3JCMe

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcme00
4M77E 2YLCA 4V2SA 4XQ3A 4EMKC 1H641 4C8QD 4M7DG 3HFOA 3SWNB 5GMKm 4MMLA 4XTXA 4WF2A 5GAOq 1U1TA 3SWNC 5GMKj 1B34B 5GAMg 5GAMd 3V7CA 5GAOl 4C8QE 4M7DE 3RESA 3V8KA 4M75C 1M5Q1 4F7UF 3L1AA 4JRIA 5LJ5g 5LJ3g 5LJ5d 3JCMX 2EJGA 3GIBA 4QVCA 4M7AA 2JN0A 4DQ2A 4PJOC 2DZCA 2E65A 4F7UB 1WPYA 4M78A 4QVDA 3JB9H 4XTVA 3JCMc 2RB6A 4M75G 5GAN7 2E10A 3V8LA 5LJ3h 1D3BA 4A54A 5GMKl 1U1SA 5GAOm 3V8JA 4HA8A 4M77D 4PJOG 2E41A 3JCMP 4XU3A 3BY7A 5GANe 4M7AC 2VXEA 4RCCA 3JCMe 2EAYA 4EMKB 2DZ9A 3PGGA 3AHUA 3SB2A 1TH7A 5GANf 3RUXA 4XU2A 1KQ1A 2VXFA 3JCMf 2EJFA 3EFSA 4M75F 4C92A 4M7DD 3EFRA 3QSUA 5I21A 3RERA 4HT9A 4C8QA 4M7AG 4F7UE 1JBMA 2DXTA 4PJOF 4N0AC 4M75B 3BFMA 1Y96B 2RD1A 2ZGWA 4NOYA 3RKYA 3JB9G 4JUVA 5LJ3d 5GAN2 4PJOB 5GMKh 3M4GA 5GAN8 3BDUA 1WQ7A 3QHSA 4M7AF 4J5YA 3JB9J 4A53A 2K57A 5GAN4 3HSBA 4M75D 3JCMV 2RM4A 4XTUA 1I5LA 3JB9F 1X01A 4M7AB 3RIRA 4C92G 3L2ZA 5GAMe 5GMKi 4PJOD 1JRIA 1WQWA 4NL2A 3JCMW 4M77A 4M75E 4M78C 4X9DA 1BIAA 3BW1A 4X9CA 1D3BB 4C92D 3FIFA 5GAMf 5LJ5e 4PJOE 2CGHA 5LJ3f 5LJ5f 1LOJA 3RKXA 4M7DA 4JLIA 4XTYA 3FJPA 4C92F 5GANj 1N9SA 2DKGA 4M78G 4C8QF 4MMKA 4M77C 1LJOA 2FB7A 4XU0A 2EWNA 3RKWA 3JB9D 4C92B 1N9RA 4M7AE 5GANh 2DEQA 3JCMh 4C8QB 4EMKA 4C92C 2E1HA 4Y91A 4C8QC 3JCMQ 4M77G 4XU1A 4RCBA 2I2LA 3QUIA 2RA2A 3V7SA 3SWNA 5GAOn 2DXUA 4NL3A 4M78F 5DY9A 4PNOA 5GAN6 4OP0A 3QO3A 1B34A 2DTIA 2YLBA 4M75A 1HK9A 2FYKA 5CAIA 1M8VA 4M78B 4C8QG 1YCYA 4PJOA 1I4K1 5LJ3e 4XTWA 4M77F 2HNIA 4C92E 1MGQA 4F7UA 2DVEA 4JRKA 3JB9I 3JCMb 5GANg 5GAOr 5GANd 3JCMg 3VU3C 3V7RA 3INZA 3JCMd 4M77B 5GAMj 2EJ9A 4M7AD 1KQ2A 1BIBA 2E64A 4M78D 4M7DF 4EMGA 1HXDA 2Y90A 5LJ3j 2VC8A 5LJ5j 5GAMh 2DTOA 5GAN5 1WNLA 5GAN3 4M7DB 2QTXA 4M78E 5LJ5h 4J6XA 1I81A 4EMHA 4M7DC 4J6YA 4XTZA 3FB9A 2YHTA 4N0AA 3JCMJ 2DTHA 5GMKe 2DJZA 1I8FA 3HFNA 4F7UG 5GAOp 4HT8A 1LNXA 4J6WA 1Y96A
chains in the Genus database with same CATH superfamily
2SEMA 4HVUA 3SWNB 2HZYA 3M59A 4RTZA 1NJIU 1W1FA 1V29B 2X4XA 5GAMg 2RJFA 2X35A 3KBGA 3CCQQ 4LD9K 3A8LB 1YN8A 2M9UA 2VV5A 2JN0A 3VS0A 1VQ5Q 3LGLA 3EAEA 1GL5A 2JW4A 1VQPQ 1M4ZA 4KH1B 4HCZA 1K0SA 3SB2A 1PKTA 1KQ1A 2VXFA 1AEYA 1RLQC 1XOVA 3CCRA 2EYXA 4RMOA 1Q81C 1VQ7T 2V26A 2A08A 1KC8R 4FU6A 3NHNA 2KDSA 4M75D 1M8MA 1VYVA 3VS6A 4HVWA 5KYNA 1IZ6A 2DRMA 1JRIA 1NJIR 2L3QA 1TXQA 4GY5A 1BI0A 2DL8A 4PJOE 1BU1A 2OAWA 3J81E 3RKXA 1M2VB 4JLIA 3FJPA 4JZ4A 3CXCA 1YJWT 1VQNQ 3JB9D 3PVLA 1N9RA 4F16A 3FRNA 3I5SA 5C0MA 3CPWS 2RA2A 4RUGA 5I22A 3QPHA 4GLMA 1WDXA 1ZUYA 2CT4A 2H8HA 1PRLC 1VUBA 3CCQT 1VQ6A 3LW5E 1BI1A 3G4SQ 2MPXC 5GANg 1VQ5T 2EJ9A 2X9HA 4LDYA 1UHCA 3F70A 4X1VA 1YJ9A 1VQPT 1U8RA 2DTOA 3OYCA 1P92A 4A63B 1PSEA 2F5KA 4M78E 4J6XA 2E6NA 2KYMA 4C92D 1WXTA 4ANJA 1TS9A 4JJNK 2HL3A 1GFDA 2GNCA 2HBWA 2KXDA 5LJ3g 5LJ5d 1IRXA 2E3IA 1JU5C 4O5VA 5I2SA 1OU8A 2JMCA 1V76A 3M57A 5HCKA 4BD3A 2RHZA 2EQIA 2SRCA 4RCCA 4DBHA 3JCMe 3LX7A 1TH7A 5A0GA 2COWA 2RJCA 4M7DD 2M02A 3UF4A 1NZ9A 1QVFA 1VQNT 4C8QA 1O75A 4BY6B 3CMAQ 1OQKA 1IHWA 4JUVA 4J8OA 4PJOB 2PVDB 1UHFA 5GAN8 3BDUA 1WQ7A 3MP6A 1ZLMA 3THKA 1SSHA 4O6JA 4CC7A 4C92G 4CC3A 4MZMA 2BE7D 4NL2A 3G4ST 1NPPA 1PM3A 2KT1A 5DLOA 1VQ9A 5IXBA 4IURA 1XJWB 1VA7A 3EG3A 4XTYA 1W2BS 4OF1A 2WSEE 4R55A 3T9NA 4M77C 4XU0A 2KR3A 5D6WA 3G6EQ 2XK0A 2DD5A 4C8QB 1ZSZC 2K3XA 1SPKA 2RQUA 4DEYA 1CKBA 1OV3A 2NWMA 1PHTA 1VYUA 1ZQ1A 5CKEA 4M78B 1LCKA 3TVTA 2HBPA 2MMPA 3A8GB 2DEUA 1IXDA 2DJQA 1BK2A 3N5BB 4K11A 5LJ5j 3X26B 1KG1A 5KYYB 1Q7YU 3M55A 1D0YA 4PJJA 2DO3A 2VGMA 4EMHA 2ATCB 2Y4YA 1UGVA 1GCPA 4II1A 3CMAT 2XDPA 5GJVB 4FSXA 1UJ0A 1FYNA 1K73U 2WSCE 2PU9B 4F7UF 4RTUA 2AZVA 1Q86U 5IT9E 2F69A 4DQ2A 4HCCA 3H6ZA 2E65A 3MHXA 2EBPA 1KK7A 1WX6A 2EYQA 2RHIA 3X24B 3ME9A 1I5OB 3V8JA 2KYBA 4M77D 2CUDA 3RDVA 1WHKA 4EMKB 3PVQA 2LC4A 5FW9A 2BZ8A 1E7OA 2DAQA 2YUOA 3EFSA 2V1QA 1JJ2P 2X3XD 3G6ET 4HVVA 3MKDA 4JJDA 4NS5A 2RQVA 2EGCA 4NOYA 1Q7YR 4MDXA 2B8AA 1FX7A 4AFUC 3MEAA 2OX7A 1CSKA 2EQJA 3FLGA 2XDBA 2RN8A 2YUNA 3VRZA 4PFOA 3VYHB 5GAMe 5GMKi 2XG8D 3EFOA 4BUGA 2DD4A 1FMVA 2DL4A 2DXCA 1BIAA 2YWWA 3FIFA 1G3SA 4ZGDB 3J80E 4C0DB 1VQOA 5D6XA 1N9SA 4MMKA 3UT1A 2YSQA 2LQKA 1AZGB 2DL5A 1Q82U 3LGFA 1IGUA 2IVWA 2GF7A 2ZPIB 2YDLA 4M77G 3MJXA 3M0RA 3RMSA 4E7KA 1KIKA 2LMJA 4QQ6A 5CAIA 2L3PA 5FROA 3CCVQ 3I55Q 5IN1A 2GTOA 3EFOB 1ZUUA 3I56A 3CCSQ 2YUQA 1GBQA 2FZCB 3LH0A 2CP0A 1AHJB 1MHNA 4ZNXA 1IHVA 4FL6A 5GMKe 3OYMA 3CC7Q 3HRUA 1NPRA 1OULA 1UB4A 1WHLA 2YLCA 1B07A 4IIOA 3CCMQ 2MIOA 2LNHB 4FCYA 3H0FA 5GAOl 1NG2A 4OMOA 3REAB 3ZEHA 1R8OB 4L6V5 2DM1A 4ME7A 4PFPA 4GLKA 3REBB 3QDFA 5GANe 2VXEA 3AHUA 3RUXA 4M75F 4XAXB 1VQ8Q 1QWFA 2H3JA 1WJRA 1UGPB 2P4TA 2ZGWA 1WHHA 3CCEQ 3PNWC 4LUDA 4P5NA 3QBYA 4QW2A 1TU0B 1EIFA 2RJEA 5HKCA 3QXEB 1I0CA 4XTUA 1VQKQ 2ROTA 3CCVT 2JZ2A 1W70A 1WXBA 2AKKA 2K4YA 4UC4A 1I5LA 3JB9F 4PJOD 2LCSA 2DRKA 5DM7R 2QDYB 2IIMA 3BW1A 4CC4B 8ATCB 2E5KA 3CCST 3PT9A 1Y0MA 1K9MC 1OOTA 1NBEB 2AKLA 3RNJA 1Q95G 3KXTA 3RKWA 2PZ1A 4M7AE 1RAAB 1UG1A 1T3LA 1YNZA 2M16A 2I2LA 2V8KA 3M0PA 1N8RU 3M0QA 1H92A 3OYDA 2CSQA 3CCMT 1I07A 2L3SA 4KUDK 1Q81R 1PD1A 5C6SA 2NUPA 3PFSA 4JRKA 2CKKA 1GXIE 2YRDA 2O4XA 3NTIA 3H41A 3VUBA 4BB7A 1WHMA 3M4YA 1NLPC 4M78D 4LE9A 2VC8A 2DX1A 4JRQA 4R0KA 4AFQC 4JLGA 2DYIA 1NLOC 5HK3A 1VQMQ 2D9TA 2RO0A 1VQLA 5D6YA 1Z9QA 1IGQA 3SHWA 1VQ8T 3M9QA 3CD6A 4XQ3A 3L2QA 2CZ1B 3CCET 4X34A 3CXCS 2B86A 3VS5A 1KD1U 2EQKA 4J9DA 1BBZA 3L1AA 4KGZB 2O88A 1O9SA 4KH0B 4M7AA 2NUPB 2EYWA 1NEBA 3HP9A 2O4XB 3OYFA 4N4GA 5GMKl 1AWWA 3C4SA 5AT1B 4PJNA 1VIEA 2PQWA 2RNAA 1UJYA 2QA4A 2MYSA 1SSFA 4BE1A 4N0AC 2GTJA 1UEBA 2LX7A 4E7JA 5LL6S 3OYBA 3JCMV 4M7AB 1GCQC 2ZZDA 1K1ZA 1KQSP 1KD1R 4JJBA 4DBRA 1QVGP 4J83A 3MP8A 1HSQA 3META 1QCFA 1VQMT 2HMAA 4ZGJB 4C5IA 4OB1B 4RCBA 2MI6A 1VQ7A 1M3AA 1QVFS 1QVGA 2A7YA 4OMNA 1K0XA 1OX9A 2HNIA 1AWJA 3L42A 4AT1B 4Q5WA 1JB0E 2K9GA 2M0YA 3TEEA 2QTXA 1YJNQ 1I81A 1B3QA 1HYOA 1XTDA 2RK2A 4FYYB 1YJWA 2QDLA 4KGXB 3FB9A 4XTZA 4J9FA 4E7SA 3EG9B 1M30A 4F7UG 1M90U 1QVPA 4JDSA 5I11A 3OYAA 4V2SA 2ED1A 2CT3A 5GMKm 4WF2A 5GMKj 2VASA 5KH6A 2QK0A 4M75C 1M5Q1 2VWFA 3JCMX 3CCQA 3UATA 2A36A 2LVMA 2L2PA 3C94A 3FJ5A 1VQ5A 1WZOA 3OBWA 4CC2A 1VQPA 3S3MA 2DIGA 2F2VA 1SKUB 1U06A 3FDRA 3M5AA 3S3OA 3JCMf 2JM9A 2FO0A 4ZN1A 3KFVA 1JBMA 3CC4Q 2X4YA 4AG2C 2K79A 1X43A 3A1PA 3PIPA 2ZPHB 1M90R 3P8HA 2FPDA 2HD0A 1TOVA 4R56A 1K76A 1D0ZA 4DOWA 2CYZB 2K6DA 2JJ9A 4ESRA 2AHJB 3ULRB 2CGHA 4M4ZA 1T0HA 5A0LA 3CC2Q 3D7SB 1YJNT 5L8RE 2QQSA 1VQNA 3E9FA 4C92C 2H3EB 1GRIA 3A8OB 3LH5A 2LJ3A 1BCMA 3CBPA 1UUEA 2RH2A 3OYIA 4XTWA 1ACMB 2KY9A 3G4SA 2JS0A 4PLLA 1I1JA 2YT6A 1HXDA 3CEYA 3JRZA 4KUIA 2DLPA 3OBYA 4BI8B 2K5FA 2F2WA 2KRMA 4M7DC 