4C92B

Crystal structure of the yeast lsm1-7 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
SENLYFQGSGSLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92B00
4NL2A 5LJ3d 3HFNA 3L2ZA 5GAOn 1LJOA 4XU1A 4C92G 4F7UE 4M75A 1N9RA 4NOYA 4XTUA 4M7AB 5LJ3h 5GAOp 5LJ3e 4M7AA 1Y96A 2RM4A 4J6XA 4M75G 2QTXA 1WQWA 4J5YA 5GAMh 2YLBA 3JCMd 2DEQA 2CGHA 3V7CA 4RCCA 5LJ5d 5GAMe 5GAN5 4M7DD 4M7DF 4M75C 3QO3A 3V7SA 5GMKh 4C8QA 2YLCA 5GAN6 4HT8A 1D3BA 2DTHA 1TH7A 1LNXA 3RKXA 4QVCA 2DTOA 1WPYA 1M5Q1 1HXDA 1B34B 4J6WA 3JCMP 4PJOG 5LJ5j 1I8FA 3HSBA 2EJ9A 4EMKC 2EWNA 4XTVA 4QVDA 4M78D 3JCMJ 4DQ2A 1LOJA 3JCMg 4XU2A 4XTYA 4PJOC 4F7UB 1JRIA 1YCYA 3SWNB 2EJGA 5GAN4 3PGGA 4PJOA 1U1SA 5LJ5h 3V8JA 4C92D 4M7AD 3BW1A 4PJOE 4C8QF 4EMKA 4M77D 5GAOq 4NL3A 5GAOm 4X9DA 3JCMX 5GAMj 3FJPA 2RD1A 5GMKj 3RERA 5CAIA 5GAOl 3V7RA 1H641 2YHTA 4C8QD 4C8QB 3BFMA 2VXEA 2E41A 1N9SA 3INZA 5GMKm 5GAN3 4JLIA 1I5LA 2DVEA 3EFSA 4X9CA 3JCMb 4JUVA 4M78B 1X01A 4V2SA 5GAMf 5LJ5e 5GANh 3JCMe 2E65A 2DXTA 3JCMV 2E10A 3EFRA 5GANf 4JRIA 4M75D 4HT9A 5GAMg 4XU3A 5GAN8 5GAOr 3FIFA 4M75E 4JRKA 4C92A 4F7UA 5GMKe 4XTXA 4A53A 2DXUA 3JB9F 5GAN7 1I81A 3RKWA 3SB2A 4F7UF 3JCMW 1U1TA 2DTIA 4MMLA 2DJZA 1KQ1A 5LJ3g 4M7DB 3RUXA 2DZCA 2HNIA 3V8KA 2EAYA 2VC8A 4M77B 4A54A 4C8QC 3JB9D 3SWNA 2RB6A 3FB9A 2VXFA 4M75F 2E64A 3L1AA 3JCMh 3JB9H 4C8QG 4C8QE 3VU3C 5GANe 2RA2A 3JB9J 4XTZA 1WQ7A 4M78A 5DY9A 1B34A 3QHSA 4J6YA 4EMGA 1M8VA 2I2LA 4C92B 3JB9I 1MGQA 1I4K1 4WF2A 2FYKA 5GANj 4M78G 4M7AG 1BIAA 2K57A 2Y90A 1KQ2A 4M75B 4N0AA 4PJOD 4RCBA 5GMKi 5GMKl 4M78C 4M7AC 3M4GA 4XQ3A 3QUIA 4OP0A 4M77A 2DKGA 3RIRA 2E1HA 4XTWA 3JCMQ 3QSUA 4M7DA 1HK9A 5GANd 1Y96B 4M78E 4M7AF 1BIBA 5I21A 2DZ9A 5LJ3f 5LJ5f 4M7DG 3BY7A 3JCMf 2ZGWA 4M77F 5GAMd 3BDUA 4EMHA 3V8LA 4M77G 3JCMc 5LJ3j 4C92F 4PJOF 1D3BB 2FB7A 1JBMA 4PJOB 4MMKA 4M7DC 4Y91A 5GAN2 1WNLA 4M77C 2EJFA 3RKYA 3SWNC 5GANg 4HA8A 3GIBA 4M77E 4C92C 4PNOA 3JB9G 2JN0A 4M78F 4N0AC 4C92E 4F7UG 3AHUA 4XU0A 4EMKB 4M7AE 5LJ5g 4M7DE 3HFOA 3RESA
chains in the Genus database with same CATH superfamily
2ROTA 1KIKA 1YJNT 4DBHA 3EAEA 1WJSA 5A0GA 1VYVA 2GNCA 3G71T 1VQOT 2VV5A 1W2BA 1D3BA 3TQ7P 4KULA 2LC4A 1M90R 1N6AA 1ZLMA 1OX9A 3THKA 3CCVQ 2Z0WA 3L2QA 1Q82C 2P0PA 4LN2A 4LDUA 3PGGA 4PJOA 4N4GA 2EQKA 4N4IA 4A4GA 2FL7A 1KQSP 2OAUA 3DLLA 5KE3A 2DNUA 2QDLA 3OW2A 1KD1C 4C8QB 2H8HA 1YBYA 3M56A 5FWBA 3C94A 3DKMA 2VB6A 3CCRA 1QW1A 1M27C 5GANf 2K5LA 5GAMg 1W6XA 3GNGA 1CSKA 2XDBA 2CP2A 1T0HA 2LDMA 1U1TA 4EIKA 1NLOC 1I07A 2CH4A 2HNIA 2QDYB 1UHCA 2XG8D 4KBMB 4C8QC 2E64A 1CKBA 4C8QE 2DF6A 3JB9J 3FEOA 3N5BB 3GF5A 3I55A 5DY9A 2B86A 3WXMB 3OMCA 4EPCA 4A4FA 2VGNA 2XIDA 1TSFA 1FMKA 1VQNT 1HD3A 1U5SA 2A37A 3OYYA 4KT0E 4XQ3A 2D9TA 2LJ3A 3QG1A 2NUTA 5KE2A 3CC4Q 1HK9A 2OJ2A 2RN8A 3MJXA 2R5MA 3JCMf 1YJNA 5LJ3j 3JCMc 4RMOA 2COYA 2DBKA 3M54A 4J9GA 2KYMA 2L3QA 4RKUE 2EJFA 5GANg 3GNFB 1KD1U 3JB9G 2DD4A 2HBWA 4OMNA 4C92G 1BBZA 4XU1A 4M75A 1UFFA 1NYFA 1Y96A 2K5FA 2L8DA 2DEQA 4RCCA 3H41A 5KYXA 4OGEA 1WPYA 5CR2A 1VQ6Q 1LOJA 3JCMg 1YHQT 4XTYA 1K9AA 4YTLA 4F7UB 2DE0X 1M3BA 2QI2A 3A8MB 5FU7C 3MCAB 3VKIA 4NL3A 5GAMj 2RHXA 1IHVA 3RERA 3ZEHA 1UDLA 2MWOA 4M4ZA 1WGSA 1VQLT 1VQKQ 4HXJA 4OB1B 1EIFA 3A8OB 1AZGB 3HRTA 3OYJA 4R0KA 2E65A 1W2BP 1JB0E 3EG9B 2E10A 2CREA 3QYHB 2CZ0B 4PLLA 4JRKA 3MP6A 3T9NA 2K79A 1U8RA 3CCSA 2DMOA 5L23A 1YCSB 4HCZA 1KQ1A 3RUXA 3JCMh 4IIMA 4VUBA 2ZAEA 2DA9A 2BKDN 2KNBB 2AKLA 2X9HA 2RHYA 1I5OB 3JRZA 2JTMA 1E6GA 4PJOD 4E7ZA 1PCXA 4RCBA 4M78C 3OYMA 3QUIA 4OP0A 1YIJT 2DKGA 3JCMQ 3PMIA 2MMPA 1ACMB 3VS1A 4M78E 3ZFJA 1BIBA 4HCCA 5I21A 2K2VA 4TVRA 5KYWA 4QW2A 1QMCA 4Y91A 2EYZA 2H3EB 4OGCA 1NBEB 4C92C 4XAXB 5LJ3d 3HFNA 2CT3A 5LJ3h 3EGXA 2PUOB 2LQKA 2E4HA 5FRNA 2HQEA 4KRTA 2C0OA 3V7CA 2JMAA 4M7DF 1T3LA 4IKFA 2FPEA 2RPNA 4Q5WA 4C8QA 3UF4A 3RKXA 2BIVA 1B7TA 1VQMQ 2LJ1A 2LT4A 1WJQA 2MOXA 1VQ9A 4EMKC 2AZSA 1Q86R 3JCMJ 3OQ5A 1DJ7B 5AYFA 1JRIA 3HHTB 2EJGA 2O9SA 4M7AD 3BW1A 2F1LA 1AHJB 4HVUA 3OY9A 2JM8A 5GAOq 1UE9A 2EQUA 2DLPA 3E9GA 1UEBA 1OPLA 3J81E 3G7ZA 5DLQE 4JDSA 3SD4A 2OTLA 1ZHIA 2CP5A 3VS6A 4OB0B 3G6ET 3CBMA 2DL5A 4QQGA 3JCMe 1IB8A 2RQUA 1N27A 2GTJA 3HRSA 4F04B 2G3RA 3FIFA 4LDXA 1Z9ZA 1QQJA 1W1FA 4AFSC 1V29B 4PJNA 2LVMA 4MMLA 3CC4T 1PNJA 5D6YA 4M77B 3SWNA 4QQ6A 4OMFB 3C0CA 1R8OB 4CC3A 5I2SA 4J9EA 3R6OA 1K8AC 2P84A 3MEWA 2CH4W 2CKKA 2ROLA 3LYIA 2QQAA 1SRLA 2M9UA 1QVFA 1K9MU 1ZX6A 3KBGA 3M4GA 4M77A 3GBQA 3DB3A 4IUQA 2YT6A 4EMHA 3C95A 3P8BB 2O4XA 2FRWA 2KI7A 2J6FA 4XU0A 2RHIA 1UUEA 1LJOA 2E6NA 1M1GA 2CUDA 1VQNA 2L3RA 2YXYA 3M58A 4B9WA 4J6XA 1R0CB 4M75G 3LWIA 2PVOB 1RAHB 3KUFA 2M16A 1O9SA 1KHIA 1MV0B 2DETA 2YLCA 4HT8A 1LNXA 3EGDA 1K9MC 4QQDA 4A4KA 4M78D 2HAXA 2HBPA 3BDLA 5GAN4 2RJDA 5LJ5h 3WVDB 3EFOB 2EGEA 4F16A 2V1QA 2EYQA 3QPHA 2RH2A 4E7SA 1FX7A 2QYZA 2E5QA 3CD6Q 1YJNQ 4FSXA 3M0QA 4JJNK 3TSZA 2DD5A 4Z89A 1WHMA 2MIOA 1LCKA 1VQ5Q 1Q81R 2XMFA 3PT9A 5FU7B 1QVGP 4FCYA 2HDAA 5IHIA 3TSWA 1I0CA 2DZCA 2QK0A 5J39A 4IUPA 1EZZB 4OB2B 1WJRA 1SRMA 3OYHA 3S3MA 2KT8A 3CBPA 3M0PA 1I4K1 2D6FA 3RDVA 3CCLA 2DX1A 2K4YA 2FEIA 1VYTA 3C12A 3GLXA 4AT1B 1PD0A 1KG1A 5GANd 1M3CA 2QEXQ 5LJ3f 5LJ5f 4M77G 1WXBA 2YSQA 2YRDA 3CXCS 6AT1B 1WX6A 2LRQA 2ZZDA 4N0AC 4C0FA 2DERA 1ZSZA 4F7UE 2V8KA 2BZYA 3UWNA 3CCLQ 2FHDA 3CPWS 1T0JA 2F2WA 1X2KA 1SKUB 4R56A 3OSSC 2HKQB 2M02A 3QO3A 3EFOA 4KH0B 2EBPA 3OYCA 1Q82R 1Q95G 1H92A 2KQWA 4J9BA 1PM3A 3G4SQ 1KC8C 1YN8A 2EFIA 4LUEA 3SEMA 3VUZA 5D7UA 1NPPA 4RG8A 4LD6A 2XD0A 4KGZB 4C0DC 3PTAA 4P5NA 2E41A 2RHZA 5IXBA 3EHRA 1QVPA 3JCMb 4CRIA 4RTVA 4K11A 3PMTA 5J26A 3CQTA 5KYYA 2NUPB 4AFQC 4M75E 1PSEA 3I35A 2A28A 3FRNA 2D0NA 2DTIA 1IZ6A 2EGAA 3EGUA 3CC7A 2V8JA 3QJYA 5KYUA 3JB9D 2BZXA 1TU0B 3SDZA 2A3LA 1IHWA 1NPRA 3MP8A 3VUBA 5KYNA 1VQ9Q 2OX7A 2E5KA 1OI1A 4NS5A 4CC4B 5DLOA 1X27A 2DIGA 4XTWA 3S3NA 4Y92A 3S3OA 1Q7YR 1IGQA 1Q86C 3CCMQ 1JO8A 4QVZA 3V8LA 1MMDA 2DJQA 3VYHB 1G3YA 4FU6A 2ZPIB 2E12A 3QZ9B 1YHQQ 1RLPC 5FRMA 2JVVA 1ZSGA 3QJ6A 4B9XA 3CPWP 2JTEA 4RTWA 5CKEA 5GAN5 2B8AA 3URGA 2OTJA 1AWOA 2CZ1B 2NYSA 1ZA2B 2AT1B 2LNVA 3QWXX 8AT1B 2DXBA 3OS2A 2LCCA 3HSBA 4XTVA 3NFCA 4JLGA 4A4HA 2LJ0A 1H3ZA 3CC2A 1ARKA 1YIJA 3NTKA 2KGTA 1WLPB 3NHNA 2EIFA 4OF1A 2JNGA 4WCIA 3F70A 3OYKA 1RAIB 5GAOl 2JM9A 1N9SA 2AHJB 4JLIA 4RTXA 3CMEQ 1UTIA 3VYGA 1M3AA 3D7SB 3RMSA 5LJ5e 2D8HA 4CC7A 5CKBA 3JB9F 1FMWA 3I55Q 3JCMW 4M7DB 4E7LA 4A54A 1UGPB 4ATOA 3OYBA 3OYDA 2GGRA 3EH1A 2KMTA 2EGCA 2DRMA 2MPXC 2X4YA 2J6OA 2O01E 2HZYA 4C92B 3JB9I 1OZ2A 1RACB 4M78G 2YWWA 1BIAA 2YDLA 1A0NB 4D8KA 2JT4A 1SEMA 2DRKA 2QA4T 3PIPA 1WFWA 1J3TA 1YI2Q 2GTOA 4M7DA 4L5GA 3L2WA 4BE1A 4ELZC 4M77F 2L0AA 2RF0A 2C06A 2FB7A 4RTTA 1QP3A 2PTKA 3RKYA 2OTJT 2A08A 1RAEB 1R77A 