4ZN3A

Crystal structure of mjspt4:spt5 complex conformation b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
147
Chain Sequence
MIFAVRTMVGQEKNIAGLMASRAEKEQLDVYSILASESLKGYVLVEAETKGDVEELIKGMPRVRGIVPGTIAIEEIEPLLTPKKIIENIEKGDVVEIIAGPFKGERAKVIRVDKHKEEVTLELENAAVPIPITLPVEGVKIVSKHKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Transcription
molecule keywords Transcription elongation factor Spt5
total genus 33
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zn3A02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 4zn3A01
1M1KC 1KQSA 3TREA 3CMEA 1VQ9T 1YJNT 2OTLT 5J26A 4YTLA 1IZ6A 1BKBA 3CMAA 1Q86U 1M90U 1JJ2A 1VQ5A 2MWOA 5DM7R 2E70A 3KBGA 1K73U 2EXUA 3JAME 3I55A 3CXCA 2DO3A 3OYYA 5IT9E 1VQNA 3QQCD 1VQOT 2MWPA 1S72A 2JVVA 2MI6A 1YBYA 5FLXE 1Q81C 1VQLA 3CCET 3P8BB 3OW2A 3CCVT 4CRIA 3PIOA 1W2BS 5A2QE 3CCRT 3CMAT 1SSFA 2QEXT 1VQ4T 1XTDA 3H7HB 2KDSA 1Q82C 2L3RA 1VQ4A 2OTLA 1YIJT 1YITA 1M1KU 1K9MC 3CCRA 3OW2S 3ER0A 2E6ZA 1VQ7T 1KQSS 3CC2A 3CCUA 2EIFA 3DB4A 3CCJT 1VQ7A 1Q7YC 3EWGA 1KHIA 3CPFA 1NZ8A 3CC7A 3G71A 3J81E 1KD1C 3I56T 2JUFA 1NZ9A 1VQMT 1YI2T 3CD6T 3CCQT 1Q82U 1YJWT 1VQKA 3LGLA 2OTJT 2CKKA 3CD6A 1VQ6T 4RG2A 3CC4T 1RL2A 3I56A 3CPWS 1VQMA 1Q81U 3CCLA 2KVQG 3CC7T 1NJIU 3CMET 3G6ET 1VQ8T 3DLLA 1VQPT 1QVGS 5DLQE 1Q7YU 1QVFS 1X6OA 2LCLA 3CC4A 1K8AC 3G4SA 2LVMA 3CCMA 1YHQA 3A5ZB 1VQ5T 1YJ9T 3CCQA 1KC8C 1VQPA 4TVRA 1YITT 1KD1U 1M1GA 1K9MU 3LH0A 4QQDA 1YIJA 5HY6A 3CCLT 1XNIA 1QVGA 3CCST 1W2BA 1YJNA 1N8RU 1K8AU 3HKSA 1VQ9A 2QEXA 1NPPA 1YJWA 3CCJA 2IG0A 1NJIC 3J7AF 3CCMT 1YHQT 1VQLT 1YI2A 3CC2T 2XHCA 3CCVA 1S72T 3G6EA 1VQ8A 1VQOA 1VQNT 2QA4T 1UEBA 4ZN3A 3CCUT 3DB3A 1VQKT 1VQ6A 2JNGA 5LL6S 3LGFA 3PIPA 5J3BA 2OTJA 1N8RC 1Q86C 5IAYA 3CCEA 1JJ2S 3LPEA 3CCSA 2QA4A 1M90C 1K73C 2OUGA 1M1HA 1QVFA 2LQ8A 4ZN1A 3CXCS 1KC8U 2G3RA 3G71T 1YJ9A 2JOYA 1EIFA 4X34A 3CPWA 2K06A 3I55T 1NPRA 3G4ST 3J80E
chains in the Genus database with same CATH superfamily
5F8HA 2F69A 3G82B 3RKYA 2DEJA 3CC4Q 3JCMX 3HT3A 2DTHA 2MB0B 4R8UB 4Q43A 2BM0A 4YP3A 4MMOA 2KAFA 4MDXA 4DFJA 1JKHA 2KDOA 3L9ZA 3FRZA 3PYGA 5D0GA 1TFYA 4IIOA 2QE5A 2WB1D 2Z8QA 1KTQA 2E1MC 4OI3A 2F5TX 1SC4B 1CJKB 2HVHA 2R4FA 4EMDA 4A4JA 1UGSB 3JTOA 1XMQF 2Y1JA 2IY5B 4C97A 4KGKA 1PAUB 2PO4A 2YQ0A 2CS7A 3AFGA 2ZM6J 4BUGA 2DNOA 5ETSA 2WOMB 4M7AB 3LGLA 3FUYA 2BJ1A 4LN2A 2QN6B 1H72C 3O2IA 3W5XA 2JWNA 3MM5B 3HSBA 1JLAA 1QSLA 1OX9A 5THWA 1WKJA 1OX8A 2D9PA 1VQPA 2XI3A 1C2PA 2LXFA 3SDEA 4CLYA 4N56A 3R5CA 2X1FA 1DAXA 5GAMe 2ZZMA 4B3OB 2BJ3A 1TMMA 1RT3A 5A0DA 3EHRA 4L75A 2GQIA 5B0CA 1GFDA 3MCMA 1MWQA 2MCNA 1Z2LA 1RABB 3IAM9 2FY1A 1FWLA 5GAGU 2XMJA 3G71T 4ECUA 2QSFA 4O4GA 2X4WA 1NXIA 2YWKA 4JV5J 2DKGA 4MMLA 3GNGA 5FU6B 1M0SA 5F41A 2UUCJ 2EQUA 1VUBA 3K0JA 1VQOS 2RD5C 2L8DA 2AWZA 4J9LA 3HHLC 4RBTA 1X60A 2Y8YA 1VQSA 2MYSA 1D9AA 2CPIA 3P8BB 2F8MA 3CO0P 3TJ9A 2IIMA 2HHWA 4A8XA 1S72S 5LSOA 1WJQA 1CSJA 4FZVA 1QVPA 1KQSS 2DIGA 3NRBA 2I1RA 1M9SA 4QWBA 1WOPA 4K59A 4HH1A 2R7XA 4YN3B 3QJYA 2RQMA 4O44B 3L7UA 2GIRA 2RVJA 5IV3A 1KS2A 1KN6A 1QVFS 1X6OA 2LCLA 2KXNB 4DV0F 4KRWA 2K2PA 4XU3A 4NLWA 2MHNA 3DFEA 1I81A 2L5QA 1Q86R 1PWTA 2W4DA 2BE7D 3VRYA 2DGOA 3DRSA 3QIPA 2AZ3A 3P45B 4O3NA 4L73A 1JLBB 5G0RB 2NPFA 1HYSA 2E5IA 3T6JA 2KO1A 3PVQA 2JN0A 3NTKA 3N5BB 1JLGA 3KWMA 4A63B 1CBKA 3O1LA 2WVDA 1VYAA 4DDFA 1RAIB 4ZPWR 2QRRA 2O31A 4FYXB 2PUKB 1N5ZA 1FEEA 2K5LA 2EQMA 2C2MB 1IBLF 3W7BA 3VGUA 1EZZB 5DZ7A 1KQSR 2HNDB 2MY8A 4Q8FA 3PW0A 2RT3A 1SKRA 1WSRA 3CCVS 2B9WA 1G83A 4NLGA 4CI0B 3LWMA 2UV8G 1I51B 4L76A 2L3RA 1NK5A 2CIMA 2EIFA 2QLWA 5KYYA 3VQTA 1N6QB 1TQLA 2RHQB 3QG1A 2AEFA 1HNIB 3EAEA 2CP2A 3DN9A 4P71A 3KJVB 2VONA 4Q7AA 1FVSA 3M4XA 2BRKA 5I42A 2V8DA 5HK0A 3U02A 2L3SA 3DLKB 3CCES 4U6PA 2QEXA 3H41A 2L0AA 1YI2A 3GLXA 2OPPA 1I94F 1U24A 2BQRA 1BI3A 1U5SA 2ZKUA 3LTOA 2HQCA 2NQPA 3CCUT 5KFMA 3KK1A 3EE3A 4KRTA 1KP6A 5MLCV 4PQAA 4ANEA 1IRXA 2J0QD 4YQWA 2K7AA 3FJ5A 1N5VA 3K5NA 3C6UA 4YHHJ 2B8AA 4G1QA 2VXFA 2OMLA 3IA0A 1ZSGA 1ULRA 3GJSB 4ZTJA 2HRTA 2HEQA 4C8MA 1P27B 4B3MJ 1AA1B 2PVGB 4DU7A 4XU0A 2P4RA 2DO4A 4QW8A 3DHXA 4J9RA 1FKPA 5IT9E 1ZBTA 2UU9F 2ZAEA 3CJ4A 4OZ0A 3RTVA 2VFUA 2LQKA 2ZEJA 4RW4A 3D4JA 2C3OA 1N32F 2DYIA 2VKZG 5J2NA 1VQ7T 3D3CJ 4H4KC 2PTKA 4OJ3A 2X4JA 2DL8A 2KSSA 3S3MA 4OL8A 3QRPA 4I6WA 5FU7C 5IT0A 1YZ7A 1RT7A 2CP7A 3MAQA 4CLWA 1S1TA 3S01A 2Y4XA 3KK2A 4B3TF 1PM3A 2XNQA 2IM3A 4YR0A 2OELA 3J80U 1RAHB 1PC0A 2IYGA 3DRPA 3IR6B 3RMSA 2QC3A 4GY5A 1CULB 2LP4A 1IJEB 3X24B 2HK3A 1YJNA 3ASKA 3SWNB 2E5GA 2PIIA 3GP8A 3KHGA 4LQ9A 1HW9A 2J0SD 4ZGDB 3RAQA 2QA4T 2ZITA 1T95A 5F8IA 2GGPB 1M3AA 3D67A 1OI1A 5J3BA 3BS9A 3CMQA 3NS6A 2KEAA 3HCXA 3MUVP 4WF2A 3OSNA 1VQOQ 3URGA 2XZWA 1FRHA 3BGLA 2KRBA 3SWNC 2CQDA 3BEGB 3BN4A 3HX9A 3Q24A 1UETA 2LP5A 3WVDB 3JAME 4PQUA 2C06A 1RHMB 4BLGA 3PEHA 2EWHA 4X66J 1QTNB 3LWLA 4K11A 3IAS9 4J9MA 4OYOA 4X4QA 3QZ9B 3DRRA 1REVB 1U8WA 4M75D 1Y10A 4P10A 2LRQA 3QDFA 2H4WB 3CJ8A 2ACYA 1SKUB 4M5GA 3UATA 3I56S 1MWYA 1G2BA 1K8AT 4H4OB 2VOOA 2X1GA 3M8QB 5LJ5e 2F3JA 1T11A 3CJTA 3QHSA 3KLEA 2LEBA 1FERA 4RCBA 4HHJA 4BS2A 5CCMA 