4PJOE

Minimal u1 snrnp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
MVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 77
sequence length 77
chains with identical sequence S, e, s
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoE00
3BDUA 3L2ZA 4HA8A 4M75B 1MGQA 3V8JA 5GAN4 4PJOD 2EJGA 4M77D 4J6WA 3FB9A 4XTXA 5GMKh 5GMKl 3JB9F 1N9SA 4F7UE 5GAOr 4M7DE 1WQWA 3BY7A 1LNXA 2YLBA 4F7UA 5CAIA 4JRKA 4M7DA 4F7UG 4M7DG 3QHSA 4OP0A 4PJOE 4M77E 1KQ2A 4M75F 4RCCA 4M78C 5LJ3h 4EMKC 3JB9D 4XU0A 4V2SA 3INZA 3L1AA 1WPYA 4M7AE 2K57A 2RD1A 3SWNA 5GAMf 3V7CA 3JCMP 2DEQA 4JLIA 1X01A 3RESA 3RKWA 5GMKi 2YHTA 5LJ5g 4HT9A 4M7AA 4M7AG 4XQ3A 1WQ7A 5GAN6 2DJZA 2DTIA 5GMKe 4DQ2A 2DXUA 3EFSA 2FYKA 5GAMh 3JB9G 2DTHA 3M4GA 2RM4A 1U1SA 4M75E 4XU2A 4XU3A 3JCMf 4C8QB 4J6XA 4NL2A 3RKYA 4M75A 1I81A 2FB7A 4M78B 4M75G 4EMKB 4XTYA 2Y90A 2CGHA 1B34B 4C92C 5LJ5h 3HFNA 1I4K1 4XTVA 3JCMh 2E1HA 5LJ3f 3JCMb 4M7AD 3JB9H 1HXDA 4C8QF 5GMKj 5GAOm 5GAN5 5GAMe 2DZCA 4M78F 3PGGA 4M7DC 2HNIA 1H641 4PJOC 3FIFA 3AHUA 4MMKA 4A53A 4C8QD 4M77C 4M7DB 3HFOA 2ZGWA 3JB9I 2DXTA 1U1TA 4JUVA 4M75D 4N0AC 3SWNC 2RA2A 2I2LA 3VU3C 4C92B 3EFRA 3JCMe 1HK9A 3JCMJ 1JBMA 4C8QE 5GAN2 5GAOl 4HT8A 3GIBA 4QVCA 5LJ5f 4X9DA 4EMGA 4C8QA 4QVDA 4M78E 5GAMj 3BW1A 4C8QG 5GAMd 5GAN8 5LJ3e 4PNOA 4M78A 4EMKA 5GANg 2VXEA 1M8VA 3QO3A 4M78G 1B34A 4PJOB 1BIAA 4EMHA 3JCMX 4M77B 2RB6A 5GAOq 2EJFA 2E65A 3SWNB 4J6YA 4A54A 5GANf 5I21A 4J5YA 1LJOA 4XTWA 3JCMc 3JCMd 2E41A 3V8LA 3BFMA 1TH7A 3JCMQ 3V7SA 1KQ1A 3JB9J 1LOJA 3RERA 3QUIA 4RCBA 5GAMg 5LJ3j 5GANh 4NL3A 4M77F 1Y96B 1I5LA 5DY9A 5LJ3d 5GAOp 4X9CA 4M78D 5LJ5e 1D3BB 2DVEA 2YLCA 4C92A 3JCMV 4M7AC 2JN0A 2VXFA 5GAN7 2DZ9A 4MMLA 4NOYA 3QSUA 5GAN3 3JCMW 3RUXA 4XTZA 1JRIA 2EJ9A 2EWNA 3FJPA 3V7RA 4XU1A 4F7UB 1M5Q1 4JRIA 4C8QC 4XTUA 3RIRA 4C92F 3RKXA 3HSBA 2EAYA 5GANe 4M75C 2DTOA 4PJOA 4PJOG 4Y91A 2VC8A 4M77A 4WF2A 4M77G 5LJ5j 2DKGA 4N0AA 5LJ5d 4M7AB 1N9RA 2QTXA 2E10A 3JCMg 4C92D 4F7UF 5GMKm 5GAOn 2E64A 4M7DF 1YCYA 4PJOF 1WNLA 1BIBA 1I8FA 3SB2A 1Y96A 4C92E 5LJ3g 4M7DD 5GANj 1D3BA 4M7AF 4C92G 5GANd 3V8KA
chains in the Genus database with same CATH superfamily
4QVZA 1IREB 1IO6A 2O4XA 2FPFA 4Q5WA 4PLLA 3RNJA 3X25B 3NMZC 3RKWA 4DOVA 2BZYA 4RTWA 4JS4A 2DK3A 1EZZB 2E5KA 1SSHA 4AMCA 1VQ9T 1MMNA 2DLPA 4YTLA 3ME9A 1BCOA 1LPLA 2IPOB 2CDTA 1OEBA 2Y4YA 2CZ0B 4BD3A 2E1HA 1KHIA 2DXCA 2F5TX 3GF5A 3CC2A 3LLRA 1HXDA 2LRQA 1WIEA 1PSEA 5KYYA 1WHLA 3TSWA 1ZBXA 4ZN1A 2KAFA 4HVWA 4A53A 3U23A 3HRUA 4DA4A 3G6EA 3OYHA 1U1TA 4C92B 3C4SA 1D1BA 2ESWA 1PD1A 4X9DA 2LJ1A 3D7SB 1VA7A 2LNVA 2QEXQ 4E6RA 2VWFA 1H92A 4MDWA 2EGAA 4C0GA 2E65A 1VQLA 1D0YA 1U5SA 4BY6C 2CP5A 1NYGA 4MDXA 5HCKA 3L42A 1K8AC 1AEYA 1WXUA 2JUFA 2QGFB 3CCUA 3QXEB 2XDPA 3M54A 2DPPB 2RQTA 5LJ5e 5DLQE 1KSWA 2X4WA 3H8ZA 1EX4A 1V76A 3HSBA 3RIRA 1XNIA 4WF2A 5FRMA 2VGMA 1TS9A 3HKSA 4M7AB 2EQMA 3OYYA 4C92D 3CC7Q 1XOVA 1BIBA 3C12A 3MJXA 3CCEQ 1PWTA 3OW2S 5ECAA 4HA8A 2MMPA 5GAN4 4J6WA 1YIJQ 1YJWA 1WQWA 1G3WA 3GPLA 1QVFP 4F7UG 1X27A 4M7DG 1K4US 2KY9A 4FYYB 1KQSA 1VQPQ 2K57A 3PVQA 5GMKi 2RJEA 3GBQA 1VQMQ 5GAMh 3JB9G 2GNCA 1XQHA 1VQ4A 4E7SA 2ZPEB 4J6XA 2JMCA 5A0DA 4M75A 1M3BA 3JAME 1SHGA 5CIUA 2VASA 3BDLA 3JV3A 1WGSA 4M7AD 1TUCA 3EGDB 2COWA 2K4YA 3VS3A 2RHZA 3DLLA 3VS5A 3OYKA 1YJNQ 3E9FA 1H8KA 1K9AA 1OI1A 2LCSA 3VU3C 1M2VB 3REAB 3VUZA 2JM9A 4QVDA 2X4YA 1QWEA 1WFWA 1BIAA 1YITA 1Q86U 1IGQA 2YWWA 2ZCFB 1LJOA 2NUTA 4JZ4A 2KSSA 3MP6A 2F5KA 2RHIA 2V8IA 5GAOp 2KK4A 4FYVB 1QVFS 5FW9A 3TCJA 3QSUA 2EJ9A 2RQWA 2DRMA 1WI7A 2DL8A 2OTLT 1VQ8T 5LJ5j 3P8BB 3CBMA 2K5FA 2BZXA 1M90U 4PJNA 3CD6Q 4MZMA 4QQGA 4PFZA 3PMIA 2JT4A 2DFUA 3CPFA 3I9QA 2J6OA 2QAZA 3CCRQ 4CC3A 1X2QA 4AFSC 3G4SQ 2QA4T 3FC3A 4IURA 5A0GA 3VS0A 4V2SA 3QPHA 2E12A 3I56T 1UDLA 4BE1A 2W0ZA 1TTHB 3C95A 2EQIA 2D6FA 4DQ2A 2RM4A 2YXYA 3M9QA 3SFMA 4KH1B 1B7TA 4N4HA 4CI0C 2RI3A 4AFZC 1OPKA 4KBMB 1UTIA 4JJNK 1IB8A 2XU8A 3QKJA 4C8QF 5GAOm 3OYMA 2L8DA 2C0OA 5L23A 3PIOA 3CMAQ 2KYMA 3PT9A 2G6FX 4OB3B 1W4SA 2XKOC 3EFRA 3OS0A 1ZA1B 1MUZA 4QVCA 1YHQT 4HVVA 4M78E 2DBMA 3EHQA 1UFFA 2W10A 2AKKA 4PJOB 1M4ZA 4RTYA 1OULA 4Y28E 3I55T 3L2VA 2GGRA 3META 4CRIA 1R0CB 2M51A 3V8LA 3EGXA 2QEXA 3VKIA 2AIRB 4F14A 1X6GA 4OMPA 2MF2A 1I07A 4A4HA 1YN8A 1M3AA 4IUUA 5FRNA 2JN0A 4Y92A 1K73C 2B8AA 2NUPA 1T3SA 1D09B 2F1LA 3P8HA 2YRCA 2F2WA 3OYGA 5D6XA 2R58A 4Y91A 3OYDA 2BE7D 5CK9A 2QASA 4PJJA 1C1AA 1YCYA 2CYZB 3VRZA 1WNLA 2EYQA 4C92E 3LWIA 3CC7A 4J9HA 3V8KA 4HKEA 4PJOD 4KGVB 2IIMA 5A2QE 4FYXB 2GBQA 1JU5C 3CCEA 4IUTA 4XU0A 2HBPA 1YIJA 3SWNA 1QCNA 1ZSZC 3OA6A 3X28B 1WHGA 4JJDA 2KNBB 2KRMA 2RQVA 2DTHA 1N27A 1VQPA 1ZUUA 3DKMA 3OYCA 3S6WA 1Q95G 2RHUA 1VQMA 2QQBA 3MEUA 1K9MC 3VRYA 2JNGA 2LX9A 4RTUA 1N8RR 1KJWA 5IXBA 2QA4A 3QWXX 5KYUA 1M1FA 4RTTA 4J7FA 2QQAA 4ZTJA 1SPKA 4FT2A 2DE0X 1OZ3A 1ZUKA 1KK7A 2I2LA 3MEWA 4CC2A 1KG1A 1MMGA 1NLPC 5GAMd 5GANg 1XJWB 2FG0A 2RMOA 2LNHB 3JCMX 3FEOA 4EPCA 4XTWA 4LE9A 3VS1A 3NHNA 1U8RA 4D6WA 5LJ3d 2CH4W 1N6AA 2YLCA 1KFZA 3FDRA 1KC8C 1MNDA 1YP5A 2I0NA 2CP7A 2SEMA 5CR2A 2PQWA 3JSCA 3CXCP 2KI7A 3CCVQ 2RI5A 3EFOA 1RADB 1QKWA 9ATCB 4F7UF 4BE2A 4M7DF 1U06A 4A4FA 4IIOA 2J6FA 2PNIA 2EYWA 5HK3A 3JB9F 4J9DA 2DD5A 3OYJA 1FMKA 5HK0A 3TVTA 1BI0A 2NUZA 1PRLC 4LNPA 5I11A 2PZ1A 2HL3A 3LH5A 2WSCE 1JJ2P 1M8MA 1H3HA 2QDYB 3G4SA 1E7OA 1WZOA 1WHMA 3UWNA 2DTIA 2GF7A 2FYKA 1T0HA 3MEVA 1U1SA 1GXIE 4E7LA 2P0KA 2QQSA 1OX9A 2WSEE 4PFOA 3PIPA 1RLQC 4OF1A 2KBTA 2M0YA 2DZCA 2ABLA 1BCMA 2YT6A 3G6ET 2NYSA 3FJ5A 3S3NA 2DXTA 3A8HB 1IRXA 2D8HA 5GJWB 3CXCS 3HRTA 3NTIA 5GAOl 3GIBA 4OMOA 4C8QA 5HKCA 4IKFA 3J7AF 1M8VA 2KRNA 2EIFA 1RAAB 1M1KU 1VQLT 2BUDA 3SWNB 2O2OA 1YWPA 3EHRA 1V29B 4C0DB 1TXQA 4Z02A 4X9CA 3I5RA 1I0CA 2PVOB 2KVQG 1D3BB 2H3EB 1SG5A 2HZYA 3M0SA 2H3JA 2FPDA 2EYXA 4NOYA 3KBGA 1KHCA 1I5LA 2O31A 2X9HA 3SD4A 4XTUA 4JS5A 3CCQT 3CPWP 3RBBB 2ZZDA 1HYOA 1WJQA 5GAOn 1WJRA 1UGPB 3OW2A 4E7HA 3NTKA 2V26A 5GJVB 1XTDA 1WHKA 1VQKQ 3L2ZA 3HPWA 5D6YA 4AFQC 5I2MA 1YJWT 2A37A 4L6V5 3ER0A 4PJOE 1Z9ZA 2MWOA 3G7ZA 4RCCA 2M16A 2RJDA 3CMEQ 4LDWA 1WPYA 3CCLQ 2OTJQ 4BI8B 4HCZA 4K11A 1X6BA 3RESA 2YHTA 4M7AG 2HD0A 1PRMC 3S3OA 5GMKe 1ZLMA 1VQ4T 3LW5E 4M75E 4XU2A 1RAEB 4ELZC 2CZ1B 4M78B 1Q86R 2DNUA 3QDFA 3HFNA 2EQJA 3A5ZB 3OS5A 2E3IA 4O5VA 4QQ6A 1JQQA 1QVGS 3FIFA 4IIMA 2RQRA 4O6JA 4JUVA 1CSKA 3JCMe 3R6NA 3ZFJA 4KH0B 1JBMA 3KXTA 1UGVA 4QQDA 2KYBA 5FWCA 1M9SA 1GFDA 1NEGA 1UGQB 1B34A 3TU4K 1JEGA 1M90R 2LCLA 1YITT 1ZSZA 3OYIA 1GBRA 2C0IA 2EJFA 2FRWA 1VQOQ 1R8OB 2EKHA 3CEYA 2XDBA 1KQ1A 2LP5A 1QVFA 4BDZA 2XIDA 2PVDB 1VIEA 2DYIA 3E2UA 1YI2Q 1Q82U 1N8RC 2YRDA 4M78D 3JCMV 2B86A 2VXFA 1FX7A 3FJPA 5GAMg 2NLUA 3OMGA 3MO8A 5EG2A 3X26B 2DTOA 3OYLA 5LJ5d 2CP3A 2E10A 