4C92B

Crystal structure of the yeast lsm1-7 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
SENLYFQGSGSLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92B00
2E64A 4C92A 1H641 4RCCA 1MGQA 5GMKe 3BFMA 1D3BA 3QSUA 4N0AA 4C92D 4HT9A 4NOYA 3QHSA 1LOJA 3V8JA 4F7UB 4PJOA 4M77E 3V8KA 4M78E 4XTYA 5LJ5h 4MMKA 4M7DB 5GANg 4PJOD 5LJ3e 2EAYA 2E41A 4M75D 4EMGA 4M75E 3EFSA 1B34A 1M5Q1 4PJOF 4XU2A 4C8QF 1U1SA 4X9CA 2YHTA 2EWNA 5GAMj 4M7AA 1JRIA 4C92B 2DZCA 5GAMg 5GANd 1X01A 2YLBA 3M4GA 4MMLA 1D3BB 4M7AD 2QTXA 1BIAA 2JN0A 4XTUA 4XTVA 2K57A 3JB9G 2DXTA 1I81A 4OP0A 4PJOB 1WNLA 3VU3C 2EJ9A 1LJOA 4M75B 3FIFA 4XQ3A 5GAMd 5GAOp 2CGHA 5LJ5e 3JCMg 3FJPA 3JB9J 5GAOn 4V2SA 4J6YA 4C92E 4EMKC 3JCMV 5GAMf 3GIBA 1B34B 2DTOA 4J6WA 4Y91A 4M78C 2DZ9A 1KQ2A 1I4K1 4C8QA 3JCMQ 5GANj 4M7AB 2FB7A 3V8LA 1BIBA 5CAIA 3JCMd 4C8QD 3SWNC 5GAN5 5GAOm 4PJOE 3BY7A 3RKWA 4HT8A 5GAOr 4M77G 3JB9F 4M78G 1I8FA 3JCMf 1YCYA 2VC8A 5I21A 5GMKj 1TH7A 3JCMc 2E1HA 2Y90A 2E65A 4WF2A 3JCMb 5GAN8 4M7DC 2DTIA 4M7AE 3JCMJ 5GANf 1LNXA 3BW1A 3JCMP 4JRKA 4F7UG 3RERA 5LJ3j 4C8QB 4QVCA 5LJ3g 2FYKA 3QUIA 3RIRA 3HSBA 4M7DG 3AHUA 3SWNA 4DQ2A 4C92C 1I5LA 4J5YA 4XU1A 5GAOl 4M77C 3HFOA 4M78F 5GAMh 3JB9H 2DXUA 1WQ7A 3JB9I 4F7UA 4JUVA 5LJ3d 2EJFA 4A54A 4RCBA 3RKYA 3JB9D 1HXDA 4C92G 4M75C 4C8QE 5LJ3f 4NL2A 4M7DA 2DTHA 2HNIA 1WQWA 4EMHA 3L1AA 3PGGA 3JCMW 2DKGA 4F7UF 3JCMh 5LJ5j 2RA2A 5GMKi 1N9RA 3BDUA 2RM4A 4XU3A 4PJOG 1WPYA 3INZA 4JRIA 3V7SA 3V7RA 3FB9A 5LJ5g 3SB2A 5GAOq 4M75G 1JBMA 5GAN6 4M7DF 4M7AC 3SWNB 4PNOA 5GAN2 1Y96A 5GAN7 4EMKA 4M77A 5GANh 1KQ1A 2ZGWA 4M78A 5DY9A 2VXFA 2RD1A 5GAMe 5GMKl 5LJ5d 4XTXA 4M77D 4M78D 3RUXA 4M7AG 4C92F 4M75A 5LJ5f 5GMKm 2VXEA 4M77F 5GMKh 1M8VA 2DJZA 4N0AC 3HFNA 3QO3A 3JCMe 4XU0A 4QVDA 3V7CA 3L2ZA 4PJOC 2I2LA 4NL3A 3RKXA 4M75F 4XTWA 4A53A 4C8QC 1U1TA 4F7UE 4J6XA 2E10A 4JLIA 4X9DA 4XTZA 1Y96B 5LJ3h 2DEQA 4EMKB 5GAN3 3EFRA 2EJGA 4M77B 5GANe 3JCMX 2RB6A 4M78B 5GAN4 4M7DD 4M7DE 1HK9A 2YLCA 1N9SA 4C8QG 2DVEA 4M7AF 3RESA 4HA8A
chains in the Genus database with same CATH superfamily
2H3JA 4C92A 2X9HA 3TEEA 2L2PA 1D3BA 3MP1A 2K2MA 2HKQB 2F69A 4DBRA 5A2QE 2KQWA 1N6AA 1IGUA 1WFWA 2K5FA 1KFZA 4PJMA 4JPBW 2KYBA 1KHCA 2COWA 4XTYA 1ZQ1A 3BDLA 1IB8A 3CCLQ 2DERA 1U1SA 5FROA 8ATCB 1NJIU 4M7AA 2C0TA 1X2KA 1QMCA 3FDRA 1PWTA 4BI4A 3HPWA 3ER0A 1VQPA 2QDYB 2XU8A 3UATA 4XQ3A 4FM4B 4IUTA 2CSIA 1VQ5T 4ME7A 1B34B 3CC2Q 1VQPQ 3GBQA 2K79A 3I55A 3JCMd 4QVZA 2YWWA 3E2UA 1YCYA 3DB4A 1Z9QA 5FRMA 2EQKA 2JS0A 3LYIA 2AHJB 2P4TA 2L5QA 1YJNA 4F7UG 4N4HA 1C1AA 1GL5A 3QZ5B 2FYKA 3VYGA 4CC4B 1BI2A 5KYUB 2A36A 3OS5A 4XAXB 3AT1B 3URGA 3ZL7C 4GY5A 2DD5A 2PVGB 1WX6A 5FU6C 4J7FA 1IRXA 4C0DB 3CCST 2DYIA 4EDUA 2HEQA 2KROA 1C6VX 1Y57A 5GAN2 5IT9E 1YWOA 3CEYA 2EGEA 3JSCA 4M77D 4B9XA 2LT1A 5CR2A 1QKXA 1K8AC 2CP7A 9ATCB 2DJZA 1Y0MA 3JCMe 1D0XA 2AKKA 1OZ3A 1YP5A 1QVGA 4Z02A 2RK1A 2ZPHB 2EJGA 5GANe 2DNUA 2PUOB 2QI2A 1E6HA 1AHJB 4J9DA 4C8QG 3RESA 2RPNA 3G7ZA 1MV3A 1NG2A 4KGXB 2VGNA 5J3BA 3G6EA 2DMOA 2D6FA 1D1AA 4JS5A 4J9EA 2R5AA 2RHXA 4M75D 3TQ7P 4MZPA 4BDYA 4PFZA 1JRIA 1DJ7B 1PNJA 5I2SA 3OYAA 3M4GA 3JB9G 4FSXA 4Z88A 2XK0A 2A0FB 1ABOA 1V76A 2J6OA 4ORZA 3JCMg 4V2SA 4R0KA 4F14A 1ZBJA 4J6YA 5IHIA 3QDRB 1VYUA 1NJIR 1NBEB 1ZSZB 4LUEA 8AT1B 1BB9A 5I21A 3I56A 1FXXA 2FG0A 1TTHB 2E1HA 2KBTA 1RLPC 2R58A 1VQNT 1V1CA 1LPLA 1UGSB 2DTIA 5FWBA 7AT1B 2PTKA 2AT1B 3A98A 1OULA 1WYXA 1WXTA 1D09B 3H0IA 4PJNA 5D6XA 4QKUA 3HFOA 5GAMh 4ELYC 2FHDA 2FVUA 4LE9A 5LJ3f 2OTJT 4EMHA 2EFIA 5GJVB 3KFVA 3NGPA 2RM4A 1BCMA 2ECZA 2FPEA 2RK2A 4LN2A 2KT1A 1K0SA 1QP2A 1M2OA 1WI7A 3M54A 4RTVA 3RUXA 1TUCA 3CCMQ 1BYMA 2DL5A 3M57A 1TXQA 1PC0A 2E5KA 4XK8E 4NL3A 5J39A 2DO3A 2DXCA 2OTLA 5I11A 2P0KA 4RTZA 3CCVA 1R0CB 4M7DE 1VOMA 6AT1B 2JUFA 1H641 4BE0A 1MGQA 4O5VA 3R6NA 4C92D 2CZ1B 2CZ0B 3QBYA 4C0DC 1NLPC 3UPUA 1VQ6Q 2K2VA 2K6DA 1ACMB 4JZ3A 4IURA 4OGEA 3LH5A 1BI0A 1ZA2B 4HCCA 3HKSA 4OMLA 4M7AD 2K57A 2BIVA 2BZYA 4FIBA 1UB4A 5GAOp 2VKNA 1UECA 1SHFA 2QQRA 2R57A 3NMZC 3D7SB 3I55T 4CRIA 3JCMV 2O4XA 4J6WA 2H8HA 1KQ2A 1EZZB 1JEGA 1BIBA 2G6FX 1K4US 2LZ6B 2LQWA 2X4WA 2PVOB 2BE9B 1YJNT 5EG2A 4PFPA 1S72Q 4B9WA 1SSFA 1VIEA 4C0GA 2VV5A 1X27A 4M77C 4M78F 3G4SQ 4A4EA 3CMEQ 5IXBA 3CC7A 1E7OA 2JTEA 5FRNA 2K9GA 4QW2A 4M7DA 3A8OB 3I35A 3JCMW 3VS1A 2NUPA 3QIIA 4M7DF 2K3YA 1IHVA 4FW1A 2DF6A 1YWPA 2IPOB 5GAN7 1O75A 2DXBA 5KCOA 2DIGA 3C12A 2LJ0A 1WJRA 5GMKm 2Y4XA 2JNGA 1M90U 2RJFA 3P8DA 2E10A 4XTZA 4BE2A 2AK5A 3EG1A 1VQMA 3WVEB 2FRYA 2RI3A 4RCCA 1N27A 3G6ET 1FX7A 5A0DA 3BFMA 3QYGB 2DL4A 2DA9A 3V8JA 1MMNA 1QCFA 1KIKA 1B3QA 1GCPA 4BUGA 2M02A 2LX7A 2BZ8A 3QJ6A 3R6OA 1B34A 2GGRA 1Q95G 4II1A 4EIKA 1R77A 2A3LA 1WXBA 3L2WA 2LQNA 1RAFB 2MCNA 3QG1A 2Y4YA 2ZPEB 2ZAEA 4E7LA 1QCOA 4JLGA 3V8LA 3I56T 4IUUA 1GBQA 4M77G 4HVUA 5KYUA 5FLXE 1Q86C 2X4XA 1M3AA 2CUBA 1NLOC 2K5LA 3JCMb 1SPKA 2D0NA 1YBYA 2DRMA 2YUNA 3OS2A 4RUGA 2GTJA 1B07A 2K7AA 3M0SA 2HL5C 4PL6A 1X6OA 5LJ5j 1NJIC 5KYNA 3RMSA 4E6RA 4M75G 3X24B 4DOWA 1S1NA 2DEUA 1VQ9Q 1KQ1A 2VGMA 4M4ZA 2RHYA 2LCSA 1AOJA 3EHRA 1RAIB 1NEBA 3VV0A 2XG8D 2OTLT 1YJWA 1JB0E 3MEVA 2YRDA 3CCVT 5GJWB 4XTWA 1QVGP 3CD6A 2GFUA 4J6XA 3QPHA 2DEQA 3JCMX 1EIFA 2RB6A 3HP9A 2LCLA 1N9SA 1ZSGA 1UJ0A 3CC4A 3L42A 4HVWA 1OPLA 3OYLA 1YIJT 3QHSA 1LOJA 2A28A 2QK0A 1M90R 3I9QA 3UF4A 3MHXA 2P0PA 2EAYA 4YTLA 2FZKB 2HD0A 2DETA 5AYFA 4B6MA 2EWNA 2MPXC 1GCQA 2MWOA 2HCKA 1ZSZA 2X3WD 4RG2A 4DBQA 2IIMA 2A7YA 3MCAB 1QWEA 2NYSA 1AT1B 2KXCA 4ZTJA 2DJQA 3OW2S 5KYXB 3CCJA 3LLRA 2LCCA 3M0RA 4E7KA 2KR3A 3M0TA 3J7AF 1VQ7A 2HZYA 1YHQT 1AWJA 1OEBA 2FO0A 1M1FA 1MUZA 2CP3A 4PFOA 3JCMJ 1KQSS 1VIFA 5A0LA 2RI5A 3RIRA 4OMOA 4DQ2A 3CC7T 2FPDA 4XU1A 2H3EB 3CCRQ 2J7IA 1HXDA 4ZGDB 3M53A 4C92G 1XQHA 2DTHA 2HBPA 2K4YA 3META 2J05A 4KT0E 1KC8U 1Q81U 3F70A 2BKDN 4D8KA 1M30A 2CH4W 4M7AG 2YXYA 3H9NA 5CKHA 3H8ZA 2ROTA 4IIMA 5GMKh 3OSSC 4E7IA 3OW2A 2LVMA 2I2LA 1VQMT 1I07A 4J9IA 5LJ3h 4ZN3A 2M16A 5GAN3 3M59A 4M78B 3M56A 1UFFA 2LT4A 4MMKA 2W0ZA 1FMVA 1AZEA 1KK7A 2E64A 1ZHIA 1QP3A 1HD3A 2D8HA 3QXEB 1KQSA 2M0YA 2XD0A 3EG2A 3CCQA 1UDLA 2X4JA 4M7DB 1FMWA 2JT4A 2JZ2A 3CPWA 5LL6S 2PU9B 3KUFA 3H0HA 3WXMB 2CZ6B 2RJCA 2M0OA 1Y7XA 3CBMA 3NHNA 2X3XD 4IUQA 2M1HA 1RUWA 3CCLA 2DBKA 2EGAA 1BCOA 4CC2A 2E3IA 3SD4A 3BY7A 1Q82U 2IVWA 5HKCA 2JS2A 2EW3A 3JCMf 1RADB 4N4GA 5M9OA 3UA7A 2F2XA 2E65A 2V1QA 4WF2A 4L59A 4O6JA 5GANf 3CC2A 1NEGA 4FSSA 2OI3A 3J80E 1I5LA 1MV0B 1K9MR 1LCKA 3CCUA 1KD1C 3X26B 1WJQA 2DD4A 4DEYA 1QVGS 2F5TX 3CCUQ 1SRMA 3PGGA 2RA2A 1WPYA 4OB0B 4AT1B 3SWNB 1T0HA 1A0NB 3OYYA 1SF9A 3PVLA 4ZGJB 2MYSA 1YJWT 1W1FA 3CD6T 2JM8A 3NTHA 4PLIA 4RTWA 3OS1A 1U1TA 3OY9A 4F7UE 2O9VA 3E19A 1O9SA 4JLIA 1OU8A 1KC8R 3FLGA 1Q81R 