4DEXA

Crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav2.2 i-ii linker.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
289
Chain Sequence
EDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit beta-2
publication title The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
total genus 95
structure length 289
sequence length 317
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4dexA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dexA02
2W2VA 5L3QA 1WXUA 3VS4A 2J6KA 1U8ZA 1L7VC 1G2BA 4OQXA 4KFUA 5HTKA 2GQIA 3O8RA 1E7OA 4R7ZA 4DVGA 4C7OB 3ZIAA 3FKSD 5E7JA 1MR3F 3IBGA 1N6IA 2G0NA 3H4MA 3LBNA 1WXTA 1II0A 1S2MA 4PQFA 4DKXA 2FEMA 4QC2A 2K7AA 5EZ5A 2CCGA 1KDRA 1E0SA 1II8B 2X1VA 2OEPA 1D5CA 3HPQA 2WWGA 4KI0A 2DNUA 4IXNA 4NPHA 3G0HA 3GJ4A 3RC8A 4IEEA 3VU9B 3VS0A 1WXBA 1OF1A 4XIGS 4C0QC 1OT3A 2D4HA 2DF6A 1J99A 2GKSA 2ZRJA 4RTUA 3R9XA 1XXHE 2BTTA 2DMOA 2JGNA 4LOAA 1DAIA 3RRMA 3EG1A 2C0IA 2BCJQ 3UG7A 2FPDA 2A28A 3LX5A 2A30A 1D9XA 3K0EA 4N0EA 3T15A 4BFZA 2P6NA 4BECA 1JEGA 3EARA 1U5SA 1AWOA 2D8HA 1GSIA 1K5DA 1VYTA 4Q66C 2A3RA 5D3MB 4DCUA 3EA5A 3FMIA 3W6PA 3DEFA 3TR0A 4B3XA 1W2GA 1QG4A 3OIUA 2Z83A 3JZAA 3THKA 5CB6A 1OB2A 1Q12A 5J47A 3ZGXA 1IN8A 1KSHA 2R44A 1VHLA 4OK5A 4RTTA 2EQBA 3RANA 5CK5A 1KK2A 2WWYA 2YC2C 1PHTA 2L2PA 1IN6A 4M9ZA 4BASA 1XTKA 1CKBA 1G3RA 4KLZA 5BXQC 4DWJA 1VG9B 2BBWA 1RJ9B 1H92A 3BERA 2DL5A 4KSBA 3RC3A 1P72A 4IDPA 2R6FA 8OHMA 4CGZA 3T1QA 5E3HA 1AZEA 4XVRA 4BQSA 1O87A 5FWBA 2PX0A 4A15A 1P60A 2IYUA 4HUQB 2A5FA 4C0JA 3ND9A 3UPUA 2OAQ1 1Q20A 4GFDA 1RRGA 3TSWA 3RS4A 4C0BA 3VS6A 4Q4JA 2QA5A 4F7WA 3VHLB 5CLQA 2EVRA 5E95A 1KI9A 3UATA 2ZVPX 3BB4A 3OFND 5AJYA 1XCMA 1WBBA 1R4AA 1XZQA 3BAFA 3NDBB 2GXSA 3IO3A 5KHOC 2JDID 4BGDA 1DAGA 1E79A 3D8BA 3A98A 4JLOA 4DLYA 3RNLA 5JFGA 2PX3A 1MABB 2FRWA 2YV5A 3AKYA 2EBPA 4TTQA 1D2NA 3DKPA 3KXIA 4RD2A 1OHHD 1L4YA 3U60B 4TYWA 3K9NA 5IH2A 2WSSD 1G6OA 3HJNA 4H9GA 2AWNA 4RJLA 4TMWA 4ESHA 3UA7A 2WJGA 2J7PA 4B6EA 1W70A 1E6HA 2X2EA 4FINA 3AB3A 1RC8A 4TWZA 4B3FX 3EC2A 3KB2A 1ODFA 2JLXA 3IGFA 3CH4B 3UIEA 1QCFA 1W7AA 1GKIA 3AVXA 2OCPA 2J0VA 1M7GA 2V6JA 4XD7D 1PKTA 4B3BA 2ESWA 2Q0HA 4L9SA 4YC7A 2QPOA 1LCKA 1OE0A 2NUZA 4CC3A 3AVUA 4OK3A 5EE9A 4BLRA 3AGPA 3IQXA 4FWIB 4J9EA 2QEQA 3LA6A 3H41A 4NCJA 2DPXA 5G40A 4DDWA 4QHSA 2A7QA 1UEJA 3KFVA 1R10A 1U8YA 4U5XA 1E4YA 4OBEA 1X8LA 2O8BB 4QL3A 4Q9KA 3IEUA 4WBSA 5GJVB 1E9RA 2DLPA 5GJWC 5KTYA 5BYKA 3HU2A 4EFMA 4JJZA 3AUXA 1UECA 3QF7A 821PA 2HCKA 1W1FA 1V43A 3SFZA 2QDLA 1YZGA 5A0FA 5C2JB 3I62A 3QUSA 2ZI3A 5BQ5A 3TNFA 2CHVA 3QVUA 2NZ8A 4QGFA 2ORWA 1NSTA 4ITRC 1HSQA 1WFWA 4HAYA 1Y57A 1UKZA 3GJXC 1XBTA 2J0UB 3OAAD 2QBYB 3CX7A 4KVGA 1IOZA 3QBTA 3M0RA 2ZROA 2ZJ8A 4QHTA 5IXFA 2CK3D 2ODNA 3DKVA 5F3WB 2IS4A 1M1YE 1ZLMA 4X1VA 1NF3A 4HAWA 2JLYA 3A8TA 1Z8FA 1OKKD 4JLPA 1FTSA 1HEIA 1MV0B 4B2IA 2A78A 1D9ZA 4A92A 1XXHA 1XEXA 3RSOA 2VA8A 4URXR 3VS7A 1FMLA 2UKDA 2WJJA 2DM1A 4B3GA 1DAHA 3H1TA 4J9GA 2BCGY 2QRNA 3MFYA 1RLPC 3NWJA 4Q4AB 1TAGA 4V0KA 5E7MA 5IDVA 4A6XA 4D4MA 3K53A 2R2AA 1YQTA 5DI3A 1NRJB 2KRNA 3IBYA 2BM0A 4LWZA 4EFLA 5FL7A 3W3AA 2JXBA 1N5LA 3WNCA 2QSZA 2A9KA 4EDHA 3OZXA 4GT1A 3THYB 1G3IA 2GRJA 1G20E 2KNBB 2WIAA 2GXQA 2B92A 1UKEA 2FZ4A 2RKOA 3KJEA 4DT1B 2OBLA 3QG1A 4GBMA 2GEDA 1W48A 3QF4A 5KNCA 1E9FA 4QOSA 2IS6A 3UMRA 4E22A 4QBFA 4EQ6B 2IHBA 2W2TA 5ECAA 2AX4A 4P3YA 2AD5A 4WVFA 2WIBA 1ZBDA 2ZSAA 3CWZA 3ZZTA 1ETUA 1W6XA 3PITA 4JLDA 3EG5A 4NP6A 4IDOA 2KSQA 5JSZA 2QZ4A 2EVWX 5DISB 4TT3D 4B73A 4P4TA 2CUBA 2RGAA 1T8UA 1DO0A 4R0KA 1ZX6A 1EGAA 4IIMA 4EIKA 3BFXA 3QVVA 2QL6A 4V0ME 5TMPA 1E96A 4C7OA 2YNMA 1RE0A 4O25A 3ADCA 2RB4A 4G3XA 1JR3D 3RS0A 1WP9A 2BV3A 5GVRA 1KHTA 1SULA 1R5OA 1YR8A 1II8A 1LV7A 3EA0A 1N2CE 2WZQA 3MCAA 2BEJA 3VU9A 2NQ2C 4OQLA 2JT4A 2V3CC 1YHNA 4BEBA 1ZD8A 1TEXA 1LF5A 3NHBA 3GMTA 4HYYA 1NEGA 3CPHA 3D6TB 1UBGA 3FMOB 4QHYA 2EYQA 4RZ2A 4AD8A 1T9HA 2FFAA 1NSFA 2OG2A 3LO5A 1BYIA 3I1FA 4LI0A 1XMVA 3QE0A 3Q9LA 4MKGA 1KO1A 1DAMA 2XEXA 4FMBB 2V55B 5KDLA 3QKSB 2GVZC 2F55A 1E2QA 1E2MA 2GZHA 1FUKA 4LC0A 2ONKA 3L0PA 2Q3MA 3Q3JB 2ONJA 4US0R 1NLZA 2XOKA 5FPSA 2J41A 3K09C 2WSMA 1KI4A 3I5RA 4AWXA 3NTUA 4I1UA 1QG2A 1ZUNB 3UANA 3MJRA 1TL7C 3GP8A 2R65A 1WLPB 1XPUA 3I32A 4NYIQ 1S9HA 4Z51A 2ZU6A 3EIEA 4EPYA 2Q3FA 4V02A 2PEYA 2DL7A 2MSDB 3MLEA 3KZ1E 3OEHA 3DM9B 4BUJA 3G82C 3QEJA 3BB1A 1U99A 4MYHA 3VKGA 4RFVA 2D0NA 5B57C 1OH8A 2IIMA 3D7MA 4IDNA 4JJDA 3OHMA 3A58B 4GPTA 4HUTA 4QM7A 3EWSA 4HZUB 1NM7A 2D2EA 5KOYA 1GFIA 1OV4A 3PFIA 4MYTA 4Q7LA 1KI6B 2C5LA 1XOVA 3RVBA 4LJ4A 2J05A 3U7HB 1LB1B 4XTRA 1I4DD 3OEED 4PC7A 4JLVA 3PCRB 1R0XA 1YKSA 3ZVMA 2VPPA 2B8TA 2HT1A 2PJRA 2FA9A 4Y0AA 3IILA 1MKYA 3FKSA 4J9DA 1MABA 1UDLA 4Z8AA 4GP7A 1PRLC 1NP6A 3SBEA 2VKNA 5EE5B 2IUTA 4NE2A 1RIFA 1UDWA 2WPDD 1SVOA 3M0PA 1HYQA 5A4JA 3VR4A 2I0NA 1QKXA 3K70D 3CX6A 2JATA 4QM6A 2CE2X 2VP4A 2IYTA 5JCPA 3MRSA 1TUCA 4DRZA 2BOVA 1RI9A 1NVVQ 2KR3A 2O0JA 3QNUA 4Z1MD 1P9NA 5LD2C 4K46A 2GXUA 2GCOA 1YZKA 3BC1A 3CR7A 1E9CA 5LB4A 2J7KA 2O8DA 2HJVA 1VG0B 