3HRUA

Crystal structure of scar with bound zn2+
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
213
structure length
211
Chain Sequence
PNKEDYLKCLYELGTNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metalloregulator ScaR
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
total genus 64
structure length 211
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hruA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hruA02
2F5EA 2ZNYA 3DXJF 2OZUA 1XSVA 1H0MA 2XAQA 2FXAA 4A0YA 1XD7A 1QBJA 5DD4A 1Z05A 2M5WA 3I53A 3C1DA 4HDVA 2XROA 1J75A 5JVTA 1LEBA 1Z9CA 3ML6A 1D8JA 3GO5A 3ABTA 2QQ9A 5LEJA 3MWMA 3BJAA 2LSOA 2P5VA 2DT5A 3TQNA 1WSUA 3L9FA 3TDUC 2EV6A 2GA1A 2VODA 4Z2YA 3HTUA 1FX7A 2QWWA 2LNBA 3R4KA 1BI2A 1TBXA 3WTVC 1IN7A 3KP2A 5ICFA 2O6GE 1R22A 2OBPA 4ENMA 5D5UB 2LDUA 4HA8A 1FNNA 3P7NA 1W7PB 1ZLJA 1IN4A 1YS6A 2YSRA 5CLSA 1G6NA 3RJPA 4L5JA 5F1RA 4ON0A 3HRSA 4KMFA 1BIAA 1FP2A 2BBYA 3GZ6A 4LLNA 3BPVA 2LF8A 3J80K 2A3SA 2HQNA 3F21A 1I5ZA 3FX3A 3LWFA 4NB5A 2PEXA 3F8FA 1KU2A 3WE2A 2A68F 4OIPF 3E6CC 2ADUA 4EJOA 4CICA 2IJLA 4M9ZA 3F6VA 1R5GA 2VC0A 4AIKA 3LQRA 1JHHA 2A5YB 4M71A 6PAXA 4MEYF 2F2EA 4EV0A 1P4AA 2NNYA 1ODDA 3F72A 5J6XA 3RDIA 3U1DA 5TRDA 2EV0A 2GAUA 3FMRA 4G8XA 4EJWA 4P9FA 2D1VA 1J9IA 4YFKF 1T2KA 2OA4A 1KYZA 2PMUA 3DP7A 3F8CA 1FBQA 1P4XA 1IW7F 5ILSA 3WTZA 3WTXC 1XDSA 2HQRA 4XSXF 4RAYA 4HOBA 4M6XA 1LQ1A 1U5TA 3HUGA 4EVIA 5FFZA 4KT5C 4YIIA 4XLPF 4XRFA 1R1TA 3CDHA 4DNCA 2IA1A 5BMZA 2M87A 2W57A 3CUQA 5FLXZ 3P9KA 1B9MA 2MBFA 5E1XA 1QZZA 1BC8C 3S2WA 1ZHFA 2FNAA 1FSHA 2MLKA 1IXSB 4Q47A 2PQ8A 3TO7A 4I01A 1RIOH 3NQOA 3VB2A 2DI3A 3BPXA 3ZMZA 3ZN1A 2X0LA 2XVCA 4CO8A 4HDUA 2IRFG 4CDGA 3VEPA 1V4RA 2NYXA 1Z6TA 3HIFA 3JSOA 4G7OF 1FY7A 2G7HA 1T98A 4WCGA 1JHFA 3ZMTA 5CVIA 3R0AA 2V6CA 1LEAA 3ROUA 3V8JA 2JPCA 1I1GA 4XLNF 2W84A 3QPHA 1STZA 2PFBA 3E6DA 4R79A 4CHUA 2PI0A 1KU7A 4M9SA 2STTA 4EQQA 1ULYA 2PN6A 1RUOA 3IWZA 4M74A 4JK1X 2RN7A 3O2PE 4QWQA 1L3LA 5L3GA 5D6EA 5CVVA 4ZZLA 2XIGA 1S7OA 4ESFA 2GWRA 3QP5A 4M73A 1EV7A 4I02A 2PBIA 3QP6A 2O0YA 1UB9A 1HKSA 2HEOA 3KZZA 4I2OA 2EWNA 1CGPA 2V1DA 2GQQA 4RB2C 1J7KA 1DDNA 2W24A 3BROA 2R3SA 2CFXA 3KLNA 1IRGA 1TLHB 2QUFA 4TV7A 5JR3A 2MA3A 1K78A 2ACJA 2V1XA 2QLZA 3F8NA 4OIRF 2GXBA 4EJVA 1BJAA 2L4MA 3CUOA 4ZH4F 2EFPA 4HX7A 4DQ2A 1ZG1A 2GA2A 2A07F 5J8CA 1KA8A 3E6BA 4GO1A 3SZTA 1EH7A 2CW0F 4KA4A 2H94A 3BP8A 1JE8A 1PP7U 4KMUX 2KIUA 3R60A 4CGZA 2YX4A 3GVAA 4KIBA 2L3DA 3WGGA 2WV0A 1BI1A 1XB4A 3KEOA 4HW0A 3F8BA 4BNCA 5ICCA 1S7AA 2HKOA 4U7DA 2M1BA 2FE3A 1GXQA 3CO6C 2ISYA 5HDKA 2KJCA 3K1PA 1OR7A 4OMZA 3W6KB 4WXCA 2X4HA 3N97A 2O3FA 2MC3A 4AWXB 4P9UA 4B8XA 1CF7B 5HS8A 2Z33A 5CVRA 4U7BA 5BPDA 2K4BA 1QVPA 2UWMA 5DUKA 2BV6A 1F5TA 2ELHA 4UVAA 4RGRA 3COAC 4I0AA 3QOPA 4AVPA 3HSFA 4ZYHA 4HBLA 4G9YA 1DPRA 3K0LA 5LHGA 5HDNA 2DK5A 3HHGA 2IVMA 4ETSA 2WC2A 3ABUA 3D5LA 3GF2A 3ZMDA 3L7WA 1TTYA 2A61A 5ILVA 2F5DA 1XGOA 1Z7UA 5D6FA 3O3KA 3MAJA 4I0BA 3I0TA 3DV8A 1OYWA 3F3XA 4A5MA 2FOKA 1K7AA 3H3ZA 3NEUA 2IT0A 2Q2EA 2FBIA 4MQ9F 4KNYA 1GVJA 3T0YA 5DYMA 5JHUA 3V8LA 3LA7A 4O5VA 2FU4A 1FT9A 1P2FA 2JT1A 4U0YA 3H3UA 4A6EA 2ZO4A 4G6DA 1TQPA 4IXAA 3JAMZ 2R7FA 4IVNA 3HHHA 2XAJA 5IT9K 5K5QA 1WQ2A 3WTTC 1R00A 1FZPB 3CTAA 2K5FA 3BJ6A 3RKWA 3E5UA 1W5SA 4YFXF 1I6XA 5A2QZ 1KU9A 4L9TA 1MJBA 5E8GA 1HSJA 3HRUA 3C7JA 3GXOA 2VXZA 3GEZA 2XV4S 5HLIA 1FYLA 1KGSA 1S29A 4HF0A 2EFQA 3F22A 1YW8A 4MTDA 5K1YA 3T8TA 1MDMA 4R1HA 2FMYA 4WF2A 2M45A 4E70A 2H6CA 2OU2A 1K6OA 4I09A 2MLGA 3ERED 1SD4A 1K79A 1ZRDA 3I59A 3J81Z 4RB0A 2FEZA 1HSTA 5HDGA 4LLGF 3B02A 1D8KA 3T1BA 2HKXA 4KIGA 3RKXA 5DDGA 2CWEA 2P6TA 1UCRA 3RTRA 1TNSA 3RYRA 2PJPA 4LG0A 3BOQA 5LGTA 5LRSA 4P5OA 4F7ZA 2FMLA 3KCCA 1XGNA 2F5CA 4YFNF 3WGHA 2STWA 3R0JA 5KVRA 1BN5A 3VOEA 4UV9A 3SZPA 4Q5SF 1D5VA 1TQMA 3M8FA 1AOYA 4UUVA 4U0WA 3REOA 4L9NA 4B09A 2XKPA 3F8MA 1XDUA 3L09A 4Q4ZF 2ZFWA 1LB2A 2BEOA 5ERIA 3H92A 2XGXA 5FB2A 4A6DA 2EFWA 2O61A 3JTGA 3NRVA 5LGNA 2KIMA 2RNJA 1O3QA 1PDNC 3M9AA 3EQLF 4Q48A 1FYMA 1L0OC 1IXRC 2JTVA 4A0ZA 3KP6A 5L3EA 2GZWA 2QBYA 1KQ8A 2TDXA 1EH6A 2QVOA 4KN7X 3E19A 2EJRA 4NHJA 1ON2A 1YLFA 3V7SA 2JPBA 3GWZA 2K4JA 5E18F 3HRMA 3V4GA 2Z3YA 3TOBA 3I54A 4CYDA 2K5IA 1UHWA 2MH9A 4HLYA 4KDPA 3FF5A 2HZTA 4LK1F 5L3FA 1R23A 3IWFA 3I64A 1SFXA 1ZYRF 4ZZDA 5LGUA 2H6BA 4FX0A 2XRNA 1QO0D 1UHMA 3ZQ7A 2HTJA 4L9JA 4LLLA 1SD5A 3KP7A 4BHPA 4L5IA 2P5LC 2OD5A 2WWYA 1KU3A 4I98B 3MEXA 2A6HF 4G6QA 3WODF 5DCFA 4UV8A 5AIQA 4BHCA 4N9IA 4LK0F 4ESBA 4FX4A 1O7LA 2A69F 2VE8A 4UVBA 3I4PA 3WE3A 1ON1A 2RVCA 2KRFA 4Y17A 4GYGA 3WTWC 1U5TC 3LFKA 1XCVA 5FFXA 4WXHA 2HYGD 1YG2A 3J80Z 4ZYEA 1BYMA 3CUQC 1DPUA 1TQIA 2ZMEA 3HSRA 1PUEE 2J5PA 3FM3A 1ZG3A 2DQLA 3HRTA 2Y75A 5AIPA 1E17A 1XMKA 2CSOA 4JQFA 2YPRA 2DAOA 1OMIA 3QU3A 3I58A 1T6SA 1I1SA 2FQ3A 3F23A 3GFIA 3WGIA 1B9NA 3C18A 1SD7A 1XN7A 2NRAC 1F9NA 1R1VA 1U6GA 2XHKA 4PZJA 1G3SA 1A04A 3BJOA 1U5TB 4UNOA 1I27A 4RGSA 1V3FA 1GXPA 5F6FA 5FD6A 3SXYA 1U8RA 3FM5A 1LDKB 2CGPA 3CUQB 1SD6A 1YW7A 2XAGA 1S8NA 1QW1A 2FRHA 1IN6A 4ENJA 1ZH5A 1E2XA 2P8TA 5DD8A 1ZN2A 4LB5A 2CG4A 1EH8A 1G3TA 4CXFA 