3HRUA

Crystal structure of scar with bound zn2+
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
213
structure length
211
Chain Sequence
PNKEDYLKCLYELGTNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
molecule keywords Metalloregulator ScaR
total genus 64
structure length 211
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hruA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hruA02
5JHUA 4CZZA 2JRTA 1R7JA 4YIIA 1HQCA 2PQ8A 2ELHA 1U5TA 5FD6A 2A61A 4I09A 3RKXA 4RB1A 3P9IA 1SFUA 4Q48A 4HBLA 2H3JA 5CVVA 4U7BA 3WG9A 1Z1DA 1I1SA 2KIFA 1Q1HA 2LF7A 2FNPA 3ECHA 4AIJA 3QOPA 2PEXA 1ODDA 3RKYA 3ABUA 2HKOA 5FO5A 3I53A 5FLXK 1JE8A 5E1ZB 4Y13A 4BHBA 2Q0OA 2DBBA 3F6VA 3RKWA 1FP2A 2NRAC 4IJAA 3I0TA 3ZMVA 1USSA 4M73A 2RQPA 1UB9A 4KIFA 3ZN1A 3ECOA 2CFXA 2AS5F 1TLHB 1IW7F 1K78A 1TTYA 3I4PA 4NHJA 2BE5F 1ZGAA 2ADUA 3HRTA 3GUDA 1Z7UA 1R5GA 2EJRA 4GO1A 4IHSA 4M9ZA 1IRGA 3LQQA 2OZ6A 1BYMA 4LJZF 4ESBA 1Z05A 2PLYA 4I0AA 2PBIA 4OIQF 3T0YA 2LNBA 4G6DA 2YPRA 5LBQA 2VN2A 1C0WA 1XGSA 1ZGJA 1YLFA 3B02A 3C18A 2RVCA 5IT9K 4EM2A 1LQ1A 1FPQA 1S7OA 1I6XA 1YS6A 3U2RA 1FX7A 3GFIA 5JVTA 3H92A 4FT8A 2V1DA 4LK1F 2QM3A 4AVPA 1XSDA 1TQMA 2XIGA 2FMLA 3I58A 3LA2A 4XSZF 3K2ZA 3ZMZA 2HQNA 2IVMA 1S7AA 1RI7A 1MJBA 2JTVA 3JTHA 3BDDA 2YU3A 4AD9A 2Z9OA 2D1HA 2DW4A 2FE3A 4ENNA 3WU0A 3RYPA 5BQTA 1FYLA 3G3ZA 5L3EA 2Z3YA 4DNCA 3AAFA 1ZN2A 3TOAA 1ZRDA 1I5ZA 4ZZLA 1QVPA 2G7HA 5KK1A 3FF5A 4M9XA 4HX4A 5D6FA 1R1TA 1XDSA 4EM0B 3E6DA 5ILSA 4IRGA 3ISPA 3LA3A 4G6QA 3H3UA 2L02A 1KYWA 2RKHA 2DLLA 4S04A 3FXUA 2EWNA 5BMZA 2IA2A 1OYWA 2BYVE 2ZMEA 2DPUA 2ZKZA 1FOKA 2QBYA 1J0RA 3E3VA 4YFNF 2W84A 4I0BA 2P4WA 1W7PA 3FMSA 4FHTA 5DEQA 2VT2A 1QPMA 3MEXA 4LMYA 4LG0A 3TO7A 3L09A 4UUVA 3O6BB 2UZKA 1FSEA 4L9JA 2Z33A 2GA1A 4L0ZB 1J7KA 3ZQ7A 2Y48A 4RB2C 3DXJF 4OOIA 1DPUA 1D5VA 2HFHA 1RUNA 4U0VA 5F64A 1R36A 2H27A 4PCQA 4HX8A 3DPTA 5K5QA 4FX4A 3TDUC 3R6SA 1O3RA 1FBSA 1D8JA 4FX0A 2FSWA 3CUQC 3CO6C 5FFZA 1BOAA 1R00A 5K5OA 4WF2A 3GZ6A 5F1RA 3MQ0A 4GYIA 3CDHA 4HLYA 1REPC 2YX7A 3E6CC 4OMZA 2P5KA 4L0YB 5A2QZ 3ROUA 1U78A 3IKVA 4A0YA 1T39A 4A2UA 1YS7A 6PAXA 1ZREA 1LDJA 2M5WA 1F9NA 2F5FA 1USTA 1B59A 1SMYF 3P7NA 4HW0A 1XD7A 5DCMB 2ISZA 4BHPA 1SFEA 1G3YA 1OMIA 2PN6A 2OU2A 3DP7A 1R1VA 3BROA 1H0MA 2FBIA 2X0LA 1E17A 2VXZA 3L2CA 3F21A 2HDCA 4UV9A 3QP5A 3DPLC 1P92A 1XGOA 3TGNA 2NAZA 4CGZA 1NHAA 3ZMDA 2WV0A 2IA0A 2DU9A 4WK8F 2HEOA 2WTEA 4KUMA 5IT9Z 2DPDA 5BPDA 4XSXF 2K4JA 1EH8A 1YTYA 5AONA 1LEBA 2ZNZA 2B0LA 3LWFA 4L18B 1J9IA 2HTJA 2P7VB 2M45A 4Q5SF 3J81K 2CG4A 4L9VA 2FQ3A 3MFKA 2FNAA 4HF1A 2FU4A 1ZLKA 4MTEA 3WE2A 3K1PA 2RN7A 2QVOA 1EV7A 2ZMEB 3KP5A 4MHGA 5ILVA 4XBFA 3IKTA 2ZFWA 4DQ2A 4PDKA 2QQ9A 1RIOH 1QZYA 3RIRA 2ACJA 2BBYA 2EFOA 4AIKA 1H9TA 3IHUA 1BIBA 2H09A 3T8TA 3ZP5A 4OIPF 5LHIA 2VBZA 2XASA 4E70A 1EH6A 4EJOA 1I27A 1F5TA 3V8LA 1IN6A 1QO0D 2CW0F 2HOEA 2F5DA 3HHGA 2L4AA 3O3KA 3ZMTA 5H20A 2K27A 2F5EA 2IP2A 3LSTA 1S6LA 2OQGA 4Q4ZF 1MKMA 4UVAA 2RNJA 4EV0A 3TKYA 2LKPA 1HKSA 2LDUA 2ZO4A 3NEUA 3IRRA 3W6KB 1Z6RA 3HYIA 1OR7A 3LA7A 1DUXC 2HKXA 2Y75A 3QPTA 1BI0A 4KNYA 3WTWC 2XGXA 1TQIA 4YG2F 3L7WA 5J6XA 3HOTA 2W25A 4BHCA 3LQRA 3P9KA 3J81Z 4AWXB 3VB2A 3WTUC 1G6NA 4LG0B 4LLLA 4A6DA 1IXSB 3VFZA 2XAFA 3C7JA 3QU6A 2FMYA 2V1UA 2QUFA 1YO5C 5DV5A 3KEOA 4H0EA 4PGHA 5JFRA 2PMHA 4N0BA 2HYGD 4EM1A 3KFWX 5D4SA 4I02A 3QU3A 4HAMA 4IRIA 1SD6A 1T98A 4ENKA 1ZRCA 1ULYA 2RC4A 1SD4A 3WGIA 2K4YA 2RDPA 1B4AA 2P6SA 4I98B 3RTRA 5FB2A 1U2WA 1ZH5A 5K5RA 2XAQA 3G73A 1P2FA 2IJLA 3F8FA 4OIOF 1EH7A 3J80Z 4WWCA 4GGGA 2STTA 1J59A 4L9NA 5LLQA 5BPIA 3DV8A 2CYYA 4OINF 5HVQC 4Q47A 3S2WA 2DFIA 5ILUA 3CUQB 3ZMSA 3FX3A 4ESJA 1KGSA 2VBWA 4UVBA 5TRDA 2K5IA 1RUOA 2G7UA 2HQRA 1ZARA 4ZYGA 1G3SA 5LGNA 2EA2A 2NNYA 1W7PD 2W57A 3IWFA 4HOBA 5D4RA 3E5XA 1ZHFA 2XROA 3I59A 4RB3C 1W5SA 5LHHA 2ZJ2A 1KQ9A 1KU3A 3DF8A 4KA4A 5L3FA 4UXNA 1WQ2A 2EB7A 4CDGA 1KU2A 3E6MA 1GHCA 4RGRA 4NB5A 4IF4A 5CJ9A 2QBYB 1SFXA 4M71A 1FLIA 2L3DA 1O57A 3ELKA 1S8NA 4HLXA 3GW2A 2HTSA 3MHXA 1BM9A 2CWEA 2O0YA 3NRVA 4KYWA 5BOXA 1IUYA 4PZJA 3F8MA 3QAHA 4I7HA 2L01A 2M30A 1YW8A 3DKWA 4RGXA 3KEQA 1P4XA 5HDKA 3SQNA 4ESFA 3V7SA 5A2QK 1B1BA 3W6JB 4MQVA 5ED4A 5ICGA 1HW1A 1U8RA 1XSVA 1YFHA 4RGSA 4U88A 2DK5A 1MJ9A 1U5TC 2P8TA 4EVIA 1PUEE 1IRFA 4EGZA 4UV8A 2BEOA 3KCCA 3V4GA 1LDDA 5LHGA 3WGGA 5E8GA 4EMSA 4U7DA 1WSUA 2J5OA 4EGYA 5CLSA 1JHFA 1ZG3A 5DUKA 4F7ZA 3BWGA 2VE9A 5EEGA 2H6CA 2M8EA 1FYMA 4G94A 5LGTA 1TBXA 4KIBA 5L3CA 2IRFG 3TO9A 3FMQA 3T1BA 2VC1A 2V79A 4P9UA 2KJBA 2O03A 1HKTA 2QLZA 1WKMA 4N9IA 3DFGA 4A0XA 4IPAA 1DDNA 5LRRA 3J80K 3RI4A 3F8CA 3WU1B 1OYYA 3BPXA 4P55A 4UHTA 3GX4X 1YYVA 2HR3A 4LLGF 4RAZA 4LD5A 1QBJA 4RS8A 3M8EA 1FZPB 2Y0MA 1ON1A 4ZH4F 1XB4A 1J5YA 2DQLA 4I01A 2XAJA 2JSCA 1S29A 1L3LA 3HTSB 3I54A 5DD8A 4L9TA 2F2EA 3F22A 3I59B 3LAJA 2O6GE 1RNLA 1YW7A 2LX9A 3L00A 4HF0A 5E1WA 1S3JA 5BS6A 1KU7A 1T6SA 2D2WA 5ICEA 2JPBA 1IN5A 3RDIA 2ZNYA 2K86A 1O7FA 3HIFA 4D0PA 1QQIA 4WXHA 2M1BA 4EJWA 1OKRA 1BI1A 1AOYA 2MH9A 1FBUA 2PFBA 2Q2EA 1U5TB 3M7GA 2J5PA 2V1XA 2CGPA 4ZZDA 5D8LB 5CVJA 2FA5A 2EK5A 1WWXA 5DD4A 2FF4A 1K79A 1K6OA 3IC7A 3R4KA 5DCFA 3E19A 4LK0F 5FD5A 3H3ZA 4KIGA 5E18F 1CF7B 4K2EA 1JXSA 3JAMZ 1FP1D 1P4WA 1ZLJA 3FWEA 3GYHX 2VE8A 3I64A 4WCGA 5HDNA 1JHHA 3Q9VA 4LGWA 3ERED 3J7AO 4BH9A 1YW9A 4S05A 3E97A 1IAWA 2QYOA 1IZ1A 3PQKA 2XHKA 3DEUA 2IW5A 3KP3A 1K78B 2ZBKA 3FZVA 1LVAA 3K69A 4TV7A 1G4DA 3BJ6A 2VODA 3QP6A 4R79A 2XRNA 1V4RA 3QPHA 1QGPA 1I1GA 3ULQB 2MLGA 2EV5A 3C1DA 5CVIA 1Y0UA 2WC2A 1CF7A 3CLOA 3V8JA 3ABTA 3F23A 1TQPA 4HQEA 4M6YA 2JZYA 1P4AA 1ZYRF 1FT9A 2X4HA 5D8KB 1ZAOA 4LB5A 4A12A 1T2KA 3BY6A 2KIMA 4M72A 3REOA 3I71A 3MWMA 1XGMA 4M74A 4RAYA 4B09A 2V9VA 1LB2A 3M1EA 1FNNA 1D8KA 4ENMA 3PFIA 2CQKA 3EYYA 4GCVA 5ERIA 1MD0A 4OIRF 1UHWA 3Q9SA 1LJ9A 4Z2YA 1SAXA 2A6HF 5DUIA 1XMAA 3TQNA 3WGHA 4P5OA 4RB0A 1XCBA 1AWCA 3HSRA 2TDXA 2PI0A 4EQQA 1G3TA 3KE2A 4R1HA 2YX4A 1GXQA 2UXXA 4YFKF 2ZCWA 4HQMA 3V8KA 1MZBA 2BV6A 2OA4A 3KETA 4CYDA 4BNCA 2A5YB 4P96A 4HZFA 3R0JA 3BJOA 2XAHA 1IN7A 1BIAA 5ICCA 4G7ZF 2OQRA 2OAZA 3KP4A 2DTRA 3KP2A 4IXAA 2F5CA 1FBQA 3FXRA 3V7RA 4A5MA 1W5TA 5DYMA 2XKOA 3M8FA 1KA8A 3WTYC 2GXBA 4KN4X 4IVNA 4MGRA 2NS0A 1BI2A 3KLOA 1B9NA 1TNTA 3E5QA 2E7WA 3VODA 3JAMK 1CGPA 2K02A 4A0ZA 4UVCA 5KVRA 3BOQA 1TW2A 1F1ZA 5IT3A 3DQVC 2ZXJA 3LAPA 5JR3A 1XN7A 5E1XA 4CO8A 1TNSA 2UXNA 2PMUA 3F6OA 1L0OC 3FMRA 1ZG1A 1KQ0A 5J8CA 2D45A 1T0FA 3IL2A 4JBAA 2JPCA 4A6EA 1GXPA 5K1YA 5JI6A 1P6RA 1J2XA 1KYZA 3RPQA 2O8XA 3U9GA 3ZN0A 2OD5A 3WTXC 3GWZA 3D5LA 3HHHA 2XV4S 1ON2A 2MH2A 2FOKA 5H6RA 2VC0A 1FC3A 4NQWA 2VOPA 3FHZA 1UCRA 3HRMA 3NQOA 3GFMA 2NYXA 5HOOA 5CYVA 3JTGA 1U6GA 5D5VB 1PP8F 5DDGA 1MJAA 4CHUA 2ETHA 1BI3A 3EDPA 1MDMB 3KZYA 5DCMA 2GCXA 2HWVA 4HV5A 5L3GA 1BN5A 2L54A 4LFUA 1X3UA 2M87A 3U1DA 1PDNC 1LEAA 3GZ5A 1A04A 2HS5A 3CTAA 1SD7A 4LLNA 1SMTA 5TJJA 2EA4A 3BZ6A 2HGCA 1Z9CA 3F8BA 1BBYA 3KP6A 2DT5A 2RGVA 3F3XA 1LNWA 1BC8C 2EFWA 4IRHA 1H9GA 4JQFA 4WX9A 1PP7U 2A07F 2LSOA 1OYIA 1HKQA 4HX7A 2PJPA 2A6EF 3QRFF 5AIPA 3HOSA 4PGGA 3VOEA 1O3QA 1IN4A 3EQLF 3E6BA 4WXCA 4MQ9F 2R3SA 4L5IA 5HLHA 3WODF 2XKPA 2GZWA 3MCZA 3O2PE 4KN7X 3M9AA 5E17F 4MEXF 1KU9A 1LDKB 5L3BA 3GO5A 1O7LA 2ISYA 4HV6A 4XRFA 4QWQA 2JT1A 1TW3A 2H6BA 2HZTA 4U0YA 1OPCA 3KP7A 2E1NA 3K9TA 4GYGA 4GXOA 4EJTA 2W24A 1YQAA 4M6XA 2K5FA 1W4MA 1YIOA 1U3EM 2FEZA 1QNTA 2D1VA 2MLKA 3BJAA 3R60A 1O3SA 4Y17A 3HSFA 3VEPA 3BPVA 4P9FA 3K1MA 2QENA 4G9YA 3LFKA 3E5UA 2VONA 2KIUA 1K7AA 1G3WA 1IN8A 1GVJA 1R58A 4MEYF 1O3TA 1ZRFA 3IWZA 3GEZA 3OOPA 5HLGA 2XUBA 2HYFA 4XLNF 2EV6A 4O5VA 2VOOA 1XCVA 1V3FA 4U0WA 2STWA 1E2XA 1WI9A 5FLXZ 2MA3A 4EJUA 1HSJA 2UWMA 1ONVA 2GA2A 3GXOA 3N4MA 1JGSA 4EJVA 5HDGA 3I5UA 2GQQA 4LB6B 1DP7P 3SZPA 3CJNA 3HUGA 4G8XA 2DAOA 2LF8A 4RGUA 4O3MA 4QLCU 1ZG5A 3GFJA 1R23A 2K4BA 1XSXA 3FXQA 2YSRA 2A69F 3TO6A 2AXLA 5CVUA 3WTVC 2KJCA 5CVRA 5HS9A 2WWYA 2C6YA 2E7XA 2MD5A 2OZUA 1T38A 4JK1X 4BAYA 4UNOA 2QQBA 1DPRA 2Z99A 3R61A 3SFZA 1XMKA 2P6TA 1HXDA 4AIHA 2K7LA 3L9FA 2VBYA 4ZYHA 1STZA 1XDUA 2ESHA 4ON0A 2BGCA 2GXGA 3EUHA 2QQAA 4L5JA 5E20A 2EFNA 5ICFA 4XLPF 1MDMA 3JW4A 1FY7A 3CUOA 4B8XA 2CSOA 4IHTA 4KMFA 4I2OA 2IA1A 5FGMA 4ZYDA 2MBFA 2OBPA 2P5LC 2FRHA 1J75A 4G7OF 3N97A 3FM3A 5EEHA 2EV0A 4ASNA 2H94A 4HYEA 1BJAA 1R5HA 1WRJA 5D5UB 3F72A 2KKOA 5LEKA 3ZPLA 5D6EA 4MTDA 3IRQA 4ETSA 2QWWA 3ML6A 5F6FA 3FM5A 3K0LA 4A5NA 1SD5A 3T8RA 2W85A 4HDVA 4N9HA 1W7PB 1VTNC 5HS7A 1HW5A 1R1UA 4ENJA 3R0AA 1QW1A 3HRUA 3CUQA 5LRSA 5D5WB 3Q5FA 3P9CA 3JSPA 5L3DA 2DQRA 4BXUA 1FYKA 4BYYA 4HDUA 2A3SA 2FBHA 1B6AA 4HA8A 3RPUA 1QZZA 4G7HF 3KLNA 4YIFA 3BP8A 3V7CA 2XVCA 3K1NA 5D5XB 2E1CA 3WE3A 5AIQA 3MZYA 4BQAA 1UFMA 3COAC 1HW2A 5HLIA 3WTZA 1F4KA 3EETA 2EFQA 5LEJA 2A68F 2GIVA 3MAJA 1XGNA 2R7FA 3WTSC 3SZTA 2COMA 3GLXA 4ZYEA 1UHMA 4M9SA 3OV8A 4KMUX 3F8NA 4OMYA 2CO5A 2O61A 3EYIA 3GFLA 2K5LA 1FWZA 2P7CB 1HBXG 4KT5C 3T5XA 3HRSA 4MNUA 2DI3A 3SXYA 1HSTA 2IPQX 3HTUA 2VBXA 2YR2A 3MZHA 2Q8KA 3RJPA 2PG4A 2O3FA 3D0SA 4HF2A 2V6CA 2GAUA 3GF2A 2EFPA 3TOBA 2MC3A 3ZMUA 2VT3A 3CO7C 1BC7C 4WXDA 2G9WA 3PQJA 2FXAA 2QZ8A 1YG2A 2FBKA 4KICA 1Z91A 4KDPA 2Z5UA 3SHFA 2R7DA 5FFXA 1FSHA 4R8HA 1IF1A 3HSEA 3RYRA 2GWRA 4KFCA 2DO7A 5HS8A 1R22A 5H6QA 4Y15A 3JSOA 1B9MA 4CICA 2XAGA 2RV8A 1MGTA 2IT0A 2KRFA 3B73A 2P5VA 1RZ4A 3TDZC 4CXFA 2DK8A 5LGUA 3KZZA 4O6JA 1KQ8A 5E8IA 1IXRC 1IXCA 4OU0A 4YFXF 3WTTC 3C3WA 1Z6TA 5J8FA 1D3YA 2NNNA 2ESNA 2L4MA 3GVAA
chains in the Genus database with same CATH superfamily
5JHUA 4CZZA 2JRTA 2KT8A 1R7JA 3CCRI 2Y90A 3M57A 2FHDA 4YIIA 1VQ6A 1HQCA 3KBGA 4GLMA 1Z7LA 2EZIA 1MMNA 4KBMB 1FXXA 1EA3A 2PQ8A 2ELHA 1U5TA 5FD6A 3NAUA 4BKXA 2A61A 4I09A 3RKXA 4RB1A 1BCMA 2EFIA 5IXBA 3P9IA 1SFUA 4Q48A 4HBLA 2EVRA 2H3JA 2QQ8A 5CVVA 1NYGA 4HCZA 3BTIA 4U7BA 4C2TA 4NBQA 5FKNA 3M5AA 5LJ5d 1D3BB 3DU6A 3ABMH 3WG9A 3D1NI 2LTOA 4DZJA 3NFCA 1XX5A 4QW2A 1Z1DA 1I1SA 4YIRX 1VQ5A 1PC0A 2D1XA 5GAHJ 2KIFA 1Q1HA 2LF7A 3CQZJ 2QTXA 1ZQ3P 4LDXA 1FMKA 2FNPA 2HDAA 4FM4B 3ECHA 1UHFA 1VQ6I 4AIJA 2EQMA 1G2BA 1WDXA 4HEA2 2O9SA 4DIQA 1DJ7B 2DM1A 3QOPA 2JUGA 2PUOB 2CUEA 3EUKL 4CCMA 3HFOA 2PEXA 4CC2A 1KC8C 1HF0A 1ODDA 1B72B 4X9CA 5I22A 2CT3A 2LT4A 2MMPA 3LWHA 3RKYA 3CD6I 5GAOn 3ABUA 1NJIC 2KP6A 2HKOA 2HVRA 1XS9A 3FISA 5FO5A 2DXTA 3EFRA 3CCJT 3C4SA 1YI2T 3I53A 2XRLA 2EIMH 2IIMA 5FLXK 4Z88A 1M2VB 4RM2A 2H3EB 2E6ZA 1JE8A 2J05A 4JX5A 2EYWA 1YJNA 1OEBA 5E1ZB 4Y13A 3BR6A 4IHVA 4BHBA 4C8QB 3OS5A 1W2BA 2R7SA 1Q81C 2Q0OA 1WQ7A 2KRMA 2DBBA 3FDRA 1UGQB 3FB9A 3HKZN 3ZQIA 1IV6A 2HSEB 3F6VA 3RKWA 5J1RA 3OW2A 2BIVA 1FP2A 1U1SA 2BW3B 3CCYA 2NRAC 4ZDOA 4IJAA 3HOWJ 1PNJA 3I0TA 5E3LA 1OPLA 5KHDA 1NJIU 3ZMVA 2E19A 3A1YA 1USSA 4M73A 4ZDLA 2OTLI 2A37A 3LWIA 3CEYA 3CC4Q 1KC8U 2RQPA 1UB9A 2WBMA 4KIFA 3ZN1A 3ECOA 4A4EA 1T33A 3I3LA 2CFXA 2AS5F 1TLHB 2V6EA 1IW7F 1K78A 4ORZA 1X1DA 3BFMA 2JVVA 2AT1B 3CDIA 1TTYA 1X2MA 3I4PA 4NHJA 1WJFA 2BE5F 1QU3A 3MKWB 2QDLA 2PVDB 1ZGAA 4HSRA 2D0NA 1MMSA 2JUFA 2ADUA 3HRTA 5IH2A 1I5LA 3MCAB 3GUDA 1Z7UA 3HP9A 1R5GA 1IREB 2EJRA 1UHCA 5GANe 4GO1A 3TP3A 3BE3A 4IHSA 3KZIC 4M9ZA 2HMAA 4QQ6A 1LFBA 2VYTA 3IH2A 1IRGA 2OF7A 5GJWB 1VQ4Q 3LQQA 2FUG2 2OZ6A 2X48A 1BYMA 2V1QA 4LJZF 1IG7A 4ESBA 2KEAA 4CCOA 4M7AA 2EQIA 3TMOA 5GAMe 1Z05A 4D9JA 2PLYA 4I0AA 2PBIA 4OIQF 1FJLA 1PRLC 1U3OA 5GADJ 1VQPT 3T0YA 2DZ9A 2SRCA 4AT1B 1VQ5I 2LX7A 1QP2A 2FPDA 2LNBA 4G6DA 5EZHA 4FSXA 2YPRA 5LBQA 5KAIC 4XTXA 2VN2A 2I8DA 4Z6YA 3BTJA 2JS0A 1X1CA 2Z1DA 1XGSA 2BXYA 1C0WA 2ZZDA 1S1NA 3JRAA 5KCOA 1ZGJA 2DA3A 2H8WA 1LOJA 3THKA 1YLFA 1ETVA 2DA2A 3B02A 4PK4A 3C18A 2RVCA 5IT9K 1Q86U 3REBB 4DEYA 1RACB 4EM2A 3EFOB 4Z89A 1O9SA 4QIWN 1LQ1A 1FPQA 1S7OA 1I6XA 1YS6A 3U2RA 5K7ZA 3LSIA 2L9VA 1JT0A 1FX7A 2MOXA 3GFIA 2AKKA 1G5VA 2QCOA 5JVTA 3H92A 1MH4A 4II1A 3BZCA 4QT7A 4ZN3A 3A8GB 4PJOA 5EGOA 2DT7B 4BUGA 4BEHA 4M77A 4DBFA 5LJ3g 4FT8A 1S72A 2VPLA 1NEBA 3TU4K 2V1DA 4LK1F 4RDUA 2QM3A 4M75A 4AVPA 2JXBA 1XSDA 1G2HA 4PNOA 3KYDB 1TQMA 2XIGA 2FMLA 3I58A 4BJ6C 2BW3A 4C2UA 3BW1A 1K1ZA 3BG7A 1G8XA 3LA2A 3IH4A 4XSZF 3K2ZA 3GTLJ 1I1JA 1N78A 2JS2A 1E0EA 4DA4A 3ZMZA 2EIKH 1TWBA 3Q0VA 2HQNA 2XK0A 2IVMA 1S7AA 3RQIA 5J4VA 3H35A 1T0JA 1ZX6A 4LD6A 1A36A 1RI7A 1IHVA 1MJBA 2HNHA 3L42A 3CCUI 2JTVA 1VI0A 4HNVA 1VQ7A 3JTHA 2DJNA 3BDDA 2DYBA 2ED0A 3I9QA 5CK9A 1WH7A 2BY0A 2YU3A 2V9KA 4HNTA 4AD9A 3R6OA 1VUBA 2Z9OA 2AXTC 2D1HA 2EPDA 2DW4A 4P1WA 2FE3A 2H8RA 4ENNA 2E1MC 3WU0A 3K6GA 2MPXC 3RYPA 5BQTA 1FYLA 5KYWB 3OOUA 3G3ZA 3I56T 5L3EA 4GFBA 5CIUA 2CZ6B 1YIJT 2XPVA 1YJ9A 2VKHA 1IZ6A 4YRVA 2WB1N 2Z3YA 3A01B 3LSRA 3CP8A 2BY1A 4DNCA 4BBRJ 4F16A 2LJ3A 2R5AA 2QA4Q 3AAFA 1ZN2A 4RLFA 3TOAA 4ZDPA 3KIOA 1QKWA 3M0TA 5GMKl 1ZRDA 5FROA 1GV5A 1V5GA 4ANJA 2KQRA 4LUDA 1ORKA 3AG1H 3LSHA 2CV1A 1I5ZA 2OUMA 3KEYA 2UUZA 1AA7A 5E3MA 3QPSA 4ZZLA 3MVPA 3SEZA 1YN8A 5CKEA 5LL6S 1QVPA 2G7HA 1H3ZA 5KK1A 3FF5A 2ROTA 1CKAA 1GFDA 4QTRA 4M9XA 4HX4A 4GY5A 5D6FA 4E6KG 1S9HA 1P7JA 3CCVI 4A3GJ 1R1TA 5E3NA 1QCOA 2DBMA 5KCHA 1XDSA 1Y6IA 3MEVA 1JJ6C 1X69A 3MKZA 2PMZN 3O8GA 4JX4A 1O75A 1UECA 4C8QG 5A0LA 4EM0B 3CC7A 4M7AE 3E6DA 5ILSA 4IRGA 4E7ZA 1ZBXA 5CCAA 3BR3A 2HOAA 3ISPA 4NDLA 2LK2A 3LA3A 5IP9J 4RKUE 2H1LA 2M0OA 4G6QA 3H3UA 1U06A 2M4KA 1R5ID 2L02A 2DBKA 4M78F 1KYWA 4A4KA 2RKHA 3WU2C 4A4HA 2DLLA 2J6FA 4S04A 2F69A 2VKDA 2HBPA 2CW7A 5IYDJ 3QDFA 3FXUA 2EWNA 4JOMA 5C4JJ 5BMZA 3GTKJ 1VZ0A 1VQ8I 4RMNA 3CMAI 2IA2A 4RAFA 1OYWA 3CQTA 2BYVE 2OTJI 2ZMEA 2DPUA 3DKXA 3PJRA 2DDBA 2ZKZA 4N0AA 1Y57A 4J9HA 1YJ9T 1FOKA 1YJNQ 2NXNB 4UB6C 3TW7A 3ZQGA 4CCKA 2GFUA 2QBYA 1LNXA 2Y0SN 3S1QJ 1J0RA 3E3VA 4YFNF 2I5UA 2W84A 3S15J 3OQ5A 3CC7I 4I0BA 3KXTA 3ASOH 1R9TJ 5GMKj 2P4WA 3Q0UA 1W7PA 2DKGA 3FMSA 1E3HA 2BKDN 2M0MA 5M3FJ 2FZCB 1VYVA 4FHTA 5DEQA 2VT2A 1YJNI 3FC3A 1QPMA 4XTZA 2X3WD 2DZCA 3OBYA 3MEXA 1FOXA 3M58A 4C92E 3FHNA 4LMYA 4LG0A 4R55A 1TWHJ 2LKSA 1M8VA 3TO7A 2ZPGB 3L09A 4UUVA 4FCYA 3O6BB 2UZKA 3PIOA 1FSEA 4JJCA 2ECBA 3MP1A 4MZPA 2TCTA 4L9JA 3EGDB 2VJIA 5KCMA 2Z33A 3I4MJ 2GA1A 5LJ5h 4L0ZB 1J7KA 2DOFA 2ZPBB 2R7QA 4ZYAA 3ZQ7A 2HEQA 2Y48A 4RB2C 1D0ZA 1WIEA 1TWAJ 3DXJF 1ETXA 4OOIA 1DPUA 1D5VA 2K3YA 4FE4A 2DL4A 2FQ4A 1HYOA 1QWFA 2EBPA 3X28B 2HFHA 1RUNA 4JZ3A 4DOVA 2RHIA 4U0VA 4XLAA 1R36A 5F64A 1KC8R 1AWWA 2EQRA 3ZQQA 3QYFA 2H27A 4XAXB 3C0CA 3J81E 4PCQA 1W2BS 4HX8A 1MMGA 4M7AG 4PJMA 4I76A 1FYNA 1UGPB 5GMKi 1X6GA 3DPTA 1UHSA 1X3ZB 3TDUC 5K5QA 4FX4A 3R6SA 1N6AA 1O3RA 3M55A 1FBSA 2K85A 1D8JA 2QEXI 4FX0A 2FSWA 3CUQC 4IHXA 1SFKA 3CO6C 3OS0A 1OZ2A 5FFZA 1AWJA 2E1HA 3HL8A 1JQQA 1BOAA 3N05A 4J83A 3LNQA 4F14A 1R00A 1CKBA 3O5ZA 1VQ6Q 5K5OA 2QGFB 4WF2A 1PD1A 4LIUA 4ZN1A 1Q81U 3WHBA 5F1RA 3GZ6A 3MQ0A 1Y71A 2AIRB 3ZGKA 4GYIA 3CDHA 1TG0A 4HLYA 3KFVA 1REPC 2YX7A 3E6CC 4BQNA 2O7OA 4KT6A 2VJJA 1W70A 1SG5A 2K3XA 2RM4A 3BDUA 2KY9A 2R92J 4LIVA 4OMZA 4XL9A 3M4GA 4M78C 2P5KA 2F4OB 1YHQI 3M0UA 1X43A 5KH6A 2IS4A 4E7LA 4NL3A 1NBEB 4L0YB 4XU0A 5A2QZ 3QWLA 2DMNA 3ROUA 2DL5A 2AKLA 1M90C 4A3DJ 1M5Q1 1K9MC 1U78A 2FYKA 3IKVA 3RESA 1Z3YA 4A0YA 3H3VK 3OYAA 4RTTA 3S17J 1EFNA 2M2EA 3W2WA 1D0YA 4A2UA 1T39A 1YS7A 1I50J 1X27A 4C5EA 2LQNA 1WHKA 4ATOA 4F52A 6PAXA 1PM3A 4DOZA 5CQYA 3RBBB 3BY7A 2FG0A 3C12A 1KQSP 1ZREA 3HFNA 4M7DA 2E5NA 1LDJA 1OCOH 2M5WA 1YNZA 2HAXA 1VQNT 1F9NA 2F5FA 1M8MA 4GBQA 3EG9A 1USTA 4CZCA 1B59A 2B63J 3INZA 5FWCA 1SMYF 1X1BA 2M7AA 2YSQA 3EPZA 1MSEC 3LLRA 2XIDA 3QOEA 3JCMQ 1TWCJ 2CMPA 2LQ8A 1BR1A 3P7NA 4HW0A 1ETYA 1Q7YC 1XD7A 5DCMB 1R49A 2ISZA 1GCQC 4BHPA 2EQKA 5CQEA 4PJOC 1YFNA 1SFEA 1G3YA 1D5YA 1XNIA 1H3HA 1OMIA 2CH0A 2GIZA 2PN6A 2EIFA 5CKBA 5DS9A 3ABKH 4DEXA 5FKKA 4ZTJA 2OU2A 1FMVA 2VQHA 4XR6A 3H0DA 4IHWA 3DP7A 4XLHA 3PNVA 2FB7A 2LQWA 4J9GA 2CP6A 2QGUA 3L2RA 3A8MB 4RTYA 4IHYA 2NUPA 2X35A 3TSZA 1R1VA 2Y9YA 1X19A 2HL5C 2DVJA 3BROA 3A1PA 4D8KA 2DNUA 2JN0A 5GAOp 1H0MA 1TH7A 2FBIA 2X0LA 3DKMA 2LVSA 3H9JA 4XU3A 1E17A 2VXZA 5IHNA 2R5MA 4EMKC 3AHUA 1IO2A 2GM4A 2M3AA 1JGGA 3L2CA 3CBMA 1JRIA 5FWBA 3F21A 1N75A 2HDCA 4F17A 2O01E 1Q81R 5EC7A 4UV9A 3A8LB 5KYUA 3QP5A 3DPLC 2M8GX 1P92A 1SANA 1XGOA 1VIFA 3EFOA 1ZBJA 3TGNA 4J6XA 2NAZA 4KULA 2OC6A 4CGZA 4J9FA 1NHAA 4C0FA 1PRMC 4II3A 4W97A 3ZMDA 5KYNA 2XGCA 2HYJA 3CJTB 4PSXA 4C92D 2WV0A 4XTWA 1WJQA 2QDYB 2IA0A 2K3FA 2K9LA 2DU9A 3DPUA 4WK8F 2HEOA 2WTEA 4KUMA 5IT9Z 3MP8A 3UA7A 1IGQA 2F2VA 3FJPA 2DPDA 3M8JA 1UGRB 1JBMA 5BPDA 4XSXF 1PCXA 4EMKA 1AVZC 2K4JA 1EH8A 3OIPA 4RTUA 2XMFA 2KGTA 3SFIA 2FEIA 5GP9A 1YTYA 1BW5A 4OAYA 4QSHA 2NVUB 2COWA 1YJWQ 4N4NB 5AONA 1LEBA 2ZNZA 4BDZA 3N5BB 4FTHA 5K7FA 1NG2A 1JUMA 4D1QA 1TXQA 3P5JA 2X6XA 5KAFC 4IUVA 2JA6J 4JLIA 2M9HA 2B0LA 1RL2A 2ZJQF 2ZFUA 1K0SA 3LWFA 3I56I 3A98A 4L18B 4M3EA 2ELJA 2HTJA 1J9IA 2LJ0A 2P81A 2GQVA 4M78A 2K3BA 1JKQC 2KT1A 4L5GA 1VQ7Q 2P7VB 1GL5A 3EGXB 2M45A 3S3OA 4Q5SF 3M0PA 2VXEA 1VQNQ 3AT1B 2LRDA 3MZ8A 4G6TB 2JA8J 1QP3A 4FW1A 3J81K 2BVMA 9ATCB 2EGAA 1QZEA 2CG4A 4L9VA 1ZSGA 4QVZA 3V42A 4YELA 2FQ3A 3MFKA 3OSVA 3J7YJ 5GAN8 4AM3A 2FNAA 4HF1A 4W1UA 2FU4A 5GAMj 1ZLKA 5F0FA 4MTEA 3K1PA 3WE2A 2DAQA 2RN7A 2J6OA 2RA2A 3MPUB 1KQ2A 2QVOA 1MBKA 1EV7A 2ZMEB 1Z0XA 3KP5A 4MHGA 2PVGB 1S72Q 1ZTRA 1SF9A 1K83J 4B48A 5ILVA 4XBFA 4MLOA 3IKTA 2QA4I 2BUDA 4PFZA 5ECAA 2ZFWA 5FU7C 1Y39A 4AMCA 1ZHIA 1OCCH 4DQ2A 4PDKA 2RJFA 3QYHB 2QQ9A 1RIOH 1PJRA 3K4CA 4BY6C 3FXJA 4MMKA 4Y3OA 1KQSA 1SVOA 3U23A 4J9EA 1QZYA 3RIRA 5GAMf 1RLQC 5IHKA 5DM6F 2QSFX 5FLMJ 1H92A 2RQUA 2ACJA 2BBYA 5H2FC 2EFOA 4AIKA 5EG0A 3G4SQ 2I10A 2JN6A 1H9TA 2ECCA 3IHUA 2LNVA 3K70D 4Z8AA 4XNFA 2O8KA 3URGA 4FE7A 1BIBA 2DFFA 1Y96B 4LNPA 2H09A 3T8TA 3NTIA 3OYYA 3ZP5A 4HCKA 4OIPF 5LHIA 2VBZA 2XASA 1YHQQ 2P0KA 3RQ4A 4E70A 4GRIA 5DY9A 4BB7A 2W7NA 2R93J 1TZLA 4X1EA 2K9GA 4ME7A 4KJZA 3MP6A 3GTOJ 1YRNA 1EH6A 3CCLT 2HQ5A 1E6HA 3VUBA 4C0ZA 1K73R 3ASNH 3PGGA 4M77F 4EJOA 5GANd 3JCMJ 3CCVQ 1I27A 4EMKB 1F5TA 3LX7A 3S8PA 3V8LA 3IV5A 1IN6A 1QO0D 1OJLA 3GTMJ 2CW0F 2K9SA 1MV3A 1SHGA 2OI3A 3CCQI 3A01A 2HOEA 5KYWA 3FJ5A 2F5DA 3HL2A 1QMCA 3QHSA 4ZGEB 4BJTA 1GUUA 1Q86C 2L3RA 2AK5A 3I56Q 4FISA 3A0HC 4CA0A 1KFZA 4BL0B 4OMFB 2L7FP 2KHMA 3HHGA 2DA5A 4JPBW 1E7OA 2MABA 4M3DA 2P0PA 1ACIA 5IN1A 2L4AA 4F93B 5GAOr 4A3CJ 3O3KA 2XAUA 3HTRA 1I81A 3ZMTA 2BXZA 1GFCA 2C0IA 4BXXJ 5H20A 2ZJRF 2IG0A 3PFSA 4JDSA 1Q82U 1LUJB 2K27A 1AHJB 2F5EA 1OCTC 2QSHX 4IUUA 2IP2A 5FU6B 5GAN4 1KD1U 3LSTA 3ONQA 1S6LA 4BEHB 2OQGA 4CYCA 4D5FA 3M4YA 3S14J 4Q4ZF 1MKMA 3G71Q 1YIJQ 4AC0A 3W2VA 1PG5B 3LSPA 1ZUYA 4UVAA 1ZSZC 1MSFC 2RNJA 4EV0A 4OF1A 3CD6A 3P8HA 3TKYA 1I07A 2WY7Q 4HSTA 1WHGA 2LKPA 1HKSA 2LDUA 2ZO4A 4RAGA 3NEUA 5BNGA 3IRRA 4A93J 2KPMA 2RI3A 3W6KB 3CCSI 2QQSA 1Z6RA 3HYIA 3OSSC 2L7ZA 1OR7A 3LA7A 3QIIA 1DUXC 4PJOG 2HKXA 2Y75A 3BR1A 1W36C 3QPTA 3FK7A 5J3BA 1BI0A 4KNYA 3WTWC 3G4ST 1VQ9Q 2XGXA 2W48A 3JSCA 1TQIA 1VQPQ 3CPFA 4YG2F 1VQMQ 2LMJA 3FRNA 3L7WA 5J47A 4GDFA 1LCKA 1HLVA 1SAUA 3CMYA 2EYQA 5J6XA 2CDTA 3HOTA 2W25A 4BHCA 3LQRA 3BTCA 3P9KA 5B3SH 1NYFA 3J81Z 4AWXB 3VS2A 4BDYA 4NC7A 1ABQA 2QAZA 3PNWC 3VB2A 5IPAA 1GLNA 3T9NA 3WTUC 2CU7A 2L5QA 1VQPI 2YHTA 3CP2A 1G6NA 1D09B 4QVDA 1VQ5Q 2LP5A 1AD5A 2HQEA 4LG0B 4LLLA 1FEXA 4A6DA 2KSSA 1IXSB 3VFZA 2XAFA 1VQ8A 3E0JB 2Z2SB 4X6AJ 2AZVA 4PUSA 5EEAA 3C7JA 3QU6A 2D6FA 5HNFA 2MG4A 2FMYA 2YUSA 1OU8A 2V1UA 1VQNI 2E41A 8AT1B 2XU8A 5IP7J 1MBGA 2IXSA 2QUFA 1YO5C 3GNFB 4XRSG 3TCJA 2CS3A 3HKZA 1WHUA 3HKSA 4AFSC 4C5IA 3CCEA 4HG2A 5LD2C 1WXBA 1WJBA 2ZCFB 5L8RE 4OP0A 2KDSA 1GCPA 5DV5A 3KEOA 2VKVA 3TL4X 4H0EA 4PGHA 5KYUB 2XSDC 1Y8QB 3BQYA 5CAIA 2V26A 1VQ6T 2W1OA 5JFRA 2CKKA 2PMHA 2KRNA 2YRVA 3I5SA 5TGTA 4OAZA 4N0BA 1ETWA 2QKLB 4V19K 2LY9A 1BB9A 3HB9A 4E47A 5HODA 2HYGD 4EM1A 3KFWX 3CC2I 1V54H 1NEGA 5D4SA 1V1CA 4I02A 3QU3A 4HAMA 2F2WA 2VUBA 3PIPA 3M3YJ 5KYXB 4QKUA 2H8HA 2EAYA 4B1RA 4AFQC 3GMEA 4IRIA 1QLYA 4M7AC 1SD6A 1T98A 2DJZA 4RCBA 1UE9A 3CCMI 3E1SA 3QXEB 1P9QC 1W0UA 1MNEA 4UC4A 2HOTA 4ENKA 3TQ7P 1Z3XA 4OMPA 3ZL7C 5LJ3f 2JA5J 4XLCA 1VQ4A 1K4US 3DLLF 1Z77A 1PSFA 5F0HA 1ZRCA 3H5RA 4OMMA 3JCMd 1ULYA 4MMLA 2RC4A 1SD4A 5EDNA 1WJRA 3WGIA 3WVDB 1X3WB 2DD4A 2K4YA 3EGXA 2RDPA 1B4AA 4V2FA 3NGPA 4OMOA 1T3SA 2P6SA 1MBJA 4ZGJB 2E64A 1FIAA 2HKNA 4I98B 3RTRA 2L3SA 3NMZC 5FB2A 1U2WA 3JRHA 3PIOF 2Y4XA 3PMIA 1ZH5A 4QQGA 1WPKA 1QVFS 2X1CA 3SZGA 5K5RA 2XAQA 3G73A 4XQ3A 1P2FA 2IJLA 1BJZA 2WA0A 3F8FA 5CKTA 5IAYA 1K9MR 4JJNK 3DWLE 1M90R 3A02A 4OIOF 1BU1A 3SDZA 1R8OB 3K4KA 2JJ7A 2JJ9A 2IGMA 4BE2A 3SWNC 1EH7A 4ZTFA 3J80Z 1V29B 2DL7A 2CRGA 4WWCA 4GGGA 2STTA 1J59A 1H8KA 1M9SA 2RAEA 3OL4A 2CV2A 1SRLA 2LY1A 