2EQMA

Solution structure of the tudor domain of phd finger protein 20-like 1 [homo sapiens]
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
88
structure length
88
Chain Sequence
GSSGSSGMSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLERPALRKEGLKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PHD finger protein 20-like 1
publication title Solution structure of the TUDOR domain of PHD finger protein 20-like 1 [Homo sapiens]
rcsb
source organism Homo sapiens
total genus 5
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eqmA01
2R58A 2RHYA 3OYHA 1KHCA 2GFAA 2HQXA 2RJDA 3PMIA 3QKJA 5J26A 5M9OA 1H3ZA 2WACA 2RHZA 1SSFA 3E9FA 3UWNA 4E7IA 2BKDN 4HCZA 3NTHA 3S6WA 2GFUA 3M9QA 2NLUA 3OYJA 2EKOA 2FHDA 4C5HA 2K3XA 2RJCA 3P8HA 4QQDA 3OYNA 3ZEHA 2L89A 3DLMA 3CEYA 3OA6A 3PFSA 3OS1A 3MEVA 4II1A 2F5KA 2M16A 3L2UA 5FRMA 4E7HA 2O4XA 4E7LA 3LGLA 3OYDA 2XK0A 3PMTA 3Q1JA 3FC3A 4C5IA 2RHIA 3OYLA 3S3OA 5C0MA 1OYXA 2QQRA 2EQKA 2L8DA 2QQSA 2B8AA 4OVAA 5KCOA 5KE3A 2K3YA 3ASKA 3F70A 2IG0A 3LYIA 3MEAA 3QBYA 4BACA 4L59A 3OYFA 5C6SA 3OY9A 5IAYA 2RHUA 2DIGA 4QVZA 4C5GA 4BE2A 1G5VA 3L2WA 1MHNA 1WJSA 5D6WA 2MWPA 3OMCA 4RG2A 3PNWC 4BDYA 1OZ2A 4N4HA 5D6YA 3BDLA 4IUQA 3OYBA 3OYGA 2PQWA 2MWOA 2BUDA 4FU6A 3OS0A 3FDRA 5CIUA 4BDZA 3H8ZA 1WGSA 3MO8A 5KH6A 3OYCA 3OYEA 2RO0A 3OYIA 5D6XA 2EQJA 3MP1A 4EDUA 2M1HA 3OMGA 5IN1A 3OQ5A 5KCHA 4E7KA 3DB3A 2JTFA 3H6ZA 4ZTFA 2VYTA 2X4YA 4IKFA 2R5AA 2XDPA 2EFIA 1WJQA 3LX7A 4IUVA 3OYMA 3L42A 3FLGA 3MEUA 2X4WA 4LD6A 3E9GA 4PL6A 4IURA 3GOXA 2CKKA 3KUFA 2R5MA 4UC4A 2E5QA 2P0KA 2L3RA 3C4SA 3LH0A 3NTIA 2RI3A 4A4HA 3OYAA 3L2RA 3S3MA 2HQEA 5FROA 3MP8A 4QW2A 2RI2A 4GY5A 3ME9A 2DAQA 4CRIA 2RJEA 4N4GA 3LLRA 1N27A 4Z02A 4FL6A 2LCCA 2JZ2A 1RI0A 2RJFA 2E6NA 2EQMA 3EAEA 1OZ3A 4Q5WA 3MEWA 1OI1A 3OB9A 4QQ6A 2X4XA 3NTKA 4A4GA 4BE0A 5KE2A 4B9WA 5J39A 3UT1A 4X34A 4BE1A 3MP6A 4IUTA 4A4EA 2DIQA 3O8VA 4IUUA 3META 4BD3A 2O4XB 2R57A 3FEOA 1WJRA 4NS5A 4QQGA 2YRVA 3SD4A 2EQUA 4N4IA 3L2QA 2LRQA 2RI5A 2X35A 3L2VA 2BIVA 4PLLA 4A4FA 2RHXA 5FRNA 3OS2A 4E7JA 3S3NA 2GF7A 4ZTJA 4C5EA 2M0OA 3P8DA 3DB4A 3QJ6A 2LTOA 2LVMA 2G3RA 3LGFA 1XNIA 2LDMA 3QIIA 4PLIA 4IUPA 3OYKA 2D9TA 4B9XA
chains in the Genus database with same CATH superfamily
3QWXX 1RABB 4M77A 3PMIA 5M9OA 2CZ6B 3INZA 4AFQC 1LNXA 3OSVA 1B3QA 2YRCA 3RIRA 1WXBA 4X9DA 1WQ7A 2QGGA 5KYYB 3REAB 3ER0A 4F7UB 2HDAA 1JJ2S 5HKCA 3LWIA 1BCMA 3F70A 2DA9A 2A28A 1Q82U 2LX9A 1Y71A 2FPDA 3CMAQ 4B6MA 2VGMA 2DILA 4FYYB 5KYWB 3CPWP 4D8DA 4M78D 2D8JA 2RM4A 3OYEA 1KQ2A 3J7AF 4ELYC 2E65A 4HXJA 4MMLA 4FSXA 1RAGB 4IKFA 2EYWA 4Z89A 1AVZC 3M0QA 3GOXA 2QA4A 2I2LA 1YIJA 2BE9B 1VQMT 1SRLA 4A63B 1JB0E 1JXMA 4A4KA 4XQ3A 1VQ6T 1R77A 3JCMQ 4DEXA 3G4ST 4M75D 5KE2A 4NL3A 3BW1A 3QHSA 1YNZA 4A4EA 2DIQA 1VQNQ 1PKSA 3EGDA 4LNPA 3L2VA 1SHFA 3KBGA 2RHXA 2FPFA 4XTUA 4O6JA 2DERA 2LVMA 4OB3B 1XNIA 3M56A 1WHKA 3J81E 3WXMB 3CC2A 3GPLA 2HCKA 2P0QA 1K9AA 1RACB 4IUPA 1NYFA 2DJZA 4M75F 1Q95G 2LJ3A 4D8KA 1MMAA 1SSFA 2LT1A 2GFUA 3CCST 2JS2A 3C12A 2A3LA 2RNAA 2RJCA 2FG0A 4C0GA 3CCQQ 1TUCA 4J9HA 2GTJA 4II1A 3JCMJ 4L6V5 2K4YA 4E7HA 3CC7A 3CD6Q 4M7DE 1QKWA 2D1XA 5A0DA 3PIOA 5LJ3h 1OYXA 3I9QA 3M53A 2KYMA 3JCMe 2AIRB 2MMPA 1EZZB 2NUTA 2LCLA 1X6OA 3OYFA 3VS2A 1BB9A 3M0UA 1QW1A 1G5VA 1Y0MA 1PD1A 2PUOB 1WJSA 1MUZA 4LD9K 2HL3A 4C92C 2YUPA 1LOJA 3A1PA 1OPLA 3HL8A 3O5ZA 4PJOF 1TS9A 2CS7A 1C1AA 4ZTFA 5EG2A 1GXIE 4M7AB 3L42A 3NHNA 4M75A 3NFCA 2BE7D 4HKEA 1VOMA 4M77B 2E12A 4ZGEB 1S72Q 4JLGA 3CXCA 1O9SA 3QG1A 3MHXA 3EH1A 1M90R 1WHHA 2XG8D 1Q81R 4J9DA 2P84A 1TG0A 1CKAA 1WZOA 3GLXA 5GAMh 4PLLA 1UFFA 2LMJA 4KULA 3VYGA 2DL5A 2VC8A 4OP0A 2M0OA 1K9MU 2NUZA 2DLPA 3QWYA 2A08A 3SWNC 1W4SA 3M59A 4JS4A 4M4ZA 4MZTA 4F16A 4KT0E 1WI7A 3HFOA 4PJOA 4BI8B 2FEIA 2RF0A 4FYVB 4J9BA 3LH5A 5LL6S 4CC4B 3A5ZB 2DJQA 1RL2A 2RK2A 4JDSA 1VQMA 1UECA 2QASA 3P8HA 3OYNA 4QT7A 2KRSA 3A98A 5GAOl 3EFOA 1D0ZA 1NYGA 1ZUYA 1VQ6A 3DKMA 1WDXA 3RKXA 2NYSA 3G4SA 3EHQA 5KE3A 1MV0B 4KBMB 5AT1B 5GMKj 4XTVA 4ME7A 3HP9A 1GFCA 1Q7YU 1BIAA 1E6GA 2CP2A 4HT8A 3OMCA 2EJ9A 4N4HA 1IHWA 1M2OA 2MWOA 4FU6A 3FDRA 3DLLA 4EIKA 2CP3A 1D0XA 2CDTA 2XU8A 3EGDB 2K5IA 2AKLA 1YHQT 2DBKA 4IUVA 2DRMA 3CCSA 4BI3A 5LJ5h 4E7SA 1YCSB 4RTUA 3KUFA 3H0IA 3M0RA 2DD4A 1JXOA 3L2ZA 4E7ZA 1WPYA 4KGZB 4FL6A 3TCJA 4RTVA 1ZSZC 3EAEA 3I56T 4WF2A 3M55A 1LPLA 2QDLA 2GQVA 2H3EB 3X24B 3V7CA 2COZA 2O2OA 1ARKA 4XTZA 4ZNXA 2KXCA 1YJWQ 4ZTJA 1WA7A 1BIBA 3CC4T 2NUTB 4JJNK 3QUIA 1W70A 3RKYA 1KQSA 1T0HA 4HCCA 4MMKA 1H3ZA 1M90C 2HBPA 1R0BG 1I0CA 2G6FX 4EPCA 1UJ0A 1Q81C 3G6EQ 2JTMA 3BY7A 2FHDA 3CXCS 2ED1A 2J6OA 3I35A 4LDXA 3REBB 2FYKA 4M7AE 1Y57A 2VVKA 3OS1A 3R6OA 5FRMA 3L2UA 4M75B 4N0AA 1NE8A 2RN8A 3VS6A 4C5IA 1AWOA 2CZ1B 1U8RA 2ECZA 3MEAA 2K2MA 1M1GA 1IZ6A 1H641 1UTIA 2F69A 1FWZA 2E70A 1TH7A 1QKXA 1RAHB 2CGHA 4C92F 5D6YA 2LJ1A 1NPRA 4OMOA 2OTLT 4MDWA 4M7DG 1RI9A 2C0TA 4XU2A 2O01E 1MGQA 2C0IA 1QCFA 3EFRA 4PJMA 2LNHB 4DBRA 3LX7A 1IGUA 1VQ7T 2DE0X 2D0QB 1WYXA 2X3WD 4BUGA 5GANg 2DKGA 2R5MA 2RI3A 4PJOB 3S3MA 1TOVA 6AT1B 1K0XA 4QW2A 1XOVA 2J05A 4VUBA 4Z02A 1SF9A 2DXTA 4NOYA 2K6DA 5LJ3j 3EFOB 3BFMA 3UDCA 1VIFA 3META 2BZYA 4NS5A 3QO3A 3CCMT 4N4IA 1Z9ZA 1BI3A 1WQWA 2PVOB 1K73U 2YUNA 3JB9D 2LTOA 1VYUA 2DYIA 2RQVA 2O31A 2K5FA 2QAZA 2Z0WA 4C92A 1BKBA 2O88A 3T9NA 4ELZC 4RTTA 1YHQA 1N8RR 2RHZA 4O5VA 4ZN3A 1GCQC 1I8FA 2CZ0B 1G3WA 4X9CA 2FO0A 4MZMA 1VA7A 8ATCB 2QDYB 1PHTA 4FT2A 2DTIA 1ZBXA 3FC3A 3PMTA 3I56A 3EHRA 5DLQE 4JRIA 2QA4Q 2J7IA 1RAFB 1WXTA 3UF4A 1YIJQ 1VQPT 1RAAB 3EG0A 1ZHIA 5FU7C 1EX4A 4OF1A 3I5SA 2RHUA 2DIGA 3QZ9B 2KT8A 5GAMj 1QWEA 2BZ8A 3CC4A 3JCMX 1BYMA 1KQSS 1PKTA 2DFUA 2RK1A 5CKBA 2BUDA 2YSQA 2LJ0A 2DL3A 4PFOA 3JCMc 3OYYA 4Z88A 1IREB 3OQ5A 3UA6A 2X4YA 3CMET 3RERA 1YWPA 1XJWB 3CC2Q 2AZVA 3M4GA 3OYAA 4JRQA 1JO8A 3CCVT 3CCLT 2VXFA 2HEQA 3ME9A 1SEMA 3JB9G 3JCMP 4KGVB 2KDSA 2E1HA 1RI0A 3VS3A 1GBQA 1NPPA 4A4GA 2AHJB 4DBQA 3C95A 3MP6A 1K1ZA 4OMLA 5CKDA 4QQGA 3SD4A 5GANe 1FYNA 3AT1B 5GAN2 4JZ3A 2DMOA 4CC7A 4FSSA 3P8DA 3DB4A 3JCMW 2OTLA 2QQAA 2LDMA 2CP6A 1PNJA 2A36A 3JCMh 2R58A 1QP2A 4Y92A 2AKKA 1LCKA 2FZGB 2GFAA 2GCXA 1YN8A 2DZ9A 2LQKA 4E47A 1VQ7A 5GANd 1PWTA 5GMKh 3UWNA 1ZA1B 2RPNA 4R56A 5IH2A 1UJYA 5LJ5j 2CYZB 2EKOA 3MJXA 4QQDA 2E41A 4AFZC 1VQ4T 1HYOA 3QZ5B 4AFUC 2F5KA 4MZPA 2CP0A 3GNGA 4HA8A 2QQRA 4OVAA 2CUDA 1NM7A 2JUFA 3ASKA 1G83A 3CCMA 1X2QA 1YP5A 2SEMA 3FRNA 3HRUA 4RUGA 3JB9H 4QVZA 2COWA 4C5GA 3L2WA 3A8OB 1MNEA 4M7AG 2YRDA 2KRNA 2CZ7B 2EYZA 2L3SA 1AD5A 4HT9A 4A54A 5DLOA 1ZBJA 2VASA 4J9EA 2DNUA 1WHGA 2Y90A 2OI3A 2VYTA 3M5AA 1BCOA 3WVEB 5GAOp 1QVGP 1G3TA 4C92B 2AZSA 1NBEB 3CBMA 1WXUA 2C0OA 3BDUA 2QQ9A 2CUBA 5HY6A 2DAQA 