3QWXX 1ZUKA 2PTKA 3S3NA 3CC4T 2O2OA 3TSWA 1SRMA 1U1TA 4C8QE 3V8KA 2KGTA 4RG2A 5IAYA 5HK0A 1GFCA 1XQHA 1M1GA 4M75G 1ZA2B 1U1SA 1G3WA 1UE9A 2CDTA 4A4HA 2HEQA 1WXUA 4D6WA 1SG5A 1NYGA 2XHCA 4XU2A 3CC2T 2O31A 1NM7A 2A3LA 4HT9A 4PJOF 4J9IA 2E70A 2L5QA 3CBOA 2RD1A 1W4SA 2QGGA 4WCIA 4JS4A 3JB9G 3CMAA 1YI2Q 3CPFA 2R5AA 4ZGEB 2YUPA 3QHSA 2OTJQ 5GJWB 3VKIA 3S6WA 4MZTA 1VQ6Q 2DL7A 2LRQA 3UA6A 5GAMf 3G1JA 2EW3A 2LCCA 5KCHA 4C8QF 3OS1A 5KCOA 2GFUA 3NMZC 2V8JA 3E9GA 3OW2P 3JCMh 1G3YA 1IB8A 4JPBW 2E1HA 3CMEQ 4OGCA 4C5EA 2DXUA 4NL3A 4M78F 5FU6B 4FT4A 1E6GA 3M56A 2K5LA 1RABB 2GQIA 2OAUA 5EC7A 4ELZC 3A5ZB 5CKFA 1AWOA 1X69A 3JSCA 4KBMB 1ABQA 2HAXA 1PG5B 1ZHIA 3OW2A 1AT1B 1G83A 2A0FB 3DB3A 2NUTA 4HCBA 2KBTA 2EYYA 1K9MR 1Y07A 2DERA 4E6RA 3G71A 3OB9A 3QYHB 3EH2A 2VB6A 1H641 1K8AU 4M7DG 2AT1B 4MMLA 2QXFA 4JS5A 1YI2T 3SEMA 2JXBA 5IXFA 2OTJT 4OMLA 1BI3A 2CREA 4FYWB 2LJ1A 9ATCB 1K4US 4D8KA 5GAN7 1VQ6T 2CP7A 2KAFA 3VS2A 4A4FA 1M2OA 1M1KU 2DVJA 3FEOA 4J9GA 1YHQQ 2E4HA 1BI2A 1QKWA 2DZ9A 2JTMA 2JTFA 2NUTB 5GANf 3OS2A 4D8DA 5I21A 3GNGA 2RI2A 1MMNA 3BFMA 4FYXB 2J6FA 3CMET 3LWHA 3A98A 2IPOB 2LT1A 2WACA 1TSFA 2RM4A 1G2BA 1K8AR 2GBQA 3CCJQ 2QI2A 2MF2A 4J9HA 4MZPA 5LJ3f 2OTLQ 1M27C 2FZGB 1OPKA 1RUWA 2VUBA 2X51A 1VQ4Q 4KGVB 4EDUA 1M1KR 1M1FA 4PNOA 1OYXA 4CI0C 4BE2A 3CPWP 1M8VA 1KC8C 2P4RA 3TCJA 4HCKA 1WJSA 4JRPA 3C0CA 2KROA 2PUKB 2XICA 3CCVA 1RI0A 1JJ2A 2JVVA 1S1NA 3NGPA 1MMAA 1NJIC 3JCMd 2DL3A 4CRIA 4WTOB 3CCSA 2EQUA 5GAMh 1JQQA 2LCLA 1YIJQ 5CR2A 1YHQT 1X27A 4N0AA 2BKDN 1H3HA 1WHJA 1I8FA 1YP5A 1NEGA 4HT8A 1Y96A 2EQMA 4DOVA 4B9XA 5A2QE 4QKUA 2DMOA 1X6BA 5I2MA 2XD0A 3CCMA 3OA6A 1NYFA 3QZ9B 1D1AA 2R58A 5LJ5g 1GCQA 2EJGA 4PK4A 1D0XA 1N5ZA 4PJOC 2DZCA 4BE0A 2KQWA 3CCJT 2X3WD 2BTTA 3M54A 2ROLA 1FWZA 2OTLT 4XK8E 2QEXQ 3RERA 1A0NB 1JXOA 1VQ4T 1VQ8A 1Y96B 1UGSB 4VUBA 2DYBA 1QKXA 2ZPBB 2IG0A 5GMKh 3CCEA 2RHUA 4FM4B 3OMGA 1FXXA 2JM8A 4HXJA 5GAN4 1UFFA 3WVDB 3L2ZA 1U3OA 3JCMW 5FRNA 2FG0A 2BZYA 1B7TA 2PVGB 2KK4A 4M78C 3DB4A 3H9NA 5M9OA 3VUZA 1WI7A 1Q81U 2RMOA 1YIJT 4KRTA 5IH2A 2NLUA 5GANh 3LLRA 2K5IA 1E6HA 4J9BA 2LQNA 2QAZA 4YTLA 5FRMA 2GQVA 1G5VA 2WSFE 2ZCFB 2ED0A 3QO3A 3I55T 4M75A 2PVOB 5LJ3e 1ZBJA 2NUZA 4C92E 1MGQA 2AK5A 2Y4XA 2V8IA 1BIBA 3I35A 2Y90A 1QQJA 1KSWA 2CZ7B 3CC7T 1VQMA 4OMMA 1OZ3A 4J7IA 2DJZA 2BZXA 2QEXT 4RTVA 5AYFA 5KYWA 4B6MA 4EMKC 4C8QD 2CS7A 6AT1B 3TREA 4FYVB 3HPWA 1AD5A 5GAMd 2JTEA 2R5MA 4M7DE 2K7AA 1WGSA 4PFZA 2KRNA 2E6ZA 3H8ZA 4XTVA 4C5HA 2E10A 1RLPC 5GAOm 2MWPA 1Z9ZA 4PJOG 3JCMP 1WFWA 1YITQ 2RHXA 2CH4A 2DBKA 5ECAA 5CCAA 2CSIA 1TG0A 2KT8A 4C92A 2D8JA 3GNFB 5KYWB 2P0KA 4IIMA 1VQKT 4M7AF 2K57A 1QMCA 3LYIA 2D6FA 2A37A 1N6AA 2RQWA 2F1LA 1JEGA 4M7DA 2QYZA 3UA7A 4M78G 1LJOA 1RAFB 4E7IA 1S72Q 4B9WA 2FZKB 3CBMA 4C92B 3L2UA 2O01E 3ASKA 4PL6A 1VQLQ 1QP3A 3JCMQ 3JAME 1Q7YC 1SF9A 5CQXA 2KSSA 2PUOB 1B34A 3ZFJA 1HK9A 1T3SA 4KT0E 3OSVA 5KE3A 1SRLA 2FRYA 3M58A 5GAOr 5GANd 3EGXA 1NE8A 3UDCA 5GAMj 3QDRB 1RAGB 1K73C 1VIFA 3EGUA 1Q86C 4M7DB 1YITT 1G3TA 4IUQA 3OYJA 5CVIA 2JUFA 1YJNA 1LPLA 3OYEA 2DFUA 2J05A 2G3RA 1MMDA 2RI5A 2LQ8A 4M77E 1KQSA 2COZA 1IREB 3QIIA 3VS7A 3MCAB 1B34B 3NFCA 4RG8A 3RESA 1U5SA 3M0TA 2MK5A 4BI4A 3GIBA 4QVCA 4LN2A 3EGXB 3JCMc 2RB6A 1D1CA 2CZ6B 2W10A 1D3BA 4HA8A 3VYGA 3QKJA 1QWEA 4XU3A 1ABOA 5EG2A 3VS4A 2X4JA 4TVRA 2EAYA 2ZAEA 2CP5A 1TUDA 1M9SA 1KJWA 3LWIA 4PJMA 1S72T 1X6OA 2DXTA 3PE0A 3OW2S 4IUTA 4FSSA 3RKYA 3CC4A 3CCUQ 5GAN2 1EZZB 1HJDA 4OMPA 3CCLQ 1XNIA 4RTYA 1Q82C 3HSBA 1M3CA 7AT1B 5L23A 3L2RA 1OI1A 2VGNA 4LNPA 2MAMA 2QQBA 4LDXA 2LP5A 4M77A 3GP8A 4LDVA 2YRCA 5LJ5e 2LT4A 1D3BB 1ZSZA 5A0DA 2EPDA 3C95A 5GANj 2LTOA 2M51A 3CC2A 2ZPFB 2LDMA 2C06A 5FU7C 3H0IA 5GAN6 1X75C 1ZSGA 1RL2A 2MWOA 2QQAA 4DEXA 1RAEB 2LQWA 1AOJA 3MPUB 2DIQA 4AG1C 1UTIA 2DK3A 3V7RA 4M77B 3Q1JA 5LJ3j 1UGRB 3OQ5A 1ZSZB 2FPFA 2MOXA 1YBYA 3X25B 2E3HA 4J6YA 2YXYA 1M2VA 2Z0WA 5KE2A 3VU3C 2QG9B 3HRSA 4QVZA 3DLLA 2EKOA 3PMTA 5DLQE 5GAOq 3CCUT 3UWNA 3FC3A 1WYXA 2OJ2A 1BCOA 3CXCP 3CCLT 1R0BG 1H3ZA 2HQXA 4A4EA 2E41A 3EG0A 4HKEA 4M7AC 2KXCA 8AT1B 1JJ2S 3NPFA 3IQLA 3CCRQ 2EJFA 3U23A 1C1AA 2FPEA 4RTWA 1YI2A 2XDDA 2OTJA 2ECZA 5CQYA 2X4WA 1X01A 3RIRA 1EFNA 3QZ5B 4N4IA 4EIKA 1N8RC 1MMGA 3MEVA 2EGEA 3M0SA 3HHTB 3HL8A 2K3YA 3VS3A 1VYTA 3PTAA 1W6XA 4RKUE 1IO6A 2QGFB 3DKMA 3OYKA 3X20B 4LDUA 2DBMA 3QUIA 3QSUA 3V7SA 2QTVA 5IHNA 4RTXA 3CMEA 1UECA 2D0NA 4DBFA 3GOXA 1DJ7B 3QG1A 3OYLA 1K9MU 4PJOA 2J6OA 2DNUA 2F2XA 1QVFP 1F1BB 3JB9I 4M7AD 1CKAA 1YJ9Q 2HKQB 1KD1C 2ZPGB 3M0UA 4BACA 2QASA 2KEAA 3MEWA 3G6EA 2RQRA 3QWYA 4Z8AA 2I0NA 3NTKA 5FWCA 4E2FB 2G6FX 3A8MB 2DTHA 3A8HB 3CCRT 4RTTA 1GBRA 1ZA1B 2VKNA 2JNGA 5J26A 2JT4A 3SWNC 2XIDA 4FW1A 1RACB 4IUPA 3MEUA 4OVAA 1TUGB 1ZBXA 4M78A 4QVDA 1D09B 1WJQA 3BDLA 3GBQA 2KRSA 2DXBA 1YHQA 3PGGA 4OMQA 2DETA 2RQTA 2GGRA 1PCXA 5KYYA 2JMAA 4M7AG 4Y92A 4F7UE 4PKCC 3OMCA 1PWTA 3CQTA 5D7UA 3M4GA 4QT7A 3JB9J 4JZ3A 4FIBA 1UGQB 1YFNA 2KVQG 3EHQA 3L2WA 3I5RA 3TQ7P 1WQWA 1VQ9Q 1WLPB 3CCJA 2HCKA 1OZ2A 1YJ9T 4FW2A 2L0AA 2OTLA 2DKGA 4AMCA 2ESWA 1D1BA 2K3BA 4EMKA 4Y91A 1VQ4A 2D1XA 3EG1A 4LXCA 3OYGA 1KHIA 5CKHA 3G71Q 2HSPA 4IUVA 4EPCA 1M90C 4ORZA 4F7UA 2DVEA 3OY9A 2C0TA 4FT2A 1X2QA 3MP1A 2KE9A 5GAN5 2QQRA 3GPLA 5CK9A 1YIJA 2L89A 1N27A 1TTHB 3JCMJ 2AZSA 5GAOp 3QYGB 4BI3A 4F14A 1PD0A 4J9CA 1QLYA 4LD6A 4XTXA 5FLXE 2XKOC 2P84A 1HD3A 1PKSA 3I55A 1MUZA 3NTHA 2FEIA 3V7CA 4IKFA 4ZN3A 2EGAA 3O8VA 5HY6A 2V1RA 4QQDA 3ZL7C 4F7UB 3SD4A 4ZTJA 4LDWA 1VQ9T 3EGDA 3BY7A 3CPWA 4J7FA 2E12A 2XMFA 3CC7A 2BUDA 2DILA 1K73R 2ZPEB 1Q86R 1AZEA 3OS0A 2QEXA 4C0ZA 2EYZA 4BY6C 1WIEA 3R6NA 2VYTA 4QQGA 1PSFA 2J7IA 1MNDA 3TSZA 4GBQA 1JO8A 3G71T 1AVZC 2CP3A 5IHKA 1KQSS 5FU6C 5CIUA 1QVGS 4ELYC 4M75E 3ER0A 4A4KA 4X9DA 4JJCA 3EGDB 1R0CB 2QQ9A 1VQOQ 3OSSC 3L2VA 2P0QA 2DF6A 1JXMA 3M53A 1SHGA 3OYHA 1QCOA 2DPPB 2C0IA 4J9EA 2VVKA 2R57A 4Y28E 1X6GA 4C0GA 4C8QC 2M0OA 4E47A 4OP0A 5J3BA 2DTIA 2RJDA 1VQKA 4Z89A 2CH4W 4DA4A 2RPNA 2KNBB 1I4K1 2FHDA 2K2VA 2FL7A 2M1HA 2L3RA 3RR6A 3I56Q 1Q82R 1OEBA 3INZA 1KFZA 2DE0X 1KQ2A 1BYMA 2HDAA 2E64A 1BB9A 2HL5C 2J6KA 2F5TX 1LVKA 1W2BP 2L8DA 1G8XA 1WNLA 2GCXA 2HKNA 1FMWA 1OU9A 2LZ6B 1V1CA 2KI7A 4J6WA 3E19A 4PLIA 3URGA 1VOMA 1PRMC 5IHIA 5FWBA 1MV3A 5CKBA 2J06A 1H8KA 3EH1A 3HRTA 1C0MA 1W2BA 3R6OA 1WPYA 1J3TA 2EFIA 3V8LA 1QP2A 2EVRA 1C6VX 5LJ3h 4A54A 1PNJA 1X2KA 2D0QB 1RI9A 3PIOA 1T0JA 4OB3B 4C5GA 1VQOT 2GFAA 1YITA 2NYSA 1SHFA 1ARKA 3EFRA 1KHCA 2C0OA 4ZTFA 2LJ0A 4M75B 2K2MA 4C0FA 4AFSC 1WHGA 3GF5A 5KYUA 4LUEA 4E7ZA 3OYYA 5CKDA 4DBQA 4J5YA 1PC0A 1YWOA 2RF0A 2FVUA 3ZBDA 4OB0B 3I56T 4X9CA 2D8HA 3SFMA 2RI3A 1MV0B 2PNIA 1RAHB 3J7AF 5LJ5f 1WA7A 1LOJA 2RHYA 2P0PA 3PMIA 4C92F 4KULA 4C0DC 