1MMNA 3HFOA 1VQ5A 2EKOA 3L2ZA 2P0QA 1Q82U 1VQNQ 3JAME 3CCUA 2DO3A 1WQWA 1WHLA 3M0UA 1Y7XA 5ECAA 3VS3A 1IO6A 4ESRA 1JU5C 2DTOA 1BI1A 1UGVA 1B34B 1WYXA 5A0LA 2R58A 4QVDA 4ELYC 1PKSA 1GBRA 1C0MA 2G6FX 3HKSA 1AEYA 1YCYA 3OYNA 4A63B 4FT2A 2HD0A 3TREA 3RMQA 4X9DA 1BB9A 3FJPA 1FMVA 4ANJA 4KH1B 2QEXA 1H641 2HSEB 1KQSS 5GMKm 1K73R 1NJIU 2LX9A 1BCMA 2HQHA 5CCAA 4X9CA 2X4JA 1UB4A 4M78B 2QQSA 5GAMf 2FPDA 2KXCA 1AWXA 2P0KA 3VS7A 1MV3A 3EFRA 2PZ1A 4RTYA 4XU3A 1WXTA 2DXUA 1XTDA 1BU1A 1YJWA 5LJ3g 4RUGA 1VIFA 2BE7D 4IUUA 2ZPGB 5CO7A 4LNPA 2RA2A 4GLKA 4FYYB 4LDWA 3QBYA 3VS0A 3J80E 2PNIA 1QVFS 3QXEB 3VJPA 2BE9B 4DA4A 2V1RA 2DYIA 1Q86U 1YI2T 1UECA 1TOVA 4E7HA 2M1HA 2C0IA 2CP3A 2KR3A 1BYMA 1K8AU 4A4EA 3M0RA 2FZKB 4M77E 3KFVA 4M78F 4ZGDB 2X3WD 5D6WA 4FW1A 1KSWA 3EGDB 1OZ3A 2M51A 3CC4A 5GAMh 4L59A 5LJ5d 1MMGA 2GFAA 2O4XB 5I2MA 3X28B 2OTLT 3H9NA 3R6NA 4JS5A 3HTRA 1Z9QA 1NLPC 3RBBB 2EJ9A 5EG2A 4Y28E 2DAQA 4C0ZA 4FYVB 1MUZA 3V8JA 1QP2A 4C8QF 2K6DA 2GCXA 1VQ9T 1M1FA 3HL8A 1K1ZA 5KCHA 4C8QD 2VXEA 3M5AA 1RUWA 2RQTA 5CKFA 2VWFA 3LH0A 2NLUA 3MP1A 2X4XA 5GAOr 3CCEQ 3VV0A 4F7UA 5GMKe 2WACA 2CZ7B 3LW5E 1OU8A 2BZ8A 2DXCA 3RKWA 1M1KC 1YJ9A 2LCSA 2O2OA 2VC8A 3TVTA 5IHNA 1AOJA 3VS2A 3CEYA 4ZTFA 3ZL7C 3A1PA 4IUVA 2RJCA 3CPWA 3H0IA 1XJWB 2E70A 4OMLA 4KGVB 1JXMA 2PU9B 3META 4BDZA 2COZA 1VQ6A 2GFUA 4RTUA 3EG9A 2KDSA 3Q1JA 2E3IA 2VVKA 1YIJQ 1FYNA 2RQVA 1PRLC 2CP7A 3O5ZA 4LXCA 2KROA 2QEXT 1SSFA 2LQWA 1QKWA 4C5GA 2EVRA 5GAMd 1OV3A 1ABQA 3BDUA 2R5AA 1S72A 1OPKA 1W70A 2CP0A 4NL2A 2COWA 5HCKA 1RAFB 1BI0A 5CQYA 1YITA 3G1JA 1QCNA 2RM4A 4ZGEB 1RAGB 2VUBA 3CCRT 3CC7T 3GOXA 2JXBA 1M1KU 1OX8A 5AT1B 1AVZC 4KUIA 3CCUT 3REBB 1I8FA 4GBQA 4B6MA 2DL7A 1H8KA 1D1CA 2RQRA 4ZGJB 3UA7A 2HMAA 4AG2C 2DILA 2ZPBB 3L42A 3JCMX 3CXCP 3RR6A 4BE0A 1M2VB 1G5VA 4FM4B 5GMKj 2A0FB 5LL6S 1TUCA 2CDTA 1Q7YU 1P92A 3OYEA 4O5VA 4LDVA 1SPKA 3CPFA 3CMEA 1X69A 1QCFA 1VIEA 2DL8A 3NMZC 1VQ7T 1GCQC 2AKKA 3CD6A 2XK0A 2VYTA 3OYGA 5C6SA 1BK2A 1ZBJA 3V8KA 2KAFA 3RNJA 3S6WA 2LT1A 1JXOA 4ZN3A 1VQ8Q 2PVGB 2X35A 1WQ7A 3OYFA 1XNIA 3EH2A 3EG0A 2YRVA 3HPWA 4JJCA 5IN1A 1Q7YC 1AZEA 1VQPA 1VQ4A 3REAB 1D1AA 2KXDA 1Y96B 3OYAA 1FWZA 1HYOA 1Y0MA 5HK3A 4ORZA 2FZGB 1YITT 1JBMA 3M57A 4KUDK 1K9MR 1H3HA 2LX7A 2XKOC 1QVGA 1WNLA 2F5KA 3I55T 1O75A 3RESA 4BACA 5CKHA 1M2OA 4O6JA 2JUFA 3KXTA 5LJ3e 2NUTB 1JJ2S 3CCVA 3CCMA 2CP6A 1VOMA 4GLMA 1LVKA 4AMCA 2QASA 3LH5A 4J6WA 2MK5A 3UA6A 3QDFA 1SG5A 4OMOA 1TXQA 1K0SA 1SF9A 3JSCA 1M30A 3M4YA 5KH6A 4CC2A 4EMKA 2EQJA 2HKNA 4E7IA 2RD1A 3MHXA 1GFDA 3JV3A 4OMQA 3V7RA 2CS7A 3INZA 1MNEA 2X4WA 2WSEE 1UGQB 4Z8AA 1PD1A 1KFZA 2FVUA 2OTLQ 4J8OA 1TUGB 4FL6A 2KYBA 5KCOA 4C92A 1EX4A 1TTHB 1JJ2P 4PJLA 1KD1R 2EAYA 2K3YA 1PWTA 4BI4A 4M75F 4BE2A 1ZUUA 2KVQG 1JEGA 4M78A 1B34A 4J6YA 1Y57A 5GANj 5HKCA 4FSSA 3H8ZA 1K4US 4KGXB 1KQ2A 4N4HA 3PNWC 2LP5A 3SFMA 2GBQA 1M9SA 2XI9A 2KBTA 2VASA 4PJOF 2MCNA 3CCEA 3CXCA 1NJIR 1HSQA 1G8XA 1ZSZC 2AZVA 2JN0A 2RI3A 3PE0A 4DBQA 1D09B 3DB4A 1S72Q 8ATCB 2O9VA 1ZBXA 3OMGA 2MWPA 4E7JA 1TUDA 1GCQA 1D0YA 3QZ5B 4J5YA 1YI2A 4PFOA 4LUDA 4JRPA 2P4TA 1WZOA 5GAN6 5KYXB 2DTHA 4QVCA 1RI0A 1IGUA 4F14A 2GQVA 2RK2A 4EDUA 1VA7A 3M0TA 2EWNA 1K76A 2QTVA 1UGSB 1VQLA 1U1SA 1WHGA 4J9CA 3GPLA 1X6OA 1TS9A 3PFSA 5GAOm 1VQ4T 1WDXA 1X2QA 1TG0A 2YUNA 4DOVA 3QWYA 5CIUA 2D8JA 1YWOA 3BFMA 1W4SA 4E7KA 4II1A 1D0XA 1WHKA 1PC0A 3A8LB 1VQ5T 3AT1B 1GBQA 3UATA 4UC4A 3NGPA 3P8DA 3I56A 3CC2T 4M75D 4PLIA 1NG2A 2CSIA 4ZTJA 2MF2A 1WHHA 3MKDA 3QKJA 4Z02A 1VQ8A 2V26A 1NEGA 2V8IA 3A8GB 1BI3A 2X3XD 1XQHA 2PQWA 2QAZA 2H3JA 3U23A 3QHSA 2MYSA 5FLXE 2RI5A 2QGFB 3NTHA 1N8RC 2QA4Q 1G3WA 1NZ9A 4JRQA 3G4ST 1G3SA 1WA7A 2ZGWA 2JS2A 2WSFE 1Y07A 2HSPA 1U06A 1RABB 3L2RA 1NEBA 2EYXA 1VQOA 3CCQQ 5FU6B 2K7AA 3I5SA 3LGLA 1N9RA 4XTUA 1VQPT 5GAOp 2LCLA 5GJVB 1ZA1B 1M4ZA 2QTXA 2HL3A 2YLBA 2KSSA 2EPDA 7AT1B 4M7DD 4JS4A 1I1JA 3QIIA 1NE8A 4LE9A 3CMAT 4BY6C 2RHUA 2DK3A 2I0NA 2Y4XA 4BB7A 3G6EQ 3PVQA 1VQKA 5LJ5j 1MHNA 3OS5A 3CCQT 4PJOC 1PSFA 5CKDA 4RG2A 2MAMA 2ABLA 2YUPA 4PJOE 4J9HA 3H6ZA 4HCBA 4C0GA 2NWMA 4OMMA 1X6GA 2K3BA 1N5ZA 3OS1A 2DEUA 2BUDA 1WHJA 5GAN3 2VKNA 3EFSA 4BDYA 1X01A 2CT4A 2JZ2A 3VS5A 2DXTA 1C6VX 1FXXA 3JCMV 1RL2A 1BKBA 5KYYB 1K8AR 1QCOA 2W10A 3A98A 1QLYA 4F7UF 1SHFA 3QYGB 1W2BS 3E9FA 3G71A 4R55A 3FB9A 1QWFA 2C0TA 3OA6A 2KRNA 3EG1A 3VU3C 1M90U 3EG2A 4AFZC 4HVWA 5IAYA 1T3SA 2O31A 2YRCA 3UDCA 2IIMA 3TU4K 3L2VA 2RJFA 3E1SA 2GQIA 4DBRA 1KC8R 3H0HA 2DL4A 3X25B 5C0MA 2X51A 4J83A 4HKEA 4C5IA 3BY7A 1KQSA 1R0BG 1SSHA 3VS4A 3WVEB 1QVFP 2OTJQ 1JJ2A 2XU8A 4PFZA 4JPBW 4F7UG 4M7AE 5GMKi 4EMKB 1YHQA 5LJ5g 3VRYA 3CCLT 4MDXA 2LNHB 1OEBA 2K9GA 3OB9A 2EQIA 2J06A 2LZ6B 1GL5A 3SHWA 1OU9A 3V7SA 5GMKh 4BD3A 1RLQC 4HVVA 1AWWA 1TH7A 1E6HA 4DEXA 4J7IA 2MI6A 1VQLQ 2JS0A 3JCMP 1ZSZB 1YJ9T 1CKAA 2F2XA 2K5IA 1XOVA 2IVWA 3LX7A 4MZPA 2ZCFB 4C92D 2FO0A 3CCJT 3I9QA 3HRUA 1AWJA 3OSVA 1GXIE 3I5RA 4ZNXA 3GP8A 3NPFA 1SHGA 4JJBA 1V76A 2QA4A 1YJWT 2JOYA 3CCVT 1YJ9Q 5HY6A 1M2VA 2OAWA 4JUVA 2D0QB 4PK4A 4V2SA 2KK4A 4BI8B 1G83A 3MO8A 1PHTA 4Z88A 4DOWA 4HT9A 2KE9A 5KYUB 2J05A 4XTXA 4CI0C 3OYIA 4MZTA 2E3HA 3P8HA 1KK7A 3CMAA 1JQQA 1ZQ1A 2O88A 2DVJA 1LPLA 2IPOB 1BI2A 1M8MA 2XDPA 3L1AA 2JJ9A 4E6RA 3JB9H 4C8QG 2F69A 3FC3A 3DLMA 2RK1A 1GCPA 4EMGA 1GRIA 4HCKA 1N8RU 1QKXA 4WTOB 4M7AC 2JMCA 3E2UA 2K2MA 1YJWQ 1G3TA 5J3BA 5A0DA 3PIOA 2XICA 2WSCE 4M7DC 1M1KR 3LWHA 1VQMT 2EKHA 1OQKA 5IT9E 2ED0A 1VQ7A 3AHUA 4AFUC 4M7DE 5M9OA 4GY5A 3CD6T 2K3XA 4NOYA 1K73U 4M7AA 1PRMC 3LLRA 3MPUB 3I56Q 3CMET 2RJEA 2J6KA 5GJWB 4C0DB 3JCMd 1ABOA 3G4SA 1NM7A 4PKCC 1M5Q1 3CCET 9ATCB 2QQ9A 2DBMA 4X34A 1ZUKA 2DIQA 5FU6C 1WIEA 3ASKA 4MDWA 4ME7A 3G6EA 3SWNB 4OB3B 1PKTA 2ZPHB 3ER0A 2CYZB 3J7AF 2YHTA 3ME9A 5KYWB 2AK5A 1K73C 3OS0A 1VUBA 3M9QA 1X43A 1VQOQ 2KY9A 3A8HB 4FT4A 2FPFA 5GAN8 4JJDA 2ZPEB 4A53A 5GAN7 1I81A 2RQWA 3SB2A 2LQNA 4IUTA 2L3SA 2RB6A 1VQPQ 2R57A 4J9IA 3LGFA 2HEQA 1KC8U 5CQXA 5IHKA 1M8VA 4ZN1A 1E7OA 1MGQA 1UJ0A 5FWCA 2FYKA 4M7AG 1S72T 1NYGA 3CBOA 3CC7Q 3ULRB 3UPUA 2Y90A 1B3QA 3O8VA 4M75B 5GMKl 1S1NA 2FRYA 2DFUA 4QT7A 4BY6B 3QSUA 3OBYA 2E1HA 1D0ZA 2Y4YA 3M53A 3M0SA 3G71Q 1UGRB 1KJWA 4FIBA 4M7DG 5D6XA 4DBFA 4C92F 2KT1A 4PFPA 3CCJQ 2KEAA 2D1XA 2W0ZA 3OYLA 2KRMA 3IQLA 3NTIA 2XHCA 2ED1A 2DM1A 2GF7A 4F17A 3CCQA 1K0XA 2NUPA 5GAOn 3MEVA 1U3OA 1VQKT 2ATCB 1B07A 5GAMe 3CCST 3CCRQ 3CC2Q 2ZPFB 1HXDA 1YWPA 1UJYA 1WI7A 2FZCB 2LMJA 2P4RA 1VQ6T 4XU2A 2A7YA 2M0YA 4LD9K 4E2FB 2PVDB 1C1AA 3TEEA 2SRCA 4M77D 2HL5C 3UT1A 2RO0A 2E6ZA 1ZUYA 2YUQA 5CAIA 3MEAA 2CUBA 1VYUA 5L8RE 1I5LA 1X6BA 2HQXA 2DVEA 3BE3A 1OULA 4MZMA 1GFCA 3EGXB 3A5ZB 3CMAQ 1PG5B 4XK8E 2CSQA 1QWEA 2XDDA 5CK9A 1QVGS 3VRZA 2ENMA 2DYBA 2EQMA 5HK0A 4IIOA 5I11A 