4DEXA

Crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav2.2 i-ii linker.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
289
Chain Sequence
EDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Voltage-dependent L-type calcium channel subunit beta-2
publication title The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 95
structure length 289
sequence length 317
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4dexA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dexA02
5L3QB 5H68A 1G3UA 1RW4A 1Z0FA 1I0CA 4V0MA 4CZ2A 4ZKEA 3LAWA 1R4AA 1JEEA 4O25A 5A4JA 4BEBA 5ELXA 1Y63A 121PA 2Z0MA 3QPWA 4RZ3A 1KKLA 5JWRA 3OZXA 1KDOA 1E99A 4HUTA 3L0OA 1VECA 2R6AA 3ZVLA 3FYHA 4F16A 4TLDA 3C15C 4WZBE 1SVKA 3B1YA 1A2KC 3VS2A 4A63B 1FZQA 4DLUA 1XPUA 2JS2A 1XTSA 1RE0A 2GETA 1Z3IX 3LBIA 1Q1QA 3F8TA 4K81B 2JLZA 4PSKA 2VIIA 4RTUA 1KO5A 3VX4A 1LF0A 2QAGA 4AURA 4LWZA 2OBMA 2OXCA 4I4LA 3UG7A 5DHAA 4ON9A 1US8B 3W9YA 4F38A 3M0SA 3BFKA 5IF9A 1E9SA 1SVSA 4QXAA 3HDTA 2QPTA 5KDLA 4Z8XA 2B8TA 4AWXA 4J9GA 4RCZA 1G2BA 5EQTA 1NVXQ 2FPDA 1LCKA 1OEBA 1DE0A 2ZRJA 3EZFA 4FMDB 4IKEA 2FFQA 5FTLA 1WYXA 1BS1A 8OHMA 1UDXA 1OOTA 3A8TA 3H0HA 4PZYA 6Q21A 1OPLA 1NMXA 1SXJA 1WRBA 2QAGC 3CLVA 3L43A 2A08A 1MO6A 1NJFA 4LHWA 4QKQA 3WYGA 2PJRA 4NBSA 4FXPA 2QENA 4X8HA 1BYIA 2G0TA 3OFNA 4DSOA 2QDLA 1Q44A 5H70A 1KSFX 1ZNWA 1U0JA 1IN8A 2QP9X 5FOWA 5JJKA 5DGXA 5BWMA 4OQXA 1EFHA 1IY0A 4HLCA 1R0WA 2JW4A 2CH4W 2WAXA 4DJTA 2OCAA 4WBSA 2L3SA 1KSHA 2W0MA 4Q4AB 5JEEA 2M51A 4IOMA 2X3XD 3RRMA 2O8CA 2ENMA 2B86A 1JJ7A 4U7DA 1R5OA 2VLIA 1QKWA 5IHKA 3PUWA 4CEIA 1Z2CA 1FQKA 2IEZA 2DA9A 3CM0A 3Q85A 1XZQA 4FCTA 2FFAA 2UKDA 2CT3A 4J9IA 2DBKA 3A4LA 3NKVA 4TYPA 2YWHA 3SFVA 4BASA 4DUGD 4FWTA 3GJ5A 1J8YF 1CIPA 1CJTC 3UMSA 2ZIAA 3FMIA 4HYYA 5J47A 1N5ZA 4U00A 1FX0B 3AVPA 3QKUA 2Q6TA 4M21A 2V1UA 1QVAA 1Z28A 5L3VA 1NKSA 1YR8A 4NYJQ 2G83A 1A82A 2XZOA 4IXNA 5EE3A 4JLMA 3ZDQA 1W46A 4PAMA 2ZJ8A 1SZPA 2D06A 1E2DA 3LA6A 4HB0A 1MV0B 3LDAA 4OHYA 4DDTA 5G40A 2ZSFA 3BB4A 3DKPA 4G1UC 1F3OA 1GL5A 3GJ4A 3I9QA 4NE2A 2QA5A 2K2MA 1GG2A 2BVNA 3FHCB 3R8CA 1W36C 4AI6A 2O8DB 2FN4A 4JZKA 1U06A 4AD8A 1RZ3A 4CT5A 1DO0A 4F93B 3MWKA 2UVQA 1KI9A 4OI1A 3CQTA 4QBGB 4DCSA 3L0PA 2HEQA 2XMFA 1BK2A 4JLDA 4XIGS 2O8EB 3EG0A 3KQNA 3LBHA 3AF4A 2A5JA 5EC7A 3A1SA 1Z6GA 1N0WA 1ZM7A 4DB2A 2IYWA 2WWXA 2C0OA 2KRSA 1CR4A 3EC1A 1R8QA 1QKXA 3U2QA 1XPOA 2Q9AA 1Q3TA 3T5DA 1OPKA 4BE7B 4RD2A 2V1RA 4A2QA 1FMLA 3MG9A 2ZUBA 1N3BA 2IYLD 3NG1A 5BN3A 2FA9A 4TWZA 2PEYA 4JLAA 3BE4A 2ZRIA 4GFDA 4Q1CA 3W5JA 2DLPA 2D1XA 1YVDA 1FUUA 2CVHA 4DUGA 1ARKA 3VR2A 3TSZA 3A1TA 2IA5A 2X2FA 4O2LA 5AUQA 1GCPA 1IN6A 1N6PA 4L9SA 2Q3FA 4M4SA 5B2ZA 5I11A 1E4YA 3QPVA 3THKA 1H8KA 3GCGA 4OJKA 3GFPA 3I92A 4AK9A 1C4OA 2DHRA 1X43A 3UK6A 2L2PA 1ZD9A 1KDPA 2GF0A 2DL7A 1YNZA 1MR3F 1CXZA 2Q3MA 1XMJA 4D80A 1WDXA 5GVRA 2IS6A 2FEIA 1G6OA 2HCBA 1COWA 4Y92A 2J05A 1HTWA 3CR7A 1A1VA 1F2TA 2PZ1A 2QPOA 3C0CA 2CLDX 3LX8A 2RHMA 4JT2A 2B92A 2WJJA 4TT3A 4V0NA 3IBYA 4C7OA 2OCBA 1Z0AA 4QHSA 2R6DA 2FFBA 3QVVA 5DYIA 4NTZA 1QDEA 3OE7D 3Q8XB 4MYCA 4IOJA 1N5KA 3QBVA 1M74A 2CDNA 1G9XA 2W58A 1ZBJA 5E4FA 5AJWA 1NNEA 1JO8A 1K1ZA 2FG0A 5KNBA 5JSZB 2QG6A 2QRNA 3U5ZB 5IXFA 2HF9A 3VFDA 1OKKA 3PEVA 1BU1A 2KRNA 1BIFA 4EIKA 4URZR 4KO8A 4OHVA 3EZ7A 4L15A 4US1R 3U60B 4P32A 1XOVA 3AVTA 4DCNA 2FPKA 4ZKDA 2GZHA 5L3RA 1M7BA 3CKLA 4B74A 1TL7C 1AOJA 1RPZA 1ZC3A 1UF9A 4B3BA 3I5YA 2GXUA 2JCSA 4R2IA 2NQ2C 4FD2A 2R6CA 3NEJA 2BZYA 3UA7A 1SGWA 2XSZD 3SS8A 4CYMA 2ZR9A 4KCGA 2QY9A 3B1WA 4MRVA 1AS2A 4NU0A 3TQFA 1YHNA 2OM2A 4BLRA 4V0KA 5FTJA 1Z0IA 1BOFA 2JTEA 2UZ3A 4XVRA 3B78A 4OJQA 5UKDA 3QJYA 3X1DA 621PA 3T1TA 3ZVNA 3X1ZA 3SU8A 2R2AA 4M53A 1AJEA 1WA7A 2GVZC 1XJQA 2LP5A 4LV5B 3EG2A 1LVGA 3B85A 4KBFA 4P33A 2N46A 3B2EA 4O3MA 2RGDA 3IQWA 4PC1A 3CUEF 1E9EA 1Q57A 1SKYE 2ZI4A 2QAGB 4OHZA 4C0HA 4D26A 1SHFA 3DVLA 3QENA 4Q9KA 1G21E 5KO2A 2EWVA 1ZIPA 1VHTA 3QG1A 5C4MA 3A37A 3OE7A 2ZETA 4B3XA 4PXAA 4BLSA 5ECAA 2F55A 1HE8B 2AK3A 2FPMA 2KNBB 3GJ3A 3CX8A 3RRNA 1N0UA 2DRKA 4B75A 2F2VA 1K8RA 3E1SA 4A4DA 2ZVQX 1CF4A 1XEWX 2CXXA 1BYUA 5HZKA 3GLGA 3TKLA 1TG0A 3K0CA 2AN9A 2EFGA 1OFTA 3W90A 3W3AA 4OQNA 3VKHA 1T0JA 4YLGA 2V1QA 2RQRA 3PUXA 1NVWQ 2KE9A 2P5SA 4NCIA 2XJ4A 1M7GA 2HJGA 1W0JD 2R8RA 4W5HA 4LJ9A 5IK2D 3A6PC 1AGRA 3LO5A 3W34A 5EJEA 3TUIC 4X8MA 4XWOA 4LYHA 1NBMD 3PEWA 2XSZA 4PAQA 4QFMA 1JEGA 3CWQA 4ACBA 4ZV4A 4CEIB 2DPXA 2LQWA 5AJZA 2D62A 4HDCA 4TLCA 1W1FA 5JI2E 1XB2A 1KK2A 1GDDA 1XCMA 2CUBA 2P6UA 5LD2C 5JS7A 2VP9A 4EPTA 4KAXA 1GOTA 4MGYR 3UKDA 3T34A 3QBTA 1JJVA 1W49A 4R2HA 3IIMA 2Q21A 1OHHD 3WNCA 4US2R 3BH7A 1MV5A 1G17A 2C78A 1W36B 3DOEA 3QXXA 4FSSA 4LBZA 3U7FB 4NYIQ 2ZJAA 4BFWA 1E2KA 2O0HA 1UFFA 1YRAA 2YKGA 3DMDA 2EU8A 1KNQA 2ZJ5A 4N0EA 3I5XA 1PRLC 2IEYA 2ERYA 4CC2A 2RNAA 4AG2C 1ZNXA 4IHQA 2BV3A 2LJ0A 3A1UA 1OH7A 4E5UA 1N25A 4Q02A 2K3BA 2QRZA 2ZRAA 3HP1A 4M22A 4TL7A 4Q21A 2V8OA 1NF3A 2NMVA 3PVQA 1RIFA 4DLRA 1N6OA 3EC2A 3H0IA 1GFIA 1M8MA 2AKLA 1ZUNB 3D3QA 3NH9A 3BGWA 4M9XA 2AZSA 1KDRA 4D4JA 1KSWA 1NLPC 2DFKB 1AGPA 3CF6R 1AZGB 2DCUA 1J3TA 2DR3A 4OMNA 1YRBA 4RCYA 4XTRA 3AVVA 4HLQB 2MIOA 2ONKA 2VHTA 2B6HA 3S1AA 2WJHA 3V4FA 2QP4A 1GITA 1SVWA 1P6XA 2GRJA 5E7IA 3G5UA 5HE9A 5JWOA 2GXSA 1M27C 4P31A 1AZSC 5FBVB 1E1QA 4EJSC 2C0IA 3I5SA 1SHKA 3HYRA 5KYKA 3DO6A 4DIDA 2C77A 2WWHA 3Q7PA 4CW7A 3W3ZB 3BRWD 3MWJA 2YC2C 2BCJQ 2QM7A 3RSOA 2DFTA 3CW2A 3K9HA 3SBEA 3M0RA 5FPKA 4QNRA 1Q20A 5K8IA 3THXB 3P27A 2DL4A 1JR3E 4A0FA 4HDOB 1UHFA 5FL7D 4DWJA 5HPYB 2PLRA 1FP7A 4I1UA 3AGPA 2WKPA 1PLJA 1XMVA 3LVRE 2GJ9A 3FHTA 2GCNA 2ZSAA 2FNAA 3CRMA 2IK8A 2RGNC 4J9FA 4KSCA 3GLFE 4S35A 4DLVA 3M4YA 4LJYA 4IRUB 1K0SA 1ZMXA 4Y0AA 5FBQB 2QTVB 1JR6A 2QM8A 2G0NA 2KE5A 1GFCA 1RRFA 2GDJA 3BB3A 4TLEA 3QG5A 2R6FA 4OMPA 3GLHA 4JIMA 4DHEA 4IOLA 3SYKA 2BWJA 3LLMA 3U3KA 2ODNA 3PEUA 4FMCF 4Q9JA 3B1XA 1GKYA 1F2TB 4WIAA 1AM4D 3R9WA 2WJYA 1W2HA 1S8FA 4C7OB 2J7PA 1AIPA 5TXGA 5L3QA 2ODBA 1XD8A 4QBFA 3AH8A 2BIFA 1IY2A 2OJ2A 2H8HA 1X8JA 3VR6A 2CSQA 3N2IA 1WI7A 2JGNA 4JLOA 1Z63A 2QMEA 1FYNA 3VQTA 2YDLA 3QKRB 4BLQA 1GZSA 4M1OA 4JZ4A 2VF7A 2ZTSA 3NBXX 4Q47A 3SJAA 1M1YE 2J0QA 1NKTA 1S1MA 1AZEA 1KYIA 3U3JA 4DDVA 4TSFD 4URYR 1P60A 4FIDA 4EPYA 3PQCA 4MGZR 1KMHA 4Z89A 1G5RA 2IYTA 3RANA 2VKNA 2C03A 2ED1A 1WP9A 4V02A 4TL6A 2QZ4A 3ULRB 2J6OA 1HA3A 1WCV1 2CBZA 5G3ZA 4LX0A 1FW6A 1MUZA 3CX6A 1ZUIA 3OEED 5DIFA 4AG6A 1YZUA 4IEEA 4HDQB 4I1VA 3ICQB 1DAGA 4KODA 3EGUA 2XB2A 1J90A 1US8A 2XZPA 3GEIA 5EUMA 3K0SA 2XXAA 4GL2A 2BBTA 2EGEA 5FI1B 1HQYE 1L4YA 4HZUA 1KSGA 5F9HA 4KU4A 2OSBA 4B35A 2F7SA 4NDZA 4Q7KA 1YKSA 4GZMA 5BYKA 3B9PA 3QY0A 2ECKA 4TMKA 3LWNA 4JLPA 2W6JA 4NZYA 1Z6AA 4DCVA 5JCPA 2LJ1A 2EFHB 2EW1A 1IY1A 1YR9A 2ZI9A 2EFEB 2AX4A 3C41J 2JLXA 4PC3A 5GADl 2G88A 2KGTA 1W1WA 2QN6A 2W0ZA 2RGEA 2V1XA 4PQRA 5EXXA 3SZRA 4B76A 2RQVA 4PC2A 3GQBA 1G8YA 2OUKA 2YHSA 3EZ2A 4HB3A 4KFSA 4ZI2A 3RC3A 2BZ8A 1U81A 721PA 2X1VA 4F14A 1AD5A 3HR7A 4BFYA 2FPLA 5IHIA 2VP2A 5JMTA 4Q4AA 3SI7A 3N2EA 2V6JA 2F1IA 2JASA 3L82B 4Q5IA 2JEOA 5IDVA 5B57C 2LCSA 4J0QA 1JU5C 1DELA 4PSAA 4Z8YA 3QF4B 3VR4A 2QAJA 4OHXA 5CJ2A 4OI0A 1CJMA 4GP6A 2ZJ2A 3UG6A 3OIVA 5EE1A 3BS4A 1NM7A 3M0EA 5EZ6B 4C0KA 4M0LA 4EPWA 2ORWA 4N1AA 4LV6A 1WBBA 2GAOA 2W0SA 4TSFA 4MGKR 4CEJB 3G82C 3GLGB 4OQLA 3HU1A 3WMEA 3DMNA 4JYBA 4YMWA 4KLNA 4H9GA 1ZX6A 2ZE5A 3IQXA 1DG1G 1OYWA 4ZCLA 2CCGA 2YUNA 2OFOA 4AKGA 5LD2B 1S1NA 1AA9A 2RGBA 3I73A 4Q4LA 1DAFA 2ZI7A 3NWJA 4CRWB 1X2QA 1G3MA 3SOPA 4JKIA 1RFLA 5AJVB 2REBA 3B1ZA 4D0GA 5BN4A 3AF3A 4TMTA 4G0NA 5EXPA 3AGQA 4DDWA 2FPEA 2GXQA 2OEPA 4TMVA 5JJLA 2DWPA 4QJ5A 4YC7A 4AYTA 2M0YA 1ZIOA 4US0R 3RRYA 2C04A 2CEAA 4OQMA 3UMFA 4FINA 3C7KA 2KWIA 3EPJA 2PCJA 3L0IB 3NGPA 2O8DA 2OAQ1 1SPKA 4TN1A 1Q0UA 1Q1EA 5LDDC 3TSOA 1XTIA 4YDSA 3TW4A 1X86B 2L3PA 4YDHB 3KQUA 1E2LA 2V3CC 1P2UA 2ZYVX 2SEMA 1N5IA 1Z06A 1CKAA 5EXSA 3Q5EA 5K8LA 4L16A 1OXTA 5IHNA 4DZZA 3SQWA 3OHMA 3UWOA 2DFNA 1EX7A 4TMWA 1U8ZA 2GZAA 3I72A 3K9NA 5AJXA 5JEDA 1Z29A 4RKEA 4U02A 2I1QA 2O88A 2J59A 1GL9B 4O2RA 2XNDD 3Q9LA 4TTQA 2VSXA 4LPSA 2P6RA 4QJ4A 3R9IA 2JA1A 4EJSB 1Z6YA 2KSQA 1GP2A 4JVMA 1IM2A 3REGA 1T8TA 2A78A 2IC5A 1GIAA 2CUDA 1ZM2A 1U5SA 4QGGA 4JJDA 1XXHE 2A5DA 3SC3A 3KL4A 3JVVA 1S4QA 2J87A 3JV3A 2DBMA 3FB4A 1HURA 1LV7A 1DG3A 2EPDA 1SQ5A 1ZINA 2VVKA 3ZIAD 2EQIA 2VP4A 1KY3A 5KTYA 4HVUA 5EP3A 2NO0A 1E2FA 2BCGY 2ZVPX 2ZYTX 3CZQA 3GP8A 1NIPA 5CJPA 1P9WA 2ATVA 3HJNA 4E6RA 1ETUA 4A8JC 1UG1A 1AVZC 4GRAA 4DLSA 4M1SA 4DIEA 1YU9A 2NO7A 2DMOA 4GOKA 2F2XA 1K6MA 4MYTA 1W4CA 5DN6A 2ZYUX 1E4VA 1X3SA 1ZUHA 4ESRA 2FF7A 2P0EA 4DLYA 2ZI5A 3ZQ6A 2OLJA 4P4UA 3U44A 3MFYA 1W4RA 5CITA 1OFIA 3EG5A 2XAUA 1G1MA 1OXUA 4MKGA 3REAB 3DZ8A 3FE2A 4E09A 4MDEA 4Z1MA 4D2IA 2MOXA 2WZQA 3M0PA 1X2KA 2JMAA 4JL6A 3ADBA 2DNUA 1E2HA 3PITA 2FFHA 3B9QA 1GVNB 3GJXC 3M1IA 3EXAA 4Z54A 4B6EA 1KZ7B 2J45A 4EFMA 2K9GA 4DEYA 4TMZA 1GTVA 1ZM3A 3TW8B 2CJWA 2AWOA 3BAFA 4HLDA 3OFND 1ESNA 3OESA 2D0NA 1II8A 2KEAA 2JIZA 4KFRA 1G3QA 3H0KA 1RI9A 1GAJA 2RHDA 5FTNA 2FSIA 3K8YA 1D2MA 1JALA 2Z4SA 4B33A 5FFMA 3OF5A 4W7SA 1AKYA 1RYHA 4B43A 1TPZA 1B0UA 2P2LA 3BFVA 4LBWA 1Y3AA 4UXHA 2HLDA 2WKQA 2QQEA 2HXSA 2WTUA 2FU5C 2LKCA 3EIQA 4MRPA 3ZIAA 2P3SA 1RRGA 5FPTA 2A5FA 1AS0A 1E6HA 4CT4B 5D3QA 4GOXA 3CH5A 1Q3HA 3KKOA 1II0A 5KOYA 1GSIA 1TQDA 1G20E 1KMHB 4JYCA 4YMTA 3FMFA 3R7WB 4A6XA 2VWFA 2HCKA 4MYUA 4ZCMA 3U3RA 2N42A 4CVNA 2HF8A 2JM8A 2GEUA 3DM5A 4LBYA 2CL7X 3TSWA 3I35A 2DFLA 2OCPA 1W36D 1DAMA 3TNFA 2QL6A 2VP6A 1KK0A 3AVQA 1XD2B 1WXQA 3OIYA 4PQYA 1BH2A 2D74A 2OXRA 1N6KA 3IIJA 3QQ5A 4R7ZA 1B3QA 4XSGA 3RRZA 2XXAB 2ZSDA 4PHFA 1E69A 4TYYA 3CH4B 3GLIE 4HZUB 5L8VA 3ZS9A 4D8DA 2RCNA 5EUQB 1G7SA 2CE7A 2OAP1 2EYYA 3UXMA 4ABYA 3BWDD 5FTKA 2DL8A 2DRMA 3IEVA 1XCPA 2YSQA 4WCIA 2W2XA 4JLNA 5C4GB 2E5KA 2KBEA 4JBYA 2HCJB 4YMUA 3MCAA 1AKEA 4ZNXA 5DLQC 4BRWA 2AD1A 3B8HA 4J9DA 2CMKA 4GP7A 4HATA 1E9CA 3ICEA 2VEDA 4BFTA 1VMAA 2O8FB 2WJVA 3KJGA 3FPAA 1KO1A 4NCNA 3EASA 4Z88A 1R0XA 2EVWX 1VCOA 1NG9A 5DE3A 1FUKA 3MD0A 3WP0A 4CC3A 4L8GA 4KVGA 1NN3A 5FOXA 1SVIA 4MUAA 3L8YA 2PJZA 1OIXA 5GJWC 3AM1A 2LNHB 1Z0DA 5GJBA 1XX6A 4PC7A 3FOZA 3ZVRA 2ECZA 4LUDA 1D9ZA 1VCIA 3BH0A 4QBIA 3MJRA 1GNQA 2DYBA 4IDPA 3T1OA 5BXQC 3CZPA 4J9EA 1EK0A 2WAYA 4Q7JB 1P9RA 3HR8A 5SZIA 1QG4A 1TF2A 2RQUA 4KI0A 3I32A 2CL0X 2CDTA 4HVWA 2C95A 2EFDB 4AIIA 1S0UA 2PZGA 1KDTA 3TQCA 1QWEA 3ZZ0A 3H86A 4B71A 5KDDA 1ZAKA 4XJXA 2CH4A 4AFQC 1KZGB 1KKMA 2CNWA 1AQUA 1G7RA 3FMOB 1E6GA 2R44A 1I4LD 2G9NA 1UDWA 4RVCA 5FOVA 4OK3A 1J70A 4C3ZA 1M3AA 4JL8A 2D3WA 2WSSA 3MUFA 1OIWA 2AKAB 4LNPA 2J46A 4D4LA 1M8PA 4D8KA 4UKDA 3TE6A 3SEMA 3BXZA 3NHNA 3KQHA 1COWD 4Q1AA 4LJ7A 4JVLA 1JQQA 2ZE6A 3C16C 3HPRA 2REXB 1D2NA 2KT8A 1VCNA 3P20A 4Q1EA 3Q7QA 4Q7LA 2HT6A 4AG1C 4TT3D 1DADA 2OT3B 2FRWA 2KROA 3NBFA 2IUTA 2IHBA 3RNLA 2IYSA 4U5XA 3CR8A 1YZNA 4A92A 2AK5A 4EQ6A 2ZRKA 3TVTA 1ZM9A 4KLZA 2KRMA 4B3DA 4ESHA 1KMQA 1OSNA 3B82A 3U61B 1OLOA 1CJVC 2GEVA 4G3XA 2ZPTX 4RFVA 3ZJYA 4ACAA 4B6FA 3HPQA 1XU4A 5DYGA 1OKKD 3RDPA 4LC0A 2EW3A 1DEKA 1UM8A 2GNOA 1XDBA 2RMOA 1N6LA 3H2YA 1QHGA 2IXGA 2F1HA 2H92A 2Z43A 1TUCA 2FSGA 4MUBA 5CK4A 1P7CA 1SVMA 1NLZA 3KKNA 4KRTA 1NP6A 4L5BA 4C0QC 3THXA 5KHOC 4UXJA 3ADDA 5K8UA 3FVQA 1FP6A 3BJIC 1RJ9A 4A8JB 1OJLA 2BMFA 2JAQA 5J4VA 1TEXA 3V4RA 2V7QD 2ZREA 4TQAA 1ZUYA 1S1CA 2ANBA 3X1XA 2LJ3A 3GBQA 1P9NA 3MGCA 2DVJA 2GBLC 2C98A 1VYUA 2WM9B 1EGAA 4GMXA 1TQ2A 3FFBA 3K53A 3RS7A 2QUZA 3TUJC 2VSFA 5B30A 3QXJA 3RYTC 2PCLA 3TRFA 4PHHA 1ZLMA 1FTSA 1SSHA 3KJIA 1GRNA 4ZIRB 2IF2A 2EBPA 2AFHE 1MO4A 1ZUUA 1X69A 1LS1A 5FWBA 2XX3A 4IW3B 5L3SB 1JR3A 3U44B 1OH6A 4C2UA 1LW7A 2YINC 4XOIA 3O8RA 5SZHB 4TYWA 2JMCA 3CRQA 3U4QB 2ZR0A 4IDHA 5CLQA 2NZJA 2DX1A 4JSYA 1BO6A 2VHQA 3ZZTA 5JHHB 2YOHA 1GCQC 3QKRA 1KHTA 1YZLA 2N1BA 4QG7A 4F91B 3GLFA 1WDTA 2F1RA 2IS2A 2WIAA 1W70A 2WWYA 2YWFA 1I2MA 3QVUA 1TF7A 2RGXA 4GBQA 3BBPA 3SBDA 3M0QA 1PUJA 4DB4A 2BMDA 2I4IA 1UECA 1XZPA 1CSKA 2CJWB 3K09C 5HTKA 4ERNA 1IONA 3OEHD 1II8B 5IRCD 2ZI6A 2ZQ5A 1NMYA 3K0EA 2IT1A 3GJ6A 3MAAC 5CM9C 1UEIA 4GNKA 1FOEB 2NOAA 1E9DA 2WWGA 4POAA 1E9RA 2G3YA 2R6GA 3IQLA 2V7QA 5AUOB 1T5IA 3NEYA 1XP8A 2BMEA 4I1SA 3MMPA 4M1WA 1UPTA 2ZITA 3KFVA 4Q66C 3MJHA 1NVVR 4QGHA 3SQXA 5LBIA 2ORIA 4EFNA 1S9DA 2SRCA 2VP5A 1JQLB 2NO1A 4QM6A 3EZ6A 2CT4A 4TZ0A 3CF2A 3P26A 4AKIA 2O8BA 1UE9A 1NLOC 4OKSA 3IGFA 1KNXA 4HI0E 4LJ5A 1LS6A 2CCJA 4B34A 3UANA 3QNUA 1XBTA 4RD3A 1RLPC 2IWHA 2FSFA 1BBZA 5FBRB 1Z5ZA 2BTTA 3MWYW 5GJVC 3W8RA 5AUNB 2GESA 5ANRB 2ZM5A 2IYRA 1DS6A 4CEHA 5FH9A 1PHTA 1FTNA 1MABA 1F2UA 1W48A 2J0UA 3E5HA 4ZCIA 4NYMQ 4M1KA 3VS6A 1AWXA 3SE0A 1VYTA 1M2OB 1SXJE 5FUYA 2XTMA 1XCGB 4EAQA 5KUTA 3BFXA 1KAGA 4XVQA 1J2JA 1OFHA 3QF4A 4Q01A 1G8PA 5F2EA 1OH8A 1I07A 3TH5A 1JECA 1RKBA 3VHLB 4I99A 1TTTA 4AYWA 3TAUA 2ZYWX 1QHSA 4CEJA 3KQLA 3IUYA 5JWHA 4RTZA 1UKVY 4F7WA 3O8CA 3FDIA 3NHBA 4CGZA 1P3JA 3PIRA 2VF8A 3OEHA 2BZXA 4RZUA 2IUUA 2A28A 1P73A 2B8WA 1W6XA 2DJQA 4D82A 2IX3A 1NYFA 2AL7A 1SKYB 4Q7MB 4OK6A 1NYGA 2W2TA 3QIAA 1M34E 1E1QD 3W8NA 1S96A 4W9MC 1NN1A 2QTFA 5IXBA 1RYFA 1Z2AA 2OBNA 2NUZA 1R5NA 1Z9QA 4MGIR 3LX5A 3OIUA 4Q1FA 1A2BA 4ZDJA 2W10A 3D7MA 5JLJA 1G18A 1P2SA 2ORVA 2YNMA 1IXSB 1WF3A 3QF7A 4MRRA 2PT5A 1KO4A 3X1WA 4X8LA 3K70C 1E9BA 2H57A 4KYIB 2AR7A 3SHWA 2VL7A 4G5OA 4IEIA 1Z6XA 1Q21A 2ZEJA 4JVSB 3PR1A 1T91A 2A3RA 2BKEA 4LHZA 4LOAA 1WMSA 3U7HB 1L2TA 1Z47A 5TDHA 4BEJA 4ORZA 2Q9CA 1I4DD 4TLBA 4MDFA 3TR0A 4DBLC 1D8TA 4PPNA 2EQBA 2W6IA 2Z83A 1R8SA 4V0OA 1F60A 3P32A 4JPBW 4HVVA 5FR1A 2GTJA 4NP6A 4EIWA 1E0KA 4M9SA 1QWFA 5FOTA 3T12A 4DDUA 2FZLA 4R71A 1GBQA 1E79D 1GUAA 2A7QA 3ADCA 521PA 4EJSA 2J7PD 2GCOA 2A36A 3LBNA 3DM9B 3TGPA 5CDFE 2OAWA 1E32A 3JZMA 5JRZA 4YXWA 1T9HA 4JZ3A 4UNPA 4Q9IA 1IQPA 4EQ6B 2K5UA 3KB1A 4OMLA 3B6EA 3T5GA 1E3MA 4PR0A 1T8UA 2PX0A 1G291 1ZBDA 4HB4A 1E2NA 3VRZA 4PPQA 5EP1A 3SFZA 5A0FA 4IFBA 1KI1A 4L4UA 4CDGA 2Z5FA 3LXRA 2RGNA 4A0RA 2JT4A 3PENA 1P4SA 2LWIA 2W2VA 1Z08A 1CRQA 1XMIA 1L7VC 4G5SA 2RQTA 1W0KA 2ED0A 1WXBA 1HY3A 3FHOA 2J3EA 4GOJA 4KVAA 1LF5A 4JJZA 3VTKA 1ZD8A 2HDNB 4M9QA 1ZNZA 3H41A 3H1TA 5FR2A 3R20A 4HZIA 1QHIA 1RJ9B 2BJWA 1AN0A 2K6DA 1OXSC 1XEWY 4FI3C 1JBKA 2JS0A 1K4US 5FUVA 1LTQA 3B1VA 1W4BA 4ZI3A 3P4YA 4DSUA 1LNZA 1KOFA 2WWWA 2QSZA 4NONA 2OZEA 2V9PA 1OYYA 3I61A 4EPVA 2H5EA 4AKHA 2WJGA 1PRMC 4HCKA 1ABQA 1G5PA 3FTQA 1UTIA 3PUZA 3SN6A 2W6JD 4DT1A 4GI7A 2VRWA 4PSVA 2WWIA 2KXDA 4A36A 4DLWA 3JVUA 1Z8FA 5KU1A 2H18A 4UXIA 3NH6A 5P21A 5EE5B 2TMKA 1KI2A 3DOFA 1E79A 2AK2A 2D2FA 5JECA 3AVXA 3ZQJA 2EYZA 1E0SA 4LV8B 1E7OA 1UJYA 4Q19A 2F9MA 3SHFA 1NY6A 5H1YA 3AVYA 1A4RA 2ZJBA 3QEOA 2ZE7A 2G6BA 3IIKA 3OAAD 2RN8A 3QSYA 1IN7A 2FDCA 4IDNA 4NCJA 1X6VA 3GLFB 1J99A 5F3WB 1CU1A 4GPTA 3GJ0A 4K46A 1EFRA 4JJBA 1AWOA 3NVAA 4HAXA 3AEZA 5FUXA 1XF9A 4LRWA 2JLRA 3KJHA 1ODFA 2F1JA 4EFLA 4IIMA 2XOKA 3THYA 2ZRNA 4RTTA 1ZUKA 3SJCA 3R7WA 1S3SA 1UBCA 2AZVA 1IJEA 2KBFA 4C2TA 2FGKA 2G1KA 2NPFA 4HAVA 3LQQA 3AVOA 5J4YA 1ELOA 1PVOA 1JXMA 1XD2A 1BB9A 3HWSA 2BKUA 3RVBA 2OILA 1IJFA 2BC9A 3DL0A 2XTNA 5GJVB 3FWYA 1WE2A 4LK2A 1H8HD 2QPAA 3ZZUA 4P4SA 1DAKA 4EPRA 2GK6A 1YZKA 2ZU6A 4DEXA 3FMPB 4RSGA 4UJ5A 5J4HA 2XZLA 1V43A 5HCIA 1SRLA 4JLJA 2CREA 1T6NA 3QKSA 2OHFA 1MO5A 1IOZA 4ARZB 2O8BB 4DC9A 1H3HA 3IBGA 4KHZA 4QNMA 4K8OA 3RHFA 1U90A 2XNSA 5J40A 4JS0A 3GD7A 2RMKA 4G5RA 4ZDWA 2KR3A 5FPHA 4II7A 1KI6B 1NJGA 4K11A 3K0AA 3O8BA 4KV9A 3THWA 1PV4A 1GFDA 1SHZA 2IYVA 4DSTA 5C1BA 2C5LA 3A58B 3VS4A 4GDFA 1A7JA 2O8FA 4MQBA 4CEHB 2ZRGA 2J0UB 1MABB 1F2UB 1TU3A 4RTXA 1ONBA 2CHVA 2O0JA 4RTWA 2W83A 4IIOA 3P4XA 4PPFA 3CONA 4OYHA 3EHQA 3OAAA 3L0SA 5BN5A 1X8KA 3GFOA 2QMUA 4XD7A 4R0KA 1U9IC 2WPDA 3CX7A 3TMKA 2IXFA 4BFVA 2ZJYA 2B21A 4DCTA 5JBQA 1G4UR 3RNJA 1HSQA 1OF1A 3RLFA 1JNYA 1R5BA 2O0KA 2VYFA 2O5VA 3MSXA 2R9VA 2ZSBA 3BD9A 1M3CA 4LHYA 4MYHA 1Z07A 4V03A 5LB2A 4Z8AA 1ESMA 2CLSA 4AKEA 4X1VA 3AVWA 3DPUA 3KX2A 1CR0A 1CR1A 1JPJA 4OI2A 3CWZA 4DLZA 1HE1C 3LXXA 3THOA 2QU8A 2OG2A 2HUPA 1E9AA 3VNVA 5HCNA 1OW3B 2EYQA 3BORA 4WAUA 4BFXA 3AKEA 3TLXA 1RRPA 1PLLA 3K70B 2FG5A 4C0LA 1QLYA 3EG1A 2KYMA 2NO6A 3TK1A 1KIMA 1H8HA 2CL6X 3BIFA 3FKSA 4OQFA 3T06B 1FL9A 3ETLA 3SR0A 1FNMA 2GEDA 2OLKA 2C2HA 3CB4A 3ADKA 2GQIA 4HXJA 2P65A 4MKIA 4IVRA 4FMDF 2B7CA 1D2EA 3I1FA 5DN6D 5DI3B 3HU3A 4AFUC 3PXGA 2HJVA 4JL5A 2ZRMA 4CIDA 2L0AA 4RKFA 1E0AA 4PTLA 2ANCA 2PLFA 4ZDIA 3VS0A 4RFSB 3TUZC 4MITA 3EX7C 2ROTA 3AF1A 2WOOA 3CO5A 1QHNA 1IN4A 2NZ8A 2QT0A 4LHVA 3WP1B 3NBZC 2MSEB 3IHWA 2EGAA 4LHXA 2ZRCA 4LCBA 4D0NA 4EUNA 1N6RA 1C1YA 4Z1MD 2CHGA 5B58C 1OT3A 3BH6A 4P4TA 1XEFA 5EE9A 1WFWA 2JM9A 1ZRHA 5KPJA 3MRSA 1GKUB 4A0HA 3K9GA 4M4ZA 5KDOA 1GL6A 1KSJA 2ASEA 4PPGA 4XSHA 5SZKB 3SNHA 3GEHA 2ZSEA 3WYFA 4BRUA 1UEJA 2ZRDA 4AG5A 2BM1A 4IDQA 2JIZD 4LYJA 2OFXA 2GCOB 2H1LA 4AFSC 1H65A 2AWNA 1VDZA 1LB1B 4A8JA 3M0UA 1GL7A 1NBME 2FX3A 2Z4RA 3VNUA 2CE2X 1KGDA 5IT5A 1E2GA 2EGCA 1NEBA 1ZVQA 1CEEA 4QHYA 4FW9A 1HT2E 1W5SA 1Z83A 2HLDD 2NTYC 1AWJA 2WHXA 4LJ4A 5FBWB 2RB4A 3VRYA 3EZ9A 5FBLB 3T35A 4FMCB 2FOLA 2BMJA 3LLUA 4DCUA 4RD0A 4WZAE 2YC4C 1R7RA 4FWIB 3TVDA 1WB9A 2KB0A 3WBKA 2JLUA 1GRIA 1WQ1R 1ZM4A 4ITRC 1OPXA 1UKZA 4Q9HA 1MH1A 1E1RA 3I62A 3RWMB 4ZIRA 4RZXA 3SJBA 4PANA 1EX6A 2VP0A 3C14C 3AKDA 4YONB 2IHYA 2VQSA 1OXXK 5L3SA 4B2PA 4D81A 5HE8A 3NPFA 4OL0A 2J9RA 1A0NB 4KSBA 4D6PA 1SRMA 3U4QA 1MOZA 1HH4A 1LFDB 2GGRA 1XXHB 2IS1A 2JDID 4RD1A 2IWRA 4URXR 3WNDA 1YR6A 3GJ7A 3Q72A 4QRHA 1DAHA 3ZD7A 4GBMA 2IYXA 1X1SA 1G41A 2OESA 2J0VA 3R6NA 2HV8A 3LW7A 5BQ5A 4A6PA 4DSNA 2P4RA 4DT1B 2ZI3A 2RAPA 2A37A 2OCYC 2QEQA 1E2PA 1Z9ZA 3ZLJA 1K5GA 2CK3D 2A5YB 1YZTA 3AUXA 3K0FA 1HD3A 4GLMA 2KJQA 5CK5A 2Q3HA 2F6RA 4LJ6A 2C99A 1J7KA 4YMVA 1TX4B 1X6GA 1G8FA 1WXTA 1TQ4A 3PUVA 4F17A 3PE0A 4LZZA 4A2PA 5KSOA 3K1JA 2C9YA 3ZGXA 1AS3A 3G0HA 5F9FA 1E2MA 3PVLA 1U0HC 1XEXA 2EVRA 3EA5A 3MWLA 4AC9A 3EPLA 3LFUA 4C4PA 1IAQA 4PO9A 4BLOA 4CC4B 1G8GA 4LGMA 4GT1A 3ZYCA 2NWMA 2JJ8A 1CKEA 1ABOA 1SVOA 1N6IA 2FWRA 2VHCA 4KBGA 1CJKC 1ZU5A 4RY2A 3THYB 4LPKA 3REFA 4BFUA 4URVR 4TTRA 3AF2A 3DZDA 2FSHA 1GRRA 1E2JA 1UBEA 1S2MA 3LVQE 5AWFC 2VH5R 1RUWA 2BBSA 2DWOA 2XTZA 3AQ4A 2J7IA 2CNWD 3D31A 4XWKA 1I1JA 3EAQA 2PZFA 3KKMA 5JJIA 1CKBA 2J7KA 2ZJZA 3H4MA 5G41A 1NG2A 2IYUA 2WSSD 1X8LA 5KSZA 1DTSA 2EYUA 1MV3A 2J41A 2JDIA 2ZROA 3EIHA 3N5CA 3IPXA 1MKYA 4P4SB 4JKYA 2CCKA 4OMQA 2NGRA 3BOSA 1G4AE 3KFXA 3QXSA 5G53C 2OI3A 2ZUCA 4URUR 1UUEA 3QKSB 2CSIA 5E95A 3NC0C 1KK1A 2RGCA 2F43A 2HSPA 1N0VC 1XTJA 1IXZA 2P5TB 1O87A 5C46F 4IDOA 5AK0A 3SJZA 4NYIR 5D3MB 2D8JA 1ZC4A 3NXSA 1MT0A 4MKHA 3GPLA 2GKSA 2AKYA 2MCNA 2CK3A 3AKCA 3K0AB 3LY5A 2RQWA 5BW8A 3THWB 1R0ZA 2A5GA 2ZRFA 4LDJA 4MA4A 2IS4A 3PV0A 2AXNA 3CF0A 1VKJA 4RD6A 1BMFA 2GVDC 3KJEA 2YT6A 5E3HA 1HEIA 1T0HB 4ESVA 3KKPA 4KXFB 1WX6A 2QTHA 3KDSE 1U94A 821PA 4H1VA 4E07A 2IBMA 3GLIB 1KTVA 3VAAA 3QEJA 2NG1A 3H0FA 4QBHA 3TBKA 4BWYA 3EIEA 1HQCA 1XNJA 4F4CA 2OFWA 5CB8A 2WMOB 1CTQA 1GKIA 3E70C 2RGGA 1NN0A 2QGNA 4Q00A 5IH2A 1M30A 5FL3A 3ZD6A 2IL1A 1XPRA 1F6BA 2GCPA 2JATA 2RGAA 4NCHA 2D4HA 1HYQA 1KI8A 1TQ6A 4BFSA 1UJ0A 1QHHA 3WRXC 1SXJC 3A4NA 4WA7A 1R0YA 1H8ED 5JZVA 5TV2A 2GJKA 2IYZA 1FPMA 4TL8A 3W6PA 1U8AA 2ZS9A 2J1LA 4IOKA 2XEXA 2NPIA 2O31A 3QI2A 3EPHA 2GAAA 1F5NA 3UATA 1KAOA 4TLAA 5CLLA 2HDAA 1B07A 2GXAA 2ZAOA 3U23A 3IO3A 5JFGA 3VKGA 3EARA 3C5HA 2WICA 5J5CA 2FE4A 3F3YA 4Q03A 2OO7A 2ZXUA 2ESWA 3KXLA 4BLTA 4F92B 2HXYA 3U3OA 2FO0A 4PX9A 1RC8A 1JR3D 2IF0A 2ERXA 2GJ8A 5HCKA 1IHUA 1PZNA 4LI0A 1KJZA 2H16A 3GJ8A 4HAUA 5KNCA 1KI3A 1DAEA 1KO8A 5FOSA 1DPFA 2BDTA 4M1MA 4RD4A 4C0BA 3B13B 1YR7A 1NI3A 1T3LA 2VA8A 1H92A 4N0DA 4ZDKA 1G7TA 1VIAA 3CPHA 1T5LA 3NC1C 3QOFA 2WBLC 1DBSA 1OV3A 1EFCA 4WOPA 2PNIA 2L0XA 2QI9C 4FMBB 4TMXA 1AWWA 1CJUC 1MRNA 221PA 2YV5A 3T61A 4HAWA 3O47A 2HT1A 3CRVA 2GBLA 2DL3A 5TVKA 2BHRA 3EPKA 1EFTA 1E2EA 2KYBA 2LX7A 4NCKA 2F9LA 1VHLA 1QCFA 3UPUA 1W47A 2LZ6B 1QZXA 1N5JA 4J9CA 5FW9A 1AZTA 1UADA 4PQFA 1FFHA 3WHKA 1TU4A 2GBQA 3FJ5A 2DY1A 1XMSA 4RUGA 3CPJB 5BYJA 4B3CA 4L9WA 5CDFA 5GVSA 3UA6A 4DXAA 1TEVA 2PMKA 2WJIA 1TAGA 1WBDA 4KJZA 4QOSA 3VS7A 2MMGA 3RS3A 1H8EA 2Y8EA 1HUQA 4DVGA 2D8HA 1JAHA 1YZQA 1U3OA 5FPSA 3SDZA 2HBWA 3VS3A 4NL4H 2ZS8A 1XWIA 4WXRA 1GCQA 5HKKD 2JLQA 1SULA 4EKDA 4D4KA 5DNYB 1XTRA 1U98A 1J8MF 3A1WA 2I0NA 1KJWA 5DH9A 3NIBA 3R9XA 4JT4A 4LUCA 2ZR7A 1W2GA 4NPHA 1PWTA 2RF0A 1UKYA 5A5GA 2YOFA 1X6BA 3IHLA 2LCFA 1ZSGA 4XVUA 5AR1A 5FOUA 1U2RA 3K09A 2HEIA 5HZHA 1NY5A 3U7GA 4WVFA 2E87A 2JLVA 1EWQA 3C5CA 1DVRA 3D8BA 2BBWA 4Q1BA 1E96A 1C9KA 1YE8A 2JJ1D 3P1JA 4Q4HB 1CR2A 4D4MA 2ZRPA 4DLTA 3ONWA 4LYAA 3Q5DA 1UJ2A 1P61B 2EFCB 4PFSA 3W6NA 4QM7A 2GTOA 3IPYA 3PUYA 5TY0A 3W6OA 3QWYA 5M04A 3PFIA 4JLVA 4V0ME 4TYQA 1V1CA 4LJ8A 3K0FB 1Q1BA 4HAYA 4PZLA 2FEMA 1CRPA 2L3QA 2NIPA 2C9CA 4IJMA 1PKTA 1FMJA 4M8NE 4W5WA 1CLUA 3EHRA 1XTQA 2D2EA 2X19A 2QGZA 4TL9A 5CIWA 2FJUA 3FFAA 4B2LA 3K70D 3GMTA 1VG0B 3CNNA 4LY6A 1XEXB 2ZAMA 1Q12A 3A36A 4LBVA 2ROLA 2AKKA 1G8HA 2ONJA 4B47A 1MRSA 1KJYA 2AD5A 1VYVA 3B7GA 3CRRA 4IVQA 1Z22A 4BZPA 1N6NA 5FPYA 4ARZA 3BC1A 2GTPA 3QPUA 1L4UA 3GEEA 2GJSA 2FV8A 4UJ3A 4FN5A 2MSDB 3CNLA 5HKKA 2OE2A 2V55B 5CM8B 2JLSA 1KI6A 1YCSB 1YQTA 3KZ1E 1U8YA 2BM0A 1KK3A 2C96A 1P72A 4LYFA 4P3YA 4BPBA 5EP4A 4D0LB 3NDBB 1N2CE 1A5TA 2KT1A 2J5XA 4KITB 2R62A 1O3YA 1I2DA 1WA5A 1W5TA 1UKEA 2W6ID 1W7AA 3FKQA 4GZLA 1HJDA 1NVUQ 1QHXA 2JJ1A 2PH1A 2REOA 2MSCB 4LSGA 1K76A 4B3GA 4HSEA 3QUSA 2HYDA 4M2LA 2F43B 3WNBA 3WRYC 4TYNA 2PEZA 4PO1A 1Z0JA 5GJWB 4B3FX 3BB1A 1JAIA 5SZJA 5DHFA 4YXWD 2GHIA 1IXRC 4ASUD 5AUPB 4FCVA 2AHOA 3D6TB 3AVUA 2VBCA 4AYXA 3A4MA 1U0LA 5TB5A 3IO5A 1II9A 1VTKA 3NTUA 1EG7A 1G16A 4KFUA 2BOVA 2FGJA 4G5QA 1QBKC 1G83A 1CS4C 2DE0X 1XJ0A 2F3RA 3LW8A 4MH0R 1G7CA 1NSFA 1NLYA 1OXVA 1SXJB 4TQ9A 2OV2A 3EWSA 4JLKA 1W0KD 5JI3E 1JI0A 1K0XA 4HB2A 3UF4A 2A2ZA 5H8WA 2P6NA 5JRJA 3VS5A 5DI3A 5C18A 4QC2A 3VKWA 1V5WA 2YYZA 1LY1A 1RLQC 1CULC 5JS8A 2ODWA 2J0SA 3ASZA 2BJVA 1NN5A 4RFSA 3WY9A 2WIBA 1TUDA 4BECA 2ZUDA 4X8OA 1OB2A 2FPFA 5I22A 5TMPA 1S3GA 1QHHB 2O8CB 4C30A 1XD9A 1UBGA 2VHUA 3BERA 1VCMA 3K0CC 4I1OA 1E2IA 2GWHA 1JXOA 5L23A 4V0LA 3RABA 3NHAA 1MO3A 2DBYA 3SYLA 421PA 3WXMA 2IW3A 2YUPA 3F0TA 3NDPA 4GSYA 3UWKA 2O2OA 3ND8A 4A0GA 3QXHA 3MLEA 4WZ6A 3RBBB 4B48A 3REBB 3RS4A 4DRZA 3TAHA 3RC8A 1X27A 3E2IA 3L2OB 5DI9A 3PJRA 3AP2A 4NKRA 1T3HA 2GNCA 1OB5A 1QF9A 1E6CA 1UBFA 4ASUA 1EESA 1R10A 2W00A 4YMSA 3JZAA 4Q4JA 2JLYA 4Y0VA 1GNPA 1VPLA 2ZRBA 4E22A 4JBWA 4D25A 1K9AA 2AFIE 5JCZA 1T3SA 1EFRD 2X3WD 3R8FA 5E7MA 2VTKA 4LUEA 3ND9A 1FMKA 1KFZA 2O52A 4OBEA 2E1RA 3V9PA 3ZL7C 2XOKD 3O8DA 1Z0KA 2X8AA 3L8ZA 1NEGA 1G5TA 3KTAA 4XH9B 3RS5A 2WKRA 3WYAA 2JLWA 5K8TA 4R9UC 5E7JA 1GWNA 5J4LA 1ZJ6A 2WWFA 4B32A 2CLCX 4EPXA 1ZCAA 4A9AA 1G19A 2MMCA 4GMDA 3PVSA 2YZ2A 4ZO4A 1W0JA 5IK2A 2FEOA 3EA0A 1PLKA 3T15A 1JB1A 2YUOA 3DDCA 2YUQA 1NBMA 1GM5A 1XXHA 4HLUA 4I81A 1R6BX 1TUIA 1XTKA 2QORA 5J4KA 2C0TA 2H7VA 4QGAA 4JSTA 1NMZA 1PUIA 4Q9LA 2QNRA 2XJ9A 3WBJA 3CIOA 4S2EA 3CRW1 5B64A 2NO9A 2LMJA 4HUQA 3AB3A 1CP2A 2V4ZA 2Z6VA 1D9XA 1E2QA 1JEDA 3KB2A 3SYNA 1L8QA 4C0AC 3A98A 3U6BA 2QBYA 2DL5A 1B23P 1OHHA 4HLUC 2RH5A 1EFUA 2YJTD 3I3SR 2VPPA 3LNCA 3ZVMA 1OH5A 2ZU0C 1T4GA 2IYQA 4QGFA 1TUEA 3C8UA 3VU9A 3LQRA 3IKJA 4WW0A 2IUSA 5DSZA 2DWQA 2B7BA 4XD7D 4IXMA 3B60A 3VR3A 2WPDD 4JLBA 5CB6A 2FZ4A 2RKOA 1SEMA 2QMOA 2J06A 2O9SA 3NBYC 1DO2A 1UGVA 1EWRA 2LQNA 3IDQA 1E98A 1N6HA 3PCRB 1YWOA 3UIEA 2Q0HA 4M1TA 2YOGA 1KI4A 3TJZA 1NIJA 1M3BA 1P2TA 1SVLA 3GFTA 2PZEA 3ZH9B 2D7DA 3DHWC 1W44A 3VS1A 2H17A 4O0MA 3N70A 1IN5A 2QE7D 3I8SA 3WMGA 4C0SA 1VIYA 4E03A 3RWOA 4N3NA 3VR1A 2CVFA 3RS2A 3FKSD 4LN2A 3IILA 1WLPB 1Q22A 1ZU4A 2CHQA 4KYUA 2G6FX 1TADA 2BBOA 5G3YA 3PEYA 3AF0A 4M9ZA 1ZYUA 3EW9A 1D6JA 4URWR 1XJCA 5EE0A 4NYJR 5EXTA 2I1VB 5FL7A 4Q18A 2ZS7A 1U9IA 1HT1E 5D3MA 3CBQA 1Y57A 2IXEA 4TQUS 1M7HA 4EDHA 2LKDA 2DILA 3ECCA 4HEJA 2PTKA 1NSTA 2GZDA 1XRJA 2P67A 1ZW6A 4NMMA 1T0HA 2QMHA 4AFZC 4J9BA 1P75A 2Q9BA 2GK7A 2F2WA 2UZIR 3AP3A 2RPNA 1G6HA 3KUDA 3PG5A 2EKHA 5LB4A 3GLGE 4TZ6A 3GLIA 1N5LA 2V6IA 3M6AA 2WOJA 4A2WA 4XTCS 1TF5A 2PBRA 2WSMA 4UNSA 3UMRA 4BGDA 2ZE8A 1Y0MA 4IFEA 2IYYA 4Q48A 1NRJB 3W5IA 1IO6A 4LC1A 2JJ2D 3CPEA 2KXCA 4JJCA 4ILEA 1YN8A 4PO8A 1UDLA 1QHYA 4Q1DA 2QQ0A 5FI0B 4A1FA 1WIEA 1JPNA 4JBXA 1Z6TA 4G01B 3VX3A 2V54A 1EFNA 4P0TA 1UAAA 2OBLA 3QXCA 3LH5A 2XGJA 4PZZA 1ZNYA 2QROA 3BK7A 2BEKA 4QT7A 2QP3A 3B5JA 2FMXA 2GA8A 1UFQA 1SHGA 4BLPA 2EWWA 2QE7A 3DKVA 3HU2A 4QL3A 1GILA 3AUYA 1S9HA 2YWEA 2C8VA 5FUWA 4A82A 2C9OA 1KY2A 1VA7A 4UNNA 5CYPA 1E1RD 1NL3A 4BUJA 2KI5A 1NVVQ 4ZPXA 4AY2A 3F5FA 4NHOA 4BZQA 2R65A 4CF7A 2KBTA 4JJKA 1T0JB 1K5DA 4BQSA 4BZXA 1Q1ZA 1QVRA 1VG9B 1FX0A 4OMMA 1PKSA 3C4JA 3OEEA 3U7EB 1ANKA 2QT1A 2G77B 3TIFA 1KI7A 1G3RA 2X77A 3QE0A 4UNQA 3RAPR 3U6KA 2DYKA 2DB3A 5KNDA 3LV8A 3EG3A 3I4LA 4A15A 1G64A 2VO1A 1YP5A 1P2VA 1ZCBA 1ZD1A 2XITA 3OIWA 5TARA 3VHXA 3ZS8A 2JXBA 2IIMA 2ZRLA 5CYOA 3Q3JB 5KPDA 1AEYA 3AP1A 1I4TD 4DLXA 3AKYA 4OK5A 2ATXA 2PMDA 3ASYA 4PAOA 3KUCA 4LJAA 2ODEA 1NLFA 1X1RA 2G1JA 2WVJA 3AV0B 1OV4A 3DEFA 2X2EA 4B73A 1UHCA 1D5CA 3TR5A 1KIKA 2JJ2A 4PC6A 1FNNA 4XWAA 4JMPA 3O5ZA 2PX3A 4G5GA 1VG1A 1DOAA 3SEAA 5LPNA 2EYXA 1DARA 3RS0A 2O8EA 2YVUA 3VR5A 2ZJOA 1E9FA 1YJ5A 4JVNA 3X1YA 4CC7A 1GRQA 1JQJC 1OE0A 2PT7A 2ZANA 4Q4JB 1EXMA 1R2QA 3KXIA 4H1UA 4PHGA 4TTPA 5HR5A 3KXKA 3LD9A 1RVDA 2WV9A 3RSLA 4Z51A 1FQJA 2FRYA 5C2JB 5JHGB 3EWAA 4MRNA 3X2SA 1ZP6A 3KKQA 2K7AA 4RTYA 3KTAB 1E94E 4UQOA 5GJCA 3K9LA 4HAZA 3U3MA 3WMFA 4QJ3A 5DISB 3IEUA 4M1YA 1KO7A 2AXPA 2DM1A 2E9SA 2A30A 4OHWA 4WXPA 3LRPA 3QWXX 3T1QA 1DAIA 4PHTA 3S1AB 5CIQA 2FH5B 5AJYA 4J9HA 4MKFA 3WHLA 1P62B 1OFUX 5KSYA 5KSPA 5DO9A 4F4JA 4C9BA 3T1VA 5EP2A 4F4IA 3GLHE 1HV8A 2DF6A 1E0JA 2VSOA 1QG2A 1YWPA 1VG8A 2VHJA 2ZRHA 4Q4HA 2HYIC 4R98A 2A9KA 3M0TA 3A1VA 1PNJA 4UNRA 3KQKA 3V00A 2GILA 4OI4A 1G3IA 1YZGA 1AK2A 3CNOA 4HUQB 1IBRA 2ABLA 1XFAA 2QSYA 2PL3A 1BKDR 4NYMR 2EYWA 2GF9A 4QHTA 5FWCA 3J81k 3I5RA 2J6FA 1CBUA 4NH0A 4RJLA 4RZ2A 5EZ5A 4C0JA 2QBYB 1P5ZB 3H84A 4W5JA 1WXUA 1U99A 3I8XA 1GBRA 5FTMA 1SKQA 1BMFD 2H8KA 1W4AA 2WMNB 4BFZA 1AQYA 4RTVA 4DKXA 3NMZC 1TNDA 3HYTA 1RRCA 2O9VA 4MRSA 3VU9B 2GJAA 2YWGA 4B2IA 5JSZA 1TMKA 2F3TA 3VMFA 2SHKA 2I3BA 3FGNA 1M6NA 3QKTA 2BEJA 4IVPA 5IHPA 4B44A 2K79A 5F98A 1QRAA 1SXJD 4LE9A 4YQFA 2J6KA 3GLHB 1PJRA 1GNRA 4KFTA 2D7CA 1NG1A 2XNDA 4FCWA 2XB4A 1F48A 1OIVA 4OMOA
chains in the Genus database with same CATH superfamily
3QQPA 4EMKC 2XMRA 3L4SO 3M49A 5A4JA 4DTIA 1L5VA 3OT1A 3G85A 3K9CA 4OGKA 2ZR8A 3C3KA 1SUAA 4D3DA 3RIGA 2ZYDA 4YK7A 2BDUA 1Y8ZA 3K92A 2JLZA 1W94A 5BNTA 4KK4A 1NVXQ 4HKTA 1AKMA 4IKEA 3PHJA 1QK3A 6Q21A 1V5GA 2Z3VA 1FLDA 5H70A 3ZG6A 1U0JA 2ZBRA 3EVTA 5JCJD 4TXNA 3RRMA 2B86A 2XDQB 3FCOA 1FQKA 4ZVOA 3W6UA 4FCTA 1WW3A 4LF8B 3U4MA 2A6PA 3AY7A 3VR2D 1ODLA 3FCXA 3GEDA 5MN4A 1AUVA 5EE3A 4GOOD 1B73A 4F60A 2C4HA 2QA5A 4RV4A 2ZM6B 3GIBA 1OJ7A 3TSAA 4F7UB 3I37X 2WB4A 1VMEA 4QOJA 4P9NA 5CAEA 5CKEA 2D54A 2V1RA 4Y9DA 4P08A 1N3BA 2TYSB 3JRXA 1A1SA 1M1XB 1SXIA 2DLPA 1YVDA 2DAPA 3GYGA 1E3IA 5H7XA 5CVIA 2CP6A 4AK9A 1B3RA 3F49S 3VVMA 3JVEA 1SG5A 3T7RA 4K2AA 1Y9AA 3IE1A 3GVHA 4GYKA 1Z8NA 3C3EA 2WT8A 3CR7A 3H2ZA 2PZ1A 3C0CA 2CLDX 2LZ0A 3O8OB 2WSEE 2WU0A 2I67A 1GARA 2Q2WA 3V8VA 5DYIA 4FOSA 3GZTB 2HSWA 3WE7A 3SQMA 2FG0A 2BKXA 4GIBA 2A4KA 1BU1A 3F6EX 4US1R 2OOKA 2TECE 3BE5A 2GZHA 1DZ3A 3CKLA 4NLLA 3GU3A 2H29A 3V8RA 4NQRA 3DE2X 3PD1A 3WNZA 1D1PA 4J6YA 2R00C 1M6YA 1T3ZA 3OHSX 4ARAA 1BKBA 4IDGA 3LLSA 3RCBA 1P92A 4UASA 1A9QA 5TR9A 3M9XA 3M2TA 4BEVA 3VPSA 4M53A 4YALA 4XU1A 2QD5A 1GEGA 1V7ZA 2QTGA 1SKYE 1TA4A 1AU9A 1QVFA 2QOEA 3QENA 5KO2A 4BLSA 1K8AU 2AC4A 1VDMA 1QZ3A 2DJIA 3ENNA 1N75A 4B75A 2C42A 4AWBA 3USCS 3UQZA 3MYRA 2X51A 3BIOA 4BWFB 4IQ4A 3GLGA 4GLLA 3W90A 3GJYA 5IUKC 2MI6A 4EO9A 5IK2D 3VOBA 4E7HA 2EATA 5AVQA 1M2KA 5FV7A 1W1FA 2NYRA 1XB2A 3G2IA 1PZGA 3IODA 2Q3DA 2AIRA 5GIPE 3CISA 4P2BA 1OHHD 3WNCA 1H22A 4MLPA 3OU6A 5CDSA 4FSSA 2YASA 4S1WA 1YRAA 2C4VA 2UVPB 4N0EA 5GAMe 1V8ZA 1ZOLA 4IHQA 2BV3A 1NJ6A 4LYEA 2A9OA 2QRZA 1UWLA 5AVUA 4DLRA 1GFIA 5CLGA 3NH9A 1VLHA 4M9XA 1QFMA 2ZK7A 1VPDA 2C9BA 1LC0A 4YMIA 2F90A 1DKOA 3Q7PA 1P7VA 3W1WA 1Q11A 3ESZA 2XB6A 1SB8A 1XMPA 3ET5A 2DRIA 3EMBA 1UIRA 5B4VA 1K63A 1A71A 1JR6A 4ZZ1A 5ECYA 2B2CA 1N2GA 3D0KA 2HF7A 4JIMA 2I3DA 3HDYA 4F2PA 4YVFA 2W6OA 1XD8A 1VBFA 4HRXA 2OOSA 2Y1CA 3TOZA 3W2GA 3BSSA 1KYIA 3P0HA 3V8NA 1G5RA 4JOSA 2VKNA 1WP9A 4R51A 2XVYA 1VQ6Q 4U7GA 5IULC 3QEAZ 3G71Q 3K0SA 3ZWDA 4IIJF 1R0LA 3D0QA 3ULKA 1BCRB 2BY4A 5TGTA 1MEOA 3ORHA 4ZAZA 2AX4A 1Q83A 2YZKA 3EZ2A 4ZI2A 5D1HA 4GRIA 1AD5A 2ACWA 2W9XA 2J3LA 5B57C 3A9CA 4OI0A 3UG6A 2ZJ2A 1EUZA 3A1EA 2JBAB 4HNUA 4DV4B 3EIFA 4N1AA 3DLTA 4LV6A 1PSZA 2YWXA 1E3SA 2WWTA 4ZCLA 5BR4A 5AVKA 3ERCA 1YASA 4NECA 5TJ9A 4CMGA 3CD6A 4D0GA 4AS2A 2UZ1A 2M0YA 1PU2A 1Q95A 3FBWA 5GANh 1KD1U 1V11A 1NVMB 2I1WA 4FOTA 4M1QA 4YI5A 5FAKA 2ZIWB 4G37A 4EG1A 5K2MA 1OXTA 2DFNA 1L6RA 4M6WA 5H9VA 3QBYA 5DSTA 3PL5A 1U4NA 4UM9B 3NAGA 1ZINA 2HAEA 2D5LA 4BJ3A 2BCGY 2BYTA 3BMOA 2PU5A 1N4AA 4DIEA 3A70A 4EZEA 4ARUA 3L05A 1P5JA 4P4UA 4BMCA 2HSDA 1VHWA 4MDEA 4Z4HA 3T7TA 2XQFA 4D2IA 2MOXA 1VE5A 3L2WA 2DNUA 4C0FA 1HETA 3ZLTA 3M1IA 4Z54A 5JRDS 5C7YA 1XOIA 5CXQA 2IHNA 4KFRA 2IOHA 2Y6UA 5U4XA 1JALA 4EA6A 3HMQA 2HJWA 3CCMQ 3KXDA 2YXPX 2JI7A 3EIQA 5FPTA 2O5CA 2AN1A 3BDUA 4CLEA 3RFFA 3GLSA 3TN7A 1NR7A 2HF8A 3TSWA 1GTG1 2NTNA 1XD2B 2Q5LA 3BEOA 2XXAB 4QSMA 3RU7A 2VJMB 3GLIE 4N7MA 2ZTVA 5HIKA 2EYYA 2O20A 3KOWA 4ZEXA 2Q4EA 1YKFA 1F0KA 3JB9I 2RHBA 3UBTA 1UJ4A 2RGWA 2VZEA 4MW1A 4XDGA 4P5NA 4BB6A 4B84A 3DMRA 1MX1A 2WJVA 3QVGA 2QQSA 4L8GA 4J3NA 1WCIB 4TYMA 4YRKA 1ONPA 3CXCP 2XNCA 1QVWA 3DHVA 5T5QA 3BULA 3BJZA 4B9EA 5KQRA 1Y4SA 2EFDB 4OLBA 3LT2A 1C4XA 3RUCA 2GF2A 1MFPA 3AK4A 1AKQA 4RVCA 3SKVA 1F5SA 4EX7A 4KR3A 2AQ8A 2ID4A 4K3UA 3GH1A 3LL7A 4AG1C 4ND6A 5C5IA 1YZNA 1I2ZA 1DJMA 1R74A 1XU4A 5DYGA 3AEYA 4UBKA 2N47A 3Q8MA 1AKNA 4D3XA 3LIIA 2R2GA 3P96A 4ND7A 4DBVO 1VOMA 3O7WA 2Z8YA 5K8UA 3TECE 2HHCA 1EBBA 5FU6B 4TQAA 4K9KA 3WB0A 1UXHA 1UGSB 2D1RA 5CGQB 3K53A 5AXBA 1C0PA 2D4AA 2GEFA 4GM4A 3DMFA 4FDTA 5HJ5A 1GG8A 3Q6MA 4I8DA 1M2GA 1YHYA 1P2FA 1LW7A 4G0YA 5CLQA 2GEKA 2H52A 5B1HA 4GYYA 3HBFA 2ZJ4A 5EHIA 4FN4A 3Q8WA 4C7VA 3SFTA 3VPDA 1U2ZA 1UECA 3FPKA 4LZLA 5IRCD 3O31A 4EGSA 1ZO8A 5IAOA 3F4BA 2WWGA 2VXEA 5ARDA 4GM0A 4WY2A 3UJCA 4D44A 1KEEB 2MSLA 4G07A 3OE1A 3C5VA 4P7KA 1UE9A 1NXVA 3A1FA 5BR1A 5KCHA 1J9GA 4LJ5A 3CGGA 4EL0A 2YRDA 3N0TA 2FKNA 3KT8A 4ZCIA 1I51A 3OH8A 4B6PA 4GUDA 1M2OB 5FUYA 2XTMA 5BSWA 5ESWA 4IF4A 3ZXUB 1QHSA 4YPFA 4CEJA 1AO0A 4TRJA 4CM6A 4ZYVA 4GY5A 1YXMA 1PT5A 2IX3A 3TTUA 2JCBA 1JIKA 1JUDA 1M34E 4TRMA 3IJ5A 1K6JA 1MXHA 2GLTA 6REQA 4ZP1A 3ZDFA 3LYIA 1XZGA 4Y18A 3O93A 2EKOA 4ZVSA 3OQOA 2VPIA 1Q21A 3ZI4A 5IBPA 3OKAA 1JSRA 1CZHA 3HKEB 1RJWA 5D2CA 4PPNA 2CXRA 4NENA 3VH2A 4EGFA 3T12A 4DDUA 4R71A 2BZGA 1GUAA 1A88A 9LDBA 3HYCA 1TSFA 2G5CA 3T5GA 2PX0A 2PQ0A 2D5IA 5JNWA 4LS3A 4O29A 2JTFA 3S4YA 4PPQA 4IFBA 1T6ZA 1QLHA 1PT8A 5DASA 5SYNA 4M9QA 2OWEA 3EXFA 3O4FA 2QW0X 2PS1A 4CF6A 1TK2A 2H5EA 5KJCA 2QA4A 1A95A 4TXJA 3FWZA 2AC2A 4GI7A 5A71A 2VPQA 4FYVA 3EVGA 3V7SA 1DUVG 4DNQA 3O03A 3ZQJA 5KX5A 4Q19A 4K6OA 2O2CA 1BCMA 4MQ5A 1J99A 2WZCA 1WEHA 2QRGA 2EQUA 1XTUA 5A4MS 4Y1GA 2FSVC 2FEPA 1UBCA 2FGKA 5JNUA 3OEYA 2DUMA 1PVOA 3HWRA 4KPGA 3PICA 1OU4A 1YBVA 5HHTA 2F48A 4OTZA 1DAKA 3K1ZA 2TRSB 4GGMX 4DC9A 1KBOA 4QNMA 1BQEA 3QVWA 4INPA 3ENZA 2GAIA 3O8BA 4B3HA 1VGQA 1GTMA 4BBZA 4IIOA 4A16A 4OYHA 5BN5A 4UZSA 2X58A 2QVYX 3UAYA 2O0KA 3E7WA 4AKEA 5FBHA 4I5DA 4IIDA 1RR6A 4NBKA 4WKPA 2H4YA 3THOA 1FA9A 3CC2T 1PLLA 4DQKA 3TK1A 2VDNB 5CVUA 1H8HA 2RJFA 3CEJA 1V47A 1IHXA 3ETLA 2DO3A 2V7GA 2GQIA 4IH9A 1NM5A 3SGLA 1FDSA 2L0AA 5LMUB 3VS0A 4MS4B 2E49A 4HGYA 4LKOA 2BEUA 3IHWA 4Z1MD 3IT0A 3MRSA 4NPCA 2SICE 4KIFA 5I8ZA 4E2XA 4X7PA 4LRQA 1GL7A 1E2GA 4RTSA 3BD7A 1GLVA 3KETA 3T35A 5DTMA 3UICA 1A0OA 5BYBA 1U5CA 3P9YA 1WPYA 3ZE1B 1E1YA 2VQSA 5L3SA 3RWBA 3F46A 4D81A 1YS7A 2BZSA 1IEQA 1AF7A 5AI8A 3ZD7A 2HV8A 3STUA 3RIYA 1NFFA 1FXUA 1ESZA 5IM4A 2MHCA 1TQHA 1QH9A 2Q3HA 4IIJB 3WLAA 4M7AD 5KQGA 1X6GA 1Y4ZA 4F17A 4NCXA 5JAPA 5EZYA 1IAQA 5EMKA 3IDSA 4CC4B 3KOOA 4L5YA 3HVKA 2G28A 3HA2A 1L7NA 5E2AA 4KBGA 3VISA 4URVR 2AE1A 2PIDA 1E2JA 1M54A 1NQWA 4FZJA 4R3UC 4MLZA 5AWFC 1NMSA 5E1OA 4LFBB 2CB9A 3KAQA 3EY9A 1D07A 3W9UA 3EIHA 4P4SB 2RM4A 3IPXA 2WSBA 2HMAA 5G53C 1GD1O 1B41A 1QOZA 1UUEA 3EF3A 4EY8A 4R05A 4P7JA 4C01A 4DNXA 3SF8A 4XDYA 5D3MB 4PGHA 5DXJA 5CT5A 2MCNA 3RROA 4MP6A 1ND5A 1BU5A 2V96A 3QYAA 1S02A 2OV1A 1FDIA 1RACA 1E92A 4ZV7A 4Y91A 1BRTA 5B1IA 3I01A 1J5XA 1UBKS 4QARA 7ABPA 5FWXB 4TL8A 2DGDA 4I5GA 2QIPA 2IZ6A 4FZVA 5CURA 3KSMA 4C92G 2PH5A 1XXLA 3LC0A 2ZBVA 4WK2B 3KXLA 3UAWA 2YWWA 3EZYA 1OZ2A 2FO0A 1PT6A 4OJMX 4AM8A 1M0TA 1TK9A 2YV4A 5TE9A 4GX2A 1WOMA 1IZ8A 4N0DA 3U7RA 5LU8A 2Z04A 3HDJA 2QG9A 2BF4A 3OX3A 3CIFA 4IUBS 5JADA 3PC3A 4L9RA 3L42A 4B5KA 3HXKA 1N5JA 3DE3X 4M1EA 4L08A 5TVGA 1J7JA 1T1JA 4QGSA 1DKQA 4Q3KA 2JCGA 5KNDH 2QHXA 4KAAA 1P81A 2Q5EA 3WR5A 4B79A 1HNNA 1YQDA 1URPA 2A57A 1BVHA 1X6BA 1KOJA 3IHLA 5AR1A 1EWQA 4DM4A 1CJCA 3QIIA 2GFAA 2VJNA 3RSGA 1UJ2A 1OLXA 3E4DA 5M04A 1JFVA 2ZB4A 1JKJA 4MP3A 4B80A 4FVTA 2ZAMA 1YCHA 1MRSA 4WCFC 3FRHA 2E89A 5JBNA 3CUKA 5EIXA 1YQTA 3DHYA 1KK3A 3FG9A 3GNSA 2HNKA 1L5WA 5B6PA 1Q0HA 4DLKA 3QX7A 2ZT7A 3HY3A 4KO3S 1FUIA 4B3GA 2D1QA 2O05A 4PFQA 1Z0JA 4EFDA 3K32A 2BIVA 4CCWA 1A5AB 4YFYA 1PJ8A 4Q9NA 4KXXA 4UE6A 3I64A 3V9AA 2P3LA 4KGZA 1Z75A 1TVEA 4U9IS 3DDWA 4XDZA 2RK1A 4P81A 2YCLA 4C7XA 3GGOA 3RABA 2AOXA 3N1UA 1MO3A 4B4WA 3SYLA 1RM4A 4GSYA 4JYMA 1ZH2A 1U02A 5JS1A 4N82A 2R7KA 3JZIA 4EHFA 3DVRX 2PV0A 2QN7A 3EC7A 2FPWA 2I8CA 3NJ4A 1KFZA 2JANA 2O52A 5T4FA 4YIKA 1NEGA 1G5TA 3EVBA 3IEIA 4JJAA 1E7RA 3PI7A 3OOEA 3D59A 3CCEA 1QB8A 4PG4A 3TL2A 1W4LA 3H3FA 5JALA 2YXYA 1PUIA 1A5ZA 2WG0A 3TIGA 4BNLA 2LMJA 1CP2A 4DA7A 1KE2A 3ZVMA 1DO8A 3RUXA 1IFXA 1EDOA 1HNWB 3LX6A 2NVWA 3IDOA 2DTHA 1IZYA 2QMOA 3RFCA 4AL4A 4M8LA 1O94A 2LQNA 4RTJA 3GAFA 3MK31 3AI3A 2HJHA 2PZAA 3KDAA 1IN5A 3I8SA 2PK3A 2OHHA 4GBED 5CDTA 1RWKA 1NTOA 2QSJA 3EVZA 1ZYUA 2I4OA 2I1VB 3D3NA 4YAIA 1J2YA 1IULA 1ZGGA 5KKNB 2DILA 5DNWA 2Z3ZA 1G9SA 3BIWA 3Q2IA 1WVGA 4QFCA 3AKZA 3P7MA 4KRYA 7REQA 3D5QA 4UCFA 2RC6A 3TL3A 4WACA 4KUHA 2EZ9A 4LC1A 4EDFA 4PO8A 2QTCA 1BJRE 5IEBA 5FI0B 3ZEIA 3N53A 1WHHA 1DBIA 2B1JA 3BK7A 3JWHA 3K1TA 2XMQA 3KCNA 4UBOA 2BH2A 3GEBA 2C8VA 4BX2A 4DLBA 4JIGA 5ALLA 3PYXA 1L5YA 3M81A 3OEEA 1FRFS 1G3RA 1XQWA 3I4LA 2D1YA 1MMDA 5DGHA 2P62A 2ZRLA 3M6WA 4J3FA 1AEYA 2ZBPA 1ODTC 2FUCA 3UOAB 3GVIA 2CJPA 4PAOA 3KUCA 1LPNA 1UFVA 4AJJA 3DEFA 2E12A 4LMBA 1MOPA 4EF4A 4I3FA 3F6YA 4KSYA 1ZI8A 3RUHA 3SEAA 1DARA 3U0VA 4JVNA 3F8WA 3KXKA 3MMNA 2PX2A 1ZP6A 3ZCQA 3KTAB 1SCAA 5DISB 4QPCA 3RNOA 2CXPA 1JDTA 4W8GA 4C0ZA 2LCCA 4MKFA 1P62B 5KSPA 4V0QA 1R8JA 2I3GA 1HV8A 4PLTA 2VSOA 2BT4A 3VO9A 4GKJB 2P40A 4Q4HA 1RHRA 1IBRA 1Q50A 4ND8B 2X9QA 2CY0A 1BKDR 1R0SA 2WTBA 3UCEA 1WXUA 3NC4A 1IAVA 2H8KA 4MUKA 3V1YA 3QKTA 1Y4DE 1QRAA 1OLSA 3ZCUA 3GJTA 2EX4A 3ZC3A 4KN6A 2FR8C 3DS8A 3L0ZA 3FCSB 4M77D 3A4TA 4J43A 1Y63A 4OAQA 3NBMA 3SP1A 3QPWA 2GFUA 3L0OA 4Z7JA 2D9TA 2R6AA 3FYHA 4TLDA 3VS2A 4A63B 3KTOA 4GBJA 3L8HA 1D0ZA 3OETA 1BEZA 4K81B 4X62B 5DHAA 1C8BA 4F38A 3BFKA 5K4HA 3PNPA 4NC9A 5FTLA 1V76A 4YRAA 3OFSA 4IWNA 3B38A 4IO0A 4M3NA 1WRBA 1ENOA 2BZ0A 2OWDA 2NU6A 1UJCA 1G8KA 1F3LA 1EINA 3JQPA 4RPGA 1U3GA 4BKQA 1R5OA 4OU4A 1QFZA 2MR5A 4DA6A 4J9IA 3H9GA 3WL7A 1EWTA 3T5BA 4B4DA 2UUOA 2ZIAA 4HXEB 3GF4A 1NKSA 3S2EA 3JWGA 4WE3A 1UINA 3MCTA 4G1UC 5AO9A 3FHCB 1JTVA 3K9QO 4PCVA 1QYIA 4OY3A 1BXGA 1TIPA 3ZY3A 2WM8A 2A5JA 2YVAA 4EX6A 4DB2A 5AKGA 1FNDA 1C3EA 5DYNA 1BFUA 2V58A 5FLXA 2ZRIA 4EUEA 4DUGA 5AKIA 2IY7A 1UBTS 4IGIA 1VA5A 2Q3FA 1UC8A 4ZGWA 1PFVA 3QPVA 3D4LA 5DW0A 3I92A 1VKOA 5GMKj 4L72A 4B31A 1ZD9A 2CP0A 1KDPA 4NJMB 4EF6A 1T8RA 4PFPA 1JQEA 3ASVA 5BWNA 4N5IX 3T99A 4J9VA 2IU0A 5ESXA 2M0OA 4IOJA 4IMJB 4MVJD 3COVA 5KNBA 2QG6A 4QDTA 2IPLA 3U5ZB 1Z2EA 4L15A 4EG4A 3ME5A 1F14A 4B3BA 1ITZA 2BZYA 3IE2A 2C5EA 4IIFA 3TQFA 1DMSA 4KL8S 4FJ2A 4GPBA 3QJYA 2QVLA 3ZGYA 1E5VA 5EKSA 3JYQA 5DX8A 4P33A 4QPPA 1NJIC 2DTEA 4M75C 4C0HA 3EVFA 3QUTA 2EWVA 5KH6A 1VHTA 4BP3A 2X7XA 2PAFA 5I8WA 1KYTA 3G0IA 4PX5A 5CDGA 3GEGA 2WYUA 2P2DA 1QVPA 1D2CA 2B8EA 2CMHA 3LK7A 4TRNA 2DPXA 5AJZA 1K6EA 4FDAA 2EQMA 4IQ8A 2Q5OA 1ZK4A 2NTEA 3AUTA 3CPWP 1P8JA 2ZTLA 2ERYA 3VJKA 1ZNXA 5DM2A 2X0IA 4WN3A 3NTHA 3EC2A 1M8MA 3AB7A 1EAMA 4D4JA 3DVAA 1HYOA 3CF6R 2DCUA 2J3KA 3KR9A 4HLQB 1WEKA 3FNEA 4YP9A 5IF3A 4ZJPA 4ARSA 4OUKX 2GXSA 3H4VA 4RPCA 3WQSB 4PYKA 3RYIB 1G5QA 4CW7A 3SEZA 5FPKA 4F9GA 4QNRA 4O3FA 3WVEB 2H48A 2C4KA 3L0BA 2C4NA 5F52A 4JAVC 3ZNNA 2BDEA 1LI5A 4D9JA 4ZT2A 4OMPA 5C3MA 4C8QE 1Y34E 1RI1A 2GBIA 1S8FA 1AIPA 1E1CA 1WI7A 1ZS9A 4ES6A 2Z1NA 1W25A 2ESRA 2B1RA 3D3EA 4G5HA 4TSFD 1LSJA 4Z89A 2Q3CA 1HA3A 5G3ZA 3V48A 2VCEA 4KODA 5LJ3d 3GH3A 1RQGA 2JGJA 3HU5A 4KU4A 3IVXA 4BJ5A 2Q5IA 2WJAA 5IUNC 4TMKA 1YR9A 2IOQA 3B8EA 1DDOA 2RGEA 4PKCC 4UEJA 2QU7A 1M5Q1 2CNOA 4HB3A 4C7MA 2HDHA 4BFYA 2FJ0A 4BAZA 3PE4A 3EBLA 5IDVA 3DBIA 1K8YB 1PS0A 1KEUA 3BREA 3QKWA 1CJMA 2DPYA 1NXPA 2VYTA 1OILA 3MAGA 4FR0A 4B6SA 5IXJA 1WBBA 3PL1A 1TGYA 4OQLA 4EO7A 2Q9UA 4YDRA 1TLLA 4ZMSA 4FR5A 3HCPA 2VQDA 3I73A 3VJRA 1VYHA 5A5EA 1ND6A 1EFAA 5ALOA 2REBA 4U39A 4EW2A 2GCXA 4WNCA 4NMLA 4C6SA 3OCWA 2VXYA 2O2EA 4U6QA 2OHIA 3ND7A 2FZCB 2C5SA 2NV0A 2EJCA 4QVGA 1U8ZA 2CZ7B 1CQWA 2NXJA 4LVUA 2JA1A 3ROPA 2KSQA 2A78A 4CMIA 1GIAA 3BZBA 1KIAA 2GHRA 3KZMA 4H6PA 3FA2A 4UUQA 2EPDA 5HW0A 4HVUA 1E2FA 1KZ4A 2DHQA 3HYLA 5JSFA 3MFYA 3WG9A 1TM1E 1X1EA 2OVBA 4EMKA 2JMAA 2FPGB 1Z68A 1GVNB 3LKBA 4IUUA 3VOTA 1KC8C 2AWOA 3ILHA 1QVFS 4Q5WA 4F1KA 4W7SA 1Y0BA 1KQOA 1O6ZA 4OP0A 3ORRA 3HVHA 2P2LA 3BFVA 4XRGA 3HN2A 4WMLA 4FFOA 2YZ7A 4TUYF 1RRGA 3D7NA 5KVCA 3MTIA 5BVGA 2HCKA 3PFGA 3CVYA 3I35A 1MMFB 3RRZA 2WAOA 4HZUB 3L79A 1EE1A 1ENZA 3UXMA 4RE5A 2DL8A 3IEVA 4WCIA 4EYQA 3KLOA 2BGWA 1D1CA 1YA8A 2FMTA 1WS6A 3UENA 1BD4A 3E9NA 2XV1A 1T8SA 5LJ3g 1SVIA 3L8YA 3AM1A 2QVZX 3I6QA 2QRMA 4MWTA 4Q12A 4PY2A 1D9ZA 1JJFA 3E05A 3CZPA 2WNHA 5SZIA 1WQ7A 1ADYA 1TF2A 2WSIA 3HYSA 1K73C 4WLFA 4AFQC 2DEUA 4J4BA 2PDAA 1D2HA 2PLWA 2Y1WA 3FTCA 2J46A 3QEKA 4D8KA 3RREA 1REQA 2GYYA 3HPRA 3DA8A 2KT8A 2GZRA 3Q7QA 2PZBA 3VR4H 5F1KA 2IUTA 3AI1A 1OX8A 1LZLA 4AJHA 4W4TA 1IQRA 2Y9PB 1GAXA 3NNSA 4C22A 5KKCA 4B6FA 1HZZC 1OKKD 1GPKA 2B8AA 4IJ5A 3CCRT 1YV9A 4BE2A 4R84A 5J1TB 2A94A 1P7CA 3PC8C 4HGPA 4E5MA 2R87A 2PRIA 4QD3A 3FVQA 3ZIUA 1VL2A 2F8LA 4Y3UA 2I0FA 4U2GA 3KT0A 4BO8A 2HMTA 3PX3A 1TQ2A 1XN1A 3MIIA 1N0HA 3EQZA 1SZJG 1RI4A 3ANSA 4RWZA 4MWEA 3KAJA 2XU8A 4P35A 3PHGA 5F4ZA 1VHJA 1KARA 4TYWA 3CINA 5I51A 4BNFA 4RTMA 4F91B 4JB3A 4CM8A 1ZA1A 1RTKA 2HL6A 3D8UA 3NM5A 2FWAA 1RCUA 2XCLA 2C9MA 1GLGA 2R00A 3G6WA 4KUIA 2CJWB 2HO4A 1NW5A 1IONA 1JYEA 5CM9C 1RXUA 1S7GA 1E9RA 3AOGA 2G3YA 3LQKA 2Q28A 2WIFA 4Q66C 1NW4A 3LHDA 2MOKA 2O8BA 2YNMD 3C6XA 1MB4A 1GXIE 4X84A 3I55T 3V3TA 1Y4AE 2GKOA 5AUNB 1ZK0A 2ZM5A 1DS6A 3Q9UA 3SSOA 3ZDEA 3KPWA 4CCYA 4IMPA 2V0GA 1J2JA 1RKBA 3PFSA 2WQZA 2XT6A 4MXDA 3ABSB 2B7LA 3HXMA 1LTKA 3FDIA 5GMKe 3JQDA 5ENVA 3I0ZA 4QVIA 4KN9S 1SQ0A 5JMPA 4E2FB 2BISA 4Q7MB 4G0VA 1MF7A 2HWXA 4MJ7A 1UKCA 1P1FA 1Z5VA 2QRUA 4O4HF 5JLJA 2PT5A 3GXOA 4DL9A 1RFGE 1ECLA 4JOBA 3E9YA 4BCBA 2Q9CA 2RHRA 3L1IA 3E84A 4EIWA 1G5HA 1E0KA 4XAXB 3DNPA 1J6UA 2JF0A 5IT4A 2YN0A 4UC0A 2J7PD 4AMGA 2VDLB 4BNMA 4PX2A 4Y0NA 5AI9A 5KTNA 2HIHA 4JQYA 1CQZA 3G9ZA 5A0FA 1KI1A 1WSAA 1XMIA 3FHOA 4NE9A 1GA6A 4W5NA 4MQFA 2ISSD 2Q4BA 4B4OA 3PFCA 1ZX1A 4TQGA 1M8JA 5KNCH 2D2XA 3PUZA 3LDHA 3JARB 4P58A 4A36A 4U8HA 5I9TA 3QUIA 1ILEA 1JLRA 4TKUB 2QW8A 3M59A 2F9MA 3S8EA 4HHEA 2RN8A 3Q7RA 1ULUA 4C06A 4JJBA 1NZJA 2IHVA 3KR0A 3PNOA 3HSYA 5KYWA 1NQVA 4FYHA 5L40A 1UKBA 1E63A 5CX1B 3DV0A 2BC9A 3FWYA 4PJOD 1C9JA 1V43A 2OHFA 4CI0B 4E7KA 4J4HA 2RK6A 3UO8B 2RMKA 4B83A 4CQLA 1M2VA 2Q0QA 3D2BA 4R31A 3WRVA 5LJ5d 4ALJA 1GFWA 3DYBA 3RNJA 2PFGA 3RJ5A 1VQNT 1P4RA 2CVZA 1W88A 1SFRA 1CY4A 3EQ8A 5E1DA 1NJ1A 4U7WA 4HQ0A 4JXZA 5GAJA 2KMTA 4EYSA 4G9BA 4UVDA 2Z8YM 1HOTA 2AMYA 5D3KA 4AFUC 5CLJA 3P9QA 1G6KA 4A10A 1IY9A 2R8YA 3LHKA 2QXYA 1C1YA 1SC4A 3ZLBA 3GIDA 3N86A 3LUPA 3DB1A 3O75A 5A1TA 1H6BA 1P4AA 2YN4A 1E1MA 3ZD6A 2WLSA 3EVCA 2BMJA 4I6JA 1G2IA 5JMWA 2QS9A 1WB9A 4NU6A 3DE0X 2FVXA 1E1RA 2DFVA 3I62A 5EQJB 4ND1A 1EDZA 4PANA 3C14C 4KTVE 3RTCA 2J3IA 4OAOA 2KQWA 1A0NB 5GGXA 2IS1A 4CXMA 1C7ZA 2IYXA 1N6AA 4KRFA 1ORVA 4R1MA 4JBLA 1UBUS 4OXYA 2PUEA 2II6A 5FJJA 2WTAA 4L2IB 4G4SP 2VF4X 5D00A 4QDXA 1CCWA 3M6UA 4MINA 4I5EA 1NR5A 3VTZA 1ZI6A 4OGWA 4DXHA 3KOZA 1NG2A 1X8LA 4JP5A 3DEZA 1VE7A 4G4IA 4HQFA 4CKEB 2G3RA 1PF7E 2RGCA 1GO2A 4OQ4A 4BMYA 3M34A 2GKSA 2GPJA 3GFBA 1P4GA 1JA0A 1CUXA 4W5RA 1ZK2A 1DMRA 1X6OA 4MDYA 3H0CA 3JW8A 1BKSB 4MHSA 1IMJA 4TKVA 3DFFA 3E23A 5CB8A 4QNNA 1TD9A 1YD7A 1XPRA 3LL4A 1GGHA 1TQ6A 2QRVB 3QVSA 4BFSA 4BKUA 1DEAA 1O97D 1CFZA 2NPIA 2GAAA 1KAOA