3JCMe

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcme00
3EFRA 4PNOA 2EJ9A 4JUVA 3RESA 4M7AF 4M77A 2VXEA 3JCMb 4M77E 4M75F 1TH7A 4PJOC 2RD1A 3SWNC 5GAMe 5GMKm 4M7DG 3QSUA 4RCCA 4C92C 1WPYA 2CGHA 2DXTA 5GMKe 5GAN5 3JCMQ 4M7DA 4M7AE 4M7DE 4A53A 1X01A 4M75E 4C8QC 5GANe 5GAMj 5GAN4 1KQ2A 3JCMg 4PJOE 1JBMA 4M7AB 4JRKA 3FIFA 5GAOm 4M75B 4NOYA 5LJ3f 4M7AD 2VXFA 4N0AC 3BY7A 4J6WA 5GAOq 2FB7A 5LJ5f 4M78C 4EMKB 2YHTA 4C8QF 5LJ5g 1HK9A 2E65A 5GAN3 4J6XA 1U1SA 3JCMd 1H641 2I2LA 4V2SA 4QVDA 1HXDA 2DTOA 5GAN8 2DVEA 3JCMh 4XTVA 4A54A 1I5LA 4NL2A 4M7AG 4M77C 4XTUA 5I21A 4XQ3A 3GIBA 4M75G 2VC8A 3JCMX 3L1AA 2DZ9A 4XU2A 3JCMW 4M7AA 4RCBA 5GAMf 1MGQA 4M75A 3BDUA 3QO3A 4MMKA 4XTXA 4C8QB 2YLBA 2E41A 4DQ2A 3JB9D 3JB9I 1U1TA 3V8JA 2DKGA 4EMKA 4C8QD 1D3BB 4XU1A 5GMKj 5GAN7 4PJOF 2YLCA 4J5YA 4X9CA 1M8VA 5GANf 3V7SA 1WQWA 4X9DA 4C92F 5CAIA 4WF2A 4F7UF 1B34B 5GANj 1LNXA 3RIRA 3V7CA 3L2ZA 5LJ3g 3V8LA 3JB9F 3RKXA 2E1HA 5GAN6 3AHUA 3JB9H 3RKWA 2Y90A 4MMLA 2JN0A 2E64A 2K57A 4XU0A 2ZGWA 4JLIA 4C8QG 3BW1A 1I8FA 2DTHA 1N9RA 3EFSA 4C8QA 3BFMA 4EMHA 3JCMe 1JRIA 5LJ3d 1I81A 4C8QE 3SWNB 4PJOB 2EJGA 4C92B 3HSBA 1D3BA 3JCMV 5LJ5d 4M78F 4F7UB 4NL3A 4PJOD 1BIAA 4XTYA 4JRIA 5LJ3h 4C92D 5GAOl 5DY9A 3JB9J 1B34A 4OP0A 5GAMg 2FYKA 4M7AC 5LJ5h 4HA8A 3JCMc 1I4K1 4M7DC 2EJFA 2HNIA 3FJPA 4M75C 4J6YA 4XTWA 3VU3C 4M77F 2DZCA 4EMKC 1LJOA 5GANg 4PJOG 4C92G 2E10A 3M4GA 5GAMd 4Y91A 1BIBA 4M78B 4F7UG 3SB2A 3JCMP 3HFNA 3SWNA 5GMKl 4M7DF 3JB9G 4PJOA 1Y96B 2DJZA 2RB6A 3FB9A 3HFOA 4M78D 4C92A 4C92E 2RA2A 4F7UA 4HT8A 1KQ1A 1LOJA 4F7UE 5GAMh 1M5Q1 4HT9A 5GANd 5GMKh 3JCMJ 5GMKi 2DXUA 2EWNA 5GAOp 2EAYA 4M77B 4XU3A 4QVCA 1N9SA 1WQ7A 3QUIA 5GAN2 5GANh 3QHSA 1WNLA 4M77D 3V8KA 3JCMf 5LJ3e 2DTIA 3INZA 4M78G 5GAOr 2RM4A 4N0AA 5LJ5e 4M7DB 3RERA 4M78A 3RUXA 3V7RA 4XTZA 4M7DD 4M78E 1Y96A 4M75D 3RKYA 5LJ3j 3PGGA 2QTXA 2DEQA 4EMGA 5LJ5j 1YCYA 4M77G 5GAOn
chains in the Genus database with same CATH superfamily
1PNJA 5IXFA 1HYOA 1OPKA 4RTVA 3HRSA 4M7DG 3CXCP 2E5QA 1W4SA 2CT3A 2GNCA 2KI7A 2RNAA 5GANe 4MZPA 4ANJA 1WHMA 1T3SA 4C5EA 1TUDA 4F04B 4PK4A 1NJIU 3C94A 2MWPA 4QQGA 5CKEA 2F1LA 2EKHA 4ZGDB 2AKLA 5IN1A 1WHHA 2K6DA 1Q86U 2X4YA 1KC8U 2RJEA 2DTOA 2ZPFB 4A54A 3CXCA 2PQWA 3CBOA 2ZPGB 1PWTA 2CP6A 4RCBA 3H9NA 3OA6A 3JB9I 4J7FA 4VUBA 3V8JA 1XJWB 4JJBA 1AHJB 5GANf 2HQXA 4IIMA 2K7AA 4CC2A 1H3HA 1VIEA 1NEBA 1WIEA 3GNFB 2LQNA 3EFSA 3QJ6A 1TU0B 2BE9B 2RJCA 3FLGA 3GLXA 2GBQA 4F16A 2HMAA 4E6RA 4PJOD 4AFSC 4J6YA 2QAZA 4JPBW 4DOVA 4PJOG 2LT1A 2DX1A 2PTKA 1R0BG 2PNIA 3HFOA 3KBGA 2ECZA 2VV5A 1UGPB 2LQKA 4ZTFA 1D1CA 1KQSP 1VQ5A 2L3SA 1WI7A 2DK3A 2J6KA 1OULA 1YITQ 3BE3A 1NEGA 3CMEA 3CMAQ 2KRSA 1Y0MA 3RERA 2BUDA 3V7RA 2ROLA 3CPWA 2QTXA 1D0XA 2OAWA 3M4YA 2CH4A 4RG8A 1VQMT 4M77E 4M75F 4A4GA 1VQ8Q 2E4HA 3I55Q 2DRKA 4C0FA 3F70A 3QPHA 2VGMA 4J9IA 2QEXA 3QBYA 5HK3A 3LGFA 3I56T 2CSQA 1PD1A 1QVGA 3OYLA 1K73U 2DRMA 4N0AC 3CPFA 3CPWS 3OY9A 1BYMA 2O2OA 3ZFJA 1JO8A 1OPLA 2COYA 4KBMB 2L0AA 2RHYA 1EFNA 3OYHA 1M3BA 5HCKA 4XTUA 1TUCA 2GFUA 4XK8E 4XQ3A 4EDUA 3QG1A 4LDUA 4XTXA 1D1AA 2DD4A 1IHVA 3M0PA 4ZGJB 4EMKA 1QVGS 4A4KA 4JRPA 3EFOA 4X9CA 3J81E 4HCKA 4F7UF 1IHWA 3JB9F 1G8XA 2LQWA 3ZBDA 4C5IA 2A08A 2LJ3A 1YWOA 2JN0A 1BI3A 4ORZA 1R0CB 4Q5WA 2HKNA 1UEBA 2GTJA 2L5QA 4C8QA 4B9XA 4RTWA 3JCMe 3CC7A 2FEIA 1ZBXA 2I0NA 1M1KR 4KGVB 5DY9A 1AWJA 2X4XA 3ASKA 1WX6A 1K0SA 1VQ6T 1YJNT 1IGQA 1LJOA 1YP5A 1XNIA 4EIKA 1QCFA 5GAMd 2XMFA 4E7KA 3J80E 1PSEA 3OYGA 2O9SA 1YJ9T 3WVDB 3URGA 3NTKA 1SRMA 3GNGA 3S3NA 3VS4A 3JV3A 5GAN2 5IH2A 3G6EQ 1WNLA 3JCMf 3CD6A 2PUOB 1UE9A 1VQ9A 3QWXX 2DBKA 1KD1R 3VRYA 3LH5A 2DEQA 2PVDB 4KGXB 1M4ZA 1YFNA 2K9GA 4C0DB 1RLQC 2XKOC 2RJDA 5GAOn 3KUFA 4E7LA 2E6NA 1K1ZA 4O5VA 1OU8A 2Z0WA 1VQNT 4RCCA 4C92C 5M9OA 4R0KA 1VQ4T 2G6FX 3VRZA 1QLYA 2M0OA 4C8QC 3G4ST 2NUPB 2EVRA 2GQVA 1PRMC 3M54A 1PSFA 4TVRA 1BB9A 1G83A 1VYUA 2K5IA 3CCQA 4M75B 1YHQA 2COWA 3ER0A 3EAEA 3CCMA 3QYGB 5GJVB 4PLLA 1AEYA 4J6XA 2K2VA 2NUTB 2DEUA 2F5KA 2C0IA 1M1GA 3GPLA 1VQOA 1MNEA 1X6OA 2PVOB 3JCMW 1WFWA 3FRNA 2IVWA 4LE9A 3VYHB 1RI9A 3OS5A 4PJJA 2CP7A 4PJLA 3MP1A 1VQPQ 2P4RA 4CC3A 4LUEA 2DTHA 1N9RA 3CCSQ 2DA9A 1I81A 2V1QA 2V8JA 5EG2A 5CKBA 4F7UB 4D8KA 3CC4A 2DO3A 5GAMg 2V8KA 1U8RA 2DETA 1T0HA 4J9BA 2DE0X 2LTOA 3M0QA 4WTOB 2OTJT 4CI0C 2VGNA 4C0ZA 3SWNA 1HD3A 4JRQA 4HT8A 1M5Q1 1MMNA 4MZTA 5GMKi 1Q82U 3EHRA 1RUWA 4AG2C 1GRIA 4FT2A 2DM1A 1Y57A 3CCUQ 1WA7A 5L23A 3RUXA 1UUEA 5LJ3j 2HBPA 2QG9B 3PGGA 4EMGA 1B07A 4E7HA 3A8MB 3EG0A 4ELYC 2ED0A 3M0RA 1KHCA 2DYIA 5GMKe 3S3OA 5DLQE 1UGQB 3LGLA 4BI4A 3EG3A 3OS2A 2YUNA 1BI0A 3I5SA 4II1A 5KCHA 4L59A 4LDXA 3UA7A 5FU7B 3FIFA 2DXCA 3E2UA 4M78C 2X35A 3SEMA 2KYBA 3EH2A 2MIOA 1VIFA 1OZ2A 1R8OB 5DLOA 1N8RR 2KT8A 2L2PA 4FW1A 4LDVA 1Z9ZA 3G7ZA 2LNVA 4M75G 1M90C 1LCKA 2LX9A 1KK7A 5FRNA 3QO3A 2QQAA 2CH4W 4BDYA 1BBZA 2KE9A 2LC4A 5GAN7 1ARKA 2ENMA 3TVTA 1FYNA 3HPWA 4ATOA 3OYCA 2RHUA 1VYVA 4HXJA 2DAQA 4JZ3A 1E6GA 2RI2A 2ABLA 2EQIA 3H8ZA 4BB7A 2A37A 3OYIA 2OI3A 1WHJA 4FSSA 3PT9A 1BIAA 2R5AA 1D09B 3CCVA 1YIJA 1JJ2A 3SFMA 3OMCA 1QW1A 4M77F 2HSPA 1OX9A 2Y4XA 4L5GA 4OMOA 4F7UG 1VYTA 3A1PA 3JB9G 1PD0A 2PU9B 4AFZC 3OYYA 3JCMJ 4FT4A 3CCRT 4FYVB 3LYIA 3Q1JA 1RLPC 2CSIA 1QKWA 1JJ2S 2D8JA 2L3PA 5GAOr 1SG5A 1MNDA 4PJMA 1M3CA 2DL8A 1QKXA 2J6OA 1YCSB 5LJ5j 1QVFS 3KFVA 2X9HA 2R5MA 1BI1A 2B86A 4M7AF 3H41A 2QK0A 4PJOC 1K76A 2RD1A 2RQUA 4HCBA 1G3TA 4J9CA 4YTLA 1AZGB 1AWOA 1SF9A 3P8HA 5FLXE 2ZCFB 1KQ2A 1JBMA 4J6WA 1VQKT 4HCZA 1JU5C 5FU6B 4IUUA 4QVDA 3TU4K 2HL5C 2RMOA 1N5ZA 3UA6A 1VQLT 3G71T 2ZZDA 3OBYA 2EYWA 3CEYA 3QZ9B 2Y4YA 2SRCA 2YLCA 2G3RA 3I56Q 3CC2T 1K4US 4WF2A 1ZSZB 2JMCA 4D8DA 2KXDA 4Z89A 2KEAA 5KYYA 5CKFA 2LX7A 2OJ2A 4J9FA 3RKWA 4FYYB 2K57A 1M2VA 1NM7A 3L2VA 4C8QE 5IT9E 2EJGA 1WHLA 2KROA 5LJ3h 3X26B 4KRTA 1B34A 5CQYA 1GCQC 3JCMc 3NPFA 1H8KA 1YI2T 4OGEA 5CKDA 2YRVA 2ZPBB 3CBPA 2QA4A 4HT9A 2CUBA 3OBWA 2P0QA 1TWBA 4M77B 2MMPA 3I9QA 1W1FA 2M02A 5KYWA 1BU1A 1QVPA 4LDYA 2LDMA 4B9WA 1TUGB 1Y96A 4AG1C 1S72A 2KXCA 2H3EB 3R6OA 1VQ6Q 1YJNQ 1YJWT 3CCET 1GFCA 2R58A 3EH1A 4JUVA 3CCLT 4J9EA 2YT6A 3GOXA 5GAMe 1MMDA 4RUGA 2GGRA 1K8AR 1YJ9Q 1Q95G 2WSCE 4M7AB 1AZEA 4HKEA 2NWMA 5GAOm 5KYUB 1M1KC 1CKBA 2FB7A 1OQKA 4ZTJA 5LJ5g 2E65A 2KVQG 4HVUA 1KIKA 1ZBJA 5KYXB 3FJ5A 4LD9K 3OMGA 5GAN8 2RH2A 2MOXA 2EQUA 2HKQB 5GAMf 2EIFA 2L3QA 1EZZB 2YLBA 2GQIA 1VQNQ 2XU8A 4DA4A 1VQ4Q 1X27A 1D3BB 2FZGB 4LN2A 3PMTA 1SSFA 3V7SA 4PFPA 3QXEB 5D6YA 2V26A 4BACA 3V7CA 3VS5A 3G4SQ 1KFZA 1UTIA 2M0YA 3V8LA 1RADB 5GAN6 3JB9H 3EGXB 1M27C 1ZHIA 1QCNA 2XHCA 3C12A 1KD1C 2JTEA 2PZ1A 4DBHA 1Y71A 2LCCA 1MUZA 1FMKA 1WJSA 2XK0A 2OX7A 1RAFB 5LJ5h 4HA8A 4DEYA 3FJPA 2OTLT 5I2MA 1WJRA 