3HRUA

Crystal structure of scar with bound zn2+
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
213
structure length
211
Chain Sequence
PNKEDYLKCLYELGTNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
molecule keywords Metalloregulator ScaR
total genus 64
structure length 211
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hruA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hruA02
3RKWA 4O6JA 4HLYA 3ZPLA 2RNJA 4LB6B 1CF7B 1IW7F 5K5RA 1KQ8A 1U78A 1QO0D 1SMTA 3GZ6A 4LK1F 2KIMA 3JAMZ 1LEBA 1RIOH 4UVCA 1XSXA 2M5WA 2G7UA 3E19A 3EQLF 5CLSA 3V8JA 4IVNA 2EK5A 3F8CA 1IAWA 1FT9A 2FMLA 4HV6A 4KIBA 6PAXA 1YW9A 3TQNA 3RYPA 4FX0A 3E6MA 3D0SA 3L9FA 3VEPA 1W7PD 2FBHA 3E6CC 4IRIA 4ZYHA 1FSHA 3EUHA 3WODF 2XAGA 2XV4S 3KFWX 4HAMA 1ZGJA 4M74A 1SFXA 4HA8A 2A69F 1FBQA 1BM9A 2DBBA 4HDVA 2XAFA 1RNLA 4U0WA 1D5VA 2WWYA 3V7CA 2MC3A 4Q4ZF 3Q5FA 1R58A 2M30A 3BJAA 3E5XA 4A0YA 3BDDA 2P6SA 2VONA 2WTEA 1MZBA 1GXPA 5HDNA 5L3GA 4PDKA 4UUVA 3ABUA 1YFHA 1P92A 3ZN0A 1KA8A 1Z7UA 4G94A 4HQMA 3NRVA 2KJCA 4EM0B 2NS0A 3MFKA 2NYXA 1ZH5A 2DAOA 4KIFA 5ED4A 4L18B 1IRFA 1G3SA 5LRRA 3N97A 3SXYA 4JK1X 2IPQX 5E8GA 1HXDA 1XCBA 5LEKA 2F5CA 2GQQA 3LQQA 4LLNA 4ENJA 2A68F 2XAJA 2HR3A 2K4BA 1QQIA 3LFKA 4YIIA 2QQBA 2ZO4A 1DPRA 1I1GA 3HTSB 2OQRA 3RJPA 1TNTA 4A2UA 3P9IA 3CUQB 1SMYF 2CO5A 3DFGA 5ILSA 1FX7A 5FFXA 2KJBA 3GZ5A 2KIUA 4G7OF 3EYYA 3PQKA 1UB9A 3WGGA 4RS8A 2QLZA 2HTJA 4I0BA 3HIFA 3P9KA 3IWZA 3JSPA 1BIAA 1BI2A 1P6RA 4HX4A 2JSCA 4OMZA 2NAZA 3OOPA 3WTVC 5LGUA 5K5OA 3NEUA 2ZNYA 4MGRA 4RB2C 1K78A 2ADUA 2Y48A 3AAFA 4ZYGA 1HW2A 5LGTA 5H20A 2D45A 1HKQA 4QWQA 1KGSA 3ZMTA 1KU3A 2K02A 1L3LA 2NNYA 1FOKA 4U88A 2LF7A 4HQEA 3ULQB 5CYVA 1FYLA 3M9AA 2W85A 4G7ZF 3VODA 4LG0A 3KP4A 1K79A 2MA3A 4FX4A 4CICA 4E70A 3WTXC 1XGMA 5IT3A 2R3SA 1QNTA 2UZKA 3L09A 3JTHA 1J0RA 3LA3A 1S7OA 5BPDA 3WTTC 5ILVA 4KMFA 2QBYB 2UXXA 3LAPA 3WE3A 2M8EA 1R1VA 5FGMA 2L4AA 1D8JA 1I1SA 1MJBA 3IWFA 2BGCA 2BBYA 5F6FA 3J80K 2L54A 2FNPA 4L0ZB 5LHGA 1USSA 1W7PB 4YFXF 3I5UA 1OMIA 3V7RA 3DP7A 2RGVA 4XLNF 1JHFA 1G6NA 4EV0A 3BJOA 2V79A 4OIQF 1O3RA 3GO5A 2PQ8A 4HX8A 3KEQA 2VXZA 3T8RA 1MJ9A 1EH6A 3EETA 4A0XA 3QAHA 1J75A 3LA7A 2Y0MA 3HRSA 5D4RA 1K7AA 1JXSA 4L5IA 3HTUA 5E1WA 2A61A 1I5ZA 4WCGA 4G7HF 1ON1A 1BC7C 4I01A 2A5YB 1SD7A 2RC4A 2COMA 4NB5A 3TO6A 1ZLKA 5LHHA 4XBFA 5L3EA 3N4MA 2CW0F 4GYIA 3CUQA 4DQ2A 2O03A 3RPQA 4LMYA 2G7HA 4MQ9F 4DNCA 3GEZA 2O3FA 2XASA 3TDUC 4KN7X 1NHAA 3KZYA 2ZMEB 3J81Z 2K5LA 1G3YA 3DEUA 4MNUA 2R7DA 2F5EA 5FO5A 1ZG5A 2EFNA 2MH2A 3F8FA 3QP5A 3I71A 2P7VB 1ZREA 1XDSA 1FZPB 1JE8A 3O2PE 3H92A 1IN5A 4UNOA 1FSEA 4ZZLA 2MD5A 2FRHA 1OYWA 3IRRA 1QVPA 3O6BB 3U1DA 5D8KB 1YW7A 1EH7A 3GUDA 1P2FA 3SQNA 5D5UB 4RB3C 2HQNA 4Z2YA 1TQMA 3GF2A 1QZYA 1XMKA 3E6DA 5E8IA 3GFIA 4A5NA 3K9TA 4KNYA 3IHUA 3B73A 1Z91A 1LEAA 3BJ6A 2W57A 3JTGA 1QPMA 2YPRA 1ZG1A 1C0WA 5L3DA 2L4MA 1Z6TA 3F8MA 2DK8A 2CSOA 1XD7A 1XGNA 3EDPA 1W5TA 1ZG3A 3JAMK 1YYVA 1G3TA 2H09A 3KP6A 5ICFA 4LGWA 2V9VA 4A6EA 1U2WA 3F6OA 3DQVC 5DD8A 5HOOA 1T0FA 4ASNA 4RGXA 5LRSA 3HSRA 3TOBA 1EH8A 4KMUX 1HBXG 3ECHA 2K4YA 2ISYA 4LG0B 1IN8A 2GCXA 2H27A 1LVAA 3I58A 3P9CA 4AIJA 4WXDA 5J8FA 1TQIA 3FMRA 1XDUA 2GIVA 4BNCA 2O8XA 4AIHA 3RPUA 4YIFA 1R36A 3KP7A 3R6SA 1PP7U 1O3SA 1J9IA 1O3QA 1X3UA 2OBPA 3R60A 1FP2A 4P96A 3F21A 2FMYA 2IA2A 5CVIA 5D8LB 4M9ZA 4CYDA 4KA4A 4N9HA 3TO9A 1PDNC 1OYYA 4IRGA 5E20A 3V4GA 3MAJA 1SFEA 2HTSA 3RIRA 4HDUA 1MDMB 4I0AA 3K1NA 3L7WA 4KN4X 4ENKA 1FBSA 3JW4A 1FYKA 1SAXA 5DV5A 2XIGA 3ABTA 2PEXA 3FF5A 4IJAA 4GYGA 3KLNA 2FSWA 2EA4A 3REOA 2BV6A 3GFJA 2EA2A 4ZH4F 5DEQA 2M1BA 4LD5A 3CUQC 3MCZA 3MZHA 4NHJA 2HGCA 2D1VA 4HV5A 2ZMEA 3T5XA 2RVCA 1LJ9A 2FU4A 1J7KA 2MH9A 2IA0A 1YS6A 4OOIA 5BMZA 2V1UA 3RDIA 2H6CA 4BXUA 2VODA 3E97A 2EFQA 1FWZA 2QM3A 2RDPA 2V6CA 1ZN2A 1R23A 2JTVA 2EV6A 2VBXA 4M6YA 1BJAA 2LKPA 4GXOA 2QQAA 1U8RA 3RKYA 2P8TA 2CYYA 3BPXA 5KVRA 2EV5A 4GCVA 4RB0A 1XCVA 1IZ1A 1ZRCA 2J5PA 2XVCA 2BYVE 2V1XA 3GYHX 2PLYA 3VOEA 5JFRA 3H3ZA 1OYIA 3R61A 5HS9A 3WTZA 3I54A 1FNNA 1MDMA 4GO1A 4LLLA 3EYIA 3DPLC 1ONVA 1IXSB 2STWA 4UV8A 3E5QA 2CQKA 2G9WA 3IKVA 2IJLA 2LNBA 4HLXA 1Q1HA 1WQ2A 3COAC 3R0AA 1IUYA 3W6JB 5L3BA 2RN7A 2F5DA 2XKOA 2A07F 3FWEA 2ESNA 1T98A 2XAHA 1RUNA 4RGSA 4ENMA 2L02A 1PP8F 2EWNA 1WWXA 2P6TA 4PCQA 4KIGA 4OIOF 1DP7P 1CF7A 1USTA 1XSDA 4YG2F 3SHFA 2OAZA 1REPC 1KYZA 1TW3A 3MQ0A 2DW4A 5D5VB 5FB2A 1YQAA 2IP2A 3MHXA 2Z5UA 1TLHB 3WU1B 5J8CA 1YW8A 3WU0A 4I7HA 3QRFF 2ZFWA 3WTUC 1STZA 1H9GA 3BY6A 4KUMA 4HBLA 5DYMA 3CUOA 4YFKF 4FT8A 2FQ3A 3WGIA 5LLQA 2Y75A 3FZVA 5H6QA 1E17A 2H94A 1BYMA 5DDGA 1R1UA 2CG4A 1U5TC 3MZYA 3ZMVA 2X0LA 1SFUA 5FLXK 2H6BA 4LJZF 2ZXJA 1QBJA 1XSVA 4MTEA 4U0YA 2PMHA 2F5FA 3HOTA 3Q9SA 4HYEA 4G6DA 2HWVA 2PJPA 1KU7A 2W84A 1DDNA 4EJTA 3K1PA 4XSZF 1F4KA 2Z9OA 2QYOA 2DQLA 4PGHA 3TKYA 3ERED 4EGZA 4EJWA 4WK8F 3FMQA 1PUEE 5F64A 3HHHA 3ZMSA 4BH9A 4EMSA 4EJVA 2QZ8A 1QW1A 5EEGA 4M9XA 2ZNZA 2E7WA 2X4HA 2A3SA 4BAYA 3JSOA 4L9NA 1J5YA 3J80Z 3GWZA 5E1XA 3F3XA 1U6GA 1YG2A 4O3MA 5FD5A 2HFHA 2EB7A 4HW0A 1JHHA 1KQ0A 2IW5A 1LDJA 2UXNA 1OKRA 5D4SA 3KCCA 