3HRUA

Crystal structure of scar with bound zn2+
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
213
structure length
211
Chain Sequence
b'PNKEDYLKCLYELGTNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metalloregulator ScaR
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
total genus 64
structure length 211
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hruA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hruA02
1UHWA 4R79A 1Z1DA 4IHTA 3IKTA 4N9IA 3HUGA 5FB2A 1IF1A 1R58A 3GF2A 3BY6A 4ZYEA 2ZNZA 3C7JA 4HX4A 2E1CA 1WQ2A 1G3SA 1MDMA 1R1VA 3F8BA 2LF7A 3LFKA 3SZTA 1ZGAA 3DKWA 1B9NA 3RPQA 3JSPA 3B02A 4UVBA 5LGTA 3KETA 4UV9A 2HKOA 2EB7A 1QO0D 5D5VB 2UXXA 1RZ4A 2R7DA 5E8GA 3KLOA 4H0EA 3ZMUA 3WTWC 1TTYA 2DI3A 5D5UB 5J6XA 3HHGA 3C1DA 3M8FA 1ZREA 2QQ9A 1OKRA 1FWZA 3GW2A 4NHJA 4A6EA 1S6LA 1SMYF 2M45A 4Q48A 2ZMEA 3QPTA 2NAZA 4GYGA 5DCMB 5LGNA 2MC3A 1MGTA 5HDGA 4ZZLA 2KRFA 4KMFA 1LB2A 3BWGA 5FFZA 2BEOA 1J7KA 3LSTA 3EDPA 1SFUA 4WCGA 4M73A 3BJAA 2PI0A 3VB2A 3H3ZA 2HR3A 4GO1A 1IUYA 5L3BA 2BGCA 3KP4A 4HDUA 5D5XB 3J81K 2VBXA 3FZVA 3R61A 3TDUC 2EFWA 4R1HA 1TBXA 2HGCA 4MNUA 4LG0B 5DUKA 2DK8A 2GWRA 4ZYHA 1OR7A 2FEZA 3BROA 2VT3A 1IXRC 1P4WA 2IPQX 1WI9A 2XHKA 4ON0A 3DXJF 4RGXA 2VN2A 5D4SA 1ZLJA 3WGGA 1B1BA 4HDVA 5JHUA 1BIBA 4MHGA 5LLQA 2W85A 3MZYA 2IVMA 1TNTA 2A69F 4OIOF 1K78A 4JK1X 3I4PA 3BP8A 1XN7A 4PCQA 2JPBA 2PN6A 2XV4S 2YR2A 2GZWA 1W5SA 2A5YB 1QNTA 3P9CA 4LJZF 1EH7A 1LDJA 3KP7A 5HLGA 4L5IA 1QVPA 4MGRA 4IRGA 4UVAA 3GO5A 1ODDA 2GIVA 3N4MA 4G7HF 3JW4A 3FF5A 3M7GA 3F23A 4HAMA 5HLHA 4KFCA 1W7PA 1V4RA 4WX9A 1KU7A 2HTJA 1K7AA 3O6BB 4ZYDA 1O3SA 1Z6TA 3T8TA 1ULYA 3V7RA 4DNCA 4A5MA 4KYWA 3EYYA 1I6XA 3OV8A 1FYMA 3E6MA 4U88A 3CJNA 2CO5A 1YW7A 1Y0UA 4IVNA 4A12A 1HSJA 3HSRA 4LD5A 5E20A 1S29A 1JHHA 3I54A 4EV0A 1J59A 2QZ8A 4I01A 1BYMA 1KYZA 2HQRA 2ZXJA 4U7BA 1BI2A 2V6CA 1JE8A 1R36A 1VTNC 3I59A 2DQRA 2XIGA 3IWZA 4A0XA 4HV5A 4U0WA 4CDGA 2OQGA 1GXQA 3N97A 4XLNF 4BH9A 1WSUA 2FMLA 1MD0A 4FX0A 2KJCA 4KDPA 4GCVA 4A2UA 1PP7U 2ZNYA 1RIOH 1EH6A 3MEXA 3QAHA 3ZMZA 4BHPA 3LAJA 4RB2C 3IWFA 2P7CB 1FC3A 5CJ9A 3QOPA 1FNNA 4KNYA 3E97A 2VBWA 1U5TC 2MBFA 1U8RA 3GEZA 4HF0A 1RUNA 2FXAA 2EFNA 2A61A 3ZMDA 4EVIA 4CICA 3LA7A 2EFQA 2LSOA 4U0VA 2K86A 2E7WA 4O3MA 5L3EA 2FBIA 3G3ZA 1ZGJA 5AONA 5H6RA 4MQ9F 1DPRA 1P4XA 1JGSA 1BI1A 3I71A 6PAXA 2K5FA 3Q9VA 2HFHA 1YQAA 4UHTA 2M1BA 1F9NA 3MAJA 1STZA 1ON2A 4RGRA 5DCFA 1BBYA 2DW4A 1MZBA 1ZH5A 4LB6B 2A6HF 3ROUA 3L7WA 2CG4A 1I5ZA 3M9AA 3D5LA 1Z91A 1D3YA 5DEQA 1E2XA 2F2EA 2L01A 1T2KA 2TDXA 2HYFA 3K9TA 5JR3A 3L9FA 4CO8A 3P9KA 1XD7A 4Q47A 4HLXA 5H6QA 2XROA 3WTTC 4ZYGA 1ZG5A 4HA8A 5DYMA 1TQPA 1T39A 4AVPA 2RDPA 3AAFA 2OQRA 2MLKA 3L00A 1ZLKA 1KQ8A 2ETHA 4G8XA 3I5UA 2HYGD 4DQ2A 3S2WA 5AIQA 4OINF 4KIGA 2QLZA 1UCRA 1U5TB 4XRFA 1W7PD 3BDDA 3M8EA 5BQTA 2GA1A 4ESJA 2K7LA 3QPHA 4HLYA 2K5LA 5LGUA 2Z3YA 1W5TA 2IRFG 4AIHA 1FPQA 3M1EA 1XCBA 3WTZA 4JQFA 5CLSA 3FMSA 2HTSA 5TRDA 2WV0A 2H09A 4CYDA 1H9TA 1IRFA 3H3UA 3WTXC 4FHTA 2IA1A 5K5QA 3SFZA 3WE2A 3WODF 2V1DA 4NB5A 5D8LB 2CW0F 1JHFA 5FD5A 1BOAA 3IL2A 4G7OF 1CF7B 2VXZA 3REOA 1I1SA 4IXAA 1HSTA 2COMA 4EQQA 1O57A 2KKOA 3ISPA 4HQEA 2G7HA 2GCXA 2QBYB 1C0WA 2Y48A 3GXOA 2XKOA 3ERED 2A07F 1K6OA 2FSWA 3LQRA 4S05A 4HQMA 2VONA 1IZ1A 2E7XA 4RAZA 2Y0MA 4UUVA 2MA3A 3ECOA 4IJAA 4FX4A 2PFBA 1YYVA 4KICA 3MQ0A 2EV0A 4EM2A 5KVRA 3VOEA 2YSRA 2M8EA 1IAWA 2R7FA 2V1XA 5ILSA 5BPIA 3RKYA 1RNLA 4YG2F 2VE9A 2XAQA 4EGZA 3OOPA 4G7ZF 1O7FA 2F5EA 1L0OC 3WTUC 3FMQA 3R60A 1ZARA 2HQNA 3RDIA 3DQVC 2QQBA 3ABTA 4M71A 2AXLA 3GX4X 1AWCA 2HEOA 5E8IA 4P9UA 1EH8A 2ADUA 1YO5C 1KQ9A 3V7CA 4HX7A 4KIBA 1ZRFA 2AS5F 2LX9A 1LEAA 3MWMA 3QP6A 4UXNA 5ED4A 1YS7A 4P96A 1FOKA 2X0LA 4LLGF 4I2OA 4L9JA 2O61A 1RI7A 5A2QK 1HXDA 1KU2A 1UB9A 4D0PA 5LHIA 1UHMA 4WK8F 2Q8KA 2UWMA 3CUQA 1SD7A 3V7SA 5D8KB 3HOTA 3GYHX 5K1YA 4UNOA 2XGXA 1R22A 5FD6A 4G6DA 1FP2A 3GFMA 1WWXA 1TQIA 3JSOA 2OAZA 1SD5A 4U7DA 2P7VB 2OZUA 4RB3C 2QWWA 1IXSB 3QRFF 1IW7F 5LBQA 2OZ6A 3NEUA 2CYYA 2EV6A 1Z6RA 4IF4A 4B8XA 2L4AA 2WC2A 1TLHB 4OIRF 2RGVA 5D5WB 1RUOA 4HZFA 4A0ZA 3BOQA 3L09A 1FBSA 4EJWA 2D45A 5ILVA 3ECHA 3WTVC 1ZYRF 4LGWA 2X4HA 2XAGA 4LB5A 2VBYA 5E1XA 4ZH4F 4BHCA 2L02A 2B0LA 1IN6A 4CGZA 4L0ZB 3ZMTA 3PQKA 3ZMSA 1EV7A 3BZ6A 2EK5A 2ZCWA 3J7AO 3RJPA 3LAPA 1J2XA 3WU1B 3HRTA 3C3WA 2ISZA 1FYLA 3VFZA 2Q2EA 4KIFA 4A6DA 3J81Z 3FM5A 3GVAA 3E19A 2H27A 2XAJA 3WE3A 5DD4A 1B59A 4M9SA 5F6FA 4EMSA 4M6YA 2Z5UA 2Z99A 3GFJA 2M87A 2QM3A 2FNPA 1TW2A 3R6SA 2ESHA 3E5UA 5FGMA 4K2EA 5J8CA 3HTUA 3IKVA 2LDUA 3FX3A 3P9IA 2KIUA 2ZFWA 3KEQA 3LQQA 1S7AA 4G94A 2STWA 2DK5A 3K2ZA 4U0YA 1AOYA 3F8FA 5DV5A 3ZPLA 1PP8F 3DFGA 1IXCA 4LLNA 1BC7C 2HWVA 2DU9A 5HDKA 2RN7A 4P55A 3CO6C 3TQNA 3E6CC 1FBUA 2BV6A 1B4AA 1KU9A 3MZHA 1BN5A 2YU3A 3DP7A 2PJPA 4AWXB 4WF2A 1WRJA 2ZMEB 4WXHA 3J80K 5HS7A 2EWNA 4E70A 3E5QA 3WTSC 3I58A 2P5VA 2JPCA 1ON1A 5BOXA 2LNBA 3K1NA 3GFLA 2D1HA 5LEJA 3KP5A 5HS8A 1G4DA 1WKMA 1XGMA 3WG9A 2ZO4A 4A0YA 3V4GA 2C6YA 4S04A 2GQQA 1QW1A 2ELHA 5CVUA 5LRSA 3EQLF 2DO7A 5DD8A 3F6OA 2D1VA 4RGUA 4Y15A 1ONVA 