4ZN3A

Crystal structure of mjspt4:spt5 complex conformation b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
147
Chain Sequence
MIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTPKKIIENIEKGDVVEIIAGPFKGERAKVIRVDKHKEEVTLELENAAVPIPITLPVEGVKIVSKHKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor Spt5
publication title Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Transcription
total genus 33
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zn3A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 4zn3A01
3CMET 2QA4T 1KC8C 1VQLT 3CCET 1K9MU 3QQCD 1M1HA 3JAME 3CCST 1Q86C 3PIOA 3KBGA 2G3RA 1Q82C 3LGFA 2OTLT 1W2BS 3CC4T 1Q82U 3TREA 1IZ6A 5HY6A 1K8AC 1KD1U 3CMAT 3G4ST 2JUFA 3LPEA 1VQPA 2XHCA 1NJIU 1YITA 1XNIA 1VQNA 1YBYA 3I55A 3CXCA 1VQ6A 1K73C 4ZN1A 3CCVA 3PIPA 2QEXT 3CCJT 3J80E 3CCMA 4TVRA 3CPWA 1VQ9T 1VQOA 1YJWA 3ER0A 1SSFA 1VQMT 1KQSA 1YJNA 3CCQA 1K9MC 1JJ2S 1VQ5T 3CCLA 5LL6S 3CCRT 2E6ZA 5J26A 3A5ZB 1VQ7T 1NPRA 1YIJT 2LCLA 3CD6T 2E70A 3DLLA 3CC2T 3CPFA 3G71T 5IAYA 3OW2A 2OUGA 3I56A 1VQLA 1YHQA 1VQ4T 1YJ9T 2JVVA 2KVQG 1KD1C 3CC7T 3EWGA 1NZ9A 2MWOA 1NZ8A 1S72A 1YI2T 1NJIC 3J7AF 1VQ8T 4CRIA 5A2QE 1VQKA 3CCUA 5DM7R 3LH0A 1XTDA 3CXCS 1RL2A 1N8RU 2LVMA 1X6OA 3CPWS 5DLQE 5J3BA 2OTJA 4X34A 3CCJA 1KQSS 1VQPT 2K06A 2LQ8A 1YITT 2JOYA 1M1KC 3I55T 3G6EA 3CMEA 1Q81C 1VQMA 1QVGA 1VQ5A 2IG0A 1VQ6T 1M1KU 2QA4A 1Q81U 3CCVT 2EIFA 1QVFA 3CCEA 3OW2S 3H7HB 1VQ7A 3CD6A 1YIJA 3CCSA 3CCMT 3CC2A 1VQOT 3G71A 2EXUA 2DO3A 1UEBA 3CCLT 3CCQT 1VQ4A 3HKSA 1YJ9A 2MI6A 2OTLA 3CC4A 3CC7A 1M90U 3LGLA 3CMAA 1N8RC 1YI2A 5IT9E 3G4SA 4QQDA 1Q7YU 1VQ8A 2MWPA 4RG2A 3I56T 3DB4A 1YHQT 3OYYA 1KC8U 1S72T 1Q86U 2QEXA 1BKBA 1W2BA 1VQKT 2JNGA 1EIFA 3CCUT 1VQ9A 5FLXE 3P8BB 1VQNT 1NPPA 1QVGS 2CKKA 3CCRA 1K8AU 3J81E 2L3RA 3DB3A 1QVFS 1KHIA 4ZN3A 1YJWT 1YJNT 2OTJT 1M90C 1K73U 1M1GA 2KDSA 1Q7YC 4YTLA 1JJ2A 3G6ET
chains in the Genus database with same CATH superfamily
1ICEB 1S1TB 2FVCA 4ZNXA 1RT6B 2D8HA 4KHPF 3BSOA 1W2BS 1SI9A 2BM1A 2K8GA 1T3SA 2OX7A 1KQSP 2OHDA 3G96A 4DV4J 2MZRA 2XU8A 1M8VA 2F8HA 4N77A 1ZSGA 5GAOp 2OKQA 2WBMA 1VQ9T 4LFBJ 5F3ZA 5J2QB 2CPFA 5T7LA 2HL3A 8RUCA 1SL2A 2FY1A 4P2MA 4IQMA 2OELA 1OSDA 5GMKi 1WXTA 2NXCA 4DR6J 2L41A 3TANA 3QGGA 2JDJA 4H4MB 3CCJA 1N88A 2AJQA 1FESA 3LWIA 3QIDA 3L7UA 2J6OA 1N54B 4DSEA 2CYZB 5CAIA 4OJ1A 1H7XA 2NXJA 3OFHA 4NZ0A 2XO7A 2O88A 4DV5F 1YX2A 2HGNA 1FVSA 1R0BG 4K4VA 4HYKA 4O3QA 1XNRJ 2W4DA 3M1VB 1U0HB 2EVZA 3CIMA 4II1A 2U1AA 1E6VB 4J9UE 3HLUA 1OY6A 3FKBA 3T5KA 1NAQA 2HBYB 2UV8G 1HJDA 4K8RA 1M1GA 4N5SA 3KLEB 2JTFA 2KVIA 5LT5A 4EO8A 5DQGA 2K2PA 4LF6F 1S5ZA 1KQGB 2B7CB 3LOUA 2M9KA 4EI2A 2XCPA 2G6FX 2AJ2A 1R31A 4OI0A 2C1EB 2VVKA 1X4BA 3C14A 4DR2F 1RHMB 3C0CA 2G9OA 5T41A 2D69A 2VL1A 2AJ1A 2DVEA 3P4UB 2LTOA 2H51B 3M54A 1VQ6Q 4B3RF 5HK0A 3MUTP 4TLQA 4XPCA 4A8QA 2JN0A 1A0OB 3LW5C 1MN7A 1RYSA 4ZPCA 3SFUA 2LQNA 4UQTA 2ZHAA 3CD5A 4UUWA 1GFDA 3L9ZA 2F69A 4VUBA 1BIBA 1M3CA 1I5OB 3OVBA 4ERDA 1WNEA 4NL5A 3ETOA 1GH8A 3GJTB 2ED0A 1S7IA 3GV5B 2YUPA 2C3UA 1NPKA 3N79A 2Y0BB 3DGPB 4U8YA 2PUOB 4P10A 4DJBA 2IHR1 4JI4J 3L1AA 2DPJA 1RABB 2R7SA 1QP2A 4DUTA 3J81j 4I6WA 4OMOA 3EZOA 1VQ5S 4FPRA 2CKWA 3F0NA 1DRZA 2HQ3A 3CD6S 1PBUA 5FU7C 4E7JA 3R7NB 1L5UA 3MEEA 2X1GA 3DOKA 5CO7A 2BOAA 2NXUA 3Q0AA 1FE4A 4D3GA 4RNFA 3LGFA 3HKWA 3OVSA 2DMOA 4WFZA 5BYQA 2OAWA 1KD1U 5KFMA 2KDOA 4C92G 1TUDA 1I0CA 1F9FA 2BJ7A 3ILLA 3M8WA 3NGKA 5HCKA 2HRTA 4CM2A 4OYMA 4WFBQ 4GVBA 2OMOA 4F04B 2DNUA 4ID5B 2ZH2A 4IG0B 1EETA 2CJYB 3W64A 2MK5A 4ELUA 3DLMA 5HVGA 4WF2A 1UVLA 4ILMA 1PSFA 1JXEA 5KE3A 4ICLA 1KDNA 2QA1A 2EVRA 1IGQA 3M57A 2J7KA 2RQMA 2HURA 3CCMT 2EXUA 3CCLT 2HEKA 3EGWB 2Z4PA 2DPIA 3HP6A 1QLYA 1KG1A 1EKRA 2WACA 4C2MA 5F9NA 1W26A 2VG6B 2E5HA 5L1KA 3OBWA 1WI7A 2D1XA 3TA0A 3EPIA 4O44A 2NYIA 1R27B 1UZHA 4BWJA 4MKVA 1SL0A 1CKBA 1J3TA 2P2CB 2MHNA 1UDLA 3HHLD 3VVTA 2RHXA 1RLPC 2RO0A 1WEYA 4H4OA 2DGUA 2RHZA 5CCMA 2LXIA 5G4DA 2CNKB 4UF4A 4DR1F 3EVOA 2V26A 1HNIB 2GMJA 3FNNA 2LQBA 4J9SA 3E01B 3SFGA 3P3DA 2PN6A 1AB8A 4OP0A 1RXOB 3BDLA 2LJ3A 4C0OC 2MJUA 3FZBA 4B3OB 3GFZA 4OJHA 3G8QA 2IIHA 4YB1P 1ELOA 2EYQA 1RI9A 4PFZA 4OJ3A 1YJWQ 1FFWB 1X8DA 3ZBDA 4XPEA 2GQVA 1UVJA 1G2BA 2RB7A 3B82A 3KLGA 2JOYA 3HDSA 2H5IB 2COZA 3H5SA 2HHSA 1VQOT 2HYIB 3A8IA 4XTZA 4GRSA 1IGUA 2YKNA 4ZVUB 1Q7YU 2OMLA 5GAEU 4F3QA 3HHLA 1RT2B 2HAFA 2HSPA 2DRMA 2CQBA 4F4WA 4OIXA 3CCUT 3SHWA 3MDFA 2XY7A 5IT0A 5JJBA 2CPZA 3TZWA 1VQ4Q 1TKTA 2CPXA 1FE0A 4CTAB 2Q1LA 3NCRA 1M90T 4PUOB 4K0KF 3W63A 2EBPA 1M1FA 3Q22A 1RTJB 4RPFA 3I6PA 1M5Q1 2F8EX 5GMKh 4DPOA 3JCMJ 4X4OA 3HHEA 5ETOA 2RUGA 1K73T 4A54A 4YUDA 4PJOG 4JS4A 2AKKA 3R7BB 3KK1B 3DDIA 4QWCA 2N82B 2ZITA 2DNOA 3I5AA 1B99A 4DSFA 1G3OA 3GTYX 4AG2C 4PG5A 1WJQA 4WK1A 4ETZA 1ZBTA 4LT6A 2DGXA 5GAMj 3CCVS 3C15B 2QLXA 2DLPA 4C9DA 2K6DA 2KFZA 4E0DA 3P8DA 5G0RB 5KYYB 1Y96A 3SFMA 5C2CA 3CJSA 1FTRA 3EG1A 4OB2B 3GV7B 2HHVA 3RGIA 2JFDA 2UUWA 3AD8C 3CC7A 1EP4B 1Y57A 1TS9A 5KFNA 1FDAA 4A8KA 2R9LA 2SXLA 3NGSA 4WXWA 4K4TA 5DM7Q 2ACMA 2DHHA 2UUBJ 3G2XA 5HQ8A 3MEUA 2QQRA 2B9XA 1GX5A 1WEXA 