4M77C 3GJTB 4B9VA 4ZIWA 3RDVA 5K14B 2RF2A 3C3LA 2EC2A 4IFVA 4IFVB 1NK7A 5B0EA 1SKSA 1T05B 4J83A 2KJVA 4ETXA 4RR5A 1F9FA 4IUUA 2B7BB 4BI8B 3JSMA 1KHVA 2GIFA 2ZH8A 4JI5J 4HLBA 3M8ZA 4MH8A 1NCLA 2JNJA 3THTA 1VS3A 4M7DD 2JHEA 3RB3A 4CO2A 1ZZNA 2BJDA 3VAHA 4E47A 2NUHA 3HSDA 2WONB 3CIMA 3WC0A 3PG9A 4LBHA 4F4AA 2XY5A 2MLZA 3LP2A 4IOCQ 4DQSA 2C2OB 2JEFA 3CVKA 2FLOA 2JLGA 3KLEB 4K4YA 4DR5J 4BDZA 2IVYA 3GIJA 1WELA 4ILMA 2DRAA 3RYLA 1S1VA 5CYJA 5GAN5 4O3PA 5J1EB 3H25A 2I2YA 1ROFA 2XULA 5J2QB 3ZNUA 1JXOA 1WHWA 2ZUAA 1PBUA 2LQNA 2YUNA 1LOJA 4PJMA 2I8EA 3IS9B 3GP9A 4X65J 4LF9F 4LREA 9RUBA 1S79A 3PJ9A 1WFWA 1XEZA 4LF2A 1ZUUA 1BQNB 2YX1A 3PFEA 1XOVA 3RB0A 2NUPA 3AQOA 2ZHOA 3OYBA 2ZBCA 4CI0C 2KXFA 4OB1B 2VIHA 2YNIA 3DXBA 4OHXA 3MEEB 2MQPA 3NGPA 3CC4A 2MKSA 2CP3A 2PA8D 3VV2B 2CQCA 3LX7A 2EFQA 1VQ5T 3RNJA 3P5TL 1QSSA 5KFDA 1TSFA 3E3XA 1F60B 2X35A 1JWWA 3R7NB 4DR5F 4K7QA 4Y2KA 3KK2B 1U3OA 4D8KA 3CJ0A 1K9AA 1JLFB 3Q2SC 1HIYA 4X62F 4DV7J 3OA6A 5FLXU 3H5XA 1OEBA 1VQ6A 4M77A 2EEYA 1WHGA 2IIHA 1E6VA 3PRBA 3NKYA 1M90C 4DWIA 1YJ7A 1IXKA 3S7RA 1XK8A 1Q53A 3A3PB 4NRTA 2DB1A 5HK4A 2W9CA 4K8RA 4OMMA 1I5OB 2LJ3A 1I0CA 1TH7A 3MDFA 4ZJLA 3LLRA 1UG1A 2HL5C 2NR0A 4CWBA 1S1XB 3G6ES 1YVFA 3KK3A 3LALA 2X1BA 4YMEA 5HSPA 1GXIE 1RU1A 4MKVA 3DRSB 2CNLB 3QIPB 1F1BB 3Q83A 4KPCA 4C8OA 2H5EA 2AIRB 1RHJB 4HCKA 1Y57A 4ZITA 4JI0F 5GANj 4EMKC 3MWBA 5HN0A 4NOYA 2LDIA 4M7AD 4LT6A 1VQ9Q 1IKYA 4ZP7A 4DFPA 3D0IE 2KK4A 3ZTSA 1NJYA 2LVMA 1IXDA 3W5YA 2HVZA 3UW1A 5A6PA 3HKSA 5KFCA 2BM1A 3MZIA 1JLEA 1VRTA 3T1YF 2XWYA 3OL9A 5HK3A 3T1HF 4EEYA 1NZAA 1U06A 1VQNT 2DMOA 4F50A 2JNGA 4IUPA 1LW2B 5JUMA 3CXCR 1EETB 1AZSB 2RAQA 1F5BA 2XS2A 2CREA 1OIAA 1M5HA 4WPAA 1SV5B 1CJVA 5KG6A 2EVRA 3EFOA 4CTAB 5KT3A 3U1LA 3ET6A 4B3SF 3KUFA 3FEYB 2MMYA 3K57A 3W66A 3G6YA 1I1JA 4DV0J 2M9UA 2HNDA 1Y5LB 5JXSA 4WFZA 2FRYA 1N33J 2OEJA 1CLFA 4O4RA 1OPLA 2OTLS 3WXMB 1XNQJ 3LP2B 5KFZA 4M7DF 4IFYA 2I9SA 2QL5B 2V4JA 4DV2J 1VQ4T 1HD0A 3PIPQ 3ETOA 2JFKA 3V6DB 4RUBA 3CCRA 4C11B 4M7DA 5CYMB 2M5YA 3KG4A 1WF1A 3UWTA 2XCAA 2XDPA 4C8QD 3GZ7A 3MEVA 2UUAJ 1T05A 3TYTA 4M77B 4JI3J 2PVDB 3DGPA 3HJFA 1U6FA 2GHPA 1HNWF 1TVRA 1OY6A 4KGVB 1MMAA 1K8AU 1S57A 5A0YB 1P6TA 1YWOA 2HHXA 1FWKA 4NOHA 3I6PA 3NLCA 5CD4H 2AGOA 3ITHA 3MEWA 4DV6F 1UEBA 1HR0F 4F7UE 4P2SA 1JNZB 2V69A 4O0NA 5DDPC 1S10A 2K57A 3M2VB 3NOGA 3C6UB 4ENOA 2PNIA 3L95X 2WSEC 4DUTA 3PFOA 1KD1T 2RIJA 3DLGA 5GANe 2DHSA 2DHXA 3QZ5B 2LTOA 2RJCA 1IWGA 3R97A 5F8JA 2LCWA 4PG4A 1H3HA 4XO0A 1MV3A 4XTZA 3K58A 2FQQB 3HTRA 2CJAA 1U0HA 1W2BR 4YB5A 5GAN2 2CDTA 1NUEA 2CZ6B 1RT3B 2A2CA 4ATNA 1JLEB 1NKBA 5KYXB 2FLLA 2B9EA 5A76A 4C5IA 3G6EQ 2ZWOA 1I4K1 2CQ3A 2WSFE 3IM9A 4K2XA 1VQ6Q 2WAQD 2XKOC 2DEQA 2DNQA 2J9DA 4A53A 3TAMB 5HQ8A 2BACA 2CA9A 5EWGA 1RL2A 2HDAA 1QAJA 3PMTA 5C0MA 3CCUQ 2GO9A 4CQ1A 4KULA 1NKEA 3GFHA 5AE2A 1CULA 3HK2A 2W24A 4RUAA 1KQSP 4N7TA 2O1PA 4BC7A 2LKZA 1WSVA 1YN8A 1UWAA 3MHYA 2QTVA 3D68A 3D54A 1IKVA 2X4YA 4RLEA 5HP1A 4ZLJA 3M55A 2VA3A 1WWHA 3UVJB 5D0HA 2L3PA 1O8BA 3EGXA 5KFGA 5LL6d 4FXDA 3CMAQ 2E9TA 2CH4W 4GBQA 2JDJA 1FNXH 4OI4A 1IBMF 1RTDB 2E9RX 3MECA 4C8ZA 1JB0E 1L3VA 2H65B 2QLBB 3CD5A 3RRHA 4ZCIA 2V2KA 3QBYA 3HSGA 1W25A 1X4DA 3PT9A 2HQIA 2RJDA 4J37A 1RWOB 4NL3A 4WFXA 5KYWA 2RILA 4F16A 1EKSA 2KNBB 3M05A 3S3OA 1M90T 1EAYC 5C24A 3FMBA 5KT4A 2E5QA 2OTJQ 3I0SA 4RW9B 5ETQA 4AFZC 1LJOA 1TUGB 3LAMA 2OPPB 3KFVA 2DH9A 1Q81U 2K79A 3QO9B 4XDDA 3KJVA 1FKOB 3VGSA 3M4YA 1YCYA 4WIQA 3P3DA 1V29B 3RERA 5B0AA 4DL5A 1M1GA 2HHTA 5E5NA 1DTQB 2AYGA 5EX3A 2P0PA 2PDAA 3CCVA 1TAUA 4XTVA 3I35A 3QGHA 1YJTA 5IWAJ 2ZC4A 4HDHA 1KVIA 4C8KA 1KD1R 5HVHA 5LJ3h 3NY0A 4L3NA 2BKDN 1FXLA 1T9VA 4Q8EA 2RHZA 2DGWA 2DD5A 2XZTB 4JUZA 4ZGEB 3KNAA 4TQSA 4IOBA 1X5TA 2IJFA 2AJQA 2NXJA 2X3WD 5E3CA 5D6XA 5CH7B 2KYMA 4ATOA 2W8LA 5IXUA 3QQCD 4LD6A 1S72A 4PFZA 2P9GA 1S6QA 3MP6A 2JVOA 1B99A 2YWWA 1ZS6A 4ICLB 3DLJA 1P92A 4EBDA 2BEFA 4AYBD 1C4AA 4OX9J 3CCJT 3D1QA 3CPFA 1OOTA 2SXLA 2EKOA 1UJYA 2L08A 1Y96B 1NKCA 1VQMT 1K1QA 4QIVA 1VBZA 3KK1B 1WC0A 1WJ9A 4RG2A 2EGAA 1MGQA 1S4EA 4RW4B 5KE3A 1KC8C 2XGQA 1U4BA 5IM0B 4B3RF 3GF5A 2QQ9A 4EBEA 4OYAA 4AG1C 2JZ5A 1OSDA 2XG8A 3DRYA 3AD8C 1ZA2B 4RTTA 2NLUA 1UFFA 2D9TA 4DQIA 2GBQA 3FJPA 1TL7B 2K3KA 2VG7B 1FE0A 1BMQB 5U47A 1IGQA 3KLHA 2VBXA 3RGIA 4C0BA 5GAEU 1RT4A 4CC3A 2HVIA 3PRVA 2M3DA 2IA6A 1UVJA 2CH4A 5IS2A 1NHVA 4ZP6A 4IQXA 2LX7A 3IQLA 4L59A 3DRPB 3AB4B 5KFSA 4NLQA 3KBGA 3WX8A 4EK2A 5GAOl 3OVBA 4F36A 3L42A 3SFGA 2YH1A 1IKYB 4IRKA 1K8AR 1RWNB 3X25B 2PMHA 5IT9U 2U2FA 2VV5A 4C8QC 4KGXB 4A8SA 2W9BA 2HBPA 3U1NA 4C0GA 1BI1A 1TMJA 3EWGA 4PWWA 2L41A 4KPYA 2LJ0A 1G3SA 1KD1C 4Y3CA 1WI6A 4DR1F 2O66A 4GRSA 1M3BA 3QZ7A 1N8RT 4RG8A 2B4VA 4NLYA 2R2UA 4MKAA 3C66A 1PD0A 5C24B 1Q79A 2JLEA 3D6MB 1U1OA 3A12A 4W98A 4UOHA 3V7CA 1IO6A 3L2RA 2MAMA 4DCPB 3V6JA 1V3RA 1LWEA 3BBBA 1UVIA 4E7IA 5KE2A 2DXBA 4OMFB 1U2FA 3HSZA 2VQEF 4WFBQ 1YWXA 1FDAA 1NE8A 4KGMA 3DOMB 2GF7A 3LGFA 4N0AC 1HR0J 2E7XA 3A8KA 4RUCA 2RU3A 3K7RA 1MMGA 1J5OA 3D9BA 2UVWA 2ROPA 5GMDA 4XTTA 1NPKA 2P84A 2ZE2A 3LPYA 2KYZA 3BBCA 3SSQA 2M51A 4DEXA 3AJ1A 1X9SA 