2M9UA 3CC4T 1SRLA 2IG0A 2EBPA 2CSQA 4J7IA 4HXJA 4L6V5 4PK4A 1VQ8Q 2RHIA 5HCKA 2JM9A 1RI0A 2CT3A 1H3HA 1ZUUA 3JRZA 3VRZA 5IH2A 4DEXA 3TREA 1IXDA 5GAMj 1M3CA 4C5GA 2DZCA 1FWZA 4MMLA 1E6GA 1BIAA 4OP0A 3ZEHA 2YUPA 3CCJT 3NTIA 3FJPA 3PMTA 2KRNA 2XDDA 3JV3A 2FZCB 4M78C 2C06A 1VQ7T 1FYNA 1T3LA 1OOTA 2DPPB 1TU0B 4EPCA 5IAYA 2E3HA 2E70A 4GLMA 4OVAA 2HBWA 1VQOA 1WLPB 4M7DC 1VQOQ 4FW2A 4RTUA 2KRMA 3DLMA 2LDMA 1Y07A 3AHUA 3PFSA 4F17A 5GAOl 1Q82R 3JB9H 4F7UA 4C5EA 4OMMA 4A54A 1NYGA 5L23A 2ROLA 1K73U 2CH4A 1WQWA 4F7UF 5CQYA 3HL8A 1U8RA 2XIDA 2Z0WA 3C95A 2ED1A 4BD3A 2X4YA 1YJ9Q 5ECAA 5GMKl 4NS5A 5LJ5d 5HK0A 3M0UA 4FT2A 4J9CA 5KYWB 3EGUA 1IO6A 3V7CA 2HQHA 2EYWA 1AEYA 2ZPIB 3LGFA 2CP2A 2RF0A 2YSQA 4AFQC 3LWIA 1G8XA 2RNAA 3VUZA 3CCMA 3HRSA 3CCQT 1MMDA 4NOYA 4AG2C 3VS7A 2DL7A 4AFUC 4M78E 4AG1C 2L3RA 1TOVA 2O88A 3CMAQ 2V26A 2VASA 2K3BA 2QDLA 3MEAA 4ZGEB 5KYXA 4C8QF 4D6WA 2P0QA 4K11A 1VQKA 1YITQ 1SG5A 1MHNA 1SHGA 1RLQC 2COZA 2QGGA 3G71Q 1MNDA 1YI2Q 2NUTB 2LRQA 2RQUA 1VQKQ 3CCLT 1PD1A 2HMAA 5LJ5e 1TUGB 1YFNA 3JB9J 1VQ6A 2K5IA 2F5KA 2WSFE 3GIBA 2VUBA 4CC3A 1SKUB 2QAZA 2FB7A 3RBBB 3A8HB 1RABB 3CCEQ 1U06A 1WHLA 3LWHA 1YCSB 3JB9F 2ZZDA 1RACB 3PT9A 3JCMc 3CC2T 2EKHA 1VQPT 3NPFA 1XNIA 2EQJA 3RERA 3VS6A 5CVIA 3JCMP 1I5OB 2CKKA 1AWXA 4QVCA 1PCXA 3UT1A 5CKDA 2YT6A 3ASKA 2L3PA 1GXIE 3IQLA 3TSWA 2XDPA 1OV3A 3TSZA 1PG5B 4NL2A 1S72A 3L1AA 3BDUA 4Y28E 5LJ5g 2CDTA 4BI3A 2RI2A 1J3TA 2E6ZA 3QZ9B 4A4KA 3G4SA 3CMEA 4M78A 3S3NA 2JTMA 3OYKA 2C0IA 2RJDA 1KHIA 2VB6A 3SHWA 4WTOB 3OW2P 2QG9B 2J6FA 4IKFA 2NLUA 1BI1A 5FWCA 3RKXA 1K9MC 3M58A 4JJDA 5KCHA 2HQEA 4TVRA 3I5RA 2XHCA 4ESRA 3VS0A 4HA8A 2J6KA 1VQLA 1GCQC 2L0AA 1KQSP 1ZSZC 1IZ6A 3EHQA 2ZPGB 1LVKA 1K8AU 1OI1A 4IUPA 3SFMA 2QEXQ 1VQLQ 1G3WA 2D1XA 2V1RA 3PTAA 4EMGA 3EFSA 3CPWP 3CXCA 4ZTFA 4OB1B 2JJ9A 1HYOA 4UC4A 2M51A 2KGTA 1EX4A 3PMIA 1JU5C 3ZBDA 2PQWA 4PJOB 1WNLA 4IIOA 2DX1A 2FZGB 1TS9A 2QASA 2E5QA 1AD5A 2FL7A 4Y91A 4JJBA 3HTRA 2OX7A 3VRYA 3OYDA 4FU6A 3S3MA 1BU1A 4HT8A 3RNJA 1D1CA 5IHNA 4X1VA 2HDAA 2EQIA 1Q7YU 2EQUA 3G1JA 3RMQA 2EGCA 1I1JA 1PM3A 5GAN8 2RH2A 4JJNK 1LNXA 1RAEB 4MDWA 2QA4Q 1GFDA 2KYMA 4QQ6A 3SWNA 1VQ4Q 2YUQA 3LH0A 2QYZA 3S3OA 2EJFA 4DOVA 3RKYA 4RKUE 3DLLA 4KUDK 4GBQA 2GCXA 3JCMh 1N9RA 3M5AA 2KY9A 4JRIA 3FB9A 3BE3A 2JMAA 2EVRA 2GF7A 3KBGA 4LNPA 2CP6A 5GANh 1M2VA 2DFUA 4KH1B 4IUVA 1QVFS 1OYXA 4Y92A 4FL6A 4QVDA 2LNVA 3EH2A 4MZTA 1Q82C 1W2BS 1GBRA 1VQ9A 2P84A 2A08A 3CCMT 3L2VA 1SSHA 3PNWC 2L3QA 5L8RE 4F7UB 4ZNXA 3QWYA 2KEAA 4HCBA 4M75E 1M27C 2KI7A 2RHZA 3EFOB 1VQ5Q 2R5MA 1UGRB 4BY6B 3CBOA 1VQ6T 2BZXA 4RG8A 2YRCA 1CKBA 3MPUB 3P8BB 5GAMd 1WXUA 1OX8A 1PSFA 3H41A 3A1PA 4GLKA 2ABLA 2L3SA 2QXFA 2RQWA 2CZ7B 2NUZA 4FYVB 1QVFA 5GAOr 3OA6A 2X51A 4A63B 5GMKj 3THKA 1WHKA 1W2BA 2VWFA 4CC7A 3CCSA 2HL3A 2PZ1A 5LJ3j 1IREB 4C8QB 1PD0A 1U3OA 1RL2A 3EH1A 3PVQA 3CCSQ 1WQ7A 5CCAA 3JB9I 1Q7YR 2BUDA 1S72T 3I5SA 1VA7A 4LDWA 5KYWA 1W70A 5CK9A 2CP0A 2JXBA 2CT4A 5GMKi 2SEMA 2DIQA 3CMET 3G4ST 3MP8A 1XOVA 4OMFB 1JXMA 5HK3A 2JMCA 5GAMe 5I2MA 5DY9A 3CCRA 1QKWA 2K3XA 4M78D 4LD9K 4M75A 1QLYA 2EYQA 2LP5A 2VXEA 1PSEA 4PJJA 1X6GA 1BI3A 3HFNA 3QWXX 3CPWS 3QJYA 5C0MA 4M75F 4A53A 1X2QA 4OMNA 1Y96B 5KYYB 3QKJA 1ZBXA 4EMKB 2B86A 2MOXA 5IHKA 5GAN4 4M7DD 4RTYA 1HSQA 4FCYA 4BACA 2EKOA 2G3RA 4OMQA 5FU6B 2E4HA 1G3YA 2NUTA 5FU7B 3V8KA 2GQIA 2KVQG 4CI0C 2I0NA 2LQKA 2A37A 4RTXA 4LXCA 3MEUA 4OMPA 1H3ZA 1CKAA 2CYZB 4ATOA 5GAMg 1X01A 1HJDA 1NM7A 1N8RU 2EJ9A 3MEWA 3FIFA 3OBWA 2D8JA 3FJ5A 1K76A 3VYHB 2LQ8A 2OAWA 1SEMA 1KSWA 3OYNA 1I4K1 1VQNQ 1JJ2S 3U23A 4PJOE 1RAHB 4J9GA 2AZSA 2SRCA 3PE0A 1UHCA 2OTJA 2LC4A 3L2QA 4LD6A 4BDZA 1G3SA 1AVZC 3REBB 1KG1A 3GNGA 4C5IA 2OTJQ 2RHUA 5C6SA 4VUBA 5D7UA 2HAXA 2KXDA 1AZGB 4HVVA 2CS7A 4JUVA 1BBZA 1OU9A 4DBFA 1Q86U 2YUOA 2XKOC 2YDLA 1WHMA 5J26A 5DM7R 2HNIA 5AT1B 2C0OA 2RN8A 1PRMC 1G2BA 2COYA 4KGZB 5GAN6 3M55A 4LDYA 5EC7A 4XTXA 3EG3A 3QDFA 1NZ9A 3H0FA 4JS4A 4C92F 3EGXB 4HCKA 2GNCA 1JJ2A 4C8QC 1VQ9T 3EGDB 2DM1A 1WGSA 1QQJA 2DK3A 4ELZC 4M7AF 4KULA 1UGQB 1WHJA 5I22A 3QSUA 4N0AA 4PJOA 3OYHA 1FMKA 3X28B 3N5BB 3CXCP 4PJOF 5A0GA 5CKBA 4XU2A 3L2RA 2KE9A 4OGCA 3I55Q 2PNIA 5GANd 1VQ8A 5KH6A 2OJ2A 1P92A 4KGVB 1I81A 1M2VB 1K0XA 5D6YA 1B7TA 5GAOn 2KSSA 3PIPA 3GLXA 3HHTB 4EMKC 1YJNQ 3OB9A 1ZUKA 2DZ9A 3L2UA 1MNEA 3OYBA 1NYFA 3OMCA 3O8VA 3UDCA 3FEOA 2F1LA 2LJ1A 1YNZA 5FU7C 1N8RR 3BW1A 4FT4A 2EYXA 3CPFA 1ABQA 4J8OA 4L5GA 1M1KU 2DLPA 2HSEB 1G5VA 2GFAA 1JXOA 1W4SA 1WHHA 4E7JA 4A4FA 1UEBA 4C8QE 4JRQA 1M90C 2DE0X 2RMOA 2KT8A 4BB7A 2L89A 3ME9A 1H8KA 5HY6A 1U5SA 3VS4A 3LGLA 3CCRT 4LUDA 2EYZA 1PHTA 1VYVA 5KE3A 2F2VA 2NWMA 4J9BA 2O01E 4AMCA 5LJ5f 1X43A 1Q86R 1UJYA 3NTKA 2JVVA 1D0ZA 3L2ZA 3G6EQ 2CUDA 1AWWA 2P4RA 1Q7YC 1YJ9A 1ARKA 1ZLMA 4M77B 4KH0B 1MMAA 3EFOA 4MDXA 3OMGA 2LTOA 3A8LB 4AFZC 1X69A 4HT9A 1PKTA 2F2WA 1M8MA 2DRKA 5GANg 2AIRB 2E41A 2KMTA 3TU4K 4X9CA 4HCZA 2L8DA 3J81E 2QQSA 2YLBA 2QTXA 4JDSA 4XTUA 4OF1A 2ZPFB 2V8JA 3I56Q 4OB2B 2B8AA 4M75B 2CP5A 1K9AA 3C0CA 2YRVA 3CMAA 1X6BA 1MMGA 2DTOA 3DKMA 4C8QA 1QVFP 1YITA 3SWNC 3VUBA 1CSKA 3RKWA 3FRNA 1YN8A 3G71A 4M78G 5FW9A 1OZ2A 3VKIA 1YI2A 3EG9B 2LX9A 1W2BP 2LNHB 1M3BA 4N4IA 1NE8A 4D8DA 4R56A 2VVKA 4AFSC 4P5NA 3C94A 4DA4A 1F1BB 1GRIA 4M7DG 2CREA 3CCEA 2FPFA 4LDUA 1WA7A 2ZPBB 2RJEA 5LJ3d 2LMJA 3SDZA 3PIOA 4A4HA 3WVDB 2DVJA 4R55A 3KXTA 2VYTA 1UUEA 1XTDA 2MK5A 2BTTA 3CBPA 3INZA 5IN1A 2OTLQ 1R0BG 1M1KR 1Y96A 5KYYA 4EMKA 4KRTA 3CCVQ 1QVPA 1TSFA 2RD1A 4F04B 2GBQA 3CCUT 1KD1U 1YIJA 5CKEA 3X20B 3CXCS 1Y71A 5DLQE 1WJSA 4BI8B 2EIFA 3A8GB 1YIJQ 1QWFA 3EFRA 2XICA 2YLCA 2DVEA 3O5ZA 3RR6A 2D9TA 1WIEA 3VJPA 4FYXB 5GMKe 4C5HA 3OYIA 1Z9ZA 4MZMA 4PJOD 5LJ3e 2WSCE 1K73R 1UE9A 3GNFB 3OQ5A 1VQ8T 1QW1A 4C92B 1YHQA 1JQQA 1D3BB 2DXTA 1WZOA 3OYEA 2W10A 2QEXA 1LJOA 2KNBB 4E2FB 1YHQQ 4ZN1A 1AWOA 1OX9A 2DILA 3S6WA 5GANj 4QQDA 4M7AB 5GAOm 1TH7A 3CC7Q 2DL3A 1H92A 2GQVA 2E6NA 4J9FA 1OQKA 1EFNA 3T9NA 4JRKA 1KC8C 3OYGA 2O31A 1Q81C 5LJ3g 3E9GA 4J5YA 2EPDA 2DXUA 1IGQA 2HKNA 3MJXA 5KE2A 4C0FA 2RO0A 1ZX6A 3EGXA 1VQOT 4M75C 3OYFA 3M9QA 3GPLA 2JTFA 2EYYA 2QA4A 3H6ZA 2V8KA 3M0QA 3V7SA 3V7RA 5GAOq 1KJWA 3EGDA 2EQMA 3E9FA 1VQ4A 1VQMQ 2KK4A 3A5ZB 2QQBA 2VXFA 1N8RC 4JZ4A 2D0QB 2DAQA 2LJ3A 2X35A 2MAMA 2ZCFB 1M1GA 1JJ2P 1YJ9T 4F16A 1M9SA 1N5ZA 4X9DA 2RQRA 5CQXA 4E7ZA 2DYBA 2QGFB 3OYMA 4JRPA 3TCJA 1RAGB 1KD1R 2DL8A 3X25B 3VS2A 4QT7A 1BK2A 2RQVA 4KBMB 4M77E 3UA6A 3M0PA 2HQXA 4FYYB 2WSEE 1RAAB 1OPKA 1WDXA 2O2OA 1GFCA 3MP6A 1M5Q1 1TWBA 3C4SA 4RTTA 2YHTA 3OYCA 2HSPA 3HRTA 1D0YA 3CMAT 1TUDA 4J83A 1RI9A 2CGHA 4PKCC 5GAMf 4FYWB 1YITT 1UGVA 4Q5WA 3G71T 2V8IA 1VQ5A 3SEMA 1YI2T 4C8QD 3LW5E 1C0MA 1VQKT 3LX7A 2VC8A 4JJCA 3M4YA 2MIOA 4BE1A 1I0CA 