4DEXA

Crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav2.2 i-ii linker.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
289
Chain Sequence
EDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
molecule keywords Voltage-dependent L-type calcium channel subunit beta-2
total genus 95
structure length 289
sequence length 317
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4dexA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dexA02
3VHXA 4GOJA 1XZPA 4DT1B 4Q9LA 2CMKA 2A5FA 4CF7A 2ATXA 1YR9A 4AKHA 1FZQA 1UBEA 4GPTA 1YN8A 1JR3E 3E2IA 3HYTA 1S3GA 721PA 4EPVA 1FW6A 2AD5A 2FDCA 3BFVA 5KSPA 2ZUDA 1FQJA 3SHWA 4AURA 2P6NA 2GDJA 2BBSA 3C16C 4J9GA 1W0KD 1KI6A 2GEUA 3GCGA 3U7GA 3CX6A 4F38A 5FUYA 1GBRA 4URZR 3IQLA 5SZIA 2RGBA 2J0UA 1IXRC 3RANA 4NKRA 5UKDA 2N42A 3CNNA 1LB1B 1CIPA 1KI4A 2FGJA 2X3XD 4BEJA 4D26A 1LCKA 2HJVA 3PR1A 2L3PA 2CVHA 2DBKA 2PX0A 4M9SA 3VU9B 3ZGXA 1UDLA 3K09A 3K1JA 1WBDA 3WBJA 3WP0A 1AVZC 1E9DA 2YV5A 2E1RA 2L2PA 4JSTA 4D4LA 1E2IA 1J90A 2ZR0A 1ZVQA 4E07A 4Z8YA 3VRZA 1D2EA 521PA 4B3GA 2ZRHA 1FP7A 4Q5IA 2K7AA 2HT1A 2NGRA 4FMDF 4HAWA 4Q4HA 4YDHB 4XVQA 3C4JA 5DN6D 1ZU4A 2KYMA 3TKLA 4W5JA 821PA 4ZCLA 2K5UA 2DR3A 2LCFA 4CDGA 4HDCA 2KNBB 5CB8A 4GMDA 5IHIA 4JLPA 1K9AA 4HVVA 1N6LA 1NM7A 3NC0C 4II7A 1WLPB 1N3BA 4MRSA 2ZJAA 1GVNB 1FTNA 3RNJA 4V02A 3WBKA 1OXSC 3IHLA 4C0LA 3CWQA 3EPJA 4BLQA 3T1VA 4M1OA 2K9GA 3I72A 4NCHA 1UPTA 4WA7A 1KSFX 3T06B 4OK3A 4A92A 3V4FA 3ASZA 2WWXA 2GZAA 5EUMA 3X2SA 1MO6A 4PO8A 5EE0A 4V03A 4KVGA 5J4HA 5AUOB 2CCJA 2J7PD 4M53A 1KI2A 1M2OB 2KBFA 3EHQA 4NYJR 4PAMA 4FCTA 1IY2A 4LYAA 1CJKC 3AVTA 1HA3A 2XB2A 5CYPA 4A15A 1NG9A 4GT1A 2HCJB 2QDLA 3VR6A 5FOXA 1OLOA 4HAXA 4Q9IA 1E1QD 4QJ4A 1UDXA 3KZ1E 5AJWA 4IDQA 4LUDA 1ZD1A 5TY0A 2WJYA 3THOA 4CC3A 4F4IA 2ANBA 4LJAA 2M51A 4N1AA 4IVRA 5J4KA 3T35A 4RTZA 1SGWA 3DOFA 4MGZR 4DKXA 2OCPA 3KXKA 4URUR 3E70C 1W4BA 3W5IA 2AWNA 4O25A 1SHKA 3CLVA 3AVQA 1OV3A 1D6JA 1ELOA 1CS4C 1DO0A 1ZD8A 2DYKA 4MUAA 1K5DA 4CC4B 1SQ5A 4DUGA 3Q9LA 2Z0MA 3E5HA 2W0MA 2XGJA 1EXMA 4PAOA 2QP3A 2ZRLA 2R6GA 2ZM5A 2W10A 4RTVA 1E3MA 1JXMA 2QMHA 2LJ3A 2ZSEA 3BB1A 4R9UC 1TUEA 3VS2A 5AJYA 3D7MA 4IEIA 3QKRA 4UNNA 2KGTA 4BFZA 3ADDA 2G6FX 2R2AA 1ZAKA 3PITA 4FSSA 2QP4A 5ECAA 4OMNA 2I3BA 2ZRMA 3C15C 3ZH9B 4GSYA 1JEGA 3P26A 2ZE8A 4EDHA 1RPZA 2O9VA 5H1YA 3QXSA 2FEMA 3OHMA 2IYZA 3LH5A 4M0LA 4DLWA 1FNMA 3LWNA 5CLQA 5KPDA 1GL6A 3DEFA 3GEIA 1XPUA 2YZ2A 2CLCX 1IN8A 2JJ1A 1UFFA 3VS4A 2JMAA 1SVKA 2W0SA 3AF2A 4I1VA 4RSGA 5FPYA 1QHIA 1FMJA 2J5XA 5J40A 3A4MA 2O0HA 1YQTA 2ZUCA 4D80A 4ZIRA 2BMFA 3FFBA 3EPKA 5HR5A 2FOLA 2HCBA 2H18A 3K0SA 5EZ5A 2JS2A 1RUWA 3I3SR 3MJRA 4DB4A 4NYIR 1W36C 5FL7A 2MOXA 1RJ9B 5KDDA 1NI3A 2M0YA 1UKVY 2CE7A 3PUWA 4IIOA 1W4AA 2RHDA 3KTAA 2ZRFA 1YZQA 4G5QA 4BRUA 4CYMA 4BLPA 1ZC4A 2AK3A 2REBA 4UJ5A 2AXNA 2BJWA 4NH0A 1GKIA 1QWEA 1CRPA 3LW8A 1TUIA 3WRXC 4QBFA 3DMNA 4P4SB 1UG1A 1VYVA 3QWYA 2IA5A 2MMGA 4D8DA 3B8HA 3ZD6A 2J45A 1BO6A 2KEAA 4IFEA 2XMFA 3MJHA 2OXCA 1SRMA 2IL1A 1XJQA 3SNHA 4XWOA 4AKIA 3KB2A 1QLYA 2DHRA 2BM0A 2UZIR 4ZKEA 1GM5A 2IEYA 3EC2A 1NLZA 3CF2A 1IJEA 1L4UA 2IYYA 3HDTA 3IDQA 2OV2A 1GOTA 4A1FA 2Z43A 2AHOA 4R71A 4G5RA 4LHZA 1HSQA 5JI3E 3FTQA 1XXHA 5BYKA 1T0HA 2VH5R 2WIAA 4QGGA 5L3QB 1AWXA 1L2TA 4HB3A 2Q0HA 5KPJA 1Y63A 3I5SA 2XTZA 4FMBB 1GIAA 2AN9A 1KAGA 3MWLA 4CC2A 1ANKA 1G7TA 1W0JA 5EJEA 5JWOA 2BCJQ 1KDOA 1P2VA 3KFVA 2O8BA 1U0JA 3U44A 1NN3A 5JEEA 1ZC3A 2GHIA 2V1QA 1X86B 3UATA 4TTPA 6Q21A 1AWWA 1U94A 3EG1A 3VR1A 1UUEA 2OBNA 4B3FX 1II8A 1MRSA 3BB3A 4RD4A 4LBVA 3VAAA 1KSGA 4DBLC 1CEEA 1WIEA 1U98A 1QHYA 1X8LA 2P0EA 2NPFA 2CT3A 2ZI5A 2IS6A 2QRNA 2ZSAA 3WNCA 1TPZA 4RZ2A 2UVQA 1MV3A 1SXJB 1T5IA 1S1CA 2XNSA 2V6JA 1VKJA 1G3MA 2GBLC 4M2LA 1OXXK 4ACAA 4AK9A 2OCAA 1Y0MA 3VHLB 2IYSA 4FCWA 1N6RA 3IPYA 4RFSA 1HE8B 1W2HA 1Z83A 4WAUA 5GJWC 4BGDA 2DB3A 3EIHA 4D0LB 2GF9A 1IONA 2CJWB 5FPKA 1AK2A 4UNQA 2YUNA 1U8YA 1Z0AA 3ZS8A 1JPNA 3KTAB 121PA 1LY1A 4MYHA 4WXRA 1E96A 2QMUA 3MAAC 4US1R 1YVDA 1RJ9A 3ECCA 3IPXA 3EWAA 3A58B 4IFBA 4BRWA 1U99A 4ACBA 1E9AA 4B73A 3BB4A 4ZCMA 1E0AA 4JKIA 2P4RA 3VS0A 1WCV1 3A1SA 4TMXA 2EW3A 3I9QA 1R2QA 3A36A 2CDNA 2DWQA 2ZRDA 3ZVRA 1PUJA 2WAYA 2OLJA 4UKDA 1NEGA 3K9GA 3BOSA 3GJ3A 5CDFA 2GTOA 2JLSA 1EFTA 2GJKA 4TYNA 4H1UA 2ZAMA 1OPKA 2ZIAA 2Z6VA 1NY5A 1TQDA 5FOSA 2WTUA 3F8TA 2OILA 3ZVNA 2C0OA 1FMLA 2JLVA 1OEBA 5EE5B 2DL8A 2FV8A 2D7CA 5ELXA 4P4TA 4XWKA 2VHQA 2R44A 5DIFA 4OKSA 1A2KC 2GBQA 1B23P 4PQYA 3NMZC 4M21A 1KDTA 2FEOA 5GJCA 1RYHA 2EVWX 3BIFA 2F1HA 1KO7A 2CHQA 3TJZA 1UF9A 3QXJA 4Q21A 1ZJ6A 1US8A 4M1SA 5E7MA 4D81A 1KIMA 3Q8XB 1M1YE 1NBME 2NO1A 1G2BA 1PLKA 4PPNA 2AZSA 2VBCA 2DBMA 4NPHA 4TMVA 4CVNA 1W4CA 4Z8AA 3LV8A 3UF4A 4Q9HA 1NVVQ 2ZI6A 4QHYA 4MA4A 5FUVA 4Q7LA 4Z1MD 1D9XA 1G16A 4KAXA 1M30A 1OH8A 1F2TB 2PT5A 4DLYA 1T6NA 1BK2A 4Z51A 3AH8A 5F98A 5EUQB 3FOZA 3BAFA 2O31A 3AKDA 3SJAA 2I4IA 2EQIA 2P5SA 3B9PA 1P60A 4IKEA 1RW4A 1VYTA 2GAAA 4XWAA 1M6NA 3M0PA 2WAXA 4DEXA 1UBCA 2QSZA 1P72A 2PZ1A 1EX6A 3REAB 4LK2A 5CYOA 1XCPA 5IF9A 1OXUA 1HQCA 1T3HA 3CH5A 2D2EA 4B2IA 2JASA 1Z0JA 