4ZN3A

Crystal structure of mjspt4:spt5 complex conformation b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
147
Chain Sequence
MIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTPKKIIENIEKGDVVEIIAGPFKGERAKVIRVDKHKEEVTLELENAAVPIPITLPVEGVKIVSKHKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Transcription
molecule keywords Transcription elongation factor Spt5
total genus 33
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zn3A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 4zn3A01
1M1HA 1VQ6A 1VQNT 3CCJT 1KQSA 3LH0A 4YTLA 1NJIU 3EWGA 2OTLT 2JOYA 1VQ7T 2EXUA 2OUGA 3QQCD 3CC7T 2MI6A 1KD1C 1VQ8A 3CPFA 2KVQG 3I55A 3CXCS 2LVMA 3CCST 2E70A 1YJWA 3I56T 1YJ9T 1YI2A 2K06A 3P8BB 2MWPA 3PIPA 3OW2S 1VQPA 1YHQA 2DO3A 3DB3A 3PIOA 3G4SA 3G71A 1W2BS 1VQ5A 1VQ4T 3CCUT 1M90U 2KDSA 2CKKA 1KHIA 2QA4A 3CCMA 1Q81C 1QVFS 3CCQT 3CPWA 1YIJA 1VQOT 1YJNT 3CCQA 3CCLA 5HY6A 3OYYA 1SSFA 3CXCA 3CCVT 3CC2T 3LPEA 1VQKT 3CCUA 1IZ6A 4QQDA 1VQ5T 1VQLT 1YHQT 3CCVA 1VQPT 3CC2A 5LL6S 1YIJT 5IT9E 3CCMT 1QVGA 1M1KC 1JJ2S 1K9MU 3CCRA 1VQ8T 3CC7A 4X34A 4ZN1A 3J81E 1Q86U 2QEXT 1KD1U 1VQ7A 3J80E 3LGLA 1YJWT 3CMET 1KC8U 1X6OA 1VQNA 1NJIC 1VQ6T 1Q7YU 1NZ8A 3HKSA 5J26A 1M90C 1XTDA 3CCRT 1EIFA 1Q82C 1KQSS 1UEBA 3CMEA 5DM7R 3CC4A 2E6ZA 5A2QE 2QEXA 1VQ9A 1YITA 1NPPA 1Q7YC 3CCET 4CRIA 1VQOA 3J7AF 2L3RA 1KC8C 2G3RA 3CPWS 2QA4T 3A5ZB 2MWOA 1VQLA 1VQMT 1VQ4A 1VQKA 3JAME 3G4ST 1N8RC 1K9MC 1N8RU 3CCLT 3CMAA 1QVGS 3CD6T 1YJNA 4ZN3A 1NZ9A 3TREA 1M1GA 3I56A 1YI2T 1YJ9A 3ER0A 3CCSA 1K73C 3OW2A 1W2BA 1S72T 1M1KU 3G71T 4RG2A 1XNIA 1K8AU 1QVFA 3CD6A 1S72A 5FLXE 3CCJA 3I55T 2LQ8A 2JUFA 1BKBA 3KBGA 2JNGA 5DLQE 3LGFA 3G6ET 1Q82U 2OTLA 3CMAT 3DB4A 1K8AC 2XHCA 4TVRA 3DLLA 3H7HB 2IG0A 1Q81U 1Q86C 1VQMA 2EIFA 2JVVA 1K73U 1VQ9T 2LCLA 3CC4T 5IAYA 2OTJA 2OTJT 3CCEA 1YITT 5J3BA 3G6EA 1RL2A 1YBYA 1NPRA 1JJ2A
chains in the Genus database with same CATH superfamily
5GANh 2QRRA 1SKWA 4OI1A 4WBFA 4AE5A 1CJKA 4NOHA 2NYSA 4M7AF 1S4EA 1K76A 1XK8A 5HCKA 4MZPA 4NLUA 2V63A 1X27A 2E65A 3GYXB 4PWDA 3TVKA 5LL6S 1BCOA 1IKYB 2A08A 3BM7A 4AG2C 2K6DA 2CQ2A 3AJDA 2Z58B 4HXJA 2YKMA 2QMWA 3RNJA 4WF2A 1U0SA 5A76A 2GNKA 1D3BA 1BBZA 3FCHA 1S99A 3IFEA 2F9JA 2VDHA 3R5AA 2RQMA 2OFHX 1VR6A 2EEYA 2QEXA 5EHHA 4EMKA 3C6UB 2DL5A 4IH6A 2XK0A 3LP1B 5SUHA 3F44A 5J2MB 2O4XA 1EFNA 2J0XA 3QAEA 4DV6F 1NZ9A 1C6VX 2YKAA 5GANf 1N52B 1SKRA 1SJ4P 2DB1A 3NTIA 3ISND 2MQOA 2HL3A 1RI9A 1OULA 5CKDA 2DPIA 3OYNA 3CMAT 1KEKA 3D0GE 2V8KA 1UGVA 3OR1B 4F4AA 2OTJS 2CZ4A 3CC4T 2GFAA 2YNGB 1SJ3P 1IHVA 2VFUA 3PW7A 2J6UA 2VGNA 1WI6A 4P7VA 1SG5A 4L73A 2RQWA 2IAJB 2GTJA 4OI4A 4X4PA 4OQJA 1R8OB 1PJ6A 4LE9A 1QAJA 3HFZB 4XTUA 2DJWA 4WCIA 2GHWA 1B99A 4C8QF 2VF3A 1VQKT 3MF5A 4E7JA 2IJNA 2A18A 1YN8A 5HMWA 3CPWP 1YSJA 3GLJA 2RJEA 4E7HA 4PJOD 1WC1A 4KUIA 4CLSA 2X35A 2DA9A 4GKJJ 5CA5A 1H3ZA 4LF4F 3GIKA 1GBQA 1E6VB 4YY3J 2KRMA 3MEEB 2BQRA 2GMJA 5FLXU 4HCZA 5KOWA 3SFUA 1WTBA 4CYUB 2M88A 3VS5A 3JCMQ 2QL9B 1R6VA 4F4WA 3UFCX 5IM0A 4KC5A 3EGNA 3B54A 1HXDA 2V4JA 2P4TA 1UPMB 2RVJA 2C3OA 1M2VA 1UW9A 3TAPA 5FLXE 1N5YB 2B4UA 1U1PA 1BKBA 4JB8B 2HHHF 1JIHA 3DLJA 4BDZA 4ANEA 1Q82R 3NNCA 1VQMA 2VONA 1DRZA 1UEKA 3FJ2A 4UC4A 1RTZA 4NLOA 2GVZA 3OYJA 3GZ7A 4RR5A 4CT9A 3NGRA 1YCSB 2D0NA 4A8OA 4RU2A 1ZS6A 2JRSA 1U8SA 4J9PA 2ZKTA 1PWTA 2QA4A 2DR6A 1P1LA 2GV1A 1PKUA 5IWAJ 4PYDA 1K1SA 2K2PA 1JXMA 4DR2F 1GXUA 4B6MA 2B86A 4LFAF 2VFTA 1VQ7A 1TTHB 2KG1A 3G6VA 4E7IA 4IKAA 5KG5A 4WPAA 1VQNA 5J2PB 5CO7A 1U45A 1NB7A 1EKRA 4C11A 1CKBA 1GXTA 3TJ9A 2HKEA 3A4TA 2CRLA 3KG1A 2ZBRA 2Y4YA 1OU9A 2VODA 5DG8A 3FQKA 5CD4A 2YNHA 4XTZA 4C0DB 1N8RU 2YWWA 5IQQA 2FVRA 4U7UK 3CCSA 1M2VB 4IO1A 2JXBA 2KBTA 4OP0A 1WJQA 4M7DA 1DQ9A 4R0JA 4MMKA 4N5SA 1YJWS 1AEYA 2K5IA 1RTIA 4C0BA 2JTMA 2DO4A 1ZH5A 1QVFR 3NG8A 1IRXA 3VAGA 1N34J 1E6VA 1Y07A 3M57A 3NCRA 1H2TZ 4USHA 1EKSA 4WP9A 1WA7A 2J7UA 1O51A 5CZXA 1LQ9A 4DHVA 1RA7A 1HLWA 4MT1A 3S6EA 4K4WA 3JCMf 3MI7X 4GLMA 5HY6A 3EYZA 2DEQA 4KSEB 4K4YA 3KHGA 1YIJT 2GFFA 4OYPA 3R9LA 3HPOA 5DJBA 2HK3A 4CM0A 2UZAA 1R8AA 3CMET 3M05A 2GIQA 3A8IA 1NB2A 1V29B 1FNMA 4M1KA 2EI5A 4RNFA 4OMMA 4P6QA 5H9FJ 1RP5A 4QWBA 1M90R 2DRDA 3BH7B 3KJNB 3HFVA 3VZIA 1LW0B 3IWXA 4LF7F 4ZK7M 2BDPA 5KFIA 2ZPHB 3M9QA 3UI3A 3JAME 3MCMA 5IH2A 1YGYA 3NAHA 2KAFA 5I22A 1RAIB 3AXKA 1SUQA 1WWHA 2EGCA 4XO0A 4P5NA 1OI1A 4R8UB 4KPCA 1TKXB 2NCKL 3RR7A 5DDQC 3GSIA 4ECTA 3JCMV 1Y4ZB 5J2MA 2UP1A 4LN2A 4DS4A 2CH4W 2AX0A 2EK6A 1WOPA 2D1XA 1N8RR 1FRIA 3AD9C 3CCRS 5IT9Y 3HK2A 1JJ2A 4ZPAA 2CWXA 4O44A 1NMEB 4A8WA 5FDLA 3DLEB 2LCSA 1LK7A 2DJZA 3IRWP 3I56T 2XMTA 4P73A 3NOGA 1PHTA 3MOJB 2OMOA 3RIRA 1M90U 2DO0A 5KFEA 2MZQA 3PX6A 2JEFA 3G4SS 3NBPB 3V5RA 3CCVT 5H1SV 3M2RA 2VG6B 2MPXC 3GU0A 4UUWA 4HT5A 4DX7A 3PR5B 4X1VA 2EBGA 1NSKL 3PW5A 4HKEA 3KWMA 3RAQA 4TYAA 4X34A 3EFSA 1R6YA 2KJVA 3BB5A 2K7JA 2K3YA 1PRLC 3H6ZA 3UPUA 3VV2B 1UZHA 4R5PB 4OZJA 2DZ9A 5J39A 1VJQA 1DZ5A 4DX8H 3T1YF 2RQUA 1R0AB 1B34B 3ZZOA 3H4DA 5GJWB 4GKKF 4LRCA 5GAN8 4RG8A 3K5NA 1S6UA 3M0PA 1HBUB 3J7AN 3L2ZA 4AT1B 4M75G 2AHOB 2HVEA 2ROLA 4F2SA 4M7AA 