2JZ2A 4GBQA 3M0TA 2CH4W 2P4TA 2HKQB 2VWFA 4Y91A 1VQPA 4QVCA 2KK4A 3JSCA 1YITA 4BE1A 4Z8AA 3QDRB 2KY9A 1VQ6Q 5HK3A 2YT6A 3G4SQ 1OU9A 4C5EA 2AK5A 2JW4A 3VS0A 2HNIA 2MAMA 4OGCA 5IHNA 4M78F 5GANf 2BTTA 2YWWA 2JM8A 2HQXA 1XQHA 1SG5A 1M8VA 3CMEA 2OTJT 4LDVA 3MPUB 3OW2A 2CSIA 3VKIA 2BKDN 1M90U 1K73C 2MF2A 1RAIB 3CCVA 3CCLA 1Q81U 4PNOA 1U3OA 4M7DC 2DM1A 2M16A 3NMZC 5AYFA 3OYDA 3M0PA 2ZPHB 5CO7A 1YCYA 1EIFA 1T3LA 2L0AA 5KCOA 1HK9A 2D0NA 4C8QC 5CVIA 5GMKl 4PJLA 3OY9A 2EJFA 1FMVA 1JJ2P 5D6WA 3CBOA 4HVUA 3HFNA 1UGVA 3M58A 1G8XA 1X27A 1M1FA 4RTYA 1ZUUA 4M78A 3M54A 2NUPA 1MMGA 1M2VA 4PL6A 3PIPA 1AOJA 1IXDA 3LW5E 1GCQA 1VQ4A 2K7AA 2DPPB 4HVVA 5I11A 4LE9A 4UC4A 4C8QE 3RDVA 2HQEA 4PFZA 4KGXB 1IRXA 1D09B 3VS7A 2RJFA 3VV0A 2E6NA 5IXBA 1Y96A 3TU4K 3UA7A 4B9WA 2ENMA 5J39A 1PCXA 5I2MA 1ABQA 1QLYA 1ZQ1A 1C6VX 4EMKC 1V29B 1C0MA 2B86A 2HMAA 3HRTA 2G3RA 1N9RA 4FW2A 1YJNT 3VRZA 4B9XA 2ROTA 3RESA 1VQLT 5LJ3g 1UGSB 1EFNA 2DD5A 3I5RA 1HSQA 4F7UE 1DJ7B 2HSEB 2JXBA 1F1BB 1HXDA 2EYQA 1A0NB 2LT4A 1AWXA 3ZEHA 1K0SA 5CCAA 2XMFA 1OPKA 1JBMA 3MEVA 2LCSA 1VQ8T 1KC8R 2O4XA 3CBPA 2MK5A 2DXUA 1QQJA 2QQSA 4OMFB 4F04B 1S72T 2X51A 2FPEA 2QG9B 2RD1A 1NJIR 5IAYA 1GFDA 2H8HA 2VGNA 2GTOA 3UATA 1TU0B 4RG2A 2VV5A 3SEMA 3EGUA 5GMKi 2DVEA 2DTOA 1VQ9T 2HD0A 5D6XA 3OW2S 2ABLA 2OTJA 3SDZA 1AEYA 3FJ5A 2RB6A 2M1HA 5KCHA 1B34A 1M27C 1OULA 2R5AA 4RG8A 2C06A 4PK4A 2P4RA 1KIKA 2L3QA 2JMAA 4Y28E 5GAMg 2V1RA 1YHQQ 2ZPGB 3P8BB 3EFSA 3VS4A 5FROA 2CT3A 5GJWB 4WCIA 5A0GA 2RJEA 5FWBA 3M4YA 1TUDA 1VYVA 4JJCA 1ACMB 4DOVA 2CP5A 3FIFA 3UT1A 3CCJT 2CT4A 1UDLA 1ZSGA 3VUBA 2LNVA 1IO6A 4DQ2A 2LRQA 2O9VA 3I56Q 2DF6A 5FRNA 1QCOA 3A8MB 3QJ6A 4LDYA 2W0ZA 1KHIA 4M7DD 3QIIA 4KH1B 4NL2A 5GAN8 3CCET 4KUIA 3VYHB 2JM9A 5J26A 2LZ6B 1VUBA 4DBHA 5DY9A 3CC4Q 4RCCA 3D7SB 3PT9A 2FVUA 2KR3A 4E7IA 3NPFA 4R55A 4ORZA 4C8QD 3JB9I 3CCRQ 4M7AC 3X25B 1QWFA 2DX1A 1N6AA 4C0DC 3CCUT 4M78B 2E3HA 5EC7A 1G2BA 2NUPB 2K79A 4ZGDB 2JJ9A 1FMKA 2IVWA 1M2VB 4XTWA 2XK0A 4OGEA 2E3IA 3V8LA 1E6HA 4J7FA 4PJJA 3QBYA 3TREA 2F2VA 4FW1A 4XU3A 1PSFA 2QEXT 1ZX6A 5LJ5g 3A8LB 4D6WA 1VQOT 1Y96B 1X6BA 1YJNA 2PQWA 4YTLA 5LJ3d 2XDDA 1VQLA 5KYNA 3G1JA 4M77E 1KC8C 3PVQA 4V2SA 5GAN7 2HL5C 3RMQA 2M51A 1WJQA 1BBZA 2OTLQ 2XD0A 1SKUB 9ATCB 1V1CA 1I4K1 3OBWA 4LN2A 4J6WA 2QQBA 1VQ5T 2Y4YA 2EYXA 2ZPBB 1VQ8A 3NGPA 2CH4A 1K8AR 2A7YA 1VQ7Q 4QVDA 4CRIA 1N27A 1S72A 5J3BA 1GL5A 3RR6A 4WTOB 1OI1A 3NTKA 2EGAA 4XTXA 4BD3A 2O4XB 4FT4A 1ABOA 2PNIA 3CPWA 3L2QA 1ZLMA 2X35A 4OMQA 5GAN4 1LJOA 4C8QG 3EG3A 2XDBA 1VQ9A 3R6NA 1T0JA 3CCMQ 3ZL7C 5IXFA 2PVDB 5CAIA 4AT1B 5CR2A 1WX6A 5GAMd 2YUQA 3NTHA 3VS5A 2E10A 4CI0C 2KROA 1BK2A 4BY6C 2K3XA 4XU1A 2LQ8A 2ZAEA 3G7ZA 2MPXC 2GQIA 1B34B 3V8KA 1RAEB 2JOYA 2CP7A 3WVDB 1WLPB 4J6YA 2DXCA 2EYYA 2YDLA 2HAXA 5C0MA 4ATOA 1U1TA 2QXFA 3CCJA 3CXCP 5I2SA 4F14A 4OMMA 2X4JA 2DEUA 3LYIA 2GNCA 4F7UG 1TSFA 1Q86R 5DM7R 5LJ3f 4JRKA 4PJNA 1VQPQ 1AWJA 3JB9F 3ZFJA 1OZ2A 5A2QE 4DOWA 3CPFA 2V8JA 1YITQ 1I07A 4EMKA 2W10A 3CCEA 3QSUA 3JCMV 4XAXB 5GAOm 4OMPA 4CC3A 1KD1R 1OX8A 4FM4B 3PE0A 1WHLA 3E9GA 4FYWB 1HD3A 4IURA 3CCUA 5FU6C 2AT1B 5D7UA 3N5BB 3LH0A 3NTIA 2ZPFB 5CKEA 1NG2A 2I0NA 3MKDA 3CMEQ 4JUVA 3KFVA 5HK0A 1WHJA 4JJDA 1YFNA 3SWNA 1M9SA 4KUDK 4J5YA 3FB9A 2X4XA 2QGFB 2PVGB 2XKOC 3CCLQ 5LJ5d 4IUTA 2QEXA 4ZN1A 2VB6A 2DK3A 1VQOA 2ED0A 5GAOr 1M5Q1 1R8OB 2KBTA 4M7AD 1NLPC 3ULRB 1X75C 1D1BA 1YWOA 3AHUA 5GAN6 2DO3A 3I55T 1G3SA 1OOTA 4M77D 1UHFA 1D3BA 4KRTA 4PLIA 3RUXA 1K8AC 5GAMf 3SB2A 1MMDA 3H9NA 1YJ9T 3OYHA 1PSEA 1JRIA 3MCAB 2M02A 4M75E 1VQ5A 2MYSA 3H0FA 3CC7Q 1Y07A 4TVRA 3UPUA 3C94A 2XI9A 1LVKA 4PJOC 4E7LA 2GGRA 2K3BA 3OYLA 1VQKT 2JMCA 4RTWA 2FRWA 3CPWS 2IG0A 5C6SA 1W1FA 4OB2B 1Z9QA 2L3PA 2MWPA 3BDLA 1I1JA 4L5GA 4BDZA 3QJYA 3V7SA 3OYIA 1AT1B 1UUEA 4EDUA 4LXCA 4ANJA 3DB3A 4PJOE 2JTFA 4AFSC 1ZSZA 4LD6A 3JV3A 1N8RC 3EH2A 2K57A 3JCMb 5FWCA 2L3RA 2CREA 1GBRA 5ECAA 3G71T 5LJ5f 2EBPA 3VU3C 4M77G 4XK8E 3EG9A 2EQMA 3X26B 1YI2T 3JCMg 2PU9B 1WFWA 1OV3A 3QXEB 4JRPA 4BE0A 2P0PA 3M57A 4X34A 1KD1C 2RQRA 3URGA 2MOXA 1WJRA 2WSCE 3A8GB 4E7JA 5GAN5 1KK7A 1TTHB 2RA2A 4RCBA 3V8JA 2QI2A 2HKNA 5GAOq 4QKUA 4J9GA 1X6GA 1VQMQ 1KFZA 2QK0A 2WACA 1QVFP 1PRMC 2FRYA 2H3JA 4EMKB 3GP8A 5GANj 2NLUA 4XU0A 1AZGB 2OTJQ 3H0HA 1UE9A 3DLMA 2K9GA 3CEYA 5CKHA 2HZYA 3OA6A 3PFSA 4PFPA 2DTHA 1KSWA 3E1SA 1RLQC 2LQWA 3S3OA 1WNLA 1W2BP 3CMAT 1PG5B 4XTYA 4BACA 1SSHA 1KQ1A 3OBYA 1M1KR 2ESWA 2KAFA 2KI7A 3QYHB 1UB4A 4RMOA 4N0AC 3SWNB 1MHNA 3I55A 1H3HA 3PNWC 1SPKA 2KGTA 4IUQA 2FZKB 1YJ9A 2J06A 3OYCA 3CCSQ 4MDXA 3HRSA 2JT4A 3MP1A 1N5ZA 1HJDA 2FZCB 1KC8U 2XDPA 2X3XD 5A0LA 2A0FB 1NEGA 2LP5A 1D3BB 2V8KA 1E7OA 1CSKA 2HQHA 3VJPA 2E5QA 2P0KA 1NJIU 3MP8A 2YLBA 4RKUE 1VQNT 2D6FA 3QDFA 1VQKA 4R0KA 3M0SA 4LUEA 4JJBA 1OZ3A 2L2PA 2VXEA 2E64A 2Y4XA 1IHVA 1TWBA 4HVWA 3J80E 2IIMA 2KNBB 2M9UA 3VUZA 2QYZA 1KG1A 2GF7A 1QMCA 1M3AA 3GF5A 3OSSC 1Q82R 1M4ZA 4PJOD 4L59A 4M78G 2RHYA 2ATCB 2PUKB 2RJDA 3CCQT 1H92A 2DL8A 5GMKe 1YJNQ 1M3CA 4HCZA 3S6WA 2DL4A 1XTDA 3M9QA 3OYJA 1RADB 3THKA 3CD6T 4C5HA 1VQLQ 3VRYA 2ZPIB 3SHWA 3G71A 1U1SA 5CKFA 1ZSZB 3JCMd 2WSFE 3EGXA 1YI2A 3GIBA 2D8HA 2PTKA 4JZ4A 1VQ8Q 1UGQB 4C0DB 4M75G 2KVQG 4FCYA 3HSBA 2EPDA 4JS5A 2EVRA 3EG9B 2MIOA 2OAWA 2JVVA 2DVJA 4AG2C 3OYGA 2PZ1A 1WGSA 4C92E 2QTXA 3TVTA 4K11A 5IN1A 3OMGA 4E7KA 1QVPA 3VS1A 1BI1A 3OYMA 3FLGA 1X2KA 1BU1A 1VQ9Q 2VKNA 2IPOB 1M1KC 2O9SA 4ESRA 4E2FB 4OMNA 4A4HA 4J83A 1UG1A 1CKBA 4J7IA 3QPHA 4GY5A 1QCNA 5CK9A 3EG2A 2KXDA 2LCCA 3CMAA 5CQXA 3E2UA 2J6FA 4PJOG 4J8OA 5GAN3 3O8VA 1KJWA 2R57A 2DZCA 2YRVA 4EMHA 2EQIA 2VUBA 3IQLA 2J6KA 2BIVA 2FL7A 4A4FA 5KYUA 3OS2A 4E6RA 2L5QA 3CCJQ 2SRCA 2LC4A 2V8IA 1M8MA 2LX7A 1J3TA 1Y7XA 3OYKA 2E5KA 3L1AA 3QKJA 1K8AU 1I81A 2KRMA 5IT9E 2DEQA 4HCKA 2MCNA 1I5LA 3CCEQ 3JCMf 2JNGA 1K4US 1IGQA 3V7RA 1VQNA 1UGRB 1NLOC 3SFMA 2ZCFB 2ROLA 5GAOn 2K5LA 4AMCA 2E6ZA 2ZZDA 3CCUQ 1T3SA 1ZUKA 2EQKA 3OS5A 1Q82C 2K3YA 2F2WA 3QYGB 4BY6B 2V1QA 1JEGA 2F2XA 4FIBA 1JQQA 2COYA 1BI2A 1YBYA 1TUGB 3JAME 2XIDA 3PTAA 4M7DF 4M77C 4LUDA 4ZGJB 2QEXQ 1V76A 3C0CA 3RMSA 2BZXA 5FW9A 5I22A 2RH2A 3CCQA 1VQOQ 3PVLA 1B7TA 5LJ3e 2KQWA 2DBMA 2EFIA 1K9MR 3ZBDA 1FMWA 3CD6A 3MEUA 4C8QF 3U23A 4C0FA 4C0ZA 4AG1C 1MMNA 3C4SA 1N8RU 3OW2P 1X69A 3L2RA 1Q86U 1B07A 5HCKA 4JPBW 2RI2A 5GMKm 3A8HB 3CCRT 1VQ5Q 5KYXA 1ZA2B 4Q5WA 1YJWT 3MEWA 4QQ6A 3OB9A 2RQWA 1VYTA 5FU7B 1WHMA 2F5TX 2EW3A 4LDUA 5FU6B 3TSWA 5I21A 1OU8A 4IUUA 1PC0A 4DBFA 5GANh 1RUWA 1MNDA 3JRZA 3EGXB 1O75A 2F1LA 1KD1U 1NJIC 3S3NA 2A37A 1WIEA 4C92D 5L8RE 3HPWA 3G6ET 1QVGA 4M7DA 3TSZA 1Q7YR 2K2VA 4F7UF 1UEBA 5CQYA 3JB9J 2HSPA 4FYXB 2GBQA 3KXTA 3E19A 1N9SA 4F17A 1D0YA 2NWMA 2YLCA 5GAMe 1K76A 2L89A 1U06A 