2DJZA 1RAAB 4J9DA 1F1BB 3M59A 3M55A 2AIRB 1G2BA 3EG3A 4XTZA 1OYXA 1MMAA 2ESWA 5EC7A 5IH2A 2I2LA 2SEMA 4IURA 3FDRA 4E47A 2QGGA 2EYWA 1V1CA 1Y71A 2K57A 4N0AA 3TCJA 3X20B 1D1BA 3PVLA 4PL6A 4M7AF 1AT1B 1YP5A 2DZ9A 1YITQ 2RNAA 1VQ7Q 4FW2A 5FW9A 4AG1C 1MNDA 1RADB 4MMKA 4OMPA 2L89A 5GAN2 4BUGA 4PNOA 4C5HA 3EHQA 4C92E 4L6V5 3C4SA 2OI3A 2QXFA 1Q81U 1TWBA 4D8DA 4M7AB 2HCKA 5CVIA 3I56T 1VQ8T 1WXUA 2CGHA 3ZBDA 4M75C 2FG0A 1UHFA 2QQBA 2J7IA 3X26B 3E19A 3OBWA 2BTTA 1VQMA 4PJOG 3CCUQ 3HP9A 1UG1A 2DL3A 4FYWB 4DQ2A 2QG9B 1HJDA 1N8RR 3H0FA 5FROA 2RMOA 1VQ4Q 4C5EA 3FLGA 3MEUA 5I22A 3QDRB 2EW3A 1YFNA 1Q81C 4QKUA 4DEYA 2CZ6B 2YUOA 3FJ5A 2M0OA 2RI2A 3OW2S 5IXFA 3CCSQ 4J9FA 3CCMT 5GANh 4BI3A 2NUZA 2IG0A 1IRXA 3X24B 4JRIA 2L2PA 1IREB 2ECZA 4LDYA 1YNZA 1EFNA 4J7FA 2KRSA 2QQRA 2A36A 4PJJA 4RTZA 2VXFA 2DPPB 1AD5A 2L3PA 1KHCA 5GANe 5A2QE 2F5TX 2L5QA 4JZ3A 1M90C 1IXDA 4D6WA 4WF2A 2JTFA 2EYYA 4X1VA 3OW2P 1X75C 2F2VA 1BCOA 3CCJA 3RIRA 1NJIC 4JZ4A 2JW4A 3L2UA 5DM7R 2PUKB 4FYXB 1RI9A 2VGMA 1D3BB 4PJOB 1OOTA 4OVAA 3SWNC 2LQ8A 4M77C 2LTOA 4HA8A 3GIBA 4PJMA
chains in the Genus database with same CATH topology
4NL2A 4F7UE 2V8KA 3CCLT 4MDXA 3UWNA 1BI0A 5CQYA 1YITA 1YJNT 2FHDA 3CPWS 3EAEA 3OB9A 1WJSA 2RM4A 5A0GA 4ZGEB 3G71T 4R56A 1VQOT 2VV5A 3OSSC 2VUBA 3QO3A 3V7SA 3CCRT 1W2BA 5GMKh 4BD3A 3CC7T 3GOXA 1D3BA 1TH7A 3OYCA 4J7IA 1M1KU 4KULA 2MI6A 2LC4A 1N6AA 3JCMP 4KUIA 3CCUT 1I8FA 1YJ9T 2KQWA 3L2QA 2K5IA 1Q82C 1XOVA 4ZGJB 2P0PA 1KC8C 2IVWA 3LX7A 4LDUA 3PGGA 4MZPA 4PJOA 2ZCFB 2EFIA 2EQKA 4N4IA 4N4GA 4A4GA 4C92D 2FL7A 3CCJT 2ZPBB 3L42A 2OAUA 3VUZA 3DLLA 1NPPA 3HRUA 4RG8A 5KE3A 4LD6A 3JCMX 4BE0A 3OSVA 1G5VA 4FM4B 5GMKj 5LL6S 1GXIE 3OW2A 1Q7YU 1P92A 1KD1C 2XD0A 3GP8A 3OYEA 4O5VA 4LDVA 4C0DC 4C8QB 3PTAA 4P5NA 2E41A 2RHZA 3CPFA 1YBYA 2QA4A 3CMEA 3M56A 1YJWT 2JOYA 1VIEA 3CCVT 3C94A 5HY6A 1QVPA 3JCMb 4JUVA 2D0QB 3DKMA 4CRIA 4V2SA 2KK4A 4BI8B 3CCRA 3MO8A 1VQ7T 3PMTA 5J26A 1QW1A 4DOWA 5GANf 2K5LA 4HT9A 5GAMg 3CD6A 4M75E 1PSEA 2XK0A 3FRNA 3GNGA 4XTXA 4CI0C 2XDBA 2LDMA 2VYTA 3OYIA 1U1TA 4MZTA 3OYGA 2DTIA 1IZ6A 3P8HA 5C6SA 3CMAA 3CC7A 2V8JA 3QJYA 1ZQ1A 2HNIA 3V8KA 3JB9D 2QDYB 4KBMB 2XG8D 4C8QC 2KAFA 1BI2A 2XDPA 2E64A 3L1AA 3S6WA 3SDZA 3JB9H 2A3LA 2LT1A 4C8QG 4C8QE 4ZN3A 3JB9J 2PVGB 2X35A 1NPRA 1WQ7A 2F69A 3FEOA 3DLMA 1XNIA 3GF5A 3MP8A 3N5BB 5DY9A 3VUBA 2RK1A 3WXMB 4EMGA 3OMCA 2YRVA 4EPCA 4A4FA 1OI1A 2VGNA 3HPWA 5IN1A 4NS5A 2XIDA 1Q7YC 1VQPA 1N8RU 1VQNT 1VQ4A 5DLOA 3OYYA 4KT0E 4M7AC 2DIGA 4XQ3A 1G3TA 2D9TA 3QG1A 4XTWA 3S3NA 5KE2A 5J3BA 1HK9A 3S3OA 1Y96B 3OYAA 1Q86C 1FWZA 5A0DA 5HK3A 2R5MA 4QVZA 3JCMf 1YITT 1YJNA 3PIOA 3V8LA 3JCMc 5LJ3j 2XICA 4RMOA 3M54A 1JBMA 3M57A 4KUDK 2WSCE 4M7DC 2XKOC 3VYHB 3LWHA 4RKUE 1VQMT 1G3YA 1WNLA 1QVGA 2EJFA 4FU6A 5GANg 2F5KA 2ZPIB 3GNFB 3I55T 5IT9E 1KD1U 2E12A 3JB9G 2DD4A 3QZ9B 1VQ7A 3AHUA 1O75A 4M7DE 5M9OA 4GY5A 3RESA 4BACA 5CKHA 4C92G 4O6JA 4XU1A 3CD6T 2JUFA 2K3XA 4M75A 4NOYA 1K73U 4M7AA 3KXTA 3LLRA 5LJ3e 5FRMA 1Y96A 2JVVA 2K5FA 2L8DA 3QJ6A 2RJEA 4B9XA 3CMET 1JJ2S 5CKEA 4C0DB 3CCVA 3JCMd 2DEQA 5GAN5 2B8AA 4RCCA 3URGA 2OTJA 3CCMA 3G4SA 2CZ1B 4PKCC 4OGEA 2LNVA 1WPYA 5CR2A 1M5Q1 2DXBA 4J6WA 3CCET 2QQ9A 3OS2A 2LCCA 3HSBA 4X34A 5FU6C 2DIQA 4XTVA 1LOJA 3JCMg 1YHQT 3ASKA 4MDWA 3NFCA 4XTYA 4YTLA 4JLGA 4F7UB 4A4HA 4ME7A 3G6EA 3SWNB 2QI2A 4OB3B 3JSCA 3A8MB 3CC2A 1H3ZA 3M4YA 1YIJA 5KH6A 5FU7C 3NTKA 4EMKA 2EQJA 3MCAB 2ZPHB 3ER0A 2EIFA 4OF1A 3VKIA 4NL3A 4E7IA 2CYZB 2JNGA 2RHXA 5GAMj 2RD1A 3F70A 3MHXA 3OYKA 3RERA 3ZEHA 3J7AF 5GAOl 2MWOA 3V7RA 2YHTA 3ME9A 2CS7A 1WGSA 3INZA 1N9SA 2AHJB 1VQLT 4OB1B 1EIFA 4JLIA 1K73C 3FC3A 3OS0A 2X4WA 2WSEE 1VUBA 3M9QA 1UGQB 3VYGA 3A8OB 3HRTA 2KY9A 3OYJA 3RMSA 5LJ5e 2FVUA 2E65A 1JB0E 3A8HB 2E10A 4J8OA 4FT4A 4FL6A 3QYHB 5GAN8 2CZ0B 5KCOA 4PLLA 4JRKA 4C92A 2ZPEB 3MP6A 5CKBA 3T9NA 4A53A 1U8RA 3JB9F 3CCSA 5GAN7 1I81A 3SB2A 3JCMW 4HCZA 1KQ1A 4M7DB 4E7LA 3RUXA 2EAYA 4A54A 1UGPB 4ATOA 2K3YA 4IUTA 3OYBA 3OYDA 2RB6A 2R57A 4BI4A 4M75F 3JCMh 2KMTA 3LGFA 1KC8U 4VUBA 5CQXA 2X4YA 4BE2A 2KVQG 4M78A 2O01E 2BKDN 1B34A 4J6YA 1M8VA 4C92B 4ZN1A 3JB9I 1OZ2A 1MGQA 5GANj 2FYKA 4M78G 4M7AG 2RHYA 3CBOA 5HKCA 1S72T 3JRZA 1BIAA 3H8ZA 3UPUA 2JTMA 2Y90A 3O8VA 4M75B 4N4HA 1KQ2A 4RCBA 5GMKl 4PJOD 4M78C 3PNWC 2QA4T 3PIPA 3QUIA 4OP0A 3OYMA 4BY6B 3SFMA 1YIJT 2DKGA 3OBYA 2E1HA 3PMIA 3JCMQ 3QSUA 4M7DA 2MMPA 2Y4YA 3M53A 4L5GA 1M9SA 1UGRB 2XI9A 4M78E 3ZFJA 1BIBA 4FIBA 3L2WA 4BE1A 2HAXA 4HCCA 5I21A 4ELZC 2K2VA 4M7DG 5D6XA 4M77F 4TVRA 4C92F 2C06A 4PJOF 2FB7A 4QW2A 3CCEA 1QP3A 3CXCA 4Y91A 3OYLA 3RKYA 3NTIA 2OTJT 4OGCA 4C92C 4XAXB 2XHCA 2JN0A 2RI3A 2GF7A 3CCQA 3DB4A 3HFOA 5LJ3d 2EKOA 3HFNA 3L2ZA 2P0QA 3MEVA 5GAOn 1VQ5A 1ZBXA 1Q82U 3OMGA 2MWPA 5LJ3h 1VQKT 3JAME 2PUOB 2DO3A 3CCUA 4E7JA 2LQKA 1WQWA 3QZ5B 4J5YA 5FRNA 2HQEA 1YI2A 3I55A 3V7CA 4JRPA 4M7DF 5GAMe 3CCST 1Y7XA 4IKFA 2P4TA 4Q5WA 4C8QA 5GAN6 2DTHA 4QVCA 1RI0A 3RKXA 2DTOA 2ZPFB 1BI1A 1HXDA 1B34B 2BIVA 2GQVA 2RK2A 4EDUA 5A0LA 2LT4A 1WJQA 1VQ9A 4EMKC 2EWNA 2R58A 4QVDA 1VQ6T 4ELYC 3JCMJ 3OQ5A 4XU2A 2A7YA 4LD9K 1DJ7B 3HKSA 5AYFA 1JRIA 1UGSB 1YCYA 3HHTB 3OYNA 1VQLA 2EJGA 2PVDB 2HD0A 4FT2A 1U1SA 3TEEA 3GPLA 4M7AD 1X6OA 3BW1A 1AHJB 3TREA 3PFSA 4M77D 5GAOq 3OY9A 3RMQA 5GAOm 1VQ4T 4X9DA 2EQUA 3E9GA 3UT1A 1UEBA 3FJPA 2RO0A 3J81E 3G7ZA 5DLQE 2E6ZA 4JDSA 3SD4A 2OTLA 1ZHIA 5CAIA 4DOVA 3MEAA 5CIUA 2QEXA 1H641 4OB0B 5L8RE 1KQSS 3BFMA 5GMKm 3G6ET 3CBMA 1I5LA 1NJIU 2HQXA 1W4SA 2LX9A 2DVEA 4II1A 4E7KA 4QQGA 5CCAA 4X9CA 3A8LB 2X4JA 1UB4A 1VQ5T 4MZMA 4M78B 2QQSA 5GAMf 3JCMe 4UC4A 3A5ZB 2P0KA 3P8DA 3I56A 1N27A 3EFRA 3HRSA 3CC2T 4M75D 4PLIA 4XK8E 4XU3A 2XDDA 2G3RA 3FIFA 5CK9A 1QVGS 4LDXA 4ZTJA 2MF2A 2DXUA 2EQMA 1XTDA 5HK0A 1V29B 3QKJA 2LVMA 4MMLA 2DJZA 4Z02A 5LJ3g 3CC4T 1YJWA 1VQ8A 5D6YA 4M77B 1VIFA 3SWNA 2V8IA 4QQ6A 4OMFB 3M59A 3M55A 3A8GB 4IUUA 2ZPGB 5CO7A 1R8OB 1BI3A 1XQHA 2RA2A 4GLKA 2PQWA 4XTZA 5I2SA 3R6OA 1OYXA 2H3JA 4LDWA 1K8AC 3QBYA 3QHSA 3LYIA 3MEWA 2I2LA 2CKKA 4IURA 2QQAA 3FDRA 5FLXE 4E47A 3J80E 2M9UA 3QXEB 1QVFS 2RI5A 3VJPA 1Y71A 2K57A 1QVFA 4N0AA 1K9MU 3NTHA 3TCJA 3KBGA 4DA4A 3M4GA 1N8RC 1G3WA 4M77A 3X20B 1Q86U 3DB3A 4IUQA 1YI2T 4PL6A 1NZ9A 4JRQA 4M7AF 3G4ST 4E7HA 2DZ9A 1G3SA 2M1HA 2ZGWA 4EMHA 2WSFE 1Y07A 3C95A 3P8BB 4MMKA 3L2RA 1BYMA 2L89A 2O4XA 4A4EA 5GAN2 1K8AU 4BUGA 1VQOA 4M77E 4PNOA 4C5HA 4M78F 4ZGDB 4C92E 4XU0A 2RHIA 4L6V5 5FU6B 3C4SA 2QXFA 5D6WA 1Q81U 1LJOA 2E6NA 1M1GA 3LGLA 1N9RA 4XTUA 1VQPT 4M7AB 1VQNA 5GAOp 2L3RA 5CVIA 3I56T 2LCLA 3M58A 4B9WA 1OZ3A 4J6XA 1M4ZA 4M75G 2QTXA 3LWIA 1VQ8T 3CC4A 2PVOB 5GAMh 2YLBA 4L59A 2KSSA 2CGHA 5LJ5d 4M7DD 3KUFA 4JS4A 2M16A 3ZBDA 4M75C 1O9SA 1KHIA 2GFAA 3QIIA 1NE8A 2O4XB 