5GJWB 1M3BA 2CG8A 4LSNB 4OI2A 2UUCF 2VHGA 1W70A 4RWXA 3CBMA 1KP6A 3EG9A 2A6OA 4HACA 3UN3A 3ZTOA 1XMBA 1RUWA 1WXBA 3EGNA 3AA9A 3PIPA 2OI3A 1RISA 5F8NA 5CQYA 1H7WA 4LVOP 5A8RA 4HVVA 2LXUA 1LEOA 1WG1A 4IG3B 4DDFA 2LQ9A 1HQ2A 4DL5A 1FX2A 3DRPB 3BZQA 2JW4A 2RDDA 4EDUA 4FF1A 1EIYB 3QG1A 4ZHRB 4N4GA 3MMCB 1TUCA 4JI6J 2XHWA 4OZLA 1N8RU 3N9UC 3GIRA 3K59A 2B6AB 1Q7LB 4XIUA 1YBAA 2GGRA 3GLXA 4M78E 2W9AA 2MXYA 4U95A 3SMZA 4HCKA 3GB0A 4L3NA 2XS2A 3QIIA 4JI2F 4UOCA 1VGYA 4KJIA 3MPWA 5KFKA 3H2UB 2HKQB 2JX2A 3RG6A 3OYNA 3VS0A 3CO0P 1SJFA 1IREB 2YLCA 2IMWP 2LQ5A 4J37A 2JS2A 4LRFA 4MK8A 4MKBA 2ROEA 1KEKA 2YXLA 3TEHB 1I5LA 2QTVA 4FP9A 3EMTA 4KTQA 3OYJA 4BC7A 4F36A 1T9YA 1HBOB 2KM8B 1HBUB 2BMBA 1GXLA 2WSEE 1C1BA 3GJRB 2EFVA 2KKHA 3X24B 3O5ZA 1NHUA 1Q86T 3KFVA 3OY9A 2DK2A 1X9MA 4ECZA 4M78D 3W2VA 1HQUA 3KMQA 1TV6A 1S1NA 5IT9Y 4O23A 1VQMT 1T05B 4B9MA 2DRDA 1KHWA 1C0UA 3JYTB 4DI6A 5D0HA 1AZEA 1OY8A 1XWLA 4J7IA 1S6UA 3PJ9A 2GW8A 3SB2A 2RJEA 3QLHA 4B9UA 4JI8J 2WVFA 2C42A 5IWAJ 1TL7B 4CYUB 3JCMW 2RD1A 3BF4A 1QSSA 3DLEA 4TKTA 3EZ5A 4OZ5A 4RUHA 2PFFB 4A8XA 2PMWA 3UR0A 2R7VA 4KHPJ 5H9EJ 1Z9ZA 3D2WA 1QAIA 2BYCA 3C8YA 3QJYA 4JI0F 2M70A 3IA0A 4KPCA 2XWXA 1F3FA 2V2KA 4C0HA 2K1RA 2NS1B 3GCXP 2ILYA 3G71S 3QJPA 2GGPB 3KLVA 1IVZA 1RAOA 1V1CA 2VG7B 1D0EA 1OZ2A 1VJWA 4J9NA 3KBGA 5A8KB 2OPPB 5GAHI 1VQ6A 1RTDA 4J7CA 2V34A 3GP9A 2RNAA 2J6KA 2GIFA 4AFQC 2CWXA 5ETQA 1VQ7T 2UZAA 1PJ6A 4DV5J 4M7AC 3LH5A 2VG5A 5GMEA 3I9QA 3QZ7A 4ED0A 4OB3B 3F73A 4ZJQA 1TVRB 1UHFA 1F9EB 1IR1A 1OU9A 2MZSA 4WF9Q 4M78F 3EVWA 4LUEA 4F7UE 3IP0A 2J05A 3VUZA 1ZAXA 4RLEA 3MP8A 2LEPA 2V9WA 3HPOA 3N01A 2K7KA 1HIYA 1OPZA 4RTUA 3ENAA 3VGVA 3CEYA 4XTXA 2RQUA 4LF6J 4X2BA 2IAJA 4AL5A 3WVDB 3E2UA 2LA6A 5GADU 2DTOA 3HT3A 1X69A 2VZ9A 2H3JA 1WWHA 2YUQA 3M2VA 4HDGA 1BXNA 2CWKA 3PNIA 3UQSA 2CKKA 8AT1B 4M77B 2OTLQ 4A4HA 4WCEQ 1SXLA 4DR2J 3OYAA 5HAOA 2P6TA 5F8MA 1Q1KA 4DBFA 1S6PA 4G6VB 4IRCA 3DM2A 4PCQA 4DR4F 4XU2A 3META 4I2QB 1YI2S 1V29B 2J7UA 3VAJA 2B9EA 1U7LA 2GJIA 3DI6B 3TJ8A 4P9SA 3AJ2A 5K8MA 3UD4P 4F7UB 2MKJA 3TUPA 3M30B 2Z8QA 3ZZRA 1S97A 1WJ9A 2R7RA 5GMDA 3CCJT 4ZVRB 2B5JA 1IBKJ 4F67A 2RU3A 2HHHF 3I5RA 1K47A 1M27C 2HQXA 2XI2A 2VJVA 2F5GA 1U1LA 5I22A 3CW2C 2R7UA 1MUZA 2IC3B 3BBFA 4KGXB 3DRSA 4C8QB 4AFZC 4FXWA 5GAN6 4RNMA 1K44A 2AW0A 4CWBA 2RJCA 2SEMA 3JSCA 1X7VA 5D6YA 4RW7A 4KKOA 3EYZA 1V76A 4IIOA 1P8GA 2D3ZA 2MY8A 1SJ4P 3PHEA 2FB0A 3NCPA 4EO6A 1SJRA 2ZFHA 5DG7A 5SZTA 1K4US 1E6GA 2H3EB 1O6XA 5K8OA 3WXMB 1X5SA 3SQOP 2Y1JA 3T41A 1BKBA 1WHHA 5KFIA 1KK7A 4ZLPA 3BKTA 3ZTQA 4X66J 1U1MA 3KK2B 1H0HB 5D4PA 2X3GA 3A3OB 3PW5A 4RWWA 3JB9F 2OO4A 3DLBA 4L76A 1AZSA 1WJSA 1RTIA 5GMKm 1FEEA 4X9DA 2P9EA 4X4QA 3HFKA 2MQQA 3G8TA 3KYLA 3US5A 4ZPAA 2A3LA 1IM4A 3UDCA 5A0GA 1CJTB 4Z88A 1PJ7A 3N28A 3FSIA 1UFKA 3MR3A 2HHXA 2E44A 3NP5A 1GK8A 4LSLB 2RH3A 1FXDA 1S99A 1YJWA 2RSQA 3OS5A 1GT8A 4BY6C 3A5ZB 1NPRA 5HK4A 2E1MC 5GAOm 1C1CA 4ZIWA 3D1QA 3BJYA 2J0WA 3QO9B 2QMXA 1NZ8A 1BE4A 1UCNA 4AE5A 4TQRA 5KFRA 3FJPA 5A2QE 2MZJA 3OTCA 3V81B 4M8LA 2IRUA 2JMAA 5DJBA 5KH6A 2OPSA 3TJAA 4F7UF 2POKA 4M75B 3LLRA 2KRMA 3A3PB 2P8IA 3KOAA 2ROTA 1VQ4A 2RVJA 3ISNC 4AT1B 3A8OB 2QRRA 1FA0A 3CO9A 5D4NA 2VFUA 2BUDA 2MYFA 2LDYA 2LQJA 4C8QF 2OTJQ 4R5PB 5B08A 3KMSA 3RBEA 1KD1R 1SKRA 2E5QA 2HNDA 2HHWA 2CPHA 3JCMV 3W60A 1VCTA 2CGHA 1OSCA 2HFNA 3A1YG 5K5MA 2XNRA 1FKPA 4RKUC 4NA1A 4C5GA 2CQGA 4QYRA 1MROB 1U1PA 2XLKA 2YDLA 2RMLA 4ZTJA 2QEXQ 4CLUA 1F9HA 3IM8A 4LRBA 3OR1A 3NNAA 4IKAA 2D3O1 2WSCE 3ZZZA 1P9QC 1SVDA 2BR0A 1LFWA 3AQOA 2RRBA 1NSKL 1F60B 3DRRA 2MKCA 5AJ3F 2ZEJA 1WHGA 3N5BB 4M5KA 3A8GB 4JRQA 3P96A 3JB9k 3M5AA 1X9SA 2VOPA 4XQ3A 2HNZA 2CAJA 3NGTA 4TXSA 3R27A 4DL6A 5DDPC 1U6ZA 2CQ4A 1PWTA 4X34A 5RUBA 3WC2A 1VUBA 4K0KJ 4LF1A 2E66A 4XTWA 1FK9A 4C4WA 1FX4A 2QJ3A 4K5SA 1LWFA 3UPFA 4LRCA 4IOCQ 3C94A 1KHCA 5GAGI 4Y28C 1VQKT 2K5FA 2K3YA 4U8VA 3NAHA 4AXIA 3TZZA 4AD6A 3L3CA 4ECSA 1R0AB 1K8AU 4OX9F 1NDCA 3ISZA 3VTIA 2W8KA 4C8NA 4DL4A 4JB8B 1TUGB 2OD6A 3K8WA 3HJVA 5FWCA 1Y0HA 4PPZA 3CJKA 1URNA 3NHNA 1UVMA 5C24B 4FS2A 2YKOA 2VYTA 2W4CA 2FJBB 1M2VA 2VUGA 5HQLA 1YWXA 2BZ8A 2KYMA 4IUQA 1CJUA 1WC0A 1HNXF 1FF2A 1LWXA 2GNKA 4YP3A 3U27A 1F5BA 1QTNB 3PG9A 3PIOQ 3CJTA 1HLWA 3UA6A 2YWGA 1X5TA 5IAYA 2C2NA 1XNQF 3CPWR 5L9NA 2JTEA 1MNEA 4QWBA 1TKXA 1Q7YR 2DGOA 3HRUA 5ADZA 2MTLA 3NCQA 2BJ1A 3CXCS 3IM9A 4DV7F 1YRXA 1RT5A 2QMUB 2V8IA 4DLEA 3L2VA 1T02A 4V19J 2FZCB 3QSIA 4DV6F 3W2WA 4RJVA 4JI7J 3VAIA 4J9VA 2KT3A 1FJGJ 2KMTA 3FGVA 4C5HA 3NTIA 1F1BB 3VCDA 2DHAA 2UUCJ 1UTIA 2DNZA 3UFCX 4LF8F 3MEEB 4M7DE 1X4CA 4KHRA 2HQDA 3E9GA 2HWHA 4PWWA 2EPIA 2WB1D 2J6TA 5L46A 3G6ES 4DQPA 3CC2S 4C92C 4O4GB 5KFBA 1RHRB 4E7IA 2DAQA 1NYGA 4QKUA 1K0SA 2IJFA 4ILRA 4PQUA 1VQ8S 4OMMA 1IXKA 3KJQB 2M8DB 2KHCA 2CQIA 3MMJA 3VF0B 3VU3C 2GIRA 1UL3A 2LEAA 5KYXA 3D54A 2F1LA 4DR3J 2MQLA 4XDDA 2OGUA 3KFWX 2NQPA 2Y90A 3CPWA 1RJJA 2FHJD 5GAN3 2PEBA 2IDLA 4JI2J 1FXLA 1PD0A 3TEEA 4M7DD 4M7DB 3T9ZA 2AX0A 5E3CA 1B34A 3CC7T 3VGSA 5T14A 1NJIC 4Z2XA 3PR5B 1U45A 1VIXA 4YB7A 3D0HE 1VQNS 2DXFA 4ETXA 4Q0BB 3MCNA 4DSLA 2C2EA 3KXTA 1C4CA 1YFNA 