2KRSA 5IXFA 4E47A 2GTOA 3OBYA 1K8AR 3CCET 4C92C 3OYJA 4C0ZA 2J06A 2ESWA 2O9SA 1NPPA 3JB9D 1T0JA 2OAUA 1JO8A 1R8OB 3P8HA 1YJWQ 3CD6Q 3SB2A 2JOYA 1JBMA 4M7AC 4PNOA 2ENMA 2MMPA 2AKLA 4M77A 2ZGWA 1NPRA 3JAME 4RMOA 3CC4Q 3HRUA 3ZFJA 4M77F 1M8VA 2XDBA 4N0AC 2FEIA 4XU0A 3FC3A 3GP8A 2DBMA 1QCNA 4PJOC 1VUBA 2MI6A 1X75C 3RDVA 2MWPA 1V29B 1D1BA 3DB3A 1HK9A 1WHGA 1M1KC 2ED0A 3ULRB 3E1SA 5LJ5h 3CQTA 1K9MU 1UTIA 4OB3B 4KUIA 4WCIA 3CCJQ 1IHWA 2ATCB 4DBHA 1UHFA 3OS0A 3UWNA 1G83A 2QEXT 2JN0A 1VQ7Q 1VQLT 4XTVA 3REAB 3EG9A 3VU3C 1ZUYA 5D6WA 4J9HA 2KDSA 4C92E 4E7SA 1T3SA 3JCMQ 2AZVA 2MF2A 2PVDB 3GOXA 5GAN5 5CAIA 3MKDA 1PRLC 3OSVA 2QQ9A 3A8MB 1I8FA 1G3TA 5DLOA 2KAFA 1PKSA 1TG0A 3EAEA 1K73C 2Y90A 4Z89A 3Q1JA 4PJLA 4M7AE 4E7HA 2O4XB 1W6XA 1VQNA 3QUIA 3HSBA 3TVTA 2FRWA 3QYHB 5CIUA 1K1ZA 4ANJA 1XJWB 4RCBA 2XMFA 2QA4T 4QQGA 3VS5A 2DKGA 1VQ4T 2WACA 4HKEA 4XU3A 4PJOG 1ZA1B 3GF5A 4LDVA 5CO7A 4A4GA 4LDXA 5CKFA 1M4ZA 3NFCA 3VS3A 2XI9A 2JW4A 1UGPB 2BE7D 2E12A 2QTVA 1UG1A 4PLLA 3QO3A 4BY6C 3EG0A 2QQAA 2NUPB 3CCQQ 4Z8AA 2PUKB 3MO8A 2RQTA 1VYTA 4X34A 1BKBA
chains in the Genus database with same CATH topology
3L42A 2H3JA 4C92A 1VQLA 3OMGA 3TEEA 2LTOA 1D3BA 1IZ6A 3OYLA 3A8LB 3MP1A 1YIJT 2F69A 4HT9A 3QHSA 1LOJA 1N6AA 2KQWA 2K5FA 2ZPGB 1OI1A 4IUPA 5A2QE 3SFMA 1K8AU 1KHCA 1G3WA 4XTYA 3MHXA 5GANg 2P0PA 1ZQ1A 2EAYA 2E41A 4YTLA 3BDLA 3PTAA 4EMGA 2KMTA 3EFSA 3CXCA 3TU4K 2HD0A 4ZTFA 1U1SA 4OB1B 4HCZA 4X9CA 5FROA 5AYFA 2L8DA 2EWNA 4UC4A 3J81E 1NJIU 4M7AA 2MWOA 2QQSA 2YLBA 4RG2A 2QTXA 4JDSA 3FDRA 3PMIA 4OF1A 4XTUA 2ZPFB 2V8JA 3ZBDA 3HPWA 2PQWA 3ER0A 4BI4A 2A7YA 1WNLA 1VQPA 4PJOB 2QDYB 2XU8A 3MCAB 4OB2B 2B8AA 4M75B 4XQ3A 4FM4B 4IUTA 2YRVA 3CMAA 2E5QA 4ZTJA 1VQ5T 2FL7A 1B34B 2DTOA 4ME7A 4Y91A 3OW2S 3CCJA 3DKMA 4C8QA 3LLRA 2LCCA 3I55A 4E7KA 3OYDA 4FU6A 3JCMd 1YITA 3SWNC 3VUBA 4QVZA 3S3MA 3RKWA 4HT8A 3J7AF 3FRNA 1VQ7A 3G71A 1Q7YU 4M78G 1YHQT 1OZ2A 2EQUA 3VKIA 1YI2A 1YCYA 3DB4A 3RMQA 5FRMA 2LX9A 2EQKA 1M1FA 3LYIA 4N4IA 2AHJB 1NE8A 5GAN8 2RH2A 4R56A 3JCMJ 4JJNK 1LNXA 4MDWA 1KQSS 2P4TA 2L5QA 1YJNA 4F7UG 4N4HA 4P5NA 1VIFA 3C94A 3QZ5B 4DA4A 5A0LA 2FYKA 2RI5A 3RIRA 4M7DG 4QQ6A 3SWNA 4DQ2A 3CCEA 3VYGA 3CC7T 4LDUA 4XU1A 1BI2A 2ZPBB 2RJEA 3LH0A 3OS5A 4XAXB 5LJ3d 3S3OA 2EJFA 3URGA 3SDZA 3RKYA 4A4HA 4DOVA 3PIOA 1HXDA 4ZGDB 3M53A 4RKUE 4C92G 3DLLA 4GY5A 4KUDK 2DD5A 3WVDB 1XQHA 2PVGB 2DTHA 4R55A 3KXTA 2VYTA 2HBPA 1XTDA 2GCXA 2K4YA 3JCMh 1N9RA 3M5AA 5FU6C 2KY9A 4J7FA 3CBPA 3INZA 4JRIA 4C0DB 5IN1A 3FB9A 3META 3CCST 4EDUA 4KT0E 1KC8U 2GF7A 3KBGA 5GAN2 1Q81U 1Y96A 3F70A 2BKDN 4EMKA 5IT9E 5GANh 1QVPA 3CEYA 2RD1A 3JSCA 4M77D 4B9XA 3CCUT 1KD1U 4M7AG 2LT1A 5CKHA 5CR2A 3H8ZA 5CKEA 1YIJA 1QVFS 4IUVA 5GMKh 3X20B 1K8AC 3OSSC 3CXCS 4E7IA 1Y71A 2DJZA 5DLQE 3JCMe 1OYXA 1WJSA 4BI8B 3OW2A 4FL6A 4QVDA 2EIFA 2LVMA 2I2LA 1VQMT 2LNVA 3A8GB 1OZ3A 4MZTA 1Q82C 1W2BS 1QVGA 4Z02A 2RK1A 2ZPHB 5LJ3h 4ZN3A 2M16A 5GAN3 3M59A 3EFRA 2EJGA 5GANe 2PUOB 2QI2A 1VQ9A 4M78B 2XICA 2YLCA 1AHJB 4C8QG 3M56A 2DVEA 3L2VA 3CCMT 3RESA 2LT4A 4MMKA 3PNWC 2E64A 1ZHIA 2D9TA 1QP3A 3VJPA 3G7ZA 4C5HA 5GMKe 5L8RE 3OYIA 3QXEB 1KQSA 5J3BA 2VGNA 4F7UB 3G6EA 2XD0A 2D6FA 4JS5A 4MZMA 3CCQA 2X4JA 4M7DB 4PJOD 2R5AA 5LJ3e 2RHXA 4M75D 2WSCE 4HCBA 4M75E 3GNFB 2JZ2A 3CPWA 3OQ5A 4MZPA 1VQ8T 2RHZA 4BDYA 1QW1A 5LL6S 1JRIA 1DJ7B 2PU9B 4C92B 2R5MA 3KUFA 5I2SA 1YHQA 3WXMB 3OYAA 3M4GA 2CZ6B 1D3BB 1UGRB 3JB9G 2RJCA 4BY6B 3CBOA 2DXTA 4FSXA 2M0OA 3OYEA 1VQ6T 1Y7XA 4RG8A 3CBMA 2QEXA 1LJOA 2XK0A 3P8BB 5GAMd 4ZN1A 3JCMg 1PSFA 4IUQA 2M1HA 4V2SA 4J6YA 4GLKA 3CCLA 3S6WA 3QDRB 2QXFA 5GANj 4QQDA 2CZ7B 4M7AB 5GAOm 3SD4A 1QVFA 3BY7A 1Q82U 2IVWA 5GAOr 5HKCA 3OA6A 3JCMf 5I21A 4N4GA 5M9OA 1TH7A 5GMKj 3I56A 1FXXA 2E1HA 2GQVA 2E6NA 2R58A 1W2BA 2E65A 4WF2A 1VQNT 1UGSB 2DTIA 4L59A 4O6JA 5GANf 3CCSA 3T9NA 3CC2A 4JRKA 1KC8C 5LJ3j 3OYGA 1IREB 4C8QB 1Q81C 5LJ3g 1RL2A 5D6XA 3J80E 1I5LA 3E9GA 4J5YA 3HFOA 5GAMh 3CCUA 1KD1C 2DXUA 1WQ7A 3X26B 5CCAA 4ELYC 2BUDA 3JB9I 1S72T 5KE2A 4C0FA 1WJQA 2FHDA 2DD4A 2RO0A 1QVGS 2FVUA 1VQOT 4M75C 2F5TX 5LJ3f 3OYFA 2OTJT 3M9QA 4LDWA 4EMHA 3GPLA 2EFIA 2JTFA 3PGGA 5CK9A 2QA4A 2RA2A 5GMKi 3H6ZA 2RM4A 2V8KA 2DIQA 1WPYA 3V7SA 3V7RA 5GAOq 3CMET 4OB0B 2RK2A 3G4ST 2EQMA 3E9FA 3MP8A 3SWNB 1VQ4A 1XOVA 4OMFB 5HK3A 1QP2A 2KK4A 5GAMe 3A5ZB 2QQBA 2VXFA 5DY9A 5I2MA 1N8RC 3M54A 3CCRA 2D0QB 2DAQA 2K3XA 4M78D 3RUXA 3OYYA 4LD9K 4ZGJB 2X35A 4M75A 2EYQA 2VXEA 1YJWT 1PSEA 2MAMA 1M1GA 2ZCFB 3CD6T 1BYMA 3NTHA 1BI3A 3HFNA 3CPWS 3QJYA 4PLIA 3OS1A 1YJ9T 3M57A 5C0MA 4NL3A 4XK8E 1M9SA 4M75F 5J39A 4A53A 1U1TA 2DO3A 2DXCA 4F7UE 3OY9A 3E19A 1O9SA 4JLIA 4X9DA 2OTLA 1Y96B 2P0KA 5CQXA 3FLGA 1ZBXA 3QKJA 4EMKB 3CCVA 2M9UA 5GAN4 3CC4T 4M7DD 4M7DE 2IG0A 3OYMA 4JRPA 2JUFA 3TCJA 1H641 4J7IA 4BE0A 1MGQA 3X25B 4L6V5 4BACA 2EKOA 2RHIA 4O5VA 2G3RA 4C92D 2CZ1B 1RI0A 5FU6B 1G3YA 4KBMB 4M77E 2CZ0B 5FU7B 3QBYA 3V8KA 4C0DC 2HQXA 2KVQG 4CI0C 3JRZA 2WSEE 2LQKA 2K2VA 3UPUA 4IURA 3MEUA 4OGEA 3MP6A 1M5Q1 3TREA 1H3ZA 3C4SA 1BI0A 2CYZB 2YHTA 5GAMj 4ATOA 4HCCA 3OYCA 3HKSA 2DZCA 4C5GA 5GAMg 1FWZA 1X01A 4M7AD 4MMLA 3HRTA 1BIAA 2K57A 2BIVA 4FIBA 4OP0A 3CMAT 1UB4A 1N8RU 2EJ9A 3MEWA 5GAOp 3FIFA 4J83A 3OBWA 3ZEHA 2CGHA 3CCJT 3NTIA 3FJPA 3PMTA 2QQRA 4PKCC 2R57A 3VYHB 2XDDA 3I55T 4CRIA 5GAMf 3JCMV 2O4XA 4J6WA 1YITT 2LQ8A 3OYNA 4M78C 1KQ2A 2C06A 1I4K1 1JJ2S 4Q5WA 1VQ7T 3G71T 2V8IA 1VQ5A 1BIBA 1YI2T 4PJOE 4C8QD 3LW5E 2DPPB 4EPCA 5IAYA 2E70A 1VQKT 3LX7A 2VC8A 4OVAA 1VQOA 2OTJA 2X4WA 2PVOB 2LC4A 3L2QA 1YJNT 5EG2A 4LD6A 3M4YA 4BE1A 4M7DC 4B9WA 4BDZA 1G3SA 1KG1A 4E47A 3GNGA 1SSFA 3OBYA 4C5IA 3CCET 3DLMA 1VIEA 2RHUA 2LDMA 5C6SA 4VUBA 4C0GA 1Y07A 2VV5A 2HAXA 3AHUA 3PFSA 4C92C 3OYJA 4C0ZA 5GAOl 4M77C 4M78F 4A4EA 3JB9H 1NPPA 2CS7A 4JUVA 4F7UA 4C5EA 3CC7A 4A54A 3JB9D 1Q86U 2XKOC 5FRNA 4QW2A 4M7DA 3A8OB 1K73U 5J26A 5DM7R 2HNIA 1WQWA 3JCMW 4F7UF 2OAUA 1R8OB 3P8HA 5CQYA 3SB2A 3HL8A 2JOYA 1U8RA 3QIIA 1JBMA 2XIDA 5GAN6 2K3YA 4M7DF 4M7AC 4PNOA 3C95A 4BD3A 2X4YA 5GAN7 1O75A 2MMPA 3M55A 4LDYA 4M77A 2DXBA 2ZGWA 5GMKl 4NS5A 1NPRA 5KCOA 5LJ5d 2DIGA 4XTXA 5HK0A 3C12A 1NZ9A 4FT2A 3JAME 4JS4A 4RMOA 4C92F 3HRUA 1WJRA 5GMKm 3ZFJA 4M77F 1M8VA 2XDBA 4N0AC 2Y4XA 2JNGA 4XU0A 3FC3A 3GP8A 3V7CA 1M90U 4PJOC 2ZPIB 2RJFA 3LGFA 1JJ2A 1VUBA 4C8QC 2MI6A 1VQ9T 3P8DA 1WGSA 2E10A 4XTZA 4BE2A 1X75C 1VQMA 2MWPA 1V29B 3LWIA 3DB3A 1HK9A 2DK3A 3WVEB 4ELZC 4M7AF 4KULA 1UGQB 2RI3A 4RCCA 1N27A 3G6ET 3VUZA 1FX7A 5A0DA 3BFMA 3HRSA 3CCMA 3CCQT 3QSUA 4N0AA 3QYGB 4NOYA 3V8JA 1M1KC 4PJOA 4M78E 3OYHA 2L3RA 3X28B 4BUGA 3E1SA 5LJ5h 3N5BB 3QJ6A 1K9MU 3R6OA 4OB3B 1B34A 3MEAA 4KUIA 4PJOF 4ZGEB 5A0GA 5CKBA 4XU2A 4C8QF 3L2RA 4D6WA 4OGCA 2P0QA 1VQKA 3OS0A 5GANd 