1LB2A 4LB5A 2AS5F 2YU3A 5FLXZ 4HF0A 1KU2A 2DQRA 1J2XA 5H6RA 5ICEA 3KP5A 5CVJA 4H0EA 1GVJA 4BHCA 2H3JA 3U9GA 1Y0UA 2BE5F 4BHPA 1R5HA 3K0LA 1OPCA 3E6BA 2QBYA 3WGHA 2EFWA 3CLOA 4UVAA 3ZMUA 1SD4A 4U7BA 1RUOA 1UFMA 2EV0A 5DUKA 1T2KA 3WTSC 2O0YA 3CTAA 2HDCA 5BQTA 4IF4A 2K5FA 4MEXF 1LQ1A 3KETA 4Y17A 3V8LA 4L9TA 3DPTA 1YIOA 3GX4X 1HW1A 3T0YA 1T6SA 3DKWA 3K2ZA 2M87A 5D6EA 4CGZA 1BI0A 1T38A 1IXCA 3TDZC 1ZGAA 4OU0A 1BN5A 5E17F 4K2EA 3ZMDA 2A6HF 3G73A 2HS5A 3ELKA 2LF8A 2DK5A 2ZJ2A 4OIPF 4L9VA 5AIPA 1JGSA 2XRNA 1ZHFA 5D5XB 1B9NA 1ZRDA 2A6EF 4XLPF 5CJ9A 4EJOA 3BPVA 4I09A 2QWWA 1ZLJA 2K27A 3WTYC 4A5MA 2K5IA 4Q47A 1R1TA 3LA2A 4PZJA 4KYWA 4RGRA 1TQPA 3ECOA 3QOPA 1I27A 4L5JA 2VBWA 1CGPA 3PQJA 1BIBA 1IN4A 1SD5A 1HKSA 3RYRA 2QENA 4D0PA 4Y13A 2NRAC 2E1CA 3NQOA 4AD9A 1G4DA 1S8NA 1XB4A 5KK1A 2V1DA 2KRFA 3I59B 1MD0A 5HLHA 2FXAA 4ZYDA 2PBIA 4M6XA 1KYWA 1I6XA 1DPUA 5DCMA 2YR2A 3I4PA 3M8EA 3SZPA 3O3KA 1QGPA 1S7AA 1YO5C 2GZWA 1BOAA 2CFXA 2WV0A 5HDKA 4UHTA 2STTA 4R8HA 1TTYA 4EM2A 5E1ZB 4CXFA 2EJRA 3GVAA 3GFMA 4KT5C 3FX3A 1DUXC 3CDHA 3I64A 5K1YA 5FFZA 3V7SA 2Q2EA 1AOYA 2HEOA 4MHGA 4JQFA 1ON2A 3TGNA 1YTYA 2DTRA 2O6GE 2QQ9A 1IRGA 2DFIA 3ISPA 4ZZDA 3IKTA 1D8KA 1R7JA 2DLLA 2OU2A 3GW2A 4OIRF 1RZ4A 4A0ZA 2W24A 4QLCU 5E18F 4A6DA 4I98B 2FE3A 1WRJA 5DD4A 2JT1A 2ISZA 2ZKZA 3E3VA 4HF1A 2XGXA 1B1BA 1XMAA 4ETSA 1LDDA 2EFOA 3FMSA 4MTDA 3FHZA 4KICA 2XHKA 4FHTA 4LK0F 5DCFA 3S2WA 4WXCA 5AIQA 5LBQA 1P4AA 4IXAA 1L0OC 3R0JA 1UCRA 4UXNA 2FNAA 4A12A 1K6OA 4M9SA 5IT9K 5HVQC 2DPUA 1MJAA 4GGGA 4N0BA 4L0YB 2DO7A 4U7DA 4EVIA 3SZTA 2GXBA 1IXRC 5K5QA 1F5TA 3QPHA 4ESJA 3PFIA 5DUIA 3TOAA 3C3WA 3HRMA 1U3EM 3B02A 1BC8C 4F7ZA 1EV7A 3HSFA 5J6XA 3L2CA 4P9FA 4Q48A 2L01A 2XUBA 5FD6A 2FF4A 4RAZA 4N9IA 4B8XA 2ELHA 1HSJA 1P4WA 3R4KA 3GXOA 2Q0OA 4M72A 3IRQA 2HYFA 4IRHA 3GFLA 1XGOA 2AXLA 3QP6A 3WE2A 4KFCA 4LLGF 3E5UA 2NNNA 1MKMA 2P5VA 3ROUA 2D1HA 2FBIA 3C1DA 2HKXA 1G3WA 3K1MA 4ON0A 3DF8A 3QU3A 2UWMA 2K86A 2QUFA 4ESBA 2D2WA 3C18A 4Q5SF 4KDPA 2YX4A 5BPIA 1IN6A 2M45A 1Z05A 1V3FA 3G3ZA 3M1EA 3SFZA 1LNWA 1O7FA 3KE2A 1IN7A 2DU9A 2GAUA 2J5OA 1TW2A 3FXRA 3DXJF 1Z9CA 1MGTA 4BHBA 3M8FA 2VOPA 4WX9A 3IC7A 4OINF 2ETHA 1ZYRF 5CVUA 5D5WB 3WG9A 1D3YA 3HYIA 2JPCA 2O61A 3P7NA 1S3JA 1W4MA 3I0TA 4LFUA 1XGSA 5LGNA 4CHUA 3KP2A 2IRFG 4O5VA 3RKXA 3WTWC 5D6FA 4BYYA 4P5OA 5JI6A 5HLIA 1IF1A 2VT2A 2RQPA 4CO8A 2C6YA 4B09A 2WC2A 4IPAA 4HOBA 1BI1A 2P5KA 1TNSA 3ML6A 4UVBA 1B59A 3LQRA 5TRDA 2RV8A 2OD5A 4XRFA 2EFPA 3U2RA 2PG4A 2LDUA 3D5LA 2FA5A 3IL2A 2F2EA 2DPDA 5LEJA 3CO7C 4XSXF 3ZMZA 3LWFA 1B6AA 5ERIA 2DT5A 1FP1D 3T8TA 3MWMA 4PGGA 3TO7A 2VT3A 4UV9A 2P4WA 5IT9Z 1E2XA 1LDKB 1R22A 3HUGA 1KQ9A 4Y15A 5AONA 3LAJA 5HDGA 1J59A 4S04A 1HSTA 5ILUA 5HS8A 1S6LA 4JBAA 3GLXA 3KEOA 5EEHA 2GXGA 1ULYA 4AIKA 2CGPA 4M73A 1O3TA 2GA2A 1FY7A 5TJJA 2K7LA 2R7FA 2VE8A 1H9TA 2HYGD 5HLGA 1AWCA 2L3DA 2FOKA 4AVPA 5F1RA 4EQQA 1GHCA 4L9JA 1SD6A 5BOXA 2VC1A 1RI7A 4WF2A 3FXQA 1HQCA 1W7PA 3KP3A 1FC3A 1WI9A 1WKMA 4IHTA 4S05A 1BI3A 5HS7A 3K69A 2DI3A 3HSEA 3RI4A 2PN6A 1FBUA 3ZP5A 4EJUA 2IA1A 5LHIA 2MBFA 2B0LA 4ZYEA 1FYMA 3M7GA 2Z33A 3BP8A 1GXQA 5ICGA 3BOQA 2P5LC 2QVOA 2IVMA 1K78B 2XAQA 1F1ZA 4P9UA 2HZTA 4G6QA 2VBZA 1O57A 2HQRA 3KLOA 1YLFA 2JZYA 3QPTA 4I02A 2Z99A 3DV8A 4P55A 3I53A 1R5GA 2ESHA 1S29A 1YS7A 4G8XA 3CJNA 1B9MA 1UHWA 2ACJA 4R1HA 1ODDA 2BEOA 2TDXA 3J7AO 4G9YA 1ZARA 2IT0A 2VE9A 2W25A 3OV8A 3J81K 2PI0A 5JHUA 2LX9A 2Q8KA 3F72A 4MQVA 5JVTA 1B4AA 5ICCA 2OQGA 4R79A 4I2OA 3HRTA 2K4JA 1W5SA 1KU9A 1VTNC 3F22A 3F23A 4HF2A 2RKHA 2Z3YA 5A2QZ 2GWRA 2XROA 1H0MA 1U5TA 2OZUA 1V4RA 3MEXA 1U5TB 4IHSA 2LSOA 2ZCWA 1ZRFA 1FPQA 1R00A 2P7CB 3W6KB 2FEZA 1A04A 1HKTA 5DCMB 2JRTA 2OA4A 4EM1A 4HX7A 3CO6C 2PFBA 3Q9VA 5JR3A 3I59A 3FM3A 4RB1A 1F9NA 2GA1A 4BQAA 3FXUA 4WXHA 2OZ6A 2VN2A 2ZBKA 2CWEA 4U0VA 4ESFA 4HZFA 4CDGA 3F6VA 1O7LA 3QU6A 5CVVA 4TV7A 1Z6RA 1OR7A 3V8KA 3VB2A 2MLGA 4M71A 3F8BA 1QZZA 1FLIA 3BZ6A 2PMUA 4RAYA 1HW5A 2KKOA 5CVRA 3F8NA 3H3UA 1TBXA 4MEYF 3ZN1A 4EGYA 1UHMA 3C7JA 3KZZA 4CZZA 2VBYA 4RGUA 2E7XA 4NQWA 2YSRA 2HKOA 3HOSA 2JPBA 1WSUA 2E1NA 3BWGA 3L00A 1P4XA 2HOEA 3BROA 5L3FA 5L3CA 2KIFA 3RTRA 4AWXB 1Z1DA 3HRUA 3LSTA 2XKPA 1XN7A 2VOOA 3VFZA 1T39A 3HHGA 2FBKA 4ENNA 5BS6A 4OMYA 1ZAOA 4YFNF 5A2QK 4WWCA 1BBYA 3FM5A 3T1BA 2MLKA 2YX7A 2VC0A 3ZQ7A
chains in the Genus database with same CATH superfamily
