4C92B

Crystal structure of the yeast lsm1-7 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
SENLYFQGSGSLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92B00
4C8QB 4C92G 2ZGWA 4XU2A 2E65A 3RKYA 2DXTA 5GANg 4M78B 5DY9A 5GAMg 4DQ2A 4M7AF 4J6YA 4PJOG 5CAIA 4M7DF 3RKWA 4F7UB 3JCMX 5GANd 4RCCA 5GAMj 5GAMd 4EMKA 5GAN7 3AHUA 4M7AC 4M7AG 2CGHA 2K57A 3RESA 4J6WA 3RKXA 2RA2A 5GAMe 4PJOD 1MGQA 1U1TA 4C92B 3QSUA 4C8QF 5GANh 3RERA 5GAOn 2DEQA 4M78G 2EJFA 4Y91A 2VXEA 2DKGA 3QHSA 4XU3A 4OP0A 4WF2A 3V8LA 1BIAA 4M77E 1JBMA 3FB9A 3SWNC 4PJOE 3JB9G 3HFOA 1N9RA 4HT9A 4V2SA 4M75D 5GAMf 5GAOr 1LNXA 2E41A 4EMKC 2HNIA 3V7RA 5GAN4 4XQ3A 2E1HA 4XU0A 4C8QA 4XTVA 1HXDA 5LJ5j 1WQWA 1Y96A 2EWNA 4M77C 3EFRA 3INZA 2QTXA 4C8QD 5I21A 1M5Q1 5LJ5h 1WNLA 2RD1A 4A53A 4M78D 3SWNB 5GMKl 3FIFA 4MMKA 4MMLA 1KQ1A 4NL2A 5GAN6 1KQ2A 2EJGA 5GAN5 4M7DG 1U1SA 2VXFA 3QUIA 4J6XA 3JCMg 4X9CA 5GAOq 1I8FA 2VC8A 1WPYA 4M7DD 1B34B 3JCMJ 2DZ9A 2EJ9A 4PJOB 5LJ3f 5GMKh 3JCMd 4F7UG 4M77B 5GMKj 1BIBA 5LJ3d 3JCMV 3VU3C 4A54A 2E64A 4C92C 4EMGA 5GAOp 1LJOA 2DTHA 1X01A 3V8KA 3JCMW 4C92F 4JRIA 2Y90A 2DZCA 2EAYA 1YCYA 2JN0A 4J5YA 4XTWA 4C92E 5GANe 1I4K1 2DTOA 4C92A 4PNOA 3JCMf 5LJ3j 3QO3A 1JRIA 3SWNA 5GAMh 3GIBA 3L1AA 3JCMe 4M75G 1LOJA 3BFMA 3EFSA 2RB6A 3RUXA 1D3BB 2E10A 2I2LA 4EMHA 4F7UA 4F7UE 5LJ5g 3JCMQ 4HT8A 3JCMP 2FB7A 2YHTA 1M8VA 2YLCA 1I5LA 3HFNA 4M78A 1B34A 3L2ZA 4M78E 3V7CA 2DXUA 4C8QG 4M7AD 5LJ5d 5GMKm 4C8QE 5LJ3e 2DVEA 3FJPA 4M78F 5GANj 4XTZA 2YLBA 3V8JA 2DTIA 5GAN3 4JRKA 4M7AE 4M78C 3HSBA 2FYKA 1WQ7A 5GAN8 1H641 2RM4A 3BY7A 4RCBA 3RIRA 4JUVA 4F7UF 4M75E 3M4GA 4XTUA 4M7DB 3JB9J 4PJOC 5GMKe 4M77D 3JCMc 3JB9D 4HA8A 3SB2A 5LJ3h 5GAOl 4PJOF 5LJ5f 1HK9A 4M75C 5GAOm 5GANf 4QVCA 4M77G 4N0AA 5LJ5e 4C92D 4M75F 4XTXA 4PJOA 1TH7A 1D3BA 4M77F 5GAN2 4XU1A 4M7DC 4C8QC 4X9DA 4QVDA 3JB9I 3JCMh 5LJ3g 3BW1A 4NL3A 1I81A 5GMKi 3JB9H 2DJZA 4M75B 4XTYA 3V7SA 3PGGA 4M7AA 4M7DA 4M7DE 3JB9F 4EMKB 3JCMb 3BDUA 1Y96B 4M75A 4NOYA 4M7AB 1N9SA 4N0AC 4M77A 4JLIA
chains in the Genus database with same CATH superfamily
5KYUB 2DILA 5GANg 3UA6A 1S72T 5KYUA 1NM7A 1VQ4Q 2CZ0B 2KI7A 1VQ8T 4BB7A 3GF5A 4L6V5 5GAOn 5HK0A 3OYGA 4K11A 1M90U 4OMNA 1N5ZA 1BI1A 2RHYA 3RDVA 1N9RA 2DL7A 2EQUA 1QKWA 1M2OA 1K8AU 2QGGA 3CBPA 2GNCA 4JJCA 5I22A 3INZA 1NPRA 1VYTA 2OAWA 4ATOA 4YTLA 1OV3A 3VS3A 1FYNA 4OMQA 5IHNA 3SWNB 3J7AF 1ZLMA 2EJGA 3OYNA 2ZPEB 2CZ1B 2XDPA 3A8MB 4J9DA 3CCRT 3VU3C 3JCMV 2BZXA 2RQTA 3JCMW 2P4TA 2XMFA 3I35A 2J6OA 4JRIA 1QWEA 3CCUA 1SPKA 4KT0E 2LRQA 3QSUA 1JB0E 3A8LB 4C92E 3RNJA 4PNOA 5LJ3j 1X6BA 1BU1A 2MCNA 2XKOC 1SRMA 2CZ6B 3PMTA 2JMAA 1X27A 2LCLA 3PVQA 3CCET 3NTKA 4BE1A 4J9BA 1YITT 2HMAA 2M51A 2AKKA 2CKKA 2HDAA 2M16A 4B9XA 3QWYA 4ZGJB 1JXMA 1YITA 2LQWA 2G6FX 2J7IA 3TSZA 1YWPA 2XG8D 4PJLA 1M27C 2GQVA 4OMLA 3CXCP 2ZAEA 5GMKi 4X1VA 5CQXA 2DJZA 3LYIA 3EG9A 1HD3A 1QCOA 4J7IA 3OYKA 1SHGA 4C8QB 2C06A 2ZGWA 3IQLA 3GLXA 2AIRB 1ZUKA 2CP0A 4CC3A 5GAMg 2GFAA 1YJWT 1D0YA 3RMSA 4M7AF 2EQKA 2QTVA 5GAMd 3CCJQ 2DPPB 1TU0B 1MGQA 4B9WA 3HL8A 4F14A 1AVZC 4EIKA 2DKGA 2ABLA 3GP8A 3HPWA 2OX7A 3ASKA 1VA7A 2V8IA 3CCSA 1M1KC 2C0TA 1G83A 2FG0A 2E6ZA 3V7RA 3OYHA 1HXDA 1KG1A 5I21A 3LWIA 2EVRA 3RBBB 4BI3A 1KQ1A 1CSKA 1U1SA 3CCST 3H0IA 2L2PA 2VB6A 3NTIA 2BTTA 1O75A 1T0HA 1WI7A 2RI5A 3CC7A 6AT1B 2F2WA 2JMCA 2D8JA 4JPBW 1VQMT 2KVQG 1VQPQ 1IXDA 1ABOA 1AOJA 3CPFA 1K9AA 3CD6A 3QG1A 3VS7A 3UWNA 2DFUA 2YSQA 3FJPA 1KD1C 3V8JA 2QQBA 5FLXE 2KROA 1KHCA 1VQ9A 2JTMA 4KRTA 3JB9J 3EHQA 5LJ5f 4DOVA 3JSCA 1D1CA 4D8DA 2DEUA 4PLLA 1I1JA 4DBHA 2ZPGB 2RF0A 3JB9F 4EMKB 1V76A 1BCMA 2FRYA 4DEYA 2KGTA 3R6NA 2H3EB 3GNFB 1VYUA 4XU2A 3L2WA 4KH0B 2NUPB 3HRUA 5M9OA 2KYMA 2CP6A 4A4KA 4AFUC 1EZZB 1RLQC 3ULRB 2GFUA 4DBRA 4PJOD 1AWJA 1FWZA 2DE0X 2LCSA 3BE3A 2JNGA 4CRIA 4M77E 1VQOT 4FYXB 4GLMA 2LQNA 2PZ1A 1VQ5T 2E41A 5FU7B 4CI0C 3VV0A 1KFZA 1IHVA 2EWNA 2HD0A 5LJ5h 3X24B 1K8AR 2LZ6B 2B8AA 1NJIC 1KD1U 4A63B 1TS9A 1ACMB 2ROTA 5J3BA 2K2MA 5GMKj 3EG1A 5CK9A 3CC7Q 1AT1B 2QQAA 1GCQC 1NJIU 3M54A 3I9QA 3WVEB 1X43A 3OYCA 1RAFB 2DD4A 5ECAA 2GQIA 1B34A 3J81E 4LD6A 4PJMA 5KE2A 2JOYA 1HYOA 2EKOA 1M30A 4ZN1A 1NYGA 1H641 4RCBA 1WHLA 2RO0A 5HK3A 1YI2Q 5CKDA 4HA8A 2L3PA 1WZOA 1VQLQ 1SSFA 5IN1A 1Q81C 1E6GA 2FHDA 2A7YA 4ORZA 4MDWA 4EDUA 7AT1B 3EG2A 4AFZC 3CPWS 5HKCA 2HKNA 3QDRB 3RKYA 4OB0B 1SKUB 2L3SA 1LPLA 2RI3A 2PTKA 5GAMj 4M7AC 5A2QE 3O8VA 4DOWA 5IH2A 1NJIR 4JJNK 1VQNA 1YITQ 2EGAA 2VKNA 2RNAA 2BZ8A 1VQOQ 1W6XA 1JEGA 2MWOA 4GBQA 4OP0A 4BACA 1A0NB 1M8MA 3M0QA 3OYJA 1TUCA 4M75D 3VUZA 2A36A 1OU8A 4KGXB 1K9MC 4XQ3A 1GBRA 2WSCE 1NG2A 5LJ5j 2RJCA 1ZA1B 1VQ6Q 1YI2T 3M57A 1VQ7Q 3HTRA 1ZHIA 4MMLA 1VUBA 1UG1A 1AHJB 4NS5A 1SEMA 2MK5A 3VYHB 3CCUQ 2K79A 5KE3A 4FU6A 5GMKh 3JCMd 1H3ZA 2E3HA 4QKUA 1YJWQ 1Y0MA 2CZ7B 2QK0A 3OW2S 2CH4W 3CCJT 1PG5B 1WFWA 3JCMf 2HL5C 3N5BB 3BFMA 1XOVA 2V1RA 2ZZDA 1M1GA 3OYEA 1MV0B 3REAB 1HSQA 2FRWA 4P5NA 5DM7R 4IUQA 4C8QE 2VWFA 5LJ3e 4BUGA 2A3LA 4PFZA 3I55A 5FW9A 1D1BA 3DLMA 2P0KA 5J39A 4N4IA 2DXCA 3EGUA 4JJBA 1K1ZA 3VJPA 1T3LA 4ZGDB 4PJOC 3OYFA 1SRLA 3JCMc 4VUBA 5GANf 3M55A 1K8AC 1D3BA 2BKDN 1G3YA 1MV3A 5LJ3g 1NBEB 1R77A 3OMGA 2LJ3A 1GRIA 3H8ZA 2KDSA 2EYZA 3BDUA 2QEXA 4M75A 2LQKA 1QWFA 1TUDA 4C92G 5IAYA 3L2QA 2O9SA 3HRTA 4DQ2A 1WIEA 4O6JA 1UGPB 4AG1C 2MAMA 2K57A 3KXTA 1W4SA 1VQ4T 1NLPC 4Y91A 4IIOA 1MMGA 1VIEA 2CUBA 4IKFA 3CCMQ 2HKQB 1FMVA 1YN8A 2DBMA 5GAOr 2F5KA 4XU0A 4C8QA 2NUZA 4RKUE 3OS5A 2DETA 1DJ7B 4X34A 1PM3A 3H6ZA 3CC2A 2YUOA 2J05A 2C0OA 5GAOq 2IPOB 4M7DD 1QCNA 1X2KA 2CS7A 3CMAA 2EJ9A 4D8KA 2KRMA 4II1A 5GAOp 3M0UA 1JJ2S 1PRMC 1YCYA 1WJSA 2DTOA 3CC2T 3L1AA 3M5AA 4M75G 3REBB 2QQSA 1UE9A 2L89A 3CCEQ 3L2UA 3M58A 1M8VA 3OW2P 3S6WA 3EFOA 4OF1A 1Q86R 3ZL7C 1QVFA 2BZYA 3OBYA 4RTXA 2DVJA 3OQ5A 2HSPA 3OA6A 1VQ5Q 2LT4A 3G71Q 1Y57A 4KUDK 4JZ3A 2QDLA 2PNIA 3MJXA 1HK9A 4C0FA 1QVFS 2QA4T 1ZBJA 2J6FA 2A08A 1QMCA 5I11A 3G6EA 3BW1A 1AWOA 2O9VA 4GY5A 3VS0A 2FPEA 2VUBA 4PLIA 1QP2A 1VYVA 1UJYA 2P84A 3OYAA 1NPPA 5CKEA 1YJNT 2VVKA 1GFDA 1YHQQ 2DL4A 5IHKA 3RKWA 4J9EA 4RCCA 1YBYA 4FYVB 3G6EQ 4M7AG 2RI2A 1U1TA 3TREA 3I56T 3HHTB 4BD3A 4FW1A 3NGPA 4LD9K 2DEQA 3UA7A 4DA4A 1F1BB 1X6GA 1GL5A 4N4HA 4LDWA 4J7FA 5HCKA 2QQ9A 3PIPA 2F1LA 4AMCA 1RUWA 1WDXA 2RJFA 1JO8A 3MP1A 1PCXA 1PD1A 1C0MA 2H8HA 4RTTA 1MUZA 5GMKl 2XHCA 1AEYA 2XIDA 4E7ZA 2YWWA 4ZN3A 4J6XA 1VOMA 4DBQA 3LX7A 2VC8A 1WPYA 4RMOA 4FL6A 2YRCA 4RTUA 1FMKA 1BCOA 1X75C 2KR3A 5CIUA 1UHFA 4J9HA 2CT3A 1H92A 2KYBA 2X4WA 4ZTFA 1S72Q 1XQHA 2HQXA 1VQPT 4M78E 1ZSZA 4PJNA 5FU6C 4Y92A 1SF9A 3T9NA 2KT1A 2BUDA 3HSBA 2RM4A 4Q5WA 5D7UA 2QAZA 4PK4A 4OB2B 3MO8A 3L2VA 5LJ5e 2CP7A 5I2SA 3TEEA 3SEMA 3VKIA 4XU1A 2R5MA 3M59A 2ECZA 3R6OA 4OB1B 1QVFP 