1MHNA 3UWNA 1VQ8A 2QEXT 1VQLT 2JN0A 4II1A 5KH6A 4XTVA 1P92A 1I81A 5LJ5g 2A3LA 3VU3C 2LRQA 3L2WA 5D6YA 3CCLT 3QG1A 5LJ5e 5D6WA 3JB9J 5GAOn 1VQ6A 2KSSA 3PIPA 2Y4YA 2K5IA 2F5KA 2WSFE 2KDSA 3GLXA 2ZPEB 3HHTB 4C92E 4EMKC 3GIBA 3OB9A 2DZ9A 4E7LA 2VUBA 3JCMQ 2MF2A 2PVDB 3L2UA 3GOXA 4JLGA 2FB7A 3V8LA 5CAIA 5GAN5 3OYBA 3A8HB 3OSVA 4IUUA 3I56T 2QQ9A 3O8VA 3OMCA 3A8MB 4M77G 3LWHA 3JB9F 3UDCA 1I8FA 5FLXE 3FEOA 1Q86C 1G3TA 2X4XA 5DLOA 2KAFA 2ZZDA 1K73C 3EAEA 3PT9A 5FU7C 2Y90A 3JCMc 3CC2T 3Q1JA 1VQPT 1XNIA 2K5LA 3JCMb 4M7AE 2EQJA 4E7HA 2O4XB 3BW1A 5CVIA 3JCMP 3RERA 1VQNA 4FT4A 2CKKA 4QVCA 3CPFA 4J8OA 3QUIA 4L5GA 3UT1A 5CKDA 1M1KU 3HSBA 3QYHB 1G5VA 3ASKA 1YBYA 3OS2A 5CIUA 2GFAA 1GXIE 1W4SA 4E7JA 4RCBA 2XDPA 2QA4T 4A4FA 1UEBA 4C8QE 4PL6A 4QQGA 4NL2A 4JRQA 1S72A 1M90C 3L1AA 1X6OA 2DKGA 5LJ5j 1NJIC 1VQ4T 2WACA 3BDUA 4HKEA 2L89A 3ME9A 4XU3A 4Y28E 4PJOG 4BB7A 3GF5A 4LDVA 3RMSA 5HY6A 5CO7A 4M75G 4A4GA 4LDXA 5CKFA 3LGLA 1M4ZA 2RI2A 3X24B 4BI3A 4DOWA 2E6ZA 3CCRT 3QZ9B 3NFCA 4A4KA 1KQ1A 3G4SA 4M78A 3CMEA 2VGMA 2XI9A 3S3NA 2JTMA 3OYKA 5KE3A 2RHYA 1UGPB 2E12A 1KHIA 2O01E 2RJDA 5LJ5f 3NTKA 4IKFA 2JVVA 4PLLA 2NLUA 3QO3A 1BI1A 2XG8D 3VV0A 4BY6C 1YJWA 1JB0E 2OTLT 2QQAA 3L2ZA 3MEVA 3RKXA 3CCVT 3CD6A 4XTWA 1K9MC 2GFUA 4J6XA 3QPHA 3M58A 1Q7YC 1YJ9A 2DEQA 2PUKB 2HQEA 3MO8A 4TVRA 4M77B 5KCHA 1EIFA 3JCMX 2RB6A 3HP9A 2LCLA 2XHCA 1N9SA 4HA8A 4MDXA 4X34A 1BKBA 3CC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E64 A;  4C92 A;  1H64 1;  4RCC A;  1MGQ A;  5GMK e;  3BFM A;  1D3B A;  3QSU A;  4N0A A;  4C92 D;  4HT9 A;  4NOY A;  3QHS A;  1LOJ A;  3V8J A;  4F7U B;  4PJO A;  4M77 E;  3V8K A;  4M78 E;  4XTY A;  5LJ5 h;  4MMK A;  4M7D B;  5GAN g;  4PJO D;  5LJ3 e;  2EAY A;  2E41 A;  4M75 D;  4EMG A;  4M75 E;  3EFS A;  1B34 A;  1M5Q 1;  4PJO F;  4XU2 A;  4C8Q F;  1U1S A;  4X9C A;  2YHT A;  2EWN A;  5GAM j;  4M7A A;  1JRI A;  4C92 B;  2DZC A;  5GAM g;  5GAN d;  1X01 A;  2YLB A;  3M4G A;  4MML A;  1D3B B;  4M7A D;  2QTX A;  1BIA A;  2JN0 A;  4XTU A;  4XTV A;  2K57 A;  3JB9 G;  2DXT A;  1I81 A;  4OP0 A;  4PJO B;  1WNL A;  3VU3 C;  2EJ9 A;  1LJO A;  4M75 B;  3FIF A;  4XQ3 A;  5GAM d;  5GAO p;  2CGH A;  5LJ5 e;  3JCM g;  3FJP A;  3JB9 J;  5GAO n;  4V2S A;  4J6Y A;  4C92 E;  4EMK C;  3JCM V;  5GAM f;  3GIB A;  1B34 B;  2DTO A;  4J6W A;  4Y91 A;  4M78 C;  2DZ9 A;  1KQ2 A;  1I4K 1;  4C8Q A;  3JCM Q;  5GAN j;  4M7A B;  2FB7 A;  3V8L A;  1BIB A;  5CAI A;  3JCM d;  4C8Q D;  3SWN C;  5GAN 5;  5GAO m;  4PJO E;  3BY7 A;  3RKW A;  4HT8 A;  5GAO r;  4M77 G;  3JB9 F;  4M78 G;  1I8F A;  3JCM f;  1YCY A;  2VC8 A;  5I21 A;  5GMK j;  1TH7 A;  3JCM c;  2E1H A;  2Y90 A;  2E65 A;  4WF2 A;  3JCM b;  5GAN 8;  4M7D C;  2DTI A;  4M7A E;  3JCM J;  5GAN f;  1LNX A;  3BW1 A;  3JCM P;  4JRK A;  4F7U G;  3RER A;  5LJ3 j;  4C8Q B;  4QVC A;  5LJ3 g;  2FYK A;  3QUI A;  3RIR A;  3HSB A;  4M7D G;  3AHU A;  3SWN A;  4DQ2 A;  4C92 C;  1I5L A;  4J5Y A;  4XU1 A;  5GAO l;  4M77 C;  3HFO A;  4M78 F;  5GAM h;  3JB9 H;  2DXU A;  1WQ7 A;  3JB9 I;  4F7U A;  4JUV A;  5LJ3 d;  2EJF A;  4A54 A;  4RCB A;  3RKY A;  3JB9 D;  1HXD A;  4C92 G;  4M75 C;  4C8Q E;  5LJ3 f;  4NL2 A;  4M7D A;  2DTH A;  2HNI A;  1WQW A;  4EMH A;  3L1A A;  3PGG A;  3JCM W;  2DKG A;  4F7U F;  3JCM h;  5LJ5 j;  2RA2 A;  5GMK i;  1N9R A;  3BDU A;  2RM4 A;  4XU3 A;  4PJO G;  1WPY A;  3INZ A;  4JRI A;  3V7S A;  3V7R A;  3FB9 A;  5LJ5 g;  3SB2 A;  5GAO q;  4M75 G;  1JBM A;  5GAN 6;  4M7D F;  4M7A C;  3SWN B;  4PNO A;  5GAN 2;  1Y96 A;  5GAN 7;  4EMK A;  4M77 A;  5GAN h;  1KQ1 A;  2ZGW A;  4M78 A;  5DY9 A;  2VXF A;  2RD1 A;  5GAM e;  5GMK l;  5LJ5 d;  4XTX A;  4M77 D;  4M78 D;  3RUX A;  4M7A G;  4C92 F;  4M75 A;  5LJ5 f;  5GMK m;  2VXE A;  4M77 F;  5GMK h;  1M8V A;  2DJZ A;  4N0A C;  3HFN A;  3QO3 A;  3JCM e;  4XU0 A;  4QVD A;  3V7C A;  3L2Z A;  4PJO C;  2I2L A;  4NL3 A;  3RKX A;  4M75 F;  4XTW A;  4A53 A;  4C8Q C;  1U1T A;  4F7U E;  4J6X A;  2E10 A;  4JLI A;  4X9D A;  4XTZ A;  1Y96 B;  5LJ3 h;  2DEQ A;  4EMK B;  5GAN 3;  3EFR A;  2EJG A;  4M77 B;  5GAN e;  3JCM X;  2RB6 A;  4M78 B;  5GAN 4;  4M7D D;  4M7D E;  1HK9 A;  2YLC A;  1N9S A;  4C8Q G;  2DVE A;  4M7A F;  3RES A;  4HA8 A; 
#chains in the Genus database with same CATH topology
 2H3J A;  4C92 A;  2X9H A;  3TEE A;  2L2P A;  1D3B A;  3MP1 A;  2K2M A;  2HKQ B;  2F69 A;  4DBR A;  5A2Q E;  2KQW A;  1N6A A;  1IGU A;  1WFW A;  2K5F A;  1KFZ A;  4PJM A;  4JPB W;  2KYB A;  1KHC A;  2COW A;  4XTY A;  1ZQ1 A;  3BDL A;  1IB8 A;  3CCL Q;  2DER A;  1U1S A;  5FRO A;  8ATC B;  1NJI U;  4M7A A;  2C0T A;  1X2K A;  1QMC A;  3FDR A;  1PWT A;  4BI4 A;  3HPW A;  3ER0 A;  1VQP A;  2QDY B;  2XU8 A;  3UAT A;  4XQ3 A;  4FM4 B;  4IUT A;  2CSI A;  1VQ5 T;  4ME7 A;  1B34 B;  3CC2 Q;  1VQP Q;  3GBQ A;  2K79 A;  3I55 A;  3JCM d;  4QVZ A;  2YWW A;  3E2U A;  1YCY A;  3DB4 A;  1Z9Q A;  5FRM A;  2EQK A;  2JS0 A;  3LYI A;  2AHJ B;  2P4T A;  2L5Q A;  1YJN A;  4F7U G;  4N4H A;  1C1A A;  1GL5 A;  3QZ5 B;  2FYK A;  3VYG A;  4CC4 B;  1BI2 A;  5KYU B;  2A36 A;  3OS5 A;  4XAX B;  3AT1 B;  3URG A;  3ZL7 C;  4GY5 A;  2DD5 A;  2PVG B;  1WX6 A;  5FU6 C;  4J7F A;  1IRX A;  4C0D B;  3CCS T;  2DYI A;  4EDU A;  2HEQ A;  2KRO A;  1C6V X;  1Y57 A;  5GAN 2;  5IT9 E;  1YWO A;  3CEY A;  2EGE A;  3JSC A;  4M77 D;  4B9X A;  2LT1 A;  5CR2 A;  1QKX A;  1K8A C;  2CP7 A;  9ATC B;  2DJZ A;  1Y0M A;  3JCM e;  1D0X A;  2AKK A;  1OZ3 A;  1YP5 A;  1QVG A;  4Z02 A;  2RK1 A;  2ZPH B;  2EJG A;  5GAN e;  2DNU A;  2PUO B;  2QI2 A;  1E6H A;  1AHJ B;  4J9D A;  4C8Q G;  3RES A;  2RPN A;  3G7Z A;  1MV3 A;  1NG2 A;  4KGX B;  2VGN A;  5J3B A;  3G6E A;  2DMO A;  2D6F A;  1D1A A;  4JS5 A;  4J9E A;  2R5A A;  2RHX A;  4M75 D;  3TQ7 P;  4MZP A;  4BDY A;  4PFZ A;  1JRI A;  1DJ7 B;  1PNJ A;  5I2S A;  3OYA A;  3M4G A;  3JB9 G;  4FSX A;  4Z88 A;  2XK0 A;  2A0F B;  1ABO A;  1V76 A;  2J6O A;  4ORZ A;  3JCM g;  4V2S A;  4R0K A;  4F14 A;  1ZBJ A;  4J6Y A;  5IHI A;  3QDR B;  1VYU A;  1NJI R;  1NBE B;  1ZSZ B;  4LUE A;  8AT1 B;  1BB9 A;  5I21 A;  3I56 A;  1FXX A;  2FG0 A;  1TTH B;  2E1H A;  2KBT A;  1RLP C;  2R58 A;  1VQN T;  1V1C A;  1LPL A;  1UGS B;  2DTI A;  5FWB A;  7AT1 B;  2PTK A;  2AT1 B;  3A98 A;  1OUL A;  1WYX A;  1WXT A;  1D09 B;  3H0I A;  4PJN A;  5D6X A;  4QKU A;  3HFO A;  5GAM h;  4ELY C;  2FHD A;  2FVU A;  4LE9 A;  5LJ3 f;  2OTJ T;  4EMH A;  2EFI A;  5GJV B;  3KFV A;  3NGP A;  2RM4 A;  1BCM A;  2ECZ A;  2FPE A;  2RK2 A;  4LN2 A;  2KT1 A;  1K0S A;  1QP2 A;  1M2O A;  1WI7 A;  3M54 A;  4RTV A;  3RUX A;  1TUC A;  3CCM Q;  1BYM A;  2DL5 A;  3M57 A;  1TXQ A;  1PC0 