2EGCA 1JU5C 4C8QA 1OEBA 1QVFA 3HKSA 1W6XA 2DETA 2B8AA 1PD0A 2WSEE 1U5SA 4J9CA 3EG1A 2V26A 1OX9A 1QP3A 2YXYA 1W2BA 1OQKA 4A53A 4BDYA 3RKWA 3GNFB 3OYBA 4J9FA 1FXXA 5CIUA 3H8ZA 3MO8A 1SHGA 1X01A 2YUOA 4EMGA 3HHTB 3X20B 2JS0A 4J9IA 5KYUB 5L23A 5KYYA 4RTZA 4F7UA 2X4WA 2EWNA 1MV3A 1X43A 3FJPA 2ZPEB 1AZEA 4LDWA 4M78C 4N4GA 2DYBA 3LLRA 4C92G 5IHKA 2RMOA 2RQUA 2EIFA 5IHIA 3LWHA 1D1CA 1JJ2A 1S1NA 2EGEA 3RNJA 5KYWA 2LQNA 1K9MC 5GJVB 5LJ5e 1PRLC 2OJ2A 1BI0A 1AWWA 2FB7A 1UGPB 4GLMA 8AT1B 2EKHA 1G3YA 4P5NA 2CSQA 4M78E 1KHCA 2RQTA 4M75C 4PKCC 2KT1A 4RTXA 3CCVQ 3I55Q 1TXQA 1YITT 3E9FA 2KE9A 4J6XA 1YJ9Q 2X9HA 4BB7A 2QA4T 1H8KA 1GCPA 1YIJT 3CCRA 4JLIA 1D1AA 3LGLA 3Q1JA 2ZGWA 2RHIA 1YJWA 1I5OB 2L8DA 1VIEA 1FX7A 1PM3A 2XHCA 1Q7YC 1M3BA 2M0YA 7AT1B 3H41A 4IIOA 2HBWA 4HCBA 4BE2A 2JN0A 2JTEA 1VQKQ 4IIMA 5KYXB 4M7AF 2DRKA 3TQ7P 5FLXE 1NZ9A 1M30A 1QVGS 2KEAA 2MI6A 3G6EA 4M77F 1P92A 4X1VA 3OS0A 5KH6A 2RO0A 3PGGA 3CC2T 2EQJA 1IB8A 3H6ZA 1VQ4Q 1K73R 1NEBA 2KYBA 2EAYA 4DEYA 4CC2A 1GRIA 2CKKA 4M7DB 1QVFS 1RLPC 2OX7A 3RBBB 2KSSA 2DXBA 1M1KU 2KMTA 2QTVA 4OB1B 2XICA 3CC7T 4KH0B 4GLKA 3TEEA 4BI4A 3HTRA 1UHCA 3CQTA 2EJGA 4C8QB 1AHJB 1R0CB 2DL7A 3G71Q 3BE3A 1W2BS 3FEOA 1KQSP 2EQUA 4DA4A 3GBQA 2RI5A 2E4HA 1YI2Q 1Q86C 1SRMA 3X28B 3LGFA 4M7AA 2OAUA 2YHTA 2D9TA 4OB0B
chains in the Genus database with same CATH topology
4M78G 2RHYA 4M77A 3VYHB 4ELZC 1YHQA 5J26A 3PMIA 2RJDA 2PUKB 5M9OA 2CZ6B 1VUBA 3INZA 5DY9A 3CCQT 4RCCA 2RHZA 4O5VA 1LNXA 2FVUA 3PT9A 4ZN3A 4E7IA 3OSVA 5GMKe 4HCZA 3S6WA 1I8FA 4R55A 1XTDA 3M9QA 3RIRA 3OYJA 3CD6T 2CZ0B 4C8QD 1G3WA 4X9CA 4MZMA 4C5HA 3X25B 3JB9I 4M7AC 1N6AA 4C0DC 3CCUT 2ZPIB 4X9DA 1WQ7A 4M78B 3G71A 4ZGDB 2QDYB 1U1SA 4FT2A 5CKFA 2IVWA 3ER0A 4F7UB 2DTIA 3JCMd 1ZBXA 4XTWA 3FC3A 1JJ2S 2WSFE 2XK0A 3PMTA 3I56A 1YI2A 3GIBA 4OGEA 5HKCA 5DLQE 4JRIA 3LWIA 3V8LA 1VQPT 4J7FA 3F70A 1UGQB 3QBYA 3TREA 4C0DB 4M75G 4XU3A 1Q82U 2KVQG 1ZHIA 1PSFA 5FU7C 3HSBA 2LX9A 2QEXT 4OF1A 2RHUA 2DIGA 1Y71A 5LJ5g 4JS5A 3A8LB 3QZ9B 4D6WA 5GAMj 3CC4A 1VQOT 3JCMX 1Y96B 1BYMA 2JVVA 1KQSS 2VGMA 2RK1A 3OYGA 1YJNA 2PQWA 5CKBA 2BUDA 4YTLA 5LJ3d 3JCMc 4M78D 1WGSA 3OYYA 4C92E 2QTXA 2XDDA 2RM4A 3OYEA 1VQLA 1KQ2A 3J7AF 4M77E 1KC8C 1IREB 4ELYC 2E65A 3OMGA 5IN1A 3OQ5A 4E7KA 4V2SA 1QVPA 4MMLA 5GAN7 4FSXA 2X4YA 3RMQA 4IKFA 1BI1A 1WJQA 3OYMA 3CMET 3RERA 3FLGA 2XD0A 3GOXA 1I4K1 2QA4A 3OBWA 1M1KC 4J6WA 2QQBA 1VQ5T 2Y4YA 2I2LA 2ZPBB 1YIJA 3M4GA 4A4HA 4J83A 3OYAA 1VQMT 1VQ8A 1JB0E 4JRQA 3CCVT 4J7IA 3QPHA 3CCLT 2VXFA 2A7YA 4GY5A 4QVDA 3ME9A 4A4KA 4CRIA 5CK9A 3JCMP 3JB9G 1N27A 4XQ3A 2KDSA 2LCCA 3CMAA 5CQXA 2E1HA 1RI0A 5J3BA 1S72A 1VQ6T 3JCMQ 1NPPA 1OI1A 4PJOG 4A4GA 2AHJB 3NTKA 4M75D 3G4ST 5KE2A 4NL3A 3BW1A 3C95A 3QHSA 3MP6A 4J8OA 4A4EA 5GAN3 2DIQA 3O8VA 4XTXA 4BD3A 2O4XB 2R57A 4FT4A 2DZCA 5CKDA 4QQGA 2YRVA 3SD4A 5GANe 3CPWA 5GAN2 4EMHA 3L2QA 3L2VA 2VUBA 2X35A 5GAN4 2BIVA 3KBGA 1LJOA 2FL7A 2RHXA 4A4FA 3OS2A 4XTUA 4O6JA 4C8QG 2L5QA 3P8DA 3DB4A 3JCMW 2OTLA 2LVMA 4OB3B 2QQAA 1XNIA 2LDMA 3M56A 2XDBA 1VQ9A 2LC4A 2V8IA 3J81E 3WXMB 3CC2A 3GPLA 2P0QA 4IUPA 1Y7XA 3OYKA 3JCMh 2R58A 1QP2A 2DJZA 3L1AA 2GFAA 4M75F 3QKJA 4ATOA 2GCXA 1K8AU 2DZ9A 1I81A 2LQKA 2PVDB 4E47A 5CAIA 1VQ7A 5CR2A 5GANd 5IT9E 2DEQA 5GMKh 5GAMd 1SSFA 2LT1A 3UWNA 3NTHA 4R56A 2GFUA 1I5LA 4CI0C 2CYZB 2E10A 2EKOA 3C12A 5LJ5j 3CCST 2A3LA 3JCMf 4BY6C 2K3XA 2RJCA 2LQ8A 4QQDA 2E41A 2JNGA 3G7ZA 4XU1A 4C0GA 1VQ4T 1B34B 3V7RA 3V8KA 1VQNA 3QZ5B 4II1A 3JCMJ 1UGRB 2F5KA 2JOYA 2K4YA 4L6V5 4E7HA 3SFMA 2ZCFB 3CC7A 5GAOn 3WVDB 4M7DE 2K5LA 2E6ZA 4J6YA 2DXCA 4MZPA 2ZZDA 2OTJA 5A0DA 5C0MA 3GNGA 4HA8A 5LJ3h 3PIOA 1OYXA 2QQRA 2EQKA 1U1TA 2QXFA 4OVAA 3M53A 3JCMe 3OS5A 3CCJA 1Q82C 2JUFA 2MMPA 5I2SA 2X4JA 2K3YA 2LCLA 3ASKA 1X6OA 3LYIA 3QYGB 4BY6B 4F7UG 3CCMA 3OYFA 3FRNA 3HRUA 3JB9H 4QVZA 5DM7R 4C5GA 4FIBA 1QW1A 5LJ3f 1G5VA 4JRKA 3L2WA 1BI2A 1WJSA 1YBYA 2PUOB 3A8OB 4LD9K 3JAME 2XIDA 3PTAA 3JB9F 4M7AG 4C92C 3ZFJA 1OZ2A 5A2QE 4DOWA 4M7DF 1LOJA 3CPFA 2V8JA 4M77C 2CZ7B 4EMKA 4ZGJB 3CCEA 3HL8A 3QSUA 3JCMV 4HT9A 4PJOF 3RMSA 2RH2A 4XAXB 4A54A 5DLOA 2CS7A 5GAOm 3CCQA 5LJ3e 2KQWA 2Y90A 4ZTFA 2VYTA 5EG2A 1GXIE 4FM4B 2EFIA 4M7AB 3ZBDA 3L42A 3M5AA 3CD6A 3MEUA 4M75A 3NFCA 3WVEB 5GAOp 3E9GA 4IURA 1G3TA 3CCUA 4C92B 4C8QF 4HKEA 5FU6C 4C0FA 3N5BB 4C0ZA 4M77B 2E12A 3CBMA 3C4SA 3LH0A 4ZGEB 3NTIA 1N8RU 2ZPFB 3L2RA 5CKEA 3BDUA 1Q86U 4JLGA 3CXCA 2QQ9A 4JUVA 1O9SA 2RI2A 5GMKm 5HY6A 5GAN8 2DAQA 3QG1A 3A8HB 5HK0A 3MHXA 2JZ2A 3CCRT 2P4TA 3SWNA 4Y91A 1M9SA 1VQPA 4QVCA 4KUDK 4Q5WA 4J5YA 1YJWT 3MEWA 4QQ6A 3FB9A 3OB9A 2KK4A 2X4XA 2PVGB 2XG8D 2XKOC 3JSCA 5FU7B 2F5TX 5FU6B 4LDUA 5I21A 5LJ5d 4BE1A 4IUTA 1YITA 2QEXA 3QDRB 4IUUA 4ZN1A 5GANh 3GLXA 3JRZA 2DK3A 2KY9A 1VQOA 1O75A 1M5Q1 5GAMh 5GAOr 1KD1U 1R8OB 1NJIC 4PLLA 5HK3A 4M7AD 4KULA 3VYGA 3S3NA 2VC8A 4OP0A 2M0OA 4C5EA 1K9MU 1X75C 4C92D 2HNIA 3SWNC 3AHUA 1W4SA 2DO3A 5L8RE 5GAN6 3I55T 1G3SA 3HPWA 4M77D 2MAMA 1D3BA 4OGCA 3M59A 4M78F 4PLIA 3RUXA 5GANf 4JS4A 3G6ET 4MZTA 1K8AC 1QVGA 4M7DA 5GAMf 3SB2A 4KT0E 1YJ9T 3OYHA 1PSEA 1JRIA 1XQHA 2HQXA 2K2VA 3MCAB 4F7UF 3CMEA 1M8VA 2OTJT 4LDVA 3HFOA 4PJOA 1UEBA 5CQYA 4BI8B 3JB9J 3OW2A 4M75E 5LL6S 3A5ZB 3VKIA 2BKDN 3KXTA 1VQ5A 1M90U 1RL2A 1K73C 2MF2A 3E19A 2RK2A 4JDSA 1N9SA 1VQMA 1Y07A 3P8HA 4TVRA 2YLCA 3C94A 3OYNA 5GAMe 3CCVA 3UPUA 2L89A 1Q81U 3CCLA 4PNOA 5GAOl 2XI9A 4C8QA 4M7DC 1QVFA 2M16A 3HKSA 3CCET 4PJOC 1VQ6A 5AYFA 3DKMA 5CO7A 2ZPHB 3OYDA 4E7LA 3OYLA 3RKXA 1YCYA 1EIFA 3G4SA 1VQKT 2B8AA 5KCOA 2WSEE 5KE3A 3CPWS 2IG0A 4KBMB 1HK9A 4L59A 5GMKj 4XTVA 4ME7A 5C6SA 4C8QC 5CVIA 5GMKl 3OY9A 3HP9A 2EJFA 1Q7YU 1QP3A 1BIAA 4OB2B 4HT8A 1W2BA 5D6WA 2MWPA 3OMCA 4A53A 4BDYA 2EJ9A 4N4HA 3RKWA 2YHTA 3CBOA 3HFNA 3BDLA 3GNFB 3OYBA 1FXXA 2MWOA 3M58A 4FU6A 4L5GA 3FDRA 3DLLA 5CIUA 4BDZA 3H8ZA 3MO8A 1X01A 1M1FA 3QJYA 2XU8A 3V7SA 4EMGA 3OYIA 2K5IA 3HHTB 4EDUA 3X20B 4M78A 3M54A 3DB3A 4PJOE 2JTFA 1YHQT 4IUVA 3CCSA 4F7UA 2X4WA 4LD6A 4BI3A 4PL6A 5LJ5h 2EWNA 1N8RC 3PIPA 3LW5E 2K57A 3KUFA 3JCMb 1VQ4A 2DPPB 4UC4A 2L3RA 2DD4A 4C8QE 3FJPA 2HQEA 3L2ZA 2ZPEB 4LDWA 4M78C 3G71T 1WPYA 4N4GA 5LJ5f 3LLRA 4C92G 4FL6A 3TCJA 3VU3C 4M77G 2RJFA 2EIFA 4XK8E 3VV0A 3X26B 2E6NA 2EQMA 3EAEA 3I56T 3LWHA 1YI2T 3JCMg 1Y96A 3TU4K 4WF2A 1JJ2A 3M55A 2PU9B 3QXEB 4JRPA 4BE0A 4B9WA 5J39A 2P0PA 3M57A 2GQVA 4X34A 3X24B 3V7CA 1KD1C 3URGA 5I2MA 1WJRA 1K9MC 5LJ5e 2WSCE 1ZQ1A 4XTZA 4EMKC 1BI0A 3A8GB 4E7JA 4ZTJA 1V29B 5GAN5 1BIBA 3CC4T 2FB7A 3HRTA 2G3RA 1N9RA 1UGPB 4JJNK 3QUIA 3RKYA 1KQSA 1YJNT 1G3YA 2RA2A 4P5NA 4RCBA 4B9XA 3V8JA 2QI2A 5GAOq 1VQLT 3RESA 4HCCA 4M78E 1KHCA 4M75C 4PKCC 5LJ3g 2HAXA 1UGSB 4MMKA 1H3ZA 2DD5A 2WACA 1M90C 1YITT 