1CR1A 1N2CE 4OK5A 1US8B 1JO8A 4BPBA 3H0IA 1DAKA 3DO6A 1N5LA 1E7OA 1Q3TA 3NH6A 1P7CA 2HLDA 1XU4A 4ZCIA 3SZRA 2A5JA 2R6FA 1DARA 1E98A 5EXXA 1DOAA 3CUEF 2WSSA 3G82C 1G6OA 4R98A 1ZNXA 3AVPA 2JLZA 5L3VA 1Z6AA 1YZUA 3VKWA 2QQEA 2VTKA 5C18A 1ETUA 3AF4A 3R9WA 3UPUA 1W44A 3FWYA 4WIAA 4X8OA 4JLMA 1N5JA 2XSZD 4OI1A 1HD3A 1OKKD 5HE9A 1NVXQ 2VF8A 4A82A 2YUPA 1G5TA 2CEAA 3A4NA 4EJSC 5SZJA 1T0JA 3O5ZA 2ZETA 2IYWA 3THYB 3GLIB 4QKQA 3RVBA 5LDDC 2YSQA 3VS3A 4MITA 3I5XA 4E03A 1LTQA 1KJWA 1KOFA 1TNDA 2NWMA 3FYHA 1SVMA 3LA6A 2YOGA 2LJ0A 3N2EA 4RTTA 4L5BA 4BFSA 3OFND 4CT5A 3IBGA 5FOTA 1AN0A 4TYPA 1AZTA 2AKYA 3RLFA 4JYCA 3NPFA 1Y57A 2O8DB 4P4SA 4OYHA 4YONB 5EE1A 1UJ0A 1W4RA 1YZLA 4RFSB 2EYWA 4TWZA 4JZKA 3X1ZA 4D0NA 2WWYA 4AFZC 1N6OA 2GWHA 2GJAA 2YVUA 4MRNA 1ZNYA 3RS0A 3OEEA 3AVWA 5JCZA 3CW2A 4CRWB 3IEUA 3AB3A 5D3MB 1N0VC 1ONBA 3LBHA 4RTYA 2J05A 3F5FA 4Q48A 3EW9A 5JI2E 1SRLA 3D31A 3EG2A 4AWXA 1QHHA 2GXQA 2HF8A 2ZRKA 3ONWA 2J9RA 2JJ2D 4C0BA 1S2MA 5EE3A 3OEED 5EP1A 1ZM4A 1PNJA 3GLGE 3AM1A 3NGPA 5FFMA 3R9XA 2W2VA 3A1UA 2O8CA 1NJFA 2I1VB 2OM2A 2ORIA 1EWQA 1YZKA 1J8YF 2WJIA 4IOMA 2MMCA 2RH5A 1Z63A 1NF3A 2PEZA 621PA 1W0KA 3CX8A 2ZI9A 1WFWA 2V1XA 2KBTA 3ZS9A 5DYGA 1CLUA 1J70A 1E4VA 3MWKA 1BMFD 4JVNA 1SPKA 1IJFA 4CW7A 3QEJA 1Z08A 1E6GA 3ZQJA 3QPUA 1NG1A 5E3HA 2XX3A 2RF0A 1GNRA 1GWNA 5CDFE 1XX6A 2F43B 3NHNA 3L82B 1G21E 2CK3D 4V0NA 1M7HA 3T12A 2ZJOA 2A7QA 1YU9A 4OL0A 5HZHA 4LUCA 2FPDA 1XEFA 1OXVA 2ZYTX 3LVRE 3OF5A 4N0EA 1W47A 1SKYB 3B1XA 2QRZA 2GESA 4H1VA 4JBXA 1KJYA 3BGWA 1OV4A 2DL5A 4NYMR 1QHSA 4OJKA 1QHGA 4PZZA 1NBMA 3U3KA 1Z2AA 4OMMA 1OFIA 1OH6A 1YRBA 2P2LA 4OI0A 2A37A 5BXQC 2HEIA 1MH1A 3JVUA 2HEQA 5BWMA 4YDSA 3QOFA 4Q7KA 5HKKD 2FFAA 3L8ZA 4ERNA 1P9NA 5FBRB 1WXUA 3FFAA 2J0QA 2KJQA 5FH9A 3N5CA 1BMFA 2NO9A 2PJZA 2YKGA 4R2HA 2BJVA 2VL7A 2O8FA 1JR3D 1E32A 2VYFA 5FPHA 2Q9CA 3KJGA 4Q1AA 2GAOA 1YNZA 4PHHA 4EFMA 1DAFA 2F1JA 1JJVA 2RGEA 5IXBA 2LX7A 1XWIA 3VNUA 3B1ZA 4LHWA 4JKYA 2FPMA 3QKTA 5EP2A 2V54A 4CEHA 1WYXA 2R8RA 4F14A 3C8UA 3RBBB 4RD2A 3ZL7C 2W2TA 3U61B 3M0QA 1XTQA 4URYR 2WPDA 2B7CA 3W3ZB 2KB0A 3AKYA 1CU1A 3K9LA 4GBQA 4Q1EA 2RQWA 3BC1A 4E22A 4HUTA 4IDHA 2WBLC 2XTNA 3EZ7A 3O8DA 3T1TA 4OQXA 1XTJA 5CM9C 3CM0A 3PUVA 4RD0A 4M9XA 5JS8A 3MSXA 2GK6A 1J8MF 2WV9A 1J7KA 2GTPA 1EESA 5C4GB 5GJVB 4RCYA 2CVFA 3VRYA 1AGRA 2KYBA 1GDDA 2ECKA 1H8KA 5DISB 5B2ZA 1NY6A 2DRMA 4B75A 1G41A 2D3WA 5C1BA 3EIEA 4JJCA 2B7BA 4RTUA 4MUBA 4NU0A 5H68A 4QJ3A 1KDRA 2QAJA 3I73A 4WVFA 3ZVLA 1MUZA 3EC1A 4HLUC 2ZRJA 2ATVA 2GA8A 2HYIC 4IRUB 3I92A 1ESNA 3U6BA 2CHVA 3QI2A 2QA5A 2JXBA 3DHWC 4GMXA 2K3BA 2ZS7A 3EPLA 3I1FA 3TSZA 1GL5A 5DLQC 4I81A 2QBYA 5HCIA 2J6OA 1P9RA 4PR0A 4BZPA 5J47A 1XTKA 2WOOA 5AJZA 4K11A 3ZJYA 4BZQA 4QJ5A 4CEJB 1GNPA 3NVAA 2PNIA 1KI6B 1UDWA 4LJ8A 3FHOA 2EYUA 3GLIA 4PPQA 4Z8XA 2JATA 3EXAA 3CRVA 2J59A 2C9CA 4F17A 4A63B 1E99A 3NHAA 4G0NA 4HLCA 4DLVA 4AY2A 2QL6A 2ED1A 2RQUA 2CHGA 5FTJA 2ZRAA 1IXZA 4BLOA 2ESWA 2JLUA 1KNQA 2CT4A 4TYYA 5IT5A 1PV4A 1VYUA 5G3ZA 4RY2A 2ZRBA 4EJSB 2OESA 4LX0A 4MDEA 2PL3A 2ZR7A 2LMJA 2CL0X 1S4QA 2ZSFA 3WNBA 5KYKA 2C5LA 3CRMA 3FHCB 4OQMA 2H92A 1II0A 4GL2A 2J46A 1IXSB 1XRJA 4EAQA 1D8TA 4B74A 2R6AA 3B6EA 4XD7A 2OSBA 3MRSA 4JS0A 2PZEA 4TQAA 1GL7A 3WMGA 1QG4A 3OESA 4KV9A 1G9XA 2GQIA 5BW8A 1CF4A 2NUZA 1DEKA 3CNLA 1AD5A 1F60A 1DVRA 4GNKA 4U5XA 2V7QA 5JMTA 2FA9A 1AZEA 3WYGA 1KFZA 1F2TA 4A0RA 3K09C 5J5CA 2ZVPX 1EG7A 1G8YA 1M8MA 1TTTA 4P33A 5FR2A 3HJNA 4UNPA 1LVGA 2L3QA 4YQFA 3IGFA 4KITB 1FYNA 2ROTA 2IF0A 1E2GA 4HDOB 4LPKA 4QBHA 3GPLA 2P6RA 2GNCA 2Y8EA 3I4LA 4MYTA 3FMPB 1J2JA 1NJGA 2OBLA 3W6PA 1ZNZA 3VR3A 1M3CA 1BOFA 3Q72A 4EPWA 2YHSA 2W6JA 3REBB 1LW7A 4QT7A 2VVKA 2ZS9A 4G1UC 1V1CA 1KIKA 1FP6A 3AUYA 2L3SA 2A78A 4PTLA 4OHYA 5KHOC 3LD9A 1Z22A 4IOKA 3RSOA 4QL3A 3EARA 4Q4AA 2YWHA 4DC9A 2OFOA 1J3TA 1E94E 4LZZA 4PQRA 2ORWA 3K70C 3ICQB 2A5GA 2Q9BA 4RTXA 1Z9QA 1XDBA 2IUSA 3O47A 2KWIA 4KFUA 1K76A 2ENMA 1NKTA 3THWB 2RGNA 2ZYVX 1JU5C 3I5RA 4YMTA 3A1VA 3W6OA 1WB9A 4B6EA 4B3BA 2ZVQX 5KTYA 3R9IA 2ED0A 3QSYA 4TN1A 2O5VA 1X6GA 1E1RD 3BFKA 1TQ4A 1Z47A 3AKEA 1C4OA 1NL3A 3OE7A 1HY3A 1F48A 1BYUA 4DWJA 3LLMA 2CNWA 2AR7A 3GQBA 4JL8A 1YZNA 3WP1B 1AM4D 3AKCA 5KUTA 1IM2A 1XPOA 3FMOB 1BKDR 1KKMA 1OYWA 4DB2A 4HUQA 1D9ZA 1KO5A 3NBZC 2YDLA 3LY5A 1Q0UA 1CJUC 2IUTA 1KO8A 3SN6A 2J3EA 4AG6A 1RYFA 4LJ9A 4ITRC 3TBKA 1UKEA 1VHTA 4POAA 3T34A 3ZVMA 4D4JA 1WP9A 4FI3C 3KXLA 1UAAA 1VG9B 2OXRA 2DL7A 2YWFA 4AFSC 1TEXA 2BWJA 2WKPA 1OE0A 3QG1A 4P3YA 4JPBW 1L4YA 1G8PA 4LCBA 4D82A 4O2RA 4ZO4A 3IO5A 5HCNA 5JSZA 2C8VA 3AV0B 4KYIB 2RQTA 1OPLA 2D2FA 2ZI3A 1K5GA 1PKSA 4ZPXA 1ABQA 2VF7A 2XJ4A 1S8FA 1GL9B 2VKNA 1WQ1R 1COWA 3BH6A 1G83A 2IF2A 2JIZD 4XSHA 4C9BA 5JS7A 1MO4A 1RRFA 1FMKA 1SKYE 2BZYA 2RAPA 4JIMA 4KXFB 5DI3A 1W48A 3VTKA 4HEJA 2O8BB 2XZPA 1X3SA 5SZKB 1VECA 2OT3B 4M22A 2IS1A 2PEYA 3EAQA 3TE6A 2AD1A 3TUJC 3TVTA 1II9A 1BYIA 4PHFA 1UM8A 5L3QA 5AJXA 1I4TD 2OAQ1 4MKIA 2KXCA 4U00A 1NG2A 1COWD 1XXHB 3ZQ6A 4BLSA 1LV7A 3KDSE 3KKNA 4NCJA 3WMFA 2X2FA 3X1XA 1JB1A 3THXB 2XOKA 2NO0A 4OMPA 1R0XA 2WHXA 3T5DA 5IHPA 2NO6A 