A;  2E5K A;  4XK8 E;  4NL3 A;  5J39 A;  2DO3 A;  2DXC A;  2OTL A;  5I11 A;  2P0K A;  4RTZ A;  3CCV A;  1R0C B;  4M7D E;  1VOM A;  6AT1 B;  2JUF A;  1H64 1;  4BE0 A;  1MGQ A;  4O5V A;  3R6N A;  4C92 D;  2CZ1 B;  2CZ0 B;  3QBY A;  4C0D C;  1NLP C;  3UPU A;  1VQ6 Q;  2K2V A;  2K6D A;  1ACM B;  4JZ3 A;  4IUR A;  4OGE A;  3LH5 A;  1BI0 A;  1ZA2 B;  4HCC A;  3HKS A;  4OML A;  4M7A D;  2K57 A;  2BIV A;  2BZY A;  4FIB A;  1UB4 A;  5GAO p;  2VKN A;  1UEC A;  1SHF A;  2QQR A;  2R57 A;  3NMZ C;  3D7S B;  3I55 T;  4CRI A;  3JCM V;  2O4X A;  4J6W A;  2H8H A;  1KQ2 A;  1EZZ B;  1JEG A;  1BIB A;  2G6F X;  1K4U S;  2LZ6 B;  2LQW A;  2X4W A;  2PVO B;  2BE9 B;  1YJN T;  5EG2 A;  4PFP A;  1S72 Q;  4B9W A;  1SSF A;  1VIE A;  4C0G A;  2VV5 A;  1X27 A;  4M77 C;  4M78 F;  3G4S Q;  4A4E A;  3CME Q;  5IXB A;  3CC7 A;  1E7O A;  2JTE A;  5FRN A;  2K9G A;  4QW2 A;  4M7D A;  3A8O B;  3I35 A;  3JCM W;  3VS1 A;  2NUP A;  3QII A;  4M7D F;  2K3Y A;  1IHV A;  4FW1 A;  2DF6 A;  1YWP A;  2IPO B;  5GAN 7;  1O75 A;  2DXB A;  5KCO A;  2DIG A;  3C12 A;  2LJ0 A;  1WJR A;  5GMK m;  2Y4X A;  2JNG A;  1M90 U;  2RJF A;  3P8D A;  2E10 A;  4XTZ A;  4BE2 A;  2AK5 A;  3EG1 A;  1VQM A;  3WVE B;  2FRY A;  2RI3 A;  4RCC A;  1N27 A;  3G6E T;  1FX7 A;  5A0D A;  3BFM A;  3QYG B;  2DL4 A;  2DA9 A;  3V8J A;  1MMN A;  1QCF A;  1KIK A;  1B3Q A;  1GCP A;  4BUG A;  2M02 A;  2LX7 A;  2BZ8 A;  3QJ6 A;  3R6O A;  1B34 A;  2GGR A;  1Q95 G;  4II1 A;  4EIK A;  1R77 A;  2A3L A;  1WXB A;  3L2W A;  2LQN A;  1RAF B;  2MCN A;  3QG1 A;  2Y4Y A;  2ZPE B;  2ZAE A;  4E7L A;  1QCO A;  4JLG A;  3V8L A;  3I56 T;  4IUU A;  1GBQ A;  4M77 G;  4HVU A;  5KYU A;  5FLX E;  1Q86 C;  2X4X A;  1M3A A;  2CUB A;  1NLO C;  2K5L A;  3JCM b;  1SPK A;  2D0N A;  1YBY A;  2DRM A;  2YUN A;  3OS2 A;  4RUG A;  2GTJ A;  1B07 A;  2K7A A;  3M0S A;  2HL5 C;  4PL6 A;  1X6O A;  5LJ5 j;  1NJI C;  5KYN A;  3RMS A;  4E6R A;  4M75 G;  3X24 B;  4DOW A;  1S1N A;  2DEU A;  1VQ9 Q;  1KQ1 A;  2VGM A;  4M4Z A;  2RHY A;  2LCS A;  1AOJ A;  3EHR A;  1RAI B;  1NEB A;  3VV0 A;  2XG8 D;  2OTL T;  1YJW A;  1JB0 E;  3MEV A;  2YRD A;  3CCV T;  5GJW B;  4XTW A;  1QVG P;  3CD6 A;  2GFU A;  4J6X A;  3QPH A;  2DEQ A;  3JCM X;  1EIF A;  2RB6 A;  3HP9 A;  2LCL A;  1N9S A;  1ZSG A;  1UJ0 A;  3CC4 A;  3L42 A;  4HVW A;  1OPL A;  3OYL A;  1YIJ T;  3QHS A;  1LOJ A;  2A28 A;  2QK0 A;  1M90 R;  3I9Q A;  3UF4 A;  3MHX A;  2P0P A;  2EAY A;  4YTL A;  2FZK B;  2HD0 A;  2DET A;  5AYF A;  4B6M A;  2EWN A;  2MPX C;  1GCQ A;  2MWO A;  2HCK A;  1ZSZ A;  2X3W D;  4RG2 A;  4DBQ A;  2IIM A;  2A7Y A;  3MCA B;  1QWE A;  2NYS A;  1AT1 B;  2KXC A;  4ZTJ A;  2DJQ A;  3OW2 S;  5KYX B;  3CCJ A;  3LLR A;  2LCC A;  3M0R A;  4E7K A;  2KR3 A;  3M0T A;  3J7A F;  1VQ7 A;  2HZY A;  1YHQ T;  1AWJ A;  1OEB A;  2FO0 A;  1M1F A;  1MUZ A;  2CP3 A;  4PFO A;  3JCM J;  1KQS S;  1VIF A;  5A0L A;  2RI5 A;  3RIR A;  4OMO A;  4DQ2 A;  3CC7 T;  2FPD A;  4XU1 A;  2H3E B;  3CCR Q;  2J7I A;  1HXD A;  4ZGD B;  3M53 A;  4C92 G;  1XQH A;  2DTH A;  2HBP A;  2K4Y A;  3MET A;  2J05 A;  4KT0 E;  1KC8 U;  1Q81 U;  3F70 A;  2BKD N;  4D8K A;  1M30 A;  2CH4 W;  4M7A G;  2YXY A;  3H9N A;  5CKH A;  3H8Z A;  2ROT A;  4IIM A;  5GMK h;  3OSS C;  4E7I A;  3OW2 A;  2LVM A;  2I2L A;  1VQM T;  1I07 A;  4J9I A;  5LJ3 h;  4ZN3 A;  2M16 A;  5GAN 3;  3M59 A;  4M78 B;  3M56 A;  1UFF A;  2LT4 A;  4MMK A;  2W0Z A;  1FMV A;  1AZE A;  1KK7 A;  2E64 A;  1ZHI A;  1QP3 A;  1HD3 A;  2D8H A;  3QXE B;  1KQS A;  2M0Y A;  2XD0 A;  3EG2 A;  3CCQ A;  1UDL A;  2X4J A;  4M7D B;  1FMW A;  2JT4 A;  2JZ2 A;  3CPW A;  5LL6 S;  2PU9 B;  3KUF A;  3H0H A;  3WXM B;  2CZ6 B;  2RJC A;  2M0O A;  1Y7X A;  3CBM A;  3NHN A;  2X3X D;  4IUQ A;  2M1H A;  1RUW A;  3CCL A;  2DBK A;  2EGA A;  1BCO A;  4CC2 A;  2E3I A;  3SD4 A;  3BY7 A;  1Q82 U;  2IVW A;  5HKC A;  2JS2 A;  2EW3 A;  3JCM f;  1RAD B;  4N4G A;  5M9O A;  3UA7 A;  2F2X A;  2E65 A;  2V1Q A;  4WF2 A;  4L59 A;  4O6J A;  5GAN f;  3CC2 A;  1NEG A;  4FSS A;  2OI3 A;  3J80 E;  1I5L A;  1MV0 B;  1K9M R;  1LCK A;  3CCU A;  1KD1 C;  3X26 B;  1WJQ A;  2DD4 A;  4DEY A;  1QVG S;  2F5T X;  3CCU Q;  1SRM A;  3PGG A;  2RA2 A;  1WPY A;  4OB0 B;  4AT1 B;  3SWN B;  1T0H A;  1A0N B;  3OYY A;  1SF9 A;  3PVL A;  4ZGJ B;  2MYS A;  1YJW T;  1W1F A;  3CD6 T;  2JM8 A;  3NTH A;  4PLI A;  4RTW A;  3OS1 A;  1U1T A;  3OY9 A;  4F7U E;  2O9V A;  3E19 A;  1O9S A;  4JLI A;  1OU8 A;  1KC8 R;  3FLG A;  1Q81 R;  2M9U A;  3CC4 T;  1SRL A;  2IG0 A;  2EBP A;  2CSQ A;  4J7I A;  4HXJ A;  4L6V 5;  4PK4 A;  1VQ8 Q;  2RHI A;  5HCK A;  2JM9 A;  1RI0 A;  2CT3 A;  1H3H A;  1ZUU A;  3JRZ A;  3VRZ A;  5IH2 A;  4DEX A;  3TRE A;  1IXD A;  5GAM j;  1M3C A;  4C5G A;  2DZC A;  1FWZ A;  4MML A;  1E6G A;  1BIA A;  4OP0 A;  3ZEH A;  2YUP A;  3CCJ T;  3NTI A;  3FJP A;  3PMT A;  2KRN A;  2XDD A;  3JV3 A;  2FZC B;  4M78 C;  2C06 A;  1VQ7 T;  1FYN A;  1T3L A;  1OOT A;  2DPP B;  1TU0 B;  4EPC A;  5IAY A;  2E3H A;  2E70 A;  4GLM A;  4OVA A;  2HBW A;  1VQO A;  1WLP B;  4M7D C;  1VQO Q;  4FW2 A;  4RTU A;  2KRM A;  3DLM A;  2LDM A;  1Y07 A;  3AHU A;  3PFS A;  4F17 A;  5GAO l;  1Q82 R;  3JB9 H;  4F7U A;  4C5E A;  4OMM A;  4A54 A;  1NYG A;  5L23 A;  2ROL A;  1K73 U;  2CH4 A;  1WQW A;  4F7U F;  5CQY A;  3HL8 A;  1U8R A;  2XID A;  2Z0W A;  3C95 A;  2ED1 A;  4BD3 A;  2X4Y A;  1YJ9 Q;  5ECA A;  5GMK l;  4NS5 A;  5LJ5 d;  5HK0 A;  3M0U A;  4FT2 A;  4J9C A;  5KYW B;  3EGU A;  1IO6 A;  3V7C A;  2HQH A;  2EYW A;  1AEY A;  2ZPI B;  3LGF A;  2CP2 A;  2RF0 A;  2YSQ A;  4AFQ C;  3LWI A;  1G8X A;  2RNA A;  3VUZ A;  3CCM A;  3HRS A;  3CCQ T;  1MMD A;  4NOY A;  4AG2 C;  3VS7 A;  2DL7 A;  4AFU C;  4M78 E;  4AG1 C;  2L3R A;  1TOV A;  2O88 A;  3CMA Q;  2V26 A;  2VAS A;  2K3B A;  2QDL A;  3MEA A;  4ZGE B;  5KYX A;  4C8Q F;  4D6W A;  2P0Q A;  4K11 A;  1VQK A;  1YIT Q;  1SG5 A;  1MHN A;  1SHG A;  1RLQ C;  2COZ A;  2QGG A;  3G71 Q;  1MND A;  1YI2 Q;  2NUT B;  2LRQ A;  2RQU A;  1VQK Q;  3CCL T;  1PD1 A;  2HMA A;  5LJ5 e;  1TUG B;  1YFN A;  3JB9 J;  1VQ6 A;  2K5I A;  2F5K A;  2WSF E;  3GIB A;  2VUB A;  4CC3 A;  1SKU B;  2QAZ A;  2FB7 A;  3RBB B;  3A8H B;  1RAB B;  3CCE Q;  1U06 A;  1WHL A;  3LWH A;  1YCS B;  3JB9 F;  2ZZD A;  1RAC B;  3PT9 A;  3JCM c;  3CC2 T;  2EKH A;  1VQP T;  3NPF A;  1XNI A;  2EQJ A;  3RER A;  3VS6 A;  5CVI A;  3JCM P;  1I5O B;  2CKK A;  1AWX A;  4QVC A;  1PCX A;  3UT1 A;  5CKD A;  2YT6 A;  3ASK A;  2L3P A;  1GXI E;  3IQL A;  3TSW A;  2XDP A;  1OV3 A;  3TSZ A;  1PG5 B;  4NL2 A;  1S72 A;  3L1A A;  3BDU A;  4Y28 E;  5LJ5 g;  2CDT A;  4BI3 A;  2RI2 A;  