3RKWA 3GPLA 1KONA 3SFIA 3EG1A 4O6JA 4HLYA 3ZPLA 2RNJA 2QSGX 4LB6B 1CF7B 1Q86C 5B1BH 1ACMB 3ZGKA 2WSCE 2RN8A 2ZPIB 2DO3A 1IW7F 2UV1A 4F93B 3DTIA 1W36D 3MKZA 3HC7A 2YWWA 3O8VA 1UEBA 5K5RA 4B3AA 1KQ8A 5GANj 2HZYA 1U78A 2DYSH 1QO0D 1SMTA 3GZ6A 4B9XA 4LK1F 2KIMA 3JAMZ 3CC2A 2OTJA 2ELKA 4MZTA 3UT1A 4BBRJ 1LEBA 3CC4I 4ITVA 3OYEA 1X19A 4F92B 2EYWA 3HTRA 1GXIE 1RIOH 3GBGA 2IGOA 4UVCA 2VKVA 1N9SA 1WHJA 2ENMA 2I5UA 4M77D 1XSXA 2M5WA 2G7UA 1IHWA 3E19A 2E6NA 4UUTA 1SEUA 2HI3A 3EQLF 5CLSA 2X6XA 4IVNA 3V8JA 2EK5A 4A3KJ 1YI2I 2CW7A 3F8CA 1IAWA 5HK0A 4C8QC 1JT0A 1FT9A 3CMAT 2FMLA 2DEQA 3A4CA 3PO3J 4HV6A 3CCSI 2QTVA 3EUAA 4KIBA 1UUEA 2KQRA 6PAXA 1YW9A 2FB7A 2H8WA 2V4JC 3TQNA 1U9NA 3A01A 3RYPA 4JPBW 2K6DA 4FX0A 3E6MA 2X9HA 3D0SA 2EQIA 3OS0A 5AYFA 2Y4YA 3L9FA 1M5Q1 3VEPA 1W7PD 3CCQQ 2FBHA 3E6CC 4RTTA 3GF5A 2KGTA 3HKSA 3X2QH 1YN8A 2DK3A 5GANe 3CMET 4XRMA 2RHIA 5IYBJ 4DBRA 2COBA 4DYQA 4IRIA 3JCMQ 4E47A 2NVXJ 4ZYHA 5GANg 3JCMW 1FSHA 3EUHA 3WODF 1YHQQ 4RG8A 2XAGA 3VPRA 1X2NA 4PK4A 1MUZA 2DXBA 3SWNB 1WDXA 2ZXIA 2XV4S 1WPYA 2E12A 4CUGA 4A3GJ 1OCRH 4BL0B 3QG1A 3X28B 4XOPA 3GTPJ 3EFOA 3KFWX 5CKFA 2KDOA 4HAMA 1ZGJA 1BKBA 4M74A 4BS9A 1MHNA 1SFXA 4IIMA 2RHUA 4HA8A 4J83A 5EDNA 2A69F 2KRMA 1PCXA 2DL4A 1AVZC 2CUDA 3S32A 5J40A 2RO0A 1FBQA 5ECAA 1R49A 1BM9A 4D8KA 1OZ2A 5I2MA 3M07A 3AHUA 2A7YA 2DBBA 4HDVA 1VQPA 1SPKA 5H2FC 1WLPB 3CC7T 2BY2A 4BQOA 1WQWA 2XAFA 1RNLA 4U0WA 1D5VA 4GRIA 2WWYA 1HF0A 3V7CA 2MC3A 1YP5A 4Q4ZF 3Q5FA 1F43A 1RR7A 3MVPA 4RTUA 1R58A 2M30A 2PX9A 3BJAA 2DE0X 2HQAA 2CU7A 1IC8A 3E5XA 4A0YA 5IAYA 2CV2A 1X2QA 1GBRA 3L2VA 1PD1A 1MNDA 2P6SA 3BDDA 2VONA 2WTEA 2ZXWH 3FBIB 2BW3A 3OL3A 1K4TA 1MZBA 1U3OA 1GXPA 2CUBA 5HDNA 3CJQB 5L3GA 4BY6C 4R0KA 4PDKA 4UUVA 3ABUA 3ZQIA 3K70D 4J6XA 1YFHA 2PVDB 1P92A 3QZ9B 3ZN0A 1KA8A 2HBWA 2XRLA 2XAUA 1Z7UA 3CCJA 2ATCB 1VIFA 4G94A 2KP6A 2JA5J 2MABA 3HL8A 3MJXA 2M7AA 2HCKA 2LK2A 2E70A 4CZCA 1JTYA 2F2XA 1D3BB 4HQMA 3CESA 1M2VA 1PSEA 3LLRA 2DERA 3NRVA 2DBMA 4MZPA 4HPQA 2KJCA 4EM0B 5E3OA 3S8PA 4FASD 1UGQB 2V8KA 3MEUA 1VQ7Q 2NS0A 3BZCA 1XNIA 2K9SA 1SHFA 3MFKA 2Y90A 4NOYA 4PLLA 2NYXA 1ZH5A 3QO3A 2YS9A 2L5QA 3SDBA 2KEAA 3LYIA 3PIPA 2DAOA 3F9KA 4CCLA 1KQ1A 1NJIR 3RBBB 2X4WA 3GBQA 4KIFA 5ED4A 4L18B 5FLMJ 1T3LA 2IGKA 1OU9A 3MO8A 1V29B 3KYDB 3ERMA 5FKMA 2HMAA 2KI7A 1IRFA 3M0UA 5GAN2 1VQ9Q 1G3SA 4N4GA 1PKSA 3H0GJ 1WXTA 3ABMH 2E3IA 5LRRA 3N97A 4DOVA 3HEFA 3SXYA 4JK1X 2IPQX 1VQ8A 3CBPA 5E8GA 1HXDA 4XU0A 1XCBA 5LEKA 2F5CA 2GQQA 3RQ4A 3A8MB 4PJ0C 3LQQA 2DL5A 1MIJA 3VYSB 1Z7LA 4LLNA 3H8ZA 3RERA 4ENJA 2H1LA 2RQWA 2A68F 2V6EA 3FLGA 3SJMA 4HVWA 2XAJA 2HR3A 3G71A 4DYRA 3JRCA 2K4BA 2C0OA 2IPOB 1QQIA 2IAIA 3DEEA 3DKXA 3LFKA 4B47A 4YIIA 2DA9A 2MC4A 2QQBA 2ZO4A 1MGQA 1DPRA 1I1GA 3HTSB 1ACIA 2E60A 3CMMA 3K2AA 2MPXC 4OB1B 2KNBB 2OQRA 2M0MA 2WADA 3FXOA 3RJPA 1VQ5Q 4M3EA 2D5VA 2L7MP 3D5SC 3W2VA 3GLLA 2R5ZB 2ZZDA 1WHGA 1UTIA 3META 2ZCFB 2WAQN 3ASNH 1YIJQ 2JVGA 1Q7YC 3CD6Q 2WSFE 1TNTA 4A2UA 5C3EJ 3CCLQ 1W0TA 2HQXA 4HSTA 4EMHA 3P9IA 3VYRB 4M6VA 2L8DA 3CUQB 1SMYF 1GCQA 1T0FC 1HD3A 2EKOA 4L5GA 4A4FA 2CO5A 4PSWA 3DFGA 1LVKA 3O8GA 5ILSA 2D9TA 2AIRB 2CMPA 2BW3B 4I6ZA 1FX7A 5FFXA 1FMWA 3GTKJ 2LCCA 1Q81U 2KJBA 3GZ5A 4E7IA 5KCHA 2KIUA 5EG0A 2OPTA 1H88C 2M1HA 4G7OF 5K7ZA 3OYDA 3EYYA 1QMCA 2DMQA 1B34A 3M0PA 3IAM2 2HQEA 4J9HA 3PQKA 5J4YA 1TG0A 2IS1A 2QG9B 1X4PA 2XF6A 3TVTA 3JB9H 4HCBA 2DDAA 1JI8A 1UB9A 3WGGA 4JS4A 4RS8A 2HOAA 2XDVA 4NBQA 2GXAA 2QLZA 2HTJA 3HPHA 2BY3A 2KDSA 2JM8A 4M75E 4I0BA 1DQUA 3HIFA 3P9KA 3CCQT 4C92A 4IUVA 1OCOH 3IWZA 1MNEA 3LSIA 3JSPA 1BIAA 1V1CA 2PUOB 5EZGA 1BI2A 1P6RA 4UUSA 1TH7A 2JUGA 2L0KA 3OIQA 5CQGA 2EBPA 1WZ2A 2EKHA 4HX4A 1QQJA 2YRVA 4A54A 2JSCA 4A3LJ 4OB0B 4OMZA 2NAZA 5JLWA 2LJ1A 3JCUC 3OOPA 4JUVA 2HVQA 3WTVC 2H3EB 2MK5A 4A3EJ 1OISA 3M0QA 2RJFA 4EDUA 5LGUA 2R92J 5K5OA 4EIKA 3NEUA 1KHIA 2ZNYA 4MGRA 3O8HA 4RB2C 3JREA 1K78A 3M58A 2ADUA 1X1PA 2Y48A 2K3XA 3PE0A 5GMKe 1N8RR 1T56A 2YRCA 2YT6A 1VQMQ 2KLOA 3AAFA 4ZYGA 3VYTB 4J9EA 1T95A 3I4MJ 2R5MA 4A4HA 1HW2A 3NGPA 1QVTA 4FETA 3A98A 5LGTA 3OSGA 3TEEA 2GFUA 3VRYA 5H20A 2D45A 2AZVA 4N0AC 2XICA 2ZJRF 1M8VA 1HKQA 1ZKGA 4HSRA 4QWQA 4LD6A 5F1JA 5IHNA 5A2QE 1QVFA 1KGSA 3A8HB 1BK2A 2W0ZA 2X4JA 4C30A 1E0EA 1OPLA 3R6NA 1KC8U 3H3VK 2CUFA 1I4K1 3ZMTA 4DBFA 4C92G 1KU3A 2K02A 5FU6C 4C8QD 1L3LA 2NNYA 4Y7NJ 4DEXA 1FOKA 4U88A 2LF7A 4HQEA 4BEHA 1YJNA 3GIBA 3ULQB 5CYVA 1VQPI 1FYLA 3M9AA 3CC7A 4HT8A 1ITYA 2W85A 1SVLA 1W5CC 2DL7A 2ESWA 2EH3A 1KD1R 4G7ZF 4M7DB 2OTJT 3M9QA 1TWFJ 3VODA 3BG6A 4LG0A 4A3CJ 3KP4A 2FEIA 1FEXA 1K79A 2MA3A 3I55I 4XRSG 2BZ8A 1TSFA 2FRWA 4FX4A 2E1HA 4CICA 4AYBA 2PQWA 2O9VA 5GJWB 3FISA 4IOCF 2GGRA 4NUBA 4E70A 4XLCA 3TREA 1ETVA 1BOBA 2LFBA 3WTXC 1XGMA 2YRDA 5LJ5f 5IT3A 2R3SA 1QNTA 2UZKA 4Y52J 3J7AF 3L09A 2VC8A 3B6AA 4J9DA 3T9NA 3JTHA 2NOGA 2VASA 1J0RA 3HOWJ 2EYZA 2HPMA 2W00A 1AZEA 3LA3A 4OP0A 1VQNQ 4ZN3A 2R0QC 2R7ZJ 1S7OA 3MKYB 3TW6A 5BPDA 1AHDP 2HVRA 3S16J 4ZGDB 3OW2P 1AKHB 4C0DC 3WTTC 4M77A 5CKDA 5ILVA 2HSEB 2M7BA 3OW2A 4OMQA 4KMFA 4E4HA 1ZELA 3HL2A 2K7AA 3PIOA 2JOYA 3S3OA 2QBYB 3IQLA 2DBKA 2BXZA 2UXXA 2LY2A 1RLQC 4E6RA 3LAPA 3WE3A 2W48A 3OYNA 5IH2A 2M4GA 2DL3A 1RETA 3N05A 2M8EA 3RZDJ 2BTTA 4G6TB 1R1VA 2QSFX 5FGMA 2CKKA 2LJ0A 2L4AA 1UJYA 1PVEA 1D8JA 1V5FA 1I1SA 4K11A 1MJBA 3IWFA 1MH4A 1ENHA 2DETA 2BGCA 2BBYA 3VS7A 2DTIA 3BLYA 3OY9A 2VJJA 3JB9D 3H41A 3M1CA 5F6FA 2L9NA 3J80K 2L54A 4B3XA 3K70C 1K4SA 2FNPA 2J6FA 4L0ZB 5LHGA 1USSA 1W7PB 3CBOA 1X01A 4JS5A 1MBKA 1IV6A 4YFXF 2VPLA 3I5UA 1OMIA 3V7RA 2M4KA 1X27A 5GAMj 2IS6A 1U0JA 3DP7A 4EEFG 5J1YA 1RRJA 1X4OA 2RGVA 4ELYC 4XLNF 1JHFA 1ZQ1A 1G6NA 2D1XA 2QAZA 1JJ2S 4ZDPA 4EV0A 5L8RE 1OFCX 2DN0A 2AK5A 5GAEJ 2NVYJ 3F70A 2OTJI 2CV1A 2NUZA 3BJOA 3DBHB 2JJ9A 2EIFA 2V79A 3RESA 2DLPA 4M75A 4OIQF 1NYGA 3JCMf 3I55T 