2IA2A 5HS7A 1YS7A 3SHFA 3WTYC 2UXXA 1WI9A 4EM0B 3SFZA 5ILUA 5AONA 3KP3A 2VT3A 2PG4A 4K2EA 4HF1A 1TW3A 4MTEA 2M30A 2QQBA 2VOOA 1FP1D 3DPTA 2EA4A 4G7ZF 1O3SA 1R36A 4PCQA 5EEGA 3HTSB 1RUNA 2K86A 3FHZA 2FBKA 2IA0A 5HLHA 3KEQA 5F64A 1FYKA 5CJ9A 1RZ4A 1Q1HA 4A0XA 2XAHA 3BZ6A 1YFHA 3GFMA 1FLIA 2M8EA 5BQTA 4H0EA 2NS0A 3IKVA 1O3RA 4OINF 2VOPA 1D3YA 2VBXA 4ZYDA 1OYYA 3T8RA 4BH9A 3IHUA 3WU0A 2LF7A 3EDPA 1QNTA 2ISZA 4OIQF 2CO5A 1QGPA 5L3BA 4IF4A 2JZYA 5E8IA 2EK5A 4OOIA 3TO6A 1WRJA 1ONVA 2HDCA 1B1BA 3LAJA 2XAFA 2W25A 1FOKA 1RNLA 3VODA 3TOAA 4MNUA 1K78B 4KIFA 1P92A 1XSDA 1BC7C 3DF8A 3WU1B 3QPTA 4HZFA 4A2UA 3FMSA 3IRQA 4IRHA 1ZAOA 4PDKA 4XBFA 4R8HA 1ZREA 4AIHA 2PMHA 3CJNA 1REPC 4Y15A 4RB3C 1GHCA 5D5WB 4ASNA 2PLYA 1W7PA 3ZP5A 2KJBA 3QAHA 1Z1DA 3BWGA 1WWXA 2K7LA 4HX8A 1XGSA 1LNWA 1DP7P 1FBSA 2RKHA 4LMYA 3DQVC 3ZMUA 2MH2A 4AIJA 4Y13A 3ZPLA 2EA2A 4HAMA 2ZCWA 4KN4X 4ENNA 3EYYA 3HYIA 2VN2A 2Y48A 1J59A 4GCVA 3ECOA 3E97A 2BYVE 1U3EM 3FMQA 2Z99A 5K5OA 1QQIA 3EUHA 1Z91A 2ZXJA 1IN5A 4LD5A 4P96A 2O03A 2DK8A 5DCMB 2C6YA 2D2WA 1B4AA 2JSCA 1BI3A 4U88A 2YX7A 1R5HA 5DEQA 2MD5A 3E3VA 2VE9A 1TNTA 3PQJA 2DW4A 2D1HA 1U2WA 5CVUA 4RAZA 1MGTA 2E1CA 1XSXA 4U0VA 1F1ZA 3BDDA 4LGWA 5LRRA 1QPMA 5FGMA 5D5VB 2P7VB 4BQAA 1X3UA 3ZMSA 4BHBA 3L2CA 3K1MA 1Y0UA 1ZGAA 1T39A 3GFJA 1MZBA 4A5NA 5L3CA 3IL2A 3J7AO 4FT8A 1LJ9A 3R61A 2J5OA 2ESNA 3E6MA 3FZVA 2VBZA 2FSWA 3GFLA 4HF2A 3IC7A 5FLXK 2VC1A 3DPLC 1ZRFA 2COMA 3Q9VA 3LA3A 2DTRA 2E7XA 1OKRA 2P7CB 2A6EF 3MQ0A 5LLQA 3PFIA 5ED4A 3KP4A 1HW5A 1BIBA 3E5QA 5LEKA 3K69A 2Q0OA 2QQAA 4OMYA 1R58A 3IKTA 2ZNZA 4A12A 4RS8A 5ICGA 2GCXA 1FPQA 2DQRA 5D8LB 3V7RA 3DEUA 5K5RA 3D0SA 5CYVA 5E1ZB 1T38A 3I5UA 2D45A 5HVQC 1SAXA 2E7WA 3G3ZA 3KP5A 2ESHA 5IT9Z 3RYPA 1USTA 2G9WA 3WG9A 1FC3A 3FWEA 3TO9A 3U9GA 3B73A 5HLGA 1IZ1A 4CZZA 2Y0MA 3RKYA 1JGSA 4LB6B 4G94A 4KFCA 2FBHA 2V1UA 2QENA 4MHGA 2ETHA 2BGCA 2Z9OA 5E20A 3KETA 1YIOA 4M72A 2K27A 2HR3A 2K02A 5LHIA 3LQQA 1MJAA 5D4RA 1XMAA 3ECHA 2H3JA 2RQPA 2K4YA 1P4WA 3ZMVA 4WXDA 4XSZF 2OQGA 2DFIA 3K9TA 1MDMB 2AXLA 1P6RA 4O6JA 3LA2A 2XASA 3V8KA 3ULQB 1B6AA 2EB7A 5ICEA 3I59B 5H20A 2O8XA 1MJ9A 3Q5FA 1Z6RA 1XGMA 4KUMA 4OIOF 4LFUA 1O7FA 2P6SA 1J2XA 3HOTA 1KYWA 1YTYA 3E5XA 4FHTA 2HS5A 1U78A 4L9VA 2F5FA 4GYIA 4QLCU 3ELKA 2ZJ2A 4LG0B 2KIFA 1LVAA 2P4WA 1BOAA 5HOOA 3P9IA 5FD5A 3QU6A 2UXNA 1O57A 5E17F 1R1UA 4RGXA 3RIRA 1LDJA 4O3MA 2XUBA 5DUIA 4WK8F 1FWZA 4M9XA 1XCBA 5LBQA 1IRFA 2RDPA 1HKTA 3KFWX 4WWCA 5FO5A 2W85A 3Q9SA 3V7CA 4HQEA 1TW2A 5EEHA 2HTSA 3TDZC 5TJJA 4I7HA 4G7HF 2HWVA 3M1EA 2XKOA 4N9HA 3TGNA 4ENKA 1QZYA 1YW9A 4MGRA 3MZHA 2RC4A 2DBBA 4IRGA 4M6YA 1ZLKA 2FA5A 5CVJA 2DPDA 1IAWA 4P55A 4GGGA 1ZRCA 2YU3A 1PP8F 2L54A 2B0LA 2QBYB 3RI4A 4N0BA 1IN8A 3FXRA 4D0PA 5L3DA 1FSEA 1IUYA 2DO7A 1CF7A 4HQMA 3T5XA 3R6SA 3EETA 1SMTA 1SFUA 2VONA 4IHSA 1NHAA 2K5LA 2DPUA 2L02A 4YIFA 3PQKA 4KYWA 2NAZA 2CYYA 4L0YB 5BOXA 1OPCA 3M7GA 3G73A 1DUXC 3FXUA 3GLXA 2IPQX 3GX4X 3DFGA 4OU0A 2HOEA 4HYEA 2JRTA 2Z5UA 4IPAA 4BAYA 1ZARA 1KQ0A 1KQ9A 3AAFA 1W7PD 3SQNA 3C3WA 2L01A 1USSA 1W5TA 4GXOA 4KICA 2KKOA 4S05A 4HLXA 4IHTA 5DV5A 3MHXA 1G4DA 3GUDA 4BXUA 5D4SA 1G3WA 3FXQA 2VBWA 2EFNA 2V9VA 1W4MA 1VTNC 2GIVA 4EGYA 2Q8KA 1HW2A 1YYVA 3RPQA 5IT3A 4AD9A 5LHHA 4HV6A 3OV8A 2RGVA 4YG2F 3QRFF 3KZYA 3JSPA 3O6BB 2LX9A 2G7UA 4PGGA 5D8KB 2E1NA 2HGCA 1SFEA 5BS6A 1S3JA 2LKPA 3JAMK 3IRRA 3KE2A 2L4AA 4BYYA 3KLOA 5JI6A 4S04A 2OQRA 3MCZA 2ZMEB 4EJUA 1S6LA 1WKMA 2QM3A 2ZKZA 3JTHA 2IW5A 4EMSA 2OZ6A 2FF4A 4RGUA 3BY6A 5A2QK 3WTUC 1G3YA 3OOPA 2ZBKA 2HYFA 2QZ8A 5DCMA 3M8EA 1AWCA 3HSEA 4IRIA 2WTEA 1YQAA 1HW1A 1BI0A 2AS5F 1H9TA 2DLLA 3GYHX 2IP2A 2BE5F 1R7JA 1J0RA 3ZN0A 2RV8A 3L00A 1F4KA 3K2ZA 3EYIA 2OAZA 4EM2A 3VFZA 3WTSC 4L0ZB 1YO5C 1UFMA 2V79A 1SMYF 1HBXG 3W6JB 1ZGJA 1C0WA 3GZ5A 4ESJA 2NNNA 1RI7A 4L18B 3J81K 3F6OA 4ZYGA 1HQCA 4PGHA 2VT2A 5BPIA 3MZYA 5D5XB 2EFOA 4EM1A 1O3TA 4MEXF 3GW2A 5E1WA 1ZG5A 1IXCA 5J8FA 3RPUA 2H27A 1MD0A 2GXGA 3CLOA 3LSTA 1T0FA 4UVCA 2UZKA 1FBUA 2CQKA 3DKWA 4LJZF 1BM9A 3LAPA 3MFKA 3CO7C 1IF1A 4EJTA 2EV5A 4EGZA 3K1NA 1B59A 3JW4A 4MQVA 2HFHA 1HKQA 2VBYA 5KK1A 1BBYA 3P9CA 5HS9A 1LDDA 4HX4A 2H09A 4HV5A 1HXDA 3U2RA 1J5YA 2DU9A 4RB1A 4IJAA 4UXNA 2QYOA 2YR2A 4WX9A 1H9GA 1MKMA 1JXSA 5H6RA 2P5KA 5JFRA 3ISPA 3TKYA 2R7DA 4UHTA 3HOSA 5H6QA 4JBAA 4NQWA 3I71A 3N4MA 2FNPA 1OYIA
chains in the Genus database with same CATH superfamily