3VRYA 1GCQA 2ENMA 1UTIA 4HXJA 4M75B 3V7SA 3PGGA 2ZCFB 3FC3A 4F16A 3A98A 5FU7C 2X4YA 3E19A 1YHQT 1M1KU 5A0GA 1K0XA 2E5QA 4PJOG 5GAN7 1UECA 4JS4A 2RN8A 2LNVA 2RJEA 2JM8A 4FSXA 1Y07A 3SFMA 2EJFA 1YHQA 4XU3A 3VS1A 3H41A 1SG5A 1M4ZA 2X3WD 2SRCA 4HVWA 3J80E 1KC8C 3OSSC 2ZPFB 3QIIA 3UT1A 2EBPA 1M5Q1 1TSFA 4A53A 1PKTA 1YFNA 4JS5A 2DJQA 4CC4B 3ME9A 2EYWA 2DMOA 3CCVT 3P8DA 3EGXB 3CC7T 2EAYA 3OYDA 1U8RA 1AZEA 5GAMh 4ANJA 2HCKA 3MHXA 4F7UA 1PC0A 4HT8A 5CVIA 3KFVA 1VQMA 1ZQ1A 9ATCB 2FL7A 3V7CA 2OTLA 2XU8A 2MIOA 2DVEA 1BI3A 3JV3A 4M75E 1B07A 1WA7A 3G4ST 4ZTJA 4ZNXA 3PTAA 2COWA 4WTOB 2DIQA 4C92D 2KXCA 3KUFA 4XTXA 1IZ6A 4X9DA 2MYSA 3PE0A 3CMET 2Y4YA 2DIGA 2C0IA 4M7DE 2EIFA 1S72A 4NOYA 4E2FB 1RAAB 3OS1A 5EC7A 1KC8R 3F70A 3U23A 4JJDA 4M78B 5DY9A 3PIOA 2V8KA 1LCKA 3DKMA 2J6KA 4E7SA 4OMOA 2KRNA 1UDLA 1VQMQ 2DF6A 4C5HA 2RA2A 2MWPA 4XK8E 3QZ9B 1N8RU 4C8QF 3RERA 2D0NA 2YT6A 4M78G 3FJ5A 4J83A 1PSFA 3V8LA 1BIAA 2O31A 1WX6A 3VUBA 3E9GA 3S3NA 3D7SB 4E7IA 2JM9A 2QTXA 4MMKA 2LC4A 4NL2A 5FRNA 2KBTA 2FEIA 1ZSZB 2QG9B 1O9SA 4A4FA 1QLYA 1T0JA 1FMWA 4QQGA 4PJOB 3TQ7P 3CMEQ 1OZ2A 4R55A 1VIFA 3CCRQ 2QI2A 5GANe 4C92A 2ED0A 1K73C 1YWOA 2HSEB 1RADB 3C12A 1NEGA 1D3BB 2E12A 2E10A 2I2LA 3JCMQ 1K9MU 2EQMA 3L2ZA 4C8QG 1PHTA 2A0FB 5LJ5d 5IXBA 4QVZA 3MP8A 3CCJA 4M7AE 2HAXA 2FYKA 5GAN8 3RR6A 1C1AA 2YRVA 1CKBA 1WHMA 4M77G 2W10A 1WHKA 3M0PA 1M9SA 4L5GA 1RAHB 4FYWB 4NL3A 4RUGA 4RTZA 2K3BA 4RTVA 1PSEA 4RG8A 2E6NA 3JCMb 1YCSB 4DEXA 3HRSA 5LL6S 5CKHA 4FIBA 1G5VA 4AFQC 2CDTA 2M0YA 3CPWP 3A8HB 1JU5C 1HJDA 3LGFA 4M7DF 2RPNA 2KE9A 5GANd 1W70A 3FLGA 4BY6B 4D6WA 1YNZA 2CGHA 2M9UA 2EQJA 2QQRA 2WSEE 2EGEA 4B6MA 2CT4A 1RL2A 2F5TX 2JXBA 1UHCA 4KGVB 2RHZA 4QQ6A 4C0DB 2YUPA 1KD1R 3JB9G 1WXBA 1D0XA 4M4ZA 2QYZA 3CCMT 3NFCA 4AFSC 2FVUA 3OYIA 4M77C 3EFRA 1PNJA 2RHIA 2CP5A 3META 1OX9A 4OMMA 3MKDA 2RMOA 1VQ9Q 4M7DG 2YUNA 1MMNA 3JCMg 1YI2A 5GJVB 2DBKA 4J9CA 3EG3A 3NHNA 1Q7YC 2DZ9A 1ZUYA 5I2MA 4C92C 3SD4A 2XDBA 3CCQA 4A4HA 2PVGB 2DL5A 3E1SA 1RAGB 5KYWA 3AT1B 4KBMB 2QXFA 1U5SA 2K3XA 1Q95G 4AT1B 2KQWA 5KYXB 1JJ2A 1IRXA 1QP3A 2AHJB 4DBFA 2RQUA 4R0KA 4XTZA 2DRKA 2YLBA 4ELYC 2DTIA 1WGSA 4JRKA 3OYLA 4O5VA 3C4SA 2X3XD 3M4GA 3P8HA 4CC7A 2JZ2A 1OQKA 1KIKA 3P8BB 2WACA 1OX8A 5LJ3h 4PJOF 5GAOm 4A4EA 4MDXA 1Q7YU 2D6FA 2VGNA 4M77F 5GAN2 2O4XB 1VQ6T 2COYA 3KBGA 2JJ9A 4ME7A 2Z0WA 1BKBA 1NEBA 5A0DA 3DB3A 3WVDB 2PUOB 1YJNQ 1NLOC 1KJWA 3G6ET 3CCLA 1VQ8Q 1K73R 2E4HA 1BBZA 2I0NA 3LLRA 2NYSA 2CP3A 5GAMe 3FEOA 5KYYB 1N6AA 1OULA 1ZBXA 2V8JA 5CKBA 2V1QA 5J26A 3DLLA 1RI0A 1V29B 1VQ5A 4PJOE 1OPLA 2M02A 3OMCA 1ZUUA 5GAN4 1EX4A 1Y96A 2EFIA 1GXIE 3QDFA 1MNEA 2RD1A 3I5RA 3FIFA 1KQ2A 2ED1A 1I5OB 1YJ9A 4OMFB 2D0QB 2X4XA 4IUPA 1VQNQ 1B34B 1AZGB 1M2VA 2NUTB 2ZPIB 3EH1A 3QJYA 3OW2A 2QASA 3M0RA 2P4RA 2F2VA 1VQKT 3CMAT 2DZCA 2JN0A 4J9GA 3CD6Q 1JRIA 2RHXA 4QW2A 3GIBA 3CC4T 3EFSA 3OS0A 2RB6A 1KQSP 4EPCA 1IGUA 2MOXA 1FX7A 3HFNA 4LDXA 2DXUA 4M7AD 2GBQA 8AT1B 1H8KA 1ZA2B 4HCZA 2BE9B 1OEBA 2LTOA 3X28B 2DL3A 3BY7A 4M7DB 3UATA 3A8OB 2KRSA 1TOVA 1YIJA 2FPDA 4IIMA 5GMKe 3CBMA 3X25B 5KCHA 1SSHA 1VQPA 3PFSA 1QVGP 2OJ2A 2PVOB 1MHNA 2PUKB 2DRMA 5KYNA 4BDZA 3VS5A 4JRPA 3QBYA 2GGRA 1KSWA 2BE7D 4J9IA 1Q82R 3THKA 3CCSQ 4LN2A 2LP5A 2QEXQ 4BDYA 3ZBDA 4M77A 1WXTA 2EYYA 1RLPC 2KXDA 1Y7XA 4XAXB 4JZ4A 3MEVA 1N8RC 1OZ3A 2X9HA 3RKXA 1YJWA 4OGEA 2XICA 3RMQA 5KCOA 1Q81R 4LDYA 2EYQA 3QYHB 2VYTA 2NWMA 2D9TA 3SWNC 2O01E 1JBMA 4HT9A 2L3QA 5AYFA 3M53A 2M0OA 3O5ZA 1N27A 3ER0A 4IUVA 3G71T 4E7LA 4ESRA 5C6SA 2K4YA 2E5KA 4M78D 2QA4Q 1P92A 1GCPA 1K76A 2KAFA 3GPLA 1I8FA 3QYGB 1VQ7T 1K0SA 3EFOB 1M90R 4A4GA 3V8KA 2L0AA 4C92F 5IT9E 3H9NA 3JRZA 4XTWA 2JTFA 1VQ7A 1J3TA 1LOJA 4FYYB 2QDYB 3CCVA 2FB7A 1I5LA 1X6OA 1D09B 2GTOA 1TG0A 1QQJA 2LDMA 3M0SA 4M78C 3G4SQ 2BIVA 2DYBA 3OYBA 5IXFA 3A1PA 5GAOl 4Z88A 2OAUA 4QT7A 1VQ9T 3X26B 5D6XA 2FZCB 3LGLA 4C8QC 2NLUA 1TUGB 3C0CA 3OSVA 2QEXT 2EQIA 4HCKA 3FDRA 4C5IA 1IREB 4M7DA 1Z9QA 2OTJT 1G3WA 3SHWA 2DERA 1T3SA 1ZSGA 3L2RA 3GOXA 2XK0A 4N0AC 3NPFA 2RK1A 3EG0A 2E65A 1VQ8A 4J6YA 1ZSZC 5CAIA 1VQ4A 1Q86U 2L3RA 2OTJA 2LNHB 2RQWA 3EG9B 2M1HA 4ZGEB 1S1NA 2AT1B 3QZ5B 1UGVA 2VXEA 3EGXA 4HVUA 1E7OA 3M56A 3PVLA 1JXOA 3M0TA 3QPHA 2RH2A 1BYMA 2HNIA 2RQVA 2DO3A 4KULA 4PL6A 2SEMA 1PKSA 4AG2C 3Q1JA 1IB8A 1WJQA 1AWWA 3TCJA 1PWTA 2LX9A 1BIBA 3G7ZA 3OY9A 2DTHA 1BI0A 2IIMA 3CCQQ 2HEQA 2FZGB 3CEYA 1V1CA 4J5YA 2JUFA 3QO3A 2DK3A 2PVDB 4FM4B 2CSIA 3CCEA 4LDUA 4F7UE 4EMHA 1WHJA 2ESWA 3VS4A 1K4US 2YRDA 2DL8A 2DAQA 4M78F 2AZSA 3MPUB 2CP2A 1ABQA 1UB4A 4F7UF 3URGA 4M77D 4BY6C 2DM1A 5FU6B 2LJ0A 3G4SA 1TH7A 5CO7A 2O2OA 3PNWC 4QQDA 4C0DC 5DLQE 5A0LA 4N4GA 3H0HA 4XTYA 3CMAQ 2HQEA 3M4YA 1YJNA 3CC2Q 3NMZC 2X35A 2QGFB 2A28A 4LXCA 2EKHA 1OPKA 5KYXA 2MMPA 3I56A 1QVPA 5KYWB 2AKLA 3AHUA 8ATCB 3RESA 4OVAA 4E7HA 4KUIA 4C92B 2F2XA 1YP5A 1EFNA 4E6RA 2DXBA 1Y71A 1UUEA 3GNGA 1LVKA 3NTHA 1OYXA 2P0PA 4PFOA 3MEWA 2ATCB 2MF2A 1MNDA 4E7JA 3CCRA 3MEUA 5IHIA 4XTVA 2CSQA 2K7AA 4FSSA 4C8QD 3FRNA 3CCUT 5GAN5 2O4XA 2YXYA 1Q82U 1QKXA 1BK2A 1RAEB 1WHGA 2LT1A 3C95A 1X01A 1OU9A 3E9FA 3SWNA 1K73U 2RK2A 3LH0A 1D1AA 1XJWB 3MCAB 2YLCA 4LE9A 2ZPHB 3PMIA 5GMKm 3A5ZB 1IHWA 1OI1A 5GANj 5GAN3 2CREA 1M1KR 2K3YA 1CKAA 4HCCA 1QCFA 1SHFA 2K5IA 2ROLA 1PRLC 3I55T 3JB9D 4FCYA 3JAME 4N0AA 1G3TA 2JS0A 2EW3A 1NE8A 1M2VB 2NUTA 3EAEA 3LH5A 1W2BS 3L42A 5CQYA 2D8HA 3MP6A 4OMPA 1H3HA 1U06A 1ZX6A 2CH4A 2FO0A 4M7AA 1FXXA 2K5LA 2LVMA 4M7AB 4F04B 1YJ9Q 1UGRB 1G3SA 1VQ6A 1UGQB 3S3MA 5CCAA 4Z89A 3S3OA 4F7UB 3JCMX 4J6WA 5FROA 1WLPB 2HL3A 5KYYA 4JDSA 1M1FA 2G3RA 2FPFA 3VRZA 5CR2A 1ARKA 2P0QA 3X20B 1XNIA 1UGSB 4V2SA 4BI8B 5GAMf 2DLPA 2EYXA 1LNXA 2PU9B 2E3IA 2F69A 1TTHB 2V26A 3CCMA 1WNLA 3BDLA 4E47A 5GAN6 4HVVA 3HP9A 2AZVA 4J9FA 2HZYA 4HKEA 5LJ3d 1E6HA 3E2UA 1UJ0A 2E64A 4A54A 3CD6T 4WCIA 1LJOA 2WSFE 2PQWA 2ZPBB 4J8OA 2FZKB 3CC4Q 2K6DA 5D6WA 2K9GA 3G1JA 1YJ9T 2MI6A 1G8XA 2XI9A 2DD5A 1U3OA 2OTLT 2MPXC 4FW2A 3PT9A 3ZEHA 4R56A 1R0CB 3JCMP 1Q81U 2YHTA 3HKSA 4M78A 4OB3B 3MEAA 4TVRA 3TU4K 1RAIB 3OYMA 1B3QA 3I55Q 1WQ7A 4LDVA 3CC4A 3RIRA 4C0GA 4L59A 3LWHA 3SB2A 3VS2A 1WYXA 3OB9A 5FWBA 1XTDA 1X2QA 1YIJQ 4QVDA 2JVVA 2DX1A 3JCMh 2R5AA 4KH1B 1M90C 3JB9H 1W2BP 5L8RE 3LW5E 2Y4XA 4KGZB 4RTYA 1K9MR 2NUPA 2DXTA 1C6VX 5D6YA 3WXMB 2DYIA 5GJWB 3QWXX 1UFFA 2D1XA 1VQOA 3I56Q 4EMKA 2COZA 3CCLT 2DNUA 2LQ8A 5GANh 1Q7YR 4IUTA 3QHSA 2LX7A 3EGDB 4WF2A 2VASA 3HFOA 5L23A 2LCCA 1M3AA 3EHRA 4EMKC 2LMJA 1WHHA 1TXQA 2E1HA 2CYZB 4GLKA 3CPWA 3QKJA 2AK5A 2JT4A 4MZMA 4Z8AA 2VXFA 3QUIA 4MZTA 1AWXA 1R0BG 4X9CA 1RI9A 1TWBA 2IG0A 4Z02A 3JCMJ 1Q82C 5LJ3f 2B86A 2H3JA 1G2BA 2K2VA 4M77B 5EG2A 4F7UG 1KQSA 2HQHA 2KMTA 4FT2A 2L8DA 1W1FA 2EPDA 2VGMA 2XD0A 5FRMA 2Y90A 