2F2XA 2EGEA 3CCVA 1I8FA 3A8MB 1EFNA 2MI6A 5LJ3g 1AWJA 3OYFA 4B9WA 1MNEA 2KT8A 1A0NB 1YNZA 2DD4A 4F7UA 4M7DA 3QHSA 3CCQA 4OB2B 1ABOA 4PK4A 5GAMf 2JTMA 2QXFA 4OGEA 5GAN6 2DL4A 1OU8A 2JTEA 4J9EA 1KD1U 1G2BA 2BIVA 4EMKB 1ZX6A 2Y90A 4GY5A 4XTVA 1ZUYA 5LJ3f 3J80E 1Q7YU 1ARKA 5GMKj 2L3SA 2DEUA 3F70A 3MEAA 3PFSA 2VB6A 3HL8A 4C8QD 2FVUA 1CKBA 3FRNA 3M53A 4FYWB 3QYHB 2C06A 1NEBA 3BW1A 2RQUA 4PNOA 5KYXA 2HQXA 1VOMA 4BUGA 2VVKA 4M77B 1NPPA 2E3HA 4AG2C 5I21A 2RJFA 5LL6S 2QEXT 4NL3A 2EGCA 3QZ5B 3EG9B 1ZHIA 2HQEA 2X4XA 3KUFA 2HEQA 2QQRA 2DMOA 1PG5B 3VUBA 2O4XB 5CO7A 2C0TA 2EAYA 2X3XD 2HSEB 5GANe 4PJOG 1UEBA 2VC8A 3ZBDA 2ZPFB 2LQKA 2FEIA 1WDXA 5GMKm 4LDXA 3CCMQ 1E6HA 4ESRA 1TWBA 3TREA 3CC4Q 3WXMB 1SRLA 3CC7T 2ZPBB 3L2UA 5FROA 4J9GA 5I2SA 1AZEA 4OB1B 1VQ6Q 4M77D 2AHJB 1N9SA 2RO0A 1M2OA 3CCET 3NTHA 3GLXA 1NJIC 5CQXA 5KYYB 2JM8A 1YIJT 2JMAA 1BK2A 3V7CA 3QWYA 1O75A 3MHXA 1VUBA 1VQPT 3MP8A 3CCLA 2MPXC 2OTJA 4RG2A 2EYYA 4XU3A 2DF6A 2L3PA 2MAMA 1KQSP 2P0PA 4FIBA 4DEXA 1VQMT 4C92C 1P92A 4X1VA 3M0RA 1QVPA 1T0JA 1Y07A 3L2QA 1NE8A 2RNAA 2ENMA 4J9BA 1S72Q 3LGLA 1G3TA 2JW4A 4A4EA 4R55A 1QQJA 1K73U 2HBWA 3C0CA 1HK9A 1YJNT 3L2WA 3QIIA 4C0FA 2LVMA 3JCMc 2OI3A 2QDLA 2E41A 1Q86C 3BFMA 2MK5A 1QP2A 1RLPC 3SHWA 1K0SA 4DBHA 1VQOA 2ZPGB 2HCKA 2DVEA 4M7AC 4BI4A 4N4IA 2H8HA 5CKBA 3LWHA 3G71Q 3VS7A 1PHTA 1TG0A 4MZPA 5GAN7 3RMSA 1YI2A 2XHCA 1QCOA 4XU1A 2L89A 3MP1A 2IG0A 1FXXA 1WHHA 5L8RE 2QTXA 1BB9A 4L5GA 1KQSS 1M90C 5HY6A 3REBB 4KGZB 3CCJQ 1Y96A 1FYNA 4M7DD 5GANj 2EQUA 1K9MU 4M7AF 3CD6T 4HCKA 4M75B 4LDYA 4XTXA 5GMKh 2EVRA 2A0FB 1SF9A 1C6VX 2D1XA 1GRIA 3C94A 1KQ2A 4Z88A 3CCRT 1M1GA 3JB9D 3G4ST 5LJ5g 1X01A 4ZGJB 3UA7A 2QG9B 1M3CA 4VUBA 3ULRB 3HRSA 2RJCA 2YUQA 2OAUA 5FU6B 3LGFA 5M9OA 4BE0A 2IVWA 1SHFA 3QZ9B 1M1KR 1AOJA 1OZ2A 3TSZA 2HSPA 2CGHA 3JCMh 2YDLA 3JB9H 4ZN3A 2WACA 3QJ6A 1MMAA 2NUTB 1UJYA 2Y4XA 5KYWA 2P0QA 2KQWA 1OOTA 4FW2A 1KC8U 2DM1A 4M75D 2M0OA 1NLOC 3CMAT 1JXMA 4C8QE 5LJ5f 3A8GB 4EMGA 1QWFA 4AG1C 1W2BA 1ABQA 2K7AA 4GBQA 4E7KA 2DJQA 3QO3A 4LXCA 5KCHA 1VQ5Q 2GFAA 4Z89A 1OPLA 5IXFA 3EH2A 3H41A 1NBEB 1TOVA 1BYMA 4LDUA 4JRPA 4A63B 2CP6A 3VS4A 3OSSC 5J39A 1RAHB 4KUIA 2RK2A 1D0ZA 2DETA 2KEAA 3VV0A 1YJNA 1S1NA 2DZ9A 1UE9A 1I5OB 2JXBA 2RF0A 1BKBA 2J6KA 1N5ZA 2OAWA 2XD0A 2A36A 2COZA 1UGRB 1SKUB 1SEMA 3DLMA 4BI3A 1VQ7Q 4PFPA 3SB2A 2BTTA 4IUQA 3CC2Q 5FLXE 4MZTA 1Y7XA 3CCMA 2EPDA 2XDDA 3A1PA 4BB7A 2EJGA 5GMKl 5GAOr 4M77E 4NS5A 3OQ5A 2YUOA 2RN8A 1VQ6A 3INZA 4FL6A 1X75C 2YUNA 2DEQA 2JVVA 4JLIA 4C5GA 2F2VA 4XK8E 2CT3A 2CREA 3EG0A 3X20B 1YBYA 3CD6A 1I81A 2J06A 3QBYA 2KRSA 1K1ZA 2ROTA 4LN2A 3ZL7C 2F69A 3CCUQ 1QVGA 1TUDA 3CCRA 2HNIA 3EGXB 1Q82R 1R77A 4PJOC 2DL3A 3WVEB 1YJ9Q 2M1HA 1I1JA 1AWWA 4PJLA 3GNFB 2K3YA 1ACMB 5IHNA 1S72A 2XMFA 5IHKA 2NUPB 1ZQ1A 4M78G 3UT1A 2KXDA 1GCPA 2CSIA 2E70A 2YUPA 3H9NA 1AD5A 3WVDB 4BACA 3QUIA 4M4ZA 5GANh 1Q81U 5KYNA 3M56A 4C92A 2FRYA 2AK5A 3CMAA 2ZAEA 3Q1JA 4EIKA 2CZ7B 2ED1A 3G71A 3HTRA 3CCSQ 1D1AA 2RK1A 3PTAA 2X35A 1KD1R 3CCVT 3CBOA 3QYGB 2CH4A 1B07A 1PCXA 2HKQB 4F16A 4C92G 1Q7YR 3V8JA 3OYBA 3CCJA 2LJ3A 4F7UE 4M7DE 1JJ2S 1K0XA 2VGNA 4FCYA 2D9TA 2YLBA 3M55A 4JRKA 2GTOA 3UPUA 4OP0A 3H0IA 1UG1A 1JXOA 4DBRA 4QKUA 5KYUB 1ZA2B 5CKDA 1VQ9Q 2GTJA 5IT9E 4M7AA 1OYXA 3PMTA 5IN1A 4JJBA 2EQKA 3EGUA 3A8LB 2QYZA 2HL5C 3OYEA 2LC4A 2PU9B 4OMQA 2COYA 4NL2A 3RKYA 4AT1B 4CC7A 1TU0B 5KCOA 2JS2A 4HVUA 1AWOA 2XK0A 3PGGA 4KUDK 1N8RU 2EW3A 2CUBA 3AHUA 3MPUB 3IQLA 3HFOA 4PJMA 4ATOA 2RA2A 1RL2A 1NYFA 1G83A 2V8JA 4RUGA 5CVIA 5I22A 2J05A 3MCAB 3J81E 3EFOB 4RKUE 2RB6A 2FZGB 5CCAA 1NPRA 2L3QA 3EGDA 1K8AU 4GLMA 3JCMd 1M1KC 3OS2A 1VQ5A 1RI0A 1LVKA 1HJDA 1J3TA 3M59A 2FPEA 1M2VA 2LQ8A 1UECA 3CPWS 4MMLA 4L59A 2DXBA 1Y0MA 4XTZA 3I5SA 1T3LA 5FWBA 3RKXA 4ANJA 4ZNXA 4M77G 1BI1A 1GBQA 2DKGA 4N4GA 4ZTFA 2O9VA 4LUEA 2Z0WA 1D1CA 2D8JA 2L0AA 2SRCA 4OMNA 1AZGB 1Y57A 1OQKA 7AT1B 2PTKA 3OB9A 1VQ7A 3M0UA 2DX1A 3CBPA 3UF4A 1TSFA 2JTFA 2ZPHB 3OW2P 1VQKT 5C6SA 3L2RA 3OYNA 3L1AA 1K73R 2DA9A 3N5BB 1AHJB 3OMCA 1GCQC 2DJZA 3CMET 2KT1A 3CCLT 2OTJT 2DAQA 4JRQA 1WLPB 4X34A 2VKNA 4LUDA 1CKAA 4C8QB 1B3QA 4J9CA 1GFCA 1G3SA 4XTYA 1H3ZA 1I4K1 2LQNA 2LX7A 2K3XA 3JCMb 2DO3A 2QTVA 4ME7A 4PL6A 2A3LA 2BE9B 5J3BA 2ZGWA 3R6OA 2JS0A 3SWNC 1SRMA 2K3BA 2M02A 4J9FA 4C0DC 2MCNA 1QLYA 2QI2A 3G1JA 2E6ZA 2KGTA 2MOXA 1YJ9A 3M4YA 2HQHA 2FL7A 4J83A 2CT4A 2FZKB 2LJ0A 5J26A 2AZVA 3VYGA 1TH7A 5AYFA 2LTOA 3RERA 1K9MR 4ORZA 5DY9A 1VQOT 2LT4A 4C5IA 3A8OB 1Q82C 4A4KA 2OTLQ 3PNWC 1VIFA 1VQ8Q 3GNGA 2RPNA 3HP9A 1YI2T 5GAN3 5FU7B 2PUKB 1NJIU 5KE2A 4D8DA 3CQTA 3V7RA 5GAN5 3OBYA 1RABB 5IAYA 5D7UA 4PJOA 4B9XA 1HD3A 4JLGA 2E6NA 2E64A 3LH0A 2JOYA 1OX8A 3CCSA 3VS6A 1PSFA 4KRTA 2MIOA 2E4HA 1QCFA 2RHXA 1AT1B 5GANd 2QA4Q 3M5AA 3BDUA 5DM7R 1RI9A 2AKLA 2VUBA 1OU9A 1IHWA 2QGGA 3EG1A 2R5MA 3BY7A 3I56Q 2LDMA 1UHFA 3KFVA 1O9SA 1U3OA 4M78C 5LJ3h 1KC8R 2MWPA 4FM4B 4RTXA 3JCMP 2A08A 1AVZC 1IGUA 2DXUA 3DB3A 4GLKA 1VQ9A 1X6OA 4LD6A 2CKKA 1BU1A 1KD1C 4M75G 1B34B 2QK0A 1ZSZB 1VQKA 2V8KA 1Q7YC 3FLGA 2CSQA 1MV3A 2KDSA 4M78F 1VQNQ 1IZ6A 1YHQQ 4MMKA 1RACB 2XI9A 4JDSA 2NWMA 1NZ9A 2PVGB 3CMEA 2KMTA 2KROA 3DB4A 3SDZA 5GAN2 4HT8A 1BI3A 2K79A 3E9GA 4P5NA 3I55Q 1D0XA 1VYUA 2GCXA 3NPFA 3S3MA 3QG1A 3M0QA 1PM3A 1WA7A 1PKTA 1HSQA 3TEEA 1SSFA 2FHDA 4RCBA 1R0BG 1EIFA 3EG2A 4C5HA 3THKA 4J7IA 3OSVA 2DL5A 3H6ZA 4F7UB 4M7DB 1M5Q1 2E5QA 3RMQA 4C92F 2CS7A 4C8QC 4ZGDB 4J8OA 4F04B 4WTOB 5A0LA 1VYTA 1N9RA 3JCMg 4XAXB 1V1CA 3QDRB 4E2FB 1ZSGA 3GP8A 1KIKA 4LD9K 2ED0A 3CCMT 1UUEA 1MGQA 2O88A 3CC4T 3I35A 1UHCA 5C0MA 2DL7A 2X51A 3EAEA 2HMAA 4AFUC 4DOWA 2DYBA 2O9SA 2EKOA 4J9IA 4EMKC 1VQ6T 2LCCA 4TVRA 2RD1A 5IH2A 1UGSB 4HT9A 1WQ7A 2QQ9A 4IUPA 4RG8A 2P4RA 4DBFA 1VQNT 5DLOA 2KXCA 1G5VA 2K2MA 3JCMf 2XG8D 1PKSA 5KYXB 2LT1A 3QJYA 6AT1B 1F1BB 5CKHA 3PE0A 2DRKA 3AT1B 2VYTA 5FU7C 2A7YA 4C0ZA 1Q81R 3OS1A 4FSSA 1G8XA 1VYVA 4M77C 4N0AC 3UATA 1Z9QA 4C5EA 1RAIB 3JCMJ 2RH2A 1S72T 4HCBA 1DJ7B 1WXBA 5GAN8 2BKDN 2DERA 2R57A 1G3YA 1LCKA 2FO0A 2RHYA 2P84A 5IHIA 2X3WD 4FT4A 4ELYC 2HAXA 4J6YA 1GCQA 2CP0A 1WJSA 2ZPIB 4RMOA 3JB9J 3CXCA 3M58A 4IUVA 4M77F 1IHVA 2HKNA 1OV3A 1JB0E 3MKDA 3TQ7P 4OMMA 3RUXA 1JRIA 1MMDA 4JRIA 3G71T 4RTZA 2OTLA 4KULA 4PLIA 1VQ8A 3M0TA 4JPBW 4D8KA 2A28A 4RTVA 3LYIA 1JJ2A 1D3BA 1M30A 2AT1B 3CCJT 5EC7A 4OB0B 3OYAA 1LNXA 1K76A 1M27C 5CAIA 4LDVA 2OX7A 3VJPA 3O5ZA 4M7AE 2KE9A 3I56A 4PKCC 4E7ZA 4XQ3A 4OMLA 3EH1A 2DBKA 3VYHB 3EFSA 1W70A 1WYXA 2FB7A 5D6WA 2D0QB 1YWOA 5LJ5h 1MV0B 2DILA 3CC4A 1K8AR 3NGPA 3E1SA 1RAFB 2GFUA 1GL5A 1E6GA 3G6EQ 5GAMe 4R0KA 4M7DC 2LQWA 2GQIA 2ATCB 1C0MA 3ASKA 3ZEHA 3GOXA 1VQNA 2MYSA 1MHNA 3PVLA 1YHQA 3X24B 2KR3A 1VQLQ 2X4JA 5LJ3e 4M78A 2EBPA 4JZ3A 3EG3A 1YFNA 