1PDNC 2EV5A 2K5IA 3CDHA 4HOBA 4BHBA 1Z7UA 3BPVA 2W57A 4WXDA 3FXUA 5JVTA 4EJUA 1H9GA 2QVOA 2ESNA 3FXRA 3TDZC 1KGSA 4ZZDA 3R0JA 3K1MA 3PQJA 5H20A 2K4YA 5CVRA 1R00A 4MTEA 4CZZA 2ISYA 3FM3A 5BPDA 3I64A 4OMYA 2H6BA 3SXYA 5L3DA 5KK1A 1SFEA 3SQNA 4G6QA 2MH9A 2VE8A 3GZ6A 1KA8A 2IJLA 2EFPA 4L5JA 3R4KA 2ZJ2A 3DV8A 2FNAA 5F1RA 3MFKA 2WTEA 2IA0A 2V1UA 2QQAA 4BQAA 2P6SA 4I0AA 4HBLA 1TW3A 4OU0A 2O3FA 3BJOA 3LA3A 3FHZA 4HF1A 3QU3A 1DUXC 1FSHA 3IHUA 1O7LA 3DEUA 4R8HA 3T1BA 4YFXF 5D4RA 3LWFA 4HX8A 3KP6A 1J5YA 2FA5A 1LJ9A 5FLXK 5IT3A 5LEKA 1G6NA 3RKXA 4A5NA 2LF8A 3HTSB 3JAMK 4CXFA 5E1WA 1HW5A 1ZHFA 3F8NA 1L3LA 2FRHA 1SD4A 1FT9A 1BI3A 4I0BA 2CQKA 3TO6A 1J0RA 2JZYA 3C18A 2XAFA 4L9TA 5CVJA 1USTA 1F1ZA 4YIIA 2VC1A 4KUMA 1YLFA 3I59B 3B73A 4QLCU 2DT5A 3F21A 4WXCA 1FP1D 4GYIA 4LMYA 1USSA 1D8KA 1SFXA 4XBFA 1F5TA 2O6GE 3CLOA 2MH2A 1U2WA 1XMKA 3HSEA 3VEPA 5CYVA 4LK0F 1FY7A 3WGIA 2EA2A 5DCMA 2RC4A 5TJJA 4NQWA 3ZP5A 2VT2A 2PQ8A 5L3CA 2UZKA 2G9WA 2JT1A 1QZYA 3JAMZ 2PEXA 1P92A 2O8XA 4KA4A 4JBAA 2W84A 1ZAOA 1XGNA 2RKHA 1SMTA 5D6EA 2L54A 2P8TA 4M72A 3KCCA 3KFWX 4LG0A 5E17F 2QUFA 5CVVA 4I09A 4XLPF 2F5FA 1H0MA 5AIPA 4KN7X 3U1DA 2BE5F 4UVCA 3KP3A 1XSVA 4M74A 4I7HA 2ZKZA 5E1ZB 3ULQB 4ASNA 5ICFA 3HRUA 2NNNA 3NRVA 4BAYA 1HKSA 3O3KA 3TOAA 1GVJA 2DPDA 3MHXA 2R3SA 2JSCA 5HS9A 3COAC 5D6FA 5FO5A 2HDCA 4AIKA 1REPC 3CO7C 1A04A 1ZRDA 4GXOA 2P4WA 4PGGA 5BMZA 4RGSA 4XSXF 1KYWA 2F5CA 4EJVA 3KEOA 1ZG3A 2RQPA 1HBXG 1R23A 2A3SA 4O6JA 1NHAA 1D8JA 1QPMA 2P5KA 3GFIA 1S3JA 2GAUA 2FU4A 4HYEA 5ICGA 3R0AA 1SD6A 1YW8A 2GXGA 4XSZF 5IT9K 2LKPA 1OMIA 4RAYA 2O03A 4KN4X 1LDDA 5HDNA 2ZBKA 2NRAC 3DPTA 5JI6A 4OIPF 1FBQA 2VODA 4EM0B 4IHSA 3ABUA 3F72A 3W6KB 3WU0A 2FBHA 3L2CA 2DAOA 2DBBA 3HHHA 1K79A 2YX4A 4MQVA 1LEBA 2XRNA 1IRGA 2VBZA 1S7OA 2H6CA 1Z05A 4PGHA 4OMZA 1FZPB 4EM1A 3IRQA 2Q0OA 4ENNA 3SZPA 1IN5A 1XCVA 2RNJA 3HIFA 1QZZA 4LLLA 2RV8A 3TKYA 3VODA 4AIJA 4IRIA 1S8NA 1V3FA 4LFUA 1YG2A 3RPUA 3U9GA 2Y75A 5IT9Z 3E5XA 2W25A 4YIFA 4CHUA 2O0YA 1P4AA 4L18B 1DDNA 2A68F 1XB4A 3KE2A 3CUQC 2FOKA 1YIOA 1BC8C 5HVQC 4YFKF 5BS6A 5LHGA 5A2QZ 3IC7A 1PUEE 3G73A 4KMUX 4FT8A 1JXSA 2RVCA 2V9VA 4RB1A 1R1TA 3I53A 4ESFA 2CGPA 4RB0A 4ENJA 1LVAA 1O3QA 4F7ZA 3O2PE 5DUIA 1ZRCA 4BXUA 5J8FA 2M30A 2G7UA 3GLXA 4M6XA 1W4MA 1R7JA 3ML6A 3FWEA 2OD5A 5L3GA 2PMHA 3RYPA 1MJ9A 3K1PA 4M9XA 2PLYA 2DQLA 3HSFA 3EUHA 1Z9CA 3KP2A 4N9HA 4P9FA 4G9YA 2Z9OA 3DPLC 3RTRA 2Z33A 1J75A 2H3JA 4HF2A 2WWYA 3IRRA 3BPXA 3F22A 4BNCA 2GA2A 1IN8A 4Q4ZF 4Z2YA 1MDMB 2L4MA 3WTYC 3T5XA 3K0LA 2CSOA 1HKTA 4MEXF 3GWZA 3RI4A 2XAHA 4Y17A 1BI0A 2YX7A 4TV7A 1XDUA 2IT0A 1I1GA 1DPUA 1BJAA 5LRRA 2QYOA 1FSEA 5EEGA 2D2WA 3ZQ7A 1T0FA 4IRHA 1U3EM 3V8JA 2EFOA 3CUQB 3Q9SA 1P6RA 3ZN0A 5E18F 4BYYA 1TNSA 1YS6A 2DTRA 4ENMA 2KIMA 3KZYA 3CTAA 3CUOA 3BJ6A 1XSDA 1T38A 1YW9A 1O3TA 2BYVE 2JRTA 3NQOA 5HOOA 1BM9A 1TQMA 1U5TA 1OYIA 2UXNA 2ACJA 1XSXA 5K5OA 2VOPA 1KU3A 3JTGA 5LHHA 4IPAA 3KLNA 4EJOA 1DP7P 1GXPA 2NYXA 1P2FA 3HYIA 2STTA 2BBYA 4WWCA 3W6JB 2K27A 3ZMVA 3ELKA 3V8LA 2J5OA 1XGOA 1OPCA 4PDKA 2OU2A 2IA2A 1R5GA 4M9ZA 3FXQA 1U78A 3TOBA 1K78B 3J80Z 5HLIA 1GHCA 4EGYA 2FMYA 3JTHA 2YPRA 3E3VA 2DPUA 3EETA 3TO7A 5ICEA 4YFNF 1CF7A 1J9IA 1HQCA 1XGSA 4MTDA 3RKWA 1G3YA 2MLGA 4MEYF 1T98A 4O5VA 1MJBA 2HZTA 3EYIA 1T6SA 5F64A 3K69A 3GUDA 4ENKA 2QBYA 1X3UA 2P6TA 4HV6A 1W7PB 2OA4A 1QBJA 1MKMA 1F4KA 1UFMA 1D5VA 2L3DA 3PFIA 1OYYA 1LQ1A 2XKPA 3F3XA 3LA2A 2IW5A 4L0YB 2DLLA 3E6DA 1E17A 1G3TA 2EA4A 3V8KA 3GZ5A 5L3FA 1KQ0A 2XUBA 1QGPA 2K02A 2FF4A 3I0TA 3FMRA 2E1NA 2K4JA 2A6EF 2PG4A 4Y13A 3KZZA 2HKXA 3F8MA 1R5HA 2VOOA 1ZN2A 1FLIA 4L9VA 1SAXA 1HW2A 3SHFA 2F5DA 4QWQA 5DDGA 1O3RA 3MCZA 5K5RA 1U6GA 4OOIA 5JFRA 5EEHA 3RYRA 5ILUA 3QP5A 2PBIA 2XVCA 5ICCA 4I98B 3T8RA 2K4BA 2FQ3A 2H94A 1YTYA 3ZN1A 2V79A 2KJBA 4OIQF 4UV8A 5CVIA 1B9MA 2XASA 3Q5FA 2DFIA 2CFXA 2P5LC 1LNWA 1IN7A 5FLXZ 3T0YA 1I27A 2KIFA 3HRMA 4ESBA 1MJAA 1Q1HA 2JTVA 2CWEA 3TGNA 1YFHA 1B6AA 4GGGA 4LK1F 4P5OA 3P7NA 1FX7A 3D0SA 3TO9A 2IP2A 4ETSA 1G3WA 2NNYA 2HOEA 2FBKA 4L9NA 1CGPA 2PMUA 3QU6A 2MD5A 4B09A 3DF8A 1XDSA 1OYWA 4PZJA 2HS5A 4Q5SF 1LDKB 3HRSA 5ERIA 4KT5C 2EJRA 3HOSA 2FE3A 4HW0A 2NS0A 5FFXA 1FYKA 3H92A 1IN4A 1XMAA 1ZG1A 1R1UA 2W24A 2QENA 3F8CA 2J5PA 3WGHA 3F6VA 1QQIA 3U2RA 4I02A 4N0BA 1HKQA 2OBPA 4EJTA 3E6BA 2VC0A 2M5WA 2GXBA 4RS8A 3RIRA 1BIAA 4AD9A 1HW1A
chains in the Genus database with same CATH superfamily