2KMTA 4L5GA 2FB7A 3KUFA 3OYNA 2EWNA 2A28A 3X28B 5FU7B 1S72A 3RBBB 4Z88A 2CP2A 5CO7A 4E7LA 5DY9A 5KYUB 1Y57A 3BE3A 2YLBA 2CP6A 1SEMA 4C8QG 1UDLA 1YCSB 1K8AC 4Z02A 1BKBA 2ABLA 3JCMg 4AFZC 2COYA 4M7DF 4EMGA 4OMFB 5KYXA 1N8RR 1MNEA 2HQEA 1RADB 2BE9B 2ENMA 3CD6Q 1LNXA 3C12A 1M1KC 1Y7XA 2JS2A 4F17A 3HFOA 2JOYA 1R77A 2YRVA 3JV3A 4L59A 3VJPA 3E2UA 1AWXA 4JRIA 4A4GA 4ATOA 2AIRB 3E1SA 1RAIB 4N4HA 3SDZA 1TUCA 3RMQA 1TWBA 4BDYA 1YWPA 3JB9H 2LX9A 1Y71A 3GLXA 5KYXB 2OI3A 3WVEB 2E5QA 1QW1A 2QA4Q 3I9QA 2XI9A 4F04B 3EHRA 2O9VA 4OB2B 1FMKA 2HSEB 2LNVA 5LJ3d 2DA9A 3EG9A 3DLMA 2HQHA 3CCUA 2W0ZA 3G7ZA 4A53A 3QJYA 3CCLA 2CZ0B 3P8BB 3P8DA 3TU4K 3UPUA 4IUUA 2FRWA 4OGEA 2O9SA 3WXMB 4BDZA 3VRYA 5J39A 2BIVA 2RK1A 2EIFA 2EKHA 1VQLT 4MDWA 3EG2A 1M3BA 3HTRA 2DEQA 3MO8A 3VV0A 1VQ7Q 3CD6T 1OPLA 4XU1A 4E7HA 5GAOn 3SWNA 2FYKA 1K9AA 1EX4A 1YCYA 4M77F 3VS1A 2CUBA 3AT1B 3JCMb 4PJLA 3H0HA 1ZX6A 2MCNA 3HKSA 1QCNA 3OS5A 5GAN3 1YJWQ 5LJ5h 3QJ6A 3O5ZA 2XU8A 1OX8A 2YHTA 1KC8U 2QA4T 3HFNA
chains in the Genus database with same CATH topology
3CD6A 2EQMA 4XQ3A 3L2QA 2CZ1B 3SWNB 3M59A 4DOVA 2JNGA 5J26A 1NJIU 3CCET 1V29B 4X34A 3CXCS 4B9XA 5A2QE 2X4XA 2XIDA 3SWNC 5GAMg 2RJFA 5I2MA 1KD1U 2XD0A 2X35A 3KBGA 2EQKA 3OA6A 3CCMA 4LD9K 3QZ9B 3A8LB 4IUPA 3L1AA 2R58A 2M9UA 3MEUA 2VV5A 5LJ5g 2EJGA 4OVAA 4M7AA 1O9SA 2JN0A 4PJOC 3LGLA 3EAEA 2DZCA 4BE0A 1ZBXA 4M78A 3HP9A 4QVDA 2O4XB 2KQWA 1WJQA 3OYFA 4N4GA 3CCJT 5GMKl 1M4ZA 4HCZA 3BDLA 3M54A 3C4SA 1FWZA 2DXBA 2OTLT 1YHQA 3PGGA 3SB2A 4XK8E 1KQ1A 2VXFA 1VIEA 2PQWA 2QA4A 3RERA 1XOVA 4M7AG 1SSFA 3CCRA 4F7UE 4BE1A 4PKCC 3OMCA 4N0AC 1VQ4T 1VQ8A 1Y96B 1UGSB 4RMOA 4VUBA 1Q81C 1VQ7T 2ZPBB 2IG0A 5GMKh 3M4GA 3CCEA 1UEBA 2RHUA 4E7JA 4FM4B 3OMGA 5LL6S 1FXXA 4FU6A 2KDSA 3JB9J 3OYBA 4FIBA 5GAN4 4M75D 1UGQB 2KVQG 3JCMV 3WVDB 3L2WA 4M7AB 1IZ6A 3L2ZA 1JRIA 1WQWA 2ZZDA 3JCMW 5FRNA 2PVGB 4GY5A 2KK4A 4M78C 1BI0A 3CCJA 3DB4A 1OZ2A 5M9OA 4PJOE 1YJ9T 3VUZA 4J83A 3J81E 3RKXA 3MP8A 1Q81U 3META 4JLIA 3FJPA 2OTLA 2DKGA 3CXCA 1YIJT 1YJWT 2NLUA 1VQMT 3JB9D 1N9RA 5GANh 3LLRA 4ZGJB 2K5IA 4C5IA 4OB1B 4EMKA 4Y91A 3FRNA 1VQ4A 5C0MA 3CPWS 4RCBA 4YTLA 2GQVA 2RA2A 5FRMA 2WSFE 2MI6A 1VQ7A 3OYGA 1G5VA 1KHIA 2ZCFB 5CKHA 3QO3A 3I55T 4M75A 3QPHA 1QVFS 2PVOB 4IUVA 4EPCA 1M90C 5LJ3e 1VUBA 2A7YA 3CCQT 1QVGA 1VQ6A 3LW5E 2HNIA 1BI1A 1MGQA 4C92E 2Y4XA 3L42A 2V8IA 4F7UA 2DVEA 5GANg 1VQ5T 3OY9A 2EJ9A 4LDYA 4Q5WA 1JB0E 1BIBA 3F70A 4FT2A 2Y90A 3MP1A 1YJ9A 1VQPT 1U8RA 2DTOA 3OYCA 3JB9F 1P92A 5GAN5 2QQRA 2CZ7B 1PSEA 2QTXA 3TEEA 2F5KA 4M78E 4J6XA 1I81A 3GPLA 1XTDA 3CC7T 2RK2A 5CK9A 2L89A 2E6NA 1YIJA 1YJWA 1N27A 1VQMA 4XTZA 3FB9A 3JCMJ 1OZ3A 4J7IA 2DJZA 3HFNA 4F7UG 5GAOp 1M90U 1QVPA 2QEXT 3QYGB 4JDSA 5AYFA 4BI3A 4C92D 3OYAA 4V2SA 4EMKC 3I56T 4C8QD 2CS7A 4JJNK 3TREA 4LD6A 4XTXA 5FLXE 5GMKm 2XKOC 4WF2A 3I55A 5GMKj 3HPWA 5GAMd 2R5MA 3NTHA 3V7CA 4M7DE 5KH6A 4IKFA 4M75C 1M5Q1 4ZN3A 5LJ3g 3JCMX 5LJ5d 3CCQA 3O8VA 4O5VA 5HY6A 5I2SA 4QQDA 1WGSA 4F7UB 2LVMA 2E6ZA 3SD4A 4ZTJA 3C94A 3H8ZA 4XTVA 1VQ5A 4C5HA 3OBWA 2E10A 4LDWA 1VQ9T 5GAOm 2MWPA 3M57A 4PJOG 4BD3A 3JCMP 2RHZA 3S3MA 1VQPA 2DIGA 3BY7A 3CPWA 2RHXA 4RCCA 4J7FA 3JCMe 2E12A 3FDRA 3M5AA 3LX7A 1TH7A 5A0GA 5CCAA 2BUDA 3CC7A 3JCMf 2RJCA 3S3OA 4M7DD 2ZPEB 4C92A 1NZ9A 1QVFA 4ZN1A 4C8QA 1VQNT 3OS0A 1JBMA 1O75A 4BY6B 3GNFB 2QEXA 2X4YA 4C0ZA 2P0KA 4BY6C 4JUVA 2VYTA 4J8OA 1PSFA 2PVDB 4QQGA 4PJOB 5GAN8 3PIPA 3BDUA 1WQ7A 3MP6A 3G71T 1VQKT 4M7AF 2ZPHB 2K57A 3P8HA 4O6JA 2HD0A 4R56A 1KQSS 4C92G 3LYIA 4MZMA 5FU6C 2D6FA 5CIUA 4DOWA 1QVGS 4ELYC 4NL2A 2CYZB 4M75E 3G4ST 3ER0A 1NPPA 4A4KA 4X9DA 5DLOA 1VQ9A 2AHJB 4IURA 1N6AA 2CGHA 2QQ9A 3OSSC 3L2VA 5A0LA 2P0QA 4M7DA 4XTYA 1W2BS 3M53A 4OF1A 2WSEE 4R55A 4M78G 3OYHA 3T9NA 4M77C 1LJOA 4E7IA 4B9WA 4XU0A 5D6WA 2DPPB 1YJNT 3CBMA 5L8RE 4C92B 2QQSA 2XK0A 2O01E 3L2UA 3ASKA 1VQNA 4PL6A 2DD5A 3E9FA 4C8QB 1QP3A 4C92C 2K3XA 2R57A 3A8OB 4Y28E 4C8QC 4C0GA 3JCMQ 3OS1A 3JAME 1Q7YC 2M0OA 4E47A 5CQXA 2KSSA 2PUOB 4OP0A 5J3BA 1B34A 2DTIA 3ZFJA 1HK9A 1ZQ1A 2RJDA 5CKEA 1VQKA 4M78B 3CBPA 2RH2A 4KT0E 3OSVA 2HBPA 4DA4A 3OYIA 1I4K1 4XTWA 5KE3A 2MMPA 2FHDA 2KY9A 2K2VA 2FL7A 2M1HA 3M58A 2L3RA 3A8GB 5GANd 5GAOr 1NE8A 3INZA 3UDCA 5GAMj 3G4SA 3QDRB 1KQ2A 1BYMA 2E64A 3JRZA 3CEYA 3N5BB 1HXDA 4KUIA 4PLLA 1K73C 5LJ5j 3X26B 1KG1A 1VIFA 2F5TX 1I5LA 2L8DA 3OBYA 4BI8B 2K5FA 1WNLA 1Q7YU 3M55A 3X24B 1Q86C 2GCXA 4M7DB 1YITT 1G3TA 4IUQA 2DO3A 2VGMA 4EMHA 3OYJA 4M7DC 5CVIA 2JUFA 1YJNA 3OYEA 2G3RA 2Y4YA 2RI5A 4J6WA 2LQ8A 3S3NA 4M77E 1KQSA 4II1A 3CMAT 3E19A 4PLIA 3CC4T 2XDPA 1IREB 3QIIA 4FSXA 3URGA 1U1TA 3MCAB 1B34B 3NFCA 4RG8A 4C8QE 1K73U 3RESA 2WSCE 2PU9B 5CKBA 3V8KA 4F7UF 4RG2A 5IAYA 4BI4A 5HK0A 3HRTA 1Q86U 5IT9E 3GIBA 4QVCA 1W2BA 2F69A 4DQ2A 4HCCA 3H6ZA 2E65A 1XQHA 3MHXA 1WPYA 3R6OA 1M1GA 2RB6A 2EYQA 2RHIA 4M75G 2EFIA 2CZ6B 3JCMc 1QP2A 3ME9A 5LJ3h 1D3BA 3V8LA 4A54A 1U1SA 3V8JA 1G3WA 2D0QB 4HA8A 4M77D 3VYGA 4A4HA 3QKJA 3PIOA 4XU3A 4OB3B 4C5GA 5EG2A 1VQOT 2X4JA 4TVRA 2EAYA 4EMKB 2GFAA 1YITA 4D6WA 2LC4A 2XHCA 4XU2A 3CC2T 1M9SA 2DAQA 3EFSA 3LWIA 2A3LA 3EFRA 1KHCA 1S72T 1X6OA 4HT9A 4ZTFA 3G6ET 2DXTA 4PJOF 3OW2S 4M75B 4NS5A 2E70A 4IUTA 2L5QA 3CBOA 2RD1A 1W4SA 4NOYA 3RKYA 4JS4A 4C0FA 3CMAA 3JB9G 3CPFA 3CC4A 4MDXA 2B8AA 2R5AA 5GAN2 1FX7A 3GF5A 4ZGEB 3MEAA 3OYYA 3QHSA 5CKDA 1XNIA 4J5YA 3VKIA 1Q82C 2EQJA 3FLGA 2XDBA 3HSBA 3S6WA 4MZTA 3VYHB 3L2RA 2FVUA 1OI1A 2VGNA 3ZBDA 2XG8D 2MAMA 4OB0B 2QQBA 5GAMe 5GMKi 4LDXA 4BUGA 2DD4A 2LRQA 4M77A 4LDVA 3GP8A 5LJ5e 2DXCA 1BIAA 2LT4A 4X9CA 1D3BB 5GAMf 3FIFA 1G3SA 3SFMA 2LCCA 2RI3A 3J7AF 4ZGDB 5LJ5f 5A0DA 3J80E 1LOJA 2RHYA 4C0DB 5KCHA 2P0PA 3C95A 3PMIA 5D6XA 4C92F 5GANj 1N9SA 4KULA 4C0DC 1VQOA 4C8QF 2KMTA 2LTOA 2GFUA 2FB7A 3KUFA 3M9QA 4L5GA 4MMKA 3UT1A 5KCOA 2EWNA 3OYNA 3CC2A 2ZPFB 2LQKA 3X28B 5FU7B 2V8JA 1S72A 2LDMA 3LGFA 3E9GA 1Q82U 2IVWA 2GF7A 3JCMh 1G3YA 2C06A 5FU7C 2ZPIB 2E1HA 4M77G 4OGCA 5CO7A 4C5EA 4E7LA 2DXUA 4NL3A 4M78F 5DY9A 5FU6B 4FT4A 5GAN6 3M56A 1X75C 2K5LA 3RMSA 4E7KA 1RL2A 2YLBA 4QQ6A 5CAIA 2OAUA 4C8QG 2MWOA 2QQAA 5FROA 4ELZC 3A5ZB 5CKFA 1K8AC 4Z02A 5IN1A 2DIQA 1BKBA 3JSCA 3JCMg 2DK3A 3V7RA 4KBMB 4M77B 2HAXA 3I56A 3Q1JA 4M7DF 4EMGA 4OMFB 1ZHIA 1UGRB 3LH0A 5LJ3j 3OW2A 3OQ5A 1AHJB 1MHNA 2HQEA 1YBYA 3DB3A 4HCBA 3X25B 4J6YA 1M1KC 1Y07A 4FL6A 5GMKe 3OYMA 3HRUA 5KE2A 1LNXA 1NPRA 3C12A 1UB4A 1Y7XA 3VU3C 3G71A 2YLCA 3HRSA 3OB9A 3QYHB 1H641 1K8AU 4M7DG 3HFOA 4QVZA 2JOYA 3DLLA 2YRVA 2EKOA 3PMTA 2QXFA 4MMLA 5DLQE 4JS5A 1YI2T 5GAOq 4L59A 3UWNA 3VJPA 3FC3A 3CCUT 5GAOl 2OTJT 4JRIA 1BI3A 4A4GA 3CCLT 4ATOA 3ZEHA 3E1SA 1R8OB 4N4HA 3SDZA 1H3ZA 3RMQA 4BDYA 4L6V5 3JB9H 2HQXA 5GAN7 1VQ6T 2LX9A 4ME7A 1Y71A 2KAFA 