4C92B

Crystal structure of the yeast lsm1-7 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
b'SENLYFQGSGSLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTERK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
molecule tags Transcription
source organism Saccharomyces cerevisiae
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92B00
4C92G 4M77F 2EJGA 4M7AF 2EAYA 4JLIA 2DTOA 5GMKl 1I81A 1D3BA 4M78F 3JB9J 5GAMd 2E65A 4PJOG 4QVDA 4C8QC 3V8JA 5GAN8 4PJOA 4M78B 5GMKe 3BW1A 5LJ5f 2Y90A 4M77C 4M7AC 1U1TA 3L1AA 1N9SA 2K57A 4M77A 4M7AA 5LJ5h 1WQ7A 2DTHA 3INZA 4PJOD 4M7DE 2E10A 1YCYA 3BY7A 3SB2A 4J6XA 3V8KA 2DVEA 4RCCA 4PJOB 3RIRA 5GMKj 4XQ3A 2DKGA 5GAMj 4F7UE 1BIAA 4C92F 1I5LA 4M78C 3QHSA 3V7CA 3VU3C 5LJ5d 5LJ3h 1KQ1A 4N0AA 1WPYA 1HXDA 3RUXA 3EFRA 3V8LA 4X9DA 5LJ5g 2DZ9A 5GAMe 2RD1A 3JCMP 2RA2A 3JCMV 4DQ2A 1BIBA 1Y96B 3FIFA 4XU1A 1WNLA 1LNXA 1LJOA 3GIBA 5GAOl 5GAN3 3FB9A 5LJ3d 5GAOp 3FJPA 4PJOE 4C92C 4M78G 4NOYA 3RKWA 4MMKA 1JBMA 4M78A 4JUVA 4XTWA 3JCMb 2VC8A 4M75D 4EMKC 3RERA 4M75C 4WF2A 3AHUA 3QUIA 4M75A 3SWNA 1D3BB 3JCMX 1JRIA 5CAIA 5GAN4 3JCMc 2FB7A 4PNOA 5GANg 2RB6A 3JB9H 4N0AC 4OP0A 4F7UB 4JRKA 2E41A 4RCBA 2EJ9A 4M75B 5GAMg 3V7SA 3JCMe 5GAN5 3JB9I 2HNIA 5GMKm 5GAOq 3JB9D 2RM4A 2YLCA 4M7DD 4A53A 2E1HA 4NL3A 4M75F 4M7DB 5DY9A 5GAOn 1HK9A 1N9RA 4C8QB 4EMHA 3PGGA 4C8QA 2DZCA 4M77B 4MMLA 4M7AB 5GMKi 5GAN2 4M75G 4J6WA 4C92B 2DXTA 1Y96A 4XTUA 2VXEA 4C8QE 5GAN6 1M5Q1 4M77E 4X9CA 5LJ3f 3V7RA 4M7AE 3M4GA 4XTXA 4M78E 3RKYA 4XTVA 5GANf 3JCMJ 4M7DA 4HA8A 1M8VA 2YLBA 3BFMA 4Y91A 4M7DC 2QTXA 5LJ3g 4M77D 2ZGWA 3JCMh 1U1SA 4EMGA 4M7AD 3HSBA 2DJZA 2DXUA 4V2SA 2CGHA 4NL2A 4C8QD 2FYKA 3JCMf 4F7UA 2E64A 1I8FA 5GANe 2VXFA 4QVCA 4JRIA 1I4K1 3JB9F 4M77G 2I2LA 1KQ2A 4M7AG 4M7DF 4XTYA 3JCMW 3JCMg 5GANd 5I21A 4C8QG 2DTIA 1WQWA 4J6YA 3QSUA 1B34B 4XU3A 4HT8A 2EJFA 4F7UF 4F7UG 5LJ3j 3JCMd 2JN0A 3SWNB 4C92E 3L2ZA 4EMKA 5LJ5e 4M78D 1MGQA 3HFNA 3RESA 4C92A 5GAOm 4XU2A 1LOJA 3JB9G 4M7DG 5GMKh 4C92D 1H641 5GANh 5GAOr 4EMKB 5LJ3e 4PJOC 4XTZA 2DEQA 1B34A 4XU0A 5LJ5j 2EWNA 3SWNC 3JCMQ 1X01A 4J5YA 3QO3A 4M75E 3EFSA 5GAMh 4A54A 5GAN7 4HT9A 2YHTA 5GANj 4PJOF 5GAMf 3HFOA 3RKXA 3BDUA 4C8QF 1TH7A
chains in the Genus database with same CATH superfamily
1VQKT 2EJGA 1RLPC 2F69A 3PMTA 4VUBA 2JNGA 2X3WD 3CD6Q 2PNIA 5FU6B 3PFSA 2F2WA 1W6XA 2CKKA 8ATCB 5CO7A 3CC2Q 3L2RA 2J7IA 2KRMA 1BCMA 3CCUQ 4C92F 2MOXA 2RJFA 2CZ7B 2VV5A 2DVJA 2L3SA 1WLPB 3M59A 3NFCA 3OQ5A 1WXTA 4AG1C 3FB9A 3MP8A 3EHQA 2EYWA 3EG3A 4ZGEB 1SF9A 1G83A 1D1BA 3UT1A 3M56A 2LVMA 1TOVA 2ZZDA 3NTHA 1SPKA 2DERA 4PKCC 3OYCA 1YJWA 3OMCA 1YHQA 5GAN4 3VKIA 2QDYB 4RCBA 4NL3A 1GFCA 2EJ9A 3R6OA 5J39A 3L42A 1YHQQ 4OMPA 1FXXA 2EGAA 3CPWA 2XK0A 1EX4A 2JTFA 4A4FA 1VQPQ 2CREA 2ABLA 2EQJA 4IIMA 4ZN1A 1QVPA 1UGSB 1YIJT 2GTJA 1VQNQ 4ELZC 1UG1A 3QXEB 4A4HA 4NL2A 1TUGB 1I8FA 2PUKB 3LYIA 2WSEE 2DRMA 1LCKA 2V26A 4J9BA 4HVUA 1FX7A 5IAYA 3M0SA 2OI3A 3EGXB 2HL5C 4FYYB 5KYXB 4C0DB 1NYGA 1KHIA 2BE7D 2EWNA 1BBZA 5GAMh 2CP3A 2NWMA 1Q81C 2YHTA 1YWPA 2WACA 3C12A 2MWPA 4E47A 2K3XA 4M77F 4M7AF 2RI2A 3META 2A37A 4DEYA 1RUWA 1XTDA 1NM7A 1GXIE 4BUGA 1QWEA 4M78B 4LDUA 3OSVA 3O8VA 2K57A 2ZPHB 1WQ7A 2E3HA 1VYVA 2DVEA 2L3PA 5GMKj 1KQSA 4LUEA 4OF1A 2DJQA 1MNEA 2RQVA 2DL3A 4PLLA 1Q7YU 1BK2A 3EG0A 3OYJA 3EFOA 3EG9B 3BE3A 2XG8D 1AD5A 4Z89A 3ER0A 3I55Q 2OTJQ 3A8OB 4P5NA 2QEXA 4BE2A 2FZKB 2OTLA 1BI2A 4TVRA 4CC4B 3CPFA 2PUOB 3VRYA 2RB6A 1VQOT 1M90U 4QQGA 2RQTA 4FL6A 4M75B 1AHJB 2MPXC 2KXCA 2KYBA 3E19A 2QDLA 4C8QB 3CCST 1VQ6T 4MMLA 2M0OA 4FIBA 2DXTA 4C8QE 2LCCA 2DL5A 1ABOA 2LX9A 3KBGA 2EVRA 2EIFA 1U1SA 2A28A 3OA6A 3S3MA 4BI3A 2JM9A 2RK1A 2DL4A 1FMWA 1WQWA 3QSUA 4L6V5 2L89A 1OYXA 3CBPA 2BIVA 1MMDA 1PWTA 5IHNA 2JJ9A 2B86A 2D0NA 2EQUA 5KE2A 1WHLA 1Y57A 5CQYA 3MEUA 4D8DA 2JMAA 1ABQA 3G1JA 3HFOA 2EGEA 1M3CA 1ZA2B 1JXOA 5C6SA 2COYA 3PIOA 2RO0A 2DYIA 3M0UA 5LJ5h 3QDFA 2ENMA 4N4GA 4CC2A 1SRLA 4J6XA 3VS0A 1QP2A 3OYLA 3IQLA 3CMAQ 3FRNA 2LQWA 1BIAA 3GPLA 4OGCA 1VQ5T 2QQAA 1XNIA 2CSIA 2PTKA 1D09B 3H9NA 2K2VA 2ECZA 2RI5A 5J26A 5L8RE 1KQSS 2GQIA 1HJDA 5M9OA 4MMKA 3DKMA 3QIIA 4M75D 1M30A 1VQ9A 3EGUA 3UWNA 1XOVA 4M75A 1YI2T 2DM1A 1JRIA 5EC7A 5CAIA 2KY9A 1K73C 2CT4A 1QW1A 1VQ9Q 1ZHIA 2CP5A 2K6DA 3M0QA 4KH0B 3TU4K 3LH0A 2E1HA 4L5GA 4DBRA 2RJDA 5GMKi 2RHYA 3EH1A 1M2VB 3I55T 5KYYA 3EG1A 1BCOA 5LJ3f 4KH1B 1TUCA 2QTXA 3M53A 4M77D 4M7AD 4F7UA 1AEYA 1ZUKA 3MCAB 1M1GA 1KQ2A 3FC3A 2ROTA 3CCVQ 4BB7A 1SHFA 3PE0A 2VGMA 1QVGP 1QLYA 1MMGA 1NJIC 1JEGA 1OX9A 2HBPA 5GANh 5GAOr 2R57A 3C0CA 5D6WA 2NUTB 2JMCA 2M51A 2CP6A 1M9SA 2FL7A 2Z0WA 1X01A 3EFSA 4PFPA 4A54A 1FYNA 1YBYA 3CCUT 2CDTA 2JXBA 5GAMf 1NBEB 2RK2A 5FU7C 2K2MA 3VS3A 5GMKl 3L2QA 2DBKA 1O9SA 5GAMd 2E65A 3V8JA 1NPPA 4ZGDB 3QJ6A 4MZPA 3VS2A 4PJNA 2PVDB 4RUGA 4BY6C 4J9FA 4PJOB 1EZZB 2HKNA 2F2XA 4RKUE 5DLOA 4J9EA 1VQ7Q 4MZMA 3FJ5A 3CCJQ 1TTHB 5KYUB 1NJIU 4HKEA 2L8DA 2HL3A 3TSWA 2ED1A 4DQ2A 1PD1A 3ME9A 3CCSA 1KG1A 3T9NA 2HCKA 3FJPA 1N8RR 1OZ3A 3OY9A 4FCYA 1VQPT 5IHKA 5J3BA 1BI0A 3QUIA 3QPHA 2RQUA 1GBRA 4LE9A 2F5KA 1Y0MA 4J83A 3I56A 2FB7A 1UJ0A 3E9GA 5FROA 3DLMA 1IXDA 3V7SA 3JCMe 3M0RA 2LCLA 1R8OB 5EG2A 1X43A 4EMHA 3G4ST 5IXBA 1HSQA 3CCEQ 4OB1B 3VS7A 2DEUA 3M4GA 2HQEA 2E3IA 3FDRA 1Y71A 2EQIA 1ACMB 1K9MR 4CI0C 4QVCA 4OMLA 2LX7A 4HCZA 5I21A 1GCQA 1OZ2A 3CCLA 2ZPFB 3L2ZA 3QYHB 2EGCA 4E7LA 2CYZB 4C92A 1PKTA 5A2QE 2LNVA 4LNPA 1UB4A 1SHGA 4EMKB 4J9HA 3FEOA 4J5YA 4E7SA 2RF0A 4LXCA 4XTUA 3S3OA 4C92G 2K5IA 3REBB 2KEAA 3HRSA 4C8QC 1VQ5Q 1AOJA 1OPKA 4X1VA 2FPEA 2DTHA 2LTOA 2LJ3A 2I0NA 1VOMA 2F1LA 3OYGA 1M3BA 4F7UE 4FYVB 1I5LA 4FYXB 1PHTA 1NLPC 2LP5A 4JLGA 1ZBJA 1PC0A 1SKUB 4HCCA 1V29B 4IUVA 1QCFA 1S1NA 1K9AA 2QK0A 1YI2Q 3VS4A 3ZEHA 4UC4A 4HXJA 5LJ3d 2OAUA 3RKWA 1VIEA 5GANj 4RTZA 2K7AA 2CH4W 1UTIA 5HK0A 1ZSZB 4XK8E 3DLLA 2X3XD 1M2OA 4LUDA 2CUDA 2O9VA 1OPLA 1RABB 1MV0B 1MUZA 1UHCA 2YLCA 1YJWT 4IIOA 3S6WA 1YCSB 4Z8AA 2X9HA 3VYHB 4ELYC 3CEYA 2QA4Q 1G8XA 4BE0A 4Y91A 3VJPA 2MI6A 1JJ2A 5I2MA 2QGFB 4XTYA 4B9WA 5KCHA 4C5GA 1S72Q 2HQHA 2LNHB 1X6BA 4HCKA 4ORZA 3G4SQ 2V1QA 2VB6A 1KQSP 4PJOC 2FZGB 4EPCA 3G4SA 1IREB 1YJ9T 4F14A 1RACB 1I07A 3GNFB 4IURA 2BZ8A 3ZFJA 4LDVA 2DL8A 1VQMQ 2DTOA 1ZSZA 2QEXT 4EDUA 4CC3A 4JJDA 2KXDA 4N4IA 1VQ7T 3HKSA 1RAEB 2M02A 2LDMA 2KR3A 3SB2A 1YCYA 2H3EB 4FYWB 3VS1A 1SSHA 4ME7A 2O4XA 2DKGA 3I9QA 2YRVA 3QHSA 2RNAA 1RAIB 5LJ3h 3G71A 4J8OA 4OB2B 5FU7B 3EFRA 2L0AA 3OS1A 5GAMe 1KC8C 3OBYA 2NUPA 1OV3A 2EBPA 4ZTJA 5ECAA 2P0KA 4NOYA 1UFFA 3OYYA 3AHUA 3CC4T 1RADB 2X4WA 3RMQA 5HK3A 3EGDB 3KUFA 2PU9B 1RAFB 1OQKA 1AT1B 2E41A 3LX7A 5CKBA 4OMMA 1RLQC 3CBOA 2AKLA 2M0YA 3MJXA 2OTLQ 2E70A 1HK9A 1QQJA 1WDXA 4F17A 4C8QA 5GAN2 2ZCFB 4PLIA 2NYSA 3JCMh 