4ZN3A

Crystal structure of mjspt4:spt5 complex conformation b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
147
Chain Sequence
MIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTPKKIIENIEKGDVVEIIAGPFKGERAKVIRVDKHKEEVTLELENAAVPIPITLPVEGVKIVSKHKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription elongation factor Spt5
publication title Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
total genus 33
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zn3A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 4zn3A01
1N8RU 1RL2A 3CC4T 3G4SA 3CCJT 3CCSA 4RG2A 4TVRA 3CCEA 1VQOA 3CC2T 3KBGA 3HKSA 3CCUA 3OW2A 1YHQT 3A5ZB 1S72A 2QA4T 1N8RC 4CRIA 1M1GA 3CCLT 3CCVT 1QVGS 3CC7A 3CPFA 1JJ2A 1VQ5A 1VQKT 1VQLT 5J26A 1NPPA 2KVQG 1Q86U 4ZN1A 1VQ6A 1VQ9T 3CD6T 2JUFA 3G71T 5DLQE 1M1HA 3CCRT 5DM7R 2E70A 3CMAA 2OTLT 1YI2A 2OTJT 4X34A 3CMEA 1Q81U 1XNIA 1K9MU 1M90U 3EWGA 5A2QE 3H7HB 1Q86C 1KQSA 3QQCD 3ER0A 3G6ET 3CXCA 1KC8U 1YITT 3I56T 2JOYA 1K9MC 2MWPA 1M90C 1KD1U 1VQ4T 1VQ8A 1JJ2S 2IG0A 1YJNT 3LH0A 1YJWT 5LL6S 2L3RA 3PIPA 2CKKA 3CCST 1W2BA 1KC8C 5IT9E 1VQOT 3CCET 2EXUA 3CC2A 4ZN3A 5FLXE 3CCUT 1KD1C 1YIJA 1S72T 1KHIA 1YHQA 3J7AF 1VQNA 2QEXA 5J3BA 1VQ5T 3CCVA 3CC7T 3CCLA 2MI6A 1VQPA 1KQSS 1M1KU 3CCQA 1VQ6T 3CXCS 3LPEA 1BKBA 1VQ9A 3CMAT 1YI2T 2XHCA 2OTLA 3LGLA 3CMET 1NZ8A 2LCLA 1Q81C 1SSFA 3OW2S 3JAME 1VQMA 1XTDA 1YJ9A 1M1KC 3DB4A 3DLLA 2LVMA 1QVGA 3CCMA 3I55T 1QVFA 2JNGA 1W2BS 4YTLA 1K8AU 1VQ7A 2JVVA 3G4ST 3CC4A 2E6ZA 3CCJA 1EIFA 3CPWA 1Q7YU 1VQ8T 3OYYA 2DO3A 2EIFA 2MWOA 1NPRA 2QA4A 5IAYA 1YBYA 2K06A 1K8AC 1YJWA 1UEBA 1IZ6A 1VQKA 3PIOA 1K73U 1VQLA 3J80E 1Q7YC 3CD6A 1YIJT 3G71A 3J81E 3DB3A 3CCRA 1VQNT 2QEXT 3LGFA 2OUGA 2OTJA 1VQ7T 5HY6A 2KDSA 1VQPT 1K73C 2LQ8A 1NJIU 1QVFS 3CCQT 4QQDA 3TREA 1Q82U 3G6EA 1NZ9A 3CPWS 3P8BB 1YITA 3I56A 1X6OA 1VQMT 1YJ9T 1NJIC 1VQ4A 2G3RA 3CCMT 1YJNA 1Q82C 3I55A
chains in the Genus database with same CATH superfamily
1UWAA 1K76A 3ISZA 2BUDA 2R8IA 1X69A 2ROPA 5M2RA 4USWA 1B3QA 2XLJA 4M5NA 2ZM6J 1UEKA 4N8NA 4YR2A 1M2VB 3MMCB 1B4SA 4IH5A 3MM5A 2ZHAA 4RW9A 1UGQB 4X2BA 2BMBA 2K57A 4JI4J 4NASA 2BJDA 2ADCA 3LGNA 4LBHA 2N3LA 3H5YA 2QO3A 1S76D 4HL9A 1M5SA 3KXTA 2OAUA 5GAMh 1U6BA 1YK9A 1SHFA 1C1BA 2IDEA 1XR6A 4MMOA 4P2FA 2EK6A 1RAOA 2AYMA 1DAXA 3A13A 1D3BA 1U1OA 2CJYB 1XC9A 1LKZA 3QG1A 4XU0A 3UVJA 3PW5A 3CPWA 5D3GB 4Q8FA 1PD0A 2FRWA 3VCDA 5CHCB 2W1BA 4LN2A 1V6HA 4I0WA 2KYXA 2X3XD 3KLIB 3W1YC 2ZH8A 5J1PA 1ZPVA 1OMSA 2OTJA 2LCWA 3HHTB 2RHUA 2J0QD 1U26A 2FJBB 4X4UA 5CCLA 1ZAVA 3GP8A 1EX4A 1AFJA 4CWBA 4J37A 3GV8B 3QAEA 4YMEA 5C25B 2UVRA 4GBQA 2XS7A 4QCLA 2DR5A 2CZ1B 5A8WA 4QWCA 1YI2A 4Q7AA 3EHQA 2M70A 2HFVA 2JW4A 1FTRA 1KK7A 4DV2F 4EZ6A 4BC9A 1M5PC 1U25A 4E7HA 2L3SA 3C0CA 2F4VF 5K9FA 2L48A 3V8KA 3JXOA 2CPFA 2YPZA 4LR7A 3OJUA 1SJ3P 4M95A 4N8OA 4FF4A 1Y5NB 4O5VA 4UOHA 2E9RX 4FYXB 4IFYA 1FA0A 5CVIA 4QW8A 3I55S 2R5MA 1FT8A 3R5GA 5I3UB 1AYEA 2EFVA 2HK3A 1XTDA 5IWAJ 3NS5A 3NGSA 1M1KR 2ILYA 2ZVSA 4KE5A 1UVJA 2O01C 4WFZA 3OYBA 2H8HA 1SRLA 1TUWA 1S6QA 3L2RA 1UDLA 1LWFA 1YJWA 1VQKA 2D0NA 2G0CA 2ZZMA 5C0MA 2MLZA 3ZTQA 4DV4J 4PNOA 1KHVA 4PJOG 3PX4A 4YB7A 3FMWA 1TK5A 5DM6Q 1IQTA 3ZZRA 1WG4A 2ZH1A 1OY8A 4X64J 4DPYA 2WONA 2B7BB 4LREA 5L8RC 3IP0A 4NLWA 5IHIA 1NK7A 4RUGA 4FXWA 3LH5A 1S72A 5DDRC 4KKOB 4WF2A 5DQHA 4A8YA 2LVWA 3HULA 3BQ0A 4PQUA 1PILA 2BKNA 2MOXA 5C2GA 1NO8A 2HBYB 1GRIA 3RKYA 3M2RA 2QG9B 3JCMc 4MYUA 5ETSA 3QT8A 4Y65A 2Y4XA 1S99A 2DNGA 4CI0B 2G1HA 3GJSB 2FGCA 4RW8A 2A3JA 4N4IA 3MM9B 1WYXA 1S6OA 4GRSA 1MROA 3T9NA 2ZKUA 3S7RA 3PRVA 1M5VC 1U1QA 1H8KA 2RF2B 2AJ2A 4Z7YA 2DCLA 1N33F 5GAN5 4A4GA 1VRUB 2YWGA 2V8KA 3D0GE 1R31A 1FERA 3ZZTA 4X66F 2HHHF 5I42B 3PIOA 5ETOA 3PDNA 3TX8A 1CJTB 4BC7A 5HY6A 5M2UA 2CG8A 3BGOP 2HGMA 5LXRA 2F4FA 1XMOF 1UB4A 4Y28E 4DV6F 5KCHA 2DIUA 2DGSA 2D3UA 2ZWPA 3FSIA 2C2DA 3FMBA 2RD1A 2CPJA 3HKSA 2DITA 3RAMA 4UY8T 4WKYA 1N27A 3QWXX 1VK3A 2DTIA 2E7VA 5HL7Q 3FDSA 4ZJLA 4NLUA 4DPWA 2JLGA 1K0VA 4DLEA 2IJNA 1YITS 4EFAC 1FNXH 4A8WA 3RRHA 2YQ3A 3N01A 3SIPB 1SHGA 2A7YA 2GGPA 4ZPVR 2YX1A 3I96A 2HMIA 1T9VA 1JXMA 3KUHA 3G6VA 2BQRA 1RBAA 2M9KA 4ED0A 1A9NB 2X1GA 4X4VA 1N6QB 2KZMA 5D15A 1WDTA 1GCQC 4HA8A 2E66A 2AJQA 3S1TA 3ETOA 1WLPB 4IG3A 2RS8A 1BIAA 5LJ3e 4CQ1A 4F14A 2AP6A 4MAKA 3PNIA 3ILJA 2BE9B 5FLXY 1Q81T 2XWXA 5IZHA 5L38A 1TKDA 2JC1A 3KNAA 1NB7A 1HBOB 3EMTA 2NXUA 2HWIA 2RDIA 2X3DA 4XTUA 5LMNJ 4XAXB 3D1QA 3L1AA 2HFSA 3OYNA 4M94A 3SWNC 5JJBA 1U0SA 1D1CA 1RBOB 2D6FA 4JV5J 2W24A 2L41A 3QRPA 4B9UA 5I11A 1NMEB 1WWHA 2NXCA 5F3ZA 2W9CA 1U1LA 4QR2A 4KFBB 1N34J 4GO7X 4ZVRB 5EWFA 1W6XA 2KBTA 3OR1A 2J5AA 3VR1A 1YZ6A 2JMCA 2E5HA 2PEHA 3VGVA 2KRNA 3MMBA 3M8PA 1N8RC 2GS8A 4OZ5A 3R6OA 4I4BA 1X31C 3PW4A 5HBMA 5D0GA 3PTAA 3OR2B 3JB9G 2MKHA 1M90U 4WU3A 3D1HA 4JI7J 3G71Q 1Y57A 2PVDB 4FF2A 1DQ9A 1AROP 1WOPA 3A8LB 3I5CA 2MHEA 2ZNYA 2JEFA 2V5HG 2RPNA 1X0PA 1RTHA 2FZGB 2LQKA 5E3QA 4DZDA 2DH7A 3OMGA 4YR0A 4BY6C 1V1CA 3GFXA 3META 2FVRA 4TKTA 3ZL7C 4F4ZA 3HFOA 4OLOA 3LH2S 2EG2A 2WOMB 1WELA 4OI2A 1RCXB 2HIYA 1LK5A 3D0HE 4J83A 4FS1A 2HHQA 