2EQMA

Solution structure of the tudor domain of phd finger protein 20-like 1 [homo sapiens]
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
88
structure length
88
Chain Sequence
GSSGSSGMSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLERPALRKEGLKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the TUDOR domain of PHD finger protein 20-like 1 [Homo sapiens]
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PHD finger protein 20-like 1
total genus 5
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eqmA01
4IUVA 5IAYA 4EDUA 1G5VA 2EQKA 5KE3A 3FDRA 2B8AA 2BIVA 3H8ZA 3QIIA 1WJQA 5CIUA 5FRMA 2RHIA 3ASKA 4FL6A 3OMGA 4QW2A 3OA6A 3UWNA 4N4GA 3NTIA 2JTFA 5KCHA 2DIQA 2P0KA 2RHXA 2X4YA 2EQJA 3OYHA 3FC3A 3LX7A 3MO8A 2LDMA 3OYKA 3E9FA 2MWPA 4BDYA 2DAQA 1N27A 3KUFA 3OYLA 2K3XA 5KH6A 3L2VA 4X34A 4A4GA 2L89A 4IURA 2QQRA 3OS2A 2RHYA 4PLIA 3FEOA 3OYFA 4C5GA 1OZ2A 1WJSA 4E7KA 3E9GA 3P8DA 3M9QA 2MWOA 4HCZA 1WJRA 4LD6A 3S3MA 3OS0A 4ZTJA 2F5KA 4PLLA 2R5MA 2R57A 1WGSA 2RJEA 3LLRA 3NTHA 3PMIA 3S6WA 4BE1A 2RHZA 4E7IA 2QQSA 2LTOA 3QJ6A 3OY9A 2G3RA 4GY5A 4B9WA 4C5EA 5FRNA 2M0OA 4IUTA 4FU6A 2RI5A 4NS5A 2WACA 5J26A 2E5QA 3OMCA 3F70A 4RG2A 2EKOA 3EAEA 1MHNA 4IKFA 1OZ3A 5D6XA 2EFIA 5C0MA 4Q5WA 3L2UA 1OI1A 2E6NA 3PFSA 4QQDA 3QBYA 3MEAA 4N4IA 4OVAA 5D6WA 5J39A 1KHCA 1RI0A 2D9TA 4L59A 5D6YA 4A4EA 3L2WA 3DB3A 2CKKA 2X35A 3BDLA 3MP8A 2GF7A 3P8HA 2GFUA 5M9OA 4QQGA 4BD3A 1SSFA 3L42A 4C5HA 4CRIA 2RJCA 3OYIA 4E7LA 3OYCA 2LCCA 2X4WA 4ZTFA 2BUDA 4IUQA 5KCOA 2O4XA 5IN1A 3GOXA 3UT1A 5C6SA 2NLUA 3OYGA 2XDPA 4UC4A 2YRVA 4E7HA 4BACA 2RO0A 5KE2A 3OYNA 4Z02A 3NTKA 3DB4A 3FLGA 3C4SA 3PNWC 3OYBA 2XK0A 3H6ZA 3ZEHA 2M16A 4QVZA 3O8VA 3OYMA 3S3NA 2RI2A 2EQMA 2GFAA 4QQ6A 2HQXA 3MP1A 3QKJA 3OB9A 3L2QA 2RJDA 2R58A 2O4XB 3LH0A 4E7JA 4BE2A 3MEVA 3OS1A 4IUUA 2FHDA 2BKDN 3LYIA 4BDZA 3LGLA 3MEWA 1H3ZA 3MP6A 1XNIA 3Q1JA 2IG0A 2M1HA 3S3OA 2LVMA 4PL6A 3OYAA 3OYJA 3CEYA 2JZ2A 4A4HA 3OQ5A 4B9XA 4C5IA 2R5AA 2PQWA 2L3RA 3SD4A 3META 2X4XA 2K3YA 3LGFA 4II1A 2RI3A 2LRQA 2DIGA 2EQUA 4IUPA 1OYXA 2HQEA 3ME9A 2VYTA 4BE0A 3DLMA 4N4HA 2L8DA 3MEUA 5FROA 2RJFA 3OYEA 3PMTA 4A4FA 3OYDA 2RHUA 3L2RA
chains in the Genus database with same CATH superfamily
4IUVA 2PUKB 4WF2A 1NBEB 4QVDA 5GANd 2OAWA 3TVTA 3EG3A 3OYHA 2QQ9A 5LJ5e 3E9FA 1TU0B 5LJ3d 2X3WD 3JCMX 1MMAA 4IURA 4Z88A 4OF1A 3OS2A 4MZTA 1WIEA 2E70A 1K0SA 4QKUA 1LVKA 5GJVB 1Q7YR 2F5KA 3REBB 1WLPB 3S6WA 2RNAA 2NUZA 2D6FA 3VJPA 2EJFA 3H41A 4FIBA 3CD6T 1YIJT 3CCRA 2H3JA 2ABLA 4KT0E 5IT9E 5IHIA 3CC2Q 1JXMA 4Z8AA 2V26A 4M75A 1YBYA 3HL8A 2EWNA 1OPKA 2JW4A 2LNHB 4L59A 5GAOl 1W70A 4EIKA 4M77A 3L42A 2RD1A 4ZTFA 1QCFA 4M78F 1U1SA 5KYYA 2DVJA 1VQ9Q 3JSCA 3QHSA 2K9GA 2LCLA 3PE0A 3REAB 5IHNA 4J8OA 3CBPA 1BI0A 1N9SA 1EIFA 2FZGB 2EKHA 2NUPA 3LGLA 2JM8A 1K73C 1KQSP 1C0MA 3TREA 3SWNC 4C5IA 4AFZC 4J9DA 2DZ9A 3A8GB 4KGVB 2AKKA 3CCVQ 5HY6A 2EGCA 2JN0A 1VQ8Q 2RI3A 4PFZA 3TCJA 2L8DA 4FT2A 5GAMh 4DBQA 2LJ3A 3PTAA 4KGZB 3VKIA 1MMNA 5KYYB 4FT4A 4QW2A 1Y57A 2XHCA 2XDDA 1UGQB 2A36A 2I0NA 1GFCA 3QZ5B 2DXTA 4F7UB 2D8JA 2DKGA 3KUFA 5GAMj 4M4ZA 3VYGA 2L89A 1BI3A 2CP6A 3M9QA 3A8LB 2K2VA 1H92A 2DL7A 2E3HA 2QTXA 3VU3C 1VQOA 3I56Q 3JB9G 4M77C 3L1AA 2LC4A 2M51A 2V1RA 2QQSA 4E7IA 1YJNT 2OTJA 1VYUA 3CMEA 4IUTA 4X9DA 4B6MA 2DL8A 3THKA 2EBPA 4N4IA 1KHCA 4OGEA 3L2WA 3DB3A 4M75C 4QQGA 4BD3A 4CRIA 2CZ6B 2YRCA 4C5HA 5GMKe 4M7DA 2E6ZA 4IUQA 4J6WA 1C6VX 1WHJA 5C6SA 4DOVA 3RMQA 4E7HA 4PJNA 2KSSA 3SWNB 2M16A 2DZCA 4P5NA 3S3NA 1ZA1B 1BI2A 3EFRA 1D3BA 5I2MA 3VS7A 2H3EB 3KBGA 3TQ7P 1SPKA 1VQNT 1NJIC 4PL6A 4C8QG 2ZCFB 4B9XA 3OQ5A 3CCVT 3BY7A 2J6KA 1G3TA 1T0JA 2GQVA 2NUPB 1YJ9A 1UGSB 2CSQA 1VQ6Q 4IUPA 4OMPA 4AG1C 2PZ1A 3INZA 1PRMC 2MCNA 2RHUA 1GRIA 4L6V5 1JJ2S 5LJ3f 1I07A 4Z89A 4RTUA 4PJLA 1QP3A 2GNCA 3JCMe 2DD4A 4OP0A 1YI2Q 3X28B 5CQXA 2RQRA 2HZYA 2MWPA 1KQ1A 5LJ5j 5GAN6 1WXUA 3NGPA 4PJMA 1OPLA 5GAMg 2K5IA 1VQOT 1Q86U 3M59A 2GGRA 3QJYA 2EYYA 8ATCB 5GMKj 4AFSC 2YUNA 3E9GA 2P4RA 4JLGA 4LD6A 3S3MA 4M78B 5KYWB 1ARKA 3OW2S 3VRZA 4TVRA 1UHCA 5I11A 3CXCS 1M1FA 4XTZA 1RAGB 4M78A 5KYWA 1ZA2B 3OMCA 1JU5C 4M7AE 3URGA 3QYGB 5HKCA 4FW2A 3M0PA 2OTLT 2KT1A 2V8JA 3VS2A 1WXBA 4CC2A 5GANf 4LN2A 3MP8A 3QSUA 2RK1A 1M1KU 2RJCA 3PGGA 1CKBA 4LDVA 1N8RC 1WHHA 1VQ4A 2C0OA 1RAAB 3U23A 3HHTB 2CUBA 1ZQ1A 2CP2A 5LJ3e 3CCMQ 2O9VA 3CCUQ 1W4SA 1F1BB 1NE8A 1X43A 3O8VA 2LQKA 3QKJA 4RMOA 2MI6A 2E1HA 2ZGWA 4BE2A 2P4TA 3WXMB 1MNDA 1VQ6A 1LCKA 2RQWA 3MEWA 1UGRB 5FU7C 2NWMA 5GMKi 3CEYA 4F7UF 1K9AA 4XK8E 1VUBA 1GXIE 2DJQA 2DA9A 4EMHA 5GAMd 3RNJA 1YHQT 1QQJA 1VYTA 5I22A 1Q82U 4KRTA 2KE9A 1VQKQ 2KRMA 1RACB 1FMWA 1G5VA 1YJWA 1M3CA 4NL3A 1VQLQ 4M7DB 1VQLT 2QDYB 2X3XD 4PK4A 3O5ZA 5CR2A 2BZXA 4HCZA 3GNGA 1WJRA 4JJNK 1K9MU 3CCUA 1MGQA 1WNLA 3GP8A 4OB1B 2DLPA 2M0OA 1R0BG 2X4JA 4NS5A 5J26A 2E64A 4OB3B 3HRTA 4M7DC 2FPFA 5D6XA 2EFIA 1KC8R 3VV0A 1M2OA 1VQNQ 4AMCA 3A8HB 2YLCA 4V2SA 5GJWB 1WXTA 2IVWA 2KYBA 3N5BB 1OOTA 3A8OB 1ZSGA 5GANj 1GFDA 4DEYA 2RO0A 3OYNA 1T0HA 2E10A 1YWPA 2DXCA 2OX7A 5CKBA 1O9SA 2GFAA 1TS9A 5LJ3h 4C8QF 4LUEA 1JQQA 1JRIA 1VQMA 3RUXA 5GAOr 4BDZA 3CMEQ 4HT9A 4ORZA 5HK3A 1XJWB 1WYXA 5IXFA 5CKHA 1RAHB 1YI2A 1Q81R 4J9EA 3SD4A 1WQWA 5FW9A 2DVEA 5FU6B 1I4K1 2ESWA 2JNGA 2VVKA 4WTOB 2FL7A 2LRQA 2YLBA 1JJ2P 2YUPA 3JCMQ 1JB0E 4RG8A 1QVPA 2C06A 3OYDA 5IAYA 2MF2A 1Q95G 3VS1A 1R77A 2YXYA 3V7RA 3J81E 1BIAA 1SHFA 5FWCA 2XD0A 2RHIA 3G71T 3ASKA 1Y07A 3RIRA 1Q86R 2CZ7B 1BI1A 1TTHB 3LX7A 3PVLA 4RTTA 1Y96A 2L5QA 4NOYA 3EFOB 4N0AC 4DBFA 2DEUA 2CP0A 1W2BA 2QK0A 1TUDA 3HRUA 3CCJA 4C5GA 2PVGB 3CXCP 4J7IA 2JOYA 3TEEA 4DBHA 1QCNA 4MZPA 3TSWA 2ZPFB 2XMFA 1BKBA 4M7DG 1X6OA 5FRNA 4PJJA 4M75E 9ATCB 1AWWA 2JMAA 1MHNA 4C92C 2NYSA 4LDXA 4C0DC 1GCQA 2CYZB 4XTYA 3EGXA 1HYOA 2YT6A 5DY9A 1VQ9T 2MIOA 2LQWA 2CGHA 2EPDA 4RTVA 2LQNA 5IN1A 4CC3A 2HEQA 4BACA 4C0ZA 1ZSZA 3DB4A 2KRSA 1MUZA 1N8RR 5J3BA 2RI2A 4HCBA 2HQXA 3CQTA 5DLQE 1IHVA 3OB9A 2RJDA 3L2QA 2DYIA 3CC2A 1QVFS 5D7UA 5LJ5g 4X9CA 3RMSA 3VUBA 4R55A 3JCMh 1Z9ZA 4C0GA 1BCMA 1YCSB 2E65A 3RKYA 4BI8B 3META 3CPFA 2BE9B 4MDWA 1Q81C 4BY6B 2DIGA 4J7FA 2PVDB 5A2QE 4ATOA 1X01A 3SHWA 3G1JA 2B8AA 2ED0A 2KT8A 4E2FB 4DA4A 3DKMA 3EG9A 2A37A 4N4GA 3X20B 2LDMA 2VC8A 2EYXA 2MYSA 3MJXA 4M78G 4C92F 1M90U 4A4GA 2EQIA 1EX4A 3RKWA 2WSFE 4PLLA 4PJOG 2RJEA 1WGSA 3LLRA 3M57A 5A0GA 1VQPA 1VQ4Q 2QGGA 2BTTA 1H3HA 2OI3A 2YDLA 3QZ9B 2EJGA 3GNFB 4JRPA 4XU3A 4OMFB 5GAOn 1Q7YC 4M7AA 3PFSA 4C8QE 1N8RU 2EJ9A 3G7ZA 4OVAA 4BI4A 1UHFA 4C92E 3C94A 1S72A 3VS0A 1GCQC 1IHWA 4EMGA 4BB7A 3I35A 4E47A 1B34B 1QWFA 4VUBA 1WPYA 2DD5A 2FPDA 4M75G 4C8QB 5GMKl 3HRSA 4J6YA 4L5GA 3KXTA 3A1PA 1KD1C 2EAYA 3MCAB 3G4ST 3E2UA 