2EQMA

Solution structure of the tudor domain of phd finger protein 20-like 1 [homo sapiens]
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
88
structure length
88
Chain Sequence
GSSGSSGMSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLERPALRKEGLKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 20-like 1
publication title Solution structure of the TUDOR domain of PHD finger protein 20-like 1 [Homo sapiens]
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eqmA01
1WJSA 5C6SA 4E7LA 5M9OA 2X4WA 2RJEA 4A4FA 4Z02A 4HCZA 2VYTA 3KUFA 2L8DA 5KCHA 2R5AA 1H3ZA 3DB4A 3PMIA 2GFAA 2O4XB 2WACA 4BDZA 3CEYA 4PLIA 2EKOA 1WJRA 3L2VA 5KH6A 2DIGA 3OYJA 2JZ2A 3OYMA 2EQJA 4IUTA 3MP6A 2EQMA 3L42A 4QQGA 4FU6A 4C5IA 1SSFA 3NTKA 2K3XA 3DB3A 4A4EA 2DAQA 3OMGA 3P8DA 3OA6A 4C5EA 1WGSA 4BD3A 2RO0A 3MEWA 3FLGA 5J39A 3MEVA 3OYFA 2LRQA 3UWNA 3OMCA 3E9FA 4GY5A 3PFSA 4E7JA 2X4XA 3MP8A 4E7IA 3META 3NTIA 3OYHA 3OS0A 3ASKA 4QQ6A 3OQ5A 3LH0A 4QVZA 5J26A 1OYXA 2MWOA 3MO8A 3OB9A 3LGLA 1WJQA 2K3YA 3PNWC 3LX7A 3Q1JA 2BKDN 2RI5A 2XDPA 2RHUA 5D6WA 4IUUA 5KE2A 2RI2A 2LCCA 3DLMA 5IN1A 3S6WA 5FRNA 3LYIA 3P8HA 3SD4A 2O4XA 3LLRA 5CIUA 2RHYA 3OS1A 2IG0A 3OYAA 2RHZA 4UC4A 2DIQA 4II1A 3F70A 3UT1A 3GOXA 2GF7A 2MWPA 2NLUA 2R5MA 2M0OA 4IUQA 5IAYA 4N4IA 3OYNA 4EDUA 2LTOA 2EFIA 1XNIA 3FEOA 2RHIA 3C4SA 3ZEHA 4BACA 2E6NA 2HQEA 2D9TA 3OYBA 3FC3A 5FRMA 2R57A 4B9XA 2CKKA 2RJFA 2RHXA 1KHCA 2LDMA 3QIIA 4PL6A 4BE0A 4RG2A 4OVAA 3OS2A 3FDRA 1MHNA 2XK0A 3QJ6A 4C5HA 3OYCA 1G5VA 2BUDA 3H8ZA 3QBYA 2GFUA 2PQWA 2F5KA 4QW2A 2P0KA 2RJCA 2EQUA 2M16A 2X4YA 4N4HA 5FROA 2RI3A 3H6ZA 3OYKA 2YRVA 4L59A 3L2QA 1OI1A 4IUPA 3QKJA 2M1HA 2R58A 1OZ3A 3S3NA 2RJDA 5D6XA 4A4HA 3OYIA 2QQRA 4QQDA 4X34A 3L2WA 2B8AA 3L2RA 3OY9A 2QQSA 1N27A 2FHDA 4CRIA 3OYGA 4BE1A 5KE3A 3MEAA 4LD6A 3ME9A 2G3RA 3MEUA 2HQXA 4Q5WA 4E7KA 1RI0A 5D6YA 3OYLA 3M9QA 3OYDA 3S3MA 3EAEA 3MP1A 3S3OA 2E5QA 2L3RA 2EQKA 3LGFA 3BDLA 3OYEA 4BDYA 4FL6A 3E9GA 4A4GA 4NS5A 2X35A 3NTHA 2LVMA 3O8VA 3PMTA 4IUVA 5C0MA 2L89A 4IKFA 1OZ2A 3L2UA 4B9WA 5KCOA 4E7HA 4PLLA 4IURA 4N4GA 4C5GA 4BE2A 2BIVA 2JTFA 4ZTJA 4ZTFA
chains in the Genus database with same CATH superfamily
3QYHB 4ANJA 3CC7Q 1ZA1B 3BY7A 1EFNA 4PJOB 1M2VA 3TREA 2HSPA 2JT4A 3RDVA 5FU6C 1QQJA 1WA7A 1GFCA 1YJ9A 2GQIA 1B3QA 1N8RR 1BCMA 1ZSZA 4C8QE 1Y7XA 3HRUA 3NTKA 3CPWP 5GAOm 2C0OA 1WGSA 4EPCA 2RO0A 5AT1B 2NYSA 2QASA 3JCMc 2LNHB 3CXCP 3NTIA 3OYHA 2D8HA 3ASKA 1WIEA 3CCSQ 4JS5A 2DL7A 1HYOA 2XIDA 3HRTA 3PNWC 1VQOT 1N9RA 2CP3A 2ED1A 4M77E 1VQLQ 2NUTA 4DQ2A 1QP3A 2RK1A 2EPDA 2I0NA 1NZ9A 1OX9A 4M78C 2QDLA 4M7DB 3ZEHA 1YHQQ 1Q7YR 5FRMA 2YUQA 2HDAA 3QIIA 1NM7A 5LJ3e 4PFPA 1C1AA 3RMQA 3VV0A 3CPWS 1K73R 1HXDA 1M1KC 2GFUA 2OAUA 3HFNA 2E10A 1V29B 2RJCA 3CXCS 2C0TA 1PM3A 3D7SB 3JCMe 3IQLA 1WDXA 3QZ9B 1VQOA 2KE9A 4FSXA 2DMOA 1RLPC 4AFSC 2R58A 5LJ5f 4MMLA 4WCIA 3PIPA 1XJWB 1X2QA 5LJ5g 1UTIA 4M75C 4PK4A 2DKGA 3CCEQ 4C0DC 3OYLA 4HCBA 1MMGA 3CCLQ 2EQKA 1T0JA 1VUBA 1D1AA 2LQKA 1K0SA 4M4ZA 2RA2A 2HZYA 4IKFA 4E47A 1VYTA 1ZA2B 3G6ET 2X4JA 2FO0A 4D8DA 2B86A 2YHTA 2X4WA 4M78E 3H0FA 3M0PA 5J3BA 3TVTA 2O4XB 3CCVT 3REBB 2EKOA 4J8OA 4EMGA 4NL3A 1NYGA 1BCOA 3I56T 2LRQA 1W70A 1BK2A 3OS0A 2KSSA 3LH0A 3G1JA 1D3BB 2OTLQ 4A54A 3ULRB 1W4SA 2DRKA 1OX8A 5HCKA 4FSSA 2KAFA 5KYNA 1FX7A 4M75E 4C92F 2MMPA 2EYWA 1GBQA 2R5MA 2EBPA 3CCVA 3FEOA 3RKWA 2VGMA 3I35A 2AZVA 1RI9A 2QEXT 1QCFA 3GPLA 1QVFA 2FZKB 3CBMA 3I56A 2RNAA 2E5KA 3AHUA 4E6RA 3QJ6A 2H3EB 2LZ6B 2JMAA 4PJOC 4OMMA 4C92G 4KT0E 3BFMA 2M0YA 3HHTB 1JQQA 1S1NA 1AOJA 2VASA 4M7AF 5D6XA 1EIFA 1Q81R 4QQDA 1C0MA 2J6FA 2EIFA 2HBWA 1X2KA 1EX4A 4LNPA 4JRKA 3RIRA 2GBQA 3CCSA 1U3OA 4LUEA 3OYDA 3S3MA 4AG2C 3SEMA 3EGDA 3OYEA 1KC8U 1VQ6T 1WHHA 1WHKA 5C0MA 1OZ2A 1MNEA 5KCOA 4ZTJA 4M7AG 5M9OA 2O01E 2E3HA 2VYTA 2FZCB 4JRQA 1G3WA 2SEMA 2K5LA 1KQ1A 2H8HA 3QSUA 3URGA 3OYJA 2W10A 1YHQA 3PGGA 4RMOA 3L42A 1LVKA 3GNGA 3DB3A 4A4EA 4WF2A 2DAQA 1D1BA 3MEWA 4GY5A 3U23A 1K8AC 4J9CA 3GBQA 1H92A 5EG2A 3TSZA 4F7UB 1BBZA 2FRYA 5GAN8 3CC4T 3X20B 2CP6A 3OQ5A 2FYKA 4PJOE 2XU8A 3A8OB 1AHJB 3CCRT 1VQ6A 1OU9A 2ESWA 2BKDN 2EYQA 2XDPA 3V8JA 2DX1A 4AFQC 2XDBA 1KD1U 5IN1A 1UJYA 3SD4A 4OB2B 1K1ZA 2MOXA 4JDSA 1NPRA 2GF7A 4ZNXA 3FJ5A 1M2VB 2ED0A 2OTLT 3CCLA 4AMCA 4EMHA 3JB9I 1K9MU 3I55T 2F5TX 1ZSZB 1KHCA 1G3YA 1K0XA 4BE0A 1PNJA 1OU8A 1JJ2S 1IHVA 2QA4T 4VUBA 3JCMb 2YUOA 3ZL7C 3H8ZA 1NLOC 2A36A 4Z88A 1QLYA 1ABQA 4L59A 3CCRA 1Y71A 1VQMQ 2FZGB 3G7ZA 1QKWA 1YIJQ 1HSQA 2QQRA 4LXCA 1M1KR 1LCKA 1Q82C 2NUTB 2ZPFB 3OYYA 2CYZB 2KK4A 4TVRA 4DA4A 5LJ5e 3VS3A 2V8JA 3M9QA 1SEMA 2OTLA 1WXUA 3VS5A 2ZPIB 4F7UF 4OB3B 1NJIU 1W2BA 3I55A 5GAN2 2VKNA 1LNXA 3M0SA 3UF4A 3JB9D 5KYYA 5IXFA 4N4GA 1ZUUA 3ZBDA 4C0FA 2J6KA 1HK9A 2ECZA 4LE9A 2PTKA 1X69A 2HKNA 3PVQA 4BI3A 2KDSA 3CEYA 4YTLA 3VRZA 4F7UG 4V2SA 1X6GA 2DPPB 5CR2A 1YCYA 2KI7A 3VRYA 1PHTA 1N8RC 3RKXA 2RF0A 3QWYA 3VU3C 3M4GA 4DEXA 3TSWA 5HKCA 2F69A 2A28A 3CCMT 1YITT 4LDUA 2DIQA 2LCLA 3CCUT 2M0OA 4KRTA 2CP7A 2QG9B 4DBRA 5GMKm 4EMKB 4D6WA 3BE3A 4MDXA 1RAHB 5DLOA 4XU2A 2P84A 2R57A 3H0HA 1AEYA 2RD1A 1NE8A 3FRNA 2HEQA 1UUEA 4OVAA 4Y28E 2LC4A 3OS2A 2L5QA 2LNVA 1Q7YC 3DKMA 1G5VA 1PG5B 1TG0A 3M0UA 3EGUA 3JCMh 1M2OA 5FU6B 1RACB 5GAMd 1YP5A 2P0PA 3QG1A 2WSFE 1K73C 1YJ9Q 4LDYA 5GAOl 3OYIA 3NMZC 1YITA 9ATCB 4C8QF 5KE3A 3KBGA 2QAZA 3CCUA 2D1XA 1TXQA 2P0QA 3PT9A 1I8FA 1YJNT 3VS1A 4J83A 2LQNA 3EHQA 3L2UA 4MZMA 3MCAB 5GMKj 2RQRA 3R6NA 2ZPHB 4XTZA 2DXUA 2VXEA 4A4FA 3R6OA 4M77F 4C8QG 4PLIA 1RUWA 1KIKA 3EFSA 2YXYA 1QP2A 1SSFA 4X9DA 2KRNA 2A0FB 5J39A 2YWWA 3V7RA 2L3QA 3REAB 2Y4XA 2MYSA 5GJVB 1WXBA 2FPFA 1R0CB 4M77G 4X9CA 3EGDB 1TOVA 3AT1B 1GCQA 3SB2A 1YJNA 3M58A 1K8AR 1VQ9T 4HVUA 4R56A 1GFDA 5GAN6 1W1FA 1VQOQ 1RADB 2E12A 3OS1A 4WTOB 4BI4A 4UC4A 3DLLA 1WNLA 3UT1A 2X9HA 2NLUA 4M75B 2F2WA 1YJWT 4C0DB 4N4IA 2I2LA 3QO3A 5GAN4 4FW2A 5CK9A 2EJ9A 2EYXA 3EG0A 3A98A 2DBMA 2M51A 3FDRA 3PTAA 5GANj 1PSFA 1ZBJA 1ZUYA 2K57A 3OYCA 1H8KA 3UDCA 1U06A 1D0ZA 2E3IA 3JAME 4DOVA 2PVOB 1UGRB 1WQWA 1BI3A 4M78F 4QVDA 4IUPA 2K4YA 1K9AA 1VQ9A 1MV0B 5KYXA 2KRSA 5CKHA 5GAN3 4FIBA 4BE1A 4LD6A 4ZN1A 1HJDA 5GAOp 1MMDA 1RI0A 1S72Q 2J7IA 1YJWA 3H0IA 1Q81C 3TQ7P 2WSCE 4CC2A 1BU1A 4J9IA 2L89A 1UE9A 4HT9A 2CT4A 4M78G 4C0ZA 1RABB 4E7LA 2VB6A 3TU4K 3G6EQ 2DERA 1UEBA 2X3WD 2CZ1B 4M75F 2DIGA 2QI2A 2DNUA 3M59A 2QTVA 3CCVQ 2YRCA 3MKDA 4B6MA 3ZFJA 4F16A 8ATCB 4KH1B 3I56Q 2NUPA 4OP0A 2DTHA 3VS6A 5IH2A 1Q86U 4ZN3A 2XICA 2K3YA 2XDDA 4RTWA 2L3PA 4M75G 1WHGA 3VS7A 1JRIA 1ZSGA 2QGGA 3S6WA 4ELYC 1RAGB 3OYAA 2KQWA 4II1A 1Z9QA 2MWPA 1MMAA 2KNBB 3MHXA 2LTOA 2DZCA 2RN8A 1U8RA 3OW2P 2RHXA 1GXIE 2KGTA 3J81E 1WQ7A 2QEXQ 1QWEA 