2AL7A 3QY0A 3T5GA 3Q5DA 4MKFA 2BZ8A 4EFNA 3DHWC 2PLRA 4RY2A 4IOMA 4F17A 4QNMA 1X69A 2QE7A 2ZXUA 5HCKA 2LCFA 2OLKA 2QPAA 3UXMA 2QG6A 1F2UA 1XMIA 2CJWB 221PA 3TUZC 1KJYA 2FOLA 1S8FA 3QXHA 4M22A 2J06A 2L0AA 1U94A 2MCNA 1XD9A 3REBB 1R0ZA 2P65A 2EFDB 4FMDF 2IT1A 1E6CA 3NHAA 4DDTA 1QHNA 1IHUA 2DFKB 2MMGA 1FZQA 3EXAA 3IIKA 3ZYCA 1UHCA 1BH2A 3F8TA 1MT0A 1KOFA 2H16A 1NMZA 3LBIA 3OIWA 4LV5B 4M1KA 1PLKA 4BE7B 2YOGA 2GZDA 2ATXA 3C5HA 3VMFA 1N5IA 1TQ4A 2XNSA 5FBWB 2FGKA 4MH0R 4Y92A 3WNDA 1Z06A 1NLOC 4LHXA 3V9PA 2WTUA 2ZRDA 4DIDA 2OV2A 4XVUA 1MRNA 1SQ5A 4IRUB 2EWVA 4V0MA 1G3QA 5FOVA 3U3KA 3WY9A 4CT4B 1JR6A 1F6BA 2ZANA 2QBYA 1P5ZB 1U0JA 4B44A 4MQBA 2ENMA 4HLCA 4R2HA 2OM2A 5C4GB 2GBQA 3EHRA 2G6BA 3CPEA 3OFNA 3AVPA 3CO5A 2XSZA 5L3QB 2A5GA 2ODWA 2XZOA 3AV0B 4QXAA 3OIVA 1GL7A 4YQFA 2HXYA 2JDIA 1ZUYA 1JR3E 2C98A 4US2R 4HVWA 2ZITA 4Z89A 1H8KA 1I1JA 3IO5A 4N3NA 4GMXA 4ZCMA 1B23P 5IT5A 3M0QA 1G16A 1K1ZA 4G5SA 3T5DA 4Q4AA 3H0IA 3V4RA 2ZJBA 4M0LA 2XMFA 1OHHA 1E98A 2GZAA 3EW9A 4KFSA 1SPKA 5HZHA 2AN9A 2PH1A 2JMCA 4MRSA 2WSSA 2AKKA 5ELXA 4RZUA 1S1CA 1YZUA 3GLHE 4GOKA 2PMDA 5BYJA 1WIEA 4I4LA 1VA7A 3EPJA 1R5BA 1GUAA 1M74A 5EJEA 2QSYA 2IYWA 3THYA 2ECKA 3NH9A 5JJKA 4D0GA 2RQRA 3VR5A 2J6OA 5K8TA 2G6FX 2ZRCA 3IQLA 5EUMA 1J7KA 2DFNA 3RWOA 1EX7A 1EFNA 4QGAA 4OYHA 2ZIAA 5GJCA 4XD7A 2DL4A 1BK2A 1D6JA 3M0TA 1A82A 1FNMA 2WVJA 3CF2A 3IHLA 4LHYA 4ZI2A 2QAJA 5KSYA 4HATA 2V6IA 2JM8A 3QKRA 2ZREA 4DSNA 1YU9A 2GEUA 1OJLA 3T35A 1T3SA 2JASA 1JQQA 1ZUKA 3EAQA 3QI2A 5GVSA 3TAUA 3U3JA 2A5JA 2ORIA 4DBLC 3HU3A 3BJIC 4ORZA 4J9BA 4WIAA 4OMOA 1G5RA 1FTNA 3KKOA 2QORA 521PA 1Z2AA 3LXRA 2VF8A 5FPKA 1EG7A 5C18A 1FUUA 4JZ3A 2Q6TA 3ZH9B 1FYNA 2FMXA 2AHOA 1N6KA 1UAAA 2IW3A 4PC6A 1I4LD 4BLTA 4DUGD 3DPUA 4EPVA 1K9AA 3OE7D 4KFTA 3QPUA 1VG8A 3IPXA 1NL3A 4FSSA 2ATVA 4KXFB 4PQRA 3SN6A 1Z0JA 4F92B 3CWQA 1G17A 4ARZA 1KI8A 4E07A 1VTKA 1JECA 2H1LA 2EYYA 4G1UC 4TLCA 4B3DA 4B2LA 4DB4A 1GRQA 5K8UA 1WCV1 4ZO4A 4TL8A 3WMFA 5B58C 4AKHA 4DEYA 1KY3A 3OAAA 4Q4JB 3B9QA 1P61B 1KZGB 1UBEA 2CK3A 2FX3A 2MSCB 2W0SA 3EWAA 4RCYA 4X8LA 3EX7C 1OIVA 1GP2A 1L4UA 5KU1A 3LRPA 1XPOA 3RNJA 2ZJYA 1VDZA 3FVQA 1OKKA 2VBCA 1HT2E 3Q72A 1TEVA 2GESA 2BKUA 3CRVA 1AGRA 5JMTA 2ZE8A 2JM9A 2ROTA 3SI7A 2F9MA 3K9HA 3C7KA 3FB4A 4ZI3A 3QKSA 1DBSA 1M27C 2IK8A 1K0XA 2FPMA 4M1SA 4D2IA 3SQXA 3DZDA 3U3MA 3THWB 2PLFA 3C4JA 3GFPA 4DLVA 4BFYA 2OSBA 4TLBA 1TU4A 3ZS8A 3KKQA 2NO0A 5TARA 3QSYA 2WMOB 1GCPA 4JLKA 4TMXA 1X86B 1ZCAA 3Q7QA 4F4JA 1DO2A 1EFTA 5DO9A 2RMKA 4URZR 5L3VA 1R8QA 1IY1A 2DYKA 2EYWA 2FJUA 2O0HA 2ODEA 3HP1A 4JMPA 4RCZA 1W0JD 4Q01A 5DH9A 1KAOA 1BU1A 1I0CA 3Q8XB 4E03A 2C04A 2G88A 4B3CA 2HCJB 4PC3A 4ZKDA 2QM7A 1YRAA 3LBHA 2J0QA 4JJCA 1ZM7A 1IY2A 3HPRA 5CM9C 4C0SA 1YR9A 4JBXA 2BMJA 1W1WA 2JJ8A 3BRWD 1T4GA 3KTAB 1YZQA 4A8JA 2XB4A 3MWLA 2B8WA 2QGZA 2V1QA 3UWKA 3QXJA 4HB2A 5JWOA 4FXPA 4HZUA 2GWHA 1P9WA 2V8OA 2ZRMA 5M04A 1KI6A 1EFHA 4MGYR 4Q4LA 3SJBA 1KSGA 2WJIA 3EIQA 5DIFA 3GFOA 1Z63A 4B32A 2Z0MA 2ZI7A 4TTRA 2V4ZA 2EU8A 5BW8A 1GNPA 4Q00A 4WZBE 4AURA 3ADDA 4HLUA 4HAZA 4QKQA 2CL7X 3NIBA 4Q7JB 4FWTA 3ZLJA 3IIMA 1OFHA 1JR3A 4DLUA 4KU4A 2FSGA 2X77A 4Z88A 2KXDA 3A1TA 4FCTA 1Z9ZA 2KXCA 4K81B 2HEQA 5EP4A 2FPLA 2OXCA 4Q1CA 1A2KC 1OFUX 1GKUB 1DELA 2P67A 2QU8A 2NMVA 4JVLA 3ADKA 1Z29A 2UZ3A 5FTLA 4J9CA 4GI7A 3CZPA 2QTVB 2DB3A 1AD5A 5IHPA 2J46A 1EWRA 2GHIA 1FFHA 5G3ZA 1KO5A 1NMXA 3GLHA 1AZSC 3PUVA 1W47A 1NIJA 2MOXA 5H68A 4JT4A 3QPWA 3O8BA 3A36A 4Q1FA 5GJBA 2XJ9A 2H17A 1XEXB 4W5WA 4LBWA 2FFBA 3N5CA 1P75A 3TLXA 4V03A 3CF6R 3VS2A 3IQWA 4IVRA 4RVCA 1B0UA 3PVLA 4DDVA 4EUNA 2EYUA 5DI3B 3LQQA 1WRBA 1RKBA 2XOKD 2FGJA 4NYJQ 1CXZA 2IXFA 2DL3A 1TX4B 2QRZA 2VP9A 1GDDA 4JKIA 1CRPA 1NVUQ 4ZDKA 1EFUA 5JHGB 1W4RA 4GZLA 3SR0A 2YWGA 3B1XA 1G8HA 4AYWA 3VKHA 2R6DA 4QNRA 3EGUA 2D7CA 3KQUA 4GOXA 3SS8A 2K3BA 2RN8A 4PANA 3QF4B 4MUBA 3T06B 5C46F 4B71A 1Q57A 1Z6TA 1CTQA 2VO1A 3C5CA 1G19A 3EZ7A 4WZAE 1TQ2A 4F16A 2EWWA 4B43A 4UJ5A 3WHKA 5AJZA 4LN2A 1C4OA 4CEIA 5FW9A 2ZAMA 2ZSFA 1EWQA 1YWOA 2YUNA 3SU8A 4QRHA 1I2MA 4OHVA 4LV6A 2OESA 4IKEA 2CEAA 1KJWA 4BZQA 2W6ID 1OXXK 1VCMA 2IHYA 2GCNA 2RQTA 4ILEA 5CDFE 2KYMA 2WJHA 3AH8A 3EASA 3OEEA 3ZS9A 4M21A 3ONWA 5CK4A 1MV5A 1P2TA 1P7CA 3GEIA 1U3OA 1F60A 1HA3A 1KI7A 1UBCA 1NVXQ 1NN0A 4A9AA 3WNBA 2FO0A 1KDOA 2GA8A 4LJ8A 1ZU4A 2NOAA 3I35A 2WPDA 2CMKA 3T1VA 2CXXA 1TNDA 2QQEA 2H5EA 4TMTA 3U2QA 1DTSA 2KYBA 3VS1A 1G9XA 2W6JD 2ZRLA 5L3SA 4V0LA 4RD1A 4LE9A 1P73A 4KSCA 4PPNA 4MDEA 4Z1MA 1N3BA 1AZTA 2ZR0A 4ACAA 2ORVA 3QJYA 1ABQA 4BFSA 2FG0A 2VP6A 1F3OA 3FTQA 1XPRA 2RF0A 4OHYA 1KO4A 4Q9HA 1MO5A 3GD7A 2GBLA 3R9IA 4CF7A 1OXTA 2XXAA 4TZ6A 2PCLA 4B6FA 1HURA 1CJVC 5JECA 2QE7D 4X8OA 5J5CA 1E2IA 4RTYA 2WKPA 2F2XA 2IS2A 3QKTA 3W6NA 2O8EA 2CUDA 1SZPA 3LH5A 2OLJA 3W5JA 3LW8A 4B34A 4ZIRA 2VP5A 4AC9A 1AN0A 1Y3AA 2BJWA 3WHLA 2YWEA 4G5QA 4IW3B 1WB9A 2J1LA 1YVDA 2XZPA 3L0SA 1IO6A 3TBKA 2N42A 4S2EA 2CE7A 3B5JA 1JU5C 3VX3A 1U9IA 4C4PA 3J81k 3T34A 2CHGA 4C0LA 2H18A 5KO2A 4IFEA 2ZSDA 1IN7A 1G21E 1GAJA 4IOLA 1E9DA 4KBGA 3A4MA 