3HRUA

Crystal structure of scar with bound zn2+
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
213
structure length
211
Chain Sequence
PNKEDYLKCLYELGTNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Metalloregulator ScaR
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
total genus 64
structure length 211
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hruA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hruA02
1XMAA 2DO7A 3W6JB 5JR3A 5LHGA 3CLOA 1T2KA 4UXNA 6PAXA 5FO5A 2XHKA 1ZRFA 1LB2A 3LFKA 4HA8A 2ISYA 3HIFA 4N0BA 1R1TA 1IN8A 4IVNA 2D1VA 1HW5A 3TO7A 5D6EA 2V1UA 1BIAA 3V8LA 3MWMA 1B6AA 4KN7X 2DU9A 1W7PA 2F5DA 3E6BA 5H20A 5HDGA 2GXGA 1YO5C 1SD4A 2CQKA 1HQCA 4UUVA 2F5CA 1DP7P 3KLOA 4HBLA 1DPUA 1R5GA 2H3JA 1SD6A 2RN7A 4FX0A 5FB2A 3D5LA 1X3UA 1MKMA 4KN4X 2V6CA 3F8CA 3IRQA 1ZG5A 1IN7A 3KEOA 3GYHX 1LNWA 4GO1A 3FX3A 5A2QK 3Q9SA 1O3RA 1R1VA 2BGCA 5CVUA 2HDCA 4KFCA 3SQNA 1D8KA 1FP1D 2WWYA 4HF0A 1HW2A 1J7KA 2EV5A 4GXOA 3JW4A 1AOYA 3KP5A 2YX7A 2OZUA 5H6RA 2GQQA 1BC7C 3RPQA 2HGCA 3ZMDA 2XV4S 1F1ZA 1JGSA 1TNSA 1WQ2A 4XBFA 1J5YA 4OMZA 2EV0A 4HF1A 3GFIA 3ZMUA 5E1ZB 2FEZA 2HKXA 3DPTA 4HV5A 1K7AA 2BE5F 1TNTA 1SAXA 2MD5A 1XGNA 2LF8A 2JT1A 5LEKA 2DTRA 2DW4A 2UZKA 1W5SA 3U1DA 1XGMA 1DUXC 3VOEA 3R61A 1BC8C 4OIOF 2XROA 2XAHA 1IXRC 4XLPF 3VODA 2VBYA 1ZLJA 5JHUA 2QQ9A 2CYYA 4IJAA 5CLSA 3MZHA 5LGUA 4I98B 2LNBA 4EM2A 2HQRA 2QBYA 5ILVA 5FD5A 3E3VA 1IN5A 1RUNA 1XSDA 2CWEA 1B4AA 4IHSA 3WU0A 2ESHA 1MGTA 3D0SA 2FBHA 1PP7U 1OYWA 5FFXA 3V7SA 3C18A 3F8BA 4LGWA 2QWWA 3WODF 4LMYA 3HYIA 3REOA 3I71A 4EVIA 2E1NA 2K4YA 5IT3A 2O3FA 1R22A 4UV9A 3B73A 4WWCA 1V4RA 1G3SA 2ZNZA 1SFXA 3ZPLA 1L3LA 1TTYA 4YIIA 4HW0A 1KYZA 1K6OA 3IHUA 2CG4A 2LKPA 4JQFA 4ESBA 5DD4A 1QVPA 5D4RA 2HYFA 5J6XA 5BOXA 3FWEA 2PQ8A 3ML6A 1KU3A 1HW1A 5D8LB 4CO8A 4ASNA 2DK5A 3C1DA 3WTVC 1I27A 1RUOA 2RV8A 4FT8A 4WXHA 4TV7A 4LLLA 2M30A 1H9GA 1ZG3A 4KNYA 1G6NA 3V4GA 3DFGA 4HF2A 1FZPB 5IT9K 3H92A 1L0OC 2E7WA 1Z91A 4KMUX 4HDUA 2XASA 3DP7A 3I54A 4G9YA 4UHTA 5ICFA 1A04A 4B09A 1UHWA 3FZVA 5E1WA 4KIBA 1OKRA 2QQAA 1ZG1A 3JTGA 1XSVA 4EJWA 2A68F 3HRUA 5CVJA 4OMYA 3KLNA 4P9FA 4IXAA 2GWRA 1K78B 2K7LA 1YYVA 5JFRA 3WTSC 4MHGA 2FE3A 3HRMA 2CW0F 3WE3A 5HLIA 1U2WA 3WTUC 1XCBA 1LJ9A 2A61A 1QBJA 1I1SA 2EFQA 5AIQA 2Z3YA 2JPBA 1T38A 4G7HF 4L0YB 2RDPA 2RKHA 5FLXZ 3HTSB 2VT2A 4RB2C 4XSXF 3KETA 4K2EA 3GEZA 3HSEA 1MJAA 2ETHA 5BS6A 1LVAA 4OINF 2K27A 2M45A 1U5TA 4XRFA 2STTA 3CO6C 2VBZA 3FM3A 1YTYA 1FC3A 5DUKA 5DEQA 1LDJA 2W57A 4RB3C 1FYMA 3KCCA 4AIKA 3KP7A 2XKOA 2QUFA 3MEXA 3R4KA 1U8RA 3M1EA 5CVIA 5HVQC 4KUMA 4NQWA 4DQ2A 3L00A 2OZ6A 1XMKA 5L3BA 1T0FA 1EH8A 2DQRA 4B8XA 1ZH5A 1FP2A 2DBBA 4JBAA 3QRFF 1PDNC 1JHFA 2PMHA 2QM3A 4LG0A 4M9XA 3R6SA 1KGSA 2TDXA 3F8FA 5H6QA 2VE8A 1UHMA 1ODDA 5DV5A 2YSRA 3FXRA 3WTZA 1I6XA 1W7PD 4RB1A 2IVMA 2K5FA 4I0BA 3T0YA 1DDNA 2M87A 5FD6A 1YW8A 4WXCA 1LEBA 2H94A 2KRFA 3H3ZA 4EGZA 4MQ9F 1XGOA 4YFKF 4O5VA 2O61A 2Q2EA 1FT9A 2JZYA 1XDSA 2MBFA 3I59A 5ICGA 2Z9OA 4LK1F 3RKYA 2P4WA 4AIHA 2EFPA 2KKOA 5E18F 2ZMEB 2MA3A 3WTTC 1P4AA 1FWZA 1SD7A 5ILUA 3E6DA 2Q0OA 1R1UA 3QAHA 4GYGA 4FX4A 3K69A 4UVCA 2W84A 4YFNF 4I2OA 3CUQB 2LDUA 4M6YA 4LFUA 2L54A 3G3ZA 3MCZA 4M9ZA 5DCFA 2O6GE 4OU0A 5D5WB 5LEJA 2R3SA 4WK8F 2V9VA 5F1RA 2ESNA 1TQPA 3NQOA 5DUIA 4HZFA 1E17A 3E6MA 2DQLA 2ZKZA 4QLCU 1B9NA 4AWXB 3F21A 2BBYA 4ENKA 3BJOA 3DQVC 3K1PA 4D0PA 3WGIA 4RS8A 4L9NA 3JAMZ 1S8NA 5LBQA 2CFXA 3NRVA 3J80K 3TO9A 1F4KA 4LLNA 1W7PB 3SHFA 3GXOA 4A0YA 4RAZA 2KIUA 3EDPA 2D45A 4L5JA 2AS5F 1DPRA 2EV6A 4G7OF 3TDZC 1SMTA 3P9KA 5HS7A 4OIPF 2XGXA 1S6LA 2HR3A 2HKOA 4RGSA 4P5OA 3F72A 4EM0B 4R1HA 4HQMA 1TBXA 1BIBA 3KP3A 3BROA 2XUBA 1D5VA 5HDKA 2EA4A 5D8KB 4G6DA 1WSUA 1ZAOA 4PGHA 2FMYA 3NEUA 2HTSA 1XSXA 2FOKA 3F8NA 3KP2A 5HOOA 2ZO4A 2K5IA 3WTYC 4A12A 2L4MA 1P4WA 5EEHA 3LSTA 1QZYA 5CYVA 1S7AA 4KA4A 2ZBKA 4M73A 3LA7A 1XDUA 1PP8F 4MNUA 3O6BB 4LB5A 4IF4A 4RAYA 4I7HA 2QQBA 3BZ6A 2JPCA 3RTRA 1EV7A 3TOBA 1CF7B 4F7ZA 3DEUA 3RKWA 2RGVA 4A0XA 1K79A 3BJ6A 2VBXA 2NYXA 1F9NA 2J5OA 1Z6RA 3FHZA 3T1BA 4BHCA 4A6EA 5ERIA 1J9IA 1FYKA 2H09A 4P96A 3PQJA 2FRHA 1HSTA 5L3FA 4ENMA 1BOAA 2G9WA 2W24A 3CTAA 5E8GA 5K5RA 1XN7A 2R7FA 1ON1A 5LRSA 2PLYA 4WX9A 2COMA 4MTDA 4DNCA 2M5WA 1HKSA 1KU2A 3M8FA 5LRRA 1IAWA 2JRTA 1B9MA 2PG4A 3QPTA 2X0LA 3J81K 3T8RA 3QP5A 3P9IA 5JVTA 2LSOA 3WG9A 1OYIA 4EM1A 1YLFA 1BJAA 5CJ9A 3F23A 5E1XA 3I64A 2L01A 3PQKA 5FGMA 1LDDA 1UFMA 2QZ8A 3IKVA 1FX7A 2FQ3A 3HTUA 1QW1A 2A69F 5BPDA 2P6SA 1G3WA 1GHCA 3BOQA 4Y15A 1H9TA 2XAQA 5E17F 3I58A 5DCMB 4BH9A 1TQMA 5K5OA 4ZYEA 3QOPA 2Z33A 1LDKB 5ILSA 4HX7A 1MJBA 3O3KA 4M9SA 5HDNA 3WGGA 1Z6TA 1MDMB 2VC0A 2FU4A 1XB4A 3RYPA 4BYYA 4KT5C 4LJZF 2PN6A 4CDGA 3GX4X 2IP2A 4NB5A 2DT5A 3I53A 5JI6A 3GVAA 1CGPA 3LQRA 3SXYA 3V7RA 2FA5A 3O2PE 2HOEA 1FPQA 2VODA 1XD7A 3IKTA 2P7CB 3FXUA 3ERED 2KJBA 1QZZA 4R79A 1T39A 2GIVA 4PZJA 3U2RA 4S05A 1JXSA 1UB9A 4I09A 1IXSB 1FOKA 4CICA 1B1BA 3B02A 1O57A 2KIMA 1ZN2A 1J75A 3M8EA 5E8IA 2OQGA 3RDIA 4HLYA 3GF2A 4HX8A 3CUOA 4MTEA 3IL2A 1P6RA 1O7FA 2IW5A 1IRGA 1IUYA 4YFXF 3ZMSA 3KP4A 