2O4XB 3CCQQ 4BI3A 3G71A 2RB6A 6AT1B 3VS4A 1PHTA 3H0HA 3Q1JA 2E3IA 1K76A 2DMOA 1PCXA 3OYJA 4A4HA 5KYNA 4EMKB 1ZUKA 4II1A 1RAFB 1NJIR 4M7AD 5ECAA 1KFZA 3DLMA 1RADB 5FU6C 5FROA 3ZBDA 4A4FA 1M2VB 3NTKA 2RQTA 5KE3A 3SWNA 4KUDK 2FRWA 1ZBXA 2HD0A 3OMGA 5AYFA 1IGUA 3X24B 3UWNA 2NUTA 1M90R 2Y90A 5CK9A 3M0RA 3ZL7C 3MKDA 3I55Q 1G3YA 2RHYA 4PJOF 1M8VA 2A3LA 3OYFA 1OZ2A 2DO3A 2HQHA 1YIJA 4KGXB 2MOXA 2MWOA 4E7SA 1N9RA 1FWZA 1JJ2A 3CC7A 4HVVA 2FYKA 3UA7A 1W6XA 1KSWA 2KQWA 4LE9A 4F16A 2X35A 2GFUA 1U1TA 2D0QB 2HKQB 1YITT 3SDZA 4GLMA 2K6DA 2QGFB 3GIBA 1OEBA 3G4SA 2CP5A 1PKSA 1ZLMA 3VUZA 4BUGA 3CXCA 1TWBA 1NJIU 4QVZA 2L0AA 4JUVA 2D0NA 4XTWA 1NPPA 4HA8A 1VQ9A 1M1GA 1V1CA 1WDXA 2V8IA 4M78D 1B7TA 3G4SQ 2KY9A 2HBPA 4FCYA 5GAN5 3JRZA 2QEXA 2BZYA 2EQUA 5LJ3j 2ZPHB 3E19A 1M3BA 2RJFA 1VQKT 1QMCA 3M55A 3L2RA 4EDUA 1D1CA 4E6RA 3RERA 1WHLA 1PWTA 2LP5A 4WCIA 1VQ4T 3V7CA 5CKFA 5KCHA 2RHXA 3FC3A 2GBQA 1RUWA 1VQ7Q 1NM7A 1YJWT 4A53A 2K4YA 2DAQA 4KH0B 2X9HA 2K3XA 1QVFP 2J7IA 2JMCA 4F17A 4LUDA 5GAMf 3JCMV 2COYA 2FG0A 4M77E 1MMGA 2R57A 2F2VA 3NTHA 3X26B 4DEXA 4C92G 1N6AA 4B9WA 4PJOC 4GBQA 4HCCA 2RMOA 3SB2A 1M3AA 2RQVA 5KYXB 3FRNA 3OSVA 3EAEA 2OTLQ 1WI7A 5GANe 1YNZA 2FEIA 4Q5WA 3JB9D 3FJPA 4M78C 3QG1A 2RQUA 4F7UA 2ZZDA 2LCCA 2QXFA 4ME7A 1E7OA 5A0LA 5GAN3 3CC4Q 3J7AF 3P8BB 3T9NA 3BDUA 1T3LA 2DBKA 2RH2A 1AHJB 1OX9A 2HSEB 2K2MA 1VYVA 1TUGB 3HFOA 4XAXB 4LNPA 3C4SA 1UJYA 2LT4A 4J9BA 5CO7A 2EGEA 5L23A 1VQMT 1Q82R 1WHKA 2DTIA 2EGAA 4E7JA 1B07A 2KYMA 2G6FX 2OTLA 2KGTA 4OMQA 2KBTA 1TSFA 2BE7D 1Y0MA 2FHDA 1PM3A 3VRYA 2LVMA 4RKUE 4M7AB 3LWIA 2DRKA 3NMZC 1PRLC 1U3OA 2K3YA 1KD1R 1K73R 4M78E 4XU1A 5CVIA 2Y4YA 4C8QD 3MEUA 3OYEA 2EYWA 4AT1B 3J80E 3LH5A 3M53A 4MDXA 1PG5B 4PJOD 1UG1A 4C8QA 3UATA 4ELZC 3CCEA 2M02A 3PIOA 4ELYC 4J9HA 1VQOQ 2ZPBB 1VQPQ 3NTIA 2JTFA 2VXEA 1I0CA 2DIQA 4PFPA 4JZ3A 3TU4K 4M75B 1AT1B 2P0PA 5FU7B 1RAIB 1CKAA 1EZZB 2CT4A 4OB2B 1T3SA 5FWBA 1K8AC 3PMIA 2F2XA 1I5LA 3M0SA 3OY9A 1RI9A 1M9SA 1ABOA 1ZX6A 4DOWA 3F70A 4RG2A 2W10A 1YIJQ 1UUEA 1AVZC 2EVRA 1QLYA 3GBQA 4R56A 2QA4A 3M58A 1JXOA 3CPWA 1OQKA 1KG1A 4DQ2A 1B34A 2I2LA 2CKKA 2IIMA 5M9OA 4C92A 5LL6S 2LJ1A 2O4XA 1DJ7B 4UC4A 4D6WA 4Z02A 1A0NB 5LJ5d 2KXCA 4A63B 5IXBA 1G2BA 2DF6A 4ZN1A 7AT1B 2IG0A 5GAN7 2O01E 2FRYA 2PUOB 4EMKA 3OYAA 1FYNA 1WA7A 2X4XA 1YJWQ 2HMAA 2NUTB 1M1KC 2F1LA 1LPLA 2A28A 3OSSC 4Y28E 4ZGEB 2K3BA 1S1NA 3BE3A 3KFVA 2CT3A 1D0YA 2DYBA 1SRMA 5GAMe 1IO6A 2EQJA 4ZGDB 1VIEA 1D1AA 2IPOB 2KNBB 4BDYA 2O9SA 3CCJQ 1TOVA 1UECA 3L2VA 1SKUB 3I5SA 1GBQA 2KRNA 1G83A 4MZMA 4X1VA 5GAN4 3BFMA 3FEOA 1BBZA 4JDSA 4E7KA 1U06A 1KC8C 1K1ZA 5CCAA 4LDUA 2VV5A 1UFFA 3R6OA 2PNIA 3UPUA 3HP9A 2DE0X 1PKTA 1QW1A 2E5QA 2DFUA 2DM1A 1IGQA 1W1FA 3G71Q 2COWA 1VQPT 1HJDA 4R0KA 1KQSA 1RABB 3M4YA 3IQLA 4RTZA 1I5OB 1IRXA 4E7LA 3CCJT 2O88A 3HFNA 4O5VA 1YJ9T 2BUDA 5KCOA 1OV3A 4C0FA 3AHUA 1YJNA 1JO8A 4QT7A 5EG2A 3OW2A 1PSEA 2ATCB 1RL2A 1KHIA 1VOMA 2LX7A 2FZKB 3NFCA 2EQMA 4JS4A 4QQ6A 4OMOA 1X69A 4OMNA 2DBMA 2OTJT 3MP6A 3VYHB 3A98A 1QVGA 2HSPA 3GPLA 1X27A 4JJDA 4J9CA 2JZ2A 1Q7YU 1WQ7A 1E6HA 2DNUA 1VQ5Q 4M75F 2BZ8A 4KUIA 1S72Q 4JJCA 1OYXA 2HQEA 2ZPGB 1OU8A 3ME9A 4AFUC 1BIBA 2ROTA 2DILA 2QI2A 5GANh 4IIMA 3JB9J 1PD0A 1XQHA 1Q86C 1FMVA 1YWOA 3CCST 2CP7A 4AFQC 4CC4B 1UB4A 1H8KA 2KR3A 1VQ7T 1BU1A 1X75C 2ZAEA 2P0KA 1PSFA 4C92B 3MO8A 2L3QA 2LJ0A 2KI7A 4M7AF 2PTKA 3D7SB 5HK0A 3UF4A 2OAUA 4M7DF 2KAFA 5KH6A 1UGVA 1KC8U 2YHTA 1XTDA 3JCMJ 1VQ5T 1H641 4CI0C 2L3PA 2WSCE 4K11A 2R5MA 4D8KA 2RHZA 3EG1A 4DBRA 4RUGA 3CCLQ 1YP5A 2FZCB 2VB6A 3QYHB 3SFMA 3I55A 1UE9A 4M77F 3EFSA 3QWXX 5J39A 3C0CA 4FYYB 3M4GA 4O6JA 2D1XA 2MAMA 1JBMA 1QVGP 1Y96B 3CBOA 1Y71A 1W2BP 4RTWA 3VS3A 4OMLA 4PFOA 2A08A 4F04B 2QQAA 4FSSA 2H8HA 3G6ET 2E41A 3PNWC 2LZ6B 3H6ZA 2J06A 5IHKA 3VS6A 3JCMf 3OYMA 1WZOA 2HAXA 2COZA 1BCOA 1ZUUA 2ECZA 3SEMA 3H0IA 3RKXA 3AT1B 4IUUA 2AZVA 5CAIA 1MV0B 2VKNA 4XTUA 2KXDA 4HVWA 1VQLA 2DJZA 3CMAA 3HSBA 2YUQA 2VWFA 2P84A 2K7AA 3DLLA 2VYTA 3CCQA 2GTJA 2HCKA 1UGPB 1IB8A 4FYWB 1VQ8A 1WJQA 1AD5A 3CD6A 3OW2P 1YJNQ 1NZ9A 3CD6Q 2JUFA 3JCMW 2AT1B 1RAEB 4ZN3A 1HK9A 2RPNA 2DERA 3I56T 2VUBA 4X34A 3JB9F 2QQRA 1U5SA 1Z9QA 2AIRB 3C95A 1YITA 3TSZA 1NEGA 1UEBA 3P8DA 1K73U 1M2VA 2JS2A 4ZTJA 2CZ1B 2QG9B 3I55T 2A7YA 4M77G 4BE1A 4F14A 1NPRA 2LTOA 3EGDA 1WHGA 4GY5A 1BK2A 2XI9A 3L2ZA 1SHGA 2B86A 4NL2A 1NEBA 4Y92A 1OZ3A 4C8QC 2RM4A 1N5ZA 1GCPA 3UA6A 1RI0A 2GF7A 1XOVA 2DX1A 4PJOE 1SSFA 2EW3A 3EH2A 3M0TA 2X51A 3PT9A 3G6EQ 5CKEA 3FLGA 2DETA 1QCOA 3QWYA 2XKOC 1VQKA 1SRLA 4M75D 4ZGJB 3QDFA 4OB0B 1I1JA 2DEQA 2K5FA 1M1KR 1ZBJA 5GAN2 3RDVA 1OULA 3LWHA 1AWOA 1WHMA 3CMAQ 4HXJA 1Y7XA 4J83A 3V8LA 2PQWA 2DTOA 2DRMA 1HXDA 3EGUA 4J9IA 1SSHA 2MK5A 1R0CB 4JRQA 2RA2A 3JB9I 2CP3A 4M7DD 3V7SA 3PMTA 1HSQA 2RK2A 2EQKA 1AZGB 3EG2A 1AWXA 3FDRA 2FPEA 2RF0A 3M56A 2MMPA 1QVFA 4LDWA 3I56A 2MPXC 1X6BA 2X4YA 1PNJA 3CCSA 4M77B 2P0QA 2CUDA 4PJOB 1YITQ 3MPUB 5GANg 3OYLA 2HBWA 2KVQG 2F2WA 2QA4Q 4J6XA 4PLIA 4PKCC 4Y91A 3CCLA 5DLOA 3BW1A 4QVCA 1VQ5A 3G6EA 1WFWA 2G3RA 1NYFA 3CCMT 3EG0A 4FU6A 1M30A 2RI5A 4D8DA 1K9MR 2ED1A 1D0ZA 4M7AC 1VQMQ 1K0XA 2ENMA 2E6NA 2V8KA 5LJ3g 1MNEA 4OMMA 1SEMA 4M7DE 5D6YA 4A4EA 1VIFA 4FYXB 4IIOA 3OYIA 3CCVA 4RCCA 3H9NA 2QA4T 1PC0A 2NLUA 3LW5E 4YTLA 1BB9A 1LOJA 4JZ4A 2JVVA 5KE2A 2LT1A 3M0UA 4KBMB 3OYBA 1YFNA 4F7UG 2CH4W 3ER0A 1IREB 1VQNA 1J3TA 5I21A 1K9MC 3MEVA 1X2QA 1CSKA 1QWEA 2QEXT 5L8RE 1XNIA 3CPWS 2DK3A 2L2PA 2D8HA 3PVQA 3GF5A 2GTOA 3RESA 3V8JA 2YSQA 5KYUB 1D1BA 3EFOA 5FLXE 1O75A 1G3SA 3PIPA 4BE0A 1E6GA 3FB9A 1FXXA 2ZPIB 2FB7A 2LCSA 2JTEA 5A0DA 1LNXA 4M77D 2QDLA 3JB9H 2Y4XA 1SF9A 3E1SA 3EHQA 2VGNA 3JCMb 1P92A 2JM9A 2BIVA 1IXDA 1YCYA 5LJ5f 5FRMA 2JT4A 2QQBA 3OA6A 3HTRA 2HL5C 2QTVA 4MMLA 4XQ3A 4A54A 5GMKm 1M90C 3CCET 2VXFA 1R8OB 3CC2T 1QKXA 1TXQA 1X6GA 3EGXB 1WX6A 1BYMA 1ZSZC 2CREA 4JJBA 5HCKA 1ABQA 2W0ZA 1GBRA 3OS0A 5DM7R 3CPWP 4F7UE 2LX9A 2AK5A 4LDYA 3UDCA 2LNVA 3RR6A 4HT8A 1JEGA 2YWWA 5LJ5h 2XICA 4RTYA 2RN8A 3CMET 2XG8D 5C0MA 3L2UA 1IZ6A 2OJ2A 3QBYA 1C1AA 2EIFA 5D6WA 4PNOA 1U8RA 3HPWA 4E7ZA 2DTHA 2ZPEB 2XIDA 1Q82C 3OYCA 2X4WA 4OGCA 2DL5A 4ZNXA 2XDPA 2ROLA 3A8MB 3QPHA 4J9FA 4EMKC 1UTIA 2HNIA 3M5AA 5GAOq 3QO3A 1KJWA 2GCXA 3LH0A 3OS5A 4RTXA 3NHNA 3OBWA 8AT1B 1K8AU 4XTXA 3EH1A 1I8FA 4EPCA 1H3ZA 2M1HA 3S3OA 1KQSS 2QASA 1EFNA 4A4KA 2DL4A 1M5Q1 3OBYA 4C0DB 4ANJA 4XU0A 3LGFA 3CCEQ 2V1QA 2WSEE 2C0IA 4N4HA 1S72T 4XTVA 4FSXA 1YI2T 1AEYA 2DL3A 1V76A 3QUIA 2CSIA 1TUCA 3CCMA 1KIKA 3H8ZA 2OTJQ 4JPBW 4FL6A 2DXUA 5GMKh 1ACMB 2AHJB 5AT1B 3CC7T 4BY6C 1QVGS 3CCRT 3CBMA 3OYKA 1FMKA 3M54A 5GAOm 2FO0A 3JCMP 4LXCA 1M27C 1G3WA 1B3QA 1UJ0A 4HKEA 1VQ6T 1KK7A 3GLXA 3EHRA 1YJ9Q 1M4ZA 1D3BB 