2J6SA 1Y71A 4WYWA 2ENMA 3OY9A 2PI4A 2EWNA 3W60A 2QDYB 1GNKA 4LDUA 2CJKA 1VFJA 4DBHA 4NLVA 4JRPA 3PY8A 4JB8B 1WKLA 3R27A 4G65A 4E7KA 3NGDA 4RTXA 2GCFA 2RNEA 3R8YA 3VU3C 1FJ7A 1BCOA 2XSFA 2AQ4A 1WX6A 3NTIA 4PJOC 2BZXA 2EYYA 1DJ0A 1WNEA 2EJFA 2HLTA 5KFUA 3CD6T 3H20A 3HL8A 1UA1A 1ZBJA 2J8SA 1Z9ZA 2YKOA 1WC3A 4RCCA 2JVRA 2BBEA 2KYXA 4ZK7M 1IHWA 2YNHB 3G82A 2F65A 2BTTA 2X7IA 5HY6A 2LA4A 2RKIB 4X9DA 5IWAF 5LJ5j 3KLIA 3V4IB 3M30B 3QATA 2JX2A 1X01A 3H5SA 1ZOTA 4M75A 3CC2Q 1S1VB 4J6XA 3GFXA 5GAN7 1VI7A 2DGXA 4N4HA 3GQCA 4NZ0A 5A6WA 1YP5A 1QVFA 3D3BJ 2DYBA 2QMWA 1WDTA 3C0CA 5LJ3e 2DPIA 3GYGA 2W8KA 2DR9A 2V8KA 2G2OA 4B17A 4Z88A 3HVTA 2DL3A 2EKYA 2I5JB 1ZAVA 2B6AB 2DNHA 2RU9A 2AYMA 4AL6A 3ZZ0A 1LWFA 4EO6A 3NMZC 3RMQA 1JQGA 3G71S 1WUUA 1EP4A 5L1LA 5I3PA 2KE9A 1QAYA 4DL7A 2WVEA 4F3MA 4NLPA 4TU9A 1SRLA 1M27C 2FB7A 4Y6IA 1RAJA 2QX0A 2HZVA 3OS5A 4M5MA 1VBYA 3DC2A 3VS2A 3RG6A 5JJBA 1ZLMA 4AQYJ 4DSKA 3MO8A 2G0CA 5LXYA 3NGRA 1B34B 5HBMA 4HT5A 2ZZTA 2ZH2A 1H2VZ 3EX7B 4DF4A 2MZTA 3INZA 3CCZA 1NH7A 2R8JA 4QQDA 3KXTA 2EJGA 5F8MA 2UXBJ 3QZ8A 2AYBA 4ECSA 1B70B 3KUHA 2R3VA 4X4SA 4QWCA 5KFHA 2IVFB 2R7WA 4XIUA 1FX7A 4A46A 1VQKT 1K4US 4PWDB 4PWDA 1WDDA 4IG0A 3JS9A 2FJDB 2UUBF 2JC1A 4DR7J 2X51A 4B6MA 5C2GA 2UUTA 3Q2TC 1S5ZA 3FEZA 2DEIA 1HQUA 1QE1B 2I6WA 3C2PA 3IBWA 1R8OB 1OPKA 1UDLA 2E1PA 1R8BA 2OTLT 4CC2A 1TUWA 3BKUA 5J26A 4A54A 2DCLA 3HVRA 2OJ3A 1X9WA 2QQAA 1PKSA 2MJNA 4R25A 5FWCA 4C9DA 3DLLQ 3OB9A 2Z4PA 1NSKL 1Q7YT 5D15A 4NCGB 3M6XA 3H0FA 2LNHB 3G8TA 5AJ3J 1Q7YC 3T5KA 1RWKB 1U1TA 3BKTA 2E5LF 3L7OA 1CJKA 3D5MA 4J9QA 2JUFA 1LFWA 1FF2A 3OFEA 4VUBA 4PLLA 1QY7A 2VDIA 3UD5A 4OMFG 4J90A 3J7AN 3UPUA 4P75A 3M2RB 2JT4A 4B3SJ 4IO1A 2ABLA 5BJRA 2MKCA 3DOMA 2FJVA 2AHJB 1SL0A 1YIJA 2VHGA 3JCMf 1AUSL 3CD6S 3OXGA 1WG5A 2IG0A 5T14A 2XSJA 1YITQ 3MGJA 2LDMA 4Y00A 4ZN3A 4C92G 3VVUA 3TZYA 3VTIA 4EFAC 3CCSA 5KYUB 3TAPA 4DU8A 2W9AA 1KC8U 2W7PA 4FS2A 4LF8J 1AYEA 4TNOA 3PJWA 4DS5A 3JCMh 4TY8A 1GXUA 5ITHA 1PYOB 5CKEA 4ILRA 1JXEA 1KEKA 5IQ6A 1UPMB 1BKBA 2KYBA 3TA1A 3OUYB 4DL6A 1ICEB 3SFMA 3IRWP 2YWFA 2GO8A 3VAKA 2JEJA 4OI2A 3QT6A 2KVIA 2VBYA 4U9RA 3A1YG 3HVTB 4ZP9A 2LXUA 1CKBA 2HVDA 2FL7A 2FLNA 2OKQA 3TQ7P 1KWMA 3IRXB 4KKOA 2HSEB 3VYGA 3AA8A 4ILLA 2K3IA 1UPPA 2YKNB 1Y3KA 4ZVFA 3JCMe 3DLGB 4LF5F 4M75C 3LGNA 1SIZA 1NB7A 1VQ4S 1IWAA 5G4DA 4JV2A 1IGUA 4Y91A 5GANh 1KQ1A 3OYFA 2A6MA 1T3NA 5KYXA 2BX6A 1X6BA 1MG7A 4DV1F 3OR1A 3D2WA 4IRCA 4WXWA 3OTEA 1VQLT 4G1PA 8ATCB 5AYFA 1DJ7B 3CEYA 4PJNA 2VJUA 1RWXB 4X62J 2ZVIA 2Q6CA 1JO8A 3R5DA 4FSXA 3EVWA 5F9NA 4FN5A 1N36F 4ZJOA 2DZCA 4FNHA 2N4CA 4I6AA 3EG2A 4M7DC 3PIOQ 1WXBA 1WI7A 3CMAA 4M7AC 3UNGC 1DRZA 3MURP 1ZETA 3UN3A 3QUIA 1HHTP 2HQXA 4FYVB 3RRKA 2D0QB 1RQ0A 1YBAA 4KO0B 3O8WA 2FRWA 2A6OA 1IHVA 1SSFA 2BZ8A 4I4BA 3BH7B 3BDUA 4PXCA 2DR8A 2ZJRQ 1FTCA 1GFWB 2PEBA 4NA1A 2D3OR 2R42A 3EGXB 3G6VA 2NUTB 2A36A 3OYJA 1UEVA 2AX0A 3ENAA 3LH2S 4O5VA 3CCQS 3EGZA 3J81E 2DF6A 3JB9J 1SQEA 2EVZA 1RTZA 3E2EA 1G3WA 3P8DA 2RHXA 2HHPA 1HI8A 3CMEQ 3VF0B 1G2EA 2CQ4A 1MSWD 5EX0A 3H98A 4O23A 1FKAF 2NS1B 4RU2A 5KFLA 4JI6J 1Q86T 3ILLA 4JOUA 4ZS6A 2M02A 2BJEA 2YX4A 1M30A 1XMBA 1FRXA 5KCHA 4O6JA 1KOHA 1N8RR 4H54A 3N5FA 1C1BB 3GIRA 1SKWA 4LRCA 2GJIA 2AT1B 2OHDA 4CLPA 1MHNA 5B08A 4R0EA 3U1MA 3D6TB 3TREA 4DQPA 3CMEA 2MLYA 2R7TA 2Q43A 2HHSA 1W2BP 3DOLA 1TFWA 2UUWA 2XMFA 1YBTA 4ZHRB 3HHLB 1R7IA 4BY6B 1JB0C 3OQ2A 2GHWA 4F7VA 2JVVA 5GAN3 4M5DA 1HBUA 3RAXA 3Q8VA 1JJCB 3THPA 1U48A 3QMQA 1XTDA 1GMUA 1OQ6A 1SJQA 2AD9A 4LDXA 2C2ZB 3SDEB 3CQTA 2VFSA 4R8UA 1MWZA 4ZNXA 1TOVA 4M5NA 4F8RA 2LU1A 2K3YA 1Y5NB 2A2DA 3SQGB 4JV5F 2FB0A 4GVBA 1WHXA 3GB0A 5A0YA 2NUZA 2WVBA 1NK0A 1QLNA 2DTIA 4LSNB 4DJBA 4RBUA 5DLQE 1KVKA 4WU3A 4CLTA 1WKKA 4LJMA 3RBBB 3JQJA 3MMCB 4B3MF 2HBWA 4QYZJ 2DNRA 5HAOA 4MTPA 5K8NA 1KTVA 1ZM2A 4AL5A 2PT0A 2OD4A 4NYPA 1X4AA 3CNQP 3QSUA 4AFFA 1H641 4J9EA 2L2PA 1WNLA 4KTQA 4WU2A 1AFIA 1HNVA 2ZH4A 2W4PA 3CPWR 3GJQB 4DV1J 1ZPVA 5GMKl 3I55T 1R89A 1GT8A 3NNCA 4HHHA 3OS1A 2ROGA 2W9CB 1X4CA 4DX5A 1I8FA 4EDUA 2WB4A 2M1HA 2WW4A 2V8VA 3GMGA 4DHVA 2PI5A 1R0CB 3KHLA 4NCBA 3CXCA 1RT5B 4ES3A 4MAKA 2OEKA 5IT4A 4WJBA 4WFYA 4C92B 4J9OA 2QK0A 3QT8A 1XC9A 1T9TA 1BQXA 3UT1A 4K4VA 2OI2A 4KBIA 2B0GA 3A8HB 3CXCP 4EYIB 5F0UA 1Y00A 3QYYA 4HT7A 2BKNA 2HAIA 3A3NB 1GMWD 1S76D 1X69A 3CCLA 3Q23A 2GMHA 1KFSA 1RT7B 2BE2B 4MDWA 5CA5A 4QIFA 4M75F 5B0BA 4LF8F 2UZAA 4I67A 2E4HA 1D3WA 3JCMg 4M5HA 5AXMA 3OYHA 1R77A 1S72T 1VQLS 1U02A 5C42A 4MJKA 1CS4A 4IUVA 2UP1A 4DSLA 2B9XA 3PIPA 2KI2A 1X2KA 5CABA 2QA4A 5FW9A 4OF1A 5IHNA 2FHJA 2CPXA 2FVPA 3M9MB 3AODA 2K4YA 2IDLA 5E3PA 2E5HA 3HFKA 4EWTA 2G0IA 2J7UA 4O3QA 3OYEA 4DV4F 3QGPA 5FROA 3PW4A 4UY85 5D7UA 1WA7A 5DGAA 5FLXE 4DUZJ 1X5PA 2HKNA 4UC4A 2V8JA 3VYHB 2OTLA 5CAAA 2YUPA 2CT4A 3NWRA 3KDNA 4LF4F 2MKHA 5IT9Y 4RWWA 1UECA 2FO0A 1HBOB 1D9FA 4I68A 2YUQA 3CEDA 1U7LA 1DZ5A 2O3DA 3CCUS 4UOCA 3NGKA 4USVA 2GHVC 1UZDA 1CPZA 4G1QB 3WIUA 2RHYA 1KDNA 5L9NA 3NCPA 4YB7A 2U1AA 4LIWA 2KXCA 2JM8A 3MD1A 4OYPA 2H4YB 1Q5VA 1YZ6A 3BV8A 3H59A 1WEYA 1IR0A 3EGDB 3UPFA 2WSEE 2OLWA 4ANDA 2ZCFB 2RI5A 3SDZA 