2ZAEA 3MEAA 1BI2A 2AK5A 3HKSA 5GMKl 2RB6A 1M30A 2NYSA 5IAYA 1KG1A 2CUDA 1UHFA 1TTHB 2B8AA 1M3AA 4QVZA 2QQ9A 1R77A 4LDWA 3QHSA 1M1FA 4M77D 3RR6A 3L2QA 1RAGB 3FEOA 4N0AA 3GF5A 3SDZA 2A28A 3MPUB 2XDBA 4XTZA 1MHNA 3RMSA 3CPWP 1PG5B 1K0XA 4M77G 1V29B 3LWHA 2AZVA 2DXBA 2QDLA 3O8VA 1NE8A 2OTJQ 4OMFB 1M8MA 5GAN5 1VQ7T 2QQBA 2QYZA 3U23A 4JDSA 3UDCA 2FZKB 1QVGP 5ECAA 4M7AD 2QGGA 1OU9A 2J05A 2X3WD 2JTMA 1YWPA 1HK9A 1TG0A 3VUZA 2J06A 1OV3A 2XD0A 1I5LA 4M7AG 1I5OB 4KH1B 3L1AA 3HP9A 3M59A 1WZOA 1U5SA 3META 1DJ7B 1WGSA 3CCJA 3H0FA 1TXQA 1OZ3A 2KGTA 4CC4B 2M9UA 1ACMB 2IIMA 1OYXA 2AIRB 3L2RA 1C6VX 3WXMB 3M0SA 2DMOA 4J8OA 1ZUUA 4A63B 2KDSA 1EX4A 1Q7YR 2P4TA 1UGRB 4M75C 2DNUA 4C5HA 1IB8A 3TREA 2JTFA 1PKSA 2EKOA 4Y91A 2H8HA 3J7AF 4C92A 4N4GA 1YITA 1FMWA 2AZSA 2DBMA 1LOJA 3CMAA 2CDTA 1X69A 3JAME 1M90U 4HCCA 1GL5A 1N8RC 4OMNA 3VS2A 2CP2A 1UECA 3I55A 2E6ZA 1K9MR 3RKYA 3PIPA 3PE0A 4BI3A 2HL3A 5HK0A 5A2QE 2EJ9A 1Y7XA 1ZUKA 1LPLA 2DL7A 5D7UA 2DL4A 1U06A 3VS1A 2JM8A 5CQXA 4FYXB 4N4HA 3MP8A 2EYZA 2LJ1A 3CCRQ 1WXUA 2EYYA 3EGDA 2EQMA 4NOYA 3QKJA 2VXFA 1G2BA 1UG1A 2O4XA 4C8QF 1IXDA 1MMGA 1UGVA 3VS3A 3ZEHA 2I2LA 4V2SA 2FL7A 3M53A 2DILA 2K3YA 1CSKA 2DLPA 2RF0A 1NYFA 2F5TX 3OYJA 3BDUA 1U1TA 4KH0B 5IHIA 2YUPA 3RIRA 3UT1A 3C95A 3OYMA 2GTOA 2KT1A 5IHNA 3VS6A 2QGFB 4OB2B 1N6AA 3E1SA 5I22A 1AT1B 3TQ7P 1VQKQ 3EGUA 2JNGA 1T3LA 4J83A 4KUIA 1VQ5T 4GBQA 5FU7C 1VQLQ 3G71Q 2DYBA 2FO0A 2JS2A 4XTWA 2QI2A 3CMET 5A0DA 1O75A 4IUPA 4GY5A 3G6EA 3SB2A 2C0TA 3N5BB 3CC2Q 4MZMA 2DJZA 2C06A 3NMZC 5KH6A 1BK2A 4F17A 1UGSB 2LQ8A 2ESWA 3QUIA 4OVAA 2QEXT 1LVKA 4BE2A 1HSQA 3CCJT 4PKCC 2R57A 4M78A 2KAFA 1UJ0A 1T0JA 2DVJA 3H0IA 2A36A 1YI2Q 4K11A 3UATA 3OYAA 1MV0B 4M7DA 2D1XA 2JZ2A 4HVVA 4IUQA 2CYZB 2HAXA 1RAIB 2J6FA 2A7YA 1TOVA 3A8HB 4EMKB 1IZ6A 4ZNXA 3EFOB 1E7OA 1P92A 1ZA1B 1AOJA 1YJWQ 3AT1B 3CCEQ 2EGEA 3CCLQ 5D6XA 3CC7T 2RK1A 4MMKA 8ATCB 4C8QB 3PTAA 1VQPA 4XU1A 2NUZA 4JZ4A 1WQWA 3CCSA 2M16A 1LNXA 3L2ZA 1GFDA 2K3XA 2EGAA 2MAMA 4MMLA 3TCJA 3EG1A 2ZGWA 3HL8A 3BFMA 5LJ3d 2BKDN 3RBBB 3EG9A 1JQQA 1NPPA 2FRWA 4LXCA 3G1JA 3MHXA 1JJ2P 4M7DC 3CBMA 4MDWA 3CD6T 4FU6A 1M1KU 4ESRA 1K8AC 1VQ9T 1C0MA 2DERA 2F69A 5KYNA 4RTTA 3MP6A 2FPDA 1QVFP 2P84A 3REAB 4PJOA 1K9MU 4BD3A 3NTIA 1W2BS 1UHCA 2XICA 2BTTA 5HKCA 3A8GB 5FW9A 2QASA 2XIDA 4JJDA 5GANh 3O5ZA 2CREA 2D9TA 3OSSC 4O6JA 4J9HA 3CCQT 1KHIA 5AT1B 3PVLA 1YHQT 2X3XD 1QVFA 5D6WA 3CCMT 2OTLQ 2AT1B 1KD1U 3JRZA 1HJDA 5KE3A 2YDLA 1NZ9A 2EQJA 4GLMA 3OYDA 1WPYA 2DXTA 1VQOT 3ULRB 3UF4A 5C6SA 2BE7D 3OB9A 4M75E 2O31A 3DKMA 2K2MA 1NJIR 5A0GA 2FRYA 1B7TA 2MF2A 1RAAB 1Q86R 4DBFA 1SHGA 1KC8R 2DD5A 4OMQA 1H641 2KQWA 3OYKA 4PFOA 3UPUA 1SEMA 4M77C 5I21A 2ED1A 2RHXA 5CR2A 2VASA 1GCQA 1MGQA 3E9GA 3QJYA 4C8QD 3CC4T 1VQ7Q 3H6ZA 4LD6A 2VKNA 5EC7A 5LJ3g 3RKXA 1QWEA 2K4YA 4X34A 2WSFE 2JXBA 4C8QG 1VOMA 2V1RA 3OYBA 3BW1A 3OW2A 4KUDK 3SWNB 1KSWA 3PVQA 5LJ5d 4BE0A 1VQMQ 4M7AC 3THKA 2CZ6B 1S1NA 4E7JA 2YSQA 1J3TA 3X24B 3P8BB 2DZCA 3M4GA 2X51A 4AMCA 4JS4A 1WXBA 1W70A 4C92E 1KQ1A 3OW2S 1ZX6A 2W10A 2LJ0A 2LP5A 2FZCB 3M9QA 2RM4A 1X6GA 2LCLA 2O01E 2XG8D 4RTYA 5CKHA 2KRNA 4PLIA 3PNWC 4RTZA 4WCIA 1ABOA 1IO6A 5GMKm 4DOWA 2E3IA 2YWWA 3JCMQ 1FX7A 1K73R 2HCKA 2M51A 3MKDA 3DB4A 1D0YA 4PFZA 3RMQA 3SHWA 1PHTA 2E12A 2HZYA 1UDLA 3X25B 1RAHB 1Q7YC 2ROTA 1U1SA 1UJYA 2YXYA 3JCMh 1FXXA 2CKKA 3I56A 2CZ0B 2DZ9A 1N8RU 3DB3A 3VYGA 1NLOC 3QWYA 4ZGEB 3CCVT 1YIJT 5CK9A 1M8VA 1F1BB 1WLPB 5CAIA 4RTXA 1I0CA 4JLGA 3NTHA 1BKBA 1Q81C 1X75C 1K9MC 1RI0A 1I8FA 2RN8A 1TSFA 3P8DA 3HSBA 1AWWA 1OEBA 2D0NA 4JRIA 2JS0A 2EJFA 2VUBA 4JS5A 3CQTA 4BY6B 2AHJB 1BIBA 2XDDA 4PL6A 2RK2A 1IRXA 2C0OA 4LUDA 3FB9A 2XDPA 1OOTA 2RA2A 1EIFA 3NHNA 1UB4A 2DXUA 1CKAA 3REBB 2GFAA 2KYMA 1V76A 3C4SA 3OSVA 1D1BA 3OS1A 1VQ6A 2J7IA 2DTIA 2ZPIB 3INZA 1YJNA 2D8HA 2D6FA 1V1CA 1VQ5Q 2ZPEB 4M78E 1NG2A 4QW2A 4AFUC 2HSEB 3OYNA 3QDRB 4Y92A 3CMEQ 3EFRA 3RESA 1YJ9A 4C0GA 2VXEA 3JCMb 3E19A 2KBTA 1SKUB 3SD4A 4M7DE 2RQTA 9ATCB 2CT4A 1SRLA 2QEXQ 1RABB 3H0HA 3MEWA 3CCJQ 5A0LA 2YUQA 1RL2A 1VQNA 1JEGA 5KYYB 1VQ4A 3CXCS 2KK4A 4NL2A 2NUPA 4Z88A 3A98A 1ZLMA 1M2VB 3G4SA 4M75A 4DQ2A 2JVVA 8AT1B 3MO8A 1B3QA 4OMLA 1TS9A 3VV0A 2NUTA 1B34B 2DIGA 1ABQA 2WSEE 3IQLA 2E64A 1AVZC 4JLIA 1BCMA 2JJ9A 2EYXA 3R6NA 1OX8A 1JRIA 2QA4T 3OS0A 1RACB 2DL3A 2CZ1B 2DFUA 5IXBA 5GAOl 2VB6A 4OB0B 4B6MA 4E7ZA 3E9FA 3CC7Q 1FWZA 5KYWB 4C0DC 4X1VA 4CRIA 3OYEA 2WACA 1S72T 4PJOE 1Y96B 1Q82R 1ZUYA 4F7UA 1KQSA 5GMKh 1IGUA 1I1JA 2HDAA 1Z9QA 3L42A 4XU3A 4QVCA 1KJWA 1N9SA 1SHFA 1WQ7A 2KSSA 3HRUA 2JT4A 4RG2A 2VWFA 5L8RE 5LJ3e 1NBEB 4L6V5 5CVIA 3L2UA 2QXFA 2RPNA 3UWNA 2E3HA 2OTJA 1X2QA 1M9SA 2HEQA 3CD6Q 2FVUA 1VQ9Q 2KNBB 4FL6A 1KQSS 3OQ5A 4M7AE 3NGPA 1G5VA 1M2OA 4E2FB 1GBQA 4Y28E 4P5NA 5GAMj 2O9VA 2CP0A 2MI6A 2HQHA 1C1AA 1K8AU 2O88A 5LJ3f 4IKFA 1VQ8A 1Q81R 2QDYB 4OGCA 2YHTA 3QDFA 1XTDA 5J3BA 2VYTA 3CCQQ 4OB3B 1HXDA 1YHQQ 4XTVA 2XI9A 3VKIA 1O9SA 3CCMQ 3EG2A 2RQWA 2VC8A 2QQRA 3M58A 1U3OA 3L2WA 5C0MA 5GJWB 2MWOA 1WHGA 1VQOQ 2K5FA 2JUFA 2A3LA 1N27A 4J5YA 4FSXA 4C92F 2EGCA 5KE2A 5GANj 1H3ZA 2PUKB 3MJXA 3GBQA 3AHUA 1G3SA 3LX7A 3D7SB 2K5LA 1MV3A 4ZN1A 2JW4A 3FC3A 4KGZB 1H92A 4IUVA 4OF1A 4NL3A 4E7IA 4RMOA 4QQDA 2V8IA 2FYKA 3M0TA 2BIVA 2EFIA 1WJQA 2ZPHB 3QIIA 3VU3C 2F2VA 4BE1A 4EMKC 1NJIC 3CC4Q 3A5ZB 1G3YA 4E47A 5DM7R 2M1HA 3PMIA 1X43A 3VS7A 5LL6S 2PVGB 1Q86C 1WYXA 4DBQA 5GANd 1KC8C 4DEXA 2EWNA 2RI5A 7AT1B 1QQJA 3JSCA 2YRCA 3V8KA 5LJ5e 4IURA 5FRMA 3C0CA 2CS7A 4QKUA 3M55A 4UC4A 2JM9A 2LVMA 4EPCA 2D0QB 2RO0A 1YNZA 3CCRA 2DIQA 1TH7A 4QQ6A 2HD0A 2EQKA 3QSUA 2CGHA 3M57A 1JB0E 3NFCA 4A53A 1X01A 3ME9A 1JXOA 2E5KA 4BI8B 2MYSA 3BY7A 5GAOq 4MDXA 5LJ5f 4ZN3A 5HY6A 5J26A 3VS0A 2OAUA 2P0KA 1QWFA 2FPEA 1QMCA 2SEMA 2H3JA 2RQRA 4FCYA 4GLKA 2E41A 1PM3A 1ZQ1A 3S6WA 2LNHB 1VQKA 3LH0A 4D6WA 1QCOA 1VUBA 2QTVA 4IUTA 2DL5A 1WDXA 4XU0A 4R55A 1A0NB 1YITT 1NYGA 3G71A 1W2BP 1VQLA 3CMAT 4C92B 4M78F 2EW3A 2P0PA 2X4JA 2RHZA 4BDZA 1ZSZA 4OP0A 3LW5E 1I4K1 2HNIA 3CC2A 2CP3A 1K73C 2L89A 2LZ6B 3MCAB 4OMMA 5GANg 1Q7YU 1VQ8T 3I55T 3CCVQ 2MPXC 1YIJQ 1K9AA 2MK5A 3HFNA 4M7DF 5GAMh 2BZ8A 3PIOA 1W2BA 3TSZA 5GAOp 4A4HA 3MEUA 3MEVA 1YI2A 3RDVA 5I2SA 2FPFA 1SPKA 2BZXA 4M75D 3EGDB 3HTRA 2LRQA 1Q81U 5FU6C 4M77A 1SSHA 2O4XB 2F2WA 3CCUA 3SWNC 1NLPC 3FDRA 4FM4B 2ATCB 4AFQC 4CC7A 1PRLC 1I07A 2RQVA 4HVWA 4JRKA 2YUOA 3VJPA 2IG0A 1ZSZC 4NS5A 1YJWA 3CCEA 1GBRA 3CCLA 3LLRA 4FIBA 4OB1B 4M4ZA 3JCMd 3GP8A 2CP5A 2DVEA 2X4WA 3M5AA 1AWXA 5FWBA 3M56A 1RAEB 3GIBA 2YRDA 3JCMX 1JXMA 4XU2A 4M7AA 4F14A 2AKKA 5KYUA 3T9NA 2VVKA 3JB9D 4KT0E 2DKGA 4PJOF 2KY9A 3WVEB 5KYXA 3BDLA 4Z8AA 4IIOA 2EPDA 2E1HA 1BCOA 4J9GA 3X20B 3G6ET 2EBPA 4EMHA 2LCSA 3OW2P 4J9DA 4ME7A 