3HVTA 3VALA 1QTMA 2PVGB 2WSFE 1XQHA 5AXMA 4FF4A 1SC1B 2KH9A 5H9FK 3MM8B 4DR7F 4NLRA 1Q5YA 1WKLA 4DX7A 1BCMA 3R8YA 3RRHA 1HD3A 3ZO7A 5IM0A 2FO0A 2CG4A 3GJSB 4AL6A 1LWCB 2ZZTA 4M5DB 4USHA 4EEYA 4DOVA 2ZBRA 3NGRA 5HQMA 3Q23A 2BDPA 4OYXA 2C06A 5EX3A 4CO0A 1IQTA 1S1XB 2DO4A 3BGLA 1JLEA 3UWTA 3G4SS 4ZCLA 2F8MA 3TR5A 1Y10A 4RL1A 3EJMA 2ZH8A 3RW6A 2DL8A 3V8JA 3ZZOA 2JSXA 1N8RR 3MD3A 1HYOA 3PMIA 2DNQA 3FBCA 3GSDA 4MYUA 4CP5A 5IHIA 2G2OA 3I9V9 1XIQA 1KKHA 4CO3A 4WZMA 1ACMB 4JRKA 2CUYA 3A8HB 3TO8A 2XZTB 1OQ3A 3HZGA 1B0PA 2AT1B 3U1NA 4P7VA 2DB1A 1VQPT 3C95A 1HYSA 1WOOA 4J9FA 3SDEA 4DZDA 5I3UA 2YNFA 2LJ1A 2QXFA 5B0GA 1YWPA 3GPLA 2OJ3A 3KLFA 2OTLA 2FD2A 2DR7A 2EC2A 1NLOC 2XMAA 3PHTA 4EIKA 4ATNA 4M7DF 4NEYA 2AYGA 1KN6A 1RA6A 4AQYF 3SBMA 3IBCB 4X4VA 2GHPA 4HCBA 2MHEA 3HF5A 2HZVA 2MYSA 1JLGB 2CSQA 4DX8H 4ZN3A 3D68A 1NHVA 5KFUA 4WFAQ 4ZGEB 2IA6A 1N32J 2MMYA 4TU7A 3GFYA 4M7AA 2H4WB 4HH1A 5F0WA 4E98A 5I42B 4P71A 4KRWA 4ED2A 4GKKF 2R8GA 3NXZA 5KYNA 3KUHA 1EB0A 4M5HA 4OHYA 3V5RA 3IQLA 4YS2A 1CS4A 1CPZA 2BJEA 2WVEA 3AJDA 2PDAA 4NOYA 3KTQA 4ZJOA 4C0DC 3GLJA 3BQ2A 1Z2ZA 3QJJA 4BDYA 2IVWA 4IFVB 3TQEA 1VK3A 2NSCA 4LR8A 2V4JA 1AROP 3DLKA 3H2LA 1NK4A 3FFIA 2YKMB 3MMBA 1QCNA 5GMKj 3EICA 5KT5A 2EK1A 3ILIA 3MURP 3K5PA 2VFTA 5GAOr 1WI8A 3LTOA 5HATA 4CLYA 3OYBA 1HR0J 1NJZA 4J9OA 4EMDA 2AQ4A 2FJXA 3DXBA 2NUZA 2RRNA 2GZOA 2ZJQQ 3GG1A 2G0CA 2IG0A 1D1BA 4EZ6A 3CCVT 1SH3A 1QE1B 2I6WA 1S4EA 1RWKB 4ZJLA 2R7WA 3V6KA 1G4CA 3MGJA 1VRQC 2MQPA 1LXNA 4I4BA 4HKEA 1RWXB 2HHHJ 2FRYA 3VWSA 1WFWA 3N4WA 1TR0A 3OB9A 5CKBA 3ZFJA 3MOZA 2ZWPA 1W2IA 5KOXA 1LW0A 3ZTRA 2CP0A 1N5SA 3LUYA 4UOFA 1CC7A 3MM5B 3BPSP 4WYLA 1EARA 1N0VC 3CPWP 2BJDA 1X5OA 1JXMA 2M88A 4NLWA 4N41A 5F41A 5K20B 2P5VA 1K0XA 1RA7A 3QJ6A 3JB9I 1S48A 3CCQS 2ZH9A 3S3OA 2MAMA 3MI7X 1ZH5A 4L6V5 2OEKA 4I7FB 4KGKA 5KT4A 1ZSZC 2EPDA 1IWAA 1NZAA 4NCGA 2E5IA 1KTVA 4PZVA 4DV2J 1MU2A 1Y0MA 3SWNC 1S1VA 2I2YA 2OTJA 2L9DA 4N47A 2DHSA 2RQ4A 3JB9J 2DM1A 2ZE2A 3MOJB 2JZ2A 2OP5A 4ANCA 2DGTA 1SQGA 1UEVA 2CQDA 2WOMA 2ILZA 3BO4A 1R8PA 4NLUA 1RCOB 2DL7A 2DZ9A 2M3DA 3HSDA 4LD6A 2V68A 1GMUA 2QEXA 3TWZA 1G3SA 4QR2A 2DXEA 3G82B 4X4SA 3O6QA 1TV6B 1WHWA 3PDNA 4HKQA 2DD8S 1LPLA 3MCMA 2DHXA 2KG0A 1K1ZA 3OSNA 3I0SA 4B6MA 3K58A 2HFOA 4NRUA 3MPVA 1C0UB 4Y28E 2MGZB 4DHVA 5DDRC 1RWUA 4ANDA 1WYXA 4N56A 1QAJA 5D4LA 4MK9A 1NCLA 3JQMA 2VOOA 4WE1A 3EH1A 4NS5A 3KLHB 1K9MC 2XS7A 1F0XA 2Q66A 1IKXA 3L2UA 2CP2A 4ZOSA 5K8PA 3QYGB 1N56A 1REGX 3REBB 1GMVA 3A4TA 3OYLA 2RHQB 6AT1B 1H2VZ 3HD2A 1K0VA 2HMIA 2ZOGA 2QX0A 4YEAA 3TU4K 1U2RA 1S1WA 1HMVB 3CBOA 2YHTA 2ZH1A 3RRKA 4BC9A 1HQEB 5I2SA 2K1RB 2KL8A 1DTQA 4RX6A 1W4SA 3GF5A 3LP0A 3GR0A 4JP8A 3LP1A 2X35A 4JDSA 1Q8BA 5EDWA 3MM6A 5D0EA 5DZ7A 4QBUA 1OZ3A 1FCAA 3DHWC 3TX0A 4NOHA 3WDOA 3KWMA 2COWA 1VQ9S 2VJUA 1F5AA 3J81E 3M9QA 3QHSA 2O01C 2HAIA 1YJWT 3SV4A 5AJ3J 1RTDB 3RU0A 2L3PA 5CYMA 2RQTA 2PA3A 3PYFA 1M9SA 3RMQA 3CMET 3VS2A 1TKZB 4WZQA 1UW4A 2VH7A 4C8MA 3PIOA 3MEWA 3BGOP 1NK0A 1AYEA 5HY6A 4ELYC 2XDDA 1RWOB 3M8RA 1IQZA 4C92E 4TY8A 1T11A 3T3FA 1T7PA 1DJ7B 1RBOB 4LBHA 1NM7A 2CQ2A 5KG3A 1UFWA 4FNIA 2XY6A 3UWNA 3RR6A 2XYHB 2FJEB 3MFHA 1VQ4T 1REVA 3G7ZA 5K14B 3UN2A 3TEGA 2GF7A 4CO2A 3Q24A 3E3XA 3W1YC 4OMNA 4IRDA 2EQIA 2Q6BA 4DCOB 3OHAA 4URGA 4TLRA 1R0CB 3VGUA 2Q79A 1AEYA 5KFCA 1B70B 4BD3A 3VKIA 2LQKA 3DM2B 4UQGA 3Q8SB 3R2CJ 4C92D 2J0XA 4G1PA 4OMFB 4Y2CA 2LCSA 3T19A 1SIZA 4K4XA 1H8KA 3JCMQ 4Q8EA 1U1KA 1BIAA 2FQQB 1HNXJ 3V6DB 1RT3A 4OI6A 1RAFB 4I64A 2OSRA 4F8RA 4PNOA 2EG1A 2N3LA 4OZ2A 2B5JB 1N9SA 3J7AN 3Q83A 2EEYA 2XI3A 3TCJA 5SUHA 1KC8C 3IRXB 4XTYA 2BE2B 1LQ9A 3DRSB 3MHYA 4J9GA 3QZ8A 3PV8A 2Y1LB 4DF4A 4XK8C 3VAMA 4DV7J 3JSRA 3BR8A 3CCRS 3DN9A 3HI9A 2FVPA 4RW7B 7FD1A 1Q53A 1B64A 1RT4A 1ZAWA 1S9EB 3BGUA 1E7OA 1YWOA 1KVKA 2MSTA 1SSFA 3TA1A 4IOBA 2ZCFB 1RU2A 5H1SV 2B51A 3T6BA 3W8PA 1TL1A 2PU9B 3OTDA 3M9MB 3OSVA 4F2RA 1SKWA 2Y4YA 2AEMA 1KD1T 3L2WA 3AQPA 3EX7B 3C12A 2ABYA 5KT2A 1HI0P 2ZKUA 2I0NA 3RKWA 5EWGA 2X4YA 4PEOA 4C92A 3JB9H 1L3VA 2X3WD 1WHKA 1K8AR 3C16B 1TH7A 3EM1A 3JB9G 4ALZA 4DEXA 5HK3A 4MAKA 4DN0A 1AZSB 4ZCIA 1JO8A 3QIPA 2LRQA 2WONA 1VIFA 4MDXA 1GXIE 1M0SA 2RF2A 2ZNYA 2HD0A 2OPRA 1RBLA 3GSIA 4DL7A 4AFUC 2W2QP 2QASA 5JVHQ 4K11A 5A0YA 2P0KA 1NK9A 3DB3A 5H9FJ 1SJQA 3PZPA 3FEYB 4KIAA 4ZVQB 2MQOA 1Y71A 5GJVB 1S1UB 4P6QA 3NNCA 5KG6A 1VBZA 1W25A 2F65A 4NEZA 2QA4T 4M77G 2VFRA 3H8ZA 1V3RA 1C1CB 3BQ1A 3BGRB 2DILA 4ECUA 1LOJA 2KU7A 4EGLA 4B9WA 3CC2Q 2W4PA 1NJXA 4NE9C 4JI5F 1SRMA 2B86A 1WTFA 1U3OA 1H641 3N6LA 2AHJB 2X1AA 3SXLA 1TL4A 4QJVA 4QVCA 4PJOE 2GFFA 5FDLA 3PGGA 2IVMA 3JQJA 3CCLS 1SPKA 2YQ1A 4LJMA 3QWPA 1DLOB 3EGZA 2HIYA 3FDSA 2MZTA 4D8DA 3ENVA 4PJLA 2ROPA 4DEZA 3ME9A 4ZCMA 5KG5A 3H25A 1EAYC 4C8QG 2JZ5A 3RR8A 3GE9A 1OV3A 4LIRA 2DTIA 4QQ6A 3EXYA 1PRLC 2HK2A 2KRRA 5KG0A 1KFZA 2YVSA 4KT0E 2B4UA 4TVAB 1PKSA 2L5QA 4JV1A 3HKSA 3AODA 2Q3PA 2DY1A 2JHEA 4QW9A 3ELHA 2GMHA 1LOUA 2D9PA 2CYYA 1YJTA 1U2FA 1J5EF 3G8SA 1OU8A 1UP1A 1HFEL 2OPQB 1RTHA 4PJOD 1TOVA 2JVRA 2CRLA 3FBFA 4A8YA 1B0VA 1CKAA 3WIVA 3QGHA 2HBRB 3KLIA 1BI0A 2E3IA 1G2EA 3IS9A 