1FXXA 3WXMB 2PQWA 1WX6A 2RB6A 1ZHIA 5FROA 2YLBA 5GMKh 3RMSA 2FPEA 2AHJB 2EQIA 4E2FB 2CH4A 3OY9A 5LJ5h 2O9VA 2ENMA 1FMWA 1M8MA 2L3RA 2DETA 4AT1B 2OTJT 2FEIA 4PJOF 1GL5A 3CBOA 4HXJA 4PLLA 1VQ6Q 2KXDA 4ZTFA 3OW2S 3SDZA 2VUBA 1QVGP 2G6FX 3KUFA 1S72T 4O5VA 1M8VA 1M3AA 4CC3A 2CT3A 1IXDA 2K3BA 1X27A 1RL2A 3OMGA 2LJ1A 2DYBA 1OULA 1IB8A 3UWNA 3OS5A 3PFSA 2X4XA 4PJOG 5GMKi 1UFFA 2JXBA 1NPPA 3OB9A 2DILA 1AWWA 3LX7A 3Q1JA 3CC4Q 2OTJA 1JXMA 2HL5C 2RI2A 1UB4A 1LJOA 2COZA 2PUOB 3EG9A 3CCRQ 2DJZA 3LLRA 2K7AA 3G4ST 2RHYA 4M7DF 2CZ6B 4PFZA 1M90C 2MIOA 1S72A 2VVKA 3LW5E 1YNZA 3QJYA 1XNIA 2JVVA 2ROLA 1QVGS 3EFRA 2ZZDA 2D9TA 2VV5A 1AWJA 2ZAEA 4LDXA 1G2BA 2EGCA 5GANf 3I55Q 2XK0A 2CSQA 4OMNA 5GANg 3G6EA 1R77A 1JBMA 4M7DG 3C0CA 4J9FA 1NEBA 3L2ZA 5CQYA 4IIOA 2QA4Q 3SFMA 2COWA 2LMJA 4KUIA 2A3LA 3L2WA 1OV3A 3VJPA 1JEGA 3L1AA 1AD5A 1R8OB 1KQSP 1NLPC 3S3OA 2V8KA 2DA9A 2HD0A 5CKEA 3A8LB 2KR3A 4KGZB 2DXBA 4RTUA 4JLIA 4PKCC 1H3ZA 1M5Q1 2BTTA 4ATOA 2H3JA 2OI3A 2WSEE 1ZUKA 2JZ2A 2NUZA 3OSVA 3PVLA 3RUXA 5KYXB 1Y96B 2QEXA 2JW4A 2KBTA 1V76A 2DL5A 5FWCA 1CKAA 5CKFA 3GF5A 2MWOA 1KQSS 2FL7A 4KGVB 2EJFA 1PC0A 2K5IA 2RHUA 2CUBA 4C92D 1FMVA 3P8HA 1WI7A 4PJLA 4PJNA 2DXTA 1JJ2P 3CCMQ 1YITQ 4IIMA 2K2MA 2CP0A 3THKA 1Y57A 5A0GA 4FM4B 5CCAA 1SRMA 3CCUQ 4GLMA 5KYWA 2RJFA 1WPYA 2DXCA 3CPWA 1M9SA 2DM1A 2JJ9A 1ZX6A 4JRPA 1M1KU 4A4KA 1QVPA 2LQ8A 3CXCA 5FU7B 5ECAA 2PUKB 2P0KA 3M4YA 2NUPB 2CSIA 2X4YA 4N4HA 1IGUA 1N9SA 4XU3A 1TWBA 4M7AD 2K5FA 2ZCFB 5D7UA 2RJDA 3S3NA 4A4HA 4OMFB 3C12A 1KC8R 4J7IA 4CRIA 3PIOA 2FHDA 2J6OA 4J9GA 3MEUA 5GAN5 4E7KA 1YWPA 1G3TA 5LJ3d 3V8LA 1O9SA 2QGFB 4Y92A 1M27C 3CC4A 2LVMA 2O2OA 1NEGA 4DOWA 4B9WA 1LPLA 4LDVA 2DYIA 1YJNQ 3JCMd 2VGNA 5C6SA 1VYUA 3KFVA 3WVEB 4JJBA 5GMKe 3NGPA 4JRIA 4F04B 3DB4A 2GFAA 3M56A 3CCQT 5KH6A 2LP5A 4Z89A 2DVEA 2RPNA 3T9NA 1Z9ZA 3OYFA 4JJNK 3CBPA 4QKUA 4M7AC 4N0AA 2DF6A 2E1HA 2HKQB 1M4ZA 1KD1R 1RLQC 3LGLA 2QA4A 2V1QA 1IREB 1JXOA 2RI5A 1X01A 3H41A 5D6WA 2KT1A 1GCQC 2JTEA 5GAMj 1I5LA 3H9NA 2V1RA 2GCXA 1K9MR 2YSQA 1XOVA 4F14A 1VQ9Q 1VQ8T 4HA8A 4Y91A 3M54A 4OB0B 2DZ9A 5IAYA 1KK7A 4ZGEB 2O88A 2YLCA 1M3CA 1XQHA 3CCQA 2FB7A 4FYXB 3M0RA 4RG8A 2OAWA 3QXEB 1YJWQ 4JUVA 5DY9A 1M90R 1KHIA 1KQ2A 2PU9B 1M1FA 2YUPA 2Z0WA 1PKSA 4GBQA 5A2QE 4OMOA 5GANe 2J05A 3GNFB 3NFCA 1RAAB 2RI3A 1K76A 3OYKA 2DVJA 3CPFA 4GLKA 3EG9B 1I1JA 4J9DA 2DL4A 1VQ8A 3LH5A 1X43A 1I0CA 4JZ3A 2SRCA 1Q95G 1RAEB 1WHLA 2JS2A 2IIMA 2JN0A 2JUFA 4BE2A 2BIVA 1LOJA 4OGCA 3CCMA 4KUDK 1PWTA 4ORZA 4AG1C 1YI2T 2CP2A 4BY6C 1T3SA 2RQVA 2QTXA 3E19A 2HL3A 2QK0A 3FJPA 2FG0A 4J7FA 4C92A 2EQJA 3EHRA 3MP6A 1TUCA 2BZXA 1YN8A 1UGSB 3C95A 5A0DA 3HSBA 1TU0B 2L3SA 1PCXA 2DTOA 4JLGA 1K8AU 3E9FA 3V7CA 4QQ6A 5J26A 1UHCA 1WHJA 2OJ2A 5FU7C 3CMET 3N5BB 1ABOA 2F2XA 2LJ3A 1U1SA 4IUUA 4E7ZA 2JOYA 4BUGA 2MAMA 3CCJQ 2O4XA 1TUDA 4HCKA 3M57A 2RHZA 3GOXA 4M7AA 2PVDB 1YI2A 3LWHA 3VS0A 2E4HA 3QPHA 1E6GA 2ZPEB 1SF9A 2CKKA 1D0YA 1PRMC 2K9GA 2RM4A 4OF1A 2LDMA 2DEQA 5HK3A 1UGQB 1AZEA 1AWOA 1VOMA 4J6WA 1BKBA 4ZGJB 1OPLA 2EQUA 2RK2A 3EG2A 3QUIA 3V8KA 1VQ4T 3H6ZA 3HPWA 3QKJA 3J80E 2PNIA 2E64A 4C8QD 4J6YA 4X34A 1Q82U 2MCNA 3HKSA 2HQXA 5CQXA 1X75C 2EKHA 1QWFA 4BDYA 1B34A 1UDLA 4NS5A 1UGPB 3PMTA 5KYUA 4BI8B 1VQNQ 5KYWB 3M55A 1KFZA 2OTJQ 4M77D 1VQ5T 3RKYA 1VA7A 3WVDB 4CC7A 1B07A 4OMPA 5KCHA 2HQHA 1W6XA 3JCMQ 4FT2A 1ZBXA 1QVFP 4QQGA 5LJ5d 4FU6A 3ER0A 2BE9B 1KG1A 3OA6A 3I5RA 2CH4W 4MZPA 4E7JA 1N8RU 2DD5A 3META 3CC2T 2D0NA 1QCOA 5LL6S 2KY9A 3MO8A 5CKBA 2FVUA 5GAMf 1I5OB 4RTZA 3A5ZB 2L2PA 1MUZA 5GAMg 5GAN7 1VQ5A 4RCCA 2CP5A 2AKKA 3JCMX 2EWNA 3INZA 1QMCA 3G4SQ 3OYNA 2EYYA 2QQBA 4HCCA 3C4SA 4M77C 2A7YA 1M3BA 3OYBA 2YUNA 4F7UA 6AT1B 3QWXX 3CCJT 4MDWA 1QVFS 1WFWA 1U5SA 2XD0A 3LWIA 1Q7YU 3CC2A 2LJ0A 1KJWA 2BUDA 5KYYB 3A1PA 4M78D 2MK5A 3VYGA 1G3SA 2DL8A 1K73U 4DBFA 1JU5C 3L2RA 2V8IA 1ARKA 2OX7A 3JCMW 2FRWA 4KGXB 1H641 1OQKA 4CI0C 2ZPBB 4JPBW 3MP1A 3VS2A 1KC8C 1VQKT 3NTHA 4K11A 2KYBA 2LX9A 2KVQG 5DLQE 3JSCA 2JTMA 3CCJA 1QW1A 5GAOq 2RJEA 2QYZA 4Z02A 1IO6A 4M75D 4J9HA 2D8JA 3E2UA 4XTYA 1PRLC 1VQNT 4IUTA 2EQMA 3RNJA 4ESRA 2LT4A 1ACMB 1UJ0A 1Q86R 3SWNA 3MEVA 3QDRB 4BB7A 3OMCA 3RERA 1VQ7T 4E7IA 1MNDA 3HL8A 2AIRB 4RTYA 4ELZC 1SPKA 1RAIB 1VQKA 3G71T 3KXTA 2M9UA 2K2VA 2LCCA 3DLMA 1KD1C 1WHMA 4KULA 5HK0A 4C8QA 1VYVA 3A8MB 3M5AA 2EFIA 1X6BA 2QQ9A 1W2BP 4C92B 1VQNA 3J7AF 1K9MC 4A53A 1B7TA 2BZ8A 1PD1A 1BI0A 1JB0E 1SG5A 3M0TA 4RG2A 4PJMA 1VQ7A 1PSEA 5GANh 2KEAA 2DBKA 4QW2A 2O9SA 2ABLA 3CMAT 4O6JA 3SHWA 3VS4A 2VC8A 1D09B 1TS9A 4M77A 2XKOC 3EFOA 3QYGB 3G71A 3A8GB 1N5ZA 3ME9A 4EMKA 2G3RA 4OB1B 4Q5WA 4M7AB 1UECA 4J9BA 1Q81U 1SSHA 4NOYA 2E5QA 4PFOA 1NJIC 2FPDA 4PJOD 1VQPQ 3CC7T 5IXBA 1DJ7B 4ME7A 1W2BS 2DJQA 3X25B 3HP9A 1WYXA 4XTVA 3QZ5B 2R5AA 2DEUA 3PMIA 3G4SA 4FYVB 2WACA 3CMAA 2HAXA 5I2MA 1NG2A 2C06A 4XTWA 3M53A 3VUZA 3NPFA 1G8XA 2F1LA 3CCQQ 2IPOB 1R0BG 4XK8E 3CCST 3EG3A 4L6V5 3P8BB 1UGVA 2AZSA 1BI2A 3EGXA 1E7OA 4N0AC 1VQLT 4L5GA 1B34B 5KYUB 3CC7A 5GMKl 2LQWA 4M7DD 4D8KA 5FRNA 2PZ1A 3CD6Q 3LYIA 4M78A 2IG0A 3OBWA 1YHQT 3E1SA 2LX7A 5GAMe 2HMAA 4IUQA 3MPUB 4EDUA 2EAYA 5CO7A 1VQ8Q 1FYNA 1I07A 5LJ3j 3JCMV 5CKDA 1MMNA 1YFNA 1I81A 5CAIA 2EW3A 3PE0A 1FWZA 3UA6A 3X26B 1GBRA 4QVCA 1TTHB 4C5HA 3QBYA 1BYMA 4FT4A 4BY6B 1WXTA 1VQLA 4LUDA 3GLXA 2A08A 3FB9A 5FLXE 1OI1A 3HTRA 3UA7A 4QT7A 3CCET 4M75A 4CC4B 1UG1A 4RTTA 7AT1B 2O31A 2KT8A 3CCLT 5GJWB 4R55A 1TH7A 1WZOA 2K79A 5I2SA 4J9EA 4M7DC 2X51A 1N6AA 4PJJA 1XTDA 3BDLA 1H3HA 1GCPA 5GAOr 2X35A 2F2VA 4IUVA 1FMKA 1SHFA 3OW2A 4E7HA 3VYHB 1U1TA 3GP8A 1WJSA 2KMTA 3JB9F 2QQAA 3FIFA 1NYFA 4AFUC 2L8DA 4J5YA 3RESA 5IHIA 2EVRA 4BDZA 2MPXC 1WJRA 3L2VA 1BIBA 3OYMA 1YI2Q 1VQPT 4C5IA 2E70A 3VUBA 2QXFA 4C92C 1ZQ1A 2YDLA 4C5EA 3CCEA 4FYWB 4JJCA 1OEBA 3MP8A 2GGRA 2GTOA 4HT8A 3JB9G 2GQVA 4QVZA 1OYXA 2M02A 2DFUA 3UATA 4MZTA 2A37A 3QDFA 1JO8A 5KE2A 3CMEQ 1Y07A 2JS0A 4DBQA 5FW9A 4PNOA 2IVWA 2CZ0B 3I9QA 1M90U 3F70A 4EIKA 1QVGA 4M7DE 2HNIA 2L0AA 2HQEA 4X1VA 3FC3A 1IHWA 1VQPA 4B9XA 2RMOA 1GRIA 2CDTA 4E7SA 1X6OA 3CD6T 5L8RE 3SWNB 2GTJA 1KSWA 2CGHA 2KRMA 2RQTA 3JV3A 4PJOA 4KH0B 1OOTA 2RH2A 2CREA 1SHGA 2DE0X 2YRVA 5DM7R 4RCBA 1HD3A 4C92E 1J3TA 2J06A 1VQ4Q 2HBPA 2P4RA 2QQSA 3JB9J 3M0QA 4A63B 3GIBA 1EZZB 3HRSA 3EAEA 3V7SA 4C8QB 2JM8A 4FL6A 2HSEB 3MJXA 1VIFA 4JS4A 2BE7D 3TCJA 4IURA 5I22A 3CD6A 2Y4YA 3X24B 2JMCA 1A0NB 1NJIR 4FYYB 1VQ5Q 4M7DA 4M7AE 5FWBA 2E6ZA 2VXFA 4P5NA 1QCNA 4M77B 3EFOB 2EJGA 3P8DA 4RKUE 4F17A 3FLGA 3C94A 2DRMA 2AK5A 1BIAA 1Y0MA 4OMQA 3NHNA 1KQSA 2BZYA 2KROA 5LJ3h 1YCSB 3RR6A 1WJQA 1Q86C 3CC2Q 2ZGWA 5AYFA 4LDWA 2DK3A 3BW1A 1CKBA 2C0IA 5A0LA 1BB9A 4RUGA 4XTUA 1M30A 2XMFA 1IGQA 5CIUA 2RQUA 2PVGB 