3M4GA 1DTQA 2FY8A 2G6FX 1VQMT 4NOHA 4ICLA 3CD7A 4J7CA 5LM7E 1T9XA 3QRQA 1GCPA 3J81U 4JI7F 4FW1A 3WHIA 3H8YA 5C25A 5G4DA 2VQEF 4YOEA 3UR0A 4HVZA 3GPLA 2MKJA 2EKHA 2BDPA 1RA6A 4AUKA 2LCWA 3MR6A 3WQPA 4HHJA 5A2QU 3D3CJ 5CK9A 3BGRB 4NOYA 4PXBA 4X4PA 3J80U 2VJVA 3OPKA 3HLUA 2EG2A 1J5OB 2SRCA 2OI2A 3JSYA 5A8WA 3R2DJ 4PK4A 3CCUA 4DV6F 3HD1A 4M7AE 3OBWA 2MYSA 3R9LA 2IM3A 4O23A 2HSPA 2EAYA 2MHEA 2HQGA 1MMDA 2DCUB 1X8DA 3NGUA 1H3DA 2KYBA 1JLFA 4ZPBA 1B7YB 2XYGB 2Q6BA 3KJFB 3BH6B 1SXLA 4OYBA 4XK8C 2NXJA 3D4JA 3M4YA 3MM5A 1ARKA 1TVRB 1BK2A 1N5ZA 2D3ZA 3M9MB 4ED8A 3HX9A 3PX4A 2DR9A 1GFDA 1Y11A 3B82A 3FSYA 1CPZA 1NE8A 4I56A 3E3XA 2HQXA 2V9WA 2EKNA 2XU8A 2LKZA 3HKWA 3ZXWA 1BHNA 3ENAA 4J9GA 4M7AF 4DV5J 3HHDA 5AJ3J 1FX4A 2Y1IA 1VQNQ 3O5ZA 2CNNB 5ITHA 4OF1A 3CE8A 1VQ5Q 2IVMA 3VGUA 1NZ8A 2OPPB 4F4WA 2W2PP 1QUPA 2CQDA 3TI0A 3QSUA 1MMGA 1M9SA 2E3HA 4M75B 2UXBJ 1CJTA 3G6ES 4NMLA 4O4GB 2R7OA 2VBXA 2CS7A 3TR5A 2V2VA 2QAZA 5KFZA 1VIFA 4KGKA 3JB9k 1TL3A 3OYMA 2BBEA 5KFHA 4OYZA 1JRIA 2QRRA 1VFJA 4X64F 2K1RB 1TK8A 4Z88A 3DI6B 3L7PA 3GYXB 1S6UA 2KT2A 4KV8A 2KG1A 1RAAB 1FFSB 3T1YF 1KIKA 1RI0A 3KLEA 1T11A 1VQLA 4HEA9 4CLYA 4F36A 3DCAA 1HNVB 4AL6A 1VQKT 2KRMA 2CREA 1FE4A 2HG4A 4NLTA 4EZ9A 2IC3B 1JLCA 4UOHA 2OEMA 4QYZJ 1WX6A 2CSQA 2B7BB 4KKOA 2E41A 1G3SA 4DBFA 4KFBB 2DRBA 5HP1B 2ZE2B 3AT1B 3HSGA 4DZ6A 1UJ6A 2HFZA 3W65A 4UQGA 2CPJA 4CLZA 2JJ4D 1YCSB 1RBAA 2DGXA 3G8SA 4DSEA 4KGZB 2DRKA 2DIUA 2F40A 4RW8B 1XOVA 2QGGA 2BRKA 2ESWA 3CJ3A 3NNAA 2COLA 2CZ6B 5HAOA 1GBQA 4BWMA 4OB1B 1VHIA 2LQNA 4PJOE 2K5LA 3DLEA 2JWNA 2DFUA 1JLEB 2XO6A 2E29A 1T0JA 2KXFA 1D3BA 2RSQA 2MWPA 4RKUE 1GMWD 3KHGA 1H2VZ 1U26A 2MSSA 4DQIA 3DM2A 5KFPA 1PSDA 3DRRB 2B4VA 3SFGA 2H4YB 3BW1A 3C12A 3OS0A 2JZ5A 1OPZA 4IFVB 2EC0A 4MAKA 4DQ2A 1LWCA 1U1KA 3GJRB 4N8OA 2MZSA 3EH1A 1ZSZB 4J9HA 4DZDA 2KHDA 2IJNA 3G96A 1HQEB 3CC2S 1ZZFA 1S4FA 3C6UB 2DILA 4J90A 4X4NA 3OS1A 2WONB 1U06A 4M78A 1RLQC 1YITA 1UEUA 3HHLB 4DQSA 2K2PA 4PJOF 1QDUB 4OIXA 2E5GA 4CQ1A 3RKXA 4DHVA 1V3RA 2AZ1A 3O5TB 1JLAB 3ZBDA 1KQ2A 3I6PA 5L1LA 5FLXE 1BE4A 4FW2A 1VQPA 1JJ2A 3IQLA 2YUQA 4ER8A 3VS6A 5CYQB 2AIRB 4N0AC 4DR2F 2Z0GA 1NB7A 4MZMA 2GFUA 3HKSA 1U3OA 1SPBP 5I22A 4WP8A 4PJNA 2UUWA 3MEDB 1QQJA 2M70A 2XMUA 2XI2A 2V34A 2L3SA 1T03A 2V63A 3MEEB 3EYZA 2DBBA 4OX7A 1MG7A 4ZVTB 1HQUA 1WHLA 3R5AA 3G4SA 4FP9A 3RKWA 3VCDA 2M7SA 3REBB 2UVWA 3HK2A 2HLTA 3I87A 2DBKA 3D6HB 4FVCA 3Q8RB 4TYAA 1S10A 3QJ6A 4V2SA 2V6AA 3PJ9A 1O0PA 3L2VA 4IOBA 