3S3MA 1D3BA 4JJNK 2F2XA 1XQHA 4XTYA 4C92D 3KXTA 3PFSA 5AYFA 3EGXA 2KRMA 4QT7A 2W0ZA 4C92G 4M78B 1VA7A 1PCXA 2MCNA 2COZA 4F7UE 2KMTA 2DJQA 5CO7A 5CIUA 4ELZC 3I35A 1G3WA 1XOVA 1OI1A 3QZ5B 6AT1B 2OTLA 1E6HA 2QA4Q 4E7SA 4M7DB 3RNJA 1YN8A 2JMAA 3HHTB 2FG0A 4FW2A 1YBYA 2DF6A 2HQEA 4PNOA 4Z02A 1WHKA 1PKTA 2RJFA 3LWIA 1X6BA 1GXIE 4C5GA 3A8OB 1S72Q 5J39A 1NPRA 1QP3A 4A4EA 4RTUA 4N4IA 2FHDA 5GAN4 2RHIA 3JCMg 3TSWA 3ZL7C 1VQPT 4BY6C 2L3RA 3OYFA 2CZ7B 2JOYA 2LT4A 3I5RA 3CCST 5GAN3 2DPPB 2RI3A 4LNPA 3HRTA 4RKUE 3TEEA 1VQ7A 2K79A 4AT1B 5I11A 4DBRA 1Q82C 2L8DA 5GMKj 5CCAA 1ZSGA 5KCOA 2E70A 3QYHB 5FROA 4X9DA 3EG9B 4J7IA 2KR3A 3M0UA 2Y90A 4FYWB 1VQMA 1AD5A 1FMVA 4JJCA 5FWCA 3DLLA 3CCUT 4PJOB 3JCMV 4PJNA 4BUGA 5IHKA 3JB9J 1UFFA 3A8LB 1X2KA 2GF7A 2EYQA 1ZA2B 4XAXB 2BZYA 1D0ZA 2E10A 3JCMP 3EHQA 4R56A 2LMJA 1M90R 2A0FB 1QP2A 4M78D 1GCPA 1W6XA 2QQSA 3DLMA 1MMAA 4KULA 1WXTA 2NLUA 2EAYA 3X28B 4M78G 4OMPA 1IREB 1Y07A 2K3BA 1PC0A 2GCXA 3VUBA 4M7DD 2HBWA 2IPOB 1YCYA 4A4FA
chains in the Genus database with same CATH topology
1BI1A 4M7AF 2FVUA 3HRSA 4FL6A 1KQSS 4PJOC 2RD1A 4M7DG 2E5QA 3OYAA 4HCBA 1W4SA 1G3TA 4M7DA 3OQ5A 4YTLA 4M7AE 1G5VA 4Y28E 4P5NA 5GANe 4MZPA 5GAMj 2JZ2A 2MI6A 4IUQA 2CYZB 3P8HA 5FLXE 2ZCFB 2HAXA 1KQ2A 2A7YA 1JBMA 4C5EA 1K8AU 3A8HB 5LJ3f 4IKFA 1VQ8A 4J6WA 1NJIU 3C94A 2QDYB 2MWPA 4QQGA 1VQKT 5CKEA 4OGCA 1IZ6A 2YHTA 4HCZA 4EMKB 4ZGDB 5IN1A 1XTDA 5J3BA 1P92A 1Q86U 2VYTA 5FU6B 2X4YA 4IUUA 4QVDA 3TU4K 4OB3B 2RJEA 1HXDA 2DTOA 1KC8U 2ZPFB 4A54A 4XTVA 2PQWA 2XI9A 3CBOA 1O9SA 3VKIA 3CXCA 2ZPGB 2VC8A 1VQLT 5D6XA 3G71T 2QQRA 3M58A 3CC7T 2ZZDA 4RCBA 2RK1A 3L2WA 4MMKA 5C0MA 3OBYA 2MWOA 4C8QB 3OA6A 3PTAA 3CEYA 3QZ9B 3JB9I 4J7FA 4VUBA 3V8JA 1VQPA 2Y4YA 4XU1A 2K5FA 1AHJB 2JUFA 2YLCA 2A3LA 1N27A 2G3RA 4FSXA 4J5YA 4C92F 1WQWA 2HQXA 5GANf 3CC2T 4WF2A 3CCSA 5KE2A 2M16A 1LNXA 5GANj 1H3ZA 3L2ZA 1VIEA 2K3XA 2PUKB 5CKFA 3AHUA 3RKWA 1G3SA 3LX7A 2MAMA 4MMLA 3TCJA 2K57A 2ZGWA 2K5LA 3HL8A 3GNFB 4ZN1A 3EFSA 3FC3A 3BFMA 3QJ6A 3L2VA 5LJ3d 3FLGA 2RJCA 4C8QE 3GLXA 4IUVA 5IT9E 2BKDN 2EJGA 4OF1A 4NL3A 4PJOD 4E7IA 5LJ3h 4RMOA 3X26B 4QQDA 1NPPA 2V8IA 1B34A 2FYKA 3MHXA 2BIVA 5CQYA 3JCMc 3CBMA 4M7DC 4MDWA 2EFIA 1WJQA 2ZPHB 3QIIA 1YI2T 3CD6T 4FU6A 4J6YA 1M1KU 4OGEA 3VU3C 1K8AC 4BE1A 5CKDA 2YRVA 4EMKC 4DOVA 1VQ9T 2ZPBB 4PJOG 2F69A 2LT1A 1NJIC 3MP6A 3A5ZB 1G3YA 4E47A 5DM7R 4PJOA 1K9MU 2M1HA 3CBPA 3PMIA 3HFOA 3KBGA 5LL6S 2PVGB 3NTIA 4BD3A 1Q86C 2QA4A 2VV5A 1W2BS 4HT9A 1UGPB 2LQKA 2XICA 5GANd 4ZTFA 1KC8C 2P0QA 3OBWA 2RI5A 2EWNA 5HKCA 1VQ5A 3A8GB 2MMPA 4M77B 2DK3A 2XIDA 5GANh 3JSCA 3V8KA 2D9TA 1QVPA 4LDYA 3OSSC 4O6JA 3CMEA 2LDMA 5LJ5e 4B9WA 4IURA 5FRMA 2BUDA 3RERA 3V7RA 2CS7A 1Y96A 3CPWA 2QTXA 3CCQT 1KHIA 3M55A 4UC4A 1YHQT 1S72A 1QVFA 5D6WA 3R6OA 3CCMT 3M4YA 1YJWT 3CCET 2LVMA 4RG8A 2R58A 4JUVA 4EPCA 3CCLT 2D0QB 2RO0A 1VQMT 1KD1U 3JRZA 4M77E 4M75F 4A4GA 3CCRA 2DIQA 5KE3A 1TH7A 1NZ9A 4QQ6A 5GAMe 2HD0A 4C0FA 3GOXA 2EQKA 2EQJA 3F70A 1WPYA 2VGMA 2CGHA 2DXTA 3QPHA 3OYDA 2QEXA 3M57A 3QBYA 1JB0E 1VQOT 5C6SA 3NFCA 3OB9A 4A53A 3LGFA 1X01A 5HK3A 4M75E 3I56T 3DKMA 3ME9A 1QVGA 5A0GA 3OYLA 2WSCE 4M7AB 4BI8B 4HKEA 1K73U 2MF2A 5GAOm 1M1KC 4N0AC 3BY7A 5GAOq 3CPFA 2FB7A 3OY9A 3CPWS 4ZTJA 4MDXA 5LJ5f 1BYMA 4ZN3A 5LJ5g 5HY6A 2E65A 3ZFJA 2DD5A 2KVQG 1H641 2KQWA 3OYKA 4KBMB 2RHYA 3UPUA 5J26A 3OYHA 4LD9K 3OMGA 5GAN8 4M77C 2GFUA 2RH2A 4XK8E 2RHXA 4XTUA 4XQ3A 5I21A 5CR2A 2OAUA 2P0KA 4EDUA 2EQUA 2H3JA 3QG1A 5GAMf 1MGQA 2EIFA 4LDUA 4XTXA 2DD4A 2YLBA 2E41A 4GLKA 3E9GA 3QJYA 2XU8A 4ZGJB 4DA4A 4EMKA 4C8QD 1D3BB 3CC4T 4A4KA 4JRPA 1QVGS 3PMTA 1ZQ1A 3S6WA 1SSFA 4X9CA 3J81E 3V7SA 1VQKA 3QXEB 5D6YA 3H6ZA 4F7UF 3LH0A 4BACA 4D6WA 3V7CA 4LD6A 5LJ3g 3V8LA 3JB9F 3RKXA 1VUBA 5GAN6 3ZBDA 4C5IA 3JB9H 4IUTA 2XHCA 1ZHIA 3C12A 2JN0A 1BI3A 2K4YA 2WSFE 4X34A 4XU0A 4C8QG 4Q5WA 1UEBA 2L5QA 3BW1A 4R55A 3OYBA 3OW2A 1KD1C 4KUDK 1YITT 3G71A 4C8QA 1VQLA 4B9XA 3JCMe 3CC7A 1Y71A 3SWNB 3CMAT 4C92B 2LCCA 1WJSA 2XK0A 4M78F 1ZBXA 5LJ5d 4BE0A 2P0PA 2X4JA 2RHZA 4BDZA 5DY9A 2X4XA 3ASKA 4OP0A 4M7AC 5LJ5h 4HA8A 2CZ6B 3LW5E 1I4K1 3FJPA 2HNIA 4E7JA 3CC2A 1VQ6T 2OTLT 1YJNT 3X24B 3P8BB 1K73C 2L89A 2DZCA 1LJOA 3MCAB 5GANg 5I2MA 1Q7YU 1VQ8T 1WJRA 1XNIA 3I55T 3M4GA 3MEAA 1BI2A 5GAMd 4E7KA 3HKSA 3J80E 3HFNA 1PSEA 5GMKl 3OYGA 4JS4A 4M7DF 2RB6A 5IAYA 4C92E 1KG1A 1KQ1A 5GAMh 3PIOA 1YJ9T 1W2BA 3OW2S 2B8AA 3WVDB 4QVZA 3URGA 3NTKA 2QQ9A 5GAOp 3GNGA 3S3NA 4A4HA 5GAN2 4LDWA 3QHSA 1M1FA 1WNLA 3MEVA 3MEUA 4M77D 3L2QA 3JCMf 3CD6A 1YI2A 2PUOB 3M9QA 2RM4A 3FEOA 4N0AA 3GF5A 3SDZA 5I2SA 1VQ9A 2LCLA 2XDBA 4XTZA 2O01E 2XG8D 4M75D 1MHNA 2DEQA 2PVDB 5CKHA 3RMSA 1M4ZA 4C0DB 1V29B 4M77G 2XKOC 2RJDA 2LRQA 3KUFA 4PLIA 3PNWC 5GAOn 3LWHA 4E7LA 2DXBA 1Q81U 2E6NA 3O8VA 4O5VA 5FU6C 4M77A 2O4XB 1NE8A 3CCUA 4OMFB 3SWNC 5GMKm 1VQNT 4DOWA 4RCCA 4C92C 5M9OA 1VQ4T 5GAN5 3JCMQ 1FX7A 3FDRA 4FM4B 1VQ7T 2M0OA 2QQBA 4C8QC 4JDSA 3UDCA 3G4ST 2GQVA 3M54A 1PSFA 3DB4A 4JRKA 2K5IA 4TVRA 3RMQA 3VJPA 3CCQA 4M75B 2IG0A 2E12A 1YHQA 4NS5A 4M7AD 3ER0A 3X25B 3EAEA 3CCMA 3QYGB 1YJWA 3CCEA 2JTMA 1Q7YC 3CCLA 4PLLA 1HK9A 3LLRA 4FIBA 4J6XA 4OB1B 1U1SA 3JCMd 2K2VA 3VUZA 2F5KA 3GP8A 3GPLA 1M1GA 2XD0A 1VQOA 1I5LA 2DVEA 3JCMh 2X4WA 3M5AA 1FXXA 4M7AG 3M56A 2CKKA 3I56A 3GIBA 3JCMX 2CZ0B 1X6OA 2DZ9A 2PVOB 3L1AA 3DB3A 4XU2A 3JCMW 3HP9A 1N8RU 4M7AA 3M59A 3VYGA 3T9NA 3JB9D 3FRNA 3META 1DJ7B 1WGSA 2IVWA 4KT0E 4ZGEB 3CCJA 2DKGA 3VYHB 3CCVT 1YIJT 5CK9A 3OS5A 4PJOF 2KY9A 1M8VA 3WVEB 5CAIA 3BDLA 1OZ3A 2E1HA 4JLGA 3NTHA 2M9UA 3MP1A 1BKBA 3X20B 1Q81C 1X75C 3G6ET 1K9MC 1RI0A 1OYXA 1I8FA 2DTHA 1N9RA 3L2RA 3WXMB 4EMHA 1I81A 2V8JA 4ME7A 3P8DA 3S3MA 5EG2A 3HSBA 1D3BA 5CKBA 4JJNK 4F7UB 1XQHA 4J8OA 4XTYA 4JRIA 4C92D 3KXTA 3CC4A 2KDSA 2DO3A 5GAMg 2V8KA 2P4TA 1UGRB 2EJFA 1U8RA 4M75C 2VUBA 3PFSA 4C5HA 5AYFA 2LTOA 4JS5A 4BY6B 3TREA 2OTJT 2AHJB 2JTFA 4C92G 4CI0C 2EKOA 4Y91A 1BIBA 2VGNA 4M78B 4C0ZA 4PL6A 2XDDA 2RK2A 3SWNA 3J7AF 3FB9A 4C92A 2XDPA 4N4GA 1YITA 4JRQA 4HT8A 2RA2A 1LOJA 4F7UE 3CMAA 1M5Q1 2KMTA 1EIFA 4MZTA 5CIUA 5CO7A 4ELZC 5GMKi 3JAME 1UB4A 2DXUA 1M90U 1Q82U 2GFAA 1G3WA 4HCCA 3C4SA 1XOVA 3OSVA 1N8RC 1OI1A 3OS1A 3QZ5B 4FT2A 1VQ6A 2DTIA 2ZPIB 3INZA 1YJNA 2OTLA 4M7DB 2D6FA 3RUXA 2ZPEB 4M78E 3I55A 2E6ZA 3HHTB 5LJ3j 2HBPA 3RKYA 3PIPA 3PGGA 4QW2A 4EMGA 4E7HA 1YBYA 4BI3A 3OYNA 3QDRB 3A8MB 5HK0A 5A2QE 2HQEA 3EFRA 2EJ9A 4PNOA 3RESA 4ELYC 1YJ9A 4C0GA 1Y7XA 2VXEA 4Z02A 3JCMb 1KHCA 3E19A 2RJFA 3LWIA 1GXIE 5GMKe 5CQXA 4C5GA 3A8OB 4N4HA 3SD4A 3S3OA 5DLQE 5J39A 1NPRA 1QP3A 4A4EA 4M7DE 1UGQB 3LGLA 2FHDA 3MP8A 4N4IA 4BI4A 3OS2A 5GAN4 1BI0A 2RHIA 4II1A 5KCHA 3JCMg 4L59A 4LDXA 2EQMA 5FU7B 3FIFA 1VQPT 2DXCA 4NOYA 