2F5EA 2FRYA 4M75F 2KI7A 2ZNYA 2GTJA 2XDDA 3DXJF 3HXLA 4RLQA 2OZUA 5FU7C 5GAN2 2L9SA 4RKUE 1XSVA 2MPXC 1H0MA 2XAQA 3TQ7P 2FXAA 2RNGA 4A0YA 4J9CA 1XD7A 1QBJA 5B1AH 4XTYA 4DYCA 1TWHJ 5DD4A 1Z05A 1V1CA 1D0ZA 2M5WA 2EZKA 1F43A 2EYXA 1GXIE 3I53A 3QDFA 3C1DA 4HDVA 2XROA 1J75A 1QVFP 4PJOF 1A36A 5CQGA 3G1JA 3OYMA 2LVSA 5JVTA 4XKBA 1RESA 1LEBA 4OB1B 1Z9CA 3ML6A 1POGA 1D8JA 3D7SB 3GO5A 2HXOA 1PWTA 3ABTA 2QQ9A 3RZOJ 5LEJA 3MWMA 1JU5C 3BJAA 1HSQA 1GT0C 2A5WA 2B7EA 4OAZA 5KNLA 5J47A 3JRDA 2KXDA 2LSOA 1FTZA 2P5VA 4K11A 1GRIA 2G6FX 5LJ5d 2DT5A 4U87A 3TQNA 1WSUA 3K6GA 3L9FA 3TDUC 2EV6A 2GA1A 2RQQA 3A01B 2VODA 1WFWA 3QWLA 1TS9A 2RQRA 4PSXA 3CDIA 3S15J 3JRGA 3GPLA 1ETWA 3HTUA 4Z2YA 3OS2A 1PD1A 1FX7A 3EUHC 2GLOA 4BI3A 2ZJPF 1T0JA 2QWWA 2LNBA 4OB0B 3R4KA 2XF5A 2WAFA 3QYBA 1KD1C 4M7DA 1X1BA 2WSCE 1XPXA 4J19A 4M4ZA 1BI2A 1TBXA 3WTVC 1GBRA 3UDCA 4LD9K 2XC7A 1IN7A 2OJ2A 4RAFA 5M5XJ 3KP2A 5ICFA 5GAMf 2JRMA 2O6GE 1UGSB 2JTMA 1VNDA 2J7IA 2L3SA 3CCLA 1R22A 5KE3A 1DGWY 2E35A 2HXIA 5C6SA 3UPUA 1K4US 1WHJA 2OBPA 3CC2A 2DYSH 2VL8A 4ENMA 5FKOA 2E41A 1UGPB 5D5UB 5GMKj 2NOGA 5GAN8 3N5BB 4D8DA 1WJAA 4M75D 3NGPA 2LDUA 3HGGA 1FNNA 4HA8A 1B34A 4F7UF 3OYIA 3P7NA 2ZSHB 4ZGJB 4CYCA 1W7PB 4DYRA 3BTJA 1PSEA 1ZLJA 2I5UA 2VPLA 1MBEA 2V4JC 2NUTA 2LMJA 3CBMA 4NUBA 5C0MA 3L2UA 1IN4A 5LJ3e 5FU7B 1YS6A 3X2QH 2YSRA 3GNFB 1NTCA 5CLSA 1G6NA 3CMET 1QVFS 3RJPA 3ZL7C 4XNFA 4L5JA 2CH4A 3I55T 4PJOD 2M51A 2ZAEA 2V9KA 5F1RA 1TL8A 2PTKA 4ON0A 4X9CA 3HRSA 3GTJJ 4C0FA 4KMFA 1BIAA 2F5TX 2EBPA 1FP2A 1X58A 3A02A 3MVPA 1X1DA 4M7AG 1X2MA 2BBYA 3NARA 2E2JJ 2DA4A 2BZ8A 3BR5A 2ZPBB 3GZ6A 2L7ZA 3BPVA 2LF8A 1IRXA 4LLNA 1E6GA 1K9MC 1K0SA 3JRHA 3J80K 2NVQJ 3CCMQ 2A3SA 2HQNA 3F21A 1I5ZA 3BT9A 3CMAI 3M0RA 3FX3A 3JCUC 3LWFA 4NB5A 1VQ9A 4PJNA 1WDXA 3DWLE 4A3GJ 1MHNA 4IIOA 2PEXA 3F8FA 1KU2A 2FYKA 3A8MB 4XLHA 4M77C 4L59A 2LP5A 1VQKT 2DA6A 1AWWA 2CQQA 3CCET 5C4XJ 3WE2A 2EYWA 1VQ8T 2A68F 2K3PA 4OIPF 1RR7A 3E6CC 2JA8J 2R5AA 3KEYA 1KQ1A 2KIQA 2DA1A 3PIPF 2ADUA 2L89A 1G5VA 2ECZA 2O4XB 4EJOA 4CICA 2IJLA 3QWXX 3SDBA 2GNCA 3HP9A 4NL2A 4M9ZA 1VQ5A 3F6VA 1YJ9I 1R5GA 1Z3XA 1IV6A 3AG2H 2VC0A 3IH4A 3LQRA 1JHHA 4YEJA 2A5YB 4AIKA 2F2XA 2M9UA 2R5YB 1MW7A 4M71A 4MLOA 1Y8RB 2EKOA 2B63J 4XLAA 6PAXA 4MEYF 3VS6A 2F2EA 5DM7F 2M3AA 4XLFA 2YUNA 5GAOr 1YHQQ 1Q86U 4M78A 4R56A 4EV0A 1P4AA 2NNYA 4RG8A 1I50J 1ODDA 3F72A 5J6XA 1BL0A 4LD6A 3RDIA 1TH7A 3K4CA 3U1DA 5TRDA 2CP6A 2V8IA 3GTKJ 1YJWQ 2EV0A 2GAUA 2M8GX 1M3BA 3FMRA 4G8XA 3OS0A 2DFEA 4AM3A 1FOWA 1TTHB 4C8QA 1YX5A 1K8AR 2EGCA 3SJMA 3DBRB 4EJWA 2LLKA 2K85A 4P9FA 2D1VA 3RQ4A 1J9IA 4YFKF 5M3FJ 1T2KA 2OA4A 1KYZA 1QRYA 5C3EJ 4QW2A 2PMUA 5IOYA 1Z3YA 3CESA 2X51A 3DP7A 2DLPA 3PVQA 2R0QC 3HSBA 3F8CA 1FJLA 1FBQA 3AT1B 3VS0A 1P4XA 4F17A 2LRDA 4ZN1A 2X1CA 1IW7F 5ILSA 5DLQE 4MFEA 2ZSIB 3WTZA 1XDSA 3WTXC 3OWTA 1TSFA 2R7SA 2HQRA 4XSXF 4F92B 3LSRA 3G6EI 2BZXA 3E9FA 1W70A 4JYKA 4XQFA 4RAYA 4HOBA 2DTHA 4M6XA 4Y4RA 2H8HA 4X34A 2R92J 2MC4A 1VA7A 2H8RA 3DLAA 1KK7A 1M90U 2PJRA 4ELZC 1LQ1A 1U5TA 1WJEA 1AEYA 3BR0A 2CZ0B 1KQSA 4MZTA 3HUGA 4EVIA 4BU2A 3FXJA 5FFZA 1WI7A 2Y90A 3VS5A 4JX4A 2LR8A 4JP0A 1BB9A 4KT5C 4QPOA 4YIIA 1YWPA 4AYBA 4XLPF 3M0SA 4AU7A 4KULA 1NJIR 4XOTA 3BY7A 4XRFA 1R1TA 1RUWA 3EG9B 2VVKA 2FG0A 3CQTA 2CW7A 2JUCA 4A3CJ 3CDHA 4DNCA 2IA1A 1HYOA 5BMZA 2ENMA 4FYXB 2M87A 2W57A 3CUQA 5FLXZ 2DFHA 1I4K1 2L7MP 3CP2A 1RAAB 1YJNT 5HK0A 3MP6A 3HOWJ 2O5RA 2Y30A 2K9MA 3P9KA 4LE9A 2JS0A 1B9MA 2MBFA 5E1XA 1QZZA 4BJ5C 1BC8C 2IS2A 1Z9ZA 3TEEA 4M6VA 2LJ3A 3S2WA 1ZHFA 2FNAA 1FSHA 2KL4A 1NLPC 5FLXE 2V7FA 1LE8B 5F0CA 2RQUA 3CCVT 2MLKA 3G1LA 3GTOJ 3C0CA 2RH2A 1IXSB 2BZTA 4Q47A 3WHBA 2VKEA 2R5ZB 2MWPA 1ZHIA 4L5GA 1AWOA 1X4OA 2Y31A 4QVZA 2KHMA 2XICA 2LY1A 1I5LA 3MN2A 2PQ8A 3OB9A 5HKCA 2P0PA 5GAN5 3HHTB 2EZLA 1MUZA 3TO7A 3GTPJ 4I01A 4BUPA 3NQOA 3VB2A 2DI3A 1RIOH 4RAGA 3BPXA 3ZMZA 4HSTA 5J3LA 2VI6A 3ZN1A 1CSKA 2YRDA 4C0GA 2X0LA 3PVLA 1AU7A 2XVCA 5IYDJ 2E65A 1YITI 2M7BA 2P0WA 1X1CA 4CO8A 2EQUA 2ROTA 4QQ6A 4E47A 2OI3A 1AZEA 2ZC2A 1D3BA 2EVRA 2EIFA 5KCOA 4CZCA 4HT8A 5IYBJ 5EG0A 2QYZA 4HDUA 3FEOA 5LJ3d 2IRFG 2GBYA 3NMZC 4PUSA 4M78D 1QWFA 3VEPA 4BXFA 4CDGA 5GAEJ 5GAOm 4E4HA 2YWWA 3ABLH 1D1CA 2K5CA 1V4RA 1HJDA 2CS3A 2EILH 2NYXA 2X9DA 1Z6TA 3HIFA 3JSOA 4CC3A 3OYAA 4NC6A 3SFIA 4G7OF 2FOWA 4XTVA 3TVTA 1W2BA 1EJ9A 1FY7A 2G7HA 1T98A 4WCGA 1AD5A 1TP4A 1JHFA 3ZMTA 2HBWA 4LN2A 4C92C 3I9QA 5IP7J 2AKKA 5CVIA 5A0DA 3WHCA 2EZHA 4FM4B 2G0EA 2HL3A 2XF6A 1V5EA 3R0AA 4D8KA 2EYZA 2GXAA 1YFNA 3PNWC 2V6CA 1LEAA 3ROUA 1ETOA 3V8JA 2JPCA 4CUGA 1JBMA 1I1GA 5AT1B 3CJTB 4M3EA 2VJIA 4XIDA 1TT5B 2DERA 4DBRA 2HZDA 2IS1A 1QKWA 4XLNF 2W84A 4GBQA 3QPHA 3LGFA 1KD1R 1STZA 1M5Q1 2PFBA 3E6DA 4J5YA 4R79A 2CUEA 5DS9A 4CHUA 1BU1A 3ONQA 3CMEA 3B6AA 3J80E 4I6ZA 3BG3A 1K1ZA 1UDLA 5EC7A 2WAQN 2PI0A 1KU7A 4UB8C 2BW3B 2WV1A 1Y6IA 1LFBA 3PJRA 4M9SA 2STTA 4EQQA 1ULYA 2Y0SA 1MBFA 2PN6A 4XKVA 1RUOA 1AZGB 2CT3A 2DX1A 1RKWA 3CC2I 3IWZA 2FZKB 1YI2I 2XGCA 3OR1C 4M7AF 2VJ5A 4M74A 4JK1X 2RN7A 2F4IA 3O2PE 4QWQA 2YUQA 3BW1A 4W97A 4UUSB 1L3LA 5KYXB 1IXDA 5L3GA 2K2VA 1PCXA 2X9HA 5D6EA 2DXTA 1GVDA 5CVVA 1ACIA 4ZZLA 2XIGA 2KT1A 3QBYA 3G71Q 4BBSJ 1S7OA 3J7YJ 4ESFA 2K40A 1ARKA 1EX4A 1R5ID 2FUG2 3X28B 3AG1H 2GWRA 1VQKA 3QP5A 1A35A 1H92A 4M73A 3OSFA 3CCEA 1VQ4I 3GCMA 1EV7A 3LFUA 3NWTA 4I02A 2A7YA 2E3IA 2WACA 2PBIA 2LK2A 1X3WB 3QP6A 2M34A 4C92E 2CZ7B 4DGWB 1SSHA 1F36A 2O0YA 1UB9A 3TBIA 2A37A 1HKSA 1N9RA 2HEOA 3KZZA 4I2OA 3GBQA 8AT1B 5LJ5g 3VYTB 3BG6A 3ZQQA 4OMQA 3REAB 5DLOA 5CO7A 2JQ7A 1PRMC 2PU9B 2EWNA 4C92B 1K9MR 4C8QG 1CGPA 2V1DA 1OX8A 2GQQA 2DRMA 3UATA 1UECA 2MWOA 4RB2C 3U1KA 3ASKA 3EGDA 1J7KA 2DMNA 3CMYA 2M2EA 4N4OB 3ZRGA 3S3OA 1XS9A 2HOTA 1DDNA 2W24A 3BROA 2R3SA 4I99C 1VFCA 1NG2A 2D8HA 4JPBW 3RESA 4DOWA 1K0XA 