4A4FA 4GLKA 4A4EA 1M1KU 2E41A 3GLXA 3FEOA 4HKEA 5GANe 3WVEB 1BI2A 2VXEA 4M7AC 2E5QA 1JJ2S 2DZ9A 2JTMA 1QW1A 2JTFA 3AHUA 5GANf 3RUXA 2XI9A 3OS2A 2EJFA 4M75F 4XAXB 4OB2B 5I21A 3GNGA 2RI2A 2H3JA 1WJRA 3BFMA 1UGPB 2P4TA 2ZGWA 2LNVA 3PNWC 5LJ3d 3CMET 3LWHA 4P5NA 3DLMA 3QBYA 1YI2A 4QW2A 2LT1A 3CCUA 1EIFA 3G7ZA 2RJEA 2WACA 5HKCA 2XDDA 4A53A 3QJYA 3QXEB 2OTJA 5CQYA 3CCLA 2RM4A 2CZ0B 4XTUA 3P8BB 2X4WA 2JZ2A 1X01A 2K4YA 3P8DA 4UC4A 3RIRA 3CCVT 3TU4K 4N4IA 3QZ5B 4PJOD 1N8RC 3MEVA 3UPUA 2QI2A 3HHTB 3HL8A 2MF2A 2K3YA 2QDYB 3BW1A 4IUUA 5DM7R 4OGEA 4MZPA 3WXMB 4BDZA 3CCST 5LJ3f 3PTAA 5J39A 3PT9A 1K9MC 2BIVA 2RK1A 2EIFA 4RKUE 1VQLT 3KXTA 3RKWA 4MDWA 2VUBA 4M7AE 2DEQA 3DKMA 3MO8A 3OYKA 3VV0A 3X20B 4EDUA 3CD6T 4XU1A 4LDUA 2M16A 2V8KA 2I2LA 3QUIA 3V7SA 1M1FA 3SWNA 5GAOn 4E7HA 1N8RU 3QSUA 4PNOA 3CMEA 1OYXA 3OYDA 4CI0C 4BE2A 3GOXA 1DJ7B 2FYKA 1M8VA 3QG1A 3OYLA 3CCMT 1KC8C 4KUDK 3TCJA 1YCYA 1K9MU 1WJSA 4JRPA 4PJOA 5C6SA 2PUKB 2XICA 4M77F 3CCVA 1RI0A 3PFSA 1JJ2A 2JVVA 4JRKA 2CKKA 3JB9I 3JCMb 1GXIE 2O4XA 3NTIA 1NJIC 3VUBA 3JCMd 4BB7A 4M7AD 3M4YA 3HKSA 4CRIA 4M78D 1KD1C 2ZPGB 2VC8A 3CCSA 2EQUA 5GAMh 4JRQA 3OS5A 4BACA 4JLGA 5HK3A 2LCLA 5GAN3 3MEWA 5CR2A 3G6EA 1YHQT 5LJ5h 2D9TA 2RO0A 3NTKA 3QJ6A 1VQLA 2XU8A 5D6YA 2YHTA 3A8MB 2BKDN 2DTHA 4N0AA 2QA4T 1KC8U 3A8HB 3CCRT 1I8FA 4HT8A 1VQ8T 1Y96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 E;  2YLC A;  4V2S A;  4XQ3 A;  4EMK C;  1H64 1;  4C8Q D;  4M7D G;  3HFO A;  3SWN B;  5GMK m;  4MML A;  4XTX A;  4WF2 A;  5GAO q;  1U1T A;  3SWN C;  5GMK j;  1B34 B;  5GAM g;  5GAM d;  3V7C A;  5GAO l;  4C8Q E;  4M7D E;  3RES A;  3V8K A;  4M75 C;  1M5Q 1;  4F7U F;  3L1A A;  4JRI A;  5LJ5 g;  5LJ3 g;  5LJ5 d;  3JCM X;  2EJG A;  3GIB A;  4QVC A;  4M7A A;  2JN0 A;  4DQ2 A;  4PJO C;  2DZC A;  2E65 A;  4F7U B;  1WPY A;  4M78 A;  4QVD A;  3JB9 H;  4XTV A;  3JCM c;  2RB6 A;  4M75 G;  5GAN 7;  2E10 A;  3V8L A;  5LJ3 h;  1D3B A;  4A54 A;  5GMK l;  1U1S A;  5GAO m;  3V8J A;  4HA8 A;  4M77 D;  4PJO G;  2E41 A;  3JCM P;  4XU3 A;  3BY7 A;  5GAN e;  4M7A C;  2VXE A;  4RCC A;  3JCM e;  2EAY A;  4EMK B;  2DZ9 A;  3PGG A;  3AHU A;  3SB2 A;  1TH7 A;  5GAN f;  3RUX A;  4XU2 A;  1KQ1 A;  2VXF A;  3JCM f;  2EJF A;  3EFS A;  4M75 F;  4C92 A;  4M7D D;  3EFR A;  3QSU A;  5I21 A;  3RER A;  4HT9 A;  4C8Q A;  4M7A G;  4F7U E;  1JBM A;  2DXT A;  4PJO F;  4N0A C;  4M75 B;  3BFM A;  1Y96 B;  2RD1 A;  2ZGW A;  4NOY A;  3RKY A;  3JB9 G;  4JUV A;  5LJ3 d;  5GAN 2;  4PJO B;  5GMK h;  3M4G A;  5GAN 8;  3BDU A;  1WQ7 A;  3QHS A;  4M7A F;  4J5Y A;  3JB9 J;  4A53 A;  2K57 A;  5GAN 4;  3HSB A;  4M75 D;  3JCM V;  2RM4 A;  4XTU A;  1I5L A;  3JB9 F;  1X01 A;  4M7A B;  3RIR A;  4C92 G;  3L2Z A;  5GAM e;  5GMK i;  4PJO D;  1JRI A;  1WQW A;  4NL2 A;  3JCM W;  4M77 A;  4M75 E;  4M78 C;  4X9D A;  1BIA A;  3BW1 A;  4X9C A;  1D3B B;  4C92 D;  3FIF A;  5GAM f;  5LJ5 e;  4PJO E;  2CGH A;  5LJ3 f;  5LJ5 f;  1LOJ A;  3RKX A;  4M7D A;  4JLI A;  4XTY A;  3FJP A;  4C92 F;  5GAN j;  1N9S A;  2DKG A;  4M78 G;  4C8Q F;  4MMK A;  4M77 C;  1LJO A;  2FB7 A;  4XU0 A;  2EWN A;  3RKW A;  3JB9 D;  4C92 B;  1N9R A;  4M7A E;  5GAN h;  2DEQ A;  3JCM h;  4C8Q B;  4EMK A;  4C92 C;  2E1H A;  4Y91 A;  4C8Q C;  3JCM Q;  4M77 G;  4XU1 A;  4RCB A;  2I2L A;  3QUI A;  2RA2 A;  3V7S A;  3SWN A;  5GAO n;  2DXU A;  4NL3 A;  4M78 F;  5DY9 A;  4PNO A;  5GAN 6;  4OP0 A;  3QO3 A;  1B34 A;  2DTI A;  2YLB A;  4M75 A;  1HK9 A;  2FYK A;  5CAI A;  1M8V A;  4M78 B;  4C8Q G;  1YCY A;  4PJO A;  1I4K 1;  5LJ3 e;  4XTW A;  4M77 F;  2HNI A;  4C92 E;  1MGQ A;  4F7U A;  2DVE A;  4JRK A;  3JB9 I;  3JCM b;  5GAN g;  5GAO r;  5GAN d;  3JCM g;  3VU3 C;  3V7R A;  3INZ A;  3JCM d;  4M77 B;  5GAM j;  2EJ9 A;  4M7A D;  1KQ2 A;  1BIB A;  2E64 A;  4M78 D;  4M7D F;  4EMG A;  1HXD A;  2Y90 A;  5LJ3 j;  2VC8 A;  5LJ5 j;  5GAM h;  2DTO A;  5GAN 5;  1WNL A;  5GAN 3;  4M7D B;  2QTX A;  4M78 E;  5LJ5 h;  4J6X A;  1I81 A;  4EMH A;  4M7D C;  4J6Y A;  4XTZ A;  3FB9 A;  2YHT A;  4N0A A;  3JCM J;  2DTH A;  5GMK e;  2DJZ A;  1I8F A;  3HFN A;  4F7U G;  5GAO p;  4HT8 A;  1LNX A;  4J6W A;  1Y96 A; 
#chains in the Genus database with same CATH topology
 2SEM A;  4HVU A;  3SWN B;  2HZY A;  3M59 A;  4RTZ A;  1NJI U;  1W1F A;  1V29 B;  2X4X A;  5GAM g;  2RJF A;  2X35 A;  3KBG A;  3CCQ Q;  4LD9 K;  3A8L B;  1YN8 A;  2M9U A;  2VV5 A;  2JN0 A;  3VS0 A;  1VQ5 Q;  3LGL A;  3EAE A;  1GL5 A;  2JW4 A;  1VQP Q;  1M4Z A;  4KH1 B;  4HCZ A;  1K0S A;  3SB2 A;  1PKT A;  1KQ1 A;  2VXF A;  1AEY A;  1RLQ C;  1XOV A;  3CCR A;  2EYX A;  4RMO A;  1Q81 C;  1VQ7 T;  2V26 A;  2A08 A;  1KC8 R;  4FU6 A;  3NHN A;  2KDS A;  4M75 D;  1M8M A;  1VYV A;  3VS6 A;  4HVW A;  5KYN A;  1IZ6 A;  2DRM A;  1JRI A;  1NJI R;  2L3Q A;  1TXQ A;  4GY5 A;  1BI0 A;  2DL8 A;  4PJO E;  1BU1 A;  2OAW A;  3J81 E;  3RKX A;  1M2V B;  4JLI A;  3FJP A;  4JZ4 A;  3CXC A;  1YJW T;  1VQN Q;  3JB9 D;  3PVL A;  1N9R A;  4F16 A;  3FRN A;  3I5S A;  5C0M A;  3CPW S;  2RA2 A;  4RUG A;  5I22 A;  3QPH A;  4GLM A;  1WDX A;  1ZUY A;  2CT4 A;  2H8H A;  1PRL C;  1VUB A;  3CCQ T;  1VQ6 A;  3LW5 E;  1BI1 A;  3G4S Q;  2MPX C;  5GAN g;  1VQ5 T;  2EJ9 A;  2X9H A;  4LDY A;  1UHC A;  3F70 A;  4X1V A;  1YJ9 A;  1VQP T;  1U8R A;  2DTO A;  3OYC A;  1P92 A;  4A63 B;  1PSE A;  2F5K A;  4M78 E;  4J6X A;  2E6N A;  2KYM A;  4C92 D;  1WXT A;  4ANJ A;  1TS9 A;  4JJN K;  2HL3 A;  1GFD A;  2GNC A;  2HBW A;  2KXD A;  5LJ3 g;  5LJ5 d;  1IRX A;  2E3I A;  1JU5 C;  4O5V A;  5I2S A;  1OU8 A;  2JMC A;  1V76 A;  3M57 A;  5HCK A;  4BD3 A;  2RHZ A;  2EQI A;  2SRC A;  4RCC A;  4DBH A;  3JCM e;  3LX7 A;  1TH7 A;  5A0G A;  2COW A;  2RJC A;  4M7D D;  2M02 A;  3UF4 A;  1NZ9 A;  1QVF A;  1VQN T;  4C8Q A;  1O75 A;  4BY6 B;  3CMA Q;  1OQK A;  1IHW A;  4JUV A;  4J8O A;  4PJO B;  2PVD B;  1UHF A;  5GAN 8;  3BDU A;  1WQ7 A;  3MP6 A;  1ZLM A;  3THK A;  1SSH A;  4O6J A;  4CC7 A;  4C92 G;  4CC3 A;  4MZM A;  2BE7 D;  4NL2 A;  3G4S T;  1NPP A;  1PM3 A;  2KT1 A;  5DLO A;  1VQ9 A;  5IXB A;  4IUR A;  1XJW B;  1VA7 A;  3EG3 A;  4XTY A;  1W2B S;  4OF1 A;  2WSE E;  4R55 A;  3T9N A;  4M77 C;  4XU0 A;  2KR3 A;  5D6W A;  3G6E Q;  2XK0 A;  2DD5 A;  4C8Q B;  1ZSZ C;  2K3X A;  1SPK A;  2RQU A;  4DEY A;  1CKB A;  1OV3 A;  2NWM A;  1PHT A;  1VYU A;  1ZQ1 A;  5CKE A;  4M78 B;  1LCK A;  3TVT A;  2HBP A;  2MMP A;  3A8G B;  2DEU A;  1IXD A;  2DJQ A;  1BK2 A;  3N5B B;  4K11 A;  5LJ5 j;  3X26 B;  1KG1 A;  5KYY B;  1Q7Y U;  3M55 A;  1D0Y A;  4PJJ A;  2DO3 A;  2VGM A;  4EMH A;  2ATC B;  2Y4Y A;  1UGV A;  1GCP A;  4II1 A;  3CMA T;  2XDP A;  5GJV