2OU2A 1H0MA 2O03A 3W6KB 4EJTA 5A2QZ 1QNTA 4U88A 4AVPA 3E97A 2VE9A 4HDVA 3FM5A 3MZYA 2D2WA 1WRJA 2FF4A 1W5TA 2OD5A 2PEXA 2MH2A 1QGPA 1ZREA 4M74A 1U5TB 4G94A 2EB7A 1KU7A 5L3EA 4GCVA 5BPIA 2MH9A 3IRRA 3TGNA 1K78A 5LGNA 1ZRCA 4L5IA 2VBWA 3RIRA 4MEXF 4ENNA 3N97A 4KICA 2UXXA 2DK8A 3FMQA 3KZZA 2XAJA 2L4AA 2IA0A 3JSOA 1U78A 3MAJA 4KMFA 3E19A 3ZMTA 1W4MA 5EEGA 1O7LA 4BQAA 5D5UB 3ZMZA 1J59A 1J2XA 4IRIA 4UVBA 1ZGJA 1HSJA 2E1CA 3CDHA 2IT0A 4HYEA 2A3SA 2NAZA 3MFKA 3GW2A 4BNCA 3MQ0A 2AXLA 4N9HA 3ULQB 3KZYA 1QPMA 3WTXC 1Z7UA 2CSOA 1Z05A 4RGRA 1G3YA 2EA2A 4S04A 1YW7A 4HX4A 3TO6A 4LB6B 4MQVA 3S2WA 1WWXA 2K02A 2RNJA 1FBQA 3HUGA 4U0WA 1TQIA 1P4XA 4ZYDA 4KYWA 1S7OA 1SFEA 1TW3A 3RKXA 1ZHFA 3M7GA 2HFHA 3KE2A 4ZYHA 2WTEA 3FXQA 2M1BA 2GA1A 4L9JA 3F22A 4CZZA 2V79A 5D5VB 3DPLC 3F8MA 5LHHA 2K4JA 3ZN0A 5KK1A 2B0LA 1YFHA 3E5XA 1STZA 2J5PA 5AONA 3LWFA 1HKQA 2GCXA 3SZTA 4LD5A 1IW7F 1I5ZA 3TDUC 3HRTA 1GXPA 3LA2A 4CHUA 4WF2A 2MLKA 4ENJA 3ECOA 3F3XA 1ZLKA 2P7VB 3E5QA 4E70A 2HQNA 4LLGF 1QO0D 3PFIA 2K86A 2HWVA 4U7BA 3HHHA 1YQAA 3LAJA 1BI3A 3BWGA 2NNYA 3RPUA 3HOTA 3T8TA 3COAC 3KFWX 4ZH4F 2LF7A 5IT9Z 1FYLA 4CXFA 2XVCA 2ZMEA 3ELKA 1BBYA 4BHPA 2VONA 2GA2A 4OIRF 1MD0A 4CGZA 3BJAA 2H27A 1R00A 1T6SA 2QYOA 3L09A 1R5HA 3T5XA 3V7CA 2UXNA 5K1YA 2EJRA 2OQRA 2IPQX 2XAGA 1MJ9A 3DKWA 4QWQA 2KJCA 4L0ZB 1ON2A 1J0RA 5K5QA 1P92A 3ISPA 2PMUA 1EH7A 4KIFA 4KIGA 2DFIA 1BI1A 3P7NA 2DAOA 2K4BA 3H3UA 5CVRA 3RJPA 3I0TA 1BI2A 3CUQC 1TLHB 2UWMA 2V1DA 1HKTA 4O3MA 3P9CA 1ONVA 3KP6A 3CO7C 5HS9A 3R0AA 1C0WA 5ICEA 3WTWC 4MGRA 2P5KA 5HLGA 3WU1B 5AIPA 2ISZA 3OV8A 2Y48A 2DPUA 1R23A 1HBXG 3R60A 3L2CA 2NNNA 1XGSA 1LEAA 5D4SA 4M72A 3K1NA 4Q48A 1XCVA 3BP8A 2ACJA 5E20A 3FF5A 1BI0A 4AIJA 2A07F 2NRAC 2MLGA 2C6YA 2ZCWA 5BQTA 4RB0A 4R8HA 1EH6A 2GAUA 4A5NA 2A6EF 1VTNC 2Q8KA 2PI0A 2BEOA 4ZYGA 3DF8A 4UV8A 3K0LA 2YU3A 4XSZF 4EMSA 2M8EA 1HXDA 3ZP5A 2BV6A 3C3WA 4JK1X 1FSHA 2ZJ2A 1R36A 2W25A 1R7JA 2P8TA 4KDPA 1KQ0A 5FLXK 4NHJA 1S29A 4HQEA 1ULYA 1R58A 3V8JA 5HLHA 2F5EA 4Y13A 3E5UA 1FLIA 4EGYA 4I01A 1FBUA 1P2FA 4I0AA 2A5YB 4IRHA 1E2XA 2FSWA 5BMZA 4BHBA 2STWA 5ED4A 3HSRA 1CF7A 2XIGA 4M6XA 2FNPA 4P9UA 2QBYB 5LHIA 4U0YA 1IF1A 3ZMVA 4MEYF 1IZ1A 2HZTA 1S3JA 3IWZA 1D8JA 4N9IA 3JSPA 2XKPA 2HYGD 4G6QA 2DPDA 2EWNA 1GVJA 2L02A 1KU9A 2IJLA 2BYVE 1WKMA 3OOPA 3JTHA 1FSEA 2HEOA 3AAFA 1IN4A 2G7HA 1RI7A 1OR7A 2Y75A 2JTVA 2H6BA 1RZ4A 3IC7A 3BDDA 2P5VA 4IPAA 3GWZA 5ICCA 2VXZA 4WCGA 4Q47A 4HOBA 4P55A 2QVOA 3I5UA 1FY7A 2DLLA 2FNAA 3DXJF 3EETA 5DD8A 3QU3A 3L7WA 3EYIA 2O8XA 1JHHA 1KQ9A 1MZBA 4ESFA 4FHTA 3GZ6A 3TKYA 5F64A 2OA4A 3GFJA 4ZZDA 2O0YA 1G4DA 3V8KA 3K9TA 1BM9A 5TRDA 3U9GA 1YIOA 3N4MA 2G7UA 3SFZA 3J80Z 3G73A 2VC1A 4XLNF 1UCRA 5DCMA 1I1GA 3E6CC 5L3GA 3QU6A 2A6HF 3VB2A 1T98A 3TOAA 2RQPA 1OYYA 4ESJA 1FBSA 1B59A 1SFUA 2ZNYA 1MDMA 1BYMA 3J7AO 4L9VA 1YW9A 4PDKA 2KIFA 1TW2A 1Y0UA 3LAPA 4Z2YA 5LLQA 3VEPA 1AWCA 4O6JA 3K2ZA 2R7DA 4U0VA 3BY6A 1WI9A 4G8XA 4M71A 2VOOA 3MHXA 1PUEE 4BAYA 1IRFA 1BN5A 3K1MA 5D6FA 3RI4A 1Q1HA 2XRNA 4WXDA 5HS8A 3JAMK 5L3DA 3ABTA 1GXQA 3LQQA 3EQLF 3TQNA 4EJOA 4EJUA 2WC2A 2CO5A 2ZFWA 3GUDA 3IWFA 3HHGA 5D5XB 2L3DA 2VOPA 2YX4A 4GGGA 3F6VA 2MC3A 3FMRA 1USTA 2DI3A 4IRGA 1FNNA 3QP6A 2OBPA 5DYMA 2F5FA 1RNLA 3ZQ7A 2FBKA 3F6OA 4LG0B 3KEQA 4A6DA 4ZZLA 1OMIA 2F2EA 3RYRA 5TJJA 3GZ5A 3ABUA 4HV6A 5DDGA 1U5TC 3C7JA 2Y0MA 2NS0A 2VT3A 3FMSA 3HOSA 2HTJA 4A5MA 1REPC 1ZGAA 5F6FA 2EFNA 2YR2A 4Y17A 2X4HA 2Z99A 4PGGA 3HSFA 5LGTA 3GLXA 4OIQF 4A2UA 2GZWA 2YPRA 4ETSA 3J81Z 2RC4A 1JE8A 5KVRA 1YG2A 1USSA 2P5LC 4BXUA 1O3SA 2P6TA 3I59B 5CVVA 4LK0F 3LA3A 1YS7A 1SMYF 3Q5FA 3R0JA 3EYYA 3VFZA 2FMLA 4EV0A 1KYWA 1QQIA 3DV8A 2IA1A 1LQ1A 3BPVA 1ZYRF 1IN6A 4L9TA 2ZXJA 2EK5A 3HRSA 4U7DA 4IHTA 2V1XA 1OPCA 2IRFG 2PJPA 3Q9VA 1IXCA 2H6CA 2PFBA 1NHAA 2Z5UA 2HS5A 3ROUA 2XAFA 2EFWA 2D1HA 2W85A 1F5TA 3QPHA 5FFZA 2EFOA 3L9FA 2K5LA 4EQQA 3GFMA 4HAMA 2ELHA 2GXBA 4UVAA 4A0ZA 2RVCA 1KQ8A 2JSCA 1Z1DA 1RIOH 2QENA 2FBIA 2PBIA 1SD5A 1YS6A 4OOIA 4RGUA 1G3TA 1D3YA 3EUHA 3ECHA 2IA2A 3BPXA 4GYIA 4I02A 2QLZA 1O3TA 4RGXA 4HLXA 4UNOA 3CUQA 4H0EA 4L18B 2ADUA 3GO5A 1ZRDA 3WE2A 1U3EM 2OAZA 1Z9CA 4YG2F 2LX9A 4EJVA 2CGPA 4PCQA 1KA8A 5J8FA 3I4PA 2FXAA 1ZARA 3CJNA 1V3FA 5L3CA 4G7ZF 3ZN1A 1O3QA 2WV0A 3WGHA 3SZPA 3M9AA 5J8CA 3GFLA 2VN2A 4Q4ZF 4AD9A 2E7XA 4ON0A 4Q5SF 4CYDA 1U6GA 4YIFA
chains in the Genus database with same CATH superfamily