1VFCA 2EILH 3EHRA 1ZSGA 1O3RA 1RAAB 3U21A 1UAAA 3M55A 3GO5A 2CQQA 2XGEA 2PQ8A 5EC7A 3J7AY 4HX8A 1EZZB 1PD0A 2CZ6B 5J26A 1WHMA 3KEQA 2VXZA 3T8RA 1MJ9A 3DBLB 2JS2A 3HG9A 1EH6A 1MMGA 2MWOA 3OR1C 4XTWA 1VQ8T 3EETA 4A0XA 3QAHA 1J75A 2HXIA 2YSQA 1ORKA 2Y0MA 3HRSA 2DA2A 3LA7A 5D4RA 3GTMJ 1K7AA 1GUUA 1JXSA 1M1GA 1H89C 4L5IA 2SEMA 4FT4A 3HTUA 5E1WA 2VVKA 2A61A 1I5ZA 4WCGA 3NTIA 3QYEA 2DOEA 4FISA 4G7HF 2DPPB 1ON1A 1YX3A 3AKZA 2R93J 2P0WA 1BC7C 2QGGA 4I01A 2A5YB 1VQKA 1SD7A 3I9QA 5GAN6 2CFOA 2XU8A 2RC4A 3H9JA 2COMA 3RSNA 4OMNA 4PLIA 4B48A 2BUDA 4QQ6A 4NB5A 1MSFC 4E7SA 1AHJB 2ZPEB 4BXXJ 2Z1DA 3K6GA 5F04A 3CMAI 2KT0A 3E9GA 1YJNT 1OJLA 3TO6A 1ZLKA 2M2EA 4JX5A 4A69C 5LHHA 3KIOA 2ZPFB 3M0RA 2HZDA 2AT1B 2DT7B 4IEJA 2ZPHB 2L9SA 4XBFA 1VQ6Q 2CH4W 5L3EA 1WQ7A 1IDYA 3N4MA 2JS0A 3LW5E 2OTJQ 2CW0F 1MMNA 2O4XB 4GYIA 3CUQA 2GQVA 4X9DA 1VQOT 4DQ2A 1TZLA 3CDIA 3TBIA 5GAGJ 2V1NA 1KJWA 1HA8A 4LDVA 1SHGA 2O03A 4D9JA 2VJ5A 3PM1A 1IZ6A 3RPQA 3J81E 7AT1B 1M1KC 4V19K 2LREA 4XQ3A 3BDLA 5GAN8 4LMYA 2LMJA 3FXKA 2G7HA 4MQ9F 4XTYA 5FU7B 2R5ZA 1W36C 3IH4A 4DNCA 5GPAA 3H0FA 2DFUA 3S93A 1CKAA 5IHKA 1S72Q 4QVCA 1TT0A 2EGAA 2FPFA 3GEZA 2P0KA 2Y69H 2O3FA 4JJDA 2G0EA 4BI8B 2XASA 1OEBA 2ZSHB 3TDUC 2DEUA 4KN7X 4ZDLA 1NHAA 3CCST 4M77C 2ECBA 1NH3A 3CXCP 3KZYA 4MIMA 3BR0A 4DZPA 1UDLA 4CA0A 2ZMEB 4JOMA 3J81Z 3H5RA 2K5LA 1RC9A 2QYZA 2RK1A 1G3YA 1M90U 4PJOD 3DEUA 4MNUA 2R7DA 2F5EA 1XC5A 5FO5A 1ZG5A 2EFNA 3F8FA 2DMTA 2MH2A 3QP5A 3FJPA 3I71A 1YHQA 2P7VB 2O4XA 3MKDA 1POGA 4LE9A 4OMOA 4CYCA 1X3ZB 1ZREA 2FZGB 2WAFA 4HRIA 1QCFA 1IJWC 3BTIA 2QSHX 4FE7A 2VI6A 4IHXA 1S5LC 2DL8A 3BE3A 3H36A 3NFCA 1IRXA 1XDSA 2BHYA 1FZPB 1GDTA 1FMKA 1YJ9Q 1JE8A 2HDAA 3CMEA 1UJ8A 3OBWA 3LGFA 4DEYA 3O2PE 1HOMA 4BB7A 3KYLA 1K4US 1IHVA 3BG5A 1IN5A 3H92A 1VQ6A 4RDUA 4UNOA 1FIAA 4M3FA 1FSEA 4ZZLA 2MD5A 3DLMA 2FRHA 1OYWA 3IRRA 3BC8A 3PNVA 2CT3A 2WV1A 1QVPA 2KYMA 1IO2A 3OR2C 3BTCA 4NL2A 2F4IA 3O6BB 3U1DA 4QPQA 4CCMA 2B8AA 1N5ZA 5D8KB 2CT4A 4M3GA 3OQ5A 1YW7A 1EH7A 3GUDA 1JU5C 1O4XA 4EMKB 3ESWB 1E3PA 1P2FA 2VXDA 3CLQA 2FX0A 3SQNA 2FVUA 3JRHA 5D5UB 4RB3C 2LKXA 3MEAA 2BE7D 5JVGF 5KYWA 2HQNA 5CKBA 2JMCA 4ZDOA 3PFSA 3W2WA 3SDZA 4Z2YA 1TQMA 4E7HA 1K83J 3GF2A 2VUMJ 4XK4A 3JCMJ 3HHTB 1QZYA 1XMKA 4FCYA 3E6DA 1JXOA 5E8IA 3GFIA 4A5NA 3K9TA 4KNYA 3I5RA 3IHUA 5J1UA 5IPAA 3OYGA 4CC7A 1LPLA 4ZGJB 5EGOA 2K3PA 3B73A 1Z91A 2JQ7A 2EFIA 4F7UA 2KZGA 1VQOI 2CDTA 2LCSA 1LEAA 3L1PA 3Q3SA 3BJ6A 5J39A 3OA6A 2W57A 3JTGA 1ETOA 1X3WB 3TMOA 2EJ9A 2X48A 1QPMA 2YPRA 1ZG1A 1TC3C 3CCMT 1C0WA 3JR9A 1DJ7B 4BUGA 2WAQA 5DY9A 2A3LA 5L3DA 2L4MA 2V1QA 1Z6TA 3F8MA 3JB9J 2NOJB 1IUFA 2L0AA 2DK8A 1OQKA 2RQTA 4QKUA 4C92C 2CSOA 5F0FA 2LTPA 4RUGA 3J80E 4KGZB 4I76A 1XD7A 1XGNA 3A1YA 2M0OA 3OS5A 3SWNA 2NUTB 3EDPA 4A3FJ 5KAFC 1W5TA 1T33A 2KVQG 1F1BB 2YU9J 3X26B 1ZG3A 4AMCA 3JAMK 1YOVB 1Y07A 4OMLA 3NTKA 1YYVA 1G3TA 2JMAA 2KE9A 2H09A 3KP6A 5ICFA 4LGWA 2V9VA 2RMOA 3M54A 4A6EA 1GCPA 4PJJA 4Y91A 5EEAA 4KISA 1Y56A 4MZMA 1U2WA 3F6OA 1D1AA 3DQVC 1IDZA 4E6KG 5KYNA 4OGEA 5DD8A 1X6GA 5HOOA 1T0FA 1OR7C 5IT9E 4KJZA 1JUMA 2MW8A 3OYYA 3NPFA 4HNTA 1S72T 3MP6A 4ASNA 2LR8A 1K9AA 4RGXA 4KUIA 4JRPA 4FL6A 4QQDA 3BW1A 1ZK8A 2RNGA 5LRSA 3R6OA 2LTOA 3CQTA 3UF4A 2P81A 2HSPA 4AFUC 2HQHA 2CS3A 3HSRA 1WHHA 2X6WA 3CXCA 1M1FA 3TOBA 1EH8A 4KMUX 1NG6A 4FIBA 4XM3A 1HBXG 3ECHA 2H8RA 2GLOA 2CRGA 1D09B 2FL7A 2GTOA 3BT9A 3NHNA 1S9HA 2K5CA 1PG5B 2K4YA 5FKNA 1D0YA 2ISYA 4LG0B 1U1SA 3SB2A 3VS5A 1IN8A 4QVDA 4R55A 1TWGJ 4M4ZA 2GCXA 2H27A 1M3BA 1ETQA 2KRNA 1S1NA 1LVAA 2J06A 3I58A 1WH5A 3AG4H 3BZKA 3P9CA 4N4OB 3LSRA 2L3SA 4AIJA 4DOZA 2DXIA 1QKXA 3DTEA 2X51A 4WXDA 5J8FA 5GMKm 1QRYA 1TQIA 3FMRA 1XDUA 3I3LA 2EVRA 2BHZA 1QHGA 2GM4A 2VV5A 2GIVA 4BNCA 1JT6A 2O8XA 4AIHA 3RPUA 1R71A 4YIFA 2WY7Q 1R36A 5CKEA 3KP7A 3R6SA 1PP7U 1O3SA 3GTGJ 2ED0A 2K3BA 1J9IA 1HSQA 1OOTA 5IXFA 1O3QA 1X3UA 2OBPA 3R60A 1YRNB 1FP2A 4A4KA 1Y8QB 4FYVB 5I2SA 4P96A 2F69A 5GANf 3F21A 2FMYA 2M9UA 2K9MA 2IA2A 2FOWA 4BE0A 3VUZA 5LJ5e 2QQSA 1ETKA 4ZC3A 1RLPC 5CVIA 3FXMA 3EH2A 2DMNA 3CMAA 5D8LB 4EMKC 2KL4A 4M9ZA 4CYDA 5GTIC 4KA4A 3M57A 3JB9F 1TTHB 4N9HA 1UZCA 3QPSA 4PJOE 4BJTA 3TO9A 1VQNI 1PDNC 3A2KA 1VQ6T 1HJDA 1W1FA 1OYYA 2AQEA 4IRGA 3SEZA 4II3A 4OAYA 3JCMb 3NARA 3S17J 4WTOB 5E20A 3V4GA 3MAJA 3M53A 1SFEA 2HTSA 4ANJA 5IOYA 3SZGA 4N0AA 4IUPA 3RIRA 4HDUA 1MDMB 4I0AA 1OV3A 1TUCA 2EPDA 3K1NA 3L7WA 4KN4X 4C3HJ 4CCOA 2WB1A 4ENKA 1FBSA 3S2HJ 3JW4A 1FYKA 1EF4A 2AKKA 4E7ZA 1VUBA 3SEMA 3G71Q 4AFQC 3M56A 1SAXA 4F7UF 2RQVA 5DV5A 2XIGA 1MBJA 4OMMA 3GTOJ 3BR5A 3CBMA 3ABTA 2HQ5A 2PEXA 2VYTA 4N4IA 3FF5A 1JO8A 2HPIA 2BY0A 3KZIC 4IJAA 5J3LA 4GYGA 4M7DF 2XC7A 3NTHA 3KLNA 4ZYAA 3M4YA 2FSWA 2KHMA 3JCMg 2EA4A 3REOA 1B7TA 2OF7A 2QA4Q 2BV6A 3GFJA 2EA2A 4ZH4F 4BDYA 3JRFA 1QU3A 1B07A 1FOXA 5DEQA 2HYJA 1MV3A 1PSFA 2CUEA 1R4MB 5C0MA 1KQ2A 2GOMA 1KZHA 4BACA 2JTMA 2M1BA 4LD5A 1Y57A 1G5VA 2W82A 2QGFB 3CUQC 3MCZA 3MZHA 4EMGA 1VQOA 2EW3A 1N8RU 4UY8I 2VQHA 1WNLA 2DRMA 3OYCA 4NHJA 2DOFA 1I8FA 3CC4A 2CSQA 4LN2A 2W7NA 4HG2A 4ZN1A 2HGCA 2XI9A 2D1VA 4HV5A 1ERDA 2ZMEA 1UHCA 