4OMLA 2CFXA 1W0UA 5IPAA 2LDMA 2CSQA 2ZMEC 3KLNA 5GPAA 3LYIA 4Y33A 1IRGA 5HLTA 4CSWA 1MV3A 4FT2A 3RPUD 3HPWA 4GY5A 1TLHB 1S72I 3PNTA 2BY3A 1KQSS 2FO0A 4PJOC 2QUFA 4TV7A 5JR3A 3EFSA 1Y96B 2MA3A 1KFZA 1MH3A 2VXDA 1K78A 2ED1A 2QA4A 1MNDA 2EIJH 3IAS2 5BNGA 1BJZA 2ACJA 2V1XA 4ITVA 2QLZA 1PD0A 3F8NA 3TP0A 1X6BA 4M7AD 4OIRF 2GXBA 5GMKl 4B43A 1Y7XA 5GANf 4EJVA 3DLMA 3ZXSA 1VQOQ 4F55A 2R93J 1BJAA 1ETYA 5FRNA 3BLYA 3BG9A 4EMKA 3KUFA 2QKLB 2L4MA 2EINH 3CUOA 4ZH4F 1YIJI 2EFPA 3PFSA 4HX7A 3H36A 3OS1A 3A5ZB 2W82A 3A0BC 2LY9A 4BE1A 4XLEA 2BXYA 2VJ4A 2XB0X 4DQ2A 5B3SH 1ZG1A 1UELB 1H89C 2FPFA 3EFOA 2GA2A 4D5FA 1HA8A 1N75A 2DILA 4XONA 5DM6F 2HNHA 1U1TA 1IREB 2A07F 2XF7A 1RACB 2DF6A 3A8LB 5J8CA 1KA8A 5J3BA 1X1PA 3E6BA 4GO1A 4NNJA 3KYDB 4F93B 2A36A 4N4IA 1YJNA 2LMDA 2F4MB 3PUBA 2DXBA 8ATCB 3SZTA 2WY8Q 2CP5A 3SDGA 3OYFA 4PSWA 3OW2A 1EH7A 3JREA 2X6YA 4ZDOA 4RTTA 1EFNA 4M75E 2KR3A 3RSNA 1VQNI 3I55Q 3JB9G 3A0HC 3FC3A 3CCVA 4C2TA 2CW0F 3HOXJ 2L9RA 4KA4A 3HZJA 4A3JJ 2M0MA 2H94A 1M2VA 2HQXA 1SHFA 3LNQA 2PX9A 1JT6A 2KDZA 1XQHA 2QTVA 1Q7YC 3BP8A 5IXBA 3L2VA 1JE8A 3AKZA 1X75C 3BDLA 3CCSQ 1PP7U 4KMUX 4OGCA 3PSIA 2B8AA 1IJWC 3MEUA 4M75B 2HU9A 2KIUA 5KAFC 4OB2B 3JB9H 3R60A 2VWFA 1JKRC 3J7ZI 3QYGB 3L1PA 3IV5A 3KYLA 1UG2A 2YX4A 4CGZA 3GVAA 2LJ1A 5LJ5j 3CCMT 4KIBA 2L3DA 4M7DF 3WGGA 2WV0A 1W4SA 3FXKA 1SEUA 1BI1A 3PTAA 3VJPA 1XB4A 2IGOA 3CC4I 1LNXA 2J6KA 3G4SQ 3HM5A 3KEOA 3I4NJ 4IUVA 5GAOl 4PJOB 4C0DC 4HW0A 2C0TA 2KQWA 1PUFA 2RAEA 3G1MA 3OY9A 1M1EB 2LYCA 4A4GA 3F8BA 2N8GA 4PK4A 1P7JA 4MFDA 4BNCA 5ICCA 2LKXA 2CZ1B 4Z88A 4XRMA 3EAEA 1S7AA 3ZQGA 1YBYA 4HVUA 2KZGA 5CPRB 4IL6C 2HKOA 4U7DA 2VXFA 2CMPA 2KISA 3RBBB 4IQ4A 2M1BA 2JNGA 5GMKh 1H88C 2FE3A 1YHQT 1GXQA 3CO6C 2QK0A 2JA5J 2ISYA 2MW8A 4E2FB 4NC8A 3MEWA 1EZZB 2VQHA 3GTQJ 4J9HA 2DK3A 2SEMA 1KG1A 1V5FA 1RAHB 5HDKA 4B9WA 2EJGA 4BS9A 1M8MA 2KJCA 3I56T 2OTJI 2X4JA 3BE3A 3K1PA 1XTDA 5IH2A 1OR7A 4OMZA 3M1CA 3TW7A 1A6QA 3W6KB 2KVQG 4LUEA 4AFQC 4BUGA 4WXCA 2X4HA 2DOAA 2EPDA 3HTRA 3N97A 1R8OB 5HCKA 4F7UE 2O3FA 4B3XA 4C3JJ 1B07A 1WZOA 2AKLA 2MC3A 4AWXB 4P9UA 4B8XA 2XK0A 3DTKA 3DTIA 4HRIA 1CF7B 1YRNA 2X1EA 1ZKGA 5HS8A 1HDDC 4TVRA 2JA2A 3TL4X 4AYBN 2Z33A 4C5IA 4E6KG 4J7IA 5AYFA 5CVRA 4U7BA 1R77A 2WB1N 4XOPA 5BPDA 3JCMg 2K4BA 4F7UB 2W7NA 3MP1A 1QVPA 3PNYA 3S1QJ 2UWMA 1GCQA 5DUKA 2BV6A 1F5TA 2ELHA 1R0BG 5KH6A 4UVAA 1N77A 4CCJA 5FLVA 4RGRA 3COAC 1P9QC 1GV2A 1JT0A 1OI1A 1T33A 2K3BA 2E1MC 4I0AA 2LCLA 3HKZA 3QOPA 4AVPA 3HSFA 2RHXA 4ZYHA 3BR2A 4HBLA 4G9YA 4JX5A 1DPRA 3SEZA 1PC0A 2CUZA 5CR2A 2NVYJ 3K0LA 5LHGA 5HDNA 3EGXB 3HFOA 1TU0B 2DK5A 3HHGA 2IVMA 1M1KU 3H0IA 4ZDPA 1C6VX 2HNIA 4C0DB 2K9SA 2CJJA 2KDSA 1BR1A 5F04A 4ETSA 2WC2A 4D9JA 2KRMA 3ABUA 3CC7T 3D5LA 5F27A 1RAFB 3GF2A 3ZMDA 3CCJQ 3L7WA 1TTYA 2ZJQF 2A61A 4BEHB 3JSCA 1ZSZA 3CXCP 1PHTA 3OQ5A 5ILVA 2GQVA 4ABZA 4C8QF 2F5DA 1MMNA 2DVEA 5LJ3g 1XOVA 3M56A 1I3AA 1XGOA 2EQJA 1OCTC 3M0UA 2R4GA 2QEXT 1Z7UA 3S8PA 1QP3A 4RBOA 5D6FA 5KYYB 3EG3A 3FBNB 1NZ9A 1V76A 2LZ6B 4P5NA 1AKHA 3O3KA 2RQTA 2KSSA 4OMOA 1T8IA 3MAJA 1QVFA 1OULA 5FKNA 4I0BA 2QGGA 3JRCA 4AT1B 2LFBA 3I0TA 3DV8A 3D1NI 1OYWA 3F3XA 4A5MA 1UE9A 3GTLJ 1WJCA 2FOKA 1K7AA 3H3ZA 2C0IA 3NEUA 2HVSA 2IT0A 4ZNXA 2Q2EA 1GFDA 2HDAA 3HPHA 5J4VA 2TRTA 3M3YJ 2FBIA 1VUBA 2A28A 4MQ9F 2KBTA 2DN0A 4KNYA 4CC2A 3H0GJ 3FXOA 3CQZJ 1GVJA 3T0YA 1RI0A 1TUGB 1K61A 5DYMA 1VOMA 2OTLT 5JHUA 4AFZC 3V8LA 3LA7A 4O5VA 2FU4A 1FT9A 1VQ7I 2JOYA 1P2FA 2JT1A 1I07A 2O01E 4U0YA 3H3UA 4A6EA 2KQRA 4BJ6C 4A3MJ 3GP8A 5GAOp 2ZO4A 4II3A 2K3FA 4G6DA 1TQPA 1NEGA 1YI2A 4IXAA 1ZA2B 4M3DA 5FKLA 4QPQA 5IYCJ 1DGRM 3JAMZ 4P1WA 2DYIA 2E1MB 4DOZA 2R7FA 2QGUA 4IVNA 3HHHA 1V54H 1VYTA 3CD6T 1WCMJ 2XAJA 5IT9K 5K5QA 4WTOB 1MBJA 1WQ2A 3JAME 1X01A 2QA4I 1I6HJ 3OYLA 2PNIA 1D0XA 4PJLA 3OYKA 1DU0A 3WTTC 1WJSA 2TCTA 2AO9A 3MEAA 3SWNC 3H5AA 3MO8A 1R00A 1ABQA 2J6FA 2DCEA 2CS7A 3BR3A 2ZJRF 1FZPB 3CTAA 3FXMA 4M78G 3UT1A 2K5FA 1T0HA 1FIAA 2XDPA 3BJ6A 3RKWA 3A1PA 3MPUB 4C8QD 1IRZA 3E5UA 2K6DA 1HDPA 1W5SA 4YFXF 3N05A 1I6XA 3SFMA 4EEFG 3FBIB 4FW2A 4RCBA 3THKA 5A2QZ 2KFDA 2CW8A 4I76A 2E5NA 1VQMI 1KU9A 4FCYA 4H4KC 4Y3OA 4BDZA 2VYTA 4L9TA 1MJBA 3PMTA 4R55A 4XRSG 3CCMA 4N0AC 2CH0A 5A2QE 2R5YA 2JM9A 4XU1A 4B1RA 5CQEA 3LSKA 5E8GA 3AL0C 3FB9A 4JS5A 2P4TA 1UHCA 1HSJA 1MMGA 3HRUA 4X6AJ 2BY2A 5LJ3j 3CCUT 4D6WA 1I1JA 3CLQA 4HNUA 2FD5A 1QHHD 3C7JA 3GXOA 2VXZA 3GEZA 2MF2A 4Y52J 3VS2A 2XV4S 5HLIA 1FYLA 2A0FB 1KGSA 3FKIJ 1S29A 4HF0A 3CCVI 2DOEA 1Q7YR 4BXXJ 2EFQA 2OC6A 3SZGA 4NL3A 3F22A 5CKFA 1QCOA 3CCQI 1OJLA 1YW8A 2JT4A 2KYBA 3NTKA 2E1OA 4KH0B 1NK3P 4MTDA 3H0DA 2BE7D 3Q3SA 1TUCA 5K1YA 3OYCA 1VQOT 1S5LC 1QA6A 4FISA 3I4MJ 4XKWA 2IGKA 3LSMA 3T8TA 1K4TA 2F2VA 3E1SA 3E7LA 3FJPA 1YHQA 1MDMA 3GBGA 4R1HA 2FMYA 4WF2A 2L2OA 3K4JA 4JUVA 1YJWA 5K7HA 1ZTRA 3S16J 2M45A 2DNUA 4UB6C 4E70A 2ED0A 2MCNA 4XU0A 2H6CA 2OU2A 1TWAJ 1ZUKA 1XC5A 1K6OA 4I09A 2MLGA 4FL6A 1W36D 1WJRA 3ERED 4C3IJ 4M3FA 3VYRB 2AK5A 1SD4A 1K79A 3PT9A 3JB9D 1ZRDA 3Q0VA 3I59A 3J81Z 3SWNB 4RB0A 2RMOA 3H1CA 2FEZA 5HY6A 1FIPA 1HSTA 5HDGA 2Z2SB 4LLGF 5IP9J 4A3DJ 3OSSC 