4RTXA 1A0NB 2OPPA 4FSXA 2HFOA 3RIRA 4XK8C 2HNIA 1U8RA 4NMLA 4DV5F 4PLIA 4ZCLA 5DG8A 2XYHB 2N3OA 3M2UB 4USIA 3I0RB 4KT0C 3ZNUA 3GTYX 2GX8A 4NEYA 1ZA1B 4A4KA 1TU0B 5EHHA 5IC6B 1YHQS 4DF4A 3HSBA 2K3KA 3K5LA 5LJ3f 4CP5A 4CYUA 4M7DG 1TL1B 3LUYA 4FNIA 4NWBA 3PXGa 2DKGA 4B3RJ 4M75G 4I2QA 3CC4Q 3JSMB 3SSQA 5D4OA 3BGRB 1D9FA 4NX9A 4PJJA 4IDKB 4Q5WA 1WJ9A 2V8HA 4B3MJ 2XHWA 3M32A 4QWAA 5G4DA 2M7SA 1Y7XA 3UO0A 4ECSA 3EGDA 5AXNA 4PJOB 2GIFA 3DOMB 2DGWA 4ECQA 2P0QA 1F3VA 1HQEB 4C7QA 2R7RA 2QQSA 1WEZA 4N0AA 3G82A 1X01A 2JH3A 2P84A 2WCXA 5GANh 4WTYA 4D3GA 2Z2ZA 1CKAA 4BWJA 4IKAA 2RU9A 1PJ7A 4KPCA 3VYHB 2RQ4A 4DR6J 4B9VA 2WVFA 4OX6A 2GIQA 1FE4A 1EZZB 1K73C 1FRHA 3Q8QB 3ELHA 2FHDA 5LJ5Y 3J7ZT 2M02A 1NU4A 1X4FA 2KRRA 4IIMA 3MHXA 3L2VA 1U49A 1YITA 1R8HA 1PCXA 5CYMB 4LF9F 4RG2A 3EXYA 2K79A 1LVKA 1LK7A 3QGGA 4DN9A 3J7Z5 3OSNA 5T14A 2BQUA 2YQ1A 1N6AA 4UZBA 3PVLA 2KVQG 2NUZA 5LSLA 2KG0A 4BUGA 3HHLA 3BJYA 4IOCQ 3FGVA 1YWOA 2JFKA 5HP1B 2F63A 2MKYA 1CS4B 2DERA 4OYZA 3BDLA 3MEGB 4M7AA 4FP9A 1CJUB 4NOYA 3SB2A 4RUCA 4ZLLA 2FIUA 4B3OB 3US5A 1KS2A 1PHTA 1W7WA 1PC5A 4LF8J 3S6EA 1MMAA 1ZX6A 2B7CB 2C2MB 2UUCJ 2ASDA 3MM7B 1TSFA 4P73A 2XSJB 4KC5A 5GAHI 3LPEA 2K2MA 4L6V5 2DA9A 3PT9A 2CJ9A 3CPWP 3FBFA 3EGWB 1Q8BA 4JLGA 5AE2A 4DU7A 3PR4A 3GIJA 2CFXA 2KYBA 1YIJS 1XQHA 3MJXA 1TKTA 5DS7A 1FNMA 3OFEA 2FJDB 1M3AA 3HP6A 1RTIB 3TWZA 5HMWA 1QCFA 2CQ0A 3CD5A 1J5EF 2GVZA 5KG7A 1U48A 1G3YA 1QKXA 1LWEB 3EVWA 3MCAB 3H2LA 1IJEB 3TZWA 1RYRA 3A8HB 4M78A 3M8WA 2RJEA 2LMIA 4OHVA 5K8PA 3T1YF 1PBUA 4ZP7A 2VU5A 3A8OB 5HVGA 3EE3A 4I56A 1WC3A 5EUHA 1Q86R 3M4XA 3E01B 3OYCA 4WP9A 1TL4A 1TMJA 1MN9A 1R6VA 3BO2A 2WVEA 5DQIA 2ZBRA 2R4FA 1IR0A 3D54A 4J9SA 3LAKA 5J2PB 3RB4A 3QUIA 1QLNA 4MIBA 4NLXA 3DYAB 4ZNXA 1EKRA 3PFSA 1SIWB 5HKCA 4CO0A 3JCMJ 2Z58B 4ED3A 4OHXA 3UD5A 1WHGA 1L5UA 2LYVA 1L3TA 5DRKA 5T41A 3J7AF 1F9HA 4ZIVA 1IBKF 3CCEQ 4IRDA 5HQMA 2LRQA 5L1IA 3U23A 3FUYA 1F5BA 1SKUB 1UJ4A 2FY8A 1RHUB 1WHKA 4PZVA 4RTWA 1K8AU 3VAMA 2D9PA 3G4ST 4OFZA 2ZH3A 4OZ1A 2HCKA 1C1CB 4WXWA 2K1RB 1S1VB 2RMLA 1NCLA 2G0IA 4BDPA 1KQ2A 3T1HJ 1IKVA 4GVLA 1UCNA 1H3HA 1TUDA 2GJFA 4TU7A 2HG4A 3HDSA 2BJ9A 2XG8D 4OX7A 3ME9A 1X6OA 4ZLJA 4TYBA 1RT5A 1IO6A 3VVTA 2ROGA 1OV3A 3MR6A 4PJNA 2PMZD 2ENMA 2W9BA 2X9HA 3RTVA 1T11A 1EP4B 1Q86U 3IGVA 5F9LA 2PTKA 4D8KA 1WHMA 1RI9A 4R8UA 3QQCD 1H641 1RP5A 1FMVA 5HROB 2O4XB 2DPJA 4OZ3A 3PKYA 1FKAF 3GF5A 1GMUA 3DFEA 1WC4A 2OGUA 4WWSA 1RTZA 1S79A 2M16A 3Q83A 1ZM2A 3G6XA 3G87A 3JTNA 1VQ9A 2AX0A 5KAKA 1R77A 1EHWA 3G86A 2ZITA 3AXKA 4FW1A 4EDUA 2QTWA 3BYRA 4M7DB 3DOKA 2R7VA 1VYAA 2PMWA 2E6ZA 4M75B 4QVDA 1HNVA 3TX0A 3KK3A 2CJBA 3OXLA 1OPKA 4JV1A 2IC3B 4M5IA 2BJ1A 3V2UC 3N0VA 1Q1KA 1X9WA 4LF7F 5IT9U 2IRUA 4DQIA 1NJXA 1UHCA 4KYZA 5CKHA 2B6AB 5KT3A 4UUXA 3J81j 1RT1B 2GNCA 1KDNA 4P2MA 2RKIB 4FYVB 1AHJB 2CKWA 3CDBA 1XMOJ 3R97A 1YG0A 5B09A 1WJQA 3MEDA 2CJXB 1GX5A 3CCVT 2D8JA 5ITHA 5GAMd 2DGUA 2VC1A 4DOZA 3EG1A 5GADI 1W26A 3J81U 1EB0A 3OBIA 4CTAB 1V3RA 3HFZB 1JB0C 3VV2B 2MJUA 2C42A 3HJFA 1OQ6A 2HQXA 2GAHC 1XK8A 1HIYA 1KLNA 2ZFHA 2R42A 1D1AA 2HVEA 1YIJA 2RQWA 2FVCA 1Y9OA 1WHYA 2HFUA 1ZBJA 3CC7T 3FDRA 4KGXB 4J6XA 3SFGA 2BIVA 1GCPA 4JI2F 1XR7A 5KG4A 1WDXA 1OWXA 5A0LA 4JJBA 1YLXA 1FFWB 4C8KA 1MNDA 3UT1A 3ILIA 3ENWA 3ISND 1U0HB 2N4DA 5L1JA 1P1TA 1PC0A 2EYZA 1UEVA 1DBDA 3IR7B 1UP1A 2UUAF 4ZMMA 4D3HA 2KYZA 4HT7A 2V50A 5GADU 1HQUA 4ECWA 1BI1A 3EFOB 2GAGC 1KLMB 4F2SA 1CG2A 3MF5A 3VRYA 1VQPQ 2P8IA 3IG1B 1FCAA 2BANA 4DSFA 3DGPB 1S59A 3MR7A 4DSKA 2XZWA 1GXIE 3BBCA 2G13A 2RI2A 5LT5A 3IA0A 4ECTA 2CDTA 1WNLA 5ETVA 4F7UA 1JLBB 2HWHA 1W70A 4JI0F 1N5YB 1HPZB 2B9WA 5CO7A 1C0TA 4ED8A 2EQIA 4ES2A 4C92E 1EFNA 3OXFA 3BE3A 4MMKA 1F0XA 1Z2LA 3P3DA 3OPKA 3R5AA 4JRPA 4A8OA 1WXTA 4ED1A 4USJC 2D1XA 1WG5A 1HMVB 3CBMA 3JSBA 3RAXA 3MDFA 2EXUA 2EVZA 1RISA 3ET6A 4OV6A 4I2PB 4QR0A 3DOLB 1QTNB 2MI6A 1WORA 3OBWA 2DL4A 3P4UB 2NXEA 1QKWA 2CNKB 1OSCA 4M7AC 2BZ2A 3P5TL 1M1KC 3BN4A 1CLFA 1FJ7A 1I1GA 1OPZA 1UGSB 4C8QE 4AL6A 3GONA 2JS0A 2DXDA 4H4OA 3GFYA 5A6PA 4OYIA 5DDPC 2E1MC 2VODA 3PMIA 1QMCA 2NZ4A 4CM2A 1QAXA 2NYIA 2I5JA 2OUGA 2ZC3A 2FGOA 3HVWA 5CYQB 4TQRA 4EU0A 3RBDA 2DL8A 5M2PA 2YSQA 4QWDA 2DXBA 4P2SA 3CCQQ 5THWA 2LQ9A 2RQRA 2BEFA 1W25A 4DL2A 3SV4A 2A37A 3NBPA 3TANA 4AXIA 3OQ2A 2LXFA 4CNYA 1R27B 4IUTA 4HCKA 3CPFA 4F4XA 3TCJA 1NE8A 3CD6T 3LP1B 2JEGA 2QE5A 2JUFA 3L9ZA 2DY9A 3UN3A 1KFZA 1O5JA 4DR1J 2DVJA 1W4SA 2FJWA 4M78C 1KONA 4L6V3 3QAUA 3CQTA 4JI6J 1TFYA 4OYMA 3EPIA 3JCMW 3PHEA 2DR9A 4Q2LA 2JVOA 3SFUA 2RRBA 1TL3A 4OX8A 2ASYA 5L1LA 1S9FA 5DDOC 1S48A 3WC0A 3OW2R 1N54B 2MY8A 4PEOA 1QTMA 3C6UA 4G65A 3NWGA 4USTA 3SDEA 3MM6A 1RUWA 3ZEHA 1FRMA 2LCCA 1TV6B 1X4CA 4JRQA 2LVMA 4RW4B 3QMQA 4FYWB 3ASKA 2XO6A 1N32J 2UU9F 1TKZA 3ZZUA 3GV5B 1PJ5A 5CQGA 3HKWA 5HJXA 4Y91A 3R5CA 3NOGA 3A1PA 4AL7A 3CDWA 1V9OA 4MH8A 2F69A 4JI3F 2RAQA 3LGFA 3I4PA 3TUJC 3M6VA 5KT2A 4OI3A 3PIPQ 1FKOB 4WFNQ 1YJRA 4JDSA 1WZOA 3JCMV 2RHXA 1RBLA 4FU6A 3UPFA 2QEXQ 3NWRA 5KFYA 2AJ0A 4LF2A 3W61A 4C97A 3PR5B 3OLBA 1AW0A 4ZVSB 4L59A 3NMAA 1UVLA 4X9CA 2AT1B 4DL6A 1N56A 1VA7A 4YOEA 4NA1A 