3H86A 2OFOA 5EXXA 2DBMA 3LD9A 5IRCD 3GEHA 3UWOA 1N5KA 4EJSB 1YNZA 4XOIA 1CS4C 4J9IA 2FNAA 3EG3A 3GJ6A 4CEJA 2GAOA 4AG5A 1U2RA 3TQCA 3CONA 2QN6A 2XSZD 3TSZA 3PEUA 2DFLA 2LWIA 3AF3A 1KI1A 3GJ7A 4OJKA 4BFVA 5A5GA 1UEIA 2QENA 2WV9A 3VX4A 4PSAA 5JS7A 4L4UA 2FWRA 1XTSA 3MWYW 1W44A 2IXEA 2F2WA 3OESA 2CH4A 1G7RA 3KB1A 4LBYA 2YYZA 1JO8A 1EXMA 4R71A 3THXB 1A2BA 1ZNZA 1Q21A 3W5IA 2PT7A 2FRYA 4R9UC 2GETA 3THWA 1NBMD 5B64A 4AYTA 2ZSBA 2YHSA 5SZIA 1H3HA 1CEEA 2PEZA 1SVWA 3NBZC 2FU5C 3VQTA 4RZ3A 5E7IA 3SEMA 3Q7PA 3W3ZB 1VCOA 1UDXA 1AOJA 1BO6A 2WMNB 2SHKA 1G8GA 4E09A 2VF7A 4WOPA 2WAXA 1A1VA 4AI6A 2HV8A 2GCOB 3PVSA 3W6OA 1P6XA 2FZLA 3QG5A 1DAFA 4QGHA 3PUXA 2QPTA 3LWNA 4UNNA 2O8DB 2BC9A 2D1XA 3PR1A 3PJRA 5KSPA 3X1WA 4KYIB 3A1SA 3C0CA 3KTAA 4KHZA 2LJ3A 2YWHA 4R2IA 3I5YA 4RTVA 1F2UB 2I3BA 3KFXA 2GDJA 3KQKA 4A36A 5TV2A 3RS2A 3ZZ0A 1FOEB 3OF5A 5IK2D 1WX6A 1GOTA 2KT1A 1S1NA 1DG3A 4KYUA 4BEJA 4J9FA 4BFWA 4D25A 2ZU0C 3MUFA 2XB2A 5FUVA 4M1WA 1H65A 4LJAA 4CZ2A 4XSGA 3BH7A 3VS5A 1AZGB 1VYUA 4TN1A 2X3XD 2YUPA 3ZQJA 1LTQA 4DUGA 3OE7A 2JLVA 3LLUA 2GK7A 4MITA 2HDNB 2QT1A 2XGJA 1G41A 4Q5IA 1B07A 5CDFA 1WDTA 1OYWA 3UMSA 5FOWA 1ZMXA 4P33A 5TY0A 1ZRHA 5KSZA 4UNPA 1HV8A 4TL9A 5JBQA 1XZPA 2J87A 4KBFA 1G291 3ADBA 3LX8A 2ZAOA 4ZCLA 1RRCA 4I99A 1CBUA 4NZYA 5LBIA 4CRWB 1E9BA 3T1TA 1ZNXA 1P3JA 3TMKA 3I8SA 2VH5R 2CSIA 1CKAA 2DBKA 3NPFA 4MRPA 5KNDA 1NMYA 1OXVA 3B2EA 5J4HA 1P4SA 1KJZA 3K0CA 1P9RA 1K6MA 2ZRGA 3B9PA 4P4SA 1W5TA 2HCBA 1CRQA 1D8TA 4C0AC 2R9VA 5GJVC 1PJRA 3U44A 2VP0A 1AIPA 5CIQA 2M51A 2D2FA 2ZYUX 4OMLA 4FCVA 5FPYA 3ICEA 3AVOA 4DC9A 1JEEA 1NKTA 3LY5A 4A0FA 1GG2A 3KUDA 5FUWA 2BKEA 3SDZA 5DLQC 3ZVLA 2BZYA 3IPYA 3V00A 1GCQA 1UFFA 4PFSA 2ZUCA 5KYKA 2ZRBA 3CB4A 1N0WA 2RGEA 4LUEA 5KNBA 4TLEA 2FPKA 2AFHE 1WA7A 2YUQA 1G83A 1W0JA 1YR6A 3BORA 1ZIOA 4FN5A 1E94E 4W7SA 4QG7A 2PJZA 4G5RA 1LY1A 2W00A 3KJIA 4GLMA 2CCKA 1X1SA 3SE0A 1CR0A 3CRQA 4L8GA 5J40A 4HAXA 1E2PA 4DLTA 3AM1A 1P2SA 4HLDA 4NTZA 1QRAA 1L2TA 2I1QA 2YC4C 3NC1C 3I61A 3FYHA 3L8YA 3QKRB 5CJ2A 3ZVRA 2XAUA 2IYLD 1GL6A 4NMMA 1E9SA 1UJYA 3B1YA 4JLJA 4PHFA 1XMJA 1S0UA 2RH5A 2BBSA 3P1JA 4NCNA 1S9DA 4BRUA 4MYUA 1ANKA 4JYBA 1N5ZA 1A7JA 2QP4A 1U81A 2P0EA 2VLIA 3PEWA 421PA 3TUJC 3GPLA 1T5IA 1QWEA 1PLLA 4HI0E 5GADl 4HAUA 3GLFE 4GMDA 1J8YF 4NYMQ 2NO1A 2YDLA 4ARZB 4O2RA 2EGCA 1TF5A 2IX3A 4KRTA 5EP1A 3AF1A 1T0HA 3ASZA 5JHHB 1X2QA 1SHGA 1CP2A 1E1QD 2CLCX 1Q3HA 4NL4H 4YMSA 1Z5ZA 3AP1A 3QEOA 2YOHA 3BOSA 4X8MA 1SHZA 3BB3A 2OZEA 2O8CA 1QHHA 2NIPA 2WWIA 3VR1A 1GL9B 2ZQ5A 1G1MA 1W36D 1IXSB 1NBME 1OH7A 3VRZA 1TADA 1XX6A 3LNCA 4LPKA 3E1SA 5J4LA 1OYYA 3ZDQA 1DOAA 2C77A 4P32A 2AD1A 4I81A 2YZ2A 3BFKA 5JJLA 1W4CA 2WJVA 4J9HA 1KO8A 2JS2A 3LW7A 2HJGA 1HJDA 1G18A 2GJ9A 1R2QA 4TMVA 4AY2A 1E6GA 2CDTA 4OHZA 3NEJA 3B1VA 3IHWA 4ZPXA 4C0HA 1XCGB 2LNHB 2LQNA 2P6UA 3SNHA 1KO7A 3FDIA 3EHQA 1R6BX 2JLQA 4W9MC 4HCKA 4TYPA 3JZMA 4YDSA 3TVDA 2IYYA 2EFEB 3A4NA 4DSUA 4PO1A 3SEAA 1AKYA 4B48A 1K76A 2LQWA 1TU3A 4K8OA 2C9OA 2QTFA 4A8JB 3KKMA 5AJVB 1KKMA 1KDPA 3BWDD 1NG1A 2UVQA 1RRFA 1Z6XA 2W83A 1OOTA 1J8MF 2OCBA 2YVUA 4EJSA 3EPHA 3MG9A 1E2KA 2ZI4A 5KUTA 2KEAA 3CNLA 5FPHA 3HR8A 1G64A 1AK2A 2JIZA 3QXXA 2W6IA 2C9CA 2BEKA 4A1FA 4C3ZA 1KIKA 4J0QA 2JAQA 4LHWA 4Q03A 3ZQ6A 3NMZC 1XTJA 1ZW6A 3N70A 4UKDA 1EFCA 4YDHB 2ERYA 4JJKA 1CR2A 4I1OA 3THXA 3GJ5A 3RS5A 4OI4A 4F4CA 1SVIA 1FL9A 1FX0A 5I22A 1IN5A 2W0MA 5BN5A 3UG6A 2WM9B 4XH9B 3U7GA 3WYFA 2W6JA 3EIHA 1EK0A 1UJ0A 1CLUA 1E0JA 1HH4A 4Z8XA 4LYAA 4A82A 3VR3A 4A8JC 2ZYWX 1XP8A 4RD4A 2CNWD 3SOPA 2ZRNA 3GLHB 2OE2A 4LYFA 1AQYA 1W36B 2AKAB 4UJ3A 5TVKA 1E0AA 4HDQB 1HT1E 4IHQA 1RVDA 3PUYA 2KBTA 3WBJA 4BLSA 1TQDA 1OW3B 2FG5A 3B85A 4D80A 1TPZA 3NH6A 4DZZA 2RGDA 3QENA 1ZM9A 4HLUC 1KK1A 4IVPA 3GLGE 1E9EA 2F1JA 3L43A 1T6NA 4M1YA 4CT5A 5L3RA 4Q7MB 1IN4A 3FKQA 4Z54A 3K0AA 2B7CA 1OPXA 4ZDWA 4YMVA 1ZC4A 3I92A 1QWFA 1RYHA 3SJZA 1UG1A 1TF2A 3SZRA 5FBLB 1KI2A 3EPKA 3S1AA 4DB2A 5FI0B 4YMUA 1GKYA 4KFRA 5TDHA 1SRMA 1E2JA 3M0SA 3QKUA 3C15C 3PV0A 2V1XA 1G8FA 3I73A 4PHHA 2DRKA 1PZNA 2QAGA 3P32A 4JVMA 4NBSA 1GFDA 2LKCA 2ZETA 4NU0A 2NO6A 4BLOA 4CVNA 2AXNA 2KE9A 4JLMA 4BFXA 2BVNA 2KBEA 3L82B 4JSYA 1OXUA 3GLFA 3NG1A 1AGPA 1SGWA 4HXJA 4YMWA 1RLQC 4RKFA 4P0TA 1NN3A 4CEIB 4Q9LA 1TUEA 1MH1A 4UQOA 3T61A 2FF7A 2HUPA 1OFTA 2OHFA 4NYIR 5FUYA 5DGXA 2RPNA 4M8NE 2FDCA 3KJHA 2X2FA 2YWFA 5C1BA 3SJCA 1G5PA 5JI3E 1FP6A 3QXSA 5SZHB 3O8DA 3EZFA 1VCIA 1E4VA 2PL3A 3RSLA 4G5OA 2D3WA 3WYAA 3GLIE 1NBMA 4RTZA 2C2HA 3SJAA 4BFTA 1S96A 5LB2A 1PKSA 1DPFA 3K70B 5L3SB 3NVAA 5J4YA 1US8A 5AUNB 3W34A 2REBA 3E2IA 2JLWA 2DR3A 3CM0A 4IDHA 2ZSEA 1KZ7B 4LK2A 3SHWA 2YSQA 1T8TA 4WXRA 3FGNA 4GL2A 2F7SA 2O31A 1KDTA 2VL7A 4LUDA 2PCJA 2EGEA 1FP7A 1KK3A 4K11A 1GBQA 2HT6A 2VHUA 4AYXA 3NHNA 4BFUA 3TIFA 2XXAB 5LPNA 2GF0A 4TQUS 4LYHA 1Z0DA 3QQ5A 3R6NA 2GJKA 4QJ5A 2FPEA 1MO4A 4PHTA 4XSHA 2ECZA 2P4RA 5C4MA 4ERNA 2O8EB 4ZIRB 3PENA 4JL5A 4CC2A 2QMOA 5IK2A 4LY6A 3ZZUA 2FEOA 1NVVR 1UADA 2QP9X 2RAPA 1CU1A 2MMCA 4OQMA 4LJYA 4XTCS 1UHFA 2HEIA 1FQJA 2OFWA 