3CMAQ 3QQAA 1UHWA 3M8JA 1T33A 3PNTA 1NBEB 2H8HA 4R79A 1Z1DA 1VIFA 2DA3A 4IHTA 3IKTA 1UTIA 5GAOn 4N9IA 3E7LA 1WHMA 2LJ1A 3HUGA 1H89C 3A5ZB 4Z02A 2DJIA 5FB2A 5IHIA 1IF1A 1WZOA 2LQNA 1R58A 1BR1A 1U9OA 1X19A 2I10A 2W1OA 3GF2A 3BY6A 4M3GA 4NC7A 2VXDA 2R0QC 1NH3A 1M8VA 3A0HC 5FKNA 4ZYEA 1Y6IA 2L2OA 2ZNZA 3JCUC 2YHTA 3C7JA 4HX4A 2E1CA 4F3QA 1WQ2A 1TWFJ 1GT0C 2EQMA 3K4MA 2EILH 1G3SA 1YIJQ 1MDMA 1VA7A 2VJJA 1R1VA 2XSDC 3QJ6A 3F8BA 2QI2A 3F0CA 2MOXA 1I39A 2LF7A 4II3A 1W2BP 3LFKA 3SZTA 4DZJA 1WJRA 1ZGAA 3DKWA 1RC9A 3G1MA 4A3EJ 1B9NA 2V1RA 3RPQA 1R4MB 4CCJA 3P8BB 1KG1A 1NM7A 3S3MA 3AL0C 2KQWA 4XTZA 3JSPA 2V8JA 1X1DA 1JJ2A 3B02A 1XC5A 2V26A 4UVBA 3OSSC 2FHDA 5LGTA 3KETA 4XL9A 1VQOQ 4UV9A 4NUBA 2CYZB 2HKOA 5B5EC 3AFHA 2EB7A 1QO0D 1VQMA 5D5VB 2LK2A 2DZ9A 4XAXB 1RAHB 3SEMA 2UXXA 1RZ4A 2R7DA 2Q1ZB 1Y96B 5E8GA 3KLOA 2PQWA 4H0EA 2RJFA 2RI2A 3ZMUA 1Y1WJ 3DLMA 3GZNB 3WTWC 1U3OA 1TTYA 2DI3A 5D5UB 1DU0A 5J6XA 1RPWA 3HHGA 3C1DA 3M8FA 3O8GA 1O75A 1IB8A 2ZPBB 1ZREA 2QQ9A 1OKRA 2YUSA 5EZHA 2R5AA 1FWZA 5HK3A 1JB0E 3GW2A 3DPUA 4NHJA 1IREB 4A6EA 4M75A 1S6LA 1SMYF 2M45A 1U06A 4W1UA 3OMGA 4QVZA 4D8DA 4IUTA 1KD1R 2DETA 1NG7A 4Q48A 4M7AG 2L7ZA 2O7OA 2ZMEA 4HSTA 2GTJA 3QPTA 2NAZA 4GYGA 5DCMB 4ZDPA 2MC3A 5LGNA 3I55I 1O4XA 1MGTA 5HDGA 4YIRX 2R92J 4ZZLA 1M2OA 1AT1B 2KRFA 4KMFA 2EPDA 2J7IA 4NS5A 4DBHA 1YBYA 1BCOA 2CJJA 4RAFA 1LB2A 1M3AA 1I5LA 1R4NB 3BWGA 4WCIA 5FFZA 2BEOA 3A1YA 4XRMA 5JVGF 1ABQA 3PNVA 4RTZA 3OYBA 3CMET 1J7KA 3LSTA 2DF6A 2DMOA 2RJCA 5GP9A 4IIOA 3EDPA 4HCKA 2K9LA 1SFUA 2NS8A 4WCGA 1VQ8T 1K73U 2BW3B 4M73A 2XGDA 3BJAA 5C4XJ 1MMAA 3JRAA 2PI0A 1MV0B 3VB2A 4QSHA 1CKAA 1X2QA 3H3ZA 2HR3A 5LJ3j 2NUPB 2ZXWH 4GO1A 2D0QB 1IUYA 5L3BA 2BGCA 3LSGA 4CCMA 3KP4A 4HDUA 4P5NA 5D5XB 2EYYA 2LNHB 3J81K 4XOPA 2VBXA 1LCKA 3FZVA 2NOGA 3R61A 3TDUC 4AVZA 2EFWA 1LE8A 4BE2A 3NMZC 5J4YA 5DM7R 4R1HA 3EFRA 2GGRA 1TBXA 2HGCA 5J26A 3C4SA 2O2OA 4MNUA 4LG0B 3EGXB 1P9QC 2LY1A 5DUKA 2DK8A 2GWRA 4J8OA 3LNQA 2SRCA 1K0XA 4OMNA 4ZYHA 1OR7A 5IXFA 2FEZA 3BROA 2VT3A 1WGSA 1V5FA 2CQXA 2CU7A 2CP7A 2J06A 2OC6A 3M58A 1IXRC 1P4WA 3OYGA 3JREA 2ZPGB 3HHTB 2PMZA 3VUZA 3UKGA 2D8HA 3BTCA 2IPQX 4XKBA 1BCMA 1WI9A 4XLFA 1IC8A 2WACA 1TWGJ 2XHKA 4FYYB 3I9V2 1ZK8A 4JX5A 4ON0A 3OB9A 3DXJF 2HDWA 4RGXA 2K57A 4JLIA 2VN2A 5D4SA 2WY7Q 1ZLJA 3WGGA 5J3LA 1B1BA 5DY9A 2QEXA 4HDVA 1FTTA 5TGTA 5JHUA 1BIBA 2R7XA 1BB9A 4MHGA 5LLQA 3T9NA 2Z1DA 2W85A 4P1WA 2X35A 1WX6A 3CCJQ 3MZYA 3L2RA 2I5UA 2IVMA 2K40A 1TNTA 2DTOA 2JJ9A 2A69F 3HBLA 2WADA 2YDLA 1YJNA 1AKHA 3EH2A 4OIOF 2A28A 4F16A 4M75E 4LE9A 3K10A 3G71I 1K78A 1WCMJ 1KHCA 2P0KA 1HJDA 2O9LA 2V9PA 3BZKA 4JK1X 3I4PA 3BP8A 3OS0A 1XN7A 4PCQA 3META 4F93B 2UV1A 3AL0B 4C8QG 2JPBA 5JLXA 3OW2A 3GTMJ 2AKLA 2PN6A 2XV4S 5KYWA 2YR2A 2LC4A 1HW1A 2GZWA 1W1WE 1PJRA 2CRGA 2HQHA 3BQZA 2VVKA 2IEKA 2DZCA 1A31A 4IUUA 4C5EA 1VQ7T 3JAME 1YJWA 5HKCA 4PLIA 1W5SA 2CW7A 2QF7A 4LDXA 4FE7A 2A5YB 3HPWA 4M4ZA 4AMCA 1QNTA 3P9CA 5KCHA 3CCMA 2PMZN 5GANe 3SD4A 5D6XA 3CMEQ 3HXLA 1FYNA 3CC2I 2DT7B 4LJZF 1R0BG 3UA6A 1EH7A 2EQIA 1VQ8Q 1LDJA 1IV6A 2JS0A 3KP7A 5HLGA 3O5ZA 1UAAA 5CO7A 4L5IA 1QVPA 2KI7A 4MGRA 2HL3A 4IRGA 4BEHA 8ATCB 1Q86R 3C2BA 3M0TA 4JJBA 5IPAA 2V9KA 4UVAA 2QKMB 2HSEB 3JCMh 2V1QA 5GAMd 1WLPB 1JO8A 1D1CA 1VUBA 3GO5A 1TP4A 2QDYB 1ODDA 2GIVA 4BGDA 3SDZA 3SHWA 4RTVA 2M7AA 3N4MA 1OEBA 5AYFA 4G7HF 3JW4A 4Y33A 3MP8A 3VYUB 3FF5A 3M7GA 3UF4A 5CK9A 3QSUA 3F23A 1SEMA 4HAMA 4A54A 2FD5A 5CKBA 1I3QJ 5HLHA 3MJXA 3L2QA 4KFCA 3FBIB 4C30A 3CD6A 3VS1A 1W7PA 1V4RA 4WX9A 3VS7A 2G0EA 3G4SI 3OSVA 1KU7A 2VB6A 4N4OB 3NWTA 2HTJA 2FUG2 3ZQGA 1K7AA 4J6XA 3O6BB 4Y52J 2IAIA 4M78A 1NTCA 4ZYDA 1O3SA 2D9TA 1VQLA 1Z6TA 1LPQA 3T8TA 1V76A 4HSRA 3CCET 1ULYA 1WVRA 3V7RA 4DNCA 3HOZJ 4V2SA 5GMKj 1WH5A 2CMPA 4RA2A 3JRBA 3PUBA 4OP0A 5D6WA 4A5MA 4EMGA 4C0DC 4KYWA 2E60A 3SDGA 3EYYA 5IYBJ 2HVSA 3MEVA 4MLOA 1I6XA 5M3MJ 2E35A 3OV8A 3K2AA 5GADJ 4R0KA 2J6OA 5LJ5d 1FYMA 3E6MA 4DBFA 4U88A 1BR2A 2R7OA 2Z2SB 3CJNA 2CO5A 4EMKB 2E5NA 4RG2A 3QIIA 1YW7A 1Y0UA 3A4CA 3OA6A 1OV3A 4IVNA 4A12A 1HSJA 1ZX6A 2GFUA 4R55A 3HSRA 4PKCC 4LD5A 3P5JA 2LRQA 5ECAA 3P8HA 2KZVA 2ED0A 5E20A 1S29A 1JHHA 3REAB 5LJ3h 3I54A 4IHWA 4EV0A 2ZSHB 1J59A 1HD3A 3MKLA 1S5LC 1JI8A 2QZ8A 1PG5B 1Y07A 2LG4A 2DA7A 1VQ7Q 4I01A 5FW9A 1GCQC 4ZTFA 1VQ9A 1BYMA 1KYZA 2HQRA 2ZXJA 2XD0A 3HC7A 4U7BA 1W70A 1BI2A 2E6NA 1UG0A 2V6CA 1JE8A 1R36A 4PL6A 1VTNC 1WXTA 3I59A 1TG0A 3W2AA 4M77A 2E5ZA 2DQRA 2XIGA 2HOTA 4JRIA 1N25A 3IWZA 2ED1A 2X48A 3FXLA 2XICA 4A0XA 2KDSA 1UHSA 4HV5A 2QA4T 4A3GJ 1VI0A 3M9QA 4U0WA 3S1QJ 5HY6A 4BI3A 2YSQA 4CDGA 5E79C 1R9TJ 4X1VA 1NEGA 1YX5A 5EGOA 3H3VK 3TCJA 2SEMA 1Q81R 2F5KA 3OOUA 3CQTA 2OQGA 2WB1A 1AA7A 3HP9A 1GXQA 4M3BA 3GTKJ 2R7TA 1M5Q1 4JJCA 1QVGA 1WA7A 2LMDA 3N97A 3PGGA 9ANTA 4XLNF 4BH9A 1VQMI 3OW2P 1WSUA 2FMLA 5IOYA 1MMSA 1MD0A 4PFOA 3D5SC 4FX0A 1X2KA 3BR6A 2LMJA 2YRDA 2KJCA 3GNGA 2KVQG 4KDPA 1Q81C 1E0EA 2JUFA 1S7EA 4GCVA 1NYGA 4A2UA 4XTWA 1R6RA 2OTLI 1TUCA 4AFQC 1WXUA 2K9GA 1PP7U 1MH3A 5FU7C 3CLQA 2AZVA 3LMMA 2ZNYA 4GFBA 1OU9A 4A4HA 1J3TA 1OCOH 4PK4A 2HCKA 3VYTB 1WHJA 2QASA 4M78E 1RIOH 4ZDLA 2IS1A 1EH6A 3IP4B 2KYBA 3MEXA 3QAHA 3ZMZA 1GV5A 4BHPA 3JB9H 5FWBA 3LAJA 4RB2C 2LOOA 3M3YJ 2FJ1A 2XF5A 3IWFA 3INZA 1YN8A 2P7CB 2M51A 1FC3A 1MBFA 5DM7F 2ZJQF 3NTHA 3CCEQ 5CJ9A 3QOPA 4XRSA 2QXFA 4FE4A 3PT9A 2BKDN 3RERA 2DTHA 1FNNA 4KNYA 2YT6A 3E97A 2A36A 2KIQA 4BB7A 4M6VA 5KCOA 2VBWA 3EG9A 1K76A 8AT1B 1U5TC 3QUIA 5GPAA 4BBSJ 1OPLA 2MBFA 2M0MA 1QHHD 1U8RA 4HXJA 1YJ9A 3GEZA 4J19A 5DM6F 4HF0A 1RUNA 1TT5B 2FXAA 2EFNA 2A61A 3ZMDA 2WB1N 4EVIA 2M4GA 1HK9A 2D0NA 2W00A 4CICA 4F04B 3LA7A 3TMOA 4OMLA 1Y0MA 2EFQA 1ZR4A 2LSOA 4U0VA 2K86A 2LQ8A 5GAMj 1TL8A 3I56Q 2FO0A 1YCSB 3JCMP 2E7WA 3M4OJ 5FKLA 4O3MA 5L3EA 2FBIA 1VQ9Q 2DCEA 3OYFA 