5EC7A 3EGDB 1RLPC 4KULA 2CDTA 5CQYA 4CC7A 3CC4A 3QJ6A 3JCMg 2GQIA 3JCMc 1KD1U 1ZSZB 2AZSA 4GLKA 5I2SA 2EKOA 1YN8A 2F5TX 1VA7A 2KMTA 4IKFA 1K4US 1OI1A 2CS7A 4QQDA 2D9TA 2PVOB 3CCLT 2C0TA 4KH1B 2J6OA 2AKLA 2JXBA 3UT1A 3RBBB 3CCUT 2LQ8A 3OYGA 2YRVA 3X25B 4LD9K 1TG0A 4J5YA 1M8MA 4HCKA 2HDAA 2XK0A 1D0XA 3FJ5A 3QDRB 3MP1A 1HD3A 2QYZA 3HKSA 1SG5A 2BKDN 2VASA 3M0QA 1VQ7A 5KYUA 3I9QA 1NG2A 1OX8A 2R5AA 4HVUA 2L3RA 2K5LA 1ZHIA 2KK4A 3R6NA 3OYYA 3JV3A 4C92D 3WVDB 1I81A 2PU9B 1YHQA 1G8XA 1LJOA 2O31A 1NLOC 1D09B 4J9GA 3QIIA 4ESRA 1AWJA 1X2KA 2KDSA 5CIUA 1V29B 3JCMd 4MMKA 2E12A 3WVEB 2A0FB 3QXEB 4AG2C 1NLPC 1OU9A 4XU2A 5CKDA 2QAZA 1VQ8T 1GL5A 4FW1A 3FIFA 1N27A 2CZ0B 5IH2A 3JAME 2YRDA 2M9UA 3H0FA 2E5KA 1MV3A 2SRCA 1AZEA 1PD1A 1WJSA 1MMDA 5KYXA 4JS5A 2DXBA 2CH4A 5GAN8 2XDBA 4N0AA 2EYZA 4C5EA 1Q81U 2JS0A 2WACA 2XU8A 2L3SA 3V8KA 2DPPB 2KEAA 2Z0WA 4RCBA 5GAOp 3CCQT 3MEAA 2J6FA 2HL3A 4PJOA 1UDLA 3BDLA 3P8HA 1RLQC 2EYQA 3A5ZB 2F69A 3C12A 2YUOA 3CMAT 2FVUA 2JTMA 3GOXA 1QP2A 2O2OA 3EG9B 4M7AG 4FM4B 2LMJA 1AOJA 3ZFJA 3ZEHA 1YHQQ 3VS5A 1NYGA 2R58A 3I5RA 3NPFA 1ZUYA 3OS1A 2QEXQ 2J05A 2JJ9A 3LYIA 3CCRQ 3CCSQ 3ULRB 1KQ2A 3CC7Q 3CC4T 2E4HA 2VGMA 2M0YA 2K79A 1QKWA 1W2BS 4JLIA 4JRKA 2K57A 4FYVB 1K8AR 1FX7A 2KROA 1TH7A 2HKNA 3MHXA 2SEMA 4JRIA
chains in the Genus database with same CATH topology
4IUVA 2MF2A 3M53A 5IAYA 4MDXA 2RK2A 2EQKA 4PJOD 2PUKB 3FDRA 4C8QA 3M56A 2MMPA 3V7RA 4ELZC 3J81E 4LDWA 1BIAA 3CCEA 2C06A 1QVFA 2XD0A 3PIOA 2RHIA 4WF2A 3ASKA 1Y07A 3RIRA 4ELYC 4QVDA 3G71T 5GANd 2ZPBB 3I56A 2CZ7B 1BI1A 3NTIA 2JTFA 2VXEA 1Q82C 2DIQA 2X4YA 3OYHA 3CCSA 2QQ9A 3LX7A 5LJ5e 4M77B 2P0QA 1Y96A 3E9FA 2L5QA 4NOYA 4N0AC 4PJOB 5LJ3d 5GANg 3OYLA 3JCMX 1W2BA 3TU4K 2KVQG 4M75B 4IURA 2P0PA 5FU7B 4OF1A 3OS2A 4MZTA 4J6XA 2E70A 3HRUA 4PLIA 3CCJA 4C5GA 4PKCC 4Y91A 2PVGB 3CCLA 5DLOA 4J7IA 3BW1A 4QVCA 2JOYA 4OB2B 3TEEA 1VQ5A 4MZPA 3G6EA 2F5KA 2ZPFB 1K8AC 3S6WA 1BKBA 3PMIA 1VQPA 1I5LA 2D6FA 3VJPA 4M7DG 2EJFA 4FIBA 2G3RA 3OY9A 1X6OA 3CCMT 5FRNA 3CD6T 1M9SA 4FU6A 2RI5A 1YIJT 4DOWA 3F70A 2H3JA 4M75E 4RG2A 3CCRA 1MHNA 4C92C 4M7AC 4KT0E 5IT9E 3JCMe 4LDXA 2E6NA 4M75A 4C0DC 1YBYA 2V8KA 4R56A 2CYZB 2QA4A 5LJ3g 3M58A 3HL8A 2EWNA 4XTYA 3CPWA 4M7DE 1KG1A 4L59A 4DQ2A 5D6YA 4A4EA 1B34A 2I2LA 5DY9A 2CKKA 5GAOl 1VIFA 1VQ9T 5M9OA 3OYIA 4M77A 3L42A 2CGHA 2RD1A 4C92A 5LL6S 3CCVA 4RCCA 4ZTFA 2O4XA 5IN1A 2QA4T 2NLUA 3LW5E 4YTLA 1DJ7B 4UC4A 4M78F 1LOJA 4D6WA 4BACA 1U1SA 2JVVA 5KE2A 4C0ZA 2LT1A 4KBMB 4Z02A 3OYBA 3DB4A 3JSCA 3QHSA 5LJ5d 5J3BA 2LCLA 2RI2A 4HCBA 2HQXA 5DLQE 3L2QA 3OB9A 4F7UG 2RJDA 1VQNA 3ER0A 1IREB 4J8OA 5I21A 1K9MC 3CC2A 1QVFS 3MEVA 3CBPA 1BI0A 1N9SA 5LJ5g 1EIFA 4X9CA 3LGLA 3PMTA 3RMSA 3VUBA 4R55A 5L8RE 2QEXT 4ZN1A 1XNIA 3CPWS 3JCMh 1K73C 2DK3A 2IG0A 5GAN7 2O01E 2PUOB 3GF5A 4EMKA 3OYAA 3TREA 4C0GA 3SWNC 3RESA 4C5IA 2DZ9A 3A8GB 2E65A 3RKYA 3V8JA 4BI8B 3META 3CPFA 2X4XA 4MDWA 5HY6A 1Q81C 2JN0A 5FLXE 1O75A 2RI3A 1G3SA 4BY6B 2DIGA 4J7FA 3PIPA 4BE0A 3FB9A 3TCJA 2L8DA 1FXXA 4FT2A 2ZPIB 2FB7A 1M1KC 2PVDB 5GAMh 5A2QE 5A0DA 1LNXA 4M77D 3OSSC 3PTAA 4Y28E 3VKIA 2Y4XA 1X01A 4ZGEB 3JB9H 4ATOA 3E1SA 3JCMb 2B8AA 2VGNA 1P92A 2BIVA 4FT4A 4DA4A 3DKMA 1YCYA 5LJ5f 5FRMA 2QQBA 3OA6A 4QW2A 4MMLA 4XQ3A 4A54A 4N4GA 5GMKm 2XHCA 5GAMe 1M90C 2EQJA 4ZGDB 2XDDA 1UGQB 1VIEA 3X20B 2LDMA 2VC8A 2DXTA 3QZ5B 4F7UB 2VXFA 3CCET 2DKGA 4BDYA 1R8OB 3CC2T 3KUFA 4M78G 5GAMj 4C92F 1M90U 1BYMA 3VYGA 3L2VA 4A4GA 5GAN4 2L89A 1BI3A 4MZMA 3BFMA 3FEOA 4JDSA 3RKWA 4E7KA 1KC8C 3M9QA 3A8LB 2K2VA 2WSFE 3OS0A 5CCAA 4LDUA 4PLLA 4PJOG 2QTXA 3VU3C 5DM7R 1VQOA 2RJEA 1WGSA 3LLRA 3M57A 4F7UE 5A0GA 2LC4A 2LX9A 3L1AA 2VV5A 4LDYA 2QQSA 4M77C 3R6OA 4E7IA 3UPUA 1YJNT 2OTJA 3UDCA 2LNVA 3HP9A 3CMEA 4IUTA 4HT8A 1QW1A 2E5QA 3QZ9B 4X9DA 5LJ5h 2XICA 2EJGA 3GNFB 4JRPA 4XU3A 4OMFB 5GAOn 3CMET 1Q7YC 2XG8D 5C0MA 3L2UA 1IZ6A 1VQPT 4M7AA 3PFSA 3QBYA 4C8QE 1N8RU 2EJ9A 3G7ZA 2EIFA 4N4IA 4OVAA 5D6WA 1KHCA 4OGEA 4PNOA 4BI4A 4C92E 1U8RA 3C94A 1S72A 3HPWA 3L2WA 3DB3A 1KQSA 3M4YA 4M75C 2DTHA 2ZPEB 2XIDA 4EMGA 4QQGA 4BD3A 4BB7A 4CRIA 2CZ6B 4C5HA 1B34B 4VUBA 4E47A 3HFNA 5GMKe 4O5VA 2E6ZA 2X4WA 3OYCA 1YJ9T 4M7DA 2BUDA 4IUQA 1WPYA 5KCOA 4J6WA 3OYDA 4OGCA 4C0FA 5C6SA 2DD5A 3RMQA 4DOVA 1YJNA 3AHUA 2XDPA 3A8MB 4E7HA 5EG2A 3OW2A 2KSSA 1PSEA 3QPHA 4M75G 3SWNB 4C8QB 4EMKC 5GMKl 3HRSA 4J6YA 2HNIA 1RL2A 3M5AA 4L5GA 3QO3A 5GAOq 3KXTA 1KHIA 2M16A 2DZCA 4P5NA 3S3NA 3NFCA 2EQMA 4JS4A 1KD1C 4QQ6A 1BI2A 2EAYA 3MCAB 2GCXA 3G4ST 2O4XB 3LH0A 3OS5A 4BI3A 3JB9G 3EFRA 3G71A 3OBWA 1D3BA 2RB6A 1K8AU 5I2MA 4XTXA 1I8FA 3KBGA 4EPCA 1H3ZA 2OTJT 3MP6A 3Q1JA 3VYHB 1QVGA 2M1HA 3S3OA 3GPLA 1VQNT 1NJIC 4PL6A 1KQSS 3OYJA 4A4KA 2JZ2A 2ZCFB 4A4HA 3OQ5A 4B9XA 4C8QG 3CCVT 1Q7YU 1M5Q1 1WQ7A 3BY7A 3OBYA 4EMKB 1G3TA 4C0DB 4XU0A 2GQVA 3LGFA 1YJ9A 1UGSB 4II1A 4M75F 4M7AD 4KUIA 2WSEE 4IUPA 1OYXA 2HQEA 2ZPGB 3ME9A 3DLMA 4N4HA 1S72T 4XTVA 1BIBA 3INZA 4FSXA 5FU6C 5FROA 3ZBDA 1YI2T 4E7LA 2QI2A 5GANh 4A4FA 2RHUA 3NTKA 4L6V5 3QUIA 5LJ3f 3JB9J 1JJ2S 5KE3A 1XQHA 1Q86C 3CCMA 3SWNA 4KUDK 3H8ZA 3CCST 1QP3A 1ZBXA 1UB4A 2HD0A 3OMGA 2DD4A 4FL6A 2DXUA 5AYFA 4OP0A 3UWNA 3X24B 5GMKh 2AHJB 1VQ7T 3CC7T 1X75C 4BY6C 2P0KA 2Y90A 1QVGS 1PSFA 5CK9A 3X28B 4C92B 5CQXA 3MO8A 3CCRT 3CBMA 3OYKA 5GAOm 3M54A 4M7AF 2MWPA 1KQ1A 5LJ5j 5GAN6 3JCMP 5HK0A 2OAUA 4M7DF 2KAFA 5KH6A 5GAMg 2K5IA 1G3WA 1VQOT 1KC8U 2YHTA 4HKEA 3M59A 1XTDA 3JCMJ 1G3YA 2RHYA 4PJOF 1Q86U 1VQ5T 1M8VA 1H641 4CI0C 3QJYA 2A3LA 3OYFA 1OZ2A 2DO3A 5GMKj 1VQ6T 1YIJA 3GLXA 3E9GA 2MWOA 2WSCE 4JLGA 4LD6A 3S3MA 1N9RA 1M4ZA 4M78B 1D3BB 1FWZA 3OW2S 4KULA 5CQYA 2R5MA 1JJ2A 2RHZA 3CC7A 4TVRA 3CXCS 3CC4A 3QJ6A 1M1FA 4XTZA 2FYKA 3JCMg 4M78A 3JCMc 1KD1U 3OMCA 5I2SA 4M7AE 4GLKA 3URGA 2EKOA 3QYGB 2F5TX 2KMTA 4IKFA 5HKCA 3QYHB 3SFMA 3I55A 1OI1A 2OTLT 4M77F 2CS7A 4QQDA 3EFSA 5J39A 2V8JA 2D9TA 2PVOB 2KQWA 3M4GA 4O6JA 5GANf 2MAMA 1JBMA 2X35A 3MP8A 3CCLT 1Y96B 2GFUA 1U1TA 2D0QB 3CBOA 2RK1A 3QSUA 1YITT 1M1KU 2RJCA 3PGGA 1Y71A 4LDVA 3SDZA 1N8RC 1VQ4A 3HHTB 3UT1A 3GIBA 1ZQ1A 3CCUT 3G4SA 2LQ8A 3OYGA 4HCCA 2QQAA 2YRVA 5LJ3e 3X25B 4LD9K 3G6ET 2E41A 3VUZA 4BUGA 4J5YA 1W4SA 3PNWC 3CXCA 2XK0A 3H6ZA 1NE8A 1NJIU 4QVZA 3O8VA 2LQKA 3QDRB 3JCMf 3OYMA 3MP1A 3QKJA 4RMOA 2MI6A 2HAXA 2E1HA 2ZGWA 4JUVA 4BE2A 2P4TA 3HKSA 3WXMB 3RKXA 4XTWA 4IUUA 1NPPA 2BKDN 4HA8A 1VQ6A 1VQ9A 1M1GA 5CAIA 4XTUA 3MEWA 1VQ7A 1UGRB 5FU7C 1VQLA 2V8IA 4M78D 5GMKi 3CEYA 2DJZA 4F7UF 2R5AA 3CMAA 4XK8E 2L3RA 1VUBA 2K5LA 2KY9A 3HSBA 1GXIE 2HBPA 1ZHIA 5GAN5 2KK4A 3JRZA 4EMHA 2QEXA 5GAMd 2EQUA 5LJ3j 3DLLA 2VYTA 2ZPHB 3E19A 1YHQT 3CCQA 3OYYA 2RJFA 1Q82U 1VQKT 4C92D 3WVDB 1I81A 3M55A 3L2RA 2PU9B 3CCJT 1YHQA 4EDUA 