1UUEA 1FDNA 3W8GA 3TQ1A 3R5AA 2BW7A 5CKFA 3CDUA 2P5VA 3P96A 4J7FA 1OSCA 4K4WA 1YJ9S 3J81j 2ZH1A 2WONA 2DGQA 1JJ2A 1LXNA 3HI9A 2ATCB 3KLHB 3OTOJ 3GG1A 4QCLA 3EZ5A 3FCHA 4ANCA 1MROA 2FC8A 3CCET 4B3OA 3ZBDA 5GVQA 5HATA 2RDDA 2HQFA 3IRXA 3L2ZA 1YI2Q 2V50A 3T41A 4NS5A 2KJWA 1ZX6A 2VF3A 2DHGA 5KFRA 3M9OB 1FX4A 4C92A 1GEHA 1YFNA 4A8QA 3ISND 1Q1KA 2EBGA 5GADI 3BO3A 1YG0A 1WOSA 2CKKA 3RZAA 4N76A 2DRMA 2N3OA 1D3BB 1FMVA 2XG8D 2FPDA 4IUFA 2KXHA 3TZXA 2DXCA 2DLPA 2CZVC 4K2JA 2MSTA 2AKWB 4BWJA 3Q8RB 4XU1A 4DN0A 3H6ZA 4Q5WA 1X8DA 4Y92A 4TU8A 4K4UA 1JMTA 5I11A 4DV3F 5ADZA 1FD2A 1EX4A 4PXBA 4E8UA 1D1BA 4OB3B 2M0YA 3I55S 2PMWA 1E6VB 3I31A 1VDHA 3EZUA 4F4XA 4QYRA 5A8WA 5LJ5f 3AXMA 1M8MA 4KHRA 3MP8A 5DDQC 4J9IA 5J2MA 2R57A 3QFHA 2W2MP 1K1ZA 3NP5A 2ROEA 3FK4A 3IWXA 1WPYA 4OX7A 3SFUA 2COWA 3F44A 1U1KA 2DH8A 2Y9HA 2IC3B 1FDDA 3EGWB 2QYGA 2O9SA 3BF4A 2IJRA 1P9YA 2C2RA 1F0XA 4DZ6A 4URSA 1OULA 3VGTA 3LANA 4FYDA 4MMKA 5M2PA 4J5YA 5KG0A 2PMZD 1TR0A 3J7ZT 4KHPJ 1SEMA 1VQKA 3R1HA 4UTGA 2KH9A 3VS4A 3EYZA 1NJIU 2VC8A 5KFOA 2AYEA 2D9OA 4ZVTB 2VBZA 1XJWB 3HKZD 3OYMA 2WSCE 3CCST 1MMLA 4CO4A 4CZCA 2FUG9 3JAMY 3H40A 4DV3J 4Q2MA 3DYAB 1J5EF 8RUCA 4JI7J 1LW0B 2B4OA 1IBMJ 4FU6A 3O44A 1GTHA 1VRUB 2O9VA 3M7VA 4LRDA 1Y0MA 2W2QP 3BPDA 5ETNA 4J9NA 1FMWA 4ZPCA 1RKIA 2CQ2A 1BD6A 1VGYA 1X4FA 3GR1A 1UEKA 4XK8C 3ETMA 3MECB 1VOMA 3RJMB 2HKEA 1CJUA 3A3OB 2EKHA 3A8GB 1HQ2A 4PXEA 2EQIA 2V5HG 1AFJA 4CLKA 1Q86U 2HL3A 2ZFHA 1VQ8S 3QJJA 2OD6A 1HYSB 1AW0A 4PLIA 3MEGA 4HVWA 2OPRB 4IDKA 3CD7A 4FXWA 2YSQA 4P9SA 5HI7A 3LYIA 4OHZA 2IAJA 5GMEA 2ZM6F 4A48A 3DNCA 3BZQA 3M1VB 1VRUA 4Z37A 1FRMA 4NEZA 1CEZA 4FS1A 1GMVA 3RKWA 3MMBB 2VUGA 1X9MA 1NLPC 3RESA 5I21A 1S9GB 2I0XA 2KTQA 1DQ9A 2AZVA 3OMGA 1R8PA 2LNVA 2GTOA 2MDAA 1RHRB 1VQ9A 1OQ3A 2X1AA 2WACA 1AWJA 3G4SS 2CSIA 1ACMB 5CXTA 5D8HB 3C94A 4GKJF 3SWNA 2A3JA 2VKNA 4RKUC 4RL1A 5EHHA 3BB5A 1T0HA 1K0TA 4HDGA 5HQMA 3BSNA 2R7QA 2ROLA 1UWBA 2XYHB 3K89A 2IAJB 1EIFA 2IRUA 4YOEA 3K5LA 4A8KA 1VQNS 4KKOB 4BDPA 5KOXA 3OW2P 2F7VA 4EIKA 4ZJQA 5HROA 1C0TA 2Z58B 3PRDA 1URNA 4QIWD 1RT5A 1UW4A 1UGPB 1YJNS 3UD4P 3PEJA 3M30A 1HWLA 2XMKA 4PKDB 3M0SA 1F2GA 2HS3A 3KG0A 2Q79A 2RK2A 1K47A 1VQNA 1XR7A 2E3HA 3GCXP 2AU0A 3CBPA 4S0MA 3TR5A 1TL5A 1X4EA 5IV4A 3POTB 3T5LA 3RB4A 3E19A 1KLNA 4OQJA 4MIBA 5KT5A 3RUXA 4HL9A 4RW7A 3DB4A 2LMJA 1SCJB 4FYYB 3G71A 3ZC4A 5LSRA 1MN7A 1LOUA 5LT5A 1NO8A 4M5IA 2Z30B 4C8YA 4J9SA 3CCRQ 1PO6A 2CPZA 2F5KA 2KZMA 3MMJA 4LUEA 4HCZA 5CKHA 3JTNA 1VJWA 5KFYA 5A0GA 2ECZA 4M78E 5FU6C 1K1SA 4FKYA 5ETRA 3CJ2A 3I32A 3I9V9 1SI9A 1KQGB 5E33A 2CQIA 1KONA 1R8HA 2A08A 2CP5A 3KMSA 4KO0A 4FW1A 4USKA 2FEIA 3MCSA 3D1HA 4OZLA 2K2VA 1WGSA 5AXNA 4YR2A 3DRRB 1LXJA 1YJ9A 3VUZA 2B56A 1H38A 1ZPWX 5KYNA 1HD1A 4EMGA 3ULHA 3K5OA 2B7CB 2IC3A 2LQ9A 5KG2A 3PJXA 1SJ3P 5GANd 5L39A 1JJ2P 1APSA 5DM7R 5CYQA 2KXDA 2AW0A 2LX9A 3ZO7A 3J7YI 4K50A 3TA0A 1U45A 4J9GA 2RN8A 4PJLA 4Y0FA 1AD5A 2W2NP 4RUGA 5IZHA 1XMOF 4ZPBA 3N6MA 4LF4J 2UVVA 1BI0A 3OUYA 4OJHA 1WHYA 2NZCA 3Q8YA 2YNFB 2CZ0B 1IB8A 2RHIA 1GXLA 2O2OA 4II1A 3C8YA 4K4SA 4RTWA 1U1LA 2FYKA 4FL6A 3J81U 1LQ9A 3CCWA 5GJVB 4WWSA 5C6SA 3OYNA 1GX6A 2X3GA 2JC0A 5J1EA 4WE1A 4L72B 5DGBA 1D1UA 2MGZA 3M9NB 2F2XA 3MMBA 2GFAA 1WYXA 1UJ6A 1S1TB 2HQHA 1XR6A 2KM8B 1KQ2A 4M7AA 4IDKB 2QA2A 4F7UB 4XDCA 2IBOA 2XWXA 3WQPA 7FD1A 3UE2A 4CP5A 1JJHA 4DLEA 3HULA 4LRFA 1CVJA 3V81B 2OPSB 2W0ZA 2FGOA 2DGVA 2QLJB 3R5BA 2CSQA 3PMIA 1S6PA 3RBXA 3LGHA 5J1NA 4EMKA 2MZQA 3N79A 1YCSB 1WC6A 2G13A 2QL7B 5CHCB 4IUTA 3FLGA 4JI3F 2CPFA 1H98A 3IFEA 2Z2YB 4QYZK 4FF1A 1VQ6S 2HHHF 2UUAF 2MGZB 4W4MA 1R0AA 3I96A 4DV2F 2DD8S 1S99A 5F8NA 2F1LA 4A4KA 3W5ZA 3CJRA 2CZ7B 4QZVB 1NM2A 4P2MA 3BGOP 2KFNA 3KYLA 3OVAA 4L6V5 4WIIA 1YJNQ 4LF6F 2QZ8A 1REVA 1KHWA 3WZ0A 1FFSB 3V5RA 2EFOA 4CC7A 2XDBA 3KLIB 4OI0A 4M5JA 2DNGA 4WTOB 2XLIA 1RLQC 3NG8A 2F1FA 5KT2A 5I3QA 2AJ4A 3NWGA 4CYUB 1X2QA 4EYHB 2LDYA 4J9PA 3E01A 2MPUA 2FJAB 5KFKA 2RQCA 1HHQA 4D3GA 1VQPQ 5AE3A 4Y28C 1CJTB 1ZAXA 4DG1B 4JJCA 2XMVA 1UA0A 2O67A 2XLKA 3MI7X 3HFNA 3CCVQ 2XK0A 5A8KB 2RS2A 2FJXA 2XHCA 1XERA 2OFGX 2R8IA 3MM7B 2CRLA 3RAMA 4J9FA 4YTLA 3QAEA 4O44A 2VODA 2JFDA 2RI3A 4DSFA 3M0RA 3MM6B 3MPWA 3CBMA 2NPIA 2LFVA 4RBVA 2BZ2A 1YJVA 1U1SA 1VQ4A 1M1KU 3QJPA 3CCEQ 2KY9A 2UU9J 2ZUGA 1TKTB 3CJQA 1R43A 2E1RA 2RF2B 3PYEA 5GANg 2ZPFB 1WC1A 1Z9QA 1RHUB 2HFNA 3EFOB 4IRDA 1B0TA 2KROA 1PKTA 2XS5A 2H54B 2E7VA 2JRSA 2E12A 5I3UB 2B3TB 5F3ZA 3TUPA 5ECAA 2VGMA 4C8QF 4ZPVR 3M8QA 4N4GA 4X66F 2D1XA 1HWIA 4OYIA 1NJXA 2H5JB 1LV5A 1WOOA 3ELHA 2HGLA 1W2BA 1QM9A 1FJGF 2H3JA 4DV5J 1P1TA 5HLFA 1T0TV 4P7TA 3G4SQ 1RE1B 2CDQA 2AZSA 2BJ7A 4DCJB 1FDBA 3KLFB 4A4FA 1O75A 1MU2B 2JZ2A 4UUWA 3MR5A 3X20B 1AZGB 2HPUA 2YNFA 4QVCA 3MPDA 4OZ5A 5CIUA 2P2CB 3V8KA 1NDPA 4NZ7A 3M8PA 2M0OA 2F63A 4FBUA 5KG5A 1LFPA 3B4MA 3OL7A 2FTRA 3MR7A 3IMQJ 1AVZC 1JLAB 4WZQA 1K73U 1S9GA 2FHJD 2VG5B 4MKBA 1VJQA 1OV3A 1ZTTA 2A28A 2GZOA 3U7JA 4HTJA 3QWYA 4C5EA 4ZVPB 4HVVA 2E10A 3D7SB 2DERA 2QEXT 1YJWQ 4X65F 4X1VA 3TOQA 1IBKF 2N3LA 1WHMA 3A8MB 2QGGA 3BE3A 4X4UA 1WORA 1AZEA 5A8RB 1UHFA 2QSWA 2RQVA 