4DBHA 1T3LA 4XU1A 2MF2A 4J6XA 2K6DA 1TSFA 5LJ3f 4BACA 1D0XA 2JNGA 4RTXA 2E6NA 4LN2A 2ATCB 5LJ3g 1SKUB 2DLPA 4DEYA 1MGQA 4PL6A 1MHNA 2CUDA 3JCMf 2JM9A 1I4K1 2ROTA 3EH1A 2DD4A 1AWXA 1MV3A 3VKIA 1QKXA 2Y90A 3EGXB 2KYMA 1VQMT 3JCMg 1D1CA 1YIJT 2LCSA 5GAOn 2DL3A 1ZLMA 2P4TA 3L2QA 3A8HB 1OZ3A 5LJ5j 2B8AA 2GNCA 4NL2A 4M78B 3HFOA 3MEAA 2RQWA 1CSKA 2AT1B 1JJ2A 1M1GA 1RAFB 1G83A 1D3BA 1P92A 2VWFA 4C0GA 1ZSZC 2EYZA 3E9GA 4KBMB 3O8VA 2ZPGB 3EH2A 3CMEA 4C5GA 1VQKQ 3JCMP 2JTFA 2LT1A 2CS7A 3RBBB 1VIEA 5HY6A 5I21A 8AT1B 4HCZA 4ZGDB 4JJDA 1TUGB 1VQMA 2D0QB 1YIJA 2COYA 4XQ3A 4JZ4A 1SRLA 2K3XA 2QDYB 3BDUA 2YRDA 3QHSA 4XU0A 4BD3A 2E65A 2DO3A 2HCKA 3CQTA 4F7UE 3SWNC 1V1CA 5IHNA 4AFZC 5IHKA 1VQ7Q 3JRZA 3O5ZA 2MI6A 1OPKA 4HKEA 4HVVA 4Z8AA 2CZ7B 1VQ4A 4R0KA 2E41A 2V26A 3JB9H 5GAMh 1K4US 3G71Q 3EG1A 1E6HA 4OMLA 1PD0A 1WLPB 1YWOA 1IRXA 4FCYA 1AZGB 2RHIA 2YT6A 1Y96A 1YBYA 1BI1A 4C8QC 3JCMJ 5EC7A 3OSSC 2XI9A 1NBEB 5L23A 2EGAA 2AKLA 3OBYA 2EGEA 4MMKA 1Q82R 2F5KA 1C6VX 1YJ9T 2XG8D 2M16A 4FW1A 1F1BB 5CVIA 4RTVA 1T0HA 2M1HA 3CMAQ 1PKTA 5IT9E 3TEEA 4XTXA 3I5SA 1N27A 3OYGA 1AT1B 2KXCA 4LD9K 2DTIA 3UPUA 4HVWA 1IZ6A 3X28B 1O75A 5D6YA 4EMKC 1AVZC 3LGFA 4XAXB 4A4GA 1UHFA 2NWMA 5GANd 2X3XD 2XHCA 5I11A 2W0ZA 2D6FA 4OGEA
chains in the Genus database with same CATH topology
3QYHB 5C6SA 2DXUA 2VXEA 4A4FA 3R6OA 3BY7A 3HP9A 4M77F 3WVEB 4XTVA 3TREA 5GMKe 4PJOB 3QZ5B 4JRIA 2R5AA 5FU6C 3DB4A 4C8QG 3PMIA 2GFAA 3G4SA 3CMAA 2WACA 3M56A 2HAXA 1YJ9A 4PLIA 5I2MA 3CCQT 5KH6A 2C06A 4XTWA 3M53A 3EFSA 3VUZA 4C8QE 1Y7XA 3HRUA 1QP2A 1SSFA 3NTKA 5GAOm 2DVEA 1WGSA 4X9DA 4XK8E 3T9NA 4EPCA 2RO0A 3OYFA 4JJNK 5J39A 3CCST 3V7RA 3JCMc 3CBPA 4M7AC 4L6V5 2Y4XA 3NTIA 3P8BB 3OYHA 4N0AA 2E1HA 1BI2A 1M4ZA 3ASKA 4JS5A 4N0AC 1VQLT 2XIDA 3LGLA 4M77G 4X9CA 2QA4A 3HRTA 3PNWC 4L5GA 3SB2A 3M58A 1VQOT 1B34B 1N9RA 1IREB 1YJNA 2RI5A 1X01A 3CC7A 1VQ9T 5D6WA 4R56A 4M77E 5GMKl 4M7DD 5GAMj 1I5LA 5GAN6 4DQ2A 5FRNA 1QP3A 2GCXA 3LYIA 4M78A 2E12A 2RK1A 1XOVA 2IG0A 3OBWA 4BI4A 4UC4A 3OS1A 1VQ8T 1NZ9A 4HA8A 3DLLA 3E1SA 4Y91A 1WNLA 3UT1A 4M78C 3M54A 5GAMe 2NLUA 4M75B 4OB0B 2DZ9A 1YJWT 4IUQA 4C0DB 5IAYA 4N4IA 4ZGEB 4EDUA 2YLCA 2EAYA 1XQHA 5CO7A 4M7DB 3CCQA 3ZEHA 2FB7A 2I2LA 5LJ3j 3QO3A 3JCMV 4RG8A 5GAN4 5FRMA 3QXEB 5CKDA 5CK9A 4JUVA 2EJ9A 1I81A 5DY9A 3QIIA 5LJ3e 5CAIA 1KHIA 1KQ2A 3FDRA 3PTAA 5GANj 3CPWS 3RMQA 3VV0A 1FWZA 1PSFA 2PU9B 3X26B 4QVCA 1HXDA 1M1FA 1M1KC 2K57A 4C5HA 3OYCA 3QBYA 3UDCA 1BYMA 2GFUA 2OAUA 3HFNA 2E10A 5A2QE 1V29B 2RJCA 4FT4A 5GANe 3GNFB 3NFCA 3JAME 4BY6B 3CXCS 4DOVA 2PVOB 1VQLA 1UGRB 1WQWA 3GLXA 2RI3A 3JCMe 1BI3A 3QZ9B 4M78F 3FB9A 5FLXE 4FSXA 1OI1A 4IUPA 4QVDA 3OYKA 1VQOA 3CPFA 2R58A 2K4YA 1VQ9A 5LJ5f 3CCET 4MMLA 4M75A 4GLKA 5CKHA 3PIPA 5GAN3 4FIBA 3CCLT 5LJ5g 4BE1A 4LD6A 4M75C 4ZN1A 2DKGA 4R55A 5GAOp 1VQ8A 1TH7A 4C0DC 5I2SA 1RI0A 3OYLA 4HCBA 4M7DC 1YJWA 1N6AA 1Q81C 2EQKA 1XTDA 1VUBA 3BDLA 2LQKA 5GAOr 2X35A 2WSCE 4IUVA 2L89A 2RA2A 4IKFA 4E47A 4HT9A 2JN0A 3G6ET 2X4JA 3OW2A 4M78G 4E7HA 2JUFA 4BE2A 3VYHB 2BIVA 1LOJA 4C0ZA 1U1TA 3GP8A 1WJSA 2KMTA 3JB9F 4OGCA 4E7LA 2YHTA 2X4WA 2QQAA 3FIFA 3CCMA 4KUDK 1YI2T 3TU4K 4M78E 2L8DA 1UEBA 4BY6C 4J5YA 3RESA 5J3BA 2QTXA 2CZ1B 3E19A 2O4XB 4BDZA 3CCVT 2EKOA 4M75F 1WJRA 3FJPA 3L2VA 2DIGA 4J7FA 2QI2A 1BIBA 3M59A 4C92A 3OYMA 2EQJA 3MP6A 1VQPT 4J8OA 4C5IA 2E70A 4EMGA 3VUBA 2QXFA 4C92C 1UGSB 1ZQ1A 3C95A 5A0DA 4NL3A 4C5EA 3CCEA 3HSBA 3ZFJA 3I56T 2DTOA 4JLGA 2LRQA 1K8AU 3E9FA 3V7CA 3MP8A 4HT8A 3OS0A 2KSSA 4QQ6A 3JB9G 3LH0A 4OP0A 2GQVA 1D3BB 2DTHA 4QVZA 5FU7C 1OYXA 5J26A 3N5BB 3CMET 4ZN3A 1Q86U 2XICA 2K3YA 4A54A 4MZTA 1W4SA 3X25B 2XDDA 1U1SA 4M75G 4IUUA 5KE2A 1Y07A 1JRIA 2JOYA 4BUGA 4PNOA 3S6WA 2MAMA 2KAFA 2IVWA 2O4XA 2CZ0B 4ELYC 3OYAA 1FX7A 3M57A 2RHZA 4M75E 1M90U 2KQWA 4C92F 4II1A 3F70A 2MMPA 3GOXA 4M7AA 2PVDB 2MWPA 1YI2A 3LWHA 2R5MA 1QVGA 4M7DE 3MHXA 2HNIA 2LTOA 3FEOA 3QPHA 2DZCA 2VGMA 3RKWA 3CCVA 1U8RA 2HQEA 2ZPEB 3FC3A 1VQPA 2QEXT 1YHQT 4B9XA 1QVFA 2CKKA 3GPLA 2RHXA 2RM4A 4OF1A 1X6OA 2LDMA 3CBMA 3CD6T 1GXIE 5L8RE 3SWNB 3J81E 1WQ7A 3I56A 3AHUA 2DEQA 2CGHA 5HK3A 1UGQB 1FXXA 4PJOA 3WXMB 3QJ6A 4J6WA 2RH2A 2PQWA 1BKBA 4ZGJB 2RB6A 4PJOC 2EQUA 1ZHIA 2RK2A 3QUIA 4KT0E 4C92G 3V8KA 4M7DF 3BFMA 1VQ4T 5FROA 3HHTB 3H6ZA 3HPWA 2YRVA 2YLBA 5DM7R 3QKJA 3J80E 4RCBA 5GMKh 4C92E 3RMSA 4M7AF 2E64A 2AHJB 1EIFA 4J6YA 5D6XA 4QQDA 4X34A 4C8QD 2HBPA 1Q82U 2EIFA 3OY9A 2QQSA 5LJ5h 3JB9J 3HKSA 4JRKA 3RIRA 2HQXA 5CQXA 1X75C 3GIBA 3CCSA 3HRSA 3OYDA 3S3MA 3EAEA 3V7SA 2L3RA 4C8QB 3OYEA 1KC8U 4BDYA 1VQ6T 1B34A 4FL6A 2OTJT 4NS5A 1UGPB 3PMTA 4BI8B 1VIFA 5C0MA 4PJOF 1OZ2A 3M55A 4JS4A 3CBOA 3TCJA 5KCOA 4ZTJA 4PLLA 4IURA 3CD6A 2Y4YA 3X24B 4M77D 4ZTFA 3RKYA 1VQ5T 3OW2S 4M7AG 5M9OA 3SDZA 2O01E 2VUBA 3WVDB 1S72T 2VYTA 3KUFA 4JRQA 4O5VA 5KCHA 1M8VA 1G3WA 2K5LA 1KQ1A 3JCMQ 3QSUA 4M7DA 4M7AE 2E6ZA 3URGA 2VXFA 3OYJA 1YHQA 3PGGA 4RMOA 4P5NA 4FT2A 1ZBXA 3L42A 4M77B 4QQGA 4FU6A 5LJ5d 3ER0A 3GNGA 3DB3A 4A4EA 1RL2A 4WF2A 2DAQA 2EJGA 3OMGA 3P8DA 3OA6A 1KG1A 4RKUE 3JCMd 3MEWA 3FLGA 3C94A 4MZPA 4GY5A 3UWNA 3OS5A 3PFSA 2X4XA 4PJOG 4E7JA 1N8RU 1K8AC 2DD5A 3META 3CC2T 1BIAA 5GMKi 5EG2A 4F7UB 5GAN8 3CC4T 3X20B 1KQSA 3OQ5A 2FYKA 5LL6S 5LJ3h 2KY9A 4PJOE 2XU8A 3A8OB 3MO8A 1NPPA 3OB9A 5CKBA 1WJQA 1Q86C 1AHJB 2ZGWA 5AYFA 4LDWA 3LX7A 3Q1JA 3CCRT 1VQ6A 2OTJA 2BKDN 2FVUA 2EYQA 2XDPA 2DK3A 3BW1A 3V8JA 5GAMf 2XDBA 2RI2A 1UB4A 1LJOA 2PUOB 3A5ZB 5IN1A 4XTUA 5A0LA 1KD1U 2DJZA 3LLRA 4OB2B 5CIUA 2RHYA 3SD4A 5GAMg 5GAN7 3G4ST 4RCCA 1VQ5A 2CZ6B 2PVGB 4JDSA 3JCMX 1M90C 2EWNA 1NPRA 2GF7A 4XU1A 3INZA 1S72A 2MF2A 4J6XA 3LW5E 2OTLT 3OYNA 3CCLA 3QJYA 2QQBA 5LJ3f 1XNIA 2JVVA 4BACA 3C4SA 4M77C 3EFRA 1QVGS 4HCCA 2A7YA 4EMHA 3JB9I 2JNGA 2ZZDA 1K9MU 2E6NA 3OYBA 2D9TA 2VV5A 3I55T 2F5TX 5LJ3g 4LDXA 1MGQA 1KHCA 4F7UA 1G3YA 4PL6A 5GANf 4BE0A 3CCJT 4MDWA 1QVFS 1MHNA 2XD0A 2XK0A 3JCMf 3LWIA 1Q7YU 1JJ2S 2QA4T 1I4K1 4VUBA 3JCMb 2DD4A 5GANg 3G6EA 3CC2A 3VKIA 2BUDA 3H8ZA 2Y90A 1JBMA 4M7DG 1VQMT 3JCMg 4M78D 1YIJT 3L2ZA 3VYGA 5CQYA 5GAOn 1G3SA 4L59A 3CCRA 2P4TA 3L2QA 1K73U 1Y71A 3SFMA 3A8HB 3G7ZA 1OZ3A 4KUIA 2A3LA 3L2WA 2QQRA 5LJ5j 2B8AA 4NL2A 3VJPA 3L1AA 1Q82C 2ZPFB 2V8IA 3OYYA 3L2RA 2CYZB 4M78B 3HFOA 3JCMW 3MEAA 1R8OB 2KK4A 4TVRA 1H641 4DA4A 1JJ2A 4CI0C 5LJ5e 1M1GA 2ZPBB 2V8JA 1D3BA 3M9QA 1P92A 3MP1A 2OTLA 4F7UF 2V8KA 2ZPIB 3S3OA 2HD0A 4OB3B 5CKEA 4C0GA 1NJIU 1VQKT 1KC8C 3E9GA 4KBMB 3NTHA 1W2BA 3O8VA 3I55A 3A8LB 2ZPGB 5GAN2 1LNXA 3CMEA 2LX9A 3JB9D 4N4GA 4C0FA 3ZBDA 2KVQG 5DLQE 2JTFA 2LT1A 2JTMA 1HK9A 2CS7A 3JSCA 2DXBA 1VIEA 5HY6A 5I21A 3CCJA 1QW1A 5GAOq 2RJEA 4JLIA 4Z02A 4HCZA 4PKCC 4ZGDB 4M75D 1H3ZA 1M5Q1 4BI3A 4ATOA 