4EPCA 1RK8A 3ADAC 2DNHA 4DS5A 4USUA 5HSPA 1Q7YT 1EJ7L 2VA2A 3CCET 4E7LA 4HHHA 4LMZA 5CYQA 1CG2A 2BA9A 5HMYA 1S59A 4WKRA 3MP6A 1ZOTA 2E9ZA 3HHNB 2J6UA 4PXBA 3VS3A 5DG9A 2R8IA 1BU1A 2EJGA 1E6HA 2O5DA 2J76E 3L4BC 1VQOS 2BM0A 1ZAVA 3HVAA 3MPDA 4DV4F 2F1FA 3W5YA 4IFYA 1S0MA 1KBRA 1LXJA 5KFSA 2OI2A 1DQ8A 5GAMd 1FK9B 2RIJA 5LJ3Y 4AQYJ 5E7OB 1KOHA 3MM9A 1U1SA 1LWFB 2HBZB 3R6NA 1OYXA 3E8OA 2GBQA 1Q79A 3WQPA 1IJFB 3EFOB 3A13A 3RESA 3OYHA 2DRBA 1SPBP 2K06A 1YITT 3O2IA 2OEJA 1VYAA 2UU9J 3CJ3A 2L9WA 3BDEA 1S72Q 4WIIA 2R4FA 3GNFB 3D6TB 1GBQA 2VONA 1MWYA 4BDPA 3BREA 1IR0A 3TSWA 4M75G 4GKKJ 3OPKA 1VYVA 1U6BA 1NSAA 2APOA 1RSCA 3PRDA 1NU4A 3TVTA 1P1TA 1XR7A 1NPPA 4TYAA 1JLQB 1G8XA 1ZM9A 1XNRF 1BGXT 2VC8A 4Z89A 1CJUB 2JTMA 3CJQA 3V7CA 3MAAA 1U8SA 5KTQA 5GAMh 4ZS6A 2RS8A 2E5JA 3EGXB 1Q82U 3GILA 3A8KA 3W66A 1V3ZA 3M2RA 4LREA 1CJVA 3ETMA 2EAYA 1ZTWA 3R6OA 4G65A 3FLGA 5LJ3e 3ZC4A 2XG8D 2O4XB 3DYAA 3OL7A 4PJOF 2LCLA 2N3OA 4EMKB 4C8YA 2KVQG 4KR0B 1VJQA 2CUDA 2SRCA 3RUBL 2Y1IA 2FHMA 2IMOA 1NO8A 1YJNQ 1BQXA 1S9FA 4ECXA 4Z7YA 4CC7A 1KQSS 5KYUB 4QIEA 3ZNJ1 2CIMA 3ULHA 3M6WA 3OS1A 1X0FA 1DTTA 2NYHA 3E19A 1N8RT 1V5IB 4J91A 1YHQT 2JM9A 1W7WA 4WTOB 3IG1A 2COYA 2R2TA 4WYWA 4HCCA 1DARA 4GKJF 3ILJA 1YIJQ 1RUSA 5E3QA 3AD7C 4DV1J 2V8GA 2MY7A 1PBAA 1JQQA 2QC3A 4J9CA 1B7YB 2HSEB 4K4YA 3ITHA 3GQCA 3G6ET 3D5MA 1FHTA 2YNGA 1D09B 1FJEB 1ZSZA 2XG8A 1DHMA 4LSZB 3EUNA 1AD5A 1O51A 4QU6A 1RWMB 1B34B 3RNJA 1WG5A 1U26A 3K17A 3SWNA 1HA1A 4Y2MA 5LJ5Y 3CUNA 3MAQA 2O9SA 4ZN1A 5KFPA 1C0TA 1YJVA 5B0AA 3JSMA 5CQXA 2A2CA 3HVTB 2ZOMA 4O5VA 1Z1ZA 1WHYA 1T9VA 2QQAA 4D8KA 5A0DA 2B43A 3MAHA 1M4ZA 3CPFA 2B4VA 3HD1A 2YX1A 3JTOA 1VR6A 3FCHA 3OW2R 2QL5B 4E7SA 3G86A 3CCQQ 4I68A 4JRIA 2DETA 3L09A 2W7OA 1TL3A 1SCJB 3N6NA 4LR9A 1TELA 5GANg 1N5ZA 1W1FA 3HSJA 1QVFA 2OH2A 3QT7A 4ZTFA 3UA7A 2RKIA 1QJHA 4A8FA 1RTZA 3QRQA 2VQFF 2YQ3A 4LRAA 1EKSA 2O67A 4F25A 4DSJA 2R58A 3PCOB 1VQMS 1KIKA 4ZPVR 1HHTP 3VV0A 2HQGA 5LJ5e 1GCQA 3LWHA 1R43A 1D3BB 3RTVA 1TAQA 2JL9A 3R6LB 2NCKL 4RW9A 2CQ3A 3T1AA 2JEJA 1Q82C 3JCMd 2KBTA 2ASLA 2VC0A 3G4ST 3K89A 5LOQA 4DU8A 2CP3A 2QO3A 1TXQA 3HCXA 2PT0A 1I1JA 3M8PB 1TFWA 4ELZC 3V7RA 2W10A 1RWWB 3OW2A 3DMJA 1FD2A 1VQLA 2ZD1A 3V4MA 4XK8E 1VFJA 2H9ZA 2K5IA 3OLBA 1WTBA 4FVMA 4Q45A 2NREA 2BKNA 1UKUA 1S4FA 3RBBB 5J2NA 3CBPA 1X6OA 3H4DA 3BBCA 3EGUA 2BACA 1OWXA 3HP9A 5LXYA 3IGNA 1BB9A 3QO3A 1TP7A 2DIUA 2H48B 4U9RA 4K50A 4DR5J 1G83A 1UFFA 4FYWB 3TZXA 2RQCA 1S12A 4ZITA 3JCMh 3ENQA 3MCAB 1X9WA 5D78A 4M7AB 1JXLA 2RHIA 1U1OA 3LP2B 3I4HX 4ES1A 1N5YB 5LJ3g 3LF0A 1GFWB 1CS4B 4CT9A 1ZX6A 1VQ7S 2DL5A 4KV8B 3D6FB 3A8MB 3GP8A 3BB5A 4JBCA 1QDUB 1AFIA 2NUHA 3SCLE 4YHHF 1UWBB 1YVFA 3C6UA 3DLKB 3MMBB 2MPXC 1VQ9Q 1NK6A 2G0JA 3MR5A 4P2XA 1SIWB 5CKDA 3R1LA 1N5VA 2LKZA 1UE9A 4QR0A 3M2UA 3W61A 3TZYA 3PVLA 5U47A 3IAM9 5AE1A 3L7OA 2RD5C 3BGFA 3MEGA 1HBNB 4BI8B 2GAHC 1EZZB 1CSJA 3CDUA 1IKVA 4FYXB 3G6XA 1XMOJ 1JXVA 4TU9A 4QU7A 1S6QA 1JLBB 4OZNA 3I87A 2HVZA 2FLOA 2AP6A 1U8WA 4YR0A 2LVWA 2HQCA 3IN5A 2NUPB 4QQBA 2FHDA 4MMLA 2DH9A 4UTGA 3FMWA 1WJRA 1PC5A 4JRPA 3IO1A 1WF2A 2G2YA 4Q2LA 3OYIA 4PK4A 1M2OA 2UXBF 2JJ9A 4PXCA 5A6PA 2E7XA 5IOLA 4J7FA 2MKKA 1YBTA 3OTOJ 4MMKA 1FKOB 1PYTA 2RUSA 3SSRA 4LF9J 3FDRA 3CCJS 1FRKA 1BD6A 2DBBA 1Y07A 2C2OB 5GMKa 3BW1A 4UW2A 5FU6C 2VB6A 3EGDB 2HL5C 2UUBF 2HFZA 1N6QA 2CP7A 2UVVA 2E7VA 3M6XA 2AEFA 2VUBA 3CCST 1VK8A 4LN2A 1U0SA 4DOZA 3GNGA 2QQBA 4KFBA 1AT1B 2PO4A 3OXFA 4ZPDA 1PILA 1WQWA 3THPA 4CLPA 5GMKl 1MU2B 1Y9OA 1VRUA 2CXEA 5I21A 2KXNB 3UVJB 2IM0A 1S9GA 4MZPA 4QPTA 1JNZB 2ZE2B 1UJ6A 4DPYA 1K0TA 2AU0A 4IDKA 4ES2A 4IH6A 3AB4B 2X1FA 2NXNA 1RWVB 3KXDA 3N5FA 3K2YA 4JI6F 4I6AA 1GRIA 2J0QD 1KLNA 2W9CB 5LJ5g 5DLOA 2V2ZA 2Y4XA 2VFSA 2YNHB 2VXFA 4XTUA 4G1QA 3MF5A 2EKOA 3QYYA 2MMPA 4A53A 2H5JB 1RAGB 2RI5A 4Q5VA 3I0SB 3HRTA 4QVDA 2DA9A 3KG4A 2LFVA 4XTTA 3L2ZA 4MKAA 2QLFB 4KH1B 4LF4F 2BJ8A 4DMZA 2F2WA 4AFSC 2OLWA 4NXMJ 3KJVA 1SEMA 3SEOA 2HQIA 4KE5A 1HNZJ 3TAQA 3AOBA 4LDWA 4HVWA 3OVAA 5KYWA 5DQIA 1AUDA 4EBDA 1NG2A 2RI3A 3MM7A 2GJFA 5E41A 5GVQA 3LPEA 4A46A 2K3IA 4O4RA 4LDVA 1S1WB 5IQQA 3OW2P 1I51B 2BEFA 2DEIA 1RAAB 4ZVPB 2W2MP 2JNJA 1MSWD 2KYBA 4XTVA 3M4GA 2V6AA 4FU6A 2ZHOA 1S72A 1FDDA 1GEHA 3J7AF 2O9VA 3PKYA 2HVIA 3DDKA 3QUIA 2L2PA 1WLPB 1JKHA 3CCMQ 2FPFA 2GQQA 5HROA 3CCLQ 4KSEB 4IR9A 1G6BA 1U09A 1NSPA 3A3NB 4WFYA 2UVUA 2K3XA 1HBMA 3CE8A 1H92A 1X4EA 5HL7Q 2YNIA 2MZ1A 2QL7B 3IR6B 5CYMB 5BYRA 4AYBD 3ET6A 4AL7A 1QVGR 4J83A 3MR6A 1FRIA 4E6RA 5KCOA 1WHLA 1FYNA 4MFBA 4PKDB 2FVSA 4ATOA 2RJZA 3BR9A 3SYZA 1QKWA 1T0HA 2X4JA 1GXTA 4JZ4A 5A0LA 1YLXA 5AE2A 2KM8C 3G6YA 2MB0B 3TQ7P 5ETPA 3UF4A 1M90C 1ZTTA 2AV5A 3KK3B 1WGSA 1N6AA 3EAEA 4BS2A 4KH0B 4ECTA 4JI3F 1QUVA 4M78C 3FC3A 4N4IA 2EGAA 1LJOA 1FD8A 2HGMA 2CZ6B 2EJFA 2AIRB 2FLLA 3QKJA 3SQGA 2NLUA 1K8AT 1GAOA 4ECYA 3SDZA 3QPHA 5HP1B 1K73C 4DS4A 5H9EK 2DXDA 4Y0FA 1JJ4A 5A8WA 1YJNA 1GL5A 4KGVB 2K79A 3X3UA 3TRGA 3M8SA 1U48A 4LDYA 2FRWA 2EW9A 1YN8A 4NYZA 2XLJA 5HKCA 4CI0B 1P6TA 3LYIA 1N34J 1VQKS 2VQEF 2DX1A 1WDXA 1VQOQ 4A4FA 3NGDA 1R3NA 2WSEC 4GC7A 3REAB 1LWEB 1S1TA 1WC1A 