2RO0A

Solution structure of the knotted tudor domain of the yeast histone acetyltransferase, esa1
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
92
structure length
92
Chain Sequence
GSHMSHDGKEEPGIAKKINSVDDIIIKCQCWVQKNDEERLAEILSINTRKAPPKFYVHYVNYNKRLDEWITTDRINLDKEVLYPKLKATDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase ESA1
publication title Novel structural and functional mode of a knot essential for RNA binding activity of the Esa1 presumed chromodomain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 6
structure length 92
sequence length 92
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2008-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ro0A00
4IUQA 3FDRA 3OMGA 3ASKA 4NS5A 4A4EA 3MEAA 2QQSA 2LTOA 2RJEA 2EQUA 5FRNA 4FL6A 3P8HA 5KCOA 2RHUA 2L3RA 2X4YA 2YRVA 5J39A 3OMCA 4A4HA 2MWPA 4BE2A 4RG2A 2RHIA 3L2UA 5M9OA 3GOXA 4C5IA 3FLGA 3SD4A 3S3MA 3BDLA 3NTIA 1OZ2A 1N27A 3F70A 3OB9A 1G5VA 2LVMA 3LLRA 5KCHA 2GFUA 2JTFA 3S3NA 3UWNA 5IAYA 4C5EA 2RI3A 2BUDA 4BDYA 1OYXA 2DAQA 1SSFA 4E7KA 2JZ2A 4UC4A 5KH6A 4HCZA 4IKFA 1RI0A 3LGFA 3M9QA 2X4WA 3PMIA 5C6SA 3OS2A 4Z02A 4E7JA 4EDUA 4QVZA 3H6ZA 2XK0A 2DIGA 4II1A 5D6WA 5FRMA 3OA6A 1MHNA 3OYGA 4IUUA 3S3OA 2LRQA 4IUPA 3OYAA 5D6XA 3H8ZA 2M0OA 3ZEHA 2QQRA 4E7HA 4QW2A 3S6WA 4N4HA 5J26A 4OVAA 4B9XA 3MEWA 3NTKA 2F5KA 4C5HA 2BIVA 2IG0A 2M16A 3L2VA 2R5MA 4BE1A 2GFAA 3OS0A 5FROA 2EQMA 4PLIA 3QKJA 2O4XB 2R57A 4QQDA 3OYBA 3FEOA 3MEUA 4GY5A 4L59A 2DIQA 2EFIA 3EAEA 3PNWC 4FU6A 3CEYA 2WACA 3PMTA 4PLLA 3OYDA 3OYHA 4BDZA 3UT1A 2LCCA 4A4FA 5IN1A 1H3ZA 2RJDA 3MP1A 4A4GA 2K3XA 4BE0A 2O4XA 2RI5A 3DB3A 3PFSA 4CRIA 3OYLA 3OYJA 3NTHA 2E6NA 2G3RA 4C5GA 3L42A 3MO8A 3OYEA 2XDPA 3L2WA 1WJQA 3E9FA 3O8VA 3LGLA 3OYFA 2R58A 4QQ6A 3DLMA 3META 3ME9A 2HQXA 4PL6A 4ZTFA 2LDMA 2P0KA 2X35A 2PQWA 2X4XA 2EKOA 2RJCA 2RJFA 3OYKA 3QBYA 3OYIA 3MP6A 1WJRA 3KUFA 3Q1JA 2EQKA 2RO0A 3MP8A 4Q5WA 2FHDA 2B8AA 3OS1A 3L2QA 3QJ6A 3LX7A 5D6YA 3OYMA 3LYIA 4B9WA 2GF7A 4BACA 3C4SA 2EQJA 2RHYA 3OQ5A 4LD6A 2R5AA 5C0MA 4BD3A 1KHCA 2NLUA 2BKDN 3LH0A 2HQEA 2RI2A 4E7LA 2E5QA 2CKKA 2K3YA 4QQGA 2L8DA 4X34A 2MWOA 3QIIA 5KE3A 3L2RA 1WJSA 4IUTA 4IUVA 1XNIA 5CIUA 3P8DA 2L89A 1WGSA 4IURA 3OYCA 2D9TA 3E9GA 2RHXA 4N4IA 1OI1A 3OY9A 3FC3A 5KE2A 4E7IA 3OYNA 4ZTJA 2M1HA 4N4GA 2RHZA 3MEVA 1OZ3A 3DB4A 2VYTA
chains in the Genus database with same CATH superfamily
3LWIA 3G6EA 4JRKA 1YIJT 1AWWA 1MNEA 2RHUA 1QCNA 1UUEA 2XDDA 5FU6C 2K57A 5GMKl 2DX1A 2ROLA 1X2KA 1YIJQ 3CCQA 4MDWA 3SD4A 5AYFA 2PZ1A 2DEQA 5KCHA 2E10A 3BY7A 2V26A 2RI3A 4J9DA 4MZTA 1K9MU 4EIKA 2JXBA 1Q86U 2DRMA 4RTYA 4M7AD 3M59A 4BI8B 4J9GA 2DBKA 2E65A 4FW2A 5FRMA 3OYGA 2K7AA 2E3IA 2O2OA 2ENMA 2LJ3A 4C0DC 1YJ9T 1UGPB 2F5KA 1D3BB 1E6GA 1WPYA 4PLIA 1YJ9Q 4M7DE 1QVFP 2YRCA 4M75C 2XHCA 1B34B 1G83A 2EYZA 2I2LA 1D3BA 2RQTA 1HJDA 2A3LA 5FU7C 2JTMA 2COYA 1K9MR 3TREA 1B34A 1YCSB 4PJOD 2HD0A 2MOXA 3PGGA 4XTYA 1TU0B 1R0BG 2BZYA 3JV3A 2O01E 3X24B 4J83A 2BZ8A 2RQWA 3OYKA 1K8AU 2EWNA 1Q7YU 2B8AA 4AFSC 4M7DB 1TUDA 1AEYA 2F2XA 2K2VA 1Y0MA 3LH0A 1IHWA 1WXBA 1M1KC 4IUTA 4F17A 4M7DA 3CCUA 3FB9A 3EGUA 3OYCA 1T0HA 3QDFA 5KYWB 2MF2A 1VYVA 1VQ8T 2EPDA 5DM7R 3MEAA 2KDSA 2YLCA 3T9NA 4M75G 3HRUA 3P8HA 5KYWA 2DTIA 2LCSA 1KQ2A 5GAOq 3LW5E 1YWPA 1W2BP 2EYWA 1E6HA 3VUZA 5FWCA 1WX6A 4C5EA 2DAQA 1EIFA 3A5ZB 2IPOB 4C8QF 2HNIA 3PMIA 4FSXA 2CT4A 4EDUA 2XK0A 2AHJB 3SHWA 1UECA 2HAXA 4PJJA 1U1TA 2CDTA 2HBPA 4ELZC 1M30A 2K5FA 5D6XA 2CSQA 2KE9A 1CKAA 3MEWA 4M77B 2FL7A 4C5HA 4AT1B 1KIKA 4OMPA 1K9MC 2ROTA 3FEOA 3OYBA 1I0CA 3G71T 4X9DA 3SWNC 2DXUA 3CC7A 2XD0A 1YHQQ 2RQVA 3CCMA 5CK9A 4HKEA 1Q82U 2W10A 1M5Q1 1M8VA 3OW2S 1RL2A 1YWOA 4PL6A 1OQKA 4M78D 4XTWA 2X35A 3NFCA 2X4XA 3NMZC 1B3QA 2KRMA 3MP6A 5GANj 2KR3A 3JSCA 4MMKA 5EC7A 3GBQA 2XDBA 3QG1A 4EMKC 1C1AA 2P0QA 3EG0A 1N6AA 4HT8A 4FYYB 3X26B 2VGNA 1OX8A 1UGVA 1VQLT 1I4K1 1OI1A 4KBMB 1VQ4A 1Q7YC 2GGRA 1VQLQ 2VKNA 2HKNA 3OMGA 4C0GA 5CCAA 1KFZA 5DLQE 4OB2B 1JJ2S 2GQIA 4MZMA 3OW2A 3S3MA 3NTIA 4PFPA 3F70A 1G5VA 4RTWA 2YLBA 2DL8A 2RH2A 2BUDA 2CZ0B 5CKBA 1OOTA 1NPRA 4HCZA 1RI0A 4WCIA 2LQ8A 3HTRA 4M75F 3UA7A 3OA6A 2BZXA 1ZUKA 4DBRA 3G6EQ 5J3BA 1Y57A 1B7TA 2DRKA 1YJNA 2RK1A 3OBYA 1QW1A 2CP6A 4GY5A 1FYNA 2DYBA 3CQTA 1PD1A 4RTVA 1QVGP 2LNHB 3JB9J 3WVEB 3JCMc 1W70A 1JJ2A 4M7DD 4LD9K 3M57A 3G4ST 2YUOA 3LGLA 2FVUA 3G4SQ 2ED1A 2JUFA 2CP3A 1O9SA 2O31A 3GNFB 2HSPA 2KT8A 1HSQA 1PHTA 4EMHA 2E41A 1SEMA 4ZGEB 2KSSA 2JJ9A 3CCSA 4RKUE 1X6BA 2CZ6B 2YXYA 1PRMC 2VV5A 2QQAA 2E5QA 4ZGDB 3C12A 4X34A 1R77A 5I2SA 2Y4XA 1WJSA 3X28B 4Z88A 4C92C 3RBBB 3A8GB 5GAMf 3A8OB 2M9UA 2HCKA 2RA2A 3VU3C 1M1FA 1VQ7A 1TOVA 3CBMA 4LNPA 2DA9A 1BIAA 4RTXA 2DZ9A 2CGHA 3TQ7P 1IHVA 4HT9A 3HL8A 1NM7A 1PSFA 4M77D 2DEUA 2GQVA 1NJIR 1M2VB 3CPWA 3PT9A 3JCMX 4JS4A 2PTKA 1K76A 4IKFA 4J9CA 2CREA 2WSCE 1YNZA 4E7JA 1RAAB 2QASA 2XICA 1M2VA 3CBOA 2ATCB 2Y90A 4J9EA 1K4US 1OPLA 2LRQA 4NOYA 4A63B 1WIEA 1M8MA 3H8ZA 1K0XA 2QTVA 3S6WA 3EGDB 1QKWA 5FU6B 1K1ZA 1KC8R 2DBMA 1I07A 2R5MA 2QTXA 4M7AE 4C92G 3I9QA 4XTVA 3EGDA 4N0AA 5LJ3f 3NGPA 1WHGA 1Q81U 2MIOA 4BY6C 1PM3A 2RB6A 3ULRB 5GAN8 4AFZC 4CRIA 4LDVA 4C5GA 4E7SA 5GAMd 2ZGWA 1QP2A 2R58A 1M4ZA 1BKBA 1VQOT 2LDMA 1VQNA 4C0DB 4XU3A 2CH4A 2VB6A 1VQOQ 1ARKA 1FMKA 2ECZA 3CMEA 3HSBA 2VWFA 4M75B 4BD3A 2L8DA 3KFVA 4M7AA 3JRZA 2LQNA 2ZPFB 2V8KA 5FU7B 1Q81R 2RN8A 5CIUA 4M75A 2LX9A 5A0DA 5GAMe 2COWA 2EYYA 4E7IA 1QWFA 1WHLA 1XTDA 1SKUB 2FPFA 4IUQA 2DD5A 1SRLA 2HL3A 2X4YA 3SFMA 1NJIC 2RHIA 1TH7A 3RESA 2RM4A 2VGMA 2VUBA 2B86A 5M9OA 5GANf 1ACMB 4Z89A 5GAN2 5ECAA 1UJYA 5LJ3d 1JXOA 4BDYA 3VS7A 2RQUA 4HVUA 2AKKA 3EGXB 1OPKA 1UB4A 1ZHIA 1KC8C 2RPNA 1SHFA 2F2VA 1NYFA 3EGXA 3UDCA 5J26A 2JTEA 5DY9A 1IGUA 2DJQA 2QA4A 4MMLA 1V1CA 4QQDA 4RG8A 1OU9A 2HBWA 5CAIA 1WZOA 2C0OA 4ORZA 4A4GA 5LJ3e 1G3TA 2ZPBB 1FMVA 4HVWA 2DD4A 2H3EB 5I22A 1GRIA 2EVRA 2NUTA 2QGFB 1MV0B 5A2QE 4C8QC 3QBYA 5GAOm 3CCJT 1BBZA 2DO3A 2YUNA 3L2QA 3V7SA 4RCBA 1YJNT 1Q81C 3CCJQ 2CZ7B 2DVEA 1VQ6A 2F69A 2JN0A 4OMFB 2R5AA 3SWNB 1MMAA 1YJNQ 1WHHA 3VS3A 1YBYA 4QQGA 2NUPB 1BI2A 2E64A 3VV0A 3QIIA 1CKBA 2DKGA 3ZFJA 3CPWP 2DK3A 3SWNA 2FB7A 2M0YA 1VQPT 3FJPA 4IURA 5IT9E 1WQ7A 1TUCA 2MI6A 1RLQC 2NUPA 2PVGB 1OZ3A 2YWWA 2EJGA 2DYIA 2K2MA 1VQMA 1R0CB 2VVKA 1HYOA 2D0QB 4A4HA 1T0JA 3EHQA 1DJ7B 1K9AA 2V8JA 1MMDA 2EGEA 4EMKB 3DKMA 4PJLA 3EG3A 4ATOA 4P5NA 2QEXT 2DILA 1WQWA 3QJYA 5IAYA 2GNCA 3CCLT 2K3BA 4JDSA 4XU2A 4UC4A 1GFCA 2QEXQ 5GANg 4EMKA 3LGFA 4YTLA 4C8QG 3OS2A 3CCLQ 3FIFA 2EYXA 3RIRA 1Y71A 2P4RA 4HCKA 3M0RA 5L8RE 4CC4B 2F2WA 3NHNA 1E7OA 1VQ7Q 4OVAA 2FZGB 4F7UF 3GNGA 4E6RA 2M16A 5LJ5h 2E3HA 3GF5A 1VIFA 1G2BA 1OX9A 1PNJA 1VQ5A 4FU6A 3LH5A 4A4FA 2LCCA 3MP1A 