1LJOA 1UGPB 1G5VA 3RERA 1YJWA 1VQ8A 3QIIA 1WJQA 4NL3A 2KDSA 5CIUA 1V29B 3CD6A 3JCMd 1VQ4T 4PJOC 4MMKA 1NZ9A 3V7CA 5CKFA 2E12A 3WVEB 5KCHA 2RHXA 2JUFA 3FC3A 3QXEB 4M7DB 3JCMW 1VQLT 4XU2A 5CKDA 1YJWT 1VQ8T 4A53A 2QDYB 2K4YA 4ZN3A 2DAQA 3FIFA 1N27A 2CZ0B 1HK9A 3JAME 2K3XA 3I56T 2VUBA 4X34A 2M9UA 3JB9F 2QQRA 3C95A 1YITA 1UEBA 5CR2A 1WJSA 5GAMf 4JS5A 2DXBA 3P8DA 3JCMV 1K73U 4HCZA 3GNGA 1WJRA 5GAN8 4N0AA 4JJNK 1K9MU 2XDBA 3CCUA 4ZTJA 1MGQA 2CZ1B 1WNLA 4M77E 2R57A 3NTHA 3X26B 3I55T 2A7YA 4M77G 3GP8A 4BE1A 1NPRA 2LTOA 4OB1B 4C92G 1N6AA 4GY5A 4B9WA 4C5EA 2M0OA 2X4JA 4NS5A 1Q81U 2XI9A 2WACA 3L2ZA 2XU8A 2E64A 5J26A 3SB2A 4OB3B 3HRTA 3FRNA 3OSVA 4NL2A 3EAEA 4M7DC 3V8KA 2DPPB 1OZ3A 5D6XA 2EFIA 4C8QC 5GANe 2RM4A 4Q5WA 3JB9D 3VV0A 4RCBA 5GAOp 3CCQT 3MEAA 1RI0A 3FJPA 3A8HB 4M78C 3QG1A 4PJOA 3BDLA 2YLCA 3P8HA 2GF7A 1XOVA 4F7UA 4PJOE 1SSFA 4V2SA 2EYQA 3A5ZB 2F69A 2ZZDA 3C12A 2LCCA 2QXFA 4ME7A 3N5BB 2IVWA 3CMAT 5A0LA 2FVUA 2JTMA 5GAN3 3A8OB 3GOXA 3J7AF 3P8BB 3PT9A 3T9NA 5GANj 1QP2A 3BDUA 2RH2A 1AHJB 2RO0A 3OYNA 5CKEA 3HFOA 4M7AG 2E10A 4XAXB 3FLGA 2DXCA 3C4SA 4FM4B 2XKOC 2LT4A 5CO7A 3ZEHA 3ZFJA 4M75D 1VQMT 5CKBA 1O9SA 1VQKA 2GFAA 2DTIA 5LJ3h 4ZGJB 4C8QF 2R58A 4E7JA 1JRIA 4OB0B 2OTLA 3OS1A 1VQMA 2DEQA 2K5FA 3RUXA 2FHDA 3LYIA 5GAOr 4BDZA 5GAN2 4HT9A 3LWHA 5HK3A 2LVMA 1Y7XA 1KQ2A 4RKUE 4M7AB 5CKHA 4J83A 3LWIA 3CC4T 3V8LA 1YI2A 2PQWA 2DTOA 1WQWA 2DVEA 1HXDA 3SD4A 2VGMA 5FU6B 1I4K1 1W2BS 2K3YA 4JLIA 2JNGA 2FL7A 4JRKA 2K57A 2LRQA 2YLBA 4JRQA 2RA2A 1FX7A 4M78E 1TH7A 4XU1A 5CVIA 3JB9I 2Y4YA 3JCMQ 4C8QD 3MEUA 1JB0E 3MHXA 3OYEA 4M7DD 4RG8A 1QVPA 3V7SA 3J80E 4JRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUV A;  5IAY A;  4EDU A;  1G5V A;  2EQK A;  5KE3 A;  3FDR A;  2B8A A;  2BIV A;  3H8Z A;  3QII A;  1WJQ A;  5CIU A;  5FRM A;  2RHI A;  3ASK A;  4FL6 A;  3OMG A;  4QW2 A;  3OA6 A;  3UWN A;  4N4G A;  3NTI A;  2JTF A;  5KCH A;  2DIQ A;  2P0K A;  2RHX A;  2X4Y A;  2EQJ A;  3OYH A;  3FC3 A;  3LX7 A;  3MO8 A;  2LDM A;  3OYK A;  3E9F A;  2MWP A;  4BDY A;  2DAQ A;  1N27 A;  3KUF A;  3OYL A;  2K3X A;  5KH6 A;  3L2V A;  4X34 A;  4A4G A;  2L89 A;  4IUR A;  2QQR A;  3OS2 A;  2RHY A;  4PLI A;  3FEO A;  3OYF A;  4C5G A;  1OZ2 A;  1WJS A;  4E7K A;  3E9G A;  3P8D A;  3M9Q A;  2MWO A;  4HCZ A;  1WJR A;  4LD6 A;  3S3M A;  3OS0 A;  4ZTJ A;  2F5K A;  4PLL A;  2R5M A;  2R57 A;  1WGS A;  2RJE A;  3LLR A;  3NTH A;  3PMI A;  3S6W A;  4BE1 A;  2RHZ A;  4E7I A;  2QQS A;  2LTO A;  3QJ6 A;  3OY9 A;  2G3R A;  4GY5 A;  4B9W A;  4C5E A;  5FRN A;  2M0O A;  4IUT A;  4FU6 A;  2RI5 A;  4NS5 A;  2WAC A;  5J26 A;  2E5Q A;  3OMC A;  3F70 A;  4RG2 A;  2EKO A;  3EAE A;  1MHN A;  4IKF A;  1OZ3 A;  5D6X A;  2EFI A;  5C0M A;  4Q5W A;  3L2U A;  1OI1 A;  2E6N A;  3PFS A;  4QQD A;  3QBY A;  3MEA A;  4N4I A;  4OVA A;  5D6W A;  5J39 A;  1KHC A;  1RI0 A;  2D9T A;  4L59 A;  5D6Y A;  4A4E A;  3L2W A;  3DB3 A;  2CKK A;  2X35 A;  3BDL A;  3MP8 A;  2GF7 A;  3P8H A;  2GFU A;  5M9O A;  4QQG A;  4BD3 A;  1SSF A;  3L42 A;  4C5H A;  4CRI A;  2RJC A;  3OYI A;  4E7L A;  3OYC A;  2LCC A;  2X4W A;  4ZTF A;  2BUD A;  4IUQ A;  5KCO A;  2O4X A;  5IN1 A;  3GOX A;  3UT1 A;  5C6S A;  2NLU A;  3OYG A;  2XDP A;  4UC4 A;  2YRV A;  4E7H A;  4BAC A;  2RO0 A;  5KE2 A;  3OYN A;  4Z02 A;  3NTK A;  3DB4 A;  3FLG A;  3C4S A;  3PNW C;  3OYB A;  2XK0 A;  3H6Z A;  3ZEH A;  2M16 A;  4QVZ A;  3O8V A;  3OYM A;  3S3N A;  2RI2 A;  2EQM A;  2GFA A;  4QQ6 A;  2HQX A;  3MP1 A;  3QKJ A;  3OB9 A;  3L2Q A;  2RJD A;  2R58 A;  2O4X B;  3LH0 A;  4E7J A;  4BE2 A;  3MEV A;  3OS1 A;  4IUU A;  2FHD A;  2BKD N;  3LYI A;  4BDZ A;  3LGL A;  3MEW A;  1H3Z A;  3MP6 A;  1XNI A;  3Q1J A;  2IG0 A;  2M1H A;  3S3O A;  2LVM A;  4PL6 A;  3OYA A;  3OYJ A;  3CEY A;  2JZ2 A;  4A4H A;  3OQ5 A;  4B9X A;  4C5I A;  2R5A A;  2PQW A;  2L3R A;  3SD4 A;  3MET A;  2X4X A;  2K3Y A;  3LGF A;  4II1 A;  2RI3 A;  2LRQ A;  2DIG A;  2EQU A;  4IUP A;  1OYX A;  2HQE A;  3ME9 A;  2VYT A;  4BE0 A;  3DLM A;  4N4H A;  2L8D A;  3MEU A;  5FRO A;  2RJF A;  3OYE A;  3PMT A;  4A4F A;  3OYD A;  2RHU A;  3L2R A; 
#chains in the Genus database with same CATH topology
 4IUV A;  2PUK B;  4WF2 A;  1NBE B;  4QVD A;  5GAN d;  2OAW A;  3TVT A;  3EG3 A;  3OYH A;  2QQ9 A;  5LJ5 e;  3E9F A;  1TU0 B;  5LJ3 d;  2X3W D;  3JCM X;  1MMA A;  4IUR A;  4Z88 A;  4OF1 A;  3OS2 A;  4MZT A;  1WIE A;  2E70 A;  1K0S A;  4QKU A;  1LVK A;  5GJV B;  1Q7Y R;  2F5K A;  3REB B;  1WLP B;  3S6W A;  2RNA A;  2NUZ A;  2D6F A;  3VJP A;  2EJF A;  3H41 A;  4FIB A;  3CD6 T;  1YIJ T;  3CCR A;  2H3J A;  2ABL A;  4KT0 E;  5IT9 E;  5IHI A;  3CC2 Q;  1JXM A;  4Z8A A;  2V26 A;  4M75 A;  1YBY A;  3HL8 A;  2EWN A;  1OPK A;  2JW4 A;  2LNH B;  4L59 A;  5GAO l;  1W70 A;  4EIK A;  4M77 A;  3L42 A;  2RD1 A;  4ZTF A;  1QCF A;  4M78 F;  1U1S A;  5KYY A;  2DVJ A;  1VQ9 Q;  3JSC A;  3QHS A;  2K9G A;  2LCL A;  3PE0 A;  3REA B;  5IHN A;  4J8O A;  3CBP A;  1BI0 A;  1N9S A;  1EIF A;  2FZG B;  2EKH A;  2NUP A;  3LGL A;  2JM8 A;  1K73 C;  1KQS P;  1C0M A;  3TRE A;  3SWN C;  4C5I A;  4AFZ C;  4J9D A;  2DZ9 A;  3A8G B;  4KGV B;  2AKK A;  3CCV Q;  5HY6 A;  2EGC A;  2JN0 A;  1VQ8 Q;  2RI3 A;  4PFZ A;  3TCJ A;  2L8D A;  4FT2 A;  5GAM h;  4DBQ A;  2LJ3 A;  3PTA A;  4KGZ B;  3VKI A;  1MMN A;  5KYY B;  4FT4 A;  4QW2 A;  1Y57 A;  2XHC A;  2XDD A;  1UGQ B;  2A36 A;  2I0N A;  1GFC A;  3QZ5 B;  2DXT A;  4F7U B;  2D8J A;  2DKG A;  3KUF A;  5GAM j;  4M4Z A;  3VYG A;  2L89 A;  1BI3 A;  2CP6 A;  3M9Q A;  3A8L B;  2K2V A;  1H92 A;  2DL7 A;  2E3H A;  2QTX A;  3VU3 C;  1VQO A;  3I56 Q;  3JB9 G;  4M77 C;  3L1A A;  2LC4 A;  2M51 A;  2V1R A;  2QQS A;  4E7I A;  1YJN T;  2OTJ A;  1VYU A;  3CME A;  4IUT A;  4X9D A;  4B6M A;  2DL8 A;  3THK A;  2EBP A;  4N4I A;  1KHC A;  4OGE A;  3L2W A;  3DB3 A;  4M75 C;  4QQG A;  4BD3 A;  4CRI A;  2CZ6 B;  2YRC A;  4C5H A;  5GMK e;  4M7D A;  2E6Z A;  4IUQ A;  4J6W A;  1C6V X;  1WHJ A;  5C6S A;  4DOV A;  3RMQ A;  4E7H A;  4PJN A;  2KSS A;  3SWN B;  2M16 A;  2DZC A;  4P5N A;  3S3N A;  1ZA1 B;  1BI2 A;  3EFR A;  1D3B A;  5I2M A;  3VS7 A;  2H3E B;  3KBG A;  3TQ7 P;  1SPK A;  1VQN T;  1NJI C;  4PL6 A;  4C8Q G;  2ZCF B;  4B9X A;  3OQ5 A;  3CCV T;  3BY7 A;  2J6K A;  1G3T A;  1T0J A;  2GQV A;  2NUP B;  1YJ9 A;  1UGS B;  2CSQ A;  1VQ6 Q;  4IUP A;  4OMP A;  4AG1 C;  2PZ1 A;  3INZ A;  1PRM C;  2MCN A;  2RHU A;  1GRI A;  4L6V 5;  1JJ2 S;  5LJ3 f;  1I07 A;  4Z89 A;  4RTU A;  4PJL A;  1QP3 A;  2GNC A;  3JCM e;  2DD4 A;  4OP0 A;  1YI2 Q;  3X28 B;  5CQX A;  2RQR A;  2HZY A;  2MWP A;  1KQ1 A;  5LJ5 j;  5GAN 6;  1WXU