4XMYA 1CQTA 2LH9A 2WAEA 2XF7A 3PNTA 3T5XA 2RVCA 5J4VA 1LJ9A 2M0YA 2FU4A 1J7KA 2O31A 1B8IB 2MH9A 2IA0A 3G71I 3CMEI 1YS6A 4OOIA 1UGRB 2CZ7B 5BMZA 4YTLA 9ATCB 2V1UA 1A6IA 1WJAA 3RDIA 2AQFA 2H6CA 2MF2A 3BQZA 4BXUA 3I9V2 1UB4A 2EAYA 1MBEA 2VODA 2RI5A 3E97A 3LGLA 2XKOC 4ZGEB 1VQKQ 4GY5A 2EFQA 3RKQA 1WXBA 1FWZA 2PUKB 2EGEA 2D0NA 5DS9A 1FTZA 1VYVA 2QM3A 1SG5A 2YLCA 2RDPA 4DGWB 2YLBA 3MD2A 2V6CA 1ZN2A 3CF5F 4NQWB 1R23A 1LJOA 2BOLA 2JTVA 2LOOA 4C3JJ 2EV6A 3HXLA 4Y3OA 4DIQA 1VQ7I 1MMSA 2VBXA 1YI2Q 4BD3A 4M6YA 1BJAA 1I3AA 2LKPA 3BTLA 3CDLA 4GXOA 2DDBA 1JBMA 2KSSA 2O9SA 1BCMA 2ROLA 2QQAA 2QDLA 5B66C 1VQ9T 2VKEA 1T08B 1EIFA 1PJRA 2VJIA 1U8RA 3HOUJ 3RKYA 2CZ1B 1MH3A 2EZKA 2P8TA 2CYYA 5FRMA 2DA7A 1NZ9A 3OYHA 3BPXA 1O75A 2X3XD 4XU3A 2VPRA 2DRKA 1H3HA 1E3HA 3GZNB 5KVRA 1FYNA 2SRCA 1KG1A 1BJZA 2EV5A 5E3MA 4RAGA 4GCVA 2RPNA 5GAOl 1A6QA 2CQ7A 4RB0A 1XCVA 2LQNA 2ZSIB 3QOEA 1RI9A 2QEXQ 2QA4I 2RNAA 3VS3A 1IZ1A 2PMZN 1VQ5I 4G12A 1ZRCA 4C9YA 3PT9A 1UECA 3E7LA 1X1AA 1WZOA 2J5PA 2XVCA 2VUBA 2JVHA 2BYVE 2V1XA 4RM2A 3GYHX 2PLYA 1X75C 4FW1A 2ME6A 5F27A 1FJLA 1X2KA 1UJ0A 1WH7A 3VOEA 3CP2A 3HM5A 5JFRA 2DD4A 1QVGS 3H3ZA 4F55A 1R8OB 1OYIA 2AO9A 2AXTC 3SFMA 2I10A 3R61A 1QLYA 1RAFB 1B3QA 4VUBA 1BW6A 3FKIJ 5HS9A 3WTZA 3X25B 3I54A 3CCJI 3SEQA 1FNNA 1ABQA 1MDMA 3AT1B 5GAN4 4AFSC 4C92D 2JWTA 1V5EA 4GO1A 2BY1A 4XLHA 4LLLA 3EYIA 3G71T 2N8GA 1ONVA 2OC6A 3DPLC 1IXSB 4LG3A 1TOVA 2W10A 5EG2A 4ABZA 3LSKA 1AD5A 2STWA 4UV8A 2OI3A 2JJ7A 3G7ZA 1QWEA 4FM4B 2VQGA 2X9DA 4S0HB 2EYQA 2QDYB 3HGYA 4CI0C 3G4SQ 3E5QA 1QHHD 2CQKA 2G9WA 2NUPB 1WPKA 3ZBDA 3IKVA 4RA2A 3BDUA 2IJLA 4CYCB 3HKZN 2LNBA 2DXCA 3G1MA 4HLXA 4XRSA 4J00A 4IURA 1Q1HA 2CREA 1WQ2A 3SHWA 3COAC 3R0AA 5FKOA 2MYSA 5IOZA 1IUYA 5CQYA 1K0SA 4XN3A 3OW2S 3W6JB 4KITB 5L3BA 2RN7A 3PFYA 1OZ3A 1YCSB 2F5DA 2R7QA 2XKOA 3MZ8A 1JKRC 1RESA 2A07F 2B86A 2CGHA 2MAMA 3DKMA 4Z89A 3KXTA 1KFZA 1WJSA 3FWEA 1DP3A 4UUSB 2YUOA 3MP1A 3L2RA 4ELZC 3L2UA 2ESNA 1ZR2A 3ER0A 1K9MC 1T98A 4MDXA 4N4HA 4V2FA 2XAHA 1C0MA 3SYTA 3ABLH 3ASOH 3HKZA 2WB1N 1ETXA 1RUNA 3BTJA 5KCMA 4RGSA 5EGOB 2R5AA 5KYYB 2NS7A 4ENMA 2L02A 1PP8F 2J6OA 1NEBA 2E71A 4A3JJ 2EWNA 1WWXA 4JZ3A 1NK3P 2DMPA 3DWLE 4RTWA 1VYUA 1I81A 2P6TA 1WJRA 3CCEQ 4PCQA 3CJTB 4KIGA 2QA4T 5GP9A 3NAUA 3QYGB 3U23A 4J19A 1VQ6I 4OIOF 1DP7P 2KAFA 3H9GA 5C4JJ 1CF7A 1USTA 4DYCA 1XSDA 1X58A 4D7NA 4YG2F 2LNVA 3SHFA 4XK8E 2OAZA 1I5OB 4LUDA 1REPC 1KYZA 2GOXB 1H8AC 1TW3A 3MQ0A 2DW4A 5D5VB 2PU9B 5FB2A 4RCBA 3M5AA 1YQAA 4MDWA 1VQ4I 2IP2A 2HDWA 1NM7A 1OYXA 3MHXA 2Z5UA 1TLHB 3CC4T 1M90R 3WU1B 4DJAA 2QA4A 4DBQA 1YW8A 5J8CA 2P4TA 2Z2SB 1X6OA 3WU0A 4I7HA 2DA6A 3QRFF 2ID6A 1RI0A 3MP8A 4XU2A 4PSXA 1M27C 2ZFWA 3WTUC 3HJEA 4C5HA 1OCZH 5GAMe 3G6EA 4N4NB 1STZA 1H9GA 3S1MJ 3BY6A 4KUMA 4B44A 4HBLA 3RDVA 4LDUA 4PJMA 3TEDA 5FWCA 2OTLT 4C5IA 4HCCA 3AFHA 2IS4A 2E6ZA 3OB9A 3VS0A 2GNCA 2Y0SN 5DYMA 2V7FA 2X6OA 3CUOA 4YFKF 1WCMJ 4FT8A 3VJPA 2FQ3A 3DB4A 4JZ4A 1I1JA 2CP5A 3WGIA 2DYIA 5CO7A 5LLQA 4LUEA 2Y75A 3ZFJA 1K9MU 1M90C 3FZVA 5H6QA 1OPKA 1E17A 4M75G 1Y0NA 4IKFA 2PZ1A 5CKHA 2H94A 2DZCA 3GOXA 5J47A 3J7YJ 1IREB 3FK7A 2RD1A 3EGUA 3MN2A 1BYMA 5DDGA 1R1UA 2CG4A 2CW8A 3DCFA 5CKTA 1K73U 1EKEA 1U5TC 1I5LA 2DFEA 2EYXA 1VQ8Q 3MZYA 2Y0SA 1YJ9I 3ZMVA 2X0LA 1SFUA 5FLXK 2H6BA 4LJZF 3RR6A 2PJRB 2ZXJA 1QBJA 2E5QA 1XSVA 1VQ9A 4MTEA 1MMAA 3LOCA 4J9IA 2JA7J 1QZEA 4U0YA 2PMHA 2F5FA 3HOTA 1WGSA 3A8OB 4M7AC 1BU1A 3Q9SA 4HYEA 4AIDA 4BI4A 3C94A 2JUCA 1ABOA 1U9OA 2NVUB 4G6DA 2HWVA 2PJPA 3NWSA 1SRMA 1K9MR 3K4MA 4M75F 3VU3C 1S72I 1KU7A 2W84A 2DKGA 1Y1VJ 1DDNA 2HOTA 5CK9A 2HKNA 1ZSZA 4EJTA 3HP9A 3K1PA 3PO2J 3QWYA 4CC3A 2IXSA 3OWTA 2E10A 4XSZF 1GRIA 3GTLJ 1F4KA 5KCOA 1SEMA 2Z9OA 3C2BA 1YITA 2QYOA 2DQLA 2E5NA 4PGHA 4IUQA 4RAFA 1YJNI 1MBFA 3TKYA 1PUFA 3ERED 3CPWS 3CCJQ 2X4XA 1V55H 4BXFA 4EGZA 2A37A 4EJWA 1D1BA 4WK8F 5LL6S 2XSJC 2BVLA 3FMQA 2BE9B 4JYKA 5J1RA 1SFKA 1PUEE 1OCCH 5F64A 1R77A 5D6YA 3VWBA 2NLUA 3HHHA 4FT2A 1UG1A 1ZX6A 2O5RA 3ZMSA 2XB0X 4BH9A 2LDMA 3CXCS 4EMSA 2DTOA 2CS7A 1V76A 2COWA 3D7SB 1VOMA 2G6FX 2QQRA 4EJVA 4PJNA 2QZ8A 5M9OA 1QW1A 5EEGA 3CPWP 4HKEA 4M9XA 1I0CA 1D0ZA 1Q82U 2ZNZA 5IP6A 2E7WA 3NWTA 5IXBA 1K73C 2CP2A 2HKQB 2GBYA 4M7DC 2X4HA 2A3SA 4BAYA 1TP4A 1VQPQ 5I22A 1CKBA 1OCPA 1WJBA 1NG2A 3JSOA 3BG9A 4L9NA 1I07A 1J5YA 3CQZJ 4IOAF 1Q86U 3CCUI 3J80Z 3GWZA 1VF9A 4B6MA 5LJ3e 1H92A 3HPGA 2AHJB 4X1EA 2OX7A 3H5AA 4I99C 4PJOB 5E1XA 1PC0A 4JLGA 3F3XA 4F17A 1U6GA 1YG2A 2R7UA 4O3MA 2QASA 5FD5A 4M78G 2KDZA 5LJ3g 3TL4X 2HFHA 3GNFB 2EB7A 2EJFA 4HW0A 2K9LA 4RBOA 1JHHA 4J6WA 2C06A 1KQ0A 3PSIA 1KHCA 2EQKA 2LVSA 2IW5A 1K1ZA 1NLPC 1LDJA 1T3SA 2UXNA 3CEYA 4B9WA 1YJ9T 1M8MA 1OKRA 2WY8Q 2KYBA 5D4SA 1A5JA 1ZUYA 1QKWA 1NYFA 1YI2A 3TQ7P 2IEKA 3KCCA 1LB2A 4LB5A 4CCJA 2AS5F 4AFZC 2YU3A 5FLXZ 2BVMA 2QEXI 4HF0A 2RJCA 4D8DA 5CCAA 1KU2A 1LOJA 2DQRA 1G2BA 4J7IA 1LFPA 4LXCA 1J2XA 3RUXA 4V2GA 3U1KA 5H6RA 5ICEA 3KP5A 2ED1A 1P7IA 5CVJA 4FTHA 2YUQA 4H0EA 2E2JJ 1P9QC 3LWHA 1K6YA 1OULA 1GVJA 1I6HJ 2ELJA 4BHCA 4LD9K 1QVUA 3CCVA 1RABB 1U5SA 3VYUB 2H3JA 3U9GA 2LC4A 1TL8A 3FHNA 4F7UB 1Y0UA 