2FDNA 3NFCA 3CDBA 1X5SA 4OYXA 3H0PA 3C6TA 4CO0A 2RO0A 3MM9B 6FDRA 2A3LA 1P8GA 1N27A 3UDEA 1U8SA 4P7VA 3EXYA 3OFGA 4YHHF 2DAQA 4UOFA 1YJ9T 4AXJA 3NAIA 4DPTA 4IIMA 4YS2A 2D6FA 4NMXA 3OTOF 1N8RU 2ZD1B 2VZ9A 4OYBA 2RRAA 1B34A 3HDSA 4Q45A 2LCCA 2C0OA 4USMA 4NEYA 2D3ZA 3BQ2A 1HKAA 4UY8T 4USTA 1H3ZA 3IN5A 1VC6A 1YIJQ 3M53A 4XK8E 1YJUA 3HPWA 3QSYB 1J5EJ 4YB6A 3MUTP 4DFMA 2HMIA 4BBYA 2AGPA 2FVRA 1AWXA 1Q82T 2MKYA 3D0HE 2YRVA 1K44A 3POTA 1NRKA 3LWHA 1CQMA 3QKJA 1S6UA 2BKOA 3BSOA 3PZPA 3T1HJ 1F2HA 4DS4A 2FPHX 2M52A 1A7GE 3CWJA 1VQ5A 2JW4A 4DOVA 1YJ9Q 4ER8A 2IPOB 5K20B 2WOMA 3TA2A 4C92F 2NYSA 3CF5Q 3FQLA 1UAWA 4K4XA 3MD3A 5A2QE 5GJWB 4OZ3A 1JLQB 1ZSZC 3M5AA 2KDSA 4DX8H 5B0DA 1G8XA 2COYA 4DG1A 3BGUA 3R7BB 3UR0A 2BUDA 3JCMQ 2MQOA 3KLGB 1CG2A 4KB7A 2ZH5A 3B54A 2DBKA 1WI8A 2HHQA 3I55Q 4R5PB 2RH2A 4FT4A 5H1SV 1HBUB 2ATLA 2JS2A 2O4XA 1RA7A 5DG8A 4AT1B 4WFAQ 4FIBA 1EETA 2KR3A 4PQUB 5GAEI 2DR6A 4M78D 3MR6A 3FBCA 1T9UA 3BY7A 2XMMA 4GVLA 5K9FA 3IWLA 4DMZA 4EMHA 3ET6B 4AFQC 4N8OA 1YGYA 3PKMA 4LFBJ 2YUOA 4EI2A 3W2VA 1MMNA 5KT7A 3BSAA 2NUTA 5LJ5h 5LJ3j 3G4ST 4NE9C 1RTJA 4WZMA 5GAGI 2EYXA 3PFSA 3FBBA 2AJFE 4F26A 3W1YC 2BQUA 1S0OA 2D1CA 1FRJA 2XQCA 4U95A 4N0AA 3KJQB 3UVJA 3VS3A 2YHTA 4C0DC 3PIOA 4PFPA 1X4GA 1Q8KA 3M8SA 3HHLD 3SI8A 2ZH9A 1SUQA 2GVZB 4OLOA 4Y65A 3QT7A 2CPYA 2C3PA 5ETVA 2HFOA 2DJZA 1L5UA 2RDJA 2XD0A 4J5OA 3CDAA 3M1VA 2MQ8A 2VFRA 3JCMP 3US5A 4U96A 5IXBA 1BQMB 3M9QA 1I5LA 3EICA 1QKXA 2D8JA 1N33F 2RS8A 3N6NA 3AAWB 3FKBA 1RT6A 4ECVA 5DRKA 1KLMA 2J0WA 2M7SA 4DR3J 1NYGA 2C2EA 1FFGB 3I56Q 4M5KA 2VASA 1VR6A 3GFZA 4IH6A 4C7QA 3GYNA 4WFNQ 1S0VA 2CUDA 1RWMB 2DRDA 2QA4S 2NUPB 2HLUA 1J2VA 5JVGQ 2MQQA 4LD9K 1EARA 1TL7A 4NLOA 2L3QA 4OB0B 1U2CA 3M59A 2J76E 2ZBIA 3V7SA 1D09B 3DOLB 1UJ4A 5T7LA 4C8QA 1MN9A 3MR2A 2J6TA 1ZQ1A 3MR3A 3QNWB 4DCOB 4M75B 5D6WA 1NSPA 2L3MA 2DR7A 1FRLA 3EDRB 2R5MA 4NLUA 2Z57B 1UKUA 2RB6A 1WHHA 1G5VA 2MI6A 5K8OA 1QVFR 1CC7A 1TELA 1VYTA 5I42B 5KG4A 2Y1IA 3T5HA 2RK1A 3OQ5A 3JCMJ 3BREA 2VPWB 3CC2A 2V2QA 1VQ7A 4Q44A 1X5OA 2OJ2A 4G6VB 2KBTA 2MZRA 3AOCA 2NXCA 5A2QY 5C25A 2ED1A 3I5AA 1XMQJ 5C5JA 2Y3YA 2KFZA 3CPWS 2OIHA 2X4XA 3CC7T 1EQ0A 1R31A 1PC5A 2BQ3A 2HCKA 2ZH7A 5FLXY 2J6KA 3PVLA 2AJ2A 3CC2S 4QBUA 4DUYF 1S9EB 1VLYA 2HMAA 3K5PA 2YH0A 3LO3A 3IR7B 1OZ3A 5KG3A 1FWZA 2OO4A 1YKWA 3VAIA 4IYQA 3U27A 2HIYA 3L09A 1OY8A 4PJJA 2QLXA 3LAKA 2GGRA 1S6PB 2DO0A 2DD4A 5LSLA 1UGVA 4PL6A 4I2PA 3KUGA 2A0FB 3L2VA 2XB2D 2ERRA 1BY9A 4MT1A 3G2XA 4ZIVA 1JJ2R 5G0RA 4NA3A 2QGFB 2DITA 3UF4A 3L4BC 3H0HA 1CS4B 2KHCA 4I56A 4UUXA 3TRGA 3JB9F 4LR9A 2MMPA 3OXLA 3J80Y 3KLGA 3HHEA 1CJVB 1AB8A 4WK3A 3H4DA 1AEYA 2R58A 4BE0A 1FNOA 3E1SA 4ECTA 2KB2A 2EFNA 3OFHA 4C3LA 4IQMA 3PHTA 3N4WA 1K0SA 2LQBA 2ZVSA 3I5CA 4ZVSB 1YIJS 3O3LA 3HPOA 5KFWA 1BCMA 1WTFA 3SSSA 2VD3A 2GJ2A 3HM9A 3CMES 3FFIA 4LVOP 5GAHU 2DFUA 2BJ9A 2RMOA 4L3KA 4CH1A 3R1LA 2SRCA 2K2MA 3HRSA 5HLFB 2DJQA 3ZZYA 4USIA 1R3NA 4JI7F 1OJ4A 2HWHA 4JS4A 1HXDA 3DB3A 1N36J 2WBMA 2NLWA 2HFUA 3CCEA 4MYUA 2LXIA 5HMWA 4X84A 4F04B 1QVFP 3AJ2A 4QW2A 4DR3F 4ED2A 1TKDA 5J39A 1H74A 4DR2J 2MKJA 2Y0SD 2VGNA 1ABQA 5GADU 3GFYA 4M4ZA 1LNXA 3ZZRA 1Q8IA 4HHUA 5D6GA 1TTHB 1E7OA 2ZOMA 1N48A 2WBRA 2PFFB 2B51A 2EBEA 2ACMA 2HBYB 1T9WA 2EFIA 2MSSA 2Y0BB 1U1NA 4CNYA 2RH3A 2VKRA 2HAFA 1LVKA 4M7AG 3W61A 2HHHJ 3CCRT 4F25A 1XIQA 1RA6A 1REGX 4F3QA 3PO5A 2OPSA 2ZGWA 3NGUA 1VQYA 4PJOD 3QYHB 3IXQA 2B5JA 3OYGA 1YITA 2EGEA 1KQKA 5ETMA 3BM7A 5KFTA 2C28A 1G6BA 2CAJA 2M88A 1RAGB 3VUBA 1HK9A 4U8VA 2UXCJ 1RGVA 2BE9B 2OTJT 2OTLQ 4UZBA 2UUCF 3CCJS 4CM0A 1ZZFA 5HVFA 4DLGA 1RADB 3SQGA 3E8OA 4MKYA 2J6OA 2CVIA 2C3MA 1KR4A 2OAUA 4PR6A 4HTIA 3JCMd 1S6QB 3CCQA 1RHQB 4F02A 1PKUA 4H4KA 1VC0A 5GAMh 1AROP 2VBWA 5L8RE 3B78A 2D7SA 2LMIA 1GBRA 4IUQA 4C5HA 3R6GB 3HF5A 4HKQA 2ADBA 4URGA 3MFIA 3M2VA 4KE5A 2AX1A 1KC8R 2UVRA 1JLFA 3HT0A 3H2UB 2GIQA 3IGNA 3JAMU 2F8EX 1NPRA 3CB4A 1H7XA 2E1CA 2Z0GA 5A8WB 2UXCF 4MK9A 3RBZA 3T3FA 3UDLA 1SH3A 3TUIC 3CCLS 4CDIA 3TI0A 1PCAA 2QL9B 3HFVA 2C22A 3G86A 2E29A 1RI7A 1VCTA 4RUHA 1ZM3A 5HBMB 2DVJA 4C6AA 1JK9B 4XPEA 2B8QA 3TP2A 1W6XA 1UVLA 2CQGA 3R2CJ 3KK3B 3NS7B 3C15A 2JMAA 5LJ3g 3JCMb 4E7LA 2PE8A 4J9UE 2V8HA 2ZPHB 4QKUA 5ETKA 3EFRA 4C3MA 3IM8A 3G96A 4HI1A 1G3YA 3Q22A 1SPKA 2VVKA 3BSCA 5CQXA 4PUOB 1VQ6T 1VQMA 1N4LA 3O5TB 3U23A 3G6ET 2D41A 2C2KB 3G4SA 2YRDA 1VYVA 4M5LA 1LEOA 3NGTA 5GAMg 3SMZA 4GC6A 2GA7A 3GG0A 4F17A 3CC2T 1G7CB 4N47A 3UDCA 2HK2A 1D8YA 1TKZB 1M8VA 1V3ZA 3E9GA 2ZE2B 4M1KA 3PW5A 1YITS 1HD3A 2UUBJ 4UT4A 1FEHA 2LQ8A 2BYCA 4PYDA 3PE0A 2QTWA 1QP2A 1F3FA 1SHFA 3TCJA 1DTQA 5FDLB 2ASLA 2EK6A 3QGIA 1N6QA 2BZYA 3OS2A 4J8OA 1UEUA 5FRNA 1SC3B 2LZ6B 3CCSQ 2FVQA 5D0EA 4UF4A 3PACA 4OLPA 1U1PA 1KFZA 1TL3A 4LF6J 1A6LA 3R3TA 4CIOA 2HWTA 3GCWP 2KG1A 2ZKTA 4P74A 4ECZA 1W2BS 2QEXQ 1JLCB 3RIRA 4P2XA 3S6WA 1Q82C 4CH0S 3M8PB 1JXLA 4PJOE 3OBWA 1FFWB 1WJRA 2V4JB 4M8LA 3SZ2A 3EGDA 2BABA 4C3KA 4F4WA 3HO1A 2YNHA 2K5IA 3PXGa 1C0UB 1H8KA 3AXKA 3NHNA 2Y1LB 2CZ1B 4LF9J 1VYUA 1N34J 2C1EB 4EZ6A 3KXDA 2DNZA 2YKMA 4FVCA 3CMET 4TXSA 1NEEA 1Q81T 3M6VA 1IVZA 4PJOB 3CCTA 3HLUA 1NSAA 