2QQBA 5I2MA 3X28B 2OTLT 3CMAT 2YLCA 4BY6C 3X26B 4HT8A 3E19A 1LNXA 2RHUA 2DK3A 2Y4XA 3OBWA 4BB7A 1VQMA 1VQKA 4JS5A 1K9MC 4QQDA 1MHNA 4PJOG 4A4KA 5LJ5j 3HP9A 3OS5A 2EJ9A 4M78D 4DQ2A 3CCQT 4PJOC 1PSFA 2HBPA 5EG2A 4Y28E 2DAQA 3BDLA 4C0ZA 5CKDA 5GAN4 4RG2A 2MAMA 5FROA 2RJDA 5LJ5h 3V8JA 1QP2A 4PJOE 4C8QF 3WVDB 3H6ZA 1YHQA 3OYFA 4HCBA 4C0GA 4C5EA 3FLGA 2EYQA 3MEUA 2GCXA 1VQ9T 3QPHA 1M1FA 2RH2A 3HL8A 3QDRB 1FX7A 3OS1A 2E5QA 5KCHA 4C8QD 1Q81C 2VXEA 2BUDA 3M5AA 4FSXA 4JJNK 5GAN3 2DD5A 2CZ6B 5CKFA 2M0OA 3EFSA 2RI2A 3OW2S 3LH0A 4BDYA 1X01A 2JZ2A 2NLUA 3CCMT 5GANh 4BI3A 2DXTA 1FXXA 2IG0A 1RL2A 3JCMV 1BKBA 3PT9A 5FU7B 3X24B 4JRIA 3MP1A 2X4XA 5GAOr 3VV0A 1IREB 4F7UA 5GMKe 4LDYA 2WACA 2CZ7B 3LW5E 2DXCA 1M1KC 3RKWA 4F7UF 3QYGB 1W2BS 1YJ9A 3E9FA 2DZCA 2VC8A 3G71A 4J7FA 4ZTFA 2QQRA 3CEYA 4IUVA 4R55A 3FB9A 2RJCA 2VXFA 5J39A 3CPWA 2DPPB 4IUPA 4OB2B 1WJRA 1KHCA 3VU3C 5GANe 3OA6A 5A2QE 2E70A 3OYHA 1M90U 5IAYA 3S3MA 2F5TX 2L5QA 2PU9B 1M90C 3CBPA 3META 3UDCA 4D6WA 4BDZA 1I4K1 4WF2A 3TU4K 1VQ6A 2GFUA 2JTFA 3L2VA 2D6FA 2RJFA 3E1SA 3CCLA 2KDSA 3Q1JA 2K4YA 1X75C 3C12A 3GLXA 3CCJA 3X25B 3RIRA 5C0MA 1NJIC 1KG1A 5GANd 4J83A 4HKEA 4C5IA 3L2UA 2QEXT 1SSFA 5DM7R 2PUKB 5LJ3f 4C5GA 5LJ5f 3BY7A 1KQSA 5GAMd 3BDUA 2R5AA 4M77G 2VGMA 1D3BB 1S72A 4PJOB 3CXCS 3WVEB 4OVAA 3SWNC 2LQ8A 4M77C 2LRQA 2LTOA 4HA8A 2ZZDA 3GIBA 1JJ2A 2XU8A 4N0AC 4F7UG 4M7AE 5GMKi 4EMKB 4C0FA 5LJ5g
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL2 A;  5LJ3 d;  3HFN A;  3L2Z A;  5GAO n;  1LJO A;  4XU1 A;  4C92 G;  4F7U E;  4M75 A;  1N9R A;  4NOY A;  4XTU A;  4M7A B;  5LJ3 h;  5GAO p;  5LJ3 e;  4M7A A;  1Y96 A;  2RM4 A;  4J6X A;  4M75 G;  2QTX A;  1WQW A;  4J5Y A;  5GAM h;  2YLB A;  3JCM d;  2DEQ A;  2CGH A;  3V7C A;  4RCC A;  5LJ5 d;  5GAM e;  5GAN 5;  4M7D D;  4M7D F;  4M75 C;  3QO3 A;  3V7S A;  5GMK h;  4C8Q A;  2YLC A;  5GAN 6;  4HT8 A;  1D3B A;  2DTH A;  1TH7 A;  1LNX A;  3RKX A;  4QVC A;  2DTO A;  1WPY A;  1M5Q 1;  1HXD A;  1B34 B;  4J6W A;  3JCM P;  4PJO G;  5LJ5 j;  1I8F A;  3HSB A;  2EJ9 A;  4EMK C;  2EWN A;  4XTV A;  4QVD A;  4M78 D;  3JCM J;  4DQ2 A;  1LOJ A;  3JCM g;  4XU2 A;  4XTY A;  4PJO C;  4F7U B;  1JRI A;  1YCY A;  3SWN B;  2EJG A;  5GAN 4;  3PGG A;  4PJO A;  1U1S A;  5LJ5 h;  3V8J A;  4C92 D;  4M7A D;  3BW1 A;  4PJO E;  4C8Q F;  4EMK A;  4M77 D;  5GAO q;  4NL3 A;  5GAO m;  4X9D A;  3JCM X;  5GAM j;  3FJP A;  2RD1 A;  5GMK j;  3RER A;  5CAI A;  5GAO l;  3V7R A;  1H64 1;  2YHT A;  4C8Q D;  4C8Q B;  3BFM A;  2VXE A;  2E41 A;  1N9S A;  3INZ A;  5GMK m;  5GAN 3;  4JLI A;  1I5L A;  2DVE A;  3EFS A;  4X9C A;  3JCM b;  4JUV A;  4M78 B;  1X01 A;  4V2S A;  5GAM f;  5LJ5 e;  5GAN h;  3JCM e;  2E65 A;  2DXT A;  3JCM V;  2E10 A;  3EFR A;  5GAN f;  4JRI A;  4M75 D;  4HT9 A;  5GAM g;  4XU3 A;  5GAN 8;  5GAO r;  3FIF A;  4M75 E;  4JRK A;  4C92 A;  4F7U A;  5GMK e;  4XTX A;  4A53 A;  2DXU A;  3JB9 F;  5GAN 7;  1I81 A;  3RKW A;  3SB2 A;  4F7U F;  3JCM W;  1U1T A;  2DTI A;  4MML A;  2DJZ A;  1KQ1 A;  5LJ3 g;  4M7D B;  3RUX A;  2DZC A;  2HNI A;  3V8K A;  2EAY A;  2VC8 A;  4M77 B;  4A54 A;  4C8Q C;  3JB9 D;  3SWN A;  2RB6 A;  3FB9 A;  2VXF A;  4M75 F;  2E64 A;  3L1A A;  3JCM h;  3JB9 H;  4C8Q G;  4C8Q E;  3VU3 C;  5GAN e;  2RA2 A;  3JB9 J;  4XTZ A;  1WQ7 A;  4M78 A;  5DY9 A;  1B34 A;  3QHS A;  4J6Y A;  4EMG A;  1M8V A;  2I2L A;  4C92 B;  3JB9 I;  1MGQ A;  1I4K 1;  4WF2 A;  2FYK A;  5GAN j;  4M78 G;  4M7A G;  1BIA A;  2K57 A;  2Y90 A;  1KQ2 A;  4M75 B;  4N0A A;  4PJO D;  4RCB A;  5GMK i;  5GMK l;  4M78 C;  4M7A C;  3M4G A;  4XQ3 A;  3QUI A;  4OP0 A;  4M77 A;  2DKG A;  3RIR A;  2E1H A;  4XTW A;  3JCM Q;  3QSU A;  4M7D A;  1HK9 A;  5GAN d;  1Y96 B;  4M78 E;  4M7A F;  1BIB A;  5I21 A;  2DZ9 A;  5LJ3 f;  5LJ5 f;  4M7D G;  3BY7 A;  3JCM f;  2ZGW A;  4M77 F;  5GAM d;  3BDU A;  4EMH A;  3V8L A;  4M77 G;  3JCM c;  5LJ3 j;  4C92 F;  4PJO F;  1D3B B;  2FB7 A;  1JBM A;  4PJO B;  4MMK A;  4M7D C;  4Y91 A;  5GAN 2;  1WNL A;  4M77 C;  2EJF A;  3RKY A;  3SWN C;  5GAN g;  4HA8 A;  3GIB A;  4M77 E;  4C92 C;  4PNO A;  3JB9 G;  2JN0 A;  4M78 F;  4N0A C;  4C92 E;  4F7U G;  3AHU A;  4XU0 A;  4EMK B;  4M7A E;  5LJ5 g;  4M7D E;  3HFO A;  3RES A; 
#chains in the Genus database with same CATH topology
 2ROT A;  1KIK A;  1YJN T;  4DBH A;  3EAE A;  1WJS A;  5A0G A;  1VYV A;  2GNC A;  3G71 T;  1VQO T;  2VV5 A;  1W2B A;  1D3B A;  3TQ7 P;  4KUL A;  2LC4 A;  1M90 R;  1N6A A;  1ZLM A;  1OX9 A;  3THK A;  3CCV Q;  2Z0W A;  3L2Q A;  1Q82 C;  2P0P A;  4LN2 A;  4LDU A;  3PGG A;  4PJO A;  4N4G A;  2EQK A;  4N4I A;  4A4G A;  2FL7 A;  1KQS P;  2OAU A;  3DLL A;  5KE3 A;  2DNU A;  2QDL A;  3OW2 A;  1KD1 C;  4C8Q B;  2H8H A;  1YBY A;  3M56 A;  5FWB A;  3C94 A;  3DKM A;  2VB6 A;  3CCR A;  1QW1 A;  1M27 C;  5GAN f;  2K5L A;  5GAM g;  1W6X A;  3GNG A;  1CSK A;  2XDB A;  2CP2 A;  1T0H A;  2LDM A;  1U1T A;  4EIK A;  1NLO C;  1I07 A;  2CH4 A;  2HNI A;  2QDY B;  1UHC A;  2XG8 D;  4KBM B;  4C8Q C;  2E64 A;  1CKB A;  4C8Q E;  2DF6 A;  3JB9 J;  3FEO A;  3N5B B;  3GF5 A;  3I55 A;  5DY9 A;  2B86 A;  3WXM B;  3OMC A;  4EPC A;  4A4F A;  2VGN A;  2XID A;  1TSF A;  1FMK A;  1VQN T;  1HD3 A;  1U5S A;  2A37 A;  3OYY A;  4KT0 E;  4XQ3 A;  2D9T A;  2LJ3 A;  3QG1 A;  2NUT A;  5KE2 A;  3CC4 Q;  1HK9 A;  2OJ2 A;  2RN8 A;  3MJX A;  2R5M A;  3JCM f;  1YJN A;  5LJ3 j;  3JCM c;  4RMO A;  2COY A;  2DBK A;  3M54 A;  4J9G A;  2KYM A;  2L3Q A;  4RKU E;  2EJF A;  5GAN g;  3GNF B;  1KD1 U;  3JB9 G;  2DD4 A;  2HBW A;  4OMN A;  4C92 G;  1BBZ A;  4XU1 A;  4M75 A;  1UFF A;  1NYF A;  1Y96 A;  2K5F A;  2L8D A;  2DEQ A;  4RCC A;  3H41 A;  5KYX A;  4OGE A;  1WPY A;  5CR2 A;  1VQ6 Q;  1LOJ A;  3JCM g;  1YHQ T;  4XTY A;  1K9A A;  4YTL A;  4F7U B;  2DE0 X;  1M3B A;  2QI2 A;  3A8M B;  5FU7 C;  3MCA B;  3VKI A;  4NL3 A;  5GAM j;  2RHX A;  1IHV A;  3RER A;  3ZEH A;  1UDL A;  2MWO A;  4M4Z A;  1WGS A;  1VQL T;  1VQK Q;  4HXJ A;  4OB1 B;  1EIF A;  3A8O B;  1AZG B;  3HRT A;  3OYJ A;  4R0K A;  2E65 A;  1W2B P;  1JB0 E;  3EG9 B;  2E10 A;  2CRE A;  3QYH B;  2CZ0 B;  4PLL A;  4JRK A;  3MP6 A;  3T9N A;  2K79 A;  1U8R A;  3CCS A;  2DMO A;  5L23 A;  1YCS B;  4HCZ A;  1KQ1 A;  3RUX A;  3JCM h;  4IIM A;  4VUB A;  2ZAE A;  2DA9 A;  2BKD N;  2KNB B;  2AKL A;  2X9H A;  2RHY A;  1I5O B;  3JRZ A;  2JTM A;  1E6G A;  4PJO D;  4E7Z A;  1PCX A;  4RCB A;  4M78 C;  3OYM A;  3QUI A;  4OP0 A;  1YIJ T;  2DKG A;  3JCM Q;  3PMI A;  2MMP A;  1ACM B;  3VS1 A;  4M78 E;  3ZFJ A;  1BIB A;  4HCC A;  5I21 A;  2K2V A;  4TVR A;  5KYW A;  4QW2 A;  1QMC A;  4Y91 A;  2EYZ A;  2H3E B;  4OGC A;  1NBE B;  4C92 