2JN6A 4M77A 3B02A 1RC9A 4GFBA 1W0TA 3GTMJ 2L7FP 3M55A 1D8KA 3UA6A 3J81E 4XTWA 3PUFA 2CV0A 4A4FA 3T1BA 2HKXA 2IBDA 4KIGA 3J7AY 3RKXA 2DMOA 4VUBA 3OYDA 2SRCA 5DDGA 2CWEA 2P6TA 1WQWA 1UCRA 4ZTJA 2M4GA 3ABMH 3PO2J 3CMMA 2CSIA 3RTRA 1JRIA 3D5SC 1NM7A 1WHKA 1TNSA 3OL4A 4M7AE 3AL0B 3RYRA 1AHJB 2PJPA 4LG0A 3BOQA 4J00A 2Z0WA 5LGTA 5EDNA 4J9BA 4UC4A 5LRSA 5DM7R 4JJDA 3JB9J 1RR8C 4P5OA 2NUPB 2FJ1A 4M3GA 4C3HJ 4FASD 4F7ZA 3SB2A 2FMLA 3KCCA 4M7AB 2Y4YA 1OU8A 2CUFA 3MKWB 1XGNA 3PIOF 4CCOA 2VKVA 3A8HB 3GMEA 1B72A 1AOJA 2XMFA 2F5CA 4YFNF 3WGHA 3CEYA 3EFRA 2STWA 3R0JA 3MP8A 5IHIA 5KVRA 1BN5A 3OIQA 1X2KA 1X69A 3CCST 2YRCA 3VOEA 4UV9A 2COZA 3EH2A 1JQQA 4PJJA 3SZPA 3K4LA 4D5CA 4Q5SF 1D5VA 2ECCA 1TQMA 3M8FA 1AOYA 4PJ0C 1Y0NA 2E36A 3SEQA 4UUVA 4AFUC 2KRNA 3EGUA 4U0WA 4A69C 3OIPA 3REOA 4C5EA 2OPTA 2H3EB 4L9NA 1C1AA 4B09A 3KFVA 2XKPA 2PMZA 2X6WA 2RQWA 3F8MA 1XDUA 3L09A 1SVOA 2JJ7A 4Q4ZF 2ZFWA 1LB2A 3JCMP 3B6CA 2MABA 2BEOA 2XPVA 2WADA 5ERIA 3H92A 1SRLA 2XGXA 4N4NB 3RQIA 3BDUA 3G4ST 5GANe 2ROLA 1O9SA 2X4XA 5FB2A 2MIOA 4A6DA 1M1FA 2VKDA 2I8DA 2EFWA 1V29B 2UUZA 1ZQ1A 2O61A 3JTGA 2CT4A 3OSGA 3AFHA 1Y39A 2W00A 2ELJA 2KRHA 3NRVA 3QPLA 4CCLA 3JCMQ 4Z8AA 3C94A 2RJEA 2RNAA 1RPWA 1HC8A 1X19A 4BKXA 3ASNH 2V8KA 3M53A 5I22A 4JJNK 2DODA 3L2WA 1NJIU 2BHYA 1IGNA 5LGNA 4M7DC 2KIMA 2ICWG 4XKCA 2BY1A 2RNJA 4BDYA 3TCJA 2MGQA 1O3QA 2K9GA 3SHWA 1QMCA 1YITQ 3GIBA 1PDNC 3M9AA 2EIKH 2GOMA 3EQLF 2ESWA 4Q48A 1FYMA 1NYGA 1FMKA 4XL9A 5JLXA 1L0OC 3HC7A 4X1EA 2KYMA 2CQ7A 4RUGA 1IXRC 2BHZA 2JTVA 3NHNA 4ORZA 4A0ZA 1MV0B 1S7EA 4AG2C 3KP6A 3I56Q 5L3EA 2GZWA 3HB9A 4HCZA 1QKXA 2JXBA 2JVVA 2DJQA 5HNHA 3CJQB 4NQWB 1Q95G 4LDWA 2CREA 5KYXA 1KHCA 2ECBA 3WU2C 2TDXA 2QBYA 1KQ8A 1EH6A 2BKDN 2DZCA 2MD0A 2QVOA 4KN7X 2HQEA 1VYUA 2R7RA 3E19A 4B4CA 2EJRA 5L23A 4S0HB 4NHJA 2P0KA 1ON2A 4M78F 4PFZA 1YLFA 2BXZA 1NPRA 3V7SA 1O4XA 4FSSA 5GAGJ 2JPBA 1FMVA 4BI8B 5GMKe 3GWZA 5LJ5h 2E4HA 2K4JA 1BW6A 2VASA 2X48A 3INZA 4A4EA 1EA3A 4HPQA 3HRMA 3V4GA 5E18F 2Z3YA 3TOBA 2XU8A 1ETVA 3I54A 4AIDA 3VPRA 4CYDA 2CU7A 3BZKA 2K5IA 3CCRI 3G71A 1K6YA 1UHWA 1NEBA 2MH9A 4HLYA 2JJ9A 1QU3A 3MEVA 5EG2A 1M2OA 1MSFC 2CFOA 3MKLA 1VQ8A 3DB3A 4KDPA 3FF5A 4V2GA 2HZTA 1WYXA 4LK1F 5L3FA 4M7DE 1R23A 3IWFA 1ERDA 1ITYA 3I64A 2QQ8A 1SFXA 1ZYRF 3M5AA 3ERMA 4ZZDA 5LGUA 2H6BA 2DXCA 3CC7Q 2YUSA 4ZTFA 4FX0A 2F5KA 3CCJT 1YI2Q 2QSFX 1D1AA 2DIQA 2XRNA 1E3OC 3OYHA 1K73C 1UJYA 1B3QA 3QQAA 4M7DB 3IQLA 1ENHA 1WZ2A 2IS4A 4KT0E 1QO0D 1UHMA 2ME6A 2WAEA 3BG5A 2FPEA 3ZQ7A 2HTJA 1NE8A 4L9JA 2CUBA 4G12A 2OAWA 4LLLA 1SD5A 2PVDB 1WI3A 3LOCA 3OYYA 1Z9QA 4PLIA 3KP7A 3EG1A 2QEXQ 1VQLI 4RA2A 2KY9A 4BHPA 1KD1U 2YU9J 3UR3C 2LCSA 5EZGA 4L5IA 2P5LC 1SHGA 3S32A 2OD5A 2HEQA 1VQ4Q 2WWYA 4J83A 4C2UA 4V2FA 2RF0A 3KIOA 3P5JA 1KU3A 4I98B 4M77G 3MEXA 2KEAA 2YT6A 4XORA 4OMFB 1O75A 3DU6A 4BY1J 2A6HF 5FLMJ 3RDVA 4Y92A 2COBA 4G6QA 5DCFA 3WODF 3OSVA 4UV8A 1B34B 4B6MA 3JCMb 2NVUB 5AIQA 1K8AC 5B5EC 2DPPB 2RB6A 4BHCA 2KROA 4N9IA 4CYCB 4LK0F 4CCMA 2E70A 4ESBA 1SKUB 2NUTB 4FX4A 3P8BB 1O7LA 2A69F 2VE8A 2NS8A 2OTLQ 3BCBA 3M4OJ 2GFAA 4UVBA 1UG0A 5HNFA 2DKGA 1AHDP 1E3HA 1Y07A 3EPZA 2KRCA 4ZJZA 3M57A 1VQOA 3J7AF 3M58A 3VU3C 5GAMg 1G2BA 3I4PA 3WE3A 3E9GA 3QJYA 1ON1A 2RVCA 4ZN3A 2LNHB 2RM4A 1OCOH 1IUFA 2KRFA 4Y17A 3NWSA 2DL4A 1YJWI 1BOBA 3HDDA 4GYGA 1S72Q 3FHNA 4YELA 4XR6A 4QSHA 1OCPA 2X1DA 3WTWC 1U5TC 3LFKA 1XCVA 2YS9A 2GIZA 5FFXA 4HVVA 4WXHA 4XK8E 5I2MA 4A4HA 1WPKA 2HYGD 1MMDA 2H8WA 2C0OA 1LFUP 1YG2A 4RTUA 3J80Z 3CD6Q 5CQYA 4ZYEA 5GANd 3ASOH 1OPKA 3KXTA 1VQ6Q 1G59A 1EF4A 1APLC 3RR6A 3JCMW 4AFSC 2A6TA 1UGVA 2EYYA 2IEKA 3MZ8A 3OIOA 3SDZA 1K9MU 3MKYB 1BYMA 2J6OA 4FYVB 3CUQC 1DPUA 2DJNA 1TQIA 2ZMEA 3HSRA 3K4NA 1W6XA 1PUEE 3S17J 2J5PA 4IOAF 3I55A 4C5GA 3FM3A 2F6CA 1FTTA 3VSLA 1ZG3A 3HEFA 2AT1B 2DQLA 2L3PA 5FU6B 4RTZA 5IHKA 2K3YA 3HRTA 3CCLI 2GBQA 3EHQA 3M0QA 3QZ9B 1YIJQ 4HEA2 3CCSA 1OYXA 2Y75A 7AT1B 3CZ6A 1OV3A 2DZ9A 5AIPA 3VSKA 5GAOn 4RMOA 4XLCA 2BE9B 3IUOA 1E17A 1XMKA 2CSOA 4JQFA 1FOXA 1PNJA 3A98A 2ZPHB 2EJFA 4C8QE 2YPRA 2DAOA 1RI9A 2WSEE 1OMIA 2D9TA 1PM3A 3QU3A 1YN8A 3I58A 1T6SA 5FKKA 2FQ3A 2OUMA 1I1SA 4XQ3A 3A1YA 3OOUA 3CCUQ 3U23A 1VQNQ 3G4SA 1OCZH 3F23A 4C0ZA 4FT4A 4IEJA 2VLAA 4EDUA 3L2ZA 3GFIA 2ELKA 5KYUA 9ANTA 1WQ7A 3VRYA 3K70D 4C8QB 3WGIA 1B8IA 1P7IA 2OX7A 1RAGB 4CCKA 4IUQA 1B9NA 1KIKA 1SG5A 2ZFUA 5CKDA 3C18A 1SD7A 3QODA 2PVOB 2LC4A 1XN7A 2NRAC 5JVGF 3CMAT 1F9NA 1R4NB 1DJ7B 4IURA 1R1VA 4RCCA 4CCNA 1U6GA 2ZB9A 1UHSA 2XHKA 1A5JA 1YP5A 4M75C 4HCBA 5I21A 3JCMh 4PZJA 1G3SA 4QIWN 1A04A 3BJOA 1VQ9I 5K7FA 1SEMA 2FB7A 2DDAA 2NS7A 3FDYA 2RD1A 4MMLA 2PJRB 2JW4A 1VF9A 4QT7A 1U5TB 1GV5A 4UNOA 1I27A 1BCMA 2F5VA 4RGSA 1V3FA 3HUGB 1TWFJ 1KC8C 1GXPA 5F6FA 1SFKA 5CIUA 5GAMj 1X27A 3TSWA 1AWJA 1MMSA 1R71A 5E3MA 1YJ9T 4E7SA 5FD6A 3SXYA 1U8RA 4NC7A 3FM5A 1QVGA 3DPUA 4D7NA 1VQ5I 1LDKB 2CGPA 2XKOC 4F14A 1OFCX 1WFXA 3GOXA 2DRKA 3CUQB 1LCKA 3CJRB 3PSFA 2YRVA 1JUSA 1SD6A 1M1GA 1YW7A 2CV1A 1U06A 2E64A 3NTIA 4OMMA 2F2WA 2D0QB 2IPOB 4RTYA 2BIVA 3JRZA 5FWCA 4JDSA 2XAGA 1QHGA 3ZQIA 5E79C 1S8NA 3LWHA 1QW1A 1WIEA 