5CKDA 1I0CA 3X26B 1KC8U 2FYKA 2D9TA 2B8AA 2JUFA 5D7UA 2BKDN 3OW2A 4NS5A 4JRIA 1I4K1 4JJCA 3OYDA 4FT4A 1AWXA 3VYGA 1YIJA 1YITT 1Q86C 5HCKA 5HKCA 1QCOA 2M9UA 3NTIA 1LOJA 2CZ1B 4C92D 1QMCA 1K73U 2LZ6B 1VQKQ 4GLMA 3CCLQ 1VQ7A 1O75A 1X27A 3URGA 1VQ8Q 2GFAA 3EHRA 2YUQA 4FW2A 3SDZA 4DBHA 1QVGS 4QKUA 2JVVA 4KGXB 2DD5A 2P4RA 4OMNA 4BDYA 1KD1C 2HQXA 2KRSA 2R5AA 1JJ2S 1D3BA 1PCXA 3JB9J 5GAN8 1GL5A 1Q82R 2K9GA 2P0QA 2W10A 1X6OA 4FM4B 2VUBA 2LT1A 3UPUA 3A8LB 4FSXA 2XU8A 3LWHA 3E2UA 5FRNA 2GGRA 2SEMA 1WPYA 4GBQA 3TCJA 1NE8A 2RA2A 2EQMA 1WNLA 2ZPIB 3QZ9B 4M78G 2X51A 3MP1A 1GCPA 3CCJA 1KD1U 3RR6A 4JJNK 1IB8A 2EFIA 1YHQT 3A5ZB 3QJYA 1Z9ZA 1FMVA 3Q1JA 3MP6A 2DBMA 1K0XA 4OP0A 4D8KA 4JRKA 3HP9A 5GAOq 2RM4A 4J7FA 5AT1B 4M7DB 1N9RA 2AHJB 1U3OA 2M16A 3UA6A 4DOVA 2WSFE 1Y96A 2VXEA 4C0DC 1H8KA 3V7RA 1K73R 4XTXA 2YRCA 2O31A 1UECA 3RKYA 5KYUA 4MDWA 3RDVA 3BFMA 3A1PA 1W70A 1T0HA 2HMAA 5KE3A 4V2SA 1GBQA 2DXUA 2FHDA 3RMSA 1BU1A 1G3YA 4RTWA 7AT1B 5I2SA 2RH2A 8AT1B 4FU6A 1OX8A 3CMEA 3VUBA 4XU3A 1NEGA 1YJ9Q 3PMIA 4A4KA 1M1KR 3S3NA 2E6ZA 1WHGA 1M1KC 1WHHA 1JQQA 1M2VA 5GMKh 3SD4A 2D8HA 3CCVA 1UGQB 5LJ5j 3OYAA 3JCMQ 5FWBA 2DO3A 2KNBB 5GAN7 4OVAA 2CH4A 2J6OA 1ZSGA 3ULRB 1TH7A 2CP7A 2CS7A 2XDDA 2ED0A 4JZ3A 2ESWA 4M78F 4DBFA 1TG0A 2O4XB 1MNDA 2EPDA 2YT6A 2IG0A 5C0MA 4AMCA 3QYGB 1WZOA 2QAZA 1KSWA 4AFUC 2QASA 5FWCA 2GFUA 4RTTA 2YUOA 1I5OB 4HVWA 3DB3A 3OBWA 2K3YA 2MK5A 2J6FA 2AK5A 2LQ8A 1LNXA 1LJOA 3NHNA 4E7JA 4PJOE 4JS4A 1D1CA 1WA7A 2VC8A 2YUNA 1FMKA 2OTLT 3CCSQ 3JCMX 2RHZA 3H0IA 5FRMA 1VQNT 2MAMA 4X34A 2DXBA 2HNIA 2V1RA 1EIFA 3G6EA 3I56T 5GAOn 1YJNT 1I1JA 2MF2A 1K9MU 4M75G 1K0SA 3G6EQ 1VQLA 4M7DA 2AIRB 2K79A 4AFQC 1M8VA 1KJWA 4M7DC 4FSSA 3HSBA 4E6RA 2DIQA 2E64A 1QKXA 2EKOA 1KHCA 5L23A 4QT7A 2KRNA 1VQ4Q 1UGVA 4HT8A 4ZTFA 2EJFA 4C5HA 3H8ZA 1E6HA 1X69A 1Q95G 1X6GA 3CXCA 5GAOm 5KH6A 1NYFA 1Z9QA 1QVFP 2PVGB 1N8RC 4Q5WA 3HPWA 5A0DA 1VQKA 2CT3A 2X35A 1G3TA 1AVZC 3CC4A 3BDUA 1FWZA 3X28B 1MV3A 2GTOA 3L2WA 3U23A 2D0QB 2C0TA 5GJVB 5GMKe 1P92A 1SSFA 3EG9A 1WHMA 2DD4A 2E5KA 1Q82C 4KGZB 5GAMj 1VQ5A 1VQLT 2QTVA 3I5SA 4R0KA 2ZPBB 3V8LA 1B3QA 4OGEA 4XU1A 1NPRA 2YUPA 2F5TX 3J80E 1VQ6Q 2RPNA 2XICA 1IZ6A 4M78A 4JUVA 1YWOA 1ZA1B 2RHUA 2OX7A 1HD3A 2L3RA 2FZCB 1UHFA 3UDCA 1JXMA 5D6YA 1VYTA 1B07A 4A63B 5GMKm 2BZYA 1R77A 1EFNA 2KMTA 1SG5A 3PGGA 2DZCA 2FPDA 4M77B 4M7AB 4D6WA 3H6ZA 1D0XA 3CCVT 1U06A 1VQ9T 3M0PA 5CQXA 2HBWA 1G5VA 5LJ3g 1A0NB 5GANe 1TXQA 3E9FA 3KFVA 3HRUA 3JB9F 1UJYA 1IGQA 3M57A 2G6FX 4J9IA 1MGQA 2QQBA 3CCQQ 2FRYA 1M1FA 3LGLA 4AG2C 5LJ3e 1WI7A 4XU0A 1C0MA 3MEWA 3CCQA 3A8GB 1OU9A 3CMAT 1KC8R 3MKDA 2DNUA 2JW4A 4O5VA 4PJOG 2CZ0B 2QI2A 1QVFS 3DB4A 1G2BA 4MDXA 3M5AA 2ZAEA 1VQMA 2XD0A 2RMOA 2KE9A 2E10A 3V8KA 3BY7A 1Q81R 4JS5A 2R58A 1JO8A 2HKQB 3VU3C 1W2BS 1CKBA 2QQSA 5LJ5d 1QVGA 2XI9A 3CC7A 1NJIR 2JOYA 3RUXA 2DZ9A 4FW1A 2P84A 4JDSA 3QBYA 2A3LA 3CCRQ 3GIBA 5GAN3 1WX6A 5CKEA 9ATCB 1PNJA 2IIMA 4C92C 3H41A 2XKOC 4DEXA 3VRZA 2RHXA 2DA9A 3CCRA 1D3BB 1QVFA 3TEEA 4ESRA 5IXFA 2COZA 3JB9H 2W0ZA 4N0AC 4F7UB 4LDXA 6AT1B 1VYUA 3SFMA 1MMAA 1M27C 4J9DA 4KULA 5CR2A 4QVZA 3H0HA 2MWOA 4M77G 4M7AG 1WYXA 1YJWQ 1OEBA 2JN0A 3SWNB 3QG1A 5LJ5e 2GNCA 5DLQE 3HFNA 1IHWA 4IUQA 4OB3B 1MMNA 2RJCA 1J3TA 2YRDA 1YIJQ 2CUBA 3CMEQ 1BYMA 1K8AU 3RNJA 3PVQA 1RI0A 3E1SA 4ANJA 2ATCB 3CCJT 4QQ6A 1D1AA 1WIEA 2RI3A 5LJ5f 1KIKA 2X4JA 1KD1R 3PTAA 2F2VA 4F16A 3OYMA 4M7DE 3RIRA 4XQ3A 3MPUB 4A4GA 5A0GA 4R56A 4M78C 1H92A 2M1HA 4JZ4A 2D1XA 3NPFA 1HXDA 1QCNA 3M9QA 5LJ5g 3OYHA 2RD1A 3C95A 2EYZA 3CQTA 5FW9A 2O88A 1VUBA 3OW2P 1VQLQ 1G3WA 1K8AC 3CCET 2JM8A 5FLXE 4EMKC 2JS0A 4WF2A 3M0TA 3SWNA 4IUTA 3G6ET 2C0IA 2RHIA 2Y4YA 2HSEB 3WVEB 3N5BB 5KYNA 4BACA 1BI3A 2XDPA 3L2VA 5GAMg 1PRMC 5CIUA 4A53A 4M75F 2DETA 2CSQA 4OMOA 1SEMA 3M55A 4C0ZA 1R0CB 2NUPB 1ZQ1A 3LGFA 1M5Q1 1GRIA 3CC4Q 3R6NA 3SEMA 4HA8A 4DA4A 1PSFA 1YN8A 4GLKA 1YP5A 2ZGWA 1WHKA 4PL6A 2VXFA 3CPWP 2L3QA 3GNGA 2PZ1A 3I5RA 3M54A 1PSEA 2YSQA 4RG8A 4E7IA 4F7UG 1QP3A 3OYIA 2V8IA 3TQ7P 3VS6A 2X4YA 4EIKA 1Q7YC 1S72A 1T0JA 1WJQA 2QQRA 2QYZA 4E2FB 1YJ9A 2BUDA 3MEAA 1TU0B 4RG2A 5IH2A 3RBBB 5FU6C 1YI2A 1K9MC 2LQKA 1G3SA 1M90R 2EAYA 1UGRB 1PD0A 1YITQ 2ROLA 3EGXA 4QVDA 3BW1A 1YNZA 1M8MA 1CKAA 4BI4A 4C5IA 3CXCS 1KFZA 1ZX6A 1TSFA 2DIGA 1RI9A 2DK3A 2C06A 2E6NA 1T3LA 2KDSA 2LQNA 4X9DA 4JRPA 4IUUA 1BIBA 4ZN3A 1ZSZC 1C6VX 1N8RU 2QGGA 3C4SA 5GAOp 2K5FA 2LJ0A 2GCXA 2IPOB 2QA4T 3RERA 1BKBA 2KK4A 3LLRA 4K11A 4DOWA 2NUZA 2DFUA 3UA7A 1WHJA 3JCMc 4ZGJB 4A4EA 3OS2A 2IVWA 4KRTA 4LD9K 4II1A 1VQOA 3VUZA 1QKWA 1AZGB 3ZBDA 4BD3A 2LMJA 4OMQA 1K4US 2VKNA 1E6GA 4HVVA 3NGPA 2DX1A 2FRWA 3JV3A 2COWA 1VQ8T 1D0YA 5GANd 3JAME 1RAGB 5LJ3j 4C92E 3TSZA 5CKFA 4M7DG 3OYBA 2VVKA 1OI1A 2FG0A 3L2UA 2KT1A 1OOTA 3OMGA 3QO3A 4PK4A 4RTXA 4N4HA 4JPBW 4AFSC 4C8QF 3LW5E 1I81A 3CCLT 2L5QA 1JU5C 4WCIA 2Y90A 1U1TA 1MHNA 3A8MB 3INZA 5CCAA 4PJOD 3MO8A 2A36A 3X20B 2CP2A 2OTJT 2JS2A 1NEBA 4IKFA 2QQ9A 1R0BG 5IHIA 3TREA 1XQHA 1HYOA 4N0AA 3CCMA 2HEQA 2VWFA 1PG5B 1TWBA 2DF6A 2RQWA 4J9GA 1AZEA 2SRCA 1PM3A 1PKSA 4Z88A 5A0LA 2KYMA 4HCBA 2BE9B 3CCMQ 4XTWA 1JBMA 5HY6A 1X2QA 1V1CA 1Q86U 3OS0A 3OB9A 2H8HA 1VQ6A 4CRIA 2LCSA 1U5SA 3X24B 4BI8B 3JB9I 2YXYA 1K76A 1K1ZA 1ZUYA 3EAEA 1NZ9A 3JB9D 4FT2A 5LL6S 5CK9A 5KYXA 1VQNA 1VQ8A 2X4XA 5D6XA 2Y4XA 3OYKA 4GY5A 4M4ZA 4X9CA 4M77E 3GBQA 4M7AE 1UDLA 4M78E 3JCMJ 2YLBA 4PJMA 1ARKA 3CMET 1WFWA 2KAFA 1N5ZA 2EYYA 3KXTA 3UATA 1B34B 3I56Q 3JCMd 4EMKA 1RL2A 1OU8A 4L59A 4PFOA 2XHCA 2JTEA 2DEQA 1B7TA 2AZVA 4M75E 2KVQG 4WTOB 4PJOF 4PJJA 3SHWA 3J81E 1AWWA 3NMZC 4LDWA 1VA7A 3C94A 4BE1A 4BY6B 3CC2A 2AKKA 2LC4A 1UUEA 1OULA 5AYFA 3QKJA 3NTKA 2D6FA 2BTTA 2E5QA 3A8HB 4ZNXA 2HD0A 3G7ZA 2GQVA 2ZPEB 4AFZC 5CKHA 3HRTA 2E12A 2MCNA 1SRMA 4KUDK 1T3SA 3HL8A 4RMOA 3G71T 3CPWS 2HDAA 2KSSA 2NUTA 4BDZA 5GAOl 4JJBA 2LJ1A 2DRKA 4OMFB 2A7YA 1VIFA 3MHXA 1Q7YR 5KCOA 1M1KU 3OYNA 2CP0A 2QA4A 3OSSC 5GANg 1E7OA 2OAWA 4MZTA 2EYXA 5GAN5 2WSCE 1Y07A 2DE0X 3CCUA 3CCEA 4Y28E 1M4ZA 4LDYA 1Q81U 1LVKA 2KROA 2DYBA 3O5ZA 4J6WA 2RN8A 2MIOA 5GANf 4XTVA 1KK7A 2QXFA 2AZSA 3UF4A 2DJZA 1YJNQ 1X2KA 2CGHA 2DILA 4C8QD 2XDBA 3WXMB 2I2LA 3JCMg 4C8QG 2VYTA 2MMPA 2ZPGB 2LRQA 2NLUA 1TS9A 1NG2A 4XU2A 2DAQA 2DMOA 1V76A 5I22A 1WJRA 3THKA 1B34A 2D8JA 3CD6T 1VQ4T 3GF5A 2O2OA 2K4YA 3J7AF 5IN1A 4OB0B 3PVLA 4RTVA 2XMFA 1VQPA 4QQDA 3QWYA 3RKXA 3CD6A 2MYSA 3OYFA 2EYQA 1W2BP 1JB0E 3CC2T 1UEBA 3EGDA 1S72T 1H3HA 5KYWA 1W2BA 4PJLA 3A98A 3CMAA 2BZXA 2FO0A 1M90C 2KBTA 4KUIA 4M77A 5GJWB 4M7AA 2DLPA 2RJEA 2A08A 3P8HA 2P0PA 4JRQA 4AT1B 1RAHB 3QWXX 3LH5A 2XIDA 2JZ2A 3CXCP 1UE9A 3D7SB 2OTJA 2DL7A 5I11A 1IHVA 3JCMP 2QEXQ 2KI7A 1ZBXA 2FEIA 4PFZA 3LWIA 4LD6A 1ZUUA 2RQRA 1LPLA 2H3JA 1N27A 2YWWA 2GF7A 4E7HA 