4W90B 3FKBA 2D3O1 3I96A 3DDIA 1Q4RA 1KQFB 1UA0A 3D6FB 4F26A 1XNRJ 3RBZA 3KK3A 4HL9A 1VQ6A 2MQNA 4ZJOA 2LVWA 3K8VA 3MM7A 2OI3A 3M0UA 5IHIA 3OYBA 1QLNA 2KDSA 4MK7A 2ZH5A 1YJ9S 4J5OA 3HHLB 3CC2S 3RBDA 4I67A 4NLQA 2ECZA 3S01A 3PO5A 1G1XA 3ZFVA 1RABB 4CNYA 5LM7E 3OA6A 2N4CA 1V6HA 1TMMA 3MECB 1WKLA 2LFVA 1K44A 1SPBP 4PG8A 1T94A 1NYGA 2EPIA 1B7FA 5A8WB 1BIBA 1D9AA 2OHDA 3TANA 3HKSA 1IHWA 5GANj 3NY0A 1FWZA 5A8KA 1NPPA 3P5TL 2C2OB 4OMPA 3HFOA 1XBWA 1XN9A 5CXTA 1F2GA 1OIAA 1MV3A 3C19A 1U2CA 4O0NA 4DV1J 3QT6A 1N0UA 2E1PA 2B8QA 1M5OC 4Q8FA 4N41A 3GIJA 3MCNA 2EFGA 1Q82U 2X4XA 4C8QE 1O75A 4ZPDA 2VKNA 1LV5A 1RAEB 2UUAF 4DSJA 2HURA 3SDEA 2DT9A 4F3MA 4E0DA 5B08A 2CJKA 2Z0WA 3L7PA 5FROA 3BBCA 2M9UA 3BGRB 2CADA 3CD5A 2EG1A 4X62F 2CQCA 5GAGU 3PIOA 3Q83A 2F1LA 1Y00A 4DPXA 1WLPB 3KK1B 3DLMA 4AL5A 3MDFA 3O3LA 4F16A 4ELYC 1GNKA 1WXBA 4C8OA 1VQ5T 2LA6A 4USTA 1A6LA 1YJ7A 3OY9A 4ICLB 4DR5J 3DNCA 2CZ9A 3JTPA 4OF1A 1T9WA 2H51B 4AQYJ 4VUBA 2JJ9A 1VIOA 4YMEA 1PGZA 3GG1A 1X6OA 5ETKA 4BDYA 4M75D 4I56A 2YT6A 2KT1A 1SH3A 3AJ2A 3ET6A 4OL8A 2ZM6F 4FPIA 2E44A 3L09A 2D7SA 4Y2MA 2Y9HA 3CD7A 1KKHA 1RAJA 4ETZA 5I3PA 5LJ3f 3M53A 1T03A 4JI4J 3CIZA 1JNZB 1FJGJ 4IQXA 1S1WB 2GQVA 4FYDA 1QW1A 1MMDA 5D77A 1HNIA 5IWAF 4ZTJA 3PVLA 3F0NA 4CLWA 3GJRB 1FD8A 1QAXA 2IPOB 3FC9A 2HVIA 1QLYA 1WEXA 2LJ0A 1YDLA 4ZCKA 1PCXA 3C12A 3CCJT 3ASKA 3EXYA 2CP2A 4X4RA 2LJ3A 1TAUA 5J1EB 5KFPA 3CPFA 4IG0B 2OLWA 4DR5F 4AL7A 2YNFB 2N3LA 3TU4K 4XAXB 1RI7A 1ZAXA 2WAQD 3GJSB 1IBLJ 2G0JA 4HLBA 2KYMA 4H4OB 2HZVA 1XQHA 2NLUA 2O1PA 3DRYA 4C98A 4TU9A 4DQSA 4LQ3A 1VQPT 2B4VA 3MEEA 2B9YA 1F60B 3QJ6A 2E9TA 1K0TA 4WK1A 4IDKA 3GBQA 2MJUA 3CCVQ 2L3PA 3MM7B 2J6TA 4JZ4A 4K5SA 2IDEA 2LP5A 1XTDA 2HNYA 1R7IA 3W3SA 4M8LA 5GAEU 1MSWD 4NEYA 2ZBQA 4UUXA 4LMZA 5A6WA 1WQWA 3IC1A 1H3DA 2AWZA 2G3RA 4ZVUB 1FXDA 4WP3A 1RT6A 4C6AA 3A8LB 2IYGA 2M7SA 2LQJA 3T1HF 2HVZA 3JRZA 4PXEA 4FVCA 1WDTA 3JQJA 2XB2D 4USVA 4RW4A 3RB3A 3OS0A 1NEGA 1G83A 2LX7A 1M3CA 5CKEA 3NGPA 2QA1A 2WBRA 4B9TA 3KLFA 1R0AA 3R6NA 4PQAA 4UQGA 2YUPA 2XMJA 5CR2A 1NKCA 4LD9K 4J7FA 1VRTA 4L75A 5L9NA 2RD5C 4JRPA 2CZVC 3TO8A 1UWBA 1RA6A 1WHHA 1YBUA 4XU3A 3M8QB 2VQEF 4TU8A 5KFRA 3QJJA 4ZCLA 2QTXA 3GB0A 4QQBA 5FU7B 2MMPA 2EAYA 5FD1A 2EJGA 3PTAA 3ETMA 3R1LA 1CVJA 3ZC4A 3CMAQ 2L3MA 2H3EB 4IUQA 4OB0B 4WIIA 2NZ4A 4C92A 1RDRA 3RMSA 2GJIA 1F9FA 3HDSA 4RW8A 4EPCA 4ZVPB 1VQ8Q 1GFDA 1D3BB 2M3DA 3CB4A 2OPPA 3CMQA 2O2OA 3FDSA 1HNWJ 4C92B 1UEBA 2H9ZA 1SV5A 5HAOA 2UXDJ 2A37A 4J9QA 3REBB 1WPYA 4OX9F 3RR8A 4RKUE 2K5FA 4M77F 2QA4T 3I9V9 1TVRA 2RMOA 4FYXB 2AEMA 4M78A 1S0VA 2PN6A 5GAMg 4E98A 5HI7A 2FHMA 1S72S 3DOMB 2QMUB 2F4VF 3MM5B 4JV1A 2EKYA 2R2UA 1ZUYA 3OTEA 2Z0GA 2ZHBA 3TZYA 1N8RT 2PUOB 1BMQB 3GFHA 1NKEA 1OQ6A 3EGVA 2HS3A 4C92F 4OI2A 1RAAB 2F2VA 3I5RA 2UVRA 2B43A 3RU0A 4N47A 2GVDB 1O8BA 2C2ZB 3MZIA 2YQ3A 4LBIA 1GX5A 3KMQA 2MI6A 3C4SA 3FBBA 5MAOA 2EKNA 4RTUA 4YB7A 1G2BA 3VR1A 4M7DF 3HRTA 1Q81C 1R0CB 1HBOA 5HQLA 1N32F 5EX3A 2HHXA 1BY9A 4DU7A 3OL6A 3OW2P 3PACA 1MWQA 5HANA 3MM5A 3IN5A 3PZPA 5GANe 2W25A 3ITHA 2A1BA 5LJ3g 1X4GA 2EBEA 1G3YA 3KFWX 2DITA 1N48A 3FMWA 1X0PA 2XWYA 3W8GA 3H8ZA 5GMEA 2DGWA 4RZRA 3UVJA 3AQPA 2ZH8A 1VCTA 3PHTA 4CRIA 3R7NB 3BV8A 3ZTPA 2P0KA 5I11A 2RJCA 3CCLT 3CMAA 1YJNA 3PM9A 1YI2T 4I1TA 1ZZNA 3HCXA 2RRBA 4DXLA 3QWYA 2KVQE 4DL7A 2GIFA 3DHWC 3OTOF 4Q43A 4OX9J 4Z7CA 3K58A 3PKYA 4CLFA 3RB4A 1Z4UA 1RISA 4MDWA 2MOXA 3OYMA 2V2ZA 1WC5A 2H5IB 4WE1A 4NE9C 3VS0A 4C11B 5KFCA 1T05A 1V5VA 4DPUA 4UY8T 2XO6A 2XSJA 2MKSA 3GJTB 2E66A 1RAHB 2VC0A 2IJRA 2C2EA 4JI7F 1Q81T 4QCLA 1W2BS 1KBRA 2XG8A 5LJ5Y 2VBZA 3D6HB 3Q23A 5HP1A 1KG1A 3I56S 2Y8WA 2V9KA 4IG3B 3E9FA 1Q86T 4I7FB 1M27C 2W2OP 1IZ6A 1GXIE 4Y6IA 3BKFA 2ALYB 2CYYA 4FPRA 5F3ZA 3OHBA 4R25A 1FF2A 3BYRA 2JEJA 1F5BA 2RA2A 4OYWA 3BR8A 3GE9A 4DCPB 4OJGA 1BHNA 2VXFA 2KXFA 5A2QU 1FXRA 2B9EA 1FX4A 2X9HA 2EQUA 3OBWA 4QW2A 2GVZB 4ICLA 4RX6A 4BBYA 2K7KA 3IM9A 2QGFB 1TMJA 2CPHA 1VQMS 4HH1A 3F70A 2XLIA 4UTGA 4J9NA 5EX0A 1LW2A 1S76D 3T1HJ 4AQYF 3CJ5A 2KHDA 3CCQS 3JSRA 1FJEB 3PHEA 5L23A 3S3OA 3VS3A 2HDAA 1RKJA 3RTVA 3LP2A 4QT7A 1RAOA 2P0QA 4H4OA 2RQTA 1QSSA 1D0ZA 2RDDA 5HVFA 4NI2B 1ZUUA 3Q8SB 2O66A 5HBMB 1HQEB 3IBFB 2CG8A 1BIAA 1NJXA 3NTHA 2BIVA 4DSKA 3US5A 3HD1A 4IFVB 2VWFA 5FRMA 5IC6B 1WKKA 4J9VA 2LQ9A 3BSAA 2I2YA 3KJVB 4LF6J 2RS2A 2G13A 2KVIA 4QZVB 1Y3KA 4E7ZA 5F8GA 2ZJPQ 2C3UA 3RUBL 2L3QA 1QDUB 5DDOC 5DGAA 3GPLA 4B17A 1XOVA 4ZLLA 4EBCA 2ZOGA 1YI2Q 3LPEA 2NQPA 1RWUA 2ZPBB 5A8KB 2P6SA 2HFZA 3V6JA 2RQRA 3EXCX 4CT8A 5F9NA 5HQ8A 1G6BA 3AD7C 3UF4A 3CTRA 5LSOA 1NU4A 5DQIA 2KFYA 3LAMA 1R8CA 2AZVA 1U48A 4DV3F 4LQ9A 1X6BA 3DMJB 3MTJA 1VQ6S 1HYSA 4J6XA 2DIQA 1OSCA 3GG0A 2ZH6A 1FCAA 2CQ1A 2DXBA 4MKAA 3LLRA 5CCLA 1WFWA 3PJXA 3HSBA 2ATCB 2KTQA 3MR2A 3PO4A 4JPBW 3MD3A 3RW7A 4N8OA 2ZDPA 1XR6A 5LMUF 2XDPA 2V6AA 4PJMA 3EVMA 5CAAA 1TL7B 2VBWA 4G1QA 2RB6A 2DJQA 2ZCFB 3G82B 3EZUA 2ZOMA 1QWEA 5KOXA 4ERDA 1WJRA 4GKKJ 1DJ0A 5C5JA 3UCZP 5GAMj 4O23A 3AAWB 3EE3A 2ZBPA 2ZOFA 4M94A 1YBYA 1G3TA 4LR8A 2VFVA 4J9KA 4PG5A 4O5VA 1HNXF 1IBKF 1RBLA 2R5AA 2Q66A 2RJDA 2P5VA 2D1CA 