3OS2A 2OTLQ 1I4K1 1VQKA 3JCMe 3SDZA 3VS6A 3RUXA 1NZ9A 1KC8U 1VQLA 3CQTA 4LNPA 2CUDA 3UDCA 2EGCA 2HBPA 4HCBA 2GF7A 3CCLQ 5AT1B 1KQSS 1QVGA 2JTEA 4BE0A 2X4JA 3UPUA 1BB9A 5HY6A 4BE2A 4XTUA 3H0FA 5CKFA 1IO6A 1Z9ZA 3TVTA 1AD5A 1M3CA 2R58A 2KK4A 1VQLT 1KHIA 4RTWA 4FT4A 4OGCA 3EH2A 2JW4A 4QVCA 1YIJT 4LUEA 1RACB 4M75F 4PJOA 3EGDA 4F17A 2X51A 3OYYA 4C5EA 1OOTA 1I81A 4ELZC 1QVGS 3OBWA 1GFCA 1WXUA 2KEAA 1VQNT 1N9SA 3GBQA 4JLIA 2OTJQ 3DB4A 3TSWA 3CBOA 1VQKQ 4C0ZA 2KSSA 1I07A 4RG2A 1KK7A 2L5QA 2E70A 3VYGA 1JQQA 2RJDA 4PKCC 5DLOA 2LJ1A 4BI4A 1PD0A 3FB9A 1X69A 1RABB 1D0ZA 3A8GB 1I0CA 1WJRA 4UC4A 2JS2A 4MZPA 2YDLA 1WQWA 3QXEB 4LUDA 2YUQA 4JRQA 3G71A 2VV5A 3CCVQ 1Q86C 1JJ2P 1BI2A 3CCQT 2RHUA 4EMGA 3ZFJA 2XDDA 4IUUA 1NYFA 2O88A 2KT8A 5LJ5g 2HBWA 1EIFA 2RQRA 1IGQA 3UF4A 5C0MA 3QJ6A 2IVWA 2KNBB 5KH6A 4CC2A 3CXCA 2KY9A 4C5GA 4Y28E 1R8OB 1MMAA 4IURA 2A37A 1GBQA 2GCXA 1B7TA 2OI3A 4JUVA 2QA4A 1QW1A 1MMDA 1UEBA 4PJJA 2GTJA 4M75C 1W2BA 3CXCS 3I5SA 1M3BA 2R57A 1N8RR 2W0ZA 4M7DC 2J06A 5FWCA 3JB9I 4E7KA 3M9QA 4JLGA 3C94A 2K5FA 4PFPA 1Y96B 3CMEA 2DA9A
chains in the Genus database with same CATH topology
4C92G 4FIBA 1G5VA 5IAYA 5GANg 1S72T 3L2QA 2MMPA 3HRTA 3A8HB 4DQ2A 4O6JA 1UGPB 3LGFA 4M7DF 3I56A 1QVPA 3OYEA 5GANd 2CZ0B 3FLGA 4BY6B 2MAMA 4D6WA 3AHUA 2CGHA 2QQRA 2K57A 2EQJA 2M9UA 2WSEE 4OVAA 3RESA 4BB7A 4E7HA 1VQ8T 4KUIA 3KXTA 4C92B 1W4SA 1VQ4T 3GF5A 4L6V5 5GAOn 5HK0A 1RL2A 2F5TX 3OYGA 1M90U 4Y91A 2RHZA 1VIEA 1BI1A 4IKFA 2DXBA 2RHYA 1Y71A 4QQ6A 4C0DB 3GNGA 3NTHA 3JB9G 1N9RA 2EQUA 1OYXA 2P0PA 5GAOr 3MEWA 2F5KA 2MF2A 3CCMT 1K8AU 3NFCA 2FVUA 4XU0A 4C8QA 4E7JA 3OYIA 3CCRA 3MEUA 4XTVA 3CBPA 4RKUE 4M77C 3EFRA 3INZA 1NPRA 4C8QD 2RHIA 3OS5A 4YTLA 4ATOA 3META 1DJ7B 3FRNA 3CCUT 4X34A 3SWNB 3J7AF 4M7DG 2EJGA 5GAN5 3H6ZA 3CC2A 3JCMg 3OYNA 5GAOq 1YI2A 4M7DD 2ZPEB 2O4XA 2CZ1B 2XDPA 1Q7YC 2CS7A 3CMAA 2DZ9A 2EJ9A 1Q82U 3A8MB 5I2MA 3CCRT 3VU3C 3JCMV 3SD4A 4C92C 4II1A 2LT1A 5GAOp 3C95A 1X01A 3JCMW 2XDBA 2P4TA 1JJ2S 3E9FA 3CCQA 4A4HA 4JRIA 3CCUA 2PVGB 4KT0E 2LRQA 3QSUA 1YCYA 1JB0E 3A8LB 4C92E 1WJSA 2DTOA 3CC2T 4PNOA 5LJ3j 3SWNA 1K73U 3L1AA 3M5AA 4M75G 2QQSA 2RK2A 3E1SA 3LH0A 2L89A 4KBMB 2QXFA 2K3XA 2XKOC 3L2UA 2CZ6B 3M58A 3MCAB 2YLCA 1M8VA 3S6WA 3PMTA 2KQWA 1JJ2A 2LCLA 2ZPHB 3CCET 3PMIA 4OF1A 5GMKm 1QVFA 3NTKA 3OBYA 1QP3A 2AHJB 3A5ZB 4BE1A 1OI1A 5GANj 4XTZA 4ELYC 3OQ5A 2YLBA 1YITT 5GAN3 2DTIA 1WGSA 4JRKA 3OA6A 2K3YA 3OYLA 4HCCA 4O5VA 3C4SA 2LT4A 3M4GA 3P8HA 4KUDK 2K5IA 2JZ2A 3P8BB 3I55T 3JB9D 2CKKA 2WACA 5LJ3h 4PJOF 2M16A 1HK9A 4C0FA 4A4EA 5GAOm 3JAME 2QA4T 4B9XA 4N0AA 1QVFS 1G3TA 4MDXA 1Q7YU 2D6FA 4ZGJB 1NE8A 2VGNA 3EAEA 4M77F 1W2BS 3L42A 1YITA 5CQYA 5GAN2 2O4XB 1VQ6T 2XG8D 3MP6A 3G6EA 3KBGA 2GQVA 3BW1A 4ME7A 4GY5A 1BKBA 5GMKi 5A0DA 5CQXA 2DJZA 3LYIA 4M7AA 1FXXA 2VUBA 4J7IA 3DB3A 2K5LA 2LVMA 1QP2A 4PLIA 3WVDB 4M7AB 3OYKA 2PUOB 1UGRB 4C8QB 2C06A 2ZGWA 3GLXA 1G3SA 5GAMg 3OYAA 2GFAA 1VQ6A 1NPPA 1UGQB 5CKEA 3G6ET 3S3MA 1YJNT 1YJWT 3CCLA 3RMSA 5CCAA 3S3OA 4M7AF 3RKWA 4F7UB 3JCMX 2EQKA 3LLRA 1YBYA 4RCCA 5GAMd 4M7AG 2DPPB 2RI2A 4J6WA 5FROA 3FEOA 5GAMe 1MGQA 4B9WA 1U1TA 3TREA 1N6AA 3HL8A 1ZBXA 3I56T 2V8JA 3HHTB 4JDSA 1M1FA 4BD3A 2DEQA 5CKBA 2G3RA 4LD9K 2DKGA 5J26A 4DA4A 3DLLA 1RI0A 1V29B 4N4HA 5CR2A 3GP8A 2P0QA 3HPWA 4LDWA 3X20B 3ASKA 1VQ5A 1XNIA 2V8IA 1UGSB 3CCSA 1M1KC 4J7FA 4PJOE 4BI8B 4V2SA 3OMCA 5GAMf 2QQ9A 3PIPA 1LNXA 2E6ZA 2PU9B 5GAN4 3V7RA 3OYHA 2F69A 2RJFA 1HXDA 3MP1A 1Y96A 1KG1A 2EFIA 5I21A 3LWIA 1GXIE 3CCMA 1WNLA 2RD1A 3BDLA 5GMKl 2XHCA 3FIFA 1KQ2A 4BI3A 1KQ1A 2XIDA 4E47A 5GAN6 4ZN3A 1U1SA 1YJ9A 4J6XA 4OMFB 3CCST 3LX7A 2D0QB 1WPYA 2VC8A 2X4XA 4IUPA 4RMOA 4FL6A 3HP9A 1B34B 3NTIA 1O75A 3CC7A 2RI5A 2ZPIB 4HKEA 5LJ3d 4A54A 2E64A 3CD6T 1X75C 5CIUA 1LJOA 2WSFE 3QJYA 3OW2A 3CMAT 1VQKT 2PQWA 2ZPBB 4J8OA 2DZCA 5D6WA 2JN0A 1YJ9T 2MI6A 1JRIA 2RHXA 4QW2A 2KVQG 1VQMT 2XI9A 2DD5A 3GIBA 3CC4T 3EFSA 3OS0A 2OTLT 2X4WA 2RB6A 4ZTFA 4EPCA 3CPFA 3PT9A 3ZEHA 1FX7A 4R56A 1Q81U 3JCMP 1XQHA 2YHTA 3HKSA 2HQXA 1VQPT 3HFNA 4M78A 3QG1A 4OB3B 4M78E 3CD6A 3MEAA 2DXUA 4LDXA 4M7AD 3UWNA 4TVRA 5FU6C 3TU4K 3FJPA 1KD1C 4HCZA 2QQBA 3T9NA 3V8JA 2BUDA 2LTOA 5FLXE 3OYMA 1K9MU 3HSBA 1WQ7A 4LDVA 2RM4A 3BY7A 4Q5WA 3RIRA 1KHCA 3X28B 3CC4A 1VQ9A 4M7DB 3A8OB 1YIJA 2JTMA 3JB9J 5GMKe 4C0GA 4L59A 3CBMA 4OB2B 3X25B 5KCHA 3LWHA 3SB2A 3MO8A 3L2VA 1VQPA 5LJ5f 3PFSA 4DOVA 5LJ5e 2PVOB 3JSCA 1MHNA 5I2SA 3TEEA 2PUKB 3OB9A 3VKIA 4XU1A 1XTDA 4QVDA 2JVVA 4BDZA 4PLLA 4JRPA 2R5MA 3M59A 3QBYA 3R6OA 3JCMh 4OB1B 2ZPGB 2R5AA 1M90C 3JB9H 4M75B 3V7SA 3PGGA 2ZCFB 3FC3A 3JB9F 5FU7C 4EMKB 4BDYA 5L8RE 3ZBDA 3LW5E 2Y4XA 4M77A 2X4YA 3E19A 3GNFB 1YHQT 4XU2A 3L2WA 1M1KU 1Y7XA 2DXTA 5D6YA 4XAXB 3HRUA 3WXMB 5A0GA 5M9OA 2E5QA 4A4KA 3MEVA 1VQOA 4PJOG 2GFUA 5GAN7 1N8RC 4EMKA 4JS4A 1OZ3A 3RKXA 2LNVA 2LQ8A 2RJEA 2XICA 4OGEA 3RMQA 5KCOA 3CCLT 1YJWA 4PJOD 4LDYA 4FSXA 1Y07A 5GANh 3SFMA 1FWZA 2EJFA 2EYQA 1YHQA 3QYHB 4IUTA 2VYTA 1KQSA 3QHSA 4XU3A 2JNGA 4CRIA 2D9TA 4WF2A 4M77E 2O01E 1JBMA 1M4ZA 3SWNC 1VQOT 4HT9A 3HFOA 5AYFA 3J80E 3M53A 2M0OA 2LCCA 1KC8C 1VQ5T 2E41A 3OSSC 2ZPFB 5FU7B 4EMKC 4CI0C 3QIIA 2E1HA 3VV0A 2CYZB 1N27A 3ER0A 4GLKA 4IUVA 3G71T 3CPWA 4E7LA 3QKJA 2EWNA 2HD0A 3UT1A 3X24B 5C6SA 2K4YA 1M5Q1 5LJ5h 4MZMA 4A53A 4M78D 1P92A 2B8AA 2VXFA 3QUIA 4MZTA 4JS5A 4X9CA 2KAFA 3GPLA 1NJIC 1I8FA 3QYGB 1KD1U 1VQ7T 3ME9A 2IG0A 4Z02A 3JCMJ 1Q82C 5EG2A 2H3JA 2K2VA 5J3BA 4M77B 5LJ3f 4F7UG 4A4GA 5GMKj 3CCVT 2KMTA 5CK9A 3P8DA 2QQAA 4FT2A 3V8KA 2L8DA 1NJIU 3M54A 4C92F 2VGMA 2XD0A 5FRMA 3WVEB 5IT9E 2Y90A 3OS2A 3CC7T 2EAYA 4XTWA 3JRZA 3OYDA 1U8RA 1I4K1 5GAMh 3OYCA 2JTFA 2DD4A 1VQKA 1VQ7A 3JCMe 1LOJA 3MHXA 3SDZA 3RUXA 4F7UA 1NZ9A 2QDYB 3CCVA 1KC8U 1VQLA 4HT8A 5CVIA 2FB7A 1VQMA 1ZQ1A 1I5LA 1B34A 1X6OA 2FL7A 3UDCA 3V7CA 3J81E 2HBPA 2OTLA 4LD6A 4HCBA 2XU8A 2DVEA 2GF7A 2JOYA 5KE2A 1KQSS 1QVGA 2LDMA 4BE0A 2EKOA 4ZN1A 4M78C 1BI3A 2X4JA 2BIVA 1H641 4RCBA 3OYBA 3UPUA 5HY6A 4BE2A 4M75E 4XTUA 2RO0A 5HK3A 5CKFA 2R58A 2KK4A 1VQLT 5CKDA 3G4ST 4ZTJA 4HA8A 5GAOl 1KHIA 2OAUA 3PTAA 4FT4A 4OGCA 1VQ9T 4QVCA 3X26B 2DIQA 1YIJT 4C92D 1SSFA 3KUFA 5D6XA 4M75F 4XTXA 4PJOA 3LGLA 5IN1A 1Q81C 1IZ6A 4X9DA 4C8QC 2FHDA 2A7YA 2NLUA 3OYYA 4C5EA 3OSVA 2QEXT 4MDWA 3CMET 1I81A 2Y4YA 4EDUA 4ELZC 1QVGS 2DIGA 3OBWA 3FDRA 4C5IA 1IREB 4M7DA 2OTJT 4M7DE 1G3WA 2EIFA 3L2RA 3CPWS 3GOXA 4NOYA 1S72A 1VQNT 2XK0A 1N9SA 4N0AC 3OS1A 4JLIA 3DB4A 5HKCA 3F70A 2RK1A 3QDRB 2E65A 3RKYA 4M78B 5DY9A 3CBOA 4OB0B 1VQ8A 4C0ZA 3PIOA 2V8KA 3DKMA 4J6YA 1VQ4A 5CAIA 1Q86U 2RI3A 2L3RA 5GAMj 2OTJA 4M7AC 2KSSA 5A2QE 3O8VA 4C5HA 2RA2A 4DOWA 4RG2A 2MWPA 4XK8E 2M1HA 3QZ9B 4JJNK 1VQNA 4ZGEB 2L5QA 4C8QF 2E70A 3VYGA 1N8RU 