4YTLA 3OYEA 4DBQA 3TVTA 3OS5A 3PT9A 3GOXA 2OJ2A 1CSKA 2EQKA 3CCRT 4C0FA 2JT4A 3EG2A 4B6MA 3EFOB 2V8JA 1UGPB 1JJ2P 2E4HA 2QG9B 2L2PA 5KYWB 1M3AA 3CC7T 2R5MA 2O9SA 2EKHA 3JRZA 3I55A 2J05A 1XJWB 1IGUA 1Q82U 3JCMW 2DTIA 4C0GA 3ZL7C 1RAAB 4M78D 1AWJA 4R55A 5KYYB 3AT1B 4QW2A 4B9XA 3JB9G 2DXCA 4RTUA 3PNWC 1Q86R 3GLXA 1K8AR 1VQ4A 1DJ7B 4HT9A 3HTRA 4Y92A 3FLGA 2PQWA 1ZLMA 4F04B 4JLIA 2VASA 1WXUA 4PJOA 3BDLA 4M77C 4E7KA 4M7AC 3L1AA 1N9SA 3CCMT 1TUDA 3QDRB 4J9CA 3H0FA 5DM7R 4KT0E 2VGNA 3P8BB 3G71Q 1Y7XA 4RCCA 2KQWA 2KT8A 1YITA 1WGSA 1PRLC 2PVOB 3V7CA 1WJSA 2CZ6B 1KQ1A 1WXBA 1IO6A 3I35A 4O6JA 3JCMV 2G3RA 1Y96B 3FIFA 2V8KA 2HZYA 1X75C 1BI1A 3HHTB 1W1FA 3JCMb 4M75C 2GBQA 1YFNA 2C0OA 1C1AA 4E7ZA 3M58A 4CC7A 4XAXB 2HAXA 2K5LA 4PNOA 2KGTA 2P4TA 4J7IA 3VS5A 3MEVA 4Z02A 2DPPB 1AWOA 4KGVB 3WVDB 2FVUA 4M7DD 2A0FB 5CVIA 5DY9A 3PIPA 3CBMA 2JTMA 4C5EA 3CCQT 2AT1B 1NLOC 4C92B 2K3BA 5GAN6 2EW3A 1VQOQ 1IRXA 2LT4A 2J06A 4LN2A 5IT9E 3F70A 1H3ZA 3VV0A 4EMGA 2YDLA 3JCMf 2J6KA 4IUPA 4RTYA 4M7DF 1GCQC 4J6YA 1VQMT 1F1BB 1YJNA 4F7UF 1W4SA 3REAB 2O01E 3RESA 3P8DA 3X25B 2HSPA 1H641 3JSCA 3QZ5B 4ATOA 3M4YA 3OW2S 1N6AA 4XTZA 3GP8A 3CC7Q 1U8RA 3ASKA 1QWFA 3EH2A 3SWNC 1D0ZA 1BB9A 4KBMB 2FPFA 1GFDA
chains in the Genus database with same CATH topology
3S3OA 1FWZA 3X28B 4C92G 1VQKT 2EJGA 3L2WA 1I81A 2K5IA 3CCLT 2F69A 3PMTA 2D0QB 4VUBA 2JNGA 3HRSA 4C8QC 5GMKe 2L5QA 2Y90A 5FU6B 1P92A 1U1TA 1MHNA 3PFSA 1SSFA 2DTHA 3A8MB 2LTOA 3INZA 5CCAA 2DD4A 4PJOD 2CKKA 3MO8A 3X20B 5CO7A 2OTJT 4IKFA 1Q82C 2QQ9A 3L2RA 5GAMj 3OYGA 1VQ5A 4F7UE 1VQLT 4C92F 1I5LA 3TREA 2RJFA 1XQHA 2CZ7B 4N0AA 4JLGA 3CCMA 2ZPBB 3V8LA 4HCCA 2VV5A 1V29B 4IUVA 4OGEA 3ZEHA 3M59A 3NFCA 3OQ5A 4XU1A 1NPRA 5A0LA 4UC4A 2F5TX 3J80E 4HCBA 3FB9A 5LJ3d 3MP8A 2OAUA 4ZGEB 2XICA 1VIEA 1IZ6A 1JBMA 4M78A 4JUVA 4XTWA 5HY6A 3RKWA 5GANj 3UT1A 2RHUA 3M56A 2LVMA 1Q86U 2ZZDA 3NTHA 3OS0A 3OB9A 4PKCC 5HK0A 4XK8E 2L3RA 3OYCA 3OMCA 1YJWA 1YHQA 1VQ6A 3DLLA 5GAN4 3VKIA 4CRIA 3UDCA 5D6YA 2QDYB 3X24B 4RCBA 4BI8B 2EJ9A 3JB9I 3R6OA 5J39A 4NL3A 5GMKm 3EAEA 1NZ9A 2YLCA 3L42A 3JB9D 1YJWT 2KMTA 4FT2A 3S6WA 1FXXA 5LL6S 3PGGA 5CK9A 3CPWA 1VQNA 2XK0A 2X4XA 1VQ8A 2DZCA 5D6XA 4M77B 4M7AB 2Y4XA 3VYHB 4GY5A 2JTFA 4D6WA 3OYKA 4ELYC 3CEYA 4A4FA 3H6ZA 4X9CA 4M77E 3CCVT 1VQ9T 4M7AE 4BE0A 4M78E 2EQJA 3JCMJ 4ZN1A 5CQXA 1QVPA 1UGSB 1YIJT 2YLBA 1G5VA 4Y91A 5LJ3g 3CMET 4ELZC 3VJPA 3QXEB 2MI6A 1JJ2A 4A4HA 2KAFA 5I2MA 4NL2A 5GANe 3E9FA 1I8FA 2PUKB 3LYIA 3HRUA 3JB9F 2WSEE 4XTYA 4B9WA 3KXTA 5KCHA 4C5GA 1B34B 3M57A 3JCMd 4EMKA 1RL2A 1MGQA 2QQBA 1FX7A 5IAYA 4L59A 4C0DB 1KHIA 1M1FA 3LGLA 2XHCA 5LJ3e 4PJOC 2DEQA 4XU0A 4EPCA 2EWNA 3MEWA 3G4SA 3CCQA 4M75E 1IREB 3A8GB 5GAMh 2KVQG 1YJ9T 3CMAT 1Q81C 2YHTA 2WACA 4PJOF 3J81E 3C12A 2MWPA 3GNFB 4E47A 2K3XA 3G6EA 4IURA 4LDWA 3ZFJA 3C94A 4BE1A 4BY6B 3CC2A 4LDVA 4M77F 4M7AF 2RI2A 2DTOA 3META 2QEXT 4EDUA 1XTDA 4O5VA 4PJOG 2CZ0B 2QI2A 4BUGA 2LC4A 4M78B 4LDUA 1GXIE 4N4IA 1VQ7T 3OSVA 5AYFA 1QVFS 3HKSA 3DB4A 3O8VA 2K57A 4MDXA 2ZPHB 3QKJA 3NTKA 2D6FA 1WQ7A 2E5QA 3A8HB 3M5AA 1VQMA 2XD0A 2LDMA 2E10A 1YCYA 2HD0A 3BY7A 3G7ZA 3SB2A 2DVEA 2GQVA 4ME7A 3V8KA 4JS5A 2R58A 2O4XA 2ZPEB 5GMKj 2DKGA 1KQSA 5CKHA 3HRTA 4OF1A 2YRVA 2E12A 3QHSA 3VU3C 1W2BS 2QQSA 5LJ5d 5LJ3h 1QVGA 3G71A 2XI9A 3CC7A 4J8OA 4OB2B 2JOYA 5FU7B 3EFRA 3RUXA 4KUDK 4PLLA 2DZ9A 3HL8A 3OS1A 5GAMe 1Q7YU 4RMOA 3G71T 4JDSA 3CPWS 2KSSA 3QBYA 3OYJA 1KC8C 2A3LA 3OBYA 4BDZA 3GIBA 5GAOl 4OMFB 5CKEA 5GAN3 2XG8D 4ZTJA 4C92C 2P0KA 2A7YA 4NOYA 1VIFA 3ER0A 2XKOC 3A8OB 3MHXA 3OYYA 4P5NA 2RHXA 5KCOA 3CC4T 3AHUA 3CCRA 2X4WA 1D3BB 2QEXA 3RMQA 5HK3A 1M1KU 4BE2A 1QVFA 3KUFA 2OTLA 1BI2A 3TEEA 4TVRA 3CPFA 2PU9B 3OYNA 2QA4A 3OSSC 2PUOB 5GANg 2RB6A 1VQOT 1M90U 3JB9H 4N0AC 4QQGA 4MZTA 4F7UB 2E41A 3LX7A 2WSCE 1Y07A 1AHJB 4FL6A 4M75B 5CKBA 5GAN5 3CCEA 3CBOA 4Y28E 3CCUA 1M4ZA 4LDYA 3E19A 1Q81U 2E70A 1HK9A 4C8QB 3CCST 1VQ6T 4C8QA 4MMLA 5GAN2 2M0OA 4FIBA 4J6WA 2DXTA 4C8QE 3SFMA 2LCCA 2ZCFB 5GANf 2LX9A 4XTVA 2QXFA 3KBGA 4KULA 4PLIA 3JCMh 5CKDA 2EIFA 1U1SA 2DJZA 5CR2A 2CGHA 4QVZA 3X26B 2FYKA 4BI3A 2D9TA 2B8AA 2JUFA 4C8QD 2BKDN 3OA6A 3WXMB 2RK1A 4NS5A 3OW2A 4JRIA 2XDBA 1I4K1 2MWOA 4M77G 2I2LA 4M7AG 3OYDA 3JCMg 4FT4A 4C8QG 1WQWA 3QSUA 2VYTA 4L6V5 2L89A 1OYXA 3VYGA 2MMPA 2JN0A 3SWNB 1YIJA 2ZPGB 3CBPA 3QG1A 1YITT 1Q86C 2LRQA 2NLUA 5LJ5e 5DLQE 3HFNA 2BIVA 4LDXA 5HKCA 2M9UA 3NTIA 4IUQA 4XU2A 1LOJA 4OB3B 2DAQA 2CZ1B 4C92D 2RJCA 1K73U 1WJRA 1VQ7A 2EQUA 1B34A 1O75A 3URGA 3CD6T 2GFAA 1VQ4T 5KE2A 3GF5A 2K4YA 3SDZA 3J7AF 1BYMA 5IN1A 1K8AU 4OB0B 1QVGS 5CQYA 3MEUA 1VQPA 2JVVA 2DD5A 3HFOA 1RI0A 3E1SA 4QQDA 3RKXA 4BDYA 3CD6A 1KD1C 2HQXA 3OYFA 2EYQA 1JB0E 3CCJT 3CC2T 1UEBA 2R5AA 4QQ6A 1S72T 1JJ2S 1D3BA 2RI3A 3JB9J 5C6SA 3PIOA 1W2BA 5GAN8 2RO0A 3CMAA 5LJ5f 1M90C 4KUIA 4M77A 4M7AA 2X4JA 5LJ5h 2RJEA 4N4GA 3PTAA 2P0QA 4M7DE 1X6OA 3P8HA 4FM4B 3OYMA 2VUBA 2P0PA 2LT1A 4J6XA 4JRQA 1QP2A 3UPUA 3RIRA 4XQ3A 3A8LB 3OYLA 4FSXA 3FRNA 2XU8A 1BIAA 4A4GA 5A0GA 4R56A 4M78C 4OGCA 3LWHA 3GPLA 2XIDA 2JZ2A 1KC8U 1VQ5T 5FRNA 2M1HA 1WPYA 2QQAA 1HXDA 1XNIA 3TCJA 2OTJA 3M9QA 5LJ5g 1NE8A 2RD1A 3OYHA 2K2VA 3C95A 2RA2A 3JCMP 2RI5A 2EQMA 1ZBXA 5J26A 5L8RE 1WNLA 2ZPIB 3LWIA 1VUBA 1KQSS 1G3WA 5M9OA 4LD6A 3QZ9B 1K8AC 4M78G 3CCET 4MMKA 3DKMA 3QIIA 3MP1A 4M75D 5FLXE 2H3JA 4EMKC 3CCJA 1N27A 3UWNA 1KD1U 1VQ9A 4WF2A 4JJNK 1YHQT 1XOVA 2EFIA 2GF7A 4M75A 3SWNA 3A5ZB 4IUTA 4YTLA 3QJYA 3OYEA 3G6ET 4E7HA 1YI2T 2RHIA 2Y4YA 1JRIA 3Q1JA 5CAIA 2KY9A 3MP6A 3WVEB 3N5BB 1K73C 3OS5A 1QW1A 4BACA 1ZHIA 3PT9A 1BI3A 4OP0A 2XDPA 3GOXA 4JRKA 3L2VA 5GAMg 3HP9A 5CIUA 5GAOq 2RM4A 3TU4K 3LH0A 4J7FA 4A53A 2E1HA 2EQKA 4M75F 4C0FA 3CCRT 4M7DB 1N9RA 2AHJB 4L5GA 2M16A 3M55A 4DOVA 2RJDA 4C0ZA 5GMKi 2RHYA 2V8JA 1UGPB 2WSFE 1ZQ1A 1Y96A 3LGFA 2VXEA 4C0DC 3I55T 1M5Q1 5LJ3f 3V7RA 4XTXA 3RKYA 4MDWA 3CC7T 2R5MA 4HA8A 3BFMA 4DA4A 1PSFA 4GLKA 2QTXA 3M53A 5KE3A 4M77D 2ZGWA 4M7AD 4V2SA 2DXUA 4PL6A 2FHDA 4F7UA 3JRZA 3RMSA 3I55A 1G3YA 2VXFA 3GNGA 3MCAB 1M1GA 5I2SA 2RH2A 1Q82U 3M54A 1PSEA 3JCMW 1KQ2A 3FC3A 4FU6A 2DTIA 3CMEA 4BB7A 4RG8A 3VUBA 4XU3A 4E7IA 2VGMA 3PMIA 4A4KA 1QP3A 4C0GA 4F7UG 3S3NA 4M78D 4R55A 3OYIA 2E6ZA 1M1KC 4QW2A 2V8IA 4B9XA 3JB9G 5GMKh 2X4YA 1NJIC 1Q7YC 2DXCA 1S72A 1WJQA 3SD4A 2QQRA 2HBPA 3PNWC 5GANh 3CCVA 5GAOr 2R57A 5D6WA 1UGQB 1YJ9A 3GLXA 1M9SA 5LJ5j 3OYAA 2FL7A 1VQ4A 2BUDA 3JCMQ 1X01A 3MEAA 2DO3A 3EFSA 1DJ7B 4A54A 4RG2A 3CCUT 1YBYA 5GAN7 4HT9A 5FU6C 1YI2A 3FLGA 5GAMf 2PQWA 4OVAA 2RK2A 5FU7C 1K9MC 2LQKA 1TH7A 1G3SA 2CS7A 2XDDA 2EAYA 4JLIA 5GMKl 1UGRB 3L2QA 4M78F 1O9SA 2O4XB 5GAMd 2E65A 4QVDA 3V8JA 1NPPA 4PJOA 4ZGDB 3BW1A 3QJ6A 4MZPA 3BDLA 4M77C 4E7KA 4M7AC 3L1AA 1N9SA 4BI4A 3CCMT 3QDRB 4C5IA 