2GF7A 1VQ5A 4NCAA 2OTLQ 3G7ZA 1PSFA 4LF8F 4HT9A 1Q8LA 1TQLA 2A3JA 3GCWP 3SBMA 3VAHA 1S6OA 2HFNA 5A0YB 4IOBA 4DV7J 1N5ZA 4PXCA 3K89A 2WSEC 3AOBA 4U8VA 4F3OA 2YQ0A 4RW7A 2VXEA 3JCMW 2XWXA 2UUCF 3TUPA 4KO0B 3BJYA 4NLTA 3G4SQ 4A46A 3MUMP 2DBKA 3E19A 2OSQA 3NAIA 2CQ3A 3MMAB 3NBPA 2MKYA 2HQFA 3HI9A 1VQLA 3GV5B 4EU0A 1FKAF 1AFIA 2DERA 3OJSA 4N4GA 2KRRA 4V19J 3OUYA 3Q8PB 2K8GA 1IQZA 2SRCA 4ATNA 2HEQA 5GANd 1NK4A 4J9BA 3PFSA 5KFZA 4U7UD 5H9FK 1X2KA 3G8SA 3X20B 3DLLA 1Q79A 1ZHIA 3MM8B 1V3SA 1S7IA 5AJ3F 2N82B 1HR0J 1VQNT 3UD5A 1LWXA 3LPYA 5KFUA 3HKWA 4JI6J 3EM1A 3OYFA 3S3MA 5I3UB 1KOOA 3PIPA 4GO7X 2B56A 5C0MA 4EZ9A 3CCJQ 1HI0P 4AFQC 2A6MA 2DNOA 1YIJA 2FJEB 4CLUA 1YWOA 3PYGA 2HWHA 2VG5A 3HVWA 1VUBA 2PI5A 3EDRB 1WHJA 2ILZA 4B9UA 1U1KA 4WKYA 2MLXA 4NLYA 3ZZZA 2LC4A 2Q6CA 5GJVB 3L9ZA 2FHJD 2E3IA 1M5KC 4LUBA 3CCET 3MM9B 2PE8A 1F3FA 2DFUA 5FWBA 1VFJA 4I2QA 2XQCA 2HRYA 3OSSC 3OB9A 4DEYA 1AZGB 3R2CJ 2COZA 2BJ8A 3CDBA 5IFMA 1N27A 3M9NB 4WFYA 3FFIA 5LT5A 2FJBB 2ZM6J 5IHNA 3H41A 2HAXA 3BGOP 1JLBB 2VIHA 3V7RA 1FI4A 2YXLA 3WQPA 1XEZA 3PFEA 2HSEB 5KFYA 1Y5NB 1PM3A 4M78G 1ZTWA 2CA9A 4C9DA 3ZTOA 1BQMB 2FGOA 1QQJA 2XDBA 4CWBA 3FCWA 5JXSA 4EYIB 2CJ9A 3EGWB 3LWIA 5KCHA 4JV5J 2MSTA 1B0TA 3DOLA 4WTOB 2E5HA 4FW1A 1NLOC 3BR9A 4PQUA 4X66F 1VQ4S 4WJBA 3I55S 4R8UA 2ED1A 4G1QB 4GVBA 1NEBA 1YZ6A 1S5ZA 3U7JA 4AXIA 3OYHA 2AHJB 4Y3CA 4ZITA 2BA9A 3Q8VA 3K57A 2PTKA 1WORA 2YRDA 1BQNB 1OMSA 3QWPA 1RT5A 5HROB 2FZKB 3QAUA 2VFSA 1NZ8A 1QCOA 3CCRT 1UB4A 3W5ZA 4KRWA 2E6ZA 1URNA 1WX6A 2ZJRQ 3J7YI 2UVVA 3J7AF 5AT1B 4J90A 1OU8A 2DH8A 1VI7A 3L1AA 4KT0C 2XG8D 2V68A 4AFUC 4EYHB 3BDEA 2EGAA 1W2BA 2OH2A 3QG1A 2CG4A 1S1TA 1T95A 4FXVA 3M8ZA 3HHTB 3KNAA 1N5SA 3GPAA 3MCSA 2DTJA 1C0MA 3SIPB 1P9YA 1WOOA 2VBXA 2XMMA 4JI8J 3NNHA 4LUEA 5L1KA 5E3PA 3SD4A 4YHHF 4I4BA 3EGZA 1QUVA 4JI0F 1RBAA 3UNGC 2KN4A 4K2JA 2V4QA 4TN2A 4MMOA 1N36J 3ZZTA 3J80Y 8RUCA 3WX8A 3SCIE 3CCUT 1KC8T 5KT7A 1W26A 4F36A 4JRIA 2F65A 3DRSB 6AT1B 3CCVA 1ZA1B 2I6WA 3V6KA 4ZJQA 4ZPTR 3QSIA 1W2IA 3I35A 3M8RA 2XIDA 5F41A 2QLJB 1SCJB 5B0FA 2R7UA 2E7XA 4KFBB 5CKFA 1UZDA 2DNNA 2RHZA 3H59A 2MKHA 2CVEA 2O67A 3I4PA 4C92E 1JJ2R 3H40A 3TCJA 1IO6A 4ZCIA 1VYTA 1NRKA 3GSDA 4LF2A 2LCCA 1S6PA 3R6OA 2GQQA 4WTYA 3UCGA 3PV8A 3FJPA 2FG0A 1C1BA 2CREA 3UWNA 2HG4A 4JJCA 1UKUA 4ER8A 2CQIA 5CHCB 4Q5VA 1DTTB 4E7SA 1FKPB 3JB9I 4DOZA 4M5DA 1WF2A 5AE3A 2V5HG 2WZ1A 4B3OA 2M0OA 4DV0F 3UDCA 1C0TB 2E5KA 3EFOA 1JJHA 4PLIA 1SHFA 2CPZA 3L7UA 4QQGA 2HHTA 4UQTA 4ZVOB 1K1QA 5GMDA 3RKWA 1D8ZA 2CKWA 2I2LA 2QASA 3OTBA 4DQQA 2BRLA 3HHLD 1RHJB 3SQGB 2BM1A 3CCMT 1BGXT 3O44A 3EG1A 4X84A 3T5KA 2JEGA 4NLVA 3VF0B 3CXCR 2AD9A 2VUBA 1D09B 3A3NB 2D9TA 3TOQA 1MNDA 4QOTA 4J9HA 1KLMA 3ISNC 2KRNA 4WFAQ 3AFGA 3TAMA 4DX5A 3UVJB 2DXEA 2PGCA 2W01A 1E6GA 1SSHA 1KQ1A 2ED0A 1KVKA 3DRPB 3W63A 2E6NA 2NYHA 3UDLA 4K4SA 3O2IA 1P1TA 1OV3A 4J9RA 2L0AA 3MMCB 1S7HA 1YZ7A 5IXFA 4QIEA 1ZM4A 4C97A 1FDDA 1RHKB 2G9OA 1QKXA 1K8AR 4TVRA 4NLGA 2FVCA 1Q81U 4KGZB 2JVVA 1X4AA 4CRJA 1JXOA 4QU7A 3SWNC 4KBMB 1CEZA 2JWNA 4PJOC 1IKWA 2CPFA 2P8IA 3R5GA 5L38A 1YCYA 5LJ5j 1WGSA 1NK5A 2QQAA 2K1RB 1Y5LB 2VPYB 4X65F 2B5JA 3RZAA 3PNWC 3OL9A 2KR3A 2BQ3A 1VQPQ 4G6VB 4N0AC 1T05B 4QVDA 5K8PA 1PYOB 4I64A 3GOXA 3DOKA 2LEPA 3WX4A 2FRYA 2YSQA 3LA0A 4A8SA 4CQ1A 4K50A 4CTAB 1TVRB 5GMKe 4NYPA 2VKZG 3CO0P 3H0PA 1N33J 3TQ7P 1RT7B 4WU3A 4F0HA 5LJ5g 3W1YC 5I42B 4N4HA 2O31A 4Y2CA 1S4FA 1NK7A 1WC4A 5FWCA 4USWA 2UXBJ 1VRUA 2G2YA 2XD0A 4E8UA 3M4YA 3OBIA 1U1RA 3WVEB 4H4MB 1YK9A 5E3AA 2ROTA 3QGHA 4PKCC 3TQEA 4DZ6A 3JB9k 4MKBA 2OAWA 2CP0A 5C24B 3TVYA 2AGPA 2W7AA 4X4VA 3HP6A 4J7IA 5CYJA 1PAEX 2ZGWA 4ETXA 4JI0J 5CAIA 4ED0A 4KGXB 4WWSA 5HMZA 2KNBB 1IJEB 3CCJS 1S1VB 2DR7A 3G4SA 1WJ9A 3CNQP 1IM6A 3OSVA 3BFMA 1XMQF 4HVUA 1JMTA 1SPKA 3CXCA 2BMBA 4ELUA 3HVTA 3QSUA 1BI1A 4QPTA 3CJSA 3E3XA 2C3PA 1RTDA 3M9OB 2FLOA 5L39A 3PW2A 1FE0A 3LGHA 2DGSA 2ZWPA 1JLFA 4O3QA 1RLPC 1SEMA 2CP5A 1NJWA 1RAGB 3ZZRA 2DVIA 2COLA 4I6AA 3MMCA 2DIUA 2CDTA 2CFXA 5JJBA 1MGQA 1LOUA 3A8OB 1RT4B 1S6QA 3VUBA 2AJ0A 1XR7A 1FTCA 2E1RA 2R7VA 5K8NA 3PX0A 3SCLE 2QA4S 4Y0FA 1KHWA 3DRPA 2BJ1A 1DARA 4P75A 4H4MA 2X3WD 5C42A 1Q95G 1WF1A 2FPFA 1CKAA 2V94A 5D3GB 1KK7A 2ABYA 4X66J 2OAUA 4GKJF 2HMIA 1VQ9Q 4RJVA 1Q86C 3K5PA 2RM4A 3HX9A 3EG0A 4J37A 5I2SA 3ZTRA 1M1HA 1UEVA 5HJXA 1RT7A 4M75F 5LXYA 2RHYA 3A13A 4OFZA 2LX9A 2HFOA 3ADAC 1H2VZ 5D0EA 1N6QB 4M5DB 2MZ1A 3CCLA 1IR0A 2DY9A 3QLHB 1VRTB 2B4PA 2WSFC 1DTTA 4ZVHA 2PQWA 4KGKA 1M1KC 2ZZDA 4NASA 3VQTA 5A8RB 5KT5A 2QEXT 3VAKA 2JHEA 5KFVA 1VQ6T 3BKTA 2BKOA 3TEHB 4DL6A 1ELOA 2WK4A 2CDQA 1MROB 4LDWA 1AFJA 2YDLA 2RMLA 3MEKA 4DR3F 4HEA9 4TVAB 4RWWA 1RWOB 3CC7S 2BM0A 5EGYA 3JTNA 3UCUP 3JSYA 2DHHA 3H0HA 3O5ZA 2EPDA 1OYDA 2MQLA 4DOVA 2R3VA 1QVFA 3CD6A 3CCMS 5IS2A 2LEBA 2R8IA 2J6FA 4M4ZA 3CJKA 1UHCA 2HNYB 3CWJA 3MOZA 1UJ6A 2CQ0A 4ZJLA 3TSZA 2VHGA 3P49B 4BI4A 3H90A 4A8YA 1BYMA 5J2QA 3HSJA 1FJ7A 4DV0J 2HVHA 3DLKA 4ECXA 4GMKA 3SDEB 1KLMB 3HRSA 3D2WA 3OL7A 4LDXA 2YKQA 4ZVSB 2RJFA 2ZH4A 2YNFA 4FT2A 3BPSP 5ETTA 4L72B 2R7RA 3CPWA 3DGVA 5F8JA 4ZPCA 3CCQA 3BBBA 4D3HA 4UOGA 