1C6VX 4HNTA 4MDXA 2QCOA 3CP8A 3G3ZA 1ZGJA 1X4OA 1YWOA 4HT8A 5AONA 1FOWA 2DMQA 5H6RA 4PJOC 2HXIA 4C0DB 4M77E 4MQ9F 2KNBB 1DPRA 3MKWB 1P4XA 5FKOA 2K3BA 1KC8U 5KNLA 1JGSA 1BI1A 3I71A 6PAXA 3QYGB 3HM5A 2K5FA 1UZCA 1B72B 1QPIA 2ROLA 2QA4Q 3OIOA 1WJDA 3C12A 2JOYA 3Q9VA 1XTAA 1YQAA 2HFHA 3LL7A 4J5YA 4F7UE 4UHTA 2M1BA 1ZSGA 1F9NA 3MAJA 2DA5A 3W2VA 1PSFA 1STZA 1A35A 2L3QA 3QOEA 1ON2A 4RGRA 1XNIA 3CJQB 3CXCA 5DCFA 1BBYA 2DW4A 2ZJPF 2EAYA 4XU1A 1MZBA 1ZH5A 5FWCA 4LB6B 4M7DE 4BUPA 1HOMA 2A6HF 3ROUA 4UUSA 5A2QE 3CC4I 2DL8A 3N05A 2DMNA 2QEXI 3L7WA 1M2VA 2KMTA 1X1CA 2CG4A 2JK3A 1I5ZA 3M9AA 1VQMT 3MN2A 3D5LA 1PUFA 2E2IJ 2DX1A 1Z91A 5GMKh 4JYKA 5F04A 4J7IA 1D3YA 3OYLA 5DEQA 2DPPB 2HBWA 5LJ5j 1WJCA 1BW5A 1N27A 2WAEA 1E2XA 2F2EA 2PU9B 2JM9A 3DTIA 2L01A 3HKZA 1T2KA 1FEXA 1UFFA 4C92E 1H8KA 2HMAA 1U8BA 3O8HA 2CDTA 3VS5A 1KQSA 1GXIE 1XOVA 1WNLA 4QT7A 2KT1A 3MEWA 2JUGA 4LOCA 3CCYA 2TDXA 2HYFA 3G1JA 3K9TA 5I2MA 1MBHA 1Y8QB 3BCBA 3I55A 4XLHA 1I50J 2O4XA 5JR3A 3RBBB 3DBHB 3L9FA 4CO8A 5IP7J 3P9KA 4HVWA 2HOSA 3VS2A 3S93A 4Y92A 2YUPA 4FISA 1XD7A 4Q47A 1GBRA 3H0HA 1B34B 1YJWI 4HLXA 2X3WD 5H6QA 1WHHA 2XROA 2RQRA 4RCCA 3BC8A 3WTTC 1JQQA 3OSGA 4ZYGA 1ZG5A 4HA8A 5DYMA 1MIJA 3BLYA 4JZ3A 4OMFB 1M30A 1UHCA 1TQPA 1T39A 5FU7B 3ZBDA 4MMLA 3HGGA 1YCYA 4AVPA 2RDPA 2KLOA 2OQRA 3AAFA 2EJ9A 2MLKA 3I3LA 1P7IA 2RHYA 2JXBA 2XDDA 3GBQA 3L00A 1ZLKA 2JZ2A 3L2ZA 1KQ8A 2ETHA 1WDXA 4G8XA 3I5UA 2HYGD 1R71A 2P4RA 2XF6A 2W10A 4NDLA 4DQ2A 5J47A 3S2WA 2ESWA 5IN1A 1X01A 2DJZA 5AIQA 4BY1J 2CREA 4OINF 1X58A 2V4JC 4DOZA 3BTLA 1I6HJ 2CSIA 3QWXX 2HOAA 4DZPA 4KIGA 1PKSA 4OGEA 4DBRA 2QLZA 4Z8AA 3HKZN 1UCRA 1SPKA 2GBYA 4XKVA 3C2GA 3UDCA 4R56A 1U5TB 3W3CA 4M78F 3TQ7P 3RZOJ 2LCLA 3OIPA 3JB9G 4XRFA 3E1SA 1I5OB 1W7PD 2QGGA 3CBPA 1U1TA 1KFZA 1TWCJ 3BDDA 3SEQA 3M8EA 1W0UA 3M07A 2VL8A 1NJIR 4II2A 5BQTA 5J40A 4D7NA 3CXCS 2XPWA 3GTOJ 3THKA 1K73R 3H0IA 2GA1A 4FT4A 1VQPQ 1FIAA 3D1NI 2K7LA 4ESJA 4M78D 1FOXA 3QPHA 5M9OA 1VQLI 2OTJT 3EUKL 4B44A 3Q0UA 1GBQA 1N9SA 2M4KA 4HLYA 1M3CA 2D6FA 4PUSA 1M1GA 2BZTA 5LGUA 1D3BA 1TS9A 2Z3YA 2K5LA 1VQKI 4KH0B 5BNGA 1LUJB 3CPWA 3A01A 1W5TA 2IRFG 4AIHA 4XNFA 1V29B 1FPQA 2WSEE 3HGYA 5J1UA 3M54A 3TREA 4GLKA 1WYXA 2LFBA 1Z9ZA 4C0GA 5GAN5 5GAHJ 3M1EA 4BY7J 1PRMC 1ZLMA 1KQSS 1XCBA 1WFXA 3WTZA 3FEOA 5A0GA 9ATCB 4JQFA 5E3OA 1VQNI 1PVEA 5C3EJ 1LVKA 2JJ7A 5CLSA 3G71A 1YJNT 1Z7LA 1SRMA 1PD0A 1QMCA 2F1LA 3FMSA 2HTSA 4E47A 5TRDA 1WPYA 2F2XA 3CPFA 1HYOA 2WV0A 3CC7A 2H09A 1ZSZC 3IH3A 4CYDA 1TC3C 3M1CA 1H9TA 1IRFA 3H3UA 1JGGA 2IIMA 3WTXC 3JRZA 1MBKA 2X1DA 3HFNA 5GAMh 2JRMA 3LSKA 5KE3A 1OOTA 4FHTA 2LP0A 2IA1A 2WV1A 3BTIA 2VQGA 5K5QA 3K70D 2AXTC 1JT0A 3SFZA 4IKFA 2KT0A 1VQ9I 3WE2A 4F55A 1QWEA 2EYWA 3WODF 3BDUA 2C0OA 4F7UG 2V1DA 4NB5A 5D8LB 4XU0A 3KBGA 3DU6A 4ZJZA 3CQZJ 4MZMA 2CW0F 1JHFA 2ZXHA 1PWTA 1X1BA 3JCMe 5FD5A 3CC2A 1BOAA 3IL2A 2A3LA 2RN8A 3LSIA 4C5IA 2GM4A 4G7OF 3CCMT 1CF7B 4ZGEB 4M77D 4XU3A 4YEJA 3CCQQ 4C3JJ 4IO9F 2DDAA 3H35A 1QCFA 4DOVA 1MMGA 1UG1A 1UJYA 3DLAA 2O9VA 2VXZA 1PKTA 3REOA 4AM3A 1KHIA 3M53A 3CF2A 2OF7A 1I1SA 4M7DF 4IXAA 1HSTA 2V1NA 1UJ8A 1YWPA 4JRKA 5EEAA 1QP2A 2COMA 1IO6A 3OR2C 4EQQA 1VZ0A 1O57A 2KKOA 3ASNH 3ISPA 1TWHJ 3B6AA 4HQEA 2G7HA 1HC8A 5CKEA 2G6FX 2GCXA 1C1AA 1UGSB 2KP6A 2QBYB 1C0WA 4QVCA 2Y48A 3GXOA 4M7DD 5HNHA 2XKOA 2EVRA 3ERED 2A07F 4JS4A 1K6OA 4CZCA 2FSWA 1D0XA 3LQRA 4S05A 4HQMA 4C92F 2VONA 4DEYA 1IZ1A 4BJ5C 3CD6T 2E7XA 2JMWA 1JKPC 1WQ7A 4J9DA 4RAZA 1B8IB 5LJ5h 2VQCA 3PJRA 2F4OB 2Y0MA 4JX6A 4UUVA 3FXKA 1G83A 1NZ9A 1OFCX 2ABLA 2MA3A 4CC3A 1OCCH 3CCLA 2BVMA 2A5WA 3QZ9B 4U87A 3ECOA 4IOCF 2R7VA 4E7JA 1ZQ3P 4IJAA 4FX4A 1VFCA 2OTJQ 2PFBA 4M3EA 5F1JA 3GTJJ 4X9CA 4BI8B 4QTRA 4C92D 1W36C 1N6AA 2LT1A 3OYIA 3LH0A 1YYVA 2LNVA 2HYJA 2PX9A 4LXCA 1U1SA 2R7WA 2FVUA 1W4SA 4KICA 2FYKA 4ME7A 4A3BJ 1WJBA 2COWA 2CT4A 4RG8A 1W2BS 3MQ0A 2EV0A 4EM2A 1SKUB 2CP2A 1ERDA 1ZR2A 3FK7A 3I5SA 5KVRA 3FISA 3VOEA 1VQ5Q 2YSRA 2M8EA 4MIMA 2R7FA 2V1XA 5ILSA 4QIWN 1IAWA 5BPIA 3RKYA 4ZTJA 1ZTRA 2FL7A 1RNLA 5KHDA 1OQYA 2CZ7B 5LJ3e 3NHNA 4YG2F 4IHYA 2JMCA 2VE9A 2ID3A 1NLPC 5L23A 2DFHA 3J80E 2XAQA 4NC6A 4EGZA 1VQ4I 3OOPA 4G7ZF 1O7FA 2F5EA 2DA6A 4XOTA 2XDBA 1L0OC 3WTUC 1GUUA 2JA7J 3EHRA 2YWWA 2QG9B 2DA1A 4MZPA 1HA8A 3A8HB 3QJYA 4PFPA 4ZN1A 1N8RU 3FMQA 3R60A 1ZARA 1ZELA 5TISC 2HQNA 4DYCA 3RDIA 1W1FA 2CZ1B 3I5RA 5GANf 1Q95G 3DQVC 4KULA 3CMMA 2QQBA 1I3AA 3ABTA 4EEFG 5LD2C 2LQWA 2BY3A 5LJ5g 1SRLA 4M71A 2AXLA 3GX4X 5EG2A 1AWCA 5F0FA 4UC4A 1BK2A 2HEOA 5E8IA 4P9UA 4KRTA 3CPWP 1VQ9T 4DJAA 1EH8A 1QHGA 2ADUA 4RM2A 4XN0A 4GDFA 4C8QC 4JPBW 3CCMQ 1YITT 2RHUA 2XPUA 3RCOA 1KQ9A 1YO5C 3V7CA 2EIJH 4HX7A 3PIOA 4KIBA 1ZRFA 3DEEA 2AS5F 1W6XA 2DIGA 2LX9A 1LEAA 3MWMA 1H3ZA 1JUMA 1YI2I 3QP6A 2VC8A 1VQNT 4UXNA 3TW6A 1QU3A 1JEGA 2JN6A 3MO8A 5CKHA 5ED4A 1YS7A 2OV7A 4P96A 1ZSZB 1FOKA 2E4HA 3M0UA 4FQGA 6AT1B 2X0LA 1NEBA 1BOBA 2VJ5A 1X2NA 2HVRA 4LLGF 4I2OA 4L9JA 4ELYC 4E7IA 2DFFA 2DMTA 4LITA 2O61A 2RK2A 3SZGA 4G6TB 3QXEB 3LSHA 3GMEA 4W97A 2R5ZB 4OB1B 4EMHA 1RI7A 1OCZH 2NVTJ 2OTLA 3HSBA 3A02A 1SVMA 3ZEHA 5A2QK 3L2VA 3CD6Q 