1N6HA 1A4RA 4HB4A 3CIOA 1ZUIA 3K70C 4KITB 1BIFA 3E70C 1GVNB 1GM5A 1UTIA 3WRYC 4D8KA 2VHJA 5LDDC 3B6EA 3BBPA 3X2SA 1G7CA 3I5XA 2ED0A 1GL5A 4AFUC 2CBZA 5JS8A 1SVSA 2D74A 2J59A 5G41A 2BMDA 3I4LA 3A6PC 3B60A 2GAAA 5K8LA 2PT5A 4KAXA 2O8FA 2I1VB 1YRBA 2GBLC 3H0KA 2H7VA 3EG2A 2ZRAA 2CVHA 2IWRA 2IUSA 4TL6A 1Q1EA 1JAHA 1PNJA 2VHCA 3ASYA 2EPDA 2B86A 4XVQA 1OEBA 1X27A 3ZL7C 3AQ4A 2EFHB 5JRJA 1N0VC 1LS6A 2O9VA 2AFIE 1JXOA 2EYZA 1AQUA 1GZSA 2F3TA 2IF2A 2CVFA 1QHGA 2K5UA 3EC1A 1GNQA 2CLSA 3IKJA 5FTNA 4YXWD 1K0SA 2G83A 5DNYB 1IM2A 1ZVQA 2KT8A 4EKDA 5EP2A 4QJ4A 1SXJD 2QNRA 2KRMA 2VWFA 3K09A 4BZPA 2AWOA 1F48A 2Z4RA 1X2KA 3FFAA 5HZKA 2QGNA 3FWYA 2V9PA 3IUYA 4TMZA 4MA4A 4BWYA 1GWNA 1TUDA 3GJ8A 5J4KA 4Q4HB 1JJVA 1X8KA 1B3QA 1W5SA 3CH5A 1YP5A 2DVJA 1HY3A 3A1VA 2ZRHA 5FH9A 4JZKA 1AS3A 3SYNA 2H8HA 4PC2A 1Z0KA 2J5XA 1NYGA 2OBMA 3R8CA 1FMJA 2KB0A 4CIDA 2C0OA 1COWA 2VEDA 3REGA 3VS3A 5F2EA 1W4AA 2JW4A 4JSTA 3KQLA 2ABLA 1RRPA 4TTPA 1Q0UA 2PTKA 1BYUA 3KQNA 1ZM2A 3PUZA 1J90A 3U6BA 2AK5A 1PUIA 5EE1A 2IYZA 2X3WD 1Z9QA 1XTQA 3BS4A 2Z5FA 3FMPB 5G3YA 4RTWA 1LF0A 3LXXA 3PEVA 4RFSA 5G53C 2ZE5A 3ZVNA 1M3CA 5FPTA 2DWQA 4LUCA 4C9BA 1JNYA 2ZRFA 4M53A 5DI9A 1NNEA 4JL8A 2XNDD 4DDUA 1M3AA 4P31A 3VNVA 4FMCB 3P4YA 2ZS7A 2O88A 2QY9A 1YN8A 2JA1A 1E3MA 2HSPA 3VFDA 4C0KA 3DDCA 4AG6A 5UKDA 2L3SA 1KMHB 3KL4A 5DYGA 1AWXA 2JJ1D 1AWJA 3R20A 2F1IA 2GCPA 1E1QA 3GLIA 1T5LA 1T3LA 4IJMA 4M9XA 4Q1EA 2VVKA 1F5NA 3CRRA 2R6AA 1X6VA 4DCVA 1KNXA 1NLYA 1Y63A 2KE5A 1Z07A 2FFHA 3BIFA 2QUZA 3D3QA 1KI3A 4P4SB 1VPLA 1H8HD 2R6CA 2PZFA 1FW6A 1CJUC 1DARA 1HUQA 1VHTA 5IHIA 1NLPC 2OAWA 4I1VA 4L5BA 1LW7A 3U44B 2A5DA 3AVYA 1E2DA 2JEOA 2IEZA 1PVOA 1AKEA 5I11A 4LDJA 5EC7A 1GTVA 1IJEA 4DLXA 2ASEA 3U3OA 1JB1A 4JIMA 4D0LB 1KY2A 1SVKA 4G0NA 1Z47A 1XD8A 1QKWA 2AKYA 1E2HA 2WOOA 2QP3A 3LVRE 1S3GA 3DZ8A 5EUQB 4D0NA 3ULRB 2QQ0A 1C9KA 1PV4A 1KSJA 5EQTA 3I72A 721PA 3HDTA 5F9HA 1U98A 1WQ1R 2KBFA 3K0CC 1Q44A 1R8SA 3SYKA 2RNAA 3B1ZA 2KJQA 4G01B 5HKKA 2O2OA 1HQYE 3M0EA 4ON9A 2ERXA 2RQVA 2JLSA 5HCNA 5JRZA 2LJ1A 4NHOA 4YLGA 1M8MA 1RYFA 1XJQA 4MRVA 1TG0A 3BH6A 4DLZA 2JIZD 1M7HA 1W0KD 5FBQB 3AUYA 4QJ3A 4MKIA 4GRAA 2W10A 3DMDA 2AK3A 1QHIA 3ZD7A 1GCQC 1M8PA 2FV8A 2IF0A 4OI2A 1ABOA 1WDXA 2O9SA 2RGCA 3F3YA 1Z22A 2ZEJA 4PPFA 3T1OA 5FOXA 2GJAA 3BE4A 4PPGA 1HTWA 3MJHA 2RHMA 4RD0A 1JBKA 4MRNA 3UF4A 1T0HB 3O47A 4II7A 2DL8A 1KK0A 4LV8B 4OKSA 3VRYA 3WXMA 1E2GA 4TYYA 2WAYA 3B1WA 4LC1A 5CM8B 2HF9A 3BH0A 1GNRA 3TH5A 2CNWA 5JEDA 2O8CB 1QHHB 1N6PA 1KGDA 3HYRA 1SXJE 2N46A 4KV9A 2D62A 1XEWX 5JJIA 3TW4A 5FL3A 2TMKA 4OMPA 4M1MA 2VSFA 2RMOA 1S4QA 1G3UA 3B13B 3WBKA 3C16C 1JJ7A 3VAAA 5K8IA 3NEYA 3CBQA 2Z4SA 4Q1BA 4UXJA 5FOTA 3TR5A 3IIJA 4OQFA 2C03A 3R9WA 4DHEA 2YINC 4NDZA 4BRWA 3ETLA 1G4UR 1I2DA 5EXSA 3U61B 3MAAC 2WWHA 1CF4A 2G0TA 1J2JA 1M30A 2ZJAA 1OXSC 2FPFA 1A5TA 1EESA 5BN4A 1ZU5A 2QM8A 4CYMA 2Q9CA 3KKPA 2CREA 3U3RA 1AS2A 2HYDA 2FE4A 1Z3IX 2XITA 3TAHA 3RHFA 3C14C 4MRRA 4TLDA 2DJQA 5FBVB 5IXBA 1JAIA 2G1KA 5HCIA 3DO6A 4PR0A 4A6PA 4AIIA 2DY1A 4LJ7A 4D4KA 1X1RA 1RW4A 3NKVA 1UFQA 1WE2A 1AEYA 4PSKA 2DFTA 4NYJR 1CJTC 2WWFA 2P5SA 4Q48A 1HQCA 2LKDA 3UMFA 2PBRA 1IXZA 4LBZA 1QBKC 2G3YA 1XEWY 2M0YA 3EZ6A 3PQCA 2EKHA 2PZEA 1E32A 2IC5A 4M1OA 4RKEA 1CJKC 3EPLA 1ARKA 3A1UA 2JLZA 3AKEA 4DXAA 1I07A 3U4QB 2C8VA 2C99A 1LFDB 2H92A 1QVAA 2BBTA 3PVQA 1Z08A 3L2OB 3RAPR 2ZE7A 4LRWA 4A0HA 2H57A 4S35A 1GRIA 1N6OA 4ESVA 4UNQA 5AUQA 2AKLA 4L15A 2GEVA 1FX0B 2ODBA 3GFTA 4LZZA 4A2WA 4Q4HA 2FFQA 4NCKA 4M2LA 1OFIA 2K9GA 3JVVA 3LDAA 4X8HA 5JCZA 1UKVY 3K0SA 2D7DA 4ESRA 4AG1C 1SSHA 3W90A 2RGNA 2NO7A 1E1RD 4XWAA 3GBQA 1JQLB 1Z6GA 4GBQA 2HF8A 2ZUDA 4M9QA 4EJSC 4WAUA 3L0OA 2BDTA 1VKJA 1M7BA 1T3HA 3K0FA 4FCWA 4N1AA 3BFVA 2P2LA 1J70A 4ASUD 4WZ6A 2BZXA 1IBRA 2E87A 3KX2A 1TF7A 1OIXA 3L8ZA 4F38A 5JLJA 4AFSC 4CEHA 1H8ED 3BGWA 2F9LA 1XD2A 2X19A 3CQTA 5GJWB 3AGQA 4TL7A 5L8VA 1G7SA 4BPBA 3K0AB 2N1BA 4MGZR 4V0OA 2L3PA 3HR7A 4PTLA 3X1ZA 1D2MA 2AR7A 2XTMA 4Q9JA 4GZMA 3RBBB 2BJVA 3HYTA 4PXAA 1P2UA 3M0UA 1KIMA 1ZNWA 2J3EA 2WJYA 3S1AB 3UK6A 2V7QD 1VG1A 2WWWA 4D26A 3K1JA 5HE9A 4Q02A 5CLLA 5DN6D 1GILA 2IUUA 2IL1A 2GILA 1G4AE 3FHTA 1KSWA 2QAGB 3CKLA 2IA5A 1WBDA 4C2UA 1W46A 1BMFD 2H8KA 3R7WA 4A2QA 1O3YA 1JPNA 2NO9A 2GNOA 2XX3A 2OUKA 2VYFA 3LLMA 4JT2A 5HR5A 4JJBA 1KMHA 1YCSB 2PNIA 1Y0MA 1X3SA 2A2ZA 2DE0X 2GF9A 4Z8YA 4URVR 1XEFA 1VCNA 3GLFB 2JLUA 2F43B 4PZZA 1PWTA 3BK7A 4TMKA 4TSFD 2W2XA 2GJ8A 2UZIR 1SVMA 4HVUA 5FWCA 1ZUHA 1UJ2A 3CR8A 1X6GA 2JTEA 1Z6AA 1R0YA 4RZXA 1QLYA 4QBGB 3IDQA 2BMFA 2VHTA 4AKGA 3P4XA 4DLRA 4YXWA 4KJZA 3TRFA 2IXGA 1AJEA 5FBRB 4URUR 4EPWA 5TB5A 5KPDA 2ZI6A 1U0HC 1ZBJA 4D8DA 4DLWA 1SXJA 1ZJ6A 1AA9A 2CSQA 3X1DA 1N6LA 2REOA 1E2NA 1NY5A 4HLQB 1NVWQ 4JZ4A 1NG2A 2LMJA 2XTZA 3F5FA 4IOJA 4AG2C 1KNQA 4KODA 2QAGC 5SZJA 3RWMB 1QVRA 3TSOA 2BIFA 1SHFA 4MUAA 1US8B 2G1JA 1EFRD 4NONA 2CL0X 3WMEA 4OMQA 1CR4A 2L0XA 4HAVA 2DX1A 1XJ0A 1Q3TA 2ZYVX 3JVUA 3RS3A 2K2MA 4W5JA 1XF9A 1COWD 2ZTSA 2GVDC 3AF4A 4KCGA 1WYXA 3CPJB 3MWKA 2YT6A 2WOJA 4DLSA 3CF0A 