C;  4XAX B;  5LJ3 d;  3HFN A;  2CT3 A;  5LJ3 h;  3EGX A;  2PUO B;  2LQK A;  2E4H A;  5FRN A;  2HQE A;  4KRT A;  2C0O A;  3V7C A;  2JMA A;  4M7D F;  1T3L A;  4IKF A;  2FPE A;  2RPN A;  4Q5W A;  4C8Q A;  3UF4 A;  3RKX A;  2BIV A;  1B7T A;  1VQM Q;  2LJ1 A;  2LT4 A;  1WJQ A;  2MOX A;  1VQ9 A;  4EMK C;  2AZS A;  1Q86 R;  3JCM J;  3OQ5 A;  1DJ7 B;  5AYF A;  1JRI A;  3HHT B;  2EJG A;  2O9S A;  4M7A D;  3BW1 A;  2F1L A;  1AHJ B;  4HVU A;  3OY9 A;  2JM8 A;  5GAO q;  1UE9 A;  2EQU A;  2DLP A;  3E9G A;  1UEB A;  1OPL A;  3J81 E;  3G7Z A;  5DLQ E;  4JDS A;  3SD4 A;  2OTL A;  1ZHI A;  2CP5 A;  3VS6 A;  4OB0 B;  3G6E T;  3CBM A;  2DL5 A;  4QQG A;  3JCM e;  1IB8 A;  2RQU A;  1N27 A;  2GTJ A;  3HRS A;  4F04 B;  2G3R A;  3FIF A;  4LDX A;  1Z9Z A;  1QQJ A;  1W1F A;  4AFS C;  1V29 B;  4PJN A;  2LVM A;  4MML A;  3CC4 T;  1PNJ A;  5D6Y A;  4M77 B;  3SWN A;  4QQ6 A;  4OMF B;  3C0C A;  1R8O B;  4CC3 A;  5I2S A;  4J9E A;  3R6O A;  1K8A C;  2P84 A;  3MEW A;  2CH4 W;  2CKK A;  2ROL A;  3LYI A;  2QQA A;  1SRL A;  2M9U A;  1QVF A;  1K9M U;  1ZX6 A;  3KBG A;  3M4G A;  4M77 A;  3GBQ A;  3DB3 A;  4IUQ A;  2YT6 A;  4EMH A;  3C95 A;  3P8B B;  2O4X A;  2FRW A;  2KI7 A;  2J6F A;  4XU0 A;  2RHI A;  1UUE A;  1LJO A;  2E6N A;  1M1G A;  2CUD A;  1VQN A;  2L3R A;  2YXY A;  3M58 A;  4B9W A;  4J6X A;  1R0C B;  4M75 G;  3LWI A;  2PVO B;  1RAH B;  3KUF A;  2M16 A;  1O9S A;  1KHI A;  1MV0 B;  2DET A;  2YLC A;  4HT8 A;  1LNX A;  3EGD A;  1K9M C;  4QQD A;  4A4K A;  4M78 D;  2HAX A;  2HBP A;  3BDL A;  5GAN 4;  2RJD A;  5LJ5 h;  3WVD B;  3EFO B;  2EGE A;  4F16 A;  2V1Q A;  2EYQ A;  3QPH A;  2RH2 A;  4E7S A;  1FX7 A;  2QYZ A;  2E5Q A;  3CD6 Q;  1YJN Q;  4FSX A;  3M0Q A;  4JJN K;  3TSZ A;  2DD5 A;  4Z89 A;  1WHM A;  2MIO A;  1LCK A;  1VQ5 Q;  1Q81 R;  2XMF A;  3PT9 A;  5FU7 B;  1QVG P;  4FCY A;  2HDA A;  5IHI A;  3TSW A;  1I0C A;  2DZC A;  2QK0 A;  5J39 A;  4IUP A;  1EZZ B;  4OB2 B;  1WJR A;  1SRM A;  3OYH A;  3S3M A;  2KT8 A;  3CBP A;  3M0P A;  1I4K 1;  2D6F A;  3RDV A;  3CCL A;  2DX1 A;  2K4Y A;  2FEI A;  1VYT A;  3C12 A;  3GLX A;  4AT1 B;  1PD0 A;  1KG1 A;  5GAN d;  1M3C A;  2QEX Q;  5LJ3 f;  5LJ5 f;  4M77 G;  1WXB A;  2YSQ A;  2YRD A;  3CXC S;  6AT1 B;  1WX6 A;  2LRQ A;  2ZZD A;  4N0A C;  4C0F A;  2DER A;  1ZSZ A;  4F7U E;  2V8K A;  2BZY A;  3UWN A;  3CCL Q;  2FHD A;  3CPW S;  1T0J A;  2F2W A;  1X2K A;  1SKU B;  4R56 A;  3OSS C;  2HKQ B;  2M02 A;  3QO3 A;  3EFO A;  4KH0 B;  2EBP A;  3OYC A;  1Q82 R;  1Q95 G;  1H92 A;  2KQW A;  4J9B A;  1PM3 A;  3G4S Q;  1KC8 C;  1YN8 A;  2EFI A;  4LUE A;  3SEM A;  3VUZ A;  5D7U A;  1NPP A;  4RG8 A;  4LD6 A;  2XD0 A;  4KGZ B;  4C0D C;  3PTA A;  4P5N A;  2E41 A;  2RHZ A;  5IXB A;  3EHR A;  1QVP A;  3JCM b;  4CRI A;  4RTV A;  4K11 A;  3PMT A;  5J26 A;  3CQT A;  5KYY A;  2NUP B;  4AFQ C;  4M75 E;  1PSE A;  3I35 A;  2A28 A;  3FRN A;  2D0N A;  2DTI A;  1IZ6 A;  2EGA A;  3EGU A;  3CC7 A;  2V8J A;  3QJY A;  5KYU A;  3JB9 D;  2BZX A;  1TU0 B;  3SDZ A;  2A3L A;  1IHW A;  1NPR A;  3MP8 A;  3VUB A;  5KYN A;  1VQ9 Q;  2OX7 A;  2E5K A;  1OI1 A;  4NS5 A;  4CC4 B;  5DLO A;  1X27 A;  2DIG A;  4XTW A;  3S3N A;  4Y92 A;  3S3O A;  1Q7Y R;  1IGQ A;  1Q86 C;  3CCM Q;  1JO8 A;  4QVZ A;  3V8L A;  1MMD A;  2DJQ A;  3VYH B;  1G3Y A;  4FU6 A;  2ZPI B;  2E12 A;  3QZ9 B;  1YHQ Q;  1RLP C;  5FRM A;  2JVV A;  1ZSG A;  3QJ6 A;  4B9X A;  3CPW P;  2JTE A;  4RTW A;  5CKE A;  5GAN 5;  2B8A A;  3URG A;  2OTJ A;  1AWO A;  2CZ1 B;  2NYS A;  1ZA2 B;  2AT1 B;  2LNV A;  3QWX X;  8AT1 B;  2DXB A;  3OS2 A;  2LCC A;  3HSB A;  4XTV A;  3NFC A;  4JLG A;  4A4H A;  2LJ0 A;  1H3Z A;  3CC2 A;  1ARK A;  1YIJ A;  3NTK A;  2KGT A;  1WLP B;  3NHN A;  2EIF A;  4OF1 A;  2JNG A;  4WCI A;  3F70 A;  3OYK A;  1RAI B;  5GAO l;  2JM9 A;  1N9S A;  2AHJ B;  4JLI A;  4RTX A;  3CME Q;  1UTI A;  3VYG A;  1M3A A;  3D7S B;  3RMS A;  5LJ5 e;  2D8H A;  4CC7 A;  5CKB A;  3JB9 F;  1FMW A;  3I55 Q;  3JCM W;  4M7D B;  4E7L A;  4A54 A;  1UGP B;  4ATO A;  3OYB A;  3OYD A;  2GGR A;  3EH1 A;  2KMT A;  2EGC A;  2DRM A;  2MPX C;  2X4Y A;  2J6O A;  2O01 E;  2HZY A;  4C92 B;  3JB9 I;  1OZ2 A;  1RAC B;  4M78 G;  2YWW A;  1BIA A;  2YDL A;  1A0N B;  4D8K A;  2JT4 A;  1SEM A;  2DRK A;  2QA4 T;  3PIP A;  1WFW A;  1J3T A;  1YI2 Q;  2GTO A;  4M7D A;  4L5G A;  3L2W A;  4BE1 A;  4ELZ C;  4M77 F;  2L0A A;  2RF0 A;  2C06 A;  2FB7 A;  4RTT A;  1QP3 A;  2PTK A;  3RKY A;  2OTJ T;  2A08 A;  1RAE B;  1R77 A;  1MMN A;  3HFO A;  1VQ5 A;  2EKO A;  3L2Z A;  2P0Q A;  1Q82 U;  1VQN Q;  3JAM E;  3CCU A;  2DO3 A;  1WQW A;  1WHL A;  3M0U A;  1Y7X A;  5ECA A;  3VS3 A;  1IO6 A;  4ESR A;  1JU5 C;  2DTO A;  1BI1 A;  1UGV A;  1B34 B;  1WYX A;  5A0L A;  2R58 A;  4QVD A;  4ELY C;  1PKS A;  1GBR A;  1C0M A;  2G6F X;  3HKS A;  1AEY A;  1YCY A;  3OYN A;  4A63 B;  4FT2 A;  2HD0 A;  3TRE A;  3RMQ A;  4X9D A;  1BB9 A;  3FJP A;  1FMV A;  4ANJ A;  4KH1 B;  2QEX A;  1H64 1;  2HSE B;  1KQS S;  5GMK m;  1K73 R;  1NJI U;  2LX9 A;  1BCM A;  2HQH A;  5CCA A;  4X9C A;  2X4J A;  1UB4 A;  4M78 B;  2QQS A;  5GAM f;  2FPD A;  2KXC A;  1AWX A;  2P0K A;  3VS7 A;  1MV3 A;  3EFR A;  2PZ1 A;  4RTY A;  4XU3 A;  1WXT A;  2DXU A;  1XTD A;  1BU1 A;  1YJW A;  5LJ3 g;  4RUG A;  1VIF A;  2BE7 D;  4IUU A;  2ZPG B;  5CO7 A;  4LNP A;  2RA2 A;  4GLK A;  4FYY B;  4LDW A;  3QBY A;  3VS0 A;  3J80 E;  2PNI A;  1QVF S;  3QXE B;  3VJP A;  2BE9 B;  4DA4 A;  2V1R A;  2DYI A;  1Q86 U;  1YI2 T;  1UEC A;  1TOV A;  4E7H A;  2M1H A;  2C0I A;  2CP3 A;  2KR3 A;  1BYM A;  1K8A U;  4A4E A;  3M0R A;  2FZK B;  4M77 E;  3KFV A;  4M78 F;  4ZGD B;  2X3W D;  5D6W A;  4FW1 A;  1KSW A;  3EGD B;  1OZ3 A;  2M51 A;  3CC4 A;  5GAM h;  4L59 A;  5LJ5 d;  1MMG A;  2GFA A;  2O4X B;  5I2M A;  3X28 B;  2OTL T;  3H9N A;  3R6N A;  4JS5 A;  3HTR A;  1Z9Q A;  1NLP C;  3RBB B;  2EJ9 A;  5EG2 A;  4Y28 E;  2DAQ A;  4C0Z A;  4FYV B;  1MUZ A;  3V8J A;  1QP2 A;  4C8Q F;  2K6D A;  2GCX A;  1VQ9 T;  1M1F A;  3HL8 A;  1K1Z A;  5KCH A;  4C8Q D;  2VXE A;  3M5A A;  1RUW A;  2RQT A;  5CKF A;  2VWF A;  3LH0 A;  2NLU A;  3MP1 A;  2X4X A;  5GAO r;  3CCE Q;  3VV0 A;  4F7U A;  5GMK e;  2WAC A;  2CZ7 B;  3LW5 E;  1OU8 A;  2BZ8 A;  2DXC A;  3RKW A;  1M1K C;  1YJ9 A;  2LCS A;  2O2O A;  2VC8 A;  3TVT A;  5IHN A;  1AOJ A;  3VS2 A;  3CEY A;  4ZTF A;  3ZL7 C;  3A1P A;  4IUV A;  2RJC A;  3CPW A;  3H0I A;  1XJW B;  2E70 A;  4OML A;  4KGV B;  1JXM A;  2PU9 B;  3MET A;  4BDZ A;  2COZ A;  1VQ6 A;  2GFU A;  4RTU A;  3EG9 A;  2KDS A;  3Q1J A;  2E3I A;  2VVK A;  1YIJ Q;  1FYN A;  2RQV A;  1PRL C;  2CP7 A;  3O5Z A;  4LXC A;  2KRO A;  2QEX