5DLGA 1UMJA 1ZAVA 2IRYA 1Y71A 1QAYA 2QTWA 3ETOA 1TV6B 5C25B 3LH5A 2AP6A 4HI1A 1NDCA 1C0TA 4IKFA 1KQKA 3ZO7A 2ZWOA 2KSSA 3DRRB 5KFSA 1AWJA 1OY9A 1PC5A 2KFZA 5DZ6A 1VBZA 3NFCA 1UJ5A 2N7CA 4MFBB 1S1TB 2W10A 3M30A 1AVZC 2NUTA 3PG9A 2HS4A 1OEBA 2YRCA 2X1BA 1KIKA 2CZ7B 3QUIA 2KXNB 1KVIA 2NS1B 1ZOTA 3OW2R 1X5SA 2AF6A 3G2XA 3MECA 3BDUA 1IB8A 4JI1J 5KCOA 2V26A 5B0AA 1VYVA 4O3RA 1G5VA 3RR6A 3DB4A 4PNOA 1YBTA 2XICA 2V1QA 2U2FA 1YJRA 4J7CA 2ABLA 2I5JA 3P45B 3UDVA 4DSFA 2BE7D 4EMHA 3FZ2A 1LCKA 4OZ5A 3GIMA 4DMZA 4O3SA 2OI2A 1FMKA 2HAFA 3M6WA 3EGDB 4J83A 1VBYA 4JI7J 1K9MT 3UPFA 3V8JA 3JTOA 5F8NA 4WF9Q 3EPIA 1Y11A 1VS3A 4C0FA 2QTVA 4KJIA 4ZPWR 3G1JA 2LT4A 1Y5IB 3CCTA 1NNDA 2LYVA 2D3OR 4W98A 3I0RA 3Q2TC 1HBMB 2EQKA 3SQOP 3TR5A 2MGZB 4OJHA 2LKZA 1B34A 2DKOB 1YNZA 4RKUC 3G6XA 3VTIA 2OKQA 3QIIA 3LWLA 5E33A 4DPWA 3M2VB 2V67A 4G1IA 4LIWA 2R42A 3HL8A 1XQIA 4J9GA 2E1MC 3CCLS 1UVNA 3A5ZB 2GBQA 3CEYA 2PUKB 3W61A 4FT4A 1M1GA 1TKZA 3CCUS 4LSLA 4Q0BB 4C0OC 3W2VB 4JRKA 2WBMA 2VFRA 5DGBA 1IUJA 3VS1A 2AYBA 4LDYA 4KYZA 4RBTA 3VAIA 2WW4A 4B3SJ 2CPIA 1UDLA 1FERA 2DLPA 2DBBA 4ILMA 1FNOA 4CC3A 3N5BA 3MEDB 2LT1A 4USJC 3E01A 2WSCE 5B7WA 2FYXA 4OHXA 2G2OA 2EFNA 2AEJA 4OZNA 3Q8RB 5LOQA 1FVQA 4F3QA 2SXLA 4PG7A 1VLYA 2GMHA 3MD1A 4IIOA 2FVPA 3X26B 5M2UA 2LTOA 3OLBA 4GC6A 1VQLT 1G8XA 5THWA 4YY3F 2V9WA 3GFYA 1X9MA 4C92G 4FF3A 3CC7A 3KHHA 2R57A 3PTWA 1YP5A 1VBXA 3JCMX 1DAXA 3MXHP 3RYLA 3EJMA 2FLLA 3L7OA 2YNIA 2O01C 5AE1A 1KLNA 2KT5A 1NYFA 1NDPA 3OYLA 1JLGA 3D3CJ 4C8QA 2GHPA 2C2MB 4KT0E 1HBUA 5L9XA 2JSXA 2Q1LA 1IGQA 3IS9A 2ZPIB 1SQEA 5FU6C 1VQ4A 2BXJA 4L6V3 4ZTFA 1N8RC 3LO3A 1NJIR 5DM6Q 1TP7A 3FEXB 3CC7Q 2E7WA 2EG2A 3M1VA 1ZSGA 1CULA 4R5PA 2XMFA 2KXHA 1FYNA 2K7AA 3FK4A 2IA0A 4L74A 2RH2A 2B8AA 3VRZA 4F14A 2HNZB 2EQIA 2JFDA 1YRXA 4O4GA 2MY8A 4DBQA 3L42A 1KWMA 4WIQA 4YN3B 3JSBA 3Q8YA 3T1AA 1ZM9A 4ELVA 4JI6F 1YG0A 2HSPA 4F7UE 3JXOA 1Y0MA 2V4RA 2XGQA 3HM9A 5E5NA 4C8LA 2P9EA 1OQ3A 4LF5J 4DV2J 4M78F 4BUGA 2BQUA 4M7DB 3CO9A 2FJXA 3V2UC 2JW4A 2AYGA 1C2PA 4CDIA 2VKRA 5IC4B 3NGUA 4FKYA 4OYMA 2Z57B 4D8DA 3CCZA 2EVZA 3PXGa 3MJXA 3MCAB 2X3XD 4E2FB 3D1HA 4LBPA 2J9EA 1QE1B 2WHOA 1SF9A 3OQ2A 3QIDA 3KHRA 4JI3F 1X8DA 3QZ8A 1TK0A 2UU9J 4I0WA 2DD5A 2APOA 1RI0A 2DNZA 2H5EA 3TREA 4DFJA 4C5HA 1KNZA 4N8NA 4B3TF 2VC1A 1KQGB 1ZETA 2D6FA 1ABQA 3MUVP 1QWFA 4ZMMA 3BSOA 3M8PA 4ES1A 4PRFA 2C0OA 4ZHRA 3M6VA 1X75C 3CJTA 3H7HB 5DO2A 3KLVA 1HI8A 2HCKA 2JDJA 3PGGA 1VIFA 3QWXX 4L59A 1LXNA 3HLUA 3E51A 4ZVQB 2IHR1 4NXMF 2I0XA 1YITT 1H73A 1FDNA 3MHXA 1UGQB 2NUZA 2KE9A 2HBRB 4RTWA 5SZTA 4MYTA 2G0IA 1YI2A 4RTYA 4DFMA 3M9MB 2HFVA 3MPYA 3VALA 1AB8A 1CJUA 2I38A 3IO1A 1XMQJ 1CJTA 5F8IA 4EGLA 2QLFB 2PEHA 2I1RA 3T1YJ 2Z56B 2AZ3A 1YHQT 1X5PA 1AYEA 4DBFA 1Q86U 1WG1A 3LALA 3AXMA 1BB9A 1X31C 2ROGA 2FB0A 3TA2A 4CYUA 2LDMA 4QYRA 3OVBA 1CJVB 2FD2A 1NK6A 2H4YB 4NEZA 2Y1JA 1TKDA 2L89A 5J2QB 3SV4A 2XMKA 3A8KA 4O6JA 1KFZA 3HHLC 2BV3A 2XYHB 3DYAB 2HZYA 3DM2B 1RSCA 2RHXA 5IXUA 3ER0A 5K8MA 5AXNA 1SJRA 1S72T 2A36A 4TXSA 1M1KR 1NJYA 2B8PA 3ENVA 4HA8A 2D74B 1UG1A 4RO0A 1HI1A 4R56A 5HJYA 1GMWD 4F0MA 5ITHA 1MWYA 2CNNB 2UUTA 2N3OA 3MEUA 4OJ1A 1SB6A 2K2VA 5KE2A 4XU0A 2XZTB 3ZEHA 4M7AC 5CKHA 2HQIA 4PZVA 4N76A 2KT3A 3BBFA 3CJ2A 2LVMA 5GAN6 1B0PA 5DDPC 3ME9A 5AXLA 2W1BA 4FNHA 2BTTA 3HKZD 4RMOA 2JTFA 3U27A 1PIEA 1BI0A 1VJWA 2MKCA 3DLBA 3X28B 4CO4A 2WSEE 2IDLA 2AKWB 4WE1B 2XLJA 1L3SA 1Q16B 5GMKm 1N6QA 4M77A 1UTAA 2J76E 2QC3A 3L2UA 3HJFA 1H92A 5D0HA 4OLPA 3RBXA 3BYPA 5DS7A 3NLCA 4ECQA 2ATLA 1RWXB 2Z30B 4YFUA 2CZ6B 3V8KA 2FZGB 5GVQA 3KJVA 2DNUA 1I94F 1Z9ZA 2M4MA 4DFPA 4ECRA 2V4JB 2L48A 2DGOA 2H4WB 3HRUA 2A7YA 3M0QA 3OS2A 1P8GA 2GIRA 3LP2B 2FC9A 3H5YA 1ROFA 4K0KF 4C0ZA 3T19A 1SL1A 1I4K1 2ASDA 1KTVA 3TZXA 2M0YA 5KG7A 3UR0A 4JS4A 3HP9A 4M7AG 1XJWB 4EMKC 4ZGJB 3BH6B 4O4GB 4GO5X 1NJIT 3HVAA 2DYIA 4JP8A 1PKSA 2NUPB 2DRBA 1I0CA 1Q5VA 2E3HA 2RQ4A 3RGIA 3I9ZA 4ECYA 1VQMQ 3AB4B 2XGPA 3S3NA 4YDXA 3ELHA 4J9MA 2ASYA 3GP8A 2AT1B 4NXNJ 1SQGA 2DR9A 2Y0SD 2EFOA 3KLEB 2F7VA 1XMBA 2CUBA 4BWMA 5GAN4 4YQWA 2VC8A 2J9DA 3RBBB 1N9RA 4Z88A 4ZLNA 5CK9A 2QMXA 4QIGA 4K7QA 2C0IA 4X4NA 2WW8A 1UTIA 2IM1A 2DIVA 2HIYA 3FNNA 1WHVA 3HXMA 2XSJB 1LOJA 5GAN3 4OX7A 3TSWA 2M8HA 3S6WA 2JN0A 2XMUA 3LF0A 2QYCA 5GMKh 3VS6A 1D1UA 1ZM2A 2D3ZA 5F8LA 4U95A 1WZOA 1Q81R 2GW8A 5B0BA 2K79A 4ANDA 2GMLA 1RU1A 1RWNB 5B0CA 1AW0A 1NAQA 1GXLA 3ZZPA 3E01B 4OYAA 2CSIA 5F8MA 3JYTA 3CCJA 2EQJA 3GCXP 2HHPA 2OSRA 3U23A 3G6ET 5FU6B 4FF4A 5KT2A 4WKRA 2VOPA 2HQ3A 4TYBA 1H7XA 3P96A 1ZX6A 2HPUA 3TNVA 1IKYA 2COYA 2B7CB 4JYAF 1JLBA 4WP8A 1U2FA 3KK2A 3LH0A 1N5TA 3LWHA 2XI9A 2RI3A 3MFHA 5KFOA 1TS9A 3EGUA 4DN9A 4UOFA 3EHRA 2HNZA 2KI2A 2CQHA 2C1EB 3DOKB 4C8NA 4I2QB 2DMOA 4CLZA 1UVJA 4YB5A 4ED6A 2H65B 4FDFA 3BEGB 5C7PA 1RWVB 4CO3A 3JCMP 3TX0A 3DI6B 3QYGB 2VDIA 4NXNF 1JJ2S 1TUCA 3PEHA 4F0KA 4MH8A 3QRPA 3D0IE 1T9VA 3R6GB 2PMWA 4NRTA 2RI5A 1HD1A 5DM7R 2RKIA 3S8SA 5E7OB 4FKXA 4CZCA 2OD4A 3W60A 2Z4PA 1VQ7S 2MWOA 3D9BA 3BPDA 1R8HA 3U1NA 1K73C 3FEZA 1NDLA 1FT8A 2HNDB 4F4YA 4HT7A 2ADBA 1UFFA 1Z2ZA 5LMNF 1Y96A 5D6GA 3PR4A 2NPIA 