4FYDA 4CH7A 4DLGA 1G8XA 1QY7A 4M77F 2OAWA 3AJDA 2E5LJ 1U1TA 2OPQB 4FYYB 4WCIA 3A3OB 3MM8A 1GXTA 5IH2A 1HI1A 1TZ0A 2HBZB 3C2PA 4X65F 1VQ4T 3M2VA 1I8FA 4WFAQ 3R7NB 2PD1A 4J6WA 2XULA 2W0ZA 3R1HA 2AQ4A 1PSEA 4EBCA 1V5IB 1IBLJ 1BYMA 3BY7A 1T03A 5CKBA 2OTLA 3L4BC 2LCLA 2DBMA 4Z8AA 5F8GA 3FFIB 2MJNA 2ZBPA 3CDAA 2Y3YA 4XPEA 4A48A 1WI6A 1JQQA 1TOVA 5B0AA 3MEAA 4OGEA 2IHR1 1W2BR 5LJ5f 4DR3F 1RWOB 2EGAA 3R9LA 4K5RA 4CLUA 3KLIA 4KUDK 2YWEA 3Q86A 7AT1B 3ZBDA 2C2NA 2H65B 4TY8B 3UA6A 2Z4PA 3B78A 3THPA 2X1BA 2IVYA 3BKUA 1HNXJ 4IH6A 3CIMA 4C5HA 1KHCA 2RHIA 1URRA 5IQ6A 2A1BA 1BQMB 1BWVA 3T1YJ 3AODA 2GJIA 5C25A 2YT6A 3W63A 2KT3A 4XQ3A 3TJAA 2MPXC 5FIIA 3M0PA 1TUVA 3QDFA 1Q5YA 3J7A1 1HWKA 1JLQB 1UJ6A 5HO4A 3RZAA 1RDRA 3GMGA 3H40A 4C3MA 5KYYA 1AFIA 1TXQA 1HNIA 4A63B 2LQ5A 3W2VB 5H1SV 1YTYA 1PSFA 2E1AA 6FD1A 1MNEA 1FK9A 1IKWB 5KG5A 3M6UA 3FKBA 3MCOA 4NL5A 2M51A 5LJ3g 1X5OA 3CMET 2RDDA 1SF9A 3JAME 3RERA 3MXHP 4AQYJ 1T9WA 3TAMA 2YRCA 4HT9A 5B0EA 5E5NA 2AV5A 3P8HA 2RH3A 3MCSA 4O3PA 2JMAA 4ITSA 2YRVA 2QC3A 1UEBA 4ZJQA 3PX6A 1RWVB 3QSUA 2JN0A 1F60B 4KGKA 5GAOl 4Y2CA 3JCMP 2YNIA 3DM2B 3M0UA 2F7VA 4PLLA 5GAN7 4IG0A 1NK5A 1SUQA 4DG1B 1VQMT 3GG0A 4PPZA 4N7TA 4DDFA 3KLFA 3NKYA 2ZH6A 4RPFA 1NKEA 1ZPWX 1T0HA 1NB2A 2FL7A 1VQLT 2DR6A 4KKOA 5KFRA 3I82A 3CCLQ 3NNHA 1K9MU 5A2QE 2V67A 1SL0A 3L3CA 3SWNB 2OTJQ 4Y00A 4E7LA 5GANd 1V3ZA 2V8VA 5C2CA 3IC1A 1VRTB 5FWCA 2W01A 5A0YA 2DTOA 4C3KA 2XMMA 1NK6A 2D8HA 2IM1A 1P1LA 3MM9A 3RMSA 1AD5A 3VVUA 4RTUA 1FE0A 2RHSB 2XLIA 3FEYB 1URNA 2VQEJ 1PC4A 3G4SS 1RZMA 2Z2MA 5JVHQ 3X26B 3UCGA 2EGEA 5C7PA 4LJMA 4WE1A 2BE7D 1W2BS 3HFNA 1YI2Q 2DNUA 2XYPB 2GMJA 4PJMA 5CKDA 3O2IA 4J7FA 3TQ7P 3V7CA 4XPCA 3M8QA 1VQ8T 3NGTA 1WKLA 2LT4A 1SC1B 3J80E 2XO7A 3AOAA 4J9IA 4HDHA 1RYSA 4DQPA 2FJAB 3QRRA 3M1VA 1QSYA 5C24A 4LIRA 5MAOA 3MM5B 4BY6B 1KQSP 4RW9B 4V19X 1FVQA 1N5TA 3M9QA 4F16A 3OTOJ 4DXLA 3NCPA 2LX7A 4P5NA 3IM8A 4A4JA 4KR0B 4P74A 1JLFA 1NHUA 1C1BB 1V3SA 3W65A 1U2FA 1HBNA 3EFSA 2J7UA 3D5MA 5FROA 5AJ3F 1EIYB 3K5PA 3JQJA 2PGCA 1VQKQ 5BR8F 3H0IA 1D3BB 1Q79A 3RBEA 2V4RA 3HSGA 2A2CA 2XG8A 4YDDB 4Z02A 2RQTA 1UTAA 3UVJB 5IT9Y 4DV7F 4M5JA 2FLNA 2VFTA 3R27A 4CDIA 1LW2A 2EBEA 2IIMA 1S72Q 1JX4A 2QSWA 2CDRB 2I1RA 1JJ4A 3JQKA 3KNGA 1T3NA 3D2WA 3BM7A 1TP7A 3AQPA 1WEXA 2V34A 5KFWA 3MFIA 1HBOA 2EJ9A 3LTOA 1Z1ZA 2Q6BA 2FVPA 5KFAA 4IQXA 3ZZYA 5A8WB 4OYAA 1PKTA 2DGOA 2VIHA 2CVIA 3CCVS 2QMUB 2MHNA 4KFBA 4DSIA 2UXCJ 3RUXA 2HGLA 1AWOA 3V6DA 2CQIA 4JUZA 3VAIA 3OW2A 1GNKA 4K4WA 5CXTA 2M0YA 2VD3A 5IV3A 4DSJA 3G96A 2ACYA 4D6WA 4IFYB 4EMKB 5CCAA 3PIOQ 2HRUA 1VC6A 4PG5A 2PUOB 3CCZA 3MMJA 3JCMe 1NKCA 2CT4A 3CC7S 1NEBA 5GAGI 5GAN8 1E6GA 5FU7C 1S97A 1K44A 2VB6A 1Q8LA 3HHEA 2XI3A 1FO1A 1UFKA 3X24B 1S6QB 3N28A 2LQBA 1LWFB 2ZKTA 4ZLNA 2VV5A 1H73A 4UQGA 1HK9A 2R8JA 2AZVA 2B8QA 3K0JA 4ETZA 2DXTA 1HBUA 1IXKA 3HK2A 3FEOA 1O75A 1VK8A 2I2YA 2JJ9A 3ITHA 1HWUA 2WZ1A 4C11A 2EBGA 2DFUA 3PYEA 3MEVA 2WONB 2HLTA 4LFBJ 2W10A 2DHHA 2RNEA 2J6KA 2M5YA 5JXSA 2FVQA 4P52A 4XIUA 4DX7A 4PQUB 2DYIA 3E2EA 1WHXA 3T5HA 4G3IA 5IXFA 3OVAA 3M2RB 5L9NA 3JTPA 2DHSA 4CC4B 3R6NA 4C92D 2CPYA 2I0NA 3CC2T 2M2BA 4CCHA 4IRKA 5GAGU 3GFZA 4RW8B 5AXKA 3LYIA 4HKQA 3VV0A 1IQZA 2F2WA 1CKBA 1MROB 2GJ2A 3BGRA 2VPYB 1NYGA 3H4DA 2R7SA 4DEYA 1ZYQA 2V8GA 1Z9ZA 4OYPA 3MAHA 2XZTB 1DQAA 3KG4A 4K4ZA 4O44A 4LSNA 3LX7A 4ECRA 1W2BA 4M7AG 3QZ8A 2GCFA 3IBWA 1KHIA 2IM2A 3DOMA 1NSQA 1AWJA 1UPPA 4C8QD 5KFVA 4QVZA 1SKRA 1Q81C 2PSZA 1BI2A 2XWYA 1PM3A 3X20B 2B4UA 4KGZB 4J6YA 1S49A 2Q43A 4PCQA 1XBWA 1H2VZ 3A8MB 4A54A 4LIWA 1TUGB 3I55Q 5KFTA 4R5PA 1HD0A 2D3O1 1WX6A 2ZH5A 4HR2A 3JCMf 1CBKA 2ZD1B 3MEEA 3VS1A 2WRMA 4ZGDB 2K9GA 2KRSA 5KYXA 3HVTA 3NXZA 3HSDA 3A1YG 1MN7A 3W2WA 4LR9A 2GGPB 1OOTA 1XQIA 1BC6A 8AT1B 1I94F 2GIRA 2HMIB 3HFVA 4PRFA 2BX6A 3KLEA 7FD1A 3CD6S 4KULA 2COWA 3EVMA 2O2OA 5LJ3j 2P0KA 4M78G 3KG1A 1M1GA 4KH0B 2YNGA 1WGSA 3KJQB 1JLAA 3BB5A 3EFRA 1M1HA 3WDOA 2HL5C 2V4JA 1T9YA 2JJ4D 4GKJJ 4HHJA 3G6ET 1G7CB 1D9DA 2PNIA 2KB2A 1VIOA 2Q6CA 1HNZF 1KFDA 1BBZA 1SXLA 3H9NA 1L3VA 4ZVTB 1VC0A 3BQ1A 2DHGA 2AGPA 2HNDA 3R6GB 3CCWA 1NLOC 2IY5B 1HHQA 5GMKe 2HHWA 4ANEA 2NS1B 2JFDA 3UNYA 3RESA 5D4LA 1KR4A 1TVRA 4CC2A 2CIMA 2MIOA 3D67A 2P5VA 2W9CB 2OJ3A 3OR1B 4TVAB 1ZLMA 3C66A 2YWWA 2E10A 3MMBB 2KXNB 5HK3A 3OFHA 2M3DA 3M8PB 4ILMA 2UUBF 5HBMB 5DY9A 2E5KA 2W8LA 4BI3A 1M5HA 3OHBA 2W9AA 3C16A 1S1XA 1XNQF 1PBAA 4XTYA 5LSRA 4CLPA 1U1SA 2WAQD 4HHHA 1FEEA 4DS5A 4UOFA 4JI5J 2RQVA 1AWXA 2DILA 1JNRB 2QLFB 4Y2AA 2OI3A 2XEXA 3E01A 2C22A 1B99A 3CC7A 3DI6A 2Y1JA 4UT4A 1MGQA 4MTPA 2VA3A 4PK4A 4C0DC 3LPYA 2WB1D 1QSSA 1VQ4S 4P72A 2B56A 1KP6A 2CNNB 2K8GA 4LRBA 1HNWF 4ANDA 3LLRA 4DQ2A 3CMQA 4QU7A 1GEHA 5GAMj 4NXMJ 5E2QA 3GIBA 3DGVA 4FXVA 2AKKA 2Q1LA 1ITPA 1YITQ 1MWZA 4DFPA 3M6XA 2OPPB 4QPTA 3SQGA 4IR9A 5J2MA 1GMWD 5J3BA 4DPTA 3AQOA 1WQWA 3T9ZA 1FX7A 3KYLA 4NXNF 1KQFB 1KFSA 4RG8A 2PZ1A 2IPOB 3ZXWA 3TO8A 1RU2A 3CXCR 2F2VA 1EIFA 3OL7A 1HQ2A 4CYUB 1S1VA 5F41A 2HHSA 4NOHA 5A8RB 3MEKA 1AOJA 2HDAA 4A8FA 5FWBA 3W7BA 3MGJA 4O4RA 2R2TA 3WVEB 3WZ0A 2CP7A 3M32B 2X3WD 1S6UA 3NGKA 1YFNA 5C42B 