3HRUA

Crystal structure of scar with bound zn2+
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
213
structure length
211
Chain Sequence
b'PNKEDYLKCLYELGTNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metalloregulator ScaR
molecule tags Transcription
source organism Streptococcus gordonii
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
total genus 64
structure length 211
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hruA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hruA02
3Q9SA 2HDCA 2E7XA 3FM3A 1STZA 1USTA 1CGPA 3FMQA 4HQMA 4BHBA 1IF1A 5CYVA 1HXDA 5L3DA 2CW0F 5L3GA 2WWYA 3R0AA 2E7WA 5AIPA 4M9SA 1B4AA 4B8XA 1B6AA 4RGUA 5H6RA 3NEUA 3E19A 2F5CA 3F8FA 3ELKA 2Z3YA 2Y48A 1OYYA 1Z05A 1GXPA 5EEHA 3K0LA 3SZPA 2EV0A 5ED4A 1P4AA 2HZTA 4HA8A 1TLHB 4G8XA 5ICGA 4M6YA 4HX8A 2OU2A 2HWVA 3BPXA 4M9XA 1TNTA 3N97A 2F2EA 1WQ2A 2OBPA 2G7UA 3TDZC 2DTRA 5IT9K 2HKOA 3K9TA 4UVAA 2HYFA 3HUGA 2RNJA 1H9TA 1QZYA 1Z9CA 2FE3A 2E1NA 2MC3A 4RGRA 2XAGA 2L54A 1EV7A 2K02A 3KLOA 3CDHA 5IT3A 5LHHA 4ESJA 3V7RA 1YS6A 3CTAA 5E1ZB 3JSOA 3DFGA 2ZFWA 2DPDA 3FMRA 2VT3A 1J9IA 2UZKA 3WTYC 3ZQ7A 4YIFA 2JT1A 2PN6A 4L5IA 2DPUA 4CGZA 2QQAA 3L00A 2EWNA 2MLGA 1Z6RA 2BEOA 1LDDA 4FX4A 4P96A 5HS8A 1LEAA 5D8LB 1Z7UA 3F72A 3GXOA 4MQVA 4G7HF 3QOPA 2A6EF 1QO0D 3ZMUA 3DXJF 5CVJA 2VODA 3LQRA 3V8JA 4P9UA 1UFMA 2PEXA 5JI6A 2P7CB 2FRHA 3KCCA 3S2WA 1B59A 3HRMA 1SMYF 4Q48A 3WTSC 1P92A 1KU7A 5CVIA 4HF2A 2VE8A 3GZ6A 3CLOA 1G6NA 4IVNA 3L7WA 1PP7U 3W6JB 5LBQA 2GA2A 2O03A 3REOA 3IKTA 4ZZLA 4LLLA 3VFZA 4QLCU 5J6XA 5DD8A 4HLYA 1MZBA 2D1HA 1TQIA 3I71A 1ZAOA 1ZYRF 2CO5A 1FP1D 1IW7F 3H3UA 3B73A 3BOQA 4GO1A 4IPAA 2L4MA 3IWZA 1T0FA 4ESBA 4KIGA 1WI9A 1VTNC 3V7SA 1R36A 3TDUC 1V3FA 4Y15A 1HKQA 2FQ3A 2P5VA 2P6TA 4OMYA 1HKSA 1WKMA 4OIRF 4Q5SF 1ZGJA 1BC7C 4RAYA 4MQ9F 3JTGA 1XSVA 1P4WA 2RVCA 1FYMA 1XGSA 4GXOA 4P9FA 3ZN0A 3DP7A 2K4JA 3F8BA 3E5UA 3LA3A 2QZ8A 2YR2A 2EB7A 3CUQA 4ZYEA 1ZLJA 1ULYA 4FX0A 1BC8C 3HYIA 1IN4A 1XDUA 1XB4A 4UHTA 4KT5C 1KGSA 1YO5C 3T0YA 3JSPA 2Z99A 1SFXA 2VBXA 4U88A 3FXUA 2GWRA 1FBQA 4EJUA 5D5UB 1G3TA 3MZYA 3PQKA 5K5RA 5BQTA 2K4YA 2O3FA 3V8LA 1W4MA 4EVIA 1QW1A 3ROUA 5E1WA 5DDGA 1HW1A 2M1BA 1MJ9A 3Q9VA 4TV7A 1SMTA 2V6CA 1RZ4A 5BMZA 1QPMA 4A12A 2C6YA 4CDGA 1CF7B 1R1VA 3I54A 2K5LA 4ESFA 4OMZA 3BZ6A 4WWCA 4I98B 2P7VB 1DUXC 1I27A 3L2CA 1YG2A 2VOOA 3K2ZA 2VBZA 4NQWA 1J7KA 1FLIA 4E70A 3HHGA 5ILVA 2X4HA 4EJOA 1LB2A 2M45A 3BY6A 5LGTA 2L4AA 2KJBA 1J59A 3LWFA 1KYZA 2HTJA 3H3ZA 4NHJA 4A5NA 3F8NA 2ESHA 2JPBA 4GYIA 2RDPA 3E97A 3EDPA 3MWMA 1FOKA 1IN7A 4ZYHA 4HYEA 1PP8F 4O5VA 5TJJA 2FA5A 1T38A 1B9MA 1JE8A 3HRUA 5DV5A 3HRSA 1KYWA 3VOEA 2Y0MA 4WXHA 2VONA 1HBXG 2Q0OA 2OAZA 2X0LA 4MHGA 4BYYA 4UNOA 1S8NA 3IWFA 1MGTA 2KRFA 3I64A 1R00A 2UXXA 2BE5F 2LF7A 4XBFA 3ERED 2K4BA 2DLLA 3EYIA 4YG2F 2CG4A 1KQ8A 1LJ9A 4L0YB 3ZN1A 1R5GA 2HS5A 2CGPA 5H20A 4MTDA 4R8HA 5D4SA 2CFXA 5ILSA 2NS0A 1BM9A 2NNYA 2H09A 1JGSA 2XGXA 1BIBA 3T8RA 2RC4A 1IN5A 3TQNA 5CVRA 4I0AA 1UHWA 2PFBA 4A6DA 3EQLF 4BHCA 3QU3A 4UUVA 1O3QA 2ZNZA 1TNSA 1ZG1A 3T5XA 3LSTA 5HDKA 1REPC 3W6KB 2Z33A 2ELHA 1R7JA 5DCMA 1T39A 1R1UA 4RS8A 1H9GA 2HEOA 2FSWA 3M7GA 2K7LA 3SQNA 2H3JA 1RUNA 2W25A 1R22A 1TW3A 2A68F 3O3KA 4CICA 4P5OA 1MD0A 5FLXK 1BN5A 4PDKA 4Y17A 3J80K 3FXQA 3FM5A 1EH8A 5D6FA 3GLXA 1G4DA 1Z91A 4PGGA 2VC1A 2FMYA 1LDJA 2QQBA 5HVQC 2EV6A 4WXCA 1I5ZA 5CVVA 2P8TA 4HF0A 2H6CA 3JTHA 5J8FA 1Z6TA 4S04A 4LK0F 3GEZA 4OIPF 1W7PB 1ONVA 3CUQB 3PQJA 4L0ZB 1W5TA 1YIOA 4EM1A 2V1XA 1OMIA 4RB0A 2XUBA 3F6OA 1IRGA 2LF8A 5TRDA 1BYMA 2ZMEB 3SXYA 4HDVA 3RPQA 3WTVC 4MNUA 4XRFA 1K6OA 1BI3A 1U78A 4F7ZA 3RYRA 4PZJA 1ON2A 3TO6A 2M8EA 4KICA 4A0YA 5D8KB 1KU9A 4LD5A 2ZCWA 2OQRA 3DEUA 3MAJA 4OIQF 2ETHA 3FHZA 3P9CA 1LNWA 5L3CA 2W24A 3E3VA 4GCVA 5L3BA 2HR3A 2A5YB 2FU4A 4L9TA 5FLXZ 3QRFF 1MKMA 2BBYA 1SAXA 1ZH5A 5BPIA 1AWCA 4AVPA 6PAXA 2VOPA 3GYHX 2OZUA 5DUIA 5LRRA 3D0SA 2AXLA 3SZTA 5E1XA 1ZRDA 5JR3A 1YYVA 3QU6A 3U1DA 2L02A 4N0BA 2XRNA 2LKPA 1U5TB 2QM3A 2RGVA 3KFWX 3K69A 1KU3A 4EGYA 5KVRA 2Y75A 1L3LA 4JQFA 2NRAC 1IN6A 4EJWA 3MQ0A 3JAMZ 4GGGA 3F23A 2XAHA 1O7LA 1XGNA 1J2XA 2HGCA 1KQ0A 3HIFA 2VT2A 1FSHA 4EJTA 1FYKA 4BAYA 2DU9A 3KP3A 1XMKA 1KA8A 1O7FA 1G3SA 5BS6A 4KMUX 4I02A 2JTVA 3HOTA 4EMSA 4U7BA 3WTXC 3FF5A 4M74A 4OINF 3G3ZA 1SD4A 2HQNA 2R3SA 5LEKA 4WK8F 5FD5A 2Z9OA 1S29A 3LAJA 3NRVA 4R1HA 4ENKA 3DF8A 1YQAA 4ON0A 1Y0UA 2JZYA 2FF4A 4AD9A 1OR7A 2QBYB 3WG9A 2EK5A 2M30A 1DDNA 3EUHA 2NYXA 5LHIA 4XLPF 2F5DA 4DNCA 2J5OA 2DK5A 2L3DA 1XCVA 4L9VA 4RAZA 5ICFA 2XV4S 3ABTA 4LJZF 1U3EM 4HW0A 1CF7A 1ZLKA 5FO5A 1LVAA 4WF2A 1FYLA 4LGWA 4UVBA 1WWXA 2D45A 4AIKA 2CQKA 3KLNA 4QWQA 1RI7A 3RKXA 1QNTA 2D2WA 3GWZA 3R0JA 3LFKA 4I2OA 3Q5FA 5HLHA 3COAC 2EV5A 3KP4A 5JVTA 3F3XA 4IRIA 1DP7P 4O3MA 3QP5A 3RKWA 3IKVA 4LB6B 5AONA 2JPCA 2BV6A 1FY7A 4IJAA 1D3YA 2MH9A 4N9HA 3F22A 2ZO4A 3WTUC 3IHUA 4RGSA 1G3YA 1XGMA 4UVCA 3HTUA 1O57A 1WSUA 2V1UA 1XSXA 5FB2A 4G7ZF 1YW9A 2RN7A 4U7DA 2YSRA 2RKHA 2YU3A 5LGNA 3P7NA 4CXFA 1BOAA 1RNLA 2JSCA 3GFMA 3IRRA 1L0OC 3OOPA 2K5FA 2PI0A 1GHCA 3QPHA 1YW7A 1H0MA 3KZYA 