2OD6A 2MAMA 2DHGA 3EZOA 3WVDB 1ICEB 4ZVTB 4NL3A 3NKYA 2ZNYA 3OSNA 3NMAA 5L1JA 3KOAA 3X1LB 4OZ1A 2F69A 1W7WA 2FJDB 2OPRB 4ECWA 1SV5B 5GAOp 3CJ8A 3PNIA 3MEDA 1Y7PA 5DZ7A 5I3QA 1FJCA 2ENMA 2ZBIA 3HT0A 3M58A 2VGMA 3OUYB 2VQEJ 3PFOA 4PPDA 4DV7F 3LX7A 5KG6A 1SSFA 2DBMA 3FB9A 1LWFB 1K0VA 4OGEA 5E3QA 1KHCA 2WONB 4OIXA 2Y8YA 2HQCA 2D0QB 5K5MA 3RRHA 4CO5A 1LJOA 4Y34A 3BW1A 4RW7B 3J81Y 1HPZB 2KMTA 2G0CA 2FGCA 3MURP 1UA1A 4RNOA 1GH8A 2QA4G 2XTJP 4DV3J 5AXKA 3EPGA 3M2VA 4DL3A 4IUTA 4FVMA 4MDXA 4ZP6A 1FWLA 4KHPJ 3CPWS 5CQGA 1R31A 1KS2A 2QDYB 2BJEA 3FIFA 1HK9A 2RE1A 4HCBA 2EGEA 5CYMA 1M5HA 2OP5A 2V69A 4ZVGA 2BABA 1NSAA 5LMUJ 3E8OA 2ZH7A 3AHPA 4BY6B 6FD1A 2XHCA 5D4OA 1G2EA 1UJYA 4HYKA 3R1HA 1M5SA 3DGPA 4M5LA 3M0SA 3CE8A 2ZFHA 4DR4F 3EUNA 3SZ2A 5A2QY 1XMOJ 1PC4A 2M0GB 3VWSA 4CC4B 4LSZB 1S77D 1ZSZA 3QQCD 1V76A 3JB9D 1SQFA 2EYXA 1H2UX 4K2XA 3T6BA 2C2DA 3JCMe 2UV8G 2MWPA 1YHQA 1MU2A 2VJVA 5HLFB 1DY3A 1VRQC 2FZCB 3CCVS 2ZITA 2HAIA 2PU9B 3RKXA 3AQOA 1WXUA 3CCUA 1DHMA 1U1SA 3CCEQ 2GGPB 5HVGA 4YDDB 4FIBA 3QNWB 1Y57A 1HNVA 1WF0A 4X64F 4LFCF 4ORZA 4ZNXA 3N28A 4ZGDB 2M52A 1YJWT 3SFGA 2KYXA 4KQZA 1WI8A 4C3MA 5KG3A 3C16B 3QJLA 2XKOC 3EDQB 1HD0A 3NXZA 1QSYA 5GAN7 4C5GA 2AJFE 3HHDA 1X5TA 4K59A 5KYUB 5BR8J 2UV8A 1XNQF 4DR1J 4EDUA 2JMAA 3MFIA 4F7VA 1SL2A 3BO4A 3AA9A 1VHIA 2JZ5A 1S1WA 1VK8A 2IVYA 2W4PA 4KULA 3FBEA 1YRUA 2XYPB 2D41A 4HVZA 2F4FA 3KBGA 3MEGA 2NXEA 2QEXS 5GAOq 1OY8A 5KYYA 5IV3A 4J9DA 2BJ9A 2AZ1A 1T3NA 4JV5F 1T9UA 2N4DA 2BOAA 1WD6A 1V5IB 3BZQA 4K4UA 2JMCA 5C42B 3TA0A 4RBVA 1J5EF 3M8WA 4EMGA 2YRVA 3ZZ0A 2FHKA 1OQKA 3CCQQ 2EFIA 1LW2B 3EAEA 1PC0A 2DILA 4ZIWA 3ZNJ1 3SXLA 1JKHB 3BDPA 2N7YA 1SXLA 4AUKA 3IGNA 4QIFA 2M8DB 4P71A 4L76A 5M9OA 1HFEL 3R3TA 1TU0B 3ENAA 1V3ZA 3FC3A 1B0VA 1H7WA 2EWHA 4JV2A 2R58A 4PJOB 1L3KA 3B6BA 1XNQJ 4EK2A 1RLCL 4ID5B 1WSRA 1VHFA 3I0SA 5A0GA 1WI7A 4TLRA 5E3RA 4EO8A 3HVTB 1MN9A 4AMCA 1HBNB 1NSPA 4EBEA 2O9VA 4HR2A 3G6YA 3QBYA 3IAS9 4MZMA 1HNZF 5J2NA 1J3TA 4MIAA 2V8GA 3UD4P 4QYZJ 4UOCA 4IR1A 1ZM3A 1FEEA 4ECSA 1R8BA 5HK4A 3W2WB 3KNGA 1A7GE 1S1VA 4P7TA 1HKAA 2J8AA 4L3KA 1DFDA 3K2YA 4DG1A 3VS4A 2QIFA 4P74A 2YQ1A 3E1SA 3THKA 3I9QA 3MPUB 1C0UB 3DXBA 3M0TA 4IFYB 1N56A 4CO2A 3CCUQ 1UVMA 2JEIA 3K5LA 2IRUA 2ASLA 2B9XA 2NXUA 2SEMA 2K3IA 4N77A 2WONA 2G6FX 3K7RA 4QPXA 2NWMA 4JJBA 1LWFA 3ILOA 2JOYA 1VQ7T 4F25A 2W2QP 5CQYA 1RHMB 1NSQA 4LRDA 2J7KA 4DLGA 3TUIC 4KR0B 1TL3A 4Q44A 5LJ5h 2XU8A 4XDCA 2E7VA 4RTXA 5H9EJ 3KUHA 5AJ3J 3QGGA 5L8RC 4OX8A 4QQDA 2KM8C 4R55A 1RWWB 3NRBA 2HNIA 3MP6A 4ELZC 1QVGA 4IUVA 3NS5A 4MIWA 4O3NA 2MQMA 1VQ8T 2ZC3A 1SIWB 3GIRA 2AKKA 3C8YA 2IRXA 1EX8A 2BR0A 2GC8A 1TKXA 2BE2A 4CLYA 1G7CB 1RT4A 5CH7B 2OJ2A 1QD1A 1SVDA 4ZP8A 3MM8A 3MEAA 1E7OA 2CP7A 2K1RA 3M4GA 5GAMe 1FX7A 1IKXA 2DXUA 4DV1F 2W2NP 3GIIA 3KDOA 1ZBXA 1RTDB 1VQ4Q 1S1UA 1BC6A 2R9LA 1UE9A 1IKWB 4NLRA 3MEVA 3N6MA 4WK3A 1WDXA 3CDUA 2QT7A 2J9CA 2MDAA 3HFKA 2K2MA 7AT1B 2DISA 3R5DA 4AFZC 4XDDA 4X4TA 3H42A 2UXDF 2RJZA 3W9JA 2ACYA 2X7IA 1HWJA 4OYZA 3H2VE 3CDEA 1MMLA 1IBKJ 2MCNA 2NUHA 3NCPA 1CSJA 1KOHA 3R7BB 2VICA 3RUXA 5A0YA 3A8HB 4ZA1A 2F2XA 5A0DA 4KGVB 1FNXH 4TLQA 2QO3A 1NKBA 4CNZA 3W62A 1PD0A 1FA0A 4PJOG 3OPKA 3OTCA 4X4OA 2XHWA 4C3KA 4QWAA 3V81A 4M95A 2CVIA 2DXCA 5CABA 2RK2A 3QT7A 5DQHA 4CLKA 3KXDA 1S1NA 3SQGA 3CC4S 3SI8A 4JOUA 5HMXA 1TL4A 4DV6J 2V2KA 2HKQB 3MO8A 4XTVA 3RB0A 1U06A 4AFSC 2YNHB 4PWUA 3D6MB 4LF7J 2QYZA 2EFQA 4X64J 1HQUA 5FJ4A 3FEOA 5L46A 3VGSA 5J1NA 1S9FA 3QPHA 4YR3A 4FXWA 4EMDA 2ZZTA 1JLAB 2E9RX 2VG7B 1ZBTA 1B3TA 3C3LA 4RLEA 3OFHA 2IVMA 2V34A 4UT4A 4JS5A 2QFIA 3A8MB 4RTVA 3B8HA 1S6PB 4NL2A 4OHZA 3VU3C 1U0HA 2WVEA 1QM9A 2QA4Q 2J0SD 2ZE2B 3I5CA 4MMLA 3L4BC 4WFNQ 2ZZNA 3GIBA 4ILLA 3GP9A 3VKIA 1FJGF 4M75E 1FWPA 4KFBA 5HK0A 2DGTA 4AL6A 1N34F 3E9GA 3OR2B 1KR4A 1TR0A 1VIEA 3LAKA 3M55A 4XTYA 2KKHA 3DYAA 3KLGB 2L9NA 2QYGA 4J9CA 3ZNUA 1WACA 3P3DA 5J26A 5IHKA 1NK0A 1VQ7Q 4CM2A 5LJ5f 1VQ5Q 2DHXA 5E41A 1X43A 2YBVA 1VIXA 4PXDA 5L1IA 2V50A 1RACB 2BW7A 4I2PA 4G65A 2FHOB 3UR3C 2PVDB 1F2HA 3SHWA 2DY1A 1OPLA 2J7IA 4MK8A 2P9CA 3D1QA 2HQXA 4LXCA 4J9FA 3KXTA 2QN6B 3E2UA 1B3QA 3PCOB 2ZPEB 4RUAA 1QP3A 2RPNA 4J91A 4HI2A 1SRLA 2RIJA 1W70A 3SMZA 4U96A 3A1PA 1D9DA 4FSXA 4DUYF 1M0SA 4M5NA 2VJUA 4M78C 1T3SA 4PUOA 4BI3A 1N88A 1NG2A 3AT1B 1JB0C 2PSZA 5J2PA 1WC3A 3T5LA 4HH0A 3VVTA 1RKIA 4J5YA 4V2SA 1YJVA 1NBEB 2FHDA 3G71A 3LW5C 2EFPA 1S9GA 2H5JB 4PK4A 4MAKA 3IR6B 5DY9A 2Q79A 3M2UB 5LMNJ 3THVA 4F67A 2ESWA 5GAN5 3AOCA 2A0FB 4OI3A 1FMWA 4KV8B 5GAOm 2DRKA 3D7SB 3D66A 1HW8A 3OTOJ 2VD3A 5HROA 2HHVA 3P6YC 1RQ0A 3KHLA 1D3WA 4UZBA 2KK4A 5KFQA 4RUBA 1HHSA 1UGRB 5F0WA 2MIOA 1RT2B 2E9ZA 1GMUA 5HQMA 5D6YA 3MEWA 1SC1B 2NPFA 1R8PA 5JUMA 5K8OA 3NTKA 5F0UA 2PVOB 9ATCB 3DOLB 2O3DA 3FRYA 4PG4A 3G71S 1BWVA 4QKUA 4F04B 1QKWA 2EW3A 4LRBA 3SEMA 2EK1A 3ULHA 4QIWD 3HT3A 2XC9A 3OQ5A 4JUVA 3K8WA 4I2PB 2QQBA 3RESA 2UUWA 4FP9A 2FRWA 3BREA 4AXJA 3EG9A 3RG6A 5ETLA 2OTLT 3D0HE 3THPA 4LT6A 2ZH3A 3MCOA 4P2FA 2XMAA 4B3SF 2XZDB 5D8HB 4M7AD 2G2ZA 1UJ4A 4C0DC 2DK3A 3CCMA 1QVFS 3CD6S 2MTLA 3KKFA 1IM4A 3QJPA 3BGUA 3MMBB 3UW1A 