3F70A 4PJOC 1XMAA 2DO7A 2X6OA 1VQ4I 2ECBA 1DP3A 2AQEA 2LTPA 1W6XA 1YJNQ 5FU6B 3W6JB 1NK2P 5JR3A 5LHGA 1JJ2A 1Q81U 3CLOA 1T2KA 4UXNA 1MSFC 3K70D 4LDYA 4QQGA 1RPWA 5K7FA 3RESA 6PAXA 1V5GA 2EGEA 3OBYA 3HJEA 1O9SA 5FO5A 2EQJA 2R7TA 1X1AA 2XHKA 3A03A 1ZRFA 1LB2A 3LFKA 1M27C 3CCUT 4HA8A 2RREA 2V8IA 1JJ8C 1PM3A 1WLPB 2ISYA 3VS7A 2O88A 3GTGJ 3HIFA 4N0BA 2D0NA 2XPUA 3CPWS 1R1TA 1TWFJ 3GTJJ 1IN8A 2Y4YA 4IVNA 1HC8A 5LJ5d 4YRVA 4AT1B 4MDWA 2D1VA 5KYXB 1HW5A 3TO7A 2H1KA 5D6EA 4XONA 2V1UA 1BIAA 3V8LA 1SG5A 5KE3A 5D6YA 1VQKA 4JS4A 3PM1A 3MWMA 4J9FA 1B6AA 4M77F 4KN7X 1QA6A 2DU9A 1KZHA 2FPEA 4X9DA 1W7PA 1M1EB 3MP8A 2F5DA 3E6BA 3OYCA 5H20A 5HDGA 3PJRA 3J7YJ 4L59A 2GXGA 1YO5C 1SD4A 2CQKA 4BQOA 1EA3A 1HQCA 3A1PA 4MMLA 1K9MC 4N4GA 4UUVA 2F5CA 1DP7P 3KLOA 1PHTA 2D0QB 4HBLA 3SZGA 5IP6A 1KQSS 4RMNA 1DPUA 4RM2A 1R5GA 1QCNA 2C0IA 1T56A 2H3JA 2OPTA 4WTOB 5CR2A 1ZELA 1SD6A 2RN7A 2RI3A 4FTHA 4FX0A 5FB2A 3D5LA 2CUBA 1X3UA 1MKMA 2L7ZA 2HVQA 3H5RA 4KN4X 3MEAA 4LD9K 2K7AA 2R5AA 2V6CA 3F8CA 1FXXA 3IRQA 1ZG5A 1IN7A 3BQYA 3KEOA 3HC7A 4UUTA 1AHDP 1RI0A 1VYUA 3H36A 1YJNI 4XLCA 3GYHX 1LNWA 3C2HA 4C2TA 4GO1A 3FX3A 2E19A 4GLMA 3GZNB 3S3OA 4QT7A 1K0SA 1GBQA 5A2QK 2LQWA 4CUGA 4QW2A 3JR9A 3Q0UA 3LSGA 4IEJA 3HOYJ 5FU6C 4XRSG 3Q9SA 5E3OA 2LKXA 1O3RA 1PRMC 1R1VA 1PD0A 4OMOA 2BGCA 4OMQA 1UTIA 1M1FA 1YIJT 5CVUA 2HDCA 1PG5B 2DE0X 3JREA 5HCKA 4KFCA 1Q82C 1SVMA 3KBGA 5IXBA 3SQNA 2R5YB 2OF7A 4A3MJ 1D8KA 3NFCA 1JT6A 1FP1D 1R77A 2FG0A 3OYMA 2WWYA 2BTTA 4BD3A 3PTAA 3CC2A 2XF6A 4A3KJ 4HF0A 5M5YJ 2QEXI 3X20B 1HW2A 2ZPIB 5E3NA 1J7KA 3MVPA 3FDRA 1VI0A 2EV5A 2XPVA 3G1LA 4GXOA 1TWCJ 3CCEQ 4J9BA 3ER0A 2FOWA 1T08B 4MFDA 3JRAA 1RI9A 1MH3A 5KYUA 1AT1B 3JW4A 3PIPA 4ZGDB 2R58A 1AOYA 4J01A 3KP5A 3ZOBA 1VQ9T 4IHWA 3QWLA 4A3LJ 1BOBA 2YX7A 5LJ5f 2OZUA 2LMDA 5F0CA 5M5XJ 1E3PA 2DT7B 3IP4B 5H6RA 3RSNA 2GQQA 3DEEA 1BC7C 1ABOA 2FUG2 4Y33A 1AWOA 3RPQA 2HGCA 1VQOA 2OV7A 1M9SA 2X3WD 3ZMDA 1NJIR 3L2ZA 1UGVA 2XV4S 2DTOA 2I5UA 1Y96B 4BE2A 4F52A 1F1ZA 2IBDA 3BTIA 8AT1B 1VQMT 4VUBA 1JGSA 1TNSA 1WQ2A 5EEAA 2DMOA 4XBFA 2R7QA 4XLEA 3EG3A 1J5YA 4OMZA 2L3RA 3NTKA 2EV0A 4HF1A 2Z16A 3GFIA 3ZMUA 2RO0A 5E1ZB 1T0HA 1BKBA 1ETKA 2CW8A 2FEZA 2HKXA 3X24B 5GMKl 5KHDA 4YIRX 3QKJA 4C8QG 2XF5A 3DPTA 2FD5A 5J40A 1MHNA 1DU6A 4PSXA 1BCOA 2HL5C 3LX7A 4RCBA 2DXIA 2A5WA 4HV5A 2LZ6B 1K7AA 4GLKA 3U23A 2BE5F 4FT4A 3GP8A 1TNTA 1SAXA 2L7MP 4C8QD 1FIAA 1XGNA 2MD5A 2LF8A 3FKIJ 2JT1A 2K2VA 5J3BA 5F0HA 1IRZA 2P84A 5LEKA 2DTRA 2DW4A 1X75C 5KYWB 2M0CA 3K4NA 4F55A 3OIQA 2Q1ZB 3MKLA 3G71I 3B6CA 2UZKA 1W5SA 3U1DA 1XTDA 1XGMA 1DUXC 2E10A 2E60A 2KXDA 3QWYA 3CCST 3VOEA 1PNJA 1UDLA 3R61A 1BC8C 2LD5A 5JLWA 4OIOF 2DVJA 3EFSA 3M0QA 3ME9A 3VUBA 2KRMA 2WAEA 1KQSP 2XROA 2XAHA 4D5CA 1MW7A 1IXRC 3BR1A 3H8ZA 4XLPF 5GAOp 3JRGA 2E5QA 2KYMA 4Y28E 1Z77A 3VODA 2VBYA 3F0CA 5GAMg 3CCVQ 1GT0C 3S15J 1LNXA 1ZLJA 5JHFA 1N5ZA 4OMMA 2MFZA 5JHUA 1MBJA 1TWGJ 4MLOA 1LE8B 3MEWA 4JUVA 2QQ9A 4RAFA 4XN0A 4XKBA 1QCOA 4JRKA 2CYYA 1K83J 2ECCA 2G0EA 1RAFB 1R49A 1F43A 2K2MA 3E9GA 5GMKm 3TMOA 2KMUA 3QO3A 1G8XA 2JM8A 1W36C 4IJAA 2NOJB 3VU3C 3BR3A 5CLSA 3CZ6A 4Y52J 3MZHA 2Y0SA 1HD3A 5LGUA 4I98B 2BHZA 2LNBA 4EM2A 2HQRA 4BBSJ 2QBYA 1N8RC 3GCMA 5ILVA 4A4FA 3GNFB 1M1KU 5FD5A 5LJ3g 3PIPF 5DY9A 4C0DB 3E3VA 1MNMC 1IN5A 1ARKA 1NTCA 1RUNA 2IG0A 2VJIA 1XSDA 2CWEA 4B4CA 2LG4A 2IGKA 5IHKA 1B4AA 2DFFA 4IHSA 2XG8D 3CMMA 3WU0A 2ESHA 3PO3J 1MGTA 1FMVA 3D0SA 2HCKA 2MIOA 1OLTA 2FBHA 2I8DA 4BBRJ 1OYWA 1PP7U 1MGQA 2V8KA 5FFXA 1VQ5T 3D5SC 5J4YA 3V7SA 1MV3A 3I5RA 3C18A 1OU8A 3FXKA 2JUFA 1U9NA 2NYSA 3QXEB 3F8BA 4LGWA 4IIMA 2GBYA 2QWWA 1NJIC 3WODF 4LMYA 2BE7D 2BZXA 3HYIA 2DM1A 3BQZA 3H9JA 3JCMh 3REOA 4XOPA 3I71A 2A36A 3RUXA 4EVIA 1X19A 4RTZA 2HQHA 1OULA 4LUEA 3CD6A 2E1NA 1W2BS 2DL5A 3M5AA 4ITVA 1H89C 4C0GA 2K4YA 5IT3A 1KHIA 2O3FA 2LC2A 4LG3A 3P8BB 4JRQA 1R22A 4UV9A 3B73A 2BE9B 2O2OA 3G1OA 1MSEC 2NLUA 2EAYA 2Y9ZA 3K70C 2R4GA 2ENMA 2Y4XA 4WWCA 4JZ3A 2JJ7A 1V76A 2GF7A 2WADA 1VQPA 1V4RA 4DOVA 1G3SA 2ZNZA 4XORA 1SFXA 1RR7A 3OYHA 2ZJRF 3ZPLA 1L3LA 1TTYA 4YIIA 3LSKA 2RNGA 4HW0A 1XJWB 1KYZA 3H9QA 1K6OA 2KQRA 2X51A 4LDVA 3IHUA 3DB4A 2CG4A 1MH4A 2LKPA 4JQFA 4ESBA 2KT8A 5DD4A 1QVPA 1JUPA 5D4RA 2HYFA 5J6XA 5BOXA 3FWEA 2PQ8A 2O01E 3ML6A 1VFCA 1VQKQ 3ZQLA 3QPSA 3JRZA 1Z0XA 2F2WA 2WY8Q 1NE8A 1Z9QA 2KRSA 1KU3A 3EHRA 3MPUB 1GL5A 3TP3A 1HW1A 2ROLA 2QAZA 4XKCA 4A3DJ 5D8LB 2Y30A 4CO8A 2ABLA 2HQEA 4ASNA 2DK5A 4M77E 3C1DA 4DOZA 2R7VA 4Q5WA 5FWCA 4C0DC 3WTVC 1I27A 1X4OA 3DTEA 5GAGJ 1RUOA 2HKQB 1X3WB 2XK0A 4FQGA 3LH5A 2RV8A 4FT8A 3DLAA 1XQHA 3OL4A 2A37A 2L3QA 3OSVA 4FW1A 1KC8C 3G7ZA 2VQCA 4WXHA 1LCKA 4HRIA 3BFMA 4IUPA 1LVKA 4F92B 4TV7A 2HBWA 3URGA 3A0HC 2K9QA 2ME0A 4LLLA 3HP9A 4OP0A 2M30A 2F5TX 4DBHA 1H9GA 2COBA 1ZG3A 3EFOA 3M0RA 4DZPA 4KNYA 1FOYA 1G6NA 3MD2A 3V4GA 3DFGA 4HF2A 2KT0A 1PUFB 9ANTA 1ZUKA 3JCMc 2LLKA 1FZPB 5IT9K 3H92A 5FRNA 1L0OC 2B63J 2E7WA 1YJ9A 5KCHA 1Z91A 4KMUX 4LN2A 3CLQA 2X85A 4XAXB 5EGOA 4HDUA 4A54A 1ETOA 2CT3A 3GOXA 1Y57A 2XASA 4C8QB 3DP7A 3I54A 4G9YA 4UHTA 5ICFA 3H0HA 1YCSB 2XGCA 2E3HA 1SHFA 4RDUA 2RHUA 1A04A 2F4IA 4B09A 1UHWA 4DEXA 3U21A 1JRIA 3FZVA 5E1WA 4ZGEB 2DN0A 4KIBA 3REAB 3X26B 1OKRA 3BCAA 2QQAA 3BTJA 3CP8A 1ZG1A 3I55T 1TUCA 3JTGA 1XSVA 3NARA 2E36A 3CC2Q 3OR2C 1B8IA 2BXYA 1YHQA 4EJWA 2A68F 3LSIA 2OTLT 1VQKI 2DOEA 3HRUA 5CVJA 4RBOA 2I0NA 2JVHA 2KDSA 2P0PA 4AUXA 4OMYA 3H41A 3KLNA 4AVZA 2LTOA 4P9FA 1OZ3A 2JRMA 4IXAA 2GWRA 2OCCH 5J39A 5KYNA 1OX9A 5EYRA 1XPXA 4ZDPA 5CQGA 2K7LA 1K78B 4L5GA 3CXCS 1YYVA 5JFRA 3WTSC 1R9TJ 3LLRA 1YX5A 2ROTA 5LJ5g 1TUGB 4F91B 4MHGA 1NLPC 5B1AH 4HVUA 1G2BA 2FE3A 1XX5A 3F9KA 4QSHA 4CZCA 1UEBA 2DD4A 3PL8A 4JJCA 1VQOQ 5B5EC 5I21A 1A36A 3HRMA 4FYWB 2CW0F 3WE3A 3M0PA 3TQ7P 3BG9A 4LITA 4XTZA 4R0KA 3UDCA 4BB7A 1NH3A 