1HXDA 1WQWA 1KU2A 2LC2A 2ZZDA 1H8AC 2K79A 1UB9A 4M7AB 3CDIA 1U5SA 2R7QA 4D0PA 5LHIA 1A36A 3GTLJ 1UHMA 5AT1B 2IPOB 4WK8F 2Q8KA 2CP5A 2IS4A 3CCRI 2UWMA 2CZ0B 3HTRA 1MBGA 1RACB 3CUQA 1SD7A 3V7SA 3VSKA 2OX7A 5D8KB 5EDNA 2P84A 3QPSA 3PM1A 4F92B 5IYCJ 3HOTA 2CV1A 3GYHX 2X6YA 4NQWB 5K1YA 4HNVA 3J7AY 1WPKA 4UNOA 4BQQA 3FC3A 2F5VA 3IAM2 2VJ4A 5GAN6 2XGXA 2P4TA 4EMKA 2R57A 1R22A 1Y0NA 5FD6A 3PIPA 1PM3A 2CP0A 4C3HJ 3CBOA 2DXIA 3GIBA 4G6DA 1JBMA 1FP2A 3GFMA 2W0ZA 1WWXA 1TQIA 3BG9A 3IH2A 1YRNB 2YXYA 3JSOA 2VUBA 3CCSQ 1YJ9T 3KFVA 2OAZA 5IY5H 3C95A 3EGDA 2RJEA 2PJRA 1SD5A 3IAS2 4U7DA 2P7VB 3G1OA 2OZUA 2VJIA 4RB3C 2QWWA 1IXSB 3QRFF 4L5EA 4M3DA 4JJNK 2BXYA 1IW7F 3PFYA 5LBQA 4E2FB 4DYQA 1QVFA 3VKIA 2OZ6A 3NEUA 4NL2A 2AKKA 2VXFA 3JCMJ 2CYYA 2EV6A 1Z6RA 2JA2A 4IF4A 4B8XA 2L4AA 1HCRA 1WHGA 3W6VA 2WC2A 1YITQ 1TLHB 3HB9A 2KYMA 2QTXA 4OIRF 2DA9A 3Q1JA 3RNJA 2JN0A 2RGVA 3NWSA 4M75C 2HPIA 1YOVB 3S3NA 1UG2A 5D5WB 1RUOA 1TZLA 3C2HA 1X27A 2PUOB 2X6XA 4QPQA 2DTZA 4HZFA 1FXXA 4A0ZA 1UGPB 4JRPA 3BOQA 3BR1A 3L09A 1UEBA 1VQ6I 3KXTA 1QLYA 5GMKe 3DKYA 2ZMEC 2X3XD 1LKXA 4A69C 2ZB9A 5C0MA 1RI9A 1FBSA 4CCNA 4QQGA 4CRIA 1K8AU 3BTJA 4EJWA 2D45A 2NUTB 3A8GB 3BW1A 3CC4A 5KH6A 5ILVA 3ECHA 4Z6YA 3WTVC 1OPKA 1QRYA 1ZYRF 4LGWA 1K1ZA 4A3LJ 4RTYA 2X4HA 2XAGA 1QA6A 3MVPA 4LB5A 1PHTA 2DK3A 2E41A 1V1CA 2VBYA 5E1XA 2MSYA 4ZH4F 5GJVB 4BI4A 1JTXA 1SHFA 3IV5A 1X1PA 2GBQA 4BHCA 2L02A 1H92A 4C8QB 1SHGA 2B0LA 3ZOBA 1IN6A 4CGZA 1Y71A 2CQNA 3A98A 1SG5A 1ETQA 3JB9J 4L0ZB 5KYUB 4IUQA 3ZMTA 3BE3A 3IQLA 3PQKA 3ZMSA 4CC4B 5FLXE 1EV7A 3BZ6A 3CC7I 3LSMA 5F0HA 3LW5E 1KC8C 4ELZC 2I2LA 2KDZA 2EK5A 2ZCWA 3J7AO 3MEAA 3RJPA 2K2VA 3LAPA 2M3AA 4J9EA 3JRGA 3I55T 5D7UA 3UNGC 2KRMA 3Q0VA 3A8OB 1J2XA 2BHYA 3WU1B 3O8VA 1I8FA 3HRTA 1I1JA 1OX9A 2F69A 3BR2A 3C3WA 4A3MJ 2ISZA 4V2FA 4HKEA 1FYLA 3VFZA 2Q2EA 4ZGJB 1A5JA 1AOJA 3WHBA 2MCNA 2EPFA 1OR7C 4KIFA 4A6DA 1YJ9Q 3QBYA 4OB3B 3J81Z 3JRIA 5FRNA 2QKLB 1B07A 3FM5A 2KT8A 4DGWB 1ZGWA 3GVAA 4IL6C 1B3QA 2H27A 2RNAA 2XAJA 3E19A 2HSPA 3WE3A 1TT0A 3U1KA 2BE7D 5DD4A 1B59A 4PJMA 3CCUI 2R58A 5IP6A 3GF5A 1YHQI 4M9SA 3HL8A 4Y28E 3HUGB 2HZYA 5F6FA 2O88A 4EMSA 2LX7A 3EFOB 2CH4W 4M6YA 2Z5UA 2MC4A 3QODA 5GTHC 3Q3SA 5IP9J 2Z99A 3GFJA 1GLNA 2LTOA 2XK0A 3VS3A 2M87A 4AFUC 3TEEA 3GPLA 2QM3A 2FNPA 2CH4A 1TW2A 2P0PA 4Q5WA 4XTUA 2Y2ZA 3X25B 2KXDA 3I9QA 4QKUA 3R6SA 1IGQA 2ESHA 3E5UA 1DGWY 2L2PA 2QGFB 2DYSH 5FGMA 2RO0A 2A7YA 4FETA 5C6SA 5CKTA 4K2EA 2CV0A 5J8CA 1VQOA 2L7MP 1OCRH 3HTUA 3IKVA 3PSFA 2LD5A 2VGMA 2LDUA 3FX3A 2FRWA 3GBGA 2KIUA 2KZGA 2ZFWA 3KEQA 1S7AA 3LQQA 3P9IA 4G94A 3AKZA 2STWA 4N0AC 2DK5A 3K2ZA 3CCLI 4U0YA 1VOMA 2E6ZA 4DOWA 3EUHC 4B1RA 3BT9A 3F8FA 3BG3A 1RRJA 1AOYA 1LNXA 1WH7A 5DV5A 4A4FA 3ZPLA 1PP8F 3DFGA 2RA2A 5IAYA 2DL3A 2L3PA 1IXCA 2KE9A 3AT1B 1RR7A 2VKNA 1Z21A 1VQKA 4NC8A 2GLOA 4LLNA 1ZHIA 1BC7C 2EKHA 2L9NA 2HWVA 1O9SA 2D8JA 3PL8A 3FIWA 2DU9A 1PYVA 5HDKA 4ZDOA 2P81A 2RN7A 2ZPFB 1QVFP 3M55A 3HOVJ 3SWNA 3PNWC 4P55A 3LSPA 1IDZA 4OAZA 2NWMA 2QAZA 4OGCA 3CO6C 4D8KA 3TQNA 4BD3A 4H4KC 3E6CC 2OAWA 3OBWA 2IGMA 1FBUA 2BV6A 1VQNA 1H641 3PMTA 3TVTA 5GAMe 1B4AA 2ELJA 4E6KG 5HNFA 2FQ4A 1KU9A 3MZHA 1XS9A 3ME9A 4JLGA 1BN5A 3OW2S 1K83J 3IH4A 2YU3A 2KROA 4M75B 4IIMA 3UT1A 1ETVA 1WI3A 2Y9ZA 1OCTC 4PJ0C 3G71T 1FMKA 3DP7A 2PJPA 1B34A 1AWWA 1M8MA 1JT6A 2F4IA 4AWXB 2KR3A 4WF2A 2JVGA 1WRJA 2ZMEB 1EFNA 1OI1A 3A8LB 4WXHA 4M75G 4AFZC 3J80K 1EZZB 5HS7A 2WSCE 1D1AA 2EWNA 3I55Q 1X75C 4E70A 2LY9A 3E5QA 3OS2A 3WTSC 3I58A 3OL3A 2P5VA 4E7SA 2JPCA 1KSWA 3PIOF 4IHVA 3RQIA 1ON1A 1PC0A 2O31A 5BOXA 2LNBA 4XONA 3FB9A 2X85A 1UJ0A 3K1NA 1MSFC 4M7DB 4B9WA 2YUNA 3VS6A 1VNDA 3GFLA 2D1HA 1Z67A 5LEJA 1IGNA 4C0ZA 3LSJA 1BL0A 3KP5A 4EDUA 3CC2T 5CCAA 3FXJA 3FDYA 5A0DA 5HS8A 1LPLA 1JJ6C 2PZ1A 1G4DA 1WKMA 1XGMA 2EINH 3BG7A 2Z16A 3LSRA 3JR9A 3E0JB 1G2HA 4M7DA 3WG9A 2P0WA 1T0FC 4FU6A 2ZO4A 2E3HA 4A0YA 3V4GA 4JZ4A 4CCKA 2GOXB 3CCVI 1MMNA 2RK1A 1LE8B 2C6YA 4S04A 3LX7A 2GQQA 1OX8A 2ELHA 5CVUA 1QW1A 3MKDA 4N4GA 4GY5A 2K9QA 5A0LA 5LJ5e 1PNJA 5LRSA 2RI5A 5KYYA 3G2BA 4AYBA 1M1EB 3EQLF 2Y0SA 3S3OA 4J00A 2VGNA 4GLMA 3OMYA 5CPRB 1NG2A 2YLCA 3HOYJ 3N5BB 3P8DA 2DO7A 4RTWA 2J6KA 5HK0A 5DD8A 1KD1U 3F6OA 2D1VA 2RPNA 4RGUA 2H8RA 2E2HJ 3GTPJ 4Y15A 1NLOC 1ONVA 1PDNC 2EV5A 3G4ST 2RAEA 1BA5A 2K5IA 2VV5A 2KAFA 1T95A 2BZXA 5CQYA 3CDHA 3FBNB 4HOBA 4BHBA 4C92A 3BFMA 1FOYA 5GAOp 2ZPIB 3CCJA 1Z7UA 3BPVA 1ZA1B 2W57A 3BR5A 4WXDA 1Z77A 4XN3A 1N78A 2HDDA 2WAFA 4PJOA 2R5YB 2NXNB 3FXUA 3K4KA 3PIPF 4RKUE 5JVTA 4X0GA 2LBFA 4EJUA 2DXTA 1AWOA 1H9GA 2HL5C 3EG0A 2QVOA 2DYIA 2ESNA 2Y69H 3FXRA 3TDZC 1ETWA 3NTKA 1KGSA 3CJTB 4ZZDA 3R0JA 4OMPA 3K1MA 3PQJA 2CQQA 5H20A 4C2TA 4PNOA 5I11A 3EGUA 4ANJA 4M77C 2JNGA 1AKHB 2K4YA 5CVRA 2PVOB 2X1EA 1R00A 4MTEA 4BACA 4CZZA 4J6YA 2ISYA 2RNGA 2X1CA 3FM3A 3G6EI 5BPDA 3TSZA 3G71Q 1VQ4A 3I64A 3C94A 2OUMA 4OMYA 2H6BA 3SXYA 2RH2A 3JCMV 2HKNA 3LFUA 3S1RJ 1DP3A 2EQJA 2WSFE 4KT0E 2G3RA 1ACMB 5L3DA 5KK1A 4AYBN 1SFEA 3SQNA 2Y0SN 1OYXA 3FJ5A 4BKXA 4G6QA 3CMAT 5M5YJ 3JRFA 2FPFA 5FLVA 3CF5F 1KIKA 2MH9A 4ZYAA 3OYMA 2VE8A 2QQSA 5H2FC 