2H3JA 2HBPA 4EPCA 4F7UE 3E9FA 4EMKB 3GP8A 1DJ7B 1Q81C 5GANj 2EYQA 1HXDA 2JTMA 2NLUA 3BY7A 4J6XA 2FHDA 4XU0A 3CXCS 2LT4A 3ZEHA 4BB7A 2QA4T 4LDXA 3DLMA 3CEYA 2FYKA 5CKHA 5CCAA 4M7AE 3OA6A 3PFSA 3OS1A 1YIJT 1JBMA 3MEVA 3R6OA 1VQ8T 5FRMA 2DTHA 3L2UA 3CCRA 4M75B 2O4XA 3CBPA 4N0AA 1NE8A 4JLIA 3LGLA 3E1SA 3Q1JA 2ZGWA 4C5IA 2DXUA 2RHIA 3S3OA 1YJWA 2CZ1B 1WNLA 1U8RA 2L8DA 2QQSA 4OMFB 3CMAT 1S72T 1VIEA 1FX7A 4XTYA 4PJOD 3MEAA 2XHCA 1M1GA 4BACA 1Q7YC 1IZ6A 2RD1A 1H641 1KQ1A 3OBYA 2F69A 4HCBA 1FWZA 5IAYA 2KAFA 4BE2A 2JN0A 3QYHB 1UB4A 2E70A 4RMOA 4M7AF 1TH7A 2VGNA 4N0AC 3SWNB 1MHNA 5FLXE 3I55A 2CGHA 1NZ9A 3PNWC 4RG2A 4C92F 5D6YA 1QVGS 4IUQA 1NPRA 2MI6A 2VV5A 1P92A 4M77F 3G6EA 3OS0A 2OTLT 4MDWA 4M7DG 5GMKi 1YJ9A 2DVEA 2DTOA 5KH6A 3OYCA 2RO0A 3PGGA 3HRSA 1VQ9T 4MDXA 2HD0A 4XU2A 2O01E 1MGQA 5D6XA 3SDZA 3OW2S 3CC2T 2EQJA 2RB6A 3EFRA 2M1HA 3MP1A 5KCHA 3H6ZA 1B34A 1KC8U 2R5AA 2XDPA 3LX7A 4RG8A 5A0LA 2EAYA 2C06A 1VQ7T 1D3BB 2V8KA 2D0QB 2CKKA 5GANg 4BUGA 4M7DB 3VJPA 1QVFS 2DKGA 4Y28E 5GAMg 2R5MA 2E5QA 2KSSA 2P0KA 2RI3A 2DXBA 1NJIU 2ZPGB 3P8BB 3S3MA 1M1KU 3EFSA 2KMTA 4PJOB 5FROA 3MP8A 2YLBA 4QW2A 1XOVA 4RKUE 5A0GA 4OB1B 4VUBA 2RJEA 4Z02A 1VQNT 2D6FA 1VQKA 2XICA 3M4YA 3CC7T 2DXTA 4NOYA 4GLKA 3TEEA 4BI4A 1OZ3A 5LJ3j 4DOVA 2EJGA 4C8QB 1AHJB 2VXEA 2E64A 3BFMA 2Y4XA 3FIFA 3UDCA 3UT1A 3CCJT 1VIFA 3META 3VUBA 1W2BS 3FEOA 4NS5A 3J80E 2LNVA 3QO3A 2M9UA 2EQUA 4DQ2A 3CCMT 4N4IA 4DA4A 2LRQA 1BI3A 2RI5A 3VUZA 1Q86C 1WQWA 2PVOB 5FRNA 3A8MB 1K73U 1KG1A 2GF7A 3X28B 3QJ6A 4LDYA 3JB9D 2LTOA 1KHIA 3LGFA 4M7AA 4M7DD 3QIIA 2OAUA 3GF5A 3OSSC 2K5FA 4C92A 4NL2A 1M4ZA 2D9TA 1BKBA 4KUIA 4OB0B 3T9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R58 A;  2RHY A;  3OYH A;  1KHC A;  2GFA A;  2HQX A;  2RJD A;  3PMI A;  3QKJ A;  5J26 A;  5M9O A;  1H3Z A;  2WAC A;  2RHZ A;  1SSF A;  3E9F A;  3UWN A;  4E7I A;  2BKD N;  4HCZ A;  3NTH A;  3S6W A;  2GFU A;  3M9Q A;  2NLU A;  3OYJ A;  2EKO A;  2FHD A;  4C5H A;  2K3X A;  2RJC A;  3P8H A;  4QQD A;  3OYN A;  3ZEH A;  2L89 A;  3DLM A;  3CEY A;  3OA6 A;  3PFS A;  3OS1 A;  3MEV A;  4II1 A;  2F5K A;  2M16 A;  3L2U A;  5FRM A;  4E7H A;  2O4X A;  4E7L A;  3LGL A;  3OYD A;  2XK0 A;  3PMT A;  3Q1J A;  3FC3 A;  4C5I A;  2RHI A;  3OYL A;  3S3O A;  5C0M A;  1OYX A;  2QQR A;  2EQK A;  2L8D A;  2QQS A;  2B8A A;  4OVA A;  5KCO A;  5KE3 A;  2K3Y A;  3ASK A;  3F70 A;  2IG0 A;  3LYI A;  3MEA A;  3QBY A;  4BAC A;  4L59 A;  3OYF A;  5C6S A;  3OY9 A;  5IAY A;  2RHU A;  2DIG A;  4QVZ A;  4C5G A;  4BE2 A;  1G5V A;  3L2W A;  1MHN A;  1WJS A;  5D6W A;  2MWP A;  3OMC A;  4RG2 A;  3PNW C;  4BDY A;  1OZ2 A;  4N4H A;  5D6Y A;  3BDL A;  4IUQ A;  3OYB A;  3OYG A;  2PQW A;  2MWO A;  2BUD A;  4FU6 A;  3OS0 A;  3FDR A;  5CIU A;  4BDZ A;  3H8Z A;  1WGS A;  3MO8 A;  5KH6 A;  3OYC A;  3OYE A;  2RO0 A;  3OYI A;  5D6X A;  2EQJ A;  3MP1 A;  4EDU A;  2M1H A;  3OMG A;  5IN1 A;  3OQ5 A;  5KCH A;  4E7K A;  3DB3 A;  2JTF A;  3H6Z A;  4ZTF A;  2VYT A;  2X4Y A;  4IKF A;  2R5A A;  2XDP A;  2EFI A;  1WJQ A;  3LX7 A;  4IUV A;  3OYM A;  3L42 A;  3FLG A;  3MEU A;  2X4W A;  4LD6 A;  3E9G A;  4PL6 A;  4IUR A;  3GOX A;  2CKK A;  3KUF A;  2R5M A;  4UC4 A;  2E5Q A;  2P0K A;  2L3R A;  3C4S A;  3LH0 A;  3NTI A;  2RI3 A;  4A4H A;  3OYA A;  3L2R A;  3S3M A;  2HQE A;  5FRO A;  3MP8 A;  4QW2 A;  2RI2 A;  4GY5 A;  3ME9 A;  2DAQ A;  4CRI A;  2RJE A;  4N4G A;  3LLR A;  1N27 A;  4Z02 A;  4FL6 A;  2LCC A;  2JZ2 A;  1RI0 A;  2RJF A;  2E6N A;  2EQM A;  3EAE A;  1OZ3 A;  4Q5W A;  3MEW A;  1OI1 A;  3OB9 A;  4QQ6 A;  2X4X A;  3NTK A;  4A4G A;  4BE0 A;  5KE2 A;  4B9W A;  5J39 A;  3UT1 A;  4X34 A;  4BE1 A;  3MP6 A;  4IUT A;  4A4E A;  2DIQ A;  3O8V A;  4IUU A;  3MET A;  4BD3 A;  2O4X B;  2R57 A;  3FEO A;  1WJR A;  4NS5 A;  4QQG A;  2YRV A;  3SD4 A;  2EQU A;  4N4I A;  3L2Q A;  2LRQ A;  2RI5 A;  2X35 A;  3L2V A;  2BIV A;  4PLL A;  4A4F A;  2RHX A;  5FRN A;  3OS2 A;  4E7J A;  3S3N A;  2GF7 A;  4ZTJ A;  4C5E A;  2M0O A;  3P8D A;  3DB4 A;  3QJ6 A;  2LTO A;  2LVM A;  2G3R A;  3LGF A;  1XNI A;  2LDM A;  3QII A;  4PLI A;  4IUP A;  3OYK A;  2D9T A;  4B9X A; 
#chains in the Genus database with same CATH topology
 3QWX X;  1RAB B;  4M77 A;  3PMI A;  5M9O A;  2CZ6 B;  3INZ A;  4AFQ C;  1LNX A;  3OSV A;  1B3Q A;  2YRC A;  3RIR A;  1WXB A;  4X9D A;  1WQ7 A;  2QGG A;  5KYY B;  3REA B;  3ER0 A;  4F7U B;  2HDA A;  1JJ2 S;  5HKC A;  3LWI A;  1BCM A;  3F70 A;  2DA9 A;  2A28 A;  1Q82 U;  2LX9 A;  1Y71 A;  2FPD A;  3CMA Q;  4B6M A;  2VGM A;  2DIL A;  4FYY B;  5KYW B;  3CPW P;  4D8D A;  4M78 D;  2D8J A;  2RM4 A;  3OYE A;  1KQ2 A;  3J7A F;  4ELY C;  2E65 A;  4HXJ A;  4MML A;  4FSX A;  1RAG B;  4IKF A;  2EYW A;  4Z89 A;  1AVZ C;  3M0Q A;  3GOX A;  2QA4 A;  2I2L A;  1YIJ A;  2BE9 B;  1VQM T;  1SRL A;  4A63 B;  1JB0 E;  1JXM A;  4A4K A;  4XQ3 A;  1VQ6 T;  1R77 A;  3JCM Q;  4DEX A;  3G4S T;  4M75 D;  5KE2 A;  4NL3 A;  3BW1 A;  3QHS A;  1YNZ A;  4A4E A;  2DIQ A;  1VQN Q;  1PKS A;  3EGD A;  4LNP A;  3L2V A;  1SHF A;  3KBG A;  2RHX A;  2FPF A;  4XTU A;  4O6J A;  2DER A;  2LVM A;  4OB3 B;  1XNI A;  3M56 A;  1WHK A;  3J81 E;  3WXM B;  3CC2 A;  3GPL A;  2HCK A;  2P0Q A;  1K9A A;  1RAC B;  4IUP A;  1NYF A;  2DJZ A;  4M75 F;  1Q95 G;  2LJ3 A;  4D8K A;  1MMA A;  1SSF A;  2LT1 A;  2GFU A;  3CCS T;  2JS2 A;  3C12 A;  2A3L A;  2RNA A;  2RJC A;  2FG0 A;  4C0G A;  3CCQ Q;  1TUC A;  4J9H A;  2GTJ A;  4II1 A;  3JCM J;  4L6V 5;  2K4Y A;  4E7H A;  3CC7 A;  3CD6 Q;  4M7D E;  1QKW A;  2D1X A;  5A0D A;  3PIO A;  5LJ3 h;  1OYX A;  3I9Q A;  3M53 A;  2KYM A;  3JCM e;  2AIR B;  2MMP A;  1EZZ B;  2NUT A;  2LCL A;  1X6O A;  3OYF A;  3VS2 A;  1BB9 A;  3M0U A;  1QW1 A;  1G5V A;  1Y0M A;  1PD1 A;  2PUO B;  1WJS A;  1MUZ A;  4LD9 K;  2HL3 A;  4C92 C;  2YUP A;  1LOJ A;  3A1P A;  1OPL A;  3HL8 A;  3O5Z A;  4PJO F;  1TS9 A;  2CS7 A;  1C1A A;  4ZTF A;  5EG2 A;  1GXI E;  4M7A B;  3L42 A;  3NHN A;  4M75 A;  3NFC A;  2BE7 D;  4HKE A;  1VOM A;  4M77 B;  2E12 A;  4ZGE B;  1S72 Q;  4JLG A;  3CXC A;  1O9S A;  3QG1 A;  3MHX A;  3EH1 A;  1M90 R;  1WHH A;  2XG8 D;  1Q81 R;  4J9D A;  2P84 A;  1TG0 A;  1CKA A;  1WZO A;  3GLX A;  5GAM h;  4PLL A;  1UFF A;  2LMJ A;  4KUL A;  3VYG A;  2DL5 A;  2VC8 A;  4OP0 A;  2M0O A;  1K9M U;  2NUZ A;  2DLP A;  3QWY A;  2A08 A;  3SWN C;  1W4S A;  3M59 A;  4JS4 A;  4M4Z A;  4MZT A;  4F16 A;  4KT0 E;  1WI7 A;  3HFO A;  4PJO A;  4BI8 B;  2FEI A;  2RF0 A;  4FYV B;  4J9B A;  3LH5 A;  5LL6 S;  4CC4 B;  3A5Z B;  2DJQ A;  1RL2 A;  2RK2 A;  4JDS A;  1VQM A;  1UEC A;  2QAS A;  3P8H A;  3OYN A;  4QT7 A;  2KRS A;  3A98 A;  