4FU6A 5HLIA 2RPNA 3QODA 3I4MJ 2HNHA 1U2WA 3WTUC 2CQ7A 4XLFA 1XCBA 1LJ9A 2A61A 3RPUD 2R5ZB 1QBJA 1I1SA 4BI4A 4BUGA 2EFQA 1JTXA 4KT6A 5AIQA 2E71A 2Z3YA 2EYXA 2P0QA 2JPBA 5DLQE 1T38A 2LOOA 2UUZA 3OYFA 3HOWJ 2EKHA 4G7HF 4M77G 4L0YB 2RDPA 2RKHA 1WNLA 4XU2A 3CCJA 5FLXZ 2E34A 4J5YA 3ASNH 3HTSB 4M78E 1ITYA 2VT2A 1PSEA 4M77D 2OX7A 8ATCB 4RB2C 2KBTA 3PGGA 3E1SA 2AQFA 4K2EA 4XSXF 3KETA 4FYYB 3TCJA 1PRLC 4C8QC 3GEZA 2F4OB 3HSEA 4G12A 2KSSA 2ZCFB 1TT0A 1MJAA 2ETHA 4FCYA 5BS6A 2ZJQF 1LVAA 4OINF 2K27A 2VQLA 1I5OB 2KDOA 1EKEA 1JT0A 2K5CA 2VKDA 2M45A 1U5TA 2X1CA 4XRFA 5B66C 1VIEA 2STTA 2EJ9A 3CO6C 1ZUYA 2EYQA 4FASD 2J7IA 2VBZA 3FM3A 5KAIC 2O31A 1YTYA 1FC3A 5DUKA 2F69A 1ZSZA 5DEQA 2CMPA 3KIOA 1SFKA 1LDJA 3PFYA 2ESWA 2BVLA 4L6V5 3FJPA 4M4ZA 3KXTA 2W57A 4RB3C 1FYMA 3KCCA 4AIKA 3M8JA 3KP7A 3ONQA 3U1KA 2DDAA 3J80E 3EHQA 1VQ4T 2XDPA 4XLAA 2DILA 2CS3A 3DWLE 2XKOA 5J4VA 2QUFA 1VQOI 2PVDB 2PVOB 3CCQA 5JLXA 1QVFA 2B7EA 2RQQA 1Y8RB 3MEXA 3LSPA 4RLQA 5GMKi 3R4KA 5EG0B 1U8RA 1M2VA 2HXIA 1WZOA 2E3IA 4EMHA 2QEXA 3W2VA 5GAMe 3M1EA 5CVIA 5HVQC 2JMWA 3UPUA 1IGNA 4KUMA 4NQWA 2E5KA 2KAFA 5EG2A 1S72A 4DQ2A 2B86A 2EZKA 3MN2A 1Q7YU 3L00A 3HUGB 1SSHA 1WPKA 4C2MJ 1YE9A 4JS5A 2KRHA 2EQRA 4N4HA 2NS7A 2OZ6A 1WHJA 3HBLA 3DBRB 3KPHA 1YFNA 2LQKA 3D7SB 1XMKA 5B3SH 5L3BA 1T0FA 1EH8A 4PJ0C 4A4HA 5KYYA 4B44A 2VLAA 2DQRA 4RUGA 4B8XA 2CH0A 1ZH5A 2VIXA 4IO9F 2KEAA 1FP2A 2K3BA 2DBBA 3ASOH 1ZA2B 5GJWB 5GANf 4JBAA 3QRFF 3CJQB 3IV5A 1PDNC 3BDLA 3CC4A 1FYNA 1M3CA 1ETWA 2V26A 3ZGKA 2F5VA 3JRBA 1VQLI 5LJ3e 1OYXA 1JHFA 2PMHA 4RCCA 2QM3A 4LG0A 2A08A 4M9XA 1AEYA 2K9SA 5K7ZA 3R6SA 4HPQA 4OMFB 3AL0B 1UECA 1KGSA 2TDXA 4ORZA 5IPAA 3S14J 5CQEA 3CCRA 3CD6Q 3F8FA 4IUUA 4KULA 3MO8A 1NYFA 2QG9B 1OISA 5H6QA 3LNQA 2VE8A 3LOCA 2X35A 3K4KA 1FEXA 4N0AA 4ZYAA 3CC7A 1UHMA 2WAQA 3I3LA 1ODDA 1LPLA 5DV5A 2DPPB 4XN3A 2K9LA 1D0YA 4ANJA 2YSRA 3VSKA 3I56I 3QYHB 3FXRA 1WI3A 4KISA 3WTZA 3OIPA 1I6XA 4BDZA 4IUQA 1W7PD 2Z2SB 4CRIA 6AT1B 1VQPQ 2HPIA 4RB1A 2IVMA 2K5FA 1RESA 1RAEB 4HSTA 4I0BA 1YJNT 4GRIA 3T0YA 2NUPA 3ZQQA 1DDNA 2M87A 5FD6A 3OA6A 1YW8A 4WXCA 1POGA 2M9HA 2R93J 2X4WA 3G71A 3OIOA 4JOMA 3VYUB 1LEBA 2HNIA 4CC2A 2YT6A 4Z88A 2W4SA 4J00A 2O9VA 1S7EA 3JB9I 2H94A 1NPRA 2BUDA 2VI6A 2KRFA 2YLBA 4M7DG 4NOYA 4ZN3A 2HDWA 3H3ZA 1QVUA 4OWRB 4EGZA 4MQ9F 3LGFA 1RLQC 3RR6A 1XGOA 3M59A 4XLHA 4M7DD 1X2KA 4LDWA 2MG4A 1GVDA 2CZ7B 1KQ2A 4YFKF 1O4XA 4O5VA 4JJNK 1JUMA 2O61A 1M5Q1 2Q2EA 2AHJB 2AT1B 2MPXC 1K73R 1FT9A 4J9CA 2JZYA 1QQJA 4PKCC 1XDSA 2YSQA 2XDDA 2MBFA 3I59A 5ICGA 5DM6F 2CKKA 2Z9OA 2OTJA 4LK1F 2HAXA 3HKSA 2ZAEA 3BTCA 3HL2A 3RKYA 2P4WA 3JSCA 4AIHA 2EFPA 2OI3A 4XKWA 3CD6I 2KKOA 3ZQGA 3OYBA 5IXFA 3AL0C 1RKTA 5TGTA 3UKGA 2OJED 5E18F 2EPDA 1RUWA 4FL6A 4RA2A 2ZMEB 4M75A 1X2MA 3BG5A 2MA3A 3WTTC 1AOJA 1D3BB 4CYCA 1SRLA 2A0FB 4A4KA 1YJ9Q 1P4AA 1WJBA 2UV1A 4IZZA 3JCMe 4M77B 2HVRA 3AKZA 2HYJA 2BY0A 2GQIA 1FWZA 1SD7A 3OYEA 5ILUA 1W70A 3HGGA 3E6DA 4RTUA 4KUDK 2Q0OA 5CKTA 4F17A 4AM3A 1R1UA 3QAHA 3E0JB 2YXYA 4GYGA 4FX4A 3JB9H 4D1QA 3K69A 4JP0A 1GRIA 4UVCA 5GADJ 1W5CC 1APLC 1IDYA 2X1DA 4EMKA 2W84A 4GDFA 1ZKGA 4YFNF 1Z3XA 1KONA 1BB9A 4I2OA 3CUQB 2DOFA 5FLVA 1N9SA 4E47A 4PLLA 2LDUA 5GAOl 1YHQQ 4M6YA 2H3EB 3CBPA 4LFUA 1R71A 1KQ1A 1K8AU 1E3OC 2L54A 4F14A 5DM7R 1IRXA 4XNFA 3G3ZA 4BQQA 2ZPBB 1K9MR 4J7FA 4NL2A 3MCZA 4M9ZA 1JQQA 5DCFA 4F7UE 2LREA 3SWNB 5GAN3 1UHSA 2O6GE 1X6BA 2FO0A 2QYZA 2MF2A 1JB0E 3A8MB 2JT4A 2XHCA 3WXMB 4FISA 4OU0A 3CCET 2BOLA 2X48A 3FBNB 3ULRB 4GFBA 1OQKA 3OW2A 5D5WB 4FT2A 5LEJA 2FJ1A 2R3SA 4WK8F 2V9VA 3ERMA 4QTRA 2V1NA 4BS9A 1X3ZB 3A02A 1U8BA 3RZDJ 3GF5A 4RTXA 1QVGP 5F1RA 3ZL7C 3LSRA 2ESNA 5LJ5e 1M8VA 1IV8A 2EJFA 1TQPA 3NQOA 3M07A 5DUIA 1Y56A 3EGDA 4IHVA 3TW6A 2H1LA 2DTHA 4HZFA 1E17A 4ZNXA 3E6MA 2DQLA 2ZKZA 4QLCU 2VQGA 3J81E 4PJOA 2ZGWA 1W0UA 3K6GA 1B9NA 4ZDOA 2ZMEC 4AWXB 3CCJQ 3F21A 2LT4A 3A01A 1SAUA 4XICA 1K73C 2BBYA 4ENKA 2DXCA 3REBB 2A3LA 3ABMH 3BJOA 3DQVC 5GANj 3K1PA 1WHHA 4D0PA 2Y2ZA 2MW8A 3WGIA 3IH3A 4RS8A 5GTIC 4L9NA 4IURA 3CQZJ 1JUSA 3OR1C 3S8PA 2HZYA 5GANd 4DBQA 4JRIA 3OYNA 2PJRA 2CQQA 3JAMZ 1X01A 5CKBA 5CKDA 4B3XA 1S8NA 1YHQI 3LSMA 1JTYA 3RQIA 4ZJZA 3CBOA 5LBQA 2E1MC 2CV2A 1KD1C 1P7IA 2JXBA 2JTEA 2CFXA 2W82A 3NRVA 3PNVA 3J80K 1VQ7A 3TO9A 5BNGA 1F4KA 1WZ2A 1WQ7A 4FE7A 4LLNA 1Z3YA 1ZK8A 1T3SA 4PNOA 3BZKA 3I9QA 4PLIA 1W7PB 3SHFA 3TVTA 4C5HA 3GXOA 4A0YA 4RAZA 2RMOA 3X28B 1SEMA 3H0DA 2KIUA 3M4GA 3EDPA 2D45A 2QGGA 3Q0WA 1X2NA 2LBFB 4L5JA 3CCQQ 2AS5F 2EQUA 1DPRA 1RETA 3CCVT 2HL3A 3NMZC 2EV6A 3R6OA 5IYDJ 2QEXQ 2LQ8A 4G7OF 3FXLA 4CC4B 3TDZC 2QQSA 4QVDA 2F48A 3S17J 1SMTA 3P9KA 3CMYA 1TL8A 1S72Q 1GLNA 1U0JA 4M7DB 5HS7A 3MKZA 4OIPF 2XGXA 2JOYA 1S6LA 2HR3A 2HKOA 4RGSA 2CH4W 1BW5A 2M02A 1UZCA 2LFBA 2MC4A 3F72A 4P5OA 4HCZA 4HXJA 4EM0B 4R1HA 1ZX6A 3UATA 1F1BB 3KYDB 3CCJI 1IHVA 3MEUA 5IHNA 1X6OA 3FXJA 4HQMA 4CCLA 1QPIA 4IHYA 1JXMA 1TBXA 2FPDA 1BIBA 1QHGA 4C5IA 3DTIA 3KP3A 4XL9A 2L2PA 3BROA 4M3EA 2B8AA 3OS5A 1GFCA 1Q86C 2XUBA 1D5VA 4M7AG 5HDKA 5GANg 3CC4Q 1W1WE 2EA4A 5GAN7 5D8KB 3HL8A 1EZZB 4G6DA 1WSUA 4M7AD 1IXDA 1UG2A 