2HVHA 3PYDA 1FJCA 4B08A 4MH8A 1QW1A 1QVGA 5JVGQ 2BBEA 2N4CA 3VAKA 1F5CA 4PQAA 1YIJA 1JU5C 2D9OA 3CCUQ 4N76A 2J9DE 1KSWA 1ZM4A 4NASA 1KVJA 2CPJA 2QDLA 2CZ9A 3V8LA 3O8VA 4IH5A 5J2QA 1ZLMA 4L72B 1OO0B 3MECB 4ELVA 3QZ5B 4U6PA 5L39A 2R5AA 2KDSA 2OJ2A 3TAMB 2RI2A 1WSRA 2G1HA 1QWFA 2CPYA 1M5PC 4K4UA 1PD1A 1Q78A 2NZCA 4DFKA 3HL8A 3K57A 3TREA 4MIBA 1IZ6A 1HARA 3FCWA 2QYGA 5F9LA 1RT1B 3OBYA 2QLWA 2CZ1B 2X4XA 4S0MA 3QDRB 4YDDB 4A48A 1C1AA 3CCQA 3VRZA 4OV6A 3CCRT 5D77A 2VODA 2H1YA 4DV0F 1IBKF 2GNCA 4BACA 2JLGA 1M5VC 2KXDA 1X4GA 1U0HA 2MCNA 1J5OB 1BYMA 2DBMA 3R9LA 1E6VA 3U1LA 4ED1A 2M7SA 4C11B 5L1LA 3SCKE 1URRA 4GKJJ 1JIHA 2RF2B 3JTPA 4U7CA 2OPRB 1JEGA 2YT6A 2J5AA 3CF5Q 4DZ6A 2YWWA 3NG8A 3BDUA 3X26B 4ER8A 2RA2A 3RAXA 4M63A 1FTCA 4QQGA 1Y7XA 3M9NB 1WC5A 3AA8A 2DNKA 3X1LB 1NSQA 1SUQB 2DNYA 3AAWB 3RUXA 3T5LA 1UA1A 4RO0A 1Q82R 1CLFA 2AWZA 4BCAA 3CCZA 3VGTA 2GC8A 3HHKA 3TJ9A 4F4AA 2AGOA 3RDVA 3HX9A 2EFNA 1Y11A 2GMLA 4OMFG 4U67Q 4RUBA 1AHJB 1B7TA 2DHGA 3MHXA 4PYDA 5A2QU 2D0QB 3GONA 4X66F 1RT7B 1H3DA 4NLVA 3CC7S 2DTJA 4LDXA 2NPFA 4RTXA 4QIFA 2J9DA 1Q86C 5BJRA 2Z2YB 3V4IA 5ETMA 2HG4A 3CC4T 2PI4A 3M32B 4DV3F 3FCVA 2MJNA 3AXKA 2KR3A 3MO8A 2VPWB 2XEXA 4A8WA 3M0QA 3CDEA 2FLPA 2NR0A 5C25B 4C8QC 3ER0A 2ZPBB 4B9TA 2AZSA 4CQ1A 4F26A 1WACA 4NCBA 2NZ4A 3UE2A 2Z2LA 3DGPA 1IJEB 3I5SA 1P27B 2VXEA 1M5KC 2K7JA 2VQFJ 3R5DA 2P0PA 1WF1A 3UN5A 2E9TA 1HXDA 3TW0A 3CD0A 3P49B 2H4YB 2L48A 1MLAA 1XEZA 1ZM3A 2A37A 3OUYB 3CIZA 4D3HA 1UEKA 3HULA 3I55T 3Q8PB 4KPYA 3H7HB 1PCAA 3S3MA 2PMHA 2DL3A 2O66A 4ZP9A 1VBKA 3MR2A 2PE8A 4KRTA 2CFXA 2K57A 3CCTA 1ABQA 2JJ4D 4HCZA 1UGRB 3OYYA 1JLCB 2HMAA 2AZVA 2RDJA 1VQ9A 4FT4A 5LMUJ 5FLXE 4ID5A 4F4ZA 5GAEI 4IG0A 4LFAF 2DH8A 2P6SA 1T03B 3F41A 2DGQA 1R6YA 4NI2A 2ZPHB 2PVOB 3FRZA 3C6TB 5K8NA 2BZ2A 4GBQA 4J9KA 5CIUA 1UG1A 4LE9A 3JAME 4C6AA 1HWUA 2FJWA 2RHUA 5F8JA 3O1LA 7AT1B 3E2EA 2BQRA 4HL9A 3GOXA 1YTYA 1VQPS 2E1CA 1OQ6A 3MM9B 3J80E 1PCXA 4JLGA 3D28A 4DU7A 4J9BA 2VG6A 4I56A 3QYHB 3IGVA 1FDBA 2XYPB 2M0YA 5IHKA 2WW8A 4XU3A 3R5AA 4F3MA 1MW7A 4RW4A 2VBXA 1QVGP 4ZVGA 3QWYA 5HMXA 5GANf 3KHLA 1D3WA 1NK7A 2JEFA 4JLIA 1L3KA 4DSKA 2IY5B 4ZP8A 2H5EA 4C98A 4JOUA 3MUVP 1YZ7A 4YHHJ 1HNIA 1UUEA 3BY7A 4QR1A 3E01A 3W7BA 3LGHA 3VRYA 2JH3A 1X4FA 3L7PA 4HH0A 2W2OP 4OVAA 4B3OA 1ROFA 5CR2A 4FYDA 4RW6B 3TVKA 1SJ1A 5GAN2 3DYAB 1FRXA 1UHCA 2GVZB 1VQLT 1RAIB 1S79A 3CDWA 5BXIA 2M51A 1BI3A 3FMBA 2ZWOA 2NXEA 4RTZA 4CC4B 3HT0A 2ACYA 3CMAT 2X3DA 2V8JA 2DRKA 2QMWA 1FRHA 3VQSA 4UUXA 4ZPWR 3OXGA 2LQWA 1QKXA 2Z2ZA 4EWTA 1BQNA 4OFZA 4UOHA 1BY9A 4LF5J 4FT2A 3PFOA 2UXBJ 1RT2A 4ZP7A 4EYHB 4RUGA 3HSGA 5B0BA 3PJWA 4M5IA 3B8HA 2VKZG 2DD5A 2ZC3A 3AXMA 4WFNQ 1O8BA 5KFYA 1VQ6S 2H54B 4CTAA 2IRYA 1S76D 1JRIA 4PUOA 3UT1A 2DNGA 1QSYA 2WSCC 1FO1A 2V1RA 2G13A 4CRJA 4CH1A 3B4DA 4RW8B 2R57A 2RPNA 1LW2B 4OYAA 1MMGA 4L73A 2HLUA 4BE1A 4JI7F 3I56T 1FJGF 1U1RA 5KG1A 1ZSZB 4Z02A 2DJWA 1KS2A 4CT8A 3KK1A 3GBQA 3NS5A 3W9HA 1ZS6A 2DRAA 5LJ3f 2MKIA 2W2NP 5D4OA 3PKMA 2VV5A 2FYXA 3FQLA 1VC6A 1UJ0A 4YY3J 2ZPEB 2C0TA 4NLYA 1FWZA 3H4BA 2DNMA 3BYRA 3C15A 2MPUA 4ANEA 1PAEX 4JPBW 4ZVEA 2CZ4A 4OZ1A 1MV3A 2KXFA 1CULB 3S01A 1OY9A 3IR5B 1B3TA 5KFLA 3Q1JA 1DJ0A 3M0UA 1ZZNA 2I9SA 3OMGA 2HBPA 3UDVA 3TUJC 2QA4G 1EP4A 3M55A 3CCMA 1TQLA 2QQ9A 4DR3F 3THVA 3CCLA 1EQMA 3R3TA 2DT9A 1S77D 4QWEA 3EWGA 4ZA1A 3KHRA 1FWKA 2RKIB 4DBHA 3NOCA 1WHJA 2XD0A 1R89A 1SHGA 4LD9K 1RL2A 2BRLA 2PTKA 5ETLA 4LF4J 3G1JA 4LSNA 4HVUA 5M2PA 4MZMA 5FLXY 3FZ2A 1NEGA 1Q81U 2RQVA 3D6HB 4XDCA 1T94A 2ALYB 2KHDA 2CJQA 4YFUA 1MMNA 1FRLA 1Y5NB 2JLFA 5I4MA 4QQDA 5KT6A 3U7JA 3NLCA 1X2QA 4DX5A 3JAMY 1U1NA 3HKZD 2Y0SD 4RW9B 4IG3A 4X4PA 1CJKB 3DRPA 4USJC 1ZYQA 2KE9A 2L89A 2M2BA 2VFVA 2QSWA 1M5OC 2YWEA 2ATCB 4QOTA 4ZHRA 1F3VA 4ED5A 3J80Y 9ATCB 2QGFB 4I1TA 2DZCA 2MQNA 3LWMA 5E0OA 4FBTA 3S3NA 2FB7A 3DMJB 4OZJA 4C0BA 5CXTA 1M30A 4GC6A 3H40A 2R2UA 1Q16B 2EYXA 2DNNA 1XNIA 1B4SA 4M5GA 2A6MA 4UOGA 1D0XA 2EFOA 1NJWA 3SZ2A 4M7DC 1VQOA 2ROGA 4I2PB 4Q8FA 4DFMA 5AYFA 1Q8LA 1N36F 3QFWA 4F2SA 2PSZA 5D0GA 1VRTB 2V67A 2QTWA 5KFAA 3ZL7C 3CCUA 4KO0B 2QZ8A 2DXBA 5J2PB 2LJ0A 5CCLA 2VWFA 3WX8A 2HS4A 1D0YA 1HBOA 2DISA 5I2MA 2I5JB 4NLXA 2KG1A 1YJWS 4TYBA 5L23A 2CH4A 4NL2A 2A08A 5LJ5f 1QWEA 2MLXA 3PW0A 2ADCA 1HWLA 3CMES 3EFSA 3B78A 3KDOA 4GLMA 3MKDA 4M78A 2GV1A 4FN5A 1IKWB 5GAMf 5DZ6A 3VJPA 2L0AA 1N48A 4JI3J 3KKFA 1IKYB 3TARA 5KOWA 3C6UB 1NM2A 4LNPA 2H65B 4EFAC 2R2SA 1FNMA 4RTVA 2WVDA 2ZUGA 4PPDA 4M5JA 4USTA 2JNGA 4UZCA 2V9KA 1V9OA 2X3XD 4OB0B 1OYEA 3RJMB 5GADI 1ZETA 3CT9A 1KHIA 1YJ9Q 2EBGA 4OX8A 2HRUA 3M2UB 2HNYA 4ED4A 5J2MA 3VS5A 1VQ4S 2DR9A 3MFIA 2A18A 1V3SA 3MEGB 1Q8KA 2WSFC 2UUAF 2BXJA 4M77E 1TL7A 4Z8AA 1N32F 1JJ2R 2L8DA 4CYUA 5B0DA 2VQEJ 1T3OA 1GTEA 4CH7A 3M8ZA 2DL4A 1R77A 4FVCA 4KBMB 2AHOB 5FIIA 5D15A 4BWMA 4QPXA 3JB9D 3D67A 3VHQA 1B3QA 1UETA 2L3QA 1U2CA 3PRBA 1OIAA 3PNWC 2ZUAA 1JNRB 1U1QA 1H38A 1EX4A 1CBKA 3MTKA 4K4ZA 2QDYB 2DITA 3ZZTA 2E3HA 1NDLA 2JEGA 2AMCB 1FKAF 1UZDA 3D3BJ 2XB2D 2F9JA 3PY8A 1QAXA 4OGEA 4IO1A 4FDFA 2W24A 4C97A 4C8QE 2GGPA 2CP6A 1HR0F 2JRSA 3AHPA 3M9OB 2HPUA 