1SPKA 3G1OA 2DMQA 3ZQHA 3PIOA 2FRHA 1IN6A 2HI3A 2LBFA 4HNVA 4ENJA 3H9JA 1ZH5A 1XJWB 2DJZA 2OTJQ 1E2XA 3VDXA 2XRLA 5KYWA 2XPWA 2P8TA 2HD0A 3HGYA 2E5KA 1ZX6A 5DD8A 5LJ3h 3K7AJ 1ZN2A 1QQJA 1K73U 1UG1A 4LB5A 4J7FA 2CG4A 3UWNA 4BGDA 1EH8A 1G3TA 4CXFA 2JTEA 2DTIA 2IA2A 2EBIA 2DXIA 5KCHA 3G6ET 2FZGB 2RQVA 5HS7A 1D3BB 3P8HA 1LUJB 1YS7A 3SHFA 3WTYC 5EG0B 3W6VA 1SFOJ 4L5EA 1BCOA 5J1UA 2UXXA 3CCJA 1WI9A 4ME7A 3RMSA 2EGEA 2HL5C 4EM0B 2WA0A 4ANJA 1R0CB 3BC8A 3A03A 3SFZA 4PKCC 1T3SA 3CBPA 4F16A 5ILUA 3G7ZA 1ZR4A 3L2QA 2D5VA 5AONA 3KP3A 3JRIA 2L3RA 3R6NA 2X6OA 2DD5A 2VT3A 2XSDC 2PG4A 4K2EA 4HF1A 1G2HA 5HK3A 1TW3A 2MI6A 1ETXA 4MTEA 3G71I 2M30A 1N6AA 2QQBA 3CXCA 4E7JA 5CKEA 2VOOA 2JUGA 1FP1D 5GPCA 1XX5A 3C2GA 3DPTA 2V1QA 5GAN7 2EA4A 2W4SA 4M77F 1QZEA 5EGOA 4BQQA 4XK4A 4G7ZF 1O3SA 2HQHA 2LT4A 1OZ3A 4KGXB 3OYGA 1R36A 2IGMA 2Z1DA 1Z0XA 1TXQA 3NAUA 1XNIA 2F1LA 4IUUA 1IHWA 3SYTA 4XRSA 4PCQA 2IG0A 3I35A 1D1BA 5EEGA 3JRFA 4IHVA 3HTSB 3DKYA 3VWBA 2P84A 4IHYA 1RUNA 1WJQA 1X43A 3G2BA 4KUIA 1A6IA 3LX7A 1I81A 4IUTA 2K86A 5IAYA 3FHZA 2R7OA 2FBKA 1N78A 3H9QA 1IGQA 2MOXA 2M0CA 2IA0A 5HLHA 3KEQA 5F64A 1FYKA 5CJ9A 3VKIA 4QKUA 4A3IJ 1RZ4A 4YIRX 1R4MB 2KDOA 4EPCA 3JB9I 1YITT 1Q1HA 4A0XA 4IUPA 2DXUA 4EMHA 2XAHA 2JSPA 1MBGA 5EJCA 2O7OA 2VKNA 3A8OB 1QVGP 2HSEB 3BZ6A 1YFHA 3GFMA 1ORKA 3FIFA 1FLIA 2M8EA 5BQTA 1SAUA 1Z77A 4H0EA 2NS0A 2NVTJ 4GRIA 1BA5A 3IH2A 3IKVA 1ZQ3P 4OVAA 1O3RA 4RTWA 4OINF 4BQOA 2VOPA 2NUZA 1RL2A 1I3QJ 1D3YA 2K9LA 5C44J 2VBXA 2M16A 4J9EA 3TU4K 1VZ0A 1OYYA 4ZYDA 1ZSGA 2Y2ZA 1I5OB 1YWOA 1N25A 1BBZA 2MYSA 4AUXA 3EUAA 1IV8A 5FKMA 2LQNA 3T8RA 1N5ZA 4BH9A 2HVQA 1VQ7Q 3LGLA 1S1NA 2E3HA 2O2OA 5CCAA 2JMAA 4UY8I 4Z6YA 5CK9A 1VQPQ 2YLBA 2E34A 3IHUA 1WGXA 3ZBDA 3WU0A 2LF7A 4KBMB 3EDPA 2YHTA 2QTXA 1IGUA 1QNTA 2ISZA 2HQAA 4OIQF 4V2SA 2RI2A 2CO5A 2QF7A 3JCMJ 2JUFA 2LQKA 3CPWP 1JJ2P 1SVMA 2DL8A 1QGPA 5L3BA 4M77D 5GJWB 1JB0E 3VS3A 4IF4A 5F0FA 2HPMA 3EGDB 4CC4B 2JZYA 5E8IA 3O5ZA 2QASA 4M78C 1PJRA 1JEGA 2EK5A 3GTGJ 4OOIA 3MKZA 2Y4XA 1ETKA 3TO6A 5GAN6 1Q81C 1WRJA 1ONVA 3CMEI 2DT7B 1OQYA 2CRGA 2XB5A 1RLQC 2HDCA 3I55I 1B1BA 1UGQB 2KK4A 3LAJA 2XAFA 3JRAA 3M07A 2W25A 1FOKA 3TW6A 1AVZC 3CC2T 2AQFA 1YI2T 1RNLA 2AQEA 3VODA 3TOAA 4MNUA 3A01A 2K79A 4JRIA 5C4JJ 2W0ZA 1K78B 3PO3J 1VIFA 2A05A 3VS4A 4Q5WA 1VQMQ 1N8RC 1KC8U 2PUOB 3VYUB 3OYBA 4LIUA 3K4MA 4KIFA 4A4KA 4F7UG 2HDDA 5IOZA 1QVGS 1P92A 1XSDA 1BC7C 3VS7A 3GLLA 1AWXA 3DF8A 2W10A 3WU1B 3QPTA 4HZFA 2JN0A 2EGAA 2EIMH 5KCMA 4A2UA 3FMSA 3IRQA 1DQUA 4F04B 2DEUA 4IRHA 1VQ4T 1ZAOA 3LH0A 1VQKI 4PDKA 4XBFA 4R8HA 1ZREA 1U8BA 3C12A 4EMKB 1R9TJ 3CCEI 4AIHA 1QVTA 1VQ8I 2PMHA 4LXCA 3CJNA 1REPC 2EYQA 1PKTA 2LRQA 1RKTA 3DBHB 1U9NA 4Y15A 2ZCFB 3M0PA 4RB3C 3CCQQ 3EFOB 3QYHB 4N0AA 4CH7A 2V1NA 5GAN3 2M7AA 1GHCA 1E6HA 2O9SA 5D5WB 3OYNA 4ASNA 3IH3A 1WHUA 2DYBA 2O8KA 2PLYA 1W7PA 1WJBA 4IX7A 3ZP5A 2R7TA 2E2IJ 2KJBA 3HFNA 3QAHA 2JA7J 1BR4A 2PQWA 1Z1DA 1JJ2S 3BWGA 3CPWS 5CKTA 5GANg 1BR2A 1E3PA 1WWXA 2K7LA 1XGSA 4HX8A 5F0HA 1M9SA 2D1XA 4M78E 1LNWA 1DP7P 2K9QA 1FBSA 1UFFA 2RKHA 4LMYA 4A3EJ 1QPIA 1M2VB 2QAZA 1EIFA 3DQVC 4HSRA 2KE9A 1S72T 3ZMUA 3ME9A 1KC8R 2GTOA 3CBOA 2MH2A 3UKGA 3TP3A 1GCQC 4JZ4A 4AIJA 2NOJB 2OJED 4Y13A 3ZPLA 4MMKA 5CKBA 2F4OB 5IN1A 2EA2A 1U3OA 3ZR8X 2ZPFB 4M78B 3G71T 2QDLA 2GOXB 2ZCWA 4HAMA 4PJMA 3S1NJ 3OMGA 4XAXB 2Y0SN 4EMGA 1Q7YU 4KN4X 4ENNA 1UJ8A 2VXEA 1UJ0A 2E1HA 1VQ6T 2HOAA 3EYYA 4DBQA 3HYIA 2VN2A 2Y48A 1J59A 1HF0A 2PZ1A 4GCVA 5IP6A 3ECOA 1D09B 4J01A 1GFCA 2HCKA 3E97A 3CXCS 4JRPA 1GDTA 3QPSA 2BYVE 1U3EM 3FMQA 3DEWA 2E71A 1LKXA 2F48A 2Z99A 3OR2C 3HG9A 2O9LA 2RJDA 5K5OA 3JB9F 2X35A 1BW5A 5LL6S 4A63B 3MD2A 3I9V2 1PUFB 3S6WA 1QQIA 2JVHA 1GLNA 4MDWA 1YIJT 5M9OA 4PL6A 5J4YA 3EUHA 4ELYC 4HCKA 1Z91A 2VPRA 2ZXJA 4G6TB 3H3VK 1FXXA 2DDBA 1IN5A 2E10A 3ZFJA 4LD5A 2O4XA 3FXLA 4P96A 1ZSZC 2AXTC 2R7QA 1WLPB 2O03A 2DK8A 3CP8A 5DCMB 2C6YA 2D2WA 2XAUA 2KXCA 3X26B 1DU6A 1WPYA 2EKHA 1B4AA 4X1VA 1Q86C 5KAIC 2RK1A 1NBEB 1PKSA 5E3OA 3EG2A 1UB4A 1X3ZB 1GBQA 3F9KA 2JSCA 1HCRA 1BI3A 5CQXA 3X24B 3CC4Q 1Q1VA 4U88A 4OMPA 4XU3A 2BZYA 4AVZA 3UF4A 2D6FA 2YX7A 1R5HA 1YJNI 2H1LA 5DEQA 4MIMA 4GLKA 1VQNT 2MD5A 5F08A 4KGZB 3E3VA 2VE9A 1T0FC 2X3XD 3META 3BTIA 3GF5A 1TNTA 3PQJA 4M7AC 2DW4A 1AT1B 2L5QA 2DFUA 2D1HA 2XHCA 4CRIA 2VC8A 1U2WA 5CVUA 4HVWA 4RAZA 2EW3A 1MGTA 2E1CA 4C92D 2XD0A 4UUTA 1XSXA 5DTDA 4U0VA 2WAQA 1PSFA 4DEXA 5D6WA 1X1AA 1F1ZA 1Z21A 4BI4A 5FROA 2DL3A 1TWBA 1BK2A 2ID3A 1YRNB 3AG3H 3BDDA 3K2AA 4LGWA 3QKJA 4J6YA 1JTXA 5LRRA 3CMAQ 1QPMA 2H1KA 4KGVB 1TUDA 2DFFA 2BTTA 4JJBA 1YITA 3PMIA 1TG0A 1G8XA 1M90C 1U0JA 1JO8A 2EQRA 5FGMA 3O8VA 3URGA 3CC4T 1OISA 5D5VB 2QDYB 2P7VB 3EGXA 4FYYB 4BQAA 5J1RA 1X3UA 1NPPA 3ZMSA 2A08A 4BHBA 3L2CA 3K1MA 1Y0UA 3EH1A 4HXJA 5EF6A 1ZGAA 3Q0UA 1MSEC 1T39A 3GFJA 1MZBA 3I56A 5GANj 2FRWA 3K10A 2XDBA 4A5NA 5L3CA 3IL2A 5M5WJ 3J7AO 1YJ9Q 1N9SA 4FT8A 1QLYA 1VQ8Q 1M3CA 4LOCA 2X6XA 2ABLA 1FEXA 1LJ9A 3R61A 2J5OA 2Y9ZA 4IO9F 2DMUA 2ESNA 3EG9A 3E6MA 3FZVA 3AHUA 2VBZA 2FSWA 3GFLA 4ZC3A 2LX7A 4HF2A 3IC7A 2L2PA 5GP9A 3QJ6A 4BL0B 5FLXK 2VC1A 3DPLC 1ZRFA 2PUKB 2RHYA 2COMA 3ABKH 2DT6A 3Q9VA 1Q81U 1Q82C 1E7OA 2RA2A 2QCOA 3JCMe 1ZA1B 1ZSZB 3LA3A 2RI3A 2DTRA 2OTJT 2E7XA 2NXNB 4HNTA 1LE8A 3DLLA 1OKRA 3W2AA 2P7CB 1R49A 1UAAA 2L9VA 3QIIA 4FE4A 1V55H 2R5ZA 2CP3A 2A6EF 2V26A 3LMMA 4ATOA 1N8RU 3MQ0A 2JA6J 2XGEA 5LLQA 3PFIA 2VUBA 2CYZB 3RCOA 5ED4A 1AKHB 2BUDA 5J26A 1HLVA 3LSPA 1M27C 1V5GA 4C2MJ 2GM4A 3HJEA 3KP4A 1HW5A 3LSIA 1H8AC 3WXMB 3G6EQ 1BIBA 3E5QA 5LEKA 2M02A 1JUPA 2RO0A 5GAHJ 3K69A 5KYNA 2Q0OA 2QQAA 2Y9YA 3Q0WA 4LIVA 4OMYA 4JLGA 4Z02A 2LTOA 1K4SA 3CC7A 3RERA 2Q2EB 4RG2A 1R58A 2NVXJ 3IKTA 1KSWA 1LPLA 2EZIA 2LH9A 2COWA 3HOZJ 1X6OA 2D8JA 4MO7A 3WVEB 4KT6A 3OA6A 2UV1A 2ZNZA 1PG5B 2DD4A 2ZPEB 4A12A 3CCRQ 4RS8A 1YNZA 5ICGA 3LSHA 3CDLA 4Y7NJ 4B3AA 5J1YA 5FRMA 2GCXA 1FPQA 2DQRA 2QEXA 3CF2A 5D8LB 1M3AA 3M0TA 1EKEA 2KMUA 2O88A 3BG7A 3V7RA 4A53A 3DEUA 1MH4A 5GAMh 5K5RA 1Z67A 3SD4A 1VQ4A 2ZPIB 1Q81R 4DBHA 3QSUA 2L0AA 2P0QA 3D0SA 5CYVA 2ZXHA 3BQYA 5E1ZB 1T38A 1VYVA 4PLLA 3I5UA 2D45A 3LSGA 5HVQC 1JGGA 3O8GA 1SAXA 4LDYA 3I5RA 3V42A 2E7WA 3G3ZA 3ZQCA 4J8OA 4CI0C 3KP5A 1E0EA 2ESHA 2KLOA 1KZHA 5IT9Z 3RYPA 4N4GA 1USTA 1RRJA 1ZGWA 3RMQA 1N8RR 2KP6A 3KZIC 2G9WA 3WG9A 2CGHA 1I0CA 1FC3A 3FWEA 3TO9A 3U9GA 2OTLA 3VS1A 3B73A 2OAUA 4FYWB 1NH3A 4DJAA 2IAIA 5IT9E 1LFPA 3HL2A 1VQLQ 5HLGA 3HKSA 1IZ1A 2O9VA 4CZZA 4KITB 2Y0MA 3DTEA 4PJOE 3RKYA 3TREA 1OCRH 4J9DA 3ER0A 1Z7LA 4FETA 1RAIB 2KRSA 1UGRB 4AG1C 4FE7A 1S72A 2BW3A 1JGSA 2FQ4A 4LB6B 4G94A 4KFCA 2JM8A 3H41A 2FBHA 2V1UA 5JHFA 5LJ5f 2QENA 1QVUA 4MHGA 4BACA 1SANA 4OP0A 2ETHA 3CD6A 3BQZA 4RTXA 4J9GA 2BGCA 2P81A 2Z9OA 2R5MA 3X20B 4UUSA 3F0CA 1VQ6A 2RHZA 4NBQA 1SF9A 5E20A 1J09A 3ZQLA 1ACMB 4E7ZA 4ESRA 1LVKA 1UMQA 2KMTA 4EATA 1VQ7T 1IC8A 1WHMA 4CC7A 4MZMA 5F1JA 4IHXA 2JWTA 2DMTA 2L9NA 3KETA 1VQPT 1YIOA 2CQXA 4ZGEB 3HKZN 1TWCJ 1H3HA 4M72A 1K9AA 2K27A 2V6EA 1J3TA 2HR3A 2K02A 4BQNA 5LHIA 1YIJA 3LQQA 1QWEA 3LSJA 4HKEA 1W5CC 1MJAA 5E3NA 5D4RA 1XMAA 3ECHA 2H3JA 2RQPA 5HODA 2IIMA 2K4YA 1P4WA 2IVWA 3PNVA 2DE0X 1SSFA 1MMAA 1XG1A 3ZMVA 2EH3A 2QA4T 3ZQFA 1JKOC 4WXDA 4XSZF 2OQGA 2DFIA 3K9TA 2JZ2A 4EIKA 5LFAA 1MDMB 4C92A 2AXLA 2DJIA 3VYGA 2KPMA 1OOTA 5JLWA 3CCUA 1P6RA 2ZPGB 2I10A 4QQGA 4O6JA 3Q1JA 1VQNA 2NYSA 3LA2A 1VI0A 2XASA 4DW6A 4L6V5 3SEMA 3CCLQ 4ZDLA 3DB4A 3V8KA 1R6RA 3E2UA 4D7MA 2OF7A 3ULQB 4M77E 1WH5A 2KT0A 5GMKm 4A93J 3O8HA 1B6AA 3BFMA 3CC2Q 2EB7A 5ICEA 1WA7A 4F52A 1VQMT 5FU6C 2K9NA 3VYSB 3VRZA 3I59B 5H20A 1HD3A 2O8XA 2E6ZA 4XM3A 1MJ9A 5GADJ 2KT8A 3Q5FA 3A4CA 1Z6RA 2WB1A 3HBLA 1XGMA 4KUMA 5B66C 4LFUA 4OIOF 1M30A 1Y96A 1O7FA 2P6SA 1JI8A 2FZCB 1J2XA 4M77B 3JCMd 3HOTA 4DOVA 1KYWA 1JUMA 1Q86R 4RLFA 1YTYA 1MNEA 3E5XA 4FHTA 3CCMI 1B7TA 4XTZA 2LNVA 2X3WD 2HS5A 4KH1B 1U78A 1ZUYA 3QHSA 1KQ2A 1UZCA 3CC4A 4L9VA 3FDRA 3L1AA 2F5FA 2K7AA 1RABB 1JJ6C 2LP0A 1IDYA 1PYVA 3MMYB 4LUDA 4GYIA 2KZVA 4IOCF 2JS2A 3CCYA 4XMYA 3H35A 4QLCU 3ELKA 2O31A 1Q82U 2ZJ2A 4LG0B 5CAIA 2KIFA 4C8QC 3CCQT 2L8DA 4KISA 2AZSA 1LVAA 2P4WA 1BOAA 3C4SA 1WXUA 2RHUA 1H3ZA 4QTRA 3E0JB 1LPQA 4PFPA 5HOOA 2JMCA 3QO3A 3P9IA 5FD5A 5IXFA 3S3MA 1MGQA 4JRKA 1T08B 2UXNA 1O57A 3QU6A 2ZXWH 4RM3A 1R1UA 5E17F 4RGXA 3RIRA 1LDJA 1YCYA 2DL7A 2ZGWA 1VQ9Q 4RM2A 1IDZA 2V8JA 4M7DG 1GUUA 3ZCOA 4DBFA 2PVGB 1M90R 1YHQI 2HAXA 4O3MA 2XUBA 1JKPC 3HOVJ 1YOVB 1B72B 2FX0A 4HG2A 2V1RA 5DUIA 4WK8F 5GTHC 2VGNA 3EG0A 2DBKA 2OTJA 1FWZA 2JVGA 4M9XA 3T9NA 2LQ8A 3FRNA 3I56I 1XCBA 1XMXA 1PVEA 5LBQA 1VQ5Q 3C2HA 3FISA 3MJXA 2CUJA 1IRFA 2RDPA 4GDFA 4A3KJ 2CZ6B 1HKTA 3KFWX 1A31A 3DEEA 2R7ZJ 4BY7J 1CKBA 4M75A 2G3RA 3VUBA 4WWCA 1VIEA 2CP7A 1UUEA 2DA3A 3KPHA 5FO5A 2MAMA 2VV5A 2HSPA 2XIDA 1A0NB 2BOLA 2K57A 2W85A 3Q9SA 3V7CA 4HQEA 1NK2P 4FU6A 1TW2A 5EEHA 4DZPA 2HTSA 2YXYA 3TDZC 5TJJA 3TSZA 4I7HA 3QYEA 4G7HF 1Q82R 5FWBA 1G83A 1C0MA 1RLPC 2HWVA 5H2FC 4YTLA 4PJOA 4QVDA 1MBHA 2XKOA 3M1EA 4N9HA 3W2WA 3EUKL 4NOYA 3TGNA 4V19K 2QI2A 4ENKA 1QZYA 3BTLA 2KNBB 2ME0A 1YW9A 5D7UA 4DA4A 3CPFA 2WBMA 4MGRA 3ZOBA 3MZHA 3NPFA 1CKAA 1W36C 1XTAA 2DBBA 2RC4A 4IRGA 2VQLA 1F1BB 4M6YA 3QYFA 1ZLKA 3GNGA 3OYJA 2FA5A 4FW1A 2QGFB 1KQSP 3RKQA 2AIRB 3JR9A 5CVJA 2DPDA 1FYNA 2DIGA 3FK7A 1CQTA 1IG7A 1WX6A 4IZZA 3OL3A 5EYRA 2LG4A 2EQIA 3JCMV 3JCMf 1IAWA 5D6YA 4P55A 1RADB 4GGGA 3OYEA 4FTHA 1ZRCA 3CC7I 4B47A 3QG1A 1JTYA 2YU3A 1PP8F 2ZXIA 1WH7A 2L54A 2RI5A 3OBYA 2B0LA 3PE0A 2QBYB 2R7WA 5KHDA 5IHNA 3WVDB 2XPUA 3RI4A 1QP2A 2MK5A 4N0BA 1MIJA 1IO6A 1IN8A 4PFOA 3FXRA 3QDRB 3H5RA 2QSHX 1DP3A 2DM1A 2MMPA 5ECAA 4BJTA 4D0PA 5L3DA 5J40A 1RAEB 2QEXI 1FSEA 1IUYA 4PNOA 4Y91A 3C95A 1WJDA 2R7XA 3H9GA 1TC3C 2DO7A 1JXOA 3DBLB 1CF7A 1YX3A 4HQMA 3T5XA 2P4RA 2Y69H 3R6SA 5LD2C 1H8KA 2AZVA 3EETA 1SMTA 3TEDA 3P8DA 2E5QA 1SFUA 1W1FA 2VB6A 2VONA 2B9SA 4F7UA 2YUOA 4IHSA 1UEBA 1NHAA 4CA0A 2K5LA 3AG4H 5I11A 2DPUA 2L02A 2RJFA 4MZPA 4BY6C 4YIFA 3PQKA 4A3LJ 4KYWA 2NAZA 2Q1ZB 3LWIA 2CYYA 4L0YB 2RPNA 4JS4A 2FEIA 2VIXA 2C06A 5BOXA 1OPCA 3M7GA 3G73A 1AA7A 5LJ3f 3RUXA 4ZGDB 1M1KC 1DUXC 3S93A 3FXUA 1VQ7A 4OMNA 2OTLI 1ETQA 1Y1VJ 3GLXA 4RMNA 4DZJA 2DA5A 4JX6A 2IPQX 4ZYAA 3GX4X 3DFGA 1JJ8C 1N27A 3OMYA 3I3LA 4OU0A 1NLOC 2QG9B 1VQPA 2E12A 3K4BA 3LLRA 2HOEA 4HYEA 5KE2A 4XICA 2JRTA 4RDUA 4N4HA 4X9DA 2L7KA 4C92G 2W48A 2Z5UA 3PFYA 4IPAA 4BB7A 3S2DJ 4BAYA 1ZARA 1MNMC 1X4PA 2DL5A 5D6XA 1KQ0A 2LQWA 1KQ9A 5TGTA 1W2BP 2NWMA 1YE9A 2CH4W 3AAFA 2DMPA 3OMCA 4X0GA 3WG7H 4LNPA 4IHWA 2CQNA 2GFUA 5DY9A 4BEHA 2DEQA 1W7PD 3SQNA 3C3WA 3CD6I 2L01A 1U9OA 1USSA 1W5TA 2VQGA 4GXOA 1TOVA 2K2MA 3S1RJ 2GGRA 4KICA 3U21A 3MCAB 5A0LA 2XI9A 2MFZA 2KKOA 1Y8QB 1W1WE 4S05A 5EEAA 1VQ6I 4HLXA 2HBPA 4IHTA 5DV5A 3MHXA 4C5HA 1G4DA 3CPWA 1JJ2A 5KYYA 3ESWB 5GAN4 1ZBXA 2LKSA 3JV3A 3GUDA 4BXUA 3IAM2 1I39A 5D4SA 2EJ9A 1G3WA 3DU5A 3FXQA 2QXFA 3L42A 3PIPA 2VBWA 4F91B 2EPFA 2EFNA 4J6WA 3BR1A 2R7VA 1ZBJA 3RNJA 2V9VA 1W4MA 1OLTA 2PMZN 2BVLA 1VTNC 1RETA 2BY0A 4QQDA 2GIVA 1VQMA 4EGYA 2Q8KA 2XGDA 2IS6A 3H0FA 4OF1A 3CCRT 1HW2A 4B48A 1YYVA 3CF5F 2QQRA 3RPQA 3H0HA 5IT3A 1BKBA 1K8AU 4AD9A 5LHHA 4HV6A 1LJOA 3M54A 1WJ5A 3OV8A 2RGVA 4YG2F 3QRFF 3KZYA 2R57A 4BBRJ 5GANh 5EZHA 1K73R 3JSPA 3O6BB 3CMEQ 2LX9A 2G7UA 4PGGA 5D8KB 1IHVA 2OCEA 2DBMA 3CCUI 3QUIA 1LOJA 1T95A 4XN3A 1ZUUA 3EHRA 2DA7A 4XN0A 5FJ8J 4NS5A 3FKJA 4XU2A 3JCMX 1MBKA 2E1NA 4E7HA 2HGCA 4BY6B 1SFEA 1ZR2A 1WXTA 3X25B 5BS6A 2LC2A 1U1SA 1WJFA 1S3JA 2LKPA 1IB8A 2DOFA 3CCQA 3JAMK 1KJWA 9ATCB 1OX9A 4OGEA 4D1QA 4DIQA 3BCAA 3DLLF 3IRRA 2EQMA 5A0GA 3KE2A 2L4AA 4BYYA 4BE0A 3KLOA 5JI6A 4S04A 4KJZA 2K3XA 1W2BS 1VQLT 2IGNA 1UTIA 1D5YA 2OQRA 2LOOA 3MCZA 2ZMEB 4EJUA 1S6LA 3I5SA 3LH5A 1VQKQ 1WKMA 1TWGJ 2QM3A 2LT1A 4M75G 3C2BA 2L3QA 2ZKZA 3KYCB 2DA9A 3CCEQ 1JXMA 5TISC 3JTHA 2IW5A 1WGSA 2JMWA 3FLGA 3H9NA 5CKHA 5GAMe 2DTZA 4EMSA 2OZ6A 3A2KA 2DVJA 1NG6A 1OCCH 2FF4A 2B86A 4EMKC 4YRVA 4E7IA 3K4KA 2FHDA 4XTXA 2E5ZA 4RGUA 3BY6A 3M59A 5A2QK 3WTUC 1G3YA 3OOPA 2OCCH 3M8JA 2ZBKA 2HYFA 4PJOG 2VGMA 2QZ8A 3KBGA 5DCMA 3M8EA 2KGTA 4E7KA 4OB3B 1AWCA 4MDXA 3HSEA 2ZZDA 4IRIA 2WTEA 1SVLA 4B44A 2LREA 1YQAA 1HW1A 3M4GA 1BI0A 4JOMA 2AS5F 1H9TA 2DLLA 5KYUB 3LL7A 2L0KA 1VQOI 1B8IB 5GAOq 4IKFA 1YJWT 2LCCA 3GYHX 1Y57A 2IP2A 1QCFA 2BE5F 3H6ZA 1WXBA 1R7JA 4LDVA 5I2SA 1J0RA 3ZN0A 4RTVA 3VV0A 2RV8A 3L00A 2DTOA 1F4KA 1YCSB 5FW9A 2DAQA 1M8VA 4A54A 2QA4Q 3BR6A 2XDVA 3DKXA 2XG8D 2ID6A 3K2ZA 2VQCA 2CUDA 2FL7A 2QSGX 3EYIA 1KONA 4Y28E 2M1HA 2QQSA 4HT9A 2OAZA 3DKMA 1WHHA 1S9HA 4EM2A 2QKMB 2W1OA 3BZCA 2HQ5A 3VFZA 3WTSC 4L0ZB 3M4YA 1YO5C 2VJJA 4J9IA 3S1MJ 1UFMA 3S14J 4C9YA 2V79A 2X85A 1Y0MA 2E6NA 2HZYA 3CCLT 2Z16A 3L2RA 4II2A 2CDTA 1SMYF 2E19A 3HOUJ 2M0OA 3JRBA 2CV2A 2JK3A 1SC7A 3JCMc 4M7DD 1HBXG 1ZLMA 1JKQC 3W6JB 1ZGJA 2GF7A 4FIBA 1GCPA 3QWYA 3CCSI 3QXEB 1ZK8A 1C0WA 3S2HJ 5LJ5e 3GZ5A 2LTPA 3OW2P 1WHGA 1OPLA 4ESJA 2NNNA 1RI7A 2RHIA 4L18B 3ZEHA 3SWNA 3CMAA 4JJCA 3QOEA 3J81K 3UNGC 3F6OA 4DEYA 3GZNB 4A3BJ 4KRTA 3HPGA 2EFIA 5GJVB 4HCCA 1YJNQ 5K7ZA 4IQJA 2RN8A 4ZYGA 1HQCA 1HK9A 2BVMA 2ATCB 4PGHA 2VT2A 2DO3A 1TT0A 2M4KA 2LBFB 5BPIA 4QVCA 3REBB 5J39A 3MZYA 3IP4B 4AC0A 2EFOA 5D5XB 4EM1A 3G4SI 1O3TA 2YDLA 5KYWB 2MSYA 3CCVQ 4MEXF 2CKKA 4WCIA 1YJ9A 3GW2A 3W2VA 5E1WA 1ZG5A 1IXCA 5J8FA 3RPUA 2H27A 1MD0A 2GXGA 2MG4A 4GLMA 4R0KA 2YLCA 1OR7C 5B1BH 1OQKA 3OBWA 3CLOA 2FPDA 1TZLA 2FVUA 4JRQA 4A3FJ 3VYHB 1OU9A 1VQ9T 3LSTA 5GMKi 1T0FA 2NUPA 4IIMA 2HDWA 2E60A 2RREA 4C92F 3BTCA 4UVCA 3PGGA 4JZ3A 2UZKA 1Y56A 4LITA 2J05A 1FBUA 2LJ0A 4JLIA 4M7AA 4LDUA 2CQKA 4E6RA 3R6OA 4FQGA 3NFCA 2EAYA 2HOSA 3DKWA 4LJZF 1BM9A 1K83J 1WHLA 2J06A 1X2NA 2HYJA 1OEBA 3LW5E 1VQ5T 3LAPA 3MFKA 3CO7C 1IF1A 1H641 5L8RE 2WY7Q 4BE2A 3FJ5A 3H5NA 3QZ5B 1IO2A 2M9HA 3K70C 2DYRH 2LY2A 2COYA 1M1KR 3DCFA 1X6GA 4Z89A 2CP2A 3ZGKA 5IY5H 3VUZA 4EJTA 2EV5A 1Y1WJ 1PRLC 3ULRB 4F3QA 3FK6A 4EGZA 2R7UA 3K1NA 1B59A 3F70A 3G6EA 1D0YA 1FOYA 4DYQA 5GTIC 1VQPI 3JW4A 5EGOB 1Y71A 2X4WA 2D0NA 3OW2S 4OAYA 1NG7A 4MQVA 1ABOA 2LD5A 2HFHA 2I0NA 3HL8A 1HKQA 4AMCA 2NLUA 2DETA 3UA7A 1M4ZA 1FMWA 2AHQA 3A8GB 1WNLA 2V9PA 2VBYA 5KK1A 2HVRA 4J9FA 1HOMA 1BBYA 2F69A 2JTFA 4FSXA 3P9CA 5HS9A 4II1A 6AT1B 2M0YA 1ZELA 2CP0A 3CCRA 1WVRA 4B9XA 1LDDA 1NJIC 3S3NA 2OV7A 4M3BA 3FIWA 2E2HJ 1IZ6A 4HX4A 5GAMd 2H09A 2AHJB 4HV5A 1HXDA 3U2RA 4J6XA 1J5YA 2DU9A 5E3LA 4RB1A 1T3LA 1T56A 1K76A 3D5RC 2I2LA 4IJAA 4NDLA 3MKDA 4LDXA 4UXNA 1NYFA 2QYOA 1X2QA 1U5SA 2YR2A 4WX9A 4BD3A 1H9GA 1MKMA 2VUMJ 1JXSA 4OWRB 5H6RA 3PL8A 2R58A 4KUDK 4E7LA 5M3MJ 2IXSA 4LG3A 1QCNA 2P5KA 2HMAA 2RJCA 5JFRA 4W1UA 3ISPA 3TKYA 1OZ2A 3CCJI 2LVMA 5M5YJ 2YSQA 3W3CA 2XSJC 2RK2A 2YUPA 1UHFA 2R7DA 4UHTA 3PM1A 3HOSA 3H8ZA 5H6QA 4JBAA 2VKHA 1I8FA 3TMOA 2DA2A 2EQKA 3HOYJ 4NQWA 2X4YA 3M9QA 1KHIA 3I71A 3N4MA 3RZDJ 3NTHA 2HKNA 3OS5A 1VQLA 2FNPA 1GL5A 2GQIA 4C30A 1SRMA 1OYIA 4XTUA 2KAFA 2HKQB 2WSFE 2HPIA 3KX2A 2A3LA
chains in the Genus database with same CATH topology
2F5EA 4M75F 2ZNYA 2XDDA 3DXJF 2OZUA 5FU7C 5GAN2 4RKUE 1XSVA 1H0MA 2XAQA 2FXAA 4A0YA 1XD7A 1QBJA 4XTYA 5DD4A 1Z05A 2M5WA 1GXIE 3I53A 3C1DA 4HDVA 2XROA 1J75A 4PJOF 3OYMA 5JVTA 1LEBA 4OB1B 1Z9CA 3ML6A 1D8JA 3GO5A 3ABTA 2QQ9A 5CQYA 5LEJA 3MWMA 3BJAA 3X28B 2LSOA 2P5VA 5LJ5d 2DT5A 3TQNA 1WSUA 3L9FA 3TDUC 2EV6A 2GA1A 2VODA 3GPLA 4Z2YA 3HTUA 3OS2A 1FX7A 4BI3A 2QWWA 2LNBA 4OB0B 3R4KA 1KD1C 4M7DA