2H3JA 1VQMA 2KDSA 3CEYA 4XTYA 2D0QB 4YTLA 1YIJA 2WSEE 2JZ2A 4XQ3A 1VQNT 4IUTA 2EQMA 3OSVA 3RUXA 2LT4A 2K3XA 2QDYB 3BDUA 4XU0A 3QHSA 4F7UG 4V2SA 4BD3A 2DPPB 2E65A 3SWNA 1Y96B 3MEVA 2DO3A 3QDRB 1YCYA 4BB7A 3OMCA 5CR2A 2QEXA 3RERA 4F7UE 1VQ7T 4E7IA 3SWNC 1N8RC 3RKXA 3HL8A 5CKFA 3GF5A 3VU3C 2MWOA 3M4GA 4ELZC 3JRZA 1KQSS 2FL7A 2EJFA 2MI6A 1VQKA 5HKCA 4HKEA 3G71T 2K5IA 2F69A 2RHUA 4C5GA 3KXTA 2CZ7B 3CCMT 1YITT 2M9UA 2K2VA 1VQ4A 2LCCA 3DLMA 2E41A 4LDUA 1KD1C 4C92D 3P8HA 3JB9H 5GAMh 2DXTA 2DIQA 4KULA 5HK0A 2LCLA 3CCUT 2M0OA 4C8QA 3A8MB 3M5AA 2EFIA 5GMKm 2RHIA 4EMKB 2QQ9A 4D6WA 5A0GA 4FM4B 1Y96A 5CCAA 4C92B 1YBYA 1BI1A 4C8QC 1VQNA 5DLOA 1K9MC 3JCMJ 4XU2A 2R57A 3J7AF 4A53A 2RJFA 2RD1A 1WPYA 2DXCA 3CPWA 1NE8A 3FRNA 1M9SA 1BI0A 1JB0E 3OSSC 4RG2A 4OVAA 4Y28E 2LC4A 3OS2A 2L5QA 2XI9A 4JRPA 1M1KU 1VQ7A 1PSEA 2LNVA 5GANh 1Q7YC 3DKMA 1QVPA 2LQ8A 4A4KA 3CXCA 3OBYA 5FU7B 4MMKA 1G5VA 2F5KA 2PUKB 4QW2A 3CMAT 2P0KA 3M4YA 3JCMh 4O6JA 1YJ9T 2XG8D 2M16A 5FU6B 2VC8A 2X4YA 4MDXA 4N4HA 1N9SA 4XU3A 5CVIA 4M77A 4M7AD 5GAMd 2XKOC 2P0PA 2M1HA 3QG1A 2WSFE 1K73C 2K5FA 3QYGB 4LDYA 3G71A 2ZCFB 5GAOl 5IT9E 3S3NA 2RJDA 4XTXA 3TEEA 4OMFB 4A4HA 3OYIA 1YITA 3A8GB 3C12A 4J7IA 4C8QF 1N27A 2FHDA 4CRIA 3PIOA 3OYGA 5KE3A 3KBGA 4LD9K 3ME9A 4EMKA 2DTIA 3UPUA 2G3RA 4OB1B 3MEUA 4Q5WA 5GAN5 1IZ6A 4E7KA 4M7AB 3X28B 1G3TA 1O75A 5D6YA 5LJ3d 3CCUA 3V8LA 4EMKC 1Q81U 2P0QA 3PT9A 4NOYA 2E5QA 1O9SA 3LGFA 3JCMP 1I8FA 1YJNT 1NJIC 4PJOD 4J83A 4XAXB 4A4GA 3CC4A 2LVMA 3CC7T 1DJ7B 4ME7A 4DOWA 5GANd 3L2UA 4B9WA 4MZMA 2XHCA 3MCAB 1W2BS 4LDVA 5GMKj 2ZPHB 4XTZA 2D6FA 4OGEA 2VGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJS A;  5C6S A;  4E7L A;  5M9O A;  2X4W A;  2RJE A;  4A4F A;  4Z02 A;  4HCZ A;  2VYT A;  3KUF A;  2L8D A;  5KCH A;  2R5A A;  1H3Z A;  3DB4 A;  3PMI A;  2GFA A;  2O4X B;  2WAC A;  4BDZ A;  3CEY A;  4PLI A;  2EKO A;  1WJR A;  3L2V A;  5KH6 A;  2DIG A;  3OYJ A;  2JZ2 A;  3OYM A;  2EQJ A;  4IUT A;  3MP6 A;  2EQM A;  3L42 A;  4QQG A;  4FU6 A;  4C5I A;  1SSF A;  3NTK A;  2K3X A;  3DB3 A;  4A4E A;  2DAQ A;  3OMG A;  3P8D A;  3OA6 A;  4C5E A;  1WGS A;  4BD3 A;  2RO0 A;  3MEW A;  3FLG A;  5J39 A;  3MEV A;  3OYF A;  2LRQ A;  3UWN A;  3OMC A;  3E9F A;  4GY5 A;  3PFS A;  4E7J A;  2X4X A;  3MP8 A;  4E7I A;  3MET A;  3NTI A;  3OYH A;  3OS0 A;  3ASK A;  4QQ6 A;  3OQ5 A;  3LH0 A;  4QVZ A;  5J26 A;  1OYX A;  2MWO A;  3MO8 A;  3OB9 A;  3LGL A;  1WJQ A;  2K3Y A;  3PNW C;  3LX7 A;  3Q1J A;  2BKD N;  2RI5 A;  2XDP A;  2RHU A;  5D6W A;  4IUU A;  5KE2 A;  2RI2 A;  2LCC A;  3DLM A;  5IN1 A;  3S6W A;  5FRN A;  3LYI A;  3P8H A;  3SD4 A;  2O4X A;  3LLR A;  5CIU A;  2RHY A;  3OS1 A;  2IG0 A;  3OYA A;  2RHZ A;  4UC4 A;  2DIQ A;  4II1 A;  3F70 A;  3UT1 A;  3GOX A;  2GF7 A;  2MWP A;  2NLU A;  2R5M A;  2M0O A;  4IUQ A;  5IAY A;  4N4I A;  3OYN A;  4EDU A;  2LTO A;  2EFI A;  1XNI A;  3FEO A;  2RHI A;  3C4S A;  3ZEH A;  4BAC A;  2E6N A;  2HQE A;  2D9T A;  3OYB A;  3FC3 A;  5FRM A;  2R57 A;  4B9X A;  2CKK A;  2RJF A;  2RHX A;  1KHC A;  2LDM A;  3QII A;  4PL6 A;  4BE0 A;  4RG2 A;  4OVA A;  3OS2 A;  3FDR A;  1MHN A;  2XK0 A;  3QJ6 A;  4C5H A;  3OYC A;  1G5V A;  2BUD A;  3H8Z A;  3QBY A;  2GFU A;  2PQW A;  2F5K A;  4QW2 A;  2P0K A;  2RJC A;  2EQU A;  2M16 A;  2X4Y A;  4N4H A;  5FRO A;  2RI3 A;  3H6Z A;  3OYK A;  2YRV A;  4L59 A;  3L2Q A;  1OI1 A;  4IUP A;  3QKJ A;  2M1H A;  2R58 A;  1OZ3 A;  3S3N A;  2RJD A;  5D6X A;  4A4H A;  3OYI A;  2QQR A;  4QQD A;  4X34 A;  3L2W A;  2B8A A;  3L2R A;  3OY9 A;  2QQS A;  1N27 A;  2FHD A;  4CRI A;  3OYG A;  4BE1 A;  5KE3 A;  3MEA A;  4LD6 A;  3ME9 A;  2G3R A;  3MEU A;  2HQX A;  4Q5W A;  4E7K A;  1RI0 A;  5D6Y A;  3OYL A;  3M9Q A;  3OYD A;  3S3M A;  3EAE A;  3MP1 A;  3S3O A;  2E5Q A;  2L3R A;  2EQK A;  3LGF A;  3BDL A;  3OYE A;  4BDY A;  4FL6 A;  3E9G A;  4A4G A;  4NS5 A;  2X35 A;  3NTH A;  2LVM A;  3O8V A;  3PMT A;  4IUV A;  5C0M A;  2L89 A;  4IKF A;  1OZ2 A;  3L2U A;  4B9W A;  5KCO A;  4E7H A;  4PLL A;  4IUR A;  4N4G A;  4C5G A;  4BE2 A;  2BIV A;  2JTF A;  4ZTJ A;  4ZTF A; 
#chains in the Genus database with same CATH topology
 3QYH B;  4ANJ A;  3CC7 Q;  1ZA1 B;  3BY7 A;  1EFN A;  4PJO B;  1M2V A;  3TRE A;  2HSP A;  2JT4 A;  3RDV A;  5FU6 C;  1QQJ A;  1WA7 A;  1GFC A;  1YJ9 A;  2GQI A;  1B3Q A;  1N8R R;  1BCM A;  1ZSZ A;  4C8Q E;  1Y7X A;  3HRU A;  3NTK A;  3CPW P;  5GAO m;  2C0O A;  1WGS A;  4EPC A;  2RO0 A;  5AT1 B;  2NYS A;  2QAS A;  3JCM c;  2LNH B;  3CXC P;  3NTI A;  3OYH A;  2D8H A;  3ASK A;  1WIE A;  3CCS Q;  4JS5 A;  2DL7 A;  1HYO A;  2XID A;  3HRT A;  3PNW C;  1VQO T;  1N9R A;  2CP3 A;  2ED1 A;  4M77 E;  1VQL Q;  2NUT A;  4DQ2 A;  1QP3 A;  2RK1 A;  2EPD A;  2I0N A;  1NZ9 A;  1OX9 A;  4M78 C;  2QDL A;  4M7D B;  3ZEH A;  1YHQ Q;  1Q7Y R;  5FRM A;  2YUQ A;  2HDA A;  3QII A;  1NM7 A;  5LJ3 e;  4PFP A;  1C1A A;  3RMQ A;  3VV0 A;  3CPW S;  1K73 R;  1HXD A;  1M1K C;  2GFU A;  2OAU A;  3HFN A;  2E10 A;  1V29 B;  2RJC A;  3CXC S;  2C0T A;  1PM3 A;  3D7S B;  3JCM e;  3IQL A;  1WDX A;  3QZ9 B;  1VQO A;  2KE9 A;  4FSX A;  2DMO A;  1RLP C;  4AFS C;  2R58 A;  5LJ5 f;  4MML A;  4WCI A;  3PIP A;  1XJW B;  1X2Q A;  5LJ5 g;  1UTI A;  4M75 C;  4PK4 A;  2DKG A;  3CCE Q;  4C0D C;  3OYL A;  4HCB A;  1MMG A;  3CCL Q;  2EQK A;  1T0J A;  1VUB A;  1D1A A;  2LQK A;  1K0S A;  4M4Z A;  2RA2 A;  2HZY A;  4IKF A;  4E47 A;  1VYT A;  1ZA2 B;  3G6E T;  2X4J A;  2FO0 A;  4D8D A;  2B86 A;  2YHT A;  2X4W A;  4M78 E;  3H0F A;  3M0P A;  5J3B A;  3TVT A;  2O4X B;  3CCV T;  3REB B;  2EKO A;  4J8O A;  4EMG A;  4NL3 A;  1NYG A;  1BCO A;  3I56 T;  2LRQ A;  1W70 A;  1BK2 A;  3OS0 A;  2KSS A;  3LH0 A;  3G1J A;  1D3B B;  2OTL Q;  4A54 A;  3ULR B;  1W4S A;  2DRK A;  1OX8 A;  5HCK A;  4FSS A;  2KAF A;  5KYN A;  1FX7 A;  4M75 E;  4C92 F;  2MMP A;  2EYW A;  1GBQ A;  2R5M A;  2EBP A;  3CCV A;  3FEO A;  3RKW A;  2VGM A;  3I35 A;  2AZV A;  1RI9 A;  2QEX T;  1QCF A;  3GPL A;  1QVF A;  2FZK B;  3CBM A;  3I56 A;  2RNA A;  2E5K A;  3AHU A;  4E6R A;  3QJ6 A;  2H3E B;  2LZ6 B;  2JMA A;  4PJO C;  4OMM A;  4C92 G;  4KT0 E;  3BFM A;  2M0Y A;  3HHT B;  1JQQ A;  1S1N A;  1AOJ A;  2VAS A;  4M7A F;  5D6X A;  1EIF A;  1Q81 R;  4QQD A;  1C0M A;  2J6F A;  2EIF A;  2HBW A;  1X2K A;  1EX4 A;  4LNP A;  4JRK A;  3RIR A;  2GBQ A;  3CCS A;  1U3O A;  4LUE A;  3OYD A;  3S3M A;  4AG2 C;  3SEM A;  3EGD A;  3OYE A;  1KC8 U;  1VQ6 T;  1WHH A;  1WHK A;  5C0M A;  1OZ2 A;  1MNE A;  5KCO A;  4ZTJ A;  4M7A G;  5M9O A;  2O01 E;  2E3H A;  2VYT A;  2FZC B;  4JRQ A;  1G3W A;  2SEM A;  2K5L A;  1KQ1 A;  2H8H A;  