1U0HB 1MW7A 5F8LA 3CCLQ 1PD1A 1X7VA 1H2TZ 1TS9A 3G6EA 5CD4A 1K0VA 2OPRA 2YNGA 3GPAA 3NMRA 3PNWC 3VAJA 5B7WA 3C14A 4O3SA 3VALA 3VRZA 1RT4B 1QMCA 2G3RA 3PHEA 3MM8B 4NX9A 1UVMA 2KM8C 3OTDA 1OO0B 4JI5F 1X75C 3OSSC 1JX4A 1D8ZA 3GTYX 3N01A 1T8EA 4F3OA 4BI4A 1KNZA 4C92C 1GX5A 3BN7A 5F0WA 4MK7A 4AUKA 3RBDA 2OH2A 2CQHA 2XM3A 4M78F 5KFNA 1V1CA 2JMCA 3TJAA 4F7UA 2MOXA 2KZZA 4C0HA 3D1OA 3MM5A 3NCQA 3DI6B 2ZD1A 3MPVA 3IP0A 3BR8A 4ZCMA 1WF2A 2P9EA 3QO3A 2YTCA 1TKXA 1SL1A 1RAEB 5HQLA 5IHIA 1CC8A 1W1FA 2F9JA 1FKPB 1HHSA 1TL1A 1M5VC 3EM1A 5C42B 1VBKA 2E41A 2CJXB 2D8HA 3VR1A 2LJ1A 3M8YA 2V8IA 3VAFA 1K8AC 5J2MB 4FXVA 3OBYA 1RXOB 2BV3A 2NXNA 2PGCA 3I9QA 2HYIB 2HURA 1RI0A 3SQOP 3DLEB 3V2UC 5T41A 3T1AA 4KT0C 3E2UA 2HRUA 2HGNA 4OIXA 4R55A 1S48A 3OL6A 1YJWS 2J9DE 2OI3A 2OTJA 5DG9A 3SEOA 4TN2A 1M1HA 4DF8A 3OPKA 1S1NA 1NH8A 3W2VB 1HWJA 3VS7A 1SJRA 1X31C 2OX7A 2LQWA 1YJNT 1Q95G 1UTIA 3A8EA 2V6AA 4P52A 1S6OA 3DXSX 3T6BA 1SVDA 2EXUA 1WDXA 5GAOr 4JJNK 4I2QA 3C46A 3CCJQ 1BQMA 3JQKA 3PR4A 5FDLA 1YK9A 3GILA 1PG5B 2Q1LA 3EPGA 4QVDA 3AOBA 2KT8A 1O5JA 1LWCA 2K1RB 2Y4YA 1S1XA 3LP0A 1O6XA 4JLGA 4CO1A 1BK2A 3CCUA 4I1TA 4M77F 1RU2A 2BOAA 1UP1A 4JUVA 3I56T 1TV6B 5BR8F 4FF3A 4C98A 4ED8A 4PJOG 3OLAA 4WP3A 1OWXA 2E64A 5BXIA 1XWLA 4LIRA 2R7SA 1U49A 1Y07A 2I0NA 1NMEB 5FRMA 3VS5A 1HYOA 2ALYB 5KYUA 2DNMA 4K4ZA 3RU0A 2MIOA 2XY6A 5J2PB 1NDLA 3FC3A 4V2SA 4LR8A 4PWUA 1FX2A 3BO2A 1UB4A 4I2PB 4IG3B 1FE4A 2KRSA 1PAEX 2YX7A 9ATCB 1V9OA 3ILIA 3SD4A 4N41A 3K2YA 4X34A 2HBZB 3IBCB 2QQRA 4FP9A 2HAXA 4AE5A 1KQFB 1I6JA 5EGYA 1AT1B 3SBMA 1G4CA 3ZXWA 4QWAA 2F4VF 2GS8A 5KAKA 1UVKA 1RT2B 5IN1A 1M90U 3WVEB 2H1YA 4ID8A 2ZPBB 4D6WA 2E70A 4GVBB 4NZ6A 3ZTOA 1NEBA 5L1KA 4HVZA 3JCMc 1U1MA 3C16B 5GAN4 1HPZA 5CYMA 3PVXA 2RNAA 4KR0B 2XEXA 4WYLA 1VQKQ 4L5GA 2XHWA 5LJ3f 1ABOA 4BCAA 4ZCKA 3MOJB 2EPDA 2CNKB 3OYDA 1NAQA 3OS0A 2JTEA 4USHA 4USUA 4OFZA 2HBRB 3NNHA 2QA4G 2HZYA 4OJGA 2DHAA 3BGFA 3UCGA 4DSJA 2D69A 3Q8UA 2VFVA 5FD1A 1TXQA 5HO4A 1BU1A 1WLPB 3IG1A 1PHTA 7AT1B 1HNXF 4CLSA 5CK9A 3MAHA 2DEUA 2M2BA 4X4PA 4B9XA 1AXQA 2ZBPA 5E3AA 5HMYA 3QBCA 4DOWA 4WCIA 3OR2A 4E7HA 4QQGA 2G1HA 2XMTA 2MKKA 2K3BA 2V63A 3H5YA 2ABYA 2MEWA 5BYRA 1M2OA 3TQEA 1WC5A 2CUYA 2GC8A 2WCXA 4X4RA 1YSJA 1N8RC 5AXKA 2KN4A 2B8PA 4HT8A 3DLEA 4OMOA 3X1LB 2QQSA 1WG1A 3DOKA 5IOLA 5KYWB 1M3CA 1T3LA 5DM6Q 1R6YA 4CT9A 2VPZB 3DU5A 4Z2XA 2VU5A 1JXMA 1D9DA 1M2VA 1YJRA 3JB9G 2FZCB 3J7Z5 1VK8A 2P9CA 3EFSA 1HWUA 4DR6F 2VICA 4FT2A 4OHYA 2NUUG 1GXTA 2N82B 4TYBA 2XU8A 1RB0A 4JI1J 3ZZUA 3FSYA 4DOZA 5FIIA 2ZZNA 4CC4B 1YIJT 5D78A 3UCUP 4IR1A 3G8QA 2EW9A 5DETA 4DV4J 4NWBA 3HMJG 3SXLA 1XQHA 3WHIA 1CJTA 2Z0WA 1RUWA 2HVEA 1SC6A 2AHOB 4IURA 5KH6A 2ILZA 3UI3A 3IR5B 4M63A 2BJ8A 4OV6A 5GAOp 2HQEA 2JL9A 3NEKA 5IH2A 3BGRA 2H5IB 1SC1B 4K4TA 3JSRA 5IXFA 2C2DA 1N0UA 2V8PA 3PYFA 2E6NA 4H4MA 4BC9A 2YRCA 1RTIA 4MYTA 3A8LB 3ISZA 4F67A 3LUYA 1PGZA 1V5VA 4DL3A 4ZMMA 1FTRA 4DL0C 1Q7LB 5CYQB 4JI4J 3RR7A 1G3OA 5KFXA 2QMUB 3J80E 4LFAF 2LA6A 4PYAA 1UGQB 5BYSA 4TYAA 2YQ3A 4KBMB 1WQ7A 1HARA 4DL4A 3T19A 4BE1A 3MMAA 4M94A 3OW2A 4JYAF 1QD1A 4L74A 2CQ1A 3UA7A 4TY8B 2J8AA 1R8CA 4D3HA 3SV3A 2E5KA 2CPJA 4KUIA 3LH5A 5I3UA 4Q5VA 1PYTA 3PV8A 2CNOB 4J6WA 3CD6A 2O88A 5M2UA 2XYGB 4LRBA 4LE9A 3TU4K 4NLSA 3VAMA 4BB7A 1XNQF 3NL0A 1M1KT 4JZ3A 5KFPA 3QPHA 3M32B 1C1CB 3G8SA 1RACB 1NJIC 3FC9A 1XTZA 1K9MR 2IM1A 2I2LA 1HJDA 1KJWA 1UTAA 2NYIA 3OHAA 2W7OA 1CJUB 3UR3C 2CQBA 3VZHA 2OPQA 6AT1B 4RNOA 2OUGA 4CM2A 1KVJA 3O5ZA 1RCXB 4DN9A 3H2LA 1ZAWA 1NB2A 3OJSA 4OB2B 3D6HB 2DXFA 1XNRJ 2VQEJ 3V8JA 3VV0A 2WRMA 3JYTA 1BIAA 4FPIA 1NJIT 3H5UA 2DA9A 3NNAA 3OYCA 4B9LA 1JNRB 5CQYA 1U47A 2ZPEB 2DHHA 2DX1A 1T7PA 1GQEA 3DM2B 4OZJA 4JI0J 2DZ9A 1HNWJ 2RJZA 2LU2A 4M75E 4W92B 4A47A 4MZMA 3CCVT 4ZVQB 2EAYA 3ZTPA 2LEPA 5LJ3d 3C15B 1RTIB 1D0EA 3OYIA 2DNUA 1E6YB 2ADCA 1QVGR 1DBDA 1NZ8A 3VS6A 1A0NB 4QPXA 4CO5A 3EG1A 2QAZA 4KY3A 5KFJA 3SCJE 3HP9A 3PR5B 2BR0A 3TX8A 4ELVA 4FW2A 2QT7A 4U7UD 4C8LA 2GV1A 2M8DB 2KVQE 1HQEA 5DS7A 4M78B 4NMLA 4XPCA 3CCLT 4IR9A 3TO8A 1TL4A 2VQFJ 3MHXA 3Q8PB 3PNIA 3GWCA 4JS5A 2DL7A 3FZ2A 4KYZA 3S1TA 5LL6S 3THKA 1WHLA 2RB7A 3C19A 5KOWA 1NJZA 1JLGB 3G71Q 3EMTA 3C95A 4CLZA 2EI5A 1UZHA 2VG7A 4A8FA 3KLFA 3SHWA 3DHWC 1BLUA 3KJFB 1H6KX 1L3TA 1L3SA 4OI6A 4F0HA 4DZDA 1T0JA 4GO5X 1R27B 4HEA9 3BO4A 5AXLA 5GMKm 3GSIA 5IHKA 2VDHA 1UGRB 3CE8A 4M5DB 4IO9Q 4PRFA 2HZCA 1QSYA 4OYWA 2GVZA 2RA2A 4CLUA 2VG5A 3W9JA 3H2VE 3OW2S 4KFBA 5CZVA 2EFVA 4DR4F 4WP9A 2F40A 4QIEA 4PNOA 1EJ7L 1S1WA 1WTBA 4M7DB 4C11A 1QDUB 3FEOA 2L9WA 1LWCB 2K1RA 5I22A 4AMCA 3HD2A 1OU9A 3CDEA 2OGUA 3P6YC 3BYRA 4F14A 1YX2A 5EG2A 2P6SA 2VJVA 3ULRB 1TUCA 3KG1A 3JB9k 4ZHRA 4ME7A 1BB9A 3DRXA 2NZ4A 1BQNA 3T9ZA 2VQFF 5CQGA 4R0KA 2CUBA 3W62A 3N6LA 2QXFA 4B02A 5BYQA 2EC0A 4F0KA 4AFUC 5F3TA 2YQ1A 3ITHB 4KGZB 2BVZA 3QGGA 5CR2A 1UWBB 2EQKA 3QXEB 3UN2A 2ZDOA 3CTRA 1Y7PA 2ASYA 2QG9B 4C8QB 2GAHC 1M5SA 2DCUB 2R5AA 3QWUA 4NL2A 1B7YB 4EZ9A 2XIDA 3ZTRA 5DDOC 2HG4A 8AT1B 2GQVA 2CADA 4LSNA 3H0IA 1PILA 2YVSA 4XQ3A 3DDKA 4Q0BB 2DY9A 2YKAA 1N52B 1RDRA 3NPFA 3CMAT 5F8GA 1U2RA 3R2DJ 3JXOA 