2PVDB 5DM7R 3CXCS 4KT0E 2VGNA 4BY6C 2IG0A 5C0MA 3P8BB 1Y7XA 4PJOB 4RCCA 2KQWA 1YITA 1WGSA 3QYGB 2PVOB 2DIGA 3V7CA 4RKUE 1WJSA 2CZ6B 2DK3A 5DLOA 2GFUA 2C06A 1KQ1A 4MZMA 2E6NA 2KDSA 3DB3A 4X9DA 3OBWA 2K3YA 4JRPA 1NJIU 4IUUA 4HKEA 2L8DA 4O6JA 3JCMV 4DQ2A 1BIBA 4ZN3A 2LQ8A 2G3RA 1Y96B 3FIFA 1LNXA 1LJOA 2V8KA 3ME9A 3CCSA 3T9NA 4E7JA 1N8RU 1KG1A 1X75C 1BI1A 3C4SA 3FJPA 3HHTB 5GAOp 1OZ3A 2K5FA 3OY9A 4JS4A 4PJOE 2GCXA 2QA4T 3JCMb 2VC8A 1VQPT 3RERA 4M75C 1BKBA 2KK4A 5J3BA 3LLRA 2OTLT 1BI0A 3QUIA 3QPHA 4DOWA 3JCMX 2RHZA 5FRMA 3M58A 1VQNT 4XAXB 2HAXA 2F5KA 2K5LA 4J83A 3JCMc 2FB7A 3E9GA 3I56A 4PNOA 5FROA 4ZGJB 4A4EA 2MAMA 2P4TA 4J7IA 3OS2A 2IVWA 3MEVA 4Z02A 2DPPB 3DLMA 4LD9K 4X34A 3V7SA 3WVDB 2FVUA 2DXBA 2HNIA 4II1A 3JCMe 1VQOA 4M7DD 2LCLA 1EIFA 1R8OB 3VUZA 5EG2A 5CVIA 5DY9A 5GAOn 3PIPA 4EMHA 3CBMA 3I56T 1YJNT 2JTMA 4C5EA 2MF2A 3G4ST 3ZBDA 3CCQT 4BD3A 1K9MU 4M75G 3S3MA 4C92B 5GAN6 4OB1B 3M4GA 2LT4A 2HQEA 1VQLA 5IT9E 4M7DA 3F70A 1M8VA 3FDRA 1H3ZA 4M7DC 3VV0A 4EMGA 1Y71A 3HSBA 2DIQA 3JCMf 4IUPA 2E64A 4CI0C 4QVCA 4M7DF 2EKOA 1KHCA 4HCZA 1VQ8T 5GANd 5I21A 1VQMT 4J6YA 3JAME 1YJNA 4HT8A 4ZTFA 2EJFA 4F7UF 1OZ2A 5LJ3j 1W4SA 4C92E 2O01E 3CCLA 2ZPFB 3L2ZA 3H8ZA 4C5HA 3QYHB 4E7LA 2CYZB 5CKFA 3RESA 3CXCA 3P8DA 4C92A 5GAOm 5KH6A 4M7DG 5A2QE 3X25B 2LNVA 3OYBA 1OI1A 1UB4A 1H641 3JSCA 3QZ5B 4ATOA 2PVGB 3M4YA 4EMKB 3L2UA 3OW2S 1N6AA 4XTZA 3GP8A 1U8RA 3ASKA 1N8RC 3FEOA 4Q5WA 3OMGA 3SWNC 3HPWA 4J5YA 3QO3A 5A0DA 4N4HA 1VQKA 4KBMB 2X35A 1G3TA 3CC4A 3BDUA 4C8QF 4XTUA 3LW5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 G;  4M77 F;  2EJG A;  4M7A F;  2EAY A;  4JLI A;  2DTO A;  5GMK l;  1I81 A;  1D3B A;  4M78 F;  3JB9 J;  5GAM d;  2E65 A;  4PJO G;  4QVD A;  4C8Q C;  3V8J A;  5GAN 8;  4PJO A;  4M78 B;  5GMK e;  3BW1 A;  5LJ5 f;  2Y90 A;  4M77 C;  4M7A C;  1U1T A;  3L1A A;  1N9S A;  2K57 A;  4M77 A;  4M7A A;  5LJ5 h;  1WQ7 A;  2DTH A;  3INZ A;  4PJO D;  4M7D E;  2E10 A;  1YCY A;  3BY7 A;  3SB2 A;  4J6X A;  3V8K A;  2DVE A;  4RCC A;  4PJO B;  3RIR A;  5GMK j;  4XQ3 A;  2DKG A;  5GAM j;  4F7U E;  1BIA A;  4C92 F;  1I5L A;  4M78 C;  3QHS A;  3V7C A;  3VU3 C;  5LJ5 d;  5LJ3 h;  1KQ1 A;  4N0A A;  1WPY A;  1HXD A;  3RUX A;  3EFR A;  3V8L A;  4X9D A;  5LJ5 g;  2DZ9 A;  5GAM e;  2RD1 A;  3JCM P;  2RA2 A;  3JCM V;  4DQ2 A;  1BIB A;  1Y96 B;  3FIF A;  4XU1 A;  1WNL A;  1LNX A;  1LJO A;  3GIB A;  5GAO l;  5GAN 3;  3FB9 A;  5LJ3 d;  5GAO p;  3FJP A;  4PJO E;  4C92 C;  4M78 G;  4NOY A;  3RKW A;  4MMK A;  1JBM A;  4M78 A;  4JUV A;  4XTW A;  3JCM b;  2VC8 A;  4M75 D;  4EMK C;  3RER A;  4M75 C;  4WF2 A;  3AHU A;  3QUI A;  4M75 A;  3SWN A;  1D3B B;  3JCM X;  1JRI A;  5CAI A;  5GAN 4;  3JCM c;  2FB7 A;  4PNO A;  5GAN g;  2RB6 A;  3JB9 H;  4N0A C;  4OP0 A;  4F7U B;  4JRK A;  2E41 A;  4RCB A;  2EJ9 A;  4M75 B;  5GAM g;  3V7S A;  3JCM e;  5GAN 5;  3JB9 I;  2HNI A;  5GMK m;  5GAO q;  3JB9 D;  2RM4 A;  2YLC A;  4M7D D;  4A53 A;  2E1H A;  4NL3 A;  4M75 F;  4M7D B;  5DY9 A;  5GAO n;  1HK9 A;  1N9R A;  4C8Q B;  4EMH A;  3PGG A;  4C8Q A;  2DZC A;  4M77 B;  4MML A;  4M7A B;  5GMK i;  5GAN 2;  4M75 G;  4J6W A;  4C92 B;  2DXT A;  1Y96 A;  4XTU A;  2VXE A;  4C8Q E;  5GAN 6;  1M5Q 1;  4M77 E;  4X9C A;  5LJ3 f;  3V7R A;  4M7A E;  3M4G A;  4XTX A;  4M78 E;  3RKY A;  4XTV A;  5GAN f;  3JCM J;  4M7D A;  4HA8 A;  1M8V A;  2YLB A;  3BFM A;  4Y91 A;  4M7D C;  2QTX A;  5LJ3 g;  4M77 D;  2ZGW A;  3JCM h;  1U1S A;  4EMG A;  4M7A D;  3HSB A;  2DJZ A;  2DXU A;  4V2S A;  2CGH A;  4NL2 A;  4C8Q D;  2FYK A;  3JCM f;  4F7U A;  2E64 A;  1I8F A;  5GAN e;  2VXF A;  4QVC A;  4JRI A;  1I4K 1;  3JB9 F;  4M77 G;  2I2L A;  1KQ2 A;  4M7A G;  4M7D F;  4XTY A;  3JCM W;  3JCM g;  5GAN d;  5I21 A;  4C8Q G;  2DTI A;  1WQW A;  4J6Y A;  3QSU A;  1B34 B;  4XU3 A;  4HT8 A;  2EJF A;  4F7U F;  4F7U G;  5LJ3 j;  3JCM d;  2JN0 A;  3SWN B;  4C92 E;  3L2Z A;  4EMK A;  5LJ5 e;  4M78 D;  1MGQ A;  3HFN A;  3RES A;  4C92 A;  5GAO m;  4XU2 A;  1LOJ A;  3JB9 G;  4M7D G;  5GMK h;  4C92 D;  1H64 1;  5GAN h;  5GAO r;  4EMK B;  5LJ3 e;  4PJO C;  4XTZ A;  2DEQ A;  1B34 A;  4XU0 A;  5LJ5 j;  2EWN A;  3SWN C;  3JCM Q;  1X01 A;  4J5Y A;  3QO3 A;  4M75 E;  3EFS A;  5GAM h;  4A54 A;  5GAN 7;  4HT9 A;  2YHT A;  5GAN j;  4PJO F;  5GAM f;  3HFO A;  3RKX A;  3BDU A;  4C8Q F;  1TH7 A; 
#chains in the Genus database with same CATH topology
 1VQK T;  2EJG A;  1RLP C;  2F69 A;  3PMT A;  4VUB A;  2JNG A;  2X3W D;  3CD6 Q;  2PNI A;  5FU6 B;  3PFS A;  2F2W A;  1W6X A;  2CKK A;  8ATC B;  5CO7 A;  3CC2 Q;  3L2R A;  2J7I A;  2KRM A;  1BCM A;  3CCU Q;  4C92 F;  2MOX A;  2RJF A;  2CZ7 B;  2VV5 A;  2DVJ A;  2L3S A;  1WLP B;  3M59 A;  3NFC A;  3OQ5 A;  1WXT A;  4AG1 C;  3FB9 A;  3MP8 A;  3EHQ A;  2EYW A;  3EG3 A;  4ZGE B;  1SF9 A;  1G83 A;  1D1B A;  3UT1 A;  3M56 A;  2LVM A;  1TOV A;  2ZZD A;  3NTH A;  1SPK A;  2DER A;  4PKC C;  3OYC A;  1YJW A;  3OMC A;  1YHQ A;  5GAN 4;  3VKI A;  2QDY B;  4RCB A;  4NL3 A;  1GFC A;  2EJ9 A;  3R6O A;  5J39 A;  3L42 A;  1YHQ Q;  4OMP A;  1FXX A;  2EGA A;  3CPW A;  2XK0 A;  1EX4 A;  2JTF A;  4A4F A;  1VQP Q;  2CRE A;  2ABL A;  2EQJ A;  4IIM A;  4ZN1 A;  1QVP A;  1UGS B;  1YIJ T;  2GTJ A;  1VQN Q;  4ELZ C;  1UG1 A;  3QXE B;  4A4H A;  4NL2 A;  1TUG B;  1I8F A;  2PUK B;  3LYI A;  2WSE E;  2DRM A;  1LCK A;  2V26 A;  4J9B A;  4HVU A;  1FX7 A;  5IAY A;  3M0S A;  2OI3 A;  3EGX B;  2HL5 C;  4FYY B;  5KYX B;  4C0D B;  1NYG A;  1KHI A;  2BE7 D;  2EWN A;  1BBZ A;  5GAM h;  2CP3 A;  2NWM A;  1Q81 C;  2YHT A;  1YWP A;  2WAC A;  3C12 A;  2MWP A;  4E47 A;  2K3X A;  4M77 F;  4M7A F;  2RI2 A;  3MET A;  2A37 A;  4DEY A;  1RUW A;  1XTD A;  1NM7 A;  1GXI E;  4BUG A;  1QWE A;  4M78 B;  4LDU A;  3OSV A;  3O8V A;  2K57 A;  2ZPH B;  1WQ7 A;  2E3H A;  1VYV A;  2DVE A;  2L3P A;  5GMK j;  1KQS A;  4LUE A;  4OF1 A;  2DJQ A;  1MNE A;  2RQV A;  2DL3 A;  4PLL A;  1Q7Y U;  1BK2 A;  3EG0 A;  3OYJ A;  3EFO A;  3EG9 B;  3BE3 A;  2XG8 D;  1AD5 A;  4Z89 A;  3ER0 A;  3I55 Q;  2OTJ Q;  3A8O B;  4P5N A;  2QEX A;  4BE2 A;  2FZK B;  2OTL A;  1BI2 A;  4TVR A;  4CC4 B;  3CPF A;  2PUO B;  3VRY A;  2RB6 A;  1VQO T;  1M90 U;  4QQG A;  2RQT A;  4FL6 A;  4M75 B;  1AHJ B;  2MPX C;  2KXC A;  2KYB A;  3E19 A;  2QDL A;  4C8Q B;  3CCS T;  1VQ6 T;  4MML A;  2M0O A;  4FIB A;  2DXT A;  4C8Q E;  2LCC A;  2DL5 A;  1ABO A;  2LX9 A;  3KBG A;  2EVR A;  2EIF A;  1U1S A;  2A28 A;  3OA6 A;  3S3M A;  4BI3 A;  2JM9 A;  2RK1 A;  2DL4 A;  1FMW A;  1WQW A;  3QSU A;  4L6V 5;  2L89 A;  1OYX A;  3CBP A;  2BIV A;  1MMD A;  1PWT A;  5IHN A;  2JJ9 A;  2B86 A;  2D0N A;  2EQU A;  5KE2 A;  1WHL A;  1Y57 A;  5CQY