5GAO l;  3EFO A;  1D0Z A;  1NYG A;  1ZUY A;  1VQ6 A;  3DKM A;  1WDX A;  3RKX A;  2NYS A;  3G4S A;  3EHQ A;  5KE3 A;  1MV0 B;  4KBM B;  5AT1 B;  5GMK j;  4XTV A;  4ME7 A;  3HP9 A;  1GFC A;  1Q7Y U;  1BIA A;  1E6G A;  2CP2 A;  4HT8 A;  3OMC A;  2EJ9 A;  4N4H A;  1IHW A;  1M2O A;  2MWO A;  4FU6 A;  3FDR A;  3DLL A;  4EIK A;  2CP3 A;  1D0X A;  2CDT A;  2XU8 A;  3EGD B;  2K5I A;  2AKL A;  1YHQ T;  2DBK A;  4IUV A;  2DRM A;  3CCS A;  4BI3 A;  5LJ5 h;  4E7S A;  1YCS B;  4RTU A;  3KUF A;  3H0I A;  3M0R A;  2DD4 A;  1JXO A;  3L2Z A;  4E7Z A;  1WPY A;  4KGZ B;  4FL6 A;  3TCJ A;  4RTV A;  1ZSZ C;  3EAE A;  3I56 T;  4WF2 A;  3M55 A;  1LPL A;  2QDL A;  2GQV A;  2H3E B;  3X24 B;  3V7C A;  2COZ A;  2O2O A;  1ARK A;  4XTZ A;  4ZNX A;  2KXC A;  1YJW Q;  4ZTJ A;  1WA7 A;  1BIB A;  3CC4 T;  2NUT B;  4JJN K;  3QUI A;  1W70 A;  3RKY A;  1KQS A;  1T0H A;  4HCC A;  4MMK A;  1H3Z A;  1M90 C;  2HBP A;  1R0B G;  1I0C A;  2G6F X;  4EPC A;  1UJ0 A;  1Q81 C;  3G6E Q;  2JTM A;  3BY7 A;  2FHD A;  3CXC S;  2ED1 A;  2J6O A;  3I35 A;  4LDX A;  3REB B;  2FYK A;  4M7A E;  1Y57 A;  2VVK A;  3OS1 A;  3R6O A;  5FRM A;  3L2U A;  4M75 B;  4N0A A;  1NE8 A;  2RN8 A;  3VS6 A;  4C5I A;  1AWO A;  2CZ1 B;  1U8R A;  2ECZ A;  3MEA A;  2K2M A;  1M1G A;  1IZ6 A;  1H64 1;  1UTI A;  2F69 A;  1FWZ A;  2E70 A;  1TH7 A;  1QKX A;  1RAH B;  2CGH A;  4C92 F;  5D6Y A;  2LJ1 A;  1NPR A;  4OMO A;  2OTL T;  4MDW A;  4M7D G;  1RI9 A;  2C0T A;  4XU2 A;  2O01 E;  1MGQ A;  2C0I A;  1QCF A;  3EFR A;  4PJM A;  2LNH B;  4DBR A;  3LX7 A;  1IGU A;  1VQ7 T;  2DE0 X;  2D0Q B;  1WYX A;  2X3W D;  4BUG A;  5GAN g;  2DKG A;  2R5M A;  2RI3 A;  4PJO B;  3S3M A;  1TOV A;  6AT1 B;  1K0X A;  4QW2 A;  1XOV A;  2J05 A;  4VUB A;  4Z02 A;  1SF9 A;  2DXT A;  4NOY A;  2K6D A;  5LJ3 j;  3EFO B;  3BFM A;  3UDC A;  1VIF A;  3MET A;  2BZY A;  4NS5 A;  3QO3 A;  3CCM T;  4N4I A;  1Z9Z A;  1BI3 A;  1WQW A;  2PVO B;  1K73 U;  2YUN A;  3JB9 D;  2LTO A;  1VYU A;  2DYI A;  2RQV A;  2O31 A;  2K5F A;  2QAZ A;  2Z0W A;  4C92 A;  1BKB A;  2O88 A;  3T9N A;  4ELZ C;  4RTT A;  1YHQ A;  1N8R R;  2RHZ A;  4O5V A;  4ZN3 A;  1GCQ C;  1I8F A;  2CZ0 B;  1G3W A;  4X9C A;  2FO0 A;  4MZM A;  1VA7 A;  8ATC B;  2QDY B;  1PHT A;  4FT2 A;  2DTI A;  1ZBX A;  3FC3 A;  3PMT A;  3I56 A;  3EHR A;  5DLQ E;  4JRI A;  2QA4 Q;  2J7I A;  1RAF B;  1WXT A;  3UF4 A;  1YIJ Q;  1VQP T;  1RAA B;  3EG0 A;  1ZHI A;  5FU7 C;  1EX4 A;  4OF1 A;  3I5S A;  2RHU A;  2DIG A;  3QZ9 B;  2KT8 A;  5GAM j;  1QWE A;  2BZ8 A;  3CC4 A;  3JCM X;  1BYM A;  1KQS S;  1PKT A;  2DFU A;  2RK1 A;  5CKB A;  2BUD A;  2YSQ A;  2LJ0 A;  2DL3 A;  4PFO A;  3JCM c;  3OYY A;  4Z88 A;  1IRE B;  3OQ5 A;  3UA6 A;  2X4Y A;  3CME T;  3RER A;  1YWP A;  1XJW B;  3CC2 Q;  2AZV A;  3M4G A;  3OYA A;  4JRQ A;  1JO8 A;  3CCV T;  3CCL T;  2VXF A;  2HEQ A;  3ME9 A;  1SEM A;  3JB9 G;  3JCM P;  4KGV B;  2KDS A;  2E1H A;  1RI0 A;  3VS3 A;  1GBQ A;  1NPP A;  4A4G A;  2AHJ B;  4DBQ A;  3C95 A;  3MP6 A;  1K1Z A;  4OML A;  5CKD A;  4QQG A;  3SD4 A;  5GAN e;  1FYN A;  3AT1 B;  5GAN 2;  4JZ3 A;  2DMO A;  4CC7 A;  4FSS A;  3P8D A;  3DB4 A;  3JCM W;  2OTL A;  2QQA A;  2LDM A;  2CP6 A;  1PNJ A;  2A36 A;  3JCM h;  2R58 A;  1QP2 A;  4Y92 A;  2AKK A;  1LCK A;  2FZG B;  2GFA A;  2GCX A;  1YN8 A;  2DZ9 A;  2LQK A;  4E47 A;  1VQ7 A;  5GAN d;  1PWT A;  5GMK h;  3UWN A;  1ZA1 B;  2RPN A;  4R56 A;  5IH2 A;  1UJY A;  5LJ5 j;  2CYZ B;  2EKO A;  3MJX A;  4QQD A;  2E41 A;  4AFZ C;  1VQ4 T;  1HYO A;  3QZ5 B;  4AFU C;  2F5K A;  4MZP A;  2CP0 A;  3GNG A;  4HA8 A;  2QQR A;  4OVA A;  2CUD A;  1NM7 A;  2JUF A;  3ASK A;  1G83 A;  3CCM A;  1X2Q A;  1YP5 A;  2SEM A;  3FRN A;  3HRU A;  4RUG A;  3JB9 H;  4QVZ A;  2COW A;  4C5G A;  3L2W A;  3A8O B;  1MNE A;  4M7A G;  2YRD A;  2KRN A;  2CZ7 B;  2EYZ A;  2L3S A;  1AD5 A;  4HT9 A;  4A54 A;  5DLO A;  1ZBJ A;  2VAS A;  4J9E A;  2DNU A;  1WHG A;  2Y90 A;  2OI3 A;  2VYT A;  3M5A A;  1BCO A;  3WVE B;  5GAO p;  1QVG P;  1G3T A;  4C92 B;  2AZS A;  1NBE B;  3CBM A;  1WXU A;  2C0O A;  3BDU A;  2QQ9 A;  2CUB A;  5HY6 A;  2DAQ A;  2JZ2 A;  4GBQ A;  3M0T A;  2CH4 W;  2P4T A;  2HKQ B;  2VWF A;  4Y91 A;  1VQP A;  4QVC A;  2KK4 A;  3JSC A;  1YIT A;  4BE1 A;  4Z8A A;  3QDR B;  2KY9 A;  1VQ6 Q;  5HK3 A;  2YT6 A;  3G4S Q;  1OU9 A;  4C5E A;  2AK5 A;  2JW4 A;  3VS0 A;  2HNI A;  2MAM A;  4OGC A;  5IHN A;  4M78 F;  5GAN f;  2BTT A;  2YWW A;  2JM8 A;  2HQX A;  1XQH A;  1SG5 A;  1M8V A;  3CME A;  2OTJ T;  4LDV A;  3MPU B;  3OW2 A;  2CSI A;  3VKI A;  2BKD N;  1M90 U;  1K73 C;  2MF2 A;  1RAI B;  3CCV A;  3CCL A;  1Q81 U;  4PNO A;  1U3O A;  4M7D C;  2DM1 A;  2M16 A;  3NMZ C;  5AYF A;  3OYD A;  3M0P A;  2ZPH B;  5CO7 A;  1YCY A;  1EIF A;  1T3L A;  2L0A A;  5KCO A;  1HK9 A;  2D0N A;  4C8Q C;  5CVI A;  5GMK l;  4PJL A;  3OY9 A;  2EJF A;  1FMV A;  1JJ2 P;  5D6W A;  3CBO A;  4HVU A;  3HFN A;  1UGV A;  3M58 A;  1G8X A;  1X27 A;  1M1F A;  4RTY A;  1ZUU A;  4M78 A;  3M54 A;  2NUP A;  1MMG A;  1M2V A;  4PL6 A;  3PIP A;  1AOJ A;  1IXD A;  3LW5 E;  1GCQ A;  1VQ4 A;  2K7A A;  2DPP B;  4HVV A;  5I11 A;  4LE9 A;  4UC4 A;  4C8Q E;  3RDV A;  2HQE A;  4PFZ A;  4KGX B;  1IRX A;  1D09 B;  3VS7 A;  2RJF A;  3VV0 A;  2E6N A;  5IXB A;  1Y96 A;  3TU4 K;  3UA7 A;  4B9W A;  2ENM A;  5J39 A;  1PCX A;  5I2M A;  1ABQ A;  1QLY A;  1ZQ1 A;  1C6V X;  4EMK C;  1V29 B;  1C0M A;  2B86 A;  2HMA A;  3HRT A;  2G3R A;  1N9R A;  4FW2 A;  1YJN T;  3VRZ A;  4B9X A;  2ROT A;  3RES A;  1VQL T;  5LJ3 g;  1UGS B;  1EFN A;  2DD5 A;  3I5R A;  1HSQ A;  4F7U E;  1DJ7 B;  2HSE B;  2JXB A;  1F1B B;  1HXD A;  2EYQ A;  1A0N B;  2LT4 A;  1AWX A;  3ZEH A;  1K0S A;  5CCA A;  2XMF A;  1OPK A;  1JBM A;  3MEV A;  2LCS A;  1VQ8 T;  1KC8 R;  2O4X A;  3CBP A;  2MK5 A;  2DXU A;  1QQJ A;  2QQS A;  4OMF B;  4F04 B;  1S72 T;  2X51 A;  2FPE A;  2QG9 B;  2RD1 A;  1NJI R;  5IAY A;  1GFD A;  2H8H A;  2VGN A;  2GTO A;  3UAT A;  1TU0 B;  4RG2 A;  2VV5 A;  3SEM A;  3EGU A;  5GMK i;  2DVE A;  2DTO A;  1VQ9 T;  2HD0 A;  5D6X A;  3OW2 S;  2ABL A;  2OTJ A;  3SDZ A;  1AEY A;  3FJ5 A;  2RB6 A;  2M1H A;  5KCH A;  1B34 A;  1M27 C;  1OUL A;  2R5A A;  4RG8 A;  2C06 A;  4PK4 A;  2P4R A;  1KIK A;  2L3Q A;  2JMA A;  4Y28 E;  5GAM g;  2V1R A;  1YHQ Q;  2ZPG B;  3P8B B;  3EFS A;  3VS4 A;  5FRO A;  2CT3 A;  5GJW B;  4WCI A;  5A0G A;  2RJE A;  5FWB A;  3M4Y A;  1TUD A;  1VYV A;  4JJC A;  1ACM B;  4DOV A;  2CP5 A;  3FIF A;  3UT1 A;  3CCJ T;  2CT4 A;  1UDL A;  1ZSG A;  3VUB A;  2LNV A;  1IO6 A;  4DQ2 A;  2LRQ A;  2O9V A;  3I56 Q;  2DF6 A;  5FRN A;  1QCO A;  3A8M B;  3QJ6 A;  