3RERA 3QZ5B 2RJDA 4M78G 2VXEA 2MWOA 4J83A 4PKCC 5DLOA 3M56A 1PSFA 4OP0A 3V8LA 4BACA 4BI4A 1BIAA 3FB9A 3OYJA 4M75D 3A8GB 2RH2A 3QPHA 3VUZA 1BYMA 3VUBA 2HNIA 1K9MC 4XQ3A 1WJRA 4UC4A 3E9GA 2DO3A 2WSCE 4MZPA 4KULA 3S3NA 5LJ5j 1WQWA 2RJCA 4E7IA 2QTXA 3QXEB 1YI2T 4PL6A 4JRQA 3M57A 4MMKA 1ZHIA 2LC4A 4MMLA 4NL2A 3G71A 5FRNA 3Q1JA 1VUBA 2VV5A 1AHJB 4NS5A 1WJQA 1Q86C 3VYHB 1O9SA 4A4FA 3TCJA 1BI2A 4QQGA 5KE3A 3CCQT 2LX9A 4FU6A 5GMKh 2RHUA 3JCMd 4PJOB 1H3ZA 1BIBA 3G7ZA 3OY9A 1OZ2A 4EMGA 4R55A 1VIFA 2DTHA 1BI0A 3CEYA 2CZ7B 3ZFJA 2XDDA 2QI2A 4IUUA 4J5YA 3OW2S 5GANe 2JUFA 4C92A 3CCJT 3JCMf 1K73C 3QO3A 2DK3A 2PVDB 4FM4B 3N5BB 3C12A 3BFMA 3CCEA 4LDUA 4F7UE 1D3BB 1XOVA 2E12A 2E10A 1M1GA 2I2LA 2ZZDA 1EIFA 4EMHA 5LJ5g 5C0MA 3JCMQ 3QJ6A 2IVWA 2EQMA 3L2ZA 4C8QG 5LJ5d 4P5NA 5KH6A 5DM7R 3CXCA 2KY9A 4IUQA 2DAQA 4C5GA 4C8QE 4Y28E 5LJ3e 1R8OB 4M78F 4BUGA 4QVZA 4IURA 3MP8A 3CCJA 4M7AE 2A3LA 3I55A 2HAXA 3DLMA 2FYKA 2GCXA 2P0KA 5GAN8 5J39A 1UB4A 2DXCA 4JUVA 4N4IA 1QW1A 4F7UF 2QA4A 3VJPA 4ZGDB 3URGA 1UEBA 4PJOC 4M77D 3OYFA 3JCMc 4BY6C 4VUBA 2YRVA 4M75C 1W2BA 3CXCS 5GANf 5FU6B 4M77G 3M55A 1K8AC 2R57A 1TH7A 3G4SA 4L5GA 1M9SA 1D3BA 5CO7A 4M7DC 2BKDN 1G3YA 3PNWC 3JB9I 4QQDA 4C0DC 5LJ3g 3M9QA 4NL3A 3OMGA 4E7KA 3H8ZA 2KDSA 4JLGA 5DLQE 1PSEA 4N4GA 5A0LA 4XTYA 3C94A 2K5FA 4RG8A 2HQEA 2E6NA 3BDUA 3JCMb 1Y96B 2QEXA 3M4YA 4M75A 3CMEA 3HRSA 5LL6S 1YJNA 5CKHA 2LQKA 2X35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q B;  4C92 G;  2ZGW A;  4XU2 A;  2E65 A;  3RKY A;  2DXT A;  5GAN g;  4M78 B;  5DY9 A;  5GAM g;  4DQ2 A;  4M7A F;  4J6Y A;  4PJO G;  5CAI A;  4M7D F;  3RKW A;  4F7U B;  3JCM X;  5GAN d;  4RCC A;  5GAM j;  5GAM d;  4EMK A;  5GAN 7;  3AHU A;  4M7A C;  4M7A G;  2CGH A;  2K57 A;  3RES A;  4J6W A;  3RKX A;  2RA2 A;  5GAM e;  4PJO D;  1MGQ A;  1U1T A;  4C92 B;  3QSU A;  4C8Q F;  5GAN h;  3RER A;  5GAO n;  2DEQ A;  4M78 G;  2EJF A;  4Y91 A;  2VXE A;  2DKG A;  3QHS A;  4XU3 A;  4OP0 A;  4WF2 A;  3V8L A;  1BIA A;  4M77 E;  1JBM A;  3FB9 A;  3SWN C;  4PJO E;  3JB9 G;  3HFO A;  1N9R A;  4HT9 A;  4V2S A;  4M75 D;  5GAM f;  5GAO r;  1LNX A;  2E41 A;  4EMK C;  2HNI A;  3V7R A;  5GAN 4;  4XQ3 A;  2E1H A;  4XU0 A;  4C8Q A;  4XTV A;  1HXD A;  5LJ5 j;  1WQW A;  1Y96 A;  2EWN A;  4M77 C;  3EFR A;  3INZ A;  2QTX A;  4C8Q D;  5I21 A;  1M5Q 1;  5LJ5 h;  1WNL A;  2RD1 A;  4A53 A;  4M78 D;  3SWN B;  5GMK l;  3FIF A;  4MMK A;  4MML A;  1KQ1 A;  4NL2 A;  5GAN 6;  1KQ2 A;  2EJG A;  5GAN 5;  4M7D G;  1U1S A;  2VXF A;  3QUI A;  4J6X A;  3JCM g;  4X9C A;  5GAO q;  1I8F A;  2VC8 A;  1WPY A;  4M7D D;  1B34 B;  3JCM J;  2DZ9 A;  2EJ9 A;  4PJO B;  5LJ3 f;  5GMK h;  3JCM d;  4F7U G;  4M77 B;  5GMK j;  1BIB A;  5LJ3 d;  3JCM V;  3VU3 C;  4A54 A;  2E64 A;  4C92 C;  4EMG A;  5GAO p;  1LJO A;  2DTH A;  1X01 A;  3V8K A;  3JCM W;  4C92 F;  4JRI A;  2Y90 A;  2DZC A;  2EAY A;  1YCY A;  2JN0 A;  4J5Y A;  4XTW A;  4C92 E;  5GAN e;  1I4K 1;  2DTO A;  4C92 A;  4PNO A;  3JCM f;  5LJ3 j;  3QO3 A;  1JRI A;  3SWN A;  5GAM h;  3GIB A;  3L1A A;  3JCM e;  4M75 G;  1LOJ A;  3BFM A;  3EFS A;  2RB6 A;  3RUX A;  1D3B B;  2E10 A;  2I2L A;  4EMH A;  4F7U A;  4F7U E;  5LJ5 g;  3JCM Q;  4HT8 A;  3JCM P;  2FB7 A;  2YHT A;  1M8V A;  2YLC A;  1I5L A;  3HFN A;  4M78 A;  1B34 A;  3L2Z A;  4M78 E;  3V7C A;  2DXU A;  4C8Q G;  4M7A D;  5LJ5 d;  5GMK m;  4C8Q E;  5LJ3 e;  2DVE A;  3FJP A;  4M78 F;  5GAN j;  4XTZ A;  2YLB A;  3V8J A;  2DTI A;  5GAN 3;  4JRK A;  4M7A E;  4M78 C;  3HSB A;  2FYK A;  1WQ7 A;  5GAN 8;  1H64 1;  2RM4 A;  3BY7 A;  4RCB A;  3RIR A;  4JUV A;  4F7U F;  4M75 E;  3M4G A;  4XTU A;  4M7D B;  3JB9 J;  4PJO C;  5GMK e;  4M77 D;  3JCM c;  3JB9 D;  4HA8 A;  3SB2 A;  5LJ3 h;  5GAO l;  4PJO F;  5LJ5 f;  1HK9 A;  4M75 C;  5GAO m;  5GAN f;  4QVC A;  4M77 G;  4N0A A;  5LJ5 e;  4C92 D;  4M75 F;  4XTX A;  4PJO A;  1TH7 A;  1D3B A;  4M77 F;  5GAN 2;  4XU1 A;  4M7D C;  4C8Q C;  4X9D A;  4QVD A;  3JB9 I;  3JCM h;  5LJ3 g;  3BW1 A;  4NL3 A;  1I81 A;  5GMK i;  3JB9 H;  2DJZ A;  4M75 B;  4XTY A;  3V7S A;  3PGG A;  4M7A A;  4M7D A;  4M7D E;  3JB9 F;  4EMK B;  3JCM b;  3BDU A;  1Y96 B;  4M75 A;  4NOY A;  4M7A B;  1N9S A;  4N0A C;  4M77 A;  4JLI A; 
#chains in the Genus database with same CATH topology
 5KYU B;  2DIL A;  5GAN g;  3UA6 A;  1S72 T;  5KYU A;  1NM7 A;  1VQ4 Q;  2CZ0 B;  2KI7 A;  1VQ8 T;  4BB7 A;  3GF5 A;  4L6V 5;  5GAO n;  5HK0 A;  3OYG A;  4K11 A;  1M90 U;  4OMN A;  1N5Z A;  1BI1 A;  2RHY A;  3RDV A;  1N9R A;  2DL7 A;  2EQU A;  1QKW A;  1M2O A;  1K8A U;  2QGG A;  3CBP A;  2GNC A;  4JJC A;  5I22 A;  3INZ A;  1NPR A;  1VYT A;  2OAW A;  4ATO A;  4YTL A;  1OV3 A;  3VS3 A;  1FYN A;  4OMQ A;  5IHN A;  3SWN B;  3J7A F;  1ZLM A;  2EJG A;  3OYN A;  2ZPE B;  2CZ1 B;  2XDP A;  3A8M B;  4J9D A;  3CCR T;  3VU3 C;  3JCM V;  2BZX A;  2RQT A;  3JCM W;  2P4T A;  2XMF A;  3I35 A;  2J6O A;  4JRI A;  1QWE A;  3CCU A;  1SPK A;  4KT0 E;  2LRQ A;  3QSU A;  1JB0 E;  3A8L B;  4C92 E;  3RNJ A;  4PNO A;  5LJ3 j;  1X6B A;  1BU1 A;  2MCN A;  2XKO C;  1SRM A;  2CZ6 B;  3PMT A;  2JMA A;  1X27 A;  2LCL A;  3PVQ A;  3CCE T;  3NTK A;  4BE1 A;  4J9B A;  1YIT T;  2HMA A;  2M51 A;  2AKK A;  2CKK A;  2HDA A;  2M16 A;  4B9X A;  3QWY A;  4ZGJ B;  1JXM A;  1YIT A;  2LQW A;  2G6F X;  2J7I A;  3TSZ A;  1YWP A;  2XG8 D;  4PJL A;  1M27 C;  2GQV A;  4OML A;  3CXC P;  2ZAE A;  5GMK i;  4X1V A;  5CQX A;  2DJZ A;  3LYI A;  3EG9 A;  1HD3 A;  1QCO A;  4J7I A;  3OYK A;  1SHG A;  4C8Q B;  2C06 A;  2ZGW A;  3IQL A;  3GLX A;  2AIR B;  1ZUK A;  2CP0 A;  4CC3 A;  5GAM g;  2GFA A;  1YJW T;  1D0Y A;  3RMS A;  4M7A F;  2EQK A;  2QTV A;  5GAM d;  3CCJ Q;  2DPP B;  1TU0 B;  1MGQ A;  4B9W A;  3HL8 A;  4F14 A;  1AVZ C;  4EIK A;  2DKG A;  2ABL A;  3GP8 A;  3HPW A;  2OX7 A;  3ASK A;  1VA7 A;  2V8I A;  3CCS A;  1M1K C;  2C0T A;  1G83 A;  2FG0 A;  2E6Z A;  3V7R A;  3OYH A;  1HXD A;  1KG1 A;  5I21 A;  3LWI A;  2EVR A;  3RBB B;  4BI3 A;  1KQ1 A;  1CSK A;  1U1S A;  3CCS T;  3H0I A;  2L2P A;  2VB6 A;  3NTI A;  2BTT A;  1O75 A;  1T0H A;  1WI7 A;  2RI5 A;  3CC7 A;  6AT1 B;  2F2W A;  2JMC A;  2D8J A;  4JPB W;  1VQM T;  2KVQ G;  1VQP Q;  1IXD A;  1ABO A;  1AOJ A;  3CPF A;  1K9A A;  3CD6 A;  3QG1 A;  3VS7 A;  3UWN A;  2DFU A;  2YSQ A;  3FJP A;  1KD1 C;  3V8J A;  2QQB A;  5FLX E;  2KRO A;  1KHC A;  1VQ9 A;  2JTM A;  4KRT A;  3JB9 J;  3EHQ A;  5LJ5 f;  4DOV A;  3JSC A;  1D1C A;  4D8D A;  2DEU A;  4PLL A;  1I1J A;  4DBH A;  2ZPG B;  2RF0 A;  3JB9 F;  4EMK B;  1V76 A;  1BCM A;  2FRY A;  4DEY A;  2KGT A;  3R6N A;  2H3E B;  3GNF B;  1VYU A;  4XU2 A;  3L2W A;  4KH0 B;  2NUP