A;  3NGP A;  4PJM A;  1OPL A;  5GAM g;  2K5I A;  1VQO T;  1Q86 U;  3M59 A;  2GGR A;  3QJY A;  2EYY A;  8ATC B;  5GMK j;  4AFS C;  2YUN A;  3E9G A;  2P4R A;  4JLG A;  4LD6 A;  3S3M A;  4M78 B;  5KYW B;  1ARK A;  3OW2 S;  3VRZ A;  4TVR A;  1UHC A;  5I11 A;  3CXC S;  1M1F A;  4XTZ A;  1RAG B;  4M78 A;  5KYW A;  1ZA2 B;  3OMC A;  1JU5 C;  4M7A E;  3URG A;  3QYG B;  5HKC A;  4FW2 A;  3M0P A;  2OTL T;  2KT1 A;  2V8J A;  3VS2 A;  1WXB A;  4CC2 A;  5GAN f;  4LN2 A;  3MP8 A;  3QSU A;  2RK1 A;  1M1K U;  2RJC A;  3PGG A;  1CKB A;  4LDV A;  1N8R C;  1WHH A;  1VQ4 A;  2C0O A;  1RAA B;  3U23 A;  3HHT B;  2CUB A;  1ZQ1 A;  2CP2 A;  5LJ3 e;  3CCM Q;  2O9V A;  3CCU Q;  1W4S A;  1F1B B;  1NE8 A;  1X43 A;  3O8V A;  2LQK A;  3QKJ A;  4RMO A;  2MI6 A;  2E1H A;  2ZGW A;  4BE2 A;  2P4T A;  3WXM B;  1MND A;  1VQ6 A;  1LCK A;  2RQW A;  3MEW A;  1UGR B;  5FU7 C;  2NWM A;  5GMK i;  3CEY A;  4F7U F;  1K9A A;  4XK8 E;  1VUB A;  1GXI E;  2DJQ A;  2DA9 A;  4EMH A;  5GAM d;  3RNJ A;  1YHQ T;  1QQJ A;  1VYT A;  5I22 A;  1Q82 U;  4KRT A;  2KE9 A;  1VQK Q;  2KRM A;  1RAC B;  1FMW A;  1G5V A;  1YJW A;  1M3C A;  4NL3 A;  1VQL Q;  4M7D B;  1VQL T;  2QDY B;  2X3X D;  4PK4 A;  3O5Z A;  5CR2 A;  2BZX A;  4HCZ A;  3GNG A;  1WJR A;  4JJN K;  1K9M U;  3CCU A;  1MGQ A;  1WNL A;  3GP8 A;  4OB1 B;  2DLP A;  2M0O A;  1R0B G;  2X4J A;  4NS5 A;  5J26 A;  2E64 A;  4OB3 B;  3HRT A;  4M7D C;  2FPF A;  5D6X A;  2EFI A;  1KC8 R;  3VV0 A;  1M2O A;  1VQN Q;  4AMC A;  3A8H B;  2YLC A;  4V2S A;  5GJW B;  1WXT A;  2IVW A;  2KYB A;  3N5B B;  1OOT A;  3A8O B;  1ZSG A;  5GAN j;  1GFD A;  4DEY A;  2RO0 A;  3OYN A;  1T0H A;  2E10 A;  1YWP A;  2DXC A;  2OX7 A;  5CKB A;  1O9S A;  2GFA A;  1TS9 A;  5LJ3 h;  4C8Q F;  4LUE A;  1JQQ A;  1JRI A;  1VQM A;  3RUX A;  5GAO r;  4BDZ A;  3CME Q;  4HT9 A;  4ORZ A;  5HK3 A;  1XJW B;  1WYX A;  5IXF A;  5CKH A;  1RAH B;  1YI2 A;  1Q81 R;  4J9E A;  3SD4 A;  1WQW A;  5FW9 A;  2DVE A;  5FU6 B;  1I4K 1;  2ESW A;  2JNG A;  2VVK A;  4WTO B;  2FL7 A;  2LRQ A;  2YLB A;  1JJ2 P;  2YUP A;  3JCM Q;  1JB0 E;  4RG8 A;  1QVP A;  2C06 A;  3OYD A;  5IAY A;  2MF2 A;  1Q95 G;  3VS1 A;  1R77 A;  2YXY A;  3V7R A;  3J81 E;  1BIA A;  1SHF A;  5FWC A;  2XD0 A;  2RHI A;  3G71 T;  3ASK A;  1Y07 A;  3RIR A;  1Q86 R;  2CZ7 B;  1BI1 A;  1TTH B;  3LX7 A;  3PVL A;  4RTT A;  1Y96 A;  2L5Q A;  4NOY A;  3EFO B;  4N0A C;  4DBF A;  2DEU A;  2CP0 A;  1W2B A;  2QK0 A;  1TUD A;  3HRU A;  3CCJ A;  4C5G A;  2PVG B;  3CXC P;  4J7I A;  2JOY A;  3TEE A;  4DBH A;  1QCN A;  4MZP A;  3TSW A;  2ZPF B;  2XMF A;  1BKB A;  4M7D G;  1X6O A;  5FRN A;  4PJJ A;  4M75 E;  9ATC B;  1AWW A;  2JMA A;  1MHN A;  4C92 C;  2NYS A;  4LDX A;  4C0D C;  1GCQ A;  2CYZ B;  4XTY A;  3EGX A;  1HYO A;  2YT6 A;  5DY9 A;  1VQ9 T;  2MIO A;  2LQW A;  2CGH A;  2EPD A;  4RTV A;  2LQN A;  5IN1 A;  4CC3 A;  2HEQ A;  4BAC A;  4C0Z A;  1ZSZ A;  3DB4 A;  2KRS A;  1MUZ A;  1N8R R;  5J3B A;  2RI2 A;  4HCB A;  2HQX A;  3CQT A;  5DLQ E;  1IHV A;  3OB9 A;  2RJD A;  3L2Q A;  2DYI A;  3CC2 A;  1QVF S;  5D7U A;  5LJ5 g;  4X9C A;  3RMS A;  3VUB A;  4R55 A;  3JCM h;  1Z9Z A;  4C0G A;  1BCM A;  1YCS B;  2E65 A;  3RKY A;  4BI8 B;  3MET A;  3CPF A;  2BE9 B;  4MDW A;  1Q81 C;  4BY6 B;  2DIG A;  4J7F A;  2PVD B;  5A2Q E;  4ATO A;  1X01 A;  3SHW A;  3G1J A;  2B8A A;  2ED0 A;  2KT8 A;  4E2F B;  4DA4 A;  3DKM A;  3EG9 A;  2A37 A;  4N4G A;  3X20 B;  2LDM A;  2VC8 A;  2EYX A;  2MYS A;  3MJX A;  4M78 G;  4C92 F;  1M90 U;  4A4G A;  2EQI A;  1EX4 A;  3RKW A;  2WSF E;  4PLL A;  4PJO G;  2RJE A;  1WGS A;  3LLR A;  3M57 A;  5A0G A;  1VQP A;  1VQ4 Q;  2QGG A;  2BTT A;  1H3H A;  2OI3 A;  2YDL A;  3QZ9 B;  2EJG A;  3GNF B;  4JRP A;  4XU3 A;  4OMF B;  5GAO n;  1Q7Y C;  4M7A A;  3PFS A;  4C8Q E;  1N8R U;  2EJ9 A;  3G7Z A;  4OVA A;  4BI4 A;  1UHF A;  4C92 E;  3C94 A;  1S72 A;  3VS0 A;  1GCQ C;  1IHW A;  4EMG A;  4BB7 A;  3I35 A;  4E47 A;  1B34 B;  1QWF A;  4VUB A;  1WPY A;  2DD5 A;  2FPD A;  4M75 G;  4C8Q B;  5GMK l;  3HRS A;  4J6Y A;  4L5G A;  3KXT A;  3A1P A;  1KD1 C;  2EAY A;  3MCA B;  3G4S T;  3E2U A;  2O4X B;  3CCQ Q;  4BI3 A;  3G71 A;  2RB6 A;  6AT1 B;  3VS4 A;  1PHT A;  3H0H A;  3Q1J A;  2E3I A;  1K76 A;  2DMO A;  1PCX A;  3OYJ A;  4A4H A;  5KYN A;  4EMK B;  1ZUK A;  4II1 A;  1RAF B;  1NJI R;  4M7A D;  5ECA A;  1KFZ A;  3DLM A;  1RAD B;  5FU6 C;  5FRO A;  3ZBD A;  4A4F A;  1M2V B;  3NTK A;  2RQT A;  5KE3 A;  3SWN A;  4KUD K;  2FRW A;  1ZBX A;  2HD0 A;  3OMG A;  5AYF A;  1IGU A;  3X24 B;  3UWN A;  2NUT A;  1M90 R;  2Y90 A;  5CK9 A;  3M0R A;  3ZL7 C;  3MKD A;  3I55 Q;  1G3Y A;  2RHY A;  4PJO F;  1M8V A;  2A3L A;  3OYF A;  1OZ2 A;  2DO3 A;  2HQH A;  1YIJ A;  4KGX B;  2MOX A;  2MWO A;  4E7S A;  1N9R A;  1FWZ A;  1JJ2 A;  3CC7 A;  4HVV A;  2FYK A;  3UA7 A;  1W6X A;  1KSW A;  2KQW A;  4LE9 A;  4F16 A;  2X35 A;  2GFU A;  1U1T A;  2D0Q B;  2HKQ B;  1YIT T;  3SDZ A;  4GLM A;  2K6D A;  2QGF B;  3GIB A;  1OEB A;  3G4S A;  2CP5 A;  1PKS A;  1ZLM A;  3VUZ A;  4BUG A;  3CXC A;  1TWB A;  1NJI U;  4QVZ A;  2L0A A;  4JUV A;  2D0N A;  4XTW A;  1NPP A;  4HA8 A;  1VQ9 A;  1M1G A;  1V1C A;  1WDX A;  2V8I A;  4M78 D;  1B7T A;  3G4S Q;  2KY9 A;  2HBP A;  4FCY A;  5GAN 5;  3JRZ A;  2QEX A;  2BZY A;  2EQU A;  5LJ3 j;  2ZPH B;  3E19 A;  1M3B A;  2RJF A;  1VQK T;  1QMC A;  3M55 A;  3L2R A;  4EDU A;  1D1C A;  4E6R A;  3RER A;  1WHL A;  1PWT A;  2LP5 A;  4WCI A;  1VQ4 T;  3V7C A;  5CKF A;  5KCH A;  2RHX A;  3FC3 A;  2GBQ A;  1RUW A;  1VQ7 Q;  1NM7 A;  1YJW T;  4A53 A;  2K4Y A;  2DAQ A;  4KH0 B;  2X9H A;  2K3X A;  1QVF P;  2J7I A;  2JMC A;  4F17 A;  4LUD A;  5GAM f;  3JCM V;  2COY A;  2FG0 A;  4M77 E;  1MMG A;  2R57 A;  2F2V A;  3NTH A;  3X26 B;  4DEX A;  4C92 G;  1N6A A;  4B9W A;  4PJO C;  4GBQ A;  4HCC A;  2RMO A;  3SB2 A;  1M3A A;  2RQV A;  5KYX B;  3FRN A;  3OSV A;  3EAE A;  2OTL Q;  1WI7 A;  5GAN e;  1YNZ A;  2FEI A;  4Q5W A;  3JB9 D;  3FJP A;  4M78 C;  3QG1 A;  2RQU A;  4F7U A;  2ZZD A;  2LCC A;  2QXF A;  4ME7 A;  1E7O A;  5A0L A;  5GAN 3;  3CC4 Q;  3J7A F;  3P8B B;  3T9N A;  3BDU A;  1T3L A;  2DBK A;  2RH2 A;  1AHJ B;  1OX9 A;  2HSE B;  2K2M A;  1VYV A;  1TUG B;  3HFO A;  4XAX B;  4LNP A;  3C4S A;  1UJY A;  2LT4 A;  4J9B A;  5CO7 A;  2EGE A;  5L23 A;  1VQM T;  1Q82 R;  1WHK A;  2DTI A;  2EGA A;  4E7J A;  1B07 A;  2KYM A;  2G6F X;  2OTL A;  2KGT A;  4OMQ A;  2KBT A;  1TSF A;  2BE7 D;  1Y0M A;  2FHD A;  1PM3 A;  3VRY A;  2LVM A;  4RKU E;  4M7A B;  3LWI A;  2DRK A;  3NMZ C;  1PRL C;  1U3O A;  2K3Y A;  1KD1 R;  1K73 R;  4M78 E;  4XU1 A;  5CVI A;  