B;  4FSX A;  1UJ0 A;  1FYN A;  1K73 U;  2WSC E;  2PU9 B;  4F7U F;  4RTU A;  2AZV A;  1Q86 U;  5IT9 E;  2F69 A;  4DQ2 A;  4HCC A;  3H6Z A;  2E65 A;  3MHX A;  2EBP A;  1KK7 A;  1WX6 A;  2EYQ A;  2RHI A;  3X24 B;  3ME9 A;  1I5O B;  3V8J A;  2KYB A;  4M77 D;  2CUD A;  3RDV A;  1WHK A;  4EMK B;  3PVQ A;  2LC4 A;  5FW9 A;  2BZ8 A;  1E7O A;  2DAQ A;  2YUO A;  3EFS A;  2V1Q A;  1JJ2 P;  2X3X D;  3G6E T;  4HVV A;  3MKD A;  4JJD A;  4NS5 A;  2RQV A;  2EGC A;  4NOY A;  1Q7Y R;  4MDX A;  2B8A A;  1FX7 A;  4AFU C;  3MEA A;  2OX7 A;  1CSK A;  2EQJ A;  3FLG A;  2XDB A;  2RN8 A;  2YUN A;  3VRZ A;  4PFO A;  3VYH B;  5GAM e;  5GMK i;  2XG8 D;  3EFO A;  4BUG A;  2DD4 A;  1FMV A;  2DL4 A;  2DXC A;  1BIA A;  2YWW A;  3FIF A;  1G3S A;  4ZGD B;  3J80 E;  4C0D B;  1VQO A;  5D6X A;  1N9S A;  4MMK A;  3UT1 A;  2YSQ A;  2LQK A;  1AZG B;  2DL5 A;  1Q82 U;  3LGF A;  1IGU A;  2IVW A;  2GF7 A;  2ZPI B;  2YDL A;  4M77 G;  3MJX A;  3M0R A;  3RMS A;  4E7K A;  1KIK A;  2LMJ A;  4QQ6 A;  5CAI A;  2L3P A;  5FRO A;  3CCV Q;  3I55 Q;  5IN1 A;  2GTO A;  3EFO B;  1ZUU A;  3I56 A;  3CCS Q;  2YUQ A;  1GBQ A;  2FZC B;  3LH0 A;  2CP0 A;  1AHJ B;  1MHN A;  4ZNX A;  1IHV A;  4FL6 A;  5GMK e;  3OYM A;  3CC7 Q;  3HRU A;  1NPR A;  1OUL A;  1UB4 A;  1WHL A;  2YLC A;  1B07 A;  4IIO A;  3CCM Q;  2MIO A;  2LNH B;  4FCY A;  3H0F A;  5GAO l;  1NG2 A;  4OMO A;  3REA B;  3ZEH A;  1R8O B;  4L6V 5;  2DM1 A;  4ME7 A;  4PFP A;  4GLK A;  3REB B;  3QDF A;  5GAN e;  2VXE A;  3AHU A;  3RUX A;  4M75 F;  4XAX B;  1VQ8 Q;  1QWF A;  2H3J A;  1WJR A;  1UGP B;  2P4T A;  2ZGW A;  1WHH A;  3CCE Q;  3PNW C;  4LUD A;  4P5N A;  3QBY A;  4QW2 A;  1TU0 B;  1EIF A;  2RJE A;  5HKC A;  3QXE B;  1I0C A;  4XTU A;  1VQK Q;  2ROT A;  3CCV T;  2JZ2 A;  1W70 A;  1WXB A;  2AKK A;  2K4Y A;  4UC4 A;  1I5L A;  3JB9 F;  4PJO D;  2LCS A;  2DRK A;  5DM7 R;  2QDY B;  2IIM A;  3BW1 A;  4CC4 B;  8ATC B;  2E5K A;  3CCS T;  3PT9 A;  1Y0M A;  1K9M C;  1OOT A;  1NBE B;  2AKL A;  3RNJ A;  1Q95 G;  3KXT A;  3RKW A;  2PZ1 A;  4M7A E;  1RAA B;  1UG1 A;  1T3L A;  1YNZ A;  2M16 A;  2I2L A;  2V8K A;  3M0P A;  1N8R U;  3M0Q A;  1H92 A;  3OYD A;  2CSQ A;  3CCM T;  1I07 A;  2L3S A;  4KUD K;  1Q81 R;  1PD1 A;  5C6S A;  2NUP A;  3PFS A;  4JRK A;  2CKK A;  1GXI E;  2YRD A;  2O4X A;  3NTI A;  3H41 A;  3VUB A;  4BB7 A;  1WHM A;  3M4Y A;  1NLP C;  4M78 D;  4LE9 A;  2VC8 A;  2DX1 A;  4JRQ A;  4R0K A;  4AFQ C;  4JLG A;  2DYI A;  1NLO C;  5HK3 A;  1VQM Q;  2D9T A;  2RO0 A;  1VQL A;  5D6Y A;  1Z9Q A;  1IGQ A;  3SHW A;  1VQ8 T;  3M9Q A;  3CD6 A;  4XQ3 A;  3L2Q A;  2CZ1 B;  3CCE T;  4X34 A;  3CXC S;  2B86 A;  3VS5 A;  1KD1 U;  2EQK A;  4J9D A;  1BBZ A;  3L1A A;  4KGZ B;  2O88 A;  1O9S A;  4KH0 B;  4M7A A;  2NUP B;  2EYW A;  1NEB A;  3HP9 A;  2O4X B;  3OYF A;  4N4G A;  5GMK l;  1AWW A;  3C4S A;  5AT1 B;  4PJN A;  1VIE A;  2PQW A;  2RNA A;  1UJY A;  2QA4 A;  2MYS A;  1SSF A;  4BE1 A;  4N0A C;  2GTJ A;  1UEB A;  2LX7 A;  4E7J A;  5LL6 S;  3OYB A;  3JCM V;  4M7A B;  1GCQ C;  2ZZD A;  1K1Z A;  1KQS P;  1KD1 R;  4JJB A;  4DBR A;  1QVG P;  4J83 A;  3MP8 A;  1HSQ A;  3MET A;  1QCF A;  1VQM T;  2HMA A;  4ZGJ B;  4C5I A;  4OB1 B;  4RCB A;  2MI6 A;  1VQ7 A;  1M3A A;  1QVF S;  1QVG A;  2A7Y A;  4OMN A;  1K0X A;  1OX9 A;  2HNI A;  1AWJ A;  3L42 A;  4AT1 B;  4Q5W A;  1JB0 E;  2K9G A;  2M0Y A;  3TEE A;  2QTX A;  1YJN Q;  1I81 A;  1B3Q A;  1HYO A;  1XTD A;  2RK2 A;  4FYY B;  1YJW A;  2QDL A;  4KGX B;  3FB9 A;  4XTZ A;  4J9F A;  4E7S A;  3EG9 B;  1M30 A;  4F7U G;  1M90 U;  1QVP A;  4JDS A;  5I11 A;  3OYA A;  4V2S A;  2ED1 A;  2CT3 A;  5GMK m;  4WF2 A;  5GMK j;  2VAS A;  5KH6 A;  2QK0 A;  4M75 C;  1M5Q 1;  2VWF A;  3JCM X;  3CCQ A;  3UAT A;  2A36 A;  2LVM A;  2L2P A;  3C94 A;  3FJ5 A;  1VQ5 A;  1WZO A;  3OBW A;  4CC2 A;  1VQP A;  3S3M A;  2DIG A;  2F2V A;  1SKU B;  1U06 A;  3FDR A;  3M5A A;  3S3O A;  3JCM f;  2JM9 A;  2FO0 A;  4ZN1 A;  3KFV A;  1JBM A;  3CC4 Q;  2X4Y A;  4AG2 C;  2K79 A;  1X43 A;  3A1P A;  3PIP A;  2ZPH B;  1M90 R;  3P8H A;  2FPD A;  2HD0 A;  1TOV A;  4R56 A;  1K76 A;  1D0Z A;  4DOW A;  2CYZ B;  2K6D A;  2JJ9 A;  4ESR A;  2AHJ B;  3ULR B;  2CGH A;  4M4Z A;  1T0H A;  5A0L A;  3CC2 Q;  3D7S B;  1YJN T;  5L8R E;  2QQS A;  1VQN A;  3E9F A;  4C92 C;  2H3E B;  1GRI A;  3A8O B;  3LH5 A;  2LJ3 A;  1BCM A;  3CBP A;  1UUE A;  2RH2 A;  3OYI A;  4XTW A;  1ACM B;  2KY9 A;  3G4S A;  2JS0 A;  4PLL A;  1I1J A;  2YT6 A;  1HXD A;  3CEY A;  3JRZ A;  4KUI A;  2DLP A;  3OBY A;  4BI8 B;  2K5F A;  2F2W A;  2KRM A;  4M7D C;  3QWX X;  1ZUK A;  2PTK A;  3S3N A;  3CC4 T;  2O2O A;  3TSW A;  1SRM A;  1U1T A;  4C8Q E;  3V8K A;  2KGT A;  4RG2 A;  5IAY A;  5HK0 A;  1GFC A;  1XQH A;  1M1G A;  4M75 G;  1ZA2 B;  1U1S A;  1G3W A;  1UE9 A;  2CDT A;  4A4H A;  2HEQ A;  1WXU A;  4D6W A;  1SG5 A;  1NYG A;  2XHC A;  4XU2 A;  3CC2 T;  2O31 A;  1NM7 A;  2A3L A;  4HT9 A;  4PJO F;  4J9I A;  2E70 A;  2L5Q A;  3CBO A;  2RD1 A;  1W4S A;  2QGG A;  4WCI A;  4JS4 A;  3JB9 G;  3CMA A;  1YI2 Q;  3CPF A;  2R5A A;  4ZGE B;  2YUP A;  3QHS A;  2OTJ Q;  5GJW B;  3VKI A;  3S6W A;  4MZT A;  1VQ6 Q;  2DL7 A;  2LRQ A;  3UA6 A;  5GAM f;  3G1J A;  2EW3 A;  2LCC A;  5KCH A;  4C8Q F;  3OS1 A;  5KCO A;  2GFU A;  3NMZ C;  2V8J A;  3E9G A;  3OW2 P;  3JCM h;  1G3Y A;  1IB8 A;  4JPB W;  2E1H A;  3CME Q;  4OGC A;  4C5E A;  2DXU A;  4NL3 A;  4M78 F;  5FU6 B;  4FT4 A;  1E6G A;  3M56 A;  2K5L A;  1RAB B;  2GQI A;  2OAU A;  5EC7 A;  4ELZ C;  3A5Z B;  5CKF A;  1AWO A;  1X69 A;  3JSC A;  4KBM B;  1ABQ A;  2HAX A;  1PG5 B;  1ZHI A;  3OW2 A;  1AT1 B;  1G83 A;  2A0F B;  3DB3 A;  2NUT A;  4HCB A;  2KBT A;  2EYY A;  1K9M R;  1Y07 A;  2DER A;  4E6R A;  3G71 A;  3OB9 A;  3QYH B;  3EH2 A;  2VB6 A;  1H64 1;  1K8A U;  4M7D G;  2AT1 B;  4MML A;  2QXF A;  4JS5 A;  1YI2 T;  3SEM A;  2JXB A;  5IXF A;  2OTJ T;  4OML A;  1BI3 A;  2CRE A;  4FYW B;  2LJ1 A;  9ATC B;  1K4U S;  4D8K A;  5GAN 7;  1VQ6 T;  2CP7 A;  2KAF A;  3VS2 A;  4A4F A;  1M2O A;  1M1K U;  2DVJ A;  3FEO A;  4J9G A;  1YHQ Q;  2E4H A;  1BI2 A;  1QKW A;  2DZ9 A;  2JTM A;  2JTF A;  2NUT B;  5GAN f;  3OS2 A;  4D8D A;  5I21 A;  3GNG A;  2RI2 A;  1MMN A;  3BFM A;  4FYX B;  2J6F A;  3CME T;  3LWH A;  3A98 A;  2IPO B;  2LT1 A;  2WAC A;  1TSF A;  2RM4 A;  1G2B A;  1K8A R;  2GBQ A;  3CCJ Q;  2QI2 A;  2MF2 A;  4J9H A;  4MZP A;  5LJ3 f;  2OTL Q;  1M27 C;  2FZG B;  1OPK A;  1RUW A;  2VUB A;  2X51 A;  1VQ4 Q;  4KGV B;  4EDU A;  1M1K R;  1M1F A;  4PNO A;  1OYX A;  4CI0 C;  4BE2 A;  3CPW P;  1M8V A;  1KC8 C;  2P4R A;  3TCJ A;  4HCK A;  1WJS A;  4JRP A;  3C0C