1J3T A;  2E6Z A;  3QZ9 B;  4A4K A;  3G4S A;  3CME A;  4M78 A;  3S3N A;  2JTM A;  3OYK A;  2C0I A;  2RJD A;  1KHI A;  2VB6 A;  3SHW A;  4WTO B;  3OW2 P;  2QG9 B;  2J6F A;  4IKF A;  2NLU A;  1BI1 A;  5FWC A;  3RKX A;  1K9M C;  3M58 A;  4JJD A;  5KCH A;  2HQE A;  4TVR A;  3I5R A;  2XHC A;  4ESR A;  3VS0 A;  4HA8 A;  2J6K A;  1VQL A;  1GCQ C;  2L0A A;  1KQS P;  1ZSZ C;  1IZ6 A;  3EHQ A;  2ZPG B;  1LVK A;  1K8A U;  1OI1 A;  4IUP A;  3SFM A;  2QEX Q;  1VQL Q;  1G3W A;  2D1X A;  2V1R A;  3PTA A;  4EMG A;  3EFS A;  3CPW P;  3CXC A;  4ZTF A;  4OB1 B;  2JJ9 A;  1HYO A;  4UC4 A;  2M51 A;  2KGT A;  1EX4 A;  3PMI A;  1JU5 C;  3ZBD A;  2PQW A;  4PJO B;  1WNL A;  4IIO A;  2DX1 A;  2FZG B;  1TS9 A;  2QAS A;  2E5Q A;  1AD5 A;  2FL7 A;  4Y91 A;  4JJB A;  3HTR A;  2OX7 A;  3VRY A;  3OYD A;  4FU6 A;  3S3M A;  1BU1 A;  4HT8 A;  3RNJ A;  1D1C A;  5IHN A;  4X1V A;  2HDA A;  2EQI A;  1Q7Y U;  2EQU A;  3G1J A;  3RMQ A;  2EGC A;  1I1J A;  1PM3 A;  5GAN 8;  2RH2 A;  4JJN K;  1LNX A;  1RAE B;  4MDW A;  2QA4 Q;  1GFD A;  2KYM A;  4QQ6 A;  3SWN A;  1VQ4 Q;  2YUQ A;  3LH0 A;  2QYZ A;  3S3O A;  2EJF A;  4DOV A;  3RKY A;  4RKU E;  3DLL A;  4KUD K;  4GBQ A;  2GCX A;  3JCM h;  1N9R A;  3M5A A;  2KY9 A;  4JRI A;  3FB9 A;  3BE3 A;  2JMA A;  2EVR A;  2GF7 A;  3KBG A;  4LNP A;  2CP6 A;  5GAN h;  1M2V A;  2DFU A;  4KH1 B;  4IUV A;  1QVF S;  1OYX A;  4Y92 A;  4FL6 A;  4QVD A;  2LNV A;  3EH2 A;  4MZT A;  1Q82 C;  1W2B S;  1GBR A;  1VQ9 A;  2P84 A;  2A08 A;  3CCM T;  3L2V A;  1SSH A;  3PNW C;  2L3Q A;  5L8R E;  4F7U B;  4ZNX A;  3QWY A;  2KEA A;  4HCB A;  4M75 E;  1M27 C;  2KI7 A;  2RHZ A;  3EFO B;  1VQ5 Q;  2R5M A;  1UGR B;  4BY6 B;  3CBO A;  1VQ6 T;  2BZX A;  4RG8 A;  2YRC A;  1CKB A;  3MPU B;  3P8B B;  5GAM d;  1WXU A;  1OX8 A;  1PSF A;  3H41 A;  3A1P A;  4GLK A;  2ABL A;  2L3S A;  2QXF A;  2RQW A;  2CZ7 B;  2NUZ A;  4FYV B;  1QVF A;  5GAO r;  3OA6 A;  2X51 A;  4A63 B;  5GMK j;  3THK A;  1WHK A;  1W2B A;  2VWF A;  4CC7 A;  3CCS A;  2HL3 A;  2PZ1 A;  5LJ3 j;  1IRE B;  4C8Q B;  1PD0 A;  1U3O A;  1RL2 A;  3EH1 A;  3PVQ A;  3CCS Q;  1WQ7 A;  5CCA A;  3JB9 I;  1Q7Y R;  2BUD A;  1S72 T;  3I5S A;  1VA7 A;  4LDW A;  5KYW A;  1W70 A;  5CK9 A;  2CP0 A;  2JXB A;  2CT4 A;  5GMK i;  2SEM A;  2DIQ A;  3CME T;  3G4S T;  3MP8 A;  1XOV A;  4OMF B;  1JXM A;  5HK3 A;  2JMC A;  5GAM e;  5I2M A;  5DY9 A;  3CCR A;  1QKW A;  2K3X A;  4M78 D;  4LD9 K;  4M75 A;  1QLY A;  2EYQ A;  2LP5 A;  2VXE A;  1PSE A;  4PJJ A;  1X6G A;  1BI3 A;  3HFN A;  3QWX X;  3CPW S;  3QJY A;  5C0M A;  4M75 F;  4A53 A;  1X2Q A;  4OMN A;  1Y96 B;  5KYY B;  3QKJ A;  1ZBX A;  4EMK B;  2B86 A;  2MOX A;  5IHK A;  5GAN 4;  4M7D D;  4RTY A;  1HSQ A;  4FCY A;  4BAC A;  2EKO A;  2G3R A;  4OMQ A;  5FU6 B;  2E4H A;  1G3Y A;  2NUT A;  5FU7 B;  3V8K A;  2GQI A;  2KVQ G;  4CI0 C;  2I0N A;  2LQK A;  2A37 A;  4RTX A;  4LXC A;  3MEU A;  4OMP A;  1H3Z A;  1CKA A;  2CYZ B;  4ATO A;  5GAM g;  1X01 A;  1HJD A;  1NM7 A;  1N8R U;  2EJ9 A;  3MEW A;  3FIF A;  3OBW A;  2D8J A;  3FJ5 A;  1K76 A;  3VYH B;  2LQ8 A;  2OAW A;  1SEM A;  1KSW A;  3OYN A;  1I4K 1;  1VQN Q;  1JJ2 S;  3U23 A;  4PJO E;  1RAH B;  4J9G A;  2AZS A;  2SRC A;  3PE0 A;  1UHC A;  2OTJ A;  2LC4 A;  3L2Q A;  4LD6 A;  4BDZ A;  1G3S A;  1AVZ C;  3REB B;  1KG1 A;  3GNG A;  4C5I A;  2OTJ Q;  2RHU A;  5C6S A;  4VUB A;  5D7U A;  2HAX A;  2KXD A;  1AZG B;  4HVV A;  2CS7 A;  4JUV A;  1BBZ A;  1OU9 A;  4DBF A;  1Q86 U;  2YUO A;  2XKO C;  2YDL A;  1WHM A;  5J26 A;  5DM7 R;  2HNI A;  5AT1 B;  2C0O A;  2RN8 A;  1PRM C;  1G2B A;  2COY A;  4KGZ B;  5GAN 6;  3M55 A;  4LDY A;  5EC7 A;  4XTX A;  3EG3 A;  3QDF A;  1NZ9 A;  3H0F A;  4JS4 A;  4C92 F;  3EGX B;  4HCK A;  2GNC A;  1JJ2 A;  4C8Q C;  1VQ9 T;  3EGD B;  2DM1 A;  1WGS A;  1QQJ A;  2DK3 A;  4ELZ C;  4M7A F;  4KUL A;  1UGQ B;  1WHJ A;  5I22 A;  3QSU A;  4N0A A;  4PJO A;  3OYH A;  1FMK A;  3X28 B;  3N5B B;  3CXC P;  4PJO F;  5A0G A;  5CKB A;  4XU2 A;  3L2R A;  2KE9 A;  4OGC A;  3I55 Q;  2PNI A;  5GAN d;  1VQ8 A;  5KH6 A;  2OJ2 A;  1P92 A;  4KGV B;  1I81 A;  1M2V B;  1K0X A;  5D6Y A;  1B7T A;  5GAO n;  2KSS A;  3PIP A;  3GLX A;  3HHT B;  4EMK C;  1YJN Q;  3OB9 A;  1ZUK A;  2DZ9 A;  3L2U A;  1MNE A;  3OYB A;  1NYF A;  3OMC A;  3O8V A;  3UDC A;  3FEO A;  2F1L A;  2LJ1 A;  1YNZ A;  5FU7 C;  1N8R R;  3BW1 A;  4FT4 A;  2EYX A;  3CPF A;  1ABQ A;  4J8O A;  4L5G A;  1M1K U;  2DLP A;  2HSE B;  1G5V A;  2GFA A;  1JXO A;  1W4S A;  1WHH A;  4E7J A;  4A4F A;  1UEB A;  4C8Q E;  4JRQ A;  1M90 C;  2DE0 X;  2RMO A;  2KT8 A;  4BB7 A;  2L89 A;  3ME9 A;  1H8K A;  5HY6 A;  1U5S A;  3VS4 A;  3LGL A;  3CCR T;  4LUD A;  2EYZ A;  1PHT A;  1VYV A;  5KE3 A;  2F2V A;  2NWM A;  4J9B A;  2O01 E;  4AMC A;  5LJ5 f;  1X43 A;  1Q86 R;  1UJY A;  3NTK A;  2JVV A;  1D0Z A;  3L2Z A;  3G6E Q;  2CUD A;  1AWW A;  2P4R A;  1Q7Y C;  1YJ9 A;  1ARK A;  1ZLM A;  4M77 B;  4KH0 B;  1MMA A;  3EFO A;  4MDX A;  3OMG A;  2LTO A;  3A8L B;  4AFZ C;  1X69 A;  4HT9 A;  1PKT A;  2F2W A;  1M8M A;  2DRK A;  5GAN g;  2AIR B;  2E41 A;  2KMT A;  3TU4 K;  4X9C A;  4HCZ A;  2L8D A;  3J81 E;  2QQS A;  2YLB A;  2QTX A;  4JDS A;  4XTU A;  4OF1 A;  2ZPF B;  2V8J A;  3I56 Q;  4OB2 B;  2B8A A;  4M75 B;  2CP5 A;  1K9A A;  3C0C A;  2YRV A;  3CMA A;  1X6B A;  1MMG A;  2DTO A;  3DKM A;  4C8Q A;  1QVF P;  1YIT A;  3SWN C;  3VUB A;  1CSK A;  3RKW A;  3FRN A;  1YN8 A;  3G71 A;  4M78 G;  5FW9 A;  1OZ2 A;  3VKI A;  1YI2 A;  3EG9 B;  2LX9 A;  1W2B P;  2LNH B;  1M3B A;  4N4I A;  1NE8 A;  4D8D A;  4R56 A;  2VVK A;  4AFS C;  4P5N A;  3C94 A;  4DA4 A;  1F1B B;  1GRI A;  4M7D G;  2CRE A;  3CCE A;  2FPF A;  4LDU A;  1WA7 A;  2ZPB B;  2RJE A;  5LJ3 d;  2LMJ A;  3SDZ A;  3PIO A;  4A4H A;  3WVD B;  2DVJ A;  4R55 A;  3KXT A;  2VYT A;  1UUE A;  1XTD A;  2MK5 A;  2BTT A;  3CBP A;  3INZ A;  5IN1 A;  2OTL Q;  1R0B G;  1M1K R;  1Y96 A;  5KYY A;  4EMK A;  4KRT A;  3CCV Q;  1QVP A;  1TSF A;  2RD1 A;  4F04 B;  2GBQ A;  3CCU T;  1KD1 U;  1YIJ A;  5CKE A;  3X20 B;  3CXC S;  1Y71 A;  5DLQ E;  1WJS A;  4BI8 B;  2EIF A;  3A8G B;  1YIJ Q;  1QWF A;  3EFR A;  2XIC A;  2YLC A;  2DVE A;  3O5Z A;  3RR6 A;  2D9T A;  1WIE A;  3VJP A;  4FYX B;  5GMK e;  4C5H A;  3OYI A;  1Z9Z A;  4MZM A;  4PJO D;  5LJ3 e;  2WSC E;  1K73 R;  1UE9 A;  3GNF B;  3OQ5 A;  1VQ8 T;  1QW1 A;  4C92 B;  1YHQ A;  1JQQ A;  1D3B B;  2DXT A;  1WZO A;  3OYE A;  2W10 A;  2QEX A;  1LJO A;  2KNB B;  4E2F B;  1YHQ Q;  4ZN1 A;  1AWO A;  1OX9 A;  2DIL A;  3S6W A;  5GAN j;  4QQD A;  4M7A B;  5GAO m;  1TH7 A;  3CC7 Q;  2DL3 A;  1H92 A;  2GQV A;  2E6N A;  4J9F A;  1OQK A;  