4AFUC 1KSWA 4OGCA 2JS2A 4FW1A 4LE9A 1WXUA 4M75D 2AZSA 2CZ1B 3MHXA 3MO8A 2FO0A 3QO3A 1I5OB 3C94A 5FLXE 3CC4A 3A8LB 1EZZB 1YP5A 1NYGA 2C0IA 2RNAA 2DFUA 1WJRA 3QDRB 2JMCA 5D7UA 2DLPA 3OYMA 3V7CA 1X43A 4CC7A 5GAMj 2EQJA 3QUIA 2HQEA 3VRZA 2OJ2A 1ZLMA 2DL4A 2C06A 3GPLA 4C92E 2A36A 4J9IA 3H0IA 4XU0A 2D9TA 1M1GA 2KRNA 4J6WA 3A8MB 2KROA 3CCEA 1B07A 4A54A 4OMNA 1OV3A 1WHKA 1QCOA 2L2PA 1TS9A 4LDYA 1VQNQ 3OMCA 1SPKA 4RG2A 3CMET 2KXCA 1FWZA 4FSSA 4TVRA 2PUKB 1WYXA 3R6NA 2JOYA 3CMEQ 1BIBA 2GFUA 4LDUA 1QKXA 4C92B 5CQXA 3QWXX 2D8HA 3RKWA 2DIGA 3QSUA 1UEBA 2K4YA 4C92A 5GAN4 2JMAA 1TSFA 3JCMh 4J9BA 4M77E 5LJ3j 5IH2A 3M0PA 1QP3A 2VASA 3NPFA 2BIVA 4IIOA 3MPUB 4FYXB 4RCCA 1LNXA 5FROA 2GBQA 1H641 2A37A 2AK5A 3EAEA 3PNWC 2RJDA 1UFFA 4BE0A 1PD0A 1YI2A 1GBQA 1WHJA 3TSZA 1QVPA 3PIPA 4HXJA 5LL6S 3VUBA 4C0FA 4LUEA 1KQSP 4D8KA 2J6KA 4GLMA 1BI3A 5HK3A 2RJFA 1YHQT 2X3WD 3JCMW 2LNVA 2YSQA 4M77A 1YJWA 1RAEB 5IHNA 2DNUA 1N9RA 4KGXB 2QA4Q 1V29B 2BKDN 4J6XA 3X20B 4BY6B 1NLPC 2V1QA 1PKTA 1GXIE 2DM1A 4IUVA 3I5RA 1WLPB 5GAN7 2OAUA 3E9GA 3OY9A 5KE2A 3OSSC 4RTZA 1XQHA 2SRCA 4XTZA 5FWBA 2ED0A 5CR2A 4RUGA 4PNOA 2AT1B 5J39A 3L2UA 3M5AA 2K5IA 3I56A 1VQ9T 2L0AA 3HHTB 4JRQA 4KGVB 1VQ9Q 3AHUA 2BE7D 1UHFA 3V8JA 1HD3A 1S72A 1VUBA 3CCVA 3EH2A 4KH1B 5C6SA 5CKFA 1KG1A 1VQKA 3JB9G 2KK4A 5D6WA 1AHJB 1MHNA 1J3TA 2V1RA 2PUOB 3CC2A 1G3SA 2QQRA 2DXCA 4JLGA 4N4HA 4PJNA 1VYUA 4ME7A 4Y28E 4D6WA 1YITA 3NTKA 3M0UA 5GMKh 5HK0A 4OB1B 1LPLA 3OSVA 3CMAA 4DBFA 3C95A 4JPBW 2EFIA 2EQIA 3FRNA 2OTLA 3J7AF 3R6OA 7AT1B 3WVDB 1X2QA 3G6ET 3M55A 3M4YA 2RD1A 3I35A 2CYZB 3E9FA 2A08A 4ZTFA 3CCQT 2EKOA 2RJCA 4C8QE 5CQYA 2EQKA 2KQWA 4Z8AA 3CCQQ 2K6DA 2DERA 2VC8A 3MJXA 3CXCS 2OTJA 5GJVB 2E1HA 3WXMB 3V7RA 1ZSZC 5FW9A 3MCAB 1WXTA 2DMOA 2FG0A 2P84A 4FT4A 4FCYA 1IRXA 1VQ5Q 1K73R 5CO7A 4L5GA 2DL3A 4QVDA 3CD6A 2J05A 4MDXA 4F04B 1IO6A 1RADB 4C92D 3DB4A 3A1PA 2Z0WA 4C8QB 3OBWA 5FRNA 2L3RA 1HK9A 3H9NA 4CC2A 4OP0A 4NL3A 1NJIU 4C8QA 4PJMA 3M0SA 1KD1U 1AT1B 2J6FA 4JJBA 2DL5A 3CCRA 1BCMA 2GTJA 1YN8A 3HFOA 3CXCA 1BB9A 4QVZA 1ZA2B 3CCET 2HSEB 5HCKA 1KC8U 2AZVA 2XU8A 3CCEQ 5LJ5d 5KYXB 4B9XA 1D1AA 2J7IA 5I21A 4JJDA 3OS0A 1GCQC 3QKJA 1YIJA 3MEUA 2K5LA 3D7SB 3CCUT 3OS5A 2E12A 5KYXA 1NZ9A 1KD1R 2WACA 3RNJA 3CBPA 3M0QA 1ZX6A 3CCUQ 3JB9F 2K3XA 1NEGA 2KT1A 4ESRA 4KULA 3JB9I 2CP2A 3DLLA 3AT1B 2QK0A 3UF4A 2KYMA 1MMGA 4MZPA 4ZNXA 1I5LA 2RF0A 4OF1A 2LC4A 4OB0B 5LJ5e 3REAB 2RO0A 5D6YA 1W4SA 4M75E 3LYIA 1K73C 2F5TX 1YJ9A 2KI7A 3BFMA 2J06A 1YI2T 2JNGA 4KRTA 3CPFA 1U1SA 1WGSA 1YI2Q 1M9SA 1JEGA 3FJ5A 1ZBJA 2HL5C 3QXEB 2LT1A 3ASKA 4J9HA 1QVFS 3GIBA 3OW2P 2ZZDA 3CC7T 1ZQ1A 2E70A 2J6OA 3CCMT 1X6OA 4M78F 4HVVA 4OMMA 5AT1B 3GOXA 4C5IA 1TG0A 1OZ2A 2YRDA 3CC7Q 3CCMQ 2KRSA 4DEYA 4EPCA 2IVWA 3QHSA 2YUQA 3RKXA 3H6ZA 1RACB 3JCMd 5GAMg 1VOMA 4IUUA 2AIRB 3VS0A 5GAN5 3JB9H 3L2ZA 2PVOB 1KD1C 2A7YA 1VQ8A 4F7UG 2GFAA 3JCMP 2EQMA 4XK8E 2YT6A 2FZKB 4L59A 1JJ2P 2HDAA 3G1JA 3OYHA 3IQLA 1QVFA 1VQ4T 1I8FA 8AT1B 2EKHA 1H92A 3SEMA 3CCVT 1KQ1A 2E6NA 2G3RA 1VQ4Q 3L42A 2DXTA 2X4JA 2XI9A 1MUZA 1S72Q 3CCVQ 3O8VA 3JCMe 2P0PA 3DLMA 3ME9A 1VQKQ 3CC2T 4RTUA 4JJCA 3I5SA 1W2BS 1RUWA 3EFRA 3URGA 4C0ZA 3Q1JA 3CC2Q 1YITQ 4HCBA 4C8QD 1JRIA 4E7LA 1TTHB 3QZ9B 3N5BB 1UHCA 2FEIA 1WI7A 5LJ3g 3G71A 2L89A 2OTLQ 3CXCP 5HY6A 4N4IA 3G7ZA 3KBGA 1RAGB 1MV3A 1ZBXA 4N4GA 3MEVA 2VYTA 2DL7A 3FDRA 4AFQC 4NS5A 2QQSA 3HRTA 2K79A 2O88A 5KCOA 2MAMA 4ANJA 1U3OA 2BE9B 2VXFA 3UA6A 1H3HA 5GJWB 1RAIB 3JCMQ 1SSHA 3PIOA 2OTJQ 4XTUA 4O5VA 2VXEA 1W2BA 3VS1A 1NPPA 4E7KA 2JZ2A 3JAME 1R8OB 1M90R 4IIMA 2CP0A 4ZN1A 1KK7A 3CCST 2P4TA 4PFOA 3O5ZA 4JLIA 2RQRA 3CCSQ 2E6ZA 3UPUA 2FYKA 1UDLA 4BE1A 3EG1A 4LN2A 2R57A 1N9SA 2ZPEB 4JRPA 4PLLA 4BDZA 3OYDA 1OEBA 5LJ5j 3VKIA 1LJOA 3DB3A 3THKA 2NWMA 1AOJA 5EG2A 1VQ7T 2HQHA 2XDPA 2A0FB 5KYUB 1QQJA 1Q95G 4JRIA 1UGRB 2C0TA 2PQWA 5CVIA 3PVQA 3VJPA 5GMKe 3REBB 1M1KR 4Q5WA 2MMPA 5KYUA 1BI0A 3OQ5A 2PU9B 4N0AC 4LDXA 2RI2A 1JQQA 2D1XA 1KJWA 1D09B 3JCMJ 2XG8D 2ZPHB 3I55A 1PSEA 2H3JA 9ATCB 1AWOA 3HKSA 4J6YA 3OYNA 2KMTA 1PKSA 1CSKA 2RHZA 4QT7A 1UJ0A 4A4EA 2F1LA 1GL5A 2XKOC 3G4SA 2EQUA 4FIBA 4FL6A 2MPXC 4E7ZA 1QVGS 2FRYA 1WA7A 1ZSZB 1M90C 1BCOA 1PWTA 2W0ZA 4M7AC 3UWNA 2OI3A 2H8HA 1PC0A 1FXXA 1X6GA 1ZSZA 5CKHA 1NBEB 4E47A 2L3PA 1VQNT 3M9QA 2L3SA 1P92A 3EH1A 3A8HB 1Y07A 4II1A 1BYMA 2HKQB 1NLOC 1SG5A 1SHGA 1LOJA 2COZA 5GAOp 1Q86R 4IUPA 2QDYB 2DPPB 8ATCB 3ZEHA 1M2OA 5GAMh 2WSEE 3L1AA 1RI9A 4JZ4A 1NEBA 3M58A 2GTOA 2QQ9A 2QGGA 4OMOA 2DIQA 1U5SA 4PJOC 3VS4A 3UT1A 3OYYA 4OMQA 1H3ZA 3X25B 3TEEA 4CI0C 3JCMV 2LT4A 2RI5A 1QVGA 1JXMA 2NUZA 1UTIA 1D1BA 1WJQA 2ESWA 3M54A 2JVVA 3META 4JUVA 2DTHA 3HPWA 2DVJA 3U23A 2Y4YA 3M56A 2WSFE 4M7AG 4B9WA 2GF7A 3C4SA 1W1FA 1VQ8Q 5CKEA 5C0MA 2FZCB 1K8AR 2EIFA 2OAWA 1Q7YR 1FMWA 3JB9D 1YFNA 3QZ5B 4F7UE 1GCQA 3TSWA 2E4HA 3VYGA 2HZYA 4OMLA 2D0NA 2DXBA 5LJ3h 3J81E 2QA4T 4BB7A 1NG2A 1D1CA 2KXDA 2ZPGB 1D0YA 3SB2A 3TVTA 2FPDA 4PJOG 1M3CA 4DBHA 1VQOA 4F14A 1QWEA 2KEAA 5GMKi 5A0LA 1AZEA 6AT1B 4ZN3A 4K11A 3H0HA 4F7UB 3JCMb 3S3NA 4FM4B 3QPHA 3RMQA 1Q86C 4XTXA 5KH6A 4E2FB 5IHKA 4JJNK 4F7UA 3G71Q 3HP9A 1AVZC 2KYBA 3GP8A 3PE0A 3S3OA 4AG1C 1VA7A 1VQ6T 1TUGB 3RKYA 4QW2A 1O75A 1GFDA 1MMNA 2DZCA 1VQ6Q 1C6VX 1Z9QA 1ZUUA 3VYHB 2YHTA 1TXQA 3H41A 4LUDA 2QDLA 2CS7A 2KVQG 4RTTA 5GAOl 3HRSA 3M0TA 5GMKj 4M78C 3PFSA 1RAFB 2PVDB 1VQMT 1UGSB 2MYSA 5GANh 3L2WA 2E5KA 4A53A 1IXDA 1T3LA 1Q82R 2PNIA 4J7IA 2HQXA 2LZ6B 3C0CA 4OB3B 1VQMQ 4KT0E 1K8AC 4AMCA 1IREB 1UGQB 2DJZA 3TU4K 4KUDK 1VYTA 4WF2A 4DOWA 4RMOA 4DBQA 1UG1A 3J80E 4EMGA 2DF6A 1K73U 2NLUA 1WFWA 2MWOA 5KE3A 2X51A 1X01A 1M3BA 1QCFA 4BUGA 1ZA1B 2O9VA 1RLPC 5LJ5f 4ZTJA 4M7AF 4B6MA 2YDLA 4BI3A 2LTOA 1AZGB 2EBPA 5DLOA 1VQ5T 4BE2A 3MKDA 2MWPA 3H0FA 4M78G 4J9FA 2AKLA 3CCJA 3OB9A 5GAN6 3BE3A 1I81A 3E1SA 3M53A 2ZAEA 4R55A 3I55T 1OYXA 3CC4T 1SSFA 2M51A 2CH4W 3PVLA 3EHRA 2ABLA 3I55Q 1TWBA 2CSIA 3CC4Q 1MNDA 3A98A 4FT2A 3V8LA 2CP7A 4PJOF 3VRYA 4DA4A 1VQPA 3OYAA 3TCJA 1S1NA 2IIMA 1C0MA 3QWYA 2L5QA 2IG0A 4KH0B 4PK4A 4M7DC 3CPWS 1JB0E 2CUBA 1WNLA 3CEYA 2JS0A 1Q82C 2XMFA 4WTOB 5GMKm 3KXTA 3NTHA 2QEXA 1OU8A 5KYYB 3OYEA 1LVKA 3CCLA 4LXCA 2XIDA 4QQ6A 1M3AA 1OULA 1A0NB 2O9SA 2KAFA 4X1VA 1Z9ZA 4L6V5 5KYYA 3OYIA 1UE9A 3E2UA 2EGAA 1PG5B 1Y7XA 3VS5A 2FHDA 3LX7A 3V8KA 2FRWA 5A0GA 4DOVA 3EG2A 3EG9B 4V2SA 2CKKA 1JO8A 1SRMA 3JCMf 1U8RA 3L2RA 1JU5C 4BI4A 3P8DA 2L3QA 2QI2A 3EFOB 2LMJA 3EG9A 1AD5A 2RHXA 1H8KA 4GLKA 2M1HA 2QYZA 5GAN3 3RUXA 2QXFA 4OGEA 4M7DG 3EFOA 1F1BB 2RJEA 5LJ5g 3ZBDA 4QKUA 2YRVA 4M77C 3RMSA 4J8OA 1X69A 2GCXA 2RK2A 3BDUA 2KNBB 3VS2A 1V76A 3E19A 1WHMA 2MCNA 2LVMA 2HMAA 1BU1A 3QYGB 1D0ZA 1SF9A 4NL2A 1BK2A 5KYNA 1FX7A 2CT3A 2X4WA 1GCPA 2JT4A 