4DSEA 2N82B 3TEGA 5F8NA 3EGDB 4C0GA 2BXJA 1XMBA 2KNBB 1HI0P 2GMLA 1ZZNA 1EP4A 2R2SA 1ZM9A 1Y5IB 4CT8A 3UD4P 4PABA 3G82B 1V76A 1RLCL 2DNQA 4DUYF 4RTTA 5CAIA 3IRWP 4EIKA 3EDRB 2VFVA 2EFIA 2VF3A 1IWGA 3CMES 3RR6A 2EFPA 4ZDNA 2CQHA 2KI7A 4HCZA 1NLKL 5K14A 1YVFA 2LA4A 2DGVA 5CQXA 1FMKA 5A0DA 2N7YA 1NXIA 3R8YA 3W9JA 2JDJA 2IVWA 2LXIA 4IQMA 4QKUA 1FJEB 4PG7A 3PJ9A 3CB4A 3SCKE 4DR7F 3BPDA 3CD6A 2RU3A 3A8KA 1VQMS 1U45A 4LFCJ 4C6AA 4RW6B 2HFZA 2NUTA 2F5GA 1X43A 4K8RA 4M7AB 4F17A 2GV1A 1QVGR 1VQLS 4KV8A 3MHYA 5KFFA 1NJIT 2VJVA 4DX8H 2FB7A 1IN0A 3HSJA 2BJ3A 2AJ4A 4J9HA 1MMDA 2LX9A 1XERA 2QQ9A 3H41A 1YHQQ 3ZTPA 2RDJA 4PJOF 5ETLA 4DN0A 4F7UG 2VQFF 2MZQA 3Q8SB 2VUGA 2W2OP 2E3IA 5LJ5g 4HACA 4FXDA 2DO0A 2RQCA 1QP3A 4A46A 3ISNC 2XMJA 1RHJB 2ZPGB 5BR8J 1TKTB 1AB8A 3JCMQ 1FX2A 2DPPB 2RJDA 4B08A 4Y28C 5D8HB 4F25A 2DRDA 4JI8F 3CXCS 1U1NA 3ENVA 2P9GA 1X5PA 2GVZB 2RJCA 3V8LA 1J2VA 3NPFA 1VQ8S 2DNRA 4WZQA 2IJRA 5IFMA 1X9SA 3O44A 4Z88A 1DTQA 4M78B 2J0SD 4USVA 3IAM9 1Z9QA 3H6ZA 1C0MA 2GHWA 4O0NA 1X6GA 2F40A 1P9QC 1ZM4A 2I6WA 2PA3A 3E9GA 1WQ7A 4RNNA 1RWXB 4NYZA 3PCOB 3PFEA 2IDLA 4ZIWA 2HNYA 4E7SA 3L2UA 1A6LA 3G8SA 2AZ1A 2GTJA 2OSQA 3ZTRA 1N8RR 4MYTA 1KLMA 4BLGA 3OW2P 1VQ4A 2B51A 2UUWA 3BR8A 4BI8B 2DGQA 3MR5A 2GCXA 4DUTA 1XNRF 4KPYA 5KT6A 3CCTA 4M5DA 4ED2A 3IWXA 5KYUA 2J9EA 4R55A 4DQRA 1Y07A 2H3JA 4YN3B 3K5OA 1B7YB 2HQDA 1JLBA 3MTJA 1N5YA 4RCBA 3SD4A 5KFOA 5IT0A 2A18A 3S6WA 2E3HA 4B3TJ 3JRZA 4NCAA 2FYXA 1RT3A 2UXBJ 1SKSA 3O5TB 4JYAJ 2XIDA 3LH0A 4DFJA 3IR5B 4DV3F 5D78A 1L3UA 5KYWA 4II1A 1WNEA 2P6SA 1KC8T 2DRBA 5I3QA 1N36F 4NLOA 1IKVB 3A8GB 1VISA 2IM0A 2NXNA 2XB2D 2IYGA 3B6BA 2D69A 4MZPA 4TQSA 4L3NA 2ZNZA 2AHJB 3VU3C 2IMOA 4X62F 2M8HA 1IBMJ 2B4VA 2UZAA 4V19J 4HTIA 1RLPC 2XU8A 4GKKF 1SQEA 2EFOA 1U8SA 1RT5B 2J9DE 3REBB 2F1FA 1NPRA 1FD8A 2KGTA 1SI9A 1VS3A 5B0CA 3EICA 4Y34A 2W9BB 5KTQA 4LDUA 2V69A 3X3UA 1Q7YT 1RWMB 2AIRB 1CC7A 1YIJQ 4OJ1A 3OA6A 3OYKA 3RG6A 5KFZA 1NUEA 3KOAA 4C8OA 3JB9D 2HZYA 2FO0A 3PRBA 1N8RU 2GHVC 1OZ3A 4TVRA 3PY8A 3UNGC 5ETNA 3BGLA 1E6VA 2CQ2A 2JNJA 3RBXA 3BR9A 4ZS6A 4ES3A 1CJKA 3CMEA 2ZZTA 1H3DA 4LUEA 2HBPA 3BKTA 3EGNA 3DNCA 1BXNA 1T3OA 1W2BP 2VG6A 4GMKA 2KAFA 4PKCC 3DOKB 4Y2IA 3AY0A 1J27A 1WHJA 1HNVB 3UN2A 2ZBIA 3KK3B 3FQLA 2CUBA 2E1RA 2WBMA 2IIHA 2VKZG 1XMQJ 2ZCFB 4ZVPB 1J5OA 2QQRA 3SQOP 3JB9F 2KVIA 5F8IA 1VQMA 2V0NA 3LAMA 2CJQA 2W7AA 2E1PA 4RW4A 4CO3A 2CGHA 4JZ3A 3FCVA 4LF1A 3OYYA 2JVRA 1YGYA 1VQLA 2Y0SD 3EPGA 1P9YA 4HVZA 4ZGJB 3MEDB 1GMVA 2DMOA 1UFWA 3VZIA 2X4YA 5FLXU 1WF0A 1TTHB 1S7IA 2HEKA 4P71A 3CC2S 1JRIA 5KFGA 2KE9A 1YJ9T 4PAAA 4Q8EA 1FRKA 5M9OA 3EAEA 4KUIA 2GQ2A 1Q82T 2HQIA 5J1EA 2K4YA 1IKXA 1RHKB 2XC9A 1M8MA 1P6TA 3M8RA 2DNNA 2CZ9A 4A8MP 1P92A 4LUBA 2F5KA 2ZPIB 4OJHA 3I0SA 4S0MA 1BK2A 5AE1A 2MSSA 4PFZA 5I2SA 4DMZA 3CXCA 3RB0A 3R2CJ 1G1XA 1YWXA 1VQ8A 2V68A 4K0KJ 2DD8S 4P7VA 2IG0A 3NAHA 5LL6S 4M7DF 2CSIA 3OYDA 3MECA 2G6FX 2BZYA 4TU8A 4J5OA 4C92A 4M75F 3QGHA 3CULA 3GJQB 2C0OA 1RSCA 4DHVA 5JUMA 2RHYA 7FDRA 2FY1A 3OY9A 3RR8A 4DR4J 2L9DA 3T19A 1EX8A 1HQUB 1SH2A 5FU6C 2BANB 2Z56B 5F8JA 2MYSA 1X4AA 3BGUA 3W66A 5H9FK 1Y11A 1UZDA 3DN9A 1NM2A 1GFDA 1K73U 4NCGA 2O9VA 2YQ0A 5T7LA 2MK5A 2ALYB 4F7UB 4XDDA 1R8AA 4DBQA 3H8YA 2HHXA 2G1DA 1YJVA 5CAAA 2E41A 1WUUA 3BO4A 1B7FA 4C8QA 5KFQA 4WF9Q 4LRAA 4JJNK 2UUBJ 1G6BA 1QVPA 4LR8A 3PO4A 2NPFA 1FDBA 2CJKA 2ZGWA 4EYIB 2EKNA 4X4PA 2DISA 3A12A 3C4SA 2OX7A 3ET6B 2G2YA 1N5QA 2E44A 3BO3A 2DNOA 3G6ES 4U7CA 2CQ4A 4OHZA 1T3SA 3OS1A 1Y3JA 2KYMA 2RM4A 2W4PA 5AT1B 4A53A 2CP5A 2HW3A 1JXEA 2YKNA 4DUZF 3WHIA 1RT6A 1JLQA 3V5RA 1SBRA 4H4OB 2GZOA 4C0FA 1U7LA 2XI9A 1ZUKA 2LQWA 4ESRA 2CADA 3JS9A 1JJ2R 4B3SJ 4MFBA 2I5JB 1ZHIA 2AZSA 1IKWA 3RBZA 4Y6IA 3Q2SC 2P2CB 2KU7A 3NOCA 2VICA 1QVGA 3R3TA 3QZ7A 2JNGA 3NHNA 1BUXA 2IVMA 4F26A 4NXNJ 5J1NA 1LFWA 2GQVA 2A36A 3NBPB 2OO4A 2GBQA 4V1Ak 1FTCA 2HK2A 5IHKA 1RT2A 1Y0HA 5LJ5j 3P6YC 2YWFA 5LJ3h 1NDCA 4DA4A 2P9CA 1GCQA 4ZTJA 4F7VA 2Q3PA 2BKDN 2V8DA 1QE1A 1B0VA 4UZCA 4TXSA 2IA6A 2ZHOA 2OTLQ 5DZ7A 2J7WA 3QXEB 1NJIR 4X4NA 3DRPA 3LP0A 2JWNA 1TL3B 1RT7A 1RAGB 2XLKA 4CH0S 2CP6A 5D7UA 4AFFA 4GY5A 1WI8A 1Q78A 1OYEA 3C6UB 3EWGA 3SDEB 3MM6B 1ACMB 3EM1A 5HJYA 5CD4H 2Y1RI 1WC0A 3DDKA 3SWNA 4G1IA 4ZJOA 2BOAA 3JQMA 4DOWA 2CVEA 1YJ7A 3JCMg 3TAQA 1S9GB 1TKZB 3CCST 2JSXA 1E7OA 4I6WA 3IMQJ 3PACA 3GNFB 1I4K1 5ETPA 3RRGA 4ORZA 4R56A 1SSFA 4RWWA 5AXMA 2JXBA 2ZOFA 1X8DA 1S5ZA 2QFIA 3Q89A 3I35A 4NLYA 3I5SA 3AD7C 1M27C 2MKKA 1IZ6A 4QT7A 3GSIA 4JS4A 4RKUE 5FU7B 1VQNT 2J6UA 4HLBA 4WU2A 1JBMA 1NEGA 4LVNP 2LQ8A 3OMCA 2ESWA 2PVOB 2L0AA 3MM8B 2BKPA 1K9AA 1O0PA 1Y71A 2Y90A 3M54A 1OX8A 1DY3A 4U95A 3M2VB 2YNHA 1LW0A 2VZ9A 3C14A 2HHPA 1SG5A 3V4MA 5GAN4 2QFJA 1M3CA 1D1BA 5D0HA 2GFFA 3PVXA 3QPHA 2DNHA 1IR2A 4YUDA 3QJPA 2YKMA 1QVFP 1T03B 3KK2B 2P4RA 4BHQA 4B17A 3LO3A 2ALZA 2DJWA 3M8YA 2QLXA 1JJ2S 3VYGA 3Q22A 4N76A 5K8OA 2GTOA 4J9KA 3WX4A 2YH0A 5DETA 1YSJA 1KC8R 3KDOA 3IFEA 3CCLA 3IS9A 1KD1T 4YHHJ 3X1LB 4JOUA 2XD0A 2J7KA 3CJ0A 1C4AA 4ETXA 2XHCA 1WG1A 3FCHA 3A98A 2KRBA 3GE9A 3T3FA 3QO9A 4LDXA 5LMUF 1FWPA 2MGZA 1T8EA 2ZZNA 1SSHA 