3HVRA 4Z37A 3FJ5A 2RHSB 4DUZJ 3W9HA 5C2CA 3M1VB 5EN1A 2W8KA 3I32A 3C95A 3QJYA 2V8DA 1YHQS 2YUOA 1U25A 4RBUA 4X4SA 4ZP7A 2ZE2A 2YKNA 2J8SA 5A8WA 4B3MF 2MF2A 3QT8A 1KFDA 2WVFA 4DSIA 4NLPA 1PJ7A 2V2VA 3KUGA 3KTQA 2HIQA 4PJJA 1IKXB 4JI2J 4DBRA 4LF8J 1U1OA 1YVFA 4XU2A 1XC9A 1IWAA 1BQNA 2GX8A 4DV5F 4JI2F 4DR2J 4ID8A 2GAHC 3B78A 4BDPA 4JI4F 4IRKA 2KYBA 4GVBB 1S72A 3DOMA 1HNZJ 3OJUA 3ZXWA 2IY5B 4RUCA 2AQ4A 1UGSB 4JJNK 2QAZA 3LOUA 2F40A 1VISA 4RWXA 2COWA 2RF2B 4JUZA 3OV7A 2OTJA 4EMKB 2XDDA 3EX7B 3CCRQ 1BQMA 2QZ8A 1FO1A 1V9OA 4DS5A 3MPWA 3N5BB 3U1MA 2F5TX 2MKIA 1MNEA 1KJWA 3UQSA 1X69A 3WC0A 2J6OA 3OW2S 1JXVA 4KGMA 2YKMB 4XTXA 2HFSA 3TEGA 2CP3A 1QCNA 3TZZA 4M5MA 5LSRA 2J05A 2ZC4A 2GO8A 4OB3B 1S1XB 4LREA 1OZ2A 5GADI 1KDNA 3FFIB 3PJ9A 2OTJQ 4BLGA 3CEDA 3BS9A 1D0XA 3IGVA 1B4SA 4B9XA 4ZIVA 3J81E 4ZLJA 4LDUA 2OIHA 4CO0A 4MJKA 4AD6A 3POTB 4QR2A 3LGMA 4K4XA 3KFVA 4BD3A 5DLOA 2CNKB 3MM9A 1IQTA 2L08A 4DG1B 3LW5E 3TVTA 2J5AA 1QUPA 4DUZF 2L41A 3H5XA 3PYDA 3FBFA 3VGTA 2P4RA 1JXLA 2MSSA 3V6HA 1KSPA 1KONA 2KT8A 2GTOA 3IAM9 5KFAA 4C48A 2D8HA 1UGPB 4NCGA 2DGQA 4WXOA 1QTMA 1YIJS 4NA1A 3NWGA 2Z2YB 5KFKA 3LGFA 3MAAB 2PT0A 1RT6B 1AHJB 1K8AT 2X4JA 5D78A 1YJUA 2PMZD 5EWGA 1WIEA 2DTHA 3G82A 3QGPA 1HNWF 2Q6BA 3PKMA 4WFBQ 3JB9G 7FD1A 2A3LA 3QRRA 3CCST 4D8KA 1K47A 5LJ3d 3UDEA 3RKYA 5D0RA 4ESRA 1VQ4T 3ZBDA 2V8IA 3C0CA 2FQQB 3EVOA 3K0JA 3CBPA 2I0NA 2P2CB 3FQLA 4X9CA 4TY8B 4U67Q 4OB2B 1QVFP 1TL3B 4DFKA 2JJ4D 4BB7A 1KFSA 1KVJA 1GCQC 1IBMF 1WSVA 1FEHA 3R6LB 2ZPGB 1D1CA 4DR3J 1FVSA 2LXUA 3G71Q 4H54A 2KRBA 1BU1A 1UCNA 2HQEA 1HD3A 1ZPWX 3DU5A 1H98A 3MMBA 3CF5Q 2HQHA 1EQMA 2DR8A 1VQOA 1GTHA 4J9OA 5HN0A 4M77E 2J0QD 2H8HA 1WHGA 3OL8A 2MKJA 2ZZMA 2XI2A 4FS2A 2LNVA 3CVKA 3SSSA 1WDDA 3W2WA 2HGLA 5F8HA 2MGZA 3RAMA 1E6YA 1CS4B 1VQ5S 3V6DA 4N56A 2F63A 5J2NB 4U8YA 4XTWA 3T5HA 2CJYB 1SC4B 1SBRA 3I0SB 1VQ9S 4NS5A 1OX9A 2CJQA 4IH5A 4DV4J 1DQ8A 1O6XA 1KD1C 3D4JA 4DN0A 2QI2A 3FSYA 1JEGA 5KT3A 4DQPA 2KEAA 1HWKA 2RD1A 4JRQA 4LFAJ 2W7PA 4IOCQ 3MAQA 1AZSA 4K11A 3HZEA 4A8KA 1ZSZB 2K3KA 4C0GA 3BQ1A 1V1CA 2OX7A 2FVQA 1Y10A 4B3TJ 1I07A 3NPFA 3RJMB 3EG3A 1C1AA 1Q86R 5EUHA 4NLSA 4URQU 3DGPB 5KE3A 2OEMA 3LP0B 4DF8A 4LIRA 3O8WA 2UU9F 2M16A 2HRTA 1U2RA 2ZVSA 2UUCJ 1BQXA 4LNPA 1FRXA 4KV8A 2RNAA 2W2MP 3UNYA 1HYSB 1UW4A 5K14A 3CJ0A 3TARA 1T7PA 3W5XA 1RTHB 5KFFA 2YPYA 1VA7A 1D1AA 4HVVA 4IG3A 2QJ3A 2DTOA 2C3MA 2AEFA 3I56A 3QO9A 2YY3A 1M1KU 2DYBA 4LJMA 4MFBA 4OZLA 1NE8A 3P8DA 1K4US 2AYEA 3W65A 1GX6A 5HMYA 4ME7A 4HACA 1U24A 4B9NA 1RCXB 2GCFA 2V8PA 1M3AA 3HFNA 3C14A 2L8DA 5C25A 1M8MA 3N9UC 2RDJA 4TY9A 1X0FA 3ILIA 1MWZA 3K5MA 4XAKA 2DPJA 3TZWA 4DOWA 2RAQA 3C16A 2EXUA 4IFVA 4B3RF 1Q82T 1RT3A 1U1MA 3H5UA 3W8PA 4M7DE 3HZGA 2CS7A 2QG9B 1N54B 1VGYA 3QDFA 1U7LA 3PRVA 3CCQT 1WEZA 2IVFB 2OO4A 3DLKB 1UPPA 1REVA 4CI0B 3MR3A 3CC2A 3SEOA 4PFZA 3S7RA 5IT9E 2PD1A 2E5QA 3NMZC 2HWTA 4PWWA 1JLCA 4P52A 5HLFA 3VHQA 3N0VA 1JLQB 4X62J 1LNQA 4JDSA 4DCJB 2JS0A 2PA3A 4B3MJ 1Q7YU 4P72A 1X5OA 1U6ZA 2M9KA 4BHQA 1Y96B 2K3XA 1S6QB 1HARA 1NDKA 5A2QE 1M8VA 1Q0NA 3KK3B 1TUVA 2HNDA 4CC2A 2ACMA 2JZ2A 1HJDA 1HIYA 3MR6A 4LF9J 1Q7LB 2W9AA 1VBKA 3BQ2A 1U3OA 2CPYA 1TUGB 2RQKA 2DNKA 4DEXA 4F7UA 1Q8IA 2GVDA 1OY6A 4C8YA 4I7FA 2KZMA 1M3BA 1OPKA 4YS2A 2AJQA 2E5LF 4PABA 2V0NA 1R0BG 2IFXA 4ZGEB 3FZBA 4PL6A 5L8RE 3OT9A 1RYSA 5BYQA 1FWKA 4E47A 2ZPFB 1IR1A 4Y2KA 4WCEQ 3EG2A 1TL5A 1AZEA 1HQUB 1U26A 2K06A 1AOJA 5BYRA 1M2OA 4Y2AA 4DPTA 1N6AA 2O4XB 3OYGA 5KFHA 4C8MA 5CCMA 2KHCA 1YHQQ 3M2RB 3AB2B 3M8YA 2FPHX 4I6WA 2HK2A 4L6V5 3TJ8A 1GMVA 4HHJA 3BO2A 1F9HA 2E29A 4PG6A 2BVZA 4Q2LA 4IH7A 2WVBA 4JLIA 2EYZA 3CD6Q 3PEJA 4RW8B 5RUBA 2F2WA 3HSDA 5FW9A 2X1GA 3R7SB 3LGNA 3JYTB 2I9SA 4KBIA 2O88A 4BE2A 2Z2ZA 3C6TB 2LQNA 3GILA 4E7LA 4G1PA 5GAHI 3MAHA 2PDAA 2L9DA 4FYVB 2R7OA 3NCQA 2KRSA 3OW2A 2LJ1A 4RG2A 2DNYA 2LLZA 1CJKB 3PDNA 1FRKA 1SUQB 2MLZA 4EUVA 3I55T 2XY6A 4XQ3A 3FRNA 2FB7A 4NMLA 1RAFB 1V3RA 3I6PA 4YUDA 2DYAA 4DLEA 4QVZA 2K4YA 2LDYA 1FRJA 2YPZA 3MPDA 1RADB 1PCAA 3F41A 1O0PA 3FDRA 3T6JA 1CQNA 1S57A 1HMVB 3FSIA 5KFLA 5K9FA 3H0FA 4M7DD 2MZSA 4PPZA 5A6PA 4HHHA 1U5SA 1F1BB 5CVIA 1BI2A 9RUBA 3PIPQ 1UP1A 1VC5A 5DETA 2HHQA 2FUG9 3UWTA 5D6WA 1T9TA 2YX7A 1SH0A 3W64A 2NSBA 2PMHA 1FKOA 4EBDA 1SC6A 2VPXB 3J81j 3T5JA 3VAJA 1WQ7A 1M90C 2RILA 3VRYA 4HTIA 3TI0A 4IDKB 4M7DC 4FF2A 3OTDA 2Y3YA 1X4FA 3DLLQ 2LXFA 2DNQA 4I69A 1Q7YC 3OHAA 4JBCA 3NMRA 4RL1A 4GY5A 2FY8A 1PYTA 3N01A 5IT4A 2VVKA 1DLOA 3CPWR 1WHXA 3V7SA 4ATOA 4MYUA 5I42A 4UOHA 1RT3B 3I82A 4IUUA 1WTFA 1ZLMA 2NREA 3G96A 3FCVA 2GS8A 1K8AC 1E6HA 3G8QA 5K20B 2CUYA 4PYAA 4IUPA 4FM4B 2PVGB 1DTQB 4B3OB 3CDAA 4DR6J 3AOAA 1PBAA 3EICA 2WVDA 4YTLA 2LP4A 2FIUA 3VAFA 2BX6A 3A8EA 2AV5A 1BD6A 5LJ5e 1W25A 2PEBA 2JC0A 1T03B 2R7TA 3DCAA 5EG2A 2ZAEA 2DVEA 2CKKA 5IT0A 4NMXA 2W8LA 5JVGQ 3OMGA 1RYRA 3IWLA 1BK2A 3BN7A 4USKA 1XMOF 2QLXA 4II1A 2KJWA 2EFVA 2HRUA 2HHHJ 1NLPC 1H3HA 1RTJB 2NLWA 3LP0A 4HDHA 2ERRA 3NEKA 4CH1A 5HK3A 4DA4A 1GTEA 2HYIB 5CIUA 5DQGA 2QLWA 5GAOl 1LWCB 4P2SA 1DURA 2O9SA 1I3OB 3GR0A 4N0AA 2BJ7A 1O5JA 4TU7A 2HBPA 1GBRA 3MR7A 1JLCB 