A;  2KRO A;  2PUK B;  2XIC A;  3CCV A;  1RI0 A;  1JJ2 A;  2JVV A;  1S1N A;  3NGP A;  1MMA A;  1NJI C;  3JCM d;  2DL3 A;  4CRI A;  4WTO B;  3CCS A;  2EQU A;  5GAM h;  1JQQ A;  2LCL A;  1YIJ Q;  5CR2 A;  1YHQ T;  1X27 A;  4N0A A;  2BKD N;  1H3H A;  1WHJ A;  1I8F A;  1YP5 A;  1NEG A;  4HT8 A;  1Y96 A;  2EQM A;  4DOV A;  4B9X A;  5A2Q E;  4QKU A;  2DMO A;  1X6B A;  5I2M A;  2XD0 A;  3CCM A;  3OA6 A;  1NYF A;  3QZ9 B;  1D1A A;  2R58 A;  5LJ5 g;  1GCQ A;  2EJG A;  4PK4 A;  1D0X A;  1N5Z A;  4PJO C;  2DZC A;  4BE0 A;  2KQW A;  3CCJ T;  2X3W D;  2BTT A;  3M54 A;  2ROL A;  1FWZ A;  2OTL T;  4XK8 E;  2QEX Q;  3RER A;  1A0N B;  1JXO A;  1VQ4 T;  1VQ8 A;  1Y96 B;  1UGS B;  4VUB A;  2DYB A;  1QKX A;  2ZPB B;  2IG0 A;  5GMK h;  3CCE A;  2RHU A;  4FM4 B;  3OMG A;  1FXX A;  2JM8 A;  4HXJ A;  5GAN 4;  1UFF A;  3WVD B;  3L2Z A;  1U3O A;  3JCM W;  5FRN A;  2FG0 A;  2BZY A;  1B7T A;  2PVG B;  2KK4 A;  4M78 C;  3DB4 A;  3H9N A;  5M9O A;  3VUZ A;  1WI7 A;  1Q81 U;  2RMO A;  1YIJ T;  4KRT A;  5IH2 A;  2NLU A;  5GAN h;  3LLR A;  2K5I A;  1E6H A;  4J9B A;  2LQN A;  2QAZ A;  4YTL A;  5FRM A;  2GQV A;  1G5V A;  2WSF E;  2ZCF B;  2ED0 A;  3QO3 A;  3I55 T;  4M75 A;  2PVO B;  5LJ3 e;  1ZBJ A;  2NUZ A;  4C92 E;  1MGQ A;  2AK5 A;  2Y4X A;  2V8I A;  1BIB A;  3I35 A;  2Y90 A;  1QQJ A;  1KSW A;  2CZ7 B;  3CC7 T;  1VQM A;  4OMM A;  1OZ3 A;  4J7I A;  2DJZ A;  2BZX A;  2QEX T;  4RTV A;  5AYF A;  5KYW A;  4B6M A;  4EMK C;  4C8Q D;  2CS7 A;  6AT1 B;  3TRE A;  4FYV B;  3HPW A;  1AD5 A;  5GAM d;  2JTE A;  2R5M A;  4M7D E;  2K7A A;  1WGS A;  4PFZ A;  2KRN A;  2E6Z A;  3H8Z A;  4XTV A;  4C5H A;  2E10 A;  1RLP C;  5GAO m;  2MWP A;  1Z9Z A;  4PJO G;  3JCM P;  1WFW A;  1YIT Q;  2RHX A;  2CH4 A;  2DBK A;  5ECA A;  5CCA A;  2CSI A;  1TG0 A;  2KT8 A;  4C92 A;  2D8J A;  3GNF B;  5KYW B;  2P0K A;  4IIM A;  1VQK T;  4M7A F;  2K57 A;  1QMC A;  3LYI A;  2D6F A;  2A37 A;  1N6A A;  2RQW A;  2F1L A;  1JEG A;  4M7D A;  2QYZ A;  3UA7 A;  4M78 G;  1LJO A;  1RAF B;  4E7I A;  1S72 Q;  4B9W A;  2FZK B;  3CBM A;  4C92 B;  3L2U A;  2O01 E;  3ASK A;  4PL6 A;  1VQL Q;  1QP3 A;  3JCM Q;  3JAM E;  1Q7Y C;  1SF9 A;  5CQX A;  2KSS A;  2PUO B;  1B34 A;  3ZFJ A;  1HK9 A;  1T3S A;  4KT0 E;  3OSV A;  5KE3 A;  1SRL A;  2FRY A;  3M58 A;  5GAO r;  5GAN d;  3EGX A;  1NE8 A;  3UDC A;  5GAM j;  3QDR B;  1RAG B;  1K73 C;  1VIF A;  3EGU A;  1Q86 C;  4M7D B;  1YIT T;  1G3T A;  4IUQ A;  3OYJ A;  5CVI A;  2JUF A;  1YJN A;  1LPL A;  3OYE A;  2DFU A;  2J05 A;  2G3R A;  1MMD A;  2RI5 A;  2LQ8 A;  4M77 E;  1KQS A;  2COZ A;  1IRE B;  3QII A;  3VS7 A;  3MCA B;  1B34 B;  3NFC A;  4RG8 A;  3RES A;  1U5S A;  3M0T A;  2MK5 A;  4BI4 A;  3GIB A;  4QVC A;  4LN2 A;  3EGX B;  3JCM c;  2RB6 A;  1D1C A;  2CZ6 B;  2W10 A;  1D3B A;  4HA8 A;  3VYG A;  3QKJ A;  1QWE A;  4XU3 A;  1ABO A;  5EG2 A;  3VS4 A;  2X4J A;  4TVR A;  2EAY A;  2ZAE A;  2CP5 A;  1TUD A;  1M9S A;  1KJW A;  3LWI A;  4PJM A;  1S72 T;  1X6O A;  2DXT A;  3PE0 A;  3OW2 S;  4IUT A;  4FSS A;  3RKY A;  3CC4 A;  3CCU Q;  5GAN 2;  1EZZ B;  1HJD A;  4OMP A;  3CCL Q;  1XNI A;  4RTY A;  1Q82 C;  3HSB A;  1M3C A;  7AT1 B;  5L23 A;  3L2R A;  1OI1 A;  2VGN A;  4LNP A;  2MAM A;  2QQB A;  4LDX A;  2LP5 A;  4M77 A;  3GP8 A;  4LDV A;  2YRC A;  5LJ5 e;  2LT4 A;  1D3B B;  1ZSZ A;  5A0D A;  2EPD A;  3C95 A;  5GAN j;  2LTO A;  2M51 A;  3CC2 A;  2ZPF B;  2LDM A;  2C06 A;  5FU7 C;  3H0I A;  5GAN 6;  1X75 C;  1ZSG A;  1RL2 A;  2MWO A;  2QQA A;  4DEX A;  1RAE B;  2LQW A;  1AOJ A;  3MPU B;  2DIQ A;  4AG1 C;  1UTI A;  2DK3 A;  3V7R A;  4M77 B;  3Q1J A;  5LJ3 j;  1UGR B;  3OQ5 A;  1ZSZ B;  2FPF A;  2MOX A;  1YBY A;  3X25 B;  2E3H A;  4J6Y A;  2YXY A;  1M2V A;  2Z0W A;  5KE2 A;  3VU3 C;  2QG9 B;  3HRS A;  4QVZ A;  3DLL A;  2EKO A;  3PMT A;  5DLQ E;  5GAO q;  3CCU T;  3UWN A;  3FC3 A;  1WYX A;  2OJ2 A;  1BCO A;  3CXC P;  3CCL T;  1R0B G;  1H3Z A;  2HQX A;  4A4E A;  2E41 A;  3EG0 A;  4HKE A;  4M7A C;  2KXC A;  8AT1 B;  1JJ2 S;  3NPF A;  3IQL A;  3CCR Q;  2EJF A;  3U23 A;  1C1A A;  2FPE A;  4RTW A;  1YI2 A;  2XDD A;  2OTJ A;  2ECZ A;  5CQY A;  2X4W A;  1X01 A;  3RIR A;  1EFN A;  3QZ5 B;  4N4I A;  4EIK A;  1N8R C;  1MMG A;  3MEV A;  2EGE A;  3M0S A;  3HHT B;  3HL8 A;  2K3Y A;  3VS3 A;  1VYT A;  3PTA A;  1W6X A;  4RKU E;  1IO6 A;  2QGF B;  3DKM A;  3OYK A;  3X20 B;  4LDU A;  2DBM A;  3QUI A;  3QSU A;  3V7S A;  2QTV A;  5IHN A;  4RTX A;  3CME A;  1UEC A;  2D0N A;  4DBF A;  3GOX A;  1DJ7 B;  3QG1 A;  3OYL A;  1K9M U;  4PJO A;  2J6O A;  2DNU A;  2F2X A;  1QVF P;  1F1B B;  3JB9 I;  4M7A D;  1CKA A;  1YJ9 Q;  2HKQ B;  1KD1 C;  2ZPG B;  3M0U A;  4BAC A;  2QAS A;  2KEA A;  3MEW A;  3G6E A;  2RQR A;  3QWY A;  4Z8A A;  2I0N A;  3NTK A;  5FWC A;  4E2F B;  2G6F X;  3A8M B;  2DTH A;  3A8H B;  3CCR T;  4RTT A;  1GBR A;  1ZA1 B;  2VKN A;  2JNG A;  5J26 A;  2JT4 A;  3SWN C;  2XID A;  4FW1 A;  1RAC B;  4IUP A;  3MEU A;  4OVA A;  1TUG B;  1ZBX A;  4M78 A;  4QVD A;  1D09 B;  1WJQ A;  3BDL A;  3GBQ A;  2KRS A;  2DXB A;  1YHQ A;  3PGG A;  4OMQ A;  2DET A;  2RQT A;  2GGR A;  1PCX A;  5KYY A;  2JMA A;  4M7A G;  4Y92 A;  4F7U E;  4PKC C;  3OMC A;  1PWT A;  3CQT A;  5D7U A;  3M4G A;  4QT7 A;  3JB9 J;  4JZ3 A;  4FIB A;  1UGQ B;  1YFN A;  2KVQ G;  3EHQ A;  3L2W A;  3I5R A;  3TQ7 P;  1WQW A;  1VQ9 Q;  1WLP B;  3CCJ A;  2HCK A;  1OZ2 A;  1YJ9 T;  4FW2 A;  2L0A A;  2OTL A;  2DKG A;  4AMC A;  2ESW A;  1D1B A;  2K3B A;  4EMK A;  4Y91 A;  1VQ4 A;  2D1X A;  3EG1 A;  4LXC A;  3OYG A;  1KHI A;  5CKH A;  3G71 Q;  2HSP A;  4IUV A;  4EPC A;  1M90 C;  4ORZ A;  4F7U A;  2DVE A;  3OY9 A;  2C0T A;  4FT2 A;  1X2Q A;  3MP1 A;  2KE9 A;  5GAN 5;  2QQR A;  3GPL A;  5CK9 A;  1YIJ A;  2L89 A;  1N27 A;  1TTH B;  3JCM J;  2AZS A;  5GAO p;  3QYG B;  4BI3 A;  4F14 A;  1PD0 A;  4J9C A;  1QLY A;  4LD6 A;  4XTX A;  5FLX E;  2XKO C;  2P84 A;  1HD3 A;  1PKS A;  3I55 A;  1MUZ A;  3NTH A;  2FEI A;  3V7C A;  4IKF A;  4ZN3 A;  2EGA A;  3O8V A;  5HY6 A;  2V1R A;  4QQD A;  3ZL7 C;  4F7U B;  3SD4 A;  4ZTJ A;  4LDW A;  1VQ9 T;  3EGD A;  3BY7 A;  3CPW A;  4J7F A;  2E12 A;  2XMF A;  3CC7 A;  2BUD A;  2DIL A;  1K73 R;  2ZPE B;  1Q86 R;  1AZE A;  3OS0 A;  2QEX A;  4C0Z A;  2EYZ A;  4BY6 C;  1WIE A;  3R6N A;  2VYT A;  4QQG A;  1PSF A;  2J7I A;  1MND A;  3TSZ A;  4GBQ A;  1JO8 A;  3G71 T;  1AVZ C;  2CP3 A;  5IHK A;  1KQS S;  5FU6 C;  5CIU A;  1QVG S;  4ELY C;  4M75 E;  3ER0 A;  4A4K A;  4X9D A;  4JJC A;  3EGD B;  1R0C B;  2QQ9 A;  1VQO Q;  3OSS C;  3L2V A;  2P0Q A;  2DF6 A;  1JXM A;  3M53 A;  1SHG A;  3OYH A;  1QCO A;  2DPP B;  2C0I A;  