T;  1SSF A;  2LQW A;  1QKW A;  4C5G A;  2EVR A;  5GAM d;  1OV3 A;  1ABQ A;  3BDU A;  2R5A A;  1S72 A;  1OPK A;  1W70 A;  2CP0 A;  4NL2 A;  2COW A;  5HCK A;  1RAF B;  1BI0 A;  5CQY A;  1YIT A;  3G1J A;  1QCN A;  2RM4 A;  4ZGE B;  1RAG B;  2VUB A;  3CCR T;  3CC7 T;  3GOX A;  2JXB A;  1M1K U;  1OX8 A;  5AT1 B;  1AVZ C;  4KUI A;  3CCU T;  3REB B;  1I8F A;  4GBQ A;  4B6M A;  2DL7 A;  1H8K A;  1D1C A;  2RQR A;  4ZGJ B;  3UA7 A;  2HMA A;  4AG2 C;  2DIL A;  2ZPB B;  3L42 A;  3JCM X;  3CXC P;  3RR6 A;  4BE0 A;  1M2V B;  1G5V A;  4FM4 B;  5GMK j;  2A0F B;  5LL6 S;  1TUC A;  2CDT A;  1Q7Y U;  1P92 A;  3OYE A;  4O5V A;  4LDV A;  1SPK A;  3CPF A;  3CME A;  1X69 A;  1QCF A;  1VIE A;  2DL8 A;  3NMZ C;  1VQ7 T;  1GCQ C;  2AKK A;  3CD6 A;  2XK0 A;  2VYT A;  3OYG A;  5C6S A;  1BK2 A;  1ZBJ A;  3V8K A;  2KAF A;  3RNJ A;  3S6W A;  2LT1 A;  1JXO A;  4ZN3 A;  1VQ8 Q;  2PVG B;  2X35 A;  1WQ7 A;  3OYF A;  1XNI A;  3EH2 A;  3EG0 A;  2YRV A;  3HPW A;  4JJC A;  5IN1 A;  1Q7Y C;  1AZE A;  1VQP A;  1VQ4 A;  3REA B;  1D1A A;  2KXD A;  1Y96 B;  3OYA A;  1FWZ A;  1HYO A;  1Y0M A;  5HK3 A;  4ORZ A;  2FZG B;  1YIT T;  1JBM A;  3M57 A;  4KUD K;  1K9M R;  1H3H A;  2LX7 A;  2XKO C;  1QVG A;  1WNL A;  2F5K A;  3I55 T;  1O75 A;  3RES A;  4BAC A;  5CKH A;  1M2O A;  4O6J A;  2JUF A;  3KXT A;  5LJ3 e;  2NUT B;  1JJ2 S;  3CCV A;  3CCM A;  2CP6 A;  1VOM A;  4GLM A;  1LVK A;  4AMC A;  2QAS A;  3LH5 A;  4J6W A;  2MK5 A;  3UA6 A;  3QDF A;  1SG5 A;  4OMO A;  1TXQ A;  1K0S A;  1SF9 A;  3JSC A;  1M30 A;  3M4Y A;  5KH6 A;  4CC2 A;  4EMK A;  2EQJ A;  2HKN A;  4E7I A;  2RD1 A;  3MHX A;  1GFD A;  3JV3 A;  4OMQ A;  3V7R A;  2CS7 A;  3INZ A;  1MNE A;  2X4W A;  2WSE E;  1UGQ B;  4Z8A A;  1PD1 A;  1KFZ A;  2FVU A;  2OTL Q;  4J8O A;  1TUG B;  4FL6 A;  2KYB A;  5KCO A;  4C92 A;  1EX4 A;  1TTH B;  1JJ2 P;  4PJL A;  1KD1 R;  2EAY A;  2K3Y A;  1PWT A;  4BI4 A;  4M75 F;  4BE2 A;  1ZUU A;  2KVQ G;  1JEG A;  4M78 A;  1B34 A;  4J6Y A;  1Y57 A;  5GAN j;  5HKC A;  4FSS A;  3H8Z A;  1K4U S;  4KGX B;  1KQ2 A;  4N4H A;  3PNW C;  2LP5 A;  3SFM A;  2GBQ A;  1M9S A;  2XI9 A;  2KBT A;  2VAS A;  4PJO F;  2MCN A;  3CCE A;  3CXC A;  1NJI R;  1HSQ A;  1G8X A;  1ZSZ C;  2AZV A;  2JN0 A;  2RI3 A;  3PE0 A;  4DBQ A;  1D09 B;  3DB4 A;  1S72 Q;  8ATC B;  2O9V A;  1ZBX A;  3OMG A;  2MWP A;  4E7J A;  1TUD A;  1GCQ A;  1D0Y A;  3QZ5 B;  4J5Y A;  1YI2 A;  4PFO A;  4LUD A;  4JRP A;  2P4T A;  1WZO A;  5GAN 6;  5KYX B;  2DTH A;  4QVC A;  1RI0 A;  1IGU A;  4F14 A;  2GQV A;  2RK2 A;  4EDU A;  1VA7 A;  3M0T A;  2EWN A;  1K76 A;  2QTV A;  1UGS B;  1VQL A;  1U1S A;  1WHG A;  4J9C A;  3GPL A;  1X6O A;  1TS9 A;  3PFS A;  5GAO m;  1VQ4 T;  1WDX A;  1X2Q A;  1TG0 A;  2YUN A;  4DOV A;  3QWY A;  5CIU A;  2D8J A;  1YWO A;  3BFM A;  1W4S A;  4E7K A;  4II1 A;  1D0X A;  1WHK A;  1PC0 A;  3A8L B;  1VQ5 T;  3AT1 B;  1GBQ A;  3UAT A;  4UC4 A;  3NGP A;  3P8D A;  3I56 A;  3CC2 T;  4M75 D;  4PLI A;  1NG2 A;  2CSI A;  4ZTJ A;  2MF2 A;  1WHH A;  3MKD A;  3QKJ A;  4Z02 A;  1VQ8 A;  2V26 A;  1NEG A;  2V8I A;  3A8G B;  1BI3 A;  2X3X D;  1XQH A;  2PQW A;  2QAZ A;  2H3J A;  3U23 A;  3QHS A;  2MYS A;  5FLX E;  2RI5 A;  2QGF B;  3NTH A;  1N8R C;  2QA4 Q;  1G3W A;  1NZ9 A;  4JRQ A;  3G4S T;  1G3S A;  1WA7 A;  2ZGW A;  2JS2 A;  2WSF E;  1Y07 A;  2HSP A;  1U06 A;  1RAB B;  3L2R A;  1NEB A;  2EYX A;  1VQO A;  3CCQ Q;  5FU6 B;  2K7A A;  3I5S A;  3LGL A;  1N9R A;  4XTU A;  1VQP T;  5GAO p;  2LCL A;  5GJV B;  1ZA1 B;  1M4Z A;  2QTX A;  2HL3 A;  2YLB A;  2KSS A;  2EPD A;  7AT1 B;  4M7D D;  4JS4 A;  1I1J A;  3QII A;  1NE8 A;  4LE9 A;  3CMA T;  4BY6 C;  2RHU A;  2DK3 A;  2I0N A;  2Y4X A;  4BB7 A;  3G6E Q;  3PVQ A;  1VQK A;  5LJ5 j;  1MHN A;  3OS5 A;  3CCQ T;  4PJO C;  1PSF A;  5CKD A;  4RG2 A;  2MAM A;  2ABL A;  2YUP A;  4PJO E;  4J9H A;  3H6Z A;  4HCB A;  4C0G A;  2NWM A;  4OMM A;  1X6G A;  2K3B A;  1N5Z A;  3OS1 A;  2DEU A;  2BUD A;  1WHJ A;  5GAN 3;  2VKN A;  3EFS A;  4BDY A;  1X01 A;  2CT4 A;  2JZ2 A;  3VS5 A;  2DXT A;  1C6V X;  1FXX A;  3JCM V;  1RL2 A;  1BKB A;  5KYY B;  1K8A R;  1QCO A;  2W10 A;  3A98 A;  1QLY A;  4F7U F;  1SHF A;  3QYG B;  1W2B S;  3E9F A;  3G71 A;  4R55 A;  3FB9 A;  1QWF A;  2C0T A;  3OA6 A;  2KRN A;  3EG1 A;  3VU3 C;  1M90 U;  3EG2 A;  4AFZ C;  4HVW A;  5IAY A;  1T3S A;  2O31 A;  2YRC A;  3UDC A;  2IIM A;  3TU4 K;  3L2V A;  2RJF A;  3E1S A;  2GQI A;  4DBR A;  1KC8 R;  3H0H A;  2DL4 A;  3X25 B;  5C0M A;  2X51 A;  4J83 A;  4HKE A;  4C5I A;  3BY7 A;  1KQS A;  1R0B G;  1SSH A;  3VS4 A;  3WVE B;  1QVF P;  2OTJ Q;  1JJ2 A;  2XU8 A;  4PFZ A;  4JPB W;  4F7U G;  4M7A E;  5GMK i;  4EMK B;  1YHQ A;  5LJ5 g;  3VRY A;  3CCL T;  4MDX A;  2LNH B;  1OEB A;  2K9G A;  3OB9 A;  2EQI A;  2J06 A;  2LZ6 B;  1GL5 A;  3SHW A;  1OU9 A;  3V7S A;  5GMK h;  4BD3 A;  1RLQ C;  4HVV A;  1AWW A;  1TH7 A;  1E6H A;  4DEX A;  4J7I A;  2MI6 A;  1VQL Q;  2JS0 A;  3JCM P;  1ZSZ B;  1YJ9 T;  1CKA A;  2F2X A;  2K5I A;  1XOV A;  2IVW A;  3LX7 A;  4MZP A;  2ZCF B;  4C92 D;  2FO0 A;  3CCJ T;  3I9Q A;  3HRU A;  1AWJ A;  3OSV A;  1GXI E;  3I5R A;  4ZNX A;  3GP8 A;  3NPF A;  1SHG A;  4JJB A;  1V76 A;  2QA4 A;  1YJW T;  2JOY A;  3CCV T;  1YJ9 Q;  5HY6 A;  1M2V A;  2OAW A;  4JUV A;  2D0Q B;  4PK4 A;  4V2S A;  2KK4 A;  4BI8 B;  1G83 A;  3MO8 A;  1PHT A;  4Z88 A;  4DOW A;  4HT9 A;  2KE9 A;  5KYU B;  2J05 A;  4XTX A;  4CI0 C;  3OYI A;  4MZT A;  2E3H A;  3P8H A;  1KK7 A;  3CMA A;  1JQQ A;  1ZQ1 A;  2O88 A;  2DVJ A;  1LPL A;  2IPO B;  1BI2 A;  1M8M A;  2XDP A;  3L1A A;  2JJ9 A;  4E6R A;  3JB9 H;  4C8Q G;  2F69 A;  3FC3 A;  3DLM A;  2RK1 A;  1GCP A;  4EMG A;  1GRI A;  4HCK A;  1N8R U;  1QKX A;  4WTO B;  4M7A C;  2JMC A;  3E2U A;  2K2M A;  1YJW Q;  1G3T A;  5J3B A;  5A0D A;  3PIO A;  2XIC A;  2WSC E;  4M7D C;  1M1K R;  3LWH A;  1VQM T;  2EKH A;  1OQK A;  5IT9 E;  2ED0 A;  1VQ7 A;  3AHU A;  4AFU C;  4M7D E;  5M9O A;  4GY5 A;  3CD6 T;  2K3X A;  4NOY A;  1K73 U;  4M7A A;  1PRM C;  3LLR A;  3MPU B;  3I56 Q;  3CME T;  2RJE A;  2J6K A;  5GJW B;  4C0D B;  3JCM d;  1ABO A;  3G4S A;  1NM7 A;  4PKC C;  1M5Q 1;  3CCE T;  9ATC B;  2QQ9 A;  2DBM A;  4X34 A;  1ZUK A;  2DIQ A;  5FU6 C;  1WIE A;  3ASK A;  4MDW A;  4ME7 A;  3G6E A;  3SWN B;  4OB3 B;  1PKT A;  2ZPH B;  3ER0 A;  2CYZ B;  3J7A F;  2YHT A;  3ME9 A;  5KYW B;  2AK5 A;  1K73 C;  3OS0 A;  1VUB A;  3M9Q A;  1X43 A;  1VQO Q;  2KY9 A;  3A8H B;  4FT4 A;  2FPF A;  5GAN 8;  4JJD A;  2ZPE B;  4A53 A;  5GAN 7;  1I81 A;  2RQW A;  3SB2 A;  2LQN A;  4IUT A;  2L3S A;  2RB6 A;  1VQP Q;  2R57 A;  4J9I A;  3LGF A;  2HEQ A;  1KC8 U;  