5H6QA 3FMSA 3GO5A 4IHSA 1S6LA 4A6EA 1RUOA 4ZYGA 3MEXA 2V79A 4I09A 3M9AA 5FFZA 4AWXB 4Q4ZF 4NB5A 5CJ9A 4M73A 2O6GE 3F6VA 1FWZA 3LQQA 2Q8KA 4P55A 2EFNA 1SD5A 2LDUA 3E6DA 2EFPA 3LAPA 2LSOA 4HQEA 2STWA 1BI1A 4ZYDA 1S7OA 3RTRA 5E18F 3ECOA 4RGXA 1K78A 2KJCA 3M8FA 3WTWC 2GAUA 5DYMA 2JRTA 4A2UA 5DCFA 2STTA 1ZRFA 4KUMA 4CZZA 5E8GA 3HSFA 2IA1A 2O0YA 2QYOA 1BIAA 3E6CC 2K86A 2ZKZA 2ZXJA 3R61A 5FD6A 1DPRA 4AIJA 4CYDA 1ZGAA 3QP6A 1U6GA 2P5KA 3WTTC 2O8XA 1XD7A 3I59A 3NQOA 1OYIA 1AOYA 2MBFA 1NHAA 1O3RA 4IF4A 4M9ZA 5E20A 2ISZA 1U5TC 3HSRA 2WV0A 2V9VA 2H27A 2HQRA 3HTSB 5LGUA 4G9YA 3VEPA 1T6SA 4UXNA 4RB3C 3P9IA 5JFRA 1P6RA 2PBIA 2UXNA 3KEOA 5LLQA 4R79A 1GVJA 1FX7A 2IP2A 4XSXF 1E17A 3KZZA 2R7DA 1FT9A 1KQ9A 5HOOA 2NNNA 5IT9Z 3GW2A 4G7OF 2EFWA 3N4MA 3I5UA 2ADUA 2K5IA 1A04A 1FNNA 3KP7A 2PG4A 1EH6A 1K7AA 1FPQA 4KFCA 3RPUA 3RDIA 4EM2A 4FHTA 4WCGA 4PGHA 4Q47A 5HS7A 3C18A 1IN8A 4OU0A 5K5OA 4BNCA 2GXBA 2DK8A 3ZMSA 3K1PA 2QUFA 1E2XA 4HBLA 4LLNA 2XHKA 2VBWA 4DQ2A 4LB5A 1FZPB 3T8TA 1S3JA 3H92A 2FMLA 3D5LA 1FC3A 5J8CA 4YFXF 1MJBA 4MTEA 2H6BA 4Z2YA 2LNBA 2WTEA 2EJRA 3O2PE 5D5VB 1D8KA 4N9IA 2QLZA 5FGMA 1D5VA 2KIMA 1C0WA 1ZN2A 4LK1F 1KU2A 3C7JA 1IXSB 4FT8A 3T1BA 2HFHA 5BPDA 3R60A 3GVAA 5D4RA 4OOIA 3EETA 3TKYA 2PMHA 5EEGA 3R4KA 2XIGA 3BJOA 3ABUA 2V1DA 1K78B 4U0YA 4RB2C 5K1YA 1P2FA 2ESNA 3TO9A 1ZG5A 1BI2A 2YPRA 4M71A 1HQCA 1MDMB 3ULQB 3GFLA 1USSA 2Z5UA 5HLGA 4HV5A 4LMYA 3RI4A 3TOAA 2DFIA 3WODF 2GIVA 3WE3A 5L3FA 3L09A 3ML6A 4KNYA 3J81Z 3MHXA 5F1RA 4ZH4F 5FFXA 1O3SA 3RIRA 2UWMA 2IPQX 2R7FA 2XROA 1XDSA 2IA0A 3C3WA 2G9WA 3U2RA 2MD5A 3KP2A 1TBXA 2A3SA 2ZNYA 5LHGA 3WGIA 2DI3A 4GYGA 3TGNA 5D5XB 3KE2A 4L5JA 4ETSA 1LQ1A 4HLXA 2VXZA 2DW4A 3LA7A 1JHFA 2HOEA 1OPCA 3QAHA 4XSZF 2CYYA 3DPLC 1UCRA 1QQIA 5K5QA 4ENNA 2A07F 2KIFA 2FXAA 1U5TA 2XAQA 2FBHA 3AAFA 2DQLA 4ZZDA 1B9NA 1U8RA 3GX4X 2QWWA 1F1ZA 2G7HA 2TDXA 4HZFA 4ENMA 3FX3A 3RYPA 4IRHA 3QPTA 1T98A 2DT5A 2OZ6A 1OYWA 2RQPA 3E6BA 4HAMA 1T2KA 3I53A 3IC7A 4EJVA 1GXQA 4JK1X 1S7AA 2M87A 3BWGA 5CVUA 4A0XA 4YFNF 1IXCA 4MEYF 1QZZA 2IRFG 2E1CA 2GZWA 1G3WA 3ZMTA 2MH2A 1R23A 1LEBA 2AS5F 3CO7C 1QBJA 3BJAA 3WTZA 4LLGF 1B1BA 1J5YA 1IZ1A 4L9JA 1HW2A 2QBYA 3GUDA 3KEQA 2IT0A 4UV9A 4LG0B 3RJPA 4XLNF 2P4WA 1JHHA 2L01A 2LX9A 5E8IA 1MDMA 3WE2A 3M1EA 3ECHA 1TW2A 2XKOA 4AIHA 3J80Z 3V8KA 2M5WA 2ZMEA 5LEJA 3DV8A 4U0VA 3K1MA 1ZG3A 3ZPLA 3BDDA 3B02A 4G6QA 1D8JA 1I6XA 1JXSA 4M6XA 2W85A 2FBIA 4JBAA 5ILUA 2KIUA 2D1VA 2XAJA 2GXGA 1SD7A 3OV8A 3R6SA 4U0WA 2H94A 2J5PA 1K79A 1HW5A 3E5XA 2F5EA 3BROA 1BJAA 3I4PA 2QQ9A 4IXAA 2W84A 3MCZA 3SFZA 1R1TA 5DEQA 1TTYA 2FBKA 2HYGD 3E5QA 2MA3A 2DAOA 2VE9A 4MEXF 2P5LC 2COMA 5ERIA 1J0RA 4BHPA 5HLIA 1P4XA 2OD5A 2ZJ2A 2KKOA 2IA2A 2BYVE 3CUOA 2P6SA 4UV8A 1I1SA 2DBBA 2W57A 1HSJA 2EA2A 5HDGA 3IRQA 3DKWA 1OKRA 4S05A 4I0BA 1QGPA 2BGCA 5D6EA 4KIFA 1IAWA 4A0ZA 3HSEA 3TOBA 5HS9A 4CO8A 5AIQA 1IUYA 1WRJA 4O6JA 4YFKF 1PUEE 1ZREA 2VN2A 4KMFA 2K27A 4EGZA 5DCMB 3ZMDA 2MLKA 3HRTA 3TO7A 1W5SA 3MZHA 2PLYA 4CHUA 1ON1A 4HV6A 5JHUA 1Q1HA 4I7HA 3F8CA 4LFUA 3GZ5A 5A2QK 4KN4X 3KETA 1DPUA 2EFQA 2QENA 1XN7A 2FOKA 4KYWA 4G94A 1PDNC 3WGHA 3P9KA 2GCXA 5LRSA 3ISPA 1TQMA 3FZVA 3VB2A 3CJNA 4D0PA 2FNPA 3JW4A 1IRFA 3I59B 5KK1A 1U2WA 1SFUA 3U9GA 4OIOF 5E17F 2A6HF 3HHHA 3ZMVA 3VODA 1ZRCA 1YW8A 1ZARA 4HDUA 1R58A 4EV0A 3F21A 1XGOA 5BOXA 4IRGA 4KA4A 4HOBA 2ISYA 4HX4A 2F5FA 5CLSA 2GQQA 3EYYA 3WU1B 1SD6A 3BJ6A 3DPTA 4MGRA 1O3TA 3G73A 1I1GA 2XAFA 3WGGA 4WXDA 3PFIA 2QVOA 1YLFA 1FBUA 3KP6A 3V7CA 1MJAA 2B0LA 4ENJA 4H0EA 1SFEA 2CWEA 1YS7A 2VBYA 5DD4A 4KN7X 2WC2A 4Y13A 2YX7A 4BQAA 3BP8A 4IHTA 1F9NA 1FSEA 5D5WB 3J81K 3ZP5A 2A61A 3GFJA 2PJPA 2RV8A 4RB1A 3E6MA 3FWEA 3SHFA 4L9NA 5A2QZ 3GFIA 4A5MA 1W7PD 4KDPA 2ACJA 1HKTA 3IL2A 1BI0A 4WX9A 2OQGA 2XVCA 3FXRA 2IVMA 4ASNA 2YX4A 2FNAA 4L18B 1W7PA 5F6FA 3M8EA 1YFHA 1FBSA 3DQVC 2A69F 3CUQC 1Z1DA 2IW5A 4M72A 3J7AO 5ICCA 1J75A 1TQPA 1F5TA 4BH9A 1ODDA 2DO7A 4B09A 5HDNA 3JAMK 4EM0B 3ZMZA 5F64A 1X3UA 1XSDA 3HOSA 4HX7A 3MFKA 1FP2A 3WU0A 2XASA 3C1DA 2VC0A 3L9FA 2FEZA 4I01A 2HTSA 3GF2A 3LA2A 2O61A 3RKYA 2OA4A 1BBYA 3I0TA 2XKPA 4YIIA 2Q2EA 3V4GA 4K2EA 3BPVA 2GA1A 2EFOA 1UHMA 4PCQA 5DUKA 4LG0A 4HF1A 2HKXA 1V4RA 2DQRA 1YTYA 3CO6C 1ZHFA 2CSOA 2EA4A 1R5HA 1XCBA 1XMAA 1QVPA 2PQ8A 2NAZA 5L3EA 4KIBA 1EH7A 1RIOH 1F4KA 4EQQA 1UB9A 2ZBKA 4BXUA 1IXRC 3I58A 1LDKB 3K1NA 3KP5A 2IJLA 3F8MA 5ICEA 2PMUA 3O6BB 4G6DA 1HSTA
chains in the Genus database with same CATH superfamily