1PRMC 4E6RA 1XTRA 1K4US 1T0JA 3M1IA 2HXSA 1HE1C 1N6RA 1OH6A 2CT3A 2EYXA 1NJGA 2C9YA 2QROA 3TJZA 3GJ0A 5JZVA 1NG9A 1DG1G 2AK2A 2I4IA 3FHOA 2XZLA 1MRSA 2B21A 2CDNA 4LBVA 5CIWA 1W4BA 1CULC 4LYJA 4TYQA 4F14A 1P2VA 4URWR 2DWOA 2IYXA 4Q7KA 4QFMA 3REFA 4D81A 4MDFA 4Q21A 4O0MA 3RABA 1F2TA 2C96A 5FTJA 2SEMA 2XNDA 4MGKR 4Q18A 2O0KA 4O2LA 2VSXA 2YKGA 4IIOA 2JMAA 3Q5EA 3VNUA 1ZNYA 1ZC3A 1G6HA 3M4YA 3NBFA 4AKIA 1TUIA 3QPVA 5AK0A 4DCSA 1BKDR 4KVAA 3TK1A 1N0UA 4Q1AA 2O8FB 1NN5A 3SC3A 3MD0A 5FFMA 1ZAKA 3L0IB 2JJ1A 2GTJA 3X1YA 1EX6A 5CITA 2X8AA 4NH0A 4POAA 3NBXX 3P20A 1E2LA 4CW7A 4U00A 3NGPA 4JVSB 1W2HA 4Q9IA 3DOEA 2IYRA 5AJWA 2ZRPA 4OHWA 4TYNA 4HB0A 1H8HA 4PAQA 4ZCIA 5AUOB 3NDPA 4CC4B 1JI0A 4HEJA 2ZI5A 1OPLA 4EPRA 1V5WA 1Z6YA 2A36A 2JJ2D 2ZI9A 3AF0A 4FW9A 4PC1A 1XNJA 2B6HA 1ZP6A 2J9RA 2QTHA 4H1UA 5HPYB 2XTNA 3H84A 3QOFA 3MSXA 1IXRC 5FR2A 4AFQC 2NTYC 4JYCA 3IEVA 2G9NA 2LP5A 2DYBA 3W8RA 4DSTA 3HWSA 1E69A 1U0LA 3GLGB 1HE8B 2KWIA 1Z83A 3CX8A 5B30A 3AVTA 1ZM4A 1LVGA 2Q21A 1S1MA 3B82A 3NXSA 2DBYA 2ZJ2A 5EE0A 4Q47A 1YR7A 1WXQA 4DIEA 1R7RA 4C2TA 3WRXC 3FMFA 1CJMA 2NG1A 3VKWA 3WP1B 4OK6A 2ZM5A 1ZINA 3I3SR 1SKQA 3KXKA 5AJXA 2EQIA 4HZIA 5D3MA 2O5VA 3FFBA 3VR6A 2F3RA 1N5JA 5HKKD 1Z2CA 1R5NA 2ZS9A 1ZSGA 2LZ6B 5IHKA 1ZCBA 1VECA 2ZYTX 4GP6A 4QBHA 2W0ZA 5BWMA 5KDDA 3FJ5A 2KI5A 3Q85A 2MSEB 3N2IA 3SHFA 4DCTA 4TQAA 1XFAA 2NZJA 1HD3A 4RFSB 2BMEA 3WYGA 2OBNA 4GNKA 1QHYA 1W0KA 4PAOA 1G8PA 3UKDA 1RJ9A 2RCNA 3U4QA 1CR1A 3GQBA 3SQWA 3B78A 3O5ZA 3RYTC 2GTOA 3C8UA 1ZUUA 3QWXX 4OMMA 3H2YA 1DVRA 2GNCA 2V1RA 4WXPA 4O3MA 4JKYA 1RUWA 4HUQA 1JEDA 1YZLA 121PA 1SEMA 3H0HA 2HLDD 1JQJC 5LD2B 1UF9A 4GOJA 1G3MA 4OI0A 4JS0A 5H1YA 3EG0A 3SYLA 1ELOA 3GLIB 1XU4A 2EFGA 3U6KA 4QBIA 4GDFA 4F93B 3NC0C 1A0NB 3A1WA 1E2FA 4LHVA 1YWPA 2DRMA 1YE8A 4MKHA 4U02A 4IOKA 4ZV4A 3ZIAD 2OCAA 1XDBA 1SRLA 1R0WA 4NYMR 1WA5A 3H0FA 4D6PA 3GCGA 2ED1A 1GRNA 2D06A 3W9YA 4JPBW 3EZ9A 1VIAA 1VYVA 4A63B 1OLOA 1JPJA 2K79A 1P62B 3ZD6A 2B7BA 3PXGA 4OQNA 4PSVA 2ZRIA 3RRNA 1OPKA 2P6RA 1M3BA 4BZXA 4OMNA 3U23A 1U8AA 3CLVA 1BS1A 2OILA 4M9SA 1Z0IA 2YJTD 1Z0AA 1FPMA 1W49A 2IYVA 4A2PA 3OIYA 4ZKEA 3TVTA 1Q22A 5EZ6B 2WWXA 3PE0A 1GFCA 4CDGA 1M2OB 2WKRA 1SHKA 1UPTA 1W36C 4LX0A 4MYCA 4YONB 1X8JA 2FSHA 3D31A 4PO9A 2VQSA 4UXIA 3SBDA 2F2VA 2BWJA 2G77B 4HDOB 2NGRA 4LNPA 1ESNA 2F43A 1Z0FA 1AVZC 4HB3A 2OJ2A 2CCJA 1OH5A 2O8BA 1BBZA 2W58A 2YOFA 2SRCA 1NN1A 3KKNA 1TMKA 1NJFA 3HU1A 4LCBA 4OJQA 3U5ZB 3QXCA 1E2EA 1NY6A 3AF2A 1KTVA 4F91B 3AVVA 2LX7A 621PA 3PG5A 1YZNA 4LJ6A 5KSOA 3CNNA 2BM1A 2RGGA 3ICQB 1MUZA 2QT0A 2HYIC 3BD9A 2GTPA 5CJPA 1IONA 5CB8A 1VIYA 3DMNA 4IDQA 2KROA 4ZNXA 1UBFA 3VHXA 1N25A 2RHDA 3AP3A 4PQYA 2E5KA 4PZLA 2F1HA 3A4LA 3PIRA 4PX9A 3TE6A 2J0UA 2QMHA 2WKQA 4B75A 1Q1ZA 5E4FA 3K8YA 2VHQA 1IQPA 4MGIR 5H70A 5AUPB 1FNNA 2AZVA 3LQRA 4AKEA 4U7DA 3AVQA 2CLDX 3AEZA 1X6BA 4LHZA 1E1RA 2CH4W 4N0DA 2ZJOA 1E9AA 1E79D 4US1R 1CSKA 2Y8EA 3U7EB 2JS0A 2DWPA 1IAQA 1UUEA 4DJTA 2JLRA 4EPTA 1ZD1A 5AWFC 3E5HA 2J0SA 3PUWA 4ASUA 5FR1A 3QIAA 5JWRA 2PZ1A 2VIIA 4AK9A 4OI1A 1BOFA 5KDOA 5FI1B 1H8EA 1I4TD 1RZ3A 4ZDIA 2CT4A 4FMCF 3B8HA 1IJFA 2BHRA 1ONBA 3K9LA 2GJSA 4D82A 1Q1BA 2R6GA 3TKLA 2HDAA 2J7PD 3LV8A 2R8RA 5AR1A 2FH5B 4KLNA 2F1RA 4GSYA 3T12A 1NLFA 3I9QA 2Q3HA 2VSOA 1IY0A 3CZQA 3REAB 1KFZA 1LNZA 1Q1QA 4IEIA 1X43A 2V7QA 1MOZA 4OHXA 5B2ZA 4DT1A 2P3SA 1U06A 1CKEA 4E5UA 1JALA 1YJ5A 1DEKA 5DN6A 2Q9AA 5FTMA 5HE8A 4EQ6A 1NIPA 2OO7A 2QI9C 5EXTA 5TXGA 4UNRA 1E99A 3KXLA 3FOZA 2KGTA 4Y0VA 2FSIA 1LS1A 2EFCB 2QMEA 1BMFA 1AS0A 4FD2A 1OIWA 2ZR9A 4M1TA 3K9GA 3P26A 1E0KA 2FEIA 2ANCA 2Z43A 1PLJA 3LFUA 1ZD9A 4B33A 2LJ0A 4NCIA 4B35A 4H1VA 4BLQA 1UM8A 1Z28A 4TSFA 4YMTA 2R62A 1GRRA 4F4IA 4IVQA 2ZJZA 4D4JA 4WCIA 2K6DA 4W5HA 3THOA 4DSOA 3U7FB 2AZSA 2DCUA 2IBMA 3QBVA 4WW0A 3TGPA 3O8CA 3RRYA 3AKDA 4Q19A 4AFZC 2VTKA 3X1XA 2GXAA 1QZXA 4KO8A 1WF3A 2CL6X 1DAEA 5KPJA 4FMDB 2QMUA 3GJ3A 4PPQA 1U9IC 4FIDA 1G5TA 1BB9A 4QT7A 2FSFA 2ZR7A 3AKCA 4A4DA 1NI3A 4B76A 1OB5A 2A37A 3MGCA 1TTTA 2GK6A 2NWMA 3I8XA 1SVLA 3W8NA 1ZM3A 5CYOA 2E9SA 3TQFA 2XJ4A 2WICA 1NEBA 3VR2A 1EFRA 1XCPA 2IYSA 3GLGA 1UGVA 3RLFA 5CYPA 3FPAA 1KMQA 2O52A 1QF9A 2PMKA 3KUCA 1NKSA 3NBYC 4QGGA 5L23A 1OSNA 1PUJA 3RDPA 3SFVA 1DE0A 2REXB 4EAQA 4RSGA 2WHXA 2DHRA 1ESMA 5DE3A 3DOFA 3K0FB 4PZYA 2OXRA 4Q1DA 2DILA 1AM4D 1JXMA 3N2EA 4A0GA 5JEEA 2HBWA 3JV3A 5IHNA 2EW1A 2RQUA 4JLBA 1VMAA 2J45A 4IFBA 4ACBA 4BLPA 2OI3A 1KYIA 2IYQA 4CEHB 3FHCB 1XD2B 4DCNA 3B7GA 3QWYA 1WMSA 5FL7D 2V1UA 1G7TA 1TQ6A 1N6NA 3LAWA 1WI7A 3TUIC 4A0RA 4XWOA 5FTKA 1GBRA 2OT3B 4L16A 2MIOA 4RD6A 1GIAA 1V1CA 4TZ0A 1SKYB 1S3SA 4CC7A 4LGMA 1NYFA 1KKLA 2E1RA 2RGBA 1XTIA 2RGNC 2IS1A 3R8FA 1OV3A 2AXPA 1XB2A 2LCSA 2BBOA 2JCSA 1M6NA 3R7WB 3FE2A 1FQKA 1MV3A 1ZYUA 2V54A 4NCHA 1FMKA 4XWKA 5FOUA 3CRW1 4TT3A 4JLAA 3KDSE 2IEYA 3RS7A 5DHFA 5DYIA 3A37A 5P21A 1L8QA 4LSGA 4URYR 3CRMA 2PZGA 4JL6A 3BXZA 4I1SA 1KSFX 4EIWA 5D3QA 4ABYA 2FN4A 3DL0A 3PEYA 3F0TA 4B47A 1CIPA 3KQHA 1QDEA 4L9WA 4FI3C 4HSEA 1T91A 2RGXA 5IF9A 2WBLC 4D4LA 1QHSA 