2DAQA 1VQMI 4ZJZA 5D7UA 2BE5F 2IIMA 1TWHJ 4BHPA 1R5HA 4M3DA 1M1EB 2DJNA 4FYWB 2H1KA 2RJEA 3Q0UA 2QCOA 3K0LA 4E7KA 1AWJA 1B34B 1OPCA 3QDFA 5IYCJ 4QPOA 1LFUP 3E6BA 1R0BG 3UDCA 1A35A 2QBYA 5CQXA 3WGHA 2EFWA 2E5KA 3CLOA 4UVAA 3ZMUA 2TCTA 3DEWA 2OJ2A 1TUDA 3QYBA 5FW9A 3INZA 1SD4A 4U7BA 2CUZA 5KHDA 1UFMA 2EV0A 5DUKA 1RUOA 2CV0A 1JXMA 2EPFA 1M9SA 2BKDN 5KYWB 1T2KA 4Z88A 4W97A 3WTSC 2L2OA 2QGUA 3JRIA 4PNOA 3M8JA 2O0YA 2CYZB 4Z02A 1Q7YU 2OTLQ 3CTAA 1ZQ3P 3VYHB 2HDCA 5BQTA 1JJ6C 5HK3A 1VZ0A 4IF4A 2K5FA 4IHYA 2IS2A 4MEXF 1LQ1A 1X1BA 2E65A 3CCUQ 5DM6F 3KETA 3QYFA 2A0FB 5GANh 2RQRA 2RHXA 4Y17A 3I55Q 3V8LA 4M77G 5D6XA 4GBQA 4L9TA 2VLAA 3DPTA 5GJVB 1R4NB 1YIOA 3GX4X 3CD6I 1XX5A 2M0CA 2K9NA 2YUNA 5GAOr 1HW1A 1Q81C 3T0YA 3QWXX 1T6SA 1YE9A 3VKIA 1VQ7A 1UGSB 3LH0A 3H6ZA 3DKWA 3K2ZA 3TW7A 2JNGA 3OMCA 1UELB 1PUFB 1JRIA 2M87A 1XJWB 4XTXA 3CCLA 5D6EA 4CGZA 4PJOG 3OMGA 4E7JA 1V54H 1BI0A 2KMUA 1NEGA 5HKCA 1KC8C 1AT1B 4XORA 1T38A 2LBFB 3WG7H 1IXCA 4UB8C 1TXQA 2RJDA 5GAOp 4F91B 2M02A 3TDZC 1OX9A 3EAEA 1YITT 1M30A 1YIJI 1ZGAA 4OU0A 2HL3A 4C8QF 5GAOq 3FC3A 2PTKA 3C12A 1BN5A 2F6CA 4XLAA 4GDFA 3QBYA 2EQMA 1ZHIA 1RADB 3OYAA 1YJNQ 5E17F 3LSMA 4BU2A 4K2EA 2OUMA 1YJ9A 1WVRA 4M7AG 4V2SA 4M7AF 2L7KA 3LSJA 3ZMDA 2A6HF 1Y39A 2OTLI 3I56A 3G73A 2K9QA 3KUFA 2HS5A 1YRNA 4NC8A 5FROA 3ELKA 2LF8A 2KZVA 4KT0E 2DK5A 5I21A 5M5XJ 4QSHA 1AU7A 1Q86R 3O5ZA 2ZJ2A 3RQIA 3CF2A 3Q0VA 3OYIA 1OI1A 2C0TA 4OIPF 4RMOA 4DW6A 4L9VA 5AIPA 1JGSA 2XRNA 4W1UA 4F7UE 4FU6A 1J3TA 4DOWA 4YIRX 1ZHFA 1K76A 4IZZA 4IIOA 1LKXA 5D5XB 4CC2A 2VQCA 4LOCA 1B9NA 3DKYA 1ZRDA 2A6EF 4XLPF 5CJ9A 4XTUA 4RKUE 4EJOA 3CCMQ 5A0DA 2DF6A 5B5EC 4HVVA 2WBMA 3BPVA 1RKTA 5L23A 3H1CA 3I55A 4I09A 2V8IA 2RHYA 3EGDB 1BB9A 5HCKA 3C4SA 2QWWA 2W1OA 5M5YJ 1ZLJA 2K27A 4XL9A 3WTYC 2JTFA 2JSPA 3EH1A 3RCOA 4M77F 4A5MA 1BR2A 2K5IA 4AG1C 2JM9A 3JCMP 4Q47A 2A08A 2JA8J 5LJ3f 3OS2A 1R1TA 2FG0A 3JSCA 2HEQA 5LJ3j 3LA2A 4PZJA 1Y96A 3CJRB 3K4JA 3C95A 1Y7XA 4RTZA 2BZTA 5GMKj 4KYWA 4IQ4A 2NUPA 4RGRA 4M78A 2M34A 2EZLA 1TQPA 3ECOA 5DM7F 4M7DG 3QOPA 5EZHA 1D3BA 2A05A 2LRDA 3FBNB 2KY9A 1I27A 3OOUA 4D5CA 4L5JA 3HDDA 2VBWA 2CP3A 2E3HA 2MMPA 1CGPA 3PQJA 2UUZA 1BR4A 1BIBA 4LIVA 3W3CA 5FLVA 3QJ6A 1IN4A 2LKSA 1SD5A 5F08A 5GAN5 1FXXA 1HKSA 3C2HA 1DU6A 1YJWT 3RYRA 2QENA 3VSLA 4D0PA 4BBSJ 4Y13A 2HOSA 3H9NA 3JCMd 4X0GA 4OWRB 3L2WA 2LY9A 2NRAC 2MFZA 1JB0E 4FSXA 4M77B 4F7UG 2E1CA 4RG2A 3NQOA 4AD9A 1E3OC 1G4DA 3I56I 3JRBA 2JXBA 4QIWN 1S8NA 2CZ0B 3JRGA 1FIPA 1XB4A 3SDGA 5KK1A 2V1DA 1VQ5T 1YX5A 2EIJH 2KRFA 3I59B 4XONA 1MD0A 3S14J 1TWBA 3GMEA 5HLHA 4A4GA 1VQLA 4OMPA 3I4NJ 3EFRA 1XG1A 2YHTA 2FXAA 4ZYDA 3D1NI 2L2PA 1YIJT 2PBIA 4M6XA 3TP3A 2E4HA 1TS9A 1KYWA 2LQWA 1I6XA 1WHLA 4A3MJ 3HBLA 3P8HA 3PNYA 4II1A 4P5NA 1DPUA 4RCCA 3QYHB 5KE3A 5DCMA 3FEOA 3DLLF 2Q1ZB 2YR2A 5CQEA 3I4PA 4BEHB 3M8EA 1TT5B 4F3QA 2A6TA 2KR3A 2ZAEA 3HFNA 5GMKl 3SZPA 3O3KA 1QGPA 2DYBA 2GBQA 1S7AA 4M7DD 1YO5C 2GZWA 1BOAA 4CSWA 2CFXA 2WV0A 3P8DA 3JB9G 3CCUT 5HDKA 4XN0A 1UGPB 2VKHA 4UHTA 2STTA 1X69A 1HCRA 2DIQA 1GV2A 3MEVA 4D1QA 3PL8A 3K4KA 1P7JA 1M4ZA 1W70A 3N5BB 4R8HA 4OB3B 1TTYA 1W2BA 4EM2A 4J9BA 2HXOA 5E1ZB 4CXFA 2EJRA 1WA7A 3GVAA 3JCMV 3CCRQ 3GFMA 2L89A 4KT5C 5GAMd 2CH0A 1LFBA 2EIKH 3FX3A 2VKNA 4IX7A 3BR1A 8ATCB 3EG2A 1LUJB 3QQAA 2ZPGB 1ZSZC 1UHFA 3M0SA 2E1MC 2I8DA 2A28A 3PMTA 2R58A 4M7AE 4Z8AA 1ZBXA 4ORZA 1DU0A 1DUXC 3CDHA 3I64A 5KH6A 1N25A 1WJCA 3AG3H 1VQ8I 5K1YA 5FFZA 1IGUA 3V7SA 1AOJA 2YUSA 1XMXA 5DTDA 2CJJA 2Q2EA 3ONQA 1AOYA 3ASKA 3C0CA 2HEOA 4MHGA 1VQ4T 2DA4A 4JQFA 4AVZA 5DLOA 3I5SA 1ON2A 2ZGWA 3KYCB 2LVMA 2E5ZA 3TGNA 2L3QA 2EINH 3FKJA 1YTYA 5EYRA 3EGXA 1E7OA 3FJ5A 3RZOJ 3H0DA 2DTRA 2PVOB 2O6GE 1VQMT 2QQ9A 2OAWA 1JTXA 1IRGA 2DFIA 4XTVA 3ISPA 4ZZDA 1GL5A 3IKTA 2R7VA 1D8KA 1R7JA 2VIXA 3CCLT 1NG7A 2DLLA 2KFDA 3AG1H 1Z67A 5FJ8J 2OU2A 1JKOC 3GW2A 2X85A 2HNHA 3V42A 4OIRF 3W2AA 2FPEA 2JK3A 3GP8A 4PL6A 1RZ4A 3FRNA 2L9RA 1VQMA 4HXJA 1RACB 1QVGA 2EQUA 3CPFA 5CPRB 2CSIA 1TUGB 4A0ZA 1FMVA 1PRLC 4LDWA 1VQKT 1AZGB 2E1MB 2FD5A 2W24A 3G1JA 4QLCU 5E18F 3JRDA 4A6DA 3RNJA 2I2LA 4I98B 5GAHJ 2FE3A 2X1DA 3BG3A 3RMSA 5EG0B 1WHKA 1I3QJ 1WRJA 3VS2A 5DD4A 2JT1A 2ISZA 3OYFA 1M1KU 2JZ2A 2ZKZA 3E3VA 1ETWA 4HF1A 1Z21A 2XGXA 4IHVA 3QIIA 1B1BA 3LFUA 3PVLA 4QVZA 5FLXE 1XMAA 2GIZA 4ETSA 1XOVA 3A0BC 1LDDA 3HPWA 2JN6A 1OX8A 1Q95G 5LJ5g 2K3FA 2R57A 2EFOA 2LC2A 3FMSA 2OAUA 4OGCA 4MTDA 4GFBA 3S1QJ 3FHZA 2M9HA 3S6WA 2KRSA 4KICA 1RR8C 1WI7A 3HGGA 4FW2A 2MD0A 1YWOA 2LRQA 2XHKA 2RAEA 4FHTA 2JMWA 4LK0F 5DCFA 3CMYA 3UPUA 3OIPA 3S2WA 4WXCA 1YJWQ 4KGVB 1K8AC 3REAB 3S15J 1EX4A 4KH1B 4D7MA 5AIQA 5LBQA 2K85A 1NLOC 1P4AA 3X20B 5GAMf 4IXAA 1WFXA 1QWFA 3VS6A 4NL3A 3ZXSA 1GBQA 1VQNT 2BXYA 2IBDA 3UATA 5A0GA 1L0OC 3R0JA 4XR6A 5E79C 3PIPF 3CCVT 1UCRA 1WYXA 4UXNA 1MSEC 1Z3YA 2JTEA 2FNAA 4A12A 1S72A 3SWNC 4PJOF 2GTJA 4QW2A 1K6OA 3K4NA 2ZJPF 2XB5A 4JRIA 2OCEA 4M9SA 4AU7A 1VQLT 5IN1A 5C44J 3K4CA 2F2WA 5BNGA 5IT9K 2FZCB 5F0CA 5HVQC 2DPUA 1VQ5A 1JEGA 2FJ1A 1Q81R 3VYGA 1HYOA 3TSWA 4HEA2 3CCYA 3CD6A 5EJCA 1MJAA 4GGGA 2B9SA 4N0BA 4L0YB 1KK7A 