3QSU A;  3URG A;  3OYJ A;  2W10 A;  1YHQ A;  3PGG A;  4RMO A;  3L42 A;  1LVK A;  3GNG A;  3DB3 A;  4A4E A;  4WF2 A;  2DAQ A;  1D1B A;  3MEW A;  4GY5 A;  3U23 A;  1K8A C;  4J9C A;  3GBQ A;  1H92 A;  5EG2 A;  3TSZ A;  4F7U B;  1BBZ A;  2FRY A;  5GAN 8;  3CC4 T;  3X20 B;  2CP6 A;  3OQ5 A;  2FYK A;  4PJO E;  2XU8 A;  3A8O B;  1AHJ B;  3CCR T;  1VQ6 A;  1OU9 A;  2ESW A;  2BKD N;  2EYQ A;  2XDP A;  3V8J A;  2DX1 A;  4AFQ C;  2XDB A;  1KD1 U;  5IN1 A;  1UJY A;  3SD4 A;  4OB2 B;  1K1Z A;  2MOX A;  4JDS A;  1NPR A;  2GF7 A;  4ZNX A;  3FJ5 A;  1M2V B;  2ED0 A;  2OTL T;  3CCL A;  4AMC A;  4EMH A;  3JB9 I;  1K9M U;  3I55 T;  2F5T X;  1ZSZ B;  1KHC A;  1G3Y A;  1K0X A;  4BE0 A;  1PNJ A;  1OU8 A;  1JJ2 S;  1IHV A;  2QA4 T;  4VUB A;  3JCM b;  2YUO A;  3ZL7 C;  3H8Z A;  1NLO C;  2A36 A;  4Z88 A;  1QLY A;  1ABQ A;  4L59 A;  3CCR A;  1Y71 A;  1VQM Q;  2FZG B;  3G7Z A;  1QKW A;  1YIJ Q;  1HSQ A;  2QQR A;  4LXC A;  1M1K R;  1LCK A;  1Q82 C;  2NUT B;  2ZPF B;  3OYY A;  2CYZ B;  2KK4 A;  4TVR A;  4DA4 A;  5LJ5 e;  3VS3 A;  2V8J A;  3M9Q A;  1SEM A;  2OTL A;  1WXU A;  3VS5 A;  2ZPI B;  4F7U F;  4OB3 B;  1NJI U;  1W2B A;  3I55 A;  5GAN 2;  2VKN A;  1LNX A;  3M0S A;  3UF4 A;  3JB9 D;  5KYY A;  5IXF A;  4N4G A;  1ZUU A;  3ZBD A;  4C0F A;  2J6K A;  1HK9 A;  2ECZ A;  4LE9 A;  2PTK A;  1X69 A;  2HKN A;  3PVQ A;  4BI3 A;  2KDS A;  3CEY A;  4YTL A;  3VRZ A;  4F7U G;  4V2S A;  1X6G A;  2DPP B;  5CR2 A;  1YCY A;  2KI7 A;  3VRY A;  1PHT A;  1N8R C;  3RKX A;  2RF0 A;  3QWY A;  3VU3 C;  3M4G A;  4DEX A;  3TSW A;  5HKC A;  2F69 A;  2A28 A;  3CCM T;  1YIT T;  4LDU A;  2DIQ A;  2LCL A;  3CCU T;  2M0O A;  4KRT A;  2CP7 A;  2QG9 B;  4DBR A;  5GMK m;  4EMK B;  4D6W A;  3BE3 A;  4MDX A;  1RAH B;  5DLO A;  4XU2 A;  2P84 A;  2R57 A;  3H0H A;  1AEY A;  2RD1 A;  1NE8 A;  3FRN A;  2HEQ A;  1UUE A;  4OVA A;  4Y28 E;  2LC4 A;  3OS2 A;  2L5Q A;  2LNV A;  1Q7Y C;  3DKM A;  1G5V A;  1PG5 B;  1TG0 A;  3M0U A;  3EGU A;  3JCM h;  1M2O A;  5FU6 B;  1RAC B;  5GAM d;  1YP5 A;  2P0P A;  3QG1 A;  2WSF E;  1K73 C;  1YJ9 Q;  4LDY A;  5GAO l;  3OYI A;  3NMZ C;  1YIT A;  9ATC B;  4C8Q F;  5KE3 A;  3KBG A;  2QAZ A;  3CCU A;  2D1X A;  1TXQ A;  2P0Q A;  3PT9 A;  1I8F A;  1YJN T;  3VS1 A;  4J83 A;  2LQN A;  3EHQ A;  3L2U A;  4MZM A;  3MCA B;  5GMK j;  2RQR A;  3R6N A;  2ZPH B;  4XTZ A;  2DXU A;  2VXE A;  4A4F A;  3R6O A;  4M77 F;  4C8Q G;  4PLI A;  1RUW A;  1KIK A;  3EFS A;  2YXY A;  1QP2 A;  1SSF A;  4X9D A;  2KRN A;  2A0F B;  5J39 A;  2YWW A;  3V7R A;  2L3Q A;  3REA B;  2Y4X A;  2MYS A;  5GJV B;  1WXB A;  2FPF A;  1R0C B;  4M77 G;  4X9C A;  3EGD B;  1TOV A;  3AT1 B;  1GCQ A;  3SB2 A;  1YJN A;  3M58 A;  1K8A R;  1VQ9 T;  4HVU A;  4R56 A;  1GFD A;  5GAN 6;  1W1F A;  1VQO Q;  1RAD B;  2E12 A;  3OS1 A;  4WTO B;  4BI4 A;  4UC4 A;  3DLL A;  1WNL A;  3UT1 A;  2X9H A;  2NLU A;  4M75 B;  2F2W A;  1YJW T;  4C0D B;  4N4I A;  2I2L A;  3QO3 A;  5GAN 4;  4FW2 A;  5CK9 A;  2EJ9 A;  2EYX A;  3EG0 A;  3A98 A;  2DBM A;  2M51 A;  3FDR A;  3PTA A;  5GAN j;  1PSF A;  1ZBJ A;  1ZUY A;  2K57 A;  3OYC A;  1H8K A;  3UDC A;  1U06 A;  1D0Z A;  2E3I A;  3JAM E;  4DOV A;  2PVO B;  1UGR B;  1WQW A;  1BI3 A;  4M78 F;  4QVD A;  4IUP A;  2K4Y A;  1K9A A;  1VQ9 A;  1MV0 B;  5KYX A;  2KRS A;  5CKH A;  5GAN 3;  4FIB A;  4BE1 A;  4LD6 A;  4ZN1 A;  1HJD A;  5GAO p;  1MMD A;  1RI0 A;  1S72 Q;  2J7I A;  1YJW A;  3H0I A;  1Q81 C;  3TQ7 P;  2WSC E;  4CC2 A;  1BU1 A;  4J9I A;  2L89 A;  1UE9 A;  4HT9 A;  2CT4 A;  4M78 G;  4C0Z A;  1RAB B;  4E7L A;  2VB6 A;  3TU4 K;  3G6E Q;  2DER A;  1UEB A;  2X3W D;  2CZ1 B;  4M75 F;  2DIG A;  2QI2 A;  2DNU A;  3M59 A;  2QTV A;  3CCV Q;  2YRC A;  3MKD A;  4B6M A;  3ZFJ A;  4F16 A;  8ATC B;  4KH1 B;  3I56 Q;  2NUP A;  4OP0 A;  2DTH A;  3VS6 A;  5IH2 A;  1Q86 U;  4ZN3 A;  2XIC A;  2K3Y A;  2XDD A;  4RTW A;  2L3P A;  4M75 G;  1WHG A;  3VS7 A;  1JRI A;  1ZSG A;  2QGG A;  3S6W A;  4ELY C;  1RAG B;  3OYA A;  2KQW A;  4II1 A;  1Z9Q A;  2MWP A;  1MMA A;  2KNB B;  3MHX A;  2LTO A;  2DZC A;  2RN8 A;  1U8R A;  3OW2 P;  2RHX A;  1GXI E;  2KGT A;  3J81 E;  1WQ7 A;  2QEX Q;  1QWE A;  1FXX A;  3WXM B;  2PQW A;  1WX6 A;  2RB6 A;  1ZHI A;  5FRO A;  2YLB A;  5GMK h;  3RMS A;  2FPE A;  2AHJ B;  2EQI A;  4E2F B;  2CH4 A;  3OY9 A;  5LJ5 h;  2O9V A;  2ENM A;  1FMW A;  1M8M A;  2L3R A;  2DET A;  4AT1 B;  2OTJ T;  2FEI A;  4PJO F;  1GL5 A;  3CBO A;  4HXJ A;  4PLL A;  1VQ6 Q;  2KXD A;  4ZTF A;  3OW2 S;  3SDZ A;  2VUB A;  1QVG P;  2G6F X;  3KUF A;  1S72 T;  4O5V A;  1M8V A;  1M3A A;  4CC3 A;  2CT3 A;  1IXD A;  2K3B A;  1X27 A;  1RL2 A;  3OMG A;  2LJ1 A;  2DYB A;  1OUL A;  1IB8 A;  3UWN A;  3OS5 A;  3PFS A;  2X4X A;  4PJO G;  5GMK i;  1UFF A;  2JXB A;  1NPP A;  3OB9 A;  2DIL A;  1AWW A;  3LX7 A;  3Q1J A;  3CC4 Q;  2OTJ A;  1JXM A;  2HL5 C;  2RI2 A;  1UB4 A;  1LJO A;  2COZ A;  2PUO B;  3EG9 A;  3CCR Q;  2DJZ A;  3LLR A;  2K7A A;  3G4S T;  2RHY A;  4M7D F;  2CZ6 B;  4PFZ A;  1M90 C;  2MIO A;  1S72 A;  2VVK A;  3LW5 E;  1YNZ A;  3QJY A;  1XNI A;  2JVV A;  2ROL A;  1QVG S;  3EFR A;  2ZZD A;  2D9T A;  2VV5 A;  1AWJ A;  2ZAE A;  4LDX A;  1G2B A;  2EGC A;  5GAN f;  3I55 Q;  2XK0 A;  2CSQ A;  4OMN A;  5GAN g;  3G6E A;  1R77 A;  1JBM A;  4M7D G;  3C0C A;  4J9F A;  1NEB A;  3L2Z A;  5CQY A;  4IIO A;  2QA4 Q;  3SFM A;  2COW A;  2LMJ A;  4KUI A;  2A3L A;  3L2W A;  1OV3 A;  3VJP A;  1JEG A;  3L1A A;  1AD5 A;  1R8O B;  1KQS P;  1NLP C;  3S3O A;  2V8K A;  2DA9 A;  2HD0 A;  5CKE A;  3A8L B;  2KR3 A;  4KGZ B;  2DXB A;  4RTU A;  4JLI A;  4PKC C;  1H3Z A;  1M5Q 1;  2BTT A;  4ATO A;  2H3J A;  2OI3 A;  2WSE E;  1ZUK A;  2JZ2 A;  2NUZ A;  3OSV A;  3PVL A;  3RUX A;  5KYX B;  1Y96 B;  2QEX A;  2JW4 A;  2KBT A;  1V76 A;  2DL5 A;  5FWC A;  1CKA A;  5CKF A;  3GF5 A;  2MWO A;  1KQS S;  2FL7 A;  4KGV B;  2EJF A;  1PC0 A;  2K5I A;  2RHU A;  2CUB A;  4C92 D;  1FMV A;  3P8H A;  1WI7 A;  4PJL A;  4PJN A;  2DXT A;  1JJ2 P;  3CCM Q;  1YIT Q;  4IIM A;  2K2M A;  2CP0 A;  3THK A;  1Y57 A;  5A0G A;  4FM4 B;  5CCA A;  1SRM A;  3CCU Q;  4GLM A;  5KYW A;  2RJF A;  1WPY A;  2DXC A;  3CPW A;  1M9S A;  2DM1 A;  2JJ9 A;  1ZX6 A;  4JRP A;  1M1K U;  4A4K A;  1QVP A;  2LQ8 A;  3CXC A;  5FU7 B;  5ECA A;  2PUK B;  2P0K A;  3M4Y A;  2NUP B;  2CSI A;  2X4Y A;  4N4H A;  1IGU A;  1N9S A;  4XU3 A;  1TWB A;  4M7A D;  2K5F A;  2ZCF B;  5D7U A;  2RJD A;  3S3N A;  4A4H A;  4OMF B;  3C12 A;  1KC8 R;  4J7I A;  4CRI A;  3PIO A;  2FHD A;  2J6O A;  4J9G A;  3MEU A;  5GAN 5;  4E7K A;  1YWP A;  1G3T A;  5LJ3 d;  3V8L A;  1O9S A;  2QGF B;  4Y92 A;  