2Q9BA 3AP2A 2ROLA 3TW8B 1KAGA 1ZIPA 1RFLA 4CEJB 4WA7A 2EGAA 3DVLA 4EPXA 3GEEA 5DSZA 2ZPTX 1SXJB 2ZJ5A 2YUOA 1MO6A 4HVVA 1XRJA 4G5GA 1UKYA 5BN3A 2JJ2A 3M6AA 3EZ2A 3LVQE 1II9A 4LJ5A 1J3TA 2ZS8A 2NPFA 5H8WA 3I5SA 5JI2E 4JBYA 4XJXA 3WP0A 4C30A 3MMPA 1AWWA 1U90A 3G5UA 2IWHA 4ZDJA 3DM5A 1MO3A 2ZVQX 4DEXA 1XJCA 2GGRA 2KRSA 1DADA 1XMSA 1C1YA 4JVNA 4M4SA 2OCYC 2ANBA 4RD3A 6Q21A 2L3QA 3MWJA 4LJ9A 4OL0A 3KJGA 5EE3A 1K8RA 4TLAA 4RTXA 1K5GA 5F9FA 4TQ9A 2A08A 1QHXA 4B2PA 1XXHB 2A5YB 3CNOA 2CHQA 3CW2A 4R98A 3P27A 2EW3A 4PHGA 5ANRB 4UXHA 5FOSA 2CJWA 3ZJYA 2DA9A 2VRWA 1T0JB 2NPIA 5FUXA 1DS6A 5JWHA 4LPSA 1SXJC 2ZRKA 3WMGA 3ND8A 1G8YA 3CUEF 4P4UA 2F6RA 1D2EA 2J7IA 2C78A 5J4VA 4B74A 4V0NA 1SKYE 2P5TB 4JBWA 2D8JA 4NKRA 5EP3A 2VP2A 1UE9A 4PAMA 3UA6A 2C0TA 2OFXA 2Z6VA 2ZUBA 5SZKB 1F2TB 1YZTA 5EXPA 3OEHD 1GITA 2ZE6A 3C41J 5F98A 4HDCA 2OAP1 3ECCA 3VTKA 1XWIA 1M34E 1RPZA 2HLDA 3RRZA 2C95A 4JLNA 5JSZB 2J6FA 2RQWA 1DAKA 4M4ZA 3AVWA 4PO8A 4RUGA 4IXMA 3V4FA 5DHAA 4UNSA
chains in the Genus database with same CATH superfamily
3VS4A 4KFUA 3TCXB 3LDUA 3PFFA 1NAIA 3ROKA 4QC2A 2K7AA 1UC5B 2II6A 2OEPA 4JFAA 3A6HA 5J2TA 2QV0A 4KNWA 3II6X 4DL9A 1WCYA 1OZAA 3EG1A 1BMTA 4R83A 2A30A 5ALNA 1T3ZA 1D9XA 3K0EA 3TSCA 2P6NA 3R5FA 3QDRB 4L4RA 2WFLA 3VYGA 3TR0A 1R5JA 3C5EA 3I6YA 3JZAA 2AF3C 3UV6A 3J7AF 2GX6A 1RI5A 5I2MA 4XB1A 2RARA 3AYXB 2X8LA 4LQ4A 5I7HA 3BERA 4YAWA 1JJ2S 3WKDA 1AZEA 3T4UA 3FLMA 5KWVA 3TSWA 3AU9A 4F7UF 3Q87B 4TT8A 2NV6A 2MSLA 1BIBA 3Q1KA 2VASA 2X4XA 3V4LA 1X19A 4BGDA 5E1DA 2XA1A 4B9WA 2Q5OA 5KE3A 2I2DA 1L4YA 4F12A 4RJLA 4NK5A 3WISA 2R8YA 1P7YA 3FPGA 3WLMA 2I03A 1CUYA 2OCPA 3QVGB 3PFBA 2A1UB 1KMNA 4GLJA 1A98A 4I2VA 3BWEA 1WKBA 2L19A 3H41A 5G40A 3DLPX 2WSCE 4ND8B 4OHUA 4LHEA 2I6UA 3S2FA 3QWBA 5J2UA 1K6XA 2D7JA 3ZXUB 5ABPA 4X1IB 3T38A 1C9NA 2GTIA 2V8KA 2Y4YA 1FTSA 1GPNA 4CF3A 4AX8A 2HJSA 4V24A 1D9ZA 1LDGA 1NM5C 1ZL2A 1TAGA 2G08A 2R2AA 4X92A 1H2HA 4JS4A 3RVQA 4ALNA 3GROA 3W3AA 4EDHA 1WETA 1LCIA 3QF4A 2Q2WA 4EQ6B 3DLAA 2Z1MA 2WHPA 3P2OA 2PKQP 4C4TA 5EMMA 2VT3A 2C4WA 4MVJF 1G98A 3U9LA 1NF9A 4FYXA 4EIKA 2D5AA 4DA0A 5JU6A 5GANf 2NXJA 3AJRA 3OM8A 4R8KA 1MN6A 4E5DA 1JR3D 2BV3A 3AERA 5TMDA 2W2KB 1BDJA 4J0KA 1PW5A 4KJXA 4PLZA 3PHHA 4G1MB 5FLXE 3U4IA 4LI0A 3LO5A 3GCDA 5HOEA 1DAMA 3G88A 1M2NA 4CLOB 4YRAA 5FPSA 3H87A 4PQEA 4HMQA 1PRYA 3CCVA 2X8JB 3R3VA 3M3PA 1YB4A 3G79A 4H3SA 2AIRB 3BB1A 3LW5E 2JFWA 2G1UA 2QDKA 1V7PC 4XJTA 3MPOA 4RTMA 1QQ5A 2PU5A 3UYKA 1K2WA 2W71A 1U2DA 2VPPA 4G0UA 1RC0A 2F90A 2FPSA 1WL8A 3CSDA 3Q7RA 4R8VA 1LC3A 2IYTA 1RI9A 4MCAA 3CR7A 3QVSA 3CS3A 4XCQA 3GG9A 1G20A 1QPBA 4RY2A 1CPYA 1PHPA 3REBB 2MMGA 3ZYCA 4HGNA 4CHGA 4C78A 3LBIA 4BE7B 3OA6A 3RF7A 1U2QA 1BGVA 4MQ5A 4O4JF 2HA6A 1JR6A 3CCSA 1P5ZB 1QTQA 3DZFA 3EHRA 2A5GA 2ODWA 3RGGA 4YQFA 1O94D 1E98A 3EW9A 3G9UA 3WLJA 2JMCA 3CLSC 4E5MA 1BXGA 4YRKA 3DWIA 5JMWA 2PMDA 1VA7A 3CLUC 4D0GA 3WB0A 4RTSA 3OS5A 2V5VA 3PDJA 2OOSA 4EY3A 2VLBA 3TNLA 1FRNA 4G5FA 2WFLB 4O08A 2PNJA 3QI2A 5GVSA 4DBLC 3F71A 1E8MA 5F2KA 4OMOA 1FMTA 1SIBE 3NV7A 3PUJA 4C03A 4LTMA 3DPUA 3IL2A 2EZTA 3WLNA 3STVA 1VGQA 3SN6A 1AO3A 3BRCA 3VU3A 5DNDA 4X6XA 1QAQA 3FKJA 2M6LA 5KNDD 1P7ZA 2XUGA 3K9HA 3FB4A 3QU9A 3UH0A 3DONA 4IZIA 2AA3A 4B4KA 4BFYA 5K0SA 1LA2A 1T8SA 2BR3A 3C1TA 5DO9A 4ZC8A 1QIMA 5KNBD 3U19A 2P3LA 4YDQA 4R41A 5I47A 1A76A 2PVGB 2JJ8A 1C7JA 4ME7A 3N5KA 3H1GA 5AK4A 5K8JB 2G4CA 3BHMA 1JFSA 4FWTA 5J2UB 1IPFA 4YJKA 2KXDA 2BEUA 2FPLA 2OXCA 4EMKA 1GKUB 3HGQA 1U5CA 4RMOA 2V0CA 4LDNA 3I01M 2EDAA 4A8TA 5M2QA 4ZI7B 3B2QA 2HJHA 3WL8A 1B6RA 3IOBA 2L5QA 3PXDA 3KV3O 1H3EA 3M81A 3PVLA 3DE6X 3JR3A 2H00A 4RQBA 1WRBA 4QG3A 2PRJA 5FEMA 1IBMB 4X00A 5EIAA 2JEYA 4ZDKA 1PG2A 5BRNA 1CEYA 4MAAA 1R64A 2CNBA 5AHRA 4PR3A 3QF4B 5LLDA 2WHPB 1LQUA 1ZONA 1DJLA 5E2IA 4IG9A 3I4FA 3RKRA 2EX1A 3G6ET 2HUNA 4JSRA 2YV3A 1H4TA 1RNLA 4FYXB 1G5VA 1TKBA 1UC4B 3AH8A 3ONWA 3DE3X 5HKCA 3GEIA 1YA6A 3JARA 3KYIB 4A9AA 4D3DA 2AI3A 3WNBA 4EY4A 3AERB 2WPDA 5JSYA 1AKWA 4CCWA 5KWJA 1T3GA 3QIVA 5FLYA 4KSCA 1DINA 4PPNA 4UEWA 3AJEA 1WXIA 4HQ0A 5H5JA 3S2EA 4CF7A 5I9BA 2QXFA 3W6NA 5EMLA 1YQXA 3LW8A 2YV1A 1YRQA 2R5FA 2QTZA 1HKHA 3I9V6 4RULA 1S72Q 2HBRA 3UB3A 4JJEA 3A4MA 1SUAA 3Q5GA 2ZULA 1W2WB 2X35A 1GTZA 2NPOA 1Y4ZA 1W59A 3JW8A 5K0FA 3PGMA 1Y4AE 1QC5A 3ZTTA 3OCZA 1FUYB 4E2FB 3S8EA 2P9CA 4DIBA 5LYJF 2FU5C 1B0PA 2GQ0A 1L9XA 3ROTA 2L2QA 3BDVA 2QPTA 3LWNA 2HQEA 4QJIA 1RWBA 1G20B 3EFBA 4BE1A 3WHPA 4MMYB 1KQPA 4ZOLF 1WZ2A 4H17A 1C4KA 3KFXA 2MSKA 1J2TA 1GOTA 3DH0A 4KYUA 3TLEA 3BXGA 3EZNA 3PJEA 1XMPA 1P17A 2Q0SA 2C4KA 4MLCA 5TY0A 3I64A 1CUDA 1XZPA 5CYFA 4EVRA 4JU8A 2BI8A 5LQDA 1WDKA 2AW3A 1KJZA 2ZRGA 2F1KA 3B9PA 2FZKA 5KX5F 1ZHHA 4KXNA 3HZHA 4WOKA 3L3BA 1YULA 4MJ7A 1BXGB 2GNAA 4MR8B 4JP2A 1QGYA 2OQRA 3V00A 3OFKA 1XALA 4B31A 2M16A 1IJKA 1ORHA 3OCXA 4LUEA 2JF0A 4YRCA 1WA7A 3U9TA 3P52A 1YIOA 2W00A 4OXRA 3CRQA 4HAXA 4Y7CA 4UMFA 2XAUA 4UTRA 4KIUA 4UZFA 4OA8A 4FFOA 3OSVA 5DHQA 1Y4SA 2AOVA 3STYA 4QWWA 3L04A 3A7DA 5CH3A 2NSJA 1Q3HA 1SHZA 4F1KA 1W29A 4MEJA 1HRDA 