2Y4Y A;  4C8Q D;  3MEU A;  3OYE A;  2EYW A;  4AT1 B;  3J80 E;  3LH5 A;  3M53 A;  4MDX A;  1PG5 B;  4PJO D;  1UG1 A;  4C8Q A;  3UAT A;  4ELZ C;  3CCE A;  2M02 A;  3PIO A;  4ELY C;  4J9H A;  1VQO Q;  2ZPB B;  1VQP Q;  3NTI A;  2JTF A;  2VXE A;  1I0C A;  2DIQ A;  4PFP A;  4JZ3 A;  3TU4 K;  4M75 B;  1AT1 B;  2P0P A;  5FU7 B;  1RAI B;  1CKA A;  1EZZ B;  2CT4 A;  4OB2 B;  1T3S A;  5FWB A;  1K8A C;  3PMI A;  2F2X A;  1I5L A;  3M0S A;  3OY9 A;  1RI9 A;  1M9S A;  1ABO A;  1ZX6 A;  4DOW A;  3F70 A;  4RG2 A;  2W10 A;  1YIJ Q;  1UUE A;  1AVZ C;  2EVR A;  1QLY A;  3GBQ A;  4R56 A;  2QA4 A;  3M58 A;  1JXO A;  3CPW A;  1OQK A;  1KG1 A;  4DQ2 A;  1B34 A;  2I2L A;  2CKK A;  2IIM A;  5M9O A;  4C92 A;  5LL6 S;  2LJ1 A;  2O4X A;  1DJ7 B;  4UC4 A;  4D6W A;  4Z02 A;  1A0N B;  5LJ5 d;  2KXC A;  4A63 B;  5IXB A;  1G2B A;  2DF6 A;  4ZN1 A;  7AT1 B;  2IG0 A;  5GAN 7;  2O01 E;  2FRY A;  2PUO B;  4EMK A;  3OYA A;  1FYN A;  1WA7 A;  2X4X A;  1YJW Q;  2HMA A;  2NUT B;  1M1K C;  2F1L A;  1LPL A;  2A28 A;  3OSS C;  4Y28 E;  4ZGE B;  2K3B A;  1S1N A;  3BE3 A;  3KFV A;  2CT3 A;  1D0Y A;  2DYB A;  1SRM A;  5GAM e;  1IO6 A;  2EQJ A;  4ZGD B;  1VIE A;  1D1A A;  2IPO B;  2KNB B;  4BDY A;  2O9S A;  3CCJ Q;  1TOV A;  1UEC A;  3L2V A;  1SKU B;  3I5S A;  1GBQ A;  2KRN A;  1G83 A;  4MZM A;  4X1V A;  5GAN 4;  3BFM A;  3FEO A;  1BBZ A;  4JDS A;  4E7K A;  1U06 A;  1KC8 C;  1K1Z A;  5CCA A;  4LDU A;  2VV5 A;  1UFF A;  3R6O A;  2PNI A;  3UPU A;  3HP9 A;  2DE0 X;  1PKT A;  1QW1 A;  2E5Q A;  2DFU A;  2DM1 A;  1IGQ A;  1W1F A;  3G71 Q;  2COW A;  1VQP T;  1HJD A;  4R0K A;  1KQS A;  1RAB B;  3M4Y A;  3IQL A;  4RTZ A;  1I5O B;  1IRX A;  4E7L A;  3CCJ T;  2O88 A;  3HFN A;  4O5V A;  1YJ9 T;  2BUD A;  5KCO A;  1OV3 A;  4C0F A;  3AHU A;  1YJN A;  1JO8 A;  4QT7 A;  5EG2 A;  3OW2 A;  1PSE A;  2ATC B;  1RL2 A;  1KHI A;  1VOM A;  2LX7 A;  2FZK B;  3NFC A;  2EQM A;  4JS4 A;  4QQ6 A;  4OMO A;  1X69 A;  4OMN A;  2DBM A;  2OTJ T;  3MP6 A;  3VYH B;  3A98 A;  1QVG A;  2HSP A;  3GPL A;  1X27 A;  4JJD A;  4J9C A;  2JZ2 A;  1Q7Y U;  1WQ7 A;  1E6H A;  2DNU A;  1VQ5 Q;  4M75 F;  2BZ8 A;  4KUI A;  1S72 Q;  4JJC A;  1OYX A;  2HQE A;  2ZPG B;  1OU8 A;  3ME9 A;  4AFU C;  1BIB A;  2ROT A;  2DIL A;  2QI2 A;  5GAN h;  4IIM A;  3JB9 J;  1PD0 A;  1XQH A;  1Q86 C;  1FMV A;  1YWO A;  3CCS T;  2CP7 A;  4AFQ C;  4CC4 B;  1UB4 A;  1H8K A;  2KR3 A;  1VQ7 T;  1BU1 A;  1X75 C;  2ZAE A;  2P0K A;  1PSF A;  4C92 B;  3MO8 A;  2L3Q A;  2LJ0 A;  2KI7 A;  4M7A F;  2PTK A;  3D7S B;  5HK0 A;  3UF4 A;  2OAU A;  4M7D F;  2KAF A;  5KH6 A;  1UGV A;  1KC8 U;  2YHT A;  1XTD A;  3JCM J;  1VQ5 T;  1H64 1;  4CI0 C;  2L3P A;  2WSC E;  4K11 A;  2R5M A;  4D8K A;  2RHZ A;  3EG1 A;  4DBR A;  4RUG A;  3CCL Q;  1YP5 A;  2FZC B;  2VB6 A;  3QYH B;  3SFM A;  3I55 A;  1UE9 A;  4M77 F;  3EFS A;  3QWX X;  5J39 A;  3C0C A;  4FYY B;  3M4G A;  4O6J A;  2D1X A;  2MAM A;  1JBM A;  1QVG P;  1Y96 B;  3CBO A;  1Y71 A;  1W2B P;  4RTW A;  3VS3 A;  4OML A;  4PFO A;  2A08 A;  4F04 B;  2QQA A;  4FSS A;  2H8H A;  3G6E T;  2E41 A;  3PNW C;  2LZ6 B;  3H6Z A;  2J06 A;  5IHK A;  3VS6 A;  3JCM f;  3OYM A;  1WZO A;  2HAX A;  2COZ A;  1BCO A;  1ZUU A;  2ECZ A;  3SEM A;  3H0I A;  3RKX A;  3AT1 B;  4IUU A;  2AZV A;  5CAI A;  1MV0 B;  2VKN A;  4XTU A;  2KXD A;  4HVW A;  1VQL A;  2DJZ A;  3CMA A;  3HSB A;  2YUQ A;  2VWF A;  2P84 A;  2K7A A;  3DLL A;  2VYT A;  3CCQ A;  2GTJ A;  2HCK A;  1UGP B;  1IB8 A;  4FYW B;  1VQ8 A;  1WJQ A;  1AD5 A;  3CD6 A;  3OW2 P;  1YJN Q;  1NZ9 A;  3CD6 Q;  2JUF A;  3JCM W;  2AT1 B;  1RAE B;  4ZN3 A;  1HK9 A;  2RPN A;  2DER A;  3I56 T;  2VUB A;  4X34 A;  3JB9 F;  2QQR A;  1U5S A;  1Z9Q A;  2AIR B;  3C95 A;  1YIT A;  3TSZ A;  1NEG A;  1UEB A;  3P8D A;  1K73 U;  1M2V A;  2JS2 A;  4ZTJ A;  2CZ1 B;  2QG9 B;  3I55 T;  2A7Y A;  4M77 G;  4BE1 A;  4F14 A;  1NPR A;  2LTO A;  3EGD A;  1WHG A;  4GY5 A;  1BK2 A;  2XI9 A;  3L2Z A;  1SHG A;  2B86 A;  4NL2 A;  1NEB A;  4Y92 A;  1OZ3 A;  4C8Q C;  2RM4 A;  1N5Z A;  1GCP A;  3UA6 A;  1RI0 A;  2GF7 A;  1XOV A;  2DX1 A;  4PJO E;  1SSF A;  2EW3 A;  3EH2 A;  3M0T A;  2X51 A;  3PT9 A;  3G6E Q;  5CKE A;  3FLG A;  2DET A;  1QCO A;  3QWY A;  2XKO C;  1VQK A;  1SRL A;  4M75 D;  4ZGJ B;  3QDF A;  4OB0 B;  1I1J A;  2DEQ A;  2K5F A;  1M1K R;  1ZBJ A;  5GAN 2;  3RDV A;  1OUL A;  3LWH A;  1AWO A;  1WHM A;  3CMA Q;  4HXJ A;  1Y7X A;  4J83 A;  3V8L A;  2PQW A;  2DTO A;  2DRM A;  1HXD A;  3EGU A;  4J9I A;  1SSH A;  2MK5 A;  1R0C B;  4JRQ A;  2RA2 A;  3JB9 I;  2CP3 A;  4M7D D;  3V7S A;  3PMT A;  1HSQ A;  2RK2 A;  2EQK A;  1AZG B;  3EG2 A;  1AWX A;  3FDR A;  2FPE A;  2RF0 A;  3M56 A;  2MMP A;  1QVF A;  4LDW A;  3I56 A;  2MPX C;  1X6B A;  2X4Y A;  1PNJ A;  3CCS A;  4M77 B;  2P0Q A;  2CUD A;  4PJO B;  1YIT Q;  3MPU B;  5GAN g;  3OYL A;  2HBW A;  2KVQ G;  2F2W A;  2QA4 Q;  4J6X A;  4PLI A;  4PKC C;  4Y91 A;  3CCL A;  5DLO A;  3BW1 A;  4QVC A;  1VQ5 A;  3G6E A;  1WFW A;  2G3R A;  1NYF A;  3CCM T;  3EG0 A;  4FU6 A;  1M30 A;  2RI5 A;  4D8D A;  1K9M R;  2ED1 A;  1D0Z A;  4M7A C;  1VQM Q;  1K0X A;  2ENM A;  2E6N A;  2V8K A;  5LJ3 g;  1MNE A;  4OMM A;  1SEM A;  4M7D E;  5D6Y A;  4A4E A;  1VIF A;  4FYX B;  4IIO A;  3OYI A;  3CCV A;  4RCC A;  3H9N A;  2QA4 T;  1PC0 A;  2NLU A;  3LW5 E;  4YTL A;  1BB9 A;  1LOJ A;  4JZ4 A;  2JVV A;  5KE2 A;  2LT1 A;  3M0U A;  4KBM B;  3OYB A;  1YFN A;  4F7U G;  2CH4 W;  3ER0 A;  1IRE B;  1VQN A;  1J3T A;  5I21 A;  1K9M C;  3MEV A;  1X2Q A;  1CSK A;  1QWE A;  2QEX T;  5L8R E;  1XNI A;  3CPW S;  2DK3 A;  2L2P A;  2D8H A;  3PVQ A;  3GF5 A;  2GTO A;  3RES A;  3V8J A;  2YSQ A;  5KYU B;  1D1B A;  3EFO A;  5FLX E;  1O75 A;  1G3S A;  3PIP A;  4BE0 A;  1E6G A;  3FB9 A;  1FXX A;  2ZPI B;  2FB7 A;  2LCS A;  2JTE A;  5A0D A;  1LNX A;  4M77 D;  2QDL A;  3JB9 H;  2Y4X A;  1SF9 A;  3E1S A;  3EHQ A;  2VGN A;  3JCM b;  1P92 A;  2JM9 A;  2BIV A;  1IXD A;  1YCY A;  5LJ5 f;  5FRM A;  2JT4 A;  2QQB A;  3OA6 A;  3HTR A;  2HL5 C;  2QTV A;  4MML A;  4XQ3 A;  4A54 A;  5GMK m;  1M90 C;  3CCE T;  2VXF A;  1R8O B;  3CC2 T;  1QKX A;  1TXQ A;  1X6G A;  3EGX B;  1WX6 A;  1BYM A;  1ZSZ C;  2CRE A;  4JJB A;  5HCK A;  1ABQ A;  2W0Z A;  1GBR A;  3OS0 A;  5DM7 R;  3CPW P;  4F7U E;  2LX9 A;  2AK5 A;  4LDY A;  3UDC A;  2LNV A;  3RR6 A;  4HT8 A;  1JEG A;  2YWW A;  5LJ5 h;  2XIC A;  4RTY A;  2RN8 A;  3CME T;  2XG8 D;  5C0M A;  3L2U A;  1IZ6 A;  2OJ2 A;  3QBY A;  1C1A A;  2EIF A;  5D6W A;  4PNO A;  1U8R A;  3HPW A;  4E7Z A;  2DTH A;  2ZPE B;  2XID A;  1Q82 C;  3OYC A;  2X4W A;  4OGC A;  2DL5 A;  4ZNX A;  2XDP