5CQX A;  5IHK A;  1M8V A;  4ZN1 A;  1E7O A;  1MGQ A;  1UJ0 A;  5FWC A;  2FYK A;  4M7A G;  1S72 T;  1NYG A;  3CBO A;  3CC7 Q;  3ULR B;  3UPU A;  2Y90 A;  1B3Q A;  3O8V A;  4M75 B;  5GMK l;  1S1N A;  2FRY A;  2DFU A;  4QT7 A;  4BY6 B;  3QSU A;  3OBY A;  2E1H A;  1D0Z A;  2Y4Y A;  3M53 A;  3M0S A;  3G71 Q;  1UGR B;  1KJW A;  4FIB A;  4M7D G;  5D6X A;  4DBF A;  4C92 F;  2KT1 A;  4PFP A;  3CCJ Q;  2KEA A;  2D1X A;  2W0Z A;  3OYL A;  2KRM A;  3IQL A;  3NTI A;  2XHC A;  2ED1 A;  2DM1 A;  2GF7 A;  4F17 A;  3CCQ A;  1K0X A;  2NUP A;  5GAO n;  3MEV A;  1U3O A;  1VQK T;  2ATC B;  1B07 A;  5GAM e;  3CCS T;  3CCR Q;  3CC2 Q;  2ZPF B;  1HXD A;  1YWP A;  1UJY A;  1WI7 A;  2FZC B;  2LMJ A;  2P4R A;  1VQ6 T;  4XU2 A;  2A7Y A;  2M0Y A;  4LD9 K;  4E2F B;  2PVD B;  1C1A A;  3TEE A;  2SRC A;  4M77 D;  2HL5 C;  3UT1 A;  2RO0 A;  2E6Z A;  1ZUY A;  2YUQ A;  5CAI A;  3MEA A;  2CUB A;  1VYU A;  5L8R E;  1I5L A;  1X6B A;  2HQX A;  2DVE A;  3BE3 A;  1OUL A;  4MZM A;  1GFC A;  3EGX B;  3A5Z B;  3CMA Q;  1PG5 B;  4XK8 E;  2CSQ A;  1QWE A;  2XDD A;  5CK9 A;  1QVG S;  3VRZ A;  2ENM A;  2DYB A;  2EQM A;  5HK0 A;  4IIO A;  5I11 A;  2DJZ A;  1RAA B;  4J9D A;  1F1B B;  3M59 A;  3M55 A;  2AIR B;  1G2B A;  3EG3 A;  4XTZ A;  1OYX A;  1MMA A;  2ESW A;  5EC7 A;  5IH2 A;  2I2L A;  2SEM A;  4IUR A;  3FDR A;  4E47 A;  2QGG A;  2EYW A;  1V1C A;  1Y71 A;  2K57 A;  4N0A A;  3TCJ A;  3X20 B;  1D1B A;  3PVL A;  4PL6 A;  4M7A F;  1AT1 B;  1YP5 A;  2DZ9 A;  1YIT Q;  2RNA A;  1VQ7 Q;  4FW2 A;  5FW9 A;  4AG1 C;  1MND A;  1RAD B;  4MMK A;  4OMP A;  2L89 A;  5GAN 2;  4BUG A;  4PNO A;  4C5H A;  3EHQ A;  4C92 E;  4L6V 5;  3C4S A;  2OI3 A;  2QXF A;  1Q81 U;  1TWB A;  4D8D A;  4M7A B;  2HCK A;  5CVI A;  3I56 T;  1VQ8 T;  1WXU A;  2CGH A;  3ZBD A;  4M75 C;  2FG0 A;  1UHF A;  2QQB A;  2J7I A;  3X26 B;  3E19 A;  3OBW A;  2BTT A;  1VQM A;  4PJO G;  3CCU Q;  3HP9 A;  1UG1 A;  2DL3 A;  4FYW B;  4DQ2 A;  2QG9 B;  1HJD A;  1N8R R;  3H0F A;  5FRO A;  2RMO A;  1VQ4 Q;  4C5E A;  3FLG A;  3MEU A;  5I22 A;  3QDR B;  2EW3 A;  1YFN A;  1Q81 C;  4QKU A;  4DEY A;  2CZ6 B;  2YUO A;  3FJ5 A;  2M0O A;  2RI2 A;  3OW2 S;  5IXF A;  3CCS Q;  4J9F A;  3CCM T;  5GAN h;  4BI3 A;  2NUZ A;  2IG0 A;  1IRX A;  3X24 B;  4JRI A;  2L2P A;  1IRE B;  2ECZ A;  4LDY A;  1YNZ A;  1EFN A;  4J7F A;  2KRS A;  2QQR A;  2A36 A;  4PJJ A;  4RTZ A;  2VXF A;  2DPP B;  1AD5 A;  2L3P A;  1KHC A;  5GAN e;  5A2Q E;  2F5T X;  2L5Q A;  4JZ3 A;  1M90 C;  1IXD A;  4D6W A;  4WF2 A;  2JTF A;  2EYY A;  4X1V A;  3OW2 P;  1X75 C;  2F2V A;  1BCO A;  3CCJ A;  3RIR A;  1NJI C;  4JZ4 A;  2JW4 A;  3L2U A;  5DM7 R;  2PUK B;  4FYX B;  1RI9 A;  2VGM A;  1D3B B;  4PJO B;  1OOT A;  4OVA A;  3SWN C;  2LQ8 A;  4M77 C;  2LTO A;  4HA8 A;  3GIB A;  4PJM A; 
#chains in the Genus database with same CATH homology
 4NL2 A;  4F7U E;  2V8K A;  3CCL T;  4MDX A;  3UWN A;  1BI0 A;  5CQY A;  1YIT A;  1YJN T;  2FHD A;  3CPW S;  3EAE A;  3OB9 A;  1WJS A;  2RM4 A;  5A0G A;  4ZGE B;  3G71 T;  4R56 A;  1VQO T;  2VV5 A;  3OSS C;  2VUB A;  3QO3 A;  3V7S A;  3CCR T;  1W2B A;  5GMK h;  4BD3 A;  3CC7 T;  3GOX A;  1D3B A;  1TH7 A;  3OYC A;  4J7I A;  1M1K U;  4KUL A;  2MI6 A;  2LC4 A;  1N6A A;  3JCM P;  4KUI A;  3CCU T;  1I8F A;  1YJ9 T;  2KQW A;  3L2Q A;  2K5I A;  1Q82 C;  1XOV A;  4ZGJ B;  2P0P A;  1KC8 C;  2IVW A;  3LX7 A;  4LDU A;  3PGG A;  4MZP A;  4PJO A;  2ZCF B;  2EFI A;  2EQK A;  4N4I A;  4N4G A;  4A4G A;  4C92 D;  2FL7 A;  3CCJ T;  2ZPB B;  3L42 A;  2OAU A;  3VUZ A;  3DLL A;  1NPP A;  3HRU A;  4RG8 A;  5KE3 A;  4LD6 A;  3JCM X;  4BE0 A;  3OSV A;  1G5V A;  4FM4 B;  5GMK j;  5LL6 S;  1GXI E;  3OW2 A;  1Q7Y U;  1P92 A;  1KD1 C;  2XD0 A;  3GP8 A;  3OYE A;  4O5V A;  4LDV A;  4C0D C;  4C8Q B;  3PTA A;  4P5N A;  2E41 A;  2RHZ A;  3CPF A;  1YBY A;  2QA4 A;  3CME A;  3M56 A;  1YJW T;  2JOY A;  1VIE A;  3CCV T;  3C94 A;  5HY6 A;  1QVP A;  3JCM b;  4JUV A;  2D0Q B;  3DKM A;  4CRI A;  4V2S A;  2KK4 A;  4BI8 B;  3CCR A;  3MO8 A;  1VQ7 T;  3PMT A;  5J26 A;  1QW1 A;  4DOW A;  5GAN f;  2K5L A;  4HT9 A;  5GAM g;  3CD6 A;  4M75 E;  1PSE A;  2XK0 A;  3FRN A;  3GNG A;  4XTX A;  4CI0 C;  2XDB A;  2LDM A;  2VYT A;  3OYI A;  1U1T A;  4MZT A;  3OYG A;  2DTI A;  1IZ6 A;  3P8H A;  5C6S A;  3CMA A;  3CC7 A;  2V8J A;  3QJY A;  1ZQ1 A;  2HNI A;  3V8K A;  3JB9 D;  2QDY B;  4KBM B;  2XG8 D;  4C8Q C;  2KAF A;  1BI2 A;  2XDP A;  2E64 A;  3L1A A;  3S6W A;  3SDZ A;  3JB9 H;  2A3L A;  2LT1 A;  4C8Q G;  4C8Q E;  4ZN3 A;  3JB9 J;  2PVG B;  2X35 A;  1NPR A;  1WQ7 A;  2F69 A;  3FEO A;  3DLM A;  1XNI A;  3GF5 A;  3MP8 A;  3N5B B;  5DY9 A;  3VUB A;  2RK1 A;  3WXM B;  4EMG A;  3OMC A;  2YRV A;  4EPC A;  4A4F A;  1OI1 A;  2VGN A;  3HPW A;  5IN1 A;  4NS5 A;  2XID A;  1Q7Y C;  1VQP A;  1N8R U;  1VQN T;  1VQ4 A;  5DLO A;  3OYY A;  4KT0 E;  4M7A C;  2DIG A;  4XQ3 A;  1G3T A;  2D9T A;  3QG1 A;  4XTW A;  3S3N A;  5KE2 A;  5J3B A;  1HK9 A;  3S3O A;  1Y96 B;  3OYA A;  1Q86 C;  1FWZ A;  5A0D A;  5HK3 A;  2R5M A;  4QVZ A;  3JCM f;  1YIT T;  1YJN A;  3PIO A;  3V8L A;  3JCM c;  5LJ3 j;  2XIC A;  4RMO A;  3M54 A;  1JBM A;  3M57 A;  4KUD K;  2WSC E;  4M7D C;  2XKO C;  3VYH B;  3LWH A;  4RKU E;  1VQM T;  1G3Y A;  1WNL A;  1QVG A;  2EJF A;  4FU6 A;  5GAN g;  2F5K A;  2ZPI B;  3GNF B;  3I55 T;  5IT9 E;  1KD1 U;  2E12 A;  3JB9 G;  2DD4 A;  3QZ9 B;  1VQ7 A;  3AHU A;  1O75 A;  4M7D E;  5M9O A;  4GY5 A;  3RES A;  4BAC A;  5CKH A;  4C92 G;  4O6J A;  4XU1 A;  3CD6 T;  2JUF A;  2K3X A;  4M75 A;  4NOY A;  1K73 U;  4M7A A;  3KXT A;  3LLR A;  5LJ3 e;  5FRM A;  1Y96 A;  2JVV A;  2K5F A;  2L8D A;  3QJ6 A;  2RJE A;  4B9X A;  3CME T;  1JJ2 S;  5CKE A;  4C0D B;  3CCV A;  3JCM d;  2DEQ A;  5GAN 5;  2B8A A;  4RCC A;  3URG A;  2OTJ A;  3CCM A;  3G4S A;  2CZ1 B;  4PKC C;  4OGE A;  2LNV A;  1WPY A;  5CR2 A;  1M5Q 1;  2DXB A;  4J6W A;  3CCE T;  2QQ9 A;  3OS2 A;  2LCC A;  3HSB A;  4X34 A;  5FU6 C;  2DIQ A;  4XTV A;  1LOJ A;  3JCM g;  1YHQ T;  3ASK A;  4MDW A;  3NFC A;  4XTY A;  4YTL A;  4JLG A;  4F7U B;  4A4H A;  4ME7 A;  3G6E A;  3SWN B;  2QI2 A;  4OB3 B;  3JSC A;  3A8M B;  3CC2 A;  1H3Z A;  3M4Y A;  1YIJ A;  5KH6 A;  5FU7 C;  3NTK A;  4EMK A;  2EQJ A;  3MCA B;  2ZPH B;  3ER0 A;  2EIF A;  4OF1 A;  3VKI A;  4NL3 A;  4E7I A;  2CYZ B;  2JNG A;  2RHX A;  5GAM j;  2RD1 A;  3F70 A;  3MHX A;  3OYK A;  3RER A;  3ZEH A;  3J7A F;  5GAO l;  2MWO A;  3V7R A;  2YHT A;  3ME9 A;  2CS7 A;  1WGS A;  3INZ A;  1N9S A;  2AHJ B;  1VQL T;  4OB1 B;  1EIF A;  4JLI A;  1K73 C;  3FC3 A;  3OS0 A;  2X4W A;  2WSE E;  1VUB A;  3M9Q A;  1UGQ B;  3VYG A;  3A8O B;  