1M27 C;  3CC4 A;  2LVM A;  2O2O A;  1NEG A;  4DOW A;  4B9W A;  1LPL A;  4LDV A;  2DYI A;  1YJN Q;  3JCM d;  2VGN A;  5C6S A;  1VYU A;  3KFV A;  3WVE B;  4JJB A;  5GMK e;  3NGP A;  4JRI A;  4F04 B;  3DB4 A;  2GFA A;  3M56 A;  3CCQ T;  5KH6 A;  2LP5 A;  4Z89 A;  2DVE A;  2RPN A;  3T9N A;  1Z9Z A;  3OYF A;  4JJN K;  3CBP A;  4QKU A;  4M7A C;  4N0A A;  2DF6 A;  2E1H A;  2HKQ B;  1M4Z A;  1KD1 R;  1RLQ C;  3LGL A;  2QA4 A;  2V1Q A;  1IRE B;  1JXO A;  2RI5 A;  1X01 A;  3H41 A;  5D6W A;  2KT1 A;  1GCQ C;  2JTE A;  5GAM j;  1I5L A;  3H9N A;  2V1R A;  2GCX A;  1K9M R;  2YSQ A;  1XOV A;  4F14 A;  1VQ9 Q;  1VQ8 T;  4HA8 A;  4Y91 A;  3M54 A;  4OB0 B;  2DZ9 A;  5IAY A;  1KK7 A;  4ZGE B;  2O88 A;  2YLC A;  1M3C A;  1XQH A;  3CCQ A;  2FB7 A;  4FYX B;  3M0R A;  4RG8 A;  2OAW A;  3QXE B;  1YJW Q;  4JUV A;  5DY9 A;  1M90 R;  1KHI A;  1KQ2 A;  2PU9 B;  1M1F A;  2YUP A;  2Z0W A;  1PKS A;  4GBQ A;  5A2Q E;  4OMO A;  5GAN e;  2J05 A;  3GNF B;  3NFC A;  1RAA B;  2RI3 A;  1K76 A;  3OYK A;  2DVJ A;  3CPF A;  4GLK A;  3EG9 B;  1I1J A;  4J9D A;  2DL4 A;  1VQ8 A;  3LH5 A;  1X43 A;  1I0C A;  4JZ3 A;  2SRC A;  1Q95 G;  1RAE B;  1WHL A;  2JS2 A;  2IIM A;  2JN0 A;  2JUF A;  4BE2 A;  2BIV A;  1LOJ A;  4OGC A;  3CCM A;  4KUD K;  1PWT A;  4ORZ A;  4AG1 C;  1YI2 T;  2CP2 A;  4BY6 C;  1T3S A;  2RQV A;  2QTX A;  3E19 A;  2HL3 A;  2QK0 A;  3FJP A;  2FG0 A;  4J7F A;  4C92 A;  2EQJ A;  3EHR A;  3MP6 A;  1TUC A;  2BZX A;  1YN8 A;  1UGS B;  3C95 A;  5A0D A;  3HSB A;  1TU0 B;  2L3S A;  1PCX A;  2DTO A;  4JLG A;  1K8A U;  3E9F A;  3V7C A;  4QQ6 A;  5J26 A;  1UHC A;  1WHJ A;  2OJ2 A;  5FU7 C;  3CME T;  3N5B B;  1ABO A;  2F2X A;  2LJ3 A;  1U1S A;  4IUU A;  4E7Z A;  2JOY A;  4BUG A;  2MAM A;  3CCJ Q;  2O4X A;  1TUD A;  4HCK A;  3M57 A;  2RHZ A;  3GOX A;  4M7A A;  2PVD B;  1YI2 A;  3LWH A;  3VS0 A;  2E4H A;  3QPH A;  1E6G A;  2ZPE B;  1SF9 A;  2CKK A;  1D0Y A;  1PRM C;  2K9G A;  2RM4 A;  4OF1 A;  2LDM A;  2DEQ A;  5HK3 A;  1UGQ B;  1AZE A;  1AWO A;  1VOM A;  4J6W A;  1BKB A;  4ZGJ B;  1OPL A;  2EQU A;  2RK2 A;  3EG2 A;  3QUI A;  3V8K A;  1VQ4 T;  3H6Z A;  3HPW A;  3QKJ A;  3J80 E;  2PNI A;  2E64 A;  4C8Q D;  4J6Y A;  4X34 A;  1Q82 U;  2MCN A;  3HKS A;  2HQX A;  5CQX A;  1X75 C;  2EKH A;  1QWF A;  4BDY A;  1B34 A;  1UDL A;  4NS5 A;  1UGP B;  3PMT A;  5KYU A;  4BI8 B;  1VQN Q;  5KYW B;  3M55 A;  1KFZ A;  2OTJ Q;  4M77 D;  1VQ5 T;  3RKY A;  1VA7 A;  3WVD B;  4CC7 A;  1B07 A;  4OMP A;  5KCH A;  2HQH A;  1W6X A;  3JCM Q;  4FT2 A;  1ZBX A;  1QVF P;  4QQG A;  5LJ5 d;  4FU6 A;  3ER0 A;  2BE9 B;  1KG1 A;  3OA6 A;  3I5R A;  2CH4 W;  4MZP A;  4E7J A;  1N8R U;  2DD5 A;  3MET A;  3CC2 T;  2D0N A;  1QCO A;  5LL6 S;  2KY9 A;  3MO8 A;  5CKB A;  2FVU A;  5GAM f;  1I5O B;  4RTZ A;  3A5Z B;  2L2P A;  1MUZ A;  5GAM g;  5GAN 7;  1VQ5 A;  4RCC A;  2CP5 A;  2AKK A;  3JCM X;  2EWN A;  3INZ A;  1QMC A;  3G4S Q;  3OYN A;  2EYY A;  2QQB A;  4HCC A;  3C4S A;  4M77 C;  2A7Y A;  1M3B A;  3OYB A;  2YUN A;  4F7U A;  6AT1 B;  3QWX X;  3CCJ T;  4MDW A;  1QVF S;  1WFW A;  1U5S A;  2XD0 A;  3LWI A;  1Q7Y U;  3CC2 A;  2LJ0 A;  1KJW A;  2BUD A;  5KYY B;  3A1P A;  4M78 D;  2MK5 A;  3VYG A;  1G3S A;  2DL8 A;  1K73 U;  4DBF A;  1JU5 C;  3L2R A;  2V8I A;  1ARK A;  2OX7 A;  3JCM W;  2FRW A;  4KGX B;  1H64 1;  1OQK A;  4CI0 C;  2ZPB B;  4JPB W;  3MP1 A;  3VS2 A;  1KC8 C;  1VQK T;  3NTH A;  4K11 A;  2KYB A;  2LX9 A;  2KVQ G;  5DLQ E;  3JSC A;  2JTM A;  3CCJ A;  1QW1 A;  5GAO q;  2RJE A;  2QYZ A;  4Z02 A;  1IO6 A;  4M75 D;  4J9H A;  2D8J A;  3E2U A;  4XTY A;  1PRL C;  1VQN T;  4IUT A;  2EQM A;  3RNJ A;  4ESR A;  2LT4 A;  1ACM B;  1UJ0 A;  1Q86 R;  3SWN A;  3MEV A;  3QDR B;  4BB7 A;  3OMC A;  3RER A;  1VQ7 T;  4E7I A;  1MND A;  3HL8 A;  2AIR B;  4RTY A;  4ELZ C;  1SPK A;  1RAI B;  1VQK A;  3G71 T;  3KXT A;  2M9U A;  2K2V A;  2LCC A;  3DLM A;  1KD1 C;  1WHM A;  4KUL A;  5HK0 A;  4C8Q A;  1VYV A;  3A8M B;  3M5A A;  2EFI A;  1X6B A;  2QQ9 A;  1W2B P;  4C92 B;  1VQN A;  3J7A F;  1K9M C;  4A53 A;  1B7T A;  2BZ8 A;  1PD1 A;  1BI0 A;  1JB0 E;  1SG5 A;  3M0T A;  4RG2 A;  4PJM A;  1VQ7 A;  1PSE A;  5GAN h;  2KEA A;  2DBK A;  4QW2 A;  2O9S A;  2ABL A;  3CMA T;  4O6J A;  3SHW A;  3VS4 A;  2VC8 A;  1D09 B;  1TS9 A;  4M77 A;  2XKO C;  3EFO A;  3QYG B;  3G71 A;  3A8G B;  1N5Z A;  3ME9 A;  4EMK A;  2G3R A;  4OB1 B;  4Q5W A;  4M7A B;  1UEC A;  4J9B A;  1Q81 U;  1SSH A;  4NOY A;  2E5Q A;  4PFO A;  1NJI C;  2FPD A;  4PJO D;  1VQP Q;  3CC7 T;  5IXB A;  1DJ7 B;  4ME7 A;  1W2B S;  2DJQ A;  3X25 B;  3HP9 A;  1WYX A;  4XTV A;  3QZ5 B;  2R5A A;  2DEU A;  3PMI A;  3G4S A;  4FYV B;  2WAC A;  3CMA A;  2HAX A;  5I2M A;  1NG2 A;  2C06 A;  4XTW A;  3M53 A;  3VUZ A;  3NPF A;  1G8X A;  2F1L A;  3CCQ Q;  2IPO B;  1R0B G;  4XK8 E;  3CCS T;  3EG3 A;  4L6V 5;  3P8B B;  1UGV A;  2AZS A;  1BI2 A;  3EGX A;  1E7O A;  4N0A C;  1VQL T;  4L5G A;  1B34 B;  5KYU B;  3CC7 A;  5GMK l;  2LQW A;  4M7D D;  4D8K A;  5FRN A;  2PZ1 A;  3CD6 Q;  3LYI A;  4M78 A;  2IG0 A;  3OBW A;  1YHQ T;  3E1S A;  2LX7 A;  5GAM e;  2HMA A;  4IUQ A;  3MPU B;  4EDU A;  2EAY A;  5CO7 A;  1VQ8 Q;  1FYN A;  1I07 A;  5LJ3 j;  3JCM V;  5CKD A;  1MMN A;  1YFN A;  1I81 A;  5CAI A;  2EW3 A;  3PE0 A;  1FWZ A;  3UA6 A;  3X26 B;  1GBR A;  4QVC A;  1TTH B;  4C5H A;  3QBY A;  1BYM A;  4FT4 A;  4BY6 B;  1WXT A;  1VQL A;  4LUD A;  3GLX A;  2A08 A;  3FB9 A;  5FLX E;  1OI1 A;  3HTR A;  3UA7 A;  4QT7 A;  3CCE T;  4M75 A;  4CC4 B;  1UG1 A;  4RTT A;  7AT1 B;  2O31 A;  2KT8 A;  3CCL T;  5GJW B;  4R55 A;  1TH7 A;  1WZO A;  2K79 A;  5I2S A;  4J9E A;  4M7D C;  2X51 A;  1N6A A;  4PJJ A;  1XTD A;  3BDL A;  1H3H A;  1GCP A;  5GAO r;  2X35 A;  2F2V A;  4IUV A;  1FMK A;  1SHF A;  3OW2 A;  4E7H A;  3VYH B;  1U1T A;  3GP8 A;  1WJS A;  2KMT A;  3JB9 F;  2QQA A;  3FIF A;  1NYF A;  4AFU C;  2L8D A;  4J5Y A;  3RES A;  5IHI A;  2EVR A;  4BDZ A;  2MPX C;  1WJR A;  3L2V A;  1BIB A;  3OYM A;  1YI2 Q;  1VQP T;  4C5I A;  2E70 A;  3VUB A;  2QXF A;  4C92 C;  1ZQ1 A;  2YDL A;  4C5E A;  3CCE A;  4FYW B;  4JJC A;  1OEB A;  3MP8 A;  2GGR A;  2GTO A;  4HT8 A;  3JB9 G;  2GQV A;  4QVZ A;  1OYX A;  2M02 A;  2DFU A;  3UAT A;  4MZT A;  2A37 A;  3QDF A;  1JO8 A;  5KE2 A;  3CME Q;  1Y07 A;  2JS0 A;  4DBQ A;  5FW9 A;  4PNO A;  2IVW A;  2CZ0 B;  3I9Q A;  1M90 U;  3F70 A;  4EIK A;  1QVG A;  4M7D E;  2HNI A;  2L0A A;  2HQE A;  4X1V A;  3FC3 A;  1IHW A;  1VQP A;  4B9X A;  2RMO A;  1GRI A;  2CDT A;  4E7S A;  1X6O A;  3CD6 T;  5L8R E;  3SWN B;  2GTJ A;  1KSW A;  2CGH A;  2KRM A;  2RQT A;  3JV3 A;  4PJO A;  