4J9E A;  2VVK A;  2R57 A;  4Y28 E;  1X6G A;  4C0G A;  4C8Q C;  2M0O A;  4E47 A;  4OP0 A;  5J3B A;  2DTI A;  2RJD A;  1VQK A;  4Z89 A;  2CH4 W;  4DA4 A;  2RPN A;  2KNB B;  1I4K 1;  2FHD A;  2K2V A;  2FL7 A;  2M1H A;  2L3R A;  3RR6 A;  3I56 Q;  1Q82 R;  1OEB A;  3INZ A;  1KFZ A;  2DE0 X;  1KQ2 A;  1BYM A;  2HDA A;  2E64 A;  1BB9 A;  2HL5 C;  2J6K A;  2F5T X;  1LVK A;  1W2B P;  2L8D A;  1G8X A;  1WNL A;  2GCX A;  2HKN A;  1FMW A;  1OU9 A;  2LZ6 B;  1V1C A;  2KI7 A;  4J6W A;  3E19 A;  4PLI A;  3URG A;  1VOM A;  1PRM C;  5IHI A;  5FWB A;  1MV3 A;  5CKB A;  2J06 A;  1H8K A;  3EH1 A;  3HRT A;  1C0M A;  1W2B A;  3R6O A;  1WPY A;  1J3T A;  2EFI A;  3V8L A;  1QP2 A;  2EVR A;  1C6V X;  5LJ3 h;  4A54 A;  1PNJ A;  1X2K A;  2D0Q B;  1RI9 A;  3PIO A;  1T0J A;  4OB3 B;  4C5G A;  1VQO T;  2GFA A;  1YIT A;  2NYS A;  1SHF A;  1ARK A;  3EFR A;  1KHC A;  2C0O A;  4ZTF A;  2LJ0 A;  4M75 B;  2K2M A;  4C0F A;  4AFS C;  1WHG A;  3GF5 A;  5KYU A;  4LUE A;  4E7Z A;  3OYY A;  5CKD A;  4DBQ A;  4J5Y A;  1PC0 A;  1YWO A;  2RF0 A;  2FVU A;  3ZBD A;  4OB0 B;  3I56 T;  4X9C A;  2D8H A;  3SFM A;  2RI3 A;  1MV0 B;  2PNI A;  1RAH B;  3J7A F;  5LJ5 f;  1WA7 A;  1LOJ A;  2RHY A;  2P0P A;  3PMI A;  4C92 F;  4KUL A;  4C0D C;  2KMT A;  4L5G A;  2FB7 A;  3KUF A;  3OYN A;  2EWN A;  2A28 A;  3X28 B;  5FU7 B;  1S72 A;  3RBB B;  4Z88 A;  2CP2 A;  5CO7 A;  4E7L A;  5DY9 A;  5KYU B;  1Y57 A;  3BE3 A;  2YLB A;  2CP6 A;  1SEM A;  4C8Q G;  1UDL A;  1YCS B;  1K8A C;  4Z02 A;  1BKB A;  2ABL A;  3JCM g;  4AFZ C;  2COY A;  4M7D F;  4EMG A;  4OMF B;  5KYX A;  1N8R R;  1MNE A;  2HQE A;  1RAD B;  2BE9 B;  2ENM A;  3CD6 Q;  1LNX A;  3C12 A;  1M1K C;  1Y7X A;  2JS2 A;  4F17 A;  3HFO A;  2JOY A;  1R77 A;  2YRV A;  3JV3 A;  4L59 A;  3VJP A;  3E2U A;  1AWX A;  4JRI A;  4A4G A;  4ATO A;  2AIR B;  3E1S A;  1RAI B;  4N4H A;  3SDZ A;  1TUC A;  3RMQ A;  1TWB A;  4BDY A;  1YWP A;  3JB9 H;  2LX9 A;  1Y71 A;  3GLX A;  5KYX B;  2OI3 A;  3WVE B;  2E5Q A;  1QW1 A;  2QA4 Q;  3I9Q A;  2XI9 A;  4F04 B;  3EHR A;  2O9V A;  4OB2 B;  1FMK A;  2HSE B;  2LNV A;  5LJ3 d;  2DA9 A;  3EG9 A;  3DLM A;  2HQH A;  3CCU A;  2W0Z A;  3G7Z A;  4A53 A;  3QJY A;  3CCL A;  2CZ0 B;  3P8B B;  3P8D A;  3TU4 K;  3UPU A;  4IUU A;  2FRW A;  4OGE A;  2O9S A;  3WXM B;  4BDZ A;  3VRY A;  5J39 A;  2BIV A;  2RK1 A;  2EIF A;  2EKH A;  1VQL T;  4MDW A;  3EG2 A;  1M3B A;  3HTR A;  2DEQ A;  3MO8 A;  3VV0 A;  1VQ7 Q;  3CD6 T;  1OPL A;  4XU1 A;  4E7H A;  5GAO n;  3SWN A;  2FYK A;  1K9A A;  1EX4 A;  1YCY A;  4M77 F;  3VS1 A;  2CUB A;  3AT1 B;  3JCM b;  4PJL A;  3H0H A;  1ZX6 A;  2MCN A;  3HKS A;  1QCN A;  3OS5 A;  5GAN 3;  1YJW Q;  5LJ5 h;  3QJ6 A;  3O5Z A;  2XU8 A;  1OX8 A;  2YHT A;  1KC8 U;  2QA4 T;  3HFN A; 
#chains in the Genus database with same CATH homology
 3CD6 A;  2EQM A;  4XQ3 A;  3L2Q A;  2CZ1 B;  3SWN B;  3M59 A;  4DOV A;  2JNG A;  5J26 A;  1NJI U;  3CCE T;  1V29 B;  4X34 A;  3CXC S;  4B9X A;  5A2Q E;  2X4X A;  2XID A;  3SWN C;  5GAM g;  2RJF A;  5I2M A;  1KD1 U;  2XD0 A;  2X35 A;  3KBG A;  2EQK A;  3OA6 A;  3CCM A;  4LD9 K;  3QZ9 B;  3A8L B;  4IUP A;  3L1A A;  2R58 A;  2M9U A;  3MEU A;  2VV5 A;  5LJ5 g;  2EJG A;  4OVA A;  4M7A A;  1O9S A;  2JN0 A;  4PJO C;  3LGL A;  3EAE A;  2DZC A;  4BE0 A;  1ZBX A;  4M78 A;  3HP9 A;  4QVD A;  2O4X B;  2KQW A;  1WJQ A;  3OYF A;  4N4G A;  3CCJ T;  5GMK l;  1M4Z A;  4HCZ A;  3BDL A;  3M54 A;  3C4S A;  1FWZ A;  2DXB A;  2OTL T;  1YHQ A;  3PGG A;  3SB2 A;  4XK8 E;  1KQ1 A;  2VXF A;  1VIE A;  2PQW A;  2QA4 A;  3RER A;  1XOV A;  4M7A G;  1SSF A;  3CCR A;  4F7U E;  4BE1 A;  4PKC C;  3OMC A;  4N0A C;  1VQ4 T;  1VQ8 A;  1Y96 B;  1UGS B;  4RMO A;  4VUB A;  1Q81 C;  1VQ7 T;  2ZPB B;  2IG0 A;  5GMK h;  3M4G A;  3CCE A;  1UEB A;  2RHU A;  4E7J A;  4FM4 B;  3OMG A;  5LL6 S;  1FXX A;  4FU6 A;  2KDS A;  3JB9 J;  3OYB A;  4FIB A;  5GAN 4;  4M75 D;  1UGQ B;  2KVQ G;  3JCM V;  3WVD B;  3L2W A;  4M7A B;  1IZ6 A;  3L2Z A;  1JRI A;  1WQW A;  2ZZD A;  3JCM W;  5FRN A;  2PVG B;  4GY5 A;  2KK4 A;  4M78 C;  1BI0 A;  3CCJ A;  3DB4 A;  1OZ2 A;  5M9O A;  4PJO E;  1YJ9 T;  3VUZ A;  4J83 A;  3J81 E;  3RKX A;  3MP8 A;  1Q81 U;  3MET A;  4JLI A;  3FJP A;  2OTL A;  2DKG A;  3CXC A;  1YIJ T;  1YJW T;  2NLU A;  1VQM T;  3JB9 D;  1N9R A;  5GAN h;  3LLR A;  4ZGJ B;  2K5I A;  4C5I A;  4OB1 B;  4EMK A;  4Y91 A;  3FRN A;  1VQ4 A;  5C0M A;  3CPW S;  4RCB A;  4YTL A;  2GQV A;  2RA2 A;  5FRM A;  2WSF E;  2MI6 A;  1VQ7 A;  3OYG A;  1G5V A;  1KHI A;  2ZCF B;  5CKH A;  3QO3 A;  3I55 T;  4M75 A;  3QPH A;  1QVF S;  2PVO B;  4IUV A;  4EPC A;  1M90 C;  5LJ3 e;  1VUB A;  2A7Y A;  3CCQ T;  1QVG A;  1VQ6 A;  3LW5 E;  2HNI A;  1BI1 A;  1MGQ A;  4C92 E;  2Y4X A;  3L42 A;  2V8I A;  4F7U A;  2DVE A;  5GAN g;  1VQ5 T;  3OY9 A;  2EJ9 A;  4LDY A;  4Q5W A;  1JB0 E;  1BIB A;  3F70 A;  4FT2 A;  2Y90 A;  3MP1 A;  1YJ9 A;  1VQP T;  1U8R A;  2DTO A;  3OYC A;  3JB9 F;  1P92 A;  5GAN 5;  2QQR A;  2CZ7 B;  1PSE A;  2QTX A;  3TEE A;  2F5K A;  4M78 E;  4J6X A;  1I81 A;  3GPL A;  1XTD A;  3CC7 T;  2RK2 A;  5CK9 A;  2L89 A;  2E6N A;  1YIJ A;  1YJW A;  1N27 A;  1VQM A;  4XTZ A;  3FB9 A;  3JCM J;  1OZ3 A;  4J7I A;  2DJZ A;  3HFN A;  4F7U G;  5GAO p;  1M90 U;  1QVP A;  2QEX T;  3QYG B;  4JDS A;  5AYF A;  4BI3 A;  4C92 D;  3OYA A;  4V2S A;  4EMK C;  3I56 T;  4C8Q D;  2CS7 A;  4JJN K;  3TRE A;  4LD6 A;  4XTX A;  5FLX E;  5GMK m;  2XKO C;  4WF2 A;  3I55 A;  5GMK j;  3HPW A;  5GAM d;  2R5M A;  3NTH A;  3V7C A;  4M7D E;  5KH6 A;  4IKF A;  4M75 C;  1M5Q 1;  4ZN3 A;  5LJ3 g;  3JCM X;  5LJ5 d;  3CCQ A;  3O8V A;  4O5V A;  5HY6 A;  5I2S A;  4QQD A;  1WGS A;  4F7U B;  2LVM A;  2E6Z A;  3SD4 A;  4ZTJ A;  3C94 A;  3H8Z A;  4XTV A;  1VQ5 A;  4C5H A;  3OBW A;  2E10 A;  4LDW A;  1VQ9 T;  5GAO m;  2MWP A;  3M57 A;  4PJO G;  4BD3 A;  3JCM P;  2RHZ A;  3S3M A;  1VQP A;  2DIG A;  3BY7 A;  3CPW A;  2RHX A;  4RCC A;  4J7F A;  3JCM e;  2E12 A;  3FDR A;  3M5A A;  3LX7 A;  1TH7 A;  5A0G A;  5CCA A;  2BUD A;  3CC7 A;  3JCM f;  2RJC A;  3S3O A;  4M7D D;  2ZPE B;  4C92 A;  1NZ9 A;  1QVF A;  4ZN1 A;  4C8Q A;  1VQN T;  3OS0 A;  1JBM A;  1O75 A;  4BY6 B;  3GNF B;  2QEX A;  2X4Y A;  4C0Z A;  2P0K A;  4BY6 C;  4JUV A;  2VYT A;  4J8O A;  1PSF A;  2PVD B;  4QQG A;  4PJO B;  5GAN 8;  3PIP A;  3BDU A;  1WQ7 A;  3MP6 A;  3G71 T;  1VQK T;  4M7A F;  2ZPH B;  2K57 A;  3P8H A;  4O6J A;  2HD0 A;  4R56 A;  1KQS S;  4C92 G;  3LYI A;  4MZM A;  5FU6 C;  2D6F A;  5CIU A;  4DOW A;  1QVG S;  4ELY C;  4NL2 A;  2CYZ B;  4M75 E;  3G4S T;  3ER0 A;  1NPP A;  4A4K A;  4X9D A;  5DLO A;  1VQ9 