1U3OA 1BHNA 1TL7A 2KFNA 4OV1A 2BQ3A 1YBAA 4NZ6A 2E12A 3VGSA 2EKHA 4LDWA 1T02A 3OYLA 1T7PA 3OHAA 4DV1F 2XDPA 1RGVA 4IUVA 1Q7YR 3G6EA 3C15A 3O5ZA 3OJSA 1S0NA 3HP9A 3RUBL 3EGVA 1OULA 1VQ7T 2FB0A 2KT2A 2RRAA 4NMXA 3N5BA 4DR5F 2P6TA 1OX9A 3MWBA 2FVSA 2RN8A 1LV5A 5KYYB 2PU9B 1NYFA 5BXIA 1HNIB 1P8GA 3ZZPA 1FK9B 4EMKA 4FZVA 4M4ZA 2XNQA 1KVJA 3W8GA 3TAMB 2KXFA 4OYOA 4GC6A 3K5MA 1O8BA 5FDLA 1SKWA 4NRUA 3D7SB 1D1UA 2DNZA 4N5SA 2ABLA 2ZJRQ 2HZAA 2B8AA 4DR2J 4DV3J 4J9DA 3C95A 5GAOm 1JXOA 2NSBA 2YNIB 3RU0A 1ABQA 1V5VA 3CDUA 4IG0B 2HD0A 1SUQB 4ECUA 1WJSA 2RHQB 2HVDA 2R2RA 2WSFE 3T1AA 1RWUA 3AFGA 3KLFB 2UUTA 4C92C 3TUPA 5FRMA 4K4SA 1M3BA 3X25B 1S7HA 3M9NB 2M88A 3NY0A 1ARKA 3GILA 4GVBA 3VALA 4N56A 2I8EA 2O9SA 2VKNA 3D6HB 3QYHB 2KFYA 3MOZA 1ZTWA 3CCMT 5HK4A 4J9GA 1Q82R 1SCJB 3NGPA 1RADB 4QIVA 5A0YB 4J9RA 2RMOA 5GMDA 2CH4A 3V6JA 2VG7A 1S0MA 2WB4A 1IXDA 3PYGA 4Q5VA 5I3PA 1FJGF 4C8QC 1YNZA 3GNGA 3QATA 1HARA 2FHKA 2GFUA 3QBYA 3KLVA 1RXOB 4A8XA 3IWNC 3I56T 4AL5A 4WE1B 5LL6d 4YB5A 3KHHA 1Y3KA 1MUZA 4O4GA 1YJWT 4BCAA 3M8QB 4MK7A 3VTIA 1OJ4A 1EQMA 1OQ3A 2H51B 2JC0A 2FDNA 2OFGX 4C0BA 3E9FA 2L3MA 1UJYA 3KFWX 3V6HA 1M1KU 4NLVA 2DXUA 1WC1A 3M1VB 4Y3CA 5C24B 3QWUA 1KEKA 4C0DB 3DLLA 5HN0A 2VFUA 1Y00A 4M5LA 3SCIE 4FPIA 3JYTB 1X6BA 4Q44A 1JLEA 2GMHA 1JU5C 4ZVUB 4HT5A 3WIVA 4XTWA 1RWNB 3JB9J 4Y0FA 5KFMA 2QA2A 1G2BA 5H9FJ 1JLFB 3RAQA 2XI2A 2GHPA 2UXDJ 3PZPA 2ZD1A 2BDPA 1HBNB 4ZTFA 2CQGA 3QJ6A 1ZTTA 2W7PA 2ZE2B 1L3SA 4XU1A 4WCEQ 1GH8A 3OVSA 3RGIA 2ZH4A 3NRBA 3ZZ0A 2VXFA 3HJVA 1NDLA 4C8YA 4M5KA 2FHMA 4JRIA 4F0HA 1QJHA 5KE2A 2AYGA 1JJ2A 2YBVA 1G3SA 3AAWB 1U24A 4DL7A 1ZOTA 2LLZA 3G8QA 3CXCP 1LW2B 2G2OA 3QIPA 2KZZA 2WVCA 1XNIA 3GR0A 1BQNA 2A08A 1UJ0A 1TH7A 5L46A 4RNHA 1WXBA 2EAYA 1LXNA 3RJMB 2B3TB 4IIOA 4JB8B 3UW1A 1ABOA 3L2WA 1W2IA 3PNWC 3S3OA 4I6AA 2YUNA 4DPOA 5F0UA 1HR0F 3R2DJ 3E8OA 3H5XA 1WA7A 2ADBA 4IUPA 3NGUA 4LF6F 4OHYA 3CMAT 3JSYA 4IFVA 3DRXA 4MT1A 1M8VA 1RAJA 3JSRA 3UDVA 1MU2B 2MTLA 4YDXA 2E6NA 1REVA 1KQ1A 4LFAJ 4P9SA 1VBYA 3G4SQ 2J6FA 4GC7A 4DS4A 1PKSA 3V6DB 2HKQB 2MLXA 3CD7A 4AYBD 3JAMY 2E5JA 2KM8C 4BE1A 4OI6A 2K5LA 4TN2A 1YJ9S 2F1LA 1OYXA 3ULHA 1Y5LB 2F5TX 2EKYA 3OL8A 3F0NA 2GQCA 1REGX 3WVDB 4BS2A 4KY3A 1K1ZA 2C3YA 3B54A 1M9SA 2LU1A 4J9QA 4I68A 2MAMA 1FWLA 4LF4J 3I55A 2HAIA 2RQKA 1S77D 4BBYA 2UVVA 2LDMA 5ECAA 3D3BJ 3QLHB 3M0SA 5CA5A 1VQSA 4KHPF 1VYVA 1K4US 1OIAA 1WJRA 2VOOA 1P27B 3GIMA 4EO6A 2UVWA 4NLQA 2NXJA 3TEEA 1QQJA 2ZM6F 1DRZA 2XYGB 1HBUB 4ZP9A 2DO4A 2DVEA 3TR5A 2KEAA 1Q8IA 4E2FB 1FDNA 3K59A 4DCPB 4F4KA 2V8JA 4NYPA 4K11A 1VYUA 4JI4F 2W2QP 3U27A 3ITHB 2KR3A 2YPYA 3TUZC 4C11B 1HKAA 1NJZA 2ZDPA 3K8VA 1VIXA 3CCUT 4M77E 5A2QY 3Q8YA 3I4HX 1VQ5T 3G8TA 8ATCB 1QVGP 1HWLA 3H20A 1VQ6T 2HS0A 4KH1B 4OZ0A 1R0AA 1OPIA 1PKUA 5KT4A 1UVKA 2W4DA 3OTBA 3DDIA 2MKCA 4FVMA 4UF4A 3UQSA 3FBEA 3FEZA 5IC4B 4U67Q 4PL6A 2YHTA 5D6WA 3OYHA 2V2QA 3S3NA 3U02A 3H0HA 3IGNA 1CEZA 5A8RA 4M5MA 2DTHA 4F2RA 5EC7A 4KHRA 1YP5A 1N52B 2HPUA 2CT3A 1OY9A 4PWUA 2EC0A 3Q2TC 1WPYA 1H2UX 1KQKA 4YB1P 2V1QA 1UWBA 1ZUYA 2OSRA 3HRSA 2EW9A 1H0HB 1RTDA 4J9CA 4O44B 4LSNB 5C42A 4X4RA 2DJZA 2GA7A 1X5TA 2HRYA 3NNCA 1UHFA 4OMLA 5DM7R 3FBBA 1BI3A 3BSAA 2XMUA 2DCUB 1WFWA 2WSCE 2YH1A 5CKEA 3OL6A 2Z2LA 3VS6A 1U6ZA 1N48A 1I0CA 3VQSA 3D6FB 1AZEA 2R8KA 3NFCA 1DLOA 1NJWA 1I1JA 3KUFA 2LEAA 3AOBA 2LXUA 2F8MA 4DX5A 4R5PB 1KD1R 3CJRA 4EMKC 2AWZA 2LKZA 4OB1B 3MEEB 1F2HA 1KVIA 4CLFA 3K17A 4BD3A 3CC7Q 3HRUA 4H54A 2XY7A 5KYXB 3HVTB 2FD2A 3PRDA 4RU2A 2LECA 4WYLA 4OX9J 3W2WB 1CJVA 3HHDA 4JP8A 4ZA1A 3ENQA 2Y9HA 1GXLA 3KLEB 3BSNA 3KWMA 1X2KA 2OH2A 2BRLA 3GQCA 3I87A 2MZTA 4YY3J 2YNGB 2XSFA 1JLAB 3O6QA 1RCOB 2R3VA 3TJ8A 1RI0A 2V4JB 2ZH7A 2OI2A 1M5Q1 2CNLB 3JSCA 4DV4F 4RW6A 5EWEA 3M30A 1SJ1A 3LANA 2M52A 2KN4A 2CP0A 4XTXA 2L8DA 1RI7A 3UR3C 1WTFA 1MWQA 3GCWP 4X64F 3UF4A 3LP2A 4I7FA 1LJOA 2HNDB 2XZDB 2C28A 1KG1A 4C98A 1EETB 2H5EA 3CCSS 2R5AA 2R8GA 1TVRB 4EI2A 2C2KB 1O6XA 2MLYA 1X2QA 1VBKA 2K7AA 1YBTA 1T05A 4I6YA 3QGIA 1S1NA 4G6VB 1YJ9A 4I64A 2XQCA 4B9MA 5LJ5h 3C16B 2LMJA 1S1XB 4J7CA 5AXLA 3DC2A 2P4TA 2F8EX 3BGFA 4EWTA 2BVZA 2YUPA 3WQPA 1VQNS 2B5JA 5SZTA 2X35A 2NWMA 1WD6A 2QIFA 4E98A 3D9BA 3G6YA 5J2NA 1QSLA 1JQGA 1ZBXA 1HW9A 3EDQB 2EEYA 2R7TA 3DI6B 5B08A 3M7VA 5F8LA 1U4BA 1T0TV 2DNPA 2XICA 1M5OC 5GAHU 4AMCA 1ZAXA 4QQ6A 3CCJT 1UETA 4PXCA 1UMJA 1HYSA 1YWPA 3SQGB 5J26A 5J2MB 4NL3A 4FM4B 1NH7A 4DV2J 4IOAQ 1NG2A 2ABYA 3GCXP 4ECXA 1RAEB 3SV3A 2F4VJ 3CD6Q 1IRXA 1WDDA 3ER0A 1F9FA 2E29A 3HHKA 4USMA 3FRNA 3EG9A 3QPIA 1I5OB 1PO6A 5KOXA 4HVWA 1ZBTA 1D9AA 5IV4A 5C5JA 1TFWA 3IRXA 1YHQA 1TKXA 3SEMA 1F6TA 1T94A 3HMJG 3LOUA 4MKVA 1B34A 3OYGA 1LOJA 2CZ4A 1U06A 3PW0A 3PW2A 2Y8YA 4OZNA 5LJ3d 4PYAA 2YTCA 1PYTA 2JM8A 2MWOA 1U2RA 2RJZA 3R6LB 4K5SA 4UOCA 4OYBA 1UW4A 1JXVA 2GC8A 1TMMA 4HDGA 1VQ7S 5LMNF 2PO4A 3QKJA 2ZHBA 5ETQA 2GQQA 4XTTA 2E1HA 1NJIC 4KGVB 4JV5F 2M0GB 4MJKA 5FU6B 1NPKA 2VDIA 3GBQA 1N34F 4J9BA 2DH9A 4Q0BA 1G83A 2Z8QA 3I5AA 1O9SA 4KQZA 3POTA 2Z0GA 1K1SA 1BQXA 5K14B 1MSWD 3I9V9 5G0RA 3N6LA 5A8KA 3TQ1A 3VUBA 3TRGA 1EKSA 2XCPA 4ZVQB 5FW9A 2CPZA 