A;  2ROL A;  3A8M B;  3QPH A;  4J9F A;  4EMK C;  1UTI A;  2HNI A;  3M5A A;  5GAO q;  3QO3 A;  1KJW A;  2GCX A;  3LH0 A;  3OS5 A;  4RTX A;  3NHN A;  3OBW A;  8AT1 B;  1K8A U;  4XTX A;  3EH1 A;  1I8F A;  4EPC A;  1H3Z A;  2M1H A;  3S3O A;  1KQS S;  2QAS A;  1EFN A;  4A4K A;  2DL4 A;  1M5Q 1;  3OBY A;  4C0D B;  4ANJ A;  4XU0 A;  3LGF A;  3CCE Q;  2V1Q A;  2WSE E;  2C0I A;  4N4H A;  1S72 T;  4XTV A;  4FSX A;  1YI2 T;  1AEY A;  2DL3 A;  1V76 A;  3QUI A;  2CSI A;  1TUC A;  3CCM A;  1KIK A;  3H8Z A;  2OTJ Q;  4JPB W;  4FL6 A;  2DXU A;  5GMK h;  1ACM B;  2AHJ B;  5AT1 B;  3CC7 T;  4BY6 C;  1QVG S;  3CCR T;  3CBM A;  3OYK A;  1FMK A;  3M54 A;  5GAO m;  2FO0 A;  3JCM P;  4LXC A;  1M27 C;  1G3W A;  1B3Q A;  1UJ0 A;  4HKE A;  1VQ6 T;  1KK7 A;  3GLX A;  3EHR A;  1YJ9 Q;  1M4Z A;  1D3B B;  5EC7 A;  3EGD B;  1RLP C;  4KUL A;  2CDT A;  5CQY A;  4CC7 A;  3CC4 A;  3QJ6 A;  3JCM g;  2GQI A;  3JCM c;  1KD1 U;  1ZSZ B;  2AZS A;  4GLK A;  5I2S A;  2EKO A;  1YN8 A;  2F5T X;  1VA7 A;  2KMT A;  4IKF A;  1K4U S;  1OI1 A;  2CS7 A;  4QQD A;  2D9T A;  2PVO B;  3CCL T;  2C0T A;  4KH1 B;  2J6O A;  2AKL A;  2JXB A;  3UT1 A;  3RBB B;  3CCU T;  2LQ8 A;  3OYG A;  2YRV A;  3X25 B;  4LD9 K;  1TG0 A;  4J5Y A;  1M8M A;  4HCK A;  2HDA A;  2XK0 A;  1D0X A;  3FJ5 A;  3QDR B;  3MP1 A;  1HD3 A;  2QYZ A;  3HKS A;  1SG5 A;  2BKD N;  2VAS A;  3M0Q A;  1VQ7 A;  5KYU A;  3I9Q A;  1NG2 A;  1OX8 A;  2R5A A;  4HVU A;  2L3R A;  2K5L A;  1ZHI A;  2KK4 A;  3R6N A;  3OYY A;  3JV3 A;  4C92 D;  3WVD B;  1I81 A;  2PU9 B;  1YHQ A;  1G8X A;  1LJO A;  2O31 A;  1NLO C;  1D09 B;  4J9G A;  3QII A;  4ESR A;  1AWJ A;  1X2K A;  2KDS A;  5CIU A;  1V29 B;  3JCM d;  4MMK A;  2E12 A;  3WVE B;  2A0F B;  3QXE B;  4AG2 C;  1NLP C;  1OU9 A;  4XU2 A;  5CKD A;  2QAZ A;  1VQ8 T;  1GL5 A;  4FW1 A;  3FIF A;  1N27 A;  2CZ0 B;  5IH2 A;  3JAM E;  2YRD A;  2M9U A;  3H0F A;  2E5K A;  1MV3 A;  2SRC A;  1AZE A;  1PD1 A;  1WJS A;  1MMD A;  5KYX A;  4JS5 A;  2DXB A;  2CH4 A;  5GAN 8;  2XDB A;  4N0A A;  2EYZ A;  4C5E A;  1Q81 U;  2JS0 A;  2WAC A;  2XU8 A;  2L3S A;  3V8K A;  2DPP B;  2KEA A;  2Z0W A;  4RCB A;  5GAO p;  3CCQ T;  3MEA A;  2J6F A;  2HL3 A;  4PJO A;  1UDL A;  3BDL A;  3P8H A;  1RLQ C;  2EYQ A;  3A5Z B;  2F69 A;  3C12 A;  2YUO A;  3CMA T;  2FVU A;  2JTM A;  3GOX A;  1QP2 A;  2O2O A;  3EG9 B;  4M7A G;  4FM4 B;  2LMJ A;  1AOJ A;  3ZFJ A;  3ZEH A;  1YHQ Q;  3VS5 A;  1NYG A;  2R58 A;  3I5R A;  3NPF A;  1ZUY A;  3OS1 A;  2QEX Q;  2J05 A;  2JJ9 A;  3LYI A;  3CCR Q;  3CCS Q;  3ULR B;  1KQ2 A;  3CC7 Q;  3CC4 T;  2E4H A;  2VGM A;  2M0Y A;  2K79 A;  1QKW A;  1W2B S;  4JLI A;  4JRK A;  2K57 A;  4FYV B;  1K8A R;  1FX7 A;  2KRO A;  1TH7 A;  2HKN A;  3MHX A;  2SEM A;  4JRI A; 
#chains in the Genus database with same CATH homology
 4IUV A;  2MF2 A;  3M53 A;  5IAY A;  4MDX A;  2RK2 A;  2EQK A;  4PJO D;  2PUK B;  3FDR A;  4C8Q A;  3M56 A;  2MMP A;  3V7R A;  4ELZ C;  3J81 E;  4LDW A;  1BIA A;  3CCE A;  2C06 A;  1QVF A;  2XD0 A;  3PIO A;  2RHI A;  4WF2 A;  3ASK A;  1Y07 A;  3RIR A;  4ELY C;  4QVD A;  3G71 T;  5GAN d;  2ZPB B;  3I56 A;  2CZ7 B;  1BI1 A;  3NTI A;  2JTF A;  2VXE A;  1Q82 C;  2DIQ A;  2X4Y A;  3OYH A;  3CCS A;  2QQ9 A;  3LX7 A;  5LJ5 e;  4M77 B;  2P0Q A;  1Y96 A;  3E9F A;  2L5Q A;  4NOY A;  4N0A C;  4PJO B;  5LJ3 d;  5GAN g;  3OYL A;  3JCM X;  1W2B A;  3TU4 K;  2KVQ G;  4M75 B;  4IUR A;  2P0P A;  5FU7 B;  4OF1 A;  3OS2 A;  4MZT A;  4J6X A;  2E70 A;  3HRU A;  4PLI A;  3CCJ A;  4C5G A;  4PKC C;  4Y91 A;  2PVG B;  3CCL A;  5DLO A;  4J7I A;  3BW1 A;  4QVC A;  2JOY A;  4OB2 B;  3TEE A;  1VQ5 A;  4MZP A;  3G6E A;  2F5K A;  2ZPF B;  1K8A C;  3S6W A;  1BKB A;  3PMI A;  1VQP A;  1I5L A;  2D6F A;  3VJP A;  4M7D G;  2EJF A;  4FIB A;  2G3R A;  3OY9 A;  1X6O A;  3CCM T;  5FRN A;  3CD6 T;  1M9S A;  4FU6 A;  2RI5 A;  1YIJ T;  4DOW A;  3F70 A;  2H3J A;  4M75 E;  4RG2 A;  3CCR A;  1MHN A;  4C92 C;  4M7A C;  4KT0 E;  5IT9 E;  3JCM e;  4LDX A;  2E6N A;  4M75 A;  4C0D C;  1YBY A;  2V8K A;  4R56 A;  2CYZ B;  2QA4 A;  5LJ3 g;  3M58 A;  3HL8 A;  2EWN A;  4XTY A;  3CPW A;  4M7D E;  1KG1 A;  4L59 A;  4DQ2 A;  5D6Y A;  4A4E A;  1B34 A;  2I2L A;  5DY9 A;  2CKK A;  5GAO l;  1VIF A;  1VQ9 T;  5M9O A;  3OYI A;  4M77 A;  3L42 A;  2CGH A;  2RD1 A;  4C92 A;  5LL6 S;  3CCV A;  4RCC A;  4ZTF A;  2O4X A;  5IN1 A;  2QA4 T;  2NLU A;  3LW5 E;  4YTL A;  1DJ7 B;  4UC4 A;  4M78 F;  1LOJ A;  4D6W A;  4BAC A;  1U1S A;  2JVV A;  5KE2 A;  4C0Z A;  2LT1 A;  4KBM B;  4Z02 A;  3OYB A;  3DB4 A;  3JSC A;  3QHS A;  5LJ5 d;  5J3B A;  2LCL A;  2RI2 A;  4HCB A;  2HQX A;  5DLQ E;  3L2Q A;  3OB9 A;  4F7U G;  2RJD A;  1VQN A;  3ER0 A;  1IRE B;  4J8O A;  5I21 A;  1K9M C;  3CC2 A;  1QVF S;  3MEV A;  3CBP A;  1BI0 A;  1N9S A;  5LJ5 g;  1EIF A;  4X9C A;  3LGL A;  3PMT A;  3RMS A;  3VUB A;  4R55 A;  5L8R E;  2QEX T;  4ZN1 A;  1XNI A;  3CPW S;  3JCM h;  1K73 C;  2DK3 A;  2IG0 A;  5GAN 7;  2O01 E;  2PUO B;  3GF5 A;  4EMK A;  3OYA A;  3TRE A;  4C0G A;  3SWN C;  3RES A;  4C5I A;  2DZ9 A;  3A8G B;  2E65 A;  3RKY A;  3V8J A;  4BI8 B;  3MET A;  3CPF A;  2X4X A;  4MDW A;  5HY6 A;  1Q81 C;  2JN0 A;  5FLX E;  1O75 A;  2RI3 A;  1G3S A;  4BY6 B;  2DIG A;  4J7F A;  3PIP A;  4BE0 A;  3FB9 A;  3TCJ A;  2L8D A;  1FXX A;  4FT2 A;  2ZPI B;  2FB7 A;  1M1K C;  2PVD B;  5GAM h;  5A2Q E;  5A0D A;  1LNX A;  4M77 D;  3OSS C;  3PTA A;  4Y28 E;  3VKI A;  2Y4X A;  1X01 A;  4ZGE B;  3JB9 H;  4ATO A;  3E1S A;  3JCM b;  2B8A A;  2VGN A;  1P92 A;  2BIV A;  4FT4 A;  4DA4 A;  3DKM A;  1YCY A;  5LJ5 f;  5FRM A;  2QQB A;  3OA6 A;  4QW2 A;  4MML A;  4XQ3 A;  4A54 A;  4N4G A;  5GMK m;  2XHC A;  5GAM e;  1M90 C;  2EQJ A;  4ZGD B;  2XDD A;  1UGQ B;  1VIE A;  3X20 B;  2LDM A;  2VC8 A;  2DXT A;  3QZ5 B;  4F7U B;  2VXF A;  3CCE T;  2DKG A;  4BDY A;  1R8O B;  3CC2 T;  3KUF A;  4M78 G;  5GAM j;  4C92 F;  1M90 U;  1BYM A;  3VYG A;  3L2V A;  4A4G A;  5GAN 4;  2L89 A;  1BI3 A;  4MZM A;  3BFM A;  3FEO A;  4JDS A;  3RKW A;  4E7K A;  1KC8 C;  3M9Q A;  3A8L B;  2K2V A;  2WSF E;  3OS0 A;  5CCA A;  4LDU A;  4PLL A;  4PJO G;  2QTX A;  3VU3 C;  5DM7 R;  1VQO A;  2RJE A;  1WGS A;  3LLR A;  3M57 A;  4F7U E;  5A0G A;  2LC4 A;  2LX9 A;  3L1A A;  2VV5 A;  4LDY A;  2QQS A;  4M77 C;  3R6O A;  4E7I A;  3UPU A;  1YJN T;  2OTJ A;  3UDC A;  2LNV A;  3HP9 A;  3CME A;  4IUT A;  4HT8 A;  1QW1 A;  2E5Q A;  3QZ9 B;  4X9D A;  5LJ5 h;  2XIC A;  2EJG A;  3GNF B;  4JRP A;  4XU3 A;  4OMF B;  5GAO n;  3CME T;  1Q7Y C;  2XG8 D;  5C0M A;  3L2U A;  1IZ6 A;  1VQP T;  4M7A A;  3PFS A;  3QBY A;  4C8Q E;  1N8R U;  