1JB0E 1LK5A 2DH7A 3ZZYA 2BZYA 5GAOr 4J8OA 4KHRA 3ZZUA 1FE4A 4DR7J 5GMKi 2HHUA 1SJQA 1NH7A 4JI3J 3GNFB 4DF4A 2XI3A 2ADCA 4LBHA 2OPSA 3CMES 3GV7B 4K8RA 4P2XA 3EGXB 1YITQ 2EYWA 1YITS 3P8HA 3A98A 3ZL7C 1PKTA 5J1EA 1CS4A 2A28A 4WYLA 4QW9A 1E6YB 3EFRA 1NZAA 1Q5YA 1IWGA 4CC7A 2CH4A 4HDGA 1TFYA 1S9EA 3IQLA 1UAWA 3CCLQ 1K73T 3DB3A 1F5AA 2UUAJ 2HGMA 4HACB 4M77B 4RPFA 5IXBA 4NZ0A 4RNMA 3KLHA 3GR1A 3RRGA 1WC0A 1VQOS 3T41A 1TK8A 3DFEA 1S0NA 5EDWA 2YUNA 3C94A 2Q3PA 1LVKA 3W5YA 1ZPVA 3OYEA 2XS5A 5HO4A 3PW0A 3B4DA 4DR1F 4ENOA 4CLTA 4DUTA 3UT1A 4C3LA 2CIMA 4ELTA 3IWNC 5D4PA 3IR7B 4K5RA 4I6YA 4YB6A 1X9WA 2DHSA 3HMJG 3GLXA 2M5YA 1A9NB 3ET6B 3PRBA 3V8LA 3OR1A 2NXCA 2VG7A 4JZ3A 2JVOA 4P2MA 1MU2B 1UETA 1YJ9A 1D9FA 2F5KA 1RK8A 1W6XA 2DXTA 1OS5A 4OMQA 3IM8A 4GBQA 1YJWQ 2WRMA 4F02A 1NEEA 2CZ1B 3JCMJ 3DM2A 3KG0A 2JNGA 4JI5F 3CMEQ 3LP1A 1W1FA 1UFWA 2L5QA 4FW2A 4TNOA 1ZTTA 2A2DA 2LXIA 2F1FA 2DXDA 1M1KT 1UEUA 4Y65A 1PRMC 3C46A 1F9EB 2DEIA 2YTCA 2DE0X 4FYYB 3RB6A 2E70A 1WHMA 4PJOE 3AA8A 2KT2A 2R7XA 4X2BA 1HR0F 1NLKL 1PG5B 4PWDB 3CC2T 3PX4A 3SDZA 2C2KB 3M7VA 3R5CA 1CJTB 1OPZA 3GYNA 2IIMA 1AWWA 2PA8D 4QIVA 4FF1A 3EH1A 1HPZA 2IMOA 2C28A 1KC8U 2P6TA 4QW8A 1U47A 2IYIA 3CCWA 3UN2A 1AT1B 2BKNA 1S1XA 4WXWA 1RWPB 1YJTA 1IBCB 3PT9A 3JCMd 2CNOB 2LQBA 4CH0S 1RE1B 2DKGA 4V19X 1M4ZA 4NL5A 1YI2S 4XIUA 2BOPA 2VH7A 3JCMc 1RZMA 3ILLA 5DLQE 1F3VA 2B51A 3HHLA 4Y28C 3PMIA 2FVSA 3D54A 1BLUA 4P10A 3SWNB 3A3OB 5ECAA 2MZTA 3ONQA 1AA1B 2BJ3A 3G6EA 2FY1A 1RL2A 4ILRA 1DQAA 3O1LA 2DNPA 3G87A 2HEKA 1TXQA 3NS6A 4U9RA 1M5VC 2JH3A 1AUSL 4QR0A 5G4DA 3P8BB 4EIKA 2VL1A 4NWBA 1D0YA 1TFWA 3DLGA 3MAAA 4HHUA 4J6WA 2CAJA 2DETA 3M56A 2O5DA 3NL0A 1VLOA 3I5SA 2JFKA 5ADZA 1UL3A 4BI8B 1NM2A 2RSQA 3CBMA 2RHUA 2AK5A 1TL1A 1H0HB 2MK5A 4PJOF 4DL5A 4DEZA 2W9CA 5KFMA 4NPOA 4FS1A 4C2MA 5ETMA 1U6BA 1Z1ZA 1Q1KA 3DI6A 4M77C 4M75A 4Q0BA 2RK1A 5LJ5d 4OGCA 1EB0A 1G3SA 2J6KA 4OZ2A 1FFSB 2WSFE 1C0UA 2QE5A 5HKCA 4TKTA 3A3PB 3POTA 4AFFA 3CD6T 3MM6A 2C2NA 1SC3B 1GEHA 4FNIA 2GQIA 2QQSA 3G9CA 1M5PC 1UVIA 3A8GB 3TRGA 1S10A 4DZDA 3IG1B 2A6OA 5GAHU 4QJVA 1LEOA 2XYGB 4J9SA 3CT9A 1AROP 2RNEA 4BC7A 2KQWA 3VS7A 2EQMA 4A8XA 1RTIB 2P9GA 1JLGB 3N5FA 1GL5A 4URGA 5FDLB 3Q8QB 3IBWA 2G4BA 3ZTQA 4DV4F 1EIYB 4J9IA 4PLLA 1GAOA 4M75C 2RF2A 3TJAA 2UVUA 3WDOA 2A10A 2HQDA 5J1PA 1IKVB 1ZYQA 4DSEA 1K1ZA 4YR0A 1JU5C 1FTRA 2F8EX 5KT6A 2DL3A 3TW0A 3JAMU 2ZH9A 4ES3A 4K4ZA 4DL2A 4AYBD 3JQKA 3QT5A 3H20A 1NJIC 1FXLA 1VMBA 1YKWA 2W4DA 4RTTA 4C4WA 1TWBA 2W2PP 2F8HA 1SRMA 4DR6F 3QPIA 4ED1A 5EWEA 4I68A 3M2UA 3GFZA 2CDRB 3VYHB 4YR2A 3DN9A 5DDRC 1RU2A 3UN3A 1KHVA 3EVWA 3O6QA 4ED8A 3MMAA 1W2BR 2L3SA 4GC7A 3NHNA 1C4AA 4IUFA 5G0RA 1K8AU 2Y1RI 1RUWA 3X25B 2CSQA 4KO0A 2Z2MA 3KLHB 3BY7A 2NUPA 2R2RA 3CULA 1TH7A 2ZHOA 3LH2S 2DRMA 4OB1B 5I4MA 1S9EB 4B9LA 5FRNA 2BANA 3J81U 1RWMB 4A63B 3NNAA 3FLGA 3RRKA 4USUA 4C92C 2FJWA 2DZCA 3M4XA 2CQBA 2OEKA 3CCSQ 4ZVEA 3I0RB 2B6AB 2PZ1A 4F2RA 2V8VA 4RTZA 4U6PA 5HBMA 5BR8F 2YVSA 1LFWA 1SJFA 1Z9QA 2DGXA 3QDRB 4DUYJ 2DL8A 1U8RA 2C0TA 4NRUA 5DG9A 3CIMA 1W2BP 4UF4A 2JLEA 4KH1B 1ULRA 4F4KA 1U4BA 3CC2Q 4CLPA 2HWIA 3SYZA 2X1AA 3OXLA 2LMJA 8ATCB 3BQ0A 2KL8A 1S12A 3VZHA 3CJKB 3B4MA 1UUEA 3LQVA 1LWCA 4CLLA 2IJFA 1QSLA 4NX9A 2Y0BB 3ENQA 4OZ0A 3JV3A 1TUDA 1D0EA 3KJFB 1U6FA 3CC4Q 5KYXA 1I94J 2DL7A 2GQCA 3G4ST 1EETA 4J9LA 2VUGA 2MB0B 4PKDB 4RUGA 1EP4A 2QFJA 1RUSA 2BBEA 4QWEA 1U0HB 1KSWA 5CYMB 3EZ5A 4QWCA 5LJ3e 1IJFB 4MZTA 4OX6A 2F9DA 4PFPA 1HWIA 1H38A 1HSQA 1EAYC 4NXMJ 1I5LA 5A8RA 1PNJA 4X65J 2R5MA 4Z02A 3UN5A 3C66A 4D6WA 5IQ6A 1MG7A 4KRTA 4LSNA 4KKOA 2B0GA 5E2QA 3FVYA 3LUYA 1QAIA 1YTYA 2CGHA 3Q86A 4LF1A 2D8JA 5KFBA 1YJWA 1IBLF 2X1FA 2MZRA 4FN5A 1WYXA 1KD1R 1OJ4A 1KN6A 3OMCA 1TAQA 3C2PA 3PRDA 1KHIA 2PO4A 3BE3A 1RCOB 1OOTA 1U09A 1Q7YR 2AJ1A 1GCPA 2AKLA 1VQPS 2VA2A 5IM0B 5MLCV 1KC8R 2OPSB 3UE2A 4DPYA 1PO6A 1FFGB 2WSCC 3TUJC 5I2MA 4KUDK 4M63A 4KTQA 2DRAA 2E5GA 3OD2A 4B9SA 1XNRF 1RHRB 4C5EA 4PR6A 1LNXA 5D3GA 2RUSA 5IZHA 2R2SA 2RO0A 3BO3A 1UFKA 3AHUA 1KQSP 2ZDOA 1MHNA 1HHQA 2KFNA 4URSA 2Y1IA 2HZAA 5GMKj 4X4UA 1DJ7B 3LYIA 1HWLA 2HBYB 2MQPA 1QTNB 4M5JA 3OR2A 1Y0HA 3UA6A 1FRMA 1U8WA 3IXQA 1HBOB 3K59A 3INZA 3QKJA 2R8GA 2LCWA 2LU2A 4BCAA 2YUQA 1FRLA 4LD6A 1HMVA 3HSGA 2E1CA 4ZHRB 3HSZA 2FHJA 2XZWA 2AJ2A 1JJ2P 5JVHQ 1S0OA 3SCKE 1S1UB 3CXCS 1C4CA 2LDIA 3DXSX 2OMLA 4GLKA 4IYQA 5CD4H 3TAQA 4M5KA 4CO1A 3L2QA 3AJ1A 1Q78A 2XO7A 2HVDA 3QLHA 2KO1A 2R7WA 1SIZA 2MYFA 3CGIA 3TA1A 3TX8A 4RNHA 4NOYA 1DTQA 1Y7XA 2DR5A 1I1JA 4FZVA 1M9SA 2W24A 4OMFB 1VC0A 2CQPA 1CG2A 2EYQA 1EIFA 1VDHA 3FMBA 3GNGA 4PEOA 1RGVA 4OV6A 2DVJA 3C6TA 1B7TA 4ZVRB 1FX2A 1RB0A 3PYFA 4E7KA 2QSFA 3I5BA 2XCPA 3IRXB 5HSPA 1VQMT 2HMIB 3PMTA 4MK9A 1EHWA 2DD4A 2UXCF 1U1QA 3BGLA 3QYYA 1VQLQ 2HBZB 3G71T 1RBOB 1WKJA 3IA0A 4DQ2A 3DRXA 3T9ZA 5KFNA 3BDLA 4NLDA 4CTAA 1X4HA 5KYWB 3QATA 1VQ6Q 1UFLA 1K73U 1FKOB 1UWBB 3ITHB 3U1LA 1U1NA 3KJQB 3GWCA 2Y4XA 2MZJA 4UY85 3UATA 4WU2A 4ZVFA 5LJ3Y 1T3LA 2J6SA 1JLFB 2M1HA 1C1CB 1HHTP 1WC6A 2Y90A 4B08A 4D3GA 1S59A 2LRQA 3VS2A 3W7BA 4RW4B 3EMTA 3I4HX 2IIHA 5KFJA 4C8QB 2BKPA 