3TJ9A 2DF6A 3CJKA 2E1CA 1Q95G 3VZHA 2NUPA 4JI7F 4ECZA 2CYZB 5GAN6 1Q81R 1M90T 5IT9E 2A10A 3MR3A 1VQ4Q 4TNOA 3N5FA 4JI1F 3REAB 4BDZA 3KLGA 1X75C 5DLOA 2MQLA 1N33J 4C92G 4IURA 4UQTA 4PYDA 2NUTB 4X66J 1EAYC 2HHHJ 3RB3A 1Y96A 3SFMA 3Q24A 2BM0A 2MQPA 3ZZZA 2KTQA 3OYAA 4C0HA 2DO3A 4KRWA 4KV8B 2J05A 5IAYA 1UKUA 4O0IA 2KKHA 3UCUP 5AYFA 4HHUA 3J81E 4A4HA 3CEDA 3PHTA 5CZVA 2Y1IA 4DV6J 3MEWA 2EC2A 3CCMS 2HL3A 2QDLA 4PXDA 1OU8A 4CLLA 1DTTB 3H2UB 2IAJA 5CH7B 1PSDA 1JJ2P 3S01A 3FC3A 4HACB 1AZSB 3HHLD 3CCSA 2RD5C 1B0TA 4C8QG 2V26A 3DRRA 1KBRA 4IRCA 2HGNA 4QQGA 2QA4T 2IVFB 5EN1A 2DR8A 5IN1A 4DBHA 4TLRA 2QL7B 4B3RF 1VQ9T 2ERRA 3I56S 2NYSA 4J90A 2O1PA 1YJWS 2JS2A 3DXBA 1NRKA 1R8CA 2HNZB 2DBKA 3OS0A 2JOYA 3GYGA 1XEZA 4IUUA 2JEIA 1DTQB 2YXLA 1RUSA 4A8QA 2UV8A 1KC8C 2CKKA 1S1TB 1CPZA 2DL5A 4A4EA 4W92B 3KJVA 1RHQB 4P6QA 2ILZA 2KXCA 4OMOA 1AEYA 2FJXA 3BDUA 1ZAWA 1VQNA 3FBCA 2NLWA 3QFWA 2HQ3A 2HNYB 1TR0A 2QLWA 1F3FA 3SYZA 3QNWB 3VF0B 4PFOA 4F0KA 3CMEQ 1IR1A 2QYCA 5DG9A 2MZSA 4LF6J 1LWXA 1XOVA 3HPOA 3WC2A 3M6WA 3QRQA 1RE1B 2LJ1A 3M4YA 1T95A 4M5DB 4NZ0A 1D8YA 1Q7YC 3BREA 4EO8A 3ILLA 5KYUB 2GW8A 4AXJA 3TOQA 2Y4YA 2CQCA 4DR6F 4FCYA 3JCMX 1KQGB 3TEHB 1SPKA 2J9DA 2ROEA 1IREB 3A8EA 3TA0A 3NEKA 2Z0WA 2VUBA 1RT3B 1VQMQ 1SQGA 1BI0A 4PKDB 3HLUA 4BE0A 5LXYA 3LGMA 3EGZA 5E0OA 2FEIA 3P96A 5KYWB 1CQNA 1WOOA 4C3LA 1IGUA 3IWLA 1ZQ1A 4ATNA 3DLEA 1VQLQ 1GT8A 4EZ9A 1SB6A 4QWBA 1SRMA 3HL8A 3I9ZA 4RNMA 1JLGA 2YLBA 3T5LA 2OPRA 2XMKA 4OI1A 2C2OB 2JLEA 1HBMA 2BABA 2AMCB 3M53A 4OB0B 4AG1C 4OMNA 4M78F 3CMAS 2QA1A 4LF8F 2MEWA 4DV0F 1S1WA 1SIZA 4DL4A 4Q2MA 2U1AA 4N47A 3KHLA 3LW5E 2UUCF 2KHCA 3FVYA 3MURP 3OUYB 4RR5A 2HEQA 3HO1A 3V7SA 3MTKA 4DQQA 2AGOA 4HXJA 2FVUA 1OSDA 2ZUGA 1VQ7A 5J2QB 2FG0A 5IXBA 4HCBA 5KG2A 3CUNA 3MPYA 4DV5J 1H92A 1ZSZA 4ZP6A 2BOPA 5KYNA 1VQ8Q 4ZGEB 3EG0A 1E6VB 3JTOA 3OSSC 3VGTA 3P49B 3R7SB 3DKMA 1CJKB 3CGIA 3EVOA 1SQFA 3I31A 2HS3A 1WEYA 1EARA 4Q43A 4J9PA 1S4EA 2VG6B 3VGUA 1Q82C 3BV8A 4HH1A 1CSJA 3C46A 2MF2A 4IYQA 4X4QA 2QYZA 2C06A 1YCYA 4OL8A 2BJ8A 2DZCA 1KOOA 1VMBA 1Y10A 2DRMA 4ED6A 3RB6A 3W5XA 9RUBA 5FD1A 3CCRT 3GPAA 1J5OB 2MQMA 3D68A 4M77D 3H90A 5K8NA 1FWKA 3CCUS 2SRCA 1VC5A 1VQ5S 4G1QA 3L42A 1VQ6S 1S9GA 1I81A 4LQ3A 4HVUA 1YRTA 4PXEA 1FXLA 1UTIA 2LP4A 1C2PA 3OYIA 4B9XA 4MKAA 2AEJA 4HI2A 3TVTA 4YS2A 3PM9A 2CJAA 3CCMA 2ASLA 3JCMh 3B4MA 1H7XA 3BYPA 4QVCA 5L39A 2LT1A 2DNMA 4LE9A 3QIIA 1WF1A 1VBZA 4GLMA 1B07A 2K5FA 4RX6A 3I5BA 5J1EB 1K8AT 1IKXB 1X4GA 4MK9A 4ERDA 4LF9J 5KFKA 1UGPB 3T1HF 3NGRA 3N6MA 3K58A 3I0SB 4DPXA 3I56A 1JKHA 1UPMB 1AUSL 1M4ZA 3PKMA 2MQQA 3HPWA 4C5GA 1S10A 1FRIA 3OS2A 3DLGA 3MECB 4C92B 1SL2A 2RE1A 2CXEA 4ZN1A 4URQU 4P75A 1FJCA 1R6YA 2C3UA 3G7ZA 1CULA 2IA0A 1R8PA 3VRZA 5A6WA 1H2TZ 3KK2A 4X4TA 1Q86T 4ED5A 2YKPA 3MPWA 3D1OA 1YJNT 3OYJA 1VQYA 1GTEA 2XGQA 2HFNA 2W2PP 2RT3A 1SV5A 2LJ0A 2QL5B 1G3TA 4NCGB 5T7LB 2EG1A 3NP5A 1GAOA 2HLUA 2QGFB 2UVUA 1QUPA 2AU0A 1QAYA 2O67A 4C8QB 2FTRA 1TAUA 1JXLA 1H72C 4Z37A 1YX2A 5KFBA 1J5EJ 3AD9C 2VFRA 2ZPEB 2VXEA 3LALA 1WKKA 3V81A 3OTDA 5E3RA 4ICLB 3FRYA 2CQ1A 1RB0A 1VI7A 3MP8A 1OZ2A 2M1HA 4ZP8A 5D4PA 4FIBA 3M8ZA 1JK9B 5E3AA 2AKWB 1FWZA 2ED1A 1I6JA 2OMLA 1DJ7B 2YKNB 4L73A 2YUOA 4ELYC 3PX0A 1RT6B 4C8LA 1ICEB 2Y0BB 4DQSA 3OB9A 5GJVB 4RNOA 5KG6A 1UEUA 3CC2Q 3QHSA 2QLBB 4LF5F 4DL5A 2OTLT 3CMAA 2AGQA 4CT9A 4MFBB 2FLPA 2VA2A 3NMRA 3A3NB 1Z4UA 1S4FA 2Y1LB 4A47A 1UE9A 3Q1JA 4B02A 3CD0A 3MP1A 4LSLA 1M90R 2J0WA 1IBKJ 4L72B 4Y2MA 1XWLA 1VQOT 3H5SA 4Z7CA 5KFJA 2E7XA 2QQAA 3P5BP 4PJOE 2ZH9A 2RRNA 1VDHA 5B0DA 4UY85 1RT2B 4C9DA 5HANA 2DL3A 2BYCA 4ZHRA 4F7UF 2CP3A 3M56A 4OQJA 5F8MA 1Y0MA 4FSSA 1QE1B 4ILRA 2B9YA 2K3IA 3HD2A 3KKFA 3SXLA 2GFAA 2E5IA 4CO2A 4M5HA 1FDAA 2H54B 3C94A 3GP9A 2XBPA 3DRPB 3LP0B 4RJVA 2XK0A 2FJEB 5GMKh 4CLZA 1RT7B 1CVJA 2D3OR 1NDKA 3LQVA 4LVOP 2IYIA 3QYGB 1H6KX 2IM3A 2YNFA 4O3RA 5IQQA 4NA2A 4J91A 3SDZA 3CCJS 2A6MA 4I67A 3TYTA 2VYTA 3KJNB 3TUIC 3IBCB 1JWWA 3I32A 4UC4A 2F2XA 4LBPA 1Q8KA 2BE2B 3CCUA 1F5AA 2LQNA 3JB9H 1OY6A 4E0DA 1VQ5A 2O88A 4U8YA 1FFGB 2VDHA 2V2VA 4Z2XA 4XAKA 1VQ6A 5I22A 2LTOA 3DLKA 3FLGA 3SSSA 2KM8B 2MZJA 5I2MA 3PVQA 3URGA 4FPRA 3GFHA 2YUQA 2FHJD 2AD9A 4CLWA 3PW7A 2PFFB 3G6EQ 3LF0A 3H42A 2KI2A 5K8MA 3TI0A 4ZKAA 1KD1C 2IBKA 5GMKm 3GWCA 2KL8A 4OIXA 4DFKA 3UATA 5GAEI 2LNVA 3FB9A 4BB7A 1VR6A 3DB4A 2M8DB 1KQSR 4K4TA 4JI1J 4NEZA 1E6YA 3UI3A 2HQCA 2PDAA 3TVZA 3JYTA 3INZA 2ZBQA 2QDYB 1MMNA 2XS5A 1ROFA 1KRPA 1YBYA 2E5GA 2OPSB 4LF7J 2YNHB 1LW0B 3FC9A 2HURA 1IBCB 2PMHA 3W8PA 5ETMA 1NK4A 2A3LA 3C14B 2WSEE 3ZTSA 1WXUA 2ZJQQ 3DMJA 4FKXA 3Q23A 4PUOA 2YKMB 2JTFA 1U09A 2ZE2A 2CZ6B 4WKRA 1RKJA 1JLCB 3N6NA 3TSZA 4DU8A 1ZSZC 4WFXA 5GAMe 3BBFA 1XN9A 2OMOA 5HQ8A 2KO1A 3KFVA 4CO4A 2NQPA 3IS9B 5CD4A 2YVSA 5GAEU 1RU1A 3MAAA 3BKFA 4OZ2A 2YKQA 5DQGA 3QO9B 4JPBW 1IUJA 2JT4A 2DHXA 1QW1A 3RKXA 3H25A 4DR1F 2MGZB 4ILLA 4JV2A 2HWTA 4JI6F 5LJ5d 2AEFA 4XO0A 4OJGA 1TL7B 2EFGA 4JI2J 1QAJA 1RAHB 3D0IE 3EH1A 1S9EB 1NHVA 4KHMA 1MWYA 1R8BA 4GLKA 3NL0A 2D9OA 5KFUA 4JZ4A 3C15B 2B4OA 2D9TA 2R7UA 1XR5A 2XDDA 1MU2A 5CQYA 3RR7A 5KT5A 4MK8A 3DLHA 