1ZAOA 4PGHA 2FMYA 2W0ZA 2ZPHB 3NEUA 2HTSA 4XOTA 3JRCA 1VQ8I 1M90C 1XSXA 1ZSGA 2BZYA 2AO9A 4FW2A 2FOKA 3F8NA 3KP2A 4B3AA 5HOOA 2A7YA 2D8JA 5I2MA 3CCRQ 1YJWA 4C92G 3GIBA 4E7JA 1GV5A 2QF7A 2RK1A 3C0CA 3MP6A 3UA7A 1AWWA 2VQHA 2ZO4A 2K5IA 3WTYC 3CQTA 2Y0SN 2L4MA 4A12A 4PJOF 5KYXA 1P4WA 4II1A 5GAN2 5EEHA 4C92D 3CC7Q 2VUBA 3BY7A 1SPKA 2SRCA 3LSTA 1BW6A 2HDDA 2IXSA 2KZVA 2TCTA 2L0AA 1QZYA 5CYVA 1S7AA 2X6WA 3CCQI 4KA4A 2JTMA 2ZBKA 1QVTA 3LA7A 1XDUA 4M73A 1PP8F 4EIKA 4MNUA 3GTPJ 3O6BB 4LB5A 4ZN1A 4IF4A 2VXEA 4PL6A 1Z67A 4RAYA 3CCYA 3G71Q 5M3MJ 2VWFA 4I7HA 3PMTA 4PFPA 2EIKH 1N8RR 1S72I 1K4SA 5CKHA 1K76A 3VRZA 2QQBA 2F6CA 5FWBA 3W3CA 4MZTA 3BZ6A 4BACA 1I4K1 2PUOB 2JPCA 3RTRA 1EV7A 4M7DC 1NM7A 5GAMh 3TOBA 1DGWY 2NS8A 2EJGA 3NTIA 1CF7B 4F7ZA 3DEUA 2DK3A 3META 4KJZA 4X0GA 3RKWA 5LL6S 2XICA 2RGVA 4A0XA 4AC0A 5FROA 1K79A 1GBRA 3BJ6A 3G1MA 1VQKT 2VBXA 3NWTA 2KROA 5GAOq 3CC4I 1UJ8A 2D5VA 2EFIA 2OTJQ 2DJNA 2NYXA 2WACA 1IO2A 3VV0A 4AYBA 1F9NA 2DAQA 2BW3A 4I76A 2J5OA 1Z6RA 2ELKA 3ZR8X 4ABZA 3FHZA 4J7IA 5I11A 3T1BA 3QQAA 4BHCA 4DYQA 2YRDA 5IH2A 1E0EA 4A6EA 1HSQA 1VYVA 1I3QJ 3CCRI 4M78F 5LJ3h 1XMXA 4Y91A 2K3YA 5ERIA 1J9IA 2L3PA 4F16A 2XGDA 4UB8C 2H8RA 3CC7I 4L5EA 1RADB 3EFRA 1FYKA 2H09A 2DBMA 3CPWP 2BY2A 4P96A 3DKMA 4DYRA 3PQJA 3JCMX 2CZ1B 3TW7A 2VV5A 2FRHA 2LKSA 3Q3SA 3M54A 2XF7A 1JKPC 2ZPGB 1TS9A 1HSTA 3BC8A 2GM4A 2CS7A 3J7ZI 4RTVA 1V54H 1VQLA 1HYOA 5CO7A 3ZEHA 2CSQA 5L3FA 3A8GB 4FYVB 4ENMA 1BOAA 3HPHA 2L9RA 5GP9A 5IP9J 2E35A 2F4MB 2V1RA 4XKVA 4D8DA 4BDYA 1D09B 2G9WA 2DA9A 2W24A 3CTAA 4V2FA 1UELB 2PVGB 3CDIA 5E8GA 2NVUB 5K5RA 4A3CJ 1XN7A 2R7FA 3QYFA 4OGCA 1ON1A 5LRSA 4B1RA 2FHDA 1M1GA 2PLYA 1T3LA 2DEQA 1AKHA 1MUZA 2JMCA 4HCCA 3DBHB 4WX9A 1Y96A 2DO3A 1X4PA 3JRFA 4J6YA 2COMA 4MTDA 4KGVB 3T9NA 1HLVA 4DNCA 4IOAF 4DOWA 3FXOA 4C9YA 2QQRA 3I56A 2M5WA 1A5JA 1HKSA 1KU2A 3HSBA 2COZA 3CC2T 1Y07A 1XC5A 3D1NI 3M8FA 3CPFA 1QRYA 5LRRA 1KC8R 1KIKA 1ZQ3P 1TP4A 1IAWA 2JRTA 1R5ID 2F5KA 1W1FA 1VQNA 3IAS2 1B9MA 2OTJI 2LX7A 1G5VA 2PG4A 4UB6C 4XU3A 2WB1A 2CP0A 2H8WA 4IHXA 2ZXHA 1N27A 3QPTA 1QHHD 3RZOJ 2RAEA 3K4LA 3ESWB 2GFAA 2X0LA 3J81K 3T8RA 1YBYA 2K3FA 2Y69H 3QP5A 3OYGA 3P9IA 4IKFA 5JVTA 1UFFA 2CP2A 5EZHA 4E7LA 5KCOA 2HZDA 3AG1H 2LSOA 3WG9A 1OYIA 3S32A 4EM1A 1PCXA 5KYWA 1YLFA 2ME6A 1VQOT 2M8GX 3M4OJ 2C0OA 1BJAA 1F36A 5CJ9A 2HMAA 4IX7A 3CMAA 2VYTA 2CDTA 4XTXA 5CIUA 3F23A 4BY1J 1QP2A 2EQKA 4NUBA 5E1XA 3OB9A 3I64A 3H3VK 2JN6A 2L01A 2RNAA 3PQKA 2RQUA 2DYSH 2KLOA 2R7UA 2COWA 2MOXA 5FGMA 3CEYA 2CV1A 3E2UA 2K9GA 1LDDA 4M7AB 2GQVA 1UFMA 2QZ8A 2FVUA 4EATA 3IKVA 3K4JA 2GIZA 4AFQC 4PK4A 3GBGA 1V29B 1D1AA 1BU1A 1UG1A 2HU9A 2PZ1A 3QDFA 1FX7A 3D5RC 4AU7A 2K3PA 4XK4A 5HY6A 2CUZA 2BZTA 2FQ3A 4BEHB 4FIBA 5C0MA 3HTUA 1QW1A 3QUIA 2QA4A 2FB7A 4F7UA 4ATOA 4GY5A 2A69F 5BPDA 2P6SA 1GCQC 1G3WA 1GHCA 2AK5A 1V5FA 4YELA 4C92B 3BOQA 4Y15A 1H9TA 3J7AY 1O75A 2XAQA 5E17F 1VQ7Q 3I58A 3EG0A 1OR7C 5J1RA 3S1RJ 1E3HA 4M75E 1K4US 2JA7J 2QSFX 5DCMB 3P5JA 3G6EQ 2HSPA 2DEUA 3PO2J 2EPFA 1T8IA 3HGYA 4BH9A 1N77A 1BCMA 4LE9A 1BJZA 4R56A 1TQMA 2L3SA 2DA2A 1GDTA 1R0CB 4KBMB 5D6XA 1GV2A 5EF6A 2HBPA 5K5OA 1WJAA 4DW6A 3BR6A 5GAN4 4MO7A 2EILH 2A6TA 4ZYEA 1ZTRA 3LWIA 1AWXA 3QOPA 3LYIA 1OJLA 5GPCA 3ASKA 2Z33A 1LDKB 5ILSA 1WHMA 4RG2A 4PFZA 2CUJA 4HX7A 4IL6C 2BY1A 2E4HA 4B47A 4J8OA 1ETXA 1MJBA 3O3KA 3Q0VA 4M9SA 4C3IJ 3WGGA 5HDNA 5B1BH 3O8GA 5JVGF 1ETYA 2EYWA 3P8HA 1Z6TA 1MDMB 2E64A 2XB5A 2VC0A 3BG7A 2FU4A 3JCUC 5FW9A 2GTOA 1XB4A 1MIJA 3RYPA 4BYYA 1QKXA 4KT5C 4PJJA 2CUFA 4BUPA 2OJ2A 1WJFA 2DODA 2CP3A 3HKZA 4FSSA 4LJZF 3HFOA 2KNBB 4DEYA 2DDBA 2PN6A 5LJ5h 1LKXA 4CDGA 3GX4X 3C4SA 5AYFA 3OWTA 2CW7A 1TXQA 2IP2A 2LJ0A 2JK3A 3NAUA 1UGQB 1QWFA 2VXDA 1YITA 5GMKj 3VYHB 1H88C 4RMOA 4NB5A 2DT5A 3I53A 1WHKA 5JI6A 4XRSA 1ZLMA 9ATCB 4HCBA 3GVAA 2PMZA 3JB9F 2IGMA 1CGPA 4M7AC 3HHTB 3LQRA 3SXYA 3V7RA 2K9NA 5IAYA 4D7MA 2FA5A 2M4GA 4XMYA 3VYSB 5J47A 3S1MJ 2RJCA 3O2PE 1YRNB 1ZHIA 2HOEA 3BE3A 1JBMA 1FPQA 3PUFA 2VODA 2WSFE 1JU5C 1RRJA 1XD7A 4ELZC 3IKTA 1U9OA 1RKWA 1YJWQ 1VQ7I 2HQ5A 1R6RA 3FXUA 2LY2A 2P7CB 3ERED 4JX6A 2KJBA 1QZZA 1G2HA 4R79A 1T39A 1AWJA 3ZRGA 3G6EI 2GIVA 2GBQA 4C92C 4PZJA 3U2RA 4M6VA 5EDNA 3OBWA 4S05A 1JXSA 4PJOE 3JCMQ 3L2QA 4II3A 1UB9A 2CH4A 3QHSA 3CD6T 1JKQC 3K4CA 2PX9A 1IXSB 2X9DA 4I09A 1IREB 3OSSC 1YIJI 1FOKA 5KE2A 3CMEA 1QVFS 1OCOH 3HZJA 4CICA 2BVMA 1B1BA 3O5ZA 3B02A 1O57A 2KIMA 3JCMV 2RM4A 1ZN2A 3BLYA 3LL7A 1J75A 2O9SA 3M8EA 3EG9A 1ERDA 3HPWA 1R8OB 4D8KA 5E8IA 1C0MA 4F04B 3NWSA 3I5SA 2OQGA 2KZGA 3RDIA 1VQPT 4C30A 4BJ6C 3L1PA 2XU8A 4HLYA 2Z1DA 4BY6B 4F7UF 3GF2A 4HX8A 3CUOA 4E2FB 3FC3A 1I39A 4MTEA 4JLIA 3IAM2 3IL2A 1YWPA 1MNDA 1P6RA 2OCEA 4FETA 2LJ1A 4D6WA 3WG7H 1Y39A 1O7FA 2IW5A 1IRGA 1IUYA 4YFXF 3ZMSA 3KP4A 1PUFA 2OU2A 2XB0X 1Y1WJ 3MKDA 1K9MU 1H3HA 1FMKA 4W1UA 2IS4A 2LCSA 4NC8A 1MBKA 1H0MA 3CCMA 2O03A 2V8JA 4ZC3A 3W6KB 2NVTJ 4AFUC 2YRCA 1W2BP 2R7RA 4EJTA 2WAQN 5A2QZ 3FEOA 3K4BA 1I6HJ 2J6FA 1WJ5A 1QNTA 2JA2A 2AZSA 4U88A 4AVPA 3E97A 2VE9A 4HDVA 3FM5A 1AVZC 3MZYA 2D2WA 1WRJA 2DYRH 2FF4A 4JDSA 3VS3A 4C8QA 3B6AA 1W5TA 