1OU8A 1WIEA 5C6SA 2YUPA 1UMQA 1CSKA 1RAEB 1GFCA 2DO7A 1PYVA 2XSDC 1XQHA 4U7DA 4HCKA 3ZL7C 4Y92A 2CP0A 2Q2EB 3FDRA 4EVIA 3SZTA 2GXBA 3JAME 1IXRC 5K5QA 1F5TA 1MNMC 3CCRI 1RAHB 1X2MA 2F5KA 3EG3A 2QEXA 2Y30A 3QPHA 4Y33A 4ESJA 2FHDA 2MI6A 3PFIA 4PJLA 2ZC2A 3OYBA 2AZSA 4MLOA 5DUIA 3TOAA 3UWNA 2LMDA 4XLEA 4CCNA 3C3WA 1ZA1B 2LQ8A 4A63B 2MOXA 2W4SA 3HRMA 2XDDA 1U3EM 2DM1A 3B02A 2M16A 4BY6B 3PIOF 4DA4A 4XLFA 5I11A 2BZXA 3LNQA 4JRQA 1WGXA 2EJGA 1ZBJA 2JA2A 1Y71A 3H0IA 4XNFA 2P84A 2QEXT 2R5YB 1BC8C 1RL2A 4F7ZA 2LP5A 5CAIA 1EV7A 5KYXA 3HSFA 5J6XA 1YJWI 2PVGB 3L2CA 4P9FA 1PKTA 3JCMc 3OYJA 4Q48A 2L01A 2XUBA 1N27A 1QA6A 1X6BA 1K8AR 5FD6A 4XU1A 2VJ4A 2FF4A 2VB6A 4BUPA 4RAZA 1QP3A 4N9IA 1OLTA 4B8XA 4XICA 2X35A 1ARKA 5IP9J 2LX7A 2ELHA 2L7ZA 2R5YA 3TCJA 3WXMB 2KRCA 4XKBA 8AT1B 1HSJA 3PTAA 1P4WA 4BKXA 3G6EI 3I35A 3R4KA 3GXOA 2Q0OA 4M72A 1S7EA 3IRQA 2KT1A 2HYFA 4ATOA 4IRHA 3CC7I 3GFLA 1N75A 1VQ4Q 2DOAA 4C0DB 2O2OA 2ID3A 4UC4A 1XGOA 2AXLA 4JLIA 3QP6A 3WE2A 1XTDA 4C5EA 4JJBA 1VQ7T 2DVJA 1IB8A 1G59A 1WJ5A 3TP0A 4KFCA 3X24B 1VI0A 2DX1A 2XPUA 3CCVI 4CRIA 2XGDA 4PFPA 4LLGF 2XPVA 3E5UA 5A0LA 2NNNA 1MKMA 3CCUA 4LNPA 2P5VA 3PSFA 3ROUA 1C1AA 3L1AA 2D1HA 1NJIU 2FBIA 4FQGA 1YCYA 4EATA 1GT0C 3OSSC 3C1DA 2ECZA 2HKXA 4XQFA 3WHCA 4KRTA 3MKWB 2XDPA 5CIUA 3G4SI 2XHCA 3CMEQ 1G2HA 5KYYA 1G3WA 4Y4RA 2HAXA 3K7AJ 3K1MA 4ON0A 3DF8A 3QU3A 4WCIA 3CCMA 1HDPA 2LJ3A 1Y96B 2UWMA 2K86A 1YHQT 4P1WA 2QUFA 4ZTJA 4ESBA 4MO7A 3KBGA 4F04B 2XG8D 1PNJA 2D2WA 5IYDJ 3BR3A 4HNVA 3C18A 2WSEE 2O7OA 2X1CA 4KULA 1H3ZA 2OTLA 3E1SA 1UFFA 1ZGWA 2RI3A 2JA6J 4BY7J 4Q5SF 1V5GA 4KDPA 1RUWA 2F5TX 4RTVA 3CCRT 2ZPBB 1KD1U 5IHIA 3PJRA 3CCQA 3QDRB 1HK9A 2YX4A 5BPIA 1IN6A 2M45A 1Z05A 1V3FA 1YITI 3G3ZA 3M1EA 4CH7A 2Z0WA 3SFZA 1LNWA 1O7FA 3KE2A 5IP7J 2PMZA 1NE8A 1IN7A 2DU9A 2JVVA 5JHFA 2QQ8A 2GAUA 1ZUUA 2J5OA 4JP0A 3ZQCA 1TW2A 3FXRA 5KYUB 3BG7A 3Q1JA 2FYKA 3DXJF 3BQYA 3CCLI 4DBHA 4C8QG 3UNGC 2QTXA 3BCBA 3RPUD 1HLVA 1N6AA 1Z9CA 1O9SA 3JCMh 5GAN3 1MGTA 1W6XA 2BZYA 3G6EQ 4A93J 2D8JA 4BHBA 3M4OJ 3IAS2 5GAOm 3M8FA 3K10A 1WJQA 3CMAQ 3M4GA 2VOPA 1E6HA 4WX9A 5FWBA 3IC7A 4OINF 3RMQA 5KYUA 1LPQA 2NXNB 1K61A 2ETHA 3P8BB 4L5EA 1ZYRF 5CVUA 3OYLA 2YDLA 2WACA 4RLQA 5D5WB 3WG9A 3S3NA 4A3DJ 4C0ZA 1D3YA 2RB6A 1BR1A 3HYIA 3OIOA 3A8GB 2DFHA 1BA5A 3G1LA 4J7FA 2F1LA 2JPCA 2O61A 3P7NA 2JT4A 1S3JA 4QTRA 4C8QB 1W4MA 1M1KR 4FYXB 1SANA 4YELA 3I0TA 1IXDA 1XTAA 4LFUA 1XGSA 1IG7A 5LGNA 3S3MA 2O8KA 3OYMA 1IGNA 4CHUA 3CCSQ 3KP2A 2IRFG 3HOZJ 1GLNA 2V1RA 3ZRGA 2M51A 4O5VA 3RKXA 4KUDK 1SAUA 2DA1A 2QXFA 1GV5A 3WTWC 5D6FA 4BYYA 2HU9A 1WJEA 2ZXHA 4P5OA 5E3LA 3ME9A 2KQWA 2L3PA 3EHQA 3HZJA 5GAMh 1I50J 5JLXA 5JI6A 1YNZA 4HT9A 1BW5A 3FDYA 4RTXA 2DTZA 4D5FA 5HLIA 1VA7A 1DGRM 1SRLA 2DVEA 2IVWA 1R0CB 1IF1A 2VT2A 2HBPA 2RQPA 2FUG2 4CO8A 2XK0A 1VIEA 3VRZA 2J6KA 5GAMg 3GCMA 2C6YA 4B09A 2ZFUA 2XDBA 2WC2A 4IPAA 4YRVA 4M7DE 4RMNA 2LY1A 2K9GA 4HOBA 1ZR4A 2BIVA 3DU6A 1BI1A 2P5KA 2R7TA 4L59A 1TNSA 4XTZA 1RAGB 3ML6A 4UVBA 1B59A 2E2HJ 4CC4B 3LQRA 5TRDA 2RV8A 1XPXA 1N8RC 3QPLA 1LE8A 4J01A 2OD5A 4XRFA 1TU0B 5D6WA 4F16A 2EFPA 2CH4A 2DIGA 2Y9YA 3ULRB 1VQLQ 3U2RA 3TSZA 3CC2T 5FKLA 3OMYA 2PG4A 3ZEHA 4R56A 1YJWA 3F0CA 2OJED 1QCNA 2LDUA 2GF7A 2KRHA 3D5LA 2FA5A 4PKCC 2ZB9A 3LSHA 4ZTFA 3IL2A 2KT8A 5HY6A 1J09A 3B6CA 2F2EA 2DPDA 2DZ9A 4C92F 5LEJA 3UA7A 3CO7C 4XSXF 3ZMZA 2XMFA 3LX7A 3ZQQA 4E7LA 3LWFA 3CCRA 1B6AA 3IUOA 5ERIA 5K7FA 2Y9ZA 2QF7A 3MEWA 4MMLA 1RKWA 1Z9ZA 4ESRA 2I0NA 1VQPT 4C5GA 2Y4XA 3OYKA 3J7ZI 3JRAA 2DT5A 3MPUB 1JKPC 4C2UA 1FP1D 4PFOA 3BR6A 3S1RJ 1BBZA 1SVMA 2OV7A 1N78A 3EFOB 2X3WD 2MIOA 1UE9A 3UR3C 1R9TJ 4IQJA 1M2OA 3T8TA 4JRKA 1UGVA 3PNWC 3MWMA 3HOYJ 2VKDA 1EFNA 2VWFA 4PGGA 1VQ9I 4C92E 1ZA2B 2DJIA 3TO7A 1Q82C 6AT1B 2VT3A 2L9VA 2K40A 2ABLA 4C8QE 2Y2ZA 2V9KA 3JRZA 4UV9A 3H0HA 2P4WA 4B43A 4BQQA 5IT9Z 1Y0MA 2HL5C 2LZ6B 2RK2A 1E2XA 1LDKB 1BCOA 2KPMA 1R22A 2NYSA 3HUGA 3G6ET 4Z6YA 1Q7YR 1KQ9A 5M3FJ 1VNDA 3M0TA 4LIUA 1W1WE 5CR2A 3CPWA 3DPUA 1NK2P 4Y15A 1FTTA 3L2QA 2RI2A 3QXEB 1Y8RB 3IH2A 5AONA 3LAJA 4J9FA 2FO0A 5HDGA 1AA7A 2JUFA 3CD6T 4C0FA 1J59A 3FIWA 4S04A 1HSTA 2M8GX 5HNFA 5ILUA 4M75C 3M3YJ 5GMKh 1KQSP 5HS8A 5KAIC 2EIMH 1S6LA 4JBAA 5LJ3h 3GLXA 2JN0A 2P0QA 4U87A 1WJDA 3L2ZA 3VS1A 4PUSA 2MG4A 4Q5WA 3E2UA 4J9GA 3EGDA 3M59A 2DODA 3IH3A 3QWLA 2R7RA 1X1DA 3IV5A 1U8BA 1G8XA 3KX2A 1YBYA 3KEOA 2V26A 3VSKA 5EEHA 5LJ5h 3A02A 2E1OA 4M7AD 2GXGA 1ULYA 2F4MB 1KSWA 2O88A 2DMOA 1A0NB 1VQNA 1WHUA 1KQSS 3KFVA 4AIKA 1JJ8C 2E64A 3QUIA 1YI2T 1K0XA 2KXDA 4M73A 4RM3A 1O3TA 2CGPA 3BFMA 2GA2A 1JQQA 1FY7A 2DA5A 1ZLMA 3G1OA 2E34A 1AKHA 2OCCH 3A0HC 2D0QB 2HD0A 5TJJA 3OS1A 2DILA 3ZQLA 3BR2A 3ZOBA 2K7LA 1Z77A 3DU5A 3EUHC 3CC2I 3LH5A 3REBB 3H5NA 2R7FA 4EMKA 2VE8A 1GFDA 3S1NJ 4IL6C 1H9TA 4M75B 5DLQE 3VUBA 4GLMA 2HYGD 4BDZA 4OF1A 3QZ5B 2K79A 5HLGA 4LDXA 3K4LA 4NC7A 2V8JA 2COYA 1AWCA 1U1TA 1MV0B 2L3DA 2J05A 4JDSA 2WA0A 2FOKA 4NNJA 4AVPA 2XD0A 5F1RA 4EQQA 1GHCA 4J5YA 2K2MA 1JUSA 3W6VA 2DTHA 2EGCA 3EPZA 2ECCA 4JX6A 4L9JA 1SD6A 3OL4A 3WHBA 5BOXA 2VC1A 5FU7C 1RI7A 4AG2C 2R7OA 2K2VA 4WF2A 