B;  3HRU A;  5M9O A;  2KYM A;  2CP6 A;  4A4K A;  4AFU C;  1EZZ B;  1RLQ C;  3ULR B;  2GFU A;  4DBR A;  4PJO D;  1AWJ A;  1FWZ A;  2DE0 X;  2LCS A;  3BE3 A;  2JNG A;  4CRI A;  4M77 E;  1VQO T;  4FYX B;  4GLM A;  2LQN A;  2PZ1 A;  1VQ5 T;  2E41 A;  5FU7 B;  4CI0 C;  3VV0 A;  1KFZ A;  1IHV A;  2EWN A;  2HD0 A;  5LJ5 h;  3X24 B;  1K8A R;  2LZ6 B;  2B8A A;  1NJI C;  1KD1 U;  4A63 B;  1TS9 A;  1ACM B;  2ROT A;  5J3B A;  2K2M A;  5GMK j;  3EG1 A;  5CK9 A;  3CC7 Q;  1AT1 B;  2QQA A;  1GCQ C;  1NJI U;  3M54 A;  3I9Q A;  3WVE B;  1X43 A;  3OYC A;  1RAF B;  2DD4 A;  5ECA A;  2GQI A;  1B34 A;  3J81 E;  4LD6 A;  4PJM A;  5KE2 A;  2JOY A;  1HYO A;  2EKO A;  1M30 A;  4ZN1 A;  1NYG A;  1H64 1;  4RCB A;  1WHL A;  2RO0 A;  5HK3 A;  1YI2 Q;  5CKD A;  4HA8 A;  2L3P A;  1WZO A;  1VQL Q;  1SSF A;  5IN1 A;  1Q81 C;  1E6G A;  2FHD A;  2A7Y A;  4ORZ A;  4MDW A;  4EDU A;  7AT1 B;  3EG2 A;  4AFZ C;  3CPW S;  5HKC A;  2HKN A;  3QDR B;  3RKY A;  4OB0 B;  1SKU B;  2L3S A;  1LPL A;  2RI3 A;  2PTK A;  5GAM j;  4M7A C;  5A2Q E;  3O8V A;  4DOW A;  5IH2 A;  1NJI R;  4JJN K;  1VQN A;  1YIT Q;  2EGA A;  2VKN A;  2RNA A;  2BZ8 A;  1VQO Q;  1W6X A;  1JEG A;  2MWO A;  4GBQ A;  4OP0 A;  4BAC A;  1A0N B;  1M8M A;  3M0Q A;  3OYJ A;  1TUC A;  4M75 D;  3VUZ A;  2A36 A;  1OU8 A;  4KGX B;  1K9M C;  4XQ3 A;  1GBR A;  2WSC E;  1NG2 A;  5LJ5 j;  2RJC A;  1ZA1 B;  1VQ6 Q;  1YI2 T;  3M57 A;  1VQ7 Q;  3HTR A;  1ZHI A;  4MML A;  1VUB A;  1UG1 A;  1AHJ B;  4NS5 A;  1SEM A;  2MK5 A;  3VYH B;  3CCU Q;  2K79 A;  5KE3 A;  4FU6 A;  5GMK h;  3JCM d;  1H3Z A;  2E3H A;  4QKU A;  1YJW Q;  1Y0M A;  2CZ7 B;  2QK0 A;  3OW2 S;  2CH4 W;  3CCJ T;  1PG5 B;  1WFW A;  3JCM f;  2HL5 C;  3N5B B;  3BFM A;  1XOV A;  2V1R A;  2ZZD A;  1M1G A;  3OYE A;  1MV0 B;  3REA B;  1HSQ A;  2FRW A;  4P5N A;  5DM7 R;  4IUQ A;  4C8Q E;  2VWF A;  5LJ3 e;  4BUG A;  2A3L A;  4PFZ A;  3I55 A;  5FW9 A;  1D1B A;  3DLM A;  2P0K A;  5J39 A;  4N4I A;  2DXC A;  3EGU A;  4JJB A;  1K1Z A;  3VJP A;  1T3L A;  4ZGD B;  4PJO C;  3OYF A;  1SRL A;  3JCM c;  4VUB A;  5GAN f;  3M55 A;  1K8A C;  1D3B A;  2BKD N;  1G3Y A;  1MV3 A;  5LJ3 g;  1NBE B;  1R77 A;  3OMG A;  2LJ3 A;  1GRI A;  3H8Z A;  2KDS A;  2EYZ A;  3BDU A;  2QEX A;  4M75 A;  2LQK A;  1QWF A;  1TUD A;  4C92 G;  5IAY A;  3L2Q A;  2O9S A;  3HRT A;  4DQ2 A;  1WIE A;  4O6J A;  1UGP B;  4AG1 C;  2MAM A;  2K57 A;  3KXT A;  1W4S A;  1VQ4 T;  1NLP C;  4Y91 A;  4IIO A;  1MMG A;  1VIE A;  2CUB A;  4IKF A;  3CCM Q;  2HKQ B;  1FMV A;  1YN8 A;  2DBM A;  5GAO r;  2F5K A;  4XU0 A;  4C8Q A;  2NUZ A;  4RKU E;  3OS5 A;  2DET A;  1DJ7 B;  4X34 A;  1PM3 A;  3H6Z A;  3CC2 A;  2YUO A;  2J05 A;  2C0O A;  5GAO q;  2IPO B;  4M7D D;  1QCN A;  1X2K A;  2CS7 A;  3CMA A;  2EJ9 A;  4D8K A;  2KRM A;  4II1 A;  5GAO p;  3M0U A;  1JJ2 S;  1PRM C;  1YCY A;  1WJS A;  2DTO A;  3CC2 T;  3L1A A;  3M5A A;  4M75 G;  3REB B;  2QQS A;  1UE9 A;  2L89 A;  3CCE Q;  3L2U A;  3M58 A;  1M8V A;  3OW2 P;  3S6W A;  3EFO A;  4OF1 A;  1Q86 R;  3ZL7 C;  1QVF A;  2BZY A;  3OBY A;  4RTX A;  2DVJ A;  3OQ5 A;  2HSP A;  3OA6 A;  1VQ5 Q;  2LT4 A;  3G71 Q;  1Y57 A;  4KUD K;  4JZ3 A;  2QDL A;  2PNI A;  3MJX A;  1HK9 A;  4C0F A;  1QVF S;  2QA4 T;  1ZBJ A;  2J6F A;  2A08 A;  1QMC A;  5I11 A;  3G6E A;  3BW1 A;  1AWO A;  2O9V A;  4GY5 A;  3VS0 A;  2FPE A;  2VUB A;  4PLI A;  1QP2 A;  1VYV A;  1UJY A;  2P84 A;  3OYA A;  1NPP A;  5CKE A;  1YJN T;  2VVK A;  1GFD A;  1YHQ Q;  2DL4 A;  5IHK A;  3RKW A;  4J9E A;  4RCC A;  1YBY A;  4FYV B;  3G6E Q;  4M7A G;  2RI2 A;  1U1T A;  3TRE A;  3I56 T;  3HHT B;  4BD3 A;  4FW1 A;  3NGP A;  4LD9 K;  2DEQ A;  3UA7 A;  4DA4 A;  1F1B B;  1X6G A;  1GL5 A;  4N4H A;  4LDW A;  4J7F A;  5HCK A;  2QQ9 A;  3PIP A;  2F1L A;  4AMC A;  1RUW A;  1WDX A;  2RJF A;  1JO8 A;  3MP1 A;  1PCX A;  1PD1 A;  1C0M A;  2H8H A;  4RTT A;  1MUZ A;  5GMK l;  2XHC A;  1AEY A;  2XID A;  4E7Z A;  2YWW A;  4ZN3 A;  4J6X A;  1VOM A;  4DBQ A;  3LX7 A;  2VC8 A;  1WPY A;  4RMO A;  4FL6 A;  2YRC A;  4RTU A;  1FMK A;  1BCO A;  1X75 C;  2KR3 A;  5CIU A;  1UHF A;  4J9H A;  2CT3 A;  1H92 A;  2KYB A;  2X4W A;  4ZTF A;  1S72 Q;  1XQH A;  2HQX A;  1VQP T;  4M78 E;  1ZSZ A;  4PJN A;  5FU6 C;  4Y92 A;  1SF9 A;  3T9N A;  2KT1 A;  2BUD A;  3HSB A;  2RM4 A;  4Q5W A;  5D7U A;  2QAZ A;  4PK4 A;  4OB2 B;  3MO8 A;  3L2V A;  5LJ5 e;  2CP7 A;  5I2S A;  3TEE A;  3SEM A;  3VKI A;  4XU1 A;  2R5M A;  3M59 A;  2ECZ A;  3R6O A;  4OB1 B;  1QVF P;  3VRY A;  1GCQ A;  2ENM A;  1UTI A;  4HXJ A;  4M75 B;  3V7S A;  3PGG A;  2ZCF B;  3FC3 A;  4F16 A;  3A98 A;  5FU7 C;  2X4Y A;  3E19 A;  1YHQ T;  1M1K U;  5A0G A;  1K0X A;  2E5Q A;  4PJO G;  5GAN 7;  1UEC A;  4JS4 A;  2RN8 A;  2LNV A;  2RJE A;  2JM8 A;  4FSX A;  1Y07 A;  3SFM A;  2EJF A;  1YHQ A;  4XU3 A;  3VS1 A;  3H41 A;  1SG5 A;  1M4Z A;  2X3W D;  2SRC A;  4HVW A;  3J80 E;  1KC8 C;  3OSS C;  2ZPF B;  3QII A;  3UT1 A;  2EBP A;  1M5Q 1;  1TSF A;  4A53 A;  1PKT A;  1YFN A;  4JS5 A;  2DJQ A;  4CC4 B;  3ME9 A;  2EYW A;  2DMO A;  3CCV T;  3P8D A;  3EGX B;  3CC7 T;  2EAY A;  3OYD A;  1U8R A;  1AZE A;  5GAM h;  4ANJ A;  2HCK A;  3MHX A;  4F7U A;  1PC0 A;  4HT8 A;  5CVI A;  3KFV A;  1VQM A;  1ZQ1 A;  9ATC B;  2FL7 A;  3V7C A;  2OTL A;  2XU8 A;  2MIO A;  2DVE A;  1BI3 A;  3JV3 A;  4M75 E;  1B07 A;  1WA7 A;  3G4S T;  4ZTJ A;  4ZNX A;  3PTA A;  2COW A;  4WTO B;  2DIQ A;  4C92 D;  2KXC A;  3KUF A;  4XTX A;  1IZ6 A;  4X9D A;  2MYS A;  3PE0 A;  3CME T;  2Y4Y A;  2DIG A;  2C0I A;  4M7D E;  2EIF A;  1S72 A;  4NOY A;  4E2F B;  1RAA B;  3OS1 A;  5EC7 A;  1KC8 R;  3F70 A;  3U23 A;  4JJD A;  4M78 B;  5DY9 A;  3PIO A;  2V8K A;  1LCK A;  3DKM A;  2J6K A;  4E7S A;  4OMO A;  2KRN A;  1UDL A;  1VQM Q;  2DF6 A;  4C5H A;  2RA2 A;  2MWP A;  4XK8 E;  3QZ9 B;  1N8R U;  4C8Q F;  3RER A;  2D0N A;  2YT6 A;  4M78 G;  3FJ5 A;  4J83 A;  1PSF A;  3V8L A;  1BIA A;  2O31 A;  1WX6 A;  3VUB A;  3E9G A;  3S3N A;  3D7S B;  4E7I A;  2JM9 A;  2QTX A;  4MMK A;  2LC4 A;  4NL2 A;  5FRN A;  2KBT A;  2FEI A;  1ZSZ B;  2QG9 B;  1O9S A;  4A4F A;  1QLY A;  1T0J A;  1FMW A;  4QQG A;  4PJO B;  3TQ7 P;  3CME Q;  1OZ2 A;  4R55 A;  1VIF A;  3CCR Q;  2QI2 A;  5GAN e;  4C92 A;  2ED0 A;  1K73 C;  1YWO A;  2HSE B;  1RAD B;  3C12 A;  1NEG A;  1D3B B;  2E12 A;  2E10 A;  2I2L A;  3JCM Q;  1K9M U;  2EQM A;  3L2Z A;  4C8Q G;  1PHT A;  2A0F B;  5LJ5 d;  5IXB A;  4QVZ A;  3MP8 A;  3CCJ A;  4M7A E;  2HAX A;  2FYK A;  5GAN 8;  3RR6 A;  1C1A A;  2YRV A;  1CKB A;  1WHM A;  4M77 G;  2W10 A;  1WHK A;  3M0P A;  1M9S A;  4L5G A;  1RAH B;  4FYW B;  4NL3 A;  4RUG A;  4RTZ A;  2K3B A;  4RTV