4KH0 B;  1OOT A;  2RH2 A;  2CRE A;  1SHG A;  2DE0 X;  2YRV A;  5DM7 R;  4RCB A;  1HD3 A;  4C92 E;  1J3T A;  2J06 A;  1VQ4 Q;  2HBP A;  2P4R A;  2QQS A;  3JB9 J;  3M0Q A;  4A63 B;  3GIB A;  1EZZ B;  3HRS A;  3EAE A;  3V7S A;  4C8Q B;  2JM8 A;  4FL6 A;  2HSE B;  3MJX A;  1VIF A;  4JS4 A;  2BE7 D;  3TCJ A;  4IUR A;  5I22 A;  3CD6 A;  2Y4Y A;  3X24 B;  2JMC A;  1A0N B;  1NJI R;  4FYY B;  1VQ5 Q;  4M7D A;  4M7A E;  5FWB A;  2E6Z A;  2VXF A;  4P5N A;  1QCN A;  4M77 B;  3EFO B;  2EJG A;  3P8D A;  4RKU E;  4F17 A;  3FLG A;  3C94 A;  2DRM A;  2AK5 A;  1BIA A;  1Y0M A;  4OMQ A;  3NHN A;  1KQS A;  2BZY A;  2KRO A;  5LJ3 h;  1YCS B;  3RR6 A;  1WJQ A;  1Q86 C;  3CC2 Q;  2ZGW A;  5AYF A;  4LDW A;  2DK3 A;  3BW1 A;  1CKB A;  2C0I A;  5A0L A;  1BB9 A;  4RUG A;  4XTU A;  1M30 A;  2XMF A;  1IGQ A;  5CIU A;  2RQU A;  2PVG B;  4DBH A;  1T3L A;  4XU1 A;  2MF2 A;  4J6X A;  2K6D A;  1TSF A;  5LJ3 f;  4BAC A;  1D0X A;  2JNG A;  4RTX A;  2E6N A;  4LN2 A;  2ATC B;  5LJ3 g;  1SKU B;  2DLP A;  4DEY A;  1MGQ A;  4PL6 A;  1MHN A;  2CUD A;  3JCM f;  2JM9 A;  1I4K 1;  2ROT A;  3EH1 A;  2DD4 A;  1AWX A;  1MV3 A;  3VKI A;  1QKX A;  2Y90 A;  3EGX B;  2KYM A;  1VQM T;  3JCM g;  1D1C A;  1YIJ T;  2LCS A;  5GAO n;  2DL3 A;  1ZLM A;  2P4T A;  3L2Q A;  3A8H B;  1OZ3 A;  5LJ5 j;  2B8A A;  2GNC A;  4NL2 A;  4M78 B;  3HFO A;  3MEA A;  2RQW A;  1CSK A;  2AT1 B;  1JJ2 A;  1M1G A;  1RAF B;  1G83 A;  1D3B A;  1P92 A;  2VWF A;  4C0G A;  1ZSZ C;  2EYZ A;  3E9G A;  4KBM B;  3O8V A;  2ZPG B;  3EH2 A;  3CME A;  4C5G A;  1VQK Q;  3JCM P;  2JTF A;  2LT1 A;  2CS7 A;  3RBB B;  1VIE A;  5HY6 A;  5I21 A;  8AT1 B;  4HCZ A;  4ZGD B;  4JJD A;  1TUG B;  1VQM A;  2D0Q B;  1YIJ A;  2COY A;  4XQ3 A;  4JZ4 A;  1SRL A;  2K3X A;  2QDY B;  3BDU A;  2YRD A;  3QHS A;  4XU0 A;  4BD3 A;  2E65 A;  2DO3 A;  2HCK A;  3CQT A;  4F7U E;  3SWN C;  1V1C A;  5IHN A;  4AFZ C;  5IHK A;  1VQ7 Q;  3JRZ A;  3O5Z A;  2MI6 A;  1OPK A;  4HKE A;  4HVV A;  4Z8A A;  2CZ7 B;  1VQ4 A;  4R0K A;  2E41 A;  2V26 A;  3JB9 H;  5GAM h;  1K4U S;  3G71 Q;  3EG1 A;  1E6H A;  4OML A;  1PD0 A;  1WLP B;  1YWO A;  1IRX A;  4FCY A;  1AZG B;  2RHI A;  2YT6 A;  1Y96 A;  1YBY A;  1BI1 A;  4C8Q C;  3JCM J;  5EC7 A;  3OSS C;  2XI9 A;  1NBE B;  5L23 A;  2EGA A;  2AKL A;  3OBY A;  2EGE A;  4MMK A;  1Q82 R;  2F5K A;  1C6V X;  1YJ9 T;  2XG8 D;  2M16 A;  4FW1 A;  1F1B B;  5CVI A;  4RTV A;  1T0H A;  2M1H A;  3CMA Q;  1PKT A;  5IT9 E;  3TEE A;  4XTX A;  3I5S A;  1N27 A;  3OYG A;  1AT1 B;  2KXC A;  4LD9 K;  2DTI A;  3UPU A;  4HVW A;  1IZ6 A;  3X28 B;  1O75 A;  5D6Y A;  4EMK C;  1AVZ C;  3LGF A;  4XAX B;  4A4G A;  1UHF A;  2NWM A;  5GAN d;  2X3X D;  2XHC A;  5I11 A;  2W0Z A;  2D6F A;  4OGE A; 
#chains in the Genus database with same CATH homology
 3QYH B;  5C6S A;  2DXU A;  2VXE A;  4A4F A;  3R6O A;  3BY7 A;  3HP9 A;  4M77 F;  3WVE B;  4XTV A;  3TRE A;  5GMK e;  4PJO B;  3QZ5 B;  4JRI A;  2R5A A;  5FU6 C;  3DB4 A;  4C8Q G;  3PMI A;  2GFA A;  3G4S A;  3CMA A;  2WAC A;  3M56 A;  2HAX A;  1YJ9 A;  4PLI A;  5I2M A;  3CCQ T;  5KH6 A;  2C06 A;  4XTW A;  3M53 A;  3EFS A;  3VUZ A;  4C8Q E;  1Y7X A;  3HRU A;  1QP2 A;  1SSF A;  3NTK A;  5GAO m;  2DVE A;  1WGS A;  4X9D A;  4XK8 E;  3T9N A;  4EPC A;  2RO0 A;  3OYF A;  4JJN K;  5J39 A;  3CCS T;  3V7R A;  3JCM c;  3CBP A;  4M7A C;  4L6V 5;  2Y4X A;  3NTI A;  3P8B B;  3OYH A;  4N0A A;  2E1H A;  1BI2 A;  1M4Z A;  3ASK A;  4JS5 A;  4N0A C;  1VQL T;  2XID A;  3LGL A;  4M77 G;  4X9C A;  2QA4 A;  3HRT A;  3PNW C;  4L5G A;  3SB2 A;  3M58 A;  1VQO T;  1B34 B;  1N9R A;  1IRE B;  1YJN A;  2RI5 A;  1X01 A;  3CC7 A;  1VQ9 T;  5D6W A;  4R56 A;  4M77 E;  5GMK l;  4M7D D;  5GAM j;  1I5L A;  5GAN 6;  4DQ2 A;  5FRN A;  1QP3 A;  2GCX A;  3LYI A;  4M78 A;  2E12 A;  2RK1 A;  1XOV A;  2IG0 A;  3OBW A;  4BI4 A;  4UC4 A;  3OS1 A;  1VQ8 T;  1NZ9 A;  4HA8 A;  3DLL A;  3E1S A;  4Y91 A;  1WNL A;  3UT1 A;  4M78 C;  3M54 A;  5GAM e;  2NLU A;  4M75 B;  4OB0 B;  2DZ9 A;  1YJW T;  4IUQ A;  4C0D B;  5IAY A;  4N4I A;  4ZGE B;  4EDU A;  2YLC A;  2EAY A;  1XQH A;  5CO7 A;  4M7D B;  3CCQ A;  3ZEH A;  2FB7 A;  2I2L A;  5LJ3 j;  3QO3 A;  3JCM V;  4RG8 A;  5GAN 4;  5FRM A;  3QXE B;  5CKD A;  5CK9 A;  4JUV A;  2EJ9 A;  1I81 A;  5DY9 A;  3QII A;  5LJ3 e;  5CAI A;  1KHI A;  1KQ2 A;  3FDR A;  3PTA A;  5GAN j;  3CPW S;  3RMQ A;  3VV0 A;  1FWZ A;  1PSF A;  2PU9 B;  3X26 B;  4QVC A;  1HXD A;  1M1F A;  1M1K C;  2K57 A;  4C5H A;  3OYC A;  3QBY A;  3UDC A;  1BYM A;  2GFU A;  2OAU A;  3HFN A;  2E10 A;  5A2Q E;  1V29 B;  2RJC A;  4FT4 A;  5GAN e;  3GNF B;  3NFC A;  3JAM E;  4BY6 B;  3CXC S;  4DOV A;  2PVO B;  1VQL A;  1UGR B;  1WQW A;  3GLX A;  2RI3 A;  3JCM e;  1BI3 A;  3QZ9 B;  4M78 F;  3FB9 A;  5FLX E;  4FSX A;  1OI1 A;  4IUP A;  4QVD A;  3OYK A;  1VQO A;  3CPF A;  2R58 A;  2K4Y A;  1VQ9 A;  5LJ5 f;  3CCE T;  4MML A;  4M75 A;  4GLK A;  5CKH A;  3PIP A;  5GAN 3;  4FIB A;  3CCL T;  5LJ5 g;  4BE1 A;  4LD6 A;  4M75 C;  4ZN1 A;  2DKG A;  4R55 A;  5GAO p;  1VQ8 A;  1TH7 A;  4C0D C;  5I2S A;  1RI0 A;  3OYL A;  4HCB A;  4M7D C;  1YJW A;  1N6A A;  1Q81 C;  2EQK A;  1XTD A;  1VUB A;  3BDL A;  2LQK A;  5GAO r;  2X35 A;  2WSC E;  4IUV A;  2L89 A;  2RA2 A;  4IKF A;  4E47 A;  4HT9 A;  2JN0 A;  3G6E T;  2X4J A;  3OW2 A;  4M78 G;  4E7H A;  2JUF A;  4BE2 A;  3VYH B;  2BIV A;  1LOJ A;  4C0Z A;  1U1T A;  3GP8 A;  1WJS A;  2KMT A;  3JB9 F;  4OGC A;  4E7L A;  2YHT A;  2X4W A;  2QQA A;  3FIF A;  3CCM A;  4KUD K;  1YI2 T;  3TU4 K;  4M78 E;  2L8D A;  1UEB A;  4BY6 C;  4J5Y A;  3RES A;  5J3B A;  2QTX A;  2CZ1 B;  3E19 A;  2O4X B;  4BDZ A;  3CCV T;  2EKO A;  4M75 F;  1WJR A;  3FJP A;  3L2V A;  2DIG A;  4J7F A;  2QI2 A;  1BIB A;  3M59 A;  4C92 A;  3OYM A;  2EQJ A;  3MP6 A;  1VQP T;  4J8O A;  4C5I A;  2E70 A;  4EMG A;  3VUB A;  2QXF A;  4C92 C;  1UGS B;  1ZQ1 A;  3C95 A;  5A0D A;  4NL3 A;  4C5E A;  3CCE A;  3HSB A;  3ZFJ A;  3I56 T;  2DTO A;  4JLG A;  2LRQ A;  1K8A U;  3E9F A;  3V7C A;  3MP8 A;  4HT8 A;  3OS0 A;  2KSS A;  4QQ6 A;  3JB9 G;  3LH0 A;  4OP0 A;  2GQV A;  1D3B B;  2DTH A;  4QVZ A;  5FU7 C;  1OYX A;  5J26 A;  3N5B B;  3CME T;  4ZN3 A;  1Q86 U;  2XIC A;  2K3Y A;  4A54 A;  4MZT A;  1W4S A;  3X25 B;  2XDD A;  1U1S A;  4M75 G;  4IUU A;  5KE2 A;  1Y07 A;  1JRI A;  2JOY A;  4BUG A;  4PNO A;  3S6W A;  2MAM A;  2KAF A;  2IVW A;  2O4X A;  2CZ0 B;  4ELY C;  3OYA A;  1FX7 A;  3M57 A;  2RHZ A;  4M75 E;  1M90 U;  2KQW A;  4C92 F;  4II1 A;  3F70 A;  2MMP A;  3GOX A;  4M7A A;  2PVD B;  2MWP A;  1YI2 A;  3LWH A;  2R5M A;  1QVG A;  4M7D E;  3MHX