2OD5A 1KHCA 5I2SA 3DLLA 4AIDA 4N4NB 2PEXA 1VQMI 2VASA 3RMSA 1YI2A 4N4IA 2O4XB 2MWPA 2KRNA 2YU9J 2MH2A 1YJWI 1QGPA 4J9DA 1ZREA 3W2AA 4M74A 1U5TB 3VKIA 3Q1JA 2VPRA 1D0ZA 1RACB 4XU1A 2O9LA 4G94A 1U1SA 2EH3A 2QKLB 1LFBA 1VQ6A 5M5WJ 2EB7A 3H35A 1KU7A 3EUAA 5L3EA 2RQVA 4GCVA 2DNUA 3EH2A 3CCLA 3UA6A 7AT1B 1WA7A 4DA4A 1VIFA 1WCMJ 1SSFA 5BPIA 1N75A 4B48A 4MZPA 2WAFA 1PVEA 1OV3A 1VQLQ 1WJCA 2MH9A 2V9PA 3P8DA 3IRRA 1BR4A 3TGNA 1K78A 1YJ9T 2LK2A 4Y4RA 1J09A 1Q82U 1WXUA 5LGNA 1ZRCA 1ETQA 3DPUA 1VQ8A 4L5IA 2VBWA 4C5GA 3RIRA 4MEXF 4YEJA 1QP3A 5C44J 1MMSA 3GPLA 4E7IA 2LP0A 2KL4A 3N05A 4EEFG 4ENNA 1X1DA 4KICA 3N97A 2G6FX 4BQNA 1WYXA 2DA7A 5L8RE 1B7TA 2DF6A 4NQWB 1RAIB 2UXXA 3SHWA 4MMKA 2DK8A 4XM3A 1WIEA 4BY6C 1M3AA 3FMQA 3KZZA 2XAJA 3OYKA 2L4AA 3S2DJ 3PMIA 3I56Q 1WGSA 2IPOB 1A31A 2R5ZA 1IC8A 2IA0A 3JSOA 1YHQT 3AG2H 1TU0B 2KY9A 1KG1A 1U78A 1VQNQ 3MAJA 4KMFA 3E19A 1WJSA 3DLMA 3ZMTA 3VS2A 3S1QJ 3ZFJA 5J3LA 2F2VA 1W4MA 5EEGA 1O7LA 3OY9A 4BQAA 2DL7A 3A8HB 5D5UB 3ZMZA 3X25B 3PVLA 1WHUA 3HG9A 4M3BA 1J59A 1J2XA 4IRIA 3H9GA 4UVBA 4RM3A 1ZGJA 1HSJA 2Y31A 3CDHA 2M0MA 2E1CA 3M58A 1I3AA 2IT0A 4A93J 2HXOA 3K10A 3QYEA 2A3SA 4HYEA 2NVQJ 5F0FA 1YCYA 2OAWA 4J6WA 2NAZA 3VJPA 3MFKA 2JUCA 3GW2A 1SFOJ 2DT6A 3CMAQ 1WPYA 1ENHA 4BNCA 3MQ0A 2AXLA 3CDLA 4N9HA 2E1OA 1LPQA 2E2HJ 2RQRA 3ULQB 4A3EJ 3KZYA 1K61A 3VS0A 2ZC2A 3PIOA 1QPMA 1VQ5I 2RJDA 2L2OA 4KRTA 3BW1A 3GNGA 2FPFA 3MJXA 5IY5H 3EH1A 5GPAA 4BJTA 2D1XA 1MV0B 2CZ0B 1WJEA 1B3QA 4RKUE 3UT1A 2CQNA 3WTXC 3FIFA 1Z7UA 2CSOA 2P81A 4C8QF 4D7NA 4ZTJA 3OMCA 3CCJT 4QQ6A 1Z05A 2CP5A 2WBMA 4RGRA 3SJMA 1SC7A 3DLLF 3CXCP 3RMQA 1G3YA 2IS2A 1U06A 1U3OA 1ZA1B 3GTMJ 2QGUA 2OC6A 2EYYA 5LD2C 4YTLA 4XIDA 2EA2A 2QA4Q 1HCRA 4S04A 2HDAA 2IS1A 3VUZA 2V7FA 3ABKH 1YW7A 4HX4A 5EG0A 3TO6A 2LH9A 4M78G 1JKRC 2KI7A 2FL7A 1GUUA 2V4JC 2R5MA 4LB6B 4MQVA 4V19K 4KH1B 3DTKA 2NUTB 3S2WA 4QPOA 3H0IA 2GLOA 1WWXA 2RNJA 2K02A 1FBQA 3EUKL 3HUGA 4U0WA 1DJ7B 2VKNA 2MCNA 1ORKA 2EBPA 4I6ZA 1TQIA 1CQTA 2LVSA 2CP7A 1P4XA 4ZYDA 2QI2A 1VQNI 3SDBA 1NPPA 3OW2S 4KYWA 1UJYA 1MBGA 1IO6A 5IOZA 2HVSA 5GAN5 2KFDA 1S7OA 2KXCA 3JV3A 1SFEA 3O8VA 1GXIE 3S2HJ 2ZB9A 2YUQA 1TW3A 3A2KA 3RKXA 1ZHFA 4LIVA 1YOVB 3M7GA 1RLPC 1OOTA 2ATCB 2HFHA 3CP2A 3KE2A 4ZYHA 5A0LA 2E1HA 4DZJA 2JA8J 2WTEA 1N8RU 3H5NA 3HFNA 3FXQA 3KYCB 5A2QE 3CCQT 3CMAI 2LY9A 1C1AA 4D5FA 2M1BA 2GA1A 4L9JA 3F22A 1XOVA 2ID6A 4CZZA 2CUDA 2V79A 3EG2A 2X4JA 5D5VB 3DPLC 2QEXT 1UB4A 2O7OA 3OMYA 4RLFA 2ECZA 2GGRA 2WSEE 3L2UA 3LSHA 3VS4A 1S72T 2KR3A 2VB6A 3F8MA 4DIQA 5LHHA 2K4JA 3ZN0A 3OSGA 2LJ3A 5KK1A 5IOYA 1QWEA 3M3YJ 2B0LA 5FU7B 2XC7A 1YFHA 3E5XA 4E6RA 1STZA 1WX6A 2J5PA 5AONA 2LCLA 5E79C 3NGPA 1NJIU 4ELYC 5FLXE 2X4XA 3GTKJ 3EGUA 3LWFA 1HKQA 2GCXA 3HTRA 1WHLA 3SZTA 4LD5A 1IW7F 1G83A 2R0QC 2RB6A 5FRMA 1KD1R 1JJ2S 1DGRM 1LUJB 3PUBA 1I5ZA 3TDUC 4XR6A 2QA4I 1IDZA 1MMDA 3HRTA 3CC4T 4A3FJ 1GXPA 2PQWA 4OB1B 3LA2A 2VJ5A 3CESA 4CHUA 3MEVA 4AG1C 4WF2A 4J9IA 1VF9A 1AU7A 2A28A 4E7ZA 2E2JJ 2MLKA 1KSWA 1UUEA 3G4SA 2R57A 2DIQA 2YHTA 3QZ5B 1WH7A 4BI3A 1B72A 3PIOF 4NS5A 4ENJA 3VRYA 3ECOA 3F3XA 1ZLKA 2P7VB 3E5QA 5HNHA 3CCRT 2ZJPF 2ZXWH 1K6YA 4E70A 3SWNC 2VJJA 1KJWA 4XQFA 3CMEQ 4J9GA 3TREA 5A0DA 3QYGB 1S5LC 2HQNA 4LLGF 2JA6J 1QO0D 3PFIA 3CC7T 2K86A 1X1BA 2LC4A 2HWVA 2ZXIA 4NC7A 3EGXA 4HT8A 1X69A 3SDGA 1TH7A 3OYLA 3GBQA 2DA3A 2O8KA 2X3XD 2GNCA 2M9UA 5E3LA 4U7BA 2XDVA 5A0GA 3HHHA 2OTLI 2CP6A 1YQAA 1QLYA 4PJNA 3LAJA 1BI3A 2KGTA 1RAAB 3BWGA 3BDUA 1M30A 2IGNA 2CZ6B 2NNYA 3RPUA 3HOTA 1AHJB 3G71T 4E7SA 4A53A 3CCUA 3EG1A 3T8TA 3CJRB 2E6ZA 3COAC 4X34A 3KFWX 1XNIA 1WH5A 4ZH4F 4OB3B 2LF7A 4Z8AA 5IT9Z 1XTAA 1FYLA 1Q86R 4CXFA 2P4RA 3S1NJ 2XVCA 3OYYA 4B6MA 2ZMEA 4XTYA 2RJFA 3CCMQ 2EZHA 2QKMB 4UUSA 1YITI 3ELKA 1KC8U 1BBYA 2IS6A 1MMGA 3FDYA 4BHPA 2VONA 1U5SA 1UHFA 2LP5A 2GA2A 4OIRF 1MD0A 4HSRA 4G6TB 3S3MA 3UWNA 5FU7C 4CGZA 3EAEA 1HA8A 4C0ZA 4E4HA 2DCEA 2GOMA 3BJAA 1M90R 2H27A 3SD4A 1TUDA 1R00A 1T6SA 2QYOA 3L09A 1R5HA 3T5XA 1JI8A 3V7CA 2HQXA 3QWXX 1QVGA 2UXNA 3AG4H 2YWWA 1YX3A 1WFXA 2MWOA 2KPMA 2RF0A 3WVDB 1YI2Q 3J7AF 4C92F 3PSIA 2OTJT 5K1YA 2EJRA 2F2XA 2OQRA 5GAOm 4JLGA 3S3NA 2M51A 4NBQA 1MBFA 3ZQFA 2IPQX 3OW2P 1H3ZA 2R7ZJ 3BCBA 1X2QA 2XAGA 4FM4B 1MJ9A 3HM5A 4M77C 2NOGA 3DKWA 4QWQA 2YUPA 3CCLQ 1VQ6Q 5DLOA 2KJCA 4L0ZB 2HD0A 1ZBXA 1ON2A 4II2A 5GANh 2W7NA 1A6QA 1J0RA 3EUHC 3PSFA 1P92A 2BHYA 3DEWA 3ISPA 5K5QA 2PMUA 3L2WA 3BZCA 3CMEI 3OOUA 1EH7A 4KIFA 1VA7A 3FJ5A 3QSUA 1I07A 1B34A 4KIGA 2I10A 5M9OA 4FSXA 3BR5A 1RR8C 2LMJA 2DFIA 1HF0A 1BI1A 4CC3A 5GAEJ 3P7NA 1VQ8Q 1ACMB 2DAOA 2K4BA 2KISA 3H3UA 5CVRA 3RJPA 1OI1A 3I0TA 1BI2A 2PNIA 3CUQC 2HOAA 4M75F 1TLHB 5FKKA 1B07A 4CSWA 1WXBA 2UWMA 2DJQA 2V1DA 4OB2B 1HKTA 4O3MA 3BT9A 5HODA 2FZCB 3P9CA 2X4YA 1ONVA 4M78A 2R7WA 2YUSA 3H1CA 3H0FA 3QYBA 4M78B 5CKEA 4RAGA 2JS0A 4UY8I 3KP6A 1E6GA 3CO7C 3L2VA 4IQ4A 1YIJA 4B43A 3CCMI 1V5EA 3R0AA 5HS9A 2DL4A 1C0WA 2CGHA 5ICEA 4HCKA 4F93B 3WTWC 2R7XA 3ZXSA 1JJ2P 4MGRA 2P5KA 1VZ0A 5HLGA 3QPLA 2ID3A 3WU1B 3WVEB 3CJTB 1MBHA 5AIPA 1WJRA 2ISZA 4BY7J 3OV8A 3GTOJ 2Y48A 1M2OA 1YI2I 1JKOC 2DPUA 3EPZA 