1EFN A;  3T9N A;  4JRK A;  1KC8 C;  3OYG A;  2O31 A;  1Q81 C;  5LJ3 g;  3E9G A;  4J5Y A;  2EPD A;  2DXU A;  1IGQ A;  2HKN A;  3MJX A;  5KE2 A;  4C0F A;  2RO0 A;  1ZX6 A;  3EGX A;  1VQO T;  4M75 C;  3OYF A;  3M9Q A;  3GPL A;  2JTF A;  2EYY A;  2QA4 A;  3H6Z A;  2V8K A;  3M0Q A;  3V7S A;  3V7R A;  5GAO q;  1KJW A;  3EGD A;  2EQM A;  3E9F A;  1VQ4 A;  1VQM Q;  2KK4 A;  3A5Z B;  2QQB A;  2VXF A;  1N8R C;  4JZ4 A;  2D0Q B;  2DAQ A;  2LJ3 A;  2X35 A;  2MAM A;  2ZCF B;  1M1G A;  1JJ2 P;  1YJ9 T;  4F16 A;  1M9S A;  1N5Z A;  4X9D A;  2RQR A;  5CQX A;  4E7Z A;  2DYB A;  2QGF B;  3OYM A;  4JRP A;  3TCJ A;  1RAG B;  1KD1 R;  2DL8 A;  3X25 B;  3VS2 A;  4QT7 A;  1BK2 A;  2RQV A;  4KBM B;  4M77 E;  3UA6 A;  3M0P A;  2HQX A;  4FYY B;  2WSE E;  1RAA B;  1OPK A;  1WDX A;  2O2O A;  1GFC A;  3MP6 A;  1M5Q 1;  1TWB A;  3C4S A;  4RTT A;  2YHT A;  3OYC A;  2HSP A;  3HRT A;  1D0Y A;  3CMA T;  1TUD A;  4J83 A;  1RI9 A;  2CGH A;  4PKC C;  5GAM f;  4FYW B;  1YIT T;  1UGV A;  4Q5W A;  3G71 T;  2V8I A;  1VQ5 A;  3SEM A;  1YI2 T;  4C8Q D;  3LW5 E;  1C0M A;  1VQK T;  3LX7 A;  2VC8 A;  4JJC A;  3M4Y A;  2MIO A;  4BE1 A;  1I0C A;  2KRS A;  5IXF A;  4E47 A;  2GTO A;  3OBY A;  1K8A R;  3CCE T;  4C92 C;  3OYJ A;  4C0Z A;  2J06 A;  2ESW A;  2O9S A;  1NPP A;  3JB9 D;  1T0J A;  2OAU A;  1JO8 A;  1R8O B;  3P8H A;  1YJW Q;  3CD6 Q;  3SB2 A;  2JOY A;  1JBM A;  4M7A C;  4PNO A;  2ENM A;  2MMP A;  2AKL A;  4M77 A;  2ZGW A;  1NPR A;  3JAM E;  4RMO A;  3CC4 Q;  3HRU A;  3ZFJ A;  4M77 F;  1M8V A;  2XDB A;  4N0A C;  2FEI A;  4XU0 A;  3FC3 A;  3GP8 A;  2DBM A;  1QCN A;  4PJO C;  1VUB A;  2MI6 A;  1X75 C;  3RDV A;  2MWP A;  1V29 B;  1D1B A;  3DB3 A;  1HK9 A;  1WHG A;  1M1K C;  2ED0 A;  3ULR B;  3E1S A;  5LJ5 h;  3CQT A;  1K9M U;  1UTI A;  4OB3 B;  4KUI A;  4WCI A;  3CCJ Q;  1IHW A;  2ATC B;  4DBH A;  1UHF A;  3OS0 A;  3UWN A;  1G83 A;  2QEX T;  2JN0 A;  1VQ7 Q;  1VQL T;  4XTV A;  3REA B;  3EG9 A;  3VU3 C;  1ZUY A;  5D6W A;  4J9H A;  2KDS A;  4C92 E;  4E7S A;  1T3S A;  3JCM Q;  2AZV A;  2MF2 A;  2PVD B;  3GOX A;  5GAN 5;  5CAI A;  3MKD A;  1PRL C;  3OSV A;  2QQ9 A;  3A8M B;  1I8F A;  1G3T A;  5DLO A;  2KAF A;  1PKS A;  1TG0 A;  3EAE A;  1K73 C;  2Y90 A;  4Z89 A;  3Q1J A;  4PJL A;  4M7A E;  4E7H A;  2O4X B;  1W6X A;  1VQN A;  3QUI A;  3HSB A;  3TVT A;  2FRW A;  3QYH B;  5CIU A;  1K1Z A;  4ANJ A;  1XJW B;  4RCB A;  2XMF A;  2QA4 T;  4QQG A;  3VS5 A;  2DKG A;  1VQ4 T;  2WAC A;  4HKE A;  4XU3 A;  4PJO G;  1ZA1 B;  3GF5 A;  4LDV A;  5CO7 A;  4A4G A;  4LDX A;  5CKF A;  1M4Z A;  3NFC A;  3VS3 A;  2XI9 A;  2JW4 A;  1UGP B;  2BE7 D;  2E12 A;  2QTV A;  1UG1 A;  4PLL A;  3QO3 A;  4BY6 C;  3EG0 A;  2QQA A;  2NUP B;  3CCQ Q;  4Z8A A;  2PUK B;  3MO8 A;  2RQT A;  1VYT A;  4X34 A;  1BKB A; 
#chains in the Genus database with same CATH homology
 3L42 A;  2H3J A;  4C92 A;  1VQL A;  3OMG A;  3TEE A;  2LTO A;  1D3B A;  1IZ6 A;  3OYL A;  3A8L B;  3MP1 A;  1YIJ T;  2F69 A;  4HT9 A;  3QHS A;  1LOJ A;  1N6A A;  2KQW A;  2K5F A;  2ZPG B;  1OI1 A;  4IUP A;  5A2Q E;  3SFM A;  1K8A U;  1KHC A;  1G3W A;  4XTY A;  3MHX A;  5GAN g;  2P0P A;  1ZQ1 A;  2EAY A;  2E41 A;  4YTL A;  3BDL A;  3PTA A;  4EMG A;  2KMT A;  3EFS A;  3CXC A;  3TU4 K;  2HD0 A;  4ZTF A;  1U1S A;  4OB1 B;  4HCZ A;  4X9C A;  5FRO A;  5AYF A;  2L8D A;  2EWN A;  4UC4 A;  3J81 E;  1NJI U;  4M7A A;  2MWO A;  2QQS A;  2YLB A;  4RG2 A;  2QTX A;  4JDS A;  3FDR A;  3PMI A;  4OF1 A;  4XTU A;  2ZPF B;  2V8J A;  3ZBD A;  3HPW A;  2PQW A;  3ER0 A;  4BI4 A;  2A7Y A;  1WNL A;  1VQP A;  4PJO B;  2QDY B;  2XU8 A;  3MCA B;  4OB2 B;  2B8A A;  4M75 B;  4XQ3 A;  4FM4 B;  4IUT A;  2YRV A;  3CMA A;  2E5Q A;  4ZTJ A;  1VQ5 T;  2FL7 A;  1B34 B;  2DTO A;  4ME7 A;  4Y91 A;  3OW2 S;  3CCJ A;  3DKM A;  4C8Q A;  3LLR A;  2LCC A;  3I55 A;  4E7K A;  3OYD A;  4FU6 A;  3JCM d;  1YIT A;  3SWN C;  3VUB A;  4QVZ A;  3S3M A;  3RKW A;  4HT8 A;  3J7A F;  3FRN A;  1VQ7 A;  3G71 A;  1Q7Y U;  4M78 G;  1YHQ T;  1OZ2 A;  2EQU A;  3VKI A;  1YI2 A;  1YCY A;  3DB4 A;  3RMQ A;  5FRM A;  2LX9 A;  2EQK A;  1M1F A;  3LYI A;  4N4I A;  2AHJ B;  1NE8 A;  5GAN 8;  2RH2 A;  4R56 A;  3JCM J;  4JJN K;  1LNX A;  4MDW A;  1KQS S;  2P4T A;  2L5Q A;  1YJN A;  4F7U G;  4N4H A;  4P5N A;  1VIF A;  3C94 A;  3QZ5 B;  4DA4 A;  5A0L A;  2FYK A;  2RI5 A;  3RIR A;  4M7D G;  4QQ6 A;  3SWN A;  4DQ2 A;  3CCE A;  3VYG A;  3CC7 T;  4LDU A;  4XU1 A;  1BI2 A;  2ZPB B;  2RJE A;  3LH0 A;  3OS5 A;  4XAX B;  5LJ3 d;  3S3O A;  2EJF A;  3URG A;  3SDZ A;  3RKY A;  4A4H A;  4DOV A;  3PIO A;  1HXD A;  4ZGD B;  3M53 A;  4RKU E;  4C92 G;  3DLL A;  4GY5 A;  4KUD K;  2DD5 A;  3WVD B;  1XQH A;  2PVG B;  2DTH A;  4R55 A;  3KXT A;  2VYT A;  2HBP A;  1XTD A;  2GCX A;  2K4Y A;  3JCM h;  1N9R A;  3M5A A;  5FU6 C;  2KY9 A;  4J7F A;  3CBP A;  3INZ A;  4JRI A;  4C0D B;  5IN1 A;  3FB9 A;  3MET A;  3CCS T;  4EDU A;  4KT0 E;  1KC8 U;  2GF7 A;  3KBG A;  5GAN 2;  1Q81 U;  1Y96 A;  3F70 A;  2BKD N;  4EMK A;  5IT9 E;  5GAN h;  1QVP A;  3CEY A;  2RD1 A;  3JSC A;  4M77 D;  4B9X A;  3CCU T;  1KD1 U;  4M7A G;  2LT1 A;  5CKH A;  5CR2 A;  3H8Z A;  5CKE A;  1YIJ A;  1QVF S;  4IUV A;  5GMK h;  3X20 B;  1K8A C;  3OSS C;  3CXC S;  4E7I A;  1Y71 A;  2DJZ A;  5DLQ E;  3JCM e;  1OYX A;  1WJS A;  4BI8 B;  3OW2 A;  4FL6 A;  4QVD A;  2EIF A;  2LVM A;  2I2L A;  1VQM T;  2LNV A;  3A8G B;  1OZ3 A;  4MZT A;  1Q82 C;  1W2B S;  1QVG A;  4Z02 A;  2RK1 A;  2ZPH B;  5LJ3 h;  4ZN3 A;  2M16 A;  5GAN 3;  3M59 A;  3EFR A;  2EJG A;  5GAN e;  2PUO B;  2QI2 A;  1VQ9 A;  4M78 B;  2XIC A;  2YLC A;  1AHJ B;  4C8Q G;  3M56 A;  2DVE A;  3L2V A;  3CCM T;  3RES A;  2LT4 A;  4MMK A;  3PNW C;  2E64 A;  1ZHI A;  2D9T A;  1QP3 A;  3VJP A;  3G7Z A;  4C5H A;  5GMK e;  5L8R E;  3OYI A;  3QXE B;  1KQS A;  5J3B A;  2VGN A;  4F7U B;  3G6E A;  2XD0 A;  2D6F A;  4JS5 A;  4MZM A;  3CCQ A;  2X4J A;  4M7D B;  4PJO D;  2R5A A;  5LJ3 e;  2RHX A;  4M75 D;  2WSC E;  4HCB A;  4M75 E;  3GNF B;  2JZ2 A;  3CPW A;  3OQ5 A;  4MZP A;  1VQ8 T;  2RHZ A;  4BDY A;  1QW1 A;  5LL6 S;  1JRI A;  1DJ7 B;  2PU9 B;  4C92 B;  2R5M A;  3KUF A;  5I2S A;  1YHQ A;  3WXM B;  3OYA A;  3M4G A;  2CZ6 B;  1D3B B;  1UGR B;  3JB9 G;  2RJC A;  4BY6 B;  3CBO A;  2DXT A;  4FSX A;  2M0O A;  3OYE A;  1VQ6 T;  1Y7X A;  4RG8 A;  3CBM A;  2QEX A;  1LJO A;  2XK0 A;  3P8B B;  5GAM d;  4ZN1 A;  3JCM g;  1PSF A;  4IUQ A;  2M1H A;  4V2S A;  4J6Y A;  4GLK A;  3CCL A;  3S6W A;  3QDR B;  2QXF A;  5GAN j;  4QQD A;  2CZ7 B;  4M7A B;  5GAO m;  3SD4 A;  1QVF A;  3BY7 A;  1Q82 U;  2IVW A;  5GAO r;  5HKC A;  3OA6 A;  3JCM f;  5I21 