2EJ9 A;  3G7Z A;  2EIF A;  4N4I A;  4OVA A;  5D6W A;  1KHC A;  4OGE A;  4PNO A;  4BI4 A;  4C92 E;  1U8R A;  3C94 A;  1S72 A;  3HPW A;  3L2W A;  3DB3 A;  1KQS A;  3M4Y A;  4M75 C;  2DTH A;  2ZPE B;  2XID A;  4EMG A;  4QQG A;  4BD3 A;  4BB7 A;  4CRI A;  2CZ6 B;  4C5H A;  1B34 B;  4VUB A;  4E47 A;  3HFN A;  5GMK e;  4O5V A;  2E6Z A;  2X4W A;  3OYC A;  1YJ9 T;  4M7D A;  2BUD A;  4IUQ A;  1WPY A;  5KCO A;  4J6W A;  3OYD A;  4OGC A;  4C0F A;  5C6S A;  2DD5 A;  3RMQ A;  4DOV A;  1YJN A;  3AHU A;  2XDP A;  3A8M B;  4E7H A;  5EG2 A;  3OW2 A;  2KSS A;  1PSE A;  3QPH A;  4M75 G;  3SWN B;  4C8Q B;  4EMK C;  5GMK l;  3HRS A;  4J6Y A;  2HNI A;  1RL2 A;  3M5A A;  4L5G A;  3QO3 A;  5GAO q;  3KXT A;  1KHI A;  2M16 A;  2DZC A;  4P5N A;  3S3N A;  3NFC A;  2EQM A;  4JS4 A;  1KD1 C;  4QQ6 A;  1BI2 A;  2EAY A;  3MCA B;  2GCX A;  3G4S T;  2O4X B;  3LH0 A;  3OS5 A;  4BI3 A;  3JB9 G;  3EFR A;  3G71 A;  3OBW A;  1D3B A;  2RB6 A;  1K8A U;  5I2M A;  4XTX A;  1I8F A;  3KBG A;  4EPC A;  1H3Z A;  2OTJ T;  3MP6 A;  3Q1J A;  3VYH B;  1QVG A;  2M1H A;  3S3O A;  3GPL A;  1VQN T;  1NJI C;  4PL6 A;  1KQS S;  3OYJ A;  4A4K A;  2JZ2 A;  2ZCF B;  4A4H A;  3OQ5 A;  4B9X A;  4C8Q G;  3CCV T;  1Q7Y U;  1M5Q 1;  1WQ7 A;  3BY7 A;  3OBY A;  4EMK B;  1G3T A;  4C0D B;  4XU0 A;  2GQV A;  3LGF A;  1YJ9 A;  1UGS B;  4II1 A;  4M75 F;  4M7A D;  4KUI A;  2WSE E;  4IUP A;  1OYX A;  2HQE A;  2ZPG B;  3ME9 A;  3DLM A;  4N4H A;  1S72 T;  4XTV A;  1BIB A;  3INZ A;  4FSX A;  5FU6 C;  5FRO A;  3ZBD A;  1YI2 T;  4E7L A;  2QI2 A;  5GAN h;  4A4F A;  2RHU A;  3NTK A;  4L6V 5;  3QUI A;  5LJ3 f;  3JB9 J;  1JJ2 S;  5KE3 A;  1XQH A;  1Q86 C;  3CCM A;  3SWN A;  4KUD K;  3H8Z A;  3CCS T;  1QP3 A;  1ZBX A;  1UB4 A;  2HD0 A;  3OMG A;  2DD4 A;  4FL6 A;  2DXU A;  5AYF A;  4OP0 A;  3UWN A;  3X24 B;  5GMK h;  2AHJ B;  1VQ7 T;  3CC7 T;  1X75 C;  4BY6 C;  2P0K A;  2Y90 A;  1QVG S;  1PSF A;  5CK9 A;  3X28 B;  4C92 B;  5CQX A;  3MO8 A;  3CCR T;  3CBM A;  3OYK A;  5GAO m;  3M54 A;  4M7A F;  2MWP A;  1KQ1 A;  5LJ5 j;  5GAN 6;  3JCM P;  5HK0 A;  2OAU A;  4M7D F;  2KAF A;  5KH6 A;  5GAM g;  2K5I A;  1G3W A;  1VQO T;  1KC8 U;  2YHT A;  4HKE A;  3M59 A;  1XTD A;  3JCM J;  1G3Y A;  2RHY A;  4PJO F;  1Q86 U;  1VQ5 T;  1M8V A;  1H64 1;  4CI0 C;  3QJY A;  2A3L A;  3OYF A;  1OZ2 A;  2DO3 A;  5GMK j;  1VQ6 T;  1YIJ A;  3GLX A;  3E9G A;  2MWO A;  2WSC E;  4JLG A;  4LD6 A;  3S3M A;  1N9R A;  1M4Z A;  4M78 B;  1D3B B;  1FWZ A;  3OW2 S;  4KUL A;  5CQY A;  2R5M A;  1JJ2 A;  2RHZ A;  3CC7 A;  4TVR A;  3CXC S;  3CC4 A;  3QJ6 A;  1M1F A;  4XTZ A;  2FYK A;  3JCM g;  4M78 A;  3JCM c;  1KD1 U;  3OMC A;  5I2S A;  4M7A E;  4GLK A;  3URG A;  2EKO A;  3QYG B;  2F5T X;  2KMT A;  4IKF A;  5HKC A;  3QYH B;  3SFM A;  3I55 A;  1OI1 A;  2OTL T;  4M77 F;  2CS7 A;  4QQD A;  3EFS A;  5J39 A;  2V8J A;  2D9T A;  2PVO B;  2KQW A;  3M4G A;  4O6J A;  5GAN f;  2MAM A;  1JBM A;  2X35 A;  3MP8 A;  3CCL T;  1Y96 B;  2GFU A;  1U1T A;  2D0Q B;  3CBO A;  2RK1 A;  3QSU A;  1YIT T;  1M1K U;  2RJC A;  3PGG A;  1Y71 A;  4LDV A;  3SDZ A;  1N8R C;  1VQ4 A;  3HHT B;  3UT1 A;  3GIB A;  1ZQ1 A;  3CCU T;  3G4S A;  2LQ8 A;  3OYG A;  4HCC A;  2QQA A;  2YRV A;  5LJ3 e;  3X25 B;  4LD9 K;  3G6E T;  2E41 A;  3VUZ A;  4BUG A;  4J5Y A;  1W4S A;  3PNW C;  3CXC A;  2XK0 A;  3H6Z A;  1NE8 A;  1NJI U;  4QVZ A;  3O8V A;  2LQK A;  3QDR B;  3JCM f;  3OYM A;  3MP1 A;  3QKJ A;  4RMO A;  2MI6 A;  2HAX A;  2E1H A;  2ZGW A;  4JUV A;  4BE2 A;  2P4T A;  3HKS A;  3WXM B;  3RKX A;  4XTW A;  4IUU A;  1NPP A;  2BKD N;  4HA8 A;  1VQ6 A;  1VQ9 A;  1M1G A;  5CAI A;  4XTU A;  3MEW A;  1VQ7 A;  1UGR B;  5FU7 C;  1VQL A;  2V8I A;  4M78 D;  5GMK i;  3CEY A;  2DJZ A;  4F7U F;  2R5A A;  3CMA A;  4XK8 E;  2L3R A;  1VUB A;  2K5L A;  2KY9 A;  3HSB A;  1GXI E;  2HBP A;  1ZHI A;  5GAN 5;  2KK4 A;  3JRZ A;  4EMH A;  2QEX A;  5GAM d;  2EQU A;  5LJ3 j;  3DLL A;  2VYT A;  2ZPH B;  3E19 A;  1YHQ T;  3CCQ A;  3OYY A;  2RJF A;  1Q82 U;  1VQK T;  4C92 D;  3WVD B;  1I81 A;  3M55 A;  3L2R A;  2PU9 B;  3CCJ T;  1YHQ A;  4EDU A;  1LJO A;  1UGP B;  1G5V A;  3RER A;  1YJW A;  1VQ8 A;  3QII A;  1WJQ A;  4NL3 A;  2KDS A;  5CIU A;  1V29 B;  3CD6 A;  3JCM d;  1VQ4 T;  4PJO C;  4MMK A;  1NZ9 A;  3V7C A;  5CKF A;  2E12 A;  3WVE B;  5KCH A;  2RHX A;  2JUF A;  3FC3 A;  3QXE B;  4M7D B;  3JCM W;  1VQL T;  4XU2 A;  5CKD A;  1YJW T;  1VQ8 T;  4A53 A;  2QDY B;  2K4Y A;  4ZN3 A;  2DAQ A;  3FIF A;  1N27 A;  2CZ0 B;  1HK9 A;  3JAM E;  2K3X A;  3I56 T;  2VUB A;  4X34 A;  2M9U A;  3JB9 F;  2QQR A;  3C95 A;  1YIT A;  1UEB A;  5CR2 A;  1WJS A;  5GAM f;  4JS5 A;  2DXB A;  3P8D A;  3JCM V;  1K73 U;  4HCZ A;  3GNG A;  1WJR A;  5GAN 8;  4N0A A;  4JJN K;  1K9M U;  2XDB A;  3CCU A;  4ZTJ A;  1MGQ A;  2CZ1 B;  1WNL A;  4M77 E;  2R57 A;  3NTH A;  3X26 B;  3I55 T;  2A7Y A;  4M77 G;  3GP8 A;  4BE1 A;  1NPR A;  2LTO A;  4OB1 B;  4C92 G;  1N6A A;  4GY5 A;  4B9W A;  4C5E A;  2M0O A;  2X4J A;  4NS5 A;  1Q81 U;  2XI9 A;  2WAC A;  3L2Z A;  2XU8 A;  2E64 A;  5J26 A;  3SB2 A;  4OB3 B;  3HRT A;  3FRN A;  3OSV A;  4NL2 A;  3EAE A;  4M7D C;  3V8K A;  2DPP B;  1OZ3 A;  5D6X A;  2EFI A;  4C8Q C;  5GAN e;  2RM4 A;  4Q5W A;  3JB9 D;  3VV0 A;  4RCB A;  5GAO p;  3CCQ T;  3MEA A;  1RI0 A;  3FJP A;  3A8H B;  4M78 C;  3QG1 A;  4PJO A;  3BDL A;  2YLC A;  3P8H A;  2GF7 A;  1XOV A;  4F7U A;  4PJO E;  1SSF A;  4V2S A;  2EYQ A;  3A5Z B;  2F69 A;  2ZZD A;  3C12 A;  2LCC A;  2QXF A;  4ME7 A;  3N5B B;  2IVW A;  3CMA T;  5A0L A;  2FVU A;  2JTM A;  5GAN 3;  3A8O B;  3GOX A;  3J7A F;  3P8B B;  3PT9 A;  3T9N A;  5GAN j;  1QP2 A;  3BDU A;  2RH2 A;  1AHJ B;  2RO0 A;  3OYN A;  5CKE A;  3HFO A;  4M7A G;  2E10 A;  4XAX B;  3FLG A;  2DXC A;  3C4S A;  4FM4 B;  2XKO C;  2LT4 A;  5CO7 A;  3ZEH A;  3ZFJ A;  4M75 D;  1VQM T;  5CKB A;  1O9S A;  1VQK A;  2GFA A;  2DTI A;  5LJ3 h;  4ZGJ B;  4C8Q F;  2R58 A;  4E7J A;  1JRI A;  4OB0 B;  2OTL A;  3OS1 A;  1VQM A;  2DEQ A;  2K5F A;  3RUX A;  2FHD A;  3LYI A;  5GAO r;  4BDZ A;  5GAN 2;  4HT9 A;  3LWH A;  5HK3 A;  2LVM A;  1Y7X A;  1KQ2 A;  4RKU E;  4M7A B;  5CKH A;  4J83 A;  3LWI A;  3CC4 T;  3V8L A;  1YI2 A;  2PQW A;  2DTO A;  1WQW A;  2DVE A;  1HXD A;  3SD4 A;  2VGM A;  5FU6 B;  1I4K 1;  1W2B S;  2K3Y A;  4JLI A;  2JNG A;  2FL7 A;  4JRK A;  2K57 A;  2LRQ A;  2YLB A;  4JRQ A;  2RA2 A;  1FX7 A;  4M78 E;  1TH7 A;  4XU1 A;  5CVI A;  3JB9 I;  2Y4Y A;  3JCM Q;  4C8Q D;  3MEU A;  1JB0 E;  3MHX A;  3OYE A;  4M7D D;  4RG8 A;  1QVP A;  3V7S A;  3J80 E;  4JRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...