1QP3A 2DIGA 4A4GA 3I55A 4F17A 2CUDA 3E19A 5GANf 4A54A 1VQ5T 3JCMQ 1W2BP 2K9GA 2JJ9A 3V7SA 1LOJA 2BZ8A 4UC4A 1WX6A 5KE3A 1Y96B 4DEYA 4OMFB 3CPWA 3SEMA 2OJ2A 3A98A 3CCQQ 2K6DA 2L5QA 5AT1B 4QT7A 5CQYA 2YSQA 4FSXA 4M75C 3OBWA 2L3RA 1FWZA 1BI2A 2DVJA 2AZSA 2M9UA 4PJOF 3P8DA 4E47A 2XICA 1YJWQ 1VQ7T 1RAGB 3FB9A 5FU6C 4BY6B 3CC2T 2V1QA 2P4TA 4KT0E 1Y71A 4WCIA 4FW1A 4M75F 4QW2A 5KYWB 1FMWA 3UA6A 1NG2A 2EYZA 2O01E 1VQ4Q 4HXJA 4B6MA 3LX7A 4II1A 1W6XA 2J7IA 2YRVA 3OY9A 4FU6A 2WSFE 3URGA 8AT1B 1TUGB 3M4GA 2K2VA 4ZGEB 4BDYA 1PNJA 2LMJA 1WHJA 3O8VA 1W2BS 2G3RA 2D0NA 1UB4A 3BE3A 3T9NA 1H641 4Z8AA 3UDCA 4DBQA 1X43A 2HDAA 2VV5A 5CKEA 8ATCB 3CCUT 3H0HA 3JB9I 4KGXB 4EDUA 3VS2A 2PUOB 1QVGP 1NJIR 2GQVA 1YITQ 1YCSB 3RDVA 5GAMj 4C8QG 1YJ9T 1X69A 1QW1A 2EFIA 4EMKA 2K5IA 2VXEA 3M0PA 4R56A 4EMHA 3NFCA 1BBZA 2FZCB 3HHTB 5GAOq 1WXTA 2K5LA 5KH6A 2ROLA 4J5YA 2L2PA 4E7JA 2V1RA 4E7IA 5LJ3j 1FMVA 3H0FA 2CP2A 3JRZA 1W1FA 2LZ6B 1Q81C 1AWXA 5CKFA 4JJCA 1QKXA 2CZ6B 1IXDA 3JCMW 2EWNA 4CC4B 4OGCA 2R5AA 4M77A 2DIQA 2ECZA 4N0AA 1UJ0A 3RR6A 1PC0A 1PD0A 1NM7A 1RUWA 4OVAA 3CCST 1ZBJA 1QMCA 3EG9A 4HCCA 1JO8A 1X2KA 3M57A 2JZ2A 2RI2A
chains in the Genus database with same CATH topology
3M5AA 3BDUA 4M75B 4QVZA 5DM7R 5HK3A 2VUBA 1IREB 4LDYA 3JB9F 4XTXA 5GMKh 2DD5A 2O4XA 2R5MA 3BY7A 3OYJA 2LDMA 4Q5WA 1O9SA 5HK0A 1BI0A 4PLLA 3C94A 1KQ2A 4M78C 1M1GA 5LJ3h 3CCRT 2WSCE 3JB9D 2MWPA 2QDYB 4FM4B 3X25B 3G4ST 3G4SA 3JCMP 5LJ5g 1X01A 3RKWA 4ZGJB 3UWNA 4DOVA 4VUBA 4JS4A 2DTIA 2GF7A 2DXUA 3DB3A 2FYKA 2DK3A 2RJCA 3HRSA 2OAUA 3MEVA 1U1SA 4GLKA 5FU6B 1VQ9T 1GXIE 3LGFA 4E7LA 1VQ9A 1X6OA 4LD6A 5M9OA 2CKKA 4BE0A 1KD1C 2P0KA 2IVWA 2QQSA 4YTLA 3ME9A 3QZ9B 4M75G 1OZ2A 2CGHA 1B34B 2WSEE 2Y4YA 2CZ0B 3JCMh 4BD3A 2E1HA 1KHIA 2DXCA 2F5TX 3GF5A 3PIPA 3CC2A 4OF1A 3LLRA 3JB9H 1HXDA 2V8KA 1VQKA 4ZN3A 2WACA 3QJ6A 2LRQA 1Q7YC 3FLGA 1PSEA 4M7AC 2DZCA 2KDSA 2Y4XA 4M78F 1ZBXA 4ZN1A 2KAFA 2P0QA 1IZ6A 4MMKA 4A53A 2KQWA 3HRUA 2XI9A 3G6ET 3G6EA 4DA4A 4JDSA 3OYHA 2DXTA 1U1TA 3A8HB 4M75D 3S3NA 1KC8U 1NZ9A 2PVGB 4C92B 3CMEA 2KMTA 3C4SA 2M0OA 3SDZA 3DB4A 3HRTA 3NTIA 3CXCS 3CMAT 4C8QE 5GAN2 5GAOl 4HT8A 3GIBA 1BI3A 5LJ5f 3A8GB 3E9GA 4P5NA 4X9DA 4C8QA 4EMGA 1W2BA 5HKCA 4IKFA 3J7AF 4E7KA 2LNVA 1M8VA 2GCXA 3QO3A 3S3MA 5KCHA 2EIFA 2GFAA 3QG1A 1M1KU 4MDWA 1VQLT 4C0GA 2BUDA 2E65A 1VQLA 3SWNB 4BY6C 1BYMA 4MDXA 3TEEA 3L42A 1SSFA 2FHDA 1K8AC 1V29B 4RCBA 4LDUA 4C0DB 4JRPA 2JUFA 3CCUA 3QXEB 2XDPA 3OSSC 4X9CA 4Z02A 2PVOB 3M54A 1EIFA 2DPPB 2KVQG 2RK2A 1D3BB 4KUIA 5LJ5e 5DLQE 3VV0A 4C5HA 1YJNA 2H3JA 2X4WA 3H8ZA 2DZ9A 4NOYA 3KBGA 4J7IA 1KHCA 3OSVA 5J39A 3H6ZA 4F7UB 4M7DB 1I5LA 3HSBA 1M5Q1 2E5QA 3RMQA 4XTUA 2CS7A 1BKBA 3RIRA 3SD4A 1XNIA 4C92F 4C8QC 4ZGDB 3CCQT 4JS5A 2XD0A 4J8OA 2ZZDA 4WF2A 1UGRB 5FRMA 2VGMA 3HKSA 1WJQA 4M7AB 2EQMA 1N9RA 3OYYA 3DLMA 3JCMg 4C92D 5A0LA 4XAXB 1WJRA 3QDRB 4BI3A 5GAOn 1UGPB 3OW2A 4E7HA 1XOVA 3NTKA 1BIBA 3SB2A 3GP8A 4IUQA 3C12A 1XTDA 4LD9K 5FLXE 4MZTA 1Y7XA 3OW2S 3CCMT 3CCMA 3L2ZA 2MMPA 4HA8A 1MGQA 3HPWA 5GAN4 2XDDA 4BB7A 2EJGA 5D6YA 4J6WA 5GMKl 5I2MA 3CC4T 1YJWT 5C0MA 5GAOr 4L6V5 1YJWA 1WQWA 1G3WA 3EAEA 3ER0A 3GPLA 4DOWA 4PJOE 4F7UG 4M7DG 4M77E 2MWOA 4NS5A 3G7ZA 2EKOA 2KY9A 3OQ5A 4RCCA 2M16A 2RJDA 4EMKC 1KQSA 1VQ6T 1VQ6A 2LCCA 3INZA 4FL6A 4LDWA 1WPYA 4TVRA 2K57A 2RD1A 4HCZA 4BI8B 1X75C 1UGSB 2DEQA 2JVVA 4JLIA 3RESA 5GMKi 4HT9A 2YHTA 4M7AG 4C5GA 2RJEA 1WQ7A 2HD0A 4XK8E 2QQ9A 3S3OA 5GMKe 4IUPA 4RG8A 5GAMh 3JB9G 1VQNT 5DLOA 1G5VA 3CD6T 1XQHA 1VQ4T 1VQ4A 3LW5E 3X20B 4M75E 2ZPEB 1YBYA 4XU2A 3JCMf 4J6XA 4ELZC 5A0DA 2XG8D 2CZ1B 3CD6A 4M75A 1I81A 4M78B 2LT1A 3QJYA 3QBYA 3JAME 3HFNA 5CIUA 3BDLA 2OTJA 5CKHA 2EQJA 3A5ZB 2F69A 3OS5A 1WGSA 1QVGA 4M7AD 2VYTA 2K4YA 5FU7C 2A7YA 2RHZA 3DLLA 4C0ZA 3CCRA 2HNIA 3OYKA 4O5VA 4QQ6A 3OS1A 3E9FA 1QVGS 4PJOC 3FIFA 4M77C 1OI1A 3WVEB 4O6JA 4JUVA 4N0AC 4C5EA 3VU3C 2M1HA 3JCMe 3ZFJA 2RH2A 3GNFB 2K3YA 3JCMJ 1JBMA 3KXTA 3VUZA 1S72T 4HCBA 1S72A 1YJ9A 4QQDA 4QVDA 1DJ7B 1ZQ1A 1M9SA 5GAN8 2X4YA 2BKDN 4M78G 1UGQB 2R57A 3UT1A 1B34A 1G3YA 3TU4K 2LCLA 2RHYA 1BIAA 1YITT 3OYIA 1YITA 1Q86U 2EJFA 4FT4A 4ELYC 2HAXA 2E70A 2ZCFB 4J6YA 1LJOA 1R8OB 3CEYA 2XDBA 1WJSA 2ZPIB 2KSSA 4RMOA 1KQ1A 3WVDB 1QVFA 4BDZA 2XIDA 3CXCA 3JB9J 4BACA 3QUIA 3M58A 3MP6A 5GANh 2F5KA 1Q81U 2PVDB 2RHIA 2V8IA 4IUVA 1VIEA 4M77F 5GAOp 1Q82U 3M56A 1N8RC 1K9MU 2KK4A 4M78D 4C92A 3JCMV 1QVFS 3CMAA 3TCJA 1JB0E 2VXFA 3QSUA 3Q1JA 1FX7A 3RUXA 1JRIA 2EJ9A 3FJPA 2CZ7B 5GAMg 2NLUA 3OMGA 4JRIA 3MO8A 3G71T 5EG2A 3G71A 1NJIU 3X26B 2OTLT 2DTOA 2OTLA 1VQ8T 4KULA 4PLIA 5GANd 1VQ8A 2RK1A 5LJ5j 3P8BB 3OYLA 3CBMA 2K5FA 5LJ5d 1M90U 3PTAA 2X35A 2E10A 2OTJT 3CCVT 3CBOA 3CCVA 4MZMA 3QYGB 4QQGA 3M57A 3PMIA 1I8FA 3A8MB 3CPFA 2MI6A 5LJ3g 3LYIA 1JJ2A 3OYFA 1D3BA 4C92G 3V8JA 4B9WA 3CCJT 3OYBA 3CCJA 4F7UE 4M7DE 1JJ2S 4OB0B 2VGNA 2DD4A 3OYAA 2D9TA 1LNXA 2YLBA 3M55A 4F7UA 4JRKA 5CAIA 4LDVA 3UPUA 3QHSA 4OP0A 2QA4T 3VJPA 3FC3A 4IURA 5A0GA 3CCQA 4OB2B 4V2SA 3QPHA 2E12A 4M7AE 5GAMf 3I56T 5CKDA 3I56A 2JTMA 4PKCC 2QXFA 4OGEA 4BE1A 5IT9E 4M7AA 1OYXA 4XQ3A 5GAN6 3C95A 3PMTA 5IN1A 2EQKA 4M7AF 3VYHB 2D6FA 4DQ2A 3EFSA 1KD1U 3A8LB 2RM4A 3M9QA 3OYEA 2LC4A 2PU9B 3SFMA 1VQPT 4NL2A 3RKYA 2BIVA 2FB7A 4N4HA 5D6WA 4EMKB 2D0QB 4CI0C 2Y90A 5KCOA 2RI3A 4GY5A 5LJ5h 4XTVA 3CC4A 5LJ3f 3E1SA 4KBMB 3J80E 1Q7YU 2GFUA 4JJNK 2XU8A 3QKJA 4C8QF 5GMKj 5GAOm 5GAMe 3OYMA 2XK0A 3PGGA 2L8DA 4KUDK 4M7DC 1N8RU 3F70A 3MEAA 3PIOA 3PFSA 3AHUA 3HL8A 3PT9A 4C8QD 3HFOA 3ASKA 4ATOA 4OB3B 3ZEHA 2RA2A 1W4SA 2XKOC 2FVUA 3EFRA 3GOXA 1VQNA 1RL2A 3OS0A 3FRNA 1MHNA 3M53A 3QYHB 4QVCA 1YHQT 2C06A 1YHQA 3X24B 2V8JA 4M78E 5CVIA 3BW1A 2X4JA 4M7DA 5LJ3e 4PNOA 4M78A 2HQXA 3MCAB 3J81E 1M4ZA 4PJOB 4BUGA 4RKUE 1QP3A 4M77B 4Y28E 2DIGA 1NPPA 2RB6A 4A4GA 3I55A 3I55T 3L2VA 3E19A 5CCAA 1NPRA 5GANf 4A54A 1K8AU 4CRIA 3META 5I21A 2RJFA 3JCMd 1M1KC 1VQ5T 3V8LA 5LL6S 3OS2A 2QEXT 1VQ5A 3JCMQ 3VKIA 3V7SA 2QEXA 1LOJA 1RI0A 4UC4A 4NL3A 5KE3A 1Y96B 3QZ5B 2MF2A 4OMFB 3CPWA 1ZHIA 3M59A 2HQEA 2X4XA 3KUFA 4A4HA 2QQRA 4IUUA 2L5QA 2LQ8A 3VUBA 5FRNA 2JN0A 1K73C 2B8AA 4MMLA 3CPWS 2O4XB 5CO7A 3P8HA 2DXBA 4L59A 4XTZA 3OYGA 5D6XA 3RKXA 2EAYA 5CQYA 2R58A 4FSXA 3OBWA 4M75C 5GANe 4PJOG 4Y91A 1UEBA 2VC8A 3ZBDA 2L3RA 1FWZA 4M77G 1BI1A 2DKGA 3OYDA 2ZPFB 4N4GA 5CK9A 1BI2A 2LQKA 4ZTFA 5GMKm 4LDXA 2M9UA 1YCYA 2CYZB 4PJOF 1WNLA 3P8DA 4E47A 3TREA 3WXMB 2EYQA 2XICA 4C92E 3LWIA 3CC7T 3CC7A 2ZPBB 3L2UA 3OB9A 3V8KA 5FROA 4HKEA 1VQ7T 1VQ7A 4PJOD 5I2SA 4OB1B 5A2QE 4M77D 3FB9A 2AHJB 1N9SA 2RO0A 3CBPA 5FU6C 2JTFA 2ZPHB 4BY6B 3CC2T 3CCET 1VQKT 2P4TA 4KT0E 3CCEA 5C6SA 1Y71A 3NTHA 3GLXA 4M75F 3L2RA 4QW2A 5CQXA 1NJIC 4IUTA 4XU0A 2HBPA 3L1AA 3OYNA 1YIJT 1YIJA 2O01E 3SWNA 