3KX2A 4KT6A 2W7NA 3GZ6A 2AZSA 2CP6A 3DTEA 3CCQI 4D9JA 3BR0A 3RQ4A 1KA8A 2IJLA 4A3IJ 3GTGJ 2JM8A 2EFPA 3K4LA 1M4ZA 2E12A 1MGQA 4LNPA 3REBB 5IT9E 1GDTA 4L5JA 3R4KA 2ZJ2A 1Q7YU 4XLCA 3DV8A 3JCMb 2FNAA 4VUBA 3CC2Q 2OCEA 1EJ9A 2DEQA 4DEXA 5F1RA 3PMIA 3MFKA 2WTEA 2EQKA 2IA0A 3QPLA 2CUJA 2B63J 1YI2A 1YITA 2V1UA 3VPRA 1WIEA 1M1KU 4KGZB 3DLLA 5EG0A 5E3MA 4OB0B 2QSGX 2KFDA 2QQAA 3M56A 2E10A 1BR4A 4BQAA 2KMUA 2P6SA 3K6GA 3OQ5A 1Q82U 1EKEA 3NFCA 3SFIA 2HQXA 1T3LA 1X6BA 4I0AA 4KUDK 4RMNA 4CYCA 2VKEA 4HBLA 1TW3A 1SF9A 3LWIA 2IGNA 4DA4A 4LD6A 3H8ZA 2JTMA 4E6RA 5FKMA 4OU0A 2O3FA 4E7LA 3RMSA 2RHIA 3BJOA 3LA3A 4F52A 3FHZA 4HF1A 3QU3A 2E5KA 4IQ4A 1MBEA 2QGUA 2BY0A 1DUXC 3PVQA 4XK8E 3TU4K 1FSHA 4XR6A 3KUFA 3GP8A 2OTLT 4NNJA 1JJ8C 1XJWB 2BXZA 2DRMA 5KYNA 3NARA 3L2WA 2E64A 3G4SQ 1N8RC 2VASA 3IHUA 2QYZA 1SC7A 4YTLA 1O7LA 3DEUA 4R8HA 4XORA 3T1BA 4YFXF 5D4RA 3LWFA 4HX8A 4BE0A 2JTEA 2MPXC 3ESWB 3KP6A 2BY2A 4C5GA 3CCRA 5GPCA 4PJOE 1J5YA 1SSFA 2ELKA 1IG7A 1VQ5I 2VUMJ 1X69A 3BY7A 2FA5A 1LJ9A 1S9HA 4M78G 1R5ID 2DOAA 3S8PA 1S72I 5FLXK 4AC0A 5IT3A 1VYTA 2DILA 2DRKA 5LEKA 3CMAI 5K7HA 2R7RA 1S1NA 2E65A 2CV2A 1Q86U 3U23A 5LJ3f 3VS0A 1K9MU 3X20B 1G6NA 3ZFJA 1WFWA 3E2UA 3RKXA 4A5NA 2LF8A 2BVLA 5IHKA 3OYEA 3HTSB 1TWBA 1OCPA 4UB8C 4CXFA 1WJ5A 3JAMK 2VPRA 1GL5A 4OB2B 5E1WA 1HW5A 1ZHFA 2L3SA 1Y8RB 3F8NA 4ESRA 5KYXB 4PLLA 5GAOm 1MNDA 3K4BA 1JUSA 1L3LA 3BR3A 5F08A 2FRHA 3DTKA 1WZ2A 2K5CA 1IRZA 1SD4A 4J6WA 1BI3A 1FT9A 1ETYA 4I0BA 2CQKA 3QHSA 3TO6A 1YIJI 2O01E 4OMMA 1J0RA 2JZYA 3C18A 2XAFA 2ICWG 3HPHA 4D5FA 1XPXA 4HVUA 4L9TA 2GF7A 3H0DA 2LREA 5CVJA 4F91B 5J3BA 3HKSA 1USTA 3X2QH 2JQ7A 3QYEA 1F1ZA 2MABA 5GAN8 4YIIA 2TRTA 2VC1A 3OYKA 4KUMA 3ZQLA 2DD5A 1YLFA 1Z3YA 3HEFA 3I59B 1C0MA 3B73A 4QLCU 2DT5A 3F21A 3EFSA 4M77B 4RTUA 4XTXA 1VQOI 4WXCA 4Z89A 2YUOA 3QO3A 1FP1D 4GYIA 4LMYA 2IG0A 4XLEA 2MYSA 1SAUA 2JW4A 3OYNA 3UWNA 3ABKH 4M3FA 4M77G 1DGRM 1USSA 2C0TA 1UB4A 1D8KA 1Y96A 2P0QA 3D7SB 4QVDA 1SFXA 2MW8A 4XBFA 1VQ6A 3J7AF 1ZBXA 4LD9K 1UE9A 2GXAA 4HCZA 1FMVA 1MW7A 3QYBA 1F5TA 2O5RA 2O6GE 3H36A 3CEYA 1ARKA 2LZ6B 3CLOA 1VQMQ 1NPPA 4B4CA 2MH2A 2RQQA 3EUAA 1U2WA 1RAFB 2DOFA 1U0JA 3CC4T 2L5QA 1XMKA 3HSEA 3VEPA 4M7AA 2RQVA 3RESA 1A6IA 4J9CA 2X4XA 5GMKl 5CYVA 3QWLA 1FY7A 4LK0F 3WGIA 2NUZA 2OTLQ 2EJGA 4M7DG 2EA2A 2LP5A 1I0CA 4AFSC 4XICA 3OIQA 2X4JA 3CCEA 2XMFA 3FJPA 4FW2A 5DCMA 2RC4A 2Y9YA 2MWOA 3ASKA 3LOCA 1CKBA 3S6WA 2AT1B 5TJJA 2MI6A 5L8RE 4NQWA 3ZP5A 1LJOA 2O8KA 2KBTA 2VT2A 2AHQA 3S17J 2BOLA 1IZ6A 1TUDA 4A63B 4F7UB 2CUFA 2PQ8A 5L3CA 4EIKA 2UZKA 5GAN4 2G9WA 3L2UA 4IHXA 2LVMA 3NTIA 3OYYA 2NLUA 4RTTA 3AG4H 3CCSI 4FM4B 2JT1A 1QZYA 4J83A 4C92G 4D1QA 3JAMZ 3FHNA 2PEXA 1N77A 5IHNA 1FJLA 1P92A 3KIOA 2BW3A 2XI9A 4LDWA 1AZEA 4XRSG 1YJWT 2FRYA 5J1YA 2PVGB 2RQWA 1P7JA 1RAAB 3I56A 4DBQA 2O8XA 4KA4A 2NUPA 3DBLB 3LYIA 4JBAA 2W84A 1AZGB 1R0CB 1ZAOA 1XGNA 2KRCA 1D1BA 2RKHA 1RAEB 3E9GA 1K8AC 2A6TA 1XQHA 3WVDB 1SMTA 4HPQA 2ME6A 2VI6A 5D6EA 1ETKA 4D7MA 2L54A 4B3AA 3MD2A 2XPVA 2P8TA 4RTXA 3CCUA 4HCCA 4M72A 1YHQA 3GNFB 3CZ6A 3KCCA 3R6OA 3KFWX 4LG0A 5E17F 3EGXA 2QUFA 4FT2A 4BJ6C 4MO7A 2VWFA 5CVVA 3X28B 3DKXA 3H6ZA 4I09A 4XLPF 1SFOJ 4BQOA 2F5FA 1JKQC 3VYRB 2HAXA 1GFCA 2K9MA 1H0MA 2M1HA 5AIPA 4KN7X 3C0CA 5EYRA 2BE5F 3U1DA 3URGA 4UVCA 2KDOA 2F2VA 3KP3A 1RKTA 1XSVA 5FROA 4M74A 3LGLA 3V42A 4CC2A 4ZN3A 4NL3A 1QQJA 4I7HA 2ZKZA 5E1ZB 1ORKA 3ULQB 2VQHA 3ZRGA 4ASNA 4KISA 3LH5A 5ICFA 2PTKA 2DM1A 4PJOF 3HRUA 4XQFA 2NNNA 4JOMA 4DYRA 5FLMJ 5J39A 3NRVA 4BAYA 1OU8A 1HKSA 4PJJA 3O3KA 3TOAA 3M57A 1GVJA 1SFKA 1A0NB 2EYQA 3CCJI 2DPDA 2DVEA 2K3XA 2R3SA 3MHXA 3NPFA 3CPWS 2JSCA 2HBPA 4HT9A 5HS9A 3PVLA 2LKSA 4JRQA 4Y7NJ 3MZ8A 2L0AA 1VQLT 3OY9A 3COAC 5D6FA 2MK5A 5FO5A 4PJOD 2HDCA 1T3SA 4M7AE 1BJZA 4HG2A 3DCFA 3E9FA 2DODA 4FYXB 2QQRA 1RKWA 4C8QA 2QEXQ 4AIKA 1REPC 3CO7C 2YU9J 5B3SH 1A04A 2A0FB 3UATA 1PUFB 2FX0A 1ZRDA 2NVQJ 1OQKA 2E5QA 2CH0A 5KYUA 4GXOA 3L1PA 2P4WA 4PGGA 5BMZA 1AEYA 3H0GJ 5HCKA 1YJNQ 3QKJA 4TVRA 1ITYA 2LTPA 3L1AA 3ERMA 4RGSA 1LOJA 4J9GA 4X34A 1LFBA 4XSXF 4OF1A 1KYWA 3PO2J 1IUFA 1K4SA 3WG7H 3HFOA 2F5CA 4UY8I 1I81A 2DAQA 3KYLA 3UR3C 4EJVA 1UHFA 1IXDA 3I4NJ 1XTDA 4BUGA 1T0HA 2HPMA 4A3KJ 3KEOA 1UGRB 1ZG3A 2RQPA 1HBXG 3CMEI 2DMPA 3ZL7C 1R23A 2A3SA 1KQ1A 2A08A 2HU9A 5FRMA 2O4XB 3HPGA 2K3PA 3GCMA 4O6JA 1NHAA 2XB5A 4LG3A 5FJ8J 1VQ8I 2KSSA 1D8JA 1RADB 2L8DA 1QPMA 3VYSB 5GMKi 2P5KA 3TL4X 2XKOC 3GFIA 1YJWQ 1BKBA 2DJQA 1ZBJA 4ITVA 1S3JA 2FB7A 2GAUA 2FU4A 1WHUA 1J09A 4HYEA 5ICGA 2R4GA 2DLPA 3HG9A 5B1AH 1E6GA 3R0AA 1TH7A 3DLLF 4HVVA 1SD6A 1YW8A 2KEAA 2GXGA 4XSZF 5M3FJ 3EFOA 2DBKA 4IUPA 3BG5A 2IXSA 5IT9K 5LL6S 2WA0A 1RLPC 2LKPA 1OMIA 2QSHX 4RAYA 2O03A 3VDXA 4MDWA 1JKOC 4KN4X 4KH1B 1LDDA 1FTZA 4GRIA 3HL2A 3CCVA 5HDNA 2ZBKA 2NRAC 4BDZA 5EC7A 1QVGP 3K4JA 3DPTA 2XDVA 5JI6A 4OIPF 2ECZA 4FASD 1FBQA 1UECA 2X4YA 2W82A 1MUZA 2RQUA 3A0BC 2VODA 2KHMA 4EM0B 4IHSA 2K6DA 1KQ2A 3ABUA 2MAMA 5KE2A 3F72A 5F0CA 3W6KB 2JA6J 1VQPA 3S1MJ 3WU0A 1A6QA 3H5AA 3H9JA 2DERA 3A8MB 1E3HA 1R49A 2COZA 1VIEA 1SSHA 1JJ2S 2FBHA 7AT1B 3M0PA 1ACIA 3HOWJ 3OSFA 