5IP7J 1PC0A 4J6XA 3HOZJ 2LCCA 4AMCA 3LGLA 1OCCH 3M4YA 2MSYA 1R23A 3QJ6A 4F7UG 4NL3A 2WV1A 1HBXG 1ACIA 3R60A 5D6WA 1K8AR 3L2CA 2JVVA 1VQ9A 2NNNA 1XGSA 2WSCE 1LEAA 1VQ6I 1WDXA 3CCLI 5D4SA 3MP1A 2M0OA 3NHNA 4M72A 4XTVA 1Q7YR 2CUEA 3K1NA 1IG7A 1UAAA 4BE1A 4LXCA 4Q48A 5HNFA 4QVZA 4IOCF 3RBBB 1XCVA 3BP8A 3FISA 2DRKA 2ACJA 5KH6A 5E20A 3FF5A 1BI0A 4Z02A 3O8HA 3HPGA 2MAMA 2EKOA 3NPFA 4OMPA 4AIJA 1MMNA 3V42A 2KIQA 2A07F 2NRAC 1JO8A 1VQMA 2MLGA 2C6YA 2DXBA 3OMGA 2VJ4A 4Z6YA 1T0JA 2LBFA 3FK7A 3VPRA 1X27A 4C8QE 2WB1N 2LNHB 2ZCWA 3VDXA 5BQTA 5GAOn 4RB0A 4R8HA 1EH6A 5F1JA 2JZ2A 2GAUA 4A5NA 2A6EF 1VTNC 4J9EA 3JCMf 1TC3C 2Q8KA 2QDYB 1NLOC 2ELJA 5F04A 5KYUB 2PI0A 2K79A 3E7LA 3VSLA 1EIFA 2BEOA 2X1EA 4ZYGA 4P5NA 3DF8A 4UV8A 4A3BJ 1G59A 3IUOA 4V2GA 2DXTA 4M78C 4M7DA 1NG6A 4E7HA 5EZGA 3K0LA 2YU3A 3WHBA 4BGDA 3I9V2 4XSZF 4EMSA 3FHNA 4JX4A 1R0BG 3SB2A 1OQYA 2D8HA 1VQ7T 2M8EA 5FKLA 3QDRB 1SVOA 3CCSA 2E5NA 3G6ET 1HXDA 2GOXB 3W6VA 3ZP5A 5CAIA 2BV6A 5LFAA 1OX8A 2DLPA 2JM9A 3JCMP 2BW3B 2YDLA 5IT9E 3C3WA 3FKJA 4JK1X 1FSHA 1TT5B 2ZJ2A 2LRQA 5GJVB 1R36A 3CBMA 2W25A 5FKOA 5CKFA 1R7JA 3RCOA 1FIPA 3RNJA 2P8TA 2QQ8A 3TL4X 2DOAA 3BR2A 5DM7F 4KDPA 3JCMb 2M4KA 1KQ0A 2LYCA 3HB9A 4MIMA 5FLXK 1D0XA 4FE4A 1BA5A 2E70A 2AKKA 2HPMA 3I35A 2YS9A 2DVEA 1Y1VJ 5HKCA 2DYBA 2R7OA 2XPWA 4NHJA 1S29A 4A3GJ 2TRTA 1OU9A 4HQEA 2X6XA 1ULYA 2XGEA 4KUIA 1R58A 1WFWA 1ETVA 1I81A 3HOXJ 3RERA 4Z89A 5GAMj 3C94A 5J26A 4LIUA 2MABA 3V8JA 5HLHA 2F5EA 5C4JJ 1C6VX 2N8GA 4Y13A 4MZMA 3E5UA 1ZR2A 2R5YA 2FRYA 2JMAA 2SEMA 3SFMA 3QBYA 5C6SA 4F3QA 1TZLA 3K2AA 2FEIA 1M8MA 2BXZA 1EF4A 1FLIA 1QKWA 4EGYA 2FYKA 4I01A 2DXUA 2D6FA 2XI9A 3BG6A 2JJ9A 1FBUA 3CPWA 2V6EA 1AKHB 3JAME 3IH4A 1YN8A 1LOJA 4C0FA 1P2FA 2Z0WA 4I0AA 2NVXJ 3G4SQ 1IZ6A 2A5YB 4IRHA 1Q7YC 1VQ5A 1NG7A 2QTXA 2JS2A 1E2XA 2FSWA 5BMZA 4BHBA 1TTHB 4BKXA 3INZA 5LJ3j 1YJWT 2STWA 2RD1A 3HKZN 5ED4A 4B9WA 3HSRA 1CF7A 1FOWA 2AHQA 2LVMA 4V2SA 2XIGA 4M6XA 1ABQA 1P9QC 5F27A 2EGCA 2FNPA 5H2FC 3OS0A 4P9UA 2GXAA 2HSEB 2NUZA 1JJ6C 3DB3A 1KQSA 2VUMJ 4XTUA 3L2RA 2QBYB 2J05A 5LHIA 4U0YA 2W00A 1N78A 2P4TA 2ICWG 2PMZN 4OAYA 3ZMVA 4MEYF 1IF1A 2DRMA 2KK4A 5CQYA 3GLLA 1PD1A 3VS6A 1IZ1A 2HZTA 2ED1A 1S3JA 3CCUQ 3HXLA 3IWZA 1FJLA 1D8JA 4M7DF 2DZCA 2K40A 4N9IA 2XSDC 3HDDA 2YLCA 3JSPA 1VYTA 2QK0A 1JEGA 2XKPA 1D1CA 4LNPA 4RTTA 3CCEI 1VOMA 1OCZH 2HYGD 2E65A 4JZ4A 4G6QA 2DPDA 1Z7LA 2EWNA 1E7OA 2FRWA 3TU4K 3FIWA 2NWMA 1ZBJA 2CU7A 3ZQCA 1GVJA 2DFUA 5CPRB 3MKWB 2MYSA 4CCNA 2L02A 1KU9A 2MD0A 1SVLA 2IJLA 2BYVE 1BL0A 2CREA 2AXTC 1WKMA 2VC8A 3OOPA 2DA1A 3JTHA 3DKXA 3I4NJ 4A4EA 1FSEA 4OGEA 4CI0C 3JCMJ 3S16J 1MMAA 4F7UB 3A98A 3SDZA 2HEOA 4A3JJ 2QTVA 1J3TA 2EQIA 1V1CA 1GCQA 1PYVA 3OYDA 3AAFA 3G4SI 1NEGA 2RI5A 1IN4A 2G7HA 3TSWA 2EZLA 1RI7A 2CJJA 3CF2A 5IN1A 1OR7A 2Y75A 2YRVA 4ESRA 3R6NA 1I8FA 3JRIA 2JQ7A 4K11A 5K7HA 3TEDA 2GTJA 2WA0A 3M0UA 1LE8A 3G1JA 2JTVA 2H6BA 4BI8B 1WXTA 1K1ZA 3FRNA 3K7AJ 3A0BC 3LSJA 1A35A 4H4KC 4MFEA 1RZ4A 4JPBW 3IC7A 4PJLA 3RKQA 1GFDA 3BDDA 3GTLJ 3M57A 2P5VA 3NTHA 3G6EA 2LQNA 4CH7A 1VQLT 4IPAA 3GWZA 4XRMA 4XTWA 3OYIA 5ICCA 2RJEA 2VXZA 4WCGA 3CCUI 2IIMA 4NNJA 4Q47A 1S1NA 4WCIA 3WHCA 2D9TA 4AFSC 4HOBA 4X6AJ 1T33A 3C2GA 3QOEA 5DTDA 1ZQ1A 4EMGA 1H92A 4P55A 3FK6A 3KX2A 4C3HJ 2EINH 2QVOA 1QU3A 2AKLA 3I5UA 4JJBA 1YIJQ 1Q81R 2IVWA 1FY7A 1OFCX 2LT1A 2DLLA 1X58A 2FNAA 3PNYA 3LH0A 3DXJF 4M3DA 2R92J 3EETA 5DD8A 2P0KA 3I55A 3QU3A 3I56T 3L7WA 4OMLA 3EYIA 3CCVI 2VL8A 4W97A 2M0YA 3EFOB 2LNVA 3AT1B 2A05A 2OTLA 2O8XA 3AG3H 4QKUA 1JHHA 4HG2A 1UE9A 1KQ9A 1MZBA 4M7AA 1VQNT 1ZR4A 3MCAB 2JTFA 3L1AA 4ZDLA 3JRHA 2JSPA 4Y7NJ 4ESFA 4FHTA 1SF9A 4A69C 3GZ6A 2E2IJ 1VUBA 1OCPA 3TSZA 3TKYA 3UR3C 1VQ9Q 2XMFA 5F64A 2OA4A 4BEHA 3GFJA 4CCJA 4ZZDA 2O0YA 1G4DA 3V8KA 4Y92A 5EGOB 5GAN6 3L42A 3QG1A 3K9TA 2V9KA 1BM9A 1XS9A 5TRDA 2RN8A 3U9GA 4IUVA 1YIOA 3N4MA 2DFHA 2G7UA 4ZGJB 1K73U 1K8AC 4C92A 3SFZA 3J80Z 3FBIB 1GCPA 3G73A 4J19A 1FTZA 5GMKh 2DYIA 3CF5F 1QMCA 2VC1A 4XLNF 1UCRA 2CT4A 2GFUA 3CMAT 5DCMA 4FYXB 1I1GA 3E6CC 2KDZA 4UC4A 2IEKA 1PJRA 3JRDA 5L3GA 3QU6A 2A6HF 3VB2A 5CK9A 1T98A 5ECAA 2L89A 3TOAA 1VQMQ 5LJ5j 3EG9B 2W1OA 1B8IB 2VPLA 2EVRA 4OB0B 2RQPA 2ZFUA 5GANe 5IYBJ 3M0TA 4BXXJ 1Z21A 1T95A 1KD1U 1OYYA 4ESJA 2HEQA 2XAUA 3K4MA 1FBSA 1HK9A 4HKEA 1B59A 3JCMg 1SFUA 2K3XA 4QPQA 5E3MA 4B9XA 4KITB 3M0SA 1KFZA 1LFUP 2ZNYA 3ZQHA 1A6IA 1MDMA 3QZ9B 5GAOr 1BYMA 3BG3A 5DS9A 2VGMA 2QA4T 2L7KA 3J7AO 2DD5A 4L9VA 2PUKB 2O5RA 2QXFA 4M78D 5FJ8J 3JB9J 1YW9A 5FKNA 3DKYA 2DA4A 4PDKA 2HOTA 2VKHA 1LFPA 2KIFA 1TW2A 4PUSA 4CCKA 1OEBA 1Y0UA 3CCSQ 3OS2A 3PE0A 1VNDA 4I99C 4Z2YA 3LAPA 2M16A 4LDUA 5LLQA 3VS5A 3VEPA 5I22A 5M3FJ 1AWCA 4O6JA 3K2ZA 1AZEA 2HKNA 4M75G 4J83A 5D7UA 1RC9A 2L7FP 2R7DA 2JNGA 4U0VA 3AFHA 1VQ9I 2ZZDA 3BY6A 1WI9A 5EJCA 4M75D 3VYRB 1YRNA 2FZGB 4G8XA 4M71A 3OL3A 2VOOA 1IUFA 3MHXA 5GAN8 4R55A 4CCMA 2CV0A 1Q81C 1PUEE 1VQ4A 4CC7A 4BXFA 1W2BA 5IYCJ 3GTQJ 1Z9ZA 1Q86U 2JUGA 2RK2A 2G3RA 3FLGA 2XIDA 2KHMA 2LY1A 3H0GJ 1AZGB 4BAYA 1IRFA 1SANA 1BN5A 1A0NB 3K1MA 5D6FA 2RH2A 3RI4A 2M1HA 2DJZA 2K6DA 1QZEA 1RL2A 1Q1HA 2XRNA 