4LDY A;  2W0Z A;  1KHI A;  4M7D D;  3QII A;  4KH1 B;  4NL2 A;  5GAN 8;  3CCE T;  4KUI A;  3VYH B;  2JM9 A;  5J26 A;  2LZ6 B;  1VUB A;  4DBH A;  5DY9 A;  3CC4 Q;  4RCC A;  3D7S B;  3PT9 A;  2FVU A;  2KR3 A;  4E7I A;  3NPF A;  4R55 A;  4ORZ A;  4C8Q D;  3JB9 I;  3CCR Q;  4M7A C;  3X25 B;  1QWF A;  2DX1 A;  1N6A A;  4C0D C;  3CCU T;  4M78 B;  2E3H A;  5EC7 A;  1G2B A;  2NUP B;  2K79 A;  4ZGD B;  2JJ9 A;  1FMK A;  2IVW A;  1M2V B;  4XTW A;  2XK0 A;  4OGE A;  2E3I A;  3V8L A;  1E6H A;  4J7F A;  4PJJ A;  3QBY A;  3TRE A;  2F2V A;  4FW1 A;  4XU3 A;  1PSF A;  2QEX T;  1ZX6 A;  5LJ5 g;  3A8L B;  4D6W A;  1VQO T;  1Y96 B;  1X6B A;  1YJN A;  2PQW A;  4YTL A;  5LJ3 d;  2XDD A;  1VQL A;  5KYN A;  3G1J A;  4M77 E;  1KC8 C;  3PVQ A;  4V2S A;  5GAN 7;  2HL5 C;  3RMQ A;  2M51 A;  1WJQ A;  1BBZ A;  2OTL Q;  2XD0 A;  1SKU B;  9ATC B;  1V1C A;  1I4K 1;  3OBW A;  4LN2 A;  4J6W A;  2QQB A;  1VQ5 T;  2Y4Y A;  2EYX A;  2ZPB B;  1VQ8 A;  3NGP A;  2CH4 A;  1K8A R;  2A7Y A;  1VQ7 Q;  4QVD A;  4CRI A;  1N27 A;  1S72 A;  5J3B A;  1GL5 A;  3RR6 A;  4WTO B;  1OI1 A;  3NTK A;  2EGA A;  4XTX A;  4BD3 A;  2O4X B;  4FT4 A;  1ABO A;  2PNI A;  3CPW A;  3L2Q A;  1ZLM A;  2X35 A;  4OMQ A;  5GAN 4;  1LJO A;  4C8Q G;  3EG3 A;  2XDB A;  1VQ9 A;  3R6N A;  1T0J A;  3CCM Q;  3ZL7 C;  5IXF A;  2PVD B;  5CAI A;  4AT1 B;  5CR2 A;  1WX6 A;  5GAM d;  2YUQ A;  3NTH A;  3VS5 A;  2E10 A;  4CI0 C;  2KRO A;  1BK2 A;  4BY6 C;  2K3X A;  4XU1 A;  2LQ8 A;  2ZAE A;  3G7Z A;  2MPX C;  2GQI A;  1B34 B;  3V8K A;  1RAE B;  2JOY A;  2CP7 A;  3WVD B;  1WLP B;  4J6Y A;  2DXC A;  2EYY A;  2YDL A;  2HAX A;  5C0M A;  4ATO A;  1U1T A;  2QXF A;  3CCJ A;  3CXC P;  5I2S A;  4F14 A;  4OMM A;  2X4J A;  2DEU A;  3LYI A;  2GNC A;  4F7U G;  1TSF A;  1Q86 R;  5DM7 R;  5LJ3 f;  4JRK A;  4PJN A;  1VQP Q;  1AWJ A;  3JB9 F;  3ZFJ A;  1OZ2 A;  5A2Q E;  4DOW A;  3CPF A;  2V8J A;  1YIT Q;  1I07 A;  4EMK A;  2W10 A;  3CCE A;  3QSU A;  3JCM V;  4XAX B;  5GAO m;  4OMP A;  4CC3 A;  1KD1 R;  1OX8 A;  4FM4 B;  3PE0 A;  1WHL A;  3E9G A;  4FYW B;  1HD3 A;  4IUR A;  3CCU A;  5FU6 C;  2AT1 B;  5D7U A;  3N5B B;  3LH0 A;  3NTI A;  2ZPF B;  5CKE A;  1NG2 A;  2I0N A;  3MKD A;  3CME Q;  4JUV A;  3KFV A;  5HK0 A;  1WHJ A;  4JJD A;  1YFN A;  3SWN A;  1M9S A;  4KUD K;  4J5Y A;  3FB9 A;  2X4X A;  2QGF B;  2PVG B;  2XKO C;  3CCL Q;  5LJ5 d;  4IUT A;  2QEX A;  4ZN1 A;  2VB6 A;  2DK3 A;  1VQO A;  2ED0 A;  5GAO r;  1M5Q 1;  1R8O B;  2KBT A;  4M7A D;  1NLP C;  3ULR B;  1X75 C;  1D1B A;  1YWO A;  3AHU A;  5GAN 6;  2DO3 A;  3I55 T;  1G3S A;  1OOT A;  4M77 D;  1UHF A;  1D3B A;  4KRT A;  4PLI A;  3RUX A;  1K8A C;  5GAM f;  3SB2 A;  1MMD A;  3H9N A;  1YJ9 T;  3OYH A;  1PSE A;  1JRI A;  3MCA B;  2M02 A;  4M75 E;  1VQ5 A;  2MYS A;  3H0F A;  3CC7 Q;  1Y07 A;  4TVR A;  3UPU A;  3C94 A;  2XI9 A;  1LVK A;  4PJO C;  4E7L A;  2GGR A;  2K3B A;  3OYL A;  1VQK T;  2JMC A;  4RTW A;  2FRW A;  3CPW S;  2IG0 A;  5C6S A;  1W1F A;  4OB2 B;  1Z9Q A;  2L3P A;  2MWP A;  3BDL A;  1I1J A;  4L5G A;  4BDZ A;  3QJY A;  3V7S A;  3OYI A;  1AT1 B;  1UUE A;  4EDU A;  4LXC A;  4ANJ A;  3DB3 A;  4PJO E;  2JTF A;  4AFS C;  1ZSZ A;  4LD6 A;  3JV3 A;  1N8R C;  3EH2 A;  2K57 A;  3JCM b;  5FWC A;  2L3R A;  2CRE A;  1GBR A;  5ECA A;  3G71 T;  5LJ5 f;  2EBP A;  3VU3 C;  4M77 G;  4XK8 E;  3EG9 A;  2EQM A;  3X26 B;  1YI2 T;  3JCM g;  2PU9 B;  1WFW A;  1OV3 A;  3QXE B;  4JRP A;  4BE0 A;  2P0P A;  3M57 A;  4X34 A;  1KD1 C;  2RQR A;  3URG A;  2MOX A;  1WJR A;  2WSC E;  3A8G B;  4E7J A;  5GAN 5;  1KK7 A;  1TTH B;  2RA2 A;  4RCB A;  3V8J A;  2QI2 A;  2HKN A;  5GAO q;  4QKU A;  4J9G A;  1X6G A;  1VQM Q;  1KFZ A;  2QK0 A;  2WAC A;  1QVF P;  1PRM C;  2FRY A;  2H3J A;  4EMK B;  3GP8 A;  5GAN j;  2NLU A;  4XU0 A;  1AZG B;  2OTJ Q;  3H0H A;  1UE9 A;  3DLM A;  2K9G A;  3CEY A;  5CKH A;  2HZY A;  3OA6 A;  3PFS A;  4PFP A;  2DTH A;  1KSW A;  3E1S A;  1RLQ C;  2LQW A;  3S3O A;  1WNL A;  1W2B P;  3CMA T;  1PG5 B;  4XTY A;  4BAC A;  1SSH A;  1KQ1 A;  3OBY A;  1M1K R;  2ESW A;  2KAF A;  2KI7 A;  3QYH B;  1UB4 A;  4RMO A;  4N0A C;  3SWN B;  1MHN A;  3I55 A;  1H3H A;  3PNW C;  1SPK A;  2KGT A;  4IUQ A;  2FZK B;  1YJ9 A;  2J06 A;  3OYC A;  3CCS Q;  4MDX A;  3HRS A;  2JT4 A;  3MP1 A;  1N5Z A;  1HJD A;  2FZC B;  1KC8 U;  2XDP A;  2X3X D;  5A0L A;  2A0F B;  1NEG A;  2LP5 A;  1D3B B;  2V8K A;  1E7O A;  1CSK A;  2HQH A;  3VJP A;  2E5Q A;  2P0K A;  1NJI U;  3MP8 A;  2YLB A;  4RKU E;  1VQN T;  2D6F A;  3QDF A;  1VQK A;  4R0K A;  3M0S A;  4LUE A;  4JJB A;  1OZ3 A;  2L2P A;  2VXE A;  2E64 A;  2Y4X A;  1IHV A;  1TWB A;  4HVW A;  3J80 E;  2IIM A;  2KNB B;  2M9U A;  3VUZ A;  2QYZ A;  1KG1 A;  2GF7 A;  1QMC A;  1M3A A;  3GF5 A;  3OSS C;  1Q82 R;  1M4Z A;  4PJO D;  4L59 A;  4M78 G;  2RHY A;  2ATC B;  2PUK B;  2RJD A;  3CCQ T;  1H92 A;  2DL8 A;  5GMK e;  1YJN Q;  1M3C A;  4HCZ A;  3S6W A;  2DL4 A;  1XTD A;  3M9Q A;  3OYJ A;  1RAD B;  3THK A;  3CD6 T;  4C5H A;  1VQL Q;  3VRY A;  2ZPI B;  3SHW A;  3G71 A;  1U1S A;  5CKF A;  1ZSZ B;  3JCM d;  2WSF E;  3EGX A;  1YI2 A;  3GIB A;  2D8H A;  2PTK A;  4JZ4 A;  1VQ8 Q;  1UGQ B;  4C0D B;  4M75 G;  2KVQ G;  4FCY A;  3HSB A;  2EPD A;  4JS5 A;  2EVR A;  3EG9 B;  2MIO A;  2OAW A;  2JVV A;  2DVJ A;  4AG2 C;  3OYG A;  2PZ1 A;  1WGS A;  4C92 E;  2QTX A;  3TVT A;  4K11 A;  5IN1 A;  3OMG A;  4E7K A;  1QVP A;  3VS1 A;  1BI1 A;  3OYM A;  3FLG A;  1X2K A;  1BU1 A;  1VQ9 Q;  2VKN A;  2IPO B;  1M1K C;  2O9S A;  4ESR A;  4E2F B;  4OMN A;  4A4H A;  4J83 A;  1UG1 A;  1CKB A;  4J7I A;  3QPH A;  4GY5 A;  1QCN A;  5CK9 A;  3EG2 A;  2KXD A;  2LCC A;  3CMA A;  5CQX A;  3E2U A;  2J6F A;  4PJO G;  4J8O A;  5GAN 3;  3O8V A;  1KJW A;  2R57 A;  2DZC A;  2YRV A;  4EMH A;  2EQI A;  2VUB A;  3IQL A;  2J6K A;  2BIV A;  2FL7 A;  4A4F A;  5KYU A;  3OS2 A;  4E6R A;  2L5Q A;  3CCJ Q;  2SRC A;  2LC4 A;  2V8I A;  1M8M A;  2LX7 A;  1J3T A;  1Y7X A;  3OYK A;  2E5K A;  3L1A A;  3QKJ A;  1K8A U;  1I81 A;  2KRM A;  5IT9 E;  2DEQ A;  4HCK A;  2MCN A;  1I5L A;  3CCE Q;  3JCM f;  2JNG A;  1K4U S;  1IGQ A;  3V7R A;  1VQN A;  1UGR B;  1NLO C;  3SFM A;  2ZCF B;  2ROL A;  5GAO n;  2K5L A;  4AMC A;  2E6Z A;  2ZZD A;  3CCU Q;  1T3S A;  1ZUK A;  2EQK A;  3OS5 A;  1Q82 C;  2K3Y A;  2F2W A;  3QYG B;  4BY6 B;  2V1Q A;  1JEG A;  2F2X A;  4FIB A;  1JQQ A;  2COY A;  1BI2 A;  1YBY A;  1TUG B;  3JAM E;  2XID A;  3PTA A;  4M7D F;  4M77 C;  4LUD A;  4ZGJ B;  2QEX Q;  1V76 A;  3C0C A;  3RMS A;  2BZX A;  5FW9 A;  5I22 A;  2RH2 A;  3CCQ A;  1VQO Q;  3PVL A;  1B7T A;  5LJ3 e;  2KQW A;  2DBM A;  2EFI A;  