A;  3MEU A;  4D8D A;  2JMA A;  1ABQ A;  3G1J A;  3HFO A;  2EGE A;  1M3C A;  1ZA2 B;  1JXO A;  5C6S A;  2COY A;  3PIO A;  2RO0 A;  2DYI A;  3M0U A;  5LJ5 h;  3QDF A;  2ENM A;  4N4G A;  4CC2 A;  1SRL A;  4J6X A;  3VS0 A;  1QP2 A;  3OYL A;  3IQL A;  3CMA Q;  3FRN A;  2LQW A;  1BIA A;  3GPL A;  4OGC A;  1VQ5 T;  2QQA A;  1XNI A;  2CSI A;  2PTK A;  1D09 B;  3H9N A;  2K2V A;  2ECZ A;  2RI5 A;  5J26 A;  5L8R E;  1KQS S;  2GQI A;  1HJD A;  5M9O A;  4MMK A;  3DKM A;  3QII A;  4M75 D;  1M30 A;  1VQ9 A;  3EGU A;  3UWN A;  1XOV A;  4M75 A;  1YI2 T;  2DM1 A;  1JRI A;  5EC7 A;  5CAI A;  2KY9 A;  1K73 C;  2CT4 A;  1QW1 A;  1VQ9 Q;  1ZHI A;  2CP5 A;  2K6D A;  3M0Q A;  4KH0 B;  3TU4 K;  3LH0 A;  2E1H A;  4L5G A;  4DBR A;  2RJD A;  5GMK i;  2RHY A;  3EH1 A;  1M2V B;  3I55 T;  5KYY A;  3EG1 A;  1BCO A;  5LJ3 f;  4KH1 B;  1TUC A;  2QTX A;  3M53 A;  4M77 D;  4M7A D;  4F7U A;  1AEY A;  1ZUK A;  3MCA B;  1M1G A;  1KQ2 A;  3FC3 A;  2ROT A;  3CCV Q;  4BB7 A;  1SHF A;  3PE0 A;  2VGM A;  1QVG P;  1QLY A;  1MMG A;  1NJI C;  1JEG A;  1OX9 A;  2HBP A;  5GAN h;  5GAO r;  2R57 A;  3C0C A;  5D6W A;  2NUT B;  2JMC A;  2M51 A;  2CP6 A;  1M9S A;  2FL7 A;  2Z0W A;  1X01 A;  3EFS A;  4PFP A;  4A54 A;  1FYN A;  1YBY A;  3CCU T;  2CDT A;  2JXB A;  5GAM f;  1NBE B;  2RK2 A;  5FU7 C;  2K2M A;  3VS3 A;  5GMK l;  3L2Q A;  2DBK A;  1O9S A;  5GAM d;  2E65 A;  3V8J A;  1NPP A;  4ZGD B;  3QJ6 A;  4MZP A;  3VS2 A;  4PJN A;  2PVD B;  4RUG A;  4BY6 C;  4J9F A;  4PJO B;  1EZZ B;  2HKN A;  2F2X A;  4RKU E;  5DLO A;  4J9E A;  1VQ7 Q;  4MZM A;  3FJ5 A;  3CCJ Q;  1TTH B;  5KYU B;  1NJI U;  4HKE A;  2L8D A;  2HL3 A;  3TSW A;  2ED1 A;  4DQ2 A;  1PD1 A;  3ME9 A;  3CCS A;  1KG1 A;  3T9N A;  2HCK A;  3FJP A;  1N8R R;  1OZ3 A;  3OY9 A;  4FCY A;  1VQP T;  5IHK A;  5J3B A;  1BI0 A;  3QUI A;  3QPH A;  2RQU A;  1GBR A;  4LE9 A;  2F5K A;  1Y0M A;  4J83 A;  3I56 A;  2FB7 A;  1UJ0 A;  3E9G A;  5FRO A;  3DLM A;  1IXD A;  3V7S A;  3JCM e;  3M0R A;  2LCL A;  1R8O B;  5EG2 A;  1X43 A;  4EMH A;  3G4S T;  5IXB A;  1HSQ A;  3CCE Q;  4OB1 B;  3VS7 A;  2DEU A;  3M4G A;  2HQE A;  2E3I A;  3FDR A;  1Y71 A;  2EQI A;  1ACM B;  1K9M R;  4CI0 C;  4QVC A;  4OML A;  2LX7 A;  4HCZ A;  5I21 A;  1GCQ A;  1OZ2 A;  3CCL A;  2ZPF B;  3L2Z A;  3QYH B;  2EGC A;  4E7L A;  2CYZ B;  4C92 A;  1PKT A;  5A2Q E;  2LNV A;  4LNP A;  1UB4 A;  1SHG A;  4EMK B;  4J9H A;  3FEO A;  4J5Y A;  4E7S A;  2RF0 A;  4LXC A;  4XTU A;  3S3O A;  4C92 G;  2K5I A;  3REB B;  2KEA A;  3HRS A;  4C8Q C;  1VQ5 Q;  1AOJ A;  1OPK A;  4X1V A;  2FPE A;  2DTH A;  2LTO A;  2LJ3 A;  2I0N A;  1VOM A;  2F1L A;  3OYG A;  1M3B A;  4F7U E;  4FYV B;  1I5L A;  4FYX B;  1PHT A;  1NLP C;  2LP5 A;  4JLG A;  1ZBJ A;  1PC0 A;  1SKU B;  4HCC A;  1V29 B;  4IUV A;  1QCF A;  1S1N A;  1K9A A;  2QK0 A;  1YI2 Q;  3VS4 A;  3ZEH A;  4UC4 A;  4HXJ A;  5LJ3 d;  2OAU A;  3RKW A;  1VIE A;  5GAN j;  4RTZ A;  2K7A A;  2CH4 W;  1UTI A;  5HK0 A;  1ZSZ B;  4XK8 E;  3DLL A;  2X3X D;  1M2O A;  4LUD A;  2CUD A;  2O9V A;  1OPL A;  1RAB B;  1MV0 B;  1MUZ A;  1UHC A;  2YLC A;  1YJW T;  4IIO A;  3S6W A;  1YCS B;  4Z8A A;  2X9H A;  3VYH B;  4ELY C;  3CEY A;  2QA4 Q;  1G8X A;  4BE0 A;  4Y91 A;  3VJP A;  2MI6 A;  1JJ2 A;  5I2M A;  2QGF B;  4XTY A;  4B9W A;  5KCH A;  4C5G A;  1S72 Q;  2HQH A;  2LNH B;  1X6B A;  4HCK A;  4ORZ A;  3G4S Q;  2V1Q A;  2VB6 A;  1KQS P;  4PJO C;  2FZG B;  4EPC A;  3G4S A;  1IRE B;  1YJ9 T;  4F14 A;  1RAC B;  1I07 A;  3GNF B;  4IUR A;  2BZ8 A;  3ZFJ A;  4LDV A;  2DL8 A;  1VQM Q;  2DTO A;  1ZSZ A;  2QEX T;  4EDU A;  4CC3 A;  4JJD A;  2KXD A;  4N4I A;  1VQ7 T;  3HKS A;  1RAE B;  2M02 A;  2LDM A;  2KR3 A;  3SB2 A;  1YCY A;  2H3E B;  4FYW B;  3VS1 A;  1SSH A;  4ME7 A;  2O4X A;  2DKG A;  3I9Q A;  2YRV A;  3QHS A;  2RNA A;  1RAI B;  5LJ3 h;  3G71 A;  4J8O A;  4OB2 B;  5FU7 B;  3EFR A;  2L0A A;  3OS1 A;  5GAM e;  1KC8 C;  3OBY A;  2NUP A;  1OV3 A;  2EBP A;  4ZTJ A;  5ECA A;  2P0K A;  4NOY A;  1UFF A;  3OYY A;  3AHU A;  3CC4 T;  1RAD B;  2X4W A;  3RMQ A;  5HK3 A;  3EGD B;  3KUF A;  2PU9 B;  1RAF B;  1OQK A;  1AT1 B;  2E41 A;  3LX7 A;  5CKB A;  4OMM A;  1RLQ C;  3CBO A;  2AKL A;  2M0Y A;  3MJX A;  2OTL Q;  2E70 A;  1HK9 A;  1QQJ A;  1WDX A;  4F17 A;  4C8Q A;  5GAN 2;  2ZCF B;  4PLI A;  2NYS A;  3JCM h;  5CKD A;  1I0C A;  3X26 B;  1KC8 U;  2FYK A;  2D9T A;  2B8A A;  2JUF A;  5D7U A;  2BKD N;  3OW2 A;  4NS5 A;  4JRI A;  1I4K 1;  4JJC A;  3OYD A;  4FT4 A;  1AWX A;  3VYG A;  1YIJ A;  1YIT T;  1Q86 C;  5HCK A;  5HKC A;  1QCO A;  2M9U A;  3NTI A;  1LOJ A;  2CZ1 B;  4C92 D;  1QMC A;  1K73 U;  2LZ6 B;  1VQK Q;  4GLM A;  3CCL Q;  1VQ7 A;  1O75 A;  1X27 A;  3URG A;  1VQ8 Q;  2GFA A;  3EHR A;  2YUQ A;  4FW2 A;  3SDZ A;  4DBH A;  1QVG S;  4QKU A;  2JVV A;  4KGX B;  2DD5 A;  2P4R A;  4OMN A;  4BDY A;  1KD1 C;  2HQX A;  2KRS A;  2R5A A;  1JJ2 S;  1D3B A;  1PCX A;  3JB9 J;  5GAN 8;  1GL5 A;  1Q82 R;  2K9G A;  2P0Q A;  2W10 A;  1X6O A;  4FM4 B;  2VUB A;  2LT1 A;  3UPU A;  3A8L B;  4FSX A;  2XU8 A;  3LWH A;  3E2U A;  5FRN A;  2GGR A;  2SEM A;  1WPY A;  4GBQ A;  3TCJ A;  1NE8 A;  2RA2 A;  2EQM A;  1WNL A;  2ZPI B;  3QZ9 B;  4M78 G;  2X51 A;  3MP1 A;  1GCP A;  3CCJ A;  1KD1 U;  3RR6 A;  4JJN K;  1IB8 A;  2EFI A;  1YHQ T;  3A5Z B;  3QJY A;  1Z9Z A;  1FMV A;  3Q1J A;  3MP6 A;  2DBM A;  1K0X A;  4OP0 A;  4D8K A;  4JRK A;  3HP9 A;  5GAO q;  2RM4 A;  4J7F A;  5AT1 B;  4M7D B;  1N9R A;  2AHJ B;  1U3O A;  2M16 A;  3UA6 A;  4DOV A;  2WSF E;  1Y96 A;  2VXE A;  4C0D C;  1H8K A;  3V7R A;  1K73 R;  4XTX A;  2YRC A;  2O31 A;  1UEC A;  3RKY A;  5KYU A;  4MDW A;  3RDV A;  3BFM A;  3A1P A;  1W70 A;  1T0H A;  2HMA A;  5KE3 A;  4V2S A;  1GBQ A;  2DXU A;  2FHD A;  3RMS A;  1BU1 A;  1G3Y A;  4RTW A;  7AT1 B;  5I2S A;  2RH2 A;  8AT1 B;  4FU6 A;  1OX8 A;  3CME A;  3VUB A;  4XU3 A;  1NEG A;  1YJ9 Q;  3PMI A;  4A4K A;  1M1K R;  3S3N A;  2E6Z A;  1WHG A;  1M1K C;  1WHH A;  1JQQ A;  1M2V A;  5GMK h;  3SD4 A;  2D8H A;  3CCV A;  1UGQ B;  5LJ5 j;  3OYA A;  3JCM Q;  5FWB A;  2DO3 A;  2KNB B;  5GAN 7;  4OVA A;  2CH4 A;  2J6O A;  1ZSG A;  3ULR B;  1TH7 A;  2CP7 A;  2CS7 A;  2XDD A;  2ED0 A;  4JZ3 A;  2ESW A;  4M78 F;  4DBF A;  1TG0 A;  2O4X B;  1MND A;  2EPD A;  2YT6 A;  2IG0 A;  5C0M A;  4AMC A;  3QYG B;  1WZO A;  2QAZ A;  1KSW A;  4AFU C;  2QAS A;  5FWC A;  2GFU A;  4RTT A;  2YUO A;  1I5O B;  4HVW A;  3DB3 A;  3OBW A;  2K3Y A;  2MK5 A;  2J6F A;  2AK5 A;  2LQ8 A;  1LNX A;  1LJO A;  3NHN A;  4E7J A;  4PJO E;  4JS4 A;  1D1C A;  1WA7 A;  2VC8 A;  2YUN A;  1FMK A;  2OTL T;  3CCS Q;  3JCM X;  2RHZ A;  3H0I A;  5FRM A;  1VQN T;  2MAM