3C95A 4WXDA 5HS8A 3JAMK 1Y71A 1BBZA 1OCRH 2CSIA 3TP0A 1M90U 4M7AF 2CQXA 5L3DA 3ABTA 5HLTA 3OQ5A 1GXQA 1Y6IA 4RTYA 1RAHB 4PJMA 2LRDA 3PT9A 1YITT 3LQQA 2ZPEB 2HI3A 3EQLF 3TQNA 4EJOA 3W2WA 2E12A 1K9AA 1Y7XA 1ZSZB 2EIFA 3PNTA 2DA6A 4PSWA 3BTLA 2P0WA 1YWOA 4KGXB 4M3FA 1HDDC 2YUNA 4EJUA 4BE0A 2XSJC 4XK8E 2WC2A 2CO5A 2EIMH 2ZFWA 1SRMA 1VQ5Q 5IHIA 3GUDA 2XRLA 5HK0A 4E6KG 3IWFA 1CSKA 1TWBA 3HHGA 2DZ9A 4X9CA 5D5XB 2KP6A 5GAHJ 3TEEA 2L3DA 2M2EA 2RA2A 4QIWN 2YX4A 2VOPA 3CCSI 1SEUA 1PSFA 3MZ8A 3LWHA 1M2VB 4A4GA 1JXOA 2Y9YA 1UGSB 2QASA 2DBKA 2H8HA 2CFOA 1NEBA 3VYGA 4GGGA 3F6VA 2MC3A 1BR2A 3FMRA 3CMET 1USTA 1X1PA 2L5QA 2L8DA 2J6OA 2JN0A 4CA0A 2EGAA 4PJOG 2DI3A 1R4NB 4BU2A 4IRGA 1IV6A 5KCMA 4GBQA 5KYYB 3CC2I 2CRGA 2O4XA 4PJOD 4EDUA 2M7BA 1FNNA 3OYJA 1W0TA 1LJOA 2L9SA 1TG0A 1EX4A 1YJNA 4HT9A 2DMTA 3DBLB 3QP6A 4RG8A 2OBPA 4M7DE 2VGNA 5DYMA 2F5FA 5J1UA 1AA7A 3PNWC 1RNLA 2J6KA 1TSFA 2EIJH 3ZQ7A 2FBKA 3F6OA 2RHIA 2EZIA 2RHXA 4LG0B 4DYCA 1Y0NA 3KEQA 4HEA2 1OZ2A 3RDVA 4A63B 4A6DA 3X2QH 4ZZLA 1SHGA 4X1VA 2QSHX 1OMIA 4OF1A 2F2EA 3CCMT 3MMYB 1N6AA 2DTZA 2EYZA 2KT1A 3RYRA 3ABLH 5TJJA 3GZ5A 1QVFP 3ABUA 4HV6A 1ZGWA 3VS1A 5DDGA 1H8AC 1U5TC 4LUDA 3C7JA 2Y0MA 3MKYB 2NS0A 3KFVA 2M3AA 2VT3A 3FMSA 3A1YA 4KGZB 3HOSA 2HTJA 4S0HB 1ZSZC 1NBEB 1M1KR 3C2BA 5HK3A 4A3IJ 1D1BA 4ZTFA 4A5MA 1BR1A 2QDLA 1REPC 3HOUJ 4HVWA 2VKVA 1YI2T 2VVKA 2QCOA 2K57A 4D9JA 4RTWA 3JCMW 1ZGAA 4JYKA 1AD5A 1TOVA 2DA5A 3SFIA 3KZIC 2HQAA 5F6FA 2EFNA 2YR2A 3RQ4A 2NUPB 1SKUB 2DMUA 4Y17A 2X4HA 5J1YA 4P1WA 1VQ6T 2XKOC 3CCLT 4DBFA 2Z99A 2M34A 1CKBA 5KNLA 2NXNB 4PGGA 3CXCA 4DBRA 3HSFA 3DCFA 5L23A 4OVAA 1K0XA 3S6WA 5LGTA 4AFZC 3GLXA 4OIQF 4A2UA 2GZWA 2YPRA 3IQLA 4ETSA 3J81Z 2RC4A 5FKMA 1D5YA 4U87A 2COYA 1VQ8T 1JE8A 5KVRA 2EQMA 1YG2A 1USSA 2OUMA 3A5ZB 4ME7A 4TVRA 2P5LC 2PU9B 4MDXA 1IJWC 1T0FC 2Q2EB 2KYBA 4BXUA 4QVCA 1TWHJ 1O3SA 2E41A 2P6TA 4BL0B 1EJ9A 3I59B 5CVVA 4BJ5C 1N9RA 2I2LA 2RHZA 3PVQA 4C2UA 1XG1A 3I55Q 4LK0F 4IIOA 3LA3A 1QVGS 4KH0B 4HNVA 1YS7A 1SMYF 3Q5FA 4M3GA 2DERA 3R0JA 3M55A 2OTLQ 3EYYA 3VFZA 2FMLA 2MK5A 4EV0A 1Q95G 1IB8A 5AT1B 4LOCA 3OSFA 2MMPA 5GAMd 1KYWA 2KMTA 1X43A 2BKDN 1V55H 3ZCOA 1QQIA 3DV8A 1W4SA 4M75B 2IA1A 2RQWA 2DL3A 4DGWB 2C06A 1IHWA 1LQ1A 4X1EA 4CYCB 3SEQA 3BPVA 1QCFA 1ZYRF 3DU5A 1IN6A 4L9TA 2LDMA 5EC7A 4N0AC 1HJDA 3CCEA 5CCAA 2ZXJA 2BIVA 2EK5A 2FZKB 1PKSA 3PFSA 4JJDA 2E5ZA 1YITQ 1BK2A 1B72B 2RQTA 3HRSA 4U7DA 2JA5J 1WGXA 1I0CA 3HEFA 2V1XA 4IHTA 1OPCA 2NUTA 4CCOA 4EMKB 1X6GA 4OMNA 3SWNA 2XDBA 1UHCA 2IRFG 1MBEA 2PJPA 2DIGA 2ED0A 3Q9VA 1IXCA 5LJ3d 1KK7A 1HOMA 3EGXB 2KQWA 2EW3A 2KE9A 5C4XJ 2K85A 3WU2C 2VKEA 2JVGA 3THKA 2W10A 3M9QA 2H6CA 2PFBA 1YP5A 5CQXA 3LFUA 2HOSA 3KEYA 2ZSIB 1UG0A 3HOVJ 2KVQG 3IH2A 1TWAJ 1WJDA 1NHAA 2R7SA 4IUTA 1MNEA 2Z5UA 1FOXA 1M3BA 1UJ0A 1M1KC 4PFOA 2RI2A 2DETA 1PWTA 2HS5A 1WJQA 2JW4A 3ROUA 3H5AA 3UNGC 1FMWA 2XAFA 3AHUA 2EFWA 2L0KA 1WHGA 1YNZA 1H641 2MI6A 3QJYA 5FLMJ 2D1HA 2MGQA 2W85A 2DMQA 2ZSHB 4UUSB 3I55I 1F5TA 1N25A 3QPHA 5FFZA 1I1JA 2EFOA 3DU6A 2DL8A 3BR0A 3L9FA 2QGFB 3FB9A 4HNTA 1VQPI 1I5LA 1FTTA 2NVYJ 4Y3OA 2K5LA 2RHYA 4LDXA 1U1TA 2EBIA 1UGRB 2IAIA 4EQQA 3GFMA 4HAMA 3H9NA 1JGGA 2ELHA 2GXBA 4UVAA 3EGDB 3KUFA 3SYTA 2B9SA 4A0ZA 2RVCA 1KQ8A 2JSCA 4JX5A 1NK3P 1Z1DA 1RIOH 4PJOB 2C0TA 2QENA 2FBIA 1S9HA 4M75C 1NYGA 2PBIA 1HDPA 1R4MB 1WVRA 2E1MB 1SD5A 5GTHC 1Q1VA 3A01B 1IGQA 1D3BA 1ZUUA 3M56A 1H8KA 4J9HA 3GMEA 2K9MA 1Y8QB 3M1CA 1NG2A 1YS6A 4M77A 1VQ4Q 4OOIA 2FX0A 4JRPA 1CKAA 2IGOA 3M53A 2Y90A 3S93A 1OCTC 4RGUA 2LR8A 4EPCA 3A4CA 5GAMf 1G3TA 1D3YA 3EUHA 2J06A 3H6ZA 3ECHA 1DU0A 2IA2A 3BPXA 3CCVA 3ZQIA 4OAZA 3SEZA 4QQDA 1K4TA 4NC6A 4GYIA 1B34B 2WY7Q 1IGUA 4I02A 1WI7A 2QLZA 2PJRB 3A8LB 5TISC 1O3TA 1M4ZA 1OPLA 4EMKC 2BY3A 3TBIA 3LW5E 2L9NA 4RGXA 2JWTA 3N5BB 2OAUA 4HLXA 1W36D 4HNUA 4IQJA 1WQWA 4UNOA 3C12A 4KT0E 5GMKe 3CUQA 4HVVA 4H0EA 1RABB 4M7AE 2YUOA 4LD6A 4L18B 2DFEA 2ADUA 3GO5A 1UMQA 3LMMA 3OYAA 1ZRDA 3WE2A 2KRCA 1U3EM 1E6HA 3E9FA 3UF4A 2OAZA 3FXMA 2X6YA 1Z9CA 4XU0A 4YG2F 1UGPB 2DMPA 2LX9A 3JCMd 4EJVA 2QSGX 5LJ3f 2CGPA 4PCQA 1KA8A 1P7JA 3KYLA 2DMNA 2AIRB 2VXFA 4C3JJ 2ZPFB 4E7KA 2L9VA 4NDLA 2DJIA 1Y0MA 2AZVA 5J8FA 4C92E 1I50J 3I4PA 4N4OB 4DJAA 1YJ9I 4C5EA 2XD0A 5KAFC 2FQ4A 3ZBDA 3JB9G 2FXAA 1NZ9A 3G4ST 1ZARA 2F1LA 1RAGB 5C3EJ 3CJNA 3VYTB 1V3FA 5L3CA 3SEMA 4AYBN 4G7ZF 1X1CA 5F08A 1EFNA 3ZN1A 3G2BA 1O3QA 2WV0A 3WGHA 2V1QA 3JB9D 2CYZB 3SZPA 3M9AA 5J8CA 1DQUA 2W48A 2VN2A 3GFLA 2DTIA 4Q4ZF 2E6NA 4XQ3A 1Q82R 2DX1A 1OPKA 3VWBA 2BZ8A 3A8OB 4AD9A 2E7XA 2X9HA 3QIIA 2PTKA 4AG2C 1PKTA 4ON0A 4Q5SF 2DKGA 2M7AA 4CYDA 1U6GA 3OS1A 4YIFA
chains in the Genus database with same CATH topology
3F70A 4PJOC 1XMAA 2DO7A 5FU6B 3W6JB 1JJ2A 5JR3A 5LHGA 1Q81U 3CLOA 1T2KA 4UXNA 3RESA 4QQGA 6PAXA 3OBYA 1O9SA 2EQJA 5FO5A 3CCUT 2XHKA 1ZRFA 1LB2A 3LFKA 4HA8A 2V8IA 2ISYA 3HIFA 4N0BA 3CPWS 1R1TA 1IN8A 2Y4YA 4IVNA 5LJ5d 4MDWA 2D1VA 1HW5A 3TO7A 5D6EA 2V1UA 1BIAA 3V8LA 5KE3A 5D6YA 1VQKA 4JS4A 3MWMA 4M77F 1B6AA 4KN7X 4X9DA 2DU9A 1W7PA 3MP8A 4M78A 2F5DA 3E6BA 3OYCA 5H20A 5HDGA 4L59A 2GXGA 1YO5C