2UUAJ 2ACMA 2FPEA 5KFSA 4AG2C 3ADAC 4Y2KA 3R5BA 1N32F 3TAPA 3N5BB 3SBMA 2HHUA 1K1QA 1YN8A 3QJJA 4ED4A 1YDLA 4WXOA 2WW4A 3PV8A 2U2FA 3E19A 4G1PA 1KN6A 1QDUB 1C6VX 1WSVA 2WW8A 3EG2A 2FPDA 2QA4S 2MZ1A 1RL2A 3HRTA 2HSEB 3T41A 2IRYA 1VQ9S 4JI0J 2PVGB 1YRUA 3DLLQ 2W2MP 3LWMA 1VJWA 4CZCA 2POKA 3QLHA 5FDLB 5HLFA 1MLAA 4W98A 2BR0A 3N9UC 2F65A 1JMTA 1BD6A 3IN5A 4M5GA 3QBCA 3MMAA 2ZWOA 3H59A 2E5LF 3KLHA 2EGCA 2G2ZA 1LWCA 1N9SA 4IO1A 4XDCA 3MOJB 4U6PA 2ZOGA 3GSDA 1YBUA 4I69A 1FKPA 4AT1B 4NI2A 2K3XA 5F3TA 1KQSS 2XS2A 3AB4B 2Z2YB 3VWSA 5GAMf 1RWWB 5FJ4A 1NZ8A 5KG1A 3VS3A 4GVBB 5ETKA 2J9CA 1IBLF 5EWGA 4DV0J 2XY5A 2DD4A 3CE8A 3KUEA 3CCJA 4M7DE 2L08A 3EGXA 3RKWA 4M75E 3OXGA 2K06A 4OZLA 3AXMA 3FQKA 5E3PA 5B0FA 2EPDA 3LA0A 3CWJA 4L76A 5DDQC 4XTVA 1K8AR 3CBOA 2OEMA 2DT9A 4ZVFA 2NREA 2DZ9A 2P9EA 2DLPA 2JL9A 2VG7B 1KTQA 2PA8D 1HL6A 3EZ5A 3LGHA 3G9CA 3RRKA 3MPVA 2DVIA 3KK1A 3G4SA 1HLWA 2KY9A 3EGUA 5IM0A 4O4GB 4F3QA 1HNXF 3DRSB 2ZPBB 1X60A 4MIWA 3AHUA 2J6TA 1HD1A 2EFNA 2CG4A 2PI5A 2BM1A 3F41A 4ID5A 3MPDA 1M30A 3CT9A 3NTHA 2L3QA 1RT4B 3DXSX 2EYQA 1JLEB 4IKFA 4OP0A 4MKYA 1N5VA 2V2ZA 2DETA 3R7BB 2VC0A 1X4HA 2LFVA 1VUBA 3QSYB 2QN6B 1X4BA 4OZJA 1S12A 2UU9J 1ZUUA 3QT5A 2V8IA 3FCWA 2QQBA 4OI4A 5GAN3 2MKSA 2LCSA 3FZ2A 1KIKA 4AQYF 4JI3J 4KJIA 4CIOA 3QYYA 2KVQE 2VBZA 3OFGA 2HKNA 4TY9A 2R7XA 3TU4K 1AZGB 2K2VA 4KBMB 3QIPB 2DEUA 2VASA 1BQNB 4ME7A 1RKIA 2QXFA 3HXMA 3UN5A 2YRDA 2DEIA 1S0OA 4QIFA 2BACA 1C4CA 3FZBA 2RUGA 4WK1A 5BYRA 3CCRS 2OD6A 3DLJA 1D0ZA 1B0PA 2VPXB 3TZXA 3VKIA 1VLYA 4KIAA 4FW2A 3G71T 1TK0A 2VPWB 3W9HA 1RTJA 2RSQA 5F9NA 1MV0B 3ICLA 4X65J 2GGRA 3L2ZA 1D0EA 3SEOA 1EETA 3NS7B 4IFVB 2LA6A 4FBTA 3L7OA 4RKUC 1ZA2B 1REVB 2B43A 2WACA 4RTZA 4H4KA 1K9MT 3BPSP 2COLA 3A3PB 1FNOA 1HWJA 1U6FA 2CQBA 1PAUB 3CCVA 2NYHA 4F4WA 1HJDA 4RWXA 1PIEA 3C6TA 2DJQA 2C1EB 4LXCA 3NTIA 2HVIA 2QX0A 4C8NA 1RA7A 2NUHA 1U2CA 4ELTA 2VQEF 4EUVA 2OIHA 4TU9A 3EZOA 4M77A 4DR3J 3GV7B 1WTBA 3FJPA 2QSFA 2DK3A 2QA4A 3CJTA 3CDEA 3DB3A 4QYRA 4DEXA 4EYHB 4FNHA 2O31A 4FKYA 3A8IA 4NYOA 5HMYA 1IKYB 2CPEA 3QSIA 1UECA 5DZ6A 3TNVA 1RAIB 3CC4T 1DZ5A 4H4MB 3RBBB 3MFHA 2QK0A 3ZO7A 2DAQA 2X1FA 3OTOF 3THVA 4AUKA 2GO9A 4NS5A 1S1UA 2VBWA 2K7KA 1UA0A 2H5JB 2E70A 2HZVA 2DRAA 3GG1A 1BWEA 1RA6A 1PRLC 3BBBA 5A76A 1YJNS 1DURA 3TZYA 1KQSA 4FF1A 3AOCA 3MUTP 1R0AB 2GO8A 2V8PA 4LD6A 1U02A 5DG7A 4EMDA 3QWPA 2CPDA 4LF5J 1PD1A 5F0WA 3KMSA 2K5IA 4YQWA 5GAOr 1QCNA 2CRLA 4L75A 2DD5A 1X27A 3M0RA 5KG3A 4MDWA 3TSWA 1NK9A 3ZC4A 1N0VC 4L3KA 1N88A 5GAOp 4BI4A 5I21A 4U96A 3GIKA 2DNLA 5BYQA 2HSPA 5I4MA 1UWBB 2FUG9 1AUDA 4PFPA 5GMKa 2LZ6B 2AKLA 1FVSA 3ZZOA 1RTDB 3J7AN 1O51A 3UA7A 3X28B 5RUBA 2R7OA 4HKEA 2Z57B 1SVDA 1NLPC 3AJ2A 3AA9A 1FRXA 2QT7A 2W4CA 2QJ3A 3F56A 3FRZA 2GVDA 3IAS9 2N4CA 1D0XA 4EBEA 4QW2A 1S6PA 5D77A 2W2NP 3D66A 1YJ9Q 5HMZA 3C8YA 1UVNA 2OTLS 5D0EA 4N0AC 1DHMA 1Q16B 3P8DA 1DLOB 1KNZA 2UXCF 2O01E 1K47A 2VG5B 2RQMA 1G3OA 4LDVA 4J9OA 2PFDA 4J9LA 3TARA 5GANe 2WSFC 3W62A 4OMFG 2CWKA 4C2MA 2ZH2A 1VIFA 1VQOS 2LJ3A 1TWBA 4PJOD 3OL9A 3M57A 2HZCA 3N4WA 2CPHA 4RW7A 3PEJA 1CJVB 5E3CA 1F5CA 4FBUA 4AE5A 4ZN3A 3JCMd 3V4IA 1JIHA 4LNPA 4DFMA 3SCLE 2CA9A 2QMXA 5L8RE 2H3EB 2WTFA 1WI7A 2UV8G 2MZRA 2PUKB 2L3PA 1RLDA 2L2PA 5EGYA 2CPXA 3TVKA 3L7PA 5L23A 1CQMA 4AFQC 4LRDA 4WBFA 3CJQA 4ZPWR 3M30B 3OQ5A 4DBRA 1VHFA 3E51A 3HHLC 2JZ2A 4LSZB 3SMZA 2QTVA 5C6SA 4USUA 5JVGQ 1TS9A 4XU2A 3LP2B 3CCRA 4LFBF 4I7FB 4EK2A 1MW7A 4K2XA 3SHWA 3WXMB 4UW2A 2ROTA 2MPUA 2V4QA 2DBBA 2KQWA 4CC3A 1DTTA 1R89A 5LM7E 1LCKA 1MMLA 4QR1A 2DX1A 1AZSA 1GL5A 5AJ3J 2M0OA 4PG4A 3ETMA 3I5RA 3M0TA 2BW7A 1SH3A 1KWMA 1C0UA 1T05B 4EPCA 4ZPAA 5AE3A 1M2OA 5CR2A 3O8VA 1F2GA 4DV7J 1ZETA 1NZAA 3OYEA 3K7RA 4PPDA 2K3BA 3MPUB 2ZOMA 2LDYA 5EDWA 3MUVP 2HNZA 4WJBA 1AWWA 4KBIA 3HX9A 3UWTA 2HHTA 2J76E 3TW0A 3CCET 2B5JB 1GBRA 3PG9A 1S1TA 4DF8A 3BH7B 1GFCA 5J2NB 3H98A 1M5KC 3AB2B 4F3MA 2XMWA 1K0SA 1IM4A 4KO0A 4OMQA 2QZ8A 5LJ5e 4GO5X 3KHRA 2WVDA 2XMTA 1X7VA 2OEJA 5B0GA 4RTVA 3NLCA 1FI4A 2LEPA 2FHJA 2DTJA 4IOBA 4ES1A 1IWAA 2FZCB 2I9SA 3SZ2A 1X9MA 3QT7A 4WFBQ 3GJRB 5GANf 4DCJB 3KTQA 1RLQC 3C19A 2L9NA 3MKDA 1HYSB 2ZEJA 2AEMA 4FT2A 1Q0NA 1GQEA 2YDLA 1N5ZA 2RJFA 2EPIA 3J7YI 2RB6A 4LDYA 3OS5A 2H4YB 3W60A 5B7WA 1YJNA 2FC9A 3QJYA 1D8ZA 3T5JA 5DO2A 3EG9B 1HHSA 1JEGA 1M0SA 2KH9A 2A6OA 2QYGA 3IRXB 4F02A 1TKXB 1HW8A 3NMZC 4LMZA 2MDAA 2N7CA 4X34A 2FLOA 5BJRA 5CK9A 1B34B 1QP2A 2EQUA 4PWDA 3OD2A 5GAOn 4M63A 2ZVIA 1M90C 4JLIA 3FNNA 1LFPA 1I51B 4GKJF 1R3NA 1T9TA 4LBIA 2BZ8A 5HMXA 2D41A 4U9RA 2GQIA 1HXDA 5DLFA 1PYOB 2D7SA 1M2VA 2CPIA 3MMCA 3UDEA 3KMQA 2AJ1A 3CCSQ 4ELVA 4CLYA 3KJFB 4LD9K 2YXYA 4WIQA 1RHRB 4C4WA 3MAQA 2V63A 3HT3A 3OUYA 3C12A 3RW7A 4RLEA 4P7TA 1UVMA 2C3PA 3QZ9B 1BLUA 3J7YU 4H4KC 2COYA 3W64A 5J2QA 2X7IA 5KFCA 3VJPA 2DXFA 2DGTA 4Q0BB 1VGYA 1NK0A 4F04B 3POTB 4FN5A 1VQNQ 5G0RB 1NZ9A 1H7WA 4W4MA 2DR7A 4HYKA 5A8KB 4DBFA 2CZ7B 5H9EK 2MYFA 2VL1A 3TVYA 4M77C 5D3GA 1Z2ZA 4E47A 1H98A 3CJKB 2VWFA 4R0KA 2HQEA 3AH6A 2DHAA 2NUPB 1LPLA 1VQOA 3Q8UA 2RK1A 1U8WA 3I9QA 5MLCV 4BE2A 2R7QA 1KJWA 1OO0B 3CJ2A 1N0UA 4JI5F 4J9FA 