5CHCB 2KROA 2VG7A 2LQ8A 4KULA 3PFSA 1Q81C 2Z2MA 1M1KU 5A8KA 4M77D 1FMWA 2KY9A 4ZKAA 2CVIA 1VQKQ 1VQSA 2PZ1A 2OPPA 4N8OA 1EHWA 1FWPA 4M5MA 3GIKA 3HO1A 3RB3A 5KFFA 3DNCA 1NJYA 1QQJA 4KB7A 3T6JA 4FCYA 1C6VX 4E2FB 3OR2A 3RAMA 4M7AG 2FUG9 2OFHX 2ALZA 3R7SB 1YJNT 5L9XA 4DV0J 3J7YI 4ZVHA 1JJ2A 1NKCA 5C5JA 3RB0A 2QAZA 4FM4B 1P1LA 1S9GB 3OT9A 2RQKA 3QQCD 1RKJA 3NRBA 4C8QD 1TVRA 4TQSA 4BUGA 4Q7AA 1NLKL 2KSSA 1BCOA 2YUNA 2BANB 5JMNA 2RK1A 3ZZ0A 1X01A 2G2ZA 2ZC4A 1FFGB 1JLFB 2PFDA 1RLQC 4U7UK 2DERA 4R8UB 1LNXA 2HHTA 4C48A 3W9IA 1R7IA 1YIJT 3LWLA 2DKOB 2FZGB 3NNHA 4C0FA 2R8JA 4A4EA 1SH2A 1ZA2B 1ZUUA 4AUKA 2ZPGB 1VC5A 1SG5A 2VPZB 2XQCA 4ECWA 2BZXA 3VS7A 3QGPA 1DY3A 5D6GA 2AEJA 4I2QA 3BPDA 2CJXB 2E1AA 1YJ7A 4DV2F 3M8QB 4CDIA 3J7YU 2GFAA 4CO4A 2QA4S 3I31A 2GVDA 2HFSA 3P6YC 4F7UA 2V8PA 3M30A 3OBIA 4M75E 2RHYA 4JV0A 4DV3J 1PO6A 1TUVA 3ZZYA 5KYWB 2ZBQA 3QWXX 1VQ5Q 4C3MA 1UMJA 2IC3A 3CD6Q 4C8QA 1Z9QA 3TI0A 3C46A 2DXTA 2XI9A 4Y91A 4PRFA 3OHBA 1Q8IA 2WTFA 2KB2A 3OJSA 1K76A 1VLYA 3W3SA 1NK5A 1UW9A 1YDLA 2FTRA 3PXGa 1VBXA 2Z0WA 3TA2A 4M77F 1NB2A 2EYZA 1U6FA 3JV3A 3HPWA 1O75A 5C42B 2RILA 4DXLA 4QCLA 1JKHB 3CC7Q 5L1IA 2V8DA 2GQ2A 1KLMB 1WORA 2J7WA 3MJXA 3CDBA 2Y8YA 2ZH7A 4M75D 1YJRA 3P5TL 2ZH4A 4XAXB 4QIGA 1R6VA 3MEKA 1NE8A 2LT1A 2KVQE 1JLAB 2EQKA 5LSRA 2D41A 2IIMA 2YY3A 2PNIA 3KK2A 5DM7R 3DFEA 2E1RA 5A76A 4CLZA 3C19A 2KT5A 4MFBB 4LFAJ 3OYMA 3CPWS 2Y1RI 3OYDA 1WI6A 4DFJA 1M1KC 2BX6A 2RAQA 4F17A 3PW2A 5CAAA 1UA0A 4DQIA 3CCES 3DU6A 4J9QA 3RKYA 1CJTA 4Z37A 2KK4A 2M02A 2LP5A 5KG2A 1I3OB 2UXDJ 2DTHA 3VR1A 3LANA 5DDOC 4O6JA 3AT1B 2HHUA 1VYTA 4WBFA 5D8HB 4LSLA 2WVBA 5T7LB 5HO4A 1BBZA 2XSFA 2RK2A 4CLWA 1TSFA 3EE3A 3M0SA 1B0TA 4NYOA 1YRTA 2O2OA 3CCWA 6FD1A 2XKOC 5DGBA 4GLKA 4TU8A 2FC8A 1KTQA 1ULRA 5A8WB 3V81A 3DOLA 2KRNA 2JWNA 4CLKA 5L8RE 1Y5IB 4CCHA 1Y3JA 1GNKA 2G0IA 1NJIU 1YITS 2RQWA 1QMCA 1I1GA 4GY5A 3EG0A 3OTBA 1E6YA 1NH7A 4Y65A 5M9OA 5FD1A 4ZLLA 4R5PA 3VZIA 4FW1A 2BTTA 5LSLA 1Q82T 2Y3YA 3UI3A 1VQPQ 2B4PA 3GV8B 4USIA 3UD5A 2YUOA 4WP3A 3RYLA 5C6SA 1FXRA 5HN0A 2PUKB 2EQMA 4K4SA 4WKYA 3K0JA 1MROA 3URGA 2C2RA 4L5GA 3FBBA 3RBZA 3MPYA 4USVA 4IYQA 1W6XA 2DIQA 4JUZA 4NXNF 4DL3A 4Y92A 4FYVB 2HNIA 3C14B 5IZHA 4M75F 4WTYA 4B3SF 1PHTA 3EH2A 4J9LA 3T1HF 2QE5A 2M0GB 3GG0A 5CQGA 2XMMA 3N5BA 1JJ2P 2ZJRQ 2KT8A 4LQ9A 2CT4A 5DLGA 1UTAA 4K5RA 4DF8A 2DD4A 4HA8A 3HHDA 4FPIA 2EFPA 3PTAA 2OTLS 2V94A 4RU2A 1WDTA 2CQ0A 1M1HA 2YWKA 4N4HA 1NLPC 5HVHA 1OEBA 2EYYA 5C0MA 4PG4A 2ZAEA 4JYAF 4QT7A 1K1SA 3BO3A 4M1KA 2VD3A 2XMVA 1U47A 3TAPA 2UXCJ 4JJDA 3MMAA 2J06A 2JC1A 4QIWD 2MQMA 4AMCA 2FZKB 1KQ2A 2CZ0B 2A36A 3KNGA 2XGQA 3BS9A 1YHQS 1U02A 3GJQB 3OV7A 3OS0A 1AA1B 1R0AA 2MF2A 3KDNA 3CCVQ 3MTJA 4RBUA 5I11A 2BKOA 3DOKB 2X4WA 3FSYA 2XULA 2L3SA 4R25A 2E65A 1LFPA 5AE3A 4TNOA 1C2PA 5C24A 2K2VA 3OL9A 2HFUA 3I96A 5GANj 4B17A 4LFCF 5EHHA 4HT9A 2D3UA 1T3NA 4NLDA 3X28B 2MI6A 2ZH6A 1WHVA 3VS6A 4CC3A 4A47A 5KFTA 1MMAA 1I4K1 4GVBB 2X9HA 4W90B 3BN4A 3V4IB 3RMSA 5EN1A 1EETB 1GCPA 1IWGA 3OMCA 2KO1A 4DUZJ 3MPUB 2DO0A 3OQ2A 1X5PA 4PWDA 3J7A1 3FK4A 5A2QY 1VA7A 1W2BR 5HLFA 2B9YA 2AJ4A 1J2VA 5ETKA 4YQWA 1FNXH 1YJUA 4ZPTR 2GHWA 1JMTA 4OMQA 4NYPA 3M6VA 3QMQA 4ICLB 3IC1A 2CQ1A 5ETSA 1HK9A 2I0XA 3CJ4A 1PRMC 3RAQA 3PRVA 1N33F 1Y00A 4NLSA 5KFGA 4USMA 1AUSL 2OIHA 1WC6A 5HBMA 2F9DA 1TK0A 2AZ3A 3GPAA 1K9AA 3F70A 2DR6A 1KOOA 4RNHA 2ZVSA 2VDHA 3K5MA 4TVRA 1DFDA 4CM0A 2P9GA 2HQFA 1SQEA 3I32A 4IR1A 3NGUA 4O44B 5KFDA 1VISA 1LK5A 4QWAA 3KNAA 1CSKA 2PD1A 4ORZA 1RI0A 5CKFA 1XERA 2DXCA 2KYXA 2UP1A 3JSBA 2LXFA 3EG3A 4O4GA 3CNQP 2LECA 5GAN5 1VC0A 2I1RA 2IM3A 4H4OB 3AOAA 2QL9B 3HRSA 3X25B 4F0HA 4B3MJ 2FEIA 5DM6Q 3N0VA 3L42A 1HSQA 4WCIA 3QATA 4URSA 1RHUB 4AXJA 2B7BB 2C2DA 3ONQA 4IQXA 2QFIA 2E64A 1QCFA 4PYAA 4NI2B 3VAGA 2LZ6B 1YJ9A 3CTRA 3AHUA 4PAAA 2O3DA 1IBLJ 3KJNB 2NPIA 2FHJA 1SHFA 1W2BA 2OTJS 2JS0A 5CK9A 1LKZA 4M7DA 3DRXA 5LJ3j 3IXQA 1FNOA 2EC0A 2F5KA 3W62A 3GCWP 4I6YA 4YTLA 1WPYA 3L2RA 1N36J 3QRRA 4Q0BA 3KLGB 4E47A 2A7YA 1HW9A 2VDIA 4MTPA 3X20B 1HPZA 2QEXS 1S6OA 2LU1A 2CQCA 4PJJA 2QN6B 4J8OA 1SC3B 2OEMA 4PG8A 4RW4B 2R42A 2YKNB 1A6LA 3MM8A 3BYPA 3HHLB 3L2QA 4F14A 4X4RA 4O3OA 3A8LB 3JRZA 2M52A 1HNWJ 1Q81R 3W5ZA 1LWCA 4M5DA 4OMPA 1TKTB 4HT7A 6FDRA 1VQKA 2EQUA 1S1XA 4M5LA 3RB6A 1EQ0A 2JMCA 1P92A 3M0PA 3PJXA 1PNJA 5FWBA 5CVIA 3MEDA 1TUWA 1AWWA 4DA4A 1NRKA 2Z0GA 2EWHA 1WOPA 3QRPA 3QT6A 4WU3A 2KI2A 5HMZA 1P9YA 2KQWA 4GVLA 2UU9F 4ECRA 2UUAJ 2MIOA 4FW2A 2DJZA 5IT9E 3NS7B 4PJOC 4B9NA 1Y3KA 4Q43A 4WWSA 3CMEQ 1WHXA 3UPUA 2WAQD 4WXOA 1R8AA 4K59A 2HHPA 3G71Q 3HSZA 3Q86A 1D0ZA 5IN1A 2P4RA 4HTJA 1BQNB 1RQ0A 1I94F 3U23A 4C0ZA 2A2DA 3EVMA 1WZOA 1MMDA 1K9MU 1QUPA 1Y96B 2OSQA 1D1UA 2G3RA 4MIWA 4KT0C 3NTHA 3MEVA 1YK9A 2C3OA 4LF7J 4OI4A 1NKEA 5ECAA 1YBYA 4DG1A 4M4ZA 5BYSA 2A28A 2XWYA 2ZM6J 1JX4A 5FU6B 1NK8A 5LL6S 2X51A 3TP2A 2M8HA 3OXLA 3ULRB 1KD1C 1D9DA 2VPYB 1V5VA 3DHXA 4F4YA 1JLGA 2IRXA 3INZA 4NPOA 4WU2A 1UECA 2CZVC 4A63B 2M0OA 2GTOA 1RDRA 3DOMA 1SL1A 2IJNA 2C3PA 2J6FA 1EX8A 2WB4A 5I42A 2B4OA 1VQ5A 1VQ6T 3HSBA 2GCXA 3EG9B 3CD6A 4HACB 5LJ5j 2W2PP 5IC4B 