3Q9SA 2HDCA 2E7XA 3FM3A 3PTAA 5GAOr 1STZA 1FEXA 2X4XA 3VYUB 5KCOA 2TCTA 1X2NA 4C3JJ 2ZJPF 1OOTA 1ZSZB 2JTMA 1USTA 3VPRA 1CGPA 4OVAA 4PJOB 1JQQA 3FMQA 4XM3A 4HQMA 5D6XA 4BHBA 1IF1A 5CYVA 1HXDA 4XU0A 5GJWB 5L3DA 1KJWA 1FIPA 2CW0F 5L3GA 2WWYA 1WZ2A 2DETA 1OQKA 3R0AA 3FXOA 2E7WA 2EINH 1W36C 2C0TA 5AIPA 4M9SA 3EG0A 1NJIU 1B4AA 3CP2A 1V55H 4B8XA 3VS3A 1B6AA 1X2MA 1BU1A 2PX9A 3SEMA 4RGUA 5H6RA 4UY8I 1ZLMA 1KZHA 3NEUA 1LE8A 3E19A 4RTVA 2F5CA 1W0UA 3DB4A 3F8FA 4D7MA 4FQGA 1OU8A 3ELKA 2X51A 4BGDA 3QKJA 3IV5A 2J7IA 2MOXA 2QXFA 4M75D 4BE2A 3B6AA 1HDPA 3AL0C 1LJOA 1WJFA 1T33A 4KISA 2W4SA 4A3IJ 2Z3YA 3L2VA 1VQKI 2JQ7A 3AL0B 2BE7D 2Y48A 2QDLA 3PFSA 1OYYA 1Z05A 3B6CA 3HPWA 1Z9ZA 4NDLA 4E7LA 1G2HA 3L42A 1GXPA 5EEHA 3OYFA 2XG8D 3W2WA 4A4GA 4H4KC 5KYYB 5GANd 3K0LA 3G2BA 2JJ9A 2K40A 3SZPA 2MC4A 3CCUI 3EUKL 1UJ0A 2L2PA 2N8GA 2BY0A 2VKDA 1JKRC 2PUKB 1XJWB 2EV0A 3ZQGA 5ED4A 3BLYA 1QVGA 4IURA 3KIOA 1MMSA 3A5ZB 5HK0A 3ZL7C 3HUGB 4J19A 4LXCA 1P4AA 2HL5C 2HZTA 4HA8A 4HCBA 5CKDA 4C8QG 3HHTB 2VGMA 1TLHB 3JRHA 2X6WA 4G8XA 1MNEA 4M6YA 5ICGA 1B72B 2WSEE 1VQKA 4HX8A 2QGFB 3EHQA 4IUPA 4J9CA 2ID3A 4RDUA 3MD2A 2OU2A 2HWVA 3A8LB 4M78A 1KD1C 2DKGA 3GIBA 1MW7A 1XC5A 2KDOA 3BPXA 3GTKJ 4M9XA 3HOVJ 1TNTA 2R57A 1VIEA 2IS1A 3N97A 2EBIA 2F2EA 1WQ2A 1LFPA 2KRCA 4F52A 3JRAA 3HTRA 2OBPA 3CPFA 1M8VA 1ZK8A 2VXDA 2JTEA 2X3XD 4R55A 3MKZA 4DBFA 3LW5E 5D7UA 2G7UA 3TDZC 9ATCB 2XSDC 2DTRA 5IT9K 1ORKA 1FJLA 2DL5A 2CUDA 2HKOA 3K9TA 1PD0A 4UVAA 4LNPA 2HYFA 3HUGA 3PO3J 1QPIA 5F0CA 2WACA 5A0DA 2RNJA 1H9TA 1QZYA 2M3AA 2NWMA 3Q0VA 1EFNA 2IXSA 1Z9CA 4FYYB 4J5YA 2RHIA 2FE3A 4Y7NJ 2E1NA 2RI5A 2MC3A 2FD5A 4RGRA 2EPFA 2XAGA 3AHUA 2L54A 2RNAA 1EV7A 3MEAA 4Y28E 2K02A 3KLOA 1QZEA 1EKEA 3CDHA 5IT3A 5LHHA 4ESJA 1HOMA 1F1BB 1RAIB 1XS9A 1RL2A 3V7RA 5JVGF 2A36A 1VQPT 2FO0A 5A0GA 1JGGA 1YWOA 2NVXJ 2CZ0B 1M90C 2JSPA 1YS6A 1U06A 2RJFA 3CTAA 1FXXA 1K76A 1WHMA 5E1ZB 3JSOA 5EG2A 3DFGA 4OGEA 1YBYA 2ZFWA 2ZJQF 1NJIC 1KSWA 2DPDA 3FMRA 2VT3A 4CSWA 1A36A 3UPUA 1J9IA 2DMUA 1ZX6A 2UZKA 4IIMA 2DBKA 4RBOA 2CSQA 4C30A 2B63J 1C0MA 2YT6A 4DBHA 2DN0A 3WTYC 3DKYA 2BVMA 3ZQ7A 2EGAA 3SWNA 4YIFA 2BOLA 3OIOA 5EZGA 4C0GA 2JT1A 2Z1DA 4OB0B 1KQSS 5KYYA 5J3BA 2PN6A 3S3OA 1W2BA 4L5IA 2F5KA 2P0QA 2DPUA 2K9MA 1YJNT 2HAXA 2RREA 3OMYA 4CGZA 2QQAA 3L00A 3X28B 3CJQB 2EWNA 4PSWA 2MLGA 2EQJA 1Z6RA 3OSSC 4ZNXA 2M4KA 1CQTA 2E10A 2BEOA 2BXZA 1SEMA 1M1KU 2MMPA 4JRPA 1LDDA 2Y31A 5BNGA 4FX4A 4A4HA 4P96A 2NUTA 1MV3A 5FLVA 4M78F 3L1AA 1WHLA 4A63B 5GADJ 5HS8A 1LEAA 2HQEA 1X4PA 5D8LB 4OB2B 2QA4T 1Z7UA 4OP0A 3DTIA 2SEMA 5LJ3g 1VYTA 3F72A 3CCUQ 3DB3A 3GXOA 4MQVA 4G7HF 1FMKA 3QOPA 3CCQI 3FISA 2A6EF 1WHKA 3H35A 4MDXA 2EH3A 3WG7H 3HJEA 1QO0D 3HPHA 3DXJF 3ZMUA 5CVJA 4UUSA 1WLPB 3FJPA 4RG2A 3Q0UA 2VODA 3D1NI 2YHTA 4EMKA 2YUNA 1VQOQ 1LE8B 3LQRA 1UG1A 3V8JA 1AKHB 2VKVA 4P9UA 1UFMA 1NEBA 2PEXA 5JI6A 2P7CB 2JA8J 5GANh 3CCRT 1NYFA 2LMDA 4M77F 2FRHA 3KCCA 1YJWI 3K7AJ 5IPAA 1JI8A 1HCRA 4Y92A 1V54H 3S2WA 5EYRA 1VQ7A 3LWHA 2KL4A 1SSFA 2D5VA 1B59A 3DTKA 1SMYF 3HRMA 4Q48A 1P92A 4RA2A 3WTSC 2CV1A 1NE8A 1KU7A 3O5ZA 5IH2A 2K79A 2DEQA 4M7DG 3OSFA 5CVIA 4HF2A 4F04B 2VE8A 4E6KG 3K4CA 3CC2A 5CKFA 2A0FB 4QSHA 2CP2A 3GZ6A 4GY5A 5LJ5f 4IL6C 2QASA 3CLOA 4NS5A 1IZ6A 1AU7A 2PNIA 1RR8C 4CZCA 2JVGA 2ABLA 1A6QA 1G6NA 5HCKA 4IVNA 2KZGA 1R49A 2E70A 3L7WA 2MSYA 5IP9J 1GVDA 5IOYA 1PP7U 3W6JB 5LBQA 4FCYA 1ZUUA 3CC4A 2GA2A 1TWCJ 2K5CA 2O03A 1EJ9A 2O4XB 1QCFA 3REOA 5FKMA 3ZQHA 3FBIB 3SZGA 3REAB 2MW8A 2R7UA 2DXCA 3TSWA 5GAMh 1VQ4A 3IKTA 4ZZLA 1FOYA 4LLLA 3JRIA 2LCSA 4M7AC 1OCOH 3VFZA 5IYCJ 3H6ZA 1V29B 4M7AB 2K9NA 4QLCU 4DZPA 1EZZB 2ZGWA 4FETA 5HKCA 3RQ4A 2DFFA 1HF0A 2IPOB 2QTXA 5J6XA 1ZQ3P 5DD8A 4HLYA 2GLOA 1MZBA 3LWIA 2QEXQ 1FTZA 2D1HA 1TQIA 4FW2A 4BQQA 3I71A 1ZAOA 1AWOA 1ZYRF 2CO5A 3VYTB 3G6EI 1FP1D 3QZ9B 3S1RJ 2E2IJ 1MUZA 1I5OB 2MIOA 3VS1A 1MMAA 1IW7F 3H3UA 2OUMA 3JV3A 4XLEA 3PT9A 1YITA 3B73A 3BOQA 3ZFJA 2BHYA 3A1YA 4GO1A 1NBEB 3JCMd 4IPAA 3ZR8X 1WCMJ 3AG3H 1CKBA 4C2TA 2F48A 1Q86U 2L4MA 2OV7A 4X6AJ 3IWZA 1T0FA 2DIGA 1TZLA 4ESBA 3AKZA 4KIGA 1WI9A 1VTNC 3V7SA 1IG7A 1R36A 3TDUC 5CO7A 3BG5A 2E1HA 1X1CA 4M7AE 1V3FA 4C3HJ 2K9GA 3NWSA 3PUBA 4Y15A 1YRNB 2WY8Q 1MNMC 1YIJA 2JT4A 5IN1A 1HKQA 2IS2A 1ZSGA 4BUGA 2KFDA 3GMEA 5HLTA 5FWCA 1B8IB 3CF5F 4M78G 2FQ3A 2L5QA 2LQ8A 2P5VA 2P6TA 4OMYA 4C5GA 2QA4A 1HKSA 1VQMI 1R71A 3CF2A 3CCET 1E3HA 1WKMA 3BTCA 2KQRA 5FKKA 4OIRF 4Q5SF 3ZQIA 2B86A 2DXUA 5EG0A 2KBTA 4FT4A 4EMGA 1VQNT 1ZGJA 4B48A 1BC7C 4RAYA 3J81E 4MQ9F 1GFCA 1T3LA 3JTGA 1XSVA 2L89A 1P4WA 2K9QA 2JXBA 2CMPA 2RVCA 3J7YJ 4AVZA 1FYMA 1XGSA 2XF6A 1RUWA 3J7ZI 7AT1B 4GXOA 4P9FA 4D1QA 4M77A 2L3PA 4ZN3A 4BY7J 2EW3A 2CUZA 1QP2A 3ZN0A 3DP7A 2K4JA 4C2MJ 2YSQA 3HSBA 3F8BA 3M53A 4HVWA 4AIDA 2RF0A 3E5UA 3LA3A 2QZ8A 1R9TJ 1BB9A 3EFOB 4IKFA 2YR2A 3VDXA 1LUJB 2EB7A 3TW6A 2NVQJ 3CUQA 4ZYEA 1APLC 2CJJA 1ZLJA 3LX7A 1ULYA 3PNVA 4FX0A 3SWNB 3BCBA 3K70C 4XIDA 1JJ6C 1AVZC 1K0SA 1Q81U 4ZYAA 1BC8C 3HYIA 2AZVA 1IN4A 3BR5A 1X01A 3CMAT 1XDUA 5J40A 1XB4A 2E5KA 3I56T 1YHQQ 2LT1A 1UG0A 5GANe 4UHTA 1O4XA 4KT5C 4LG3A 1KGSA 2M34A 2LNHB 2XU8A 4M3DA 1YO5C 4XONA 3T0YA 3CJRB 3JSPA 1I1JA 4BU2A 4JJDA 1MBEA 4V2FA 1K9MC 1KQSP 2Z99A 1SFXA 2VBXA 4U88A 1RAFB 3FXUA 2GWRA 1FBQA 2BIVA 2X6OA 4EJUA 5D5UB 2JN0A 1G3TA 2CQXA 3MZYA 1DGWY 1X27A 3PQKA 5K5RA 4PJOF 5JLWA 5BQTA 2AXTC 3QWXX 4X0GA 2MF2A 4NC6A 3RR6A 3BR3A 2O3FA 3VSLA 2K4YA 3MKWB 2GBYA 4J9EA 2ZB9A 1W4MA 3V8LA 2K2MA 3JRFA 4EVIA 1WZOA 1QW1A 4JS4A 2B7EA 4E7IA 2CSIA 1V5FA 1KQ1A 3ROUA 3P8BB 3L2UA 5KE3A 2KHMA 5E1WA 5DDGA 1HD3A 1YCYA 1HW1A 2LLKA 2M1BA 4IHVA 4HSRA 2QGUA 2JZ2A 1MJ9A 4D9JA 4C0DB 3I55A 3CMAQ 3Q9VA 5J4VA 3OYLA 4TV7A 1SMTA 3DPUA 1JBMA 3ZQCA 3EFSA 2V6CA 1Y8QB 4UUTA 2BY3A 2OTJI 3M0SA 3P8HA 1M4ZA 1SPKA 4F7UB 2GIZA 2A28A 1RZ4A 5BMZA 4XTXA 1ZSZC 1KHCA 2EYWA 1I0CA 2COYA 2E41A 1VA7A 1QPMA 2VASA 4A12A 2C6YA 1HK9A 2ZPIB 4NBQA 4DW6A 3NMZC 1AWJA 2F2XA 4N4OB 2R5ZA 4KT0E 4CDGA 1CF7B 4OB3B 4C5IA 4FISA 1R1VA 3I54A 5F27A 1VQPQ 1P7JA 2HU9A 4ESFA 2L7MP 2LR8A 3BZ6A 4OMZA 4CCJA 2K5LA 1KIKA 3CCMQ 4WWCA 1Q81R 4I98B 5E3LA 2P7VB 4BL0B 1I27A 3L2CA 3HKZA 1DUXC 1YG2A 2VOOA 1ZUYA 3F70A 3K2ZA 3A98A 1MSFC 4M3FA 2QKMB 2VBZA 2KY9A 3IH3A 3K10A 4NQWA 1J7KA 1KONA 1IDZA 3UKGA 1FLIA 4E70A 3HHGA 4Y91A 1UUEA 5ILVA 2X4HA 2NUPB 1D1AA 3CP8A 4B4CA 4B43A 1YCSB 4EJOA 1LB2A 4PSXA 3CCUT 1VIFA 3M07A 1DJ7B 4HNVA 2M45A 3BY6A 4XRSA 2FPDA 2JMAA 5LGTA 2L4AA 2KJBA 1H3HA 5CAIA 4C92D 2XRLA 4MLOA 1K73C 3HFOA 3WVEB 2KE9A 2KT8A 3JCMg 3CPWP 2CH4A 2RJCA 4JP0A 2JA6J 4AC0A 1J59A 3GTQJ 1Q82U 4J7IA 3CC7T 1QWEA 3PM1A 3LWFA 4PJMA 4B3AA 1KYZA 1YOVB 2HTJA 3F0CA 3LL7A 3S3NA 3H3ZA 1K83J 4XKBA 4NHJA 4BEHA 2O88A 3S1NJ 4A5NA 3DBLB 3F8NA 2ESHA 2JPBA 2QCOA 4PJOA 4GYIA 2RDPA 4FYXB 3E97A 2YUPA 3DLLA 1Z77A 1DGRM 2R5MA 2CW8A 3EDPA 3HBLA 3MWMA 1FOKA 1UGQB 4XU2A 1IN7A 4IZZA 5E3NA 1IB8A 2WV1A 2W1OA 2PVOB 4ZYHA 5LJ3f 2RK1A 3WVDB 1BL0A 3KYCB 3ABLH 4HYEA 1IGNA 2KQWA 5GAN8 1PP8F 2K2VA 2C06A 3HOZJ 4O5VA 5TJJA 2FA5A 4RM3A 4YRVA 1T38A 3O8VA 4XQFA 1B9MA 1UGRB 1QCOA 1MBHA 1JE8A 4IQJA 3HRUA 5DV5A 3GNGA 3HRSA 2JK3A 1Y6IA 4BBSJ 4DA4A 4AYBA 1KG1A 5EDNA 1X3WB 4S0HB 1KYWA 2HKNA 3KUFA 2DDAA 2LY1A 3VOEA 1YX5A 1Z7LA 2CKKA 2AO9A 3MP6A 4QT7A 3I9V2 1IXDA 2Y0MA 3HXLA 4WXHA 2VONA 3EH2A 1HBXG 2KYMA 3DWLE 4QTRA 2Q0OA 2OAUA 2OAZA 3IQLA 3G4ST 4II3A 2X0LA 4MHGA 4BYYA 1JB0E 4UNOA 1S8NA 3IWFA 3I3LA 1MGTA 4E7JA 1IRXA 2YRDA 2KRFA 3I64A 3EGXB 2BZ8A 3CMEI 3BQYA 1R00A 2UXXA 2BE5F 1ACMB 2YS9A 2BUDA 4JUVA 3CCSQ 2LF7A 4XBFA 2DLPA 3ERED 2K4BA 2DLLA 3EYIA 2JW4A 4YG2F 1GT0C 4JJCA 1VQLA 2OTJQ 4C0FA 2CG4A 1WQ7A 1WNLA 1KQ8A 1K1ZA 1RAEB 2K9LA 1D3BA 2WSFE 1KD1R 2VVKA 1LJ9A 4PL6A 1VQ4Q 3OYDA 2DA4A 4BQNA 4M77G 4L0YB 5CQXA 3ZN1A 2L3SA 2DT6A 2AQEA 2G0EA 1R5GA 1XX5A 1NH3A 1S7EA 2FRYA 2HS5A 2CGPA 4F92B 2DYIA 5H20A 2BTTA 4MTDA 1M1EB 1B34B 1UDLA 4R8HA 4ZTFA 5D4SA 2V1QA 2CFXA 5ILSA 2NS0A 2EYZA 4OB1B 1BM9A 2NNYA 2H09A 1JGSA 3OR2C 1R0BG 3HM5A 1YHQA 4CCOA 2XGXA 1BIBA 3T8RA 2RN8A 2RC4A 1IN5A 2M2EA 2R92J 4JPBW 1OJLA 5DM7R 1QRYA 2HZYA 4FW1A 4LDUA 3N05A 3TQNA 4A54A 5CVRA 2KIQA 4KGXB 3BTIA 4I0AA 1UHWA 2V8JA 2K3XA 5E3MA 5JHFA 1FTTA 1UMQA 2PFBA 2ZCFB 5I2MA 2IBDA 4A6DA 2EZKA 3BZKA 3EQLF 2RJEA 4BHCA 2XICA 1TTHB 2UV1A 4RKUE 3QU3A 4UUVA 3L2QA 1O3QA 2XGEA 2TRTA 2ZNZA 1MV0B 1TNSA 2H8HA 4PFOA 4BDZA 4IUVA 3FXKA 2DERA 2JMWA 1ZUKA 1GDTA 3BR1A 3T5XA 3LSTA 1ZG1A 2RHXA 4OMOA 5JLXA 2HXOA 5HDKA 5I11A 4J9DA 1XTAA 1REPC 3W6KB 1S5LC 2Z33A 1JO8A 2ELHA 1XTDA 3JCMV 4ZGJB 3CCUA 2XPVA 4HNTA 1R7JA 2VIXA 5DCMA 1UE9A 2FZKB 1AWXA 1VNDA 1T39A 2LJ3A 1R1UA 2L9SA 1C6VX 4RS8A 4NC7A 4C0ZA 1H9GA 2HEOA 1X19A 2FSWA 1S72A 3FDYA 2VUMJ 3M7GA 1VQ4I 3MPUB 4Y4RA 2K7LA 3RPUD 2GOXB 2Y2ZA 3SQNA 1ABQA 5DLQE 2H3JA 1WFXA 1RUNA 5GMKl 1PVEA 3I56A 1BCOA 4ME7A 2W25A 1PJRA 1N8RR 3KBGA 1VQLQ 5FRMA 1R22A 4ANJA 4W97A 1TW3A 2A68F 5GPCA 2BZXA 3O3KA 4PJJA 4CICA 2RJDA 3BDLA 5GJVB 4P5OA 1MD0A 1K8AR 1Y07A 2AK5A 3LGLA 4XMYA 2CP6A 1YNZA 2ECBA 3G1OA 2DL7A 5FLXK 4R56A 1BN5A 4CUGA 4PDKA 1JT0A 4HT8A 3G1JA 1OISA 2RAEA 1YJWT 1OQYA 3EUHC 4Y17A 5FU7B 1VQ9T 1ETXA 5CQEA 3J80K 3FXQA 3FJ5A 1LVKA 1ETKA 2GQIA 1G59A 2XSJC 3FM5A 1PHTA 1EH8A 1BR1A 2JUCA 2LKSA 2QF7A 2Z16A 3GLXA 5D6FA 1G4DA 1N78A 1XMXA 3H0FA 4M75F 3CXCP 1B72A 1TWAJ 1QMCA 1Z91A 2HOSA 3DBRB 4PGGA 4B3XA 3MP1A 2D8JA 2VC1A 3DLAA 2FMYA 3ONQA 4C92A 2DEUA 4RCCA 1A0NB 1LDJA 2QQBA 1H3ZA 5HVQC 5GAHJ 2EV6A 4WXCA 1I5ZA 5CVVA 2P8TA 1T8IA 4UUSB 3OWTA 2MYSA 4HF0A 4PUSA 2H6CA 3JTHA 5J8FA 1Z6TA 4S04A 4LK0F 4RLFA 2DOAA 4RAGA 3K70D 3GEZA 1OCTC 5E79C 2GXAA 2Y4YA 3FKIJ 1GBQA 2ATCB 2VXEA 4OIPF 1A6IA 4LUDA 5GAN5 1U8BA 3NFCA 1W7PB 1ONVA 5M5YJ 1FOXA 2KI7A 4C8QD 3CUQB 3I5RA 3QUIA 3PQJA 2VV5A 1AA7A 4L0ZB 1UJYA 2DZCA 4LUEA 2L7FP 2PVDB 1W5TA 2LY2A 1YIOA 3NAUA 4EM1A 3DLMA 2V1XA 3M0PA 1OMIA 2OI3A 2RHUA 3QDRB 3WHBA 1AT1B 2HNIA 4RB0A 2XUBA 2GQVA 3OYEA 2NUTB 4JRKA 3F6OA 1IRGA 4M75A 3RERA 2LF8A 5TRDA 1BYMA 2ZMEB 5F08A 3SXYA 2R7RA 3ZQLA 1BW6A 2VB6A 3RNJA 2DA6A 2DTZA 3QPSA 2R7WA 4HDVA 2ZPFB 3RPQA 4C8QC 3WTVC 4A3GJ 4J6XA 2E34A 1SG5A 1QVFA 4A3EJ 2LD5A 4MNUA 4XRFA 1K6OA 3LFUA 1BI3A 4PJOG 1U78A 3GBGA 2ED1A 1VQNI 4F7ZA 2E5ZA 3RYRA 4FYWB 3A03A 4QVDA 4PZJA 1OZ3A 2LQWA 2YRVA 1ON2A 5FKOA 1OULA 1VQPA 3JCMb 4IQ4A 4BACA 2VGNA 4DEXA 3TO6A 5CCAA 2M8EA 4KICA 4A0YA 3G7ZA 4BI3A 1X1PA 5D8KB 2DXIA 1KU9A 4LD5A 1PWTA 2ZCWA 2OQRA 2KRSA 3T9NA 2Z0WA 3DEUA 4DOWA 1VQ9I 3MAJA 2KRNA 4OIQF 2ETHA 3OW2P 3L1PA 3CCEI 1O9SA 2K3PA 2CS7A 2G6FX 3VRYA 2CUFA 4WTOB 4RTXA 2HQXA 3FHZA 3P9CA 1LNWA 2DVEA 3CC4Q 3M3YJ 5L3CA 2V1NA 3OYMA 2QSHX 2K3YA 2JNGA 2W24A 3I55Q 3PNYA 1H8AC 2DT7B 4XL9A 1RR7A 4BUPA 1ZR4A 2F2VA 2XB5A 4M78E 1X1BA 3HOWJ 1T0HA 2W10A 4M78B 4IHYA 3ER0A 3E3VA 4GCVA 2XF7A 2LREA 2WY7Q 1ABOA 1OPLA 5KH6A 2VQCA 2ZZDA 3H0IA 5L3BA 3AG4H 2HR3A 3K4MA 4JYKA 2A5YB 5M3FJ 4J83A 3S2HJ 1E0EA 4PKCC 3A8HB 1GCQC 2HOAA 2OTLT 2FU4A 3HC7A 4L9TA 2H8WA 5B1AH 2R7ZJ 2R5YA 3O8GA 2Q1ZB 5FLXZ 3QRFF 1IHVA 1WPYA 1MKMA 2BBYA 3JCMW 1SAXA 2VJJA 1D0XA 3CZ6A 2HBPA 1ZH5A 3FXJA 1ZBXA 5TISC 5BPIA 1FIAA 2EQRA 1WJQA 2DNUA 1AWCA 4LIVA 4AVPA 2NOGA 1T0JA 1XOVA 3H0HA 2RNGA 2JS0A 1OX9A 6PAXA 3S3MA 2JA5J 1S9HA 2VOPA 4KUDK 3GYHX 2OZUA 5DUIA 1KC8C 5LRRA 5J1RA 2AIRB 3D0SA 1W36D 3GZNB 1IUFA 2EYXA 2AXLA 3PUFA 3SZTA 1S72I 4HCZA 1YJ9Q 5E1XA 1ZRDA 4QVZA 3JB9I 4GRIA 2CW7A 4D5FA 4J9GA 3RMSA 2HPIA 3BQZA 5JR3A 3OYHA 2PJRB 3C4SA 4B1RA 2CGHA 2VQGA 3VS2A 1YYVA 3QU6A 3R6OA 4LN2A 3U1DA 2L02A 4FE7A 4N0BA 2XRNA 3VKIA 3M4GA 1SFKA 2LKPA 6AT1B 2XDBA 1U5TB 2L9RA 2QM3A 2RGVA 3LH0A 3KFWX 3K69A 2VWFA 2VJ4A 1KU3A 1R0CB 4C0DC 5GAOn 2M0OA 3LSHA 4RTTA 1WHGA 1VQ4T 1VQ5A 4EGYA 1K4SA 1SRMA 3Q1JA 3BCAA 5KVRA 4EMKB 2Y75A 1YIJT 1W1FA 2H8RA 2HI3A 1Y57A 1K73R 3S17J 3ABKH 2HVSA 5J1YA 2Y0SA 2DYBA 1L3LA 2M8GX 5LJ5h 2DTOA 4JQFA 5GAOl 3IUOA 2X4JA 2W00A 1JJ8C 2NRAC 3VWBA 4HCKA 1IN6A 3SB2A 4EJWA 3MQ0A 3JAMZ 4MZMA 2MFZA 1B34A 4GGGA 2HMAA 3EG9A 3F23A 2X4YA 5ECAA 1VQ8A 4E7KA 2XAHA 1O7LA 3OS2A 1XGNA 2HCKA 2DO3A 1B7TA 3S93A 4NL3A 1J2XA 5FRNA 3PVQA 2HGCA 4FASD 4MDWA 4E4HA 4CC7A 1KQ0A 2BY2A 3DCFA 3HIFA 3S16J 2JTFA 3C95A 3CCMA 4MMLA 5FROA 4Z89A 4AFZC 3UWNA 4F16A 1KQ2A 4C92B 1B07A 1I8FA 5D6YA 1VQMA 2W0ZA 4XN0A 2RQUA 2VT2A 2DD5A 2KRMA 1FSHA 2CDTA 1JEGA 4EJTA 2DL3A 5FJ8J 2VL8A 1FYKA 3EGXA 2P0KA 3NPFA 3ZQFA 4BAYA 5HK3A 2DODA 1WJRA 2DVJA 2DU9A 4J7FA 3KP3A 2IG0A 4P5NA 1KC8U 1TWFJ 3FLGA 1EA3A 1YN8A 3KFVA 1XMKA 1KA8A 1O7FA 2VPLA 2UUZA 4E7HA 2LKXA 1G3SA 5BS6A 2WAFA 4KMUX 5CQYA 4I02A 3VYSB 2JTVA 3HOTA 1VQOT 3PNTA 4LITA 4EMSA 5IAYA 3OS5A 5GAN4 2EGEA 3Q3SA 3SEZA 4U7BA 3WTXC 3JSCA 2BW3A 1QP3A 3CC2T 3FF5A 3VYHB 4M74A 3G71A 2DTIA 2QQSA 4OINF 2KZVA 4OAYA 2MI6A 3G3ZA 2DRKA 3JB9G 1SD4A 2HQNA 1WIEA 3HGGA 2R3SA 3MEWA 5LEKA 3A8OB 4MMKA 4WK8F 2X85A 5DM6F 5EGOB 4PJLA 5FD5A 5EF6A 2Z9OA 3OR1C 3OBWA 4B9WA 1S29A 4AM3A 1NLPC 2XK0A 1YIJI 2YUSA 4J6YA 1RPWA 3LAJA 2YU9J 3QWYA 1U9NA 3NRVA 4PNOA 4R1HA 4ENKA 3DF8A 1YQAA 4X34A 2FX0A 1Z21A 2H3EB 2QTVA 3OYAA 2EIJH 2LY9A 5KYUA 3FEOA 1OCRH 3DU5A 1Y0UA 4ON0A 2HQHA 4M7DB 4JDSA 3SEQA 1XQHA 1UZCA 2AT1B 2D9TA 3OW2S 1M3AA 1VYVA 4R0KA 3WHCA 2JZYA 3BG3A 1U5SA 4FT2A 3J7AF 1WJEA 2M1HA 2COBA 2KYBA 1ZGWA 1Q7YU 2AQFA 1BA5A 2W7NA 3CC2Q 2XD0A 4MZTA 2FF4A 2FRWA 2QEXT 3TL4X 4AD9A 1OR7A 2V26A 4FIBA 3VUBA 1X58A 2ID6A 3WG9A 5EGOA 2QBYB 3X25B 1RKWA 2EK5A 3ZGKA 3FRNA 2M30A 1DDNA 4PJ0C 3LSRA 3OQ5A 3JB9F 1Y56A 2JJ7A 3EUHA 5K7ZA 2NYXA 2V8KA 2ZXIA 5LHIA 2E64A 1ZR2A 4XLPF 1YJWQ 2F5DA 1JUMA 4DNCA 2DJZA 2E35A 2CV2A 3G71T 2J5OA 2DK5A 2L3DA 3QDFA 1XCVA 4L9VA 3GTOJ 2DCEA 1B3QA 1U1TA 2DD4A 1WPKA 4RTWA 5M5XJ 4RAZA 5ICFA 2XV4S 1TXQA 1TS9A 2K57A 3ABTA 4LJZF 3RESA 1Y39A 1MH3A 3KX2A 4HW0A 5C44J 1U3EM 2CZ1B 1CF7A 1ZLKA 2PMZN 4Q5WA 3CMEA 3H0DA 2LRQA 5FO5A 3HP9A 3MEVA 1LVAA 2VYTA 4WF2A 4L5EA 3UNGC 1FYLA 4LGWA 2E3IA 3H9JA 4UVBA 1N77A 2M9HA 2I2LA 1WWXA 2D45A 1SFOJ 4AIKA 2CP5A 4W1UA 2HSPA 2ZXHA 3G6ET 4DEYA 2CQKA 4X1VA 1VZ0A 3KLNA 3BG9A 4QWQA 3GWZA 1RI7A 2CQQA 1QNTA 2D2WA 4KT6A 3RKXA 3PO2J 3R0JA 4FL6A 4JOMA 3QOEA 3LFKA 4I2OA 2IIMA 2LJ0A 1ARKA 3Q5FA 4EPCA 5HLHA 3COAC 3PMIA 5IXBA 3G6EQ 4KBMB 3HL8A 2EV5A 2HDWA 3KP4A 3LSIA 5A2QE 5JVTA 2C0IA 3ME9A 3OS1A 4CC3A 1YJ9A 3F3XA 5B5EC 3HDDA 4IRIA 1PRMC 2HDAA 1DP7P 4O3MA 3VV0A 3QP5A 3D5RC 3RKWA 3IKVA 1V5GA 4IO9F 1ACIA 2DZ9A 4LB6B 2PQWA 4N4HA 4FSSA 2A6TA 4JX5A 5AONA 2V7FA 2JPCA 2BV6A 1FY7A 2CREA 1G8XA 4CA0A 2Y90A 4XTZA 1Q86C 4IJAA 3HL2A 1D3YA 2MH9A 2F4MB 4N9HA 3F22A 1RADB 2DJQA 1Q82R 2ZO4A 3WTUC 3IHUA 3I4MJ 2MWOA 1WX6A 2GFUA 4RGSA 4IOAF 1G3YA 2CZ7B 3CMAA 3E1SA 2OTLA 2ZFUA 1XGMA 3JREA 3H9GA 4UVCA 1A5JA 4ABZA 3HTUA 1O57A 3VJPA 2OTLQ 1WSUA 1OCPA 3M56A 3I56Q 3CCYA 2V1UA 1M1GA 3CCVI 1YHQT 2Z2SB 2CH4W 1XSXA 4J9IA 1YI2A 5FB2A 4G7ZF 1YW9A 2X1DA 2M9UA 3ASNH 4C92F 1IC8A 3C2GA 2RN7A 3INZA 5IYBJ 1A31A 4U7DA 2YSRA 1ZA2B 3RUXA 2ELJA 2RKHA 2YU3A 2J6OA 5GAOq 5LGNA 3P7NA 2NVTJ 3PNWC 1JJ2S 2RQTA 1Y71A 3EFOA 3RZDJ 4CXFA 1RAGB 2BHZA 5HNFA 3TQ7P 5B1BH 5EC7A 2X6YA 2COWA 1BOAA 1RNLA 3NWTA 1UELB 2LC2A 5F1JA 1I4K1 3M57A 4GLMA 2XKOC 2JSCA 3GFMA 4IOCF 4CCLA 3IRRA 1PG5B 4EDUA 1L0OC 2EJFA 3OOPA 3OYNA 2K5FA 2PI0A 4ZDOA 1GHCA 2B9SA 9ANTA 4B9XA 3P5JA 2RO0A 4BD3A 4BY6B 3QPHA 1YW7A 1H0MA 3KZYA 4A3DJ 1W6XA 1U1SA 5KHDA 1ETOA 2LZ6B 4BY6C 1M1KC 1GBRA 1DP3A 2EBPA 4FE4A 5H6QA 4AU7A 1UHFA 3FMSA 3GO5A 1IV6A 1B8IA 1QVFP 1TT5B 4A3KJ 3EH1A 4IHSA 3OYCA 5LJ5g 2LCLA 1S6LA 4A6EA 1IV8A 4A3BJ 4II1A 5KYUB 3QSUA 1K8AC 3GNFB 1N8RC 4A93J 2M0CA 1RUOA 2MPXC 4ZYGA 3MEXA 4MZPA 4OMFB 2V79A 2R7OA 3A02A 5I22A 4C92E 1ZA1B 3AG2H 1WJDA 4IEJA 1SC7A 2F1LA 4WCIA 4JRQA 3BG7A 4ORZA 1WHHA 5DTDA 2COZA 1WJBA 4Z02A 1R77A 2RB6A 2QG9B 3ZEHA 4F7UA 5C3EJ 4M7AA 2NUPA 4I09A 2R5ZB 3F9KA 3CQTA 3FIWA 1Q7YR 3M9AA 1V5EA 4NL2A 5FFZA 3Q0WA 4AWXB 2P84A 3QHSA 4Q4ZF 1WXTA 4NB5A 5CJ9A 4M73A 4XNFA 2O6GE 2WSCE 3M54A 4JLGA 3F6VA 1FWZA 1Q95G 2JS2A 4M78D 3LQQA 2V9KA 1X1AA 5FU6C 3DTEA 2E65A 4LD9K 2Q8KA 4P55A 5B3SH 2EFNA 1SD5A 1K8AU 2LDUA 4XLFA 3E6DA 4AG2C 2EFPA 1WDXA 3K4KA 4MFEA 1Q1VA 5FKNA 3GTLJ 3RCOA 3META 3LAPA 1M90U 1I81A 1M9SA 1D0ZA 2LSOA 3PIOF 3K2AA 1YI2Q 3K4JA 4HQEA 2STWA 3QYBA 1RLPC 2L3QA 4DBRA 1BI1A 4ZYDA 1YIJQ 2E2HJ 1SHFA 1S7OA 4F55A 1YITI 2EGCA 3BT9A 3MEUA 5IHIA 3RTRA 4V19K 1JTYA 2WA0A 3CCQQ 5E18F 2L9VA 3C0CA 4XORA 3ECOA 2LH9A 4BXXJ 1G2BA 2X1CA 4I76A 3ASOH 4RGXA 2LJ1A 4JS5A 1K78A 3H5RA 4QQGA 4M77E 2KJCA 3HPGA 3M8FA 3WTWC 4ZTJA 2RI3A 3VYGA 1MH4A 2GAUA 1PM3A 3CC7Q 1D5YA 1QQJA 2ECCA 4TVRA 5DYMA 2JRTA 4A2UA 5DCFA 4YIRX 1TUCA 2HDDA 1R4MB 4IHXA 2STTA 1MSEC 2HYJA 1ZRFA 4KUMA 3OB9A 4DGWB 4CZZA 2EFIA 2EYYA 4XKCA 1BK2A 5E8GA 4GLKA 3ESWB 2JUGA 1M30A 2KDZA 1F43A 1LCKA 3HSFA 1GUUA 2IA1A 1NK3P 2O0YA 5CR2A 2WAQN 2QYOA 1NJIR 1VQ8Q 1VQKT 1T95A 2F2WA 2KPMA 3W2AA 5C6SA 2I0NA 2R7XA 1BIAA 1TG0A 1Q82C 3E6CC 2K86A 3OY9A 4M77D 4XTUA 5GMKe 2EIMH 2ZKZA 4RLQA 3RQIA 3AG1H 1QKXA 4A4KA 5CKTA 4DOVA 4LDVA 2ZXJA 1DU0A 1OZ2A 3R61A 5FD6A 3A0BC 1DPRA 4AIJA 5GANg 4M75B 4CYDA 1WQWA 2K3FA 2CUEA 2DOEA 4M75C 4AFQC 1P9QC 2XDPA 2DMPA 1W2BP 1BJZA 3V42A 1IO6A 3ZRGA 4NUBA 3OYIA 1ZGAA 3QP6A 5EJCA 1U6GA 2P5KA 3WTTC 2ELKA 3CCST 1I5LA 2O8XA 1NM7A 1XD7A 3I59A 3NQOA 4B47A 5IP7J 1WJSA 2LVSA 3K6GA 3MO8A 1N25A 1OYIA 3QXEB 1AOYA 2MBFA 2QQ8A 1NHAA 2ICWG 2LYCA 1O3RA 4IF4A 4M9ZA 3R6NA 5E20A 2ISZA 4AMCA 5GAMf 1U5TC 1G83A 2JRMA 3HSRA 3K4NA 3OSVA 2WV0A 2XPUA 2V9VA 1E6HA 2H27A 2F4OB 2VKHA 1MNDA 1WGXA 2HQRA 1X1DA 2OPTA 4AYBN 4BQOA 1TH7A 2NXNB 4I99C 5FLMJ 4AUXA 1VQPI 2FPEA 2X1EA 3HTSB 2QEXI 2DA1A 3FK7A 2HBWA 3CBOA 5GAMg 1VQ5Q 3X20B 2HQAA 1K61A 1YRNA 5LGUA 3C12A 1QHHD 2R5YB 1T3SA 1JUPA 4G9YA 1RESA 1GRIA 3VEPA 1OU9A 1AWWA 1T6SA 4UXNA 1QU3A 4RTUA 3VU3C 3DKXA 4RB3C 3IAS2 1VQNQ 3P9IA 1YJ9I 5JFRA 8AT1B 1P6RA 2PBIA 3TU4K 2UXNA 3KEOA 2ZPEB 5LLQA 3HOYJ 2NVYJ 4R79A 2AHQA 1GVJA 1FX7A 3J7AY 4KJZA 4XQ3A 4ZGEB 2IP2A 4XSXF 4JZ4A 1HSQA 4M7DA 1H88C 1YWPA 1E17A 2FZCB 3KZZA 5FWBA 3CCJI 2R7DA 1FT9A 1KQ9A 2KVQG 1MGQA 5HOOA 4XRMA 2CFOA 5KYXA 2NNNA 3CCLA 3I4NJ 4V2SA 3A01A 4C9YA 5IT9Z 4OWRB 2OCEA 3SWNC 1JU5C 3KXTA 1SKUB 2DILA 3GW2A 3CXCS 4G7OF 4CYCB 2EFWA 2L8DA 2LG4A 2X6XA 2KT1A 1VFCA 2LRDA 3N4MA 2VLAA 2KISA 3I5UA 4U87A 2XHCA 1XPXA 2ADUA 2K5IA 2PVGB 1O75A 4HKEA 1YJWA 1A04A 1ETVA 1FNNA 3KP7A 1JKPC 2M02A 5LJ5e 1DQUA 3MCAB 2GOMA 2BXYA 2R7TA 2PG4A 1EH6A 1VQOI 4YTLA 5J4YA 1K7AA 5J39A 1A35A 2P4TA 2EQIA 2PUOB 2RHZA 2GBQA 1FPQA 4KFCA 5GAOp 3RPUA 5GTHC 2VKEA 3DEEA 1CKAA 5LJ3e 2CQNA 3RDIA 4EM2A 4FHTA 1OEBA 2KR3A 4JZ3A 4WCGA 3BDUA 4PGHA 4Q47A 3X2QH 1VQ6T 4FSXA 2RI2A 3EG2A 5HS7A 3C18A 5KYWB 1IN8A 4OU0A 4C3IJ 4RCBA 4XLCA 5K5OA 4BNCA 3G71Q 2GTOA 2GXBA 4RM2A 3HGYA 2DK8A 3ZMSA 3E0JB 4PJOD 4OF1A 3K1PA 2QUFA 2DYSH 1E2XA 1FOWA 1Y8RB 4GDFA 3CCLI 2EKHA 4B6MA 2IGOA 1AKHA 5GTIC 4HBLA 4LLNA 2XHKA 2VBWA 2XB0X 4DQ2A 1X6OA 2R5AA 4LB5A 3PSFA 1YITT 2E1MC 1FZPB 1HA8A 3T8TA 1IRZA 2E1MB 1S3JA 4BE1A 1MMGA 1Z3XA 2EAYA 3UA6A 3TCJA 3H92A 2FMLA 3D5LA 1NK2P 2DM1A 2FB7A 1FC3A 1PUFB 1ERDA 4PJOC 3GF5A 4M7AF 3EG9B 1M2OA 1VQ7Q 5J8CA 3CCRI 3PGGA 4YFXF 2A08A 2V1RA 4A3JJ 2O2OA 3ASKA 1MJBA 2DIQA 3CBPA 4XLHA 3CD6T 1WYXA 1FMWA 3OIQA 1VQ6Q 4MTEA 3G71I 4XTVA 1AZGB 2H6BA 1UEBA 2KDSA 2XAUA 4C8QF 5C0MA 3OW2A 3G1LA 2HD0A 3BG6A 4Z2YA 1UHSA 5F04A 2NS8A 2LNBA 2WTEA 2ESWA 4BEHB 2J05A 1Z0XA 2EJRA 3O2PE 2KP6A 3HKSA 4QKUA 5D5VB 1D8KA 4N9IA 1X2QA 2QLZA 3FHNA 4V2GA 5FGMA 1H89C 1D5VA 2KIMA 1C0WA 2QK0A 2Y30A 5D6WA 2JA7J 5LJ3h 1ZN2A 1UAAA 2DA5A 3MN2A 4LK1F 1M27C 4M77C 1OYXA 1HYOA 4M77B 3TEEA 2IVWA 2GTJA 1QA6A 1KU2A 3C7JA 1IXSB 1P7IA 2VJIA 4FT8A 2KT0A 3T1BA 2X35A 3QIIA 3JCMQ 2HFHA 5BPDA 3FXLA 4DYQA 1PC0A 4EIKA 3R60A 4D6WA 3G4SA 4XOPA 1VQ6I 1TUGB 3GVAA 2AHJB 3M4YA 2Y9ZA 3JRCA 1PSFA 1Y96A 1Y7XA 5D4RA 1SAUA 4QQ6A 4ZN1A 2L3RA 5EG0B 3KEYA 3KYDB 2E60A 4OOIA 3TEDA 3EETA 2QSGX 1LOJA 1SHGA 4JJBA 3VS5A 3TKYA 4AFUC 4CC4B 4X9DA 2PMHA 4A3LJ 1X2KA 1N5ZA 1T56A 5EEGA 2QDYB 1R6RA 2RM4A 2R4GA 2DOFA 3R4KA 4I6ZA 2NYSA 4J9HA 4BI8B 2XIGA 4ZC3A 1H8KA 3FK6A 3BJOA 1KQSA 2RQQA 2E6ZA 3SD4A 3ABUA 3CC4T 2QSFX 1XG1A 1PRLC 1WVRA 4BS9A 2L0KA 4JX6A 3CEYA 3P8DA 2V1DA 1K78B 2V9PA 2VKNA 5GAN2 2M4GA 1Q86R 4U0YA 4RB2C 2H1KA 3VS0A 2Y69H 5GAMe 1JTXA 3H41A 1E7OA 5K1YA 1P2FA 2ESNA 3TO9A 1ZG5A 2O8KA 3MVPA 1BI2A 5LJ3j 4HNUA 2K3BA 2YPRA 4M71A 5GANf 3G6EA 1WH5A 1HQCA 2F4IA 2VPRA 1MDMB 3S2DJ 2RQWA 1QVGP 3ULQB 1VQ6A 1GCPA 1EF4A 3GFLA 2O9VA 5HY6A 2B8AA 1U0JA 2XF5A 2M16A 2O9SA 1USSA 2Z5UA 4NNJA 5HLGA 4HV5A 2BZYA 4LMYA 3EGDB 5AYFA 5IHNA 3RI4A 3TOAA 2DFIA 3WODF 2K7AA 3DLLF 2LQKA 3LSPA 3CCRQ 2LC4A 2VC8A 2LTPA 3UDCA 2GIVA 3WE3A 2CS3A 5L3FA 1Y1WJ 3L09A 3ML6A 3PJRA 5GAN6 4VUBA 3BR2A 4PLIA 4KNYA 3J81Z 1NLOC 3OMGA 3ULRB 2QAZA 4ZGDB 3CBMA 5L8RE 3NGPA 5GMKj 1K9MR 2KMTA 5L23A 4M4ZA 2JWTA 1TC3C 4A4FA 1GV5A 4NC8A 4D5CA 3CMAI 1M2VA 3EG1A 3MHXA 4OMNA 3JB9J 4BJTA 5CIUA 1MBJA 2YXYA 3E2UA 1YJ9T 1LKXA 2DFEA 5F1RA 4ZH4F 1VQ9Q 5FFXA 3TVTA 1O3SA 3RIRA 3OSGA 5KYXB 2OTJT 2UWMA 4E2FB 1JKQC 1GFDA 2IPQX 3S8PA 2R7FA 2XROA 1XDSA 2DAQA 3U23A 2IA0A 2YRCA 5GANj 3C3WA 1POGA 2F5VA 2G9WA 4Y33A 2A5WA 3BR6A 2MABA 3WU2C 1U3OA 3U2RA 4CC2A 2Y9YA 2JUFA 3HB9A 2EJGA 2HZDA 2MD5A 3KP2A 1TBXA 4DOZA 2A3SA 2ZNYA 5LHGA 1QKWA 1R8OB 3WGIA 2DI3A 1MHNA 2D8HA 4EMHA 4GYGA 2BE9B 4M3EA 3TGNA 4EATA 5D5XB 5DS9A 4A53A 4UC4A 2E36A 3KE2A 4L5JA 4HXJA 1RETA 3X26B 3CCSI 2XI9A 2VI6A 3RKQA 2VJ5A 2ME0A 3ZQQA 3S32A 3CC4I 4ETSA 3BE3A 1LQ1A 4HLXA 4C8QE 2VXZA 1AZEA 2DW4A 2E1OA 4CI0C 3LA7A 3LNQA 1NG7A 1JHFA 3CC7I 1X6GA 2HOEA 1OPCA 3QAHA 2QKLB 4XSZF 3JCMc 2HVRA 2CYYA 2KMUA 3DPLC 4ZDPA 2FEIA 1UCRA 2E71A 1QQIA 3H0GJ 5K5QA 4ENNA 2A07F 2YLBA 1GXIE 1BR2A 2KIFA 5KAIC 2DJIA 2HSEB 2IAIA 2FXAA 3CCJA 1U5TA 1I39A 4NOYA 2XAQA 2Y0SN 3W3CA 2K6DA 2MWPA 2FBHA 3HOUJ 3AAFA 1D3BB 1VQ7I 2CV0A 4F7UE 3H1CA 2DQLA 3M0UA 1VQKQ 1ETQA 3JB9H 2DA2A 2JVHA 4A3MJ 1UECA 4F17A 4ZZDA 4QVCA 1B9NA 1U8RA 4L59A 1VQOA 1M5Q1 4DYCA 3CLQA 3BTJA 1KK7A 4C8QB 5KYNA 3JCMJ 3I55I 3GX4X 2QWWA 3BY7A 1F1ZA 1T08B 1GCQA 2G7HA 3I5SA 2JM9A 2TDXA 1KC8R 4HZFA 2EZIA 2ZSHB 4ENMA 3M0QA 3CCVA 3SFMA 3FX3A 1UGVA 2CZ6B 1K9AA 1NPRA 5M3MJ 2WAQA 4YEJA 2DFUA 1VQ9A 1WGSA 1K0XA 3RYPA 4IRHA 3SJMA 2HQ5A 5GAMd 3JRBA 5E3OA 2L9NA 4A3CJ 3UATA 1W5CC 4RTZA 5GP9A 3QPTA 3JB9D 4E7ZA 4MIMA 1T98A 2DT5A 2OZ6A 1UHCA 1OYWA 2KROA 3QZ5B 3HEFA 1M1FA 1VQMQ 3SYTA 1ZKGA 2KK4A 2RQPA 3E6BA 3H9QA 2ZAEA 1WA7A 4HSTA 2KAFA 4HAMA 1I07A 2XGCA 3OOUA 4RTYA 1T2KA 2OF7A 3I53A 3IC7A 1ZHIA 2HVQA 3CXCA 1KD1U 4EJVA 1GXQA 2M0MA 2R7QA 1N9SA 3UA7A 3E9GA 2C0OA 2R58A 1SANA 5J3LA 1PCXA 1K4US 2F69A 5IHKA 4LDWA 1GL5A 2F5TX 3PIOA 4JK1X 1WJCA 3CMEQ 1S7AA 2I5UA 1VYUA 2M87A 3BWGA 1YP5A 5CVUA 2A3LA 4A0XA 4YFNF 1IXCA 1JRIA 1M2VB 1K73U 1RAHB 4MEYF 5HNHA 1VI0A 4Z88A 3PVLA 1QZZA 4XRSG 2E1CA 2IRFG 3LGFA 4HT9A 1W1WE 2GZWA 3A0HC 1G3WA 2W48A 3ZMTA 3GOXA 2MH2A 2DA3A 2V6EA 3PE0A 2O4XA 2LFBA 1U9OA 3BTLA 4DYRA 2KLOA 1R23A 1LEBA 2AS5F 1HC8A 1NG2A 2XPWA 3CO7C 1QBJA 3BJAA 1I3QJ 2CH0A 3GTMJ 2E3HA 2FZGB 3LSGA 4ZDLA 3SDBA 1Y0NA 2ZMEC 3WTZA 3RZOJ 2EYQA 4ELYC 3FXMA 4LLGF 1B1BA 2XIDA 3EGDA 5K7HA 1J5YA 1KHIA 1D1CA 1OPKA 2DYRH 3CD6Q 4BKXA 1NG6A 1SVLA 4KUIA 1IZ1A 5H2FC 4L9JA 5HODA 1HW2A 1UB4A 4IUTA 4L5GA 2QBYA 4PFPA 3GUDA 3KEQA 2WB1A 5F0HA 2IT0A 4UV9A 4LG0B 3I56I 3RBBB 3RJPA 2DDBA 2VQLA 4XLNF 3SHWA 2M7AA 2P4WA 1JHHA 1F36A 2L01A 3BW1A 5LD2C 1MIJA 4RMOA 3GTPJ 2LX9A 5E8IA 1MDMA 1VOMA 3WE2A 3M1EA 3ECHA 1TW2A 3M9QA 3CMET 2XKOA 4J6WA 4AIHA 1N75A 3V8KA 3J80Z 2CYZB 5I21A 2QA4Q 2OJED 4HPQA 2CP3A 4C5HA 2RPNA 2M5WA 2A05A 4EEFG 1M3BA 2ZMEA 1RRJA 1FYNA 5LEJA 3IH2A 4ATOA 3TBIA 1PD1A 3ZXSA 1WJ5A 1XNIA 3S6WA 2RH2A 3DV8A 1QVGS 4U0VA 3K4LA 1VQ8I 2OJ2A 3K1MA 1JUSA 3CMMA 1ZG3A 3ZPLA 2A7YA 2CP0A 3IH4A 2DL8A 2FOWA 2LDMA 2MK5A 3BDDA 3JCMh 1ITYA 2EQMA 1W70A 3B02A 4G6QA 1Y96B 1D8JA 1V76A 1I6XA 4BE0A 3QPLA 4XN3A 2L7ZA 1JXSA 4M6XA 2NLUA 2LOOA 2W85A 2FBIA 2XGDA 3JCUC 4JBAA 3KPHA 1JKOC 2LT4A 4KULA 1V1CA 1N6AA 3OBYA 4IUQA 1RABB 1Q7YC 3CDIA 1WI7A 2PU9B 4XKWA 4M78C 2LK2A 1M3CA 3CCJT 2HNHA 5ILUA 2KIUA 2D1VA 3SDGA 1YHQI 3W2VA 3W6VA 3S1MJ 3QJYA 2XAJA 3BR0A 5FKLA 4CCKA 5K7FA 1ENHA 8ATCB 4ITVA 2OAWA 4XICA 1Y0MA 1QVTA 4CH7A 4PFZA 1AEYA 3JCMP 1YJNA 3GTGJ 2O31A 3CDLA 2P0PA 3TREA 4F7UF 2GXGA 2NUZA 1SD7A 4OGCA 4C92G 3OYKA 3OV8A 2VQHA 4PK4A 2V8IA 2KRHA 4D8DA 1QLYA 5LJ5d 3CJTB 3R6SA 2DF6A 3REBB 2A37A 5TGTA 4AG1C 2CQ7A 3SFIA 5A0LA 4U0WA 1Y1VJ 1QVFS 2H94A 2J5PA 2YUOA 3LSJA 1K79A 1VQLI 1I6HJ 2LP5A 3MKLA 3OYGA 1HW5A 3E5XA 4RAFA 2EJ9A 1NTCA 2F5EA 2PJRA 3DKMA 2FVUA 1E3PA 3QYFA 4J8OA 3M0RA 5FW9A 3LYIA 2NOJB 3BROA 2XDVA 1BJAA 2ZPGB 3I4PA 2QQ9A 1E6GA 4DIQA 4IXAA 2IGKA 5CKBA 3CPWA 3TSZA 2E2JJ 1IJWC 2W84A 2J6KA 3S15J 2E4HA 4B44A 1JXMA 3N5BB 3MCZA 3SFZA 2ED0A 2P81A 3FKJA 4HRIA 2HL3A 1WFWA 1R1TA 2OX7A 5DEQA 2MGQA 1TTYA 2FBKA 3QO3A 2HYGD 2IEKA 3E5QA 2MA3A 2CRGA 2DAOA 3QYHB 4XAXB 3HZJA 3VYRB 3G4SI 4M3GA 3A01B 2VE9A 2P5LC 2COMA 2R0QC 4MEXF 1LNXA 1SVOA 5ERIA 5GAGJ 1J0RA 2BZTA 3ZOBA 2XDDA 1LFUP 4BHPA 3MP8A 3M55A 1R5ID 5HLIA 1P4XA 3H3VK 2OD5A 3TW7A 5GAN7 2ZJ2A 2KEAA 2KKOA 4HVUA 3JCMf 1QHGA 1YI2I 3JRZA 2EIKH 2G3RA 2IA2A 1AOJA 2BYVE 3X24B 3CUOA 5IY5H 3CD6I 2JN6A 2HOTA 1LPLA 2P6SA 1OCZH 1OFCX 4UV8A 1MBFA 1Z3YA 2HKQB 1OLTA 4LIUA 4KITB 4GFBA 1I1SA 3CCEA 2DJNA 3CCQA 1I3AA 2DBBA 2W57A 2FPFA 2LNVA 2QQRA 1VQ7T 1HSJA 3JRDA 2EA2A 5HDGA 4CCNA 3IRQA 1TSFA 2DK3A 2PZ1A 2RQRA 4RUGA 2NVUB 3UF4A 3CCEQ 3MKDA 4M7DC 4KGZB 3DKWA 1OKRA 3TP3A 3GTJJ 1UFFA 4S05A 5B66C 4F93B 1E3OC 2DMNA 1N9RA 1SSHA 2P4RA 4I0BA 3LH5A 4M7DE 1QGPA 1WJAA 2BGCA 2DMTA 5D6EA 2H1LA 2L2OA 4KIFA 2LX7A 1IAWA 4A0ZA 1WXBA 4C92C 3HSEA 3TOBA 2FJ1A 5CQGA 3ZBDA 5HS9A 4JRIA 3M4OJ 4CO8A 3QBYA 2ECZA 4Z6YA 5KNLA 4D7NA 5IP6A 5AIQA 5IXFA 1IUYA 3HG9A 1OR7C 2BVLA 1WRJA 4BB7A 4O6JA 3THKA 1N8RU 1IHWA 4YFKF 1PUEE 1ZREA 4J00A 1S1NA 2WB1N 2VN2A 4KMFA 2K27A 5KCHA 1K6YA 3HOXJ 2SRCA 2W82A 4LDYA 4ZJZA 5DCMB 3ZMDA 4EGZA 2R93J 2HEQA 2ROLA 3BZCA 2MLKA 3HRTA 3TO7A 1W5SA 3MZHA 2QEXA 2PLYA 2R7VA 4CHUA 1SRLA 1ON1A 5F0FA 4HV6A 5JHUA 3HFNA 2J6FA 1Q1HA 2L0AA 4I7HA 1OI1A 3F8CA 1H92A 5EEAA 3JCMe 4LFUA 1YFNA 2CP7A 1VQ8T 3GZ5A 1WXUA 1SEUA 5A2QK 4BI4A 2Y4XA 5CKHA 1W2BS 4KN4X 3KETA 1DPUA 1QCNA 2EFQA 2JA2A 2QENA 2P0WA 5IYDJ 1VUBA 1XN7A 5J47A 2FHDA 4M75G 4OMPA 1K9MU 2FOKA 1AHJB 1D0YA 1RKTA 3ABMH 4KYWA 4G94A 1X6BA 4X9CA 2BKDN 2QYZA 2ZPBB 1J3TA 1VQMT 2O7OA 1PDNC 1M90R 3CCVQ 1J09A 1NPPA 3WGHA 1BW5A 3P9KA 1BCMA 3QQAA 5LRSA 1PKSA 3ISPA 2GCXA 2DBMA 1YI2T 1TQMA 4F14A 3FZVA 3VB2A 3H36A 1X69A 1JJ2P 3OYYA 5DM7F 3I9QA 2R7SA 2EQKA 3E9FA 2DTHA 5FLXE 1Q81C 1UTIA 3CJNA 3KZIC 3JRGA 3NARA 4D0PA 3GBQA 3VS7A 4OMMA 1BOBA 2FNPA 3JW4A 1IRFA 5C4XJ 1S72T 3OA6A 3I59B 4XKVA 1IGQA 2YUQA 3CC7A 4G6TB 5KK1A 4J9FA 1ZQ1A 1U2WA 1SFUA 3U9GA 4OIOF 2D0NA 4XK8E 5E17F 2A6HF 2FUG2 3HHHA 3ZMVA 3JR9A 3KYLA 2JMCA 3OS0A 3EHRA 3VODA 4K11A 3H5AA 2LTOA 2IGNA 1ZRCA 3TP0A 4DJAA 4OMQA 1YW8A 2WBMA 1TWBA 1ZARA 4HDUA 3FC3A 1R58A 2PMZA 4EV0A 3F21A 2BY1A 4IHWA 2LQNA 1XGOA 2DMQA 3VSKA 4BDYA 5BOXA 2D0QB 3S1QJ 2FQ4A 4IRGA 1NYGA 2K85A 2KXCA 4KA4A 4E7SA 4BBRJ 1X4OA 4HOBA 4BJ5C 4F3QA 3CCLQ 3WXMB 3L2RA 2ISYA 4Y3OA 2FL7A 1R4NB 1FMVA 4M6VA 4AFSC 3CCMT 1Z9QA 5FU7C 2RD1A 1YJNI 3M59A 4HX4A 3H5NA 1PSEA 3IP4B 3MMYB 3PFYA 2F5FA 2ENMA 5CLSA 3QYEA 2DMOA 2GQQA 3NHNA 1MBGA 4FU6A 3EYYA 4XR6A 4J01A 1YX3A 1W0TA 2EQUA 2RQVA 3M0TA 1SVMA 3WU1B 1SD6A 1SF9A 4JJNK 3BJ6A 3MKYB 3DPTA 3FB9A 4E6RA 4MGRA 1O3TA 2EVRA 2KNBB 2K9SA 2KGTA 1TT0A 3OMCA 4A4EA 3QODA 3G73A 1RAAB 1I1GA 4HCCA 2XAFA 3WGGA 3C2HA 2DL4A 2AKLA 3E7LA 4KH1B 4WXDA 1IREB 4CYCA 5J26A 3PFIA 3PIPA 2M0YA 1PYVA 2QVOA 5GAEJ 3URGA 1YLFA 5KAFC 2I8DA 1FBUA 4N4NB 1RACB 2YLCA 3LLRA 4XLAA 3RSNA 3KP6A 3V7CA 4A69C 1MJAA 2IS6A 2EZLA 5KYWA 4M7DF 3A4CA 1TP4A 2B0LA 2EZHA 4ENJA 3UR3C 5IOZA 2EIFA 2D6FA 4H0EA 3OIPA 2JVVA 1SFEA 2RK2A 3M8JA 1ETWA 2CWEA 2X48A 4N4GA 3CCLT 2RA2A 4L6V5 5LJ5j 4M7DD 1NEGA 1LPQA 1RI0A 3FBNB 2YDLA 3OYBA 1YS7A 2QA4I 2VBYA 5DD4A 2MAMA 3CCJQ 1JXOA 4KN7X 3LSKA 2E12A 2WC2A 5LL6S 4Y13A 3SDZA 2CT3A 2YX7A 4BJ6C 4BQAA 3A2KA 1MMDA 1RLQC 3BP8A 4N0AC 2GGRA 2KXDA 3BC8A 4IHTA 1QWFA 4IIOA 4QQDA 4M7AD 3O8HA 1F9NA 3PIPF 4XK4A 4KGVB 5GMKi 3NTKA 1HDDC 3EGUA 1UJ8A 2CUJA 1BKBA 2OC6A 4DZJA 1FSEA 5I2SA 3UT1A 5D5WB 3J81K 3ZP5A 2A61A 4J9BA 3GFJA 2PJPA 2RV8A 5GAMj 4RB1A 4LE9A 1IDYA 5J1UA 3U21A 3EFRA 2F6CA 2JM8A 5GMKm 3E6MA 3FWEA 1VQ5I 2CT4A 3SHFA 4L9NA 5A2QZ 2GFAA 3GFIA 4A5MA 3MZ8A 2AKKA 4BY1J 2YWWA 5DLOA 3CCMI 4C2UA 1W7PD 3I55T 2XMFA 4CCMA 4KDPA 2IS4A 2ACJA 3C94A 2MG4A 3IL2A 1HKTA 4N0AA 2XC7A 2ZSIB 2ZC2A 1BI0A 3QWLA 1OX8A 3VS6A 1AHDP 1N27A 3CCRA 2O5RA 4WX9A 2RMOA 2GNCA 2OQGA 1TWGJ 2XVCA 3FXRA 2IVMA 4ASNA 2YX4A 2FNAA 3M1CA 4LOCA 1TL8A 4L18B 2CUBA 4XU3A 1W7PA 5F6FA 3GCMA 1GLNA 1TWHJ 1ZELA 3M8EA 4BXFA 1YFHA 1UGPB 3ZCOA 4JX4A 1FBSA 3DQVC 3EPZA 2LMJA 4XU1A 4Z8AA 4ESRA 3A8GB 2PTKA 2E5QA 1M8MA 1TOVA 4YELA 1Z67A 2A69F 4A3FJ 1GV2A 3CUQC 1MBKA 2OTLI 1Z1DA 3NTHA 4XOTA 2IW5A 1HJDA 1VF9A 3S14J 3CQZJ 3NTIA 2BW3B 2KSSA 3I35A 1ZSZA 2MD0A 2GM4A 2EILH 1OV3A 4M72A 4CRIA 3G4SQ 1EIFA 2HXIA 2WADA 5ICCA 3J7AO 1J75A 1TQPA 4E47A 1F5TA 3CC2I 1AD5A 2E6NA 3CPWS 3FIFA 1D1BA 4C8QA 5LFAA 1H641 3VRZA 3JCMX 1YJNQ 3PSIA 5KCMA 3GP8A 4M3BA 3QYGB 4BH9A 2LVMA 2HPMA 4LDXA 1JT6A 1ODDA 3LMMA 5GMKh 2DO7A 3CMYA 5FU6B 4B09A 5HDNA 3K4BA 3JAMK 3HKZN 1LFBA 3D5SC 4EM0B 3EAEA 4PLLA 2FG0A 3ZMZA 4QPQA 2WAEA 1UGSB 2AZSA 4GBQA 2EPDA 5F64A 4DBQA 1X3ZB 2NS7A 4HVVA 4IUUA 4ELZC 4KRTA 3IAM2 3RDVA 4M75E 4II2A 4N4IA 3FDRA 2J06A 3LSMA 4QW2A 2ROTA 1X3UA 1ETYA 4OAZA 1XSDA 4AT1B 1PKTA 5GAN3 5KE2A 1C1AA 3GPLA 2DX1A 3HOSA 4HX7A 3EG3A 1RI9A 3MFKA 1PUFA 1BBZA 2DXBA 5DY9A 1WH7A 4UB8C 3RMQA 1FP2A 2ME6A 1WHUA 3WU0A 4FTHA 5IT9E 2XASA 2M51A 3A8MB 3C1DA 1X75C 2VC0A 2DA7A 4MFDA 3L9FA 1NZ9A 1PNJA 4MO7A 2FEZA 3L2WA 1IGUA 2RHYA 3DBHB 4X1EA 3M58A 1VQ5T 4I01A 3DEWA 2HTSA 1KFZA 4NQWB 3GF2A 1BR4A 4UB6C 4RG8A 4EMKC 3C2BA 4PJNA 1UG2A 4QPOA 3LA2A 3D7SB 2QI2A 2O61A 3PMTA 3CCQT 2OA4A 3RKYA 2L7KA 1YE9A 1BBYA 3CCSA 3I0TA 2XKPA 4YIIA 2Q2EA 3V4GA 2DPPB 4D8KA 1VQNA 3M5AA 4LD6A 3JAME 2OTJA 4K2EA 5EZHA 1D09B 5C4JJ 1OCCH 3BPVA 5CKEA 2GA1A 2X9DA 3BFMA 2CU7A 2EFOA 4F91B 1HLVA 2ZPHB 1UHMA 1RC9A 1WI3A 4PCQA 5DUKA 1K4TA 3AFHA 1JJ2A 4HEA2 5M9OA 2EKOA 3A1PA 4LG0A 1I50J 5GAOm 4HF1A 4FM4B 2HKXA 1V4RA 4RMNA 5AT1B 2JOYA 2DQRA 1YTYA 3CO6C 2QGGA 2LBFA 3ERMA 3OL4A 1QVUA 1DU6A 3G1MA 2X9HA 3L2ZA 1ZHFA 2CSOA 2EA4A 3LOCA 2LBFB 1R5HA 2DFHA 5LJ3d 2GF7A 1XCBA 2Q2EB 1XMAA 3H9NA 2OCCH 1QVPA 2VXFA 2O01E 2PQ8A 3VUZA 1VQLT 1CSKA 3GLLA 3CD6A 1ZBJA 2DA9A 2E5NA 5M5WJ 2IGMA 2FYKA 2ZXWH 2NAZA 5L3EA 1W4SA 1X43A 2D1XA 4KIBA 4F7UG 3OL3A 2V4JC 4C5EA 1TU0B 4M7AG 1EH7A 3EUAA 2DRMA 2ZJRF 2DXTA 5CK9A 1G5VA 1EX4A 2MCNA 3VS4A 1RIOH 3OYJA 2VUBA 1F4KA 5GPAA 3DU6A 3TMOA 1UB9A 4EQQA 3CCVT 2I10A 3U1KA 2ZBKA 1ZTRA 4IX7A 4PJOE 5CPRB 1MMNA 2O9LA 4BXUA 1IXRC 2M7BA 1T0FC 3I58A 3QG1A 4P1WA 1LDKB 3K1NA 4XTWA 3MJXA 4JLIA 3KP5A 3CESA 4QIWN 1TUDA 3AT1B 3J80E 1YITQ 2IJLA 3F8MA 1M1KR 5ICEA 3QJ6A 3H8ZA 4XTYA 2PMUA 4KH0B 1S72Q 4Y52J 4OMLA 3O6BB 2LCCA 3PL8A 4G6DA 4FYVB 2E19A 4HG2A 1WHJA 2X3WD 2X4WA 1IO2A 2DE0X 2LP0A 4G12A 1HSTA
chains in the Genus database with same CATH topology
3Q9SA 2HDCA 2E7XA 3FM3A 3PTAA 5GAOr 1STZA 2X4XA 5KCOA 2JTMA 1USTA 4OVAA 1CGPA 4PJOB 3FMQA 5D6XA 4HQMA 4BHBA 1IF1A 5CYVA 1HXDA 4XU0A 5L3DA 2CW0F 5L3GA 2WWYA 3R0AA 2E7WA 5AIPA 4M9SA 1NJIU 1B4AA 4B8XA 1B6AA 4RGUA 5H6RA 3NEUA 3E19A 2F5CA 3DB4A 3F8FA 3ELKA 3QKJA 2QXFA 4M75D 4BE2A 1LJOA 3PFSA 2Z3YA 3L2VA 4XTXA 2Y48A 1OYYA 1Z05A 3HPWA 3L42A 4E7LA 1GXPA 5EEHA 2XG8D 4A4GA 5GANd 3OYFA 3K0LA 3SZPA