3HRT A;  2KY9 A;  3OYJ A;  3RMS A;  5LJ5 e;  2FVU A;  2E65 A;  1JB0 E;  3A8H B;  2E10 A;  4J8O A;  4FT4 A;  4FL6 A;  3QYH B;  5GAN 8;  2CZ0 B;  5KCO A;  4PLL A;  4JRK A;  4C92 A;  2ZPE B;  3MP6 A;  5CKB A;  3T9N A;  4A53 A;  1U8R A;  3JB9 F;  3CCS A;  5GAN 7;  1I81 A;  3SB2 A;  3JCM W;  4HCZ A;  1KQ1 A;  4M7D B;  4E7L A;  3RUX A;  2EAY A;  4A54 A;  1UGP B;  4ATO A;  2K3Y A;  4IUT A;  3OYB A;  3OYD A;  2RB6 A;  2R57 A;  4BI4 A;  4M75 F;  3JCM h;  2KMT A;  3LGF A;  1KC8 U;  4VUB A;  5CQX A;  2X4Y A;  4BE2 A;  2KVQ G;  4M78 A;  2O01 E;  2BKD N;  1B34 A;  4J6Y A;  1M8V A;  4C92 B;  4ZN1 A;  3JB9 I;  1OZ2 A;  1MGQ A;  5GAN j;  2FYK A;  4M78 G;  4M7A G;  2RHY A;  3CBO A;  5HKC A;  1S72 T;  3JRZ A;  1BIA A;  3H8Z A;  3UPU A;  2JTM A;  2Y90 A;  3O8V A;  4M75 B;  4N4H A;  1KQ2 A;  4RCB A;  5GMK l;  4PJO D;  4M78 C;  3PNW C;  2QA4 T;  3PIP A;  3QUI A;  4OP0 A;  3OYM A;  4BY6 B;  3SFM A;  1YIJ T;  2DKG A;  3OBY A;  2E1H A;  3PMI A;  3JCM Q;  3QSU A;  4M7D A;  2MMP A;  2Y4Y A;  3M53 A;  4L5G A;  1M9S A;  1UGR B;  2XI9 A;  4M78 E;  3ZFJ A;  1BIB A;  4FIB A;  3L2W A;  4BE1 A;  2HAX A;  4HCC A;  5I21 A;  4ELZ C;  2K2V A;  4M7D G;  5D6X A;  4M77 F;  4TVR A;  4C92 F;  2C06 A;  4PJO F;  2FB7 A;  4QW2 A;  3CCE A;  1QP3 A;  3CXC A;  4Y91 A;  3OYL A;  3RKY A;  3NTI A;  2OTJ T;  4OGC A;  4C92 C;  4XAX B;  2XHC A;  2JN0 A;  2RI3 A;  2GF7 A;  3CCQ A;  3DB4 A;  3HFO A;  5LJ3 d;  2EKO A;  3HFN A;  3L2Z A;  2P0Q A;  3MEV A;  5GAO n;  1VQ5 A;  1ZBX A;  1Q82 U;  3OMG A;  2MWP A;  5LJ3 h;  1VQK T;  3JAM E;  2PUO B;  2DO3 A;  3CCU A;  4E7J A;  2LQK A;  1WQW A;  3QZ5 B;  4J5Y A;  5FRN A;  2HQE A;  1YI2 A;  3I55 A;  3V7C A;  4JRP A;  4M7D F;  5GAM e;  3CCS T;  1Y7X A;  4IKF A;  2P4T A;  4Q5W A;  4C8Q A;  5GAN 6;  2DTH A;  4QVC A;  1RI0 A;  3RKX A;  2DTO A;  2ZPF B;  1BI1 A;  1HXD A;  1B34 B;  2BIV A;  2GQV A;  2RK2 A;  4EDU A;  5A0L A;  2LT4 A;  1WJQ A;  1VQ9 A;  4EMK C;  2EWN A;  2R58 A;  4QVD A;  1VQ6 T;  4ELY C;  3JCM J;  3OQ5 A;  4XU2 A;  2A7Y A;  4LD9 K;  1DJ7 B;  3HKS A;  5AYF A;  1JRI A;  1UGS B;  1YCY A;  3HHT B;  3OYN A;  1VQL A;  2EJG A;  2PVD B;  2HD0 A;  4FT2 A;  1U1S A;  3TEE A;  3GPL A;  4M7A D;  1X6O A;  3BW1 A;  1AHJ B;  3TRE A;  3PFS A;  4M77 D;  5GAO q;  3OY9 A;  3RMQ A;  5GAO m;  1VQ4 T;  4X9D A;  2EQU A;  3E9G A;  3UT1 A;  1UEB A;  3FJP A;  2RO0 A;  3J81 E;  3G7Z A;  5DLQ E;  2E6Z A;  4JDS A;  3SD4 A;  2OTL A;  1ZHI A;  5CAI A;  4DOV A;  3MEA A;  5CIU A;  2QEX A;  1H64 1;  4OB0 B;  5L8R E;  1KQS S;  3BFM A;  5GMK m;  3G6E T;  3CBM A;  1I5L A;  1NJI U;  2HQX A;  1W4S A;  2LX9 A;  2DVE A;  4II1 A;  4E7K A;  4QQG A;  5CCA A;  4X9C A;  3A8L B;  2X4J A;  1UB4 A;  1VQ5 T;  4MZM A;  4M78 B;  2QQS A;  5GAM f;  3JCM e;  4UC4 A;  3A5Z B;  2P0K A;  3P8D A;  3I56 A;  1N27 A;  3EFR A;  3HRS A;  3CC2 T;  4M75 D;  4PLI A;  4XK8 E;  4XU3 A;  2XDD A;  2G3R A;  3FIF A;  5CK9 A;  1QVG S;  4LDX A;  4ZTJ A;  2MF2 A;  2DXU A;  2EQM A;  1XTD A;  5HK0 A;  1V29 B;  3QKJ A;  2LVM A;  4MML A;  2DJZ A;  4Z02 A;  5LJ3 g;  3CC4 T;  1YJW A;  1VQ8 A;  5D6Y A;  4M77 B;  1VIF A;  3SWN A;  2V8I A;  4QQ6 A;  4OMF B;  3M59 A;  3M55 A;  3A8G B;  4IUU A;  2ZPG B;  5CO7 A;  1R8O B;  1BI3 A;  1XQH A;  2RA2 A;  4GLK A;  2PQW A;  4XTZ A;  5I2S A;  3R6O A;  1OYX A;  2H3J A;  4LDW A;  1K8A C;  3QBY A;  3QHS A;  3LYI A;  3MEW A;  2I2L A;  2CKK A;  4IUR A;  2QQA A;  3FDR A;  5FLX E;  4E47 A;  3J80 E;  2M9U A;  3QXE B;  1QVF S;  2RI5 A;  3VJP A;  1Y71 A;  2K57 A;  1QVF A;  4N0A A;  1K9M U;  3NTH A;  3TCJ A;  3KBG A;  4DA4 A;  3M4G A;  1N8R C;  1G3W A;  4M77 A;  3X20 B;  1Q86 U;  3DB3 A;  4IUQ A;  1YI2 T;  4PL6 A;  1NZ9 A;  4JRQ A;  4M7A F;  3G4S T;  4E7H A;  2DZ9 A;  1G3S A;  2M1H A;  2ZGW A;  4EMH A;  2WSF E;  1Y07 A;  3C95 A;  3P8B B;  4MMK A;  3L2R A;  1BYM A;  2L89 A;  2O4X A;  4A4E A;  5GAN 2;  1K8A U;  4BUG A;  1VQO A;  4M77 E;  4PNO A;  4C5H A;  4M78 F;  4ZGD B;  4C92 E;  4XU0 A;  2RHI A;  4L6V 5;  5FU6 B;  3C4S A;  2QXF A;  5D6W A;  1Q81 U;  1LJO A;  2E6N A;  1M1G A;  3LGL A;  1N9R A;  4XTU A;  1VQP T;  4M7A B;  1VQN A;  5GAO p;  2L3R A;  5CVI A;  3I56 T;  2LCL A;  3M58 A;  4B9W A;  1OZ3 A;  4J6X A;  1M4Z A;  4M75 G;  2QTX A;  3LWI A;  1VQ8 T;  3CC4 A;  2PVO B;  5GAM h;  2YLB A;  4L59 A;  2KSS A;  2CGH A;  5LJ5 d;  4M7D D;  3KUF A;  4JS4 A;  2M16 A;  3ZBD A;  4M75 C;  1O9S A;  1KHI A;  2GFA A;  3QII A;  1NE8 A;  2O4X B;  2QQB A;  5I2M A;  3X28 B;  2OTL T;  3CMA T;  2YLC A;  4BY6 C;  3X26 B;  4HT8 A;  3E19 A;  1LNX A;  2RHU A;  2DK3 A;  2Y4X A;  3OBW A;  4BB7 A;  1VQM A;  1VQK A;  4JS5 A;  1K9M C;  4QQD A;  1MHN A;  4PJO G;  4A4K A;  5LJ5 j;  3HP9 A;  3OS5 A;  2EJ9 A;  4M78 D;  4DQ2 A;  3CCQ T;  4PJO C;  1PSF A;  2HBP A;  5EG2 A;  4Y28 E;  2DAQ A;  3BDL A;  4C0Z A;  5CKD A;  5GAN 4;  4RG2 A;  2MAM A;  5FRO A;  2RJD A;  5LJ5 h;  3V8J A;  1QP2 A;  4PJO E;  4C8Q F;  3WVD B;  3H6Z A;  1YHQ A;  3OYF A;  4HCB A;  4C0G A;  4C5E A;  3FLG A;  2EYQ A;  3MEU A;  2GCX A;  1VQ9 T;  3QPH A;  1M1F A;  2RH2 A;  3HL8 A;  3QDR B;  1FX7 A;  3OS1 A;  2E5Q A;  5KCH A;  4C8Q D;  1Q81 C;  2VXE A;  2BUD A;  3M5A A;  4FSX A;  4JJN K;  5GAN 3;  2DD5 A;  2CZ6 B;  5CKF A;  2M0O A;  3EFS A;  2RI2 A;  3OW2 S;  3LH0 A;  4BDY A;  1X01 A;  2JZ2 A;  2NLU A;  3CCM T;  5GAN h;  4BI3 A;  2DXT A;  1FXX A;  2IG0 A;  1RL2 A;  3JCM V;  1BKB A;  3PT9 A;  5FU7 B;  3X24 B;  4JRI A;  3MP1 A;  2X4X A;  5GAO r;  3VV0 A;  1IRE B;  4F7U A;  5GMK e;  4LDY A;  2WAC A;  2CZ7 B;  3LW5 E;  2DXC A;  1M1K C;  3RKW A;  4F7U F;  3QYG B;  1W2B S;  1YJ9 A;  3E9F A;  2DZC A;  2VC8 A;  3G71 A;  4J7F A;  4ZTF A;  2QQR A;  3CEY A;  4IUV A;  4R55 A;  3FB9 A;  2RJC A;  2VXF A;  5J39 A;  3CPW A;  2DPP B;  4IUP A;  4OB2 B;  1WJR A;  1KHC A;  3VU3 C;  5GAN e;  3OA6 A;  5A2Q E;  2E70 A;  3OYH A;  1M90 U;  5IAY A;  3S3M A;  2F5T X;  2L5Q A;  2PU9 B;  1M90 C;  3CBP A;  3MET A;  3UDC A;  4D6W A;  4BDZ A;  1I4K 1;  4WF2 A;  3TU4 K;  1VQ6 A;  2GFU A;  2JTF A;  3L2V A;  2D6F A;  2RJF A;  3E1S A;  3CCL A;  2KDS A;  3Q1J A;  2K4Y A;  1X75 C;  3C12 A;  3GLX A;  3CCJ A;  3X25 B;  3RIR A;  5C0M A;  1NJI C;  1KG1 A;  5GAN d;  4J83 A;  4HKE A;  4C5I A;  3L2U A;  2QEX T;  1SSF A;  5DM7 R;  2PUK B;  5LJ3 f;  4C5G A;  5LJ5 f;  3BY7 A;  1KQS A;  5GAM d;  3BDU A;  2R5A A;  4M77 G;  2VGM A;  1D3B B;  1S72 A;  4PJO B;  3CXC S;  3WVE B;  4OVA A;  3SWN C;  2LQ8 A;  4M77 C;  2LRQ A;  2LTO A;  4HA8 A;  2ZZD A;  3GIB A;  1JJ2 A;  2XU8 A;  4N0A C;  4F7U G;  4M7A E;  5GMK i;  4EMK B;  4C0F A;  5LJ5 g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...