2C0IA 2RRAA 3NKYA 2GO9A 2O66A 3EJMA 4F2RA 4ZVSB 4I6YA 1B7TA 4BI8B 1V9OA 4C3KA 3CPWA 2DH8A 1XTZA 3HXMA 2G9OA 5CKDA 1O9SA 3PYFA 4DR3F 4RBTA 2M1HA 4NS5A 1IHWA 1WEYA 4PFPA 4NLQA 1AYEA 1TG0A 4PRFA 3MPUB 1FWZA 4EBCA 1B7FA 2QMWA 1WNEA 3LLRA 3WVEB 2DNMA 2XM3A 7FD1A 1HHQA 4B3OA 4FXVA 1FTCA 1HBUB 3QGIA 4M5HA 1SJQA 4DLGA 2GIFA 2ZNZA 4WP9A 4QWEA 3RAXA 4LRFA 2DKGA 5H9FJ 3VV0A 4P7VA 2X3GA 3QGHA 4JUZA 2VQFJ 2KL8A 3I35A 3R6GB 1RAIB 4ETZA 3HL8A 2AYGA 2VG7A 2VHGA 2ADCA 5J1NA 3FQKA 3OFHA 1XC9A 2CG4A 5E41A 2OIHA 4ZP9A 2DHAA 4ZCMA 4J9LA 5L1JA 2C2NA 2CPFA 2JEIA 3RBDA 2ATCB 3ZEHA 4ZJOA 3G6YA 1S79A 4XTVA 3FVYA 4M78G 2XNQA 1YJ9T 5D0RA 4UT4A 2I0XA 4BACA 4NI2B 4IOCQ 2KRSA 5GAEI 3GV8B 3K59A 5KFGA 4EMGA 2R7QA 2DZCA 4EMKC 5I3UB 4M5DA 2ZH3A 2R57A 3PFEA 1B99A 3KLGB 3TSWA 3MUMP 1AW0A 3NS7B 5GANh 4RNOA 1HLWA 3IN5A 1UZHA 4DL4A 2YKOA 2DETA 2A7YA 4X9CA 2AX1A 3LGFA 1XMQJ 4HVWA 4JI6J 3NMRA 4IFYB 2GAGC 3GFHA 5ETNA 2AP6A 4PQUA 4ZGJB 3EDRB 5BXIA 4IUVA 5KYXA 2F4VF 1FRLA 4J9PA 1EX8A 1TUWA 3VVUA 3KG0A 2BKOA 5RUBA 3V4IB 2DXDA 1M3CA 2DL8A 3BZQA 1SRMA 3NL0A 2DMOA 4P2MA 4YB1P 1DRZA 5HQMA 2E1CA 3E01A 2VVKA 1U45A 3KUGA 2G13A 3NAIA 1RACB 1T0HA 2DVEA 3OLAA 5CKEA 1YJVA 4QQBA 1S0NA 1NJIC 1FT8A 1RT3A 4KBIA 2DNOA 2JMCA 4P10A 1MU2B 5DQHA 1R8AA 3JAMY 2CYYA 3HVRA 4EYHB 4I4BA 5CHCB 1K0SA 4OHZA 5JJBA 2V8KA 3CCJT 2KXNB 3GJTB 2H51B 1PKSA 2GVDB 4B9LA 1VQKS 4B3SF 2OMLA 5I2SA 1Y57A 2DAQA 2LP5A 4P2FA 3CXCS 2W9AA 4MT1A 1S1UB 1FMKA 1K9MC 4FNIA 4C11A 4P2XA 2DRDA 1VYVA 2GFFA 5GAOl 2QEXT 1RT2A 1SCJB 4NCBA 3KUEA 4ANDA 2BQUA 4F4KA 3FZBA 3AHPA 4PG4A 1S1XB 4EMDA 5U47A 2QO3A 5LJ3h 2FPHX 1KLNA 2CJQA 4R0KA 4TNOA 3HT0A 3QIIA 1IUJA 1O75A 3ZZOA 4DV3J 2DXUA 5CKHA 1PIEA 1WACA 4NLXA 8AT1B 2VF3A 2F8EX 1UTAA 2ED1A 4NEZA 1K8AT 3OR1B 3C6TB 2ZZMA 3KOAA 3DRSA 1X4FA 2HNYA 4LDWA 2ZFHA 2NUPB 1C1CB 2A37A 2MPUA 1SH2A 2HIQA 3MAQA 4QT7A 1FXXA 1CQMA 2CVEA 3BH7B 1OPKA 1ZH5A 3EFRA 3H0FA 3KNAA 4FPRA 5L23A 3KTQA 1PWTA 4OX9J 4C8LA 1H38A 2AGPA 3A8HB 3MD1A 2B5JA 4I7FA 4JI1J 1M90R 4HT7A 1X60A 4GVLA 2LJ3A 3ZNJ1 1YIJA 2F3JA 3FFIA 1UFFA 1XNQF 1HI1A 3H7HB 1RAHB 1PKUA 2CA9A 1PYOB 5LJ3Y 2MHNA 3U1LA 5IHKA 1TUDA 1CKBA 1J3TA 3SCLE 3I5AA 1K0XA 5BR8F 3OTCA 4OYIA 4RU9A 2NXNA 4CM0A 1F1BB 4JV5J 2RS2A 3H5SA 1UW9A 1RTJB 3SSSA 2CPYA 4JRQA 4Y3CA 3MECB 2ZCFB 4CLKA 1G2EA 1ZTWA 2ZD1A 2FVPA 3CC4Q 1GXLA 3V5RA 2IAJA 1T3OA 1UVNA 2AKLA 3JV3A 4BWJA 2ROPA 3NTIA 2Y4YA 2PDAA 3L42A 5ETVA 2IM0A 1JLBA 3S1TA 2KFNA 1G4CA 2E6ZA 4B3TJ 2B6AB 1M4ZA 5GMEA 