A;  1PSE A;  4RG8 A;  2E6N A;  3JCM b;  1YCS B;  4DEX A;  3HRS A;  5LL6 S;  5CKH A;  4FIB A;  1G5V A;  4AFQ C;  2CDT A;  2M0Y A;  3CPW P;  3A8H B;  1JU5 C;  1HJD A;  3LGF A;  4M7D F;  2RPN A;  2KE9 A;  5GAN d;  1W70 A;  3FLG A;  4BY6 B;  4D6W A;  1YNZ A;  2CGH A;  2M9U A;  2EQJ A;  2QQR A;  2WSE E;  2EGE A;  4B6M A;  2CT4 A;  1RL2 A;  2F5T X;  2JXB A;  1UHC A;  4KGV B;  2RHZ A;  4QQ6 A;  4C0D B;  2YUP A;  1KD1 R;  3JB9 G;  1WXB A;  1D0X A;  4M4Z A;  2QYZ A;  3CCM T;  3NFC A;  4AFS C;  2FVU A;  3OYI A;  4M77 C;  3EFR A;  1PNJ A;  2RHI A;  2CP5 A;  3MET A;  1OX9 A;  4OMM A;  3MKD A;  2RMO A;  1VQ9 Q;  4M7D G;  2YUN A;  1MMN A;  3JCM g;  1YI2 A;  5GJV B;  2DBK A;  4J9C A;  3EG3 A;  3NHN A;  1Q7Y C;  2DZ9 A;  1ZUY A;  5I2M A;  4C92 C;  3SD4 A;  2XDB A;  3CCQ A;  4A4H A;  2PVG B;  2DL5 A;  3E1S A;  1RAG B;  5KYW A;  3AT1 B;  4KBM B;  2QXF A;  1U5S A;  2K3X A;  1Q95 G;  4AT1 B;  2KQW A;  5KYX B;  1JJ2 A;  1IRX A;  1QP3 A;  2AHJ B;  4DBF A;  2RQU A;  4R0K A;  4XTZ A;  2DRK A;  2YLB A;  4ELY C;  2DTI A;  1WGS A;  4JRK A;  3OYL A;  4O5V A;  3C4S A;  2X3X D;  3M4G A;  3P8H A;  4CC7 A;  2JZ2 A;  1OQK A;  1KIK A;  3P8B B;  2WAC A;  1OX8 A;  5LJ3 h;  4PJO F;  5GAO m;  4A4E A;  4MDX A;  1Q7Y U;  2D6F A;  2VGN A;  4M77 F;  5GAN 2;  2O4X B;  1VQ6 T;  2COY A;  3KBG A;  2JJ9 A;  4ME7 A;  2Z0W A;  1BKB A;  1NEB A;  5A0D A;  3DB3 A;  3WVD B;  2PUO B;  1YJN Q;  1NLO C;  1KJW A;  3G6E T;  3CCL A;  1VQ8 Q;  1K73 R;  2E4H A;  1BBZ A;  2I0N A;  3LLR A;  2NYS A;  2CP3 A;  5GAM e;  3FEO A;  5KYY B;  1N6A A;  1OUL A;  1ZBX A;  2V8J A;  5CKB A;  2V1Q A;  5J26 A;  3DLL A;  1RI0 A;  1V29 B;  1VQ5 A;  4PJO E;  1OPL A;  2M02 A;  3OMC A;  1ZUU A;  5GAN 4;  1EX4 A;  1Y96 A;  2EFI A;  1GXI E;  3QDF A;  1MNE A;  2RD1 A;  3I5R A;  3FIF A;  1KQ2 A;  2ED1 A;  1I5O B;  1YJ9 A;  4OMF B;  2D0Q B;  2X4X A;  4IUP A;  1VQN Q;  1B34 B;  1AZG B;  1M2V A;  2NUT B;  2ZPI B;  3EH1 A;  3QJY A;  3OW2 A;  2QAS A;  3M0R A;  2P4R A;  2F2V A;  1VQK T;  3CMA T;  2DZC A;  2JN0 A;  4J9G A;  3CD6 Q;  1JRI A;  2RHX A;  4QW2 A;  3GIB A;  3CC4 T;  3EFS A;  3OS0 A;  2RB6 A;  1KQS P;  4EPC A;  1IGU A;  2MOX A;  1FX7 A;  3HFN A;  4LDX A;  2DXU A;  4M7A D;  2GBQ A;  8AT1 B;  1H8K A;  1ZA2 B;  4HCZ A;  2BE9 B;  1OEB A;  2LTO A;  3X28 B;  2DL3 A;  3BY7 A;  4M7D B;  3UAT A;  3A8O B;  2KRS A;  1TOV A;  1YIJ A;  2FPD A;  4IIM A;  5GMK e;  3CBM A;  3X25 B;  5KCH A;  1SSH A;  1VQP A;  3PFS A;  1QVG P;  2OJ2 A;  2PVO B;  1MHN A;  2PUK B;  2DRM A;  5KYN A;  4BDZ A;  3VS5 A;  4JRP A;  3QBY A;  2GGR A;  1KSW A;  2BE7 D;  4J9I A;  1Q82 R;  3THK A;  3CCS Q;  4LN2 A;  2LP5 A;  2QEX Q;  4BDY A;  3ZBD A;  4M77 A;  1WXT A;  2EYY A;  1RLP C;  2KXD A;  1Y7X A;  4XAX B;  4JZ4 A;  3MEV A;  1N8R C;  1OZ3 A;  2X9H A;  3RKX A;  1YJW A;  4OGE A;  2XIC A;  3RMQ A;  5KCO A;  1Q81 R;  4LDY A;  2EYQ A;  3QYH B;  2VYT A;  2NWM A;  2D9T A;  3SWN C;  2O01 E;  1JBM A;  4HT9 A;  2L3Q A;  5AYF A;  3M53 A;  2M0O A;  3O5Z A;  1N27 A;  3ER0 A;  4IUV A;  3G71 T;  4E7L A;  4ESR A;  5C6S A;  2K4Y A;  2E5K A;  4M78 D;  2QA4 Q;  1P92 A;  1GCP A;  1K76 A;  2KAF A;  3GPL A;  1I8F A;  3QYG B;  1VQ7 T;  1K0S A;  3EFO B;  1M90 R;  4A4G A;  3V8K A;  2L0A A;  4C92 F;  5IT9 E;  3H9N A;  3JRZ A;  4XTW A;  2JTF A;  1VQ7 A;  1J3T A;  1LOJ A;  4FYY B;  2QDY B;  3CCV A;  2FB7 A;  1I5L A;  1X6O A;  1D09 B;  2GTO A;  1TG0 A;  1QQJ A;  2LDM A;  3M0S A;  4M78 C;  3G4S Q;  2BIV A;  2DYB A;  3OYB A;  5IXF A;  3A1P A;  5GAO l;  4Z88 A;  2OAU A;  4QT7 A;  1VQ9 T;  3X26 B;  5D6X A;  2FZC B;  3LGL A;  4C8Q C;  2NLU A;  1TUG B;  3C0C A;  3OSV A;  2QEX T;  2EQI A;  4HCK A;  3FDR A;  4C5I A;  1IRE B;  4M7D A;  1Z9Q A;  2OTJ T;  1G3W A;  3SHW A;  2DER A;  1T3S A;  1ZSG A;  3L2R A;  3GOX A;  2XK0 A;  4N0A C;  3NPF A;  2RK1 A;  3EG0 A;  2E65 A;  1VQ8 A;  4J6Y A;  1ZSZ C;  5CAI A;  1VQ4 A;  1Q86 U;  2L3R A;  2OTJ A;  2LNH B;  2RQW A;  3EG9 B;  2M1H A;  4ZGE B;  1S1N A;  2AT1 B;  3QZ5 B;  1UGV A;  2VXE A;  3EGX A;  4HVU A;  1E7O A;  3M56 A;  3PVL A;  1JXO A;  3M0T A;  3QPH A;  2RH2 A;  1BYM A;  2HNI A;  2RQV A;  2DO3 A;  4KUL A;  4PL6 A;  2SEM A;  1PKS A;  4AG2 C;  3Q1J A;  1IB8 A;  1WJQ A;  1AWW A;  3TCJ A;  1PWT A;  2LX9 A;  1BIB A;  3G7Z A;  3OY9 A;  2DTH A;  1BI0 A;  2IIM A;  3CCQ Q;  2HEQ A;  2FZG B;  3CEY A;  1V1C A;  4J5Y A;  2JUF A;  3QO3 A;  2DK3 A;  2PVD B;  4FM4 B;  2CSI A;  3CCE A;  4LDU A;  4F7U E;  4EMH A;  1WHJ A;  2ESW A;  3VS4 A;  1K4U S;  2YRD A;  2DL8 A;  2DAQ A;  4M78 F;  2AZS A;  3MPU B;  2CP2 A;  1ABQ A;  1UB4 A;  4F7U F;  3URG A;  4M77 D;  4BY6 C;  2DM1 A;  5FU6 B;  2LJ0 A;  3G4S A;  1TH7 A;  5CO7 A;  2O2O A;  3PNW C;  4QQD A;  4C0D C;  5DLQ E;  5A0L A;  4N4G A;  3H0H A;  4XTY A;  3CMA Q;  2HQE A;  3M4Y A;  1YJN A;  3CC2 Q;  3NMZ C;  2X35 A;  2QGF B;  2A28 A;  4LXC A;  2EKH A;  1OPK A;  5KYX A;  2MMP A;  3I56 A;  1QVP A;  5KYW B;  2AKL A;  3AHU A;  8ATC B;  3RES A;  4OVA A;  4E7H A;  4KUI A;  4C92 B;  2F2X A;  1YP5 A;  1EFN A;  4E6R A;  2DXB A;  1Y71 A;  1UUE A;  3GNG A;  1LVK A;  3NTH A;  1OYX A;  2P0P A;  4PFO A;  3MEW A;  2ATC B;  2MF2 A;  1MND A;  4E7J A;  3CCR A;  3MEU A;  5IHI A;  4XTV A;  2CSQ A;  2K7A A;  4FSS A;  4C8Q D;  3FRN A;  3CCU T;  5GAN 5;  2O4X A;  2YXY A;  1Q82 U;  1QKX A;  1BK2 A;  1RAE B;  1WHG A;  2LT1 A;  3C95 A;  1X01 A;  1OU9 A;  3E9F A;  3SWN A;  1K73 U;  2RK2 A;  3LH0 A;  1D1A A;  1XJW B;  3MCA B;  2YLC A;  4LE9 A;  2ZPH B;  3PMI A;  5GMK m;  3A5Z B;  1IHW A;  1OI1 A;  5GAN j;  5GAN 3;  2CRE A;  1M1K R;  2K3Y A;  1CKA A;  4HCC A;  1QCF A;  1SHF A;  2K5I A;  2ROL A;  1PRL C;  3I55 T;  3JB9 D;  4FCY A;  3JAM E;  4N0A A;  1G3T A;  2JS0 A;  2EW3 A;  1NE8 A;  1M2V B;  2NUT A;  3EAE A;  3LH5 A;  1W2B S;  3L42 A;  5CQY A;  2D8H A;  3MP6 A;  4OMP A;  1H3H A;  1U06 A;  1ZX6 A;  2CH4 A;  2FO0 A;  4M7A A;  1FXX A;  2K5L A;  2LVM A;  4M7A B;  4F04 B;  1YJ9 Q;  1UGR B;  1G3S A;  1VQ6 A;  1UGQ B;  3S3M A;  5CCA A;  4Z89 A;  3S3O A;  4F7U B;  3JCM X;  4J6W A;  5FRO A;  1WLP B;  2HL3 A;  5KYY A;  4JDS A;  1M1F A;  2G3R A;  2FPF A;  3VRZ A;  5CR2 A;  1ARK A;  2P0Q A;  3X20 B;  1XNI A;  1UGS B;  4V2S A;  4BI8 B;  5GAM f;  2DLP A;  2EYX A;  1LNX A;  2PU9 B;  2E3I A;  2F69 A;  1TTH B;  2V26 A;  3CCM A;  1WNL A;  3BDL A;  4E47 A;  5GAN 6;  4HVV A;  3HP9 A;  2AZV A;  4J9F A;  2HZY A;  4HKE A;  5LJ3 d;  1E6H A;  3E2U A;  1UJ0 A;  2E64 A;  4A54 A;  3CD6 T;  4WCI A;  1LJO A;  2WSF E;  2PQW A;  2ZPB B;  4J8O A;  2FZK B;  3CC4 Q;  2K6D A;  5D6W A;  2K9G A;  3G1J A;  1YJ9 T;  2MI6 A;  1G8X A;  2XI9 A;  2DD5 A;  1U3O A;  