2ROEA 4RCCA 4ID5A 5GANg 3VGUA 3H9NA 1OPIA 2YNIB 4USIA 4BE1A 2R2TA 2HBWA 1KP6A 4ED2A 4YP3A 1Q8BA 2RF0A 4WFXA 1H8KA 2EKOA 2M51A 2E5JA 4ANJA 2HZCA 3T9NA 1VQ9A 2IBKA 4DQIA 3IR5B 1W4SA 3R27A 1HW9A 2WB1D 3GTYX 2PFDA 3BGFA 2G1HA 5KG1A 5C24A 2YWHA 2C22A 2K9GA 3QMQA 4KPYA 2RS8A 2CZ0B 2JX2A 3H2LA 4L5GA 3H2UB 3H98A 1YQHA 2DXFA 4NYOA 3GQCA 2F5GA 3S1TA 1RT1A 4F8RA 1S72Q 1JNRB 5F3TA 5KG0A 3ZTSA 5KYYB 4TQSA 2OTJT 2ZH1A 2GO9A 1ZZFA 1T9XA 3DDNA 3FEYB 3E2EA 1YJ9Q 5EC7A 1VQ8A 4NCBA 3H0IA 4PJNA 1FRHA 5U47A 3C14B 5KFDA 3MTKA 1MLAA 4IFYA 1I8FA 4LFCJ 2YH0A 3GFXA 3JSMA 1P27B 1AUDA 2KROA 1QJHA 5T14A 4RCBA 1T0HA 3EHQA 2DK2A 2DGUA 4FBTA 3VGVA 4A4EA 4KKOB 3HHNB 1U1TA 1J5OA 4XTTA 3M0RA 2AZSA 1K9MU 1RHQB 3TYTA 2HHSA 1AWOA 1QVGR 4DQRA 2ZKUA 4BY6C 4DDFA 2CJAA 2Q43A 1TZ0A 1JO8A 3O5TB 1L3TA 4P9SA 2GNCA 4LFBF 1HBNA 1LWEA 2GGPA 2J7WA 4JI8F 2QQ9A 2H3JA 1KRPA 1CLFA 5GAOn 4MIBA 3VUZA 2KGTA 1AD5A 1UWAA 3K5OA 4WZMA 3KYLA 2F8MA 2CPDA 1T9YA 2GCXA 2XS2A 4J9EA 3OLAA 4LF5F 2XS7A 3UD3P 3QZ7A 1UVLA 3R8YA 3RAXA 2MPUA 1JKHA 4RW6B 5DM7Q 1XERA 1UHFA 4B3RJ 3KK1A 1CPZA 2DCUB 1R77A 4WYWA 2CWKA 2I5JB 2EC2A 1NK8A 1FDBA 5GAMh 2YWGA 2QXFA 4HT8A 5IAYA 2FDNA 5FIIA 5B0DA 3BGRA 1Q8KA 2D9PA 1XR5A 3DRSA 1N5VA 4X9DA 2PC6A 2C3YA 4M78D 4M7AE 1VQPA 1CC8A 2CPJA 1ACMB 2QL7B 4NYZA 3OYIA 4IO9Q 5CYQB 4XPCA 3RDVA 3MEGB 2WOMA 4HKQA 2EC0A 3L95X 2G1DA 1ZA2B 5AYFA 3N4WA 1VQKQ 3CBOA 5CZVA 4RNNA 3HULA 2X4YA 3META 2YLCA 5KFTA 1S0MA 4Y92A 4HCKA 3BN4A 5EWFA 2MYSA 3DRRA 1H6KX 5KYUA 4MKYA 5AE2A 5GAEI 3JSCA 4JI1F 4DCOB 1HNIB 4KIAA 2JLGA 1YRTA 4QQ6A 4LSNB 4ED4A 1FKPA 4ZLPA 4V1Ak 1B07A 2VQFF 1O9SA 1WXTA 2E4HA 2CT4A 5GAMf 2WOMB 2QEXQ 2XSFA 5CYQA 2HS0A 3BSCA 2BZXA 3DC2A 2NXJA 4ZN3A 5CKBA 1Q53A 4LRAA 5LSLA 1RTHA 2CNLB 2UUBF 2XNRA 5HATA 1EP4B 1NM7A 4Y28E 3L3CA 1R43A 1PSEA 3X24B 5D4LA 2GHVC 4QYZK 4OJ3A 3WXMB 5CCAA 2Y1LB 3QHSA 4C92D 1P9QC 3VYGA 3JAMY 4C8QD 1FFWB 4LF6F 3DU6A 1JLEB 4BWJA 4QU6A 2QLBB 1EARA 2DCLA 4N4IA 3WHIA 5J3BA 4ZS6A 3I5AA 1QE1A 2XMWA 2FLNA 3PVQA 3UO0A 4GRSA 3A1YG 2B3TB 4OVAA 2ZD1B 1R89A 1X60A 4DSLA 2XEXA 5M2PA 1VQKS 2LZ6B 1PJ5A 4U7CA 2FJVA 4Y00A 3I87A 4FL6A 1XIQA 3H4BA 1UECA 1K0XA 3VQSA 1NHUA 3PVXA 5D0GA 2LECA 2WACA 5KG2A 1KD1U 2RRNA 3J80E 4LRFA 2FPEA 1FESA 4DX6A 1JJ4A 1FHTA 4IIMA 3NS7B 4F4ZA 1IBMJ 2BANB 2XBPA 2QGGA 4OI6A 1J5OB 1YITA 3P4UB 1WHKA 3MM6B 1WELA 3V7CA 4FSSA 1NPKA 2XNQA 4Z8AA 2OFGX 2XMVA 2RUGA 1TKTB 4A4KA 5G0RB 4NZ7A 1YBAA 2L9WA 1BUXA 2VG6A 3ULRB 2QX0A 3QWUA 2VQFJ 1FK9B 3KUFA 5IN1A 1TG0A 4ANCA 1AWXA 3OBYA 2EIFA 2K5LA 2GA7A 1WG5A 1YFNA 4R0KA 2X3GA 2VG5B 2IC3B 4WFZA 2OJ3A 2V8JA 1MW7A 1IN0A 3DLEA 4NLWA 2OTLS 5IT9U 4M5HA 4O44B 2DNGA 2KU7A 2E41A 3TP2A 2BW2A 4C8KA 2DEJA 5KFGA 4C5IA 2POKA 3CCSS 1QP2A 1TK5A 1YJNT 1WNEA 4B02A 2B9WA 3HHKA 4O4RA 4O3PA 2ASJA 3QBCA 2W9BB 2GZOA 3H25A 2K3BA 2PNIA 3G86A 3QSYB 4XPEA 3L2VA 1N36F 1ZSZC 1BE4A 4Q8EA 3QFWA 1LW0A 2JTEA 5GAN2 1URRA 4EI2A 2EVRA 3JCMh 1N4LA 4PJLA 3M5AA 2IC3A 4ECZA 2RKIB 2KDOA 2DGVA 2L3RA 1KC8C 2BYCA 2PI4A 3N79A 4M5GA 1FK9A 1QVGS 1WJSA 1ZQ1A 5KYNA 3KLEA 2BACA 1C1CA 2X4WA 4OMNA 1EJ7L 1ARKA 3HTRA 4USMA 2Z8QA 1TKZB 3KMSA 3V4MA 2OTLA 3KUEA 1X4CA 2EJ9A 5IOLA 3TEEA 2FEIA 4OYBA 1I51B 3DHXA 2LQKA 5KYWA 2LQ5A 4ZPBA 2ZJQQ 2MHEA 2PFFB 3MR5A 4XK8C 1M1FA 4OMLA 5DRKA 1BI3A 1R27B 3EG9B 2KVQG 2X51A 2A2CA 5D15A 1KQSR 3DLHA 4F7UF 2WVCA 2VASA 4OMFG 2FTRA 4QVCA 3CW2C 3NOCA 1HQ2A 4IQMA 3URGA 3OYAA 3OYCA 1MMGA 4KHMA 1PYSB 2OGUA 2BUNA 1EZZB 1B64A 2BUDA 2EYYA 2QDLA 4YEAA 4CIOA 3I31A 2OEJA 4ZOSA 2JVRA 2XLKA 4A48A 5KG4A 4LF4J 1IGUA 1B70B 4G3IA 3WIVA 3SWNA 2YX1A 2RHQB 3D1OA 1K9MC 5GADU 1BWEA 4M77D 1ZUKA 4NA3A 2BKDN 2RT3A 2GAGC 3N6NA 4QR1A 2AIRB 3M54A 2CXEA 3GJQB 1X4BA 3W66A 2HLTA 2E64A 2CJXB 4O3OA 8AT1B 2MHNA 1CQMA 4KE5A 2DM1A 2BE9B 2CQDA 5KFWA 2NUTB 5ETPA 1UVKA 3M30B 2B4OA 2Z2LA 2K57A 1NPRA 3C15B 5DLFA 1EQ0A 1NJIU 3I56Q 4IOAQ 2VPZB 4RW9A 2EJFA 3D68A 2RU3A 3CCMQ 1WNLA 3Q1JA 1PD1A 4K4VA 4YB1P 1FD2A 7FDRA 5KAKA 2YKPA 3D6TB 2RI2A 1WG4A 3EH2A 3A8JA 2J0WA 3RBEA 3M32B 3UA7A 5M2RA 2LU1A 2IVWA 3TAMB 1MMNA 2JS2A 3NP5A 3QIPB 3EGXA 1CJVA 4ECUA 3J7YU 2OPQB 2P84A 1FDAA 2MEWA 3QRQA 2AMCB 2YX4A 2BRKA 1ZBJA 1VQOQ 5C6SA 2CT3A 3L2WA 3JB9F 1YLXA 2DNHA 4DV5J 4W4MA 3D28A 2YLBA 2AU0A 4NLXA 4YOEA 3JS9A 2FVUA 2E10A 2CQ4A 3KLGA 4LFBJ 2IM0A 4RW6A 4M5IA 1OX8A 3CD0A 4A47A 4Q7AA 1RT2A 4RU9A 4PFOA 2L2PA 2NR0A 1XWLA 1OZ3A 1QVGP 5GAGI 3CXCP 3PIOQ 3REAB 4WZQA 4FYWB 3HF5A 2LEAA 1RTJA 2VOOA 1GFCA 4AG1C 1C1BB 2XY5A 2RH3A 2CPEA 1LKZA 1PILA 5LJ3j 2HGNA 4LR7A 1U49A 2VV5A 5I21A 2BEFA 3NGSA 5KT4A 3CC7T 4KH0B 2E1AA 1VQNQ 4PCQA 3LTOA 5HP1B 1S9GB 1IREB 1YJ9T 1S97A 4DBHA 1T02A 3HPWA 1F0XA 3OFGA 1EETB 1JLAA 5B0GA 2DL4A 2CPXA 1SJ1A 2RRAA 3QXEB 5KYXB 2D69A 1VQOT 2UXBF 4DL0C 4IRDA 4PUOB 2QQRA 4O0IA 4JYAJ 3CJQA 4ES2A 5GMKa 2VU5A 4FCYA 3QZ9B 4A4JA 1QY7A 1YX2A 3D3BJ 1YWXA 3AY0A 3QGIA 4PXBA 5T41A 1Q82C 1VYAA 1N5YA 4F50A 3TQ1A 5B09A 3FRZA 4EWTA 2FPDA 1HQEA 1GCQA 3MP1A 1DLOB 4HTJA 2MQQA 2AX1A 5ETRA 4NI2A 2XY7A 2JNJA 3WBZA 3V81B 1YJNS 2OPQA 3J7ZT 3ENWA 5CQXA 2DTIA 1L3VA 5BYSA 3QIPA 2MJNA 4BC9A 1VOMA 2B6AA 3O8VA 2KB2A 1WUUA 3M32A