4WK1A 3TARA 1H92A 4B9TA 5KG1A 1RK8A 3MFHA 1JKHB 3ER0A 2LQ5A 2DY1A 4ZA1A 5HJXA 3LW5C 4ZVHA 1Z1ZA 1NK6A 4GC7A 2HMIB 4MZPA 3I0SB 4RW9A 1VQMS 2VFTA 1TKXB 2RE1A 3R7SB 3DDIA 4P73A 2D3UA 2P8IA 4M77E 2YNGB 1J3TA 1QLYA 5A0LA 4M78G 1FXDA 4ES2A 2KQWA 1FMKA 4C0DB 4X64J 2XGPA 3MMCA 1IR2A 1ZHIA 3PCOB 4DSIA 2DTJA 3LOUA 2PUOB 1RP5A 2QO3A 2R7UA 1K9MU 2XZDB 2EPIA 3DLKA 3LH0A 3FBEA 1QVGA 1RJJA 1RT1A 1K9MT 4FDFA 5KFVA 1T94A 3TVTA 1YRUA 4EUVA 1HNVB 3OL8A 3OR1B 1VQOA 4LRAA 2ZZDA 2FPEA 3BBFA 1IKWB 4JZ4A 2D74B 2HS0A 4J9BA 4C8NA 2KU7A 4B9UA 1DURA 2M4MA 2M9KA 3CXCS 1S4FA 1F5AA 2IFXA 3WC2A 1XBWA 3KLVA 3EGNA 4E7SA 3CULA 2DPJA 2XO7A 5ETLA 1Q16B 3TJ8A 4RW8B 1TZ0A 4Y34A 4XTXA 2J7KA 5H9EK 2H51B 1SH2A 3MPYA 3ZZOA 3S6EA 4HCBA 4FF4A 2QIFA 4OX8A 2H8HA 2B4PA 1VQPS 4PG7A 2W10A 2A1BA 2DL5A 2A37A 4ESRA 2HSPA 2RQKA 2JEGA 1N9SA 1MU2A 2QI2A 1Y11A 3AOAA 1JIHA 2NSCA 2ZNZA 4OMPA 5KCOA 3CC4S 1YJWT 1SG5A 2IHR1 3KOAA 2DRKA 1GCPA 1BHNA 3CJSA 4LFCF 3AD9C 2FJBB 5IM0A 2FHDA 5JVHQ 1RWWB 1FT8A 3REAB 3DCAA 4IG0B 2UV8A 4F7UF 6FD1A 1I1GA 2BIVA 1SUQB 3FSXA 1GCQC 2QASA 4HACA 1Y0HA 2E5JA 4KC5A 2V67A 2MQLA 4N4IA 3O8VA 1U1RA 1NEGA 1XQIA 1MNEA 3LPEA 3MF5A 4CT8A 1X4BA 4TU7A 3HXMA 3N28A 4X64F 1FRIA 2L9NA 3MEDA 4M7DE 3MJXA 2CP0A 2QDLA 4FM4B 1PNJA 5L9XA 4TY9A 4JJDA 1HBNB 3FDRA 2CJBA 5EUHA 2WK4A 1O9SA 1BI2A 2MYFA 3HJVA 1PRLC 2K5FA 3HD1A 4RWXA 4GLMA 1X0FA 2ZJPQ 4NCGA 2DXUA 1M4ZA 1YHQQ 5GAN6 1F6TA 2GMLA 2DXTA 3PX0A 1IJFB 2B5JB 1V5IB 4X4OA 2QYCA 4YY3J 3B8HA 2R8HA 2RQ4A 2XO6A 4V19J 1CSKA 4Q0BA 1URRA 1V3SA 4DQ2A 4Y2IA 2Y90A 2UXDF 4I0WA 4QPTA 3GIIA 1Q4RA 1WXUA 3M6WA 3OYKA 3RW7A 3L2WA 3I5RA 3TEGA 3V7RA 2OPQB 4WP8A 1FVQA 5AT1B 1LNQA 4JI8F 2COLA 2G0JA 4ECQA 2YPYA 4N77A 1QCOA 2P6TA 1YJWA 3JSMB 3UD3P 2OTJS 3A13A 4KHMA 3UWNA 3Q89A 3TVKA 3CIZA 1X43A 5K8MA 3CJ3A 4CH7A 2JTMA 3CC7Q 5HROB 4MZTA 2EBPA 2LC4A 1IKXB 1VHIA 1YTYA 1MV0B 3GLJA 2E3IA 3AHUA 3SIPB 1HNZF 2HS4A 5RUBA 4FSSA 1HNXJ 5L38A 3CPWA 3M2UA 4EO8A 4I7FB 2DIQA 2DBBA 5D77A 4XAXB 2L48A 3LWIA 2JXBA 2R9LA 1X6GA 1LWXA 1GCQA 4C0FA 4ED1A 3FEXB 2LECA 1IREB 3TUJC 4DBQA 1R0BG 4DEZA 4RU9A 4Z02A 4E7ZA 4DI6A 2N7CA 4NI2A 2F5GA 1X27A 2Q66A 2C0TA 3NCRA 3UN5A 5D6YA 3CMAS 4ORZA 4HYKA 3MP1A 4DL2A 1KOOA 3KTQA 4LUBA 5CKDA 2BOPA 1T3SA 1IBKJ 5HJYA 2I5JA 3X28B 1C0TB 2HBQB 4B9NA 3QDRB 1NYFA 1W4SA 1WHVA 4PUOA 2G9OA 3MUMP 1S9EA 4OX6A 2M16A 2M0GB 2OSQA 2VPXB 5E0OA 1QVGS 2E1AA 4ZVOB 1QAXA 4Z8AA 1IBLJ 1HQEB 3CCMA 3L2QA 1F5CA 2GJFA 3F0NA 2DILA 1B0PA 4X4VA 4X2BA 1OQKA 1VK3A 1M1FA 3CJ5A 4W90B 5EC7A 4I64A 2DJWA 5C7PA 1VIEA 4HXJA 1Q78A 1RBOB 3GBQA 1B3TA 1S59A 3FZBA 5KFFA 5LOQA 2JOYA 4A4HA 1HBOA 4DV5F 2RJFA 4YFUA 2IBKA 4ZVRB 3M58A 2XBPA 4AL7A 1E6HA 3R9LA 5J2NB 4JV1A 1NLKL 2XI2A 2V68A 3MTJA 4USWA 5C25B 3TVZA 2QYZA 4WBFA 4LBPA 4A8OA 1A9NB 1E6YA 2YBVA 2CYYA 3ENVA 3ME9A 2DNPA 1LK7A 1YDLA 3I4PA 1K9MC 2DK3A 2VG6A 3M32A 2J7IA 4EPCA 1D0XA 4NXMJ 2CZ9A 3QO9A 1IN0A 1YLXA 3FDSA 3V8LA 1FA0A 3UCZP 1PSFA 4ELYC 3CC4T 2YKQA 3TX0A 5H9EJ 3JSYA 3TUZC 3ZZTA 1JLCA 3BJYA 2DBMA 4TLRA 4IKFA 4ZTFA 3IO1A 2DTOA 2FZGB 3OW2R 4U7CA 3MOZA 1KIKA 2AZ1A 2VC0A 1Y9OA 3M6UA 5K8PA 4JI4F 2ASJA 2YPZA 2NREA 4YDDB 2DRBA 1TUDA 4D8DA 1VHFA 4PABA 3EJMA 4DPOA 3TWZA 4EMKB 1K73C 4FKXA 4K5SA 3HHKA 4AG2C 1OU8A 2Z2MA 4Y2CA 5CZXA 4RZRA 2J9CA 5GAOm 4RNNA 7FDRA 4GLKA 3CGIA 4C0OC 1D3BA 1KG1A 2KT1A 1WACA 3DGPB 1O51A 2RJEA 5EN1A 5KFIA 2F2VA 2JH3A 1LW0A 1XR5A 2EG2A 1Y5IB 4YEAA 3RBEA 2WVCA 3V6DA 4ZDNA 1OYDA 4NI2B 5L8RC 1W26A 4PFOA 1UJ0A 5D4OA 2QV6A 1ZTWA 3QJLA 2YKMB 3Q8SB 4J6YA 2VPYB 1IBCB 4EGLA 2DNKA 4CYUA 4JRIA 2CZ4A 5M9OA 2HQGA 3HSJA 1ZSZA 1KRPA 4LNPA 2X9HA 3PX4A 3D66A 2DETA 5KFAA 3NBPA 4ZGJB 5ETOA 3GR0A 4RW8A 4U67Q 3HRUA 2MZSA 3PDNA 4C92E 4OHWA 1Q8LA 3ZZZA 3OFFA 2DGTA 2MPXC 1ZA1B 5T7LB 3M56A 1MLAA 2RQWA 5HP1B 3GIKA 1JLBA 1HI0P 1QW1A 5B09A 3BYPA 4YUDA 1VMBA 2QEXS 2DPPB 1ZBXA 2JJ9A 1VA7A 1UHCA 4ZLPA 1VQ9S 2G2YA 2EW3A 2J0XA 3H4BA 3CSKA 4G3IA 3OYYA 4K0KJ 1T03A 4EBCA 1FO1A 1ZYQA 2LYVA 2V9KA 3MEKA 3CT9A 1IQTA 4CRIA 2DKOB 3OTBA 3RKXA 1RTHB 3LW5E 3FB9A 1GK8A 5SZTA 2DIUA 3M0UA 2V26A 4LF5J 3P4UB 3AJDA 4JV0A 2JOQA 4LDWA 2Z56B 3ILOA 1FXXA 4K0KF 3EDQB 1TU0B 1VQ4Q 4ZVEA 2RRBA 4NLDA 3JB9I 4U8YA 1LWEB 4Z89A 5J1PA 2RDIA 2DR5A 4E6RA 2WTFA 2NXEA 2ZDPA 3EVOA 5KFQA 2MKIA 2V34A 2DM1A 5D4LA 1NU4A 3HVAA 1HQUB 1QE1A 4LF1A 1K0XA 4NA2A 2IVWA 3TNVA 4C0ZA 3BDEA 1FNMA 1RZMA 1W70A 2YLBA 1PC4A 2GX8A 3J7YU 5IAYA 1WF0A 3TW0A 2ZH6A 3CBOA 5AE1A 1KKHA 3CCRS 1B7TA 4HA8A 3LA0A 3FBFA 2PA3A 3DKDA 4B3RJ 2MLXA 2OMOA 2G2ZA 3F56A 1NLOC 1U1QA 4FCYA 2X3XD 1IZ6A 2OEMA 3CCSS 1EX8A 2NCKL 5BR8J 2KRNA 5F9LA 1BYMA 2GTJA 4AXIA 3GV8B 2MF2A 1C0UA 4ES1A 4DR1J 4YDXA 1N34F 3W3SA 3DGVA 3EGVA 3F41A 3K59A 2A10A 2V2VA 4OHVA 1M5PC 3BDLA 4FBTA 1M5KC 1XMOJ 1YWPA 4OX9F 2CWKA 3ENWA 1BBZA 2KFYA 1NZ9A 2YLCA 4G1IA 2DVIA 2CG8A 3QRQA 1TP7A 4F4YA 3CCMS 2J06A 3EH1A 2P0QA 2PN6A 3W65A 1FI4A 2R2SA 1VQ8T 1VQPT 1H2UX 3IGVA 4ETZA 2RUSA 4E0DA 4LUDA 2IA0A 3J7A1 4ZP8A 4R56A 5DO2A 5M2RA 1C6VX 1S12A 3Q8QB 2KT5A 1H7WA 3DMJA 4ZCLA 1SV5A 2M8HA 3GPLA 3QIDA 4KAIA 4UQTA 5KT6A 3JB9D 2MTLA 3R6OA 1N5SA 3QWXX 3K8WA 2ZNYA 3TAQA 3FSIA 