A;  4X34 A;  2DXB A;  2HNI A;  2V1R A;  1EIF A;  3G6E A;  3I56 T;  5GAO n;  1YJN T;  1I1J A;  2MF2 A;  1K9M U;  4M75 G;  1K0S A;  3G6E Q;  1VQL A;  4M7D A;  2AIR B;  2K79 A;  4AFQ C;  1M8V A;  1KJW A;  4M7D C;  4FSS A;  3HSB A;  4E6R A;  2DIQ A;  2E64 A;  1QKX A;  2EKO A;  1KHC A;  5L23 A;  4QT7 A;  2KRN A;  1VQ4 Q;  1UGV A;  4HT8 A;  4ZTF A;  2EJF A;  4C5H A;  3H8Z A;  1E6H A;  1X69 A;  1Q95 G;  1X6G A;  3CXC A;  5GAO m;  5KH6 A;  1NYF A;  1Z9Q A;  1QVF P;  2PVG B;  1N8R C;  4Q5W A;  3HPW A;  5A0D A;  1VQK A;  2CT3 A;  2X35 A;  1G3T A;  1AVZ C;  3CC4 A;  3BDU A;  1FWZ A;  3X28 B;  1MV3 A;  2GTO A;  3L2W A;  3U23 A;  2D0Q B;  2C0T A;  5GJV B;  5GMK e;  1P92 A;  1SSF A;  3EG9 A;  1WHM A;  2DD4 A;  2E5K A;  1Q82 C;  4KGZ B;  5GAM j;  1VQ5 A;  1VQL T;  2QTV A;  3I5S A;  4R0K A;  2ZPB B;  3V8L A;  1B3Q A;  4OGE A;  4XU1 A;  1NPR A;  2YUP A;  2F5T X;  3J80 E;  1VQ6 Q;  2RPN A;  2XIC A;  1IZ6 A;  4M78 A;  4JUV A;  1YWO A;  1ZA1 B;  2RHU A;  2OX7 A;  1HD3 A;  2L3R A;  2FZC B;  1UHF A;  3UDC A;  1JXM A;  5D6Y A;  1VYT A;  1B07 A;  4A63 B;  5GMK m;  2BZY A;  1R77 A;  1EFN A;  2KMT A;  1SG5 A;  3PGG A;  2DZC A;  2FPD A;  4M77 B;  4M7A B;  4D6W A;  3H6Z A;  1D0X A;  3CCV T;  1U06 A;  1VQ9 T;  3M0P A;  5CQX A;  2HBW A;  1G5V A;  5LJ3 g;  1A0N B;  5GAN e;  1TXQ A;  3E9F A;  3KFV A;  3HRU A;  3JB9 F;  1UJY A;  1IGQ A;  3M57 A;  2G6F X;  4J9I A;  1MGQ A;  2QQB A;  3CCQ Q;  2FRY A;  1M1F A;  3LGL A;  4AG2 C;  5LJ3 e;  1WI7 A;  4XU0 A;  1C0M A;  3MEW A;  3CCQ A;  3A8G B;  1OU9 A;  3CMA T;  1KC8 R;  3MKD A;  2DNU A;  2JW4 A;  4O5V A;  4PJO G;  2CZ0 B;  2QI2 A;  1QVF S;  3DB4 A;  1G2B A;  4MDX A;  3M5A A;  2ZAE A;  1VQM A;  2XD0 A;  2RMO A;  2KE9 A;  2E10 A;  3V8K A;  3BY7 A;  1Q81 R;  4JS5 A;  2R58 A;  1JO8 A;  2HKQ B;  3VU3 C;  1W2B S;  1CKB A;  2QQS A;  5LJ5 d;  1QVG A;  2XI9 A;  3CC7 A;  1NJI R;  2JOY A;  3RUX A;  2DZ9 A;  4FW1 A;  2P84 A;  4JDS A;  3QBY A;  2A3L A;  3CCR Q;  3GIB A;  5GAN 3;  1WX6 A;  5CKE A;  9ATC B;  1PNJ A;  2IIM A;  4C92 C;  3H41 A;  2XKO C;  4DEX A;  3VRZ A;  2RHX A;  2DA9 A;  3CCR A;  1D3B B;  1QVF A;  3TEE A;  4ESR A;  5IXF A;  2COZ A;  3JB9 H;  2W0Z A;  4N0A C;  4F7U B;  4LDX A;  6AT1 B;  1VYU A;  3SFM A;  1MMA A;  1M27 C;  4J9D A;  4KUL A;  5CR2 A;  4QVZ A;  3H0H A;  2MWO A;  4M77 G;  4M7A G;  1WYX A;  1YJW Q;  1OEB A;  2JN0 A;  3SWN B;  3QG1 A;  5LJ5 e;  2GNC A;  5DLQ E;  3HFN A;  1IHW A;  4IUQ A;  4OB3 B;  1MMN A;  2RJC A;  1J3T A;  2YRD A;  1YIJ Q;  2CUB A;  3CME Q;  1BYM A;  1K8A U;  3RNJ A;  3PVQ A;  1RI0 A;  3E1S A;  4ANJ A;  2ATC B;  3CCJ T;  4QQ6 A;  1D1A A;  1WIE A;  2RI3 A;  5LJ5 f;  1KIK A;  2X4J A;  1KD1 R;  3PTA A;  2F2V A;  4F16 A;  3OYM A;  4M7D E;  3RIR A;  4XQ3 A;  3MPU B;  4A4G A;  5A0G A;  4R56 A;  4M78 C;  1H92 A;  2M1H A;  4JZ4 A;  2D1X A;  3NPF A;  1HXD A;  1QCN A;  3M9Q A;  5LJ5 g;  3OYH A;  2RD1 A;  3C95 A;  2EYZ A;  3CQT A;  5FW9 A;  2O88 A;  1VUB A;  3OW2 P;  1VQL Q;  1G3W A;  1K8A C;  3CCE T;  2JM8 A;  5FLX E;  4EMK C;  2JS0 A;  4WF2 A;  3M0T A;  3SWN A;  4IUT A;  3G6E T;  2C0I A;  2RHI A;  2Y4Y A;  2HSE B;  3WVE B;  3N5B B;  5KYN A;  4BAC A;  1BI3 A;  2XDP A;  3L2V A;  5GAM g;  1PRM C;  5CIU A;  4A53 A;  4M75 F;  2DET A;  2CSQ A;  4OMO A;  1SEM A;  3M55 A;  4C0Z A;  1R0C B;  2NUP B;  1ZQ1 A;  3LGF A;  1M5Q 1;  1GRI A;  3CC4 Q;  3R6N A;  3SEM A;  4HA8 A;  4DA4 A;  1PSF A;  1YN8 A;  4GLK A;  1YP5 A;  2ZGW A;  1WHK A;  4PL6 A;  2VXF A;  3CPW P;  2L3Q A;  3GNG A;  2PZ1 A;  3I5R A;  3M54 A;  1PSE A;  2YSQ A;  4RG8 A;  4E7I A;  4F7U G;  1QP3 A;  3OYI A;  2V8I A;  3TQ7 P;  3VS6 A;  2X4Y A;  4EIK A;  1Q7Y C;  1S72 A;  1T0J A;  1WJQ A;  2QQR A;  2QYZ A;  4E2F B;  1YJ9 A;  2BUD A;  3MEA A;  1TU0 B;  4RG2 A;  5IH2 A;  3RBB B;  5FU6 C;  1YI2 A;  1K9M C;  2LQK A;  1G3S A;  1M90 R;  2EAY A;  1UGR B;  1PD0 A;  1YIT Q;  2ROL A;  3EGX A;  4QVD A;  3BW1 A;  1YNZ A;  1M8M A;  1CKA A;  4BI4 A;  4C5I A;  3CXC S;  1KFZ A;  1ZX6 A;  1TSF A;  2DIG A;  1RI9 A;  2DK3 A;  2C06 A;  2E6N A;  1T3L A;  2KDS A;  2LQN A;  4X9D A;  4JRP A;  4IUU A;  1BIB A;  4ZN3 A;  1ZSZ C;  1C6V X;  1N8R U;  2QGG A;  3C4S A;  5GAO p;  2K5F A;  2LJ0 A;  2GCX A;  2IPO B;  2QA4 T;  3RER A;  1BKB A;  2KK4 A;  3LLR A;  4K11 A;  4DOW A;  2NUZ A;  2DFU A;  3UA7 A;  1WHJ A;  3JCM c;  4ZGJ B;  4A4E A;  3OS2 A;  2IVW A;  4KRT A;  4LD9 K;  4II1 A;  1VQO A;  3VUZ A;  1QKW A;  1AZG B;  3ZBD A;  4BD3 A;  2LMJ A;  4OMQ A;  1K4U S;  2VKN A;  1E6G A;  4HVV A;  3NGP A;  2DX1 A;  2FRW A;  3JV3 A;  2COW A;  1VQ8 T;  1D0Y A;  5GAN d;  3JAM E;  1RAG B;  5LJ3 j;  4C92 E;  3TSZ A;  5CKF A;  4M7D G;  3OYB A;  2VVK A;  1OI1 A;  2FG0 A;  3L2U A;  2KT1 A;  1OOT A;  3OMG A;  3QO3 A;  4PK4 A;  4RTX A;  4N4H A;  4JPB W;  4AFS C;  4C8Q F;  3LW5 E;  1I81 A;  3CCL T;  2L5Q A;  1JU5 C;  4WCI A;  2Y90 A;  1U1T A;  1MHN A;  3A8M B;  3INZ A;  5CCA A;  4PJO D;  3MO8 A;  2A36 A;  3X20 B;  2CP2 A;  2OTJ T;  2JS2 A;  1NEB A;  4IKF A;  2QQ9 A;  1R0B G;  5IHI A;  3TRE A;  1XQH A;  1HYO A;  4N0A A;  3CCM A;  2HEQ A;  2VWF A;  1PG5 B;  1TWB A;  2DF6 A;  2RQW A;  4J9G A;  1AZE A;  2SRC A;  1PM3 A;  1PKS A;  4Z88 A;  5A0L A;  2KYM A;  4HCB A;  2BE9 B;  3CCM Q;  4XTW A;  1JBM A;  5HY6 A;  1X2Q A;  1V1C A;  1Q86 U;  3OS0 A;  3OB9 A;  2H8H A;  1VQ6 A;  4CRI A;  2LCS A;  1U5S A;  3X24 B;  4BI8 B;  3JB9 I;  2YXY A;  1K76 A;  1K1Z A;  1ZUY A;  3EAE A;  1NZ9 A;  3JB9 D;  4FT2 A;  5LL6 S;  5CK9 A;  5KYX A;  1VQN A;  1VQ8 A;  2X4X A;  5D6X A;  2Y4X A;  3OYK A;  4GY5 A;  4M4Z A;  4X9C A;  4M77 E;  3GBQ A;  4M7A E;  1UDL A;  4M78 E;  3JCM J;  2YLB A;  4PJM A;  1ARK A;  3CME T;  1WFW A;  2KAF A;  1N5Z A;  2EYY A;  3KXT A;  3UAT A;  1B34 B;  3I56 Q;  3JCM d;  4EMK A;  1RL2 A;  1OU8 A;  4L59 A;  4PFO A;  2XHC A;  2JTE A;  2DEQ A;  1B7T A;  2AZV A;  4M75 E;  2KVQ G;  4WTO B;  4PJO F;  4PJJ A;  3SHW A;  3J81 E;  1AWW A;  3NMZ C;  4LDW A;  1VA7 A;  3C94 A;  4BE1 A;  4BY6 B;  3CC2 A;  2AKK A;  2LC4 A;  1UUE A;  1OUL A;  5AYF A;  3QKJ A;  3NTK A;  2D6F A;  2BTT A;  2E5Q A;  3A8H B;  4ZNX A;  2HD0 A;  3G7Z A;  2GQV A;  2ZPE B;  4AFZ C;  5CKH A;  3HRT A;  2E12 A;  2MCN A;  1SRM A;  4KUD K;  1T3S A;  3HL8 A;  4RMO A;  3G71 T;  3CPW S;  2HDA A;  2KSS A;  2NUT A;  4BDZ A;  5GAO l;  4JJB A;  2LJ1 A;  2DRK A;  4OMF B;  2A7Y A;  1VIF A;  3MHX A;  1Q7Y R;  5KCO A;  1M1K U;  3OYN A;  2CP0 A;  2QA4 A;  3OSS C;  5GAN g;  1E7O A;  2OAW A;  4MZT A;  2EYX A;  5GAN 5;  2WSC E;  1Y07 A;  2DE0 X;  3CCU A;  3CCE A;  4Y28 E;  1M4Z A;  4LDY A;  1Q81 U;  1LVK A;  2KRO A;  2DYB A;  3O5Z A;  4J6W A;  2RN8 A;  2MIO A;  5GAN f;  