1K9M R;  3ZBD A;  1FMW A;  3CD6 A;  3MEU A;  4C8Q F;  3U23 A;  4C0F A;  4C0Z A;  4AG1 C;  1MMN A;  3C4S A;  1N8R U;  3OW2 P;  1X69 A;  3L2R A;  1Q86 U;  1B07 A;  5HCK A;  4JPB W;  2RI2 A;  5GMK m;  3A8H B;  3CCR T;  1VQ5 Q;  5KYX A;  1ZA2 B;  4Q5W A;  1YJW T;  3MEW A;  4QQ6 A;  3OB9 A;  2RQW A;  1VYT A;  5FU7 B;  1WHM A;  2F5T X;  2EW3 A;  4LDU A;  5FU6 B;  3TSW A;  5I21 A;  1OU8 A;  4IUU A;  1PC0 A;  4DBF A;  5GAN h;  1RUW A;  1MND A;  3JRZ A;  3EGX B;  1O75 A;  2F1L A;  1KD1 U;  1NJI C;  3S3N A;  2A37 A;  1WIE A;  4C92 D;  5L8R E;  3HPW A;  3G6E T;  1QVG A;  4M7D A;  3TSZ A;  1Q7Y R;  2K2V A;  4F7U F;  1UEB A;  5CQY A;  3JB9 J;  2HSP A;  4FYX B;  2GBQ A;  3KXT A;  3E19 A;  1N9S A;  4F17 A;  1D0Y A;  2NWM A;  2YLC A;  5GAM e;  1K76 A;  2L89 A;  1U06 A;  2EGC A;  1JU5 C;  4C8Q A;  1OEB A;  1QVF A;  3HKS A;  1W6X A;  2DET A;  2B8A A;  1PD0 A;  2WSE E;  1U5S A;  4J9C A;  3EG1 A;  2V26 A;  1OX9 A;  1QP3 A;  2YXY A;  1W2B A;  1OQK A;  4A53 A;  4BDY A;  3RKW A;  3GNF B;  3OYB A;  4J9F A;  1FXX A;  5CIU A;  3H8Z A;  3MO8 A;  1SHG A;  1X01 A;  2YUO A;  4EMG A;  3HHT B;  3X20 B;  2JS0 A;  4J9I A;  5KYU B;  5L23 A;  5KYY A;  4RTZ A;  4F7U A;  2X4W A;  2EWN A;  1MV3 A;  1X43 A;  3FJP A;  2ZPE B;  1AZE A;  4LDW A;  4M78 C;  4N4G A;  2DYB A;  3LLR A;  4C92 G;  5IHK A;  2RMO A;  2RQU A;  2EIF A;  5IHI A;  3LWH A;  1D1C A;  1JJ2 A;  1S1N A;  2EGE A;  3RNJ A;  5KYW A;  2LQN A;  1K9M C;  5GJV B;  5LJ5 e;  1PRL C;  2OJ2 A;  1BI0 A;  1AWW A;  2FB7 A;  1UGP B;  4GLM A;  8AT1 B;  2EKH A;  1G3Y A;  4P5N A;  2CSQ A;  4M78 E;  1KHC A;  2RQT A;  4M75 C;  4PKC C;  2KT1 A;  4RTX A;  3CCV Q;  3I55 Q;  1TXQ A;  1YIT T;  3E9F A;  2KE9 A;  4J6X A;  1YJ9 Q;  2X9H A;  4BB7 A;  2QA4 T;  1H8K A;  1GCP A;  1YIJ T;  3CCR A;  4JLI A;  1D1A A;  3LGL A;  3Q1J A;  2ZGW A;  2RHI A;  1YJW A;  1I5O B;  2L8D A;  1VIE A;  1FX7 A;  1PM3 A;  2XHC A;  1Q7Y C;  1M3B A;  2M0Y A;  7AT1 B;  3H41 A;  4IIO A;  2HBW A;  4HCB A;  4BE2 A;  2JN0 A;  2JTE A;  1VQK Q;  4IIM A;  5KYX B;  4M7A F;  2DRK A;  3TQ7 P;  5FLX E;  1NZ9 A;  1M30 A;  1QVG S;  2KEA A;  2MI6 A;  3G6E A;  4M77 F;  1P92 A;  4X1V A;  3OS0 A;  5KH6 A;  2RO0 A;  3PGG A;  3CC2 T;  2EQJ A;  1IB8 A;  3H6Z A;  1VQ4 Q;  1K73 R;  1NEB A;  2KYB A;  2EAY A;  4DEY A;  4CC2 A;  1GRI A;  2CKK A;  4M7D B;  1QVF S;  1RLP C;  2OX7 A;  3RBB B;  2KSS A;  2DXB A;  1M1K U;  2KMT A;  2QTV A;  4OB1 B;  2XIC A;  3CC7 T;  4KH0 B;  4GLK A;  3TEE A;  4BI4 A;  3HTR A;  1UHC A;  3CQT A;  2EJG A;  4C8Q B;  1AHJ B;  1R0C B;  2DL7 A;  3G71 Q;  3BE3 A;  1W2B S;  3FEO A;  1KQS P;  2EQU A;  4DA4 A;  3GBQ A;  2RI5 A;  2E4H A;  1YI2 Q;  1Q86 C;  1SRM A;  3X28 B;  3LGF A;  4M7A A;  2OAU A;  2YHT A;  2D9T A;  4OB0 B; 
#chains in the Genus database with same CATH homology
 4M78 G;  2RHY A;  4M77 A;  3VYH B;  4ELZ C;  1YHQ A;  5J26 A;  3PMI A;  2RJD A;  2PUK B;  5M9O A;  2CZ6 B;  1VUB A;  3INZ A;  5DY9 A;  3CCQ T;  4RCC A;  2RHZ A;  4O5V A;  1LNX A;  2FVU A;  3PT9 A;  4ZN3 A;  4E7I A;  3OSV A;  5GMK e;  4HCZ A;  3S6W A;  1I8F A;  4R55 A;  1XTD A;  3M9Q A;  3RIR A;  3OYJ A;  3CD6 T;  2CZ0 B;  4C8Q D;  1G3W A;  4X9C A;  4MZM A;  4C5H A;  3X25 B;  3JB9 I;  4M7A C;  1N6A A;  4C0D C;  3CCU T;  2ZPI B;  4X9D A;  1WQ7 A;  4M78 B;  3G71 A;  4ZGD B;  2QDY B;  1U1S A;  4FT2 A;  5CKF A;  2IVW A;  3ER0 A;  4F7U B;  2DTI A;  3JCM d;  1ZBX A;  4XTW A;  3FC3 A;  1JJ2 S;  2WSF E;  2XK0 A;  3PMT A;  3I56 A;  1YI2 A;  3GIB A;  4OGE A;  5HKC A;  5DLQ E;  4JRI A;  3LWI A;  3V8L A;  1VQP T;  4J7F A;  3F70 A;  1UGQ B;  3QBY A;  3TRE A;  4C0D B;  4M75 G;  4XU3 A;  1Q82 U;  2KVQ G;  1ZHI A;  1PSF A;  5FU7 C;  3HSB A;  2LX9 A;  2QEX T;  4OF1 A;  2RHU A;  2DIG A;  1Y71 A;  5LJ5 g;  4JS5 A;  3A8L B;  3QZ9 B;  4D6W A;  5GAM j;  3CC4 A;  1VQO T;  3JCM X;  1Y96 B;  1BYM A;  2JVV A;  1KQS S;  2VGM A;  2RK1 A;  3OYG A;  1YJN A;  2PQW A;  5CKB A;  2BUD A;  4YTL A;  5LJ3 d;  3JCM c;  4M78 D;  1WGS A;  3OYY A;  4C92 E;  2QTX A;  2XDD A;  2RM4 A;  3OYE A;  1VQL A;  1KQ2 A;  3J7A F;  4M77 E;  1KC8 C;  1IRE B;  4ELY C;  2E65 A;  3OMG A;  5IN1 A;  3OQ5 A;  4E7K A;  4V2S A;  1QVP A;  4MML A;  5GAN 7;  4FSX A;  2X4Y A;  3RMQ A;  4IKF A;  1BI1 A;  1WJQ A;  3OYM A;  3CME T;  3RER A;  3FLG A;  2XD0 A;  3GOX A;  1I4K 1;  2QA4 A;  3OBW A;  1M1K C;  4J6W A;  2QQB A;  1VQ5 T;  2Y4Y A;  2I2L A;  2ZPB B;  1YIJ A;  3M4G A;  4A4H A;  4J83 A;  3OYA A;  1VQM T;  1VQ8 A;  1JB0 E;  4JRQ A;  3CCV T;  4J7I A;  3QPH A;  3CCL T;  2VXF A;  2A7Y A;  4GY5 A;  4QVD A;  3ME9 A;  4A4K A;  4CRI A;  5CK9 A;  3JCM P;  3JB9 G;  1N27 A;  4XQ3 A;  2KDS A;  2LCC A;  3CMA A;  5CQX A;  2E1H A;  1RI0 A;  5J3B A;  1S72 A;  1VQ6 T;  3JCM Q;  1NPP A;  1OI1 A;  4PJO G;  4A4G A;  2AHJ B;  3NTK A;  4M75 D;  3G4S T;  5KE2 A;  4NL3 A;  3BW1 A;  3C95 A;  3QHS A;  3MP6 A;  4J8O A;  4A4E A;  5GAN 3;  2DIQ A;  3O8V A;  4XTX A;  4BD3 A;  2O4X B;  2R57 A;  4FT4 A;  2DZC A;  5CKD A;  4QQG A;  2YRV A;  3SD4 A;  5GAN e;  3CPW A;  5GAN 2;  4EMH A;  3L2Q A;  3L2V A;  2VUB A;  2X35 A;  5GAN 4;  2BIV A;  3KBG A;  1LJO A;  2FL7 A;  2RHX A;  4A4F A;  3OS2 A;  4XTU A;  4O6J A;  4C8Q G;  2L5Q A;  3P8D A;  3DB4 A;  3JCM W;  2OTL A;  2LVM A;  4OB3 B;  2QQA A;  1XNI A;  2LDM A;  3M56 A;  2XDB A;  1VQ9 A;  2LC4 A;  2V8I A;  3J81 E;  3WXM B;  3CC2 A;  3GPL A;  2P0Q A;  4IUP A;  1Y7X A;  3OYK A;  3JCM h;  2R58 A;  1QP2 A;  2DJZ A;  3L1A A;  2GFA A;  4M75 F;  3QKJ A;  4ATO A;  2GCX A;  1K8A U;  2DZ9 A;  1I81 A;  2LQK A;  2PVD B;  4E47 A;  5CAI A;  1VQ7 A;  5CR2 A;  5GAN d;  5IT9 E;  2DEQ A;  5GMK h;  5GAM d;  1SSF A;  2LT1 A;  3UWN A;  3NTH A;  4R56 A;  2GFU A;  1I5L A;  4CI0 C;  2CYZ B;  2E10 A;  2EKO A;  3C12 A;  5LJ5 j;  3CCS T;  2A3L A;  3JCM f;  4BY6 C;  2K3X A;  2RJC A;  2LQ8 A;  4QQD A;  2E41 A;  2JNG A;  3G7Z A;  4XU1 A;  4C0G A;  1VQ4 T;  1B34 B;  3V7R A;  3V8K A;  1VQN A;  3QZ5 B;  4II1 A;  3JCM J;  1UGR B;  2F5K A;  2JOY A;  2K4Y A;  4L6V 5;  4E7H A;  3SFM A;  2ZCF B;  3CC7 A;  5GAO n;  3WVD B;  4M7D E;  2K5L A;  2E6Z A;  4J6Y A;  2DXC A;  4MZP A;  2ZZD A;  2OTJ A;  5A0D A;  5C0M A;  3GNG A;  4HA8 A;  5LJ3 h;  3PIO A;  1OYX A;  2QQR A;  2EQK A;  1U1T A;  2QXF A;  4OVA A;  3M53 A;  3JCM e;  3OS5 A;  3CCJ A;  1Q82 C;  2JUF A;  2MMP A;  5I2S A;  2X4J A;  2K3Y A;  2LCL A;  3ASK A;  1X6O A;  3LYI A;  3QYG B;  4BY6 B;  4F7U G;  3CCM A;  3OYF A;  3FRN A;  3HRU A;  3JB9 H;  4QVZ A;  5DM7 R;  4C5G A;  4FIB A;  1QW1 A;  5LJ3 f;  1G5V A;  4JRK A;  3L2W A;  1BI2 A;  1WJS A;  1YBY A;  2PUO B;  3A8O B;  4LD9 K;  3JAM E;  2XID