3SDZA 5GAOn 2CP5A 1YJWT 2EW3A 1JBMA 1HXDA 4E7HA 4KUIA 4XQ3A 1PCXA 2EJFA 2QQBA 4DQ2A 2SEMA 4CC3A 2NYSA 3HFNA 1YJWQ 3ER0A 3ZL7C 3QYHB 4PKCC 1G8XA 3INZA 4O6JA 5I2MA 4M7AB 3PMTA 4PJOE 5IN1A 4ELYC 2G6FX 4F16A 1N8RU 2BTTA 2LJ0A 3OYLA 2I0NA 4XU1A 1PRLC 1IGQA 1LCKA 4M77G 1VIEA 5IXBA 2P0KA 2DE0X 2LX7A 4FYVB 3I56T 2LJ1A 5I11A 1GBRA 3KUFA 1I1JA 3MP8A 4FYWB 2JM9A 2QG9B 3I56Q 1D0XA 1YCYA 4ZGJB 4LD6A 2EAYA 1ABQA 4J5YA 1KHCA 2M02A 1ZUYA 4HCCA 1S72T 4PJOB 2K3YA 1U06A 3GLXA 2LP5A 4VUBA 4R56A 1VQKT 2DETA 1N5ZA 1NE8A 1XNIA 1IZ6A 4Y92A 4M4ZA 1ZSGA 1N8RR 2A28A 2JW4A 4GBQA 4PJOA 4A4KA 1WDXA 2JM8A 1YITT 3JCMg 3M4GA 3CMAT 2ZCFB 1W6XA 1M27C 5L23A 4KGZB 3VS6A 2CUDA 4DEXA 3CMAQ 5IHIA 2MK5A 5HKCA 1K0SA 3FLGA 2OTLT 3BDLA 4R0KA 1YHQA 1N27A 1XOVA 1IB8A 3LLRA 1M90U 2QAZA 1G3WA 1KHIA 4D8DA 2X9HA 2JTFA 2EJ9A 1RAHB 2OX7A 4J7FA 2HEQA 1X27A 1KQSS 2FPEA 1X75C 4PFZA 1ABOA 2EYQA 2LQKA 4M7DF 2LQWA 4Z02A 3EFSA 3RERA 2NUTB 4QVCA 1XJWB 3PTAA 3BW1A 1QLYA 2OTJT 3RR6A 3P8BB 2M0OA 1BI1A 3L2VA 2LCLA 4C92F 1EX4A 2K9GA 1T3SA 2O4XB 1AWXA 3CD6T 3UATA 2X3XD 4JZ3A 4Y91A 5GANd 4M78E 2O4XA 5IXFA 1VQ9A 3CD6Q 3OYJA 4XAXB 1VQLA 4HA8A 2KGTA 2YUPA 1M1KU 4LDWA 2D8JA 3OYFA 2KY9A 1Y96B 2V8IA 2RMOA 4JS5A 2D6FA 4X9CA 1KQSA 1QMCA 1VQPQ 3OS1A 3LWHA 3QJ6A 1Y96A 3CCRT 1RABB 4BACA 2RHYA 1EFNA 1N8RC 1MGQA 2EGCA 2KBTA 3CCRQ 1G3YA 2ZPIB 4M78B 3RDVA 5GAOr 4M77F 5GANe 2DTOA 1AWJA 3FC3A 4M78A 5CKDA 4AG2C
chains in the Genus database with same CATH topology
4IUQA 3J81E 3LWIA 2QA4T 2DD5A 4C8QB 3G6EA 4BB7A 3OBWA 4JRKA 1YIJT 5FRNA 2ZPGB 3SB2A 2RHUA 2XDDA 2L3RA 1HK9A 2X4YA 5FU6C 2K57A 4OP0A 4PJOG 3SFMA 5GMKl 1NJIC 1VQOA 2RHIA 1TH7A 3RESA 4NL3A 5GMKi 2RM4A 2VGMA 2VUBA 3CCQA 5M9OA 4C8QA 5GANf 4MDWA 5A0LA 1NJIU 3SD4A 5AYFA 1KD1U 5GAN2 4ZN3A 2DEQA 5KCHA 2E10A 4F7UB 3JCMb 3BY7A 3CCRA 3S3NA 4FM4B 3QPHA 2RI3A 4MZTA 3RMQA 5LJ3d 4BDYA 1K9MU 1Q86C 4XTXA 3HFOA 5KH6A 3CXCA 1Q86U 1UB4A 4JJNK 4F7UA 4M7AD 1ZHIA 3HP9A 3M59A 4QVZA 4BI8B 1KC8C 3CCET 5FRMA 2E65A 1KC8U 3OYGA 2XU8A 3GP8A 3S3OA 1VQ6T 3UDCA 3RKYA 4C0DC 4QW2A 1O75A 5LJ5d 5J26A 1YJ9T 4B9XA 1UGPB 2F5KA 2DZCA 1D3BB 5DY9A 1WPYA 3VYHB 5I21A 4MMLA 2QA4A 3OS0A 2YHTA 4PLIA 3QKJA 4M7DE 4QQDA 1YIJA 3MEUA 2CS7A 2K5LA 2KVQG 4RG8A 3CCUT 3OS5A 2E12A 5GAOl 1NZ9A 3HRSA 2XHCA 4M75C 1B34B 5CAIA 2I2LA 2WACA 1D3BA 3CBPA 5GMKj 4A4GA 3JB9F 2A3LA 2K3XA 5LJ3e 1G3TA 4M78C 3PFSA 5FU7C 2ZPBB 2JTMA 4KULA 3JB9I 3TREA 2PVDB 1B34A 1VQMT 1UGSB 2DD4A 5GANh 4PJOD 2HD0A 3L2WA 3PGGA 3DLLA 4A53A 4XTYA 4J7IA 2HQXA 2O01E 3X24B 4J83A 4OB3B 4KT0E 4C92D 5A2QE 1K8AC 4MZPA 4C8QC 1I5LA 3OYKA 3QBYA 5GAOm 1IREB 1UGQB 2DJZA 2DO3A 2EWNA 2LC4A 4OB0B 4OF1A 5LJ5e 3TU4K 2RO0A 1Q7YU 4KUDK 4WF2A 4DOWA 2B8AA 3L2QA 3V7SA 4RCBA 5D6YA 1W4SA 4M75E 4RMOA 3J80E 3LYIA 1YJNT 1Q81C 1K73C 2CZ7B 2DVEA 1VQ6A 4EMGA 2F69A 2JN0A 4OMFB 4M7DB 1K73U 2R5AA 3SWNB 2F5TX 2K2VA 1YJ9A 2NLUA 3LH0A 3BFMA 1YBYA 4QQGA 1BI2A 2E64A 2MWOA 3VV0A 3QIIA 1YI2T 5KE3A 1M1KC 2JNGA 4IUTA 4M7DA 1X01A 2DKGA 3CPFA 3CCUA 3FB9A 3ZFJA 2DK3A 3SWNA 1U1SA 2FB7A 4BUGA 1VQPT 1WGSA 3FJPA 4IURA 3OYCA 5IT9E 1WQ7A 5LJ5f 2MI6A 1M9SA 2PVGB 2MF2A 4ZTJA 1VQ8T 1OZ3A 3QXEB 4M7AF 2LT1A 2EJGA 3ASKA 5DM7R 3MEAA 2KDSA 4BI3A 2LTOA 1VQMA 2YLCA 1QVFS 3T9NA 4M75G 3GIBA 3HRUA 3P8HA 5DLOA 1VQ5T 2ZZDA 3CC7T 2DTIA 1ZQ1A 2E70A 2D0QB 2MWPA 4A4HA 3CCMT 1X6OA 4BE2A 1KQ2A 5GAOq 3LW5E 4M78F 3GOXA 1DJ7B 4M78G 4C5IA 2V8JA 3CCJA 1OZ2A 3OB9A 4EMKB 3DKMA 3VUZA 5GAN6 4ATOA 1I81A 3E1SA 3M53A 4P5NA 2QEXT 1WQWA 3QJYA 4EPCA 4C5EA 5IAYA 4R55A 3CCLT 3I55T 1OYXA 2IVWA 2DAQA 1EIFA 1SSFA 4JDSA 3CC4T 4XU2A 4UC4A 3A5ZB 5GANg 3QHSA 4C8QF 4EMKA 3LGFA 2HNIA 4YTLA 4C8QG 3PMIA 3OS2A 3FIFA 4FSXA 3RIRA 1Y71A 3H6ZA 2XK0A 3RKXA 2AHJB 4EDUA 3JCMd 5GAMg 5L8RE 4FT2A 3V8LA 2HAXA 1U1TA 2HBPA 4PJOF 4ELZC 4IUUA 4DA4A 1VQPA 3OYAA 3TCJA 2K5FA 5GAN5 3JB9H 3L2ZA 5D6XA 2PVOB 1KD1C 4OVAA 2A7YA 3MEWA 4F7UF 3GNGA 4M77B 2FL7A 4C5HA 1VQ8A 4F7UG 2L5QA 2IG0A 2M16A 5LJ5h 2GFAA 3JCMP 2EQMA 1K9MC 4XK8E 3GF5A 4M7DC 3OYBA 3FEOA 1VIFA 3CPWS 3G71T 4L59A 1JB0E 4X9DA 3SWNC 2DXUA 1VQ5A 4FU6A 1WNLA 3CC7A 2XD0A 3CEYA 3OYHA 3CCMA 1Q82C 4A4FA 2LCCA 5CK9A 1QVFA 4HKEA 3MP1A 1VQ4T 1I8FA 1Q82U 1K8AU 5GMKm 4OGCA 3CCVT 3KXTA 1KQ1A 1M5Q1 3NTHA 2E6NA 2G3RA 4M75D 2QEXA 1M8VA 3L42A 2CZ1B 2DXTA 3MHXA 3MO8A 2X4JA 2XI9A 3OYEA 3OW2S 3CCLA 3O8VA 3QO3A 1RL2A 2XIDA 3C94A 2P0PA 3DLMA 4QQ6A 3A8LB 3ME9A 4PL6A 4M78D 5FLXE 3CC2T 2KAFA 3CCJT 4XTWA 2X35A 3NFCA 2X4XA 4L6V5 1W2BS 3OYIA 3EFRA 3URGA 3MP6A 4C0ZA 5GANj 1WJRA 3QDRB 3Q1JA 3JSCA 1Y7XA 4MMKA 2FHDA 3LX7A 3OYMA 3V8KA 3V7CA 4HCBA 5GAMj 2EQJA 3QUIA 5A0GA 2XDBA 4DOVA 4C8QD 1JRIA 3QG1A 2HQEA 4EMKC 4E7LA 4V2SA 2CKKA 2P0QA 3QZ9B 1N6AA 4HT8A 3CC4A 3JCMf 1U8RA 3N5BB 2C06A 3GPLA 3L2RA 3X26B 2VGNA 4C92E 5LJ3g 4BI4A 3P8DA 3G71A 2QI2A 1VQLT 2L89A 4XU0A 2D9TA 5HY6A 2RHXA 1I4K1 1M1GA 1OI1A 4N4IA 3G7ZA 3KBGA 4J6WA 4KBMB 1VQ4A 1Q7YC 4GLKA 1ZBXA 3A8MB 2M1HA 4N4GA 3CCEA 3MEVA 4A54A 2VYTA 5GAN3 3FDRA 3OMGA 3RUXA 4NS5A 2QXFA 4OGEA 2QQSA 4C0GA 5CCAA 4M7DG 2RJEA 3HRTA 5DLQE 4LDYA 4OB2B 5KCOA 5LJ5g 3ZBDA 2MAMA 1JJ2S 2YRVA 3OMCA 4M77C 4RG2A 3RMSA 2VXFA 3CMET 4MZMA 4J8OA 2GCXA 2RK2A 3BDUA 3OW2A 1FWZA 3E19A 3S3MA 3NTIA 4TVRA 3JCMQ 2PUKB 1KG1A 3F70A 1G5VA 2LVMA 3PIOA 2JOYA 4XTUA 2YLBA 1BIBA 2GFUA 2VXEA 4O5VA 4LDUA 1W2BA 2RH2A 1NPPA 2BUDA 3QYGB 2CZ0B 5CQXA 4C92B 5CKBA 4NL2A 4E7KA 2JZ2A 3JAME 1R8OB 1NPRA 4HCZA 1RI0A 1FX7A 2X4WA 2LQ8A 3RKWA 2DIGA 3SDZA 3QSUA 4M75F 3OA6A 1UEBA 2K4YA 4C92A 5GAOn 5GAN4 4ZN1A 3CCST 2P4TA 3JCMh 1YJWT 4M77E 1JBMA 1HXDA 5LJ3j 4E7HA 4KUIA 4XQ3A 1QP3A 2EJFA 2QQBA 4DQ2A 4JLIA 5J3BA 3UPUA 2E6ZA 3HFNA 2BIVA 2FYKA 3ER0A 4BE1A 4RCCA 1LNXA 5FROA 1YJNA 2RK1A 2R57A 3OBYA 3QYHB 1N9SA 1H641 1QW1A 4GY5A 4PKCC 2ZPEB 3INZA 4O6JA 4JRPA 5I2MA 4PLLA 3EAEA 3PNWC 4M7AB 3OYDA 3PMTA 4BDZA 4PJOE 3JB9J 5IN1A 2RJDA 3WVEB 4ELYC 3JCMc 5LJ5j 4BE0A 1N8RU 1YI2A 3VKIA 1LJOA 1JJ2A 3DB3A 4M7DD 4LD9K 1QVPA 3OYLA 3M57A 5EG2A 1VQ7T 3PIPA 3G4ST 5LL6S 3VUBA 4XU1A 2XDPA 4C0FA 3LGLA 4M77G 2FVUA 1VIEA 4JRIA 1UGRB 1BI3A 2JUFA 2P0KA 1O9SA 2PQWA 5HK3A 5CVIA 3GNFB 3VJPA 3I56T 2RJFA 1YHQT 5GMKe 3KUFA 4Q5WA 3MP8A 4EMHA 2MMPA 2E41A 1BI0A 4ZGEB 3JCMW 2LNVA 2KSSA 3CCSA 4M77A 4RKUE 1YJWA 1YCYA 3OQ5A 2CZ6B 4ZGJB 2VV5A 2PU9B 1N9RA 2EAYA 4LD6A 4N0AC 1V29B 4J5YA 1KHCA 4HCCA 4LDXA 2BKDN 1S72T 4PJOB 2RI2A 2QQAA 2E5QA 2K3YA 4J6XA 4ZGDB 3GLXA 4VUBA 3C12A 4X34A 3X20B 4BY6B 4R56A 3JCMJ 1VQKT 5I2SA 2Y4XA 1WJSA 1GXIE 3X28B 1NE8A 1XNIA 1IZ6A 2XG8D 2ZPHB 4IUVA 3A8GB 1PSEA 2H3JA 4C92C 5GAMf 3I55A 3A8OB 5GAN7 2OAUA 3HKSA 4PJOA 2M9UA 3E9GA 4A4KA 3OY9A 4J6YA 3OSSC 5KE2A 2KMTA 3OYNA 1YITT 2RA2A 3VU3C 3JCMg 1M1FA 2RHZA 1XQHA 4XTZA 3M4GA 4A4EA 1VQ7A 3CMAT 2XKOC 2ZCFB 3CBMA 3G4SA 2EQUA 5CR2A 4FIBA 4FL6A 4PNOA 5J39A 1BIAA 1QVGS 2DZ9A 2CGHA 5HKCA 3L2UA 3M5AA 2K5IA 3I56A 3FLGA 1M90C 2OTLT 3BDLA 1YHQA 3HL8A 4HT9A 1N27A 1XOVA 3LLRA 1PSFA 1VQ9T 1M90U 1G3WA 1KHIA 2JTFA 2EJ9A 3HHTB 4JRQA 3UWNA 4M7AC 4J7FA 4M77D 2GQVA 3AHUA 1FXXA 3CPWA 3PT9A 3JCMX 5CKHA 4JS4A 4E47A 1KQSS 3V8JA 1X75C 4IKFA 2WSCE 1VQNT 1S72A 3M9QA 1VUBA 3CCVA 2EYQA 1P92A 2LQKA 5C6SA 5CKFA 4Z02A 3EFSA 4E7JA 3RERA 4M7DF 3A8HB 4QVCA 1Y07A 2KK4A 2XICA 4II1A 5D6WA 3JB9G 1VQKA 1AHJB 1BYMA 1MHNA 3PTAA 3BW1A 3CBOA 1LOJA 2Y90A 2PUOB 4NOYA 2LRQA 4IUPA 2QDYB 2DPPB 5GAOp 3CC2A 2OTJT 3H8ZA 3P8BB 1G3SA 2M0OA 2QQRA 3ZEHA 2DXCA 4JLGA 4N4HA 3S6WA 1BI1A 4ME7A 4Y28E 5FU6B 4D6WA 1YITA 3NTKA 5GAMh 2WSEE 5GMKh 3L2VA 3L1AA 2LCLA 2R5MA 2QTXA 4OB1B 4C92F 5HK0A 3OSVA 3CMAA 4M7AE 4C92G 2O4XB 3M58A 2QQ9A 4XTVA 3C95A 4N0AA 2DIQA 2EFIA 5LJ3f 4PJOC 3CD6T 3UT1A 3OYYA 1Q81U 3X25B 1H3ZA 3TEEA 4CI0C 3JCMV 4BY6C 3FRNA 2RB6A 4Y91A 2OTLA 5GANd 3J7AF 4M78E 2LT4A 2O4XA 2RI5A 3R6OA 4CRIA 5GAN8 1QVGA 1VQ9A 3WVDB 3OYJA 3G6ET 4LDVA 4C5GA 3M55A 4XAXB 1VQLA 5GAMd 4HA8A 3M4YA 2RD1A 2CYZB 1M1KU 4LDWA 1WJQA 2ZGWA 3E9FA 1QP2A 3OYFA 3M54A 2KY9A 2R58A 2JVVA 1Y96B 3META 1M4ZA 2V8IA 4JUVA 1BKBA 2DTHA 4ZTFA 2LDMA 3HPWA 4JS5A 1VQOT 3CCQT 1VQNA 2D6FA 4C0DB 2EKOA 2RJCA 4XU3A 4C8QE 4X9CA 1KQSA 5CQYA 2Y4YA 3M56A 2WSFE 2EQKA 2KQWA 4M7AG 3OS1A 3LWHA 3QJ6A 1Y96A 3CCRT 2VC8A 4B9WA 2GF7A 3CXCS 4BACA 3C4SA 2OTJA 2RHYA 2E1HA 3WXMB 5CKEA 3V7RA 3CMEA 1N8RC 1MGQA 3MCAB 5C0MA 4M75B 4BD3A 2EIFA 3HSBA 3JB9D 1G3YA 2ZPIB 4FT4A 2L8DA 3QZ5B 4F7UE 4M7AA 3JRZA 2ZPFB 2V8KA 4M78B 5FU7B 3VYGA 5GAOr 5CIUA 4M77F 5CO7A 5GANe 4M75A 4L5GA 2LX9A 5A0DA 4QVDA 3CD6A 2DTOA 4MDXA 5GAMe 3FC3A 4E7IA 2DXBA 4M78A 5CKDA 1XTDA 3JCMe 5LJ3h 3DB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUQ A;  3FDR A;  3OMG A;  3ASK A;  4NS5 A;  4A4E A;  3MEA A;  2QQS A;  2LTO A;  2RJE A;  2EQU A;  5FRN A;  4FL6 A;  3P8H A;  5KCO A;  2RHU A;  2L3R A;  2X4Y A;  2YRV A;  5J39 A;  3OMC A;  4A4H A;  2MWP A;  4BE2 A;  4RG2 A;  2RHI A;  3L2U A;  5M9O A;  3GOX A;  4C5I A;  3FLG A;  3SD4 A;  3S3M A;  3BDL A;  3NTI A;  1OZ2 A;  1N27 A;  3F70 A;  3OB9 A;  1G5V A;  2LVM A;  3LLR A;  5KCH A;  2GFU A;  2JTF A;  3S3N A;  3UWN A;  5IAY A;  4C5E A;  2RI3 A;  2BUD A;  4BDY A;  1OYX A;  2DAQ A;  1SSF A;  4E7K A;  2JZ2 A;  4UC4 A;  5KH6 A;  4HCZ A;  4IKF A;  1RI0 A;  3LGF A;  3M9Q A;  2X4W A;  3PMI A;  5C6S A;  3OS2 A;  4Z02 A;  4E7J A;  4EDU A;  4QVZ A;  3H6Z A;  2XK0 A;  2DIG A;  4II1 A;  5D6W A;  5FRM A;  3OA6 A;  1MHN A;  3OYG A;  4IUU A;  3S3O A;  2LRQ A;  4IUP A;  3OYA A;  5D6X A;  3H8Z A;  2M0O A;  3ZEH A;  2QQR A;  4E7H A;  4QW2 A;  3S6W A;  4N4H A;  5J26 A;  4OVA A;  4B9X A;  3MEW A;  3NTK A;  2F5K A;  4C5H A;  2BIV A;  2IG0 A;  2M16 A;  3L2V A;  2R5M A;  4BE1 A;  2GFA A;  3OS0 A;  5FRO A;  2EQM A;  4PLI A;  3QKJ A;  2O4X B;  2R57 A;  4QQD A;  3OYB A;  3FEO A;  3MEU A;  4GY5 A;  4L59 A;  2DIQ A;  2EFI A;  3EAE A;  3PNW C;  4FU6 A;  3CEY A;  2WAC A;  3PMT A;  4PLL A;  3OYD A;  3OYH A;  4BDZ A;  3UT1 A;  2LCC A;  4A4F A;  5IN1 A;  1H3Z A;  2RJD A;  3MP1 A;  4A4G A;  2K3X A;  4BE0 A;  2O4X A;  2RI5 A;  3DB3 A;  3PFS A;  4CRI A;  3OYL A;  3OYJ A;  3NTH A;  2E6N A;  2G3R A;  4C5G A;  3L42 A;  3MO8 A;  3OYE A;  2XDP A;  3L2W A;  1WJQ A;  3E9F A;  3O8V A;  3LGL A;  3OYF A;  2R58 A;  4QQ6 A;  3DLM A;  3MET A;  3ME9 A;  2HQX A;  4PL6 A;  4ZTF A;  2LDM A;  2P0K A;  2X35 A;  2PQW A;  2X4X A;  2EKO A;  2RJC A;  2RJF A;  3OYK A;  3QBY A;  3OYI A;  3MP6 A;  1WJR A;  3KUF A;  3Q1J A;  2EQK A;  2RO0 A;  3MP8 A;  4Q5W A;  2FHD A;  2B8A A;  3OS1 A;  3L2Q A;  3QJ6 A;  3LX7 A;  5D6Y A;  3OYM A;  3LYI A;  4B9W A;  2GF7 A;  4BAC A;  3C4S A;  2EQJ A;  2RHY A;  3OQ5 A;  4LD6 A;  2R5A A;  5C0M A;  4BD3 A;  1KHC A;  2NLU A;  2BKD N;  3LH0 A;  2HQE A;  2RI2 A;  4E7L A;  2E5Q A;  2CKK A;  2K3Y A;  4QQG A;  2L8D A;  4X34 A;  2MWO A;  3QII A;  5KE3 A;  3L2R A;  1WJS A;  4IUT A;  4IUV A;  1XNI A;  5CIU A;  3P8D A;  2L89 A;  1WGS A;  4IUR A;  3OYC A;  2D9T A;  3E9G A;  2RHX A;  4N4I A;  1OI1 A;  3OY9 A;  3FC3 A;  5KE2 A;  4E7I A;  3OYN A;  4ZTJ A;  2M1H A;  4N4G A;  2RHZ A;  3MEV A;  1OZ3 A;  3DB4 A;  2VYT A; 
#chains in the Genus database with same CATH topology
 3LWI A;  3G6E A;  4JRK A;  1YIJ T;  1AWW A;  1MNE A;  2RHU A;  1QCN A;  1UUE A;  2XDD A;  5FU6 C;  2K57 A;  5GMK l;  2DX1 A;  2ROL A;  1X2K A;  1YIJ Q;  3CCQ A;  4MDW A;  3SD4 A;  5AYF A;  2PZ1 A;  2DEQ A;  5KCH A;  2E10 A;  3BY7 A;  2V26 A;  2RI3 A;  4J9D A;  4MZT A;  1K9M U;  4EIK A;  2JXB A;  1Q86 U;  2DRM A;  4RTY A;  4M7A D;  3M59 A;  4BI8 B;  4J9G A;  2DBK A;  2E65 A;  4FW2 A;  5FRM A;  3OYG A;  2K7A A;  2E3I A;  2O2O A;  2ENM A;  2LJ3 A;  4C0D C;  1YJ9 T;  1UGP B;  2F5K A;  1D3B B;  1E6G A;  1WPY A;  4PLI A;  1YJ9 Q;  4M7D E;  1QVF P;  2YRC A;  4M75 C;  2XHC A;  1B34 B;  1G83 A;  2EYZ A;  2I2L A;  1D3B A;  2RQT A;  1HJD A;  2A3L A;  5FU7 C;  2JTM A;  2COY A;  1K9M R;  3TRE A;  1B34 A;  1YCS B;  4PJO D;  2HD0 A;  2MOX A;  3PGG A;  4XTY A;  1TU0 B;  1R0B G;  2BZY A;  3JV3 A;  2O01 E;  3X24 B;  4J83 A;  2BZ8 A;  2RQW A;  3OYK A;  1K8A U;  2EWN A;  1Q7Y U;  2B8A A;  4AFS C;  4M7D B;  1TUD A;  1AEY A;  2F2X A;  2K2V A;  1Y0M A;  3LH0 A;  1IHW A;  1WXB A;  1M1K C;  4IUT A;  4F17 A;  4M7D A;  3CCU A;  3FB9 A;  3EGU A;  3OYC A;  1T0H A;  3QDF A;  5KYW B;  2MF2 A;  1VYV A;  1VQ8 T;  2EPD A;  5DM7 R;  3MEA A;  2KDS A;  2YLC A;  3T9N A;  4M75 G;  3HRU A;  3P8H A;  5KYW A;  2DTI A;  2LCS A;  1KQ2 A;  5GAO q;  3LW5 E;  1YWP A;  1W2B P;  2EYW A;  1E6H A;  3VUZ A;  5FWC A;  1WX6 A;  4C5E A;  2DAQ A;  1EIF A;  3A5Z B;  2IPO B;  4C8Q F;  2HNI A;  3PMI A;  4FSX A;  2CT4 A;  4EDU A;  2XK0 A;  2AHJ B;  3SHW A;  1UEC A;  2HAX A;  4PJJ A;  1U1T A;  2CDT A;  2HBP A;  4ELZ C;  1M30 A;  2K5F A;  5D6X A;  2CSQ A;  2KE9 A;  1CKA A;  3MEW A;  4M77 B;  2FL7 A;  4C5H A;  4AT1 B;  1KIK A;  4OMP A;  1K9M C;  2ROT A;  3FEO A;  3OYB A;  1I0C A;  3G71 T;  4X9D A;  3SWN C;  2DXU A;  3CC7 A;  2XD0 A;  1YHQ Q;  2RQV A;  3CCM A;  5CK9 A;  4HKE A;  1Q82 U;  2W10 A;  1M5Q 1;  1M8V A;  3OW2 S;  1RL2 A;  1YWO A;  4PL6 A;  1OQK A;  4M78 D;  4XTW A;  2X35 A;  3NFC A;  2X4X A;  3NMZ C;  1B3Q A;  2KRM A;  3MP6 A;  5GAN j;  2KR3 A;  3JSC A;  4MMK A;  5EC7 A;  3GBQ A;  2XDB A;  3QG1 A;  4EMK C;  1C1A A;  2P0Q A;  3EG0 A;  1N6A A;  4HT8 A;  4FYY B;  3X26 B;  2VGN A;  1OX8 A;  1UGV A;  1VQL T;  1I4K 1;  1OI1 A;  4KBM B;  1VQ4 A;  1Q7Y C;  2GGR A;  1VQL Q;  2VKN A;  2HKN A;  3OMG A;  4C0G A;  5CCA A;  1KFZ A;  5DLQ E;  4OB2 B;  1JJ2 S;  2GQI A;  4MZM A;  3OW2 A;  3S3M A;  3NTI A;  4PFP A;  3F70 A;  1G5V A;  4RTW A;  2YLB A;  2DL8 A;  2RH2 A;  2BUD A;  2CZ0 B;  5CKB A;  1OOT A;  1NPR A;  4HCZ A;  1RI0 A;  4WCI A;  2LQ8 A;  3HTR A;  4M75 F;  3UA7 A;  3OA6 A;  2BZX A;  1ZUK A;  4DBR A;  3G6E Q;  5J3B A;  1Y57 A;  1B7T A;  2DRK A;  1YJN A;  2RK1 A;  3OBY A;  1QW1 A;  2CP6 A;  4GY5 A;  1FYN A;  2DYB A;  3CQT A;  1PD1 A;  4RTV A;  1QVG P;  2LNH B;  3JB9 J;  3WVE B;  3JCM c;  1W70 A;  1JJ2 A;  4M7D D;  4LD9 K;  3M57 A;  3G4S T;  2YUO A;  3LGL A;  2FVU A;  3G4S Q;  2ED1 A;  2JUF A;  2CP3 A;  1O9S A;  2O31 A;  3GNF B;  2HSP A;  2KT8 A;  1HSQ A;  1PHT A;  4EMH A;  2E41 A;  1SEM A;  4ZGE B;  2KSS A;  2JJ9 A;  3CCS A;  4RKU E;  1X6B A;  2CZ6 B;  2YXY A;  1PRM C;  2VV5 A;  2QQA A;  2E5Q A;  4ZGD B;  3C12 A;  4X34 A;  1R77 A;  5I2S A;  2Y4X A;  1WJS A;  3X28 B;  4Z88 A;  4C92 C;  3RBB B;  3A8G B;  5GAM f;  3A8O B;  2M9U A;  2HCK A;  2RA2 A;  3VU3 C;  1M1F A;  1VQ7 A;  1TOV A;  3CBM A;  4LNP A;  2DA9 A;  1BIA A;  4RTX A;  2DZ9 A;  2CGH A;  3TQ7 P;  1IHV A;  4HT9 A;  3HL8 A;  1NM7 A;  1PSF A;  4M77 D;  2DEU A;  2GQV A;  1NJI R;  1M2V B;  3CPW A;  3PT9 A;  3JCM X;  4JS4 A;  2PTK A;  1K76 A;  4IKF A;  4J9C A;  2CRE A;  2WSC E;  1YNZ A;  4E7J A;  1RAA B;  2QAS A;  2XIC A;  1M2V A;  3CBO A;  2ATC B;  2Y90 A;  4J9E A;  1K4U S;  1OPL A;  2LRQ A;  4NOY A;  4A63 B;  1WIE A;  1M8M A;  3H8Z A;  1K0X A;  2QTV A;  3S6W A;  3EGD B;  1QKW A;  5FU6 B;  1K1Z A;  1KC8 R;  2DBM A;  1I07 A;  2R5M A;  2QTX A;  4M7A E;  4C92 G;  3I9Q A;  4XTV A;  3EGD A;  4N0A A;  5LJ3 f;  3NGP A;  1WHG A;  1Q81 U;  2MIO A;  4BY6 C;  1PM3 A;  2RB6 A;  3ULR B;  5GAN 8;  4AFZ C;  4CRI A;  4LDV A;  4C5G A;  4E7S A;  5GAM d;  2ZGW A;  1QP2 A;  2R58 A;  1M4Z A;  1BKB A;  1VQO T;  2LDM A;  1VQN A;  4C0D B;  4XU3 A;  2CH4 A;  2VB6 A;  1VQO Q;  1ARK A;  1FMK A;  2ECZ A;  3CME A;  3HSB A;  2VWF A;  4M75 B;  4BD3 A;  2L8D A;  3KFV A;  4M7A A;  3JRZ A;  2LQN A;  2ZPF B;  2V8K A;  5FU7 B;  1Q81 R;  2RN8 A;  5CIU A;  4M75 A;  2LX9 A;  5A0D A;  5GAM e;  2COW A;  2EYY A;  4E7I A;  1QWF A;  1WHL A;  1XTD A;  1SKU B;  2FPF A;  4IUQ A;  2DD5 A;  1SRL A;  2HL3 A;  2X4Y A;  3SFM A;  1NJI C;  2RHI A;  1TH7 A;  3RES A;  2RM4 A;  2VGM A;  2VUB A;  2B86 A;  5M9O A;  5GAN f;  1ACM B;  4Z89 A;  5GAN 2;  5ECA A;  1UJY A;  5LJ3 d;  1JXO A;  4BDY A;  3VS7 A;  2RQU A;  4HVU A;  2AKK A;  3EGX B;  1OPK A;  1UB4 A;  1ZHI A;  1KC8 C;  2RPN A;  1SHF A;  2F2V A;  1NYF A;  3EGX A;  3UDC A;  5J26 A;  2JTE A;  5DY9 A;  1IGU A;  2DJQ A;  2QA4 A;  4MML A;  1V1C A;  4QQD A;  4RG8 A;  1OU9 A;  2HBW A;  5CAI A;  1WZO A;  2C0O A;  4ORZ A;  4A4G A;  5LJ3 e;  1G3T A;  2ZPB B;  1FMV A;  4HVW A;  2DD4 A;  2H3E B;  5I22 A;  1GRI A;  2EVR A;  2NUT A;  2QGF B;  1MV0 B;  5A2Q E;  4C8Q C;  3QBY A;  5GAO m;  3CCJ T;  1BBZ A;  2DO3 A;  2YUN A;  3L2Q A;  3V7S A;  4RCB A;  1YJN T;  1Q81 C;  3CCJ Q;  2CZ7 B;  2DVE A;  1VQ6 A;  2F69 A;  2JN0 A;  4OMF B;  2R5A A;  3SWN B;  1MMA A;  1YJN Q;  1WHH A;  3VS3 A;  1YBY A;  4QQG A;  2NUP B;  1BI2 A;  2E64 A;  3VV0 A;  3QII A;  1CKB A;  2DKG A;  3ZFJ A;  3CPW P;  2DK3 A;  3SWN A;  2FB7 A;  2M0Y A;  1VQP T;  3FJP A;  4IUR A;  5IT9 E;  1WQ7 A;  1TUC A;  2MI6 A;  1RLQ C;  2NUP A;  2PVG B;  1OZ3 A;  2YWW A;  2EJG A;  2DYI A;  2K2M A;  1VQM A;  1R0C B;  2VVK A;  1HYO A;  2D0Q B;  4A4H A;  1T0J A;  3EHQ A;  1DJ7 B;  1K9A A;  2V8J A;  1MMD A;  2EGE A;  4EMK B;  3DKM A;  4PJL A;  3EG3 A;  4ATO A;  4P5N A;  2QEX T;  2DIL A;  1WQW A;  3QJY A;  5IAY A;  2GNC A;  3CCL T;  2K3B A;  4JDS A;  4XU2 A;  4UC4 A;  1GFC A;  2QEX Q;  5GAN g;  4EMK A;  3LGF A;  4YTL A;  4C8Q G;  3OS2 A;  3CCL Q;  3FIF A;  2EYX A;  3RIR A;  1Y71 A;  2P4R A;  4HCK A;  3M0R A;  5L8R E;  4CC4 B;  2F2W A;  3NHN A;  1E7O A;  1VQ7 Q;  4OVA A;  2FZG B;  4F7U F;  3GNG A;  4E6R A;  2M16 A;  5LJ5 h;  2E3H A;  3GF5 A;  1VIF A;  1G2B A;  1OX9 A;  1PNJ A;  1VQ5 A;  4FU6 A;  3LH5 A;  4A4F A;  2LCC A;  3MP1 A;  4AFU C;  1KSW A;  4OGC A;  2JS2 A;  4FW1 A;  4LE9 A;  1WXU A;  4M75 D;  2AZS A;  2CZ1 B;  3MHX A;  3MO8 A;  2FO0 A;  3QO3 A;  1I5O B;  3C94 A;  5FLX E;  3CC4 A;  3A8L B;  1EZZ B;  1YP5 A;  1NYG A;  2C0I A;  2RNA A;  2DFU A;  1WJR A;  3QDR B;  2JMC A;  5D7U A;  2DLP A;  3OYM A;  3V7C A;  1X43 A;  4CC7 A;  5GAM j;  2EQJ A;  3QUI A;  2HQE A;  3VRZ A;  2OJ2 A;  1ZLM A;  2DL4 A;  2C06 A;  3GPL A;  4C92 E;  2A36 A;  4J9I A;  3H0I A;  4XU0 A;  2D9T A;  1M1G A;  2KRN A;  4J6W A;  3A8M B;  2KRO A;  3CCE A;  1B07 A;  4A54 A;  4OMN A;  1OV3 A;  1WHK A;  1QCO A;  2L2P A;  1TS9 A;  4LDY A;  1VQN Q;  3OMC A;  1SPK A;  4RG2 A;  3CME T;  2KXC A;  1FWZ A;  4FSS A;  4TVR A;  2PUK B;  1WYX A;  3R6N A;  2JOY A;  3CME Q;  1BIB A;  2GFU A;  4LDU A;  1QKX A;  4C92 B;  5CQX A;  3QWX X;  2D8H A;  3RKW A;  2DIG A;  3QSU A;  1UEB A;  2K4Y A;  4C92 A;  5GAN 4;  2JMA A;  1TSF A;  3JCM h;  4J9B A;  4M77 E;  5LJ3 j;  5IH2 A;  3M0P A;  1QP3 A;  2VAS A;  3NPF A;  2BIV A;  4IIO A;  3MPU B;  4FYX B;  4RCC A;  1LNX A;  5FRO A;  2GBQ A;  1H64 1;  2A37 A;  2AK5 A;  3EAE A;  3PNW C;  2RJD A;  1UFF A;  4BE0 A;  1PD0 A;  1YI2 A;  1GBQ A;  1WHJ A;  3TSZ A;  1QVP A;  3PIP A;  4HXJ A;  5LL6 S;  3VUB A;  4C0F A;  4LUE A;  1KQS P;  4D8K A;  2J6K A;  4GLM A;  1BI3 A;  5HK3 A;  2RJF A;  1YHQ T;  2X3W D;  3JCM W;  2LNV A;  2YSQ A;  4M77 A;  1YJW A;  1RAE B;  5IHN A;  2DNU A;  1N9R A;  4KGX B;  2QA4 Q;  1V29 B;  2BKD N;  4J6X A;  3X20 B;  4BY6 B;  1NLP C;  2V1Q A;  1PKT A;  1GXI E;  2DM1 A;  4IUV A;  3I5R A;  1WLP B;  5GAN 7;  2OAU A;  3E9G A;  3OY9 A;  5KE2 A;  3OSS C;  4RTZ A;  1XQH A;  2SRC A;  4XTZ A;  5FWB A;  2ED0 A;  5CR2 A;  4RUG A;  4PNO A;  2AT1 B;  5J39 A;  3L2U A;  3M5A A;  2K5I A;  3I56 A;  1VQ9 T;  2L0A A;  3HHT B;  4JRQ A;  4KGV B;  1VQ9 Q;  3AHU A;  2BE7 D;  1UHF A;  3V8J A;  1HD3 A;  1S72 A;  1VUB A;  3CCV A;  3EH2 A;  4KH1 B;  5C6S A;  5CKF A;  1KG1 A;  1VQK A;  3JB9 G;  2KK4 A;  5D6W A;  1AHJ B;  1MHN A;  1J3T A;  2V1R A;  2PUO B;  3CC2 A;  1G3S A;  2QQR A;  2DXC A;  4JLG A;  4N4H A;  4PJN A;  1VYU A;  4ME7 A;  4Y28 E;  4D6W A;  1YIT A;  3NTK A;  3M0U A;  5GMK h;  5HK0 A;  4OB1 B;  1LPL A;  3OSV A;  3CMA A;  4DBF A;  3C95 A;  4JPB W;  2EFI A;  2EQI A;  3FRN A;  2OTL A;  3J7A F;  3R6O A;  7AT1 B;  3WVD B;  1X2Q A;  3G6E T;  3M55 A;  3M4Y A;  2RD1 A;  3I35 A;  2CYZ B;  3E9F A;  2A08 A;  4ZTF A;  3CCQ T;  2EKO A;  2RJC A;  4C8Q E;  5CQY A;  2EQK A;  2KQW A;  4Z8A A;  3CCQ Q;  2K6D A;  2DER A;  2VC8 A;  3MJX A;  3CXC S;  2OTJ A;  5GJV B;  2E1H A;  3WXM B;  3V7R A;  1ZSZ C;  5FW9 A;  3MCA B;  1WXT A;  2DMO A;  2FG0 A;  2P84 A;  4FT4 A;  4FCY A;  1IRX A;  1VQ5 Q;  1K73 R;  5CO7 A;  4L5G A;  2DL3 A;  4QVD A;  3CD6 A;  2J05 A;  4MDX A;  4F04 B;  1IO6 A;  1RAD B;  4C92 D;  3DB4 A;  3A1P A;  2Z0W A;  4C8Q B;  3OBW A;  5FRN A;  2L3R A;  1HK9 A;  3H9N A;  4CC2 A;  4OP0 A;  4NL3 A;  1NJI U;  4C8Q A;  4PJM A;  3M0S A;  1KD1 U;  1AT1 B;  2J6F A;  4JJB A;  2DL5 A;  3CCR A;  1BCM A;  2GTJ A;  1YN8 A;  3HFO A;  3CXC A;  1BB9 A;  4QVZ A;  1ZA2 B;  3CCE T;  2HSE B;  5HCK A;  1KC8 U;  2AZV A;  2XU8 A;  3CCE Q;  5LJ5 d;  5KYX B;  4B9X A;  1D1A A;  2J7I A;  5I21 A;  4JJD A;  3OS0 A;  1GCQ C;  3QKJ A;  1YIJ A;  3MEU A;  2K5L A;  3D7S B;  3CCU T;  3OS5 A;  2E12 A;  5KYX A;  1NZ9 A;  1KD1 R;  2WAC A;  3RNJ A;  3CBP A;  3M0Q A;  1ZX6 A;  3CCU Q;  3JB9 F;  2K3X A;  1NEG A;  2KT1 A;  4ESR A;  4KUL A;  3JB9 I;  2CP2 A;  3DLL A;  3AT1 B;  2QK0 A;  3UF4 A;  2KYM A;  1MMG A;  4MZP A;  4ZNX A;  1I5L A;  2RF0 A;  4OF1 A;  2LC4 A;  4OB0 B;  5LJ5 e;  3REA B;  2RO0 A;  5D6Y A;  1W4S A;  4M75 E;  3LYI A;  1K73 C;  2F5T X;  1YJ9 A;  2KI7 A;  3BFM A;  2J06 A;  1YI2 T;  2JNG A;  4KRT A;  3CPF A;  1U1S A;  1WGS A;  1YI2 Q;  1M9S A;  1JEG A;  3FJ5 A;  1ZBJ A;  2HL5 C;  3QXE B;  2LT1 A;  3ASK A;  4J9H A;  1QVF S;  3GIB A;  3OW2 P;  2ZZD A;  3CC7 T;  1ZQ1 A;  2E70 A;  2J6O A;  3CCM T;  1X6O A;  4M78 F;  4HVV A;  4OMM A;  5AT1 B;  3GOX A;  4C5I A;  1TG0 A;  1OZ2 A;  2YRD A;  3CC7 Q;  3CCM Q;  2KRS A;  4DEY A;  4EPC A;  2IVW A;  3QHS A;  2YUQ A;  3RKX A;  3H6Z A;  1RAC B;  3JCM d;  5GAM g;  1VOM A;  4IUU A;  2AIR B;  3VS0 A;  5GAN 5;  3JB9 H;  3L2Z A;  2PVO B;  1KD1 C;  2A7Y A;  1VQ8 A;  4F7U G;  2GFA A;  3JCM P;  2EQM A;  4XK8 E;  2YT6 A;  2FZK B;  4L59 A;  1JJ2 P;  2HDA A;  3G1J A;  3OYH A;  3IQL A;  1QVF A;  1VQ4 T;  1I8F A;  8AT1 B;  2EKH A;  1H92 A;  3SEM A;  3CCV T;  1KQ1 A;  2E6N A;  2G3R A;  1VQ4 Q;  3L42 A;  2DXT A;  2X4J A;  2XI9 A;  1MUZ A;  1S72 Q;  3CCV Q;  3O8V A;  3JCM e;  2P0P A;  3DLM A;  3ME9 A;  1VQK Q;  3CC2 T;  4RTU A;  4JJC A;  3I5S A;  1W2B S;  1RUW A;  3EFR A;  3URG A;  4C0Z A;  3Q1J A;  3CC2 Q;  1YIT Q;  4HCB A;  4C8Q D;  1JRI A;  4E7L A;  1TTH B;  3QZ9 B;  3N5B B;  1UHC A;  2FEI A;  1WI7 A;  5LJ3 g;  3G71 A;  2L89 A;  2OTL Q;  3CXC P;  5HY6 A;  4N4I A;  3G7Z A;  3KBG A;  1RAG B;  1MV3 A;  1ZBX A;  4N4G A;  3MEV A;  2VYT A;  2DL7 A;  3FDR A;  4AFQ C;  4NS5 A;  2QQS A;  3HRT A;  2K79 A;  2O88 A;  5KCO A;  2MAM A;  4ANJ A;  1U3O A;  2BE9 B;  2VXF A;  3UA6 A;  1H3H A;  5GJW B;  1RAI B;  3JCM Q;  1SSH A;  3PIO A;  2OTJ Q;  4XTU A;  4O5V A;  2VXE A;  1W2B A;  3VS1 A;  1NPP A;  4E7K A;  2JZ2 A;  3JAM E;  1R8O B;  1M90 R;  4IIM A;  2CP0 A;  4ZN1 A;  1KK7 A;  3CCS T;  2P4T A;  4PFO A;  3O5Z A;  4JLI A;  2RQR A;  3CCS Q;  2E6Z A;  3UPU A;  2FYK A;  1UDL A;  4BE1 A;  3EG1 A;  4LN2 A;  2R57 A;  1N9S A;  2ZPE B;  4JRP A;  4PLL A;  4BDZ A;  3OYD A;  1OEB A;  5LJ5 j;  3VKI A;  1LJO A;  3DB3 A;  3THK A;  2NWM A;  1AOJ A;  5EG2 A;  1VQ7 T;  2HQH A;  2XDP A;  2A0F B;  5KYU B;  1QQJ A;  1Q95 G;  4JRI A;  1UGR B;  2C0T A;  2PQW A;  5CVI A;  3PVQ A;  3VJP A;  5GMK e;  3REB B;  1M1K R;  4Q5W A;  2MMP A;  5KYU A;  1BI0 A;  3OQ5 A;  2PU9 B;  4N0A C;  4LDX A;  2RI2 A;  1JQQ A;  2D1X A;  1KJW A;  1D09 B;  3JCM J;  2XG8 D;  2ZPH B;  3I55 A;  1PSE A;  2H3J A;  9ATC B;  1AWO A;  3HKS A;  4J6Y A;  3OYN A;  2KMT A;  1PKS A;  1CSK A;  2RHZ A;  4QT7 A;  1UJ0 A;  4A4E A;  2F1L A;  1GL5 A;  2XKO C;  3G4S A;  2EQU A;  4FIB A;  4FL6 A;  2MPX C;  4E7Z A;  1QVG S;  2FRY A;  1WA7 A;  1ZSZ B;  1M90 C;  1BCO A;  1PWT A;  2W0Z A;  4M7A C;  3UWN A;  2OI3 A;  2H8H A;  1PC0 A;  1FXX A;  1X6G A;  1ZSZ A;  5CKH A;  1NBE B;  4E47 A;  2L3P A;  1VQN T;  3M9Q A;  2L3S A;  1P92 A;  3EH1 A;  3A8H B;  1Y07 A;  4II1 A;  1BYM A;  2HKQ B;  1NLO C;  1SG5 A;  1SHG A;  1LOJ A;  2COZ A;  5GAO p;  1Q86 R;  4IUP A;  2QDY B;  2DPP B;  8ATC B;  3ZEH A;  1M2O A;  5GAM h;  2WSE E;  3L1A A;  1RI9 A;  4JZ4 A;  1NEB A;  3M58 A;  2GTO A;  2QQ9 A;  2QGG A;  4OMO A;  2DIQ A;  1U5S A;  4PJO C;  3VS4 A;  3UT1 A;  3OYY A;  4OMQ A;  1H3Z A;  3X25 B;  3TEE A;  4CI0 C;  3JCM V;  2LT4 A;  2RI5 A;  1QVG A;  1JXM A;  2NUZ A;  1UTI A;  1D1B A;  1WJQ A;  2ESW A;  3M54 A;  2JVV A;  3MET A;  4JUV A;  2DTH A;  3HPW A;  2DVJ A;  3U23 A;  2Y4Y A;  3M56 A;  2WSF E;  4M7A G;  4B9W A;  2GF7 A;  3C4S A;  1W1F A;  1VQ8 Q;  5CKE A;  5C0M A;  2FZC B;  1K8A R;  2EIF A;  2OAW A;  1Q7Y R;  1FMW A;  3JB9 D;  1YFN A;  3QZ5 B;  4F7U E;  1GCQ A;  3TSW A;  2E4H A;  3VYG A;  2HZY A;  4OML A;  2D0N A;  2DXB A;  5LJ3 h;  3J81 E;  2QA4 T;  4BB7 A;  1NG2 A;  1D1C A;  2KXD A;  2ZPG B;  1D0Y A;  3SB2 A;  3TVT A;  2FPD A;  4PJO G;  1M3C A;  4DBH A;  1VQO A;  4F14 A;  1QWE A;  2KEA A;  5GMK i;  5A0L A;  1AZE A;  6AT1 B;  4ZN3 A;  4K11 A;  3H0H A;  4F7U B;  3JCM b;  3S3N A;  4FM4 B;  3QPH A;  3RMQ A;  1Q86 C;  4XTX A;  5KH6 A;  4E2F B;  5IHK A;  4JJN K;  4F7U A;  3G71 Q;  3HP9 A;  1AVZ C;  2KYB A;  3GP8 A;  3PE0 A;  3S3O A;  4AG1 C;  1VA7 A;  1VQ6 T;  1TUG B;  3RKY A;  4QW2 A;  1O75 A;  1GFD A;  1MMN A;  2DZC A;  1VQ6 Q;  1C6V X;  1Z9Q A;  1ZUU A;  3VYH B;  2YHT A;  1TXQ A;  3H41 A;  4LUD A;  2QDL A;  2CS7 A;  2KVQ G;  4RTT A;  5GAO l;  3HRS A;  3M0T A;  5GMK j;  4M78 C;  3PFS A;  1RAF B;  2PVD B;  1VQM T;  1UGS B;  2MYS A;  5GAN h;  3L2W A;  2E5K A;  4A53 A;  1IXD A;  1T3L A;  1Q82 R;  2PNI A;  4J7I A;  2HQX A;  2LZ6 B;  3C0C A;  4OB3 B;  1VQM Q;  4KT0 E;  1K8A C;  4AMC A;  1IRE B;  1UGQ B;  2DJZ A;  3TU4 K;  4KUD K;  1VYT A;  4WF2 A;  4DOW A;  4RMO A;  4DBQ A;  1UG1 A;  3J80 E;  4EMG A;  2DF6 A;  1K73 U;  2NLU A;  1WFW A;  2MWO A;  5KE3 A;  2X51 A;  1X01 A;  1M3B A;  1QCF A;  4BUG A;  1ZA1 B;  2O9V A;  1RLP C;  5LJ5 f;  4ZTJ A;  4M7A F;  4B6M A;  2YDL A;  4BI3 A;  2LTO A;  1AZG B;  2EBP A;  5DLO A;  1VQ5 T;  4BE2 A;  3MKD A;  2MWP A;  3H0F A;  4M78 G;  4J9F A;  2AKL A;  3CCJ A;  3OB9 A;  5GAN 6;  3BE3 A;  1I81 A;  3E1S A;  3M53 A;  2ZAE A;  4R55 A;  3I55 T;  1OYX A;  3CC4 T;  1SSF A;  2M51 A;  2CH4 W;  3PVL A;  3EHR A;  2ABL A;  3I55 Q;  1TWB A;  2CSI A;  3CC4 Q;  1MND A;  3A98 A;  4FT2 A;  3V8L A;  2CP7 A;  4PJO F;  3VRY A;  4DA4 A;  1VQP A;  3OYA A;  3TCJ A;  1S1N A;  2IIM A;  1C0M A;  3QWY A;  2L5Q A;  2IG0 A;  4KH0 B;  4PK4 A;  4M7D C;  3CPW S;  1JB0 E;  2CUB A;  1WNL A;  3CEY A;  2JS0 A;  1Q82 C;  2XMF A;  4WTO B;  5GMK m;  3KXT A;  3NTH A;  2QEX A;  1OU8 A;  5KYY B;  3OYE A;  1LVK A;  3CCL A;  4LXC A;  2XID A;  4QQ6 A;  1M3A A;  1OUL A;  1A0N B;  2O9S A;  2KAF A;  4X1V A;  1Z9Z A;  4L6V 5;  5KYY A;  3OYI A;  1UE9 A;  3E2U A;  2EGA A;  1PG5 B;  1Y7X A;  3VS5 A;  2FHD A;  3LX7 A;  3V8K A;  2FRW A;  5A0G A;  4DOV A;  3EG2 A;  3EG9 B;  4V2S A;  2CKK A;  1JO8 A;  1SRM A;  3JCM f;  1U8R A;  3L2R A;  1JU5 C;  4BI4 A;  3P8D A;  2L3Q A;  2QI2 A;  3EFO B;  2LMJ A;  3EG9 A;  1AD5 A;  2RHX A;  1H8K A;  4GLK A;  2M1H A;  2QYZ A;  5GAN 3;  3RUX A;  2QXF A;  4OGE A;  4M7D G;  3EFO A;  1F1B B;  2RJE A;  5LJ5 g;  3ZBD A;  4QKU A;  2YRV A;  4M77 C;  3RMS A;  4J8O A;  1X69 A;  2GCX A;  2RK2 A;  3BDU A;  2KNB B;  3VS2 A;  1V76 A;  3E19 A;  1WHM A;  2MCN A;  2LVM A;  2HMA A;  1BU1 A;  3QYG B;  1D0Z A;  1SF9 A;  4NL2 A;  1BK2 A;  5KYN A;  1FX7 A;  2CT3 A;  2X4W A;  1GCP A;  2JT4 A;  3SDZ A;  5GAO n;  2CP5 A;  1YJW T;  2EW3 A;  1JBM A;  1HXD A;  4E7H A;  4KUI A;  4XQ3 A;  1PCX A;  2EJF A;  2QQB A;  4DQ2 A;  2SEM A;  4CC3 A;  2NYS A;  3HFN A;  1YJW Q;  3ER0 A;  3ZL7 C;  3QYH B;  4PKC C;  1G8X A;  3INZ A;  4O6J A;  5I2M A;  4M7A B;  3PMT A;  4PJO E;  5IN1 A;  4ELY C;  2G6F X;  4F16 A;  1N8R U;  2BTT A;  2LJ0 A;  3OYL A;  2I0N A;  4XU1 A;  1PRL C;  1IGQ A;  1LCK A;  4M77 G;  1VIE A;  5IXB A;  2P0K A;  2DE0 X;  2LX7 A;  4FYV B;  3I56 T;  2LJ1 A;  5I11 A;  1GBR A;  3KUF A;  1I1J A;  3MP8 A;  4FYW B;  2JM9 A;  2QG9 B;  3I56 Q;  1D0X A;  1YCY A;  4ZGJ B;  4LD6 A;  2EAY A;  1ABQ A;  4J5Y A;  1KHC A;  2M02 A;  1ZUY A;  4HCC A;  1S72 T;  4PJO B;  2K3Y A;  1U06 A;  3GLX A;  2LP5 A;  4VUB A;  4R56 A;  1VQK T;  2DET A;  1N5Z A;  1NE8 A;  1XNI A;  1IZ6 A;  4Y92 A;  4M4Z A;  1ZSG A;  1N8R R;  2A28 A;  2JW4 A;  4GBQ A;  4PJO A;  4A4K A;  1WDX A;  2JM8 A;  1YIT T;  3JCM g;  3M4G A;  3CMA T;  2ZCF B;  1W6X A;  1M27 C;  5L23 A;  4KGZ B;  3VS6 A;  2CUD A;  4DEX A;  3CMA Q;  5IHI A;  2MK5 A;  5HKC A;  1K0S A;  3FLG A;  2OTL T;  3BDL A;  4R0K A;  1YHQ A;  1N27 A;  1XOV A;  1IB8 A;  3LLR A;  1M90 U;  2QAZ A;  1G3W A;  1KHI A;  4D8D A;  2X9H A;  2JTF A;  2EJ9 A;  1RAH B;  2OX7 A;  4J7F A;  2HEQ A;  1X27 A;  1KQS S;  2FPE A;  1X75 C;  4PFZ A;  1ABO A;  2EYQ A;  2LQK A;  4M7D F;  2LQW A;  4Z02 A;  3EFS A;  3RER A;  2NUT B;  4QVC A;  1XJW B;  3PTA A;  3BW1 A;  1QLY A;  2OTJ T;  3RR6 A;  3P8B B;  2M0O A;  1BI1 A;  3L2V A;  2LCL A;  4C92 F;  1EX4 A;  2K9G A;  1T3S A;  2O4X B;  1AWX A;  3CD6 T;  3UAT A;  2X3X D;  4JZ3 A;  4Y91 A;  5GAN d;  4M78 E;  2O4X A;  5IXF A;  1VQ9 A;  3CD6 Q;  3OYJ A;  4XAX B;  1VQL A;  4HA8 A;  2KGT A;  2YUP A;  1M1K U;  4LDW A;  2D8J A;  3OYF A;  2KY9 A;  1Y96 B;  2V8I A;  2RMO A;  4JS5 A;  2D6F A;  4X9C A;  1KQS A;  1QMC A;  1VQP Q;  3OS1 A;  3LWH A;  3QJ6 A;  1Y96 A;  3CCR T;  1RAB B;  4BAC A;  2RHY A;  1EFN A;  1N8R C;  1MGQ A;  2EGC A;  2KBT A;  3CCR Q;  1G3Y A;  2ZPI B;  4M78 B;  3RDV A;  5GAO r;  4M77 F;  5GAN e;  2DTO A;  1AWJ A;  3FC3 A;  4M78 A;  5CKD A;  4AG2 C; 
#chains in the Genus database with same CATH homology
 4IUQ A;  3J81 E;  3LWI A;  2QA4 T;  2DD5 A;  4C8Q B;  3G6E A;  4BB7 A;  3OBW A;  4JRK A;  1YIJ T;  5FRN A;  2ZPG B;  3SB2 A;  2RHU A;  2XDD A;  2L3R A;  1HK9 A;  2X4Y A;  5FU6 C;  2K57 A;  4OP0 A;  4PJO G;  3SFM A;  5GMK l;  1NJI C;  1VQO A;  2RHI A;  1TH7 A;  3RES A;  4NL3 A;  5GMK i;  2RM4 A;  2VGM A;  2VUB A;  3CCQ A;  5M9O A;  4C8Q A;  5GAN f;  4MDW A;  5A0L A;  1NJI U;  3SD4 A;  5AYF A;  1KD1 U;  5GAN 2;  4ZN3 A;  2DEQ A;  5KCH A;  2E10 A;  4F7U B;  3JCM b;  3BY7 A;  3CCR A;  3S3N A;  4FM4 B;  3QPH A;  2RI3 A;  4MZT A;  3RMQ A;  5LJ3 d;  4BDY A;  1K9M U;  1Q86 C;  4XTX A;  3HFO A;  5KH6 A;  3CXC A;  1Q86 U;  1UB4 A;  4JJN K;  4F7U A;  4M7A D;  1ZHI A;  3HP9 A;  3M59 A;  4QVZ A;  4BI8 B;  1KC8 C;  3CCE T;  5FRM A;  2E65 A;  1KC8 U;  3OYG A;  2XU8 A;  3GP8 A;  3S3O A;  1VQ6 T;  3UDC A;  3RKY A;  4C0D C;  4QW2 A;  1O75 A;  5LJ5 d;  5J26 A;  1YJ9 T;  4B9X A;  1UGP B;  2F5K A;  2DZC A;  1D3B B;  5DY9 A;  1WPY A;  3VYH B;  5I21 A;  4MML A;  2QA4 A;  3OS0 A;  2YHT A;  4PLI A;  3QKJ A;  4M7D E;  4QQD A;  1YIJ A;  3MEU A;  2CS7 A;  2K5L A;  2KVQ G;  4RG8 A;  3CCU T;  3OS5 A;  2E12 A;  5GAO l;  1NZ9 A;  3HRS A;  2XHC A;  4M75 C;  1B34 B;  5CAI A;  2I2L A;  2WAC A;  1D3B A;  3CBP A;  5GMK j;  4A4G A;  3JB9 F;  2A3L A;  2K3X A;  5LJ3 e;  1G3T A;  4M78 C;  3PFS A;  5FU7 C;  2ZPB B;  2JTM A;  4KUL A;  3JB9 I;  3TRE A;  2PVD B;  1B34 A;  1VQM T;  1UGS B;  2DD4 A;  5GAN h;  4PJO D;  2HD0 A;  3L2W A;  3PGG A;  3DLL A;  4A53 A;  4XTY A;  4J7I A;  2HQX A;  2O01 E;  3X24 B;  4J83 A;  4OB3 B;  4KT0 E;  4C92 D;  5A2Q E;  1K8A C;  4MZP A;  4C8Q C;  1I5L A;  3OYK A;  3QBY A;  5GAO m;  1IRE B;  1UGQ B;  2DJZ A;  2DO3 A;  2EWN A;  2LC4 A;  4OB0 B;  4OF1 A;  5LJ5 e;  3TU4 K;  2RO0 A;  1Q7Y U;  4KUD K;  4WF2 A;  4DOW A;  2B8A A;  3L2Q A;  3V7S A;  4RCB A;  5D6Y A;  1W4S A;  4M75 E;  4RMO A;  3J80 E;  3LYI A;  1YJN T;  1Q81 C;  1K73 C;  2CZ7 B;  2DVE A;  1VQ6 A;  4EMG A;  2F69 A;  2JN0 A;  4OMF B;  4M7D B;  1K73 U;  2R5A A;  3SWN B;  2F5T X;  2K2V A;  1YJ9 A;  2NLU A;  3LH0 A;  3BFM A;  1YBY A;  4QQG A;  1BI2 A;  2E64 A;  2MWO A;  3VV0 A;  3QII A;  1YI2 T;  5KE3 A;  1M1K C;  2JNG A;  4IUT A;  4M7D A;  1X01 A;  2DKG A;  3CPF A;  3CCU A;  3FB9 A;  3ZFJ A;  2DK3 A;  3SWN A;  1U1S A;  2FB7 A;  4BUG A;  1VQP T;  1WGS A;  3FJP A;  4IUR A;  3OYC A;  5IT9 E;  1WQ7 A;  5LJ5 f;  2MI6 A;  1M9S A;  2PVG B;  2MF2 A;  4ZTJ A;  1VQ8 T;  1OZ3 A;  3QXE B;  4M7A F;  2LT1 A;  2EJG A;  3ASK A;  5DM7 R;  3MEA A;  2KDS A;  4BI3 A;  2LTO A;  1VQM A;  2YLC A;  1QVF S;  3T9N A;  4M75 G;  3GIB A;  3HRU A;  3P8H A;  5DLO A;  1VQ5 T;  2ZZD A;  3CC7 T;  2DTI A;  1ZQ1 A;  2E70 A;  2D0Q B;  2MWP A;  4A4H A;  3CCM T;  1X6O A;  4BE2 A;  1KQ2 A;  5GAO q;  3LW5 E;  4M78 F;  3GOX A;  1DJ7 B;  4M78 G;  4C5I A;  2V8J A;  3CCJ A;  1OZ2 A;  3OB9 A;  4EMK B;  3DKM A;  3VUZ A;  5GAN 6;  4ATO A;  1I81 A;  3E1S A;  3M53 A;  4P5N A;  2QEX T;  1WQW A;  3QJY A;  4EPC A;  4C5E A;  5IAY A;  4R55 A;  3CCL T;  3I55 T;  1OYX A;  2IVW A;  2DAQ A;  1EIF A;  1SSF A;  4JDS A;  3CC4 T;  4XU2 A;  4UC4 A;  3A5Z B;  5GAN g;  3QHS A;  4C8Q F;  4EMK A;  3LGF A;  2HNI A;  4YTL A;  4C8Q G;  3PMI A;  3OS2 A;  3FIF A;  4FSX A;  3RIR A;  1Y71 A;  3H6Z A;  2XK0 A;  3RKX A;  2AHJ B;  4EDU A;  3JCM d;  5GAM g;  5L8R E;  4FT2 A;  3V8L A;  2HAX A;  1U1T A;  2HBP A;  4PJO F;  4ELZ C;  4IUU A;  4DA4 A;  1VQP A;  3OYA A;  3TCJ A;  2K5F A;  5GAN 5;  3JB9 H;  3L2Z A;  5D6X A;  2PVO B;  1KD1 C;  4OVA A;  2A7Y A;  3MEW A;  4F7U F;  3GNG A;  4M77 B;  2FL7 A;  4C5H A;  1VQ8 A;  4F7U G;  2L5Q A;  2IG0 A;  2M16 A;  5LJ5 h;  2GFA A;  3JCM P;  2EQM A;  1K9M C;  4XK8 E;  3GF5 A;  4M7D C;  3OYB A;  3FEO A;  1VIF A;  3CPW S;  3G71 T;  4L59 A;  1JB0 E;  4X9D A;  3SWN C;  2DXU A;  1VQ5 A;  4FU6 A;  1WNL A;  3CC7 A;  2XD0 A;  3CEY A;  3OYH A;  3CCM A;  1Q82 C;  4A4F A;  2LCC A;  5CK9 A;  1QVF A;  4HKE A;  3MP1 A;  1VQ4 T;  1I8F A;  1Q82 U;  1K8A U;  5GMK m;  4OGC A;  3CCV T;  3KXT A;  1KQ1 A;  1M5Q 1;  3NTH A;  2E6N A;  2G3R A;  4M75 D;  2QEX A;  1M8V A;  3L42 A;  2CZ1 B;  2DXT A;  3MHX A;  3MO8 A;  2X4J A;  2XI9 A;  3OYE A;  3OW2 S;  3CCL A;  3O8V A;  3QO3 A;  1RL2 A;  2XID A;  3C94 A;  2P0P A;  3DLM A;  4QQ6 A;  3A8L B;  3ME9 A;  4PL6 A;  4M78 D;  5FLX E;  3CC2 T;  2KAF A;  3CCJ T;  4XTW A;  2X35 A;  3NFC A;  2X4X A;  4L6V 5;  1W2B S;  3OYI A;  3EFR A;  3URG A;  3MP6 A;  4C0Z A;  5GAN j;  1WJR A;  3QDR B;  3Q1J A;  3JSC A;  1Y7X A;  4MMK A;  2FHD A;  3LX7 A;  3OYM A;  3V8K A;  3V7C A;  4HCB A;  5GAM j;  2EQJ A;  3QUI A;  5A0G A;  2XDB A;  4DOV A;  4C8Q D;  1JRI A;  3QG1 A;  2HQE A;  4EMK C;  4E7L A;  4V2S A;  2CKK A;  2P0Q A;  3QZ9 B;  1N6A A;  4HT8 A;  3CC4 A;  3JCM f;  1U8R A;  3N5B B;  2C06 A;  3GPL A;  3L2R A;  3X26 B;  2VGN A;  4C92 E;  5LJ3 g;  4BI4 A;  3P8D A;  3G71 A;  2QI2 A;  1VQL T;  2L89 A;  4XU0 A;  2D9T A;  5HY6 A;  2RHX A;  1I4K 1;  1M1G A;  1OI1 A;  4N4I A;  3G7Z A;  3KBG A;  4J6W A;  4KBM B;  1VQ4 A;  1Q7Y C;  4GLK A;  1ZBX A;  3A8M B;  2M1H A;  4N4G A;  3CCE A;  3MEV A;  4A54 A;  2VYT A;  5GAN 3;  3FDR A;  3OMG A;  3RUX A;  4NS5 A;  2QXF A;  4OGE A;  2QQS A;  4C0G A;  5CCA A;  4M7D G;  2RJE A;  3HRT A;  5DLQ E;  4LDY A;  4OB2 B;  5KCO A;  5LJ5 g;  3ZBD A;  2MAM A;  1JJ2 S;  2YRV A;  3OMC A;  4M77 C;  4RG2 A;  3RMS A;  2VXF A;  3CME T;  4MZM A;  4J8O A;  2GCX A;  2RK2 A;  3BDU A;  3OW2 A;  1FWZ A;  3E19 A;  3S3M A;  3NTI A;  4TVR A;  3JCM Q;  2PUK B;  1KG1 A;  3F70 A;  1G5V A;  2LVM A;  3PIO A;  2JOY A;  4XTU A;  2YLB A;  1BIB A;  2GFU A;  2VXE A;  4O5V A;  4LDU A;  1W2B A;  2RH2 A;  1NPP A;  2BUD A;  3QYG B;  2CZ0 B;  5CQX A;  4C92 B;  5CKB A;  4NL2 A;  4E7K A;  2JZ2 A;  3JAM E;  1R8O B;  1NPR A;  4HCZ A;  1RI0 A;  1FX7 A;  2X4W A;  2LQ8 A;  3RKW A;  2DIG A;  3SDZ A;  3QSU A;  4M75 F;  3OA6 A;  1UEB A;  2K4Y A;  4C92 A;  5GAO n;  5GAN 4;  4ZN1 A;  3CCS T;  2P4T A;  3JCM h;  1YJW T;  4M77 E;  1JBM A;  1HXD A;  5LJ3 j;  4E7H A;  4KUI A;  4XQ3 A;  1QP3 A;  2EJF A;  2QQB A;  4DQ2 A;  4JLI A;  5J3B A;  3UPU A;  2E6Z A;  3HFN A;  2BIV A;  2FYK A;  3ER0 A;  4BE1 A;  4RCC A;  1LNX A;  5FRO A;  1YJN A;  2RK1 A;  2R57 A;  3OBY A;  3QYH B;  1N9S A;  1H64 1;  1QW1 A;  4GY5 A;  4PKC C;  2ZPE B;  3INZ A;  4O6J A;  4JRP A;  5I2M A;  4PLL A;  3EAE A;  3PNW C;  4M7A B;  3OYD A;  3PMT A;  4BDZ A;  4PJO E;  3JB9 J;  5IN1 A;  2RJD A;  3WVE B;  4ELY C;  3JCM c;  5LJ5 j;  4BE0 A;  1N8R U;  1YI2 A;  3VKI A;  1LJO A;  1JJ2 A;  3DB3 A;  4M7D D;  4LD9 K;  1QVP A;  3OYL A;  3M57 A;  5EG2 A;  1VQ7 T;  3PIP A;  3G4S T;  5LL6 S;  3VUB A;  4XU1 A;  2XDP A;  4C0F A;  3LGL A;  4M77 G;  2FVU A;  1VIE A;  4JRI A;  1UGR B;  1BI3 A;  2JUF A;  2P0K A;  1O9S A;  2PQW A;  5HK3 A;  5CVI A;  3GNF B;  3VJP A;  3I56 T;  2RJF A;  1YHQ T;  5GMK e;  3KUF A;  4Q5W A;  3MP8 A;  4EMH A;  2MMP A;  2E41 A;  1BI0 A;  4ZGE B;  3JCM W;  2LNV A;  2KSS A;  3CCS A;  4M77 A;  4RKU E;  1YJW A;  1YCY A;  3OQ5 A;  2CZ6 B;  4ZGJ B;  2VV5 A;  2PU9 B;  1N9R A;  2EAY A;  4LD6 A;  4N0A C;  1V29 B;  4J5Y A;  1KHC A;  4HCC A;  4LDX A;  2BKD N;  1S72 T;  4PJO B;  2RI2 A;  2QQA A;  2E5Q A;  2K3Y A;  4J6X A;  4ZGD B;  3GLX A;  4VUB A;  3C12 A;  4X34 A;  3X20 B;  4BY6 B;  4R56 A;  3JCM J;  1VQK T;  5I2S A;  2Y4X A;  1WJS A;  1GXI E;  3X28 B;  1NE8 A;  1XNI A;  1IZ6 A;  2XG8 D;  2ZPH B;  4IUV A;  3A8G B;  1PSE A;  2H3J A;  4C92 C;  5GAM f;  3I55 A;  3A8O B;  5GAN 7;  2OAU A;  3HKS A;  4PJO A;  2M9U A;  3E9G A;  4A4K A;  3OY9 A;  4J6Y A;  3OSS C;  5KE2 A;  2KMT A;  3OYN A;  1YIT T;  2RA2 A;  3VU3 C;  3JCM g;  1M1F A;  2RHZ A;  1XQH A;  4XTZ A;  3M4G A;  4A4E A;  1VQ7 A;  3CMA T;  2XKO C;  2ZCF B;  3CBM A;  3G4S A;  2EQU A;  5CR2 A;  4FIB A;  4FL6 A;  4PNO A;  5J39 A;  1BIA A;  1QVG S;  2DZ9 A;  2CGH A;  5HKC A;  3L2U A;  3M5A A;  2K5I A;  3I56 A;  3FLG A;  1M90 C;  2OTL T;  3BDL A;  1YHQ A;  3HL8 A;  4HT9 A;  1N27 A;  1XOV A;  3LLR A;  1PSF A;  1VQ9 T;  1M90 U;  1G3W A;  1KHI A;  2JTF A;  2EJ9 A;  3HHT B;  4JRQ A;  3UWN A;  4M7A C;  4J7F A;  4M77 D;  2GQV A;  3AHU A;  1FXX A;  3CPW A;  3PT9 A;  3JCM X;  5CKH A;  4JS4 A;  4E47 A;  1KQS S;  3V8J A;  1X75 C;  4IKF A;  2WSC E;  1VQN T;  1S72 A;  3M9Q A;  1VUB A;  3CCV A;  2EYQ A;  1P92 A;  2LQK A;  5C6S A;  5CKF A;  4Z02 A;  3EFS A;  4E7J A;  3RER A;  4M7D F;  3A8H B;  4QVC A;  1Y07 A;  2KK4 A;  2XIC A;  4II1 A;  5D6W A;  3JB9 G;  1VQK A;  1AHJ B;  1BYM A;  1MHN A;  3PTA A;  3BW1 A;  3CBO A;  1LOJ A;  2Y90 A;  2PUO B;  4NOY A;  2LRQ A;  4IUP A;  2QDY B;  2DPP B;  5GAO p;  3CC2 A;  2OTJ T;  3H8Z A;  3P8B B;  1G3S A;  2M0O A;  2QQR A;  3ZEH A;  2DXC A;  4JLG A;  4N4H A;  3S6W A;  1BI1 A;  4ME7 A;  4Y28 E;  5FU6 B;  4D6W A;  1YIT A;  3NTK A;  5GAM h;  2WSE E;  5GMK h;  3L2V A;  3L1A A;  2LCL A;  2R5M A;  2QTX A;  4OB1 B;  4C92 F;  5HK0 A;  3OSV A;  3CMA A;  4M7A E;  4C92 G;  2O4X B;  3M58 A;  2QQ9 A;  4XTV A;  3C95 A;  4N0A A;  2DIQ A;  2EFI A;  5LJ3 f;  4PJO C;  3CD6 T;  3UT1 A;  3OYY A;  1Q81 U;  3X25 B;  1H3Z A;  3TEE A;  4CI0 C;  3JCM V;  4BY6 C;  3FRN A;  2RB6 A;  4Y91 A;  2OTL A;  5GAN d;  3J7A F;  4M78 E;  2LT4 A;  2O4X A;  2RI5 A;  3R6O A;  4CRI A;  5GAN 8;  1QVG A;  1VQ9 A;  3WVD B;  3OYJ A;  3G6E T;  4LDV A;  4C5G A;  3M55 A;  4XAX B;  1VQL A;  5GAM d;  4HA8 A;  3M4Y A;  2RD1 A;  2CYZ B;  1M1K U;  4LDW A;  1WJQ A;  2ZGW A;  3E9F A;  1QP2 A;  3OYF A;  3M54 A;  2KY9 A;  2R58 A;  2JVV A;  1Y96 B;  3MET A;  1M4Z A;  2V8I A;  4JUV A;  1BKB A;  2DTH A;  4ZTF A;  2LDM A;  3HPW A;  4JS5 A;  1VQO T;  3CCQ T;  1VQN A;  2D6F A;  4C0D B;  2EKO A;  2RJC A;  4XU3 A;  4C8Q E;  4X9C A;  1KQS A;  5CQY A;  2Y4Y A;  3M56 A;  2WSF E;  2EQK A;  2KQW A;  4M7A G;  3OS1 A;  3LWH A;  3QJ6 A;  1Y96 A;  3CCR T;  2VC8 A;  4B9W A;  2GF7 A;  3CXC S;  4BAC A;  3C4S A;  2OTJ A;  2RHY A;  2E1H A;  3WXM B;  5CKE A;  3V7R A;  3CME A;  1N8R C;  1MGQ A;  3MCA B;  5C0M A;  4M75 B;  4BD3 A;  2EIF A;  3HSB A;  3JB9 D;  1G3Y A;  2ZPI B;  4FT4 A;  2L8D A;  3QZ5 B;  4F7U E;  4M7A A;  3JRZ A;  2ZPF B;  2V8K A;  4M78 B;  5FU7 B;  3VYG A;  5GAO r;  5CIU A;  4M77 F;  5CO7 A;  5GAN e;  4M75 A;  4L5G A;  2LX9 A;  5A0D A;  4QVD A;  3CD6 A;  2DTO A;  4MDX A;  5GAM e;  3FC3 A;  4E7I A;  2DXB A;  4M78 A;  5CKD A;  1XTD A;  3JCM e;  5LJ3 h;  3DB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...