4XTV A;  1KK7 A;  2QXF A;  2AZS A;  3UF4 A;  2DJZ A;  1YJN Q;  1X2K A;  2CGH A;  2DIL A;  4C8Q D;  2XDB A;  3WXM B;  2I2L A;  3JCM g;  4C8Q G;  2VYT A;  2MMP A;  2ZPG B;  2LRQ A;  2NLU A;  1TS9 A;  1NG2 A;  4XU2 A;  2DAQ A;  2DMO A;  1V76 A;  5I22 A;  1WJR A;  3THK A;  1B34 A;  2D8J A;  3CD6 T;  1VQ4 T;  3GF5 A;  2O2O A;  2K4Y A;  3J7A F;  5IN1 A;  4OB0 B;  3PVL A;  4RTV A;  2XMF A;  1VQP A;  4QQD A;  3QWY A;  3RKX A;  3CD6 A;  2MYS A;  3OYF A;  2EYQ A;  1W2B P;  1JB0 E;  3CC2 T;  1UEB A;  3EGD A;  1S72 T;  1H3H A;  5KYW A;  1W2B A;  4PJL A;  3A98 A;  3CMA A;  2BZX A;  2FO0 A;  1M90 C;  2KBT A;  4KUI A;  4M77 A;  5GJW B;  4M7A A;  2DLP A;  2RJE A;  2A08 A;  3P8H A;  2P0P A;  4JRQ A;  4AT1 B;  1RAH B;  3QWX X;  3LH5 A;  2XID A;  2JZ2 A;  3CXC P;  1UE9 A;  3D7S B;  2OTJ A;  2DL7 A;  5I11 A;  1IHV A;  3JCM P;  2QEX Q;  2KI7 A;  1ZBX A;  2FEI A;  4PFZ A;  3LWI A;  4LD6 A;  1ZUU A;  2RQR A;  1LPL A;  2H3J A;  1N27 A;  2YWW A;  2GF7 A;  4E7H A;  4YTL A;  3OYE A;  4DBQ A;  3TVT A;  3OS5 A;  3PT9 A;  3GOX A;  2OJ2 A;  1CSK A;  2EQK A;  3CCR T;  4C0F A;  2JT4 A;  3EG2 A;  4B6M A;  3EFO B;  2V8J A;  1UGP B;  1JJ2 P;  2E4H A;  2QG9 B;  2L2P A;  5KYW B;  1M3A A;  3CC7 T;  2R5M A;  2O9S A;  2EKH A;  3JRZ A;  3I55 A;  2J05 A;  1XJW B;  1IGU A;  1Q82 U;  3JCM W;  2DTI A;  4C0G A;  3ZL7 C;  1RAA B;  4M78 D;  1AWJ A;  4R55 A;  5KYY B;  3AT1 B;  4QW2 A;  4B9X A;  3JB9 G;  2DXC A;  4RTU A;  3PNW C;  1Q86 R;  3GLX A;  1K8A R;  1VQ4 A;  1DJ7 B;  4HT9 A;  3HTR A;  4Y92 A;  3FLG A;  2PQW A;  1ZLM A;  4F04 B;  4JLI A;  2VAS A;  1WXU A;  4PJO A;  3BDL A;  4M77 C;  4E7K A;  4M7A C;  3L1A A;  1N9S A;  3CCM T;  1TUD A;  3QDR B;  4J9C A;  3H0F A;  5DM7 R;  4KT0 E;  2VGN A;  3P8B B;  3G71 Q;  1Y7X A;  4RCC A;  2KQW A;  2KT8 A;  1YIT A;  1WGS A;  1PRL C;  2PVO B;  3V7C A;  1WJS A;  2CZ6 B;  1KQ1 A;  1WXB A;  1IO6 A;  3I35 A;  4O6J A;  3JCM V;  2G3R A;  1Y96 B;  3FIF A;  2V8K A;  2HZY A;  1X75 C;  1BI1 A;  3HHT B;  1W1F A;  3JCM b;  4M75 C;  2GBQ A;  1YFN A;  2C0O A;  1C1A A;  4E7Z A;  3M58 A;  4CC7 A;  4XAX B;  2HAX A;  2K5L A;  4PNO A;  2KGT A;  2P4T A;  4J7I A;  3VS5 A;  3MEV A;  4Z02 A;  2DPP B;  1AWO A;  4KGV B;  3WVD B;  2FVU A;  4M7D D;  2A0F B;  5CVI A;  5DY9 A;  3PIP A;  3CBM A;  2JTM A;  4C5E A;  3CCQ T;  2AT1 B;  1NLO C;  4C92 B;  2K3B A;  5GAN 6;  2EW3 A;  1VQO Q;  1IRX A;  2LT4 A;  2J06 A;  4LN2 A;  5IT9 E;  3F70 A;  1H3Z A;  3VV0 A;  4EMG A;  2YDL A;  3JCM f;  2J6K A;  4IUP A;  4RTY A;  4M7D F;  1GCQ C;  4J6Y A;  1VQM T;  1F1B B;  1YJN A;  4F7U F;  1W4S A;  3REA B;  2O01 E;  3RES A;  3P8D A;  3X25 B;  2HSP A;  1H64 1;  3JSC A;  3QZ5 B;  4ATO A;  3M4Y A;  3OW2 S;  1N6A A;  4XTZ A;  3GP8 A;  3CC7 Q;  1U8R A;  3ASK A;  1QWF A;  3EH2 A;  3SWN C;  1D0Z A;  1BB9 A;  4KBM B;  2FPF A;  1GFD A; 
#chains in the Genus database with same CATH homology
 3S3O A;  1FWZ A;  3X28 B;  4C92 G;  1VQK T;  2EJG A;  3L2W A;  1I81 A;  2K5I A;  3CCL T;  2F69 A;  3PMT A;  2D0Q B;  4VUB A;  2JNG A;  3HRS A;  4C8Q C;  5GMK e;  2L5Q A;  2Y90 A;  5FU6 B;  1P92 A;  1U1T A;  1MHN A;  3PFS A;  1SSF A;  2DTH A;  3A8M B;  2LTO A;  3INZ A;  5CCA A;  2DD4 A;  4PJO D;  2CKK A;  3MO8 A;  3X20 B;  5CO7 A;  2OTJ T;  4IKF A;  1Q82 C;  2QQ9 A;  3L2R A;  5GAM j;  3OYG A;  1VQ5 A;  4F7U E;  1VQL T;  4C92 F;  1I5L A;  3TRE A;  2RJF A;  1XQH A;  2CZ7 B;  4N0A A;  4JLG A;  3CCM A;  2ZPB B;  3V8L A;  4HCC A;  2VV5 A;  1V29 B;  4IUV A;  4OGE A;  3ZEH A;  3M59 A;  3NFC A;  3OQ5 A;  4XU1 A;  1NPR A;  5A0L A;  4UC4 A;  2F5T X;  3J80 E;  4HCB A;  3FB9 A;  5LJ3 d;  3MP8 A;  2OAU A;  4ZGE B;  2XIC A;  1VIE A;  1IZ6 A;  1JBM A;  4M78 A;  4JUV A;  4XTW A;  5HY6 A;  3RKW A;  5GAN j;  3UT1 A;  2RHU A;  3M56 A;  2LVM A;  1Q86 U;  2ZZD A;  3NTH A;  3OS0 A;  3OB9 A;  4PKC C;  5HK0 A;  4XK8 E;  2L3R A;  3OYC A;  3OMC A;  1YJW A;  1YHQ A;  1VQ6 A;  3DLL A;  5GAN 4;  3VKI A;  4CRI A;  3UDC A;  5D6Y A;  2QDY B;  3X24 B;  4RCB A;  4BI8 B;  2EJ9 A;  3JB9 I;  3R6O A;  5J39 A;  4NL3 A;  5GMK m;  3EAE A;  1NZ9 A;  2YLC A;  3L42 A;  3JB9 D;  1YJW T;  2KMT A;  4FT2 A;  3S6W A;  1FXX A;  5LL6 S;  3PGG A;  5CK9 A;  3CPW A;  1VQN A;  2XK0 A;  2X4X A;  1VQ8 A;  2DZC A;  5D6X A;  4M77 B;  4M7A B;  2Y4X A;  3VYH B;  4GY5 A;  2JTF A;  4D6W A;  3OYK A;  4ELY C;  3CEY A;  4A4F A;  3H6Z A;  4X9C A;  4M77 E;  3CCV T;  1VQ9 T;  4M7A E;  4BE0 A;  4M78 E;  2EQJ A;  3JCM J;  4ZN1 A;  5CQX A;  1QVP A;  1UGS B;  1YIJ T;  2YLB A;  1G5V A;  4Y91 A;  5LJ3 g;  3CME T;  4ELZ C;  3VJP A;  3QXE B;  2MI6 A;  1JJ2 A;  4A4H A;  2KAF A;  5I2M A;  4NL2 A;  5GAN e;  3E9F A;  1I8F A;  2PUK B;  3LYI A;  3HRU A;  3JB9 F;  2WSE E;  4XTY A;  4B9W A;  3KXT A;  5KCH A;  4C5G A;  1B34 B;  3M57 A;  3JCM d;  4EMK A;  1RL2 A;  1MGQ A;  2QQB A;  1FX7 A;  5IAY A;  4L59 A;  4C0D B;  1KHI A;  1M1F A;  3LGL A;  2XHC A;  5LJ3 e;  4PJO C;  2DEQ A;  4XU0 A;  4EPC A;  2EWN A;  3MEW A;  3G4S A;  3CCQ A;  4M75 E;  1IRE B;  3A8G B;  5GAM h;  2KVQ G;  1YJ9 T;  3CMA T;  1Q81 C;  2YHT A;  2WAC A;  4PJO F;  3J81 E;  3C12 A;  2MWP A;  3GNF B;  4E47 A;  2K3X A;  3G6E A;  4IUR A;  4LDW A;  3ZFJ A;  3C94 A;  4BE1 A;  4BY6 B;  3CC2 A;  4LDV A;  4M77 F;  4M7A F;  2RI2 A;  2DTO A;  3MET A;  2QEX T;  4EDU A;  1XTD A;  4O5V A;  4PJO G;  2CZ0 B;  2QI2 A;  4BUG A;  2LC4 A;  4M78 B;  4LDU A;  1GXI E;  4N4I A;  1VQ7 T;  3OSV A;  5AYF A;  1QVF S;  3HKS A;  3DB4 A;  3O8V A;  2K57 A;  4MDX A;  2ZPH B;  3QKJ A;  3NTK A;  2D6F A;  1WQ7 A;  2E5Q A;  3A8H B;  3M5A A;  1VQM A;  2XD0 A;  2LDM A;  2E10 A;  1YCY A;  2HD0 A;  3BY7 A;  3G7Z A;  3SB2 A;  2DVE A;  2GQV A;  4ME7 A;  3V8K A;  4JS5 A;  2R58 A;  2O4X A;  2ZPE B;  5GMK j;  2DKG A;  1KQS A;  5CKH A;  3HRT A;  4OF1 A;  2YRV A;  2E12 A;  3QHS A;  3VU3 C;  1W2B S;  2QQS A;  5LJ5 d;  5LJ3 h;  1QVG A;  3G71 A;  2XI9 A;  3CC7 A;  4J8O A;  4OB2 B;  2JOY A;  5FU7 B;  3EFR A;  3RUX A;  4KUD K;  4PLL A;  2DZ9 A;  3HL8 A;  3OS1 A;  5GAM e;  1Q7Y U;  4RMO A;  3G71 T;  4JDS A;  3CPW S;  2KSS A;  3QBY A;  3OYJ A;  1KC8 C;  2A3L A;  3OBY A;  4BDZ A;  3GIB A;  5GAO l;  4OMF B;  5CKE A;  5GAN 3;  2XG8 D;  4ZTJ A;  4C92 C;  2P0K A;  2A7Y A;  4NOY A;  1VIF A;  3ER0 A;  2XKO C;  3A8O B;  3MHX A;  3OYY A;  4P5N A;  2RHX A;  5KCO A;  3CC4 T;  3AHU A;  3CCR A;  2X4W A;  1D3B B;  2QEX A;  3RMQ A;  5HK3 A;  1M1K U;  4BE2 A;  1QVF A;  3KUF A;  2OTL A;  1BI2 A;  3TEE A;  4TVR A;  3CPF A;  2PU9 B;  3OYN A;  2QA4 A;  3OSS C;  2PUO B;  5GAN g;  2RB6 A;  1VQO T;  1M90 U;  3JB9 H;  4N0A C;  4QQG A;  4MZT A;  4F7U B;  2E41 A;  3LX7 A;  2WSC E;  1Y07 A;  1AHJ B;  4FL6 A;  4M75 