2OTL T;  2MPX C;  4FW2 A;  3PT9 A;  3ZEH A;  4R56 A;  1R0C B;  3JCM P;  1Q81 U;  2YHT A;  3HKS A;  4M78 A;  4OB3 B;  3MEA A;  4TVR A;  3TU4 K;  1RAI B;  3OYM A;  1B3Q A;  3I55 Q;  1WQ7 A;  4LDV A;  3CC4 A;  3RIR A;  4C0G A;  4L59 A;  3LWH A;  3SB2 A;  3VS2 A;  1WYX A;  3OB9 A;  5FWB A;  1XTD A;  1X2Q A;  1YIJ Q;  4QVD A;  2JVV A;  2DX1 A;  3JCM h;  2R5A A;  4KH1 B;  1M90 C;  3JB9 H;  1W2B P;  5L8R E;  3LW5 E;  2Y4X A;  4KGZ B;  4RTY A;  1K9M R;  2NUP A;  2DXT A;  1C6V X;  5D6Y A;  3WXM B;  2DYI A;  5GJW B;  3QWX X;  1UFF A;  2D1X A;  1VQO A;  3I56 Q;  4EMK A;  2COZ A;  3CCL T;  2DNU A;  2LQ8 A;  5GAN h;  1Q7Y R;  4IUT A;  3QHS A;  2LX7 A;  3EGD B;  4WF2 A;  2VAS A;  3HFO A;  5L23 A;  2LCC A;  1M3A A;  3EHR A;  4EMK C;  2LMJ A;  1WHH A;  1TXQ A;  2E1H A;  2CYZ B;  4GLK A;  3CPW A;  3QKJ A;  2AK5 A;  2JT4 A;  4MZM A;  4Z8A A;  2VXF A;  3QUI A;  4MZT A;  1AWX A;  1R0B G;  4X9C A;  1RI9 A;  1TWB A;  2IG0 A;  4Z02 A;  3JCM J;  1Q82 C;  5LJ3 f;  2B86 A;  2H3J A;  1G2B A;  2K2V A;  4M77 B;  5EG2 A;  4F7U G;  1KQS A;  2HQH A;  2KMT A;  4FT2 A;  2L8D A;  1W1F A;  2EPD A;  2VGM A;  2XD0 A;  5FRM A;  2Y90 A;  3OS2 A;  2OTL Q;  1I4K 1;  1VQK A;  3JCM e;  3SDZ A;  3VS6 A;  3RUX A;  1NZ9 A;  1KC8 U;  1VQL A;  3CQT A;  4LNP A;  2CUD A;  3UDC A;  2EGC A;  2HBP A;  4HCB A;  2GF7 A;  3CCL Q;  5AT1 B;  1KQS S;  1QVG A;  2JTE A;  4BE0 A;  2X4J A;  3UPU A;  1BB9 A;  5HY6 A;  4BE2 A;  4XTU A;  3H0F A;  5CKF A;  1IO6 A;  1Z9Z A;  3TVT A;  1AD5 A;  1M3C A;  2R58 A;  2KK4 A;  1VQL T;  1KHI A;  4RTW A;  4FT4 A;  4OGC A;  3EH2 A;  2JW4 A;  4QVC A;  1YIJ T;  4LUE A;  1RAC B;  4M75 F;  4PJO A;  3EGD A;  4F17 A;  2X51 A;  3OYY A;  4C5E A;  1OOT A;  1I81 A;  4ELZ C;  1QVG S;  3OBW A;  1GFC A;  1WXU A;  2KEA A;  1VQN T;  1N9S A;  3GBQ A;  4JLI A;  2OTJ Q;  3DB4 A;  3TSW A;  3CBO A;  1VQK Q;  4C0Z A;  2KSS A;  1I07 A;  4RG2 A;  1KK7 A;  2L5Q A;  2E70 A;  3VYG A;  1JQQ A;  2RJD A;  4PKC C;  5DLO A;  2LJ1 A;  4BI4 A;  1PD0 A;  3FB9 A;  1X69 A;  1RAB B;  1D0Z A;  3A8G B;  1I0C A;  1WJR A;  4UC4 A;  2JS2 A;  4MZP A;  2YDL A;  1WQW A;  3QXE B;  4LUD A;  2YUQ A;  4JRQ A;  3G71 A;  2VV5 A;  3CCV Q;  1Q86 C;  1JJ2 P;  1BI2 A;  3CCQ T;  2RHU A;  4EMG A;  3ZFJ A;  2XDD A;  4IUU A;  1NYF A;  2O88 A;  2KT8 A;  5LJ5 g;  2HBW A;  1EIF A;  2RQR A;  1IGQ A;  3UF4 A;  5C0M A;  3QJ6 A;  2IVW A;  2KNB B;  5KH6 A;  4CC2 A;  3CXC A;  2KY9 A;  4C5G A;  4Y28 E;  1R8O B;  1MMA A;  4IUR A;  2A37 A;  1GBQ A;  2GCX A;  1B7T A;  2OI3 A;  4JUV A;  2QA4 A;  1QW1 A;  1MMD A;  1UEB A;  4PJJ A;  2GTJ A;  4M75 C;  1W2B A;  3CXC S;  3I5S A;  1M3B A;  2R57 A;  1N8R R;  2W0Z A;  4M7D C;  2J06 A;  5FWC A;  3JB9 I;  4E7K A;  3M9Q A;  4JLG A;  3C94 A;  2K5F A;  4PFP A;  1Y96 B;  3CME A;  2DA9 A; 
#chains in the Genus database with same CATH homology
 4C92 G;  4FIB A;  1G5V A;  5IAY A;  5GAN g;  1S72 T;  3L2Q A;  2MMP A;  3HRT A;  3A8H B;  4DQ2 A;  4O6J A;  1UGP B;  3LGF A;  4M7D F;  3I56 A;  1QVP A;  3OYE A;  5GAN d;  2CZ0 B;  3FLG A;  4BY6 B;  2MAM A;  4D6W A;  3AHU A;  2CGH A;  2QQR A;  2K57 A;  2EQJ A;  2M9U A;  2WSE E;  4OVA A;  3RES A;  4BB7 A;  4E7H A;  1VQ8 T;  4KUI A;  3KXT A;  4C92 B;  1W4S A;  1VQ4 T;  3GF5 A;  4L6V 5;  5GAO n;  5HK0 A;  1RL2 A;  2F5T X;  3OYG A;  1M90 U;  4Y91 A;  2RHZ A;  1VIE A;  1BI1 A;  4IKF A;  2DXB A;  2RHY A;  1Y71 A;  4QQ6 A;  4C0D B;  3GNG A;  3NTH A;  3JB9 G;  1N9R A;  2EQU A;  1OYX A;  2P0P A;  5GAO r;  3MEW A;  2F5K A;  2MF2 A;  3CCM T;  1K8A U;  3NFC A;  2FVU A;  4XU0 A;  4C8Q A;  4E7J A;  3OYI A;  3CCR A;  3MEU A;  4XTV A;  3CBP A;  4RKU E;  4M77 C;  3EFR A;  3INZ A;  1NPR A;  4C8Q D;  2RHI A;  3OS5 A;  4YTL A;  4ATO A;  3MET A;  1DJ7 B;  3FRN A;  3CCU T;  4X34 A;  3SWN B;  3J7A F;  4M7D G;  2EJG A;  5GAN 5;  3H6Z A;  3CC2 A;  3JCM g;  3OYN A;  5GAO q;  1YI2 A;  4M7D D;  2ZPE B;  2O4X A;  2CZ1 B;  2XDP A;  1Q7Y C;  2CS7 A;  3CMA A;  2DZ9 A;  2EJ9 A;  1Q82 U;  3A8M B;  5I2M A;  3CCR T;  3VU3 C;  3JCM V;  3SD4 A;  4C92 C;  4II1 A;  2LT1 A;  5GAO p;  3C95 A;  1X01 A;  3JCM W;  2XDB A;  2P4T A;  1JJ2 S;  3E9F A;  3CCQ A;  4A4H A;  4JRI A;  3CCU A;  2PVG B;  4KT0 E;  2LRQ A;  3QSU A;  1YCY A;  1JB0 E;  3A8L B;  4C92 E;  1WJS A;  2DTO A;  3CC2 T;  4PNO A;  5LJ3 j;  3SWN A;  1K73 U;  3L1A A;  3M5A A;  4M75 G;  2QQS A;  2RK2 A;  3E1S A;  3LH0 A;  2L89 A;  4KBM B;  2QXF A;  2K3X A;  2XKO C;  3L2U A;  2CZ6 B;  3M58 A;  3MCA B;  2YLC A;  1M8V A;  3S6W A;  3PMT A;  2KQW A;  1JJ2 A;  2LCL A;  2ZPH B;  3CCE T;  3PMI A;  4OF1 A;  5GMK m;  1QVF A;  3NTK A;  3OBY A;  1QP3 A;  2AHJ B;  3A5Z B;  4BE1 A;  1OI1 A;  5GAN j;  4XTZ A;  4ELY C;  3OQ5 A;  2YLB A;  1YIT T;  5GAN 3;  2DTI A;  1WGS A;  4JRK A;  3OA6 A;  2K3Y A;  3OYL A;  4HCC A;  4O5V A;  3C4S A;  2LT4 A;  3M4G A;  3P8H A;  4KUD K;  2K5I A;  2JZ2 A;  3P8B B;  3I55 T;  3JB9 D;  2CKK A;  2WAC A;  5LJ3 h;  4PJO F;  2M16 A;  1HK9 A;  4C0F A;  4A4E A;  5GAO m;  3JAM E;  2QA4 T;  4B9X A;  4N0A A;  1QVF S;  1G3T A;  4MDX A;  1Q7Y U;  2D6F A;  4ZGJ B;  1NE8 A;  2VGN A;  3EAE A;  4M77 F;  1W2B S;  3L42 A;  1YIT A;  5CQY A;  5GAN 2;  2O4X B;  1VQ6 T;  2XG8 D;  3MP6 A;  3G6E A;  3KBG A;  2GQV A;  3BW1 A;  4ME7 A;  4GY5 A;  1BKB A;  5GMK i;  5A0D A;  5CQX A;  2DJZ A;  3LYI A;  4M7A A;  1FXX A;  2VUB A;  4J7I A;  3DB3 A;  2K5L A;  2LVM A;  1QP2 A;  4PLI A;  3WVD B;  4M7A B;  3OYK A;  2PUO B;  1UGR B;  4C8Q B;  2C06 A;  2ZGW A;  3GLX A;  1G3S A;  5GAM g;  3OYA A;  2GFA A;  1VQ6 A;  1NPP A;  1UGQ B;  5CKE A;  3G6E T;  3S3M A;  1YJN T;  1YJW T;  3CCL A;  3RMS A;  5CCA A;  3S3O A;  4M7A F;  3RKW A;  4F7U B;  3JCM X;  2EQK A;  3LLR A;  1YBY A;  4RCC A;  5GAM d;  4M7A G;  2DPP B;  2RI2 A;  4J6W A;  5FRO A;  3FEO A;  5GAM e;  1MGQ A;  4B9W A;  1U1T A;  3TRE A;  1N6A A;  3HL8 A;  1ZBX A;  3I56 T;  2V8J A;  3HHT B;  4JDS A;  1M1F A;  4BD3 A;  2DEQ A;  5CKB A;  2G3R A;  4LD9 K;  2DKG A;  5J26 A;  4DA4 A;  3DLL A;  1RI0 A;  1V29 B;  4N4H A;  5CR2 A;  3GP8 A;  2P0Q A;  3HPW A;  4LDW A;  3X20 B;  3ASK A;  1VQ5 A;  1XNI A;  2V8I A;  1UGS B;  3CCS A;  1M1K C;  4J7F A;  4PJO E;  4BI8 B;  4V2S A;  3OMC A;  5GAM f;  2QQ9 A;  3PIP A;  1LNX A;  2E6Z A;  2PU9 B;  5GAN 4;  3V7R A;  3OYH A;  2F69 A;  2RJF A;  1HXD A;  3MP1 A;  1Y96 A;  1KG1 A;  2EFI A;  5I21 A;  3LWI A;  1GXI E;  3CCM A;  1WNL A;  2RD1 A;  3BDL A;  5GMK l;  2XHC A;  3FIF A;  1KQ2 A;  4BI3 A;  1KQ1 A;  2XID A;  4E47 A;  5GAN 6;  4ZN3 A;  1U1S A;  1YJ9 A;  4J6X A;  4OMF B;  3CCS T;  3LX7 A;  2D0Q B;  1WPY A;  2VC8 A;  2X4X A;  4IUP A;  4RMO A;  4FL6 A;  3HP9 A;  1B34 B;  