A;  2AHJ B;  4IUR A;  1N6A A;  2CGH A;  2QQ9 A;  3OSS C;  3L2V A;  5A0L A;  2P0Q A;  4M7D A;  4XTY A;  1W2B S;  3M53 A;  4OF1 A;  2WSE E;  4R55 A;  4M78 G;  3OYH A;  3T9N A;  4M77 C;  1LJO A;  4E7I A;  4B9W A;  4XU0 A;  5D6W A;  2DPP B;  1YJN T;  3CBM A;  5L8R E;  4C92 B;  2QQS A;  2XK0 A;  2O01 E;  3L2U A;  3ASK A;  1VQN A;  4PL6 A;  2DD5 A;  3E9F A;  4C8Q B;  1QP3 A;  4C92 C;  2K3X A;  2R57 A;  3A8O B;  4Y28 E;  4C8Q C;  4C0G A;  3JCM Q;  3OS1 A;  3JAM E;  1Q7Y C;  2M0O A;  4E47 A;  5CQX A;  2KSS A;  2PUO B;  4OP0 A;  5J3B A;  1B34 A;  2DTI A;  3ZFJ A;  1HK9 A;  1ZQ1 A;  2RJD A;  5CKE A;  1VQK A;  4M78 B;  3CBP A;  2RH2 A;  4KT0 E;  3OSV A;  2HBP A;  4DA4 A;  3OYI A;  1I4K 1;  4XTW A;  5KE3 A;  2MMP A;  2FHD A;  2KY9 A;  2K2V A;  2FL7 A;  2M1H A;  3M58 A;  2L3R A;  3A8G B;  5GAN d;  5GAO r;  1NE8 A;  3INZ A;  3UDC A;  5GAM j;  3G4S A;  3QDR B;  1KQ2 A;  1BYM A;  2E64 A;  3JRZ A;  3CEY A;  3N5B B;  1HXD A;  4KUI A;  4PLL A;  1K73 C;  5LJ5 j;  3X26 B;  1KG1 A;  1VIF A;  2F5T X;  1I5L A;  2L8D A;  3OBY A;  4BI8 B;  2K5F A;  1WNL A;  1Q7Y U;  3M55 A;  3X24 B;  1Q86 C;  2GCX A;  4M7D B;  1YIT T;  1G3T A;  4IUQ A;  2DO3 A;  2VGM A;  4EMH A;  3OYJ A;  4M7D C;  5CVI A;  2JUF A;  1YJN A;  3OYE A;  2G3R A;  2Y4Y A;  2RI5 A;  4J6W A;  2LQ8 A;  3S3N A;  4M77 E;  1KQS A;  4II1 A;  3CMA T;  3E19 A;  4PLI A;  3CC4 T;  2XDP A;  1IRE B;  3QII A;  4FSX A;  3URG A;  1U1T A;  3MCA B;  1B34 B;  3NFC A;  4RG8 A;  4C8Q E;  1K73 U;  3RES A;  2WSC E;  2PU9 B;  5CKB A;  3V8K A;  4F7U F;  4RG2 A;  5IAY A;  4BI4 A;  5HK0 A;  3HRT A;  1Q86 U;  5IT9 E;  3GIB A;  4QVC A;  1W2B A;  2F69 A;  4DQ2 A;  4HCC A;  3H6Z A;  2E65 A;  1XQH A;  3MHX A;  1WPY A;  3R6O A;  1M1G A;  2RB6 A;  2EYQ A;  2RHI A;  4M75 G;  2EFI A;  2CZ6 B;  3JCM c;  1QP2 A;  3ME9 A;  5LJ3 h;  1D3B A;  3V8L A;  4A54 A;  1U1S A;  3V8J A;  1G3W A;  2D0Q B;  4HA8 A;  4M77 D;  3VYG A;  4A4H A;  3QKJ A;  3PIO A;  4XU3 A;  4OB3 B;  4C5G A;  5EG2 A;  1VQO T;  2X4J A;  4TVR A;  2EAY A;  4EMK B;  2GFA A;  1YIT A;  4D6W A;  2LC4 A;  2XHC A;  4XU2 A;  3CC2 T;  1M9S A;  2DAQ A;  3EFS A;  3LWI A;  2A3L A;  3EFR A;  1KHC A;  1S72 T;  1X6O A;  4HT9 A;  4ZTF A;  3G6E T;  2DXT A;  4PJO F;  3OW2 S;  4M75 B;  4NS5 A;  2E70 A;  4IUT A;  2L5Q A;  3CBO A;  2RD1 A;  1W4S A;  4NOY A;  3RKY A;  4JS4 A;  4C0F A;  3CMA A;  3JB9 G;  3CPF A;  3CC4 A;  4MDX A;  2B8A A;  2R5A A;  5GAN 2;  1FX7 A;  3GF5 A;  4ZGE B;  3MEA A;  3OYY A;  3QHS A;  5CKD A;  1XNI A;  4J5Y A;  3VKI A;  1Q82 C;  2EQJ A;  3FLG A;  2XDB A;  3HSB A;  3S6W A;  4MZT A;  3VYH B;  3L2R A;  2FVU A;  1OI1 A;  2VGN A;  3ZBD A;  2XG8 D;  2MAM A;  4OB0 B;  2QQB A;  5GAM e;  5GMK i;  4LDX A;  4BUG A;  2DD4 A;  2LRQ A;  4M77 A;  4LDV A;  3GP8 A;  5LJ5 e;  2DXC A;  1BIA A;  2LT4 A;  4X9C A;  1D3B B;  5GAM f;  3FIF A;  1G3S A;  3SFM A;  2LCC A;  2RI3 A;  3J7A F;  4ZGD B;  5LJ5 f;  5A0D A;  3J80 E;  1LOJ A;  2RHY A;  4C0D B;  5KCH A;  2P0P A;  3C95 A;  3PMI A;  5D6X A;  4C92 F;  5GAN j;  1N9S A;  4KUL A;  4C0D C;  1VQO A;  4C8Q F;  2KMT A;  2LTO A;  2GFU A;  2FB7 A;  3KUF A;  3M9Q A;  4L5G A;  4MMK A;  3UT1 A;  5KCO A;  2EWN A;  3OYN A;  3CC2 A;  2ZPF B;  2LQK A;  3X28 B;  5FU7 B;  2V8J A;  1S72 A;  2LDM A;  3LGF A;  3E9G A;  1Q82 U;  2IVW A;  2GF7 A;  3JCM h;  1G3Y A;  2C06 A;  5FU7 C;  2ZPI B;  2E1H A;  4M77 G;  4OGC A;  5CO7 A;  4C5E A;  4E7L A;  2DXU A;  4NL3 A;  4M78 F;  5DY9 A;  5FU6 B;  4FT4 A;  5GAN 6;  3M56 A;  1X75 C;  2K5L A;  3RMS A;  4E7K A;  1RL2 A;  2YLB A;  4QQ6 A;  5CAI A;  2OAU A;  4C8Q G;  2MWO A;  2QQA A;  5FRO A;  4ELZ C;  3A5Z B;  5CKF A;  1K8A C;  4Z02 A;  5IN1 A;  2DIQ A;  1BKB A;  3JSC A;  3JCM g;  2DK3 A;  3V7R A;  4KBM B;  4M77 B;  2HAX A;  3I56 A;  3Q1J A;  4M7D F;  4EMG A;  4OMF B;  1ZHI A;  1UGR B;  3LH0 A;  5LJ3 j;  3OW2 A;  3OQ5 A;  1AHJ B;  1MHN A;  2HQE A;  1YBY A;  3DB3 A;  4HCB A;  3X25 B;  4J6Y A;  1M1K C;  1Y07 A;  4FL6 A;  5GMK e;  3OYM A;  3HRU A;  5KE2 A;  1LNX A;  1NPR A;  3C12 A;  1UB4 A;  1Y7X A;  3VU3 C;  3G71 A;  2YLC A;  3HRS A;  3OB9 A;  3QYH B;  1H64 1;  1K8A U;  4M7D G;  3HFO A;  4QVZ A;  2JOY A;  3DLL A;  2YRV A;  2EKO A;  3PMT A;  2QXF A;  4MML A;  5DLQ E;  4JS5 A;  1YI2 T;  5GAO q;  4L59 A;  3UWN A;  3VJP A;  3FC3 A;  3CCU T;  5GAO l;  2OTJ T;  4JRI A;  1BI3 A;  4A4G A;  3CCL T;  4ATO A;  3ZEH A;  3E1S A;  1R8O B;  4N4H A;  3SDZ A;  1H3Z A;  3RMQ A;  4BDY A;  4L6V 5;  3JB9 H;  2HQX A;  5GAN 7;  1VQ6 T;  2LX9 A;  4ME7 A;  1Y71 A;  2KAF A;  4A4F A;  4GLK A;  4A4E A;  1M1K U;  2E41 A;  3GLX A;  3FEO A;  4HKE A;  5GAN e;  3WVE B;  1BI2 A;  2VXE A;  4M7A C;  2E5Q A;  1JJ2 S;  2DZ9 A;  2JTM A;  1QW1 A;  2JTF A;  3AHU A;  5GAN f;  3RUX A;  2XI9 A;  3OS2 A;  2EJF A;  4M75 F;  4XAX B;  4OB2 B;  5I21 A;  3GNG A;  2RI2 A;  2H3J A;  1WJR A;  3BFM A;  1UGP B;  2P4T A;  2ZGW A;  2LNV A;  3PNW C;  5LJ3 d;  3CME T;  3LWH A;  4P5N A;  3DLM A;  3QBY A;  1YI2 A;  4QW2 A;  2LT1 A;  3CCU A;  1EIF A;  3G7Z A;  2RJE A;  2WAC A;  5HKC A;  2XDD A;  4A53 A;  3QJY A;  3QXE B;  2OTJ A;  5CQY A;  3CCL A;  2RM4 A;  2CZ0 B;  4XTU A;  3P8B B;  2X4W A;  2JZ2 A;  1X01 A;  2K4Y A;  3P8D A;  4UC4 A;  3RIR A;  3CCV T;  3TU4 K;  4N4I A;  3QZ5 B;  4PJO D;  1N8R C;  3MEV A;  3UPU A;  2QI2 A;  3HHT B;  3HL8 A;  2MF2 A;  2K3Y A;  2QDY B;  3BW1 A;  4IUU A;  5DM7 R;  4OGE A;  4MZP A;  3WXM B;  4BDZ A;  3CCS T;  5LJ3 f;  3PTA A;  5J39 A;  3PT9 A;  1K9M C;  2BIV A;  2RK1 A;  2EIF A;  4RKU E;  1VQL T;  3KXT A;  3RKW A;  4MDW A;  2VUB A;  4M7A E;  2DEQ A;  3DKM A;  3MO8 A;  3OYK A;  3VV0 A;  3X20 B;  4EDU A;  3CD6 T;  4XU1 A;  4LDU A;  2M16 A;  2V8K A;  2I2L A;  3QUI A;  3V7S A;  1M1F A;  3SWN A;  5GAO n;  4E7H A;  1N8R U;  3QSU A;  4PNO A;  3CME A;  1OYX A;  3OYD A;  4CI0 C;  4BE2 A;  3GOX A;  1DJ7 B;  2FYK A;  1M8V A;  3QG1 A;  3OYL A;  3CCM T;  1KC8 C;  4KUD K;  3TCJ A;  1YCY A;  1K9M U;  1WJS A;  4JRP A;  4PJO A;  5C6S A;  2PUK B;  2XIC A;  4M77 F;  3CCV A;  1RI0 A;  3PFS A;  1JJ2 A;  2JVV A;  4JRK A;  2CKK A;  3JB9 I;  3JCM b;  1GXI E;  2O4X A;  3NTI A;  1NJI C;  3VUB A;  3JCM d;  4BB7 A;  4M7A D;  3M4Y A;  3HKS A;  4CRI A;  4M78 D;  1KD1 C;  2ZPG B;  2VC8 A;  3CCS A;  2EQU A;  5GAM h;  4JRQ A;  3OS5 A;  4BAC A;  4JLG A;  5HK3 A;  2LCL A;  5GAN 3;  3MEW A;  5CR2 A;  3G6E A;  1YHQ T;  5LJ5 h;  2D9T A;  2RO0 A;  3NTK A;  3QJ6 A;  1VQL A;  2XU8 A;  5D6Y A;  2YHT A;  3A8M B;  2BKD N;  2DTH A;  4N0A A;  2QA4 T;  1KC8 U;  3A8H B;  3CCR T;  1I8F A;  4HT8 A;  1VQ8 T;  1Y96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...