1AUDA 2ZEJA 4O3RA 4OX8A 2VA3A 3OUYA 2HEQA 2EJFA 3N0VA 3MM7B 1Q5YA 4RTWA 2A6MA 4H4KC 1S0OA 4M5NA 3RESA 1QW1A 4EEYA 2VPWB 4KPYA 3LGLA 2GGRA 2JUFA 1GL5A 1R8BA 2W0ZA 3M8ZA 3GIMA 1YJWS 4HL9A 2JFDA 2A28A 3PFOA 4BI4A 5HCKA 4X1VA 1X7VA 4TVAB 1MGQA 1KVIA 4CO5A 2JVOA 3A3OB 1HR0F 2KDSA 3TUZC 1Q7YR 3ET6A 5D0GA 4CM2A 5F8MA 2JTMA 3ILIA 3IC1A 4OVAA 3C15A 1VK8A 2J6OA 3JCMQ 4HKQA 3SDEB 1QVPA 2KM8B 3K5OA 2J06A 1WF1A 3GLJA 3KYLA 2H9ZA 3EAEA 1BQNA 3NOGA 3OMCA 2UXCF 5LOQA 5D7UA 4KY3A 2JLEA 4ORZA 4LFBF 5A8RA 3I0RA 2EJGA 2YNHB 3MEKA 3OW2R 1NXIA 3D9BA 2JC0A 3SYZA 2FLPA 3KJVA 2ZBPA 1RI9A 1ZETA 4YB6A 1BI1A 2P0QA 1FXRA 3KLFB 4R0EA 3OTOF 2EQKA 1H92A 2DTJA 4J9CA 3MCSA 3CBOA 1FJEB 2BIVA 5C24B 1WHVA 3EH2A 3H0HA 2QJ3A 3V8JA 2E5LF 1YRXA 5LJ5j 1OMSA 3PACA 1ZS6A 3KFWX 5F3ZA 3I31A 1AVZC 4LNPA 4OYMA 3ZFJA 1UHCA 1UZDA 2RNEA 3QIDA 4MFBB 4KGXB 1VQNA 3KK3B 2JNGA 2VUBA 1VQ5A 4XTXA 3PR5B 3VQSA 1TKXA 4WFNQ 5GMKm 3CMEQ 1TK0A 5F0WA 5T7LB 3AAWB 1IKWB 3UA6A 3M0RA 4JI3J 3O3LA 4A47A 1DJ7B 4NLUA 1HJDA 1QAYA 2FJVA 3C66A 3K5NA 3DNCA 1YJ9S 2ABYA 1VYAA 2RI2A 2E44A 2KJVA 1NPKA 1FD2A 1FJ7A 4M77G 2WVBA 1UGPB 5G0RB 1WF0A 1OSCA 4H4OA 2H4WB 2L3MA 2IYIA 2H5EA 2WACA 1GNKA 1S1WA 1CJUA 2M0GB 1IKYB 1UB4A 2HBZB 3AQOA 3JQJA 3FBCA 5F8HA 3HRTA 4NCGA 4OP0A 2V2QA 4DDFA 2YWKA 4DS4A 5IOLA 3W5XA 1RT4B 3C3LA 4ZVOB 3HCXA 4TQSA 3JCMW 1NHUA 3DN9A 2V67A 1YJTA 1OS5A 4R5PB 1KVKA 3S8SA 2OTJA 2CKKA 2I0NA 4CH1A 1QVFR 3NS5A 4OLPA 2YPYA 1NBEB 1BI3A 1N5SA 4X9DA 1WG5A 1HBNA 4Q7AA 3K17A 1OZ2A 2QK0A 2D8JA 4RO0A 1W2IA 1L3TA 2RQTA 3KLHB 4M63A 1N88A 2AZVA 3OW2A 1U02A 2R7VA 1YCYA 3UN5A 1RT5B 3WC2A 4C92A 5GAN6 1G3OA 1YGYA 3LOUA 2O5DA 3I4HX 1SKUB 1YZ7A 4HHHA 5L8RE 3KDNA 4PXEA 1GH8A 4F26A 3GP9A 3LH2S 2Y90A 2CPXA 3PV8A 4B9XA 2ZZTA 3GFYA 4IRDA 3OTDA 3QBYA 3RUBL 2MY7A 1RAEB 4DQPA 1SJ1A 4DEYA 1QUVA 3WIVA 4C8QB 3VHQA 1V3ZA 1CJVB 3CCJS 3A8OB 3D0GE 4C0FA 4U95A 5D6YA 1UFLA 2LQ5A 2HFUA 5EN1A 4DBQA 1M30A 4DPYA 3SFUA 4EMKB 1B70B 4PLIA 5IT0A 4PYAA 1F2GA 4UF4A 3H6ZA 2QSWA 4J9FA 2UVUA 2WSEC 4MKAA 3GYNA 2ZM6J 2W8KA 4IIOA 1WZOA 3TEHB 3SCKE 1A0NB 4NZ6A 3JCMb 3HFVA 1Q81T 1GCQA 2QEXS 2MJUA 3RRHA 4C92D 1X2KA 1PC0A 2CVIA 5A0LA 2WBMA 5CAIA 3MAAB 4X34A 4J9SA 2E70A 3IXQA 1WELA 4JS4A 1RLDA 5ETSA 2QL5B 3M6VA 4OMFG 3PJXA 1BB9A 2AYBA 2VBYA 3MMJA 2BE2A 3GIRA 1DARA 2GBQA 4ZK7M 4C4WA 3OS2A 2GO8A 2VFVA 1M2VB 1QVFA 2COWA 3DHWC 1P92A 1RU1A 2ZPHB 3V4MA 3RGIA 3KMQA 2P9EA 2XLIA 5KFDA 3JCMc 3SQGB 5E3RA 3JCMe 2CRLA 2UXBF 4M75G 1IR0A 3CC7T 