3NTI A;  1O75 A;  3CC7 A;  2RI5 A;  2ZPI B;  4HKE A;  5LJ3 d;  4A54 A;  2E64 A;  3CD6 T;  1X75 C;  5CIU A;  1LJO A;  2WSF E;  3QJY A;  3OW2 A;  3CMA T;  1VQK T;  2PQW A;  2ZPB B;  4J8O A;  2DZC A;  5D6W A;  2JN0 A;  1YJ9 T;  2MI6 A;  1JRI A;  2RHX A;  4QW2 A;  2KVQ G;  1VQM T;  2XI9 A;  2DD5 A;  3GIB A;  3CC4 T;  3EFS A;  3OS0 A;  2OTL T;  2X4W A;  2RB6 A;  4ZTF A;  4EPC A;  3CPF A;  3PT9 A;  3ZEH A;  1FX7 A;  4R56 A;  1Q81 U;  3JCM P;  1XQH A;  2YHT A;  3HKS A;  2HQX A;  1VQP T;  3HFN A;  4M78 A;  3QG1 A;  4OB3 B;  4M78 E;  3CD6 A;  3MEA A;  2DXU A;  4LDX A;  4M7A D;  3UWN A;  4TVR A;  5FU6 C;  3TU4 K;  3FJP A;  1KD1 C;  4HCZ A;  2QQB A;  3T9N A;  3V8J A;  2BUD A;  2LTO A;  5FLX E;  3OYM A;  1K9M U;  3HSB A;  1WQ7 A;  4LDV A;  2RM4 A;  3BY7 A;  4Q5W A;  3RIR A;  1KHC A;  3X28 B;  3CC4 A;  1VQ9 A;  4M7D B;  3A8O B;  1YIJ A;  2JTM A;  3JB9 J;  5GMK e;  4C0G A;  4L59 A;  3CBM A;  4OB2 B;  3X25 B;  5KCH A;  3LWH A;  3SB2 A;  3MO8 A;  3L2V A;  1VQP A;  5LJ5 f;  3PFS A;  4DOV A;  5LJ5 e;  2PVO B;  3JSC A;  1MHN A;  5I2S A;  3TEE A;  2PUK B;  3OB9 A;  3VKI A;  4XU1 A;  1XTD A;  4QVD A;  2JVV A;  4BDZ A;  4PLL A;  4JRP A;  2R5M A;  3M59 A;  3QBY A;  3R6O A;  3JCM h;  4OB1 B;  2ZPG B;  2R5A A;  1M90 C;  3JB9 H;  4M75 B;  3V7S A;  3PGG A;  2ZCF B;  3FC3 A;  3JB9 F;  5FU7 C;  4EMK B;  4BDY A;  5L8R E;  3ZBD A;  3LW5 E;  2Y4X A;  4M77 A;  2X4Y A;  3E19 A;  3GNF B;  1YHQ T;  4XU2 A;  3L2W A;  1M1K U;  1Y7X A;  2DXT A;  5D6Y A;  4XAX B;  3HRU A;  3WXM B;  5A0G A;  5M9O A;  2E5Q A;  4A4K A;  3MEV A;  1VQO A;  4PJO G;  2GFU A;  5GAN 7;  1N8R C;  4EMK A;  4JS4 A;  1OZ3 A;  3RKX A;  2LNV A;  2LQ8 A;  2RJE A;  2XIC A;  4OGE A;  3RMQ A;  5KCO A;  3CCL T;  1YJW A;  4PJO D;  4LDY A;  4FSX A;  1Y07 A;  5GAN h;  3SFM A;  1FWZ A;  2EJF A;  2EYQ A;  1YHQ A;  3QYH B;  4IUT A;  2VYT A;  1KQS A;  3QHS A;  4XU3 A;  2JNG A;  4CRI A;  2D9T A;  4WF2 A;  4M77 E;  2O01 E;  1JBM A;  1M4Z A;  3SWN C;  1VQO T;  4HT9 A;  3HFO A;  5AYF A;  3J80 E;  3M53 A;  2M0O A;  2LCC A;  1KC8 C;  1VQ5 T;  2E41 A;  3OSS C;  2ZPF B;  5FU7 B;  4EMK C;  4CI0 C;  3QII A;  2E1H A;  3VV0 A;  2CYZ B;  1N27 A;  3ER0 A;  4GLK A;  4IUV A;  3G71 T;  3CPW A;  4E7L A;  3QKJ A;  2EWN A;  2HD0 A;  3UT1 A;  3X24 B;  5C6S A;  2K4Y A;  1M5Q 1;  5LJ5 h;  4MZM A;  4A53 A;  4M78 D;  1P92 A;  2B8A A;  2VXF A;  3QUI A;  4MZT A;  4JS5 A;  4X9C A;  2KAF A;  3GPL A;  1NJI C;  1I8F A;  3QYG B;  1KD1 U;  1VQ7 T;  3ME9 A;  2IG0 A;  4Z02 A;  3JCM J;  1Q82 C;  5EG2 A;  2H3J A;  2K2V A;  5J3B A;  4M77 B;  5LJ3 f;  4F7U G;  4A4G A;  5GMK j;  3CCV T;  2KMT A;  5CK9 A;  3P8D A;  2QQA A;  4FT2 A;  3V8K A;  2L8D A;  1NJI U;  3M54 A;  4C92 F;  2VGM A;  2XD0 A;  5FRM A;  3WVE B;  5IT9 E;  2Y90 A;  3OS2 A;  3CC7 T;  2EAY A;  4XTW A;  3JRZ A;  3OYD A;  1U8R A;  1I4K 1;  5GAM h;  3OYC A;  2JTF A;  2DD4 A;  1VQK A;  1VQ7 A;  3JCM e;  1LOJ A;  3MHX A;  3SDZ A;  3RUX A;  4F7U A;  1NZ9 A;  2QDY B;  3CCV A;  1KC8 U;  1VQL A;  4HT8 A;  5CVI A;  2FB7 A;  1VQM A;  1ZQ1 A;  1I5L A;  1B34 A;  1X6O A;  2FL7 A;  3UDC A;  3V7C A;  3J81 E;  2HBP A;  2OTL A;  4LD6 A;  4HCB A;  2XU8 A;  2DVE A;  2GF7 A;  2JOY A;  5KE2 A;  1KQS S;  1QVG A;  2LDM A;  4BE0 A;  2EKO A;  4ZN1 A;  4M78 C;  1BI3 A;  2X4J A;  2BIV A;  1H64 1;  4RCB A;  3OYB A;  3UPU A;  5HY6 A;  4BE2 A;  4M75 E;  4XTU A;  2RO0 A;  5HK3 A;  5CKF A;  2R58 A;  2KK4 A;  1VQL T;  5CKD A;  3G4S T;  4ZTJ A;  4HA8 A;  5GAO l;  1KHI A;  2OAU A;  3PTA A;  4FT4 A;  4OGC A;  1VQ9 T;  4QVC A;  3X26 B;  2DIQ A;  1YIJ T;  4C92 D;  1SSF A;  3KUF A;  5D6X A;  4M75 F;  4XTX A;  4PJO A;  3LGL A;  5IN1 A;  1Q81 C;  1IZ6 A;  4X9D A;  4C8Q C;  2FHD A;  2A7Y A;  2NLU A;  3OYY A;  4C5E A;  3OSV A;  2QEX T;  4MDW A;  3CME T;  1I81 A;  2Y4Y A;  4EDU A;  4ELZ C;  1QVG S;  2DIG A;  3OBW A;  3FDR A;  4C5I A;  1IRE B;  4M7D A;  2OTJ T;  4M7D E;  1G3W A;  2EIF A;  3L2R A;  3CPW S;  3GOX A;  4NOY A;  1S72 A;  1VQN T;  2XK0 A;  1N9S A;  4N0A C;  3OS1 A;  4JLI A;  3DB4 A;  5HKC A;  3F70 A;  2RK1 A;  3QDR B;  2E65 A;  3RKY A;  4M78 B;  5DY9 A;  3CBO A;  4OB0 B;  1VQ8 A;  4C0Z A;  3PIO A;  2V8K A;  3DKM A;  4J6Y A;  1VQ4 A;  5CAI A;  1Q86 U;  2RI3 A;  2L3R A;  5GAM j;  2OTJ A;  4M7A C;  2KSS A;  5A2Q E;  3O8V A;  4C5H A;  2RA2 A;  4DOW A;  4RG2 A;  2MWP A;  4XK8 E;  2M1H A;  3QZ9 B;  4JJN K;  1VQN A;  4ZGE B;  2L5Q A;  4C8Q F;  2E70 A;  3VYG A;  1N8R U;  3RER A;  3QZ5 B;  2RJD A;  4M78 G;  2VXE A;  2MWO A;  4J83 A;  4PKC C;  5DLO A;  3M56 A;  1PSF A;  4OP0 A;  3V8L A;  4BAC A;  4BI4 A;  1BIA A;  3FB9 A;  3OYJ A;  4M75 D;  3A8G B;  2RH2 A;  3QPH A;  3VUZ A;  1BYM A;  3VUB A;  2HNI A;  1K9M C;  4XQ3 A;  1WJR A;  4UC4 A;  3E9G A;  2DO3 A;  2WSC E;  4MZP A;  4KUL A;  3S3N A;  5LJ5 j;  1WQW A;  2RJC A;  4E7I A;  2QTX A;  3QXE B;  1YI2 T;  4PL6 A;  4JRQ A;  3M57 A;  4MMK A;  1ZHI A;  2LC4 A;  4MML A;  4NL2 A;  3G71 A;  5FRN A;  3Q1J A;  1VUB A;  2VV5 A;  1AHJ B;  4NS5 A;  1WJQ A;  1Q86 C;  3VYH B;  1O9S A;  4A4F A;  3TCJ A;  1BI2 A;  4QQG A;  5KE3 A;  3CCQ T;  2LX9 A;  4FU6 A;  5GMK h;  2RHU A;  3JCM d;  4PJO B;  1H3Z A;  1BIB A;  3G7Z A;  3OY9 A;  1OZ2 A;  4EMG A;  4R55 A;  1VIF A;  2DTH A;  1BI0 A;  3CEY A;  2CZ7 B;  3ZFJ A;  2XDD A;  2QI2 A;  4IUU A;  4J5Y A;  3OW2 S;  5GAN e;  2JUF A;  4C92 A;  3CCJ T;  3JCM f;  1K73 C;  3QO3 A;  2DK3 A;  2PVD B;  4FM4 B;  3N5B B;  3C12 A;  3BFM A;  3CCE A;  4LDU A;  4F7U E;  1D3B B;  1XOV A;  2E12 A;  2E10 A;  1M1G A;  2I2L A;  2ZZD A;  1EIF A;  4EMH A;  5LJ5 g;  5C0M A;  3JCM Q;  3QJ6 A;  2IVW A;  2EQM A;  3L2Z A;  4C8Q G;  5LJ5 d;  4P5N A;  5KH6 A;  5DM7 R;  3CXC A;  2KY9 A;  4IUQ A;  2DAQ A;  4C5G A;  4C8Q E;  4Y28 E;  5LJ3 e;  1R8O B;  4M78 F;  4BUG A;  4QVZ A;  4IUR A;  3MP8 A;  3CCJ A;  4M7A E;  2A3L A;  3I55 A;  2HAX A;  3DLM A;  2FYK A;  2GCX A;  2P0K A;  5GAN 8;  5J39 A;  1UB4 A;  2DXC A;  4JUV A;  4N4I A;  1QW1 A;  4F7U F;  2QA4 A;  3VJP A;  4ZGD B;  3URG A;  1UEB A;  4PJO C;  4M77 D;  3OYF A;  3JCM c;  4BY6 C;  4VUB A;  2YRV A;  4M75 C;  1W2B A;  3CXC S;  5GAN f;  5FU6 B;  4M77 G;  3M55 A;  1K8A C;  2R57 A;  1TH7 A;  3G4S A;  4L5G A;  1M9S A;  1D3B A;  5CO7 A;  4M7D C;  2BKD N;  1G3Y A;  3PNW C;  3JB9 I;  4QQD A;  4C0D C;  5LJ3 g;  3M9Q A;  4NL3 A;  3OMG A;  4E7K A;  3H8Z A;  2KDS A;  4JLG A;  5DLQ E;  1PSE A;  4N4G A;  5A0L A;  4XTY A;  3C94 A;  2K5F A;  4RG8 A;  2HQE A;  2E6N A;  3BDU A;  3JCM b;  1Y96 B;  2QEX A;  3M4Y A;  4M75 A;  3CME A;  3HRS A;  5LL6 S;  1YJN A;  5CKH A;  2LQK A;  2X35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...