3L2CA 1K61A 2ME0A 2DAOA 3TP3A 2DBBA 3HHHA 1K79A 4ZGDB 3H9NA 2VIXA 3JCMQ 2YX4A 1X6OA 2RMOA 1Y39A 4RUGA 4MQVA 5FU6C 4AT1B 1LEBA 2CUDA 3OYHA 2HD0A 1K9AA 2RB6A 1VQLQ 5JLWA 3G7ZA 1PD1A 2CSQA 2XRNA 1IRGA 1CQTA 1D3BB 4C8QE 2XC7A 3CCJT 2NVXJ 2VBZA 3W2WA 1S7OA 2D1XA 2L7FP 1VQKQ 4XLAA 2H6CA 3L42A 1Z05A 3A01B 2VXEA 4PGHA 2AIRB 1WI7A 4Y4RA 5GAMf 1EA3A 3SEZA 1SEUA 2XSJC 4OMZA 1FZPB 5DLQE 1K4US 1T8IA 1F1BB 4EM1A 2KL4A 3ER0A 3OL4A 3IRQA 2LKXA 2R7SA 2Q0OA 4ENNA 1VQNQ 4IQJA 4IZZA 3SZPA 3NGPA 2E3IA 3G6EA 1K6YA 1IN5A 1VQ7I 2I0NA 3OBYA 4PJOB 1XCVA 4NOYA 1H3HA 2RNJA 2W48A 2ZSIB 3HIFA 3JRHA 4D6WA 2DEUA 2BZ8A 5GAN3 2WY8Q 2JA5J 1VQ4T 2E71A 1MHNA 1QZZA 1KD1C 4LLLA 5FKKA 1E7OA 2D5VA 2DYBA 2RV8A 4FTHA 3TKYA 3VODA 1GRIA 1H88C 4J01A 4AG1C 4AIJA 3CCQA 1YE9A 1ZKGA 2X9HA 1NJIU 4IRIA 1S8NA 1V3FA 2EIMH 1YG2A 2EZKA 4LFUA 3RPUA 3U9GA 4B43A 3MPUB 2Y75A 4ZC3A 3WU2C 3ZQQA 3E5XA 5DS9A 5IT9Z 2W25A 2LLKA 4YIFA 4Y91A 4CHUA 4A93J 3D5RC 2O0YA 4RBOA 2EQUA 3EPZA 2M9UA 2MFZA 2L9SA 4BXXJ 1P4AA 4L18B 3EG3A 1DDNA 2A68F 2NS7A 3FLGA 2DNUA 4KGVB 2VYTA 1XB4A 4EATA 3PO3J 2KXCA 3KE2A 2E34A 4DIQA 2CP3A 2JTFA 2LQKA 3CUQC 2FOKA 4E4HA 2H8WA 2M0OA 1YIOA 3DWLE 1YI2T 5LJ5f 3FRNA 1BC8C 3M59A 5HVQC 1CSKA 4YFKF 3SB2A 1Q1VA 1M1FA 1TU0B 4M7AF 5BS6A 4G12A 5LHGA 5A2QZ 1XG1A 4JJDA 3IC7A 2YLBA 2RD1A 4OMOA 4XQ3A 1M90U 1PUEE 3G73A 3ABLH 4KMUX 4FT8A 2EZHA 1JXSA 2B7EA 2RVCA 2V9VA 2EGEA 4EMKC 2GQIA 4RB1A 2ROTA 1R1TA 5GANd 3I53A 4M7AD 4ESFA 4LIUA 2CGPA 1JXMA 3A1PA 4X1EA 4B9XA 4RB0A 1HLVA 5GAN2 1KC8R 4ENJA 1LVAA 2HDAA 1Q7YR 2IGKA 2VKHA 3CCEI 5LFAA 1O3QA 2C06A 2NVYJ 2XF7A 5CQGA 4F7ZA 2MD0A 2HEQA 3J7ZI 1OZ2A 1Q81U 1D0YA 2R5YA 2R7UA 3J7YJ 3O2PE 2M7BA 4ABZA 5DUIA 4BXUA 1ZRCA 2AHJB 3PUFA 5IH2A 5J8FA 2M30A 2Y4YA 2DFEA 1ENHA 2E2JJ 2G7UA 4I6ZA 5D6YA 1VQ5A 3GLXA 4M6XA 1W4MA 4S0HB 3RZDJ 1VQKT 4KBMB 1Q7YC 4CA0A 1M1KR 3ONQA 1R7JA 3JCMc 3CCRT 4RMOA 3ML6A 3FWEA 4PFZA 2OD5A 3QWYA 5L3GA 2PMHA 3U21A 5EJCA 1S72A 1DU6A 4BDYA 1Q82R 3RYPA 2LJ3A 3CMAA 2HZDA 5GAEJ 2ZPHB 1MJ9A 2AQEA 1APLC 3EH1A 3K1PA 4M9XA 2HQAA 2PLYA 1M1KC 2DQLA 2E36A 2JUCA 3HSFA 2AQFA 3I56I 1AHDP 4PJLA 4N0AA 4N4NB 2CW8A 2EGAA 4FSSA 2CUEA 3EUHA 1RETA 2F6CA 1VF9A 2DN0A 3KP2A 1Z9CA 2CS3A 1Q82C 2DE0X 1BU1A 4N9HA 4P9FA 4A53A 1HF0A 4G9YA 3ZCOA 2Z9OA 4BY6C 3I4MJ 3DPLC 2OTJA 1V5GA 1JJ2P 3RTRA 2CKKA 2Z33A 2DL7A 1QVFS 4CSWA 1W36D 1J75A 1VQ4Q 3EHQA 2BIVA 3KYDB 1RL2A 2H3JA 1MH4A 4C2MJ 4JDSA 4HF2A 3FK6A 4UB6C 1POGA 2MGQA 4CCOA 2XRLA 4E7ZA 3TEDA 5FU6B 1X4PA 4WTOB 4J7FA 3UPUA 1YIJA 2JS2A 2WWYA 3IRRA 2L89A 2ZPEB 3BPXA 4MFDA 2XG8D 1ETOA 4K11A 3TP0A 1RUWA 2HNHA 2QA4I 1WJEA 3F22A 1B72A 4IOAF 1PRLC 4BNCA 2K3YA 2GA2A 2IGOA 3CMYA 1OJLA 1RABB 2RF0A 1E3PA 3S2DJ 1IN8A 4Q4ZF 3KEYA 3KPHA 4Z2YA 1ZQ1A 2FZCB 4YRVA 1RAGB 1MDMB 3FXMA 4FCYA 2JT4A 1K9MR 2EKOA 2L4MA 5CKDA 4BS9A 3RDVA 5IOZA 1KK7A 5GAGJ 1Z3XA 3WTYC 1UELB 2H1KA 2Y90A 3QYHB 1R77A 3T5XA 1UUEA 3K0LA 3KYCB 2DFUA 1NJIC 2X51A 2EYZA 2CSOA 1HKTA 4MEXF 1Q86C 2LCCA 1K9MC 1RI0A 2GFAA 1YI2Q 3GWZA 1GCQA 2DTIA 4C8QF 2QQ8A 4F14A 3RI4A 3VRZA 4ZNXA 3ULRB 2XAHA 4Y17A 2L9VA 4J9HA 1VQ6T 2W4SA 1QKWA 3PTAA 2WBMA 1BI0A 2DVJA 2YX7A 3JCMW 2QSFX 4PSWA 4TV7A 2H3EB 4NBQA 1XDUA 2MWPA 3BCAA 4CCLA 2XAUA 2H1LA 2IT0A 1WGXA 1I1GA 1DPUA 4C8QD 1BJAA 2R7ZJ 5LRRA 3WHCA 2N8GA 2QYOA 1FSEA 4XK4A 1GFDA 3HOUJ 5EEGA 1RAIB 3M0SA 1SVLA 2EFIA 5I21A 2D2WA 2OI3A 3ZQ7A 3OR1C 3F70A 3DBRB 2MMPA 1T0FA 1NPRA 2EIFA 2KRNA 3QG1A 2KQRA 4IRHA 3RR6A 1U3EM 3VUBA 2KRHA 2CUBA 2CZ6B 5I22A 3HDDA 5GAOl 1X43A 3V8JA 2EFOA 4E7HA 3CUQB 3CCRQ 3Q9SA 4B47A 1P6RA 3CC7T 4CUGA 1GV2A 3LWHA 2NOJB 2DA4A 1QP3A 2F5TX 3CCSA 3ZN0A 2VKVA 1QCNA 4FW1A 5E18F 1XMXA 2FPEA 4BYYA 1TNSA 1YS6A 2RREA 1IJWC 2DTRA 3JCMg 4PJNA 5E3NA 2GQVA 3DB4A 5KYXA 4ENMA 2KIMA 3KZYA 3TBIA 1YP5A 3CTAA 1BW6A 3H9QA 3CUOA 2RQTA 2DT6A 3BJ6A 2EYXA 3MP6A 1XSDA 4GBQA 1T38A 4XTVA 3I56T 1SANA 5F27A 1I4K1 1X6GA 4M78C 2DMUA 3S1NJ 1YW9A 3EGDB 3S15J 1RLQC 1O3TA 4L6V5 4F17A 1T08B 2F2WA 4BL0B 2PJRB 3Q0WA 1DJ7B 2EZLA 2CT3A 2JSPA 1AWXA 2XDPA 3OMCA 4L59A 3VYHB 2BYVE 5KAFC 3MEUA 2JRTA 4LUEA 1JTYA 2QDLA 4C5HA 2E1MC 2A37A 2NVUB 3CCUT 3NQOA 4B3XA 2ID6A 4CI0C 3ZQFA 5HOOA 1F36A 2DIQA 1BM9A 1TQMA 1U5TA 2KK4A 2KY9A 1YHQT 3EG1A 1OYIA 3PE0A 1M3BA 1MMDA 3BDLA 2ATCB 1Y57A 1MSEC 2UXNA 2ACJA 2V6EA 2K2MA 2LJ0A 3IUOA 3SWNC 4HNUA 5HODA 5GANj 1OLTA 1XSXA 5K5OA 2VOPA 1VQPI 4HRIA 1KU3A 3OYAA 3JTGA 2B86A 2FG0A 4LUDA 4ORZA 4L5GA 2OPTA 3WXMB 5LHHA 3A03A 1UMQA 4IPAA 3KLNA 4EJOA 1DP7P 2MG4A 1GXPA 4A3JJ 2XGCA 3ZQCA 4V19K 1LFUP 2DXUA 2NYXA 2ZC2A 2Z0WA 1P2FA 3VU3C 4MFEA 3HYIA 2STTA 2BBYA 4JUVA 2V7FA 3W6JB 4WWCA 2LCSA 2LVSA 2LH9A 4BY6B 3SDBA 1Y7XA 4C3IJ 3AHUA 2LY2A 3TSWA 2K27A 3ZMVA 3CCLT 3ELKA 5B1BH 3K70C 1VQ6Q 5GAN7 3V8LA 5GAOr 2J5OA 1MBJA 5JHFA 4M75F 1E3OC 1XGOA 4LDUA 3OS1A 1HDDC 1G2BA 2XGEA 1D09B 3QZ5B 5GAOq 1OPCA 4PDKA 2OU2A 2IA2A 3S16J 1R5GA 2ZGWA 4MZTA 4M9ZA 1KONA 2F48A 3FXQA 4YELA 1U78A 2C0IA 2OCCH 1E6HA 2RHZA 5LJ3g 3DB3A 1OISA 2Y31A 3F9KA 4OVAA 4M75D 5IYDJ 2K9NA 3TOBA 1PSEA 4F7UA 1K78B 5CQXA 3J80Z 2L7KA 2X4WA 3CBMA 5HLIA 1GHCA 1Y56A 2FPDA 4EGYA 1ABOA 2FMYA 3JTHA 5CAIA 1TTHB 