3CCSS 1T95A 3BH7B 2I8EA 8ATCB 5A8RB 4MZTA 1X0PA 1YCSB 4A4KA 3KG1A 2KXHA 2V4RA 1FRMA 1WC4A 3I82A 3Q2TC 1F2HA 4KGMA 5CH7B 4IFVA 2YKMA 3Q89A 4KHMA 2JOQA 4ZVFA 4L3KA 1YI2Q 5B0EA 4DV1F 4CLSA 1WNLA 1ZA1B 5DY9A 2ZZDA 5IH2A 5B7WA 3M53A 2I38A 3W5XA 4B3TJ 3HMJG 2LU2A 1OULA 2I2LA 2KYZA 2JUFA 1AOJA 3IRWP 2DEQA 2RHSB 1N5TA 1KNZA 2CZ7B 1QE1A 1HI1A 2V8VA 4QWDA 2HVDA 5F8GA 1M5SA 3UW1A 4EMKC 3NPFA 4RZRA 1GQEA 4QW8A 1M1KR 1RADB 5ITHA 1RHQB 3PX0A 4OYPA 1KQKA 2ROLA 3QAEA 3D0IE 2XSJA 2YRDA 1FDNA 2VIHA 1C1BB 2CNLB 4H54A 1QCOA 3IBWA 2KXCA 1VDHA 3W2VB 1HQUB 3MM5A 3RRGA 2AGPA 3MEAA 1FT8A 2ZPIB 3W8GA 4YR3A 5M2RA 1W2BP 5FJ4A 5FW9A 2QT7A 2AJ0A 2PQWA 3UATA 1QD1A 4E8UA 2R8KA 1MWZA 2IVYA 1WOSA 3M4XA 3M56A 1KC8U 1WA7A 4UZBA 5HI7A 2LEBA 2QA4Q 3PO5A 1HWJA 4O0IA 4CH0S 3P45B 4I7FA 3S1TA 4Y2KA 4NLOA 1Q7YC 3QLHB 3U02A 5CCAA 4B9VA 4LQ3A 1IBMJ 2W9BA 3IBFB 1GCQC 3DLEB 2FDNA 4JV5J 4KYZA 4IUTA 2VBYA 1VQPA 2DH7A 2ZZMA 2PVDB 3FUYA 2WCXA 3HXMA 3JTNA 2ASYA 2GFUA 2HWTA 1YNZA 4K2JA 4QYZK 2XK0A 4X62F 5KFVA 1SC6A 3RBDA 1Y5LB 2FPDA 1WDDA 5DDQC 3QSUA 2RB6A 5FRNA 1PYOB 1ZPVA 4M78B 3G82A 4O3RA 3JCMX 4ZMMA 3QJLA 2E6NA 3OYGA 3F56A 2XMTA 4C0GA 4LVNP 5CKEA 1GXUA 4ZLNA 2OFGX 2M9UA 3DLLQ 2FYKA 2GQIA 1XBWA 1RZMA 4OYIA 1SB6A 2MGZA 3GU0A 2F4VJ 4ZVTB 4DLGA 2HNYB 2DIGA 5J2MB 2YXYA 4DR5F 4Q2MA 2XYGB 5LMNJ 2MWPA 3R5GA 4FIBA 2IYGA 4MK7A 3KLHA 5EWEA 3M4YA 5GAOq 4C3KA 3OSSC 3CCEQ 3CSKA 4X4TA 3FQKA 2VG5B 2V8KA 2IFXA 4M95A 4JZ3A 5IS2A 4DUYF 5ETNA 4ID8A 3OYFA 4HDHA 3ZZUA 2QK0A 1TG0A 5ETVA 3HVWA 5DETA 4GO7X 4PFPA 3LW5E 1GBRA 4DCJB 1HMVA 1ZZFA 2LT4A 1ZQ1A 5AT1B 2UV8A 5CD4H 1HQEA 3FSXA 4XAKA 3F44A 2WVCA 2E29A 3ZXWA 2HHQA 4TN2A 4EU0A 2VASA 2NUTA 4LRDA 4A8MP 1NDKA 2IAJB 3CCVA 2IPOB 3H0PA 4YB6A 2KZMA 1ZBJA 2XDBA 2LA4A 3KUGA 2WBRA 3M2VB 2RJFA 4Q5WA 3PVQA 4NXNJ 1YITQ 4B3SJ 1S6PB 3V6HA 3H41A 4IKFA 3T1HJ 1N27A 3NEKA 1XMOF 3OFEA 2AGQA 1T3LA 2LP4A 1TKZA 1BI2A 4AG1C 3Q8RB 1SSHA 3OR2B 1KVIA 3EHRA 1U4BA 2RQRA 2DO3A 3IR7B 1AWXA 1N8RC 1RHJB 4B9XA 3DKMA 2GCFA 4ES3A 4EBEA 2ZH3A 4J5OA 2FGOA 2CDTA 4CLTA 1SV5A 4JYAJ 4OI1A 3DLHA 3GFXA 1NJIR 4WP8A 3OTOF 4EK2A 2L08A 1KWMA 4HTIA 5K14A 4LF9F 3N6MA 4HI2A 5IT4A 1NUEA 2DGVA 2HBQB 5IV3A 2HGLA 4KKOB 1WX6A 2K2MA 3TYTA 1R8CA 2RDIA 5FU7B 1G5VA 1Y7PA 5GAHU 3A98A 2N4DA 5FRMA 1XC9A 1X60A 4ZGDB 4DL0C 3RIRA 4DX6A 4F50A 2B8QA 2P0QA 4G3IA 4LFCJ 3PE0A 2YX4A 2ZKTA 2YWFA 4B3RJ 3OTEA 4C3LA 4E7HA 2HKNA 4GO5X 2NSBA 2GVDB 3V6DA 4ZIVA 2D7SA 4CC2A 3HTRA 1TU0B 3WBZA 1H6KX 1RTIB 4ZLJA 3PEHA 5FROA 2B3TB 2P4TA 1X4AA 2C0OA 2MZQA 2DKGA 2KT1A 2NUUG 4USKA 3IRXA 2BE2A 1YHQQ 4OLOA 5KFZA 4BI3A 2BVZA 3OFGA 1KJWA 4YR2A 3AH6A 4ED7A 3VAHA 3CC4S 4WP9A 3CJ2A 1TMJA 1S9EA 1N33J 1HHQA 4L59A 4PLIA 1X6GA 3G6EQ 3U1MA 1S0VA 2GJ2A 3NFCA 3NY0A 1XK8A 3G6VA 3A8JA 3VQTA 1SF9A 1VQ8Q 1IHVA 1NKBA 2CP5A 1IUJA 4MT1A 5EGYA 2OPSB 4NXMF 1A7GE 4X4UA 3DRYA 1PSEA 2W1BA 1D8YA 1GX6A 5ETTA 1HNZF 3TOQA 3NWRA 3C16A 1BWVA 3UCUP 4DPUA 4YDXA 3I55S 1U8RA 2F40A 3I0RA 2DPPB 1FEHA 3I9ZA 2ZZNA 4MYTA 2HNDB 3HFVA 4OI3A 2XLIA 3J81Y 1NZ9A 2QTXA 1BHNA 1VQNQ 1JK9B 2CADA 1FKPB 2BJ3A 2XMUA 3Q8VA 4FZVA 4DPTA 2COLA 1VS3A 2HQEA 1S1UA 2EFQA 5DLQE 3OR1B 4O0NA 3CMEA 2BE7D 3H0IA 5GANe 3BGRA 1VOMA 3G71A 1UEBA 2R5MA 3M59A 1XN9A 1UGSB 4FSXA 2HS3A 3DOLB 3PMTA 3DRRB 2F63A 3MZIA 3KUFA 4RBVA 1SKUB 1DLOA 3DXSX 4IUVA 1QVFS 2L3MA 4IUUA 3C2PA 2HNZB 3G4SQ 2E10A 3H9NA 1E6YB 3B54A 2DGWA 1T9UA 2E5LF 2ADBA 4DR1J 4FBUA 2RNEA 2BKDN 1B07A 1OX8A 2YH1A 2HZCA 3ZFVA 2L9NA 5DQHA 1FFSB 2KRSA 2YQ0A 2AYMA 2YPYA 3FJ2A 2B8AA 4OYOA 3UO0A 1WF0A 2PC6A 4JS5A 4FKYA 4L75A 3SSSA 5J1EA 4R55A 2OPQA 1YJ9T 4PJOA 3RERA 3M6UA 4M5NA 2HIQA 4C8ZA 3CJKB 2MSSA 2VGMA 5KAKA 1NEEA 4RBTA 3GIIA 1N34F 3SCIE 4IOAQ 1PIEA 2AX1A 2FJDB 2ZDPA 4NCAA 1M2VB 3RKXA 3FJ5A 3MD1A 5HJXA 4PXEA 3OW2S 1I94J 1YKWA 1VQLS 4LBIA 5J1NA 5LSOA 3QBYA 1YI2A 3BFMA 3LA0A 3CMAS 2WW4A 4YMEA 3DB4A 1ZUKA 4EYIB 3THKA 5C2GA 4N7TA 1FWLA 1TKXB 2P84A 3JSYA 4HI1A 4Y00A 1LCKA 4B02A 3EGVA 2EK6A 2A10A 2HAXA 2R2RA 3TNVA 1RT5B 5DG8A 3WHIA 1NDPA 1HL6A 4N8NA 4AFFA 3MMAB 5GAN7 2EW3A 3EFOA 1QP3A 5B0CA 4FNHA 2FG0A 1NYFA 2EBEA 1IN0A 2OTLT 3W2WB 2VBWA 1H3HA 3H0FA 3B4MA 1JBMA 2V63A 2CUBA 3M0TA 2JM8A 4FXVA 3AOCA 2MKHA 3QDFA 3SEMA 1H74A 1KFSA 1O9SA 4CI0C 1TMMA 4FSSA 3D4JA 3I56S 4P52A 2XC9A 1JLQA 2VKRA 1OYDA 1QVFR 3DC2A 1SC4B 4PLLA 1UVIA 1RI7A 4NZ7A 4PQUB 4XU0A 4DOWA 3EZUA 3HFOA 1RCXB 2HS0A 4CZCA 3GYNA 5IQ6A 2J0SD 1T0JA 1OS5A 4PWDB 2W01A 5KYXB 2QA4A 3I35A 3EGXA 4PJMA 2V69A 4PABA 4E7KA 5HLFB 4N0AC 1WSVA 5GAGU 2XMFA 3HM9A 3MCOA 1U5SA 3H5XA 2DEJA 1K9MR 2QG9B 4F16A 2O4XA 2BW7A 1CQNA 4HHUA 1OQKA 2ZNZA 3NMAA 3BE3A 1I81A 3CCSQ 1Q81T 4EMKA 4W4MA 4J90A 5HBMB 3PW4A 1DURA 3P8HA 4NLGA 1QVPA 1FJ7A 2AZ1A 3BDPA 2RS2A 1FRJA 2C3MA 3D6MB 1PSDA 3R2DJ 2KGTA 2FLNA 3H5UA 3FBEA 1G3TA 3RZAA 4OQJA 3DGVA 2CQHA 2J7IA 5KYUA 4QVZA 2BV3A 5KFEA 4NA2A 1FI4A 2D74B 3NTKA 1RP5A 1T0TV 4ED8A 5IM0B 1TAUA 4F0KA 4BLGA 3TQ1A 3VAFA 4J9DA 2V0NA 2E5KA 4IIMA 1VQ5T 3OYCA 3K8VA 3CD6T 3DLLA 2DCLA 4NL3A 1OX9A 5FLXU 2QSFA 3PW7A 3NGPA 1NXIA 2B8PA 4OYBA 2LMIA 2XGPA 3NMZC 3TUZC 1JLEB 4H4KC 4NZ6A 4DQQA 3JCMb 1AVZC 2D3OR 4QYZJ 