3N9UC 2HZAA 2RAQA 1K73T 1BWVA 1YX2A 3N28A 2HQHA 1NK5A 3UATA 4F0KA 4ZVEA 3M7VA 1G3YA 2K4YA 2QDLA 4QWCA 3W2WB 3HPWA 4ZVFA 1X0PA 3C95A 1MN7A 1RU2A 4AFZC 3ER0A 3ONQA 2W4CA 2DL4A 2EFVA 1RADB 3QPIA 2P5VA 4A4JA 4MMOA 1RL2A 5EG2A 5K8MA 2MGZB 2OMOA 2Y1RI 1R8HA 1RB0A 1PCXA 3AY0A 1M5KC 1K8AU 1RT6B 4XIUA 3VRYA 1GBRA 3BREA 3R5GA 3DOMB 4O4RA 1WORA 2PA8D 1I94J 2EK6A 1IKXB 2FUG9 3WDOA 1LK7A 3ICLA 1LWFA 4KE5A 2L48A 4CRJA 3MPVA 3ITHA 2GNCA 2KE9A 4Q0BB 2VH7A 2PEBA 5CCMA 3QDFA 1U0HB 3QGGA 3UT1A 5FJ4A 4YR2A 4NLWA 2XK0A 1ZBTA 5GAGI 2R2TA 2KK4A 3OFGA 3R7SB 4JS5A 3ASKA 3CCEQ 2DM1A 3B78A 4ZCIA 1IJFB 2V1QA 2YRDA 4DJBA 3RMQA 2R7SA 3ZTQA 1U1RA 4YEAA 3CIMA 2I6WA 3H41A 2KN4A 2O31A 2B4PA 2GMHA 3X26B 3CCLT 2YX4A 2EYXA 2CT4A 4PNOA 1H74A 4WFAQ 2CDQA 2DD4A 2CUDA 4DPWA 1OJ4A 3BN7A 1KHCA 3HFOA 1NM2A 4JJBA 3I5RA 4K11A 3KJQB 1FDNA 2FVUA 3CJ2A 4ZLNA 3Q8PB 5HVGA 2P4RA 3IBFB 2LQBA 4JP8A 1AWJA 3A3PB 5FWCA 4BY6C 4CYUA 3CXCR 3QAUA 3CD5A 4OB0B 4AE5A 4PG7A 3PRBA 5HK4A 2PVDB 4Y34A 4NA3A 3TAMA 1QVGS 2QZ8A 4MMLA 5FRMA 2XO7A 3D1OA 3EGUA 3AB4B 1N6QB 2NYSA 1H6KX 4O44B 3MOZA 4LSNB 2EJ9A 3L09A 2KNBB 2ACYA 3DHXA 4PABA 2VC8A 3J7YI 2C28A 2IIHA 2DGOA 4RZRA 2IRYA 4L74A 2ZDPA 4JJCA 1KDNA 1OSDA 2IJFA 2B9EA 3C0CA 4H4MB 4LDUA 1S6QA 4C5GA 4Y00A 1OO0B 2P84A 1G8XA 4BI3A 4FN5A 1U1TA 2YQ3A 2V4QA 4DR5F 1AT1B 4Y28E 3R8YA 2KHCA 3TVZA 4M7AB 4F4ZA 2HL5C 4F50A 3OJUA 4XAKA 4R55A 2AGOA 3QIPA 2EFGA 1QLNA 2ZPGB 3O8VA 4ZKAA 1FNOA 4ZJQA 3GSIA 2OX7A 5CQXA 1VQ7T 1LOUA 2V8IA 3OYJA 5GAOq 1T0TV 5IV3A 3I0SB 2CDTA 5C42A 3M8WA 3FK4A 3DLJA 2HS0A 2HDAA 2MB0B 5M2PA 2R58A 1N34J 4ECYA 2YLBA 1X6GA 3T5LA 1UWAA 4OJ3A 1TUGB 2YKQA 1KLMB 1YBYA 3X28B 3POTA 3OR2A 3B8HA 4AQYJ 1YI2Q 2RE1A 1CJKA 3P8BB 2DEIA 3GFZA 3HSBA 3G7ZA 4X4SA 3IMQJ 3RR8A 1TUVA 3DLGB 2CP5A 3K89A 5KG7A 5D4OA 2W8LA 2B8AA 2XWYA 4KAIA 4A8FA 2CJKA 4L72B 1DJ0A 3UCZP 2RQUA 2LXFA 2WVDA 1PD0A 4OZ2A 1RT7A 3U7JA 5B0BA 2MKKA 5GAOr 2YNIB 4YHHJ 1S49A 2KYZA 3VYGA 1EETB 2CNLB 2V5HG 2JNJA 3MXHP 2XWXA 4PPZA 1S1NA 1HI8A 4FKXA 3PTAA 2R7TA 1YJNA 1GXIE 3FRYA 4M7DB 2HNDB 3TZYA 2Z56B 2XMKA 4EIKA 4TY8B 1WHHA 2OO4A 5EX0A 2RHZA 1S9EA 2DB1A 1FERA 4DEZA 2KRBA 4NCAA 1S76D 3OYDA 2DA9A 4ECWA 1SF9A 1WLPB 3JB9J 1ICEB 3QJYA 1D0EA 4PWUA 2M4MA 3GIBA 4O6JA 3CJ0A 2DO0A 3EICA 4DL2A 3FB9A 3W9JA 5B0CA 3IGNA 3M2UA 3IR6B 5DZ6A 3GPAA 3IA0A 3M9QA 3ZC4A 1NKEA 1D9FA 2KFZA 4K4XA 4HT5A 2K57A 1T9UA 2XY7A 3R5DA 1B3TA 2VQFF 3IM8A 1YG0A 1Y96A 2Y8WA 3FC9A 2OFHX 3EGDA 4LD6A 5LMUJ 2GMJA 3OSPA 4FF4A 