A;  4N4G A;  5M9O A;  1TH7 A;  5GMK j;  3I56 A;  1FXX A;  2E1H A;  2GQV A;  2E6N A;  2R58 A;  1W2B A;  2E65 A;  4WF2 A;  1VQN T;  1UGS B;  2DTI A;  4L59 A;  4O6J A;  5GAN f;  3CCS A;  3T9N A;  3CC2 A;  4JRK A;  1KC8 C;  5LJ3 j;  3OYG A;  1IRE B;  4C8Q B;  1Q81 C;  5LJ3 g;  1RL2 A;  5D6X A;  3J80 E;  1I5L A;  3E9G A;  4J5Y A;  3HFO A;  5GAM h;  3CCU A;  1KD1 C;  2DXU A;  1WQ7 A;  3X26 B;  5CCA A;  4ELY C;  2BUD A;  3JB9 I;  1S72 T;  5KE2 A;  4C0F A;  1WJQ A;  2FHD A;  2DD4 A;  2RO0 A;  1QVG S;  2FVU A;  1VQO T;  4M75 C;  2F5T X;  5LJ3 f;  3OYF A;  2OTJ T;  3M9Q A;  4LDW A;  4EMH A;  3GPL A;  2EFI A;  2JTF A;  3PGG A;  5CK9 A;  2QA4 A;  2RA2 A;  5GMK i;  3H6Z A;  2RM4 A;  2V8K A;  2DIQ A;  1WPY A;  3V7S A;  3V7R A;  5GAO q;  3CME T;  4OB0 B;  2RK2 A;  3G4S T;  2EQM A;  3E9F A;  3MP8 A;  3SWN B;  1VQ4 A;  1XOV A;  4OMF B;  5HK3 A;  1QP2 A;  2KK4 A;  5GAM e;  3A5Z B;  2QQB A;  2VXF A;  5DY9 A;  5I2M A;  1N8R C;  3M54 A;  3CCR A;  2D0Q B;  2DAQ A;  2K3X A;  4M78 D;  3RUX A;  3OYY A;  4LD9 K;  4ZGJ B;  2X35 A;  4M75 A;  2EYQ A;  2VXE A;  1YJW T;  1PSE A;  2MAM A;  1M1G A;  2ZCF B;  3CD6 T;  1BYM A;  3NTH A;  1BI3 A;  3HFN A;  3CPW S;  3QJY A;  4PLI A;  3OS1 A;  1YJ9 T;  3M57 A;  5C0M A;  4NL3 A;  4XK8 E;  1M9S A;  4M75 F;  5J39 A;  4A53 A;  1U1T A;  2DO3 A;  2DXC A;  4F7U E;  3OY9 A;  3E19 A;  1O9S A;  4JLI A;  4X9D A;  2OTL A;  1Y96 B;  2P0K A;  5CQX A;  3FLG A;  1ZBX A;  3QKJ A;  4EMK B;  3CCV A;  2M9U A;  5GAN 4;  3CC4 T;  4M7D D;  4M7D E;  2IG0 A;  3OYM A;  4JRP A;  2JUF A;  3TCJ A;  1H64 1;  4J7I A;  4BE0 A;  1MGQ A;  3X25 B;  4L6V 5;  4BAC A;  2EKO A;  2RHI A;  4O5V A;  2G3R A;  4C92 D;  2CZ1 B;  1RI0 A;  5FU6 B;  1G3Y A;  4KBM B;  4M77 E;  2CZ0 B;  5FU7 B;  3QBY A;  3V8K A;  4C0D C;  2HQX A;  2KVQ G;  4CI0 C;  3JRZ A;  2WSE E;  2LQK A;  2K2V A;  3UPU A;  4IUR A;  3MEU A;  4OGE A;  3MP6 A;  1M5Q 1;  3TRE A;  1H3Z A;  3C4S A;  1BI0 A;  2CYZ B;  2YHT A;  5GAM j;  4ATO A;  4HCC A;  3OYC A;  3HKS A;  2DZC A;  4C5G A;  5GAM g;  1FWZ A;  1X01 A;  4M7A D;  4MML A;  3HRT A;  1BIA A;  2K57 A;  2BIV A;  4FIB A;  4OP0 A;  3CMA T;  1UB4 A;  1N8R U;  2EJ9 A;  3MEW A;  5GAO p;  3FIF A;  4J83 A;  3OBW A;  3ZEH A;  2CGH A;  3CCJ T;  3NTI A;  3FJP A;  3PMT A;  2QQR A;  4PKC C;  2R57 A;  3VYH B;  2XDD A;  3I55 T;  4CRI A;  5GAM f;  3JCM V;  2O4X A;  4J6W A;  1YIT T;  2LQ8 A;  3OYN A;  4M78 C;  1KQ2 A;  2C06 A;  1I4K 1;  1JJ2 S;  4Q5W A;  1VQ7 T;  3G71 T;  2V8I A;  1VQ5 A;  1BIB A;  1YI2 T;  4PJO E;  4C8Q D;  3LW5 E;  2DPP B;  4EPC A;  5IAY A;  2E70 A;  1VQK T;  3LX7 A;  2VC8 A;  4OVA A;  1VQO A;  2OTJ A;  2X4W A;  2PVO B;  2LC4 A;  3L2Q A;  1YJN T;  5EG2 A;  4LD6 A;  3M4Y A;  4BE1 A;  4M7D C;  4B9W A;  4BDZ A;  1G3S A;  1KG1 A;  4E47 A;  3GNG A;  1SSF A;  3OBY A;  4C5I A;  3CCE T;  3DLM A;  1VIE A;  2RHU A;  2LDM A;  5C6S A;  4VUB A;  4C0G A;  1Y07 A;  2VV5 A;  2HAX A;  3AHU A;  3PFS A;  4C92 C;  3OYJ A;  4C0Z A;  5GAO l;  4M77 C;  4M78 F;  4A4E A;  3JB9 H;  1NPP A;  2CS7 A;  4JUV A;  4F7U A;  4C5E A;  3CC7 A;  4A54 A;  3JB9 D;  1Q86 U;  2XKO C;  5FRN A;  4QW2 A;  4M7D A;  3A8O B;  1K73 U;  5J26 A;  5DM7 R;  2HNI A;  1WQW A;  3JCM W;  4F7U F;  2OAU A;  1R8O B;  3P8H A;  5CQY A;  3SB2 A;  3HL8 A;  2JOY A;  1U8R A;  3QII A;  1JBM A;  2XID A;  5GAN 6;  2K3Y A;  4M7D F;  4M7A C;  4PNO A;  3C95 A;  4BD3 A;  2X4Y A;  5GAN 7;  1O75 A;  2MMP A;  3M55 A;  4LDY A;  4M77 A;  2DXB A;  2ZGW A;  5GMK l;  4NS5 A;  1NPR A;  5KCO A;  5LJ5 d;  2DIG A;  4XTX A;  5HK0 A;  3C12 A;  1NZ9 A;  4FT2 A;  3JAM E;  4JS4 A;  4RMO A;  4C92 F;  3HRU A;  1WJR A;  5GMK m;  3ZFJ A;  4M77 F;  1M8V A;  2XDB A;  4N0A C;  2Y4X A;  2JNG A;  4XU0 A;  3FC3 A;  3GP8 A;  3V7C A;  1M90 U;  4PJO C;  2ZPI B;  2RJF A;  3LGF A;  1JJ2 A;  1VUB A;  4C8Q C;  2MI6 A;  1VQ9 T;  3P8D A;  1WGS A;  2E10 A;  4XTZ A;  4BE2 A;  1X75 C;  1VQM A;  2MWP A;  1V29 B;  3LWI A;  3DB3 A;  1HK9 A;  2DK3 A;  3WVE B;  4ELZ C;  4M7A F;  4KUL A;  1UGQ B;  2RI3 A;  4RCC A;  1N27 A;  3G6E T;  3VUZ A;  1FX7 A;  5A0D A;  3BFM A;  3HRS A;  3CCM A;  3CCQ T;  3QSU A;  4N0A A;  3QYG B;  4NOY A;  3V8J A;  1M1K C;  4PJO A;  4M78 E;  3OYH A;  2L3R A;  3X28 B;  4BUG A;  3E1S A;  5LJ5 h;  3N5B B;  3QJ6 A;  1K9M U;  3R6O A;  4OB3 B;  1B34 A;  3MEA A;  4KUI A;  4PJO F;  4ZGE B;  5A0G A;  5CKB A;  4XU2 A;  4C8Q F;  3L2R A;  4D6W A;  4OGC A;  2P0Q A;  1VQK A;  3OS0 A;  5GAN d;  1MHN A;  3UWN A;  1VQ8 A;  2QEX T;  1VQL T;  2JN0 A;  4II1 A;  5KH6 A;  4XTV A;  1P92 A;  1I81 A;  5LJ5 g;  2A3L A;  3VU3 C;  2LRQ A;  3L2W A;  5D6Y A;  3CCL T;  3QG1 A;  5LJ5 e;  5D6W A;  3JB9 J;  5GAO n;  1VQ6 A;  2KSS A;  3PIP A;  2Y4Y A;  2K5I A;  2F5K A;  2WSF E;  2KDS A;  3GLX A;  2ZPE B;  3HHT B;  4C92 E;  4EMK C;  3GIB A;  3OB9 A;  2DZ9 A;  4E7L A;  2VUB A;  3JCM Q;  2MF2 A;  2PVD B;  3L2U A;  3GOX A;  4JLG A;  2FB7 A;  3V8L A;  5CAI A;  5GAN 5;  3OYB A;  3A8H B;  3OSV A;  4IUU A;  3I56 T;  2QQ9 A;  3O8V A;  3OMC A;  3A8M B;  4M77 G;  3LWH A;  3JB9 F;  3UDC A;  1I8F A;  5FLX E;  3FEO A;  1Q86 C;  1G3T A;  2X4X A;  5DLO A;  2KAF A;  2ZZD A;  1K73 C;  3EAE A;  3PT9 A;  5FU7 C;  2Y90 A;  3JCM c;  3CC2 T;  3Q1J A;  1VQP T;  1XNI A;  2K5L A;  3JCM b;  4M7A E;  2EQJ A;  4E7H A;  2O4X B;  3BW1 A;  5CVI A;  3JCM P;  3RER A;  1VQN A;  4FT4 A;  2CKK A;  4QVC A;  3CPF A;  4J8O A;  3QUI A;  4L5G A;  3UT1 A;  5CKD A;  1M1K U;  3HSB A;  3QYH B;  1G5V A;  3ASK A;  1YBY A;  3OS2 A;  5CIU A;  2GFA A;  1GXI E;  1W4S A;  4E7J A;  4RCB A;  2XDP A;  2QA4 T;  4A4F A;  1UEB A;  4C8Q E;  4PL6 A;  4QQG A;  4NL2 A;  4JRQ A;  1S72 A;  1M90 C;  3L1A A;  1X6O A;  2DKG A;  5LJ5 j;  1NJI C;  1VQ4 T;  2WAC A;  3BDU A;  4HKE A;  2L89 A;  3ME9 A;  4XU3 A;  4Y28 E;  4PJO G;  4BB7 A;  3GF5 A;  4LDV A;  3RMS A;  5HY6 A;  5CO7 A;  4M75 G;  4A4G A;  4LDX A;  5CKF A;  3LGL A;  1M4Z A;  2RI2 A;  3X24 B;  4BI3 A;  4DOW A;  2E6Z A;  3CCR T;  3QZ9 B;  3NFC A;  4A4K A;  1KQ1 A;  3G4S A;  4M78 A;  3CME A;  2VGM A;  2XI9 A;  3S3N A;  2JTM A;  3OYK A;  5KE3 A;  2RHY A;  1UGP B;  2E12 A;  1KHI A;  2O01 E;  2RJD A;  5LJ5 f;  3NTK A;  4IKF A;  2JVV A;  4PLL A;  2NLU A;  3QO3 A;  1BI1 A;  2XG8 D;  3VV0 A;  4BY6 C;  1YJW A;  1JB0 E;  2OTL T;  2QQA A;  3L2Z A;  3MEV A;  3RKX A;  3CCV T;  3CD6 A;  4XTW A;  1K9M C;  2GFU A;  4J6X A;  3QPH A;  3M58 A;  1Q7Y C;  1YJ9 A;  2DEQ A;  2PUK B;  2HQE A;  3MO8 A;  4TVR A;  4M77 B;  5KCH A;  1EIF A;  3JCM X;  2RB6 A;  3HP9 A;  2LCL A;  2XHC A;  1N9S A;  4HA8 A;  4MDX A;  4X34 A;  1BKB A;  3CC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...