2ZFUA 4BJTA 3B6CA 3VJPA 1G5VA 1IRXA 3CMEA 2B9SA 5KYWB 1QKXA 3HOXJ 3CC7Q 1YX3A 2YPRA 3E3VA 2WAQA 2KPMA 3EETA 2XB0X 3TO7A 2DPUA 2M16A 5ICEA 3SFMA 1VQ8A 4M7DC 4YFNF 2UUZA 1ZUYA 5GMKm 1CF7A 1N5ZA 1J9IA 1T0JA 1HQCA 1X3ZB 5HLTA 3LGFA 1T56A 3H5NA 1XGSA 4MTDA 4A3FJ 4D5CA 1PCXA 2ENMA 2IVWA 3RKWA 2MF2A 1G3YA 2Q2EB 2EW3A 2E1HA 3RPUD 3S2HJ 2M34A 2MLGA 1T98A 4MEYF 3ABMH 2M9HA 2DOEA 4O5VA 5K7ZA 4IURA 4HCBA 2DKGA 1MJBA 2HZTA 3EYIA 4N4IA 2BY1A 2I8DA 1X1AA 2TCTA 4BEHB 1T6SA 4C92C 1V55H 5F64A 2QEXT 3K69A 2X6WA 3GUDA 2DYRH 2COYA 2HI3A 4Y3OA 4ENKA 3SJMA 2QBYA 2ECCA 1WHKA 1BBZA 4J9IA 5CR2A 3CCUQ 2X9DA 1YHQQ 1X3UA 1JU5C 2P6TA 5CIUA 2L3RA 4HV6A 2L0KA 2BUDA 3VWBA 1EF4A 2ZCFB 3CCVT 1N8RR 3ZQIA 2M02A 2HVQA 1B8IA 1X3WB 2E1OA 2KISA 2AK5A 1ZUKA 2L9RA 2EZIA 4OWRB 2K7AA 2YUQA 1W7PB 2OA4A 3A2KA 1QBJA 2OTJI 4RAGA 1MKMA 2JMAA 2XIDA 4QW2A 4OMQA 3R6NA 1Y1VJ 1VQPT 3EG2A 2FZKB 1F4KA 4LDYA 4JS5A 4UUTA 2DL5A 1UFMA 3RUXA 1D5VA 2HQ5A 3PSIA 3JCMf 2M2EA 4M78B 2WAQN 2L3DA 3PFIA 2FZGB 3X26B 4KJZA 1OYYA 2COBA 1FIPA 2HQEA 3BQYA 3M5AA 1LQ1A 3CCLQ 2XKPA 3F3XA 5C44J 1IV8A 3LA2A 4J9BA 2IW5A 2FOWA 3MKZA 4L0YB 1JXOA 1UGQB 3H5RA 3UA7A 2Y30A 2DLLA 3E6DA 2E1MB 5J4VA 1E17A 3FDRA 3JV3A 2KGTA 2YRVA 1YJNI 2EH3A 1Z9QA 1G3TA 2HKQB 1WJSA 2EA4A 3H1CA 4QPOA 4RLFA 3K4NA 3V8KA 4A4EA 3GZ5A 5L3FA 1MV3A 1KQ0A 2B8AA 3DU5A 3M0RA 3RKQA 3SWNB 1AWJA 2XUBA 2MIOA 4N4HA 4RLQA 4XM3A 2GOMA 4PSXA 1QGPA 3K7AJ 4JX4A 1V54H 1QVUA 1KJWA 1MNMC 3JSCA 2BHZA 2K02A 2FEIA 1JRIA 2FF4A 1JUPA 3I0TA 3FMRA 2E1NA 1HDPA 5E3LA 5DLOA 2K4JA 4RCBA 2A6EF 2BE9B 2E19A 4IX7A 1VQ7A 2PG4A 4Y13A 4QQ6A 3HZJA 1U9NA 3G6ET 3KZZA 2HKXA 1B7TA 2ZXIA 2A05A 4DW6A 1W0TA 2M0YA 1UDLA 2CQ7A 2K9SA 3F8MA 2CFOA 1R5HA 3BG6A 3CCMI 3FKJA 2VOOA 2V8IA 1N9RA 1N75A 2NYSA 1ZN2A 2GNCA 3GLLA 1DQUA 1FLIA 4II1A 2F4MB 3J81E 4L9VA 4C9YA 1SAXA 1AU7A 1HW2A 3CCQT 3SHFA 2F5DA 1NK3P 2XU8A 2OJED 5GANh 3ZXSA 4QWQA 5I2SA 2ZJRF 1TXQA 1D5YA 4IUVA 4JP0A 1ZSZA 2RM4A 2CGHA 3M4GA 5DDGA 1O3RA 4LN2A 4CH7A 1HSQA 3MCZA 4FIBA 5K5RA 5EGOB 2DDBA 1G59A 4FYWB 4XIDA 1U6GA 4OOIA 5B66C 2LDMA 3M0QA 4BXFA 4KGXB 5JFRA 5EEHA 3I35A 3JCMX 1LFPA 3RYRA 2M8GX 3RMQA 2R5ZA 2EBIA 2GIZA 2LR8A 5ILUA 1AVZC 3H41A 3CD6I 4KITB 2X6OA 3QP5A 2PBIA 1M27C 3JRDA 2XVCA 2DO3A 3CCVQ 5ICCA 3ZR8X 1V5EA 2VPLA 4I98B 3T8RA 3FKIJ 1I07A 2DBMA 2DXCA 2RI3A 2K4BA 2YRCA 2CS7A 2FQ3A 4XKCA 5KYYB 2H94A 1YTYA 1EX4A 1IO2A 3ZN1A 2IS2A 2IS6A 1TOVA 1YFNA 3FXOA 2R93J 2QK0A 4XU2A 3JCMd 1XX5A 2V79A 2KJBA 1ZUUA 2GTOA 3OWTA 1WHLA 3PFSA 4OIQF 3VRYA 3VS4A 1TUGB 3LLRA 4UV8A 5CVIA 3OS5A 4A4GA 1B9MA 2XASA 1WXBA 3Q5FA 3S14J 4X6AJ 5K7FA 2LT4A 3QDRB 2QTVA 2DFIA 5IXBA 3CP2A 2CFXA 4RDUA 4XMYA 1GCPA 4HEA2 2P5LC 1LNWA 1IN7A 2YS9A 3CESA 3T0YA 5FLXZ 2K3FA 4I99C 4C92B 5M5WJ 1I27A 2J05A 1TWAJ 1K73C 1NK2P 2KIFA 3QDFA 3HRMA 4ESBA 1MJAA 1Q1HA 2JTVA 3AG3H 2CWEA 1VQ5T 5KAIC 2VQLA 3GTQJ 2PNIA 1W2BA 1K8AR 2LBFB 1YRNA 4RM3A 1QCOA 5GANg 4V2GA 3TGNA 3K4CA 4B48A 2Y4XA 1M90R 3NAUA 1YFHA 3EG9B 4PJOG 1JKRC 1S72T 4LIVA 2BTTA 3ZGKA 1B6AA 3ZQHA 2VLAA 4E7KA 4A3DJ 3RSNA 1YNZA 3DEWA 4GGGA 2IBDA 3OYDA 2E70A 4C2UA 1RESA 3JB9F 5GTIC 1Z0XA 4LK1F 4P5OA 3P7NA 1WJQA 1M90C 3TW7A 3CDLA 4AU7A 1OZ3A 2ZAEA 2AO9A 3ASOH 4BE1A 1FX7A 3D0SA 2DXBA 2OAUA 3SYTA 4FYVB 4MMKA 3PNYA 3G6EQ 3TO9A 3CXCP 2IP2A 4BQNA 2PUKB 3JB9I 2DJNA 2EQRA 1W5CC 3MKYB 4M77F 4ETSA 2HXOA 1EIFA 2DD4A 2LYCA 3JB9D 1IDYA 1YITI 1G3WA 1NG6A 5EF6A 1ZA2B 4C0FA 2J6FA 1VYVA 2NNYA 2JA8J 3EAEA 5CKFA 2QA4A 2HOEA 1YIJT 2FBKA 4L9NA 1CGPA 4IEJA 2O9SA 3X24B 4CC7A 2PMUA 1QWFA 3JRCA 3QU6A 3H0FA 2MD5A 4B09A 3MCAB 4M7AC 1MNEA 3DF8A 1WJFA 2JVHA 4ATOA 1XDSA 5DTDA 1NYFA 1QVTA 2EBPA 4OAYA 4AIDA 4Z88A 1OYWA 1G8XA 4QQDA 1IHVA 4PZJA 1SVOA 5LJ3d 2PVDB 1WJAA 4XKWA 2HS5A 3VSLA 4Q5SF 1LDKB 3CJRB 2V8KA 1KQSP 3MP1A 3HRSA 1KZHA 1VQOT 1K0SA 5ERIA 3FIFA 2NUTA 1K4TA 1GVDA 1AD5A 1IHWA 4KT5C 1QZEA 3S32A 2EJRA 3BZCA 5EG0B 3HOSA 1RR8C 2FE3A 5M5XJ 2OJ2A 3OYJA 4HW0A 3M4YA 2HNIA 4FL6A 2NS0A 3QYFA 5FFXA 4UUSB 3H92A 1FYKA 4AUXA 1M2VB 3G4SA 2R5MA 2JWTA 4FSXA 3CC4Q 1OULA 1IN4A 4CYCB 2JVVA 3KZIC 4I76A 1D0ZA 4F7UF 2M0CA 1XMAA 1ZG1A 1R1UA 2EJFA 2W24A 4A4KA 4EPCA 2LRDA 1F43A 4AG2C 2QENA 5GAMg 3G1LA 4BBRJ 4KUIA 2RHXA 4XTYA 3F8CA 2J5PA 1QVGS 4J9FA 3GOXA 3WGHA 2DA2A 2VKDA 5CQEA 1M9SA 2K85A 5EZGA 5GJWB 3F6VA 1QQIA 3DKMA 3OYCA 3U2RA 3AG1H 1R8OB 2DL4A 4I02A 1NE8A 3WVEB 4N0BA 1TSFA 1VYUA 1HKQA 3VV0A 2RJDA 2KRSA 2OBPA 4EJTA 1X2MA 1ETXA 1FMWA 3E6BA 2VC0A 5J1RA 4B6MA 1IGUA 3MMYB 2M5WA 5C4JJ 1YJ9I 2BZYA 2GXBA 3VYGA 4LDVA 4RS8A 3RIRA 4BU2A 3H9GA 1UGVA 1BIAA 2ECBA 3HJEA 4AD9A 5KCMA 2CUZA 3AG2H 4A3CJ 2EGCA 1AHJB 4X9DA 3CCST 1S72Q 2XHCA 2EIKH
chains in the Genus database with same CATH topology
1UHWA 4R79A 1Z1DA 1VIFA 4IHTA 3IKTA 5GAOn 4N9IA 3HUGA 3A5ZB 4Z02A 5FB2A 1IF1A 1R58A 3GF2A 3BY6A 1M8VA 4ZYEA 2YHTA 2ZNZA 3C7JA 4HX4A 2E1CA 1WQ2A 2EQMA 1G3SA 1MDMA 1R1VA 3QJ6A 3F8BA 2QI2A 2LF7A 3LFKA 3SZTA 1WJRA 1ZGAA 3DKWA 1B9NA 3RPQA 3P8BB 2KQWA 3S3MA 4XTZA 3JSPA 2V8JA 1JJ2A 3B02A 4UVBA 3OSSC 2FHDA 5LGTA 3KETA 4UV9A 2CYZB 2HKOA 2EB7A 1QO0D 1VQMA 5D5VB 2DZ9A 4XAXB 2UXXA 1RZ4A 2R7DA 1Y96B