A;  3PTA A;  3JB9 F;  4M7A G;  4C92 C;  3ZFJ A;  1OZ2 A;  5A2Q E;  4DOW A;  4M7D F;  1LOJ A;  3CPF A;  2V8J A;  4M77 C;  2CZ7 B;  4EMK A;  4ZGJ B;  3CCE A;  3HL8 A;  3QSU A;  3JCM V;  4HT9 A;  4PJO F;  3RMS A;  2RH2 A;  4XAX B;  4A54 A;  5DLO A;  2CS7 A;  5GAO m;  3CCQ A;  5LJ3 e;  2KQW A;  2Y90 A;  4ZTF A;  2VYT A;  5EG2 A;  1GXI E;  4FM4 B;  2EFI A;  4M7A B;  3ZBD A;  3L42 A;  3M5A A;  3CD6 A;  3MEU A;  4M75 A;  3NFC A;  3WVE B;  5GAO p;  3E9G A;  4IUR A;  1G3T A;  3CCU A;  4C92 B;  4C8Q F;  4HKE A;  5FU6 C;  4C0F A;  3N5B B;  4C0Z A;  4M77 B;  2E12 A;  3CBM A;  3C4S A;  3LH0 A;  4ZGE B;  3NTI A;  1N8R U;  2ZPF B;  3L2R A;  5CKE A;  3BDU A;  1Q86 U;  4JLG A;  3CXC A;  2QQ9 A;  4JUV A;  1O9S A;  2RI2 A;  5GMK m;  5HY6 A;  5GAN 8;  2DAQ A;  3QG1 A;  3A8H B;  5HK0 A;  3MHX A;  2JZ2 A;  3CCR T;  2P4T A;  3SWN A;  4Y91 A;  1M9S A;  1VQP A;  4QVC A;  4KUD K;  4Q5W A;  4J5Y A;  1YJW T;  3MEW A;  4QQ6 A;  3FB9 A;  3OB9 A;  2KK4 A;  2X4X A;  2PVG B;  2XG8 D;  2XKO C;  3JSC A;  5FU7 B;  2F5T X;  5FU6 B;  4LDU A;  5I21 A;  5LJ5 d;  4BE1 A;  4IUT A;  1YIT A;  2QEX A;  3QDR B;  4IUU A;  4ZN1 A;  5GAN h;  3GLX A;  3JRZ A;  2DK3 A;  2KY9 A;  1VQO A;  1O75 A;  1M5Q 1;  5GAM h;  5GAO r;  1KD1 U;  1R8O B;  1NJI C;  4PLL A;  5HK3 A;  4M7A D;  4KUL A;  3VYG A;  3S3N A;  2VC8 A;  4OP0 A;  2M0O A;  4C5E A;  1K9M U;  1X75 C;  4C92 D;  2HNI A;  3SWN C;  3AHU A;  1W4S A;  2DO3 A;  5L8R E;  5GAN 6;  3I55 T;  1G3S A;  3HPW A;  4M77 D;  2MAM A;  1D3B A;  4OGC A;  3M59 A;  4M78 F;  4PLI A;  3RUX A;  5GAN f;  4JS4 A;  3G6E T;  4MZT A;  1K8A C;  1QVG A;  4M7D A;  5GAM f;  3SB2 A;  4KT0 E;  1YJ9 T;  3OYH A;  1PSE A;  1JRI A;  1XQH A;  2HQX A;  2K2V A;  3MCA B;  4F7U F;  3CME A;  1M8V A;  2OTJ T;  4LDV A;  3HFO A;  4PJO A;  1UEB A;  5CQY A;  4BI8 B;  3JB9 J;  3OW2 A;  4M75 E;  5LL6 S;  3A5Z B;  3VKI A;  2BKD N;  3KXT A;  1VQ5 A;  1M90 U;  1RL2 A;  1K73 C;  2MF2 A;  3E19 A;  2RK2 A;  4JDS A;  1N9S A;  1VQM A;  1Y07 A;  3P8H A;  4TVR A;  2YLC A;  3C94 A;  3OYN A;  5GAM e;  3CCV A;  3UPU A;  2L89 A;  1Q81 U;  3CCL A;  4PNO A;  5GAO l;  2XI9 A;  4C8Q A;  4M7D C;  1QVF A;  2M16 A;  3HKS A;  3CCE T;  4PJO C;  1VQ6 A;  5AYF A;  3DKM A;  5CO7 A;  2ZPH B;  3OYD A;  4E7L A;  3OYL A;  3RKX A;  1YCY A;  1EIF A;  3G4S A;  1VQK T;  2B8A A;  5KCO A;  2WSE E;  5KE3 A;  3CPW S;  2IG0 A;  4KBM B;  1HK9 A;  4L59 A;  5GMK j;  4XTV A;  4ME7 A;  5C6S A;  4C8Q C;  5CVI A;  5GMK l;  3OY9 A;  3HP9 A;  2EJF A;  1Q7Y U;  1QP3 A;  1BIA A;  4OB2 B;  4HT8 A;  1W2B A;  5D6W A;  2MWP A;  3OMC A;  4A53 A;  4BDY A;  2EJ9 A;  4N4H A;  3RKW A;  2YHT A;  3CBO A;  3HFN A;  3BDL A;  3GNF B;  3OYB A;  1FXX A;  2MWO A;  3M58 A;  4FU6 A;  4L5G A;  3FDR A;  3DLL A;  5CIU A;  4BDZ A;  3H8Z A;  3MO8 A;  1X01 A;  1M1F A;  3QJY A;  2XU8 A;  3V7S A;  4EMG A;  3OYI A;  2K5I A;  3HHT B;  4EDU A;  3X20 B;  4M78 A;  3M54 A;  3DB3 A;  4PJO E;  2JTF A;  1YHQ T;  4IUV A;  3CCS A;  4F7U A;  2X4W A;  4LD6 A;  4BI3 A;  4PL6 A;  5LJ5 h;  2EWN A;  1N8R C;  3PIP A;  3LW5 E;  2K57 A;  3KUF A;  3JCM b;  1VQ4 A;  2DPP B;  4UC4 A;  2L3R A;  2DD4 A;  4C8Q E;  3FJP A;  2HQE A;  3L2Z A;  2ZPE B;  4LDW A;  4M78 C;  3G71 T;  1WPY A;  4N4G A;  5LJ5 f;  3LLR A;  4C92 G;  4FL6 A;  3TCJ A;  3VU3 C;  4M77 G;  2RJF A;  2EIF A;  4XK8 E;  3VV0 A;  3X26 B;  2E6N A;  2EQM A;  3EAE A;  3I56 T;  3LWH A;  1YI2 T;  3JCM g;  1Y96 A;  3TU4 K;  4WF2 A;  1JJ2 A;  3M55 A;  2PU9 B;  3QXE B;  4JRP A;  4BE0 A;  4B9W A;  5J39 A;  2P0P A;  3M57 A;  2GQV A;  4X34 A;  3X24 B;  3V7C A;  1KD1 C;  3URG A;  5I2M A;  1WJR A;  1K9M C;  5LJ5 e;  2WSC E;  1ZQ1 A;  4XTZ A;  4EMK C;  1BI0 A;  3A8G B;  4E7J A;  4ZTJ A;  1V29 B;  5GAN 5;  1BIB A;  3CC4 T;  2FB7 A;  3HRT A;  2G3R A;  1N9R A;  1UGP B;  4JJN K;  3QUI A;  3RKY A;  1KQS A;  1YJN T;  1G3Y A;  2RA2 A;  4P5N A;  4RCB A;  4B9X A;  3V8J A;  2QI2 A;  5GAO q;  1VQL T;  3RES A;  4HCC A;  4M78 E;  1KHC A;  4M75 C;  4PKC C;  5LJ3 g;  2HAX A;  1UGS B;  4MMK A;  1H3Z A;  2DD5 A;  2WAC A;  1M90 C;  1YIT T;  2H3J A;  2HBP A;  4EPC A;  4F7U E;  3E9F A;  4EMK B;  3GP8 A;  1DJ7 B;  1Q81 C;  5GAN j;  2EYQ A;  1HXD A;  2JTM A;  2NLU A;  3BY7 A;  4J6X A;  2FHD A;  4XU0 A;  3CXC S;  2LT4 A;  3ZEH A;  4BB7 A;  2QA4 T;  4LDX A;  3DLM A;  3CEY A;  2FYK A;  5CKH A;  5CCA A;  4M7A E;  3OA6 A;  3PFS A;  3OS1 A;  1YIJ T;  1JBM A;  3MEV A;  3R6O A;  1VQ8 T;  5FRM A;  2DTH A;  3L2U A;  3CCR A;  4M75 B;  2O4X A;  3CBP A;  4N0A A;  1NE8 A;  4JLI A;  3LGL A;  3E1S A;  3Q1J A;  2ZGW A;  4C5I A;  2DXU A;  2RHI A;  3S3O A;  1YJW A;  2CZ1 B;  1WNL A;  1U8R A;  2L8D A;  2QQS A;  4OMF B;  3CMA T;  1S72 T;  1VIE A;  1FX7 A;  4XTY A;  4PJO D;  3MEA A;  2XHC A;  1M1G A;  4BAC A;  1Q7Y C;  1IZ6 A;  2RD1 A;  1H64 1;  1KQ1 A;  3OBY A;  2F69 A;  4HCB A;  1FWZ A;  5IAY A;  2KAF A;  4BE2 A;  2JN0 A;  3QYH B;  1UB4 A;  2E70 A;  4RMO A;  4M7A F;  1TH7 A;  2VGN A;  4N0A C;  3SWN B;  1MHN A;  5FLX E;  3I55 A;  2CGH A;  1NZ9 A;  3PNW C;  4RG2 A;  4C92 F;  5D6Y A;  1QVG S;  4IUQ A;  1NPR A;  2MI6 A;  2VV5 A;  1P92 A;  4M77 F;  3G6E A;  3OS0 A;  2OTL T;  4MDW A;  4M7D G;  5GMK i;  1YJ9 A;  2DVE A;  2DTO A;  5KH6 A;  3OYC A;  2RO0 A;  3PGG A;  3HRS A;  1VQ9 T;  4MDX A;  2HD0 A;  4XU2 A;  2O01 E;  1MGQ A;  5D6X A;  3SDZ A;  3OW2 S;  3CC2 T;  2EQJ A;  2RB6 A;  3EFR A;  2M1H A;  3MP1 A;  5KCH A;  3H6Z A;  1B34 A;  1KC8 U;  2R5A A;  2XDP A;  3LX7 A;  4RG8 A;  5A0L A;  2EAY A;  2C06 A;  1VQ7 T;  1D3B B;  2V8K A;  2D0Q B;  2CKK A;  5GAN g;  4BUG A;  4M7D B;  3VJP A;  1QVF S;  2DKG A;  4Y28 E;  5GAM g;  2R5M A;  2E5Q A;  2KSS A;  2P0K A;  2RI3 A;  2DXB A;  1NJI U;  2ZPG B;  3P8B B;  3S3M A;  1M1K U;  3EFS A;  2KMT A;  4PJO B;  5FRO A;  3MP8 A;  2YLB A;  4QW2 A;  1XOV A;  4RKU E;  5A0G A;  4OB1 B;  4VUB A;  2RJE A;  4Z02 A;  1VQN T;  2D6F A;  1VQK A;  2XIC A;  3M4Y A;  3CC7 T;  2DXT A;  4NOY A;  4GLK A;  3TEE A;  4BI4 A;  1OZ3 A;  5LJ3 j;  4DOV A;  2EJG A;  4C8Q B;  1AHJ B;  2VXE A;  2E64 A;  3BFM A;  2Y4X A;  3FIF A;  3UDC A;  3UT1 A;  3CCJ T;  1VIF A;  3MET A;  3VUB A;  1W2B S;  3FEO A;  4NS5 A;  3J80 E;  2LNV A;  3QO3 A;  2M9U A;  2EQU A;  4DQ2 A;  3CCM T;  4N4I A;  4DA4 A;  2LRQ A;  1BI3 A;  2RI5 A;  3VUZ A;  1Q86 C;  1WQW A;  2PVO B;  5FRN A;  3A8M B;  1K73 U;  1KG1 A;  2GF7 A;  3X28 B;  3QJ6 A;  4LDY A;  3JB9 D;  2LTO A;  1KHI A;  3LGF A;  4M7A A;  4M7D D;  3QII A;  2OAU A;  3GF5 A;  3OSS C;  2K5F A;  4C92 A;  4NL2 A;  1M4Z A;  2D9T A;  1BKB A;  4KUI A;  4OB0 B;  3T9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...