B;  5CKB A;  5GAN 5;  3CCE A;  3CBO A;  4Y28 E;  3CCU A;  1M4Z A;  4LDY A;  3E19 A;  1Q81 U;  2E70 A;  1HK9 A;  4C8Q B;  3CCS T;  1VQ6 T;  4C8Q A;  4MML A;  5GAN 2;  2M0O A;  4FIB A;  4J6W A;  2DXT A;  4C8Q E;  3SFM A;  2LCC A;  2ZCF B;  5GAN f;  2LX9 A;  4XTV A;  2QXF A;  3KBG A;  4KUL A;  4PLI A;  3JCM h;  5CKD A;  2EIF A;  1U1S A;  2DJZ A;  5CR2 A;  2CGH A;  4QVZ A;  3X26 B;  2FYK A;  4BI3 A;  2D9T A;  2B8A A;  2JUF A;  4C8Q D;  2BKD N;  3OA6 A;  3WXM B;  2RK1 A;  4NS5 A;  3OW2 A;  4JRI A;  2XDB A;  1I4K 1;  2MWO A;  4M77 G;  2I2L A;  4M7A G;  3OYD A;  3JCM g;  4FT4 A;  4C8Q G;  1WQW A;  3QSU A;  2VYT A;  4L6V 5;  2L89 A;  1OYX A;  3VYG A;  2MMP A;  2JN0 A;  3SWN B;  1YIJ A;  2ZPG B;  3CBP A;  3QG1 A;  1YIT T;  1Q86 C;  2LRQ A;  2NLU A;  5LJ5 e;  5DLQ E;  3HFN A;  2BIV A;  4LDX A;  5HKC A;  2M9U A;  3NTI A;  4IUQ A;  4XU2 A;  1LOJ A;  4OB3 B;  2DAQ A;  2CZ1 B;  4C92 D;  2RJC A;  1K73 U;  1WJR A;  1VQ7 A;  2EQU A;  1B34 A;  1O75 A;  3URG A;  3CD6 T;  2GFA A;  1VQ4 T;  5KE2 A;  3GF5 A;  2K4Y A;  3SDZ A;  3J7A F;  1BYM A;  5IN1 A;  1K8A U;  4OB0 B;  1QVG S;  5CQY A;  3MEU A;  1VQP A;  2JVV A;  2DD5 A;  3HFO A;  1RI0 A;  3E1S A;  4QQD A;  3RKX A;  4BDY A;  3CD6 A;  1KD1 C;  2HQX A;  3OYF A;  2EYQ A;  1JB0 E;  3CCJ T;  3CC2 T;  1UEB A;  2R5A A;  4QQ6 A;  1S72 T;  1JJ2 S;  1D3B A;  2RI3 A;  3JB9 J;  5C6S A;  3PIO A;  1W2B A;  5GAN 8;  2RO0 A;  3CMA A;  5LJ5 f;  1M90 C;  4KUI A;  4M77 A;  4M7A A;  2X4J A;  5LJ5 h;  2RJE A;  4N4G A;  3PTA A;  2P0Q A;  4M7D E;  1X6O A;  3P8H A;  4FM4 B;  3OYM A;  2VUB A;  2P0P A;  2LT1 A;  4J6X A;  4JRQ A;  1QP2 A;  3UPU A;  3RIR A;  4XQ3 A;  3A8L B;  3OYL A;  4FSX A;  3FRN A;  2XU8 A;  1BIA A;  4A4G A;  5A0G A;  4R56 A;  4M78 C;  4OGC A;  3LWH A;  3GPL A;  2XID A;  2JZ2 A;  1KC8 U;  1VQ5 T;  5FRN A;  2M1H A;  1WPY A;  2QQA A;  1HXD A;  1XNI A;  3TCJ A;  2OTJ A;  3M9Q A;  5LJ5 g;  1NE8 A;  2RD1 A;  3OYH A;  2K2V A;  3C95 A;  2RA2 A;  3JCM P;  2RI5 A;  2EQM A;  1ZBX A;  5J26 A;  5L8R E;  1WNL A;  2ZPI B;  3LWI A;  1VUB A;  1KQS S;  1G3W A;  5M9O A;  4LD6 A;  3QZ9 B;  1K8A C;  4M78 G;  3CCE T;  4MMK A;  3DKM A;  3QII A;  3MP1 A;  4M75 D;  5FLX E;  2H3J A;  4EMK C;  3CCJ A;  1N27 A;  3UWN A;  1KD1 U;  1VQ9 A;  4WF2 A;  4JJN K;  1YHQ T;  1XOV A;  2EFI A;  2GF7 A;  4M75 A;  3SWN A;  3A5Z B;  4IUT A;  4YTL A;  3QJY A;  3OYE A;  3G6E T;  4E7H A;  1YI2 T;  2RHI A;  2Y4Y A;  1JRI A;  3Q1J A;  5CAI A;  2KY9 A;  3MP6 A;  3WVE B;  3N5B B;  1K73 C;  3OS5 A;  1QW1 A;  4BAC A;  1ZHI A;  3PT9 A;  1BI3 A;  4OP0 A;  2XDP A;  3GOX A;  4JRK A;  3L2V A;  5GAM g;  3HP9 A;  5CIU A;  5GAO q;  2RM4 A;  3TU4 K;  3LH0 A;  4J7F A;  4A53 A;  2E1H A;  2EQK A;  4M75 F;  4C0F A;  3CCR T;  4M7D B;  1N9R A;  2AHJ B;  4L5G A;  2M16 A;  3M55 A;  4DOV A;  2RJD A;  4C0Z A;  5GMK i;  2RHY A;  2V8J A;  1UGP B;  2WSF E;  1ZQ1 A;  1Y96 A;  3LGF A;  2VXE A;  4C0D C;  3I55 T;  1M5Q 1;  5LJ3 f;  3V7R A;  4XTX A;  3RKY A;  4MDW A;  3CC7 T;  2R5M A;  4HA8 A;  3BFM A;  4DA4 A;  1PSF A;  4GLK A;  2QTX A;  3M53 A;  5KE3 A;  4M77 D;  2ZGW A;  4M7A D;  4V2S A;  2DXU A;  4PL6 A;  2FHD A;  4F7U A;  3JRZ A;  3RMS A;  3I55 A;  1G3Y A;  2VXF A;  3GNG A;  3MCA B;  1M1G A;  5I2S A;  2RH2 A;  1Q82 U;  3M54 A;  1PSE A;  3JCM W;  1KQ2 A;  3FC3 A;  4FU6 A;  2DTI A;  3CME A;  4BB7 A;  4RG8 A;  3VUB A;  4XU3 A;  4E7I A;  2VGM A;  3PMI A;  4A4K A;  1QP3 A;  4C0G A;  4F7U G;  3S3N A;  4M78 D;  4R55 A;  3OYI A;  2E6Z A;  1M1K C;  4QW2 A;  2V8I A;  4B9X A;  3JB9 G;  5GMK h;  2X4Y A;  1NJI C;  1Q7Y C;  2DXC A;  1S72 A;  1WJQ A;  3SD4 A;  2QQR A;  2HBP A;  3PNW C;  5GAN h;  3CCV A;  5GAO r;  2R57 A;  5D6W A;  1UGQ B;  1YJ9 A;  3GLX A;  1M9S A;  5LJ5 j;  3OYA A;  2FL7 A;  1VQ4 A;  2BUD A;  3JCM Q;  1X01 A;  3MEA A;  2DO3 A;  3EFS A;  1DJ7 B;  4A54 A;  4RG2 A;  3CCU T;  1YBY A;  5GAN 7;  4HT9 A;  5FU6 C;  1YI2 A;  3FLG A;  5GAM f;  2PQW A;  4OVA A;  2RK2 A;  5FU7 C;  1K9M C;  2LQK A;  1TH7 A;  1G3S A;  2CS7 A;  2XDD A;  2EAY A;  4JLI A;  5GMK l;  1UGR B;  3L2Q A;  4M78 F;  1O9S A;  2O4X B;  5GAM d;  2E65 A;  4QVD A;  3V8J A;  1NPP A;  4PJO A;  4ZGD B;  3BW1 A;  3QJ6 A;  4MZP A;  3BDL A;  4M77 C;  4E7K A;  4M7A C;  3L1A A;  1N9S A;  4BI4 A;  3CCM T;  3QDR B;  4C5I A;  2PVD B;  5DM7 R;  3CXC S;  4KT0 E;  2VGN A;  4BY6 C;  2IG0 A;  5C0M A;  3P8B B;  1Y7X A;  4PJO B;  4RCC A;  2KQW A;  1YIT A;  1WGS A;  3QYG B;  2PVO B;  2DIG A;  3V7C A;  4RKU E;  1WJS A;  2CZ6 B;  2DK3 A;  5DLO A;  2GFU A;  2C06 A;  1KQ1 A;  4MZM A;  2E6N A;  2KDS A;  3DB3 A;  4X9D A;  3OBW A;  2K3Y A;  4JRP A;  1NJI U;  4IUU A;  4HKE A;  2L8D A;  4O6J A;  3JCM V;  4DQ2 A;  1BIB A;  4ZN3 A;  2LQ8 A;  2G3R A;  1Y96 B;  3FIF A;  1LNX A;  1LJO A;  2V8K A;  3ME9 A;  3CCS A;  3T9N A;  4E7J A;  1N8R U;  1KG1 A;  1X75 C;  1BI1 A;  3C4S A;  3FJP A;  3HHT B;  5GAO p;  1OZ3 A;  2K5F A;  3OY9 A;  4JS4 A;  4PJO E;  2GCX A;  2QA4 T;  3JCM b;  2VC8 A;  1VQP T;  3RER A;  4M75 C;  1BKB A;  2KK4 A;  5J3B A;  3LLR A;  2OTL T;  1BI0 A;  3QUI A;  3QPH A;  4DOW A;  3JCM X;  2RHZ A;  5FRM A;  3M58 A;  1VQN T;  4XAX B;  2HAX A;  2F5K A;  2K5L A;  4J83 A;  3JCM c;  2FB7 A;  3E9G A;  3I56 A;  4PNO A;  5FRO A;  4ZGJ B;  4A4E A;  2MAM A;  2P4T A;  4J7I A;  3OS2 A;  2IVW A;  3MEV A;  4Z02 A;  2DPP B;  3DLM A;  4LD9 K;  4X34 A;  3V7S A;  3WVD B;  2FVU A;  2DXB A;  2HNI A;  4II1 A;  3JCM e;  1VQO A;  4M7D D;  2LCL A;  1EIF A;  1R8O B;  3VUZ A;  5EG2 A;  5CVI A;  5DY9 A;  5GAO n;  3PIP A;  4EMH A;  3CBM A;  3I56 T;  1YJN T;  2JTM A;  4C5E A;  2MF2 A;  3G4S T;  3ZBD A;  3CCQ T;  4BD3 A;  1K9M U;  4M75 G;  3S3M A;  4C92 B;  5GAN 6;  4OB1 B;  3M4G A;  2LT4 A;  2HQE A;  1VQL A;  5IT9 E;  4M7D A;  3F70 A;  1M8V A;  3FDR A;  1H3Z A;  4M7D C;  3VV0 A;  4EMG A;  1Y71 A;  3HSB A;  2DIQ A;  3JCM f;  4IUP A;  2E64 A;  4CI0 C;  4QVC A;  4M7D F;  2EKO A;  1KHC A;  4HCZ A;  1VQ8 T;  5GAN d;  5I21 A;  1VQM T;  4J6Y A;  3JAM E;  1YJN A;  4HT8 A;  4ZTF A;  2EJF A;  4F7U F;  1OZ2 A;  5LJ3 j;  1W4S A;  4C92 E;  2O01 E;  3CCL A;  2ZPF B;  3L2Z A;  3H8Z A;  4C5H A;  3QYH B;  4E7L A;  2CYZ B;  5CKF A;  3RES A;  3CXC A;  3P8D A;  4C92 A;  5GAO m;  5KH6 A;  4M7D G;  5A2Q E;  3X25 B;  2LNV A;  3OYB A;  1OI1 A;  1UB4 A;  1H64 1;  3JSC A;  3QZ5 B;  4ATO A;  2PVG B;  3M4Y A;  4EMK B;  3L2U A;  3OW2 S;  1N6A A;  4XTZ A;  3GP8 A;  1U8R A;  3ASK A;  1N8R C;  3FEO A;  4Q5W A;  3OMG A;  3SWN C;  3HPW A;  4J5Y A;  3QO3 A;  5A0D A;  4N4H A;  1VQK A;  4KBM B;  2X35 A;  1G3T A;  3CC4 A;  3BDU A;  4C8Q F;  4XTU A;  3LW5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...