3WVEB 3FXQA 4C8QA 1RPWA 2DJQA 3A01B 1MBHA 4OMFB 3URGA 4F14A 3A5ZB 3PUFA 4II2A 1HQCA 2XF5A 3G4SA 1W7PA 1VQLI 3KP3A 1NBEB 2RM4A 5FRNA 3L42A 1FC3A 1WI9A 1WKMA 2VGMA 3JB9I 4IHTA 4S05A 1LE8B 2D6FA 1BI3A 2MGQA 2LT1A 3I56Q 1I39A 1NTCA 5HS7A 1IO6A 3THKA 2JW4A 3FXLA 1T0HA 2LLKA 4J9CA 3JCMX 2QKLB 3K69A 3ZQFA 2DMUA 2DI3A 4YEJA 3HSEA 3RI4A 2PN6A 1JGGA 1VQ4A 1FBUA 3ZP5A 4EJUA 2IA1A 1JJ2A 5LHIA 2MBFA 4PJOC 2B0LA 4ZYEA 1FYMA 1SSHA 3M7GA 1HDDC 4XKWA 2Z33A 1W0UA 3BP8A 2E19A 4XOTA 4A53A 1GXQA 5ICGA 4QT7A 3BOQA 2X6YA 3EUKL 3OSVA 2P5LC 4IHWA 1JKQC 1SVOA 2QVOA 3DLAA 3FB9A 1N9RA 1W4SA 2IVMA 1K78B 3PUBA 1PWTA 1N77A 2XAQA 1F1ZA 2RHZA 1VYTA 2QKMB 1MW7A 2RQQA 4P9UA 1F36A 5M5WJ 2HZTA 4G6QA 2VL8A 4CCKA 1WFWA 2VBZA 4M78B 1O57A 2HQRA 2VQLA 2F4OB 1YLFA 2JZYA 3KLOA 4XKCA 4J6YA 2MCNA 2NUTA 3QPTA 4I02A 2AHQA 2Z99A 3DV8A 3I53A 4P55A 4XKVA 2XGCA 4XAXB 4HNUA 3HSBA 2LBFA 1TWCJ 2NWMA 1R5GA 2QI2A 4B1RA 2ESHA 2DFFA 1S29A 1LCKA 2H8HA 2L7FP 1SC7A 1UG0A 3VDXA 1YS7A 1NPPA 1X43A 2X1EA 2DXUA 1FOYA 2IGMA 4G8XA 2EQJA 1QVGP 3CJNA 3LWIA 1B9MA 2VXEA 2LQKA 3H9QA 4M7DA 1UHWA 1QCOA 1WXUA 2ACJA 2LNHB 4R1HA 2AKLA 4FYYB 3LSGA 1D1CA 2FRYA 4LITA 3AG2H 1QP2A 1ODDA 2BEOA 3QODA 4MMKA 2A5WA 3ABKH 5B1AH 2XIDA 3QSUA 2TDXA 1EJ9A 1C6VX 9ANTA 5LJ3d 3J7AO 4A4EA 1HC8A 1QVFP 1E6GA 2DT6A 4G9YA 2LG4A 3GTJJ 2LYCA 2R7WA 1ZARA 1WX6A 2IT0A 2VE9A 5K7HA 1YIJA 2W25A 3OV8A 1WJFA 3J81K 2PI0A 5JHUA 2LX9A 4M78C 4ZNXA 2DXTA 5LJ5d 2Q8KA 3F72A 4MQVA 3UKGA 3VV0A 1JUPA 2A36A 1W2BS 3A03A 5JVTA 2IGNA 2DJZA 1B4AA 2X4YA 5ICCA 4M78F 4AUXA 3E9FA 1B72B 3QHSA 1AWWA 2OQGA 2J7IA 5TGTA 3BY7A 2DYRH 3G4ST 4R79A 4XIDA 2F48A 2E36A 2RF0A 5GANd 3CCQI 1X1CA 1QVFS 4IUTA 3G2BA 3EG9B 2KIQA 4Y28E 2KISA 4M3BA 2KBTA 4IUUA 4I2OA 1YITQ 3CC2Q 1D0XA 3HRTA 2K4JA 4C3IJ 1W5SA 5B3SH 4IO9F 3MMYB 1YHQI 1KU9A 3AL0B 1M3CA 1VTNC 4HCZA 1UG2A 5GAN7 2CP6A 4MFEA 4NDLA 3F22A 2RQUA 3EG0A 1GVDA 4OAZA 5DM7R 3LL7A 1W2BP 2B7EA 3Q0WA 5IY5H 3CCEA 3F23A 4A3IJ 3ZCOA 5FKKA 4HF2A 1EA3A 1Q82R 2CQXA 1KD1C 3CZ6A 2RKHA 2Z3YA 4F52A 1OQYA 5A2QZ 2CQNA 1PRMC 4OB2B 4M7AB 3TU4K 4JX4A 2GWRA 1VQKI 4C92B 2F5VA 4BE1A 2YXYA 2XROA 1H0MA 1U5TA 4BI3A 4M77E 2OZUA 1DGWY 1V4RA 4KT6A 2GQIA 4X9CA 5GTHC 3JCMe 3MEXA 1U5TB 4IHSA 2LSOA 4L6V5 2ZCWA 1ZRFA 3EGXB 1Z0XA 1FPQA 3CP8A 4KGXB 1R00A 4M7AA 3CCET 1AWOA 2P7CB 3W6KB 2VGNA 2R7SA 3WVDB 3CCSA 3MKLA 2KMTA 3DBRB 4D6WA 3CCMI 1A04A 2FEZA 3I56T 4DZJA 3E0JB 1BL0A 2FZKB 1KC8R 5J3BA 1HKTA 1H8KA 1M2VB 5KNLA 3QKJA 4J8OA 3C2GA 2Z16A 1YFNA 5AT1B 5DCMB 2DA3A 4PJOA 1ETYA 2JRTA 2LD5A 1G83A 3MCAB 4M75D 3S2DJ 2OA4A 2E41A 2LP0A 2QK0A 4EM1A 4HX7A 2XPWA 5GAOn 3HOVJ 1D5YA 1IRZA 3CO6C 5GPCA 1IGQA 3CC4Q 1Z3XA 2PFBA 2ROTA 3Q9VA 5JR3A 4HVUA 3I59A 1K8AU 3FM3A 4RB1A 2O9LA 4RTYA 1SFOJ 3QJYA 1VQOQ 1F9NA 3GNGA 4M78D 4ME7A 2GA1A 1H641 4BQAA 1ZUKA 3FXUA 4WXHA 3HOXJ 3BCAA 4BJ6C 2OZ6A 2VN2A 2ZBKA 5F0HA 4BE2A 1B8IA 2R7XA 2CWEA 3ZQGA 2CP7A 4U0VA 2FPDA 4MFDA 3VS4A 1JJ2P 2KXCA 2HNIA 3P5JA 4ESFA 4HZFA 4CDGA 1K73R 4AYBN 2E35A 2RA2A 1R5ID 2KROA 2LCLA 3GTQJ 3F6VA 1O7LA 3QU6A 2O01E 4RLFA 3DB3A 3FIFA 2R4GA 3OBYA 3DTKA 1MBGA 5CVVA 3H35A 2HDDA 4TV7A 4KH0B 2DNUA 1QPIA 1Z6RA 1OR7A 2MSYA 3WU2C 3LMMA 3V8KA 2HVSA 2L3RA 3VB2A 2COZA 3HFOA 3ZR8X 2MLGA 4UB6C 4A3BJ 5LFAA 4M71A 2CUJA 3F8BA 1QZZA 1FLIA 1PM3A 1A31A 4M78E 2MWPA 3BZ6A 5C4XJ 2PMUA 2F2VA 4RAYA 1WI3A 2EYYA 2KK4A 2ZJQF 1HW5A 5HNHA 3PVQA 4NS5A 1Y6IA 2KKOA 5CVRA 3F8NA 3H3UA 1MMDA 4FSSA 1KIKA 1TBXA 4AT1B 4MEYF 3ZN1A 3KEYA 4EGYA 1UHMA 3A8LB 3SD4A 1R6RA 1AEYA 3C7JA 1SKUB 3KZZA 2FQ4A 2ME0A 2VBYA 4CZZA 1M3AA 2RH2A 4RGUA 2E7XA 4B4CA 3PMIA 4H4KC 4X6AJ 5LD2C 1A36A 1AWXA 2V9PA 5TISC 3LSPA 4NQWA 2YSRA 2ZMEC 2EZIA 1Q1VA 1APLC 2PJRA 2K57A 4JJCA 4TVRA 3CCEI 3PGGA 3NMZC 5FU6B 2HKOA 3CCVQ 3IP4B 1TWAJ 2NS8A 3HOSA 3KPHA 4FE4A 5HLTA 2JPBA 3K4BA 1WSUA 1B72A 2M3AA 3CCJT 5LJ5j 3UA6A 2E1NA 1RAIB 3BWGA 1T0JA 2EQRA 3CC7Q 3L00A 1P4XA 4GLKA 2HOEA 3BROA 4BJ5C 5L3FA 1YWPA 4E2FB 3D5RC 4C2TA 1PHTA 1OCTC 4LDYA 4BGDA 5L3CA 2K3YA 2LT4A 2NVTJ 2NVQJ 4AM3A 2RREA 2KIFA 1SF9A 1IV8A 2DCEA 2P4RA 3RTRA 4NC6A 3ZQHA 4AWXB 4AC0A 1Z1DA 3AL0C 1LNXA 1SSFA 2P0PA 3A1PA 2PNIA 3EFSA 3HRUA 3LSTA 1ZSZB 3HUGB 1U06A 2XKPA 2VXFA 1XN7A 3FXJA 5HODA 2VOOA 2EBIA 1ZTRA 2B63J 3EG9A 1KQSA 3VFZA 4QQGA 1Z9QA 1Y1WJ 2EZHA 5M3MJ 1NPRA 4PFZA 1T39A 3HHGA 2JRMA 4X1VA 3HB9A 5GADJ 5E3NA 2FBKA 5KYXB 4ENNA 1NJIC 2C0IA 2Y31A 5BS6A 1ZAOA 4OMYA 4EPCA 5EF6A 2TRTA 4BY1J 2DD5A 4X34A 2E2IJ 3JV3A 4YFNF 4KBMB 4OVAA 4JJNK 5A2QK 4WWCA 1FOWA 5KE2A 5GMKi 3FK6A 1BBYA 3FM5A 2D8HA 3T1BA 4BQNA 2ICWG 2MLKA 1UHSA 4C2MJ 3OSFA 3DLLA 1XS9A 2YX7A 2G3RA 2VC0A 4C0GA 1T8IA 1GCQC 3ZQ7A 2IG0A 2GFAA
chains in the Genus database with same CATH topology
3RKWA 3GPLA 4O6JA 4HLYA 3ZPLA 2RNJA 4LB6B 1CF7B 2WSCE 2ZPIB 2DO3A 1IW7F 3O8VA 1UEBA 5K5RA 1KQ8A 5GANj 1U78A 1QO0D 1SMTA 3GZ6A 4B9XA 4LK1F 2KIMA 3JAMZ 3CC2A 2OTJA 4MZTA 3UT1A 1LEBA 3OYEA 1GXIE 1RIOH 4UVCA 1N9SA 4M77D 1XSXA 2M5WA 2G7UA 3E19A 2E6NA 1N6AA 3EQLF 5CLSA 3V8JA 4IVNA 2EK5A 3F8CA 1IAWA 5HK0A 4C8QC 3CMAT 1FT9A 2FMLA 2DEQA 4HV6A 4KIBA 6PAXA 1YW9A 2FB7A 3TQNA 3RYPA 4FX0A 3E6MA 3D0SA