3QKJA 2L3RA 4BY6C 2VXFA 3OYFA 2CZ7B 2O4XA 2JOYA 2LT4A 4M78C 2X35A 4C8QF 3CCST 3MEWA 5GAN3 2DPPB 1VIFA 5A0LA 1OZ2A 2RI3A 1RL2A 2I2LA 3ZEHA 4V2SA 2FL7A 1R8OB 1VQNA 5DLOA 3M53A 3HRTA 4RKUE 1VQ4A 2K3YA 3TEEA 4LDVA 3CXCS 2KK4A 4NL2A 3G7ZA 2LNVA 1VQ7A 4M75G 1M90C 3G4SA 1Q82C 2F5TX 2L8DA 2LX9A 3OYJA 4M75A 5FRNA 3BDUA 2QQAA 3QO3A 4DQ2A 2JVVA 4BDYA 1U1TA 5GMKj 2LC4A 5CCAA 5GAN7 3MO8A 5KCOA 2E70A 3QYHB 5FROA 3HPWA 4ATOA 4X9DA 2RHUA 3VV0A 3OYCA 1B34B 4J7IA 3RIRA 3UT1A 2DIGA 3C95A 2DAQA 3OYMA 2WSEE 2Y90A 4OB2B 1N6AA 2RI2A 3E1SA 1VQMA 2E64A 4JLIA 3DLLA 3H8ZA 4BB7A 1JRIA 3CCUT 2JNGA 3OYIA 2QA4T 4PJOB 3OS0A 3JCMV 3PT9A 1BIAA 2R5AA 4J83A 4KUIA 4BUGA 1VQ5T 3CCVA 2CZ1B 5GAOl 3JB9J 1YIJA 1JJ2A 4OB0B 3A8LB 5FU7C 3SFMA 3OMCA 4XTWA 2GF7A 2QI2A 3E9FA 1QW1A 2EYQA 3CMET 4M77F 1FWZA 4XAXB 3QSUA 5A0DA 4C0DC 1O75A 4IUPA 4CRIA 4GY5A 2E10A 3OYEA 4R56A 2Y4XA 4L5GA 4F7UG 3G6EA 3SB2A 2WACA 3JCMP 3N5BB 3JB9G 1S72T 1Y96B 2DJZA 4MZMA 1QP2A 2C06A 4M78D 4PJOE 4F7UA 1KQSA 2PU9B 5KH6A 2QQSA 3DLMA 4KULA 3OYYA 5GMKh 3JCMJ 4FT4A 3CCRT 2NLUA 1UGSB 2LQ8A 2EAYA 3LYIA 3L42A 3Q1JA 4XU3A 1N9SA 1WQ7A 2KSSA 3QUIA 3HRUA 4OVAA 4QVCA 2QEXT 4RG2A 5L8RE 5LJ3e 3X28B 1JJ2S 4BE2A 4M78G 5GAOr 1IREB 1Y07A 4L6V5 5CVIA 3L2UA 3CCJT 2QXFA 2R57A 4PKCC 4M78A 3UWNA 2GCXA 3VUBA 4M7DD 2OTJA 2KAFA 1M9SA 5LJ5j 1QVFS 1YCYA 4A4FA 2R5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFR A;  4PNO A;  2EJ9 A;  4JUV A;  3RES A;  4M7A F;  4M77 A;  2VXE A;  3JCM b;  4M77 E;  4M75 F;  1TH7 A;  4PJO C;  2RD1 A;  3SWN C;  5GAM e;  5GMK m;  4M7D G;  3QSU A;  4RCC A;  4C92 C;  1WPY A;  2CGH A;  2DXT A;  5GMK e;  5GAN 5;  3JCM Q;  4M7D A;  4M7A E;  4M7D E;  4A53 A;  1X01 A;  4M75 E;  4C8Q C;  5GAN e;  5GAM j;  5GAN 4;  1KQ2 A;  3JCM g;  4PJO E;  1JBM A;  4M7A B;  4JRK A;  3FIF A;  5GAO m;  4M75 B;  4NOY A;  5LJ3 f;  4M7A D;  2VXF A;  4N0A C;  3BY7 A;  4J6W A;  5GAO q;  2FB7 A;  5LJ5 f;  4M78 C;  4EMK B;  2YHT A;  4C8Q F;  5LJ5 g;  1HK9 A;  2E65 A;  5GAN 3;  4J6X A;  1U1S A;  3JCM d;  1H64 1;  2I2L A;  4V2S A;  4QVD A;  1HXD A;  2DTO A;  5GAN 8;  2DVE A;  3JCM h;  4XTV A;  4A54 A;  1I5L A;  4NL2 A;  4M7A G;  4M77 C;  4XTU A;  5I21 A;  4XQ3 A;  3GIB A;  4M75 G;  2VC8 A;  3JCM X;  3L1A A;  2DZ9 A;  4XU2 A;  3JCM W;  4M7A A;  4RCB A;  5GAM f;  1MGQ A;  4M75 A;  3BDU A;  3QO3 A;  4MMK A;  4XTX A;  4C8Q B;  2YLB A;  2E41 A;  4DQ2 A;  3JB9 D;  3JB9 I;  1U1T A;  3V8J A;  2DKG A;  4EMK A;  4C8Q D;  1D3B B;  4XU1 A;  5GMK j;  5GAN 7;  4PJO F;  2YLC A;  4J5Y A;  4X9C A;  1M8V A;  5GAN f;  3V7S A;  1WQW A;  4X9D A;  4C92 F;  5CAI A;  4WF2 A;  4F7U F;  1B34 B;  5GAN j;  1LNX A;  3RIR A;  3V7C A;  3L2Z A;  5LJ3 g;  3V8L A;  3JB9 F;  3RKX A;  2E1H A;  5GAN 6;  3AHU A;  3JB9 H;  3RKW A;  2Y90 A;  4MML A;  2JN0 A;  2E64 A;  2K57 A;  4XU0 A;  2ZGW A;  4JLI A;  4C8Q G;  3BW1 A;  1I8F A;  2DTH A;  1N9R A;  3EFS A;  4C8Q A;  3BFM A;  4EMH A;  3JCM e;  1JRI A;  5LJ3 d;  1I81 A;  4C8Q E;  3SWN B;  4PJO B;  2EJG A;  4C92 B;  3HSB A;  1D3B A;  3JCM V;  5LJ5 d;  4M78 F;  4F7U B;  4NL3 A;  4PJO D;  1BIA A;  4XTY A;  4JRI A;  5LJ3 h;  4C92 D;  5GAO l;  5DY9 A;  3JB9 J;  1B34 A;  4OP0 A;  5GAM g;  2FYK A;  4M7A C;  5LJ5 h;  4HA8 A;  3JCM c;  1I4K 1;  4M7D C;  2EJF A;  2HNI A;  3FJP A;  4M75 C;  4J6Y A;  4XTW A;  3VU3 C;  4M77 F;  2DZC A;  4EMK C;  1LJO A;  5GAN g;  4PJO G;  4C92 G;  2E10 A;  3M4G A;  5GAM d;  4Y91 A;  1BIB A;  4M78 B;  4F7U G;  3SB2 A;  3JCM P;  3HFN A;  3SWN A;  5GMK l;  4M7D F;  3JB9 G;  4PJO A;  1Y96 B;  2DJZ A;  2RB6 A;  3FB9 A;  3HFO A;  4M78 D;  4C92 A;  4C92 E;  2RA2 A;  4F7U A;  4HT8 A;  1KQ1 A;  1LOJ A;  4F7U E;  5GAM h;  1M5Q 1;  4HT9 A;  5GAN d;  5GMK h;  3JCM J;  5GMK i;  2DXU A;  2EWN A;  5GAO p;  2EAY A;  4M77 B;  4XU3 A;  4QVC A;  1N9S A;  1WQ7 A;  3QUI A;  5GAN 2;  5GAN h;  3QHS A;  1WNL A;  4M77 D;  3V8K A;  3JCM f;  5LJ3 e;  2DTI A;  3INZ A;  4M78 G;  5GAO r;  2RM4 A;  4N0A A;  5LJ5 e;  4M7D B;  3RER A;  4M78 A;  3RUX A;  3V7R A;  4XTZ A;  4M7D D;  4M78 E;  1Y96 A;  4M75 D;  3RKY A;  5LJ3 j;  3PGG A;  2QTX A;  2DEQ A;  4EMG A;  5LJ5 j;  1YCY A;  4M77 G;  5GAO n; 
#chains in the Genus database with same CATH topology
 1PNJ A;  5IXF A;  1HYO A;  1OPK A;  4RTV A;  3HRS A;  4M7D G;  3CXC P;  2E5Q A;  1W4S A;  2CT3 A;  2GNC A;  2KI7 A;  2RNA A;  5GAN e;  4MZP A;  4ANJ A;  1WHM A;  1T3S A;  4C5E A;  1TUD A;  4F04 B;  4PK4 A;  1NJI U;  3C94 A;  2MWP A;  4QQG A;  5CKE A;  2F1L A;  2EKH A;  4ZGD B;  2AKL A;  5IN1 A;  1WHH A;  2K6D A;  1Q86 U;  2X4Y A;  1KC8 U;  2RJE A;  2DTO A;  2ZPF B;  4A54 A;  3CXC A;  2PQW A;  3CBO A;  2ZPG B;  1PWT A;  2CP6 A;  4RCB A;  3H9N A;  3OA6 A;  3JB9 I;  4J7F A;  4VUB A;  3V8J A;  1XJW B;  4JJB A;  1AHJ B;  5GAN f;  2HQX A;  4IIM A;  2K7A A;  4CC2 A;  1H3H A;  1VIE A;  1NEB A;  1WIE A;  3GNF B;  2LQN A;  3EFS A;  3QJ6 A;  1TU0 B;  2BE9 B;  2RJC A;  3FLG A;  3GLX A;  2GBQ A;  4F16 A;  2HMA A;  4E6R A;  4PJO D;  4AFS C;  4J6Y A;  2QAZ A;  4JPB W;  4DOV A;  4PJO G;  2LT1 A;  2DX1 A;  2PTK A;  1R0B G;  2PNI A;  3HFO A;  3KBG A;  2ECZ A;  2VV5 A;  1UGP B;  2LQK A;  4ZTF A;  1D1C A;  1KQS P;  1VQ5 A;  2L3S A;  1WI7 A;  2DK3 A;  2J6K A;  1OUL A;  1YIT Q;  3BE3 A;  1NEG A;  3CME A;  3CMA Q;  2KRS A;  1Y0M A;  3RER A;  2BUD A;  3V7R A;  2ROL A;  3CPW A;  2QTX A;  1D0X A;  2OAW A;  3M4Y A;  2CH4 A;  4RG8 A;  1VQM T;  4M77 E;  4M75 F;  4A4G A;  1VQ8 Q;  2E4H A;  3I55 Q;  2DRK A;  4C0F A;  3F70 A;  3QPH A;  2VGM A;  4J9I A;  2QEX A;  3QBY A;  5HK3 A;  3LGF A;  3I56 T;  2CSQ A;  1PD1 A;  1QVG A;  3OYL A;  1K73 U;  2DRM A;  4N0A C;  3CPF A;  3CPW S;  3OY9 A;  1BYM A;  2O2O A;  3ZFJ A;  1JO8 A;  1OPL A;  2COY A;  4KBM B;  2L0A A;  2RHY A;  1EFN A;  3OYH A;  1M3B A;  5HCK A;  4XTU A;  1TUC A;  2GFU A;  4XK8 E;  4XQ3 A;  4EDU A;  3QG1 A;  4LDU A;  4XTX A;  1D1A A;  2DD4 A;  1IHV A;  3M0P A;  4ZGJ B;  4EMK A;  1QVG S;  4A4K A;  4JRP A;  3EFO A;  4X9C A;  3J81 E;  4HCK A;  4F7U F;  1IHW A;  3JB9 F;  1G8X A;  2LQW A;  3ZBD A;  4C5I A;  2A08 A;  2LJ3 A;  1YWO A;  2JN0 A;  1BI3 A;  4ORZ A;  1R0C B;  4Q5W A;  2HKN A;  1UEB A;  2GTJ A;  2L5Q A;  4C8Q A;  4B9X A;  4RTW A;  3JCM e;  3CC7 A;  2FEI A;  1ZBX A;  2I0N A;  1M1K R;  4KGV B;  5DY9 A;  1AWJ A;  2X4X A;  3ASK A;  1WX6 A;  1K0S A;  1VQ6 T;  1YJN T;  1IGQ A;  1LJO A;  1YP5 A;  1XNI A;  4EIK A;  1QCF A;  5GAM d;  2XMF A;  4E7K A;  3J80 E;  1PSE A;  3OYG A;  2O9S A;  1YJ9 T;  3WVD B;  3URG A;  3NTK A;  1SRM A;  3GNG A;  3S3N A;  3VS4 A;  3JV3 A;  5GAN 2;  5IH2 A;  3G6E Q;  1WNL A;  3JCM f;  3CD6 A;  2PUO B;  1UE9 A;  1VQ9 A;  3QWX X;  2DBK A;  1KD1 R;  3VRY A;  3LH5 A;  2DEQ A;  2PVD B;  4KGX B;  1M4Z A;  1YFN A;  2K9G A;  4C0D B;  1RLQ C;  2XKO C;  2RJD A;  5GAO n;  3KUF A;  4E7L A;  2E6N A;  1K1Z A;  4O5V A;  1OU8 A;  2Z0W A;  1VQN T;  4RCC A;  4C92 C;  5M9O A;  4R0K A;  1VQ4 T;  2G6F X;  3VRZ A;  1QLY A;  2M0O A;  4C8Q C;  3G4S T;  2NUP B;  2EVR A;  2GQV A;  1PRM C;  3M54 A;  1PSF A;  4TVR A;  1BB9 A;  1G83 A;  1VYU A;  2K5I A;  3CCQ A;  4M75 B;  1YHQ A;  2COW A;  3ER0 A;  3EAE A;  3CCM A;  3QYG B;  5GJV B;  4PLL A;  1AEY A;  4J6X A;  2K2V A;  2NUT B;  2DEU A;  2F5K A;  2C0I A;  1M1G A;  3GPL A;  1VQO A;  1MNE A;  1X6O A;  2PVO B;  3JCM W;  1WFW A;  3FRN A;  2IVW A;  4LE9 A;  3VYH B;  1RI9 A;  3OS5 A;  4PJJ A;  2CP7 A;  4PJL A;  3MP1 A;  1VQP Q;  2P4R A;  4CC3 A;  4LUE A;  2DTH A;  1N9R A;  3CCS Q;  2DA9 A;  1I81 A;  2V1Q A;  2V8J A;  5EG2 A;  5CKB A;  4F7U B;  4D8K A;  3CC4 A;  2DO3 A;  5GAM g;  2V8K A;  1U8R A;  2DET A;  1T0H A;  4J9B A;  2DE0 X;  2LTO A;  3M0Q A;  4WTO B;  2OTJ T;  4CI0 C;  2VGN A;  4C0Z A;  3SWN A;  1HD3 A;  4JRQ A;  4HT8 A;  1M5Q 1;  1MMN A;  4MZT A;  5GMK i;  1Q82 U;  3EHR A;  1RUW A;  4AG2 C;  1GRI A;  4FT2 A;  2DM1 A;  1Y57 A;  3CCU Q;  1WA7 A;  5L23 A;  3RUX A;  1UUE A;  5LJ3 j;  2HBP A;  2QG9 B;  3PGG A;  4EMG A;  1B07 A;  4E7H A;  3A8M B;  3EG0 A;  4ELY C;  2ED0 A;  3M0R A;  1KHC A;  2DYI A;  5GMK e;  3S3O A;  5DLQ E;  1UGQ B;  3LGL A;  4BI4 A;  3EG3 A;  3OS2 A;  2YUN A;  1BI0 A;  3I5S A;  4II1 A;  5KCH A;  4L59 A;  4LDX A;  3UA7 A;  5FU7 B;  3FIF A;  2DXC A;  3E2U A;  4M78 C;  2X35 A;  3SEM A;  2KYB A;  3EH2 A;  2MIO A;  1VIF A;  1OZ2 A;  1R8O B;  5DLO A;  1N8R R;  2KT8 A;  2L2P A;  4FW1 A;  4LDV A;  1Z9Z A;  3G7Z A;  2LNV A;  4M75 G;  1M90 C;  1LCK A;  2LX9 A;  1KK7 A;  5FRN A;  3QO3 A;  2QQA A;  2CH4 W;  4BDY A;  1BBZ A;  2KE9 A;  2LC4 A;  5GAN 7;  1ARK A;  2ENM A;  3TVT A;  1FYN A;  3HPW A;  4ATO A;  3OYC A;  2RHU A;  1VYV A;  4HXJ A;  2DAQ A;  4JZ3 A;  1E6G A;  2RI2 A;  2ABL A;  2EQI A;  3H8Z A;  4BB7 A;  2A37 A;  3OYI A;  2OI3 A;  1WHJ A;  4FSS A;  3PT9 A;  1BIA A;  2R5A A;  1D09 B;  3CCV A;  1YIJ A;  1JJ2 A;  3SFM A;  3OMC A;  1QW1 A;  4M77 F;  2HSP A;  1OX9 A;  2Y4X A;  4L5G A;  4OMO A;  4F7U G;  1VYT A;  3A1P A;  3JB9 G;  1PD0 A;  2PU9 B;  4AFZ C;  3OYY A;  3JCM J;  4FT4 A;  3CCR T;  4FYV B;  3LYI A;  3Q1J A;  1RLP C;  2CSI A;  1QKW A;  1JJ2 S;  2D8J A;  2L3P A;  5GAO r;  1SG5 A;  1MND A;  4PJM A;  1M3C A;  2DL8 A;  1QKX A;  2J6O A;  1YCS B;  5LJ5 j;  1QVF S;  3KFV A;  2X9H A;  2R5M A;  1BI1 A;  2B86 A;  4M7A F;  3H41 A;  2QK0 A;  4PJO C;  1K76 A;  2RD1 A;  2RQU A;  4HCB A;  1G3T A;  4J9C A;  4YTL A;  1AZG B;  1AWO A;  1SF9 A;  3P8H A;  5FLX E;  2ZCF B;  1KQ2 A;  1JBM A;  4J6W A;  1VQK T;  4HCZ A;  1JU5 C;  5FU6 B;  4IUU A;  4QVD A;  3TU4 K;  2HL5 C;  2RMO A;  1N5Z A;  3UA6 A;  1VQL T;  3G71 T;  2ZZD A;  3OBY A;  2EYW A;  3CEY A;  3QZ9 B;  2Y4Y A;  2SRC A;  2YLC A;  2G3R A;  3I56 Q;  3CC2 T;  1K4U S;  4WF2 A;  1ZSZ B;  2JMC A;  4D8D A;  2KXD A;  4Z89 A;  2KEA A;  5KYY A;  5CKF A;  2LX7 A;  2OJ2 A;  4J9F A;  3RKW A;  4FYY B;  2K57 A;  1M2V A;  1NM7 A;  3L2V A;  4C8Q E;  5IT9 E;  2EJG A;  1WHL A;  2KRO A;  5LJ3 h;  3X26 B;  4KRT A;  1B34 A;  5CQY A;  1GCQ C;  3JCM c;  3NPF A;  1H8K A;  1YI2 T;  4OGE A;  5CKD A;  2YRV A;  2ZPB B;  3CBP A;  2QA4 A;  4HT9 A;  2CUB A;  3OBW A;  2P0Q A;  1TWB A;  4M77 B;  2MMP A;  3I9Q A;  1W1F A;  2M02 A;  5KYW A;  1BU1 A;  1QVP A;  4LDY A;  2LDM A;  4B9W A;  1TUG B;  1Y96 A;  4AG1 C;  1S72 A;  2KXC A;  2H3E B;  3R6O A;  1VQ6 Q;  1YJN Q;  1YJW T;  3CCE T;  1GFC A;  2R58 A;  3EH1 A;  4JUV A;  3CCL T;  4J9E A;  2YT6 A;  3GOX A;  5GAM e;  1MMD A;  4RUG A;  2GGR A;  1K8A R;  1YJ9 Q;  1Q95 G;  2WSC E;  4M7A B;  1AZE A;  4HKE A;  2NWM A;  5GAO m;  5KYU B;  1M1K C;  1CKB A;  2FB7 A;  1OQK A;  4ZTJ A;  5LJ5 g;  2E65 A;  2KVQ G;  4HVU A;  1KIK A;  1ZBJ A;  5KYX B;  3FJ5 A;  4LD9 K;  3OMG A;  5GAN 8;  2RH2 A;  2MOX A;  2EQU A;  2HKQ B;  5GAM f;  2EIF A;  2L3Q A;  1EZZ B;  2YLB A;  2GQI A;  1VQN Q;  2XU8 A;  4DA4 A;  1VQ4 Q;  1X27 A;  1D3B B;  2FZG B;  4LN2 A;  3PMT A;  1SSF A;  3V7S A;  4PFP A;  3QXE B;  5D6Y A;  2V26 A;  4BAC A;  3V7C A;  3VS5 A;  3G4S Q;  1KFZ A;  1UTI A;  2M0Y A;  3V8L A;  1RAD B;  5GAN 6;  3JB9 H;  3EGX B;  1M27 C;  1ZHI A;  1QCN A;  2XHC A;  3C12 A;  1KD1 C;  2JTE A;  2PZ1 A;  4DBH A;  1Y71 A;  2LCC A;  1MUZ A;  1FMK A;  1WJS A;  2XK0 A;  2OX7 A;  1RAF B;  5LJ5 h;  4HA8 A;  4DEY A;  3FJP A;  2OTL T;  5I2M A;  1WJR A;  2ZAE A;  3MEA A;  1BI2 A;  2AK5 A;  3HKS A;  5GMK l;  2RB6 A;  1M30 A;  2NYS A;  5IAY A;  1KG1 A;  2CUD A;  1UHF A;  1TTH B;  2B8A A;  1M3A A;  4QVZ A;  2QQ9 A;  1R77 A;  4LDW A;  3QHS A;  1M1F A;  4M77 D;  3RR6 A;  3L2Q A;  1RAG B;  3FEO A;  4N0A A;  3GF5 A;  3SDZ A;  2A28 A;  3MPU B;  2XDB A;  4XTZ A;  1MHN A;  3RMS A;  3CPW P;  1PG5 B;  1K0X A;  4M77 G;  1V29 B;  3LWH A;  2AZV A;  2DXB A;  2QDL A;  3O8V A;  1NE8 A;  2OTJ Q;  4OMF B;  1M8M A;  5GAN 5;  1VQ7 T;  2QQB A;  2QYZ A;  3U23 A;  4JDS A;  3UDC A;  2FZK B;  1QVG P;  5ECA A;  4M7A D;  2QGG A;  1OU9 A;  2J05 A;  2X3W D;  2JTM A;  1YWP A;  1HK9 A;  1TG0 A;  3VUZ A;  2J06 A;  1OV3 A;  2XD0 A;  1I5L A;  4M7A G;  1I5O B;  4KH1 B;  3L1A A;  3HP9 A;  3M59 A;  1WZO A;  1U5S A;  3MET A;  1DJ7 B;  1WGS A;  3CCJ A;  3H0F A;  1TXQ A;  1OZ3 A;  2KGT A;  4CC4 B;  2M9U A;  1ACM B;  2IIM A;  1OYX A;  2AIR B;  3L2R A;  1C6V X;  3WXM B;  3M0S A;  2DMO A;  4J8O A;  1ZUU A;  4A63 B;  2KDS A;  1EX4 A;  1Q7Y R;  2P4T A;  1UGR B;  4M75 C;  2DNU A;  4C5H A;  1IB8 A;  3TRE A;  2JTF A;  1PKS A;  2EKO A;  4Y91 A;  2H8H A;  3J7A F;  4C92 A;  4N4G A;  1YIT A;  1FMW A;  2AZS A;  2DBM A;  1LOJ A;  3CMA A;  2CDT A;  1X69 A;  3JAM E;  1M90 U;  4HCC A;  1GL5 A;  1N8R C;  4OMN A;  3VS2 A;  2CP2 A;  1UEC A;  3I55 A;  2E6Z A;  1K9M R;  3RKY A;  3PIP A;  3PE0 A;  4BI3 A;  2HL3 A;  5HK0 A;  5A2Q E;  2EJ9 A;  1Y7X A;  1ZUK A;  1LPL A;  2DL7 A;  5D7U A;  2DL4 A;  1U06 A;  3VS1 A;  2JM8 A;  5CQX A;  4FYX B;  4N4H A;  3MP8 A;  2EYZ A;  2LJ1 A;  3CCR Q;  1WXU A;  2EYY A;  3EGD A;  2EQM A;  4NOY A;  3QKJ A;  2VXF A;  1G2B A;  1UG1 A;  2O4X A;  4C8Q F;  1IXD A;  1MMG A;  1UGV A;  3VS3 A;  3ZEH A;  2I2L A;  4V2S A;  2FL7 A;  3M53 A;  2DIL A;  2K3Y A;  1CSK A;  2DLP A;  2RF0 A;  1NYF A;  2F5T X;  3OYJ A;  3BDU A;  1U1T A;  4KH0 B;  5IHI A;  2YUP A;  3RIR A;  3UT1 A;  3C95 A;  3OYM A;  2GTO A;  2KT1 A;  5IHN A;  3VS6 A;  2QGF B;  4OB2 B;  1N6A A;  3E1S A;  5I22 A;  1AT1 B;  3TQ7 P;  1VQK Q;  3EGU A;  2JNG A;  1T3L A;  4J83 A;  4KUI A;  1VQ5 T;  4GBQ A;  5FU7 C;  1VQL Q;  3G71 Q;  2DYB A;  2FO0 A;  2JS2 A;  4XTW A;  2QI2 A;  3CME T;  5A0D A;  1O75 A;  4IUP A;  4GY5 A;  3G6E A;  3SB2 A;  2C0T A;  3N5B B;  3CC2 Q;  4MZM A;  2DJZ A;  2C06 A;  3NMZ C;  5KH6 A;  1BK2 A;  4F17 A;  1UGS B;  2LQ8 A;  2ESW A;  3QUI A;  4OVA A;  2QEX T;  1LVK A;  4BE2 A;  1HSQ A;  3CCJ T;  4PKC C;  2R57 A;  4M78 A;  2KAF A;  1UJ0 A;  1T0J A;  2DVJ A;  3H0I A;  2A36 A;  1YI2 Q;  4K11 A;  3UAT A;  3OYA A;  1MV0 B;  4M7D A;  2D1X A;  2JZ2 A;  4HVV A;  4IUQ A;  2CYZ B;  2HAX A;  1RAI B;  2J6F A;  2A7Y A;  1TOV A;  3A8H B;  4EMK B;  1IZ6 A;  4ZNX A;  3EFO B;  1E7O A;  1P92 A;  1ZA1 B;  1AOJ A;  1YJW Q;  3AT1 B;  3CCE Q;  2EGE A;  3CCL Q;  5D6X A;  3CC7 T;  2RK1 A;  4MMK A;  8ATC B;  4C8Q B;  3PTA A;  1VQP A;  4XU1 A;  2NUZ A;  4JZ4 A;  1WQW A;  3CCS A;  2M16 A;  1LNX A;  3L2Z A;  1GFD A;  2K3X A;  2EGA A;  2MAM A;  4MML A;  3TCJ A;  3EG1 A;  2ZGW A;  3HL8 A;  3BFM A;  5LJ3 d;  2BKD N;  3RBB B;  3EG9 A;  1JQQ A;  1NPP A;  2FRW A;  4LXC A;  3G1J A;  3MHX A;  1JJ2 P;  4M7D C;  3CBM A;  4MDW A;  3CD6 T;  4FU6 A;  1M1K U;  4ESR A;  1K8A C;  1VQ9 T;  1C0M A;  2DER A;  2F69 A;  5KYN A;  4RTT A;  3MP6 A;  2FPD A;  1QVF P;  2P84 A;  3REA B;  4PJO A;  1K9M U;  4BD3 A;  3NTI A;  1W2B S;  1UHC A;  2XIC A;  2BTT A;  5HKC A;  3A8G B;  5FW9 A;  2QAS A;  2XID A;  4JJD A;  5GAN h;  3O5Z A;  2CRE A;  2D9T A;  3OSS C;  4O6J A;  4J9H A;  3CCQ T;  1KHI A;  5AT1 B;  3PVL A;  1YHQ T;  2X3X D;  1QVF A;  5D6W A;  3CCM T;  2OTL Q;  2AT1 B;  1KD1 U;  3JRZ A;  1HJD A;  5KE3 A;  2YDL A;  1NZ9 A;  2EQJ A;  4GLM A;  3OYD A;  1WPY A;  2DXT A;  1VQO T;  3ULR B;  3UF4 A;  5C6S A;  2BE7 D;  3OB9 A;  4M75 E;  2O31 A;  3DKM A;  2K2M A;  1NJI R;  5A0G A;  2FRY A;  1B7T A;  2MF2 A;  1RAA B;  1Q86 R;  4DBF A;  1SHG A;  1KC8 R;  2DD5 A;  4OMQ A;  1H64 1;  2KQW A;  3OYK A;  4PFO A;  3UPU A;  1SEM A;  4M77 C;  5I21 A;  2ED1 A;  2RHX A;  5CR2 A;  2VAS A;  1GCQ A;  1MGQ A;  3E9G A;  3QJY A;  4C8Q D;  3CC4 T;  1VQ7 Q;  3H6Z A;  4LD6 A;  2VKN A;  5EC7 A;  5LJ3 g;  3RKX A;  1QWE A;  2K4Y A;  4X34 A;  2WSF E;  2JXB A;  4C8Q G;  1VOM A;  2V1R A;  3OYB A;  3BW1 A;  3OW2 A;  4KUD K;  3SWN B;  1KSW A;  3PVQ A;  5LJ5 d;  4BE0 A;  1VQM Q;  4M7A C;  3THK A;  2CZ6 B;  1S1N A;  4E7J A;  2YSQ A;  1J3T A;  3X24 B;  3P8B B;  2DZC A;  3M4G A;  2X51 A;  4AMC A;  4JS4 A;  1WXB A;  1W70 A;  4C92 E;  1KQ1 A;  3OW2 S;  1ZX6 A;  2W10 A;  2LJ0 A;  2LP5 A;  2FZC B;  3M9Q A;  2RM4 A;  1X6G A;  2LCL A;  2O01 E;  2XG8 D;  4RTY A;  5CKH A;  2KRN A;  4PLI A;  3PNW C;  4RTZ A;  4WCI A;  1ABO A;  1IO6 A;  5GMK m;  4DOW A;  2E3I A;  2YWW A;  3JCM Q;  1FX7 A;  1K73 R;  2HCK A;  2M51 A;  3MKD A;  3DB4 A;  1D0Y A;  4PFZ A;  3RMQ A;  3SHW A;  1PHT A;  2E12 A;  2HZY A;  1UDL A;  3X25 B;  1RAH B;  1Q7Y C;  2ROT A;  1U1S A;  1UJY A;  2YXY A;  3JCM h;  1FXX A;  2CKK A;  3I56 A;  2CZ0 B;  2DZ9 A;  1N8R U;  3DB3 A;  3VYG A;  1NLO C;  3QWY A;  4ZGE B;  3CCV T;  1YIJ T;  5CK9 A;  1M8V A;  1F1B B;  1WLP B;  5CAI A;  4RTX A;  1I0C A;  4JLG A;  3NTH A;  1BKB A;  1Q81 C;  1X75 C;  1K9M C;  1RI0 A;  1I8F A;  2RN8 A;  1TSF A;  3P8D A;  3HSB A;  1AWW A;  1OEB A;  2D0N A;  4JRI A;  2JS0 A;  2EJF A;  2VUB A;  4JS5 A;  3CQT A;  4BY6 B;  2AHJ B;  1BIB A;  2XDD A;  4PL6 A;  2RK2 A;  1IRX A;  2C0O A;  4LUD A;  3FB9 A;  2XDP A;  1OOT A;  2RA2 A;  1EIF A;  3NHN A;  1UB4 A;  2DXU A;  1CKA A;  3REB B;  2GFA A;  2KYM A;  1V76 A;  3C4S A;  3OSV A;  1D1B A;  3OS1 A;  1VQ6 A;  2J7I A;  2DTI A;  2ZPI B;  3INZ A;  1YJN A;  2D8H A;  2D6F A;  1V1C A;  1VQ5 Q;  2ZPE B;  4M78 E;  1NG2 A;  4QW2 A;  4AFU C;  2HSE B;  3OYN A;  3QDR B;  4Y92 A;  3CME Q;  3EFR A;  3RES A;  1YJ9 A;  4C0G A;  2VXE A;  3JCM b;  3E19 A;  2KBT A;  1SKU B;  3SD4 A;  4M7D E;  2RQT A;  9ATC B;  2CT4 A;  1SRL A;  2QEX Q;  1RAB B;  3H0H A;  3MEW A;  3CCJ Q;  5A0L A;  2YUQ A;  1RL2 A;  1VQN A;  1JEG A;  5KYY B;  1VQ4 A;  3CXC S;  2KK4 A;  4NL2 A;  2NUP A;  4Z88 A;  3A98 A;  1ZLM A;  1M2V B;  3G4S A;  4M75 A;  4DQ2 A;  2JVV A;  8AT1 B;  3MO8 A;  1B3Q A;  4OML A;  1TS9 A;  3VV0 A;  2NUT A;  1B34 B;  2DIG A;  1ABQ A;  2WSE E;  3IQL A;  2E64 A;  1AVZ C;  4JLI A;  1BCM A;  2JJ9 A;  2EYX A;  3R6N A;  1OX8 A;  1JRI A;  2QA4 T;  3OS0 A;  1RAC B;  2DL3 A;  2CZ1 B;  2DFU A;  5IXB A;  5GAO l;  2VB6 A;  4OB0 B;  4B6M A;  4E7Z A;  3E9F A;  3CC7 Q;  1FWZ A;  5KYW B;  4C0D C;  4X1V A;  4CRI A;  3OYE A;  2WAC A;  1S72 T;  4PJO E;  1Y96 B;  1Q82 R;  1ZUY A;  4F7U A;  1KQS A;  5GMK h;  1IGU A;  1I1J A;  2HDA A;  1Z9Q A;  3L42 A;  4XU3 A;  4QVC A;  1KJW A;  1N9S A;  1SHF A;  1WQ7 A;  2KSS A;  3HRU A;  2JT4 A;  4RG2 A;  2VWF A;  5L8R E;  5LJ3 e;  1NBE B;  4L6V 5;  5CVI A;  3L2U A;  2QXF A;  2RPN A;  3UWN A;  2E3H A;  2OTJ A;  1X2Q A;  1M9S A;  2HEQ A;  3CD6 Q;  2FVU A;  1VQ9 Q;  2KNB B;  4FL6 A;  1KQS S;  3OQ5 A;  4M7A E;  3NGP A;  1G5V A;  1M2O A;  4E2F B;  1GBQ A;  4Y28 E;  4P5N A;  5GAM j;  2O9V A;  2CP0 A;  2MI6 A;  2HQH A;  1C1A A;  1K8A U;  2O88 A;  5LJ3 f;  4IKF A;  1VQ8 A;  1Q81 R;  2QDY B;  4OGC A;  2YHT A;  3QDF A;  1XTD A;  5J3B A;  2VYT A;  3CCQ Q;  4OB3 B;  1HXD A;  1YHQ Q;  4XTV A;  2XI9 A;  3VKI A;  1O9S A;  3CCM Q;  3EG2 A;  2RQW A;  2VC8 A;  2QQR A;  3M58 A;  1U3O A;  3L2W A;  5C0M A;  5GJW B;  2MWO A;  1WHG A;  1VQO Q;  2K5F A;  2JUF A;  2A3L A;  1N27 A;  4J5Y A;  4FSX A;  4C92 F;  2EGC A;  5KE2 A;  5GAN j;  1H3Z A;  2PUK B;  3MJX A;  3GBQ A;  3AHU A;  1G3S A;  3LX7 A;  3D7S B;  2K5L A;  1MV3 A;  4ZN1 A;  2JW4 A;  3FC3 A;  4KGZ B;  1H92 A;  4IUV A;  4OF1 A;  4NL3 A;  4E7I A;  4RMO A;  4QQD A;  2V8I A;  2FYK A;  3M0T A;  2BIV A;  2EFI A;  1WJQ A;  2ZPH B;  3QII A;  3VU3 C;  2F2V A;  4BE1 A;  4EMK C;  1NJI C;  3CC4 Q;  3A5Z B;  1G3Y A;  4E47 A;  5DM7 R;  2M1H A;  3PMI A;  1X43 A;  3VS7 A;  5LL6 S;  2PVG B;  1Q86 C;  1WYX A;  4DBQ A;  5GAN d;  1KC8 C;  4DEX A;  2EWN A;  2RI5 A;  7AT1 B;  1QQJ A;  3JSC A;  2YRC A;  3V8K A;  5LJ5 e;  4IUR A;  5FRM A;  3C0C A;  2CS7 A;  4QKU A;  3M55 A;  4UC4 A;  2JM9 A;  2LVM A;  4EPC A;  2D0Q B;  2RO0 A;  1YNZ A;  3CCR A;  2DIQ A;  1TH7 A;  4QQ6 A;  2HD0 A;  2EQK A;  3QSU A;  2CGH A;  3M57 A;  1JB0 E;  3NFC A;  4A53 A;  1X01 A;  3ME9 A;  1JXO A;  2E5K A;  4BI8 B;  2MYS A;  3BY7 A;  5GAO q;  4MDX A;  5LJ5 f;  4ZN3 A;  5HY6 A;  5J26 A;  3VS0 A;  2OAU A;  2P0K A;  1QWF A;  2FPE A;  1QMC A;  2SEM A;  2H3J A;  2RQR A;  4FCY A;  4GLK A;  2E41 A;  1PM3 A;  1ZQ1 A;  3S6W A;  2LNH B;  1VQK A;  3LH0 A;  4D6W A;  1QCO A;  1VUB A;  2QTV A;  4IUT A;  2DL5 A;  1WDX A;  4XU0 A;  4R55 A;  1A0N B;  1YIT T;  1NYG A;  3G71 A;  1W2B P;  1VQL A;  3CMA T;  4C92 B;  4M78 F;  2EW3 A;  2P0P A;  2X4J A;  2RHZ A;  4BDZ A;  1ZSZ A;  4OP0 A;  3LW5 E;  1I4K 1;  2HNI A;  3CC2 A;  2CP3 A;  1K73 C;  2L89 A;  2LZ6 B;  3MCA B;  4OMM A;  5GAN g;  1Q7Y U;  1VQ8 T;  3I55 T;  3CCV Q;  2MPX C;  1YIJ Q;  1K9A A;  2MK5 A;  3HFN A;  4M7D F;  5GAM h;  2BZ8 A;  3PIO A;  1W2B A;  3TSZ A;  5GAO p;  4A4H A;  3MEU A;  3MEV A;  1YI2 A;  3RDV A;  5I2S A;  2FPF A;  1SPK A;  2BZX A;  4M75 D;  3EGD B;  3HTR A;  2LRQ A;  1Q81 U;  5FU6 C;  4M77 A;  1SSH A;  2O4X B;  2F2W A;  3CCU A;  3SWN C;  1NLP C;  3FDR A;  4FM4 B;  2ATC B;  4AFQ C;  4CC7 A;  1PRL C;  1I07 A;  2RQV A;  4HVW A;  4JRK A;  2YUO A;  3VJP A;  2IG0 A;  1ZSZ C;  4NS5 A;  1YJW A;  3CCE A;  1GBR A;  3CCL A;  3LLR A;  4FIB A;  4OB1 B;  4M4Z A;  3JCM d;  3GP8 A;  2CP5 A;  2DVE A;  2X4W A;  3M5A A;  1AWX A;  5FWB A;  3M56 A;  1RAE B;  3GIB A;  2YRD A;  3JCM X;  1JXM A;  4XU2 A;  4M7A A;  4F14 A;  2AKK A;  5KYU A;  3T9N A;  2VVK A;  3JB9 D;  4KT0 E;  2DKG A;  4PJO F;  2KY9 A;  3WVE B;  5KYX A;  3BDL A;  4Z8A A;  4IIO A;  2EPD A;  2E1H A;  1BCO A;  4J9G A;  3X20 B;  3G6E T;  2EBP A;  4EMH A;  2LCS A;  3OW2 P;  4J9D A;  4ME7 A;  3S3M A;  1D3B A;  4JJN K;  2F2X A;  1XQH A;  4XTY A;  4C92 D;  3KXT A;  3PFS A;  5AYF A;  3EGX A;  2KRM A;  4QT7 A;  2W0Z A;  4C92 G;  4M78 B;  1VA7 A;  1PCX A;  2MCN A;  2COZ A;  4F7U E;  2KMT A;  2DJQ A;  5CO7 A;  5CIU A;  4ELZ C;  3I35 A;  1G3W A;  1XOV A;  1OI1 A;  3QZ5 B;  6AT1 B;  2OTL A;  1E6H A;  2QA4 Q;  4E7S A;  4M7D B;  3RNJ A;  1YN8 A;  2JMA A;  3HHT B;  2FG0 A;  4FW2 A;  1YBY A;  2DF6 A;  2HQE A;  4PNO A;  4Z02 A;  1WHK A;  1PKT A;  2RJF A;  3LWI A;  1X6B A;  1GXI E;  4C5G A;  3A8O B;  1S72 Q;  5J39 A;  1NPR A;  1QP3 A;  4A4E A;  4RTU A;  4N4I A;  2FHD A;  5GAN 4;  2RHI A;  3JCM g;  3TSW A;  3ZL7 C;  1VQP T;  4BY6 C;  2L3R A;  3OYF A;  2CZ7 B;  2JOY A;  2LT4 A;  3I5R A;  3CCS T;  5GAN 3;  2DPP B;  2RI3 A;  4LNP A;  3HRT A;  4RKU E;  3TEE A;  1VQ7 A;  2K79 A;  4AT1 B;  5I11 A;  4DBR A;  1Q82 C;  2L8D A;  5GMK j;  5CCA A;  1ZSG A;  5KCO A;  2E70 A;  3QYH B;  5FRO A;  4X9D A;  3EG9 B;  4J7I A;  2KR3 A;  3M0U A;  2Y90 A;  4FYW B;  1VQM A;  1AD5 A;  1FMV A;  4JJC A;  5FWC A;  3DLL A;  3CCU T;  4PJO B;  3JCM V;  4PJN A;  4BUG A;  5IHK A;  3JB9 J;  1UFF A;  3A8L B;  1X2K A;  2GF7 A;  2EYQ A;  1ZA2 B;  4XAX B;  2BZY A;  1D0Z A;  2E10 A;  3JCM P;  3EHQ A;  4R56 A;  2LMJ A;  1M90 R;  2A0F B;  1QP2 A;  4M78 D;  1GCP A;  1W6X A;  2QQS A;  3DLM A;  1MMA A;  4KUL A;  1WXT A;  2NLU A;  2EAY A;  3X28 B;  4M78 G;  4OMP A;  1IRE B;  1Y07 A;  2K3B A;  1PC0 A;  2GCX A;  3VUB A;  4M7D D;  2HBW A;  2IPO B;  1YCY A;  4A4F A; 
#chains in the Genus database with same CATH homology
 1BI1 A;  4M7A F;  2FVU A;  3HRS A;  4FL6 A;  1KQS S;  4PJO C;  2RD1 A;  4M7D G;  2E5Q A;  3OYA A;  4HCB A;  1W4S A;  1G3T A;  4M7D A;  3OQ5 A;  4YTL A;  4M7A E;  1G5V A;  4Y28 E;  4P5N A;  5GAN e;  4MZP A;  5GAM j;  2JZ2 A;  2MI6 A;  4IUQ A;  2CYZ B;  3P8H A;  5FLX E;  2ZCF B;  2HAX A;  1KQ2 A;  2A7Y A;  1JBM A;  4C5E A;  1K8A U;  3A8H B;  5LJ3 f;  4IKF A;  1VQ8 A;  4J6W A;  1NJI U;  3C94 A;  2QDY B;  2MWP A;  4QQG A;  1VQK T;  5CKE A;  4OGC A;  1IZ6 A;  2YHT A;  4HCZ A;  4EMK B;  4ZGD B;  5IN1 A;  1XTD A;  5J3B A;  1P92 A;  1Q86 U;  2VYT A;  5FU6 B;  2X4Y A;  4IUU A;  4QVD A;  3TU4 K;  4OB3 B;  2RJE A;  1HXD A;  2DTO A;  1KC8 U;  2ZPF B;  4A54 A;  4XTV A;  2PQW A;  2XI9 A;  3CBO A;  1O9S A;  3VKI A;  3CXC A;  2ZPG B;  2VC8 A;  1VQL T;  5D6X A;  3G71 T;  2QQR A;  3M58 A;  3CC7 T;  2ZZD A;  4RCB A;  2RK1 A;  3L2W A;  4MMK A;  5C0M A;  3OBY A;  2MWO A;  4C8Q B;  3OA6 A;  3PTA A;  3CEY A;  3QZ9 B;  3JB9 I;  4J7F A;  4VUB A;  3V8J A;  1VQP A;  2Y4Y A;  4XU1 A;  2K5F A;  1AHJ B;  2JUF A;  2YLC A;  2A3L A;  1N27 A;  2G3R A;  4FSX A;  4J5Y A;  4C92 F;  1WQW A;  2HQX A;  5GAN f;  3CC2 T;  4WF2 A;  3CCS A;  5KE2 A;  2M16 A;  1LNX A;  5GAN j;  1H3Z A;  3L2Z A;  1VIE A;  2K3X A;  2PUK B;  5CKF A;  3AHU A;  3RKW A;  1G3S A;  3LX7 A;  2MAM A;  4MML A;  3TCJ A;  2K57 A;  2ZGW A;  2K5L A;  3HL8 A;  3GNF B;  4ZN1 A;  3EFS A;  3FC3 A;  3BFM A;  3QJ6 A;  3L2V A;  5LJ3 d;  3FLG A;  2RJC A;  4C8Q E;  3GLX A;  4IUV A;  5IT9 E;  2BKD N;  2EJG A;  4OF1 A;  4NL3 A;  4PJO D;  4E7I A;  5LJ3 h;  4RMO A;  3X26 B;  4QQD A;  1NPP A;  2V8I A;  1B34 A;  2FYK A;  3MHX A;  2BIV A;  5CQY A;  3JCM c;  3CBM A;  4M7D C;  4MDW A;  2EFI A;  1WJQ A;  2ZPH B;  3QII A;  1YI2 T;  3CD6 T;  4FU6 A;  4J6Y A;  1M1K U;  4OGE A;  3VU3 C;  1K8A C;  4BE1 A;  5CKD A;  2YRV A;  4EMK C;  4DOV A;  1VQ9 T;  2ZPB B;  4PJO G;  2F69 A;  2LT1 A;  1NJI C;  3MP6 A;  3A5Z B;  1G3Y A;  4E47 A;  5DM7 R;  4PJO A;  1K9M U;  2M1H A;  3CBP A;  3PMI A;  3HFO A;  3KBG A;  5LL6 S;  2PVG B;  3NTI A;  4BD3 A;  1Q86 C;  2QA4 A;  2VV5 A;  1W2B S;  4HT9 A;  1UGP B;  2LQK A;  2XIC A;  5GAN d;  4ZTF A;  1KC8 C;  2P0Q A;  3OBW A;  2RI5 A;  2EWN A;  5HKC A;  1VQ5 A;  3A8G B;  2MMP A;  4M77 B;  2DK3 A;  2XID A;  5GAN h;  3JSC A;  3V8K A;  2D9T A;  1QVP A;  4LDY A;  3OSS C;  4O6J A;  3CME A;  2LDM A;  5LJ5 e;  4B9W A;  4IUR A;  5FRM A;  2BUD A;  3RER A;  3V7R A;  2CS7 A;  1Y96 A;  3CPW A;  2QTX A;  3CCQ T;  1KHI A;  3M55 A;  4UC4 A;  1YHQ T;  1S72 A;  1QVF A;  5D6W A;  3R6O A;  3CCM T;  3M4Y A;  1YJW T;  3CCE T;  2LVM A;  4RG8 A;  2R58 A;  4JUV A;  4EPC A;  3CCL T;  2D0Q B;  2RO0 A;  1VQM T;  1KD1 U;  3JRZ A;  4M77 E;  4M75 F;  4A4G A;  3CCR A;  2DIQ A;  5KE3 A;  1TH7 A;  1NZ9 A;  4QQ6 A;  5GAM e;  2HD0 A;  4C0F A;  3GOX A;  2EQK A;  2EQJ A;  3F70 A;  1WPY A;  2VGM A;  2CGH A;  2DXT A;  3QPH A;  3OYD A;  2QEX A;  3M57 A;  3QBY A;  1JB0 E;  1VQO T;  5C6S A;  3NFC A;  3OB9 A;  4A53 A;  3LGF A;  1X01 A;  5HK3 A;  4M75 E;  3I56 T;  3DKM A;  3ME9 A;  1QVG A;  5A0G A;  3OYL A;  2WSC E;  4M7A B;  4BI8 B;  4HKE A;  1K73 U;  2MF2 A;  5GAO m;  1M1K C;  4N0A C;  3BY7 A;  5GAO q;  3CPF A;  2FB7 A;  3OY9 A;  3CPW S;  4ZTJ A;  4MDX A;  5LJ5 f;  1BYM A;  4ZN3 A;  5LJ5 g;  5HY6 A;  2E65 A;  3ZFJ A;  2DD5 A;  2KVQ G;  1H64 1;  2KQW A;  3OYK A;  4KBM B;  2RHY A;  3UPU A;  5J26 A;  3OYH A;  4LD9 K;  3OMG A;  5GAN 8;  4M77 C;  2GFU A;  2RH2 A;  4XK8 E;  2RHX A;  4XTU A;  4XQ3 A;  5I21 A;  5CR2 A;  2OAU A;  2P0K A;  4EDU A;  2EQU A;  2H3J A;  3QG1 A;  5GAM f;  1MGQ A;  2EIF A;  4LDU A;  4XTX A;  2DD4 A;  2YLB A;  2E41 A;  4GLK A;  3E9G A;  3QJY A;  2XU8 A;  4ZGJ B;  4DA4 A;  4EMK A;  4C8Q D;  1D3B B;  3CC4 T;  4A4K A;  4JRP A;  1QVG S;  3PMT A;  1ZQ1 A;  3S6W A;  1SSF A;  4X9C A;  3J81 E;  3V7S A;  1VQK A;  3QXE B;  5D6Y A;  3H6Z A;  4F7U F;  3LH0 A;  4BAC A;  4D6W A;  3V7C A;  4LD6 A;  5LJ3 g;  3V8L A;  3JB9 F;  3RKX A;  1VUB A;  5GAN 6;  3ZBD A;  4C5I A;  3JB9 H;  4IUT A;  2XHC A;  1ZHI A;  3C12 A;  2JN0 A;  1BI3 A;  2K4Y A;  2WSF E;  4X34 A;  4XU0 A;  4C8Q G;  4Q5W A;  1UEB A;  2L5Q A;  3BW1 A;  4R55 A;  3OYB A;  3OW2 A;  1KD1 C;  4KUD K;  1YIT T;  3G71 A;  4C8Q A;  1VQL A;  4B9X A;  3JCM e;  3CC7 A;  1Y71 A;  3SWN B;  3CMA T;  4C92 B;  2LCC A;  1WJS A;  2XK0 A;  4M78 F;  1ZBX A;  5LJ5 d;  4BE0 A;  2P0P A;  2X4J A;  2RHZ A;  4BDZ A;  5DY9 A;  2X4X A;  3ASK A;  4OP0 A;  4M7A C;  5LJ5 h;  4HA8 A;  2CZ6 B;  3LW5 E;  1I4K 1;  3FJP A;  2HNI A;  4E7J A;  3CC2 A;  1VQ6 T;  2OTL T;  1YJN T;  3X24 B;  3P8B B;  1K73 C;  2L89 A;  2DZC A;  1LJO A;  3MCA B;  5GAN g;  5I2M A;  1Q7Y U;  1VQ8 T;  1WJR A;  1XNI A;  3I55 T;  3M4G A;  3MEA A;  1BI2 A;  5GAM d;  4E7K A;  3HKS A;  3J80 E;  3HFN A;  1PSE A;  5GMK l;  3OYG A;  4JS4 A;  4M7D F;  2RB6 A;  5IAY A;  4C92 E;  1KG1 A;  1KQ1 A;  5GAM h;  3PIO A;  1YJ9 T;  1W2B A;  3OW2 S;  2B8A A;  3WVD B;  4QVZ A;  3URG A;  3NTK A;  2QQ9 A;  5GAO p;  3GNG A;  3S3N A;  4A4H A;  5GAN 2;  4LDW A;  3QHS A;  1M1F A;  1WNL A;  3MEV A;  3MEU A;  4M77 D;  3L2Q A;  3JCM f;  3CD6 A;  1YI2 A;  2PUO B;  3M9Q A;  2RM4 A;  3FEO A;  4N0A A;  3GF5 A;  3SDZ A;  5I2S A;  1VQ9 A;  2LCL A;  2XDB A;  4XTZ A;  2O01 E;  2XG8 D;  4M75 D;  1MHN A;  2DEQ A;  2PVD B;  5CKH A;  3RMS A;  1M4Z A;  4C0D B;  1V29 B;  4M77 G;  2XKO C;  2RJD A;  2LRQ A;  3KUF A;  4PLI A;  3PNW C;  5GAO n;  3LWH A;  4E7L A;  2DXB A;  1Q81 U;  2E6N A;  3O8V A;  4O5V A;  5FU6 C;  4M77 A;  2O4X B;  1NE8 A;  3CCU A;  4OMF B;  3SWN C;  5GMK m;  1VQN T;  4DOW A;  4RCC A;  4C92 C;  5M9O A;  1VQ4 T;  5GAN 5;  3JCM Q;  1FX7 A;  3FDR A;  4FM4 B;  1VQ7 T;  2M0O A;  2QQB A;  4C8Q C;  4JDS A;  3UDC A;  3G4S T;  2GQV A;  3M54 A;  1PSF A;  3DB4 A;  4JRK A;  2K5I A;  4TVR A;  3RMQ A;  3VJP A;  3CCQ A;  4M75 B;  2IG0 A;  2E12 A;  1YHQ A;  4NS5 A;  4M7A D;  3ER0 A;  3X25 B;  3EAE A;  3CCM A;  3QYG B;  1YJW A;  3CCE A;  2JTM A;  1Q7Y C;  3CCL A;  4PLL A;  1HK9 A;  3LLR A;  4FIB A;  4J6X A;  4OB1 B;  1U1S A;  3JCM d;  2K2V A;  3VUZ A;  2F5K A;  3GP8 A;  3GPL A;  1M1G A;  2XD0 A;  1VQO A;  1I5L A;  2DVE A;  3JCM h;  2X4W A;  3M5A A;  1FXX A;  4M7A G;  3M56 A;  2CKK A;  3I56 A;  3GIB A;  3JCM X;  2CZ0 B;  1X6O A;  2DZ9 A;  2PVO B;  3L1A A;  3DB3 A;  4XU2 A;  3JCM W;  3HP9 A;  1N8R U;  4M7A A;  3M59 A;  3VYG A;  3T9N A;  3JB9 D;  3FRN A;  3MET A;  1DJ7 B;  1WGS A;  2IVW A;  4KT0 E;  4ZGE B;  3CCJ A;  2DKG A;  3VYH B;  3CCV T;  1YIJ T;  5CK9 A;  3OS5 A;  4PJO F;  2KY9 A;  1M8V A;  3WVE B;  5CAI A;  3BDL A;  1OZ3 A;  2E1H A;  4JLG A;  3NTH A;  2M9U A;  3MP1 A;  1BKB A;  3X20 B;  1Q81 C;  1X75 C;  3G6E T;  1K9M C;  1RI0 A;  1OYX A;  1I8F A;  2DTH A;  1N9R A;  3L2R A;  3WXM B;  4EMH A;  1I81 A;  2V8J A;  4ME7 A;  3P8D A;  3S3M A;  5EG2 A;  3HSB A;  1D3B A;  5CKB A;  4JJN K;  4F7U B;  1XQH A;  4J8O A;  4XTY A;  4JRI A;  4C92 D;  3KXT A;  3CC4 A;  2KDS A;  2DO3 A;  5GAM g;  2V8K A;  2P4T A;  1UGR B;  2EJF A;  1U8R A;  4M75 C;  2VUB A;  3PFS A;  4C5H A;  5AYF A;  2LTO A;  4JS5 A;  4BY6 B;  3TRE A;  2OTJ T;  2AHJ B;  2JTF A;  4C92 G;  4CI0 C;  2EKO A;  4Y91 A;  1BIB A;  2VGN A;  4M78 B;  4C0Z A;  4PL6 A;  2XDD A;  2RK2 A;  3SWN A;  3J7A F;  3FB9 A;  4C92 A;  2XDP A;  4N4G A;  1YIT A;  4JRQ A;  4HT8 A;  2RA2 A;  1LOJ A;  4F7U E;  3CMA A;  1M5Q 1;  2KMT A;  1EIF A;  4MZT A;  5CIU A;  5CO7 A;  4ELZ C;  5GMK i;  3JAM E;  1UB4 A;  2DXU A;  1M90 U;  1Q82 U;  2GFA A;  1G3W A;  4HCC A;  3C4S A;  1XOV A;  3OSV A;  1N8R C;  1OI1 A;  3OS1 A;  3QZ5 B;  4FT2 A;  1VQ6 A;  2DTI A;  2ZPI B;  3INZ A;  1YJN A;  2OTL A;  4M7D B;  2D6F A;  3RUX A;  2ZPE B;  4M78 E;  3I55 A;  2E6Z A;  3HHT B;  5LJ3 j;  2HBP A;  3RKY A;  3PIP A;  3PGG A;  4QW2 A;  4EMG A;  4E7H A;  1YBY A;  4BI3 A;  3OYN A;  3QDR B;  3A8M B;  5HK0 A;  5A2Q E;  2HQE A;  3EFR A;  2EJ9 A;  4PNO A;  3RES A;  4ELY C;  1YJ9 A;  4C0G A;  1Y7X A;  2VXE A;  4Z02 A;  3JCM b;  1KHC A;  3E19 A;  2RJF A;  3LWI A;  1GXI E;  5GMK e;  5CQX A;  4C5G A;  3A8O B;  4N4H A;  3SD4 A;  3S3O A;  5DLQ E;  5J39 A;  1NPR A;  1QP3 A;  4A4E A;  4M7D E;  1UGQ B;  3LGL A;  2FHD A;  3MP8 A;  4N4I A;  4BI4 A;  3OS2 A;  5GAN 4;  1BI0 A;  2RHI A;  4II1 A;  5KCH A;  3JCM g;  4L59 A;  4LDX A;  2EQM A;  5FU7 B;  3FIF A;  1VQP T;  2DXC A;  4NOY A;  3QKJ A;  2L3R A;  4BY6 C;  2VXF A;  3OYF A;  2CZ7 B;  2O4X A;  2JOY A;  2LT4 A;  4M78 C;  2X35 A;  4C8Q F;  3CCS T;  3MEW A;  5GAN 3;  2DPP B;  1VIF A;  5A0L A;  1OZ2 A;  2RI3 A;  1RL2 A;  2I2L A;  3ZEH A;  4V2S A;  2FL7 A;  1R8O B;  1VQN A;  5DLO A;  3M53 A;  3HRT A;  4RKU E;  1VQ4 A;  2K3Y A;  3TEE A;  4LDV A;  3CXC S;  2KK4 A;  4NL2 A;  3G7Z A;  2LNV A;  1VQ7 A;  4M75 G;  1M90 C;  3G4S A;  1Q82 C;  2F5T X;  2L8D A;  2LX9 A;  3OYJ A;  4M75 A;  5FRN A;  3BDU A;  2QQA A;  3QO3 A;  4DQ2 A;  2JVV A;  4BDY A;  1U1T A;  5GMK j;  2LC4 A;  5CCA A;  5GAN 7;  3MO8 A;  5KCO A;  2E70 A;  3QYH B;  5FRO A;  3HPW A;  4ATO A;  4X9D A;  2RHU A;  3VV0 A;  3OYC A;  1B34 B;  4J7I A;  3RIR A;  3UT1 A;  2DIG A;  3C95 A;  2DAQ A;  3OYM A;  2WSE E;  2Y90 A;  4OB2 B;  1N6A A;  2RI2 A;  3E1S A;  1VQM A;  2E64 A;  4JLI A;  3DLL A;  3H8Z A;  4BB7 A;  1JRI A;  3CCU T;  2JNG A;  3OYI A;  2QA4 T;  4PJO B;  3OS0 A;  3JCM V;  3PT9 A;  1BIA A;  2R5A A;  4J83 A;  4KUI A;  4BUG A;  1VQ5 T;  3CCV A;  2CZ1 B;  5GAO l;  3JB9 J;  1YIJ A;  1JJ2 A;  4OB0 B;  3A8L B;  5FU7 C;  3SFM A;  3OMC A;  4XTW A;  2GF7 A;  2QI2 A;  3E9F A;  1QW1 A;  2EYQ A;  3CME T;  4M77 F;  1FWZ A;  4XAX B;  3QSU A;  5A0D A;  4C0D C;  1O75 A;  4IUP A;  4CRI A;  4GY5 A;  2E10 A;  3OYE A;  4R56 A;  2Y4X A;  4L5G A;  4F7U G;  3G6E A;  3SB2 A;  2WAC A;  3JCM P;  3N5B B;  3JB9 G;  1S72 T;  1Y96 B;  2DJZ A;  4MZM A;  1QP2 A;  2C06 A;  4M78 D;  4PJO E;  4F7U A;  1KQS A;  2PU9 B;  5KH6 A;  2QQS A;  3DLM A;  4KUL A;  3OYY A;  5GMK h;  3JCM J;  4FT4 A;  3CCR T;  2NLU A;  1UGS B;  2LQ8 A;  2EAY A;  3LYI A;  3L42 A;  3Q1J A;  4XU3 A;  1N9S A;  1WQ7 A;  2KSS A;  3QUI A;  3HRU A;  4OVA A;  4QVC A;  2QEX T;  4RG2 A;  5L8R E;  5LJ3 e;  3X28 B;  1JJ2 S;  4BE2 A;  4M78 G;  5GAO r;  1IRE B;  1Y07 A;  4L6V 5;  5CVI A;  3L2U A;  3CCJ T;  2QXF A;  2R57 A;  4PKC C;  4M78 A;  3UWN A;  2GCX A;  3VUB A;  4M7D D;  2OTJ A;  2KAF A;  1M9S A;  5LJ5 j;  1QVF S;  1YCY A;  4A4F A;  2R5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...