2PLFA 2WM9B 4AFUC 1TF7A 4C4PA 5JWHA 2DFLA 3IILA 5J4VA 2WJJA 2FPFA 1QHHB 3BERA 2VP0A 2FFQA 4B71A 3BJIC 4RZ3A 3DZ8A 2J7KA 2VHJA 3KX2A 4Q4HB 5LD2B 1LS6A 1VCNA 3DMDA 3M0EA 1PWTA 3B85A 2DPXA 4PAQA 4GP6A 4WBSA 4TSFD 1ZW6A 3H86A 1G19A 2QMOA 2J6FA 2CSQA 1VCIA 3PIRA 1KMHA 2DYBA 4A4DA 5JHHB 1RVDA 1VG8A 1P73A 1MABA 4I4LA 1VCMA 3NTUA 4EQ6A 4C0JA 4HZIA 1XEXA 2BCGY 2DRKA 1F2UA 4LBZA 1ZUHA 2B21A 1X2QA 1HV8A 1ZIOA 4M4SA 4TYWA 3WHKA 4A8JC 3HPRA 2NZJA 3EA0A 1JQJC 3QKSB 2FPKA 4GOKA 1ZUKA 4NTZA 5KSOA 1EFRA 2QPTA 3HPQA 1GZSA 2KE5A 2G1KA 1GSIA 1OIVA 2EKHA 3SYLA 1M27C 1DELA 1ARKA 5E4FA 5LB2A 3AGPA 2AK2A 1SVWA 1Z29A 5F3WB 1P62B 2EGEA 2GCPA 2O52A 2ZRCA 1SVSA 1S0UA 2J6KA 1ZYUA 3D3QA 1DAIA 5FTNA 1R5OA 1QCFA 1XEWY 2CLDX 3SBDA 3PEYA 1U9IA 2IYTA 3W90A 3H0FA 1C9KA 4DT1A 2F6RA 3LX5A 3BS4A 1X8KA 2WWFA 4HLDA 4Q9JA 3WY9A 2QPAA 2JEOA 2JLWA 2RGNC 2IWHA 5KSZA 4RD3A 1I4DD 5I22A 1P2SA 4JLVA 3UANA 5FTMA 1NRJB 4GFDA 2AK5A 3OZXA 4ESRA 1XP8A 4TMTA 5EP4A 1XTSA 4BLRA 1CKBA 2C0IA 4R0KA 3B13B 1TL7C 4EFNA 4MYCA 2W6JD 3ZIAD 1W36D 1BBZA 3BH0A 3NWJA 3RS4A 1JXOA 4DXAA 3BH7A 4FIDA 4DLXA 4NP6A 1W5SA 3B1VA 1SHZA 4ZI2A 5FWCA 1Q1QA 4Q03A 3R7WB 4QFMA 2ZJ5A 2LQWA 2EBPA 3TQFA 1B3QA 4DLZA 2Z4RA 2DBYA 1SVOA 2GKSA 4G5GA 3AEZA 1N6IA 4DCTA 1IOZA 1NLFA 3B5JA 2YC4C 4Q1CA 2H8HA 4MGIR 3T61A 1WXBA 5FPTA 2A30A 4URWR 4DLSA 1WDTA 2RMOA 3B78A 1KKLA 3U3OA 2EFHB 4DCNA 5DSZA 4F91B 1WBBA 5L3SA 4A0FA 1YP5A 4AYXA 2ZS8A 2L0XA 1S1NA 3DPUA 5IK2D 2A28A 3K0CC 3GMTA 2D4HA 4ILEA 3C5HA 2HXSA 1E2JA 3B2EA 3RWMB 4PFSA 2C2HA 2EWWA 4PO1A 1CP2A 3B82A 4PQFA 1SZPA 1CRQA 1G8HA 1Q22A 1FX0B 2Q3FA 4IJMA 1G5RA 1TUCA 1EFCA 3H4MA 1NLOC 1TADA 1OT3A 1M34E 3GJ5A 1FTSA 4DDTA 4ARZA 2E87A 3CWZA 2JMCA 5FR1A 2FFBA 4JBWA 3KJIA 5LB4A 1O87A 3QKUA 3U4QB 1E2DA 1G8GA 1N5IA 5E7JA 3NXSA 1E9SA 2EPDA 1KI9A 2PCJA 1XF9A 1VG0B 2ZR9A 3PENA 2O9SA 5BN5A 2F3RA 4TZ0A 5JJLA 3R8FA 4X1VA 2DMOA 5DN6A 1SVLA 1A4RA 2VIIA 3AP2A 3THWA 4AG5A 2WWGA 3RRMA 2AFHE 3CF0A 1FOEB 2FSHA 1OW3B 1TU3A 2QGZA 4FW9A 2K6DA 1OSNA 3R8CA 1NLYA 3AUXA 2VP6A 1ABOA 4BFVA 2EGAA 1SXJC 5CLLA 2CCKA 2JA1A 2G1JA 5DI3B 3GFOA 5HTKA 1GRIA 1Z9ZA 3UIEA 2KT1A 4J9IA 1R5BA 4PSKA 3CR8A 3RNLA 5GJBA 2CH4A 3FKSA 3H1TA 1W2GA 2VHTA 2HDNB 2XJ9A 4A8JB 2ZROA 1XNJA 2VEDA 4ZDIA 1TX4B 2V1RA 4HB2A 2RNAA 3VKGA 3KJHA 1ZIPA 4NCKA 4ZDJA 3K53A 1HURA 4L15A 3ND8A 1A82A 2EU8A 2RGXA 4TLBA 3A37A 3F3YA 4TT3A 4KFRA 1VHLA 4N0DA 1NSFA 3VS6A 3L0PA 4MRRA 1S9HA 1WA5A 1U5SA 2J7IA 1JEDA 1Q44A 4GZLA 4GRAA 2CL7X 1XCMA 2WMOB 3LO5A 4PHTA 2EYQA 3EG3A 3ZIAA 1G7SA 2AKKA 3AVOA 4F4JA 2VSOA 1KZ7B 5K8TA 4QGAA 1G8FA 1TEVA 1VMAA 3SFZA 3BD9A 4B43A 3LNCA 2ONJA 3D6TB 1KK3A 3MFYA 3EIQA 2VP2A 2GCOB 3KQUA 3ADCA 4UXJA 3R7WA 5TMPA 1QHXA 3UWKA 1AZSC 1P61B 5DHAA 1W46A 2HT6A 2WJGA 4PSVA 1XD8A 5TARA 3ZZUA 2B86A 4E6RA 4TL9A 5IXFA 1GRRA 5L3RA 3Q7PA 2DNUA 1SULA 2F43A 5EP3A 4KBFA 1I1JA 5AK0A 4KYUA 4J9BA 4M8NE 4TL7A 4JJZA 3PUZA 2JLQA 4AYTA 4EJSA 3QVVA 4Q4JA 3NBFA 4JLAA 1GFIA 4IVQA 1W1WA 4HCKA 1R0ZA 3KB1A 3ZZTA 2GVDC 4D4KA 1VA7A 3WHLA 1XFAA 1N5KA 4IEEA 3QXHA 5K8UA 1T3SA 2OI3A 2OFWA 4NDZA 3GD7A 1I07A 4FWTA 1PRLC 4LPSA 3SHFA 2OCBA 5GVSA 4GLMA 1Z6TA 4RCZA 2RB4A 5FL3A 2IS2A 2VSXA 3BWDD 4M1KA 4R7ZA 4UQOA 2P6UA 1RC8A 2O8CB 4ABYA 4FMDB 1UGVA 2ZJYA 3A8TA 1KSWA 2OAWA 1KK0A 3GLFB 4V0OA 2ZYUX 5CM8B 3AF0A 1I2DA 4QG7A 2C04A 3EG0A 3O8BA 2ODEA 4PC2A 3UK6A 2HF9A 1EGAA 2G77B 1K8RA 4HYYA 3VNVA 4O0MA 1XMVA 1H8HD 1JI0A 4EPRA 2ZJBA 1N5ZA 1DAEA 4D25A 4DCSA 3K9NA 1R0WA 3CZPA 2IEZA 1XEXB 3VR4A 2J41A 1KY2A 5F9HA 2F2XA 4YMWA 2ZU6A 4PC3A 4YMSA 2HBWA 1Z0IA 2EFGA 3SYKA 3T1QA 1J99A 3SEAA 2KRMA 4FD2A 2CLSA 1XXHE 5AUPB 2YJTD 4HZUA 4B47A 221PA 5JECA 2W83A 3AVVA 2B8TA 2XNDD 3B60A 4KO8A 1ZM2A 4MYUA 4A2PA 1QKXA 1S9DA 3QE0A 2BKUA 3SR0A 4IVPA 1MV0B 2BOVA 1ZBDA 5KOYA 5G41A 4P0TA 3REGA 3IIKA 3VKHA 3CBQA 2X77A 2ZXUA 4FINA 2QQ0A 3L43A 4XSGA 3RSLA 1AKYA 1SVIA 5IRCD 2Z5FA 2J7PA 2ZRNA 3ETLA 4QXAA 5FBQB 1GBQA 2B8WA 3JZMA 1CBUA 4DSOA 2ORVA 5B30A 4RJLA 2KR3A 4Y92A 2ODWA 3AP3A 3NDPA 4JLBA 1B0UA 2D1XA 3CF6R 1T91A 3SYNA 3T5GA 3NBYC 1HH4A 3W3AA 4MRVA 3HYRA 4DJTA 4Q01A 1DAGA 1ZUUA 1AWOA 1AKEA 1HQYE 2ECZA 1JQLB 2P5TB 4V0ME 3TUIC 4BECA 3CPEA 2O8FB 3K8YA 4NYJQ 2DL4A 4RFVA 3HU3A 2XB4A 3JVVA 4LDJA 1N0WA 4LYHA 4DRZA 4KBGA 1E2FA 3QXCA 4LV6A 3LXRA 3QY0A 3KL4A 3IIMA 5JSZB 2FO0A 2QBYB 2REOA 3FDIA 5GADl 4KHZA 4V0MA 1A7JA 4QM6A 4DCUA 3I5YA 4P32A 2RQVA 2QUZA 4RKFA 1E9RA 2XXAB 1E2EA 1LFDB 4LHXA 1ZU5A 1E1RA 2J06A 3DM5A 2DFKB 2DVJA 3KQHA 4EKDA 2RKOA 3K0FB 1F6BA 4C0AC 1H92A 3GEEA 5KNDA 3FVQA 1W1FA 1Q1EA 1E2KA 4L8GA 2C9YA 1OKKA 1JQQA 4HUQB 3WMEA 2VP5A 2XSZA 4TYQA 3RS3A 1CTQA 2LWIA 3TK1A 3SQXA 4RD1A 4XTRA 5C2JB 2XTMA 3M0RA 2A9KA 3GJ4A 3CIOA 3KQKA 3NEJA 2D0NA 5FUXA 3U7EB 3P20A 3SU8A 1R8SA 1QVAA 4DIEA 5FTLA 2GJ9A 2I1QA 3GLHA 4C0QC 2FZLA 1AIPA 3TRFA 2IYXA 1R7RA 4IXNA 2DLPA 4C3ZA 2OFXA 4J9CA 1NMXA 3KKOA 3Q5DA 2G6BA 1U8AA 4Z54A 1GTVA 2KRSA 1E0SA 2DWOA 1MO5A 3J81k 1SSHA 3EZFA 1UECA 2ZAOA 1JECA 3NEYA 1O3YA 4JSYA 2QEQA 4EFLA 2HUPA 1XBTA 1Z0DA 5EC7A 2PJRA 3KKPA 2W0ZA 2AKLA 3UKDA 3IEVA 1QKWA 3LVQE 4LJ7A 4LHYA 1NMZA 4MGKR 2VSFA 3UA6A 1BIFA 2HV8A 3O8CA 2F1IA 4B3XA 1PVOA 5DNYB 4GP7A 4B3DA 2KE9A 4ZI3A 1I4LD 1Z5ZA 4WZBE 4M9QA 2GRJA 2H8KA 3BRWD 3QG5A 1E9FA 1Z28A 1G4UR 2REXB 3EZ6A 3QPWA 4R2IA 2ODNA 2QAGA 4C30A 4NYIQ 3P4YA 4LYFA 4LJ6A 3QEOA 5G3YA 4HAVA 4KODA 3SJCA 3BE4A 1IY0A 2BDTA 3V00A 1V43A 1GKYA 2QTHA 2F9MA 1G64A 2KROA 4QNMA 4TL6A 1KNXA 1NN0A 4NL4H 4F7WA 1XTIA 2J0UB 1WMSA 2EFDB 4RUGA 2CUDA 2FE4A 2CK3A 3GLGB 1KDPA 4IDPA 4M1TA 3M0UA 4A36A 2ZRPA 5M04A 3DZDA 5EQTA 8OHMA 1UTIA 1Z8FA 1KK2A 5DI9A 1ZBJA 3I62A 2YT6A 3VFDA 3PQCA 4A0HA 4W9MC 3VQTA 1E0JA 1X8JA 2QN6A 3F0TA 3GJ0A 4GI7A 1ZRHA 2UZ3A 1N25A 2R9VA 4JBYA 3RRNA 4L16A 4MRPA 3SJZA 4E09A 1KYIA 3AVYA 1JPJA 4L9SA 2HSPA 1EFUA 1PLJA 3EHRA 3VX3A 1U9IC 4DDUA 4WZ6A 1NYGA 1HJDA 4EUNA 5HE8A 3ZYCA 1U2RA 4Y0VA 1D2MA 1C1YA 1TQ2A 3X1DA 2OG2A 3EG5A 5FPSA 4CEIA 5JRZA 2ZITA 4B32A 3OEHD 1EFHA 1OHHD 2DM1A 1IQPA 2VRWA 3M1IA 3FMIA 3CO5A 2GCOA 4GDFA 1AS3A 1E9BA 2NPIA 1IN7A 5FOVA 1KI8A 4D2IA 4L9WA 2W6ID 2AZVA 1W49A 1E0KA 1V5WA 1UBFA 2UKDA 2BVNA 3AF1A 4LSGA 3Q7QA 5DO9A 1BH2A 3NH9A 4G3XA 4XTCS 2DCUA 2PT7A 1ZCAA 4Q66C 1N6HA 3H0KA 3KKMA 1RFLA 4CZ2A 1AGPA 1P6XA 1H8ED 2GJ8A 3CPJB 3CRQA 2JLRA 3DVLA 4BFTA 1ZSGA 4LOAA 5LD2C 4C2UA 4EQ6B 3SS8A 1G5PA 1OB2A 1OF1A 4Q02A 3MLEA 3G5UA 3FHTA 3Q5EA 2BM1A 1NIJA 5K8IA 3UWOA 2VQSA 1Z6XA 4B76A 4P4UA 4C0HA 3JV3A 2O8DA 4QM7A 4URVR 4D4MA 4AKGA 2SEMA 4OMLA 2V1UA 2FX3A 2LZ6B 2YUQA 1QWFA 1AA9A 2G83A 2OO7A 2QTVB 2V6IA 3U6KA 1H65A 5FTKA 2CXXA 4JJBA 1OFUX 3AGQA 4E5UA 3RHFA 4FWIB 4Z88A 1HT1E 5FI1B 4A6PA 2LQNA 2RHMA 3OIVA 4ESHA 1DTSA 4ZIRB 3THXA 2GETA 3RDPA 2GXUA 2QZ4A 4LWZA 3QF4B 2ZQ5A 1Z0KA 4M1YA 2J0VA 5JJIA 3CRW1 2A3RA 2WICA 3ND9A 1S1MA 4OBEA 1W5TA 5CB6A 3K0AA 2F9LA 2QI9C 5D3QA 1UJ2A 1YZTA 4QGFA 4FXPA 1OFTA 2GBLA 2PLRA 3NBXX 2PH1A 1MRNA 3K0EA 4K46A 2H17A 4Q4AB 1U3OA 5KU1A 3M4YA 2VP4A 4XH9B 4HAUA 4HSEA 4HLQB 4LYJA 2GJSA 4ARZB 1U8ZA 3CPHA 1OPXA 2VHCA 4TT3D 1XMIA 2FMXA 3K70D 1R0YA 4J9EA 5IK2A 1YR6A 5CK5A 4W7SA 4AIIA 4TLCA 4AD8A 4KI0A 1AOJA 1ZP6A 1I0CA 5IHKA 1XCGB 1N6NA 2JJ8A 5I11A 4I1UA 4BUJA 4C7OA 2IK8A 3TUZC 4MDFA 2HLDD 3NHBA 1NVUQ 1XOVA 3H0HA 1W36B 3EZ9A 1OIXA 1U0LA 3C5CA 1IN5A 1NVVR 2FU5C 3LQQA 2GXAA 4YLGA 4RKEA 1CJVC 2EFEB 2ZPTX 1TG0A 3CH4B 4PC7A 5FWBA 4OMOA 2RGDA 2XNDA 2VA8A 3HR7A 4NCNA 5HCKA 2CUBA 1L8QA 5DH9A 2HJGA 2FSIA 2FH5B 3Q3JB 4GBMA 3KFXA 3KUCA 2XZOA 1Z06A 1GCPA 2H57A 4OQFA 4NHOA 1U90A 3MD0A 4JLNA 2HDAA 4YMUA 3HU2A 2A08A 2ZRIA 3KKQA 1X27A 2E9SA 5JFGA 2YWEA 1E2QA 1FUUA 1X69A 1M8PA 2JGNA 3OAAD 3QQ5A 3TR5A 4U7DA 4LUEA 3G0HA 3OFNA 1G7RA 2CREA 1VTKA 4KU4A 4TQ9A 4KJZA 2A5YB 4RTWA 3SI7A 2W00A 1NMYA 1PUIA 4JLKA 1JAIA 2BZXA 4ZKDA 3PXGA 4YC7A 2FG0A 2JJ2A 2EQBA 4OK6A 2ROLA 1CR0A 2QORA 1DG1G 4MKHA 5FOUA 4LY6A 2GTJA 3W6NA 1T5LA 4B3CA 3KXIA 3OE7D 4DDVA 4GZMA 4NZYA 1S3SA 4LBYA 5JCPA 3ASYA 5A0FA 1N6PA 1XMSA 2QGNA 1WXTA 2R62A 4KLZA 4XJXA 1JALA 3CQTA 3LBIA 4QRHA 1Q12A 2C77A 2KT8A 2QP9X 2Z4SA 5GJWB 2JAQA 3LXXA 4IW3B 2NIPA 5JWRA 3IUYA 3B1YA 3C7KA 2ZSDA 2KXDA 2KI5A 1NLPC 1AQUA 4FMCB 4IOJA 4Q18A 5EXSA 3TSOA 4X8HA 1X43A 2FSGA 1HUQA 2WSSD 4M1WA 3NKVA 4IDNA 2PZGA 1KSHA 2SRCA 2QMEA 3TGPA 1CKEA 2CJWA 5G40A 4TQUS 1N0UA 3C14C 2V55B 2YYZA 3RS2A 1EWRA 2D74A 2CNWD 3PVSA 4BASA 2IXFA 3GLGA 2VPPA 2W2XA 1OH5A 3IKJA 3BORA 5AUQA 4J9DA 2MSCB 2QNRA 4PPGA 5BQ5A 2AXPA 1K6MA 2H1LA 2JJ1D 3ZD7A 3RS5A 1KSJA 1KI7A 1YR7A 2XITA 1PJRA 2XOKD 3L8YA 3MMPA 4MGYR 4H9GA 1EFNA 2MCNA 4XOIA 5IH2A 1G18A 4DLUA 3R20A 3UG6A 2WWWA 3SEMA 2O88A 2KBEA 4LJ4A 2ZREA 2PTKA 2VO1A 3QVUA 5JJKA 3TH5A 5KO2A 1RLQC 1GP2A 1BU1A 2NG1A 4Q1BA 3LDAA 5EXTA 3FMFA 1KTVA 3RYTC 4DIDA 3NG1A 3THYA 1D5CA 2QM7A 4Z1MA 3WNDA 1AS2A 2QU8A 4JJKA 3NDBB 5TXGA 3KUDA 3WYAA 4A2WA 1H3HA 1P4SA 4US2R 3GP8A 4KSCA 2EW1A 3LX8A 4JL6A 1LF5A 4DLTA 3HU1A 3U7HB 4YMVA 2GF0A 3U5ZB 2WMNB 3PJRA 1VPLA 2QE7A 2Q3HA 3TNFA 2H5EA 2FN4A 1SEMA 3LLUA 1SXJD 4EPYA 1CULC 2D7DA 1TF5A 5JZVA 3UMSA 1NBMD 2IYQA 2NQ2C 4O3MA 3P32A 4PXAA 4JZ4A 5JLJA 3U3MA 4DVGA 4N3NA 1AWJA 4LI0A 4QC2A 5IDVA 2IYVA 3O8RA 4ESVA 3MUFA 2OE2A 4NYMQ 3PUYA 4A2QA 1FUKA 2ZSBA 2AFIE 3W8NA 4KCGA 1GRNA 1GG2A 3K0FA 1OB5A 3AVXA 2X19A 2F3TA 1NNEA 2C98A 4XVRA 2IT1A 1CJMA 2ZI7A 4B44A 1ZM3A 2ZE5A 1WX6A 2L0AA 3CNOA 3OIWA 2ZRGA 4JLDA 3MWYW 4HI0E 4PO9A 2NO7A 1X6VA 4EIKA 4WOPA 4DDWA 2ERYA 3DKVA 3MG9A 3SQWA 1FQKA 2OEPA 1BB9A 4CGZA 2RN8A 2EVRA 2F1RA 1GITA 2ERXA 3I32A 2OZEA 4A8JA 4BFYA 1ZUNB 4YXWA 4XVUA 2JCSA 4RVCA 1SKQA 3GJ6A 1QBKC 2H16A 5JRJA 1IHUA 1DAHA 2O0KA 3A98A 2WWHA 3EPHA 1SHGA 3TVDA 1K4US 4TSFA 1HT2E 3FE2A 4G5OA 3A1TA 4S35A 2RGCA 2LCSA 3M6AA 1KJZA 1CR4A 2NTYC 2Q3MA 2ZU0C 1JNYA 5KDOA 3HP1A 4CEHB 1L7VC 4DSUA 1MOZA 1DBSA 4AI6A 1P5ZB 1XB2A 3AVUA 2EFCB 2JLYA 2O2OA 5CJPA 3LRPA 1CKAA 3VS1A 4DEYA 1GFDA 2JT4A 1XD2A 2G0TA 2JIZA 3K0AB 3QF4A 2Q9AA 2V4ZA 5G53C 2Q21A 2J1LA 3PEVA 5TB5A 2LP5A 3TR0A 5EE9A 4TMKA 1YCSB 4JL5A 2FFHA 3SFVA 1HE1C 2DY1A 1EFRD 5CJ2A 3TIFA 1Y3AA 4PZLA 4JLJA 1OIWA 5TDHA 4HVWA 1RRPA 2QSYA 2AWOA 2AL7A 2BKEA 1FPMA 1G20E 4HAYA 3VMFA 2N1BA 2G3YA 1WA7A 2GEVA 4HZUB 1OXTA 1SXJE 5D3MA 4ZDWA 2WVJA 4PX9A 1P75A 2ONKA 1U0HC 2ZE7A 1NVWQ 1WI7A 2C99A 2YINC 4C0SA 4OQLA 2ZANA 1F5NA 1NN5A 3BXZA 3MCAA 1EX7A 2F2WA 4B6FA 5EXPA 4TMWA 3SE0A 3VU9A 1RKBA 1XEWX 1SXJA 2PBRA 5DE3A 3QXXA 2GVZC 4J9FA 1KZGB 4LN2A 1Z6YA 1Q21A 2QG6A 4CT4B 1W7AA 2HXYA 3BFXA 2TMKA 2VHUA 3K0CA 5L23A 3SDZA 1RZ3A 3HR8A 1RLPC 2FRWA 3PVLA 1JEEA 2WKRA 1GILA 1UKZA 2G0NA 1ZCBA 2LKCA 2YOHA 3CR7A 4BLTA 2C96A 4TLAA 4I1SA 1II8B 1NKSA 2RCNA 1GNQA 2OBMA 2B6HA 2IWRA 3IO3A 1T0JB 1G291 3LBNA 4G01B 5B58C 2KSQA 5J4YA 4IOLA 2IIMA 1CSKA 3MWJA 4OI2A 2BEJA 3DKPA 3U44B 1YJ5A 4A9AA 1H8EA 1U81A 1G7CA 4AYWA 5L8VA 1UFQA 2YUOA 3LFUA 4TLEA 3EZ2A 2J0SA 3CKLA 2FGKA 2A5DA 5KNBA 2QM8A 1Z0FA 2R65A 4KRTA 4JVSB 5FL7D 4NBSA 1E2MA 1XMJA 2IHBA 2A2ZA 2P67A 3GLIE 3DM9B 4HDQB 5HKKA 4K8OA 2G9NA 4BWYA 4LJYA 4TLDA 4UNRA 5DYIA 2GILA 4QNRA 3PVQA 1NP6A 4G5SA 2R6CA 2EWVA 2FPLA 1P2TA 2WIBA 2X2EA 4QBIA 2P3SA 3RRZA 5JHGB 1OYYA 1X1RA 3EA5A 3W5JA 4JYBA 3PEWA 2SHKA 1UADA 2F7SA 5FUWA 3AQ4A 3A6PC 2C78A 4C0KA 2GZHA 2DILA 1PRMC 2BMEA 5DGXA 4NE2A 4B33A 4Q00A 4DSNA 1XD9A 4Y0AA 2GCNA 3GEHA 3UG7A 3QNUA 4WCIA 2BEKA 4AC9A 1R8QA 1E9CA 2WWIA 4BFUA 1HYQA 1YHNA 2IYLD 1Z6GA 2X8AA 4Q7MB 1S96A 3QIAA 4YXWD 1ZUYA 4ZNXA 2RMKA 4HB4A 3QKSA 1P2UA 4M1MA 2AKAB 5JEDA 2BBTA 1WXQA 2C95A 2AX4A 4UXIA 5KDLA 3TMKA 2DF6A 1E79A 1T3LA 1I2MA 2C9OA 4IDOA 3T15A 5C4MA 5K8LA 1R5NA 3H2YA 5DHFA 3RWOA 3VX4A 2C0TA 4F16A 2IXGA 4LC1A 5CIQA 1MABB 4AKEA 2PMKA 5F2EA 1E6CA 4DZZA 4F93B 4URXR 2LKDA 2MSEB 3IQXA 2GEDA 3OEHA 1DAMA 3QUSA 4ON9A 4UJ3A 4DSTA 5KSYA 5E95A 3GLFA 2N46A 4DUGD 1KHTA 3PFIA 5AJVB 1H8HA 1NN1A 3EGUA 1E1QA 1Z2CA 5BN4A 2DWPA 2QT0A 1T4GA 2ZJ8A 2X3WD 5ANRB 5B57C 1G3UA 4KFSA 3LQRA 3D8BA 1A0NB 1YKSA 3QBVA 4L4UA 4AG1C 2BTTA 1GCQA 4LJ5A 4KVAA 1KI1A 3V9PA 3RRYA 3OAAA 4Q7JB 4XD7D 5GVRA 4TMZA 3U23A 3SBEA 4B34A 1IBRA 1KGDA 4FN5A 3ZDQA 2EGCA 1DE0A 2DFNA 1K0SA 2YOFA 4LC0A 1IAQA 1R4AA 1ZD9A 1TU4A 1NSTA 2D8HA 2FZ4A 3ICEA 4V0LA 4EIWA 5GJVC 3S1AB 2QT1A 5H70A 3TQCA 1UEJA 1ESMA 4D0GA 2V3CC 3UMRA 4LNPA 1YZGA 2F55A 1Z3IX 1XZQA 3DOEA 3AP1A 5A5GA 2FJUA 4V0KA 1RI9A 2JM9A 1TAGA 2MSDB 1K0XA 4JJDA 3NC1C 4Z89A 1YRAA 4OHZA 1JR6A 1ZM9A 2WSMA 3PEUA 1OJLA 3W9YA 1A1VA 4LBWA 2BMDA 4KSBA 1ODFA 4IHQA 5FOWA 2CE2X 1M7BA 3WRYC 4B2PA 3QF7A 4K81B 4QHSA 2KRNA 4X8LA 2BIFA 4MQBA 1QRAA 1UHFA 2QENA 1Q1ZA 4LV8B 4I1OA 5EZ6B 1YE8A 2QE7D 3JZAA 2LNHB 1QZXA 1VIAA 2X1VA 4RZUA 4O2LA 4C7OB 1CJTC 1MT0A 3DL0A 1CXZA 4QBGB 3V4RA 5B64A 5F9FA 4PPFA 3REFA 1OOTA 1ZINA 1ZMXA 4F4CA 2I0NA 3PG5A 5L3SB 1UHCA 1DPFA 2ZJZA 1HEIA 3VS5A 1E2NA 1RRGA 1QVRA 1MO3A 2DFTA 2IX3A 3P27A 1KO4A 2ZI4A 1PZNA 5CITA 1UBGA 5LBIA 1RIFA 1WDXA 3QWXX 1G4AE 2DE0X 2HCKA 2GNOA 3I61A 4PC6A 3CZQA 4DHEA 3KJEA 1PKTA 2VP9A 4EPXA 1QF9A 1T0HB 2ODBA 3W34A 3PCRB 3ADBA 2CL6X 1RE0A 1ZUIA 3QPVA 1VDZA 4QHTA 1E2LA 3RS7A 4C2TA 1NYFA 3IBYA 3SOPA 5FBVB 5J4LA 5AWFC 3Q85A 3U4QA 3TAHA 2QAGC 3FGNA 4J9HA 2WZQA 1DG3A 2EYZA 1Q3HA 3CX7A 4Q4LA 2IHYA 4Q1FA 4JVMA 2OUKA 4FCVA 3U60B 1NEBA 4CC7A 2D06A 2PZFA 1JAHA 1MV5A 2VLIA 4OQNA 1AEYA 3I8XA 1GKUB 1R10A 1QDEA 1T9HA 3VR5A 1XJCA 3MGCA 1X1SA 4HVUA 3U7FB 2CCGA 5CK4A 2V9PA 3VR2A 3N70A 1DS6A 2ANCA 2HYDA 1AQYA 4TZ6A 2PX3A 3B9QA 1AZGB 1VIYA 2EYXA 1LNZA 1QG2A 2FPEA 1AJEA 2W6IA 5CIWA 3U3RA 5JBQA 4JT4A 2VWFA 3CONA 1E6HA 1K1ZA 1F2UB 3ADKA 2GXSA 2OAP1 3FB4A 3ZLJA 4HAZA 2NOAA 2RQRA 4OHVA 1GAJA 3K9HA 5C46F 3B1WA 2RGGA 3TAUA 4QOSA 1E69A 1Q57A 2JDIA 2CSIA 1ZNWA 2BBWA 1W70A 3B7GA 3L0IB 1KMHB 1XJ0A 4FMCF 5FI0B 4AFQC 4MKGA 1YR8A 4RZXA 1X6BA 3C0CA 1IY1A 2IBMA 3CB4A 3GJ8A 1BS1A 1JJ7A 3OIUA 4X8MA 2FRYA 3KQLA 2XEXA 2F2VA 4CEIB 1ZLMA 1A5TA 3QENA 2PCLA 2RGAA 4BE7B 2V7QD 2JM8A 4P31A 4JZ3A 1G3QA 3PUXA 4W5WA 2FG5A 2IYUA 3R6NA 1DADA 4OI4A 3UXMA 2QY9A 5LPNA 3GLFE 3I8SA 2XAUA 1R6BX 3P1JA 4LV5B 4AG2C 1EK0A 1KK1A 5SZHB 3I35A 1JR3A 1E2PA 4JT2A 3TLXA 4BQSA 2E5KA 4A0GA 1AS0A 1XPRA 5KNCA 3T1OA 4JVLA 3ZZ0A 2YNMA 2K2MA 3PE0A 3KQNA 1G1MA 1F3OA 4OMQA 1TUDA 421PA 2IUUA 2DX1A 2LJ1A 2GZDA 3QJYA 3U3JA 1CR2A 2ZTSA 1IO6A 3GLHB 2JTEA 2QTFA 2BV3A 2WOJA 4M4ZA 5AR1A 4B2LA 2DL3A 1E4YA 2YWGA 2IW3A 3TSWA 4LRWA 2WPDD 4W5HA 1LF0A 4TTQA 4MKFA 3L0OA 4M9ZA 2D8JA 1B07A 1NIPA 4Q1DA 1KI3A 2B92A 2CDTA 4WZAE 4ORZA 4DLRA 4KLNA 4PSAA 5H8WA 3EWSA 2BC9A 4EPTA 4CEJA 5TV2A 2A36A 1YWPA 1IN6A 2FNAA 4GOXA 3P4XA 5FBLB 2BHRA 4IIMA 4OHXA 4BFWA 3L2OB 1GFCA 3TW4A 4ZDKA 1A2BA 1GUAA 3PV0A 5E7IA 1VCOA 3RAPR 1D2NA 1UJYA 1ZM7A 2K79A 2DJQA 4A6XA 2YC2C 2FEIA 1GCQC 3IHWA 1M74A 4ASUA 4UNSA 4BZXA 3THKA 4QGHA 3IIJA 4PANA 2QAGB 1RRCA 2O0JA 3DDCA 2V8OA 4TTRA 5A4JA 4PHGA 1UE9A 1IN4A 1DO2A 1W0JD 1OH7A 4B48A 3M0TA 1JBKA 4LGMA 2WJVA 4ASUD 1YWOA 5FBWB 2J87A 2RPNA 4D8KA 1KMQA 2IXEA 2R6DA 2EYYA 2W58A 3RC3A 1VG1A 4BFXA 4F92B 2WJHA 1M3BA 2ABLA 1FL9A 1WE2A 1XTRA 3X1WA 1GRQA 5BYJA 2OJ2A 1G3RA 2BMJA 2GK7A 2WKQA 2IS4A 3TW8B 4CIDA 3C41J 3S1AA 2DA9A 2ZEJA 2MIOA 2D62A 3EX7C 2O8EB 3FPAA 1M3AA 1M7GA 2OLKA 5FW9A 1T8TA 4Q19A 2NMVA 1ZX6A 1XD2B 4HXJA 3QKRB 3N2IA 3WYFA 1G3IA 4ZV4A 2O8EA 1P3JA 2ZYWX 4LE9A 3E1SA 3LAWA 2ZUBA 4RD6A 5TVKA 1Q1BA 3WXMA 2Q6TA 3GJ7A 1T8UA 1MKYA 3EASA 1KAOA 4LHVA 4BEBA 1SHFA 2QPOA 5HZKA 1KY3A 1MR3F 2FWRA 1X2KA 1HTWA 1E79D 4XIGS 2OHFA 3AF3A 4U02A 4OHWA 2QROA 3H84A 4NCIA 3X1YA 3GJXC 4I99A 4JLOA 1E9EA 1N6KA 1FX0A 3K70B 2CH4W 2IYRA 2JW4A 2C03A 5BN3A 5IHNA 2BZ8A 4Q9KA 4WW0A 2XXAA 1W6XA 1FNNA 1TF2A 4Q47A 3FKQA 1TQ6A 4TL8A 3FKSD 3LW7A 4J0QA 4IXMA 1TMKA 2ZJ2A 2BBOA 2OCYC 4JMPA 3SJBA 4DCVA 5P21A 5AUNB 1PHTA 2PMDA 4UXHA 2JLXA 1P9WA 1KO1A 3UMFA 1G17A 3QBTA 4HLUA 3RABA 1OHHA 3GLHE 3A4LA 1G6HA 2P65A 2JS0A 3L0SA 2IC5A 3CRRA 2XZLA 3W8RA 2GGRA 1PLLA 3GBQA 1LS1A 3IQWA 4KFTA 2CBZA 1Q20A 4US0R 4OJQA 3GFTA 3A1WA 1WRBA 4D6PA 3VS7A 2FF7A 1E2HA 4HATA 2ZE6A 3U2QA 3H41A 4NONA 2Z83A 1UKYA 4WXPA 1Z07A 4B35A 4PZYA 3FJ5A 4MH0R 3SC3A 4Q4JB 5HPYB 4HB0A 3RC8A 3GFPA 2NZ8A 3HWSA 1QHNA 3ULRB 2ASEA 4NMMA 2FSFA 1OFHA 4PC1A 4S2EA 1U06A 1FFHA 2H7VA 3NIBA 3M0SA 3UA7A 2JDID 3BBPA 1WF3A 3BK7A 1UEIA 2G88A 3OIYA
chains in the Genus database with same CATH superfamily
3OYDA 4X45A 5IN4A 2AYZA 4GOJA 3VUEA 4JC5A 4Q9LA 1IYZA 5JNTA 4OXQA 2VP3A 2D2XA 4RE5A 1YR9A 2Z9CA 1FZQA 4QYSA 4JEHA 3JD4A 1MOPA 1K9MR 2AD5A 2IE0A 4VUBA 3BFVA 3PQ8A 2IBTA 2DKGA 1GRVA 4UU8A 5CLHA 1FQJA 3VVBA 4KWCA 4AURA 3MEQA 2GPBA 1JH8A 1J1ZA 2P6NA 1UXJA 2GDJA 5FYDA 4J9GA 4DADA 2GEUA 5KYTA 4QYIB 3VVCA 3U7GA 3V7YA 2QAZA 3WMWA 5SZIA 1FYFA 2J0UA 4YJHB 2N42A 1DV2A 3GGGA 4F1WA 1DCFA 1KI4A 4KIWA 2J3MA 2LXNA 1DKLA 3F70A 1BEEA 3OYFA 1JYSA 3S28A 5DBEX 1ZSYA 1I36A 2QXTA 3I01A 5AW0A 5HKLA 3TKYA 3TFOA 3WB1A 5ESRA 2PLWA 3N76A 4BYGA 3BE8A 2RJEA 1UDLA 4JLWA 3ZGXA 4BL5A 1DXQA 2C0PA 3H8SA 1WBDA 3WBJA 4C8QD 3WP0A 3ENWA 2BGIA 3GGCA 2YV5A 4U2DA 2L2PA 4O6JA 4D4LA 4AU1A 3HI6A 4NS1A 3HG7A 1ZVQA 3E48A 1QSGA 4LQDA 4CLRB 4RK7A 2OBYA 3T0GA 1RI3A 3EEYA 4WASA 1ESEA 4JI0B 1FP7A 4O5VA 2RK3A 1FFAA 4FMDF 2PSFA 4HAWA 1S7CA 1TQ8A 1ZU4A 1EUCB 2KYMA 2E6ZA 3TKLA 2AFRA 2QQ5A 4P7JA 821PA 4DUYB 2K5UA 4TV8A 2LCFA 3C6YA 4EH1A 1MFZA 3TSYA 1S3FA 1VLQA 4CQMA 5E0OA 1V41E 4O4HB 1GQRA 5DBIA 4GMDA 4H7HA 1PFQA 2ZG6A 4JLPA 4Z02A 1JHOA 1N6LA 1NM7A 1CEYA 3MCTA 1WLPB 4LD6A 1N3BA 1C1HA 1QPBA 3NV9A 4V02A 3Q5GA 1R6XA 1O03A 1PI3A 1XKQA 3CWQA 4Y1RB 2XUOA 3HCNA 3ZI0A 1B1CA 4M1OA 3WZMA 1RLJA 1KH2A 4WKPA 1NXPA 2JZCA 5CVVA 3T06B 1MMFB 1XA3A 4JBIA 3NEAA 1EXNA 1WM1A 3PU6A 4OK3A 2DG2A 4ZI5A 4E14A 6ABPA 2AQHA 2O3RA 3ASZA 2WWXA 3V4FA 2A9PA 2GZAA 1DO8A 2O2ZA 4IDEA 1O08A 1MZVA 1QFJA 1PW7A 1YU6A 3GDHA 4KVGA 4TVBA 4YRTA 3WK9A 2J7PD 2IUEA 2AQ8A 5EJIA 3ANTA 3JU3A 3G2MA 3L4KA 4FCTA 5KCOA 3NKFA 2PQ2A 3C0KA 4G41A 3OS0A 5B5SA 1QDLB 3W2TA 1FDRA 5JH7B 2WHPA 2DH5A 4UOZA 4QJ4A 1DJLA 2VTVA 4YRRA 2E1HA 1WZCA 2J30A 1TTPB 2I6TA 2P35A 4IZHA 4L72A 1J5XA 2BEWA 2O5RA 4IVRA 4P58A 4H2DA 1E20A 1AB5A 3MCAB 3T35A 1SGWA 3ZR4B 3DOFA 5I48A 4MGZR 3ZNNA 3A8HB 2JI4A 2VCYA 5TF4A 1UM9B 1IVYA 1Z75A 2AWNA 2Z3VA 3W5IA 3CLTD 1SHKA 3CLVA 3AJEA 3E15A 3KWJA 4N8SA 3UPDA 1VIFA 1ZD8A 2DYKA 3PCXA 4M78G 1L4EA 4LZLA 4DXDA 1X7XA 3HDVA 4DUGA 2W0MA 4BTVA 1Y9EA 3OZEA 3T7SA 3LUHA 4PAOA 5L8RE 3WBFA 1DEHA 4XIYA 1QVVA 1BI0A 3GZTB 2ZRLA 4EHIA 1LLFA 5A4DA 2W10A 5BQFA 3OLWA 4TV8F 4CCYA 4U4AA 2ZM5A 3I3OA 1QIJA 2PGAA 1G9TA 4N3CA 1RXIA 1KS9A 4R9UC 1FTQA 4DCOA 4MMXB 5D6NA 1ZONA 3D7MA 1A2OA 3STVA 5KJCA 1UBNA 4BFUA 2P5UA 2G8NA 4FU6A 5ELLA 3N1UA 2IPOA 4KREA 2G6FX 3C4QA 4N7MA 1R3UA 4QECA 4FSSA 2Y71A 4WN9B 4OMNA 2JAPA 1V29B 1KZ1A 4FWBA 4GSYA 1E3SA 2I2DA 3F6YA 3FIUA 5LQUA 4UQLA 1T5TA 1EIFA 3H5NA 5A9TA 1IPEA 1JTVA 2ETVA 1PUXA 2H59A 1BW9B 2IYZA 4RORA 1KXJA 5HEKA 3OCUA 4D92A 1V3VA 5LQJA 4DLWA 4UOEA 5C7IO 3HY4A 4O5AA 1UJ6A 4DDMA 5KJ6A 1AHNA 1AKWA 1L6RA 4P5NA 1THMA 3DEFA 3N8DA 4R01A 4QPNA 1N36B 3OBWA 3VS4A 3IEKA 3L7KA 1SVKA 1CDZA 1M2FA 4I1VA 3CX3A 1FQOA 2ECPA 5FPYA 4ZCPA 1KK7A 2J5XA 3IUSA 3A4MA 4BV3A 2E5FA 2ZUCA 3EPKA 1ZVKA 4Q3DA 2QRVA 4RA6A 1A8QA 5EZ5A 4XTWA 4DB4A 1W36C 3FB9A 2OTJT 5ALUA 2YHIB 5DNDA 4CR8A 2MOXA 5K5EA 1N9KA 4G8JA 1PR3A 2IEIA 2XWSA 4QUKA 1UKVY 1YS9A 2CE7A 3KHUA 4LWPA 3SCZA 2BH2A 2RHDA 1BJRE 3E9DA 3TXYA 3D1JA 2WKWA 4P38A 1R12A 2H5JA 3KZVA 3Q6MA 2ZRFA 5AHWA 3WWPA 4CYMA 1TVEA 4BRUA 4LDQA 4ZN6A 5KX5A 5CLJA 4B6PA 1ZC4A 3EFOA 1PD0A 3TLGB 3PYXA 4C8QC 4MRMB 1A27A 2FUG1 3TB6A 1GKIA 1QWEA 1C5KA 1PFGA 3KP1A 1HNZB 4ED9A 1PJBA 1TAQA 4P4SB 4YROA 3ICOA 4IGFA 4LX8A 5DGCA 3OMCA 4D8DA 1R8XA 4RS4A 2J45A 1BO6A 4BU0A 1SBIA 2XMFA 1CZLA 1DQRA 3MJHA 3R0XA 3SHVA 1NNSA 1PTKA 1SRMA 2BJHA 4DR3B 5GAN7 2QK0A 3LF2A 1NVTA 3U7IA 1PWYE 2XGOA 3KB2A 4MWOA 2ZUTA 3RO7A 2W6NA 1TDJA 1JB0E 2HPVA 1IAVA 2IEYA 3EC2A 1RAFA 3IDQA 1P18A 1JAXA 1OT5A 2HSGA 2QLLA 3KTOA 3NONA 1CUFA 2PO7A 5F12A 2FPPA 1X1CA 2FW0A 1T24A 4G5RA 2BEUA 4WBNA 1HSQA 2ZCVA 5JI3E 3FPLA 3FTQA 5BVGA 3ETGA 5TT1A 2WIAA 1B6TA 1HT0A 2DUJA 4I3FA 4EZBA 4EVRA 1ISMA 3MQ4A 4ZO7A 3V1LA 2XTZA 4HWSA 4DN6A 1H4QA 2AN9A 2O2SA 4YT8A 3TU4K 1W0JA 5JWOA 4C0FA 4QT0A 1KDOA 4Y7DA 3KFVA 2P62A 1NRXA 1QCYA 1U2GA 4ATOA 3K73O 3OCWA 1C50A 2ZPAA 5G1OA 4E5DA 1Y96B 2XKAA 1X1QA 2GHIA 2HK7A 3UATA 5TQ0B 1AKRA 3QLVA 5IBPA 2Z1MA 5KQSA 2P69A 3HWWA 3IQEA 4EO9A 4OB7A 2YYSA 1UUEA 3BB3A 1RAFB 3PI7A 4TUYF 1G3YA 4C92B 5CB4F 1AUQA 1QHYA 4Q3NA 5B55A 4PWYA 3K6SA 2ZI5A 2VDLB 1SSFA 3GCXA 3PMIA 3CCVT 3EVZA 3WSVA 3DE7X 5EVJA 1LX6A 2VRBA 4HNSA 4PSUA 4LTMA 1OWMA 4NK5A 4IKPA 4JH0A 1PNRA 2XADA 2YDXA 2YQ4A 1K8ZB 1LNQA 3I6BA 2C7PA 2EWNA 4GP9A 4KQIA 2IYSA 1N6RA 2DPHA 1ZA1A 4L3WA 1W2HA 3IAEA 4G24A 4BGDA 1XPJA 3EIHA 1HNNA 1CUSA 2XOEA 3JCZA 1IONA 4IIJF 2CJWB 2YUIA 4R7GA 5FPKA 1AK2A 2AJDA 1JXAA 4MGHA 4WEQA 4BBPA 4M89A 4CF5A 6NULA 2ONZA 1U8YA 1GO2A 1ONOA 1P4AA 3HXLA 3CCRT 1E96A 4FZJA 4M78E 4MS3B 4TSKA 3ECCA 3ZE2B 2BF4A 5KYXA 4AG3A 1U99A 2P77A 2ZYHA 4IUCS 5AOAA 5G4LA 2X7HA 4ACBA 2EFJA 2XF2A 5AESA 2DB3A 1KHIA 1G55A 3JQFC 2P4RA 3LGLA 3NTHA 3VS0A 1WCV1 3C1OA 3P9KA 3HJTA 1AUOA 5ADVA 1UBOS 3E19A 4PK4A 1JEQB 2CDNA 5BMVA 1PUJA 2WAYA 4D42A 3AQIA 2IKSA 4M75B 1NEGA 2CDRA 4H17A 1NPRA 2JIQA 3FFWA 4BQIA 4TYNA 1IQ0A 4IICA 1WMBA 2ZIAA 4EZIA 1TQDA 5FOSA 2VK4A 5E3JA 3FTNA 3ZVNA 2C0OA 4RF4A 3TRIA 2JLVA 4FSXA 2DERA 3DL7A 3L8HA 3I09A 1DUVG 1MAVA 5ELXA 3OSZA 2B9VA 4V1CB 4NH4A 1GU1A 4P4TA 1M5RA 4K3VA 2OGUA 2I7XA 1J97A 1ONNA 4PQYA 5NLLA 4M21A 3TGLA 3PPXA 5B1HA 3IAHA 3SQMA 2B1QA 3VO1A 3EC7A 1D1PA 1Y4SA 2QQ9A 2CHQA 2P4HX 2B5VA 3RMQA 1ZGHA 2I8AA 2NYUA 3INGA 3PVZA 4IO0A 5E7MA 1E4OA 1KIMA 2R8ZA 1GZDA 3U5TA 3L2QA 2Q0XA 3BFJA 2X4IA 3DOCA 1G2BA 2C58A 3WLKX 3JQAD 4PPNA 1M0TA 2VBCA 3HFNA 3RARA 2GFQA 4NPHA 4TN5A 1DP4A 2FDRA 4MVYA 4Z8AA 4FEGA 2PTHA 1DT5A 3UHPA 3MEWA 3UF4A 5IFKA 5EKDA 2WJ6A 1FFYA 2CP7A 1K08A 5FUVA 4Q7LA 4UM9B 3VPDA 1O7JA 4W7HA 4KAXA 1M30A 4JT9A 1JS1X 4X1IA 3T9CA 8ATCB 4Z51A 1I9CA 4RGQA 3M1AA 3OE5A 1P74A 4YJDA 1PWXA 3FOZA 3SJAA 3S70A 2EQIA 4Z1OA 3A0UA 3ENNA 1P60A 3LCMA 1RW4A 2GAAA 2QUHA 1RACB 4IKEA 4XWAA 3M0PA 2PSDA 1HRDA 2Q27A 2WAXA 2QSZA 4EOGA 1WLSA 1P72A 3IT1A 1JF8A 3REAB 4MR7A 3ZWNA 4FGUA 4RA9B 5B7NA 2OSVA 1HQCA 1T3HA 3CH5A 1SCQA 2ZOSA 2JASA 3HADA 4R1NA 4YJ2B 4ALJA 3MT8A 4OK5A 1US8B 5HBRA 1F1BA 7ABPA 4U5QA 1ZH0A 3EXEB 4IL5A 1N5LA 1E7OA 3OH8A 4PFQA 4UCXA 3U3JA 1OAKA 3A9RA 4W7IA 5BO5A 3VC3A 1F1JA 1MGQA 3U56A 1DOZA 3JAWB 4P54A 4G65A 3CUEF 3JD0A 2WSSA 1RAHB 3ASVA 3WGLA 1ZNXA 1RHMA 3LY9A 2C3YA 5M34A 4NICA 1T4DA 1PF7E 1XR3A 1Y8CA 3AVPA 4QGSA 4GX0A 5B3LA 1K66A 5IEJA 1SR8A 1JR4A 3AF4A 1MC8A 3KAQA 2HSJA 2ZWVA 4X8OA 4AN1A 1ZGJA 2GRAA 2JFBA 2QZJA 3RYIB 4KUIA 1BTOA 5CFMA 5KQLA 4X1KB 1XN4A 5F4ZA 4ENTA 1ZXLA 1G5TA 1WXDA 2J5BA 3NR2A 1W73A 4FOLA 2ZETA 2IYWA 2POQX 1WBJB 4S1TA 5F1PA 3ZK7A 3RVBA 3LWDA 3VS3A 4KZKA 3VV3A 4TM8A 4PZAA 3E23A 4BP9A 3EXHC 3LQYA 4E03A 3F6SA 1KJWA 1N6AA 1EH5A 1TE2A 1OAOA 1SVMA 1NF8A 3OQHA 1UMCB 3MUOA 4QAJA 1OC4A 1J9EA 1GG9A 3N2EA 4GMHA 1Z15A 4I9NA 4QGBA 2ADFA 5DHRA 2HJWA 3RLFA 4JYCA 4WJZA 1PDWA 4PG4A 5DX0A 2O8DB 5HJ5A 1BE8A 3SKYA 1E8MA 1DWPA 2PJUA 4S1NA 3OM8A 4INJA 4YONB 4JP8A 4HQ6A 1UJ0A 4WLEA 1YZLA 4TWZA 4X41A 2BFEB 3X1ZA 3NTOA 2EKLA 2D5LA 3KLNA 3D0OA 4XSVA 2WWYA 3K92A 4MRNA 2GJAA 2QW1A 3ZBDA 1ZNYA 3TLGA 2ZBVA 1GA4A 5JCZA 2ECOA 2ECQA 1YB4A 1CS0A 3AB3A 3IEUA 1Z5GA 5D3MB 1LI5A 1L8OA 3LBHA 2YFQA 3A7DA 3SGLA 3WNZA 4K1XA 1DAOA 1QHHA 4C0DC 1V71A 3EGCA 1N8SA 3IOBA 4AULA 5KWVA 5JH7A 2OB2A 1PL0A 4IJUA 1I13A 3D7NA 3OC6A 2OXTA 1F2VA 1ZM4A 1WHLA 2I6GA 4AMZA 4BKPA 4LDYA 4NZZA 4Y1FA 2I6UA 4C87A 1RI1A 2RHIA 1KTIA 5FADA 2O8CA 1VQ6Q 3ZNOA 3VUZA 3JCMQ 2Q1UA 1BEZA 2QXUA 3JWJA 2MMCA 2RH5A 4JC4A 1IHDA 2ZB8A 4IOMA 3VR6D 1NF3A 2OPBA 5KSWB 3D6UA 4YP7A 1TA9A 5AXAA 3P4UA 4W99A 4CE6A 4H08A 2V1XA 4D3DA 3E9QA 4RTNA 5DYGA 2JS7A 3KC2A 1S2GA 3IESA 4S1OA 2NYAA 4HN4B 1OWLA 4JVNA 1RL2A 4KQEA 3QEJA 5EIBD 1ESZA 3SLKA 1JBQA 3TL2A 4E6PA 2G17A 3I1IA 4N9WA 5FO1A 3ZQJA 1N2SA 5LZ2A 3HO1A 4JOQA 2RF0A 3IJRA 1GWNA 2F43B 3LXMA 3NHNA 4DA8A 4XU3A 1L5QA 1Z37A 1M1KC 2GD1O 5IBCA 5JMWA 3HZRA 5E1OA 1QR2A 2YBEA 2ZJOA 3G59A 1PJSA 4F5EA 4YRFA 2A7QA 4Y2UA 1E58A 5ENZA 2FEWB 2FMIA 4TYMA 4YAWA 3AW8A 4LZOA 4MV9A 3LVRE 3OF5A 1X7ZB 5A71A 2WQZA 1SKYB 3B1XA 3V1YA 3KBGA 1NATA 2QRZA 2GESA 2YIJA 3DDOA 1SU6A 4GQAA 4JBXA 1DBPA 2O2DA 3OO1A 2YFYA 3JPYA 4AJJA 1J9GA 3EF3A 1Y5RA 1QHGA 1TI7A 3VPGA 1QQJA 2NU6B 3CLKA 3U3KA 1Z2AA 3W9BA 3ZHBA 4ZVNA 1UPFA 2G5PA 2Q5FA 3KQTA 2EDCA 2GX6A 1YRBA 2P2LA 2V5UA 3C6KA 5BXQC 2VNKA 3B70A 3I2IA 5JCJA 2Z6UA 1VBFA 2DP4E 2CS7A 1WMEA 3R3VA 1UOOA 4C4TA 3L8ZA 2GCXA 3OQ6A 1TMYA 3LSTA 3OPVA 4XYBA 1N75A 3TQOA 3FFAA 4J7UA 1KC8C 4YV2A 4ZGGA 5LN1A 1Z6QA 3N5CA 2NO9A 4RA6B 1KVQA 1JHMA 4M7PA 1Q95A 1U5CA 3LUKA 3HUEA 3ZD9A 3I83A 2VL7A 2VYFA 2ZBGA 2VAXA 2BP7B 1FTYA 4IJKA 3P0EA 3KJGA 4K1LA 1CYEA 3ZGNA 1YNZA 1I3OA 2PY6A 4BP1A 3QJ5A 1HETA 2I78A 3RB8A 1VQ5A 5IXBA 4LTNA 1SIBE 3WZLA 3EBOA 1U7HA 5TVGA 1Z26A 2FPMA 3PQFA 1N4DA 1XZFA 4GSKA 4G23A 2XWPA 3GJRA 3RBBB 4RD2A 2VHXA 3IALA 2JAOA 4YCJA 5LQSA 3QKIA 4URYR 3VOAA 1UEXC 1ID8A 1SC6A 3BDVA 2JARA 1L4LA 2JVKA 2KB0A 3KAKA 4IDCA 3AKYA 2IPOB 1JHVA 3EG9A 1P6QA 3G17A 4GPBA 4I50B 5AM5A 3N59A 2W4QA 4ZT3A 3O8DA 3T1TA 1GNLA 5CM9C 2JZNA 1A5BB 3QFHA 4YV1A 3H16A 3CM0A 1QCNA 1RFGE 3WKEA 1KD1U 5JS8A 2UDPA 2YV4A 3PSHA 1J8MF 3ES9A 2WV9A 2YCLA 1DXOA 1S5PA 5C4GB 2QEXQ 1EESA 3SYMA 3V1KA 3QIIA 2BLNA 1GDDA 2FZEA 3J7TA 3PWZA 4HDSA 4P7FA 5K03A 1NY6A 4BWGA 4XU2A 4HCCA 2D3WA 4UDXX 5C1BA 5KTPA 1T15A 4QJ3A 2N47A 1JU9A 4GF5A 5ETJA 4X62B 4ES6A 4WXMA 1GAXA 3Q7IA 4HADA 3TREA 2JIMA 2VJOA 4RDXA 4PJOF 1MUZA 2P0QA 1L7BA 2ZRJA 2WWVD 4F91B 5CVTA 3NP9A 3WQHA 4B81A 3I92A 3O8OA 3G4SQ 3HL8A 1GR1A 2YWWA 4ML3A 2CD7A 4GMXA 1GTL1 2CZQA 4N5LA 1OU8A 1X7ZA 3CMAT 2R5NA 3I1FA 4JA0A 3WB2A 5DLQC 2FI1A 1ZXXA 3PQDA 4J4TA 5FPQA 3T9AA 1P9RA 1IHWA 4PR0A 2PJDA 4Q3AA 1HSOA 4AZVA 4BZPA 5AJZA 3I30X 3AWIA 4KUDK 1U2EA 5JS2A 3O94A 1O75A 4QREA 1BXRB 2JFGA 2GPJA 3NVAA 2CXHA 4U7WA 2ZSKA 2EYUA 4LDAA 1GUZA 2C8JA 2JATA 3WOHA 5A4IS 2V6FA 1VDMA 3CRVA 1OILA 5BR7A 1LI7A 4MQ4A 3TFQA 4MQLA 4CM4A 2PUDA 4HLCA 4AY2A 3K9CA 4QOFA 4AP9A 4G1VA 3KV3O 2ED1A 4M76B 3GIDA 2QTAA 3QBDA 3LUCA 4DA4A 3KR1A 1V96A 5FI3A 1IXZA 1VPDA 5D7BA 3GVCA 2GASA 2WU0A 4UCWA 3KU4A 4EATA 2HIGA 3PTLA 2DR2A 3ITKA 5ALRA 4HVCA 3A11A 3QV2A 5G3ZA 5EZYA 4KZPA 4OX9Y 3JAWA 1T0UA 3I45A 4BZWA 2AF4C 1CUDA 4IMRA 4S2UA 1J2TA 1JUDA 3MJEA 3P2YA 2IHTA 4C03A 2EL9A 4RNDB 1IK6A 1SUPA 1ISRA 1V7PC 2HNBA 2C5LA 3CRMA 1MC4A 3OFKA 2H92A 4Z9BA 3T7AA 2Y1EA 2OD2A 5K3EA 4GL2A 1YFZA 2ZPBB 3ANXA 3IDSA 4WFQA 4EAQA 2YMMA 2SCUA 4B74A 3CMCO 2AQKA 1POXA 4ZQCB 2OSBA 3DC2A 4YASA 3TW0A 3WYCA 4CWAA 4DQDA 2VJBA 3LUFA 1WHHA 5KYWA 2BF7A 1I32A 3LX6A 4LSWA 1GL7A 1L3IA 1M5UA 3D6AA 2W42A 1G9XA 2R5FA 2ACVA 5THXA 5BW8A 4P2GA 3U1TA 4DILA 2IOYA 1AD5A 1XDGA 5ALTA 1AKVA 1PS9A 4AJPA 4GNKA 5JMTA 3TTVA 2VWHA 3A5ZB 1CUCA 4FT2A 3BRWA 3H8JA 2GQVA 1RU3A 3AR4A 1T8YA 1YA4A 1LBTA 2CD9A 2PUKB 3HGTA 3NAZA 5J5CA 2J8ZA 3B3QA 3DMFA 5LJ3d 3ER0A 1UP7A 3IYLW 1M8MA 4YRDA 4P33A 1NE7A 4UNPA 1LVGA 4YQFA 1RC8A 1VBNA 2WE7A 4QBHA 4GWLA 3SVLA 3K1YA 1MMGA 3G5LA 3JYQA 4B31A 2GERA 2Y8EA 4MYTA 4PCLA 3UKJA 3ZBTA 3V7RA 3DDNA 2E4UA 3DUWA 2Z6QA 1K88A 5DJ5A 5NULA 2OZLB 4O5OA 2XQVA 2ZIEA 3Q72A 4C3UA 3RVRA 3HGQA 4RG2A 3EJWA 1EWKA 1V1MA 3EE6A 2WU3A 2ZZKA 3AFHA 2BI4A 1LW7A 2ZS9A 2VVKA 4PJOE 2QUBA 4E3ZA 5IAAA 4YP9A 4ND5A 1UPCA 1CFJA 5B53A 4PTLA 2XKJE 1YITQ 4HWKA 5JIBA 3LOPA 5A9RA 3OYAA 1N9RA 4N7JA 1XJWB 1QX3A 3D1VA 2B4TO 3EARA 4F2HA 4AJHA 4DC9A 5F52A 1QU2A 3ECAA 2DUNA 1J3TA 1E94E 4G26A 3CCLA 4Q37A 1JTEA 3A1EA 5I7HA 4PGFA 1AT1B 4C4ZA 2A3LA 3ICQB 2Q9BA 2NV2B 4RTXA 1Z9QA 1TCVA 1XDBA 2D00A 3AR9A 4CW7A 1VQ9A 1Y3IA 5F1YA 5JR3A 2PGJA 1TUGB 1MEOA 1W96A 4CN9A 1NW6A 1JU5C 1PYOA 1Y7HA 5K0LA 4GX1A 1OU4A 1U3FA 5EMNA 3WWDA 4PJOG 4B3BA 2ZVQX 4B6EA 3R9IA 3GNTA 3JQPA 3M5DA 4TN1A 2W2PA 1A69A 4XLTA 3RC2A 1WOYA 3KM0A 4ALNA 1Y1RA 3BJZA 4YJ2A 4FYIA 4H7IA 5IS2A 4MXDA 2OGZA 2D59A 1BYUA 4DWJA 3M54A 4JL8A 5K8JB 1CQIA 1RXEA 1RP1A 4J8PA 3ESXA 4R1SA 1G38A 3AKCA 1YF3A 5KUTA 1VL0A 1XPOA 1DBRA 2HIMA 4M7OA 2OBBA 1ECBA 1OYWA 1ZGCA 3KK0A 1GZHB 5ENDA 4HUQA 1D9ZA 4EMBA 1HLGA 5AYFA 1NLUA 3O38A 2BL4A 3LY5A 1UR5A 3R5HA 3SN6A 8ATCA 4KH1A 3H1EA 2FVXA 4Z0TA 1D4AA 4LJ9A 5IBQA 4BQRA 4OYLA 3TBKA 2XIDA 1UKEA 4EHAA 2HREA 1LUAA 4QXOA 1UAAA 1VG9B 1WTAA 1UBUS 2FR8C 2OXRA 2YWFA 3X0DA 5I5EA 3N6VA 4IJWA 2BWJA 1CZRA 2ODPA 2ZSIA 1YRYE 1MDFA 2B0JA 3KWMA 3CCJQ 2NZXA 3NRBA 5A4MS 3T5AA 4Z0NA 3VKFA 2O2GA 4G09A 4OU4A 4GE0A 4R83A 4JPBW 3VJLA 3G4ST 1L4YA 2V7TA 4I5IA 4AZSA 4Z4CA 3OURA 3W5VA 5JSZA 1VSVA 1U65A 4QU9A 2W8BA 2CNKA 1XO1A 1TT5B 2WWTA 3UJ9A 3V80A 1OPLA 2HTEA 1G5HA 4KT0E 5AW4A 1NXTA 4DMUB 3RDVA 1LBQA 2WNHA 4N40A 5IJAA 2O4XB 2VKNA 1COWA 1JMKC 2VR1A 5AM2A 2RI2A 2Q07A 2EQKA 2A33A 1FMKA 2H4WA 1U9ZA 3L0ZA 3RUFA 3W6UA 5I8PA 1YXMA 4YAJA 3BD6A 2VWGA 4XVHA 4ZK2A 3DLBA 4HCZA 2MSLA 5IDWA 2R8YA 3ECSA 4JV5B 5IXSA 4EX7A 2MWPA 2J3JA 4GPAA 4M22A 4XDZA 5CJJA 3W7VA 3IA7A 4N5MA 1WCXA 1AQIA 2IW1A 4D57A 3M4NA 3TUJC 2IVZA 5DNAA 3MWEB 1VLMA 2VQ6A 4PHFA 1UZMA 3ICVA 3L5KA 3STXA 3OW2S 3W5UA 5L3QA 2KXCA 1NG2A 5BVGB 3IT0A 4BLSA 2FP3A 2R4TA 4NCJA 8MHTA 4L2IA 3WMFA 1U6IA 2Y6VA 4EB8A 5JQGB 3THXB 1RQGA 1FVOA 4RF3A 2Q5LA 4OMPA 1PV2A 3X3HA 1WIWA 1O9GA 3T5DA 2PLFA 1EA5A 3FHJA 1KFEB 5CKDA 1J1IA 4XWYA 2O2IA 3D54D 4Q4DA 3GRAA 3IUPA 3IRUA 3JR7A 1TIBA 1R8OB 1KQ1A 2WJWA 1DQNA 3H0CA 3I6MA 3M6IA 4RV4A 3RK0A 1H3FA 3WIBA 3ZLUA 5LD2B 2DXTA 1BNCA 2YIDA 1JSXA 4EG7A 1RLUA 4PAQA 3R3ZA 5BSKA 2FG7C 4IF6A 5GPBA 4B3TB 2QMOA 4DC1A 1R9NA 1VCIA 4JLIA 2LCIA 3JQBA 3VNBA 1NDUA 3A3OA 4DCGA 1DT3A 1PQWA 3OM1A 3QBJA 4NOYA 3AM5A 2PO5A 4HQKA 2CP0A 5E6SA 5A0TA 1VCMA 3QEMB 4I50F 3T3EA 5ALDA 2PA0A 4HZIA 4C0JA 3B5EA 4B3RB 1R6VA 1GPYA 4JSRA 5KVQA 1F2UA 4IQ0A 5IAEA 5K0GA 1ZUHA 2RH9B 5F7JA 1X2QA 1HV8A 4M4SA 1UBHS 2V7WA 1YL7A 3S29A 2FPKA 3QWIA 1E1KA 4GOKA 1Q0HA 2IOFK 3JAMA 3EPPA 3I64A 1QTIA 3LT1A 1OGYA 1PHPA 1PSWA 3UWMA 3SYLA 3NNSA 1ARKA 2GA9A 4AF7A 1SVWA 1Z29A 5F3WB 2Q4TA 4AFNA 2O8NA 4O1IA 1E63A 2ZRCA 1S0UA 2PSHA 2X1HA 1EB9A 1QCFA 1L3CA 2CLDX 2OTCA 4Y30A 5FTNA 3SBDA 5JAUA 5AVTA 5J26A 2H4YA 3L2ZA 1C9KA 2NP7A 3WY9A 3PIDA 2HZ7A 4C7JA 2JLWA 2JEOA 2RKWA 4CMIA 2A59A 4FJ1A 4P86A 3IUQA 2YY7A 4MB6A 3VC1A 3PE3A 1EZZB 1JBMA 1CEQA 4IUTA 1AG9A 1TCAA 3RF7A 2QVZX 1FZTA 2JBAB 2C0IA 1Q19A 1FU4A 2IGTA 1QO7A 2EQMA 3CG4A 3KUFA 4CCAA 4MYCA 1NLMA 3NWJA 3RS4A 4UTVA 3DBHA 1GKKA 1WDMA 3BH7A 3MWEA 4CFYA 4C20A 4K0KB 1T1IA 1GCGA 1ZBXA 4EW1A 5IU6A 1JDSA 4QQ6A 3ASUA 4BBAA 1YRLA 1BYMA 3B1VA 3PE4A 4R5MA 3TXXA 1TC2A 1D3AA 1LQ2A 1K73C 1TMOA 1Q1QA 1QQ7A 3LVBA 1A9RA 5CDHA 2ZJ5A 4QOIA 1X1AA 3OYGA 1WUYA 2CJPA 2CYCA 4DLZA 2DBYA 5DSXA 3PT9A 3B6ZA 4AZ3A 1N6IA 4H77A 3ZDDA 1IOZA 3OYEA 1NLFA 4MGIR 4NJOA 5FPTA 3T61A 4BMDA 5D51S 3OYBA 2E55A 3COSA 4ILKA 1KKLA 2RI0A