4E6RA 4XTZA 3KLGB 3RW6A 1FXRA 5EX0A 2EVRA 4XK8E 1FHTA 3T6JA 4LRCA 5DM7Q 1GK8A 1JJHA 4KT0E 2C3MA 2X51A 1VHIA 1Y96B 1K9MR 5KFPA 4NXMF 5FLXE 2VGNA 3L95X 1U1PA 1IB8A 2JHEA 3L09A 5D6XA 1E6HA 2E9ZA 4M7DD 3D4JA 5GMEA 4OHWA 1OU9A 4M75D 3OW2S 3LWHA 3U1NA 3ZTOA 2EWHA 2IAJB 4X84A 1BCMA 4ED7A 4RBUA 2BA9A 3WX8A 2ROLA 3HTRA 1Q4RA 4CO5A 2WSCC 3DRRB 3K57A 5CIUA 4OMFB 3BZQA 2CZ0B 2B86A 1VQPT 5I3UA 1WHVA 4ZPBA 1I94J 1HSQA 1ZH5A 1UAWA 1GX6A 4JRKA 4FS2A 4JJDA 5IT4A 4DL0C 4KRTA 4DI6A 3HM9A 5IS2A 2PN6A 2EYYA 1ZSGA 2DGXA 2C2RA 1L3KA 3JAMU 4ZLPA 2P0PA 3IXQA 5D4NA 4QQBA 2AK5A 1VQ7Q 2RUSA 1WHWA 3KJVB 1FXXA 1KOHA 2YKOA 3IBFB 3AT1B 4VUBA 1WC5A 1WACA 2YY3A 2C0TA 3H7HB 2WK4A 1HNZJ 3RYLA 3BEGB 3CW2C 4OMMA 3GYXB 4U7UD 4DEZA 2C2EA 1XIQA 2EWNA 3V7RA 3NAIA 1LNXA 3IQLA 1TG0A 3M9OB 4RUHA 2HBRB 1UA1A 3M59A 1QWFA 1YRXA 4L74A 5HSPA 3DHXA 3UD3P 1D0YA 4F8RA 1SJFA 1T9UA 2L89A 5ETRA 3PJXA 4OYWA 4IR1A 4YEAA 2O3DA 4MMLA 5A2QU 2BBEA 3EXCX 4XU3A 5GJWB 1LNQA 5GVQA 2PIIA 1BB9A 1XNQJ 5DJBA 4ICLA 3CCQT 1D09B 1D3WA 3B8HA 2RF2A 3M55A 4F67A 3DLEB 4LFCF 4BDYA 5EX3A 3OTCA 9ATCB 1JLGB 1VRUA 1FESA 3JCMb 4QIGA 3VS7A 1IJFB 2OPRB 2QTXA 4R0JA 3M5AA 3DCAA 3G71S 5I42A 4FVCA 2C2ZB 2EQKA 3CCMQ 5GAMg 1HBMB 4C5EA 3D6TB 3GLJA 1CJTA 3KDNA 3FJ2A 1VCTA 2HS4A 5E7OB 2QASA 1QAIA 1HNWJ 2H4WB 2KT8A 1BGXT 1TUCA 1S1WB 3J80U 3ULRB 3OYFA 3RDVA 2VGMA 1Q7LB 2MCNA 1SPBP 1NSPA 4KSEB 3OLAA 1X4DA 2MQ8A 3I56Q 2MMPA 2JEJA 2LC4A 4ECVA 1NM7A 2MQOA 2EYXA 1ZSZB 1RK8A 1SC3B 1YJWQ 4MZTA 2R8HA 3EZUA 4NRTA 2ED0A 2ZDOA 3TP2A 3FK4A 2QGGA 1WC6A 2PE8A 5CCMA 4P10A 2DRKA 2FPHX 2VPZB 1N6QA 4UOGA 1X0FA 2EIFA 4EBDA 3PJWA 4X4OA 1K8AC 4WPAA 4ANJA 2X4XA 1H3ZA 3NCRA 2ZZDA 5DLGA 3R1LA 2GF7A 2OP5A 2QEXT 3BSCA 3JB9I 1ZZFA 2RI5A 2E7WA 5ETTA 2J6OA 3GR1A 3T6BA 2AX1A 4ATOA 3CC4S 1NSKL 3CEYA 2AJFE 3QGPA 4CRJA 4C0OC 4A8KA 3QO3A 1HFEL 3J81Y 1JNZB 4NLDA 1OYDA 2DE0X 4U7UK 1I5LA 2BE2A 4G1QB 2CYYA 3VAJA 2KJWA 2X4JA 4PG6A 4FL6A 2KJVA 3OT9A 4ELZC 3AJ1A 4DUYJ 4O3QA 1SL1A 1AA1B 1NEEA 2JTEA 3CJSA 4EMHA 1ULRA 3EJMA 5GAN2 4I1TA 4N77A 2R57A 1Q86C 2YWHA 1F9EB 2HBQB 3EHRA 4MZMA 2MWPA 2J6SA 5KFIA 2ZJPQ 5J39A 4B3TF 2B4PA 4NPOA 4EGLA 1R43A 1SC4B 4YFUA 4A8SA 1FFSB 3CC2A 5D6GA 2UXBF 3JB9k 2NR0A 1YQHA 4JYAF 3OR2A 4K4XA 3IO1A 3HI9A 3WBZA 4ZVHA 4OF1A 2RA2A 4AD6A 1GMWA 1CSKA 3CMAQ 2NZCA 1NK8A 4DR7J 1JKHB 1IBMF 4CLTA 3DDNA 2W25A 4C8ZA 2OPSA 3BF4A 2OHDA 1BMQB 4YR3A 1VRQC 3DLGB 3MD3A 5HCKA 4J8OA 2FYKA 4X1VA 1NJIU 2BRKA 1FF2A 5HK0A 4QQDA 2Z30B 2WOMA 1CULB 4J9EA 1G3WA 1QCOA 2YX7A 2KK4A 1SJQA 1QVFR 1JLCA 1IGQA 3KBGA 4ZOSA 3MD1A 3GU0A 2OFHX 4ELUA 3K2YA 1SV5B 4ZCKA 2AYEA 2VQFJ 2C0IA 3M2UA 3I0RA 2VC8A 3RNJA 3CNQP 4PQAA 1N8RT 5EG2A 2ATCB 4BWMA 5A0GA 4ER8A 2EW3A 2QI2A 4OGCA 1R0CB 4CC7A 4K50A 1BU1A 4KB7A 4P2XA 1TL1A 2WVBA 4DCOB 4EEYA 1FRLA 2D0QB 4JI8J 3FEXB 4J7IA 2BJEA 2DPIA 3JSMA 1APSA 2D1CA 1X4EA 2DIVA 3MO8A 1WF2A 4IDKA 4NLRA 2XM3A 5KFNA 4IO9Q 3V81B 3CCUQ 1S9EA 5IXUA 3PFOA 2K6DA 1XMQF 2JRSA 2KT5A 2O66A 1VQ5Q 1HD3A 3DKDA 1VQ6Q 1B64A 3H2VE 1RQ0A 3KHGA 2SXLA 2FPFA 3LWIA 4PR6A 4PJOA 1ELOA 4ANCA 4AFSC 4O3NA 2R7WA 4OLPA 3A8JA 4JS5A 1WIEA 3DRYA 1JB0E 4WP3A 2HVHA 1HQEA 4LRFA 2FZKB 2XKOC 3G71A 4LQ9A 2HKEA 4HTJA 3VHQA 4QZVB 4NA3A 3M0QA 1X5SA 4M8LA 1UFFA 3TREA 1A7GE 4C92F 2NCKL 1XTZA 3H8ZA 1XNRJ 2RI3A 1JJCB 3QZ5B 2RNAA 2J8SA 1H38A 1G4CA 2K7JA 1IHWA 5H9EJ 2DYBA 3W5ZA 1JO8A 4DJBA 2LEBA 3GB0A 4LSLB 2DYAA 2VKRA 3H5UA 3TZZA 2OD4A 1SC6A 3THTA 3CCLT 4MIAA 2BJ7A 4MKBA 1DQ8A 3OTEA 4URSA 4RO0A 2E9TA 2OTJT 1NJYA 5KE3A 4K4YA 4WTOB 1FDDA 4ZHRB 4NE9C 5CYMA 3CCES 1KC8U 3M8SA 1ZS6A 1FYNA 3K5NA 4USHA 4C8QF 1OS5A 1N36J 2KROA 3M05A 3K8WA 4DX6A 4K0KF 4AFUC 4IG3B 2HIQA 1R8OB 3G2XA 5CABA 5HP1A 4RBVA 4X62J 2J7IA 1I3OB 1CS4A 2VBYA 4GKKJ 1YI2T 3MEGA 2YNFB 3JV3A 1TL5A 1CJUA 2EK1A 5SUHA 2CDQA 3THKA 3Q8RB 2R58A 2QMWA 4B3OA 1G2EA 1Q53A 5BYSA 3CC4A 2RVJA 4DR4F 4W90B 1Q7YU 3HF5A 4OB3B 3MM7A 3VAHA 2BZXA 2XSJA 1UJ5A 4QPXA 4V2SA 4RL1A 3W3SA 1HYOA 2B9EA 3UE2A 2IMWP 1VYTA 2HQGA 4UTGA 1QVFS 1KKHA 1BY9A 1F1BB 3DLKB 4CI0C 1K73T 4PXBA 1Y4ZB 2F9JA 4M7AE 2OLWA 2VBXA 5HATA 3LW5C 2DNYA 3KG0A 3GZ7A 2JLFA 1PRMC 1PG5B 1RTIA 1VQKT 3CTRA 1G5VA 1NPPA 3UDLA 2KDOA 3DRSA 3BDPA 2MY7A 1LWEA 3E2UA 5DLQE 1XJWB 2RS2A 3QIDA 3DLMA 2VJUA 3OBYA 3HVRA 3B82A 2XCAA 2FJVA 3MR2A 2CS7A 1RTHB 1E6YB 2DXEA 2E4HA 1RT4A 2FLLA 3GLXA 1KSWA 3HHNB 4A4FA 4DZ6A 1YJUA 3GIRA 1S72T 1S57A 1LXJA 5J2PA 2LQJA 2CZVC 3GPLA 2EQMA 3AA8A 1GTHA 4J9VA 3DYAA 3UFCX 5DGBA 2I0XA 3BS9A 4B3SF 2I38A 3DMJB 4L5GA 4PUOB 4TYAA 1RACB 1HI8A 4E7IA 1K0TA 4M78E 4KTQA 1DFDA 2D3ZA 2V9KA 2CNOB 4QW9A 3M4GA 3U1LA 3HZEA 1T0JA 2HHVA 2KXHA 4M77G 4WZMA 3VQTA 1SEMA 3PGGA 1PNJA 3EG3A 2QA4G 4PG8A 4QU6A 1BIBA 1Q82U 2Y8WA 3P8BB 1KSPA 4ZITA 4ZVGA 3MAAB 2HRTA 2CUDA 1C1CA 2YX4A 1EJ7L 2K1RA 3MUMP 4URGA 1WHLA 4QIEA 2KT1A 4I2QB 3EYZA 2KHDA 1N9RA 3CCJQ 2MB0B 4QBUA 2JTMA 4K2JA 2SEMA 3FSXA 5U47A 8RUCA 4NCBA 5GANg 4R25A 4QYZK 3DHWC 3E1SA 3D6MB 4KAIA 4K4UA 3GIIA 4E7ZA 5KG0A 2L3RA 3PO5A 1EQ0A 2PC6A 4DL3A 1NAQA 4NLSA 2FRYA 2J8AA 2YWKA 4X9DA 1BKBA 4HCCA 5HAOA 3Q8PB 3ONQA 4ZPTR 2WBRA 5HROA 2O4XA 1GXUA 1RABB 3QFHA 2M9UA </