3MTDA 2JIDA 2QS9A 3IPLA 2DT8A 1X2EA 2WM3A 5HDBB 3OSSC 5AJTA 5F2NA 2X13A 4PO1A 4D9BA 2C2WA 4CETA 1MC4A 3KKMA 5HK8A 1E3QA 5IG2A 1O5OA 2IZ0A 1EX1A 2CD7A 3IAEA 2HU5A 1E3WB 4G09A 1VSBA 1YRHA 2BEUB 3GEGA 4EMKB 1M90C 1K0FA 3WGOA 1C1HA 1AMNA 1WOMA 4N6OA 4DR3B 1YJ8A 1AQYA 3O3NB 1JXQA 4LDAA 1PFKA 4IFIA 4DZZA 3QTTA 4AJEA 3DC7A 2K4MA 3JB9I 2B7CA 3GU3A 3P9IA 3DZCA 1NBAA 3K5IA 4C01A 1X1TA 2C4MA 1FS5A 4MV7A 1CW2B 3JCMQ 5LMUB 3M4ZA 3GMDA 3G71T 2P41A 5AOCA 1ZSNA 1R37A 2LXNA 1SGWA 2WSYB 4FHEA 1A2OA 3OZRA 4UUPA 3KT0A 3DKIA 2ZVDA 3OCWA 1OFTA 4JOBA 2VI5A 3PPIA 3NGLA 3JARB 1CJCA 5IBPA 2AUMA 1OLSA 4AWBA 3PHJA 1S96A 1SCIA 3ZWAA 3F3KA 5LZ8A 1V41E 3HYLA 4TZKA 1LLCA 2A3NA 1WM1A 3SHWA 3S3TA 2C2XA 4RORA 2XMSA 4BB9A 1H42A 4C6TA 3AY7A 1MJGA 4I36A 4QJ5A 2OYCA 3TOCA 1X38A 4KKXB 5C4MA 5H9WA 4XTCS 2HEIA 4HB4A 3CIOA 4MXDA 3E70C 1Q0RA 4YFYA 3IERA 3L84A 3PQ8A 3ZL7C 1VSUA 2O9VA 4KYVA 4FJ0A 1JHRA 1QHGA 1U3FA 1EVJA 3HKBA 2QXYA 3ZHCA 3JASA 4O4LA 2QPLA 4G41A 3H16A 1X2KA 4B3TB 3W1VA 5H83A 1NPRA 3WJ1A 3T3MB 1E5DA 1Y3IA 1I7SB 4QXRA 5ALEA 4D9IA 2QDXA 5BR1A 1HQKA 3DBRA 1DIOB 1COWA 4C76A 3EC7A 3KCQA 3PUZA 3OPQA 1FJ2A 2X3WD 2H11A 1XTQA 4UBKA 2MCFA 3LXXA 1M3CA 4MW0A 5GAN2 2QLBA 5DI9A 3PXAA 1ZDMA 2WUDA 2HSPA 4AG6A 3YASA 3KL4A 1T5LA 4Q1EA 4RKYA 3NORA 4H6XA 4UBJA 1KQNA 2JJMA 3IRVA 2FZKB 1NX9A 5C5EA 3HUUA 2R6CA 2XYRA 4PGGA 5K0LA 4KIGA 1GTVA 4DLXA 2WMYA 4PIMA 2P6MA 3IPRA 1E2HA 2QQ0A 3W5CA 3I6BA 2B83A 1X74A 1LSJA 1Q44A 1CV2A 5KJEA 3SQDA 2O2OA 5JLAA 3R3ZA 2V7GA 4DQXA 1H3ZA 3BH6A 1H2AS 1M7HA 2NXNA 1Y8QA 4Y7DA 3ZHVA 3H2BA 4EGFA 3R0ZA 5KKCA 5FOXA 3FWNA 1WTAA 3VNQA 1H9AA 3IAAA 1YRYE 2Y05A 3S70A 3ESDA 5HIJA 3QV1A 1AQLA 3UGKA 1ZVMA 5ADVA 3TEJA 2C03A 1MGOA 4EA9A 1E18A 3MT9A 1BE0A 3HMKA 4DIFA 4H7JA 1T5OA 2QMQA 3DWEX 1DEHA 5H82A 3SCZA 5HCIA 4NAUA 1ZGZA 3X1KA 1HQCA 3A8MB 3SX4A 4PNHA 3TCJA 3GIBA 2YZ7A 4C92C 4NULA 3EFEA 3OFJA 3EEOA 3LYIA 1QZUA 1R9JA 2QL7A 2NTEA 3CMAT 2ZWIA 1VJ0A 4L85A 2D7DA 3JVVA 5ARDA 5ALOA 3D3JA 2NO7A 3LT5A 3V7WA 3T4PA 1UDBA 1FVOA 3BULA 4IJ6A 1IMJA 2A0XA 1DRJA 1RYEA 4YRSA 1UK9A 4W99A 4CMBA 4LAFA 3M53A 3KLBA 1AK1A 2E7ZA 2E6NA 1O57A 3DBIA 2F3SA 1D07A 4Y91A 5DN6D 3VTAA 4RIHA 3OOJA 2OUKA 3EHDA 2CXNA 1VQ9Q 2F43B 3DHEA 4TSFD 1CEQA 4Q4CA 4C5EA 2VDVE 4DLWA 4TYMA 3WNVA 4TVRA 3LL7A 3RADC 5DWDA 4NONA 2DX1A 1UXOA 3FLGA 5EWLA 2XVYA 4CKZA 4C6TB 4DA4A 1XK7A 3CF0A 1SOUA 3TOZA 5JJBA 3ANLA 3U4AA 2EYXA 1USIA 3TNDA 2HTEA 4RIIA 3VI3B 4AJOA 1RXSA 3NKFA 1BFKA 1Y8ZA 2XMGA 3Q5EA 2PMEA 3NBFA 3DC2A 4UUQA 5ALFA 5DK4A 1TUIA 2ZYDA 1RWMA 1ZAKA 2X8AA 5EKSA 1N0IA 5EKXA 5AJWA 2C61A 3JASB 4O4LB 4LC9A 4FW9A 2O01E 1ZP6A 3QOFA 4A53A 4AFQC 4W7HA 3LT4A 1FSZA 2GPAA 3PC6A 3WADA 1GT6A 2N75A 3DBRB 2GLXA 4A8PA 1BS9A 5CMLA 1GZ5A 4WUTA 2PL9A 3BIXA 2EQIA 3WXBA 3KELA 1K9MU 1W0KA 4CL0A 3ZW8A 4WXPA 4MIEA 4JS0A 3NC0C 1ARZA 1RM4A 4RCCA 3HXKA 1SRLA 4XB2A 2CYAA 4BEWA 2RH9B 1L5VA 5F35A 1OPKA 1KZHA 1J4AA 1SHLA 1NPYA 4ZKEA 2ISQA 2WG0A 5ALMA 4KIWA 3QK7A 1XVTA 1YJWQ 1ORRA 2XKJE 3CCLT 1X8JA 1KQGA 5D01A 4F4DA 4LNPA 5LIRA 4ZWNA 4DM7A 1C9YA 1YZNA 1PEAA 4W8HA 1Y8QB 2PLWA 3JQAA 3OT1B 4LGYA 5EC8A 4RE6A 3ZDXB 2NACA 5EESA 3TE6A 3C85A 1XLTC 3ZHOA 1XTPA 3LGAA 1NPDA 4MGIR 2BUDA 2REQA 4PG7A 1E1RA 2CH4W 2RHXA 3LT0A 4N0DA 2ZJOA 4M7DA 4US1R 1I4K1 4D79A 1GEEA 2Z5VA 2GK4A 1H8EA 1VOTA 3T7EA 2HPVA 4C0FA 4MHOA 5AR1A 4CKYA 3OKAA 4KLNA 2Q3HA 4DOVA 3REAB 1YJ9A 3SC2A 4DT1A 1L7OA 5C7YA 5BV2P 2JCGA 1HKUA 2ZR9A 5DTRA 4HJRA 5THXA 2O20A 4N8DA 4BLQA 2BHSA 2DTXA 3C5WP 5IW8A 4PJOA 3IEMA 5ERYA 2IBMA 1HDRA 1OAKA 2J5QA 4D5GA 3HJUA 2XYVA 1F4LA 1IY8A 3K1TA 4PLFA 2ZR7A 4B76A 1SVLA 4AG3A 2YH2A 5CR9A 4WK6A 2G04A 2YQ4A 4MQ4A 3ZDBA 4B6PA 1DE0A 2REXB 5CFRA 2WHXA 1W4SA 3IA7A 3MVEA 4QLAA 3OO1A 1Q0QA 3WWOA 1B8OA 3WYNA 2DKNA 3JCMd 4F9TA 7ADHA 2ZUTA 3V42A 4ZJZA 4RLHA 4L7VA 1YS1X 4BRZA 1PQPA 3G2PA 3H8VA 3K0BA 5FOUA 3CRW1 3FOCA 3MTIA 4I1SA 3PI6A 1VJTA 1JEYA 1JAYA 2BP7A 4EPXA 4M77G 3OQVA 2ZXEA 1U90A 3LUDA 4LJ9A 3RSHA 3EAFA 5EWLB 1QHXA 1NUSA 4QTTB 3ZJYA 5FUXA 1VIEA 2H2FA 5AVSA 2J7IA 4OQPA 5CVJA 3UA3A 3UM9A 3HTRA 3CWCA 4L9RA 3USZA 4MS1A 2ZUBA 4QQ6A 4F9FA 1SCJA 4JUAA 3OQIA 3KJFA 4L3WA 3DB4A 5JSZB 3U0VA 4M4ZA 3BZUA 4DGSA 4PO8A 4D6XA 4LCEA 2W2VA 3FDJA 3ANSA 1TZMA 3FCOA 5HKLA 4EVIA 3O8RA 5JO0A 2FDRA 2QVLA 2WR8A 3HM2A 4PQFA 1YS4A 2CCGA 1JJFA 4KI0A 5A2QA 4LDXA 1JA0A 2C82A 2D4HA 4LWQA 4P38A 1Q7YR 2WV7A 3OEWA 1PR4A 3AZOA 2BGGA 1QKIA 2EGGA 4L78A 3EA5A 4NE7A 1Y9AA 1KSHA 1L7QA 2EQBA 4IDDA 9GPBA 1KK2A 4GMKA 1LRKA 3KOMA 1ZW1A 1Q1GA 2BBWA 2DQKA 2HWXA 4BQSA 1O87A 5ECYA 2CFOA 4N8EA 4IZOA 4F7WA 5CLQA 5I7WA 1R0KA 3D8BA 4HZGA 3I83A 1U9JA 2EBPA 4L5IA 1LK5A 1XZBA 3NWPA 1P81A 2FK7A 4MSUA 3RC7A 2J7PA 1A8IA 4M9CA 1E20A 1ODFA 1A4XA 1HFJA 4YK7A 1M7GA 2BT4A 1J0AA 2QTTA 3K6JA 4H08A 5EE9A 2B25A 1M34A 2CXOA 4EQZA 2O0LA 3G2KA 5DMHA 2JRLA 3N74A 4MJ3A 3JQAB 4ATOA 3QVUA 1VQ8A 2NZ8A 5C3UA 4X7BA 3O31A 1WFWA 4HAYA 3GJXC 1DLIA 2Q7XA 2BGKA 4KVGA 2P84A 1UZLA 5F3WB 4DG8A 1GGMA 2REQB 1TS9A 4M7DB 2ZLBA 2J9ZB 5GANd 3VS7A 3RT7A 4P7FA 3ADPA 4YROA 1J0CA 1KQ1A 4G63A 3BD8A 5GMKj 