A;  2HNI A;  2LTO A;  3FEO A;  3QPH A;  2DZC A;  2VGM A;  3RKW A;  3CCV A;  1U8R A;  2HQE A;  2ZPE B;  3FC3 A;  1VQP A;  2QEX T;  1YHQ T;  4B9X A;  1QVF A;  2CKK A;  3GPL A;  2RHX A;  2RM4 A;  4OF1 A;  1X6O A;  2LDM A;  3CBM A;  3CD6 T;  1GXI E;  5L8R E;  3SWN B;  3J81 E;  1WQ7 A;  3I56 A;  3AHU A;  2DEQ A;  2CGH A;  5HK3 A;  1UGQ B;  1FXX A;  4PJO A;  3WXM B;  3QJ6 A;  4J6W A;  2RH2 A;  2PQW A;  1BKB A;  4ZGJ B;  2RB6 A;  4PJO C;  2EQU A;  1ZHI A;  2RK2 A;  3QUI A;  4KT0 E;  4C92 G;  3V8K A;  4M7D F;  3BFM A;  1VQ4 T;  5FRO A;  3HHT B;  3H6Z A;  3HPW A;  2YRV A;  2YLB A;  5DM7 R;  3QKJ A;  3J80 E;  4RCB A;  5GMK h;  4C92 E;  3RMS A;  4M7A F;  2E64 A;  2AHJ B;  1EIF A;  4J6Y A;  5D6X A;  4QQD A;  4X34 A;  4C8Q D;  2HBP A;  1Q82 U;  2EIF A;  3OY9 A;  2QQS A;  5LJ5 h;  3JB9 J;  3HKS A;  4JRK A;  3RIR A;  2HQX A;  5CQX A;  1X75 C;  3GIB A;  3CCS A;  3HRS A;  3OYD A;  3S3M A;  3EAE A;  3V7S A;  2L3R A;  4C8Q B;  3OYE A;  1KC8 U;  4BDY A;  1VQ6 T;  1B34 A;  4FL6 A;  2OTJ T;  4NS5 A;  1UGP B;  3PMT A;  4BI8 B;  1VIF A;  5C0M A;  4PJO F;  1OZ2 A;  3M55 A;  4JS4 A;  3CBO A;  3TCJ A;  5KCO A;  4ZTJ A;  4PLL A;  4IUR A;  3CD6 A;  2Y4Y A;  3X24 B;  4M77 D;  4ZTF A;  3RKY A;  1VQ5 T;  3OW2 S;  4M7A G;  5M9O A;  3SDZ A;  2O01 E;  2VUB A;  3WVD B;  1S72 T;  2VYT A;  3KUF A;  4JRQ A;  4O5V A;  5KCH A;  1M8V A;  1G3W A;  2K5L A;  1KQ1 A;  3JCM Q;  3QSU A;  4M7D A;  4M7A E;  2E6Z A;  3URG A;  2VXF A;  3OYJ A;  1YHQ A;  3PGG A;  4RMO A;  4P5N A;  4FT2 A;  1ZBX A;  3L42 A;  4M77 B;  4QQG A;  4FU6 A;  5LJ5 d;  3ER0 A;  3GNG A;  3DB3 A;  4A4E A;  1RL2 A;  4WF2 A;  2DAQ A;  2EJG A;  3OMG A;  3P8D A;  3OA6 A;  1KG1 A;  4RKU E;  3JCM d;  3MEW A;  3FLG A;  3C94 A;  4MZP A;  4GY5 A;  3UWN A;  3OS5 A;  3PFS A;  2X4X A;  4PJO G;  4E7J A;  1N8R U;  1K8A C;  2DD5 A;  3MET A;  3CC2 T;  1BIA A;  5GMK i;  5EG2 A;  4F7U B;  5GAN 8;  3CC4 T;  3X20 B;  1KQS A;  3OQ5 A;  2FYK A;  5LL6 S;  5LJ3 h;  2KY9 A;  4PJO E;  2XU8 A;  3A8O B;  3MO8 A;  1NPP A;  3OB9 A;  5CKB A;  1WJQ A;  1Q86 C;  1AHJ B;  2ZGW A;  5AYF A;  4LDW A;  3LX7 A;  3Q1J A;  3CCR T;  1VQ6 A;  2OTJ A;  2BKD N;  2FVU A;  2EYQ A;  2XDP A;  2DK3 A;  3BW1 A;  3V8J A;  5GAM f;  2XDB A;  2RI2 A;  1UB4 A;  1LJO A;  2PUO B;  3A5Z B;  5IN1 A;  4XTU A;  5A0L A;  1KD1 U;  2DJZ A;  3LLR A;  4OB2 B;  5CIU A;  2RHY A;  3SD4 A;  5GAM g;  5GAN 7;  3G4S T;  4RCC A;  1VQ5 A;  2CZ6 B;  2PVG B;  4JDS A;  3JCM X;  1M90 C;  2EWN A;  1NPR A;  2GF7 A;  4XU1 A;  3INZ A;  1S72 A;  2MF2 A;  4J6X A;  3LW5 E;  2OTL T;  3OYN A;  3CCL A;  3QJY A;  2QQB A;  5LJ3 f;  1XNI A;  2JVV A;  4BAC A;  3C4S A;  4M77 C;  3EFR A;  1QVG S;  4HCC A;  2A7Y A;  4EMH A;  3JB9 I;  2JNG A;  2ZZD A;  1K9M U;  2E6N A;  3OYB A;  2D9T A;  2VV5 A;  3I55 T;  2F5T X;  5LJ3 g;  4LDX A;  1MGQ A;  1KHC A;  4F7U A;  1G3Y A;  4PL6 A;  5GAN f;  4BE0 A;  3CCJ T;  4MDW A;  1QVF S;  1MHN A;  2XD0 A;  2XK0 A;  3JCM f;  3LWI A;  1Q7Y U;  1JJ2 S;  2QA4 T;  1I4K 1;  4VUB A;  3JCM b;  2DD4 A;  5GAN g;  3G6E A;  3CC2 A;  3VKI A;  2BUD A;  3H8Z A;  2Y90 A;  1JBM A;  4M7D G;  1VQM T;  3JCM g;  4M78 D;  1YIJ T;  3L2Z A;  3VYG A;  5CQY A;  5GAO n;  1G3S A;  4L59 A;  3CCR A;  2P4T A;  3L2Q A;  1K73 U;  1Y71 A;  3SFM A;  3A8H B;  3G7Z A;  1OZ3 A;  4KUI A;  2A3L A;  3L2W A;  2QQR A;  5LJ5 j;  2B8A A;  4NL2 A;  3VJP A;  3L1A A;  1Q82 C;  2ZPF B;  2V8I A;  3OYY A;  3L2R A;  2CYZ B;  4M78 B;  3HFO A;  3JCM W;  3MEA A;  1R8O B;  2KK4 A;  4TVR A;  1H64 1;  4DA4 A;  1JJ2 A;  4CI0 C;  5LJ5 e;  1M1G A;  2ZPB B;  2V8J A;  1D3B A;  3M9Q A;  1P92 A;  3MP1 A;  2OTL A;  4F7U F;  2V8K A;  2ZPI B;  3S3O A;  2HD0 A;  4OB3 B;  5CKE A;  4C0G A;  1NJI U;  1VQK T;  1KC8 C;  3E9G A;  4KBM B;  3NTH A;  1W2B A;  3O8V A;  3I55 A;  3A8L B;  2ZPG B;  5GAN 2;  1LNX A;  3CME A;  2LX9 A;  3JB9 D;  4N4G A;  4C0F A;  3ZBD A;  2KVQ G;  5DLQ E;  2JTF A;  2LT1 A;  2JTM A;  1HK9 A;  2CS7 A;  3JSC A;  2DXB A;  1VIE A;  5HY6 A;  5I21 A;  3CCJ A;  1QW1 A;  5GAO q;  2RJE A;  4JLI A;  4Z02 A;  4HCZ A;  4PKC C;  4ZGD B;  4M75 D;  1H3Z A;  1M5Q 1;  4BI3 A;  4ATO A;  2H3J A;  1VQM A;  2KDS A;  3CEY A;  4XTY A;  2D0Q B;  4YTL A;  1YIJ A;  2WSE E;  2JZ2 A;  4XQ3 A;  1VQN T;  4IUT A;  2EQM A;  3OSV A;  3RUX A;  2LT4 A;  2K3X A;  2QDY B;  3BDU A;  4XU0 A;  3QHS A;  4F7U G;  4V2S A;  4BD3 A;  2DPP B;  2E65 A;  3SWN A;  1Y96 B;  3MEV A;  2DO3 A;  3QDR B;  1YCY A;  4BB7 A;  3OMC A;  5CR2 A;  2QEX A;  3RER A;  4F7U E;  1VQ7 T;  4E7I A;  3SWN C;  1N8R C;  3RKX A;  3HL8 A;  5CKF A;  3GF5 A;  3VU3 C;  2MWO A;  3M4G A;  4ELZ C;  3JRZ A;  1KQS S;  2FL7 A;  2EJF A;  2MI6 A;  1VQK A;  5HKC A;  4HKE A;  3G71 T;  2K5I A;  2F69 A;  2RHU A;  4C5G A;  3KXT A;  2CZ7 B;  3CCM T;  1YIT T;  2M9U A;  2K2V A;  1VQ4 A;  2LCC A;  3DLM A;  2E41 A;  4LDU A;  1KD1 C;  4C92 D;  3P8H A;  3JB9 H;  5GAM h;  2DXT A;  2DIQ A;  4KUL A;  5HK0 A;  2LCL A;  3CCU T;  2M0O A;  4C8Q A;  3A8M B;  3M5A A;  2EFI A;  5GMK m;  2RHI A;  4EMK B;  2QQ9 A;  4D6W A;  5A0G A;  4FM4 B;  1Y96 A;  5CCA A;  4C92 B;  1YBY A;  1BI1 A;  4C8Q C;  1VQN A;  5DLO A;  1K9M C;  3JCM J;  4XU2 A;  2R57 A;  3J7A F;  4A53 A;  2RJF A;  2RD1 A;  1WPY A;  2DXC A;  3CPW A;  1NE8 A;  3FRN A;  1M9S A;  1BI0 A;  1JB0 E;  3OSS C;  4RG2 A;  4OVA A;  4Y28 E;  2LC4 A;  3OS2 A;  2L5Q A;  2XI9 A;  4JRP A;  1M1K U;  1VQ7 A;  1PSE A;  2LNV A;  5GAN h;  1Q7Y C;  3DKM A;  1QVP A;  2LQ8 A;  4A4K A;  3CXC A;  3OBY A;  5FU7 B;  4MMK A;  1G5V A;  2F5K A;  2PUK B;  4QW2 A;  3CMA T;  2P0K A;  3M4Y A;  3JCM h;  4O6J A;  1YJ9 T;  2XG8 D;  2M16 A;  5FU6 B;  2VC8 A;  2X4Y A;  4MDX A;  4N4H A;  1N9S A;  4XU3 A;  5CVI A;  4M77 A;  4M7A D;  5GAM d;  2XKO C;  2P0P A;  2M1H A;  3QG1 A;  2WSF E;  1K73 C;  2K5F A;  3QYG B;  4LDY A;  3G71 A;  2ZCF B;  5GAO l;  5IT9 E;  3S3N A;  2RJD A;  4XTX A;  3TEE A;  4OMF B;  4A4H A;  3OYI A;  1YIT A;  3A8G B;  3C12 A;  4J7I A;  4C8Q F;  1N27 A;  2FHD A;  4CRI A;  3PIO A;  3OYG A;  5KE3 A;  3KBG A;  4LD9 K;  3ME9 A;  4EMK A;  2DTI A;  3UPU A;  2G3R A;  4OB1 B;  3MEU A;  4Q5W A;  5GAN 5;  1IZ6 A;  4E7K A;  4M7A B;  3X28 B;  1G3T A;  1O75 A;  5D6Y A;  5LJ3 d;  3CCU A;  3V8L A;  4EMK C;  1Q81 U;  2P0Q A;  3PT9 A;  4NOY A;  2E5Q A;  1O9S A;  3LGF A;  3JCM P;  1I8F A;  1YJN T;  1NJI C;  4PJO D;  4J83 A;  4XAX B;  4A4G A;  3CC4 A;  2LVM A;  3CC7 T;  1DJ7 B;  4ME7 A;  4DOW A;  5GAN d;  3L2U A;  4B9W A;  4MZM A;  2XHC A;  3MCA B;  1W2B S;  4LDV A;  5GMK j;  2ZPH B;  4XTZ A;  2D6F A;  4OGE A;  2VGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...