4F0MA 4YR0A 1S1VB 3LGNA 4BS2A 2KGTA 1F9EB 1L3SA 3MWBA 1PJ7A 2CP3A 3VTIA 1LVKA 1XQIA 3WZ0A 4QPTA 1I07A 3VAIA 1U7LA 4WCIA 1N9RA 3LAMA 2PT0A 2VOPA 2V8HA 1IQZA 2EYQA 1QCNA 4IO1A 1SL1A 4J9VA 2DPJA 2YBVA 2AV5A 2DERA 2NXEA 3SWNC 1FMWA 4C92E 3QFHA 2RU3A 4XTYA 5E3PA 3UDVA 2MKYA 1B0VA 3VALA 1EIFA 1SC6A 5KAKA 4OHYA 1FX7A 3JCMg 1VQOA 1XBWA 5F41A 1UG1A 4IH6A 1XMQF 4JI6F 5GAN5 2NWMA 2IM2A 2VDIA 3H0PA 5D4NA 4V1Ak 3CC4A 3VRZA 2K6DA 1CULA 3T41A 1RAOA 4USTA 2HBWA 1CLFA 4ELTA 4AFQC 1WFWA 3CMQA 2ZWOA 1I1JA 4IYQA 1S12A 4C8ZA 2ZH1A 2IBKA 2IFXA 3OYHA 3NNCA 1OY8A 1FRIA 3EZOA 1K1ZA 1P9YA 3I5BA 4B9WA 5DLGA 3CC7S 2XCPA 5GAOn 3MEVA 2GC8A 2HYIB 4RW4A 1FJGJ 2N7CA 1Q81U 2RHSB 4WE1B 3KK2A 2OD6A 4ZTJA 1N5TA 1RTDA 3VVTA 3BN4A 4PL6A 3U23A 3PYEA 3CD0A 5E0OA 3GG1A 4PWDA 2DXTA 1GFCA 3FMWA 3J81j 2WB4A 1SV5B 2FZGB 1Q79A 2PD1A 1F0XA 1LFPA 1BCMA 2FIUA 5HL7Q 1WC3A 2CP0A 2HFSA 4G1QB 3UWNA 2YKPA 1LW2A 4DQRA 4ZVGA 1VQ6S 4WCEQ 3CJ5A 1TQLA 2NXCA 1PRLC 1YWPA 2MQMA 1JLGA 4A8OA 2NQPA 1Q86R 1BD6A 4J9OA 3M8YA 4LF4J 2LDYA 5E3CA 1JXMA 1WA7A 1K73U 2CFXA 4ECZA 1JMTA 8RUCA 3C16B 4QJVA 2NZCA 2HHPA 1NDLA 4MKBA 1AZGB 3Q8YA 4ED0A 3QRRA 1FEHA 2MDAA 2VKZG 5IM0B 5J2MA 3L2ZA 4PZVA 1S5ZA 1PJ5A 1KC8R 2ASLA 4DL7A 1BI0A 2DEQA 2DIVA 3MUTP 2X1GA 4W98A 3CCLS 4IUFA 4XPEA 4DFMA 1BIBA 1LFWA 1C0UB 3WC0A 2YNFB 3IRXA 1S9GA 5FLXY 2RN8A 1FYNA 4X4QA 2CZ9A 1AZSA 3JAMU 2E66A 3KHLA 2QA1A 4F17A 4DV3F 3CJKB 5KG0A 3LF0A 5HLFB 4P2SA 4G65A 2VG5B 4EI2A 1OULA 2JC1A 3L7UA 3I56S 3CCST 2W1BA 4U8VA 2OELA 1HNWF 3E9FA 2RI3A 5DO2A 5DLOA 2J6SA 2NREA 3MHXA 4P9SA 3DLHA 1WOPA 4KULA 3CMEA 1VDHA 4C0OC 1BUXA 4ECRA 3CDEA 1MNDA 2F63A 4TYBA 2NZ4A 4OX9F 1FEEA 2HBYB 2Q1LA 1VGYA 3V7CA 5C5JA 3GCXP 4JI1F 5D3GA 3CCQQ 5DM7Q 4E47A 3AD7C 1F9HA 5LL6S 2K79A 5KG6A 3TVKA 1TOVA 1LK5A 2VA2A 1RYRA 2KRRA 4AG2C 2OTLT 3CMAQ 4FSXA 1NK8A 4ELVA 3QJLA 2ZBIA 1HMVB 2FJAB 3TVYA 3LW5C 2DRMA 4CO0A 1SHGA 4DX5A 2DR6A 2QC3A 4JV5F 4JV0A 1YQHA 2RKIA 3CCRA 3AXMA 3CJSA 4PFZA 2MKCA 1QE1B 2C1EB 4U7UK 2O3DA 3P5BP 1MMLA 2F5GA 3H20A 1TKZB 2MK5A 1M5PC 4BHQA 2HQEA 1VQ7S 3Q8UA 3A1YG 2KH9A 4ICLB 4FYWB 4L3KA 2D0QB 4CDIA 3ENWA 1NEEA 4WFYA 2FVQA 2QX0A 2DJWA 1K1QA 5C25B 3QBCA 4RU2A 3QXEB 1LJOA 1UMJA 2BANA 4I6AA 5KE2A 2VD3A 3KWMA 3G8TA 4OJGA 2XLKA 2GCXA 4OX6A 4U7CA 3N5FA 1UJ5A 3W60A 2MI6A 4BB7A 1VQ9Q 4WIQA 2XC9A 2FGCA 5A8WB 4LF9F 2V2KA 3PW2A 4AFUC 1DQ8A 3TA0A 3OD2A 2CXEA 2R8JA 2CUBA 1CQNA 4JI4J 1SIWB 1JJHA 5GJWB 1XJWB 2EVZA 1KRPA 1X75C 1QWFA 1WDTA 1SEMA 2VC0A 5KFEA 2G2ZA 2OPSA 1KQ1A 4DPOA 1TU0B 2B9YA 2HHSA 3IR7B 4RW9A 4OZ5A 1REGX 2CNOB 1JLFB 2IG0A 1FI4A 4ZVHA 1K9MT 5HMWA 5HANA 3MM5B 4HCCA 3OS5A 4HCBA 1VQ8Q 5KCHA 3BS9A 4I2PA 4N7TA 1P27B 3QJJA 1HYSA 4DFJA 4OZ1A 1D1AA 1QVGR 2UVRA 4ZPTR 1D09B 3H98A 1YBTA 1JBMA 2PGCA 2BJ8A 1NLPC 3X3UA 5KYWB 2CJ9A 2CT3A 3UD5A 3S6WA 4QPXA 3RBZA 1LKZA 2HAIA 5LSLA 2BOAA 2R7XA 4PXDA 3K5MA 1FRMA 5GAN3 3UW1A 4MTPA 1RWOB 3SIPB 4IRKA 3PJWA 3IWXA 2YSQA 5DLFA 4J9NA 2HVEA 1OQ6A 4KB7A 4GO5X 5CCLA 4X4RA 1SQFA 2F69A 4OMPA 1Y07A 3D67A 4M95A 2RO0A 1CJTB 2MQQA 3HHNB 5EWFA 1M8VA 2ZBQA 5BYSA 1UHFA 1JJ2P 3NAHA 3M6UA 1IBLJ 3MMBA 3JYTA 1UGQB 2B8PA 1NZ9A 2MOXA 2B9WA 4BC9A 1VR6A 1TL3B 1RLCL 4DR1J 5SUHA 3Q8QB 2F8HA 1N5YA 3MPWA 3MMAB 3GF5A 5DQGA 2Y9HA 3V81A 4K4ZA 2E65A 1QLYA 3I55S 1OQ3A 1JLQA 1RWNB 3JB9D 5BYRA 4KV8B 1MLAA 1S59A 4J9DA 3KLEB 2HMAA 1ZUYA 3G71A 1W4SA 4OHWA 2NS1B 3FKBA 1LV5A 4ATNA 2J05A 3DLLQ 4OJ1A 1A0OB 3QKJA 1U5SA 1LQ9A 3UNYA 3LWMA 3RB6A 3SBMA 4M77C 3TVTA 1UECA 1UEVA 1WI8A 1JLCB 4JYAJ 2CQBA 1HBMA 4X2BA 4QVZA 4WIIA 1ZX6A 4K2XA 4KKOB 4PJMA 3NXZA 2PE8A 2C06A 5IAYA 2LVWA 2B4OA 1EP4A 1RA7A 3F41A 2LFVA 3CPWP 1NH8A 3MP1A 3NCPA 1FKPA 3IAS9 2Q79A 3CCEA 1U1NA 1QVGA 1NZAA 3NWRA 4RG8A 2ZH8A 3ULHA 1UDLA 4N4IA 3CB4A 2DHXA 3F56A 3LGMA 2HQIA 1UJ0A 2EKYA 4RUCA 1WTFA 3CJTA 4XTZA 3UI3A 2P4TA 3P3DA 3N6LA 3A8JA 2PZ1A 1HNVA 3DLEB 4P52A 4EBEA 1U1SA 2ZH9A 1VQ4Q 2EKOA 1WPYA 5CH7B 5IT9E 1D3BB 1RAJA 3MM6B 1AWWA 1RTHA 2OD4A 5GAMe 3DM2B 4HTJA 2GCFA 2NYHA 2YXLA 5KFXA 3M2VA 3B6BA 1WDXA 2F5TX 2QGFB 2A10A 4LR7A 2DYBA 4NE9C 4KFBA 3A8LB 4C8QG 2DNKA 1XTDA 4DV0J 3CTRA 5EGYA 2L3QA 1LWCB 2DGUA 2MF2A 2ACMA 3I5CA 2ZH2A 2JLGA 3ZZYA 1K8AC 3BSAA 3PG9A 4XO0A 3UD3P 4JPBW 2OSRA 3BGFA 3UN3A 3GONA 3HRSA 4M78B 3ZZUA 2IHR1 5KG2A 1M5VC 1YKWA 2C3OA 2VL1A 4DSFA 2XZDB 3LGHA 5LJ5e 3VYHB 4C0ZA 1ZBJA 4QCLA 4O0IA 4QYRA 3Q8VA 4USUA 5KFRA 2EQUA 2DD5A 4DI6A 1GTEA 2UZAA 3W9HA 3LALA 2QFIA 4E7ZA 2IRUA 1YITQ 2FL7A 2PO4A 2CAJA 2YH0A 2K5IA 2J0WA 3KLVA 2HD0A 6AT1B 3CCSS 2PIIA 2IMWP 4DOZA 2GX8A 4EDUA 3A4TA 1HW9A 1T03B 2RM4A 1VQPQ 4DU8A 4WFXA 3QPHA 4MJKA 2H1YA 1HQUB 3PX6A 2LMJA 3THPA 3QJPA 2CUYA 5FROA 4K50A 3N4WA 3JSMA 3HHLA 1IGQA 4URGA 4TXSA 3TA1A 1YI2A 4II1A 4C8YA 3MCMA 2WVEA 3KK1A 4IG0A 3LP1A 2D0NA 3W61A 1IGUA 5E2QA 4O5VA 5KFKA 4HI2A 2OTLS 2X4XA 1U48A 4M75C 1AB8A 3C94A 3GFXA 1O8BA 3GWCA 3IAM9 2HGMA 1VRTA 1AWXA 1FDDA 1U2FA 4Y2AA 1I94F 1T9TA 2D41A 3RDVA 2AJ0A 5KYUA 4IUPA 2C2OB 3VAJA 1JEGA 2KYXA 1N8RR 1D8ZA 4IR9A 4LUEA 3OYEA 1BLUA 1U49A 5GMKa 3D68A 1F3FA 4BE0A 3GR0A 1XEZA 2Q66A 4ETXA 3V6JA 1SL2A 4OYOA 1Y3JA 1T05A 4NXNJ 4KTQA 1RUWA 2XB2D 4CO4A 3CCVT 2HFVA 1RAGB 4B3OB 3FRNA 1BQMA 2YRCA 1NUEA 1X6OA 3UWTA 4N56A 1NJWA 3FQLA 2KDOA 4D8KA 3H4BA 5DG7A 3HHLD 3EXCX 3NP5A 2AGQA 4NA1A 2QG9B 2O9VA 4B3MJ 1QSSA 3QZ8A 1BKBA 3OBYA 2VG7B 3EGNA 1D1UA 1UGSB 3FDRA 1Q8IA 3CEYA 1KQSA 5HBMA 3M55A 1FTRA 2N3OA 3HMJG 1R31A 5AE2A 5KFIA 2XYHB 1TSFA 3T9ZA 2RPNA 1L3KA 4DOWA 4J7IA 3FBFA 2HK2A 3QATA 1S7IA 1SSFA 1H7WA 3EPGA 2XKOC 3BO4A 2BJ7A 1NJYA 2LECA 3MR3A 2Q3PA 3PKMA 4EUVA 4B6MA 2CJYB 5FIIA 1HBUA 1SB6A 3M8PA 5D78A 4M5DB 1R8CA 2XLJA 1JJCB 2GMLA 2XMJA 3GIIA 2QLJB 4AL5A 1PSFA 1W26A 2W2OP 4WYLA 3T5HA 4IR1A 2CH4A 4K4VA 4P5NA 4JI0J 2LCLA 3TJ8A 4H54A 3CD6T 2DIQA 4PQUB 3JB9I 4M7AG 2B0GA 3VGSA 5KYXB 3ISNC 4Q5WA 5GANf 4IOAQ 2RJFA 4OMNA 1GMVA 4MIWA 4RJVA 2LNVA 3MM8A 4A4GA 3PZPA 3ILOA 4PJOA 4PR6A 2I2LA 1UETA 1ZSZC 2HZYA 4ZCKA 3UQSA 2DNGA 5IQ6A 3FBBA 2MZTA 4MK7A 2V8JA 2RQRA 3N6MA 3D54A 2QL7B 2V50A 3E01B 5J1PA 3CCMS 4WU3A 2DNNA 2DXBA 4J9IA 1PG5B 1N5VA 2EXUA 5AE1A 1N34F 1REVA 1VQ6A 2AYMA 3QWPA 2QTWA 2EWHA 1N27A 3WXMB 1ZM9A 2DNLA 3EWGA 3DRXA 1RT3B 4AQYF 1HWKA 1N4LA 4ZN1A 3OXFA 1ZAXA 1GK8A 1QTMA 2A3LA 4LF5J 1Y3KA 3FUYA 3Q2SC 3GCWP 4O3SA 3U27A 3FJ5A 5LL6d 3OYKA 4UUWA 3D6MB 3P8HA 3ILJA 3Q2TC 3NLCA 3PRVA 3K5LA 3BY7A 2QN6B 3EGWB 4XPCA 2C0TA 1S72T 1RE1B 2W9CA 3TYTA 4YHHF 4UTGA 1OX9A 2ZC4A 3VUZA 3P4UB 5EWGA 1OYDA 3DDKA 4HH0A 1RBLA 4W92B 4LDYA 4GKKF 3VS3A 2ZHOA 5KH6A 4PLLA 4M7DG 2QLFB 1Q8BA 4MDWA 3A98A 3LANA 2X3WD 1Z2LA 2G2OA 1RT2B 2RNAA 2IMOA 1HWUA 1D0YA 1F5BA 3JB9F 3MHYA 5KYYA 3M32A 4FSSA 1RWKB 3BYPA 5GAMg 4F67A 3U1MA 3QHSA 3MCAB 3T19A 4JI2F 3CT9A 2V8GA 2DE0X 5HK0A 1M1FA 3UPFA 2ZH6A 2LEBA 3GQCA 1DFDA 1YWOA 2R42A 3BR9A 3KXDA 2F5KA 4OYAA 1ZM2A 3JSBA 3DRSB 1QAJA 5HI7A 4IKFA 2HNYB 4HI1A 1NDKA 3OXGA 3P5TL 2AU0A 3M0QA 1Q81C 3CCUT 2PQWA 1GFWB 4C8KA 3IR5B 3MDFA 4WZQA 1IM4A 2BUDA 5LMUF 3MR7A 1VIEA 4IDKA 3T5JA 4RCCA 3LUYA 4ZLLA 4ZOSA 2HQDA 5JUMA 2VZ9A 5L1IA 5LJ5d 4KBMB 2B5JB 2FPFA 4PJJA 4B02A 5LJ5g 3US5A 2FB0A 4F02A 4LT6A 2QA4S 2MMYA 4HDHA 4WPAA 4C8NA 3CCQA 2HEKA 1VISA 1HNIA 2ZBRA 1XR5A 1F60B 4UUXA 2AT1B 4M77B 3CMAA 3J7ZT 1Q7LB 4EO8A 1RWXB 1K73C 1VYUA 1YIJQ 1WQ7A 3NGTA 2E1MC 2LVMA 2ZD1B 2G0IA 4C8MA 2GQVA 1IHVA 1YVFA 2IAJB 2XMWA 3SFMA 2YKMA 3OYFA 4TLRA 2JS2A 2YKNA 2VGMA 3INZA 4M75F 1NDPA 4CTAB 2QIFA 3AOBA 2DTOA 1KSWA 1JLBB 4LBPA 1FHTA 3MUVP 2I2YA 2V8PA 3DDNA 1H7XA 2NUTA 1D9AA 3NBPA 3DYAA 3RR6A 3H8ZA 1TH7A 2HHHJ 2OGUA 2DGTA 4USJC 4FBUA 1AUSL 3OUYB 4USWA 1WXBA 5HSPA 5LSOA 4OZJA 2PNIA 4Y6IA 3DLKA 3TJ9A 3KUHA 5KG1A 1AOJA 2GIQA 1OYXA 2A08A 2JTEA 2P0PA 1FJGF 4J9MA 2V2ZA 4F7UA 3OW2P 2JLFA 1AXQA 2IJRA 1EAYC 3M0UA 2K9GA 1VQ9A 3JXOA 1T3SA 1C0MA 4M5IA 5HVFA 5IQQA 2OPQA 1L5UA 3GSDA 1LW0A 4RUGA 3FDSA 1HHTP 3ET6B 2ASJA 1JB0C 1EHWA 3C15B 4ED4A 3DDIA 2R5MA 1WD6A 3MGJA 3G9CA 2CP2A 3JCMf 5GMKj 1VQLT 4DA4A 1BQNB 3HVTA 2DK2A 2UXDF 5KFQA 4I64A 5F9LA 1F5AA 1M3BA 3D1QA 5CA5A 5A8RB 2LZ6B 1AA1B 3W8PA 3I0RB 2PN6A 3MM7A 4LF4F 1JU5C 4X4TA 1A9NB 5KFBA 2RUSA 4N4GA 4KHPJ 5F8IA 1VQ8A 1FFWB 2MTLA 3HD2A 2EVRA 3E9GA 2D8HA 1SC1B 3HFNA 2OJ2A 3KJVB 1TWBA 2A0FB 1IXKA 3LAKA 1ZLMA 3CCVS 4DV6J 2NUUG 3W9IA 4ED5A 2KXDA 1G2BA 1JXVA 1ZHIA 1E6GA 1LWEA 4LJMA 2BACA 4KT0C 4OL8A 3EFOA 2VFSA 4Q2LA 2UV8A 4OZ0A 2HSEB 1CG2A 4OYXA 2UVVA 1K47A 5FD1A 3MOJB 3RMSA 1NDCA 4QKUA 5IS2A 3OL7A 4FS1A 3HJFA 2DHSA 4AMCA 4FU6A 3I55A 1URNA 1VIXA 4OMFB 4ZS6A 2F2XA 2RB7A 5KOWA 1U47A 1VCTA 2YNHA 1EFNA 1QVFP 2Z2YB 2FRWA 3ETMA 1GT8A 4CCHA 2FRYA 1HWIA 5IHIA 2HAFA 4DX7A 2DRAA 4FS2A 1T95A 4H4OB 1M5HA 2AJFE 2KVQG 4NZ7A 2RQVA 1JXOA 1IBMJ 2E6NA 1S1WB 4FM4B 5IZHA 1CJUB 2V4RA 4N0AA 3DLMA 2JS0A 2F4FA 2DVJA 1ZAWA 4KQZA 3QT7A 5A8KA 3JQMA 4ZLPA 2HIYA 4NCGB 2O01E 2DL5A 2AZ3A 5DDRC 3HTRA 2DITA 3AJ2A 3IBWA 2FHKA 5GAN2 2A36A 5FLXU 3PW5A 4LF8J 1YITT 2BTTA 3CD6S 3DGPA 3PVLA 2QL9B 2JVRA 1Z2ZA 3DLLA 4MK8A 1RWMB 4P75A 3BQ1A 5HQ8A 2WHOA 3WX4A 1QY7A 1PILA 1C4AA 3D0HE 3RERA 4B3RJ 1VQPT 3TEEA 3GJQB 1HBNB 5B0DA 4F4YA 4EZ6A 1KEKA 1YHQA 2DCLA 4FT4A 1R27B 1NKCA 5IC4B 1WHKA 4Y65A 1NM7A 4GMKA 4DCJB 1HPZA 2BXJA 1GMWA 5GAHU 3Q24A 4M5MA 3EZ5A 4USHA 2DO4A 4W4MA 4QWDA 1FRJA 2VASA 4C92B 2HNZA 3M54A 2SXLA 2OTJQ 4M94A 3TAPA 3MURP 4D3HA 3BV8A 2X9HA 3RAMA 1O5JA 2VOOA 4EPCA 3IM9A 5J2NA 2X35A 2CQ2A 1NRKA 1H72C 1JO8A 4QW2A 3MR5A 1RCXB 3ENQA 4PQAA 3QYGB 3PEJA 1E7OA 3G4ST 5AE3A 2Y1LB 2J5AA 5T41A 3G82A 3O8WA 4YY3J 3NTHA 2VB6A 2H8HA 3TOQA 1KFDA 2POKA 3TRGA 2RQMA 1VQ4A 4JI4F 3OL6A 3QDRB 5EC7A 2W24A 1B34A 4LRAA 1S57A 4A63B 2OH2A 3GP8A 1S72S 4DEXA 1EARA 2DY9A 2RDIA 5LSRA 1A6LA 4USIA 2ZJPQ 2CQIA 4LUBA 1ABQA 4CC4B 4E98A 1NJIR 4Z8AA 1OU8A 3GR1A 1DLOA 2RH2A 3CC2Q 2E7WA 3AOAA 2KB2A 3SEMA 1Y00A 3SV4A 6FD1A 2RU9A 2XMVA 4PWWA 4A8WA 1ZAVA 3AA8A 2DLPA 4G3IA 4G1IA 4RNMA 3OL9A 1TMMA 2VONA 2FJDB 2EYYA 3S3OA 3JAME 2EPIA 4J9UE 2D9PA 1FESA 3HP9A 2KM8C 2BE2B 2DT9A 2BRLA 3G2XA 2M16A 5HVHA 3PE0A 2EFQA 3TZZA 4JI8J 1WKJA 1K9MR 3MP6A 3CJQA 3CJ