1ZLYA 3SC2B 4DT1B 4K9KA 4KQFA 4ZQGA 5ECAA 3AL2A 5AW8A 5H02A 1W6XA 4JLDA 2C7VA 4JP5A 4B73A 1QIJA 2A94A 4GGPA 3KSMA 1M1KC 5TMPA 1Z2OX 3USCS 5TS2A 3IEKA 1M9NA 1Z82A 1HRKA 1N2CE 5KTKA 4DWVA 3RFFA 5CLJA 3FI0A 1T9HA 3QE0A 4HYQA 2W6CX 3WJ7A 4YUAA 1E6MA 1N2HA 4N54A 1VSQA 4EKIA 4YWHA 1NLZA 5C8DA 2EQKA 4LRSB 3V1YA 3MJRA 3ZI7A 3EIEA 4LE2A 3KZ1E 1ZS9A 1KYZA 1QAMA 3QEJA 1RZRA 1RYNA 2X14A 4GPTA 2ID8A 3OMLA 2XUPA 1GFIA 4CXMA 4EJMA 2CGEA 4Y2QA 2Q99A 3MO8A 3BREA 1C6VX 4N7JA 4MS4A 1PHRA 3ZDAA 3MB8A 4K6MA 1JEYB 2HBPA 4RQAA 2Q3CA 4GKJB 3S5UA 4BWGA 4D92A 3KZOA 4FX2A 4KQXA 1HYQA 1JLMA 4NBVA 2H5JA 4Z1MD 1SBTA 3BC1A 2XT0A 3Q5DA 4IOMA 4QNMA 2QPAA 4ZYWA 3N76A 5DEIA 2FOLA 1G5FA 3MXOA 4X94A 3ZI4A 4QDJA 4BQNA 1NMZA 4MS1B 4JEMA 4MV5A 4EB8A 1ZA1A 2P9JA 1NWCA 1G5IA 4MQBA 4HLCA 2OM2A 3DZKA 1V9CA 3IMGA 1A95A 5G02A 4HWSA 3H3JA 5K0ZA 5HRCA 1I1JA 2YDYA 5FLXA 1YL5A 4DOWA 4M0LA 5HZHA 4KRXA 1S1CA 1YCFA 4RG8A 2EP8A 2H5IA 2GRAA 3PR3A 4CMIB 3AKZA 2C92A 1D6JA 2V6IA 4EKEA 3G4ST 1OJLA 3DE2X 5IMSA 3HFJA 2R79A 3GJQA 2I66A 4DKJA 2DLCX 4BZZA 3LXRA 4OG2A 1JE1A 3DCJA 4O1HA 3PT5A 4PBTA 3OE7D 4FSSA 2BFFA 1G17A 4KGZA 1VTKA 3ZCXA 2EYYA 1SFRA 5B58C 4JZYA 1Z12A 2EAUA 2L18A 2P4HX 2ATCA 4QUHA 3CC4T 1OKKA 1WSWA 3QITA 3SI7A 2ROTA 3KHSA 1N7GA 2O1WA 3FXAA 1YI0A 4Y6RA 1H9CA 1K88A 3CVYA 1GGEA 1RS0A 1Q91A 1ZCZA 5DP2A 4L59A 5FUMA 3CC7Q 1JX6A 3UFBA 1N2ZA 5I7VA 2C4NA 4JBXA 5GAOq 2C7GA 1I2CA 3MWLA 4FXPA 1QTIA 1MQ8B 2GKOA 5JXWA 5BNIA 3NOXA 1M34B 3EE6A 2WF8A 3T5MA 1H0RA 3ZLJA 3PTZA 4FCTA 3DKKA 4K81B 1KEZA 2LCIA 1OFUX 2CHUA 2P67A 1FC0A 2P9HA 4GI7A 4GM0A 3UXEA 3PFNA 1VPDA 5DYTA 1PWEA 5HDQA 2Y93A 4O1IA 2DH5A 1FTYA 1FDIA 3CF6R 4HQOA 2COUA 2SICE 2WFZA 5ARBA 4NYJQ 2FGJA 5DM2A 3SB2A 3CD6A 2HA7A 1TX4B 2VXYA 4GZLA 3N53A 3ZUPA 2PZKA 4HFJA 3CJTA 2B36A 4AZWA 4E2XA 2VO1A 1VJCA 2ZAMA 3SU8A 2YMQA 5ESXA 1HA3A 4NDNE 4XQ9A 1F51E 2CMKA 2XVAA 3HSSA 4L0DA 1RL2A 1F8GA 5FWDA 2FSUA 2RF0A 1U4NA 1MO5A 1TYCA 3R9IA 2XXAA 1JR4A 2PY6A 1IMOA 2NXWA 2YRVA 5BR8B 3AY6A 3W5JA 3ZIDA 1VL1A 2G72A 2XU8A 1RACA 4TS3A 1QLHA 4NFYA 2QR5A 1U9IA 3QELA 4EO7A 3T34A 1SSFA 4TV8F 3FPCA 1TMYA 2W22A 1YB6A 2HV9A 5IRCD 3QBYA 1T15A 4QPNA 4EJSB 2GA9A 1RAGA 1M6WA 4CEJA 1AZLA 1KI1A 4OJKA 3I9JA 4MS4B 2G70A 3FMGA 3E7PA 3KQWA 5D6OA 1ZUD1 5SZIA 4OXKA 4C88A 1A8PA 5FLKA 4ZEOA 4FW2A 1H4QA 2K7FA 3PUIA 5A9SA 4QVDA 3CN7A 4R2IA 3DDHA 4FT2A 3Q3GE 1SXHA 5J3BA 3GUCA 3HV0A 1RQPA 2CB9A 3I6IA 1E3LA 1OU9A 1ZA1B 2QUKA 4EB6A 4A0QA 4AJPA 4NZYA 1ZNXA 3MS7A 3FA2A 5E9AA 4P4SA 3CGWA 5F4ZA 3U39A 2R9VA 2XCTB 4M77D 2VP0A 2P3QA 3C1OA 1YCGA 4YH1A 3AVOA 4P8RA 2FPIA 3ST7A 3SDZA 5KYKA 2ZRBA 5EA2A 3IR7A 2VKQA 1VQ6A 4GXNA 3S68A 1QVGA 3M1AA 4E7OA 1T9AA 2JGKA 2YC4C 5H3CA 1K8ZB 4BQPA 1GL6A 2ZR8A 4ND6A 4PHFA 3VPAA 2HSEA 5JZBA 1YMUA 5F5LA 5KJFA 2Q4DA 2R97A 1EE1A 3GLFE 4B4DA 3H4TA 4FGSA 2FB9A 3NRJA 2YDLA 2BFFB 9MHTA 4KGZB 5HGJA 5EP1A 3EVEA 1L5RA 2FUKA 4J2TA 1ZPDA 1QHHA 2ATCB 3LX4A 2W11A 1OH7A 1Y07A 1OYYA 5ADUS 1JN0A 2Y0DA 3VI4B 2JS2A 2HNBA 2HJGA 4TMVA 1JSLA 3HYCA 5A6SA 5CCXA 1NONA 3KB8A 3EHQA 2F3UA 1PD1A 1YVEI 4K8OA 4DVJA 4BJ6A 1KDPA 2V45A 1NG1A 4J1NA 3EPHA 3MG9A 1IB8A 5I9TA 5KUTA 3AR3A 2BFBA 4UW9A 4MW7A 4LHWA 2JAQA 4JUBA 1IWOA 1PDVA 2JK1A 4MMXB 3ZJ4A 4MNTA 3WKCA 4UBMA 1SVIA 1YVPA 4D9GA 1IN5A 5LOVA 2YHIA 1V2GA 4J3FA 4IXTA 5CH8A 4KLAA 3OY2A 3D2BA 2B9EA 2O2CA 1IZ8A 3DDZX 4UJ3A 1HT1E 5I5GA 2A0UA 4FZJA 1PWZA 3UEOA 2MSNA 5LA6A 1QH8A 3NS7A 1NJ5A 4P5DA 2E2WA 2LX9A 4DB2A 4N7RA 3QKUA 9ATCA 4LVNA 1TVKA 2R3SA 1GFDA 4QDXA 2BY4A 4JLMA 4BN4A 2QY6A 4WNAA 4AO7A 4G4JA 4RKFA 3C6YA 4ARSA 4DLKA 4UQOA 1XYGA 2YWDA 2GLUA 4JNKA 1VCIA 3UOGA 1F38A 1SOMA 3DTVD 2PS9A 4MUHA 2NVBA 1KZ7B 2BLLA 2VPQA 2EWNA 4ZGWA 2D2VA 1KK3A 3U17A 2XXAB 1D2CA 3G2OA 1Z0DA 1YFJA 4XTYA 1UBOS 5IK2A 1GV0A 2RAPA 4UZSA 4BJ5A 1RACB 5AKZA 4OLHA 3QELB 5LDDC 2BGLA 3OPNA 3TLJA 2I1VB 2DK3A 5BRJA 3KLOA 4F8EA 3M9WA 1JAHA 1LS6A 1RAGB 3H83A 4CEJB 4MO2A 2UVPA 2H3HA 4NCBA 4CU2A 3GC6A 4UAJA 2QNRA 4B8YA 1F48A 2QGNA 4MA4A 4BDTA 1JJVA 4G0QA 4B9AA 1OAOC 3JV7A 1QB8A 1GTJ1 2VEDA 3REGA 5A9SB 1RRPA 2BHNA 4HEHA 4EGSA 1DBPA 3ZVNA 4Q3EA 1DJOA 3GF5A 2R5NA 1E62A 1FU7A 3CTMA 2VHZA 1Y3CE 3NZEA 2QYOA 4EB6B 2JJ1D 3RUAA 4WA8A 3CRRA 1C30A 1Y63A 4C92F 4P4SB 1H8HD 3WIDA 4MW2A 4J07A 4ZZIA 1FW6A 1FNDA 4DIMA 1R1DA 1ML4A 4DV4B 3O7WA 1EGVB 5ARCA 2OD7A 2FPIB 1KY2A 4INAA 4J8PA 3INGA 5JVDF 4M75G 4QE3A 721PA 4KFCA 4II1A 1DB3A 2R8XA 3P96A 4IM7A 1PX2A 2VTDA 5JQGF 3TRDA 1M8MA 4OGEA 1RYFA 3PEFA 2XDWA 2FV8A 5IDWA 3IPAA 3BE4A 3AHDA 4JB0A 4JR0A 1JBKA 2H4WA 5THQA 5MHTA 1QHHB 3HYRA 1NOJA 1XQWA 4WXYB 5FL3A 4KR0A 5FJJA 3B13B 3CBQA 4QPDA 3RAFC 1WSDA 3AY0A 3ETLA 2FWIA 5A6SB 3HB0A 2XOXA 1YJNT 1J2JA 3QHPA 2PBZA 2GEJA 3GLUA 1XGKA 1YDWA 1Z3IX 3TAHA 1THZA 5I7AA 1UFQA 2DFTA 2DSNA 2O7NA 2LKDA 2ONZA 3NR2A 2YXLA 2BFBB 2OECA 2C8VA 4MVXA 4JJFA 4A0HA 2D4AA 1GRIA 1N6OA 5KHLB 5LOVB 2JFUA 2ZB2A 2YHIB 2C29D 5EHGA 5KJ1A 4IQ0A 1XDWA 2GNPA 4KPUA 4WAUA 2HW8A 1T0PA 3N2KA 4ARCA 2X6RA 1WV0A 3HCFA 2BZXA 4R8MA 4R1LA 3SXPA 4HGQA 1QH8B 4TKZA 3PC8C 1XZFA 4B85A 3R24A 4GZMA 3RBBB 1ZSