2RO0A

Solution structure of the knotted tudor domain of the yeast histone acetyltransferase, esa1
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
92
structure length
92
Chain Sequence
GSHMSHDGKEEPGIAKKINSVDDIIIKCQCWVQKNDEERLAEILSINTRKAPPKFYVHYVNYNKRLDEWITTDRINLDKEVLYPKLKATDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone acetyltransferase ESA1
publication title Novel structural and functional mode of a knot essential for RNA binding activity of the Esa1 presumed chromodomain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 6
structure length 92
sequence length 92
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2008-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ro0A00
4FL6A 4NS5A 3MO8A 4C5HA 5CIUA 1XNIA 4EDUA 4QVZA 3QBYA 4IUVA 3LH0A 1WJQA 3OYMA 2GFUA 2HQXA 2QQSA 2BUDA 3DLMA 4IURA 2RJEA 2VYTA 3E9FA 3MP1A 4ZTFA 3UT1A 2RHIA 2PQWA 5FROA 4BACA 2WACA 2RHZA 3ME9A 3NTKA 3FEOA 4C5EA 3L2VA 4IKFA 2E5QA 3OMGA 5KE3A 2K3XA 2EKOA 5IAYA 3OY9A 4ZTJA 4B9XA 2K3YA 3L2UA 2YRVA 4BE1A 4BE2A 5FRNA 2BKDN 1WGSA 3NTIA 2DIGA 2EQMA 5KCHA 4BE0A 4IUPA 1MHNA 1OI1A 3UWNA 3E9GA 3L42A 3S3MA 3P8HA 3OYAA 3OYCA 2X35A 3OYDA 3OYJA 2G3RA 2L8DA 3FLGA 3S3OA 1OZ3A 1G5VA 1OZ2A 4PLIA 4A4GA 2XDPA 4Z02A 2RJCA 4QQDA 3OYNA 4N4GA 5KE2A 4UC4A 5IN1A 3OS0A 4C5GA 2LCCA 4A4FA 5D6YA 4PL6A 1RI0A 2P0KA 2X4WA 3EAEA 3OYHA 2XK0A 4Q5WA 4B9WA 2JTFA 2RHYA 3QKJA 4OVAA 3MEUA 2M16A 3O8VA 3QJ6A 3FDRA 3MEWA 2FHDA 1SSFA 2M0OA 3NTHA 2NLUA 2X4XA 3DB3A 3QIIA 3CEYA 2LRQA 2MWOA 3ZEHA 2R5AA 3SD4A 2RI2A 3P8DA 3PMIA 3PMTA 2LTOA 2E6NA 2M1HA 3MEAA 4II1A 4X34A 3DB4A 3ASKA 4GY5A 1N27A 3OQ5A 2GF7A 2R57A 5D6XA 2RO0A 5M9OA 1OYXA 2R5MA 2RI5A 4CRIA 4E7JA 2X4YA 3F70A 4IUTA 2RJDA 2DAQA 2QQRA 3OYBA 3MEVA 4QQGA 3H6ZA 3OYKA 1KHCA 4RG2A 2EQUA 3BDLA 2RHUA 4E7HA 3GOXA 4IUQA 3LX7A 2R58A 3MP6A 4BD3A 3M9QA 2D9TA 3OB9A 4QQ6A 3OA6A 3KUFA 2BIVA 3LYIA 2O4XA 5KH6A 2IG0A 2HQEA 2JZ2A 3META 4L59A 1H3ZA 3L2WA 2EFIA 2B8AA 2O4XB 2EQKA 2MWPA 3LGLA 5J26A 5FRMA 3MP8A 3OYLA 4IUUA 4PLLA 4E7LA 2LDMA 2RI3A 3OMCA 2RJFA 4A4EA 3C4SA 4E7KA 4N4IA 1WJRA 5KCOA 2EQJA 4QW2A 5C6SA 1WJSA 2DIQA 4BDZA 4FU6A 2CKKA 3S3NA 3OS1A 3LGFA 4E7IA 4A4HA 3L2RA 3Q1JA 2F5KA 4LD6A 2RHXA 3H8ZA 3S6WA 4C5IA 2GFAA 4HCZA 3PNWC 3OS2A 2L89A 3LLRA 4N4HA 5J39A 3OYEA 3OYIA 4BDYA 3OYGA 5D6WA 3PFSA 5C0MA 2LVMA 3FC3A 3OYFA 2L3RA 3L2QA
chains in the Genus database with same CATH superfamily
1R8OB 5I21A 5LJ3j 1VQOQ 5GMKl 4HCKA 3CCUA 4M77E 2BUDA 3CMAA 2HAXA 2PQWA 3CCUQ 1VQ6T 2E41A 1TOVA 3ZBDA 3CMAQ 2DO3A 5KYYA 2IPOB 3QYHB 1M3BA 3RUXA 3JCMc 2ZZDA 1S1NA 3CXCA 1PD1A 3S3MA 2O31A 1K0XA 1AVZC 1NYGA 2JN0A 2VWFA 1YHQA 2EQIA 3OYNA 1YHQQ 4RCCA 1PNJA 4M77D 2CP7A 2E12A 2V1RA 2V8IA 1YITA 2LRQA 2HL3A 1YCSB 5GAOp 3CCVT 4E2FB 2XI9A 4PJNA 2DERA 2HZYA 4J9CA 2JMCA 3NPFA 2GQIA 1MMAA 3CBMA 3OYBA 4RG2A 2OAUA 2E3HA 1K73U 4RTUA 2KVQG 2D9TA 1KQ1A 3JB9I 2FYKA 3QO3A 4OB3B 3VUZA 4CC2A 5GANh 2E1HA 1VQ8T 2O01E 1SPKA 4L59A 1KQSS 2O4XB 4EMGA 1BCMA 3G7ZA 2EGCA 4OMNA 1WQWA 1VQKA 2RQVA 1UGPB 3J80E 3SWNB 4N4IA 4C92G 1QVFS 4KBMB 4OMLA 1LPLA 3E2UA 1VQKQ 1NG2A 4FT2A 4C92C 1FX7A 2BE7D 3MCAB 1YBYA 3MJXA 1TUGB 1K9MR 3SEMA 2X51A 1Y57A 5GAN7 4ZGJB 1V29B 1WHHA 2QGFB 5CCAA 3EHQA 2JM8A 1YNZA 2LQKA 1VQ6A 2MAMA 1N8RR 4O6JA 1KIKA 1VQ6Q 1UFFA 2RHZA 3L2VA 1H92A 2QQAA 4NL3A 3L2UA 2RB6A 2GGRA 3CPFA 1JU5C 4KUDK 3OYDA 3FLGA 1IGQA 2F1LA 4C5GA 1D09B 4A4FA 5D6YA 1BIAA 3RKXA 1QVGS 4E6RA 5IXFA 4B9WA 2DXCA 2Y4XA 4X1VA 4OVAA 4FYXB 3I5RA 4HVUA 1WHGA 4F14A 3CMEA 1GFDA 3H41A 1WLPB 3H0FA 4JRPA 5HK0A 5GANf 3PMIA 1M90R 2M1HA 3G1JA 3GNFB 4F16A 1W2BS 3ASKA 2L3SA 2RO0A 2X4YA 2OAWA 4HKEA 4E7ZA 1UGRB 2L2PA 4JJDA 2HSPA 4IUQA 2VUBA 4JLGA 1K8AR 2DZCA 4M7AF 1VQ8A 2ED0A 4LUEA 1YIJA 2DBMA 2K3BA 2FZCB 1VQ8Q 1H3ZA 4FYWB 4X9CA 4M7DE 3EFOA 2KXCA 2YUNA 5LJ5d 2E65A 4ZN1A 5GANg 4PK4A 2NYSA 3X24B 3BE3A 3RDVA 3A8MB 3QDRB 3S3NA 1K0SA 1B34B 2QTVA 4C5IA 2KGTA 2CSQA 4RG8A 3CCRT 1X6GA 5A0LA 2LJ0A 2K5IA 5CVIA 3L2QA 4NS5A 1C6VX 1XNIA 2AHJB 1BI0A 1WXTA 3LH0A 2GFUA 3CC2T 4EMKA 2PU9B 2PZ1A 1Q81C 2EYXA 1TTHB 4M7DD 4QKUA 3TEEA 1QVPA 1Q7YR 3V7CA 3JAME 1ZA2B 2PNIA 2EW3A 3NTKA 3M0PA 2K3YA 1F1BB 2BKDN 3L42A 1VIEA 3QHSA 4B6MA 1BB9A 2KK4A 1G5VA 1TS9A 4LDYA 5GAOm 3CCLT 5GAMh 4MMLA 4C0ZA 4UC4A 4M78E 1TG0A 2X4WA 3H9NA 1G83A 2COYA 1UG1A 3UATA 4FM4B 2ESWA 2MCNA 3KFVA 2FB7A 3DB3A 3X28B 4KH0B 5LJ3h 1Q82U 5I22A 5DM7R 1UJ0A 4BI3A 2DYBA 2OI3A 4XTXA 3WXMB 2VKNA 4LE9A 3RESA 4Z8AA 3HP9A 1UEBA 1KD1C 1KHCA 4QVDA 1X27A 1ZA1B 3OA6A 5ECAA 4F7UB 5KH6A 2JXBA 3SFMA 4C8QB 3L2WA 3CC7T 3LGLA 1EFNA 2DJQA 1BU1A 2RI3A 3C12A 4E7KA 1VQMT 2DRMA 1YN8A 3HPWA 2DIQA 2FG0A 2XG8D 3CCRA 3S6WA 1K73C 4HCZA 5KYXB 2HKQB 1UUEA 5KYUB 3CCRQ 3PFSA 2LMJA 4GBQA 3CC2A 3X20B 5AT1B 2XDDA 3LH5A 3CC2Q 4PFPA 4IURA 1RAIB 4XTZA 2QASA 2RHIA 5GAMf 3QXEB 3OW2S 1IO6A 1ZHIA 2EWNA 1M1KR 5HKCA 2EJ9A 3PE0A 4RTTA 2RQWA 3NTIA 1JO8A 5LJ3f 3CCLA 5CO7A 3OYCA 4MDWA 2FO0A 2G3RA 2KY9A 2LNVA 2DX1A 1YFNA 3BY7A 1NPRA 1YCYA 2JW4A 3JCMh 3JCMJ 4A4GA 4F17A 3CCLQ 2OX7A 1JJ2A 4C0FA 3CCET 3KXTA 1WZOA 3M55A 2RK2A 2WSFE 1AZEA 1K4US 3MEUA 3CC4T 3O8VA 2W0ZA 2FHDA 5GAMg 1ZBJA 3REAB 2KNBB 1BKBA 2LTOA 4V2SA 3MEAA 3HHTB 3EG1A 1K76A 1NYFA 2R57A 1OYXA 3CCST 4CRIA 4ZGEB 2OTJT 8ATCB 2K2MA 3TVTA 3VU3C 5LJ3g 4R0KA 2A37A 5CKEA 2KRSA 1VQ9T 1OULA 1OU8A 4PNOA 3TCJA 4D8DA 3QDFA 2HQEA 4LUDA 3PVLA 1G3YA 1C1AA 1O75A 4PJOA 3A98A 2CZ1B 3EG0A 1VYUA 5GJWB 2CT4A 2JM9A 4D6WA 1VQMQ 5L8RE 3URGA 2K4YA 3DLLA 2CZ6B 2H3EB 1WJSA 2LX7A 2PTKA 1M1FA 4RTWA 1MUZA 3PNWC 5J39A 2Z0WA 1MV0B 1RADB 4KT0E 1S72T 2RA2A 2P84A 5EG2A 2EYZA 4OGCA 2GBQA 2D0QB 4QVZA 1CSKA 3VYGA 2XHCA 2QQSA 1B7TA 2VVKA 3E9FA 2XICA 3JCMf 4ORZA 4KULA 2K6DA 2X3XD 1TXQA 3FEOA 3UDCA 2PUOB 2YUQA 4RMOA 2E10A 3NHNA 2A0FB 2YLBA 2PVOB 2K5LA 2A28A 1MMNA 5CKDA 2X4JA 2CDTA 2L8DA 1M30A 3CCEA 3S3OA 2D6FA 2DL7A 4J5YA 3CCEQ 3CC4A 2M9UA 2C06A 1WXBA 1NZ9A 3CC4Q 4C92F 1VQPT 3BW1A 2KR3A 3JCMg 4HT8A 4M75E 2X4XA 4C0GA 2LCLA 4JUVA 2R5AA 2LQWA 1WFWA 1E7OA 3SD4A 3VS0A 3P8DA 4JRQA 2DE0X 4M7AE 2HMAA 5J3BA 2OTJA 4GY5A 4HXJA 1T3SA 3CCSQ 5CAIA 3F70A 3RMSA 2OTJQ 5I2SA 3ER0A 4IIOA 3FJ5A 4HVWA 4KGZB 1VQ9A 1U06A 3MP6A 2KE9A 4M77B 3KUFA 1VQ9Q 2O4XA 2RK1A 1WA7A 3I9QA 2J06A 1ZQ1A 3X25B 3SWNA 2HBWA 3T9NA 1Q82C 1Q95G 1YITT 4KRTA 1BI2A 3OYLA 4FW1A 4AMCA 2CSIA 2LDMA 3OSVA 4M7AD 1OV3A 1WHMA 4PJOG 2YT6A 1WJRA 1QQJA 5GAOr 2RD1A 1OPLA 4FU6A 4ZNXA 1QCFA 2DVEA 4PJOC 1T0HA 3RMQA 1NLOC 2RHXA 1AWXA 2XU8A 1IGUA 2AZVA 1S72A 1WHLA 4N4HA 1AWWA 1NJIU 1S72Q 2COZA 4DOWA 4BACA 4ZN3A 4J6XA 2HQXA 1M2VB 2DXBA 2QAZA 3X26B 4IIMA 2VGMA 1AZGB 2KQWA 2LT1A 1R0BG 5FWCA 2YXYA 1G3WA 2ENMA 4DBQA 5KE3A 1KQSP 3CD6T 3UA7A 2CUBA 1I8FA 2EGAA 5KYWB 2V8KA 2EPDA 4XU0A 3UWNA 5FU6B 3OSSC 3OYAA 3OYJA 3HFOA 2RQUA 2RPNA 3MPUB 2RJCA 1ABOA 1G3SA 1VQPA 2RNAA 2DL3A 4A63B 1VQPQ 2DKGA 2VB6A 3QIIA 4Z88A 3CEYA 2KYMA 2MMPA 1KK7A 3DB4A 2KT8A 3OQ5A 1K9MU 2E64A 5IH2A 5GANd 3JCMb 2X3WD 2JT4A 4XTVA 4L6V5 3V8JA 1R0CB 2JOYA 1VYTA 5IHKA 1OX8A 1WI7A 4CI0C 5FWBA 1N8RU 2XD0A 2X9HA 1BIBA 1GCPA 2KSSA 4XTYA 1YITQ 3CMET 5FRMA 4O5VA 2YDLA 4DEYA 1I07A 2EAYA 2B86A 4L5GA 1T3LA 1B34A 2QDYB 2HQHA 3SWNC 2FVUA 1JJ2P 2E3IA 1Q81R 2ECZA 3L2RA 3Q1JA 4ME7A 2KRNA 1W2BP 1HXDA 2F69A 2EJFA 1SSHA 4KGXB 1BK2A 1HYOA 4YTLA 4BDYA 2ZPBB 3FC3A 5KYNA 1X6OA 1YIJT 3M5AA 1H641 4PFZA 3EGDB 2QDLA 2VV5A 1U5SA 3TSWA 4AFSC 1QWFA 1WPYA 1I4K1 4C0DB 2W10A 3PGGA 1M90U 4OB0B 3CD6A 3QPHA 2K3XA 3CPWS 3AT1B 2YRVA 1BCOA 3CD6Q 2JS2A 2OJ2A 4MMKA 2HNIA 2EYWA 2DXUA 3HRTA 2L3QA 3HTRA 1TUDA 3OBYA 1UDLA 2EIFA 4M7DB 5CKFA 2HKNA 4J9DA 3BDUA 2CT3A 2JMAA 1KD1R 4QVCA 2VGNA 1OQKA 1SSFA 1I5OB 2Y4YA 1IHWA 3KBGA 1VQLT 3H0IA 1WQ7A 4J9GA 2JJ9A 2JVVA 2NUPB 2F2XA 4LN2A 5AYFA 2DAQA 4DOVA 3RIRA 4F7UA 3DKMA 4XU3A 4VUBA 4E7SA 4C8QA 1W70A 5GMKj 1JXOA 5A0GA 5GAN8 5CQXA 1K73R 2FPEA 1QKWA 2EFIA 5J26A 1PSEA 2DEUA 3M57A 3CMEQ 4PLLA 3OMCA 1YWPA 4MDXA 5KCOA 1TU0B 4X9DA 5KYXA 5KYUA 2BZYA 1PM3A 4OMMA 1AWOA 2VXFA 4NL2A 4ZGDB 4M78B 3LLRA 4XK8E 3V7RA 2JTEA 5HY6A 2VASA 2LVMA 1GXIE 1VQ5T 1YIJQ 1Z9QA 2M02A 4J9EA 2KBTA 2ZAEA 3UT1A 2LX9A 4N0AA 2WACA 2DILA 2GCXA 1D1AA 4OMOA 4Y91A 3A8HB 3QSUA 5I2MA 5GMKm 2EVRA 3G4ST 4C92E 1NJIC 2KT1A 2XKOC 1T0JA 3OS0A 1AOJA 2LCCA 3V8LA 5A2QE 4DBFA 1C0MA 4BI4A 8AT1B 1VQLA 4FIBA 4J9FA 1ARKA 4J83A 2NLUA 1IB8A 2DBKA 1VQLQ 2VC8A 3PMTA 4FCYA 1JRIA 1WDXA 1B3QA 1N27A 1M8MA 3OW2P 3LWHA 2RI5A 4J8OA 3CCJT 4C92D 2L3PA 1ACMB 2GQVA 4DBRA 3GOXA 1Q86U 1TSFA 2AKLA 3GF5A 4QQ6A 3V8KA 4F7UG 3M4GA 1RACB 1M8VA 1SRLA 4RTYA 4LNPA 4C8QG 3JRZA 1BBZA 2ABLA 2A7YA 4ELYC 2DRKA 4C8QC 2J05A 5GANe 4M4ZA 1M1KU 4Y28E 1D3BB 1SKUB 2ZPFB 3RERA 1KQSA 1PG5B 4BB7A 3ZL7C 3OYEA 1VQ5A 4OP0A 1QVFA 1GL5A 1JQQA 4PJLA 4BE1A 1VQ5Q 4C5HA 3JCMW 4TVRA 2K2VA 4AFUC 4GLKA 3VS1A 3MP1A 5HCKA 1NE8A 3EG3A 4D8KA 4FYVB 1GFCA 1JEGA 4OMQA 2JS0A 3G4SA 5FLXE 1YJWA 2LP5A 1BI3A 3G4SQ 4N0AC 1YJWQ 3I56A 3FJPA 1GRIA 1M2OA 3HFNA 3RKYA 4PL6A 3EAEA 4J9HA 2F2WA 1B07A 2MK5A 1VQNT 1VQ4T 2M16A 4PJOF 4RTXA 1EIFA 2M0OA 2RQRA 2LQ8A 1JBMA 1IHVA 3HSBA 4WTOB 4X34A 3RKWA 2AIRB 3CCJA 4KH1B 2DL5A 1VYVA 1Q82R 3CCJQ 3EFOB 2HL5C 4OB1B 2RHUA 1H8KA 1U1SA 1W2BA 4J7IA 3M9QA 1M27C 2BIVA 1X2KA 1UGQB 2D8JA 1NEGA 1EZZB 4LDXA 1W4SA 1SRMA 1AT1B 2GTJA 2FPDA 3WVEB 3EG9B 2KROA 2EQKA 3TQ7P 1ZSZB 5LJ5g 2C0IA 1NEBA 1XJWB 2YWWA 4WCIA 2XDBA 1U8RA 4J9BA 1RAHB 3RBBB 4EMKB 2IVWA 4JRKA 2E70A 2KAFA 3A5ZB 3JV3A 1M2VA 1SF9A 1UJYA 1Y7XA 3TREA 4R55A 4M75B 4XAXB 2CYZB 3FB9A 4JLIA 1WJQA 1I81A 4ATOA 2MOXA 1KSWA 2L5QA 4M7AB 1M1GA 2LCSA 2VYTA 4ZTFA 1KFZA 5GMKh 3CXCS 2MYSA 3ME9A 4HT9A 4OMPA 5KYWA 4IKFA 4CC3A 1J3TA 1H3HA 1M3CA 4AG1C 4IUPA 1ZLMA 1MHNA 1U3OA 3OYYA 2X35A 4JJBA 3VS3A 3VRYA 5KE2A 3H0HA 1KQ2A 1VQNA 1VQ4A 2IIMA 2E6ZA 3O5ZA 1KC8U 1G2BA 1VQNQ 1VQ4Q 2HDAA 5GAMe 3PVQA 2QQBA 1V1CA 1X69A 2FEIA 1M4ZA 2E6NA 2QEXA 3NGPA 3M59A 4BY6B 5CKBA 5M9OA 3G71T 2R5MA 5LJ3e 2QEXQ 4J7FA 2NWMA 2RJDA 3SB2A 4E7HA 3GIBA 3OB9A 4DA4A 5GAOq 1IZ6A 4M77C 7AT1B 1I0CA 2CH4W 2CP0A 1FWZA 3VV0A 2KYBA 1Z9ZA 1RABB 4E7LA 4BI8B 4J6YA 3I55T 2PUKB 5C6SA 3CBOA 1PCXA 3LWIA 2V26A 1D0YA 4E7IA 4A4HA 1JXMA 3H8ZA 2GFAA 1Q86C 3EGDA 4A54A 4LD9K 3EH2A 1GBQA 2ATCB 3EGXB 2MI6A 2M0YA 1PRLC 4LDVA 2F5TX 3EFRA 2YLCA 1IRXA 1FXXA 4XU2A 2KXDA 1PHTA 4ZTJA 4CC4B 1PSFA 2Y90A 2ZPEB 2EQMA 5GAOn 4M78F 3OW2A 4M7DA 2LNHB 3FIFA 4FSSA 1UECA 5FU6C 3M0QA 1CKAA 2XK0A 4Q5WA 5FU7B 2MF2A 3JCMe 3QJ6A 3J81E 4OF1A 2WSEE 3TU4K 2LJ1A 2MWOA 3HKSA 3IQLA 2J6OA 2NUPA 5LJ5j 2FZGB 2RI2A 1G3TA 3G71A 1QVFP 1Q81U 2ZCFB 1QP2A 5D6XA 3G71Q 3AHUA 1RI9A 3THKA 3QZ5B 4QQGA 1SHFA 4JJNK 1X2QA 2LT4A 4JDSA 1Y96B 1RAFB 1WIEA 2QQ9A 3VS5A 1VQOA 2KEAA 1SEMA 3I55A 4JJCA 1NPPA 4A4EA 3PT9A 3I55Q 2EJGA 3M0UA 2M51A 4M78A 3VYHB 3QWYA 3JB9F 2RQTA 1NBEB 2ZGWA 4XU1A 2SRCA 5GMKe 1TUCA 2AT1B 1UGSB 4RTZA 3VRZA 1KJWA 5C0MA 2L3RA 4EIKA 4EDUA 5FW9A 3QBYA 1QVGP 2O2OA 4E47A 1D1BA 1KD1U 5D7UA 3HL8A 2DTHA 3DLMA 3E1SA 1NJIR 2RJEA 3RNJA 5GAOl 3GLXA 3MHXA 3OMGA 4C0DC 3A8GB 3ZFJA 1K9AA 1X75C 4JPBW 4B9XA 2C0TA 1P92A 4AFZC 1IXDA 1OI1A 4F7UF 4PJOE 4WF2A 1RLQC 2D8HA 2NUTB 2ROLA 3A8OB 3VUBA 4C8QF 1WX6A 3SDZA 4M7DG 4LDUA 1SG5A 2DMOA 1Y71A 2RN8A 1KHIA 2JTFA 4M7DC 2L0AA 3QJYA 3JB9H 1WHKA 3M53A 1UTIA 2AK5A 3INZA 4DBHA 1GCQA 2J6FA 3LW5E 4AG2C 1MNEA 4Z89A 5A0DA 2DL4A 3GBQA 4LXCA 4II1A 2AZSA 1K8AU 4K11A 2GF7A 1FMVA 1N9SA 2KI7A 1G8XA 4PJOD 2QQRA 2QI2A 2P4TA 3MKDA 2K9GA 1HJDA 1QLYA 2R58A 2DVJA 1TH7A 3N5BB 1XQHA 2FRYA 1M5Q1 2E4HA 1KC8C 1D1CA 4AT1B 4F04B 1BI1A 1D3BA 1PD0A 1NM7A 1ABQA 4IUUA 4C92B 2CP5A 3E19A 1UHFA 3L2ZA 1UE9A 4MZPA 1D0XA 4OB2B 3CCMT 4M78G 2L89A 2DTOA 2KDSA 2NUZA 4GLMA 4DEXA 2DEQA 2E5KA 4M78C 1Q7YU 2GTOA 1MGQA 4FYYB 1WNLA 4PJMA 3VS7A 3A1PA 2YUPA 1WYXA 2CH4A 2V8JA 5CR2A 1GBRA 1M9SA 2PVGB 4ESRA 2CP3A 5IAYA 2CUDA 3CCVA 3A8LB 2F2VA 1JJ2S 3BFMA 2D1XA 4BE2A 1WGSA 2XMFA 1FMWA 1UGVA 2EYYA 5KYYB 3CCVQ 1RAGB 2LC4A 3E9GA 1ZSGA 1LCKA 2QYZA 2CZ0B 1OZ2A 4Z02A 4M75F 1YWOA 5IN1A 1OX9A 1ZBXA 1RI0A 2GNCA 2RHYA 3UF4A 3M0TA 4PJJA 2VXEA 3FDRA 3VS2A 1X43A 2HBPA 2BZ8A 2I2LA 5GAMd 1PKTA 2SEMA 4RCBA 2CGHA 3NMZC 1YJWT 3OS5A 2DZ9A 3JB9G 1QP3A 4FW2A 2ROTA 1I1JA 1GCQC 4HVVA 4IUTA 3GPLA 1HD3A 3D7SB 3H6ZA 5LJ3d 3OYKA 3I56T 2HEQA 1AD5A 3PTAA 1CKBA 3LX7A 2EGEA 5IT9E 3EG9A 2AKKA 1ZSZA 2JUFA 1PRMC 2K5FA 1R77A 2BTTA 3META 2QK0A 4BUGA 2B8AA 4LDWA 2RJFA 3C4SA 3C95A 2HSEB 4KUIA 2EQJA 4QW2A 2MPXC 2EYQA 4BDZA 2CREA 2CKKA 2CZ7B 3CCMA 3EHRA 5LJ5h 3CCMQ 3C94A 4M75A 2C0OA 5L23A 3JCMP 1RAAB 4J9IA 3GP8A 3OYGA 2DM1A 2K7AA 1ZUYA 1MMGA 2OTLT 3I5SA 4M7AA 4FL6A 3MO8A 5GAN3 4HA8A 4IUVA 3CBPA 2QG9B 1YJNT 2XIDA 1FYNA 1X6BA 1RL2A 4PKCC 4J6WA 2A3LA 2YHTA 1UB4A 5GAN2 1K9MC 2E5QA 2EKOA 3OY9A 3J7AF 4M77F 2KRMA 2DIGA 5KCHA 4KGVB 3C0CA 3P8HA 1N8RC 1QMCA 1HSQA 3M58A 2DA9A 3EH1A 3CPWA 4XQ3A 2XDPA 5DY9A 2V1QA 1YJ9T 1MV3A 5IHIA 1JB0E 3ULRB 1XTDA 3G6ET 1LJOA 1PWTA 1OEBA 3OYHA 4DQ2A 3M0SA 3QWXX 2YUOA 4M78D 2RF0A 4Y92A 1RAEB 3JCMd 3QZ9B 1HK9A 2ED1A 1YP5A 1TWBA 4JZ3A 3CXCP 1E6HA 4EPCA 2PVDB 6AT1B 4PFOA 2YSQA 1VIFA 3EFSA 3I56Q 2EQUA 3BDLA 3M56A 1N5ZA 1LOJA 2P0QA 3TSZA 1ZUUA 1M90C 3NFCA 3JSCA 5LJ5f 3CCQT 3OBWA 1QVGA 1Q86R 3UA6A 2MWPA 1W6XA 2FZKB 3MP8A 1DJ7B 3M54A 1YI2T 1QKXA 1ZSZC 2QEXT 4M77A 1K8AC 4MZMA 1Y0MA 1WXUA 3FRNA 3EG2A 4RKUE 4HCBA 1QWEA 2DXTA 3VS4A 1FMKA 3EGXA 4EMKC 4QT7A 2D0NA 1U1TA 2OTLA 2I0NA 1K1ZA 3OYFA 4M75G 1YJNA 2OTLQ 1BYMA 3HRSA 5CIUA 3OYMA 3JB9D 1YJNQ 4M7AG 4M75C 3WVDB 1PKSA 2O9SA 4F7UE 1LVKA 4M7AC 4RTVA 3VKIA 3P8BB 5GAN4 4C8QE 4C5EA 2A08A 4JZ4A 1ZUKA 1MNDA 1AHJB 2YRCA 3CQTA 2HD0A 1A0NB 4A4KA 4FT4A 5GANj 5CK9A 4AFQC 1YJ9A 4JS4A 5LL6S 3G6EA 1OZ3A 1Q7YC 2MIOA 4PLIA 1D0ZA 2EBPA 1YJ9Q 4QQDA 3G6EQ 4OMFB 5IXBA 3UPUA 2P0KA 2LJ3A 1ZX6A 3QKJA 2DNUA 1AEYA 2CP2A 3SHWA 3MEWA 5GMKi 1KG1A 3CC7A 2QA4T 3PIPA 3ZEHA 4C8QD 3CC7Q 1W1FA 2QTXA 1VQMA 4MZTA 3M0RA 2O88A 2ZPIB 2DK3A 5EC7A 3MEVA 4BY6C 2DTIA 1Y96A 2JNGA 2RH2A 3M4YA 2QXFA 1M3AA 2DJZA 2DL8A 2RM4A 3I35A 2G6FX 3CCQA 1IREB 2JTMA 4HCCA 2K79A 5IHNA 1RLPC 3CCQQ 2FRWA 4RUGA 1YI2A 5LJ5e 4EMHA 2LQNA 1OU9A 1YI2Q 2DLPA 3HRUA 3GNGA 1VQ7T 2CP6A 3OS1A 4JS5A 4M77G 3LGFA 1O9SA 4LD6A 2F5KA 1X01A 2YRDA 1V76A 3RR6A 4M7DF 3OS2A 1EX4A 4R56A 4FSXA 3VJPA 1LNXA 2BZXA 3PIOA 3V7SA 1VQOT 2COWA 4A53A 1VOMA 2CS7A 4OGEA 3R6OA 1QCOA 1N6AA 2KMTA 2RMOA 3CCUT 2WSCE 5FROA 1NLPC 1OPKA 5CQYA 2P0PA 2DYIA 3JB9J 3CMAT 4XTUA 1QCNA 2LZ6B 2DF6A 2NUTA 2HCKA 5FRNA 1Y07A 5I11A 2H8HA 4BE0A 3CCSA 3QG1A 3L1AA 3EGUA 1VUBA 3JCMX 2ZPHB 4N4GA 1M1KC 5GAN5 1YHQT 2A36A 5DLOA 1PC0A 2QA4A 2DPPB 4CC7A 3NTHA 5FU7C 2QA4Q 5CKHA 9ATCB 1XOVA 1WHJA 1E6GA 4M75D 5GJVB 1KC8R 2H3JA 4NOYA 2EKHA 4E7JA 4ANJA 2DD5A 4ELZC 4BD3A 3JCMV 1AWJA 1SHGA 1OOTA 2K57A 3LYIA 2DETA 2IG0A 4JRIA 1QW1A 3JCMQ 5HK3A 2JZ2A 1N9RA 1MMDA 4C92A 2QGGA 3QYGB 2ZPGB 1I5LA 2DD4A 1VQ7A 2DFUA 3QUIA 4PJOB 1UHCA 5GAN6 1VQKT 3CPWP 2BE9B 3U23A 1VQ7Q 2FPFA 1RUWA 3VS6A 5GAMj 2O9VA 4XTWA 5DLQE 2FL7A 1VA7A 3R6NA 3OYIA 2J7IA 2J6KA 5D6WA 2P4RA 4P5NA 3REBB
chains in the Genus database with same CATH topology
4OGCA 1R8OB 5I21A 4C5HA 5LJ3j 2D0QB 3JCMW 4QVZA 4TVRA 1WNLA 5GMKl 3VYGA 3CCUA 4M77E 2K2VA 2QQSA 2BUDA 2XHCA 2V8JA 4GLKA 5CR2A 3E9FA 2XICA 3JCMf 3CMAA 4KULA 2HAXA 3MP1A 2PQWA 1M9SA 1VQ6T 2E41A 1NE8A 2PVGB 3ZBDA 3FEOA 3UDCA 2DO3A 2PUOB 3QYHB 5IAYA 4RMOA 3G4SA 3RUXA 3CCVA 3A8LB 2E10A 3JCMc 1JJ2S 2ZZDA 3BFMA 5FLXE 2YLBA 4BE2A 2PVOB 1YJWA 2K5LA 1WGSA 1BI3A 3CXCA 5CKDA 4N0AC 2X4JA 2LC4A 3E9GA 3S3MA 2L8DA 3I56A 3CCEA 3FJPA 3S3OA 2CZ0B 1OZ2A 2D6FA 2JN0A 4Z02A 1YHQA 4M75F 3OYNA 4J5YA 5IN1A 3HFNA 3RKYA 3CC4A 4PL6A 2M9UA 1ZBXA 2C06A 1RI0A 3EAEA 4RCCA 4M77D 2RHYA 2E12A 1VQNT 1NZ9A 1VQ4T 2M16A 4PJOF 2VXEA 4C92F 3BW1A 3FDRA 3JCMg 1EIFA 1VQPT 4HT8A 2M0OA 4M75E 2HBPA 2V8IA 2X4XA 2LQ8A 1JBMA 2I2LA 4C0GA 2LCLA 5GAMd 2LRQA 1YITA 3HSBA 4JUVA 2R5AA 3SD4A 3P8DA 5GAOp 4JRQA 4M7AE 4RCBA 3CCVT 2CGHA 4X34A 5J3BA 2XI9A 3RKWA 1YJWT 2OTJA 3CCJA 3OS5A 4GY5A 2DZ9A 3JB9G 1QP3A 5CAIA 3F70A 3RMSA 4IUTA 3GPLA 3CBMA 3OYBA 5I2SA 3ER0A 3H6ZA 5LJ3d 3OYKA 4RG2A 4OB1B 2OAUA 3I56T 1VQ9A 3PTAA 1K73U 2RHUA 1U1SA 1W2BA 3LX7A 2KVQG 4J7IA 3MP6A 4M77B 3M9QA 2D9TA 1KQ1A 3JB9I 5IT9E 3KUFA 2BIVA 2FYKA 3QO3A 4OB3B 3VUZA 1UGQB 2O4XA 5GANh 2RK1A 2E1HA 2JUFA 4LDXA 2K5FA 1VQ8T 1W4SA 2O01E 4L59A 3META 3WVEB 1ZQ1A 3X25B 3SWNA 3T9NA 4BUGA 2B8AA 2EQKA 2O4XB 4EMGA 1Q82C 1KQSS 1YITT 3G7ZA 1BI2A 5LJ5g 3OYLA 4LDWA 1WQWA 1VQKA 2LDMA 3OSVA 1UGPB 2RJFA 3J80E 3C4SA 3C95A 3SWNB 4M7AD 4KUIA 4N4IA 4PJOG 4C92G 1QVFS 1WJRA 4KBMB 2EQJA 4QW2A 2XDBA 1U8RA 2EYQA 2RD1A 4BDZA 5GAOr 4FU6A 2CKKA 2CZ7B 4FT2A 4EMKB 3CCMA 2IVWA 2DVEA 1FX7A 4JRKA 3MCAB 2E70A 1YBYA 3RMQA 4C92C 4PJOC 2XU8A 2RHXA 1S72A 5LJ5h 3C94A 4M75A 4N4HA 3JCMP 5GAN7 4ZGJB 2KAFA 1NJIU 1V29B 3A5ZB 3OYGA 3GP8A 4DOWA 2OTLT 4BACA 4M7AA 1Y7XA 4FL6A 3TREA 3MO8A 4M75B 4XAXB 5GAN3 4HA8A 5CCAA 4R55A 2CYZB 4IUVA 3CBPA 3FB9A 4JLIA 4ZN3A 1WJQA 1YJNT 2XIDA 1I81A 2LQKA 2HQXA 4J6XA 4ATOA 2DXBA 2MAMA 1KD1C 1VQ6A 1RL2A 2L5QA 4PKCC 1M1GA 4M7AB 4O6JA 2VYTA 3X26B 4J6WA 2VGMA 2A3LA 2YHTA 5GMKh 1UB4A 2KQWA 2LT1A 5GAN2 3CXCS 4ZTFA 1K9MC 1G3WA 2RHZA 3ME9A 4HT9A 3L2VA 4IKFA 2E5QA 5KE3A 2EKOA 2QQAA 4NL3A 3OY9A 3L2UA 2RB6A 3CPFA 3CD6T 3J7AF 4M77F 1I8FA 2DIGA 2V8KA 5KCHA 4IUPA 1MHNA 4XU0A 3UWNA 4KUDK 3OYYA 3P8HA 3OSSC 2X35A 5FU6B 3OYAA 3OYDA 3OYJA 1N8RC 3M58A 3FLGA 3HFOA 3CPWA 4XQ3A 2XDPA 5DY9A 1YJ9T 2RJCA 5KE2A 1JB0E 3G6ET 1XTDA 1G3SA 1LJOA 4C5GA 1KQ2A 4A4FA 5D6YA 1BIAA 3RKXA 1VQ4A 1QVGS 1VQPA 1VQNA 3OYHA 4DQ2A 2E6ZA 4B9WA 2DXCA 2Y4XA 4OVAA 1KC8U 4M78D 2DKGA 5GAMe 3JCMd 3QZ9B 1HK9A 3QIIA 2QQBA 3CEYA 3CMEA 4JRPA 5HK0A 2MMPA 5GANf 3PMIA 1M4ZA 2E6NA 2M1HA 3GNFB 2QEXA 1W2BS 3DB4A 3M59A 3ASKA 3OQ5A 4BY6B 5CKBA 2RO0A 5M9OA 3G71T 2R5MA 1K9MU 5LJ3e 2E64A 2X4YA 4J7FA 4EPCA 4HKEA 3JCMb 2RJDA 5GANd 2PVDB 3SB2A 4XTVA 4L6V5 1VIFA 3EFSA 1UGRB 3V8JA 2EQUA 3BDLA 3M56A 4E7HA 1LOJA 4IUQA 2P0QA 2VUBA 2JOYA 4JLGA 3GIBA 2DZCA 3OB9A 4M7AF 4DA4A 5GAOq 1VQ8A 1IZ6A 1YIJA 4M77C 4CI0C 1M90C 3NFCA 1N8RU 2XD0A 3JSCA 5LJ5f 1BIBA 3CCQT 1FWZA 3VV0A 1H3ZA 3OBWA 1QVGA 2KSSA 2MWPA 4X9CA 4M7DE 4XTYA 3CMET 5FRMA 3MP8A 4O5VA 4E7LA 1DJ7B 3M54A 4BI8B 5LJ5d 4J6YA 1YI2T 2E65A 2EAYA 4L5GA 4ZN1A 5GANg 3I55T 2QEXT 2PUKB 4M77A 1K8AC 1B34A 2QDYB 3X24B 5C6SA 4MZMA 3CBOA 3A8MB 3SWNC 2FVUA 3QDRB 3S3NA 3FRNA 3LWIA 4RKUE 4HCBA 2DXTA 4E7IA 4A4HA 3L2RA 3Q1JA 1B34B 4ME7A 3H8ZA 4EMKC 1HXDA 2F69A 4C5IA 2GFAA 1U1TA 2EJFA 1Q86C 2OTLA 4A54A 4YTLA 4LD9K 4BDYA 4RG8A 3CCRT 2ZPBB 3FC3A 1X6OA 5A0LA 4M75G 2MI6A 2K5IA 3M5AA 5CVIA 3OYFA 4NS5A 3L2QA 1H641 1YJNA 3HRSA 5CIUA 1XNIA 2AHJB 1BI0A 3LH0A 2VV5A 3OYMA 2GFUA 3JB9D 4LDVA 4EMKA 4M75C 2PU9B 3CC2T 4M7AG 1Q81C 3WVDB 2F5TX 3EFRA 2YLCA 4M7DD 4F7UE 3TEEA 1QVPA 1WPYA 3V7CA 1I4K1 3JAME 4C0DB 3PGGA 4M7AC 1M90U 1YIJT 4OB0B 3VKIA 3P8BB 5GAN4 1FXXA 3NTKA 4C8QE 4C5EA 4XU2A 3CD6A 3QPHA 2K3XA 3CPWS 4ZTJA 1AHJB 2K3YA 2YRVA 2BKDN 2HD0A 1PSFA 2Y90A 2ZPEB 2EQMA 4A4KA 4FT4A 4MMKA 5GAOn 5GANj 4M78F 3L42A 3OW2A 1VIEA 2HNIA 3QHSA 5CK9A 4M7DA 1YJ9A 2DXUA 4JS4A 5LL6S 2KK4A 3FIFA 3G6EA 1OZ3A 3HRTA 1Q7YC 1G5VA 4LDYA 4PLIA 5GAOm 3CCLT 5FU6C 4MMLA 5GAMh 3OBYA 4QQDA 2EIFA 4C0ZA 4UC4A 4M7DB 4OMFB 4M78E 3UPUA 2P0KA 2X4WA 5CKFA 2XK0A 4Q5WA 5FU7B 2MF2A 3QKJA 3JCMe 4FM4B 3BDUA 3QJ6A 4QVCA 2VGNA 3MEWA 3J81E 5GMKi 1KG1A 1SSFA 3CC7A 2FB7A 2QA4T 3DB3A 3X28B 2Y4YA 4OF1A 5LJ3h 3KBGA 2WSEE 3TU4K 2MWOA 3HKSA 1WQ7A 3ZEHA 4C8QD 3PIPA 5LJ5j 1VQLT 2RI2A 1G3TA 3G71A 2QTXA 1Q81U 5DM7R 1VQMA 4MZTA 2ZCFB 2JVVA 4BI3A 1QP2A 2ZPIB 4XTXA 2DK3A 5D6XA 3WXMB 3AHUA 3RESA 5AYFA 2DAQA 3QZ5B 4DOVA 3MEVA 4QQGA 3HP9A 2DTIA 3RIRA 1UEBA 1Y96A 2JNGA 1KHCA 2RH2A 3M4YA 2QXFA 3DKMA 4F7UA 4XU3A 2DJZA 4QVDA 4VUBA 4JJNK 2LT4A 2RM4A 3OA6A 4C8QA 4JDSA 5GMKj 3CCQA 1Y96B 4F7UB 2QQ9A 1IREB 5A0GA 5KH6A 2JTMA 4HCCA 3SFMA 5GAN8 1VQOA 5CQXA 4C8QB 3L2WA 3CC7T 2EFIA 5J26A 1YI2A 1PSEA 5LJ5e 3LGLA 4EMHA 3I55A 3M57A 4PLLA 1NPPA 2RI3A 3C12A 3OMCA 3PT9A 4A4EA 4MDXA 2EJGA 4E7KA 1VQMT 5KCOA 3HRUA 3GNGA 3HPWA 2DIQA 1VQ7T 4M78A 4X9DA 3VYHB 3OS1A 4JS5A 2XG8D 3JB9F 4M77G 3LGFA 4BY6C 1O9SA 4LD6A 2F5KA 2ZGWA 3S6WA 1X01A 3CCRA 2VXFA 1K73C 4NL2A 4XU1A 4M7DF 4ZGDB 4HCZA 3OS2A 4M78B 3LLRA 4XK8E 3V7RA 5GMKe 5HY6A 4R56A 1UGSB 4FSXA 3VJPA 3PFSA 5C0MA 1LNXA 2LVMA 3PIOA 1GXIE 1VQ5T 2L3RA 3V7SA 3CC2A 3X20B 4EDUA 1VQOT 2XDDA 3QBYA 4A53A 4E47A 1KD1U 3HL8A 2DTHA 2CS7A 3DLMA 3E1SA 4IURA 3R6OA 4OGEA 2RJEA 1N6AA 4XTZA 2KMTA 3UT1A 3CCUT 2LX9A 2RHIA 2WSCE 4N0AA 5FROA 2WACA 5GAMf 5CQYA 5GAOl 3QXEB 2GCXA 2P0PA 3OW2S 1ZHIA 3GLXA 3MHXA 3JB9J 3CMAT 3OMGA 4C0DC 2EWNA 3A8GB 3ZFJA 5HKCA 4XTUA 1X75C 4Y91A 4B9XA 3A8HB 2EJ9A 3QSUA 1P92A 5I2MA 5FRNA 1Y07A 5GMKm 3NTIA 3G4ST 4BE0A 3CCSA 3QG1A 1OI1A 3L1AA 4F7UF 5LJ3f 4WF2A 4C92E 1NJIC 3CCLA 5CO7A 3OYCA 4PJOE 4MDWA 2G3RA 1VUBA 2KY9A 2LNVA 3A8OB 3JCMX 3BY7A 1NPRA 1YCYA 3JCMh 2ZPHB 3VUBA 4C8QF 3JCMJ 4A4GA 3SDZA 2XKOC 1JJ2A 4C0FA 4M7DG 1Q82U 4N4GA 4LDUA 3CCET 3OS0A 2LCCA 3V8LA 3KXTA 5A2QE 1M1KC 5GAN5 1YHQT 1Y71A 3M55A 5DLOA 1KHIA 4BI4A 2JTFA 2RK2A 2WSFE 2QA4A 4M7DC 2DPPB 3MEUA 3CC4T 3QJYA 3O8VA 1VQLA 4FIBA 3JB9H 2FHDA 3M53A 3NTHA 5FU7C 4J83A 1BYMA 5GAMg 2NLUA 3INZA 5CKHA 3LW5E 1XOVA 2VC8A 1BKBA 5A0DA 4M75D 3PMTA 2LTOA 4V2SA 1JRIA 3HHTB 3MEAA 4II1A 2H3JA 4NOYA 1K8AU 1N27A 2GF7A 2R57A 1N9SA 3LWHA 1OYXA 2RI5A 3CCST 4CRIA 4E7JA 4ZGEB 2OTJT 4J8OA 3CCJT 4C92D 4PJOD 5LJ3g 2DD5A 2QQRA 2QI2A 2P4TA 3VU3C 2GQVA 4ELZC 5CKEA 3GOXA 2R58A 1Q86U 4BD3A 3GF5A 3JCMV 4QQ6A 3V8KA 2K57A 1TH7A 4F7UG 1VQ9T 3M4GA 3LYIA 3N5BB 1XQHA 4PNOA 3TCJA 1M8VA 1M5Q1 2IG0A 1KC8C 4JRIA 1QW1A 3JCMQ 5HK3A 2HQEA 3JRZA 4C8QG 2JZ2A 1N9RA 1BI1A 1G3YA 2A7YA 4ELYC 1D3BA 1O75A 4C92A 4PJOA 3QYGB 4C8QC 2ZPGB 4IUUA 1I5LA 2CZ1B 5GANe 2DD4A 1M1KU 1VQ7A 4Y28E 1D3BB 2ZPFB 4D6WA 3QUIA 5L8RE 3URGA 2K4YA 4C92B 2CZ6B 5GAN6 3DLLA 1VQKT 4PJOB 3E19A 1WJSA 3RERA 3L2ZA 1KQSA 5GAMj 1M1FA 4BB7A 4MZPA 4OB2B 3CCMT 4M78G 4XTWA 3OYEA 5DLQE 3PNWC 2FL7A 2L89A 3OYIA 5J39A 1VQ5A 2DTOA 4OP0A 1QVFA 2KDSA 4KT0E 1S72T 5D6WA 2RA2A 4P5NA 2DEQA 4M78C 5EG2A 4BE1A 1Q7YU 1MGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FL6 A;  4NS5 A;  3MO8 A;  4C5H A;  5CIU A;  1XNI A;  4EDU A;  4QVZ A;  3QBY A;  4IUV A;  3LH0 A;  1WJQ A;  3OYM A;  2GFU A;  2HQX A;  2QQS A;  2BUD A;  3DLM A;  4IUR A;  2RJE A;  2VYT A;  3E9F A;  3MP1 A;  4ZTF A;  3UT1 A;  2RHI A;  2PQW A;  5FRO A;  4BAC A;  2WAC A;  2RHZ A;  3ME9 A;  3NTK A;  3FEO A;  4C5E A;  3L2V A;  4IKF A;  2E5Q A;  3OMG A;  5KE3 A;  2K3X A;  2EKO A;  5IAY A;  3OY9 A;  4ZTJ A;  4B9X A;  2K3Y A;  3L2U A;  2YRV A;  4BE1 A;  4BE2 A;  5FRN A;  2BKD N;  1WGS A;  3NTI A;  2DIG A;  2EQM A;  5KCH A;  4BE0 A;  4IUP A;  1MHN A;  1OI1 A;  3UWN A;  3E9G A;  3L42 A;  3S3M A;  3P8H A;  3OYA A;  3OYC A;  2X35 A;  3OYD A;  3OYJ A;  2G3R A;  2L8D A;  3FLG A;  3S3O A;  1OZ3 A;  1G5V A;  1OZ2 A;  4PLI A;  4A4G A;  2XDP A;  4Z02 A;  2RJC A;  4QQD A;  3OYN A;  4N4G A;  5KE2 A;  4UC4 A;  5IN1 A;  3OS0 A;  4C5G A;  2LCC A;  4A4F A;  5D6Y A;  4PL6 A;  1RI0 A;  2P0K A;  2X4W A;  3EAE A;  3OYH A;  2XK0 A;  4Q5W A;  4B9W A;  2JTF A;  2RHY A;  3QKJ A;  4OVA A;  3MEU A;  2M16 A;  3O8V A;  3QJ6 A;  3FDR A;  3MEW A;  2FHD A;  1SSF A;  2M0O A;  3NTH A;  2NLU A;  2X4X A;  3DB3 A;  3QII A;  3CEY A;  2LRQ A;  2MWO A;  3ZEH A;  2R5A A;  3SD4 A;  2RI2 A;  3P8D A;  3PMI A;  3PMT A;  2LTO A;  2E6N A;  2M1H A;  3MEA A;  4II1 A;  4X34 A;  3DB4 A;  3ASK A;  4GY5 A;  1N27 A;  3OQ5 A;  2GF7 A;  2R57 A;  5D6X A;  2RO0 A;  5M9O A;  1OYX A;  2R5M A;  2RI5 A;  4CRI A;  4E7J A;  2X4Y A;  3F70 A;  4IUT A;  2RJD A;  2DAQ A;  2QQR A;  3OYB A;  3MEV A;  4QQG A;  3H6Z A;  3OYK A;  1KHC A;  4RG2 A;  2EQU A;  3BDL A;  2RHU A;  4E7H A;  3GOX A;  4IUQ A;  3LX7 A;  2R58 A;  3MP6 A;  4BD3 A;  3M9Q A;  2D9T A;  3OB9 A;  4QQ6 A;  3OA6 A;  3KUF A;  2BIV A;  3LYI A;  2O4X A;  5KH6 A;  2IG0 A;  2HQE A;  2JZ2 A;  3MET A;  4L59 A;  1H3Z A;  3L2W A;  2EFI A;  2B8A A;  2O4X B;  2EQK A;  2MWP A;  3LGL A;  5J26 A;  5FRM A;  3MP8 A;  3OYL A;  4IUU A;  4PLL A;  4E7L A;  2LDM A;  2RI3 A;  3OMC A;  2RJF A;  4A4E A;  3C4S A;  4E7K A;  4N4I A;  1WJR A;  5KCO A;  2EQJ A;  4QW2 A;  5C6S A;  1WJS A;  2DIQ A;  4BDZ A;  4FU6 A;  2CKK A;  3S3N A;  3OS1 A;  3LGF A;  4E7I A;  4A4H A;  3L2R A;  3Q1J A;  2F5K A;  4LD6 A;  2RHX A;  3H8Z A;  3S6W A;  4C5I A;  2GFA A;  4HCZ A;  3PNW C;  3OS2 A;  2L89 A;  3LLR A;  4N4H A;  5J39 A;  3OYE A;  3OYI A;  4BDY A;  3OYG A;  5D6W A;  3PFS A;  5C0M A;  2LVM A;  3FC3 A;  3OYF A;  2L3R A;  3L2Q A; 
#chains in the Genus database with same CATH topology
 1R8O B;  5I21 A;  5LJ3 j;  1VQO Q;  5GMK l;  4HCK A;  3CCU A;  4M77 E;  2BUD A;  3CMA A;  2HAX A;  2PQW A;  3CCU Q;  1VQ6 T;  2E41 A;  1TOV A;  3ZBD A;  3CMA Q;  2DO3 A;  5KYY A;  2IPO B;  3QYH B;  1M3B A;  3RUX A;  3JCM c;  2ZZD A;  1S1N A;  3CXC A;  1PD1 A;  3S3M A;  2O31 A;  1K0X A;  1AVZ C;  1NYG A;  2JN0 A;  2VWF A;  1YHQ A;  2EQI A;  3OYN A;  1YHQ Q;  4RCC A;  1PNJ A;  4M77 D;  2CP7 A;  2E12 A;  2V1R A;  2V8I A;  1YIT A;  2LRQ A;  2HL3 A;  1YCS B;  5GAO p;  3CCV T;  4E2F B;  2XI9 A;  4PJN A;  2DER A;  2HZY A;  4J9C A;  2JMC A;  3NPF A;  2GQI A;  1MMA A;  3CBM A;  3OYB A;  4RG2 A;  2OAU A;  2E3H A;  1K73 U;  4RTU A;  2KVQ G;  2D9T A;  1KQ1 A;  3JB9 I;  2FYK A;  3QO3 A;  4OB3 B;  3VUZ A;  4CC2 A;  5GAN h;  2E1H A;  1VQ8 T;  2O01 E;  1SPK A;  4L59 A;  1KQS S;  2O4X B;  4EMG A;  1BCM A;  3G7Z A;  2EGC A;  4OMN A;  1WQW A;  1VQK A;  2RQV A;  1UGP B;  3J80 E;  3SWN B;  4N4I A;  4C92 G;  1QVF S;  4KBM B;  4OML A;  1LPL A;  3E2U A;  1VQK Q;  1NG2 A;  4FT2 A;  4C92 C;  1FX7 A;  2BE7 D;  3MCA B;  1YBY A;  3MJX A;  1TUG B;  1K9M R;  3SEM A;  2X51 A;  1Y57 A;  5GAN 7;  4ZGJ B;  1V29 B;  1WHH A;  2QGF B;  5CCA A;  3EHQ A;  2JM8 A;  1YNZ A;  2LQK A;  1VQ6 A;  2MAM A;  1N8R R;  4O6J A;  1KIK A;  1VQ6 Q;  1UFF A;  2RHZ A;  3L2V A;  1H92 A;  2QQA A;  4NL3 A;  3L2U A;  2RB6 A;  2GGR A;  3CPF A;  1JU5 C;  4KUD K;  3OYD A;  3FLG A;  1IGQ A;  2F1L A;  4C5G A;  1D09 B;  4A4F A;  5D6Y A;  1BIA A;  3RKX A;  1QVG S;  4E6R A;  5IXF A;  4B9W A;  2DXC A;  2Y4X A;  4X1V A;  4OVA A;  4FYX B;  3I5R A;  4HVU A;  1WHG A;  4F14 A;  3CME A;  1GFD A;  3H41 A;  1WLP B;  3H0F A;  4JRP A;  5HK0 A;  5GAN f;  3PMI A;  1M90 R;  2M1H A;  3G1J A;  3GNF B;  4F16 A;  1W2B S;  3ASK A;  2L3S A;  2RO0 A;  2X4Y A;  2OAW A;  4HKE A;  4E7Z A;  1UGR B;  2L2P A;  4JJD A;  2HSP A;  4IUQ A;  2VUB A;  4JLG A;  1K8A R;  2DZC A;  4M7A F;  1VQ8 A;  2ED0 A;  4LUE A;  1YIJ A;  2DBM A;  2K3B A;  2FZC B;  1VQ8 Q;  1H3Z A;  4FYW B;  4X9C A;  4M7D E;  3EFO A;  2KXC A;  2YUN A;  5LJ5 d;  2E65 A;  4ZN1 A;  5GAN g;  4PK4 A;  2NYS A;  3X24 B;  3BE3 A;  3RDV A;  3A8M B;  3QDR B;  3S3N A;  1K0S A;  1B34 B;  2QTV A;  4C5I A;  2KGT A;  2CSQ A;  4RG8 A;  3CCR T;  1X6G A;  5A0L A;  2LJ0 A;  2K5I A;  5CVI A;  3L2Q A;  4NS5 A;  1C6V X;  1XNI A;  2AHJ B;  1BI0 A;  1WXT A;  3LH0 A;  2GFU A;  3CC2 T;  4EMK A;  2PU9 B;  2PZ1 A;  1Q81 C;  2EYX A;  1TTH B;  4M7D D;  4QKU A;  3TEE A;  1QVP A;  1Q7Y R;  3V7C A;  3JAM E;  1ZA2 B;  2PNI A;  2EW3 A;  3NTK A;  3M0P A;  2K3Y A;  1F1B B;  2BKD N;  3L42 A;  1VIE A;  3QHS A;  4B6M A;  1BB9 A;  2KK4 A;  1G5V A;  1TS9 A;  4LDY A;  5GAO m;  3CCL T;  5GAM h;  4MML A;  4C0Z A;  4UC4 A;  4M78 E;  1TG0 A;  2X4W A;  3H9N A;  1G83 A;  2COY A;  1UG1 A;  3UAT A;  4FM4 B;  2ESW A;  2MCN A;  3KFV A;  2FB7 A;  3DB3 A;  3X28 B;  4KH0 B;  5LJ3 h;  1Q82 U;  5I22 A;  5DM7 R;  1UJ0 A;  4BI3 A;  2DYB A;  2OI3 A;  4XTX A;  3WXM B;  2VKN A;  4LE9 A;  3RES A;  4Z8A A;  3HP9 A;  1UEB A;  1KD1 C;  1KHC A;  4QVD A;  1X27 A;  1ZA1 B;  3OA6 A;  5ECA A;  4F7U B;  5KH6 A;  2JXB A;  3SFM A;  4C8Q B;  3L2W A;  3CC7 T;  3LGL A;  1EFN A;  2DJQ A;  1BU1 A;  2RI3 A;  3C12 A;  4E7K A;  1VQM T;  2DRM A;  1YN8 A;  3HPW A;  2DIQ A;  2FG0 A;  2XG8 D;  3CCR A;  3S6W A;  1K73 C;  4HCZ A;  5KYX B;  2HKQ B;  1UUE A;  5KYU B;  3CCR Q;  3PFS A;  2LMJ A;  4GBQ A;  3CC2 A;  3X20 B;  5AT1 B;  2XDD A;  3LH5 A;  3CC2 Q;  4PFP A;  4IUR A;  1RAI B;  4XTZ A;  2QAS A;  2RHI A;  5GAM f;  3QXE B;  3OW2 S;  1IO6 A;  1ZHI A;  2EWN A;  1M1K R;  5HKC A;  2EJ9 A;  3PE0 A;  4RTT A;  2RQW A;  3NTI A;  1JO8 A;  5LJ3 f;  3CCL A;  5CO7 A;  3OYC A;  4MDW A;  2FO0 A;  2G3R A;  2KY9 A;  2LNV A;  2DX1 A;  1YFN A;  3BY7 A;  1NPR A;  1YCY A;  2JW4 A;  3JCM h;  3JCM J;  4A4G A;  4F17 A;  3CCL Q;  2OX7 A;  1JJ2 A;  4C0F A;  3CCE T;  3KXT A;  1WZO A;  3M55 A;  2RK2 A;  2WSF E;  1AZE A;  1K4U S;  3MEU A;  3CC4 T;  3O8V A;  2W0Z A;  2FHD A;  5GAM g;  1ZBJ A;  3REA B;  2KNB B;  1BKB A;  2LTO A;  4V2S A;  3MEA A;  3HHT B;  3EG1 A;  1K76 A;  1NYF A;  2R57 A;  1OYX A;  3CCS T;  4CRI A;  4ZGE B;  2OTJ T;  8ATC B;  2K2M A;  3TVT A;  3VU3 C;  5LJ3 g;  4R0K A;  2A37 A;  5CKE A;  2KRS A;  1VQ9 T;  1OUL A;  1OU8 A;  4PNO A;  3TCJ A;  4D8D A;  3QDF A;  2HQE A;  4LUD A;  3PVL A;  1G3Y A;  1C1A A;  1O75 A;  4PJO A;  3A98 A;  2CZ1 B;  3EG0 A;  1VYU A;  5GJW B;  2CT4 A;  2JM9 A;  4D6W A;  1VQM Q;  5L8R E;  3URG A;  2K4Y A;  3DLL A;  2CZ6 B;  2H3E B;  1WJS A;  2LX7 A;  2PTK A;  1M1F A;  4RTW A;  1MUZ A;  3PNW C;  5J39 A;  2Z0W A;  1MV0 B;  1RAD B;  4KT0 E;  1S72 T;  2RA2 A;  2P84 A;  5EG2 A;  2EYZ A;  4OGC A;  2GBQ A;  2D0Q B;  4QVZ A;  1CSK A;  3VYG A;  2XHC A;  2QQS A;  1B7T A;  2VVK A;  3E9F A;  2XIC A;  3JCM f;  4ORZ A;  4KUL A;  2K6D A;  2X3X D;  1TXQ A;  3FEO A;  3UDC A;  2PUO B;  2YUQ A;  4RMO A;  2E10 A;  3NHN A;  2A0F B;  2YLB A;  2PVO B;  2K5L A;  2A28 A;  1MMN A;  5CKD A;  2X4J A;  2CDT A;  2L8D A;  1M30 A;  3CCE A;  3S3O A;  2D6F A;  2DL7 A;  4J5Y A;  3CCE Q;  3CC4 A;  2M9U A;  2C06 A;  1WXB A;  1NZ9 A;  3CC4 Q;  4C92 F;  1VQP T;  3BW1 A;  2KR3 A;  3JCM g;  4HT8 A;  4M75 E;  2X4X A;  4C0G A;  2LCL A;  4JUV A;  2R5A A;  2LQW A;  1WFW A;  1E7O A;  3SD4 A;  3VS0 A;  3P8D A;  4JRQ A;  2DE0 X;  4M7A E;  2HMA A;  5J3B A;  2OTJ A;  4GY5 A;  4HXJ A;  1T3S A;  3CCS Q;  5CAI A;  3F70 A;  3RMS A;  2OTJ Q;  5I2S A;  3ER0 A;  4IIO A;  3FJ5 A;  4HVW A;  4KGZ B;  1VQ9 A;  1U06 A;  3MP6 A;  2KE9 A;  4M77 B;  3KUF A;  1VQ9 Q;  2O4X A;  2RK1 A;  1WA7 A;  3I9Q A;  2J06 A;  1ZQ1 A;  3X25 B;  3SWN A;  2HBW A;  3T9N A;  1Q82 C;  1Q95 G;  1YIT T;  4KRT A;  1BI2 A;  3OYL A;  4FW1 A;  4AMC A;  2CSI A;  2LDM A;  3OSV A;  4M7A D;  1OV3 A;  1WHM A;  4PJO G;  2YT6 A;  1WJR A;  1QQJ A;  5GAO r;  2RD1 A;  1OPL A;  4FU6 A;  4ZNX A;  1QCF A;  2DVE A;  4PJO C;  1T0H A;  3RMQ A;  1NLO C;  2RHX A;  1AWX A;  2XU8 A;  1IGU A;  2AZV A;  1S72 A;  1WHL A;  4N4H A;  1AWW A;  1NJI U;  1S72 Q;  2COZ A;  4DOW A;  4BAC A;  4ZN3 A;  4J6X A;  2HQX A;  1M2V B;  2DXB A;  2QAZ A;  3X26 B;  4IIM A;  2VGM A;  1AZG B;  2KQW A;  2LT1 A;  1R0B G;  5FWC A;  2YXY A;  1G3W A;  2ENM A;  4DBQ A;  5KE3 A;  1KQS P;  3CD6 T;  3UA7 A;  2CUB A;  1I8F A;  2EGA A;  5KYW B;  2V8K A;  2EPD A;  4XU0 A;  3UWN A;  5FU6 B;  3OSS C;  3OYA A;  3OYJ A;  3HFO A;  2RQU A;  2RPN A;  3MPU B;  2RJC A;  1ABO A;  1G3S A;  1VQP A;  2RNA A;  2DL3 A;  4A63 B;  1VQP Q;  2DKG A;  2VB6 A;  3QII A;  4Z88 A;  3CEY A;  2KYM A;  2MMP A;  1KK7 A;  3DB4 A;  2KT8 A;  3OQ5 A;  1K9M U;  2E64 A;  5IH2 A;  5GAN d;  3JCM b;  2X3W D;  2JT4 A;  4XTV A;  4L6V 5;  3V8J A;  1R0C B;  2JOY A;  1VYT A;  5IHK A;  1OX8 A;  1WI7 A;  4CI0 C;  5FWB A;  1N8R U;  2XD0 A;  2X9H A;  1BIB A;  1GCP A;  2KSS A;  4XTY A;  1YIT Q;  3CME T;  5FRM A;  4O5V A;  2YDL A;  4DEY A;  1I07 A;  2EAY A;  2B86 A;  4L5G A;  1T3L A;  1B34 A;  2QDY B;  2HQH A;  3SWN C;  2FVU A;  1JJ2 P;  2E3I A;  1Q81 R;  2ECZ A;  3L2R A;  3Q1J A;  4ME7 A;  2KRN A;  1W2B P;  1HXD A;  2F69 A;  2EJF A;  1SSH A;  4KGX B;  1BK2 A;  1HYO A;  4YTL A;  4BDY A;  2ZPB B;  3FC3 A;  5KYN A;  1X6O A;  1YIJ T;  3M5A A;  1H64 1;  4PFZ A;  3EGD B;  2QDL A;  2VV5 A;  1U5S A;  3TSW A;  4AFS C;  1QWF A;  1WPY A;  1I4K 1;  4C0D B;  2W10 A;  3PGG A;  1M90 U;  4OB0 B;  3CD6 A;  3QPH A;  2K3X A;  3CPW S;  3AT1 B;  2YRV A;  1BCO A;  3CD6 Q;  2JS2 A;  2OJ2 A;  4MMK A;  2HNI A;  2EYW A;  2DXU A;  3HRT A;  2L3Q A;  3HTR A;  1TUD A;  3OBY A;  1UDL A;  2EIF A;  4M7D B;  5CKF A;  2HKN A;  4J9D A;  3BDU A;  2CT3 A;  2JMA A;  1KD1 R;  4QVC A;  2VGN A;  1OQK A;  1SSF A;  1I5O B;  2Y4Y A;  1IHW A;  3KBG A;  1VQL T;  3H0I A;  1WQ7 A;  4J9G A;  2JJ9 A;  2JVV A;  2NUP B;  2F2X A;  4LN2 A;  5AYF A;  2DAQ A;  4DOV A;  3RIR A;  4F7U A;  3DKM A;  4XU3 A;  4VUB A;  4E7S A;  4C8Q A;  1W70 A;  5GMK j;  1JXO A;  5A0G A;  5GAN 8;  5CQX A;  1K73 R;  2FPE A;  1QKW A;  2EFI A;  5J26 A;  1PSE A;  2DEU A;  3M57 A;  3CME Q;  4PLL A;  3OMC A;  1YWP A;  4MDX A;  5KCO A;  1TU0 B;  4X9D A;  5KYX A;  5KYU A;  2BZY A;  1PM3 A;  4OMM A;  1AWO A;  2VXF A;  4NL2 A;  4ZGD B;  4M78 B;  3LLR A;  4XK8 E;  3V7R A;  2JTE A;  5HY6 A;  2VAS A;  2LVM A;  1GXI E;  1VQ5 T;  1YIJ Q;  1Z9Q A;  2M02 A;  4J9E A;  2KBT A;  2ZAE A;  3UT1 A;  2LX9 A;  4N0A A;  2WAC A;  2DIL A;  2GCX A;  1D1A A;  4OMO A;  4Y91 A;  3A8H B;  3QSU A;  5I2M A;  5GMK m;  2EVR A;  3G4S T;  4C92 E;  1NJI C;  2KT1 A;  2XKO C;  1T0J A;  3OS0 A;  1AOJ A;  2LCC A;  3V8L A;  5A2Q E;  4DBF A;  1C0M A;  4BI4 A;  8AT1 B;  1VQL A;  4FIB A;  4J9F A;  1ARK A;  4J83 A;  2NLU A;  1IB8 A;  2DBK A;  1VQL Q;  2VC8 A;  3PMT A;  4FCY A;  1JRI A;  1WDX A;  1B3Q A;  1N27 A;  1M8M A;  3OW2 P;  3LWH A;  2RI5 A;  4J8O A;  3CCJ T;  4C92 D;  2L3P A;  1ACM B;  2GQV A;  4DBR A;  3GOX A;  1Q86 U;  1TSF A;  2AKL A;  3GF5 A;  4QQ6 A;  3V8K A;  4F7U G;  3M4G A;  1RAC B;  1M8V A;  1SRL A;  4RTY A;  4LNP A;  4C8Q G;  3JRZ A;  1BBZ A;  2ABL A;  2A7Y A;  4ELY C;  2DRK A;  4C8Q C;  2J05 A;  5GAN e;  4M4Z A;  1M1K U;  4Y28 E;  1D3B B;  1SKU B;  2ZPF B;  3RER A;  1KQS A;  1PG5 B;  4BB7 A;  3ZL7 C;  3OYE A;  1VQ5 A;  4OP0 A;  1QVF A;  1GL5 A;  1JQQ A;  4PJL A;  4BE1 A;  1VQ5 Q;  4C5H A;  3JCM W;  4TVR A;  2K2V A;  4AFU C;  4GLK A;  3VS1 A;  3MP1 A;  5HCK A;  1NE8 A;  3EG3 A;  4D8K A;  4FYV B;  1GFC A;  1JEG A;  4OMQ A;  2JS0 A;  3G4S A;  5FLX E;  1YJW A;  2LP5 A;  1BI3 A;  3G4S Q;  4N0A C;  1YJW Q;  3I56 A;  3FJP A;  1GRI A;  1M2O A;  3HFN A;  3RKY A;  4PL6 A;  3EAE A;  4J9H A;  2F2W A;  1B07 A;  2MK5 A;  1VQN T;  1VQ4 T;  2M16 A;  4PJO F;  4RTX A;  1EIF A;  2M0O A;  2RQR A;  2LQ8 A;  1JBM A;  1IHV A;  3HSB A;  4WTO B;  4X34 A;  3RKW A;  2AIR B;  3CCJ A;  4KH1 B;  2DL5 A;  1VYV A;  1Q82 R;  3CCJ Q;  3EFO B;  2HL5 C;  4OB1 B;  2RHU A;  1H8K A;  1U1S A;  1W2B A;  4J7I A;  3M9Q A;  1M27 C;  2BIV A;  1X2K A;  1UGQ B;  2D8J A;  1NEG A;  1EZZ B;  4LDX A;  1W4S A;  1SRM A;  1AT1 B;  2GTJ A;  2FPD A;  3WVE B;  3EG9 B;  2KRO A;  2EQK A;  3TQ7 P;  1ZSZ B;  5LJ5 g;  2C0I A;  1NEB A;  1XJW B;  2YWW A;  4WCI A;  2XDB A;  1U8R A;  4J9B A;  1RAH B;  3RBB B;  4EMK B;  2IVW A;  4JRK A;  2E70 A;  2KAF A;  3A5Z B;  3JV3 A;  1M2V A;  1SF9 A;  1UJY A;  1Y7X A;  3TRE A;  4R55 A;  4M75 B;  4XAX B;  2CYZ B;  3FB9 A;  4JLI A;  1WJQ A;  1I81 A;  4ATO A;  2MOX A;  1KSW A;  2L5Q A;  4M7A B;  1M1G A;  2LCS A;  2VYT A;  4ZTF A;  1KFZ A;  5GMK h;  3CXC S;  2MYS A;  3ME9 A;  4HT9 A;  4OMP A;  5KYW A;  4IKF A;  4CC3 A;  1J3T A;  1H3H A;  1M3C A;  4AG1 C;  4IUP A;  1ZLM A;  1MHN A;  1U3O A;  3OYY A;  2X35 A;  4JJB A;  3VS3 A;  3VRY A;  5KE2 A;  3H0H A;  1KQ2 A;  1VQN A;  1VQ4 A;  2IIM A;  2E6Z A;  3O5Z A;  1KC8 U;  1G2B A;  1VQN Q;  1VQ4 Q;  2HDA A;  5GAM e;  3PVQ A;  2QQB A;  1V1C A;  1X69 A;  2FEI A;  1M4Z A;  2E6N A;  2QEX A;  3NGP A;  3M59 A;  4BY6 B;  5CKB A;  5M9O A;  3G71 T;  2R5M A;  5LJ3 e;  2QEX Q;  4J7F A;  2NWM A;  2RJD A;  3SB2 A;  4E7H A;  3GIB A;  3OB9 A;  4DA4 A;  5GAO q;  1IZ6 A;  4M77 C;  7AT1 B;  1I0C A;  2CH4 W;  2CP0 A;  1FWZ A;  3VV0 A;  2KYB A;  1Z9Z A;  1RAB B;  4E7L A;  4BI8 B;  4J6Y A;  3I55 T;  2PUK B;  5C6S A;  3CBO A;  1PCX A;  3LWI A;  2V26 A;  1D0Y A;  4E7I A;  4A4H A;  1JXM A;  3H8Z A;  2GFA A;  1Q86 C;  3EGD A;  4A54 A;  4LD9 K;  3EH2 A;  1GBQ A;  2ATC B;  3EGX B;  2MI6 A;  2M0Y A;  1PRL C;  4LDV A;  2F5T X;  3EFR A;  2YLC A;  1IRX A;  1FXX A;  4XU2 A;  2KXD A;  1PHT A;  4ZTJ A;  4CC4 B;  1PSF A;  2Y90 A;  2ZPE B;  2EQM A;  5GAO n;  4M78 F;  3OW2 A;  4M7D A;  2LNH B;  3FIF A;  4FSS A;  1UEC A;  5FU6 C;  3M0Q A;  1CKA A;  2XK0 A;  4Q5W A;  5FU7 B;  2MF2 A;  3JCM e;  3QJ6 A;  3J81 E;  4OF1 A;  2WSE E;  3TU4 K;  2LJ1 A;  2MWO A;  3HKS A;  3IQL A;  2J6O A;  2NUP A;  5LJ5 j;  2FZG B;  2RI2 A;  1G3T A;  3G71 A;  1QVF P;  1Q81 U;  2ZCF B;  1QP2 A;  5D6X A;  3G71 Q;  3AHU A;  1RI9 A;  3THK A;  3QZ5 B;  4QQG A;  1SHF A;  4JJN K;  1X2Q A;  2LT4 A;  4JDS A;  1Y96 B;  1RAF B;  1WIE A;  2QQ9 A;  3VS5 A;  1VQO A;  2KEA A;  1SEM A;  3I55 A;  4JJC A;  1NPP A;  4A4E A;  3PT9 A;  3I55 Q;  2EJG A;  3M0U A;  2M51 A;  4M78 A;  3VYH B;  3QWY A;  3JB9 F;  2RQT A;  1NBE B;  2ZGW A;  4XU1 A;  2SRC A;  5GMK e;  1TUC A;  2AT1 B;  1UGS B;  4RTZ A;  3VRZ A;  1KJW A;  5C0M A;  2L3R A;  4EIK A;  4EDU A;  5FW9 A;  3QBY A;  1QVG P;  2O2O A;  4E47 A;  1D1B A;  1KD1 U;  5D7U A;  3HL8 A;  2DTH A;  3DLM A;  3E1S A;  1NJI R;  2RJE A;  3RNJ A;  5GAO l;  3GLX A;  3MHX A;  3OMG A;  4C0D C;  3A8G B;  3ZFJ A;  1K9A A;  1X75 C;  4JPB W;  4B9X A;  2C0T A;  1P92 A;  4AFZ C;  1IXD A;  1OI1 A;  4F7U F;  4PJO E;  4WF2 A;  1RLQ C;  2D8H A;  2NUT B;  2ROL A;  3A8O B;  3VUB A;  4C8Q F;  1WX6 A;  3SDZ A;  4M7D G;  4LDU A;  1SG5 A;  2DMO A;  1Y71 A;  2RN8 A;  1KHI A;  2JTF A;  4M7D C;  2L0A A;  3QJY A;  3JB9 H;  1WHK A;  3M53 A;  1UTI A;  2AK5 A;  3INZ A;  4DBH A;  1GCQ A;  2J6F A;  3LW5 E;  4AG2 C;  1MNE A;  4Z89 A;  5A0D A;  2DL4 A;  3GBQ A;  4LXC A;  4II1 A;  2AZS A;  1K8A U;  4K11 A;  2GF7 A;  1FMV A;  1N9S A;  2KI7 A;  1G8X A;  4PJO D;  2QQR A;  2QI2 A;  2P4T A;  3MKD A;  2K9G A;  1HJD A;  1QLY A;  2R58 A;  2DVJ A;  1TH7 A;  3N5B B;  1XQH A;  2FRY A;  1M5Q 1;  2E4H A;  1KC8 C;  1D1C A;  4AT1 B;  4F04 B;  1BI1 A;  1D3B A;  1PD0 A;  1NM7 A;  1ABQ A;  4IUU A;  4C92 B;  2CP5 A;  3E19 A;  1UHF A;  3L2Z A;  1UE9 A;  4MZP A;  1D0X A;  4OB2 B;  3CCM T;  4M78 G;  2L89 A;  2DTO A;  2KDS A;  2NUZ A;  4GLM A;  4DEX A;  2DEQ A;  2E5K A;  4M78 C;  1Q7Y U;  2GTO A;  1MGQ A;  4FYY B;  1WNL A;  4PJM A;  3VS7 A;  3A1P A;  2YUP A;  1WYX A;  2CH4 A;  2V8J A;  5CR2 A;  1GBR A;  1M9S A;  2PVG B;  4ESR A;  2CP3 A;  5IAY A;  2CUD A;  3CCV A;  3A8L B;  2F2V A;  1JJ2 S;  3BFM A;  2D1X A;  4BE2 A;  1WGS A;  2XMF A;  1FMW A;  1UGV A;  2EYY A;  5KYY B;  3CCV Q;  1RAG B;  2LC4 A;  3E9G A;  1ZSG A;  1LCK A;  2QYZ A;  2CZ0 B;  1OZ2 A;  4Z02 A;  4M75 F;  1YWO A;  5IN1 A;  1OX9 A;  1ZBX A;  1RI0 A;  2GNC A;  2RHY A;  3UF4 A;  3M0T A;  4PJJ A;  2VXE A;  3FDR A;  3VS2 A;  1X43 A;  2HBP A;  2BZ8 A;  2I2L A;  5GAM d;  1PKT A;  2SEM A;  4RCB A;  2CGH A;  3NMZ C;  1YJW T;  3OS5 A;  2DZ9 A;  3JB9 G;  1QP3 A;  4FW2 A;  2ROT A;  1I1J A;  1GCQ C;  4HVV A;  4IUT A;  3GPL A;  1HD3 A;  3D7S B;  3H6Z A;  5LJ3 d;  3OYK A;  3I56 T;  2HEQ A;  1AD5 A;  3PTA A;  1CKB A;  3LX7 A;  2EGE A;  5IT9 E;  3EG9 A;  2AKK A;  1ZSZ A;  2JUF A;  1PRM C;  2K5F A;  1R77 A;  2BTT A;  3MET A;  2QK0 A;  4BUG A;  2B8A A;  4LDW A;  2RJF A;  3C4S A;  3C95 A;  2HSE B;  4KUI A;  2EQJ A;  4QW2 A;  2MPX C;  2EYQ A;  4BDZ A;  2CRE A;  2CKK A;  2CZ7 B;  3CCM A;  3EHR A;  5LJ5 h;  3CCM Q;  3C94 A;  4M75 A;  2C0O A;  5L23 A;  3JCM P;  1RAA B;  4J9I A;  3GP8 A;  3OYG A;  2DM1 A;  2K7A A;  1ZUY A;  1MMG A;  2OTL T;  3I5S A;  4M7A A;  4FL6 A;  3MO8 A;  5GAN 3;  4HA8 A;  4IUV A;  3CBP A;  2QG9 B;  1YJN T;  2XID A;  1FYN A;  1X6B A;  1RL2 A;  4PKC C;  4J6W A;  2A3L A;  2YHT A;  1UB4 A;  5GAN 2;  1K9M C;  2E5Q A;  2EKO A;  3OY9 A;  3J7A F;  4M77 F;  2KRM A;  2DIG A;  5KCH A;  4KGV B;  3C0C A;  3P8H A;  1N8R C;  1QMC A;  1HSQ A;  3M58 A;  2DA9 A;  3EH1 A;  3CPW A;  4XQ3 A;  2XDP A;  5DY9 A;  2V1Q A;  1YJ9 T;  1MV3 A;  5IHI A;  1JB0 E;  3ULR B;  1XTD A;  3G6E T;  1LJO A;  1PWT A;  1OEB A;  3OYH A;  4DQ2 A;  3M0S A;  3QWX X;  2YUO A;  4M78 D;  2RF0 A;  4Y92 A;  1RAE B;  3JCM d;  3QZ9 B;  1HK9 A;  2ED1 A;  1YP5 A;  1TWB A;  4JZ3 A;  3CXC P;  1E6H A;  4EPC A;  2PVD B;  6AT1 B;  4PFO A;  2YSQ A;  1VIF A;  3EFS A;  3I56 Q;  2EQU A;  3BDL A;  3M56 A;  1N5Z A;  1LOJ A;  2P0Q A;  3TSZ A;  1ZUU A;  1M90 C;  3NFC A;  3JSC A;  5LJ5 f;  3CCQ T;  3OBW A;  1QVG A;  1Q86 R;  3UA6 A;  2MWP A;  1W6X A;  2FZK B;  3MP8 A;  1DJ7 B;  3M54 A;  1YI2 T;  1QKX A;  1ZSZ C;  2QEX T;  4M77 A;  1K8A C;  4MZM A;  1Y0M A;  1WXU A;  3FRN A;  3EG2 A;  4RKU E;  4HCB A;  1QWE A;  2DXT A;  3VS4 A;  1FMK A;  3EGX A;  4EMK C;  4QT7 A;  2D0N A;  1U1T A;  2OTL A;  2I0N A;  1K1Z A;  3OYF A;  4M75 G;  1YJN A;  2OTL Q;  1BYM A;  3HRS A;  5CIU A;  3OYM A;  3JB9 D;  1YJN Q;  4M7A G;  4M75 C;  3WVD B;  1PKS A;  2O9S A;  4F7U E;  1LVK A;  4M7A C;  4RTV A;  3VKI A;  3P8B B;  5GAN 4;  4C8Q E;  4C5E A;  2A08 A;  4JZ4 A;  1ZUK A;  1MND A;  1AHJ B;  2YRC A;  3CQT A;  2HD0 A;  1A0N B;  4A4K A;  4FT4 A;  5GAN j;  5CK9 A;  4AFQ C;  1YJ9 A;  4JS4 A;  5LL6 S;  3G6E A;  1OZ3 A;  1Q7Y C;  2MIO A;  4PLI A;  1D0Z A;  2EBP A;  1YJ9 Q;  4QQD A;  3G6E Q;  4OMF B;  5IXB A;  3UPU A;  2P0K A;  2LJ3 A;  1ZX6 A;  3QKJ A;  2DNU A;  1AEY A;  2CP2 A;  3SHW A;  3MEW A;  5GMK i;  1KG1 A;  3CC7 A;  2QA4 T;  3PIP A;  3ZEH A;  4C8Q D;  3CC7 Q;  1W1F A;  2QTX A;  1VQM A;  4MZT A;  3M0R A;  2O88 A;  2ZPI B;  2DK3 A;  5EC7 A;  3MEV A;  4BY6 C;  2DTI A;  1Y96 A;  2JNG A;  2RH2 A;  3M4Y A;  2QXF A;  1M3A A;  2DJZ A;  2DL8 A;  2RM4 A;  3I35 A;  2G6F X;  3CCQ A;  1IRE B;  2JTM A;  4HCC A;  2K79 A;  5IHN A;  1RLP C;  3CCQ Q;  2FRW A;  4RUG A;  1YI2 A;  5LJ5 e;  4EMH A;  2LQN A;  1OU9 A;  1YI2 Q;  2DLP A;  3HRU A;  3GNG A;  1VQ7 T;  2CP6 A;  3OS1 A;  4JS5 A;  4M77 G;  3LGF A;  1O9S A;  4LD6 A;  2F5K A;  1X01 A;  2YRD A;  1V76 A;  3RR6 A;  4M7D F;  3OS2 A;  1EX4 A;  4R56 A;  4FSX A;  3VJP A;  1LNX A;  2BZX A;  3PIO A;  3V7S A;  1VQO T;  2COW A;  4A53 A;  1VOM A;  2CS7 A;  4OGE A;  3R6O A;  1QCO A;  1N6A A;  2KMT A;  2RMO A;  3CCU T;  2WSC E;  5FRO A;  1NLP C;  1OPK A;  5CQY A;  2P0P A;  2DYI A;  3JB9 J;  3CMA T;  4XTU A;  1QCN A;  2LZ6 B;  2DF6 A;  2NUT A;  2HCK A;  5FRN A;  1Y07 A;  5I11 A;  2H8H A;  4BE0 A;  3CCS A;  3QG1 A;  3L1A A;  3EGU A;  1VUB A;  3JCM X;  2ZPH B;  4N4G A;  1M1K C;  5GAN 5;  1YHQ T;  2A36 A;  5DLO A;  1PC0 A;  2QA4 A;  2DPP B;  4CC7 A;  3NTH A;  5FU7 C;  2QA4 Q;  5CKH A;  9ATC B;  1XOV A;  1WHJ A;  1E6G A;  4M75 D;  5GJV B;  1KC8 R;  2H3J A;  4NOY A;  2EKH A;  4E7J A;  4ANJ A;  2DD5 A;  4ELZ C;  4BD3 A;  3JCM V;  1AWJ A;  1SHG A;  1OOT A;  2K57 A;  3LYI A;  2DET A;  2IG0 A;  4JRI A;  1QW1 A;  3JCM Q;  5HK3 A;  2JZ2 A;  1N9R A;  1MMD A;  4C92 A;  2QGG A;  3QYG B;  2ZPG B;  1I5L A;  2DD4 A;  1VQ7 A;  2DFU A;  3QUI A;  4PJO B;  1UHC A;  5GAN 6;  1VQK T;  3CPW P;  2BE9 B;  3U23 A;  1VQ7 Q;  2FPF A;  1RUW A;  3VS6 A;  5GAM j;  2O9V A;  4XTW A;  5DLQ E;  2FL7 A;  1VA7 A;  3R6N A;  3OYI A;  2J7I A;  2J6K A;  5D6W A;  2P4R A;  4P5N A;  3REB B; 
#chains in the Genus database with same CATH homology
 4OGC A;  1R8O B;  5I21 A;  4C5H A;  5LJ3 j;  2D0Q B;  3JCM W;  4QVZ A;  4TVR A;  1WNL A;  5GMK l;  3VYG A;  3CCU A;  4M77 E;  2K2V A;  2QQS A;  2BUD A;  2XHC A;  2V8J A;  4GLK A;  5CR2 A;  3E9F A;  2XIC A;  3JCM f;  3CMA A;  4KUL A;  2HAX A;  3MP1 A;  2PQW A;  1M9S A;  1VQ6 T;  2E41 A;  1NE8 A;  2PVG B;  3ZBD A;  3FEO A;  3UDC A;  2DO3 A;  2PUO B;  3QYH B;  5IAY A;  4RMO A;  3G4S A;  3RUX A;  3CCV A;  3A8L B;  2E10 A;  3JCM c;  1JJ2 S;  2ZZD A;  3BFM A;  5FLX E;  2YLB A;  4BE2 A;  2PVO B;  1YJW A;  2K5L A;  1WGS A;  1BI3 A;  3CXC A;  5CKD A;  4N0A C;  2X4J A;  2LC4 A;  3E9G A;  3S3M A;  2L8D A;  3I56 A;  3CCE A;  3FJP A;  3S3O A;  2CZ0 B;  1OZ2 A;  2D6F A;  2JN0 A;  4Z02 A;  1YHQ A;  4M75 F;  3OYN A;  4J5Y A;  5IN1 A;  3HFN A;  3RKY A;  3CC4 A;  4PL6 A;  2M9U A;  1ZBX A;  2C06 A;  1RI0 A;  3EAE A;  4RCC A;  4M77 D;  2RHY A;  2E12 A;  1VQN T;  1NZ9 A;  1VQ4 T;  2M16 A;  4PJO F;  2VXE A;  4C92 F;  3BW1 A;  3FDR A;  3JCM g;  1EIF A;  1VQP T;  4HT8 A;  2M0O A;  4M75 E;  2HBP A;  2V8I A;  2X4X A;  2LQ8 A;  1JBM A;  2I2L A;  4C0G A;  2LCL A;  5GAM d;  2LRQ A;  1YIT A;  3HSB A;  4JUV A;  2R5A A;  3SD4 A;  3P8D A;  5GAO p;  4JRQ A;  4M7A E;  4RCB A;  3CCV T;  2CGH A;  4X34 A;  5J3B A;  2XI9 A;  3RKW A;  1YJW T;  2OTJ A;  3CCJ A;  3OS5 A;  4GY5 A;  2DZ9 A;  3JB9 G;  1QP3 A;  5CAI A;  3F70 A;  3RMS A;  4IUT A;  3GPL A;  3CBM A;  3OYB A;  5I2S A;  3ER0 A;  3H6Z A;  5LJ3 d;  3OYK A;  4RG2 A;  4OB1 B;  2OAU A;  3I56 T;  1VQ9 A;  3PTA A;  1K73 U;  2RHU A;  1U1S A;  1W2B A;  3LX7 A;  2KVQ G;  4J7I A;  3MP6 A;  4M77 B;  3M9Q A;  2D9T A;  1KQ1 A;  3JB9 I;  5IT9 E;  3KUF A;  2BIV A;  2FYK A;  3QO3 A;  4OB3 B;  3VUZ A;  1UGQ B;  2O4X A;  5GAN h;  2RK1 A;  2E1H A;  2JUF A;  4LDX A;  2K5F A;  1VQ8 T;  1W4S A;  2O01 E;  4L59 A;  3MET A;  3WVE B;  1ZQ1 A;  3X25 B;  3SWN A;  3T9N A;  4BUG A;  2B8A A;  2EQK A;  2O4X B;  4EMG A;  1Q82 C;  1KQS S;  1YIT T;  3G7Z A;  1BI2 A;  5LJ5 g;  3OYL A;  4LDW A;  1WQW A;  1VQK A;  2LDM A;  3OSV A;  1UGP B;  2RJF A;  3J80 E;  3C4S A;  3C95 A;  3SWN B;  4M7A D;  4KUI A;  4N4I A;  4PJO G;  4C92 G;  1QVF S;  1WJR A;  4KBM B;  2EQJ A;  4QW2 A;  2XDB A;  1U8R A;  2EYQ A;  2RD1 A;  4BDZ A;  5GAO r;  4FU6 A;  2CKK A;  2CZ7 B;  4FT2 A;  4EMK B;  3CCM A;  2IVW A;  2DVE A;  1FX7 A;  4JRK A;  3MCA B;  2E70 A;  1YBY A;  3RMQ A;  4C92 C;  4PJO C;  2XU8 A;  2RHX A;  1S72 A;  5LJ5 h;  3C94 A;  4M75 A;  4N4H A;  3JCM P;  5GAN 7;  4ZGJ B;  2KAF A;  1NJI U;  1V29 B;  3A5Z B;  3OYG A;  3GP8 A;  4DOW A;  2OTL T;  4BAC A;  4M7A A;  1Y7X A;  4FL6 A;  3TRE A;  3MO8 A;  4M75 B;  4XAX B;  5GAN 3;  4HA8 A;  5CCA A;  4R55 A;  2CYZ B;  4IUV A;  3CBP A;  3FB9 A;  4JLI A;  4ZN3 A;  1WJQ A;  1YJN T;  2XID A;  1I81 A;  2LQK A;  2HQX A;  4J6X A;  4ATO A;  2DXB A;  2MAM A;  1KD1 C;  1VQ6 A;  1RL2 A;  2L5Q A;  4PKC C;  1M1G A;  4M7A B;  4O6J A;  2VYT A;  3X26 B;  4J6W A;  2VGM A;  2A3L A;  2YHT A;  5GMK h;  1UB4 A;  2KQW A;  2LT1 A;  5GAN 2;  3CXC S;  4ZTF A;  1K9M C;  1G3W A;  2RHZ A;  3ME9 A;  4HT9 A;  3L2V A;  4IKF A;  2E5Q A;  5KE3 A;  2EKO A;  2QQA A;  4NL3 A;  3OY9 A;  3L2U A;  2RB6 A;  3CPF A;  3CD6 T;  3J7A F;  4M77 F;  1I8F A;  2DIG A;  2V8K A;  5KCH A;  4IUP A;  1MHN A;  4XU0 A;  3UWN A;  4KUD K;  3OYY A;  3P8H A;  3OSS C;  2X35 A;  5FU6 B;  3OYA A;  3OYD A;  3OYJ A;  1N8R C;  3M58 A;  3FLG A;  3HFO A;  3CPW A;  4XQ3 A;  2XDP A;  5DY9 A;  1YJ9 T;  2RJC A;  5KE2 A;  1JB0 E;  3G6E T;  1XTD A;  1G3S A;  1LJO A;  4C5G A;  1KQ2 A;  4A4F A;  5D6Y A;  1BIA A;  3RKX A;  1VQ4 A;  1QVG S;  1VQP A;  1VQN A;  3OYH A;  4DQ2 A;  2E6Z A;  4B9W A;  2DXC A;  2Y4X A;  4OVA A;  1KC8 U;  4M78 D;  2DKG A;  5GAM e;  3JCM d;  3QZ9 B;  1HK9 A;  3QII A;  2QQB A;  3CEY A;  3CME A;  4JRP A;  5HK0 A;  2MMP A;  5GAN f;  3PMI A;  1M4Z A;  2E6N A;  2M1H A;  3GNF B;  2QEX A;  1W2B S;  3DB4 A;  3M59 A;  3ASK A;  3OQ5 A;  4BY6 B;  5CKB A;  2RO0 A;  5M9O A;  3G71 T;  2R5M A;  1K9M U;  5LJ3 e;  2E64 A;  2X4Y A;  4J7F A;  4EPC A;  4HKE A;  3JCM b;  2RJD A;  5GAN d;  2PVD B;  3SB2 A;  4XTV A;  4L6V 5;  1VIF A;  3EFS A;  1UGR B;  3V8J A;  2EQU A;  3BDL A;  3M56 A;  4E7H A;  1LOJ A;  4IUQ A;  2P0Q A;  2VUB A;  2JOY A;  4JLG A;  3GIB A;  2DZC A;  3OB9 A;  4M7A F;  4DA4 A;  5GAO q;  1VQ8 A;  1IZ6 A;  1YIJ A;  4M77 C;  4CI0 C;  1M90 C;  3NFC A;  1N8R U;  2XD0 A;  3JSC A;  5LJ5 f;  1BIB A;  3CCQ T;  1FWZ A;  3VV0 A;  1H3Z A;  3OBW A;  1QVG A;  2KSS A;  2MWP A;  4X9C A;  4M7D E;  4XTY A;  3CME T;  5FRM A;  3MP8 A;  4O5V A;  4E7L A;  1DJ7 B;  3M54 A;  4BI8 B;  5LJ5 d;  4J6Y A;  1YI2 T;  2E65 A;  2EAY A;  4L5G A;  4ZN1 A;  5GAN g;  3I55 T;  2QEX T;  2PUK B;  4M77 A;  1K8A C;  1B34 A;  2QDY B;  3X24 B;  5C6S A;  4MZM A;  3CBO A;  3A8M B;  3SWN C;  2FVU A;  3QDR B;  3S3N A;  3FRN A;  3LWI A;  4RKU E;  4HCB A;  2DXT A;  4E7I A;  4A4H A;  3L2R A;  3Q1J A;  1B34 B;  4ME7 A;  3H8Z A;  4EMK C;  1HXD A;  2F69 A;  4C5I A;  2GFA A;  1U1T A;  2EJF A;  1Q86 C;  2OTL A;  4A54 A;  4YTL A;  4LD9 K;  4BDY A;  4RG8 A;  3CCR T;  2ZPB B;  3FC3 A;  1X6O A;  5A0L A;  4M75 G;  2MI6 A;  2K5I A;  3M5A A;  5CVI A;  3OYF A;  4NS5 A;  3L2Q A;  1H64 1;  1YJN A;  3HRS A;  5CIU A;  1XNI A;  2AHJ B;  1BI0 A;  3LH0 A;  2VV5 A;  3OYM A;  2GFU A;  3JB9 D;  4LDV A;  4EMK A;  4M75 C;  2PU9 B;  3CC2 T;  4M7A G;  1Q81 C;  3WVD B;  2F5T X;  3EFR A;  2YLC A;  4M7D D;  4F7U E;  3TEE A;  1QVP A;  1WPY A;  3V7C A;  1I4K 1;  3JAM E;  4C0D B;  3PGG A;  4M7A C;  1M90 U;  1YIJ T;  4OB0 B;  3VKI A;  3P8B B;  5GAN 4;  1FXX A;  3NTK A;  4C8Q E;  4C5E A;  4XU2 A;  3CD6 A;  3QPH A;  2K3X A;  3CPW S;  4ZTJ A;  1AHJ B;  2K3Y A;  2YRV A;  2BKD N;  2HD0 A;  1PSF A;  2Y90 A;  2ZPE B;  2EQM A;  4A4K A;  4FT4 A;  4MMK A;  5GAO n;  5GAN j;  4M78 F;  3L42 A;  3OW2 A;  1VIE A;  2HNI A;  3QHS A;  5CK9 A;  4M7D A;  1YJ9 A;  2DXU A;  4JS4 A;  5LL6 S;  2KK4 A;  3FIF A;  3G6E A;  1OZ3 A;  3HRT A;  1Q7Y C;  1G5V A;  4LDY A;  4PLI A;  5GAO m;  3CCL T;  5FU6 C;  4MML A;  5GAM h;  3OBY A;  4QQD A;  2EIF A;  4C0Z A;  4UC4 A;  4M7D B;  4OMF B;  4M78 E;  3UPU A;  2P0K A;  2X4W A;  5CKF A;  2XK0 A;  4Q5W A;  5FU7 B;  2MF2 A;  3QKJ A;  3JCM e;  4FM4 B;  3BDU A;  3QJ6 A;  4QVC A;  2VGN A;  3MEW A;  3J81 E;  5GMK i;  1KG1 A;  1SSF A;  3CC7 A;  2FB7 A;  2QA4 T;  3DB3 A;  3X28 B;  2Y4Y A;  4OF1 A;  5LJ3 h;  3KBG A;  2WSE E;  3TU4 K;  2MWO A;  3HKS A;  1WQ7 A;  3ZEH A;  4C8Q D;  3PIP A;  5LJ5 j;  1VQL T;  2RI2 A;  1G3T A;  3G71 A;  2QTX A;  1Q81 U;  5DM7 R;  1VQM A;  4MZT A;  2ZCF B;  2JVV A;  4BI3 A;  1QP2 A;  2ZPI B;  4XTX A;  2DK3 A;  5D6X A;  3WXM B;  3AHU A;  3RES A;  5AYF A;  2DAQ A;  3QZ5 B;  4DOV A;  3MEV A;  4QQG A;  3HP9 A;  2DTI A;  3RIR A;  1UEB A;  1Y96 A;  2JNG A;  1KHC A;  2RH2 A;  3M4Y A;  2QXF A;  3DKM A;  4F7U A;  4XU3 A;  2DJZ A;  4QVD A;  4VUB A;  4JJN K;  2LT4 A;  2RM4 A;  3OA6 A;  4C8Q A;  4JDS A;  5GMK j;  3CCQ A;  1Y96 B;  4F7U B;  2QQ9 A;  1IRE B;  5A0G A;  5KH6 A;  2JTM A;  4HCC A;  3SFM A;  5GAN 8;  1VQO A;  5CQX A;  4C8Q B;  3L2W A;  3CC7 T;  2EFI A;  5J26 A;  1YI2 A;  1PSE A;  5LJ5 e;  3LGL A;  4EMH A;  3I55 A;  3M57 A;  4PLL A;  1NPP A;  2RI3 A;  3C12 A;  3OMC A;  3PT9 A;  4A4E A;  4MDX A;  2EJG A;  4E7K A;  1VQM T;  5KCO A;  3HRU A;  3GNG A;  3HPW A;  2DIQ A;  1VQ7 T;  4M78 A;  4X9D A;  3VYH B;  3OS1 A;  4JS5 A;  2XG8 D;  3JB9 F;  4M77 G;  3LGF A;  4BY6 C;  1O9S A;  4LD6 A;  2F5K A;  2ZGW A;  3S6W A;  1X01 A;  3CCR A;  2VXF A;  1K73 C;  4NL2 A;  4XU1 A;  4M7D F;  4ZGD B;  4HCZ A;  3OS2 A;  4M78 B;  3LLR A;  4XK8 E;  3V7R A;  5GMK e;  5HY6 A;  4R56 A;  1UGS B;  4FSX A;  3VJP A;  3PFS A;  5C0M A;  1LNX A;  2LVM A;  3PIO A;  1GXI E;  1VQ5 T;  2L3R A;  3V7S A;  3CC2 A;  3X20 B;  4EDU A;  1VQO T;  2XDD A;  3QBY A;  4A53 A;  4E47 A;  1KD1 U;  3HL8 A;  2DTH A;  2CS7 A;  3DLM A;  3E1S A;  4IUR A;  3R6O A;  4OGE A;  2RJE A;  1N6A A;  4XTZ A;  2KMT A;  3UT1 A;  3CCU T;  2LX9 A;  2RHI A;  2WSC E;  4N0A A;  5FRO A;  2WAC A;  5GAM f;  5CQY A;  5GAO l;  3QXE B;  2GCX A;  2P0P A;  3OW2 S;  1ZHI A;  3GLX A;  3MHX A;  3JB9 J;  3CMA T;  3OMG A;  4C0D C;  2EWN A;  3A8G B;  3ZFJ A;  5HKC A;  4XTU A;  1X75 C;  4Y91 A;  4B9X A;  3A8H B;  2EJ9 A;  3QSU A;  1P92 A;  5I2M A;  5FRN A;  1Y07 A;  5GMK m;  3NTI A;  3G4S T;  4BE0 A;  3CCS A;  3QG1 A;  1OI1 A;  3L1A A;  4F7U F;  5LJ3 f;  4WF2 A;  4C92 E;  1NJI C;  3CCL A;  5CO7 A;  3OYC A;  4PJO E;  4MDW A;  2G3R A;  1VUB A;  2KY9 A;  2LNV A;  3A8O B;  3JCM X;  3BY7 A;  1NPR A;  1YCY A;  3JCM h;  2ZPH B;  3VUB A;  4C8Q F;  3JCM J;  4A4G A;  3SDZ A;  2XKO C;  1JJ2 A;  4C0F A;  4M7D G;  1Q82 U;  4N4G A;  4LDU A;  3CCE T;  3OS0 A;  2LCC A;  3V8L A;  3KXT A;  5A2Q E;  1M1K C;  5GAN 5;  1YHQ T;  1Y71 A;  3M55 A;  5DLO A;  1KHI A;  4BI4 A;  2JTF A;  2RK2 A;  2WSF E;  2QA4 A;  4M7D C;  2DPP B;  3MEU A;  3CC4 T;  3QJY A;  3O8V A;  1VQL A;  4FIB A;  3JB9 H;  2FHD A;  3M53 A;  3NTH A;  5FU7 C;  4J83 A;  1BYM A;  5GAM g;  2NLU A;  3INZ A;  5CKH A;  3LW5 E;  1XOV A;  2VC8 A;  1BKB A;  5A0D A;  4M75 D;  3PMT A;  2LTO A;  4V2S A;  1JRI A;  3HHT B;  3MEA A;  4II1 A;  2H3J A;  4NOY A;  1K8A U;  1N27 A;  2GF7 A;  2R57 A;  1N9S A;  3LWH A;  1OYX A;  2RI5 A;  3CCS T;  4CRI A;  4E7J A;  4ZGE B;  2OTJ T;  4J8O A;  3CCJ T;  4C92 D;  4PJO D;  5LJ3 g;  2DD5 A;  2QQR A;  2QI2 A;  2P4T A;  3VU3 C;  2GQV A;  4ELZ C;  5CKE A;  3GOX A;  2R58 A;  1Q86 U;  4BD3 A;  3GF5 A;  3JCM V;  4QQ6 A;  3V8K A;  2K57 A;  1TH7 A;  4F7U G;  1VQ9 T;  3M4G A;  3LYI A;  3N5B B;  1XQH A;  4PNO A;  3TCJ A;  1M8V A;  1M5Q 1;  2IG0 A;  1KC8 C;  4JRI A;  1QW1 A;  3JCM Q;  5HK3 A;  2HQE A;  3JRZ A;  4C8Q G;  2JZ2 A;  1N9R A;  1BI1 A;  1G3Y A;  2A7Y A;  4ELY C;  1D3B A;  1O75 A;  4C92 A;  4PJO A;  3QYG B;  4C8Q C;  2ZPG B;  4IUU A;  1I5L A;  2CZ1 B;  5GAN e;  2DD4 A;  1M1K U;  1VQ7 A;  4Y28 E;  1D3B B;  2ZPF B;  4D6W A;  3QUI A;  5L8R E;  3URG A;  2K4Y A;  4C92 B;  2CZ6 B;  5GAN 6;  3DLL A;  1VQK T;  4PJO B;  3E19 A;  1WJS A;  3RER A;  3L2Z A;  1KQS A;  5GAM j;  1M1F A;  4BB7 A;  4MZP A;  4OB2 B;  3CCM T;  4M78 G;  4XTW A;  3OYE A;  5DLQ E;  3PNW C;  2FL7 A;  2L89 A;  3OYI A;  5J39 A;  1VQ5 A;  2DTO A;  4OP0 A;  1QVF A;  2KDS A;  4KT0 E;  1S72 T;  5D6W A;  2RA2 A;  4P5N A;  2DEQ A;  4M78 C;  5EG2 A;  4BE1 A;  1Q7Y U;  1MGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...