2O5RA 2R7OA 4L9NA 5LLQA 5GAMh 4E6RA 5BPIA 1VQLI 4HVVA 3DV8A 2CYYA 4OINF 5HVQC 4R0KA 1WFWA 2YUQA 4Q47A 3S2WA 2XGDA 1NLOC 3TW6A 4OMLA 1H641 3ZQCA 3FXOA 2QSGX 4XTYA 3GOXA 4I6ZA 1FTTA 4M7DC 2DFIA 4A3KJ 4C3IJ 1YI2I 3LH5A 5ILUA 1EJ9A 3DB4A 2GLOA 2Y69H 3PM1A 4BUPA 3CUQB 2R5ZA 1KHIA 1OZ3A 3ZMSA 1D1AA 1PHTA 2DFUA 3FX3A 4ESJA 1S72T 2CZ1B 5J3LA 4QPQA 1KGSA 2VBWA 3VJPA 5E3OA 4UVBA 5TRDA 2K5IA 2Y2ZA 2GBQA 2RQRA 1RUOA 2EKOA 2G7UA 2HQRA 1IDYA 5GAOq 3VSKA 1ZARA 1KQ1A 2KAFA 2RK1A 4IURA 4Q5WA 3CJQB 2L7MP 3DBLB 1X6BA 2ED1A 3VRZA 5CKHA 3HXLA 1HSQA 2WADA 1UJ0A 4ZYGA 3JRBA 5M9OA 1G3SA 2EGEA 2ECZA 2VI6A 5LGNA 4OGCA 2EA2A 5FLVA 2NNYA 2A0FB 1W7PD 1OCZH 2N8GA 2W57A 3IWFA 4HOBA 2EZHA 5D4RA 3JCMe 2QYZA 2F5KA 4ELZC 2XSJC 5FKLA 3E5XA 1WJAA 4PLIA 4AUXA 1ZHFA 2XROA 2L3PA 3I59A 2DOAA 1D1CA 1W5SA 5LHHA 4RB3C 3I55T 1NJIR 2DTIA 1TP4A 2DMTA 2DOEA 4RM3A 2EJFA 2ZJ2A 3PT9A 4M75G 1KQ9A 1KU3A 3KX2A 2CSIA 1V55H 3BLYA 3C2BA 4PFOA 1ZQ1A 3DF8A 4KA4A 2D9TA 3MKLA 2KROA 2L3QA 1WJ5A 3JV3A 3HEFA 4IQ4A 2YUOA 3QDRB 4IUTA 5L3FA 4UXNA 1Q95G 2DL8A 3GCMA 1WQ2A 2EQUA 4F7UF 2EB7A 1VQMT 4CDGA 1KU2A 4BY1J 4FL6A 3E6MA 1YCSB 1GHCA 2ICWG 4NB5A 4RGRA 4IF4A 3W2AA 2KBTA 3RUXA 1NTCA 4S0HB 1AHDP 4X1VA 5CJ9A 2QBYB 1SFXA 1GCQA 4M71A 2CQNA 1FLIA 2L3DA 4JS5A 1O57A 3ELKA 1S8NA 2HPMA 1YITA 1YWOA 1JT6A 1ENHA 1I6HJ 3QG1A 2OTJQ 3D5RC 4HLXA 1NPPA 1ZA2B 2XDDA 3GW2A 2B86A 2HTSA 1JI8A 5FW9A 3MHXA 2RHUA 3S2DJ 1BM9A 2CWEA 2CUFA 2O0YA 1M90U 1K9MU 3NRVA 4KYWA 5BOXA 2RB6A 1VQ7T 4XRSA 3ME9A 2BY2A 1IUYA 2YU9J 4PZJA 4N4GA 4XK8E 5JHFA 4BY7J 4J00A 3F8MA 3G1LA 3QAHA 4BD3A 3LFUA 4I7HA 3EHRA 2L01A 2M30A 1B7TA 2M1HA 1YW8A 3DKWA 4RGXA 4J9DA 2DO3A 1PYVA 4AG1C 4J5YA 3LL7A 2R7UA 3KEQA 4CSWA 1P4XA 5HDKA 2G3RA 3SQNA 4ESFA 2Y0SA 2QGGA 4B9XA 3CC2T 2VQCA 3V7SA 1BW6A 3QWXX 2BOLA 3CCVT 5A2QK 4BXFA 1B1BA 1FTZA 2LT1A 3W6JB 1DGRM 4MQVA 5ED4A 3CMET 2EPFA 4CYCB 5ICGA 3VWBA 5CQXA 2DYRH 3RNJA 4LDVA 1C6VX 3OSGA 1HW1A 1DU6A 3G6ET 1U8RA 1XSVA 4DGWB 1JXOA 4FSSA 1T8IA 1K9AA 1IGNA 2IS1A 2DXCA 3LGFA 3JCMh 3RCOA 1BR2A 2KRCA 1KHCA 2Y30A 2NVQJ 3VS1A 2K5CA 1YFHA 2WAQA 5FKMA 5D6XA 3RSNA 1ZLMA 4A4GA 4RGSA 1WHMA 4U88A 3SWNA 2DK5A 2RHXA 2VV5A 1MJ9A 3X25B 1U5TC 2HL3A 2RH2A 4F7UG 4M78B 3SB2A 4M75E 3VS0A 2BZXA 3TSWA 2P8TA 4EVIA 1PUEE 3CLQA 1HDDC 3EUAA 1BOBA 1IRFA 1TUCA 3OYNA 2W00A 4EGZA 4RUGA 3K4BA 3REAB 3VYHB 3HOUJ 3CCRA 5EYRA 4M4ZA 3H9GA 4UV8A 4EEFG 2O2OA 2BEOA 2DEUA 3X24B 3KCCA 3V4GA 3H5NA 5GAOm 1LDDA 5LHGA 3ZQFA 3WGGA 1LVKA 1VQOT 4J19A 2A08A 5E8GA 4EMSA 1MBFA 2B8AA 4FYXB 3TREA 3CCJQ 3DLLA 4U7DA 1WSUA 1A6QA 3JRZA 1M2VA 2J5OA 2RNAA 4C5HA 3X2QH 2E12A 4M7DB 2XF7A 4OB3B 1M3CA 4EGYA 5CLSA 3HOZJ 1JHFA 2K9QA 3GTJJ 4C92C 1ZG3A 4NNJA 5DUKA 4NC6A 3BWGA 3I9V2 4F7ZA 2VE9A 3DEWA 4E7HA 5EEGA 2H6CA 1SFOJ 1APLC 2M8EA 2LC2A 1FYMA 5AYFA 3AL0B 1JJ2S 1SPKA 3VS6A 3OYBA 2FD5A 2JNGA 1S7EA 4G94A 3LW5E 2OTLA 2V8KA 1YHQT 2W4SA 5LGTA 5EG0B 2KMTA 2KQWA 1TBXA 3CMEA 2DLPA 1YJWI 3IQLA 5KE3A 4KIBA 5L3CA 2G6FX 3G6EQ 3S2HJ 1A5JA 4FETA 2VASA 2BHYA 2IRFG 3TO9A 3WXMB 1AWXA 1MNDA 2KISA 3FMQA 5IYBJ 2PJRA 4M3FA 3G1OA 3LSGA 3T1BA 2YRDA 2IGKA 3GNGA 2VC1A 2V79A 1JUSA 2LOOA 4P9UA 3G71I 2HKQB 1YE9A 1I3AA 2HVSA 1ZUUA 2KJBA 2O03A 1ZKGA 2Y31A 3PNYA 4IX7A 3JRCA 4IZZA 1HKTA 2ABLA 4QQDA 2IS2A 3CCUQ 1VQ8Q 2QLZA 1WKMA 4N9IA 1F43A 3DFGA 4A0XA 1VQLA 1JEGA 1UTIA 5A0DA 2M7BA 4IPAA 3GP8A 4KGZB 1AT1B 2E70A 2RQTA 4PLLA 1DDNA 4XU2A 2ID3A 5LRRA 3J80K 3RI4A 3GTGJ 1Q82R 1I4K1 3F8CA 3WU1B 2JQ7A 4KRTA 3IAS2 1LFPA 1OYYA 3BPXA 4P55A 4UHTA 2FJ1A 5M5XJ 2MSYA 5GTHC 3GX4X 1N8RC 3TEDA 2JWTA 1YYVA 3CC4I 2HR3A 4LLGF 2OTLQ 4RAZA 2VQGA 4LD5A 4BACA 1QVGP 2LP0A 1R4MB 3L2VA 2KFDA 4D5CA 1ZGWA 3L2QA 2E2JJ 2O4XB 2ZSIB 4N4HA 2AO9A 1QBJA 4RS8A 3M8EA 1WQWA 1Q86R 1FZPB 3KUFA 2Y0MA 5CKFA 2GTOA 1M2OA 3H5AA 1T56A 3CZ6A 3OYLA 1WZOA 2FPEA 1N25A 1ON1A 3S16J 2C06A 1NH3A 2VGNA 1T3LA 1X2NA 3X26B 4ZH4F 1XB4A 1RAFB 2JM8A 2X1EA 1J5YA 2DQLA 3HPGA 2VJ5A 2CP5A 2FO0A 5HCKA 1AOJA 4C92F 4PJNA 4BQQA 3OBWA 4I01A 3FIWA 2XAJA 2NS7A 2JSCA 3OL3A 1MHNA 1S29A 1L3LA 3HTSB 3I54A 3H36A 3UT1A 5DD8A 4L59A 3OWTA 2EKHA 3LSMA 1ZSZB 2HNIA 4L9TA 3H0IA 3BR5A 4G12A 2LD5A 4JJDA 1U8BA 1T0FC 4NOYA 2F2EA 1OOTA 1A6IA 3VS5A 2F5VA 5IT9E 3F22A 3JCUC 3MEUA 4J9BA 3I59B 4LUEA 3LAJA 2O6GE 3TEEA 4XORA 4A3BJ 2LRQA 1RNLA 1QPIA 1HA8A 1YW7A 1MMAA 3L00A 4HF0A 2LX9A 2GBYA 5E1WA 1S3JA 1OLTA 1WXTA 5BS6A 1U5SA 1KU7A 1VQ7I 4UUSA 3J7AY 1T6SA 2D2WA 1UGSB 1E6GA 1PVEA 5ICEA 2JPBA 5CQGA 1TUDA 2M02A 3CC4A 3SJMA 4ZNXA 4BE1A 3HM5A 1WNLA 1VQKT 3RZOJ 4XONA 4DOWA 1IN5A 3RDIA 2D8JA 2ZNYA 2RI5A 2V8JA 2GOMA 3I56A 2NVXJ 3OMGA 4OB0B 4LDWA 2M16A 3OYDA 2K86A 1O7FA 3HIFA 5TISC 4D0PA 3L1PA 1TS9A 1K4TA 3PTAA 5D6WA 2R5YA 1YBYA 2BE7D 1QQIA 3QYGB 1JKRC 4WXHA 2M1BA 2GTJA 3P8BB 4EJWA 1SKUB 2CQQA 1OKRA 2ME0A 1IO6A 1BI1A 2IEKA 1AOYA 2CYZB 4DJAA 5KNLA 5GAN2 2MH9A 2DE0X 1FBUA 2QI2A 4RMOA 4FT2A 2PFBA 2Q2EA 1U5TB 3M7GA 2J5PA 2V1XA 2XF5A 4CCJA 5I2MA 2VJ4A 4ZZDA 2CGPA 1YJNT 4QPOA 4L5EA 4FQGA 2FA5A 2X1DA 2EK5A 4JX6A 5CVJA 1WWXA 5DD4A 4BS9A 5HK3A 1WGSA 3WVEB 2XD0A 3VYUB 3JB9F 4HNUA 2FF4A 2K40A 2LTPA 4DBRA 5LJ5e 1K79A 2KXDA 1K6OA 3IC7A 3R4KA 5DCFA 3TP0A 2DPPB 2L9NA 4KUIA 4C8QD 2PUKB 2RJCA 1I0CA 3E19A 4FYYB 4R56A 1MMDA 4LK0F 5FD5A 3OMCA 4A3FJ 3H3ZA 3SD4A 2XC7A 1WI3A 2DMUA 2EZKA 4IUQA 1YIJI 3QO3A 4KIGA 5E18F 1NM7A 2DRMA 1JKPC 4LDUA 1CF7B 4K2EA 1JXSA 1UB4A 2WSCE 1JKOC 5J40A 1BA5A 5J39A 4MDWA 1ZK8A 3JAMZ 4XTVA 1FP1D 3CCLI 2NS8A 2E34A 1R0BG 4M7DG 1V5FA 3D7SB 1P4WA 1ZLJA 2E4HA 1G83A 2QTVA 4CC4B 3LMMA 1VQOI 1TUGB 3I55A 2QEXQ 1A31A 4BU2A 2CP2A 3JCMc 3FWEA 3GYHX 3JCMb 2FOWA 2JVGA 4PKCC 3F70A 2VE8A 4RCCA 1GBQA 2ROLA 2RN8A 1VQMI 3I64A 5C4XJ 5GAGJ 2YUPA 3E2UA 4M77C 1RKWA 4WCGA 2DMOA 4C8QE 1X2KA 3MKYB 5HDNA 3A4CA 1RRJA 1RI0A 3G6EA 1JHHA 3Q9VA 4XLEA 2KT0A 3NWSA 2L2OA 3HOXJ 4LGWA 1JO8A 2X85A 3ERED 2COZA 3FLGA 3J7AO 1UFFA 5B1AH 4BH9A 3OA6A 1WFXA 1YW9A 3CD6Q 4CCLA 4LITA 5FJ8J 3CMMA 4S05A 1TU0B 3VSLA 2ZXIA 3E97A 4A53A 2DEQA 1IAWA 2TRTA 1K4SA 2MWOA 2WACA 4J9CA 2QYOA 4DW6A 2A28A 4E7SA 1IZ1A 3GBGA 2NUTB 1YI2A 3PQKA 4RG8A 2DMPA 1YJWA 2DFHA 2XHKA 3DEUA 3OYHA 2IW5A 3KP3A 2WAEA 1K78B 3QODA 2ZBKA 3FZVA 1POGA 3PUFA 3SDGA 1PUFA 4B43A 4M3GA 1LVAA 3A0BC 1VF9A 3QBYA 3CC2A 1RLPC 3ESWB 3K69A 4TV7A 5GAMd 2JA7J 2EW3A 4XLFA 3UKGA 4JJBA 1G4DA 1Y07A 3E9FA 4IUPA 5EGOB 1HCRA 3CCSQ 3BJ6A 4KH0B 4PSWA 9ANTA 5GTIC 2JSPA 3M53A 3OIOA 2KRHA 3JB9I 2VODA 1HOMA 4RLQA 4M75B 3QP6A 3W3CA 4AG2C 1ACMB 4PFPA 4R79A 2PTKA 4EPCA 2BTTA 2HXIA 2XRNA 1KONA 1V4RA 4D7MA 3QPHA 2RQVA 1KZHA 4FYWB 3CPWA 1ARKA 1O4XA 1QGPA 2YXYA 1I1GA 4D6WA 3JCMV 3ULQB 2A7YA 2L0KA 4C0GA 3EG0A 2MLGA 4AYBA 2AQEA 2EV5A 3L2WA 3C1DA 5CVIA 1Y0UA 3IH3A 3LSJA 4LG3A 4CH7A 1PKSA 2WC2A 2E35A 5FLXE 1CF7A 3CLOA 4MZMA 3RMSA 4EMGA 3V8JA 1ETQA 4B6MA 3ABTA 3CCMQ 3F23A 3OS1A 3CJRB 2PVOB 1M1KC 2RMOA 4M7DE 4HT9A 1TQPA 1MUZA 4HQEA 2X6OA 3EG1A 4M78D 4BI8B 4M6YA 3AKZA 4EDUA 2JZYA 5LJ5j 1P4AA 1ZYRF 3VV0A 4C8QF 4XKCA 1FT9A 2E1OA 2X4HA 4XK4A 5D8KB 4C92G 1ZAOA 1F1BB 1WPYA 3GBQA 2R7RA 2L9RA 5DM7F 4LB5A 5D7UA 1IXDA 4A12A 3FBNB 1T2KA 4BBSJ 2X3XD 3HGYA 2LG4A 4FU6A 3BY6A 1FIPA 1W6XA 4KUDK 3DTKA 1K76A 5KYXA 2KIMA 3BZKA 4M72A 4M3BA 3I71A 3MWMA 3REOA 2LCLA 2COBA 2OJ2A 3VRYA 1XGMA 1UMQA 5GMKh 4FYVB 1YP5A 4M74A 3CCSA 1K0XA 2JMAA 4RAYA 3H0FA 4B09A 2RK2A 1WJEA 3O8HA 2V9VA 1LB2A 3M1EA 1FNNA 2I0NA 5CO7A 1D8KA 1HD3A 2KMUA 3PO3J 1WXUA 4ENMA 2DXIA 3CMAT 3GIBA 3PFIA 4Y33A 2NUTA 1WJCA 2O9VA 3SWNB 1Q1VA 2CQKA 2K3PA 3L1AA 2LDMA 3EYYA 4ZJZA 3JRDA 1QCFA 1RR7A 1LKXA 2X6WA 4GCVA 5ERIA 1MD0A 3F0CA 4OIRF 1OU9A 3UATA 3PL8A 1U9NA 1UHWA 4MFEA 3Q9SA 4Y28E 1KD1C 3EG9B 1LJ9A 2DDAA 1WCMJ 2A6HF 4PJLA 4Z2YA 5DUIA 1XMAA 2BY3A 3OYGA 3TQNA 4NS5A 3CMAA 3K4MA 1Q82C 1TL8A 1XQHA 1WI7A 3WGHA 3BCBA 4P5OA 1NG6A 2X4XA 3TBIA 3O8VA 3ZOBA 2W10A 1KG1A 2SEMA 2R7WA 2OAUA 4RB0A 2NLUA 5I2SA 1R4NB 1OI1A 2X4YA 3C94A 3CCEQ 3BCAA 1XCBA 1M1GA 1VQKA 3FKIJ 1AWCA 3HSRA 2TDXA 2PI0A 1YITI 1QVUA 5J1YA 4A3MJ 4EQQA 5EJCA 1G3TA 1GDTA 2VIXA 3OYFA 3KE2A 4R1HA 2COYA 2YX4A 1GXQA 3SHWA 2UXXA 3ZQHA 4OB1B 3I55Q 5F08A 4YFKF 2ZCWA 1Y0MA 2ZXWH 3FEOA 2CFOA 4HQMA 3V8KA 4MO7A 1W1FA 2R5YB 1MZBA 2O88A 2R57A 2JTMA 2BV6A 2BZ8A 2MC4A 2CP3A 1KD1R 3D5SC 2OA4A 3KETA 4CYDA 4BNCA 2R7XA 4E4HA 2AHJB 2YLCA 1X4PA 2A5YB 3OMYA 2YDLA 2HBWA 1TWFJ 3CBOA 4P96A 2VXDA 2ZB9A 4CUGA 2E6NA 4HZFA 1MBHA 3R0JA 2FRYA 2VUMJ 3I55I 1VQOA 2ZPIB 5IHIA 2L7KA 1ZUKA 3HHTB 3BJOA 4F55A 2XAHA 4KH1B 1IN7A 1C1AA 1BIAA 1U0JA 1K6YA 2P0WA 5ICCA 4A3LJ 2CH4W 3K10A 1RAGB 4G7ZF 1YX3A 2OQRA 2OAZA 3FBIB 3KP4A 2DTRA 3KP2A 2R7TA 2X4JA 4A3IJ 4IXAA 2HVQA 4LXCA 1VQ4T 1VQ9A 2F5CA 4B47A 2OCCH 4HKEA 1C0MA 1FBQA 4WCIA 1QVFA 3K4NA 3FXRA 3V7RA 3QKJA 4UUSB 4A5MA 1W5TA 4C30A 5FU6C 2A05A 5DYMA 2XKOA 1K8AR 3M8FA 3ZQLA 1KA8A 3WTYC 2LBFA 2MD0A 3DEEA 2CJJA 3SEQA 3PIPF 2HOSA 2GXBA 4JRIA 2JZ2A 4D8DA 2WAQN 2LKXA 1ETOA 2MYSA 2WB1A 4KISA 1VYUA 3ABLH 1TTHB 3TVTA 4KN4X 1WZ2A 1D1BA 2QQRA 4IVNA 4A54A 1X4OA 2Z16A 5LJ3j 4MGRA 3OR1C 3BC8A 1CSKA 2LLKA 3OYKA 5C44J 1UAAA 4M75C 2NS0A 2JA2A 2DILA 2J06A 1LE8A 5GAOl 4Y7NJ 1BI2A 2KI7A 2DTHA 3CCQA 3UNGC 5HKCA 3KLOA 2Q2EB 4XRMA 3GTPJ 1B9NA 3A5ZB 3H6ZA 1XJWB 2D8HA 2E2IJ 3OYJA 1TNTA 4J7IA 5HY6A 1JXMA 2NVTJ 3VYGA 3E5QA 3G2BA 2E7WA 3VODA 3JAMK 1CGPA 2K02A 4A0ZA 3S1RJ 2D5VA 1WA7A 2E5QA 3JREA 3EGDA 4UVCA 4UY8I 2F6CA 5F27A 5KVRA 3BG3A 5JLXA 2PMZA 4HXJA 1S5LC 2LQKA 4Y91A 3F9KA 2ME6A 3LOCA 4DBHA 2VGMA 3BOQA 3NTHA 4M78E 2M9UA 2CUBA 3Q1JA 2HPIA 3CC7Q 1TW2A 1PWTA 1DGWY 2RREA 4OMNA 1MNMC 1F1ZA 5IT3A 1Y7XA 2L8DA 5LJ5g 3CXCP 5F0CA 4AYBN 1IGUA 2NOJB 1QVGA 3DQVC 2NUZA 4AFUC 3CXCA 4M7AF 3K4JA 1YWPA 2ZXJA 3LAPA 1VQKQ 2CREA 5JR3A 1XN7A 5E1XA 4CO8A 1GV2A 1WLPB 4J8OA 2LCSA 3WHCA 1TNSA 5J4YA 2UXNA 4IOAF 2PMUA 2VLAA 3F6OA 1L0OC 3FMRA 3VYRB 1ZG1A 5M5YJ 1R0CB 2YUNA 1T08B 1PUFB 5KYYA 1KQ0A 3GF5A 5J8CA 1OQKA 3G7ZA 2D45A 1T0FA 4C92B 1YITT 3IL2A 4JBAA 2JPCA 4A6EA 2XI9A 2YRCA 1GXPA 1PD0A 3OY9A 2QA4T 3U1KA 3A8OB 5K1YA 5JI6A 1P6RA 2R7ZJ 3EG3A 1Z67A 1R71A 1J2XA 3JCMX 2VB6A 1KYZA 2QA4A 2IAIA 3RPQA 2O8XA 3U9GA 3ZN0A 2OD5A 3G1JA 4ABZA 1W0TA 3WTXC 2HQAA 3BG5A 3GWZA 3D5LA 3HHHA 1E3OC 2KXCA 1PSEA 2EILH 3K2AA 3S1MJ 2XV4S 1SVLA 2XB0X 1ON2A 2MH2A 1SRMA 3RZDJ 2E3IA 3GZNB 3HPWA 2FOKA 4Y52J 3I35A 3VS4A 3SYTA 3VU3C 2DX1A 5H6RA 4NUBA 1UG0A 3M07A 1WYXA 2XDBA 2VC0A 1NK2P 1FC3A 2E36A 4NQWA 4RBOA 2YS9A 3FHZA 2VOPA 2L0AA 3L2ZA 4M75F 1UCRA 3I4NJ 3UA6A 1MBEA 3ZXSA 2UV1A 1VYTA 4EMHA 1VQOQ 2LR8A 3HRMA 2PQWA 3QUIA 4C9YA 2J7IA 1UJYA 3NQOA 2K57A 2DL3A 3OYEA 2HQXA 3GFMA 1B07A 2NYXA 1U1TA 4RTXA 3FDYA 5HOOA 2K79A 1M1KU 4N4IA 5CYVA 4DYCA 3OIQA 3FK6A 2HI3A 3JTGA 4LOCA 3C95A 2OTJT 1U6GA 5D5VB 4J01A 2CUZA 4FASD 1PP8F 5DDGA 1CQTA 2X4WA 1VQLQ 2DERA 1OFCX 4D7NA 3LYIA 1MJAA 3CMEI 3LSKA 1B8IA 4CHUA 2ETHA 1BI3A 3EDPA 2AHQA 1MDMB 3KZYA 4II2A 3AG4H 4CRIA 5B1BH 3GTQJ 2VVKA 1IJWC 2XPUA 3G6EI 2GNCA 4XIDA 5LJ3d 2M4GA 2DA4A 5DCMA 2GCXA 1WGXA 2DT6A 1VQMA 3E7LA 1MH3A 2HWVA 2V1NA 4BGDA 4HV5A 5L3GA 1BN5A 2L54A 5FRMA 2NYSA 1UG2A 4LFUA 1X3UA 2K9MA 3CCET 2M87A 3U1DA 4BE0A 2PNIA 1PDNC 2DD5A 1ABOA 1LEAA 5LJ5f 3GZ5A 4AU7A 4J7FA 2Q1ZB 2WSFE 4F7UB 1A04A 1KIKA 4I99C 2JTFA 2MGQA 2HS5A 3BQZA 3CTAA 2LFBA 1K73C 1SD7A 3EH2A 4XICA 1H8AC 4LLNA 3DBRB 2CZ7B 4B4CA 3CCJI 5M5WJ 3GLLA 1SMTA 5B66C 1M27C 1V76A 2Z0WA 4FT4A 1VNDA 5TJJA 2EA4A 2EYZA 3BZ6A 2HDDA 3CCJA 3S6WA 2HGCA 3JAME 2YWWA 2DMQA 3U21A 2JT4A 3F8BA 1Z9CA 1BBYA 2P4RA 3KP6A 1J3TA 3CBPA 2DT5A 2PJRB 2R4GA 5FU7B 1I3QJ 2RGVA 3F3XA 2RHYA 1LNWA 1W36D 5GAN5 1BC8C 2R7VA 2EFWA 4IRHA 1H9GA 4OB2B 5IOZA 3PE0A 4VUBA 1OV3A 3H0HA 1IRZA 4JQFA 1YCYA 4J9IA 1ERDA 4WX9A 3H41A 5IP6A 4JS4A 4XTUA 1JJ2A 1PP7U 4YTLA 2A07F 2LSOA 1UG1A 1AWOA 1N77A 1OYIA 3H8ZA 4XU1A 4XMYA 3S32A 2EYXA 4RTVA 5GAN6 2A5WA 1HKQA 3S3MA 4HX7A 1Y8RB 4XOTA 2F4IA 2PJPA 3J7ZI 2R58A 1TWGJ 2FPFA 1MIJA 2A6EF 2XF6A 5AIPA 4PGGA 3HOSA 3QRFF 1WJSA 3CCQQ 3CCMA 4B9WA 1R6RA 2NVYJ 3PO2J 2KR3A 3OYIA 1AZEA 1N5ZA 1QRYA 3VOEA 3GPLA 1IN4A 1O3QA 3EQLF 3HSBA 3CDLA 3ZEHA 3M0RA 3E6BA 4WXCA 2PU9B 2DIGA 3HZJA 3OW2P 1BKBA 4MQ9F 4XKVA 1OCRH 3ER0A 2EJGA 2R3SA 5D6YA 4Z02A 2LJ1A 4L5IA 1JJ2P 2JTEA 3QZ5B 2KZVA 3CCUT 1YHQA 1YOVB 3M1CA 5HLHA 2KK4A 3WODF 2XKPA 4HRIA 2GZWA 3MCZA 3O2PE 4KN7X 3M9AA 3PUBA 2ZPEB 4A4FA 2CT4A 2HSPA 5E17F 2M51A 2XB5A 3PVLA 4M7DD 4MEXF 2GOXB 2EIJH 3CC7T 1KU9A 1LDKB 2LREA 2LBFB 5L3BA 1ZSZA 2FVUA 3GO5A 1GVDA 3M59A 1I39A 5GANh 3JCMP 1O7LA 2A6TA 4DZPA 1JB0E 2JVHA 1DU0A 2ISYA 1XTAA 3CC2Q 4HV6A 2X6YA 4QWQA 4XRFA 2R0QC 2OTJA 2G0EA 2JT1A 4M6VA 2NWMA 1TW3A 2CQXA 2H6BA 2HZTA 4UUTA 3RPUD 5EF6A 1RUWA 4K11A 2KL4A 2DN0A 2K2VA 4U0YA 1OPCA 4HT8A 2XDVA 2JMWA 3KP7A 1TSFA 1AKHA 4F3QA 2E1NA 2CS7A 3K9TA 4GYGA 3QPLA 4GXOA 1JU5C 4EJTA 4XKWA 3MEWA 1YJWT 2Y4YA 1TT5B 2W24A 1YQAA 1UZCA 4M6XA 1W4MA 2K5FA 3HOVJ 1YITQ 3HUGB 1YIOA 2QKMB 3DTIA 1XG1A 1U3EM 1VQ9I 2FEZA 1QNTA 3AFHA 3EH1A 1XOVA 2D1VA 1M3BA 2MLKA 4HVWA 2CV0A 4L6V5 3CPWS 2F48A 3VS3A 3CXCS 1QVGS 3C2HA 3BJAA 2VWFA 2BVLA 4B3AA 2YT6A 2ZPHB 1NLPC 3R60A 4FW2A 4Y92A 5I11A 1O3SA 1YRNB 4F7UE 4Y17A 3PSFA 3BR0A 3HSFA 2A3LA 3PMTA 2VPRA 3VEPA 3BPVA 5GPAA 2I2LA 4P9FA 2P4TA 4XQFA 6AT1B 4PJOF 1QA6A 3K1MA 2E2HJ 3S3NA 1JUPA 2LZ6B 3JCMg 2E71A 2QENA 3M0SA 2FZGB 4G9YA 1N27A 3LFKA 3E5UA 2K6DA 1RAAB 2RQQA 4Y4RA 2LNHB 2NUPB 3JR9A 3HC7A 1PKTA 3I5RA 3BG6A 2VONA 4BY6B 2KIUA 4J6WA 2WY8Q 3CPWP 3HGGA 3M54A 1K7AA 1G3WA 2EZLA 3K4LA 1IN8A 1E3PA 3CF5F 3W6VA 2CUDA 2E65A 4C92A 1GVJA 1SSHA 5AT1B 3CMAQ 4HVUA 1R58A 4MEYF 1O3TA 1Q7YR 1ZRFA 2RHZA 4JRKA 5GAEJ 3IWZA 1YJ9I 3GEZA 1VQKI 4MFDA 1Z21A 1QCNA 2DK3A 4F91B 3OOPA 5HLGA 2XUBA 4BI4A 1OULA 2QF7A 3KPHA 1ZR4A 2HYFA 3IUOA 4XLNF 2EV6A 2VQLA 4O5VA 4CC3A 2VOOA 1SSFA 4A63B 1XCVA 2DRKA 1V3FA 3CC4T 1UJ8A 2ZC2A 4M7AB 2DJIA 1OPKA 4U0WA 2HCKA 1GRIA 2STWA 1RAEB 1E2XA 3K7AJ 1WI9A 5FLXZ 2MA3A 4EJUA 1HSJA 4X0GA 3LH0A 4AIDA 2UWMA 4ZGDB 3JCMW 2JK3A 4OVAA 1D0XA 2AQFA 2ZSHB 5HNHA 2J6KA 1ONVA 2L89A 2GA2A 1H89C 3IP4B 3GXOA 4BJ5C 3N4MA 1JGSA 5C3EJ 1ETKA 4EJVA 4DBQA 5I21A 5HDGA 1M4ZA 3I5UA 3FXMA 5JVGF 2CQ7A 2GQQA 4LB6B 3DTEA 1GT0C 2ESWA 3AL0C 1IHWA 4TVRA 2DA9A 4ELYC 1BK2A 3CCLA 4KGVB 2CGHA 1VQ8T 2E3HA 1FOYA 5KYYB 1DP7P 3NHNA 3H1CA 1U9OA 1SHFA 3SZPA 5D8LB 1OX9A 5LFAA 3CJNA 5EZGA 1B34B 3HUGA 2OV7A 4G8XA 2DAOA 4DYQA 1V5EA 1W1WE 2ENMA 2LF8A 4RGUA 4O3MA 1YX5A 2K2MA 4C3HJ 4QLCU 1K8AC 4HCCA 1ZG5A 2YLBA 1MGQA 3LGLA 4XKBA 2LY2A 5DM7R 3E9GA 1OX8A 2DVEA 3GFJA 4E7IA 1I8FA 1R23A 4IOCF 5F1JA 3PVQA 4MDXA 2L2PA 2K4BA 3M4OJ 1VFCA 3QSUA 1RR8C 1XSXA 2RJDA 3FXQA 2YSRA 2A69F 3TO6A 4X34A 2AXLA 5CVUA 3WTVC 2KJCA 3SFMA 5CVRA 2QEXT 5GAN7 5HS9A 2WWYA 3UPUA 2E7XA 2C6YA 3DB3A 2MD5A 2OZUA 1H88C 1QKXA 1T38A 3A8HB 1WX6A 4JK1X 4BAYA 4UNOA 2ZAEA 5A2QE 2QQBA 2E10A 1DPRA 2LMDA 4NC8A 2CW8A 2Z99A 3R61A 3SFZA 1NZ9A 1IUFA 1Y1WJ 1XMKA 1QQJA 2P6TA 4C3JJ 3EFSA 1HXDA 4U87A 4AIHA 2K7LA 2V9PA 2ZGWA 3L9FA 1JJ8C 2VBYA 3NPFA 4ZYHA 4V2SA 2MWPA 1STZA 4ZC3A 1XDUA 2ESHA 4ON0A 3M56A 2BGCA 1X01A 2GXGA 2OCEA 2RO0A 2C0TA 5FRNA 3B6AA 3EUHA 5A0GA 2QQAA 1YJ9Q 4L5JA 5E20A 3HDDA 4F04B 3VPRA 2HDWA 1XTDA 5DLOA 2IVWA 1IB8A 3UDCA 5K7HA 3H9NA 1K8AU 2EFNA 1YI2Q 1QVFP 2JM9A 3JRIA 3UR3C 5ICFA 2KNBB 1D3BA 4XLPF 1MDMA 3JW4A 1FY7A 3HBLA 4H4KC 4X9DA 3JB9J 3CUOA 4B8XA 2CSOA 2HD0A 3M9QA 4IHTA 2GXAA 4KMFA 1KK7A 1RETA 4I2OA 3QWYA 2IA1A 5FGMA 8ATCB 3PFYA 4AVZA 2DYSH 4ZYDA 2Y9ZA 1J09A 1ZELA 2MBFA 4XN0A 1HC8A 2DA6A 2OBPA 2RI2A 2KIQA 2P5LC 1RADB 2FRHA 1J75A 1TC3C 4G7OF 4RA2A 2LVMA 3G1MA 2XG8D 2CH4A 2GGRA 1N8RU 3N97A 3FM3A 5EEHA 1A0NB 2EV0A 4ASNA 2JMCA 3EGUA 2H94A 2HXOA 3IAM2 2KVQG 3OW2S 1B72A 2QEXA 4HYEA 3Q3SA 1AZGB 2F1LA 3R6NA 5LJ3h 3SEMA 3PNTA 1BJAA 1M1EB 3QJ6A 1R5HA 2V4JC 1X1PA 3ZFJA 4AFZC 4RG2A 3QZ9B 2P0QA 1LE8B 5GANg 2IGOA 1WRJA 3VKIA 3SDBA 5D5UB 3ZBDA 3F72A 4E7JA 2KKOA 5LEKA 1I5OB 4JP0A 2M34A 4XN3A 3ZPLA 5L23A 1VQ9T 4JYKA 2KZGA 1IC8A 1VQPA 5D6EA 1EKEA 3KYLA 4C8QA 3CCMT 4MTDA 3VDXA 5GJVB 1IRXA 1Y0NA 1ZA1B 3IRQA 4IO9F 4OMQA 4ETSA 2QWWA 3ML6A 5GANf 5F6FA 2VC8A 5DTDA 4EIKA 5HK0A 2KLOA 1R77A 2DTOA 3FM5A 3META 2KDOA 1EX4A 3K0LA 4A5NA 1SC7A 1SD5A 3UWNA 3A03A 2RD1A 3T8RA 2JUCA 1NG7A 2K9NA 2W85A 2L9SA 4HDVA 1RPWA 4N9HA 2E5KA 3X20B 1W7PB 1BCOA 1VTNC 1YIJA 3JB9D 5C6SA 5HS7A 2QASA 1Q7YU 1HW5A 2X51A 1LFUP 2EJ9A 2BZYA 2MI6A 1R1UA 2W82A 5JLWA 2CP0A 2B7EA 1AU7A 5B5EC 3R0AA 4ENJA 3MO8A 1G59A 4JRPA 4YEJA 1VA7A 4BI3A 2LC4A 1KJWA 4PL6A 3ERMA 1QW1A 1JTXA 3HRUA 3CUQA 2R5ZB 5LRSA 3MMYB 1OISA 5D5WB 3ZRGA 1K61A 2RF0A 1P7IA 3Q5FA 3G71A 3KYCB 3P9CA 3JSPA 2FZKB 3HG9A 4UB8C 5L3DA 1QHGA 2BHZA 4PJOE 2W0ZA 2DQRA 2E5ZA 2ID6A 4A69C 2KDZA 4BXUA 1RC9A 1FYKA 1RABB 4BYYA 4M77E 3ULRB 4C8QC 2VXFA 5J26A 2ZMEC 3RDVA 1UELB 3H9QA 4HDUA 1LPQA 4IQJA 1RAIB 2FRWA 2A3SA 2D0QB 2FBHA 2DXBA 1B6AA 4HA8A 3JRGA 2C0OA 4JZ4A 5GMKm 3RPUA 2PX9A 1QZZA 3BTLA 1KQSS 4G7HF 1FMWA 4HCBA 3BDLA 2FX0A 3FXKA 3KLNA 1RKTA 5KE2A 4YIFA 3BP8A 4C5GA 3V7CA 2WSEE 1W4SA 2XVCA 4CI0C 2V7FA 2MCNA 1GXIE 3K1NA 5D5XB 2E1CA 1XMXA 4KGXB 3WE3A 3G71T 5AIQA 3MZYA 1UEBA 4BQAA 1Y1VJ 3VYTB 2WV1A 2HZYA 4ITVA 4LE9A 4NL2A 1WH5A 3J7AF 5LJ3e 1UFMA 1X58A 3COAC 2XDPA 2XHCA 1HW2A 5CR2A 1LPLA 3JRFA 2CSQA 4J6YA 3RKQA 1S72I 4B3XA 1BL0A 1QWEA 2O9LA 3CCVA 5HLIA 2KE9A 4M78G 2RNGA 3NWTA 3WTZA 1F4KA 1B8IB 1F36A 2DIQA 2VL8A 2DODA 2JRMA 3EETA 4M77G 3EAEA 3G4SA 3CCRT 2GF7A 4QVCA 2EFQA 3OYCA 5LEJA 2HU9A 4ESRA 2A68F 3BT9A 1A35A 2GIVA 3MAJA 1RI9A 1NK3P 2ATCB 3MKDA 4A3EJ 2HZDA 1VQ4I 3OSFA 1XGNA 2IPOB 1K73U 2R7FA 2DETA 2DYIA 3B6CA 3WTSC 3SZTA 4C0DC 2PZ1A 2COMA 3GLXA 4ZYEA 2FL7A 4KT0E 1UHMA 2P84A 3EHQA 4M9SA 2EH3A 3OV8A 1DQUA 4MIMA 5HLTA 4M75D 3M0QA 2OPTA 4KMUX 4JLGA 3F8NA 3ZCOA 4OMYA 2EBIA 2RJEA 2IGNA 2CO5A 3C2GA 4RTWA 4PJOD 1SEMA 2KYBA 2O61A 5E79C 3EYIA 2BZTA 1XPXA 2QK0A 3GFLA 3NARA 3CCUA 3JB9G 4A3JJ 2V1RA 2K5LA 2H1KA 3CCQT 3NTKA 5IYCJ 1X1AA 3L2UA 2KYMA 1FWZA 3DCFA 3DU5A 2P7CB 1HBXG 1T95A 3VS7A 2NOGA 2A36A 4KT5C 4LD9K 2IS6A 1UUEA 7AT1B 3T5XA 4F7UA 1VQNA 1EF4A 1N9SA 3CMEQ 2DA7A 3HRSA 4MNUA 3QJYA 3DBHB 2DI3A 1HDPA 4XM3A 3SXYA 2JW4A 1HSTA 2IPQX 1DP3A 3HTUA 1MW7A 2OX7A 2VBXA 4FIBA 4C0DB 1M1FA 4RTZA 1HK9A 2K7AA 2HQHA 2YR2A 4BQOA 5GPCA 3MZHA 2Q8KA 3RJPA 3ASKA 2PG4A 2O3FA 3VYSB 1Z9ZA 4M7AD 1HJDA 3D0SA 3CF2A 3EUHC 1EIFA 3JCMf 3J80E 4HF2A 2V6CA 1RAHB 1UDLA 2GAUA 2EYYA 3GF2A 5M3MJ 2OTLT 4E7KA 2EINH 2KRSA 3H0GJ 2WAFA 2EQJA 1SVMA 2F5TX 2XKOC 2EFPA 2LH9A 1XC5A 1W5CC 1B34A 3DLAA 1N9RA 1EZZB 4P5NA 5CKDA 5GAN3 3HOYJ 4NQWB 3TOBA 2MC3A 3DLMA 4HPQA 2XGEA 2VT3A 3ZMUA 1WHHA 2GFAA 1ZR2A 2VKNA 3CO7C 1BC7C 1QVTA 4WXDA 5CPRB 4F92B 2QG9B 3CCRQ 3UF4A 3BR2A 2G9WA 3RERA 4IKFA 3K70C 2F2XA 3BG9A 2MIOA 4CC7A 3PQJA 1W2BP 2ZXHA 1T0HA 2M0YA 2FXAA 1WJDA 2LYCA 1OCPA 1WVRA 2M0CA 2QZ8A 1YG2A 2FBKA 3QYBA 4KICA 4EATA 1IDZA 2DF6A 1KSWA 5IOYA 3FIFA 3Q0WA 3MEAA 4M77D 5GMKe 4IEJA 1Z91A 3VUZA 4KDPA 5EG2A 2Z5UA 3SHFA 2R7DA 1Z9QA 3AG3H 5FFXA 1FSHA 4JRQA 4R8HA 2LCCA 4V2GA 1SEUA 4M7DF 1IF1A 1SAXA 3HSEA 1IV8A 3RYRA 1QHHD 2MW8A 1OYXA 2CZ0B 2MK5A 4PJOB 2GWRA 3FKJA 1M3AA 1VOMA 4M77B 4KFCA 2GQIA 2O4XA 3CD6T 4XOPA 3DKYA 3MD2A 2DO7A 5HS8A 2O31A 2QXFA 1OQYA 2E1MB 1RESA 5GAMg 5FKOA 1VQ5T 2OAWA 4MZTA 1R22A 2OJED 3OR2C 3QQAA 2MFZA 5H6QA 4DYRA 1AKHB 3CESA 4PJ0C 4Y15A 1NE8A 1JTYA 4LN2A 3WG7H 2RQWA 4OWRB 2DJQA 2RPNA 4CCNA 3CCLQ 2X9HA 5IY5H 2MF2A 3QYEA 1LJOA 3JB9H 3JSOA 1B9MA 5GANj 2ZPFB 4CICA 2F4MB 3MJXA 2XAGA 5IXFA 1NPRA 2DCEA 2RV8A 1FOWA 3HPHA 4E2FB 3OYMA 4GLKA 3P8DA 4WTOB 1MGTA 2IT0A 1VQLT 2B9SA 2XICA 2BE9B 4KITB 5C0MA 3FXLA 1WHJA 3G4SI 2VKEA 1X6OA 4JUVA 4PJJA 1UGVA 3RMQA 2V8IA 2EGCA 1TT0A 3RR6A 4IIMA 1X2QA 2KRFA 2DXUA 3B73A 2P5VA 2ZJPF 1OR7C 5F04A 4C2MJ 1Y56A 3S1NJ 1TOVA 2DFEA 1M30A 1B3QA 2CUJA 3A2KA 1RZ4A 1AEYA 3CCST 3S93A 3TDZC 4OGEA 3MN2A 1MV0B 1M1KR 5J1UA 4CXFA 2DK8A 3PSIA 5LGUA 3KZZA 4B44A 4O6JA 1VIEA 2CP7A 1ITYA 2JOYA 1KQ8A 4LDYA 3AG2H 1WHLA 4N0AC 2XPWA 5E8IA 2DA1A 1IXRC 3OS2A 3HJEA 2X9DA 1Y96A 1GBRA 3CCEI 1IXCA 4OU0A 4YFXF 3WTTC 3C3WA 1Z6TA 2DTZA 2E60A 2AZSA 4IIOA 2ELKA 5J8FA 5DLQE 3OB9A 1D3YA 2MAMA 1BR4A 2ESNA 2NNNA 4IL6C 2L4MA 2IBDA 3GVAA 1BBZA 3EG2A 1X75C 3ZR8X 4N4OB 1N8RR
chains in the Genus database with same CATH topology
5JHUA 4CZZA 2JRTA 2Y90A 1R7JA 3M57A 2FHDA 4YIIA 1VQ6A 1HQCA 3KBGA 4KBMB 1FXXA 2PQ8A 2ELHA 1U5TA 5FD6A 2A61A 4I09A 3RKXA 4RB1A 2EFIA 3P9IA 1SFUA 4Q48A 4HBLA 2H3JA 5CVVA 4HCZA 4U7BA 3M5AA 5LJ5d 1D3BB 3WG9A 2LTOA 3NFCA 4QW2A 1Z1DA 1I1SA 1VQ5A 2KIFA 1Q1HA 2LF7A 2QTXA 4LDXA 2FNPA 4FM4B 3ECHA 4AIJA 2EQMA 1DJ7B 3QOPA 2PUOB 3HFOA 2PEXA 1KC8C 1ODDA 4X9CA 2LT4A 2MMPA 3LWHA 3RKYA 5GAOn 3ABUA 1NJIC