3V7CA 3OA6A 3X28B 3LX7A 3N5BB 1AHJB 4II1A 1O75A 3OMCA 2DJZA 2YRVA 3CMET 3MHXA 3OY9A 4FU6A 1VUBA 2WSFE 2DTHA 1N27A 3URGA 3M4GA 3MP8A 2DAQA 3CCLT 4JRQA 4X34A 1VQPA 2K2VA 3CCLA 4ZGEB 4RG2A 3DKMA 4XU3A 4C8QB 3OYCA 2MAMA 3S6WA 4BDYA 2P0PA 2RHUA 4FIBA 1G3SA 4XTYA 1VQMT 1VQMA 4C92C 1H3ZA 1P92A 2QQBA 1I4K1 3MEUA 1K9MC 2K3XA 3O8VA 3JCMb 1QVPA 2JNGA 1W2BS 2LX9A 2DO3A 2G3RA 1Y07A 3L2QA 1UB4A 1NE8A 2QA4A 4ME7A 4PL6A 3T9NA 1H641 2A3LA 3UDCA 1M1FA 4J7FA 2QQAA 4ZTJA 2VV5A 5CKEA 3CCUT 3LGLA 1G3TA 4FT2A 5J3BA 4A4EA 2ZGWA 1OZ3A 3R6OA 3JB9I 3SWNC 4EDUA 4R55A 1K73U 2I2LA 1HK9A 3MEWA 1YJNT 2PUOB 1KG1A 2GQVA 3L2WA 4C0DC 5GAMj 4C8QG 1YJ9T 5GAMd 2E6ZA 2QI2A 1QW1A 2EFIA 4EMKA 2K5IA 3M4YA 2VXEA 3QIIA 5GANg 2FL7A 4J83A 4R56A 4C0FA 4EMHA 3NFCA 3HHTB 3JCMX 3FEOA 5GAOq 2K5LA 5KH6A 2LVMA 4EPCA 4J5YA 4XTWA 3JCMc 5J26A 3VYGA 2E41A 4E7JA 3BFMA 4E7IA 1Q86C 1TH7A 5AYFA 1U8RA 4D6WA 1YI2A 2LTOA 1QP2A 3RERA 5LJ3j 5DY9A 5LJ3d 3JRZA 1VQOT 1VQOA 2LT4A 1N6AA 2ZPGB 2DVEA 2YLCA 3A8OB 4C5IA 1Q81C 4BI4A 4N4IA 5CKBA 3FDRA 3LWHA 1Q82C 5CKFA 4A4KA 1KC8C 3PNWC 1VIFA 3GNGA 5GAN7 4MZPA 2CZ6B 3HP9A 3RMSA 1YI2T 5GAN3 5FU7B 2PUKB 2XHCA 3JCMW 5CR2A 2PQWA 3JSCA 5KE2A 2EWNA 3V7RA 5GAN5 3OBYA 4XU1A 5IAYA 4OGCA 2R5AA 2RI5A 4B9XA 4PJOA 2L89A 3MP1A 4M77A 2DIQA 4JLGA 4N0AA 2IG0A 1FXXA 5L8RE 2QTXA 4F7UF 4BE2A 4M7DF 2E6NA 2E64A 4L5GA 3LH0A 1KQSS 2JOYA 1M90C 3CCST 4OVAA 3CCSA 5HY6A 1PSFA 4A4FA 1Y96A 4HCCA 4M7DD 5GANj 2RHXA 2EQUA 2JZ2A 2RI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDU A;  3L2Z A;  4HA8 A;  4M75 B;  1MGQ A;  3V8J A;  5GAN 4;  4PJO D;  2EJG A;  4M77 D;  4J6W A;  3FB9 A;  4XTX A;  5GMK h;  5GMK l;  3JB9 F;  1N9S A;  4F7U E;  5GAO r;  4M7D E;  1WQW A;  3BY7 A;  1LNX A;  2YLB A;  4F7U A;  5CAI A;  4JRK A;  4M7D A;  4F7U G;  4M7D G;  3QHS A;  4OP0 A;  4PJO E;  4M77 E;  1KQ2 A;  4M75 F;  4RCC A;  4M78 C;  5LJ3 h;  4EMK C;  3JB9 D;  4XU0 A;  4V2S A;  3INZ A;  3L1A A;  1WPY A;  4M7A E;  2K57 A;  2RD1 A;  3SWN A;  5GAM f;  3V7C A;  3JCM P;  2DEQ A;  4JLI A;  1X01 A;  3RES A;  3RKW A;  5GMK i;  2YHT A;  5LJ5 g;  4HT9 A;  4M7A A;  4M7A G;  4XQ3 A;  1WQ7 A;  5GAN 6;  2DJZ A;  2DTI A;  5GMK e;  4DQ2 A;  2DXU A;  3EFS A;  2FYK A;  5GAM h;  3JB9 G;  2DTH A;  3M4G A;  2RM4 A;  1U1S A;  4M75 E;  4XU2 A;  4XU3 A;  3JCM f;  4C8Q B;  4J6X A;  4NL2 A;  3RKY A;  4M75 A;  1I81 A;  2FB7 A;  4M78 B;  4M75 G;  4EMK B;  4XTY A;  2Y90 A;  2CGH A;  1B34 B;  4C92 C;  5LJ5 h;  3HFN A;  1I4K 1;  4XTV A;  3JCM h;  2E1H A;  5LJ3 f;  3JCM b;  4M7A D;  3JB9 H;  1HXD A;  4C8Q F;  5GMK j;  5GAO m;  5GAN 5;  5GAM e;  2DZC A;  4M78 F;  3PGG A;  4M7D C;  2HNI A;  1H64 1;  4PJO C;  3FIF A;  3AHU A;  4MMK A;  4A53 A;  4C8Q D;  4M77 C;  4M7D B;  3HFO A;  2ZGW A;  3JB9 I;  2DXT A;  1U1T A;  4JUV A;  4M75 D;  4N0A C;  3SWN C;  2RA2 A;  2I2L A;  3VU3 C;  4C92 B;  3EFR A;  3JCM e;  1HK9 A;  3JCM J;  1JBM A;  4C8Q E;  5GAN 2;  5GAO l;  4HT8 A;  3GIB A;  4QVC A;  5LJ5 f;  4X9D A;  4EMG A;  4C8Q A;  4QVD A;  4M78 E;  5GAM j;  3BW1 A;  4C8Q G;  5GAM d;  5GAN 8;  5LJ3 e;  4PNO A;  4M78 A;  4EMK A;  5GAN g;  2VXE A;  1M8V A;  3QO3 A;  4M78 G;  1B34 A;  4PJO B;  1BIA A;  4EMH A;  3JCM X;  4M77 B;  2RB6 A;  5GAO q;  2EJF A;  2E65 A;  3SWN B;  4J6Y A;  4A54 A;  5GAN f;  5I21 A;  4J5Y A;  1LJO A;  4XTW A;  3JCM c;  3JCM d;  2E41 A;  3V8L A;  3BFM A;  1TH7 A;  3JCM Q;  3V7S A;  1KQ1 A;  3JB9 J;  1LOJ A;  3RER A;  3QUI A;  4RCB A;  5GAM g;  5LJ3 j;  5GAN h;  4NL3 A;  4M77 F;  1Y96 B;  1I5L A;  5DY9 A;  5LJ3 d;  5GAO p;  4X9C A;  4M78 D;  5LJ5 e;  1D3B B;  2DVE A;  2YLC A;  4C92 A;  3JCM V;  4M7A C;  2JN0 A;  2VXF A;  5GAN 7;  2DZ9 A;  4MML A;  4NOY A;  3QSU A;  5GAN 3;  3JCM W;  3RUX A;  4XTZ A;  1JRI A;  2EJ9 A;  2EWN A;  3FJP A;  3V7R A;  4XU1 A;  4F7U B;  1M5Q 1;  4JRI A;  4C8Q C;  4XTU A;  3RIR A;  4C92 F;  3RKX A;  3HSB A;  2EAY A;  5GAN e;  4M75 C;  2DTO A;  4PJO A;  4PJO G;  4Y91 A;  2VC8 A;  4M77 A;  4WF2 A;  4M77 G;  5LJ5 j;  2DKG A;  4N0A A;  5LJ5 d;  4M7A B;  1N9R A;  2QTX A;  2E10 A;  3JCM g;  4C92 D;  4F7U F;  5GMK m;  5GAO n;  2E64 A;  4M7D F;  1YCY A;  4PJO F;  1WNL A;  1BIB A;  1I8F A;  3SB2 A;  1Y96 A;  4C92 E;  5LJ3 g;  4M7D D;  5GAN j;  1D3B A;  4M7A F;  4C92 G;  5GAN d;  3V8K A; 
#chains in the Genus database with same CATH topology
 4QVZ A;  1IRE B;  1IO6 A;  2O4X A;  2FPF A;  4Q5W A;  4PLL A;  3RNJ A;  3X25 B;  3NMZ C;  3RKW A;  4DOV A;  2BZY A;  4RTW A;  4JS4 A;  2DK3 A;  1EZZ B;  2E5K A;  1SSH A;  4AMC A;  1VQ9 T;  1MMN A;  2DLP A;  4YTL A;  3ME9 A;  1BCO A;  1LPL A;  2IPO B;  2CDT A;  1OEB A;  2Y4Y A;  2CZ0 B;  4BD3 A;  2E1H A;  1KHI A;  2DXC A;  2F5T X;  3GF5 A;  3CC2 A;  3LLR A;  1HXD A;  2LRQ A;  1WIE A;  1PSE A;  5KYY A;  1WHL A;  3TSW A;  1ZBX A;  4ZN1 A;  2KAF A;  4HVW A;  4A53 A;  3U23 A;  3HRU A;  4DA4 A;  3G6E A;  3OYH A;  1U1T A;  4C92 B;  3C4S A;  1D1B A;  2ESW A;  1PD1 A;  4X9D A;  2LJ1 A;  3D7S B;  1VA7 A;  2LNV A;  2QEX Q;  4E6R A;  2VWF A;  1H92 A;  4MDW A;  2EGA A;  4C0G A;  2E65 A;  1VQL A;  1D0Y A;  1U5S A;  4BY6 C;  2CP5 A;  1NYG A;  4MDX A;  5HCK A;  3L42 A;  1K8A C;  1AEY A;  1WXU A;  2JUF A;  2QGF B;  3CCU A;  3QXE B;  2XDP A;  3M54 A;  2DPP B;  2RQT A;  5LJ5 e;  5DLQ E;  1KSW A;  2X4W A;  3H8Z A;  1EX4 A;  1V76 A;  3HSB A;  3RIR A;  1XNI A;  4WF2 A;  5FRM A;  2VGM A;  1TS9 A;  3HKS A;  4M7A B;  2EQM A;  3OYY A;  4C92 D;  3CC7 Q;  1XOV A;  1BIB A;  3C12 A;  3MJX A;  3CCE Q;  1PWT A;  3OW2 S;  5ECA A;  4HA8 A;  2MMP A;  5GAN 4;  4J6W A;  1YIJ Q;  1YJW A;  1WQW A;  1G3W A;  3GPL A;  1QVF P;  4F7U G;  1X27 A;  4M7D G;  1K4U S;  2KY9 A;  4FYY B;  1KQS A;  1VQP Q;  2K57 A;  3PVQ A;  5GMK i;  2RJE A;  3GBQ A;  1VQM Q;  5GAM h;  3JB9 G;  2GNC A;  1XQH A;  1VQ4 A;  4E7S A;  2ZPE B;  4J6X A;  2JMC A;  5A0D A;  4M75 A;  1M3B A;  3JAM E;  1SHG A;  5CIU A;  2VAS A;  3BDL A;  3JV3 A;  1WGS A;  4M7A D;  1TUC A;  3EGD B;  2COW A;  2K4Y A;  3VS3 A;  2RHZ A;  3DLL A;  3VS5 A;  3OYK A;  1YJN Q;  3E9F A;  1H8K A;  1K9A A;  1OI1 A;  2LCS A;  3VU3 C;  1M2V B;  3REA B;  3VUZ A;  2JM9 A;  4QVD A;  2X4Y A;  1QWE A;  1WFW A;  1BIA A;  1YIT A;  1Q86 U;  1IGQ A;  2YWW A;  2ZCF B;  1LJO A;  2NUT A;  4JZ4 A;  2KSS A;  3MP6 A;  2F5K A;  2RHI A;  2V8I A;  5GAO p;  2KK4 A;  4FYV B;  1QVF S;  5FW9 A;  3TCJ A;  3QSU A;  2EJ9 A;  2RQW A;  2DRM A;  1WI7 A;  2DL8 A;  2OTL T;  1VQ8 T;  5LJ5 j;  3P8B B;  3CBM A;  2K5F A;  2BZX A;  1M90 U;  4PJN A;  3CD6 Q;  4MZM A;  4QQG A;  4PFZ A;  3PMI A;  2JT4 A;  2DFU A;  3CPF A;  3I9Q A;  2J6O A;  2QAZ A;  3CCR Q;  4CC3 A;  1X2Q A;  4AFS C;  3G4S Q;  2QA4 T;  3FC3 A;  4IUR A;  5A0G A;  3VS0 A;  4V2S A;  3QPH A;  2E12 A;  3I56 T;  1UDL A;  4BE1 A;  2W0Z A;  1TTH B;  3C95 A;  2EQI A;  2D6F A;  4DQ2 A;  2RM4 A;  2YXY A;  3M9Q A;  3SFM A;  4KH1 B;  1B7T A;  4N4H A;  4CI0 C;  2RI3 A;  4AFZ C;  1OPK A;  4KBM B;  1UTI A;  4JJN K;  1IB8 A;  2XU8 A;  3QKJ A;  4C8Q F;  5GAO m;  3OYM A;  2L8D A;  2C0O A;  5L23 A;  3PIO A;  3CMA Q;  2KYM A;  3PT9 A;  2G6F X;  4OB3 B;  1W4S A;  2XKO C;  3EFR A;  3OS0 A;  1ZA1 B;  1MUZ A;  4QVC A;  1YHQ T;  4HVV A;  4M78 E;  2DBM A;  3EHQ A;  1UFF A;  2W10 A;  2AKK A;  4PJO B;  1M4Z A;  4RTY A;  1OUL A;  4Y28 E;  3I55 T;  3L2V A;  2GGR A;  3MET A;  4CRI A;  1R0C B;  2M51 A;  3V8L A;  3EGX A;  2QEX A;  3VKI A;  2AIR B;  4F14 A;  1X6G A;  4OMP A;  2MF2 A;  1I07 A;  4A4H A;  1YN8 A;  1M3A A;  4IUU A;  5FRN A;  2JN0 A;  4Y92 A;  1K73 C;  2B8A A;  2NUP A;  1T3S A;  1D09 B;  2F1L A;  3P8H A;  2YRC A;  2F2W A;  3OYG A;  5D6X A;  2R58 A;  4Y91 A;  3OYD A;  2BE7 D;  5CK9 A;  2QAS A;  4PJJ A;  1C1A A;  1YCY A;  2CYZ B;  3VRZ A;  1WNL A;  2EYQ A;  4C92 E;  3LWI A;  3CC7 A;  4J9H A;  3V8K A;  4HKE A;  4PJO D;  4KGV B;  2IIM A;  5A2Q E;  4FYX B;  2GBQ A;  1JU5 C;  3CCE A;  4IUT A;  4XU0 A;  2HBP A;  1YIJ A;  3SWN A;  1QCN A;  1ZSZ C;  3OA6 A;  3X28 B;  1WHG A;  4JJD A;  2KNB B;  2KRM A;  2RQV A;  2DTH A;  1N27 A;  1VQP A;  1ZUU A;  3DKM A;  3OYC A;  3S6W A;  1Q95 G;  2RHU A;  1VQM A;  2QQB A;  3MEU A;  1K9M C;  3VRY A;  2JNG A;  2LX9 A;  4RTU A;  1N8R R;  1KJW A;  5IXB A;  2QA4 A;  3QWX X;  5KYU A;  1M1F A;  4RTT A;  4J7F A;  2QQA A;  4ZTJ A;  1SPK A;  4FT2 A;  2DE0 X;  1OZ3 A;  1ZUK A;  1KK7 A;  2I2L A;  3MEW A;  4CC2 A;  1KG1 A;  1MMG A;  1NLP C;  5GAM d;  5GAN g;  1XJW B;  2FG0 A;  2RMO A;  2LNH B;  3JCM X;  3FEO A;  4EPC A;  4XTW A;  4LE9 A;  3VS1 A;  3NHN A;  1U8R A;  4D6W A;  5LJ3 d;  2CH4 W;  1N6A A;  2YLC A;  1KFZ A;  3FDR A;  1KC8 C;  1MND A;  1YP5 A;  2I0N A;  2CP7 A;  2SEM A;  5CR2 A;  2PQW A;  3JSC A;  3CXC P;  2KI7 A;  3CCV Q;  2RI5 A;  3EFO A;  1RAD B;  1QKW A;  9ATC B;  4F7U F;  4BE2 A;  4M7D F;  1U06 A;  4A4F A;  4IIO A;  2J6F A;  2PNI A;  2EYW A;  5HK3 A;  3JB9 F;  4J9D A;  2DD5 A;  3OYJ A;  1FMK A;  5HK0 A;  3TVT A;  1BI0 A;  2NUZ A;  1PRL C;  4LNP A;  5I11 A;  2PZ1 A;  2HL3 A;  3LH5 A;  2WSC E;  1JJ2 P;  1M8M A;  1H3H A;  2QDY B;  3G4S A;  1E7O A;  1WZO A;  1WHM A;  3UWN A;  2DTI A;  2GF7 A;  2FYK A;  1T0H A;  3MEV A;  1U1S A;  1GXI E;  4E7L A;  2P0K A;  2QQS A;  1OX9 A;  2WSE E;  4PFO A;  3PIP A;  1RLQ C;  4OF1 A;  2KBT A;  2M0Y A;  2DZC A;  2ABL A;  1BCM A;  2YT6 A;  3G6E T;  2NYS A;  3FJ5 A;  3S3N A;  2DXT A;  3A8H B;  1IRX A;  2D8H A;  5GJW B;  3CXC S;  3HRT A;  3NTI A;  5GAO l;  3GIB A;  4OMO A;  4C8Q A;  5HKC A;  4IKF A;  3J7A F;  1M8V A;  2KRN A;  2EIF A;  1RAA B;  1M1K U;  1VQL T;  2BUD A;  3SWN B;  2O2O A;  1YWP A;  3EHR A;  1V29 B;  4C0D B;  1TXQ A;  4Z02 A;  4X9C A;  3I5R A;  1I0C A;  2PVO B;  2KVQ G;  1D3B B;  2H3E B;  1SG5 A;  2HZY A;  3M0S A;  2H3J A;  2FPD A;  2EYX A;  4NOY A;  3KBG A;  1KHC A;  1I5L A;  2O31 A;  2X9H A;  3SD4 A;  4XTU A;  4JS5 A;  3CCQ T;  3CPW P;  3RBB B;  2ZZD A;  1HYO A;  1WJQ A;  5GAO n;  1WJR A;  1UGP B;  3OW2 A;  4E7H A;  3NTK A;  2V26 A;  5GJV B;  1XTD A;  1WHK A;  1VQK Q;  3L2Z A;  3HPW A;  5D6Y A;  4AFQ C;  5I2M A;  1YJW T;  2A37 A;  4L6V 5;  3ER0 A;  4PJO E;  1Z9Z A;  2MWO A;  3G7Z A;  4RCC A;  2M16 A;  2RJD A;  3CME Q;  4LDW A;  1WPY A;  3CCL Q;  2OTJ Q;  4BI8 B;  4HCZ A;  4K11 A;  1X6B A;  3RES A;  2YHT A;  4M7A G;  2HD0 A;  1PRM C;  3S3O A;  5GMK e;  1ZLM A;  1VQ4 T;  3LW5 E;  4M75 E;  4XU2 A;  1RAE B;  4ELZ C;  2CZ1 B;  4M78 B;  1Q86 R;  2DNU A;  3QDF A;  3HFN A;  2EQJ A;  3A5Z B;  3OS5 A;  2E3I A;  4O5V A;  4QQ6 A;  1JQQ A;  1QVG S;  3FIF A;  4IIM A;  2RQR A;  4O6J A;  4JUV A;  1CSK A;  3JCM e;  3R6N A;  3ZFJ A;  4KH0 B;  1JBM A;  3KXT A;  1UGV A;  4QQD A;  2KYB A;  5FWC A;  1M9S A;  1GFD A;  1NEG A;  1UGQ B;  1B34 A;  3TU4 K;  1JEG A;  1M90 R;  2LCL A;  1YIT T;  1ZSZ A;  3OYI A;  1GBR A;  2C0I A;  2EJF A;  2FRW A;  1VQO Q;  1R8O B;  2EKH A;  3CEY A;  2XDB A;  1KQ1 A;  2LP5 A;  1QVF A;  4BDZ A;  2XID A;  2PVD B;  1VIE A;  2DYI A;  3E2U A;  1YI2 Q;  1Q82 U;  1N8R C;  2YRD A;  4M78 D;  3JCM V;  2B86 A;  2VXF A;  1FX7 A;  3FJP A;  5GAM g;  2NLU A;  3OMG A;  3MO8 A;  5EG2 A;  3X26 B;  2DTO A;  3OYL A;  5LJ5 d;  2CP3 A;  2E10 A;  2F2X A;  2EGE A;  3CCV A;  1I8F A;  3A8M B;  1EFN A;  2MI6 A;  5LJ3 g;  1AWJ A;  3OYF A;  4B9W A;  1MNE A;  2KT8 A;  1A0N B;  1YNZ A;  2DD4 A;  4F7U A;  4M7D A;  3QHS A;  3CCQ A;  4OB2 B;  1ABO A;  4PK4 A;  5GAM f;  2JTM A;  2QXF A;  4OGE A;  5GAN 6;  2DL4 A;  1OU8 A;  2JTE A;  4J9E A;  1KD1 U;  1G2B A;  2BIV A;  4EMK B;  1ZX6 A;  2Y90 A;  4GY5 A;  4XTV A;  1ZUY A;  5LJ3 f;  3J80 E;  1Q7Y U;  1ARK A;  5GMK j;  2L3S A;  2DEU A;  3F70 A;  3MEA A;  3PFS A;  2VB6 A;  3HL8 A;  4C8Q D;  2FVU A;  1CKB A;  3FRN A;  3M53 A;  4FYW B;  3QYH B;  2C06 A;  1NEB A;  3BW1 A;  2RQU A;  4PNO A;  5KYX A;  2HQX A;  1VOM A;  4BUG A;  2VVK A;  4M77 B;  1NPP A;  2E3H A;  4AG2 C;  5I21 A;  2RJF A;  5LL6 S;  2QEX T;  4NL3 A;  2EGC A;  3QZ5 B;  3EG9 B;  1ZHI A;  2HQE A;  2X4X A;  3KUF A;  2HEQ A;  2QQR A;  2DMO A;  1PG5 B;  3VUB A;  2O4X B;  5CO7 A;  2C0T A;  2EAY A;  2X3X D;  2HSE B;  5GAN e;  4PJO G;  1UEB A;  2VC8 A;  3ZBD A;  2ZPF B;  2LQK A;  2FEI A;  1WDX A;  5GMK m;  4LDX A;  3CCM Q;  1E6H A;  4ESR A;  1TWB A;  3TRE A;  3CC4 Q;  3WXM B;  1SRL A;  3CC7 T;  2ZPB B;  3L2U A;  5FRO A;  4J9G A;  5I2S A;  1AZE A;  4OB1 B;  1VQ6 Q;  4M77 D;  2AHJ B;  1N9S A;  2RO0 A;  1M2O A;  3CCE T;  3NTH A;  3GLX A;  1NJI C;  5CQX A;  5KYY B;  2JM8 A;  1YIJ T;  2JMA A;  1BK2 A;  3V7C A;  3QWY A;  1O75 A;  3MHX A;  1VUB A;  1VQP T;  3MP8 A;  3CCL A;  2MPX C;  2OTJ A;  4RG2 A;  2EYY A;  4XU3 A;  2DF6 A;  2L3P A;  2MAM A;  1KQS P;  2P0P A;  4FIB A;  4DEX A;  1VQM T;  4C92 C;  1P92 A;  4X1V A;  3M0R A;  1QVP A;  1T0J A;  1Y07 A;  3L2Q A;  1NE8 A;  2RNA A;  2ENM A;  4J9B A;  1S72 Q;  3LGL A;  1G3T A;  2JW4 A;  4A4E A;  4R55 A;  1QQJ A;  1K73 U;  2HBW A;  3C0C A;  1HK9 A;  1YJN T;  3L2W A;  3QII A;  4C0F A;  2LVM A;  3JCM c;  2OI3 A;  2QDL A;  2E41 A;  1Q86 C;  3BFM A;  2MK5 A;  1QP2 A;  1RLP C;  3SHW A;  1K0S A;  4DBH A;  1VQO A;  2ZPG B;  2HCK A;  2DVE A;  4M7A C;  4BI4 A;  4N4I A;  2H8H A;  5CKB A;  3LWH A;  3G71 Q;  3VS7 A;  1PHT A;  1TG0 A;  4MZP A;  5GAN 7;  3RMS A;  1YI2 A;  2XHC A;  1QCO A;  4XU1 A;  2L89 A;  3MP1 A;  2IG0 A;  1FXX A;  1WHH A;  5L8R E;  2QTX A;  1BB9 A;  4L5G A;  1KQS S;  1M90 C;  5HY6 A;  3REB B;  4KGZ B;  3CCJ Q;  1Y96 A;  1FYN A;  4M7D D;  5GAN j;  2EQU A;  1K9M U;  4M7A F;  3CD6 T;  4HCK A;  4M75 B;  4LDY A;  4XTX A;  5GMK h;  2EVR A;  2A0F B;  1SF9 A;  1C6V X;  2D1X A;  1GRI A;  3C94 A;  1KQ2 A;  4Z88 A;  3CCR T;  1M1G A;  3JB9 D;  3G4S T;  5LJ5 g;  1X01 A;  4ZGJ B;  3UA7 A;  2QG9 B;  1M3C A;  4VUB A;  3ULR B;  3HRS A;  2RJC A;  2YUQ A;  2OAU A;  5FU6 B;  3LGF A;  5M9O A;  4BE0 A;  2IVW A;  1SHF A;  3QZ9 B;  1M1K R;  1AOJ A;  1OZ2 A;  3TSZ A;  2HSP A;  2CGH A;  3JCM h;  2YDL A;  3JB9 H;  4ZN3 A;  2WAC A;  3QJ6 A;  1MMA A;  2NUT B;  1UJY A;  2Y4X A;  5KYW A;  2P0Q A;  2KQW A;  1OOT A;  4FW2 A;  1KC8 U;  2DM1 A;  4M75 D;  2M0O A;  1NLO C;  3CMA T;  1JXM A;  4C8Q E;  5LJ5 f;  3A8G B;  4EMG A;  1QWF A;  4AG1 C;  1W2B A;  1ABQ A;  2K7A A;  4GBQ A;  4E7K A;  2DJQ A;  3QO3 A;  4LXC A;  5KCH A;  1VQ5 Q;  2GFA A;  4Z89 A;  1OPL A;  5IXF A;  3EH2 A;  3H41 A;  1NBE B;  1TOV A;  1BYM A;  4LDU A;  4JRP A;  4A63 B;  2CP6 A;  3VS4 A;  3OSS C;  5J39 A;  1RAH B;  4KUI A;  2RK2 A;  1D0Z A;  2DET A;  2KEA A;  3VV0 A;  1YJN A;  1S1N A;  2DZ9 A;  1UE9 A;  1I5O B;  2JXB A;  2RF0 A;  1BKB A;  2J6K A;  1N5Z A;  2OAW A;  2XD0 A;  2A36 A;  2COZ A;  1UGR B;  1SKU B;  1SEM A;  3DLM A;  4BI3 A;  1VQ7 Q;  4PFP A;  3SB2 A;  2BTT A;  4IUQ A;  3CC2 Q;  5FLX E;  4MZT A;  1Y7X A;  3CCM A;  2EPD A;  2XDD A;  3A1P A;  4BB7 A;  2EJG A;  5GMK l;  5GAO r;  4M77 E;  4NS5 A;  3OQ5 A;  2YUO A;  2RN8 A;  1VQ6 A;  3INZ A;  4FL6 A;  1X75 C;  2YUN A;  2DEQ A;  2JVV A;  4JLI A;  4C5G A;  2F2V A;  4XK8 E;  2CT3 A;  2CRE A;  3EG0 A;  3X20 B;  1YBY A;  3CD6 A;  1I81 A;  2J06 A;  3QBY A;  2KRS A;  1K1Z A;  2ROT A;  4LN2 A;  3ZL7 C;  2F69 A;  3CCU Q;  1QVG A;  1TUD A;  3CCR A;  2HNI A;  3EGX B;  1Q82 R;  1R77 A;  4PJO C;  2DL3 A;  3WVE B;  1YJ9 Q;  2M1H A;  1I1J A;  1AWW A;  4PJL A;  3GNF B;  2K3Y A;  1ACM B;  5IHN A;  1S72 A;  2XMF A;  5IHK A;  2NUP B;  1ZQ1 A;  4M78 G;  3UT1 A;  2KXD A;  1GCP A;  2CSI A;  2E70 A;  2YUP A;  3H9N A;  1AD5 A;  3WVD B;  4BAC A;  3QUI A;  4M4Z A;  5GAN h;  1Q81 U;  5KYN A;  3M56 A;  4C92 A;  2FRY A;  2AK5 A;  3CMA A;  2ZAE A;  3Q1J A;  4EIK A;  2CZ7 B;  2ED1 A;  3G71 A;  3HTR A;  3CCS Q;  1D1A A;  2RK1 A;  3PTA A;  2X35 A;  1KD1 R;  3CCV T;  3CBO A;  3QYG B;  2CH4 A;  1B07 A;  1PCX A;  2HKQ B;  4F16 A;  4C92 G;  1Q7Y R;  3V8J A;  3OYB A;  3CCJ A;  2LJ3 A;  4F7U E;  4M7D E;  1JJ2 S;  1K0X A;  2VGN A;  4FCY A;  2D9T A;  2YLB A;  3M55 A;  4JRK A;  2GTO A;  3UPU A;  4OP0 A;  3H0I A;  1UG1 A;  1JXO A;  4DBR A;  4QKU A;  5KYU B;  1ZA2 B;  5CKD A;  1VQ9 Q;  2GTJ A;  5IT9 E;  4M7A A;  1OYX A;  3PMT A;  5IN1 A;  4JJB A;  2EQK A;  3EGU A;  3A8L B;  2QYZ A;  2HL5 C;  3OYE A;  2LC4 A;  2PU9 B;  4OMQ A;  2COY A;  4NL2 A;  3RKY A;  4AT1 B;  4CC7 A;  1TU0 B;  5KCO A;  2JS2 A;  4HVU A;  1AWO A;  2XK0 A;  3PGG A;  4KUD K;  1N8R U;  2EW3 A;  2CUB A;  3AHU A;  3MPU B;  3IQL A;  3HFO A;  4PJM A;  4ATO A;  2RA2 A;  1RL2 A;  1NYF A;  1G83 A;  2V8J A;  4RUG A;  5CVI A;  5I22 A;  2J05 A;  3MCA B;  3J81 E;  3EFO B;  4RKU E;  2RB6 A;  2FZG B;  5CCA A;  1NPR A;  2L3Q A;  3EGD A;  1K8A U;  4GLM A;  3JCM d;  1M1K C;  3OS2 A;  1VQ5 A;  1RI0 A;  1LVK A;  1HJD A;  1J3T A;  3M59 A;  2FPE A;  1M2V A;  2LQ8 A;  1UEC A;  3CPW S;  4MML A;  4L59 A;  2DXB A;  1Y0M A;  4XTZ A;  3I5S A;  1T3L A;  5FWB A;  3RKX A;  4ANJ A;  4ZNX A;  4M77 G;  1BI1 A;  1GBQ A;  2DKG A;  4N4G A;  4ZTF A;  2O9V A;  4LUE A;  2Z0W A;  1D1C A;  2D8J A;  2L0A A;  2SRC A;  4OMN A;  1AZG B;  1Y57 A;  1OQK A;  7AT1 B;  2PTK A;  3OB9 A;  1VQ7 A;  3M0U A;  2DX1 A;  3CBP A;  3UF4 A;  1TSF A;  2JTF A;  2ZPH B;  3OW2 P;  1VQK T;  5C6S A;  3L2R A;  3OYN A;  3L1A A;  1K73 R;  2DA9 A;  3N5B B;  1AHJ B;  3OMC A;  1GCQ C;  2DJZ A;  3CME T;  2KT1 A;  3CCL T;  2OTJ T;  2DAQ A;  4JRQ A;  1WLP B;  4X34 A;  2VKN A;  4LUD A;  1CKA A;  4C8Q B;  1B3Q A;  4J9C A;  1GFC A;  1G3S A;  4XTY A;  1H3Z A;  1I4K 1;  2LQN A;  2LX7 A;  2K3X A;  3JCM b;  2DO3 A;  2QTV A;  4ME7 A;  4PL6 A;  2A3L A;  2BE9 B;  5J3B A;  2ZGW A;  3R6O A;  2JS0 A;  3SWN C;  1SRM A;  2K3B A;  2M02 A;  4J9F A;  4C0D C;  2MCN A;  1QLY A;  2QI2 A;  3G1J A;  2E6Z A;  2KGT A;  2MOX A;  1YJ9 A;  3M4Y A;  2HQH A;  2FL7 A;  4J83 A;  2CT4 A;  2FZK B;  2LJ0 A;  5J26 A;  2AZV A;  3VYG A;  1TH7 A;  5AYF A;  2LTO A;  3RER A;  1K9M R;  4ORZ A;  5DY9 A;  1VQO T;  2LT4 A;  4C5I A;  3A8O B;  1Q82 C;  4A4K A;  2OTL Q;  3PNW C;  1VIF A;  1VQ8 Q;  3GNG A;  2RPN A;  3HP9 A;  1YI2 T;  5GAN 3;  5FU7 B;  2PUK B;  1NJI U;  5KE2 A;  4D8D A;  3CQT A;  3V7R A;  5GAN 5;  3OBY A;  1RAB B;  5IAY A;  5D7U A;  4PJO A;  4B9X A;  1HD3 A;  4JLG A;  2E6N A;  2E64 A;  3LH0 A;  2JOY A;  1OX8 A;  3CCS A;  3VS6 A;  1PSF A;  4KRT A;  2MIO A;  2E4H A;  1QCF A;  2RHX A;  1AT1 B;  5GAN d;  2QA4 Q;  3M5A A;  3BDU A;  5DM7 R;  1RI9 A;  2AKL A;  2VUB A;  1OU9 A;  1IHW A;  2QGG A;  3EG1 A;  2R5M A;  3BY7 A;  3I56 Q;  2LDM A;  1UHF A;  3KFV A;  1O9S A;  1U3O A;  4M78 C;  5LJ3 h;  1KC8 R;  2MWP A;  4FM4 B;  4RTX A;  3JCM P;  2A08 A;  1AVZ C;  1IGU A;  2DXU A;  3DB3 A;  4GLK A;  1VQ9 A;  1X6O A;  4LD6 A;  2CKK A;  1BU1 A;  1KD1 C;  4M75 G;  1B34 B;  2QK0 A;  1ZSZ B;  1VQK A;  2V8K A;  1Q7Y C;  3FLG A;  2CSQ A;  1MV3 A;  2KDS A;  4M78 F;  1VQN Q;  1IZ6 A;  1YHQ Q;  4MMK A;  1RAC B;  2XI9 A;  4JDS A;  2NWM A;  1NZ9 A;  2PVG B;  3CME A;  2KMT A;  2KRO A;  3DB4 A;  3SDZ A;  5GAN 2;  4HT8 A;  1BI3 A;  2K79 A;  3E9G A;  4P5N A;  3I55 Q;  1D0X A;  1VYU A;  2GCX A;  3NPF A;  3S3M A;  3QG1 A;  3M0Q A;  1PM3 A;  1WA7 A;  1PKT A;  1HSQ A;  3TEE A;  1SSF A;  2FHD A;  4RCB A;  1R0B G;  1EIF A;  3EG2 A;  4C5H A;  3THK A;  4J7I A;  3OSV A;  2DL5 A;  3H6Z A;  4F7U B;  4M7D B;  1M5Q 1;  2E5Q A;  3RMQ A;  4C92 F;  2CS7 A;  4C8Q C;  4ZGD B;  4J8O A;  4F04 B;  4WTO B;  5A0L A;  1VYT A;  1N9R A;  3JCM g;  4XAX B;  1V1C A;  3QDR B;  4E2F B;  1ZSG A;  3GP8 A;  1KIK A;  4LD9 K;  2ED0 A;  3CCM T;  1UUE A;  1MGQ A;  2O88 A;  3CC4 T;  3I35 A;  1UHC A;  5C0M A;  2DL7 A;  2X51 A;  3EAE A;  2HMA A;  4AFU C;  4DOW A;  2DYB A;  2O9S A;  2EKO A;  4J9I A;  4EMK C;  1VQ6 T;  2LCC A;  4TVR A;  2RD1 A;  5IH2 A;  1UGS B;  4HT9 A;  1WQ7 A;  2QQ9 A;  4IUP A;  4RG8 A;  2P4R A;  4DBF A;  1VQN T;  5DLO A;  2KXC A;  1G5V A;  2K2M A;  3JCM f;  2XG8 D;  1PKS A;  5KYX B;  2LT1 A;  3QJY A;  6AT1 B;  1F1B B;  5CKH A;  3PE0 A;  2DRK A;  3AT1 B;  2VYT A;  5FU7 C;  2A7Y A;  4C0Z A;  1Q81 R;  3OS1 A;  4FSS A;  1G8X A;  1VYV A;  4M77 C;  4N0A C;  3UAT A;  1Z9Q A;  4C5E A;  1RAI B;  3JCM J;  2RH2 A;  1S72 T;  4HCB A;  1DJ7 B;  1WXB A;  5GAN 8;  2BKD N;  2DER A;  2R57 A;  1G3Y A;  1LCK A;  2FO0 A;  2RHY A;  2P84 A;  5IHI A;  2X3W D;  4FT4 A;  4ELY C;  2HAX A;  4J6Y A;  1GCQ A;  2CP0 A;  1WJS A;  2ZPI B;  4RMO A;  3JB9 J;  3CXC A;  3M58 A;  4IUV A;  4M77 F;  1IHV A;  2HKN A;  1OV3 A;  1JB0 E;  3MKD A;  3TQ7 P;  4OMM A;  3RUX A;  1JRI A;  1MMD A;  4JRI A;  3G71 T;  4RTZ A;  2OTL A;  4KUL A;  4PLI A;  1VQ8 A;  3M0T A;  4JPB W;  4D8K A;  2A28 A;  4RTV A;  3LYI A;  1JJ2 A;  1D3B A;  1M30 A;  2AT1 B;  3CCJ T;  5EC7 A;  4OB0 B;  3OYA A;  1LNX A;  1K76 A;  1M27 C;  5CAI A;  4LDV A;  2OX7 A;  3VJP A;  3O5Z A;  4M7A E;  2KE9 A;  3I56 A;  4PKC C;  4E7Z A;  4XQ3 A;  4OML A;  3EH1 A;  2DBK A;  3VYH B;  3EFS A;  1W70 A;  1WYX A;  2FB7 A;  5D6W A;  2D0Q B;  1YWO A;  5LJ5 h;  1MV0 B;  2DIL A;  3CC4 A;  1K8A R;  3NGP A;  3E1S A;  1RAF B;  2GFU A;  1GL5 A;  1E6G A;  3G6E Q;  5GAM e;  4R0K A;  4M7D C;  2LQW A;  2GQI A;  2ATC B;  1C0M A;  3ASK A;  3ZEH A;  3GOX A;  1VQN A;  2MYS A;  1MHN A;  3PVL A;  1YHQ A;  3X24 B;  2KR3 A;  1VQL Q;  2X4J A;  5LJ3 e;  4M78 A;  2EBP A;  4JZ3 A;  3EG3 A;  1YFN A;  1QP3 A;  2DIG A;  4A4G A;  3I55 A;  4F17 A;  2CUD A;  3E19 A;  5GAN f;  4A54 A;  1VQ5 T;  3JCM Q;  1W2B P;  2K9G A;  2JJ9 A;  3V7S A;  1LOJ A;  2BZ8 A;  4UC4 A;  1WX6 A;  5KE3 A;  1Y96 B;  4DEY A;  4OMF B;  3CPW A;  3SEM A;  2OJ2 A;  3A98 A;  3CCQ Q;  2K6D A;  2L5Q A;  5AT1 B;  4QT7 A;  5CQY A;  2YSQ A;  4FSX A;  4M75 C;  3OBW A;  2L3R A;  1FWZ A;  1BI2 A;  2DVJ A;  2AZS A;  2M9U A;  4PJO F;  3P8D A;  4E47 A;  2XIC A;  1YJW Q;  1VQ7 T;  1RAG B;  3FB9 A;  5FU6 C;  4BY6 B;  3CC2 T;  2V1Q A;  2P4T A;  4KT0 E;  1Y71 A;  4WCI A;  4FW1 A;  4M75 F;  4QW2 A;  5KYW B;  1FMW A;  3UA6 A;  1NG2 A;  2EYZ A;  2O01 E;  1VQ4 Q;  4HXJ A;  4B6M A;  3LX7 A;  4II1 A;  1W6X A;  2J7I A;  2YRV A;  3OY9 A;  4FU6 A;  2WSF E;  3URG A;  8AT1 B;  1TUG B;  3M4G A;  2K2V A;  4ZGE B;  4BDY A;  1PNJ A;  2LMJ A;  1WHJ A;  3O8V A;  1W2B S;  2G3R A;  2D0N A;  1UB4 A;  3BE3 A;  3T9N A;  1H64 1;  4Z8A A;  3UDC A;  4DBQ A;  1X43 A;  2HDA A;  2VV5 A;  5CKE A;  8ATC B;  3CCU T;  3H0H A;  3JB9 I;  4KGX B;  4EDU A;  3VS2 A;  2PUO B;  1QVG P;  1NJI R;  2GQV A;  1YIT Q;  1YCS B;  3RDV A;  5GAM j;  4C8Q G;  1YJ9 T;  1X69 A;  1QW1 A;  2EFI A;  4EMK A;  2K5I A;  2VXE A;  3M0P A;  4R56 A;  4EMH A;  3NFC A;  1BBZ A;  2FZC B;  3HHT B;  5GAO q;  1WXT A;  2K5L A;  5KH6 A;  2ROL A;  4J5Y A;  2L2P A;  4E7J A;  2V1R A;  4E7I A;  5LJ3 j;  1FMV A;  3H0F A;  2CP2 A;  3JRZ A;  1W1F A;  2LZ6 B;  1Q81 C;  1AWX A;  5CKF A;  4JJC A;  1QKX A;  2CZ6 B;  1IXD A;  3JCM W;  2EWN A;  4CC4 B;  4OGC A;  2R5A A;  4M77 A;  2DIQ A;  2ECZ A;  4N0A A;  1UJ0 A;  3RR6 A;  1PC0 A;  1PD0 A;  1NM7 A;  1RUW A;  4OVA A;  3CCS T;  1ZBJ A;  1QMC A;  3EG9 A;  4HCC A;  1JO8 A;  1X2K A;  3M57 A;  2JZ2 A;  2RI2 A; 
#chains in the Genus database with same CATH homology
 3M5A A;  3BDU A;  4M75 B;  4QVZ A;  5DM7 R;  5HK3 A;  2VUB A;  1IRE B;  4LDY A;  3JB9 F;  4XTX A;  5GMK h;  2DD5 A;  2O4X A;  2R5M A;  3BY7 A;  3OYJ A;  2LDM A;  4Q5W A;  1O9S A;  5HK0 A;  1BI0 A;  4PLL A;  3C94 A;  1KQ2 A;  4M78 C;  1M1G A;  5LJ3 h;  3CCR T;  2WSC E;  3JB9 D;  2MWP A;  2QDY B;  4FM4 B;  3X25 B;  3G4S T;  3G4S A;  3JCM P;  5LJ5 g;  1X01 A;  3RKW A;  4ZGJ B;  3UWN A;  4DOV A;  4VUB A;  4JS4 A;  2DTI A;  2GF7 A;  2DXU A;  3DB3 A;  2FYK A;  2DK3 A;  2RJC A;  3HRS A;  2OAU A;  3MEV A;  1U1S A;  4GLK A;  5FU6 B;  1VQ9 T;  1GXI E;  3LGF A;  4E7L A;  1VQ9 A;  1X6O A;  4LD6 A;  5M9O A;  2CKK A;  4BE0 A;  1KD1 C;  2P0K A;  2IVW A;  2QQS A;  4YTL A;  3ME9 A;  3QZ9 B;  4M75 G;  1OZ2 A;  2CGH A;  1B34 B;  2WSE E;  2Y4Y A;  2CZ0 B;  3JCM h;  4BD3 A;  2E1H A;  1KHI A;  2DXC A;  2F5T X;  3GF5 A;  3PIP A;  3CC2 A;  4OF1 A;  3LLR A;  3JB9 H;  1HXD A;  2V8K A;  1VQK A;  4ZN3 A;  2WAC A;  3QJ6 A;  2LRQ A;  1Q7Y C;  3FLG A;  1PSE A;  4M7A C;  2DZC A;  2KDS A;  2Y4X A;  4M78 F;  1ZBX A;  4ZN1 A;  2KAF A;  2P0Q A;  1IZ6 A;  4MMK A;  4A53 A;  2KQW A;  3HRU A;  2XI9 A;  3G6E T;  3G6E A;  4DA4 A;  4JDS A;  3OYH A;  2DXT A;  1U1T A;  3A8H B;  4M75 D;  3S3N A;  1KC8 U;  1NZ9 A;  2PVG B;  4C92 B;  3CME A;  2KMT A;  3C4S A;  2M0O A;  3SDZ A;  3DB4 A;  3HRT A;  3NTI A;  3CXC S;  3CMA T;  4C8Q E;  5GAN 2;  5GAO l;  4HT8 A;  3GIB A;  1BI3 A;  5LJ5 f;  3A8G B;  3E9G A;  4P5N A;  4X9D A;  4C8Q A;  4EMG A;  1W2B A;  5HKC A;  4IKF A;  3J7A F;  4E7K A;  2LNV A;  1M8V A;  2GCX A;  3QO3 A;  3S3M A;  5KCH A;  2EIF A;  2GFA A;  3QG1 A;  1M1K U;  4MDW A;  1VQL T;  4C0G A;  2BUD A;  2E65 A;  1VQL A;  3SWN B;  4BY6 C;  1BYM A;  4MDX A;  3TEE A;  3L42 A;  1SSF A;  2FHD A;  1K8A C;  1V29 B;  4RCB A;  4LDU A;  4C0D B;  4JRP A;  2JUF A;  3CCU A;  3QXE B;  2XDP A;  3OSS C;  4X9C A;  4Z02 A;  2PVO B;  3M54 A;  1EIF A;  2DPP B;  2KVQ G;  2RK2 A;  1D3B B;  4KUI A;  5LJ5 e;  5DLQ E;  3VV0 A;  4C5H A;  1YJN A;  2H3J A;  2X4W A;  3H8Z A;  2DZ9 A;  4NOY A;  3KBG A;  4J7I A;  1KHC A;  3OSV A;  5J39 A;  3H6Z A;  4F7U B;  4M7D B;  1I5L A;  3HSB A;  1M5Q 1;  2E5Q A;  3RMQ A;  4XTU A;  2CS7 A;  1BKB A;  3RIR A;  3SD4 A;  1XNI A;  4C92 F;  4C8Q C;  4ZGD B;  3CCQ T;  4JS5 A;  2XD0 A;  4J8O A;  2ZZD A;  4WF2 A;  1UGR B;  5FRM A;  2VGM A;  3HKS A;  1WJQ A;  4M7A B;  2EQM A;  1N9R A;  3OYY A;  3DLM A;  3JCM g;  4C92 D;  5A0L A;  4XAX B;  1WJR A;  3QDR B;  4BI3 A;  5GAO n;  1UGP B;  3OW2 A;  4E7H A;  1XOV A;  3NTK A;  1BIB A;  3SB2 A;  3GP8 A;  4IUQ A;  3C12 A;  1XTD A;  4LD9 K;  5FLX E;  4MZT A;  1Y7X A;  3OW2 S;  3CCM T;  3CCM A;  3L2Z A;  2MMP A;  4HA8 A;  1MGQ A;  3HPW A;  5GAN 4;  2XDD A;  4BB7 A;  2EJG A;  5D6Y A;  4J6W A;  5GMK l;  5I2M A;  3CC4 T;  1YJW T;  5C0M A;  5GAO r;  4L6V 5;  1YJW A;  1WQW A;  1G3W A;  3EAE A;  3ER0 A;  3GPL A;  4DOW A;  4PJO E;  4F7U G;  4M7D G;  4M77 E;  2MWO A;  4NS5 A;  3G7Z A;  2EKO A;  2KY9 A;  3OQ5 A;  4RCC A;  2M16 A;  2RJD A;  4EMK C;  1KQS A;  1VQ6 T;  1VQ6 A;  2LCC A;  3INZ A;  4FL6 A;  4LDW A;  1WPY A;  4TVR A;  2K57 A;  2RD1 A;  4HCZ A;  4BI8 B;  1X75 C;  1UGS B;  2DEQ A;  2JVV A;  4JLI A;  3RES A;  5GMK i;  4HT9 A;  2YHT A;  4M7A G;  4C5G A;  2RJE A;  1WQ7 A;  2HD0 A;  4XK8 E;  2QQ9 A;  3S3O A;  5GMK e;  4IUP A;  4RG8 A;  5GAM h;  3JB9 G;  1VQN T;  5DLO A;  1G5V A;  3CD6 T;  1XQH A;  1VQ4 T;  1VQ4 A;  3LW5 E;  3X20 B;  4M75 E;  2ZPE B;  1YBY A;  4XU2 A;  3JCM f;  4J6X A;  4ELZ C;  5A0D A;  2XG8 D;  2CZ1 B;  3CD6 A;  4M75 A;  1I81 A;  4M78 B;  2LT1 A;  3QJY A;  3QBY A;  3JAM E;  3HFN A;  5CIU A;  3BDL A;  2OTJ A;  5CKH A;  2EQJ A;  3A5Z B;  2F69 A;  3OS5 A;  1WGS A;  1QVG A;  4M7A D;  2VYT A;  2K4Y A;  5FU7 C;  2A7Y A;  2RHZ A;  3DLL A;  4C0Z A;  3CCR A;  2HNI A;  3OYK A;  4O5V A;  4QQ6 A;  3OS1 A;  3E9F A;  1QVG S;  4PJO C;  3FIF A;  4M77 C;  1OI1 A;  3WVE B;  4O6J A;  4JUV A;  4N0A C;  4C5E A;  3VU3 C;  2M1H A;  3JCM e;  3ZFJ A;  2RH2 A;  3GNF B;  2K3Y A;  3JCM J;  1JBM A;  3KXT A;  3VUZ A;  1S72 T;  4HCB A;  1S72 A;  1YJ9 A;  4QQD A;  4QVD A;  1DJ7 B;  1ZQ1 A;  1M9S A;  5GAN 8;  2X4Y A;  2BKD N;  4M78 G;  1UGQ B;  2R57 A;  3UT1 A;  1B34 A;  1G3Y A;  3TU4 K;  2LCL A;  2RHY A;  1BIA A;  1YIT T;  3OYI A;  1YIT A;  1Q86 U;  2EJF A;  4FT4 A;  4ELY C;  2HAX A;  2E70 A;  2ZCF B;  4J6Y A;  1LJO A;  1R8O B;  3CEY A;  2XDB A;  1WJS A;  2ZPI B;  2KSS A;  4RMO A;  1KQ1 A;  3WVD B;  1QVF A;  4BDZ A;  2XID A;  3CXC A;  3JB9 J;  4BAC A;  3QUI A;  3M58 A;  3MP6 A;  5GAN h;  2F5K A;  1Q81 U;  2PVD B;  2RHI A;  2V8I A;  4IUV A;  1VIE A;  4M77 F;  5GAO p;  1Q82 U;  3M56 A;  1N8R C;  1K9M U;  2KK4 A;  4M78 D;  4C92 A;  3JCM V;  1QVF S;  3CMA A;  3TCJ A;  1JB0 E;  2VXF A;  3QSU A;  3Q1J A;  1FX7 A;  3RUX A;  1JRI A;  2EJ9 A;  3FJP A;  2CZ7 B;  5GAM g;  2NLU A;  3OMG A;  4JRI A;  3MO8 A;  3G71 T;  5EG2 A;  3G71 A;  1NJI U;  3X26 B;  2OTL T;  2DTO A;  2OTL A;  1VQ8 T;  4KUL A;  4PLI A;  5GAN d;  1VQ8 A;  2RK1 A;  5LJ5 j;  3P8B B;  3OYL A;  3CBM A;  2K5F A;  5LJ5 d;  1M90 U;  3PTA A;  2X35 A;  2E10 A;  2OTJ T;  3CCV T;  3CBO A;  3CCV A;  4MZM A;  3QYG B;  4QQG A;  3M57 A;  3PMI A;  1I8F A;  3A8M B;  3CPF A;  2MI6 A;  5LJ3 g;  3LYI A;  1JJ2 A;  3OYF A;  1D3B A;  4C92 G;  3V8J A;  4B9W A;  3CCJ T;  3OYB A;  3CCJ A;  4F7U E;  4M7D E;  1JJ2 S;  4OB0 B;  2VGN A;  2DD4 A;  3OYA A;  2D9T A;  1LNX A;  2YLB A;  3M55 A;  4F7U A;  4JRK A;  5CAI A;  4LDV A;  3UPU A;  3QHS A;  4OP0 A;  2QA4 T;  3VJP A;  3FC3 A;  4IUR A;  5A0G A;  3CCQ A;  4OB2 B;  4V2S A;  3QPH A;  2E12 A;  4M7A E;  5GAM f;  3I56 T;  5CKD A;  3I56 A;  2JTM A;  4PKC C;  2QXF A;  4OGE A;  4BE1 A;  5IT9 E;  4M7A A;  1OYX A;  4XQ3 A;  5GAN 6;  3C95 A;  3PMT A;  5IN1 A;  2EQK A;  4M7A F;  3VYH B;  2D6F A;  4DQ2 A;  3EFS A;  1KD1 U;  3A8L B;  2RM4 A;  3M9Q A;  3OYE A;  2LC4 A;  2PU9 B;  3SFM A;  1VQP T;  4NL2 A;  3RKY A;  2BIV A;  2FB7 A;  4N4H A;  5D6W A;  4EMK B;  2D0Q B;  4CI0 C;  2Y90 A;  5KCO A;  2RI3 A;  4GY5 A;  5LJ5 h;  4XTV A;  3CC4 A;  5LJ3 f;  3E1S A;  4KBM B;  3J80 E;  1Q7Y U;  2GFU A;  4JJN K;  2XU8 A;  3QKJ A;  4C8Q F;  5GMK j;  5GAO m;  5GAM e;  3OYM A;  2XK0 A;  3PGG A;  2L8D A;  4KUD K;  4M7D C;  1N8R U;  3F70 A;  3MEA A;  3PIO A;  3PFS A;  3AHU A;  3HL8 A;  3PT9 A;  4C8Q D;  3HFO A;  3ASK A;  4ATO A;  4OB3 B;  3ZEH A;  2RA2 A;  1W4S A;  2XKO C;  2FVU A;  3EFR A;  3GOX A;  1VQN A;  1RL2 A;  3OS0 A;  3FRN A;  1MHN A;  3M53 A;  3QYH B;  4QVC A;  1YHQ T;  2C06 A;  1YHQ A;  3X24 B;  2V8J A;  4M78 E;  5CVI A;  3BW1 A;  2X4J A;  4M7D A;  5LJ3 e;  4PNO A;  4M78 A;  2HQX A;  3MCA B;  3J81 E;  1M4Z A;  4PJO B;  4BUG A;  4RKU E;  1QP3 A;  4M77 B;  4Y28 E;  2DIG A;  1NPP A;  2RB6 A;  4A4G A;  3I55 A;  3I55 T;  3L2V A;  3E19 A;  5CCA A;  1NPR A;  5GAN f;  4A54 A;  1K8A U;  4CRI A;  3MET A;  5I21 A;  2RJF A;  3JCM d;  1M1K C;  1VQ5 T;  3V8L A;  5LL6 S;  3OS2 A;  2QEX T;  1VQ5 A;  3JCM Q;  3VKI A;  3V7S A;  2QEX A;  1LOJ A;  1RI0 A;  4UC4 A;  4NL3 A;  5KE3 A;  1Y96 B;  3QZ5 B;  2MF2 A;  4OMF B;  3CPW A;  1ZHI A;  3M59 A;  2HQE A;  2X4X A;  3KUF A;  4A4H A;  2QQR A;  4IUU A;  2L5Q A;  2LQ8 A;  3VUB A;  5FRN A;  2JN0 A;  1K73 C;  2B8A A;  4MML A;  3CPW S;  2O4X B;  5CO7 A;  3P8H A;  2DXB A;  4L59 A;  4XTZ A;  3OYG A;  5D6X A;  3RKX A;  2EAY A;  5CQY A;  2R58 A;  4FSX A;  3OBW A;  4M75 C;  5GAN e;  4PJO G;  4Y91 A;  1UEB A;  2VC8 A;  3ZBD A;  2L3R A;  1FWZ A;  4M77 G;  1BI1 A;  2DKG A;  3OYD A;  2ZPF B;  4N4G A;  5CK9 A;  1BI2 A;  2LQK A;  4ZTF A;  5GMK m;  4LDX A;  2M9U A;  1YCY A;  2CYZ B;  4PJO F;  1WNL A;  3P8D A;  4E47 A;  3TRE A;  3WXM B;  2EYQ A;  2XIC A;  4C92 E;  3LWI A;  3CC7 T;  3CC7 A;  2ZPB B;  3L2U A;  3OB9 A;  3V8K A;  5FRO A;  4HKE A;  1VQ7 T;  1VQ7 A;  4PJO D;  5I2S A;  4OB1 B;  5A2Q E;  4M77 D;  3FB9 A;  2AHJ B;  1N9S A;  2RO0 A;  3CBP A;  5FU6 C;  2JTF A;  2ZPH B;  4BY6 B;  3CC2 T;  3CCE T;  1VQK T;  2P4T A;  4KT0 E;  3CCE A;  5C6S A;  1Y71 A;  3NTH A;  3GLX A;  4M75 F;  3L2R A;  4QW2 A;  5CQX A;  1NJI C;  4IUT A;  4XU0 A;  2HBP A;  3L1A A;  3OYN A;  1YIJ T;  1YIJ A;  2O01 E;  3SWN A;  3V7C A;  3OA6 A;  3X28 B;  3LX7 A;  3N5B B;  1AHJ B;  4II1 A;  1O75 A;  3OMC A;  2DJZ A;  2YRV A;  3CME T;  3MHX A;  3OY9 A;  4FU6 A;  1VUB A;  2WSF E;  2DTH A;  1N27 A;  3URG A;  3M4G A;  3MP8 A;  2DAQ A;  3CCL T;  4JRQ A;  4X34 A;  1VQP A;  2K2V A;  3CCL A;  4ZGE B;  4RG2 A;  3DKM A;  4XU3 A;  4C8Q B;  3OYC A;  2MAM A;  3S6W A;  4BDY A;  2P0P A;  2RHU A;  4FIB A;  1G3S A;  4XTY A;  1VQM T;  1VQM A;  4C92 C;  1H3Z A;  1P92 A;  2QQB A;  1I4K 1;  3MEU A;  1K9M C;  2K3X A;  3O8V A;  3JCM b;  1QVP A;  2JNG A;  1W2B S;  2LX9 A;  2DO3 A;  2G3R A;  1Y07 A;  3L2Q A;  1UB4 A;  1NE8 A;  2QA4 A;  4ME7 A;  4PL6 A;  3T9N A;  1H64 1;  2A3L A;  3UDC A;  1M1F A;  4J7F A;  2QQA A;  4ZTJ A;  2VV5 A;  5CKE A;  3CCU T;  3LGL A;  1G3T A;  4FT2 A;  5J3B A;  4A4E A;  2ZGW A;  1OZ3 A;  3R6O A;  3JB9 I;  3SWN C;  4EDU A;  4R55 A;  1K73 U;  2I2L A;  1HK9 A;  3MEW A;  1YJN T;  2PUO B;  1KG1 A;  2GQV A;  3L2W A;  4C0D C;  5GAM j;  4C8Q G;  1YJ9 T;  5GAM d;  2E6Z A;  2QI2 A;  1QW1 A;  2EFI A;  4EMK A;  2K5I A;  3M4Y A;  2VXE A;  3QII A;  5GAN g;  2FL7 A;  4J83 A;  4R56 A;  4C0F A;  4EMH A;  3NFC A;  3HHT B;  3JCM X;  3FEO A;  5GAO q;  2K5L A;  5KH6 A;  2LVM A;  4EPC A;  4J5Y A;  4XTW A;  3JCM c;  5J26 A;  3VYG A;  2E41 A;  4E7J A;  3BFM A;  4E7I A;  1Q86 C;  1TH7 A;  5AYF A;  1U8R A;  4D6W A;  1YI2 A;  2LTO A;  1QP2 A;  3RER A;  5LJ3 j;  5DY9 A;  5LJ3 d;  3JRZ A;  1VQO T;  1VQO A;  2LT4 A;  1N6A A;  2ZPG B;  2DVE A;  2YLC A;  3A8O B;  4C5I A;  1Q81 C;  4BI4 A;  4N4I A;  5CKB A;  3FDR A;  3LWH A;  1Q82 C;  5CKF A;  4A4K A;  1KC8 C;  3PNW C;  1VIF A;  3GNG A;  5GAN 7;  4MZP A;  2CZ6 B;  3HP9 A;  3RMS A;  1YI2 T;  5GAN 3;  5FU7 B;  2PUK B;  2XHC A;  3JCM W;  5CR2 A;  2PQW A;  3JSC A;  5KE2 A;  2EWN A;  3V7R A;  5GAN 5;  3OBY A;  4XU1 A;  5IAY A;  4OGC A;  2R5A A;  2RI5 A;  4B9X A;  4PJO A;  2L89 A;  3MP1 A;  4M77 A;  2DIQ A;  4JLG A;  4N0A A;  2IG0 A;  1FXX A;  5L8R E;  2QTX A;  4F7U F;  4BE2 A;  4M7D F;  2E6N A;  2E64 A;  4L5G A;  3LH0 A;  1KQS S;  2JOY A;  1M90 C;  3CCS T;  4OVA A;  3CCS A;  5HY6 A;  1PSF A;  4A4F A;  1Y96 A;  4HCC A;  4M7D D;  5GAN j;  2RHX A;  2EQU A;  2JZ2 A;  2RI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...