1H73A 2KT3A 3BQ1A 4F4ZA 4QW9A 2AK5A 2B6AA 3OD2A 2F4FA 3OXFA 1S7IA 4F2SA 3OBIA 3EG3A 2HRYA 4ED5A 1PBAA 2RQTA 3BGRB 2N4DA 4ZLLA 2BA9A 1K76A 2WHOA 5GMKe 4Y2MA 3RB6A 1JQQA 2CPDA 4NXMF 2G6FX 1HSQA 5B0FA 4A4EA 3BH6B 3FNNA 2W2OP 1LK5A 2QA1A 2J7WA 4ZPDA 2K7KA 3K8VA 4XAKA 1OMSA 2XNRA 2HNYB 2E66A 3QT5A 4LSLB 5DQHA 2FD2A 3KNGA 2VUBA 5B0GA 2R7VA 1J27A 4R5PA 1RWUA 1N0VC 5EDWA 3UO0A 2HNZA 1YI2T 2WSFC 4DX7A 3MCOA 4RMOA 4KV8A 2IYIA 4RNFA 1NHKL 1FHTA 1DLOA 4B9WA 3W2WA 3FRYA 2GAGC 2R2TA 2X3DA 4FPRA 4DXLA 3G1JA 2RHSB 4RTZA 1K73R 1AWWA 1L3UA 2VWFA 1C1BA 4NCAA 2FJEB 3CCJA 1OY9A 2GFUA 4OYMA 1VQ8A 4P2FA 1OYXA 3X26B 3WDOA 3ZFVA 4QT7A 4USJC 1CKAA 2YY3A 2VH7A 1S0MA 3TSWA 2PEHA 2W4CA 5CCLA 1K73T 2GNCA 4BE2A 3VWSA 3UQSA 4OYZA 3CDWA 3HP6A 3P49B 3G9CA 2B86A 4PJOF 4ECWA 1J5OB 4M78A 2AKLA 2O5DA 2CQ0A 3JCMW 1FYNA 3ZZPA 2V9WA 3QFWA 2CYZB 3KMQA 3BKFA 1GH8A 2WVFA 2CPHA 2ROTA 1B07A 4OGEA 1SB6A 1WJSA 2RHUA 1RTDA 1DFDA 3TAMA 1KFDA 2APOA 3V4MA 3MEDB 2QFIA 3V6KA 1SJFA 3ZTQA 1WEZA 5A8RA 1Y4ZB 4AD6A 1NJWA 3CJKB 5DLFA 1KHIA 1B0VA 2L9DA 5FWBA 1HLWA 3EZOA 1UMJA 1VBXA 1N88A 2MQNA 4FVMA 1M1KR 3GNFB 3DLMA 4JRKA 4OZNA 3T9NA 5D4PA 4HI2A 5LM7E 3IBFB 2Q6BA 3I56A 2MHEA 3S3NA 5GMKh 2NSBA 3R5GA 4DUZF 3HHNB 2C2NA 2FHMA 1NJIR 2XS7A 1BE4A 3PTWA 2VG6B 3MM8A 1AUDA 1NK9A 3UA6A 1QVGP 3MEAA 2A18A 3NOCA 2J6UA 2PVOB 5LMUJ 5E2QA 3D0GE 3SV4A 4DV7F 4MFBA 2DGSA 3CPWP 3CCMT 1FRKA 4NXNF 1YQHA 4V19X 5DQGA 4NLRA 1DARA 1IR1A 2ZBQA 2BRLA 2UXBF 3GSDA 1M90R 1VIXA 5I4MA 3HHLA 3OVSA 2MXYA 1S1UA 3DYAA 1WXTA 3L2UA 2V4QA 4RPFA 3T5JA 4ZN1A 1QJHA 1D1CA 3LGMA 1DTTB 4J9KA 1Z2ZA 4C48A 1S72Q 1C1CA 4LDVA 4PCQA 4JI8J 2RMLA 2YWGA 4X4TA 4RNHA 4JPBW 4B08A 1F9EB 2MY7A 4X4NA 1TVRB 2IJNA 5HCKA 1FK9A 2OSRA 2EFGA 2FVSA 4M7AE 4LF7F 2ZC3A 2J9EA 1I07A 2V1QA 4DFKA 1W7WA 5E7OB 1MUZA 1U09A 3GV7B 2FVCA 4NL5A 5KG7A 3HRTA 5HL7Q 1TK8A 4TLQA 2XMWA 1G3TA 4B9MA 3AY0A 3RRGA 3FGVA 1Q82U 2V1RA 2GFFA 3WBZA 5IC6B 4GKKJ 4JDSA 3GYXB 1YRXA 1Y96A 1CQNA 4X9CA 2RF0A 3VKIA 2LLZA 2DXDA 5E41A 2IRYA 3OYLA 1LPLA 4OMLA 5HKCA 5H9FJ 2Q3PA 4KH1B 4PZVA 3MEEA 3VCDA 2ZPGB 1VQ5S 1RSCA 2HZAA 5HVGA 4PKCC 1UW9A 2DVEA 4JBCA 3PM9A 4QJVA 4IH7A 2JTFA 4GMKA 1RTJB 2W25A 1BIBA 4FYWB 3FRNA 5L46A 1OPIA 3META 1SBRA 4C8QG 2DGUA 1QP3A 2ZJQQ 4LFCJ 1PIEA 2IVMA 4UW2A 1SH0A 4BY6C 4CCHA 2HD0A 4M7AF 1JLQA 1QWEA 2ESWA 4RW7B 4J9DA 4WCEQ 4XTYA 4ED6A 1QWFA 4B9SA 1RI9A 2E5LJ 3I9ZA 3QPIA 5GAMj 1RYRA 4IFYB 3TEEA 3WX4A 3ILJA 2W7AA 4FF2A 2JLFA 5SUHA 1N5QA 4P6QA 3RR8A 2XI9A 3M4GA 3ZNJ1 3IC1A 3NS5A 1SQGA 2XY7A 2FHOB 1SPBP 4OJ1A 3A8IA 2W9BB 1KBRA 2QLFB 2Z2ZA 3N5BA 4IG3A 3TSZA 5IFMA 3QRRA 3X3UA 3B4DA 4LFAJ 1YBUA 2HWIA 1KD1U 4KFBB 1N54B 3QLHA 2C3YA 4LMZA 5GMKj 1EIYB 2AKKA 5K5MA 1QUPA 1KSWA 1H3DA 4UZCA 2CKWA 4PG5A 1SQFA 4DUYJ 3QIIA 4OV1A 2VXEA 4OI1A 1ITPA 1OZ2A 4ECXA 4QU6A 1N9RA 2HHVA 1KLMB 2ZH3A 1M1KC 2H3EB 2HEKA 3A1PA 4J91A 1U8RA 4B3TJ 4KUDK 2HFSA 4JJBA 2DL4A 5FU7B 1BWVA 5H9FK 3ZEHA 3JTPA 3CCMQ 1TKZA 4J9VA 4QQ6A 5IC4B 3AT1B 1KHCA 1RT6B 5DM7Q 1EQMA 5LJ5Y 1FK9B 2RM4A 4I69A 4DR4J 2HNIA 2O01E 3RW6A 3TZWA 4ALZA 3OR2B 1AZSA 1TUVA 5GANf 3C4SA 1JXVA 3MEUA 3CCQT 1RWVB 3GIBA 3OSVA 2VYTA 1ZM9A 2MK5A 1PCXA 4DPWA 1N5YA 4Y28E 3H8YA 5ETPA 2E1HA 3EG9B 1HBMA 1NSQA 3R5JB 4ZPAA 3V4IA 3KJNB 4HR2A 2C42A 2HW3A 1UL3A 1WHKA 4TVRA 1MMDA 3NBPB 3ENQA 4HCCA 4JI2J 3VQSA 5EWEA 3HHDA 4URQU 5HMXA 1QUVA 1JU5C 4ED7A 1E6GA 3TEHB 3NXZA 3MCNA 2KRMA 2YKNA 3QSIA 4ITSA 4BHQA 3KKFA 2FYXA 4LSLA 1MNDA 3M8WA 2SEMA 2QMXA 4M77D 4PEOA 1TL1B 2IRXA 2K06A 3DLHA 1S1UB 1BWEA 3PW7A 1VQLQ 2CNNB 1VQ9T 2YNIB 1T3OA 2BXJA 3CUNA 4LQ3A 1NNDA 4DBFA 2DO3A 3DKMA 3GONA 1I3OB 2HNZB 3G7ZA 3SYZA 3GJRB 2P0KA 1Y7XA 2DH7A 4HT9A 3FCVA 4V1Ak 4CLFA 4Y2AA 2RPNA 5LJ5d 3TVYA 1PRMC 1RT1B 3OV7A 1LWFB 1AOJA 4YR3A 2BANA 1WHJA 1W2IA 4ID5B 5DJBA 5I2SA 3G87A 1S0NA 4F4KA 1RLDA 3I4HX 3ADAC 3MM6A 3THVA 1N32J 1QKWA 1BC6A 5KFEA 5GAHI 2F4VJ 1FJEB 1HI1A 4WTYA 2WZ1A 1ZUKA 2E44A 1YHQA 1Q81R 4U7UK 4ED3A 2HKQB 1HMVA 2JEIA 1KK7A 3E01B 2AP6A 3M0PA 2DK2A 4M77G 1F9HA 1OS5A 2EQJA 1VQMQ 1EB0A 2KG0A 3J7AF 2EJ9A 5HMZA 3VJPA 2NWMA 3PX6A 4DPXA 4HACB 4C4WA 1VQ7S 4OZ1A 5J2PA 1FJGJ 3A8OB 2CGHA 2GGPA 4FNIA 3MMAB 4BDYA 1VQ5Q 3AB2B 3MCAB 4RTUA 1VRTB 4I6YA 1SIWB 3GIMA 3BQ0A 3GOXA 3R6LB 2CQPA 2IMWP 3B82A 5D4NA 1RAFB 3JRZA 2V4RA 4GKKF 3CCQQ 3BDPA 3TZZA 3KUEA 4KQZA 1IKVB 3EVMA 1WQWA 1DQ8A 2FJWA 4J9CA 2RUGA 2DYAA 1VC5A 5A2QU 2NYHA 1Q7YR 1HA1A 4N8NA 1GTEA 5D3GA 4CTAA 1TK5A 3FIFA 2AGQA 4ZVGA 4ANJA 1TL3B 3FQKA 2FHKA 4DEYA 4QQBA 1LCKA 1UE9A 4OMQA 1GBQA 1VQ8Q 1A0OB 2GW8A 1UFWA 3CC7A 2CJQA 4LF7J 2GVDB 4J7CA 3P5BP 3DU6A 1RHKB 4A8WA 1GL5A 2HGMA 4HH0A 3MAAA 1IUJA 2IM2A 3KFWX 2J6FA 1QQJA 1Q7YU 3OJUA 3H90A 4BI3A 3AD7C 5J2QA 1H0HB 2AJ0A 4DQQA 3EH2A 2MZJA 1N5YB 2R7RA 4PPZA 2H9ZA 3R6NA 4QR1A 1WIEA 2XYPB 2XMUA 2CT3A 1NBEB 5L23A 2B43A 4LSZB 2XCPA 2Y1RI 3FVYA 3VZIA 4DPYA 4JI6F 1XN9A 4DR7F 1S49A 1AHJB 5DY9A 2YT6A 2BANB 4HVUA 4A8MP 3D28A 4P72A 1UCNA 4ZPTR 2GVDA 3DDNA 3MM9A 2V0NA 4WE1B 1PJ7A 5LJ5g 4LBIA 3PW2A 1HFEL 4F7UG 3VS1A 3MTKA 1HW8A 3FFIB 2BE2A 4EU0A 2KKHA 3FJ2A 4C5GA 1RLCL 2QTXA 1P9QC 4ELUA 3IG1B 3HVWA 4RNMA 1R8AA 3JB9H