3JAMU 1U1TA 2EYWA 1SQFA 2E9RX 4ED6A 2XMKA 1H3ZA 4EUVA 3CCEA 3PYGA 4RNNA 4IO9Q 3LGNA 4RUCA 1IM6A 2CPDA 2IBKA 4WJBA 1U06A 2LMJA 4V2SA 3J80U 5BR8F 2KJVA 4OHXA 5GAMe 4PG7A 1X2KA 4UY85 1HPZB 1G3WA 3J7Z5 3JCMc 1KSPA 4QW2A 1MG7A 2FJVA 2VC1A 3WVEB 4M7AE 1X43A 5LMUF 3K7RA 1FX7A 2CDRB 2OTJT 3FRNA 4BDZA 4X62J 2UVWA 1U25A 3BEGB 1NBEB 2CVEA 1H72C 3NL0A 1HYSB 2LYVA 4K7QA 3SDEB 3NBPA 2WRMA 5I3UB 2YNFB 2RH2A 2B0GA 1K8AC 2JVOA 1QSLA 3HZEA 3KLFB 3GFHA 1YITA 1B7FA 2QEXT 5LXRA 5KFWA 1UFLA 3MEDB 4JJNK 5GAN4 2HZYA 4OHWA 2E6ZA 3CXCR 1Q5VA 1JJCB 1ZPWX 4I0WA 3CB4A 2K9GA 3Q8YA 2B9WA 3RBXA 5AXKA 5D6WA 4LUBA 4LDUA 2W25A 1KR4A 1KC8R 4M7AD 9RUBA 1D3BA 4F0MA 3A1PA 1M5HA 3WZ0A 3SD4A 4DUYJ 3PVXA 3DLGA 4F02A 4OZ3A 2XICA 1S72S 4RTWA 1RBAA 3C4SA 1L3TA 4JI0J 1TK8A 2V4JB 3FFIB 2MOXA 1RWNB 2LCCA 3M8PA 3NS6A 3T1YF 3QBCA 3P8BB 2JC0A 1M1KT 2DE0X 3A8EA 4XU1A 4V19X 4DG1B 2WK4A 2ZBPA 3TSZA 3FEXB 3D1OA 4X65F 2Y9HA 1O5JA 1QAYA 1H2UX 3H20A 2RM4A 2CPEA 4JUVA 4PFOA 2DYIA 3BM7A 2CSIA 2AF6A 2K4YA 5E3AA 2ASJA 4ZVSB 3CXCA 1UPMB 3DOMB 3D9BA 4MJKA 4F7VA 2BJ9A 1HNVA 4J9EA 3RB4A 2QYZA 1ABOA 4MIAA 1R8OB 3VVUA 4MKYA 2LX9A 1YHQA 3LP2A 5E3RA 2ESWA 4LF5F 2C2KB 1N5YA 3VS1A 4CRIA 2BQ3A 2N7YA 4KV8A 3BKUA 4RUAA 1LW0B 5EG2A 5KE2A 1KQ1A 1UWBA 1YJNS 5EWFA 3MUMP 3G6EA 2ZOFA 2EIFA 3CC2A 5I3PA 3O8WA 1M90U 3MR7A 2YKAA 1YP5A 5CZXA 4BBYA 1VQ8A 3HFZB 2DY9A 3DLJA 3V8KA 2YH0A 4DPWA 3MP1A 1HBNA 2X1BA 1UEUA 4BE0A 4J6YA 2JEIA 1QVGS 1OJ4A 3D3CJ 4DR4J 4P7TA 2D6FA 4M7AF 4NCGB 1YIJS 1LV5A 3POTA 3SSQA 1K73U 3TVZA 1JLBA 1S1VB 3GZ7A 1RKIA 2ATLA 4B9LA 1VIEA 4YY3F 1U24A 1NMEB 1SKSA 3VV2B 4OB1B 1PM3A 4OX6A 2NUPA 2R7XA 2IBOA 3CCRQ 3OL6A 4L6V3 3PX6A 2WOMB 4RCBA 4C8LA 1VQNA 1XMQF 2MLZA 3HK2A 1IR2A 1BI1A 2XSJB 1RLDA 1IB8A 3BBBA 1OPKA 2LC4A 1QVFP 3OYKA 3CDAA 1D1AA 1TKDA 4KC5A 1FKOA 2OUGA 3I5BA 4BY6B 1L3SA 5CZVA 4A8OA 5KCHA 2N7CA 3S6EA 1LK7A 3UCZP 4OYWA 4J6XA 3LH0A 4Y2AA 3B6BA 3EGDA 3G87A 4RKUE 3JCMe 5GAMg 2W8LA 3VZHA 5ETRA 3FC9A 3NKYA 1Q95G 3D1HA 3E1SA 3KG0A 3H90A 4HXJA 5IV4A 1HD0A 2AD9A 3TX8A 2EQJA 1OOTA 3SCJE 3OFFA 1S0NA 1NHKL 4WE1B 4YN3B 3G4SA 1IKXB 3ISND 3R97A 4DQRA 2HLTA 2W9BB 1KHVA 2YTCA 4A8SA 3UVJA 2RN8A 4ITSA 4BI4A 1I8FA 3PX4A 3ZTPA 2HMIB 5GAOn 3CC4Q 4P74A 1YSJA 2JLEA 3EHQA 3EG2A 1T9WA 2R8HA 2HRYA 4ZGJB 4EBCA 3R1HA 4PXDA 5KT3A 1OMSA 1DQAA 3HHTB 3Q2SC 2M16A 3V6JA 1DTQB 3GIJA 3LP0B 1X27A 4KY3A 2W9CA 2V1QA 4LUDA 3GYXB 3LP1B 4FKXA 4CO5A 3CQTA 2FPHX 2FY8A 2YNHA 2C2MB 3JCMP 3MM6B 2YPZA 1MV0B 1UB4A 4L74A 2YBVA 1DZ5A 3AFGA 2E70A 4CNZA 4NLTA 4LXCA 4JJCA 2M5YA 1TTHB 2FHKA 3I55Q 1NJIT 5IFMA 1BQMA 2U2FA 2RJDA 4WPAA 5A6WA 2ZHBA 3IWXA 2Q43A 2CREA 2K3BA 4J9RA 1AFJA 4DEYA 4J9MA 2E5LJ 4TY8B 4C5IA 1T9TA 1RYRA 4ZPBA 3NAIA 1F2GA 3HJFA 3LALA 5DS7A 2KEAA 4IUFA 1TK5A 5LL6d 3M05A 1C0MA 3M7VA 2ZVIA 1Q86U 2CH4W 3UDLA 1REVB 3LGMA 1RU1A 2RE1A 5IXFA 2NUTB 4X4NA 1C4AA 3ENWA 4CIOA 2LLZA 3QFHA 2XY5A 3QPIA 1SBRA 2F2VA 2QI2A 1MNDA 3OS2A 3V7SA 2VICA 3UCGA 3S6WA 2KFYA 3CXCP 4BE2A 5JXSA 2DVIA 3BH6B 3LPYA 1PJ5A 2FHOB 1X6BA 2JT4A 3QAUA 4F4KA 2HK3A 2DXUA 1MN9A 3I4PA 1IHWA 4Y34A 1U49A 5D3GA 2E12A 4NX9A 3D66A 1UGQB 2X7IA 2DEUA 1XJWB 1HW8A 4KAIA 4OX7A 2CDQA 2EGCA 5J26A 1RT6A 2PA8D 3G71T 1RT3B 1S0OA 2AK5A 3ZTSA 2ENMA 3R5BA 2ZBIA 1MWQA 1VIOA 2AYBA 2LDIA 5AXLA 1PGZA 4ESRA 4ANJA 3KK3A 2QQSA 5GANd 1T9XA 5CABA 3Q8QB 1VHFA 2VBZA 2PI5A 4M78G 3WIUA 1SV5B 3OL8A 3OD2A 2DJQA 3IWLA 1WD6A 3CCSA 4K4WA 2VF3A 1RT4B 2V5HG 5HP1A 3LAMA 4UC4A 3UNGC 2CJKA 1TL1B 4OX9J 4O3SA 4H4MA 4RR5A 1VQLQ 3T5HA 5GAN8 3VYHB 3TUIC 1VQYA 3BV8A 3W9JA 2XM3A 3UR3C 5KFJA 5AXNA 5HVFA 3HVRA 3CMAQ 3DU5A 5HANA 1PKTA 4MMOA 1WXUA 2G1DA 2XDPA 2GX8A 4C92B 5L1JA 3CJRA 3CWJA 1LWEA 2RF0A 2IDEA 2B56A 3M1VA 5GANh 4DPXA 2DIVA 2IM2A 3K5LA 3JCMg 4IURA 4OLPA 2OAUA 2MKSA 4MDWA 3QIPB 1APSA 2Q6CA 3L95X 2WONB 1T8EA 3OQ5A 1XNQJ 1GMWD 4ECQA 2G4BA 3KLEA 1N5QA 4N0AA 2DBKA 2LDMA 1PAUB 4HT5A 5A0YB 2EG2A 2ZJPQ 2PMZD 5DRKA 1YRUA 1YI2T 3MECA 3C66A 3PT9A 2FVUA 3UD3P 4JI1F 4LIWA 1WEZA 1ZUYA 1VLOA 2UUTA 4OHZA 1G7CB 3TAMA 1V6HA 4F3OA 4DV6J 4M77C 3I56Q 1Q0NA 3QT8A 2GIQA 4LF8J 3K5NA 3G9CA 1PKUA 2Z58B 3VS4A 1RT1A 1Z4UA 3A12A 2GS8A 3O44A 4RG2A 5FDLB 3LX7A 1RWPB 2E1PA 3CMQA 4OL8A 2RRAA 1UVKA 5LJ3d 2VA3A 1EIFA 2QGGA 3EDRB 4HEA9 5EUHA 3Q8UA 1H73A 2L3RA 1J5OA 2RMOA 2R7TA 4I69A 4NA3A 1AXQA 3I0RB 2YKPA 4C11A 1ITPA 2DK3A 2OD4A 1H2TZ 2MEWA 2R7OA 4H4KA 1GMWA 2H8HA 3JQKA 1F6TA 3FEZA 1RB0A 3ZNUA 4YOEA 4U96A 2W7PA 4C8OA 1AZGB 4RG8A 2E1HA 3UDEA 5KFQA 3EFRA 1SJ3P 3OLAA 1H98A 3CGIA 4WK3A 3QZ9B 2ABLA 4G1IA 4Y3CA 1NEBA 4E7ZA 1SUQA 2CS7A 3LQVA 1JB0C 1RTHB 1BC6A 2C22A 1HWIA 5BR8J 4J5YA 2MLYA 2DF6A 3KLIB 5LJ3h 3IS9B 4C92F 5F8LA 4CNYA 1RT7A 1LVKA 3CCMS 2HKEA 3DCAA 4F7UG 5CYQB 1VMBA 1FMVA 4DR7J 2BQUA 2E4HA 2DNRA 2VKNA 5F0UA 3M32A 4P5NA 4X64F 4FF3A 3FVYA 1XTZA 3D7SB 1MMLA 4ELTA 1DAXA 2FL7A 4QZVB 4P75A 1XR6A 2XIDA 4ME7A 5LM7E 1RACB 5B09A 5C25A 4B9SA 2ZDOA 2UXDF 4NMLA 4IFYB 1VQMQ 2A1BA 2J9CA 3P5BP 3BSNA 5E3PA 3MCSA 5M2UA 3M8YA 2AJFE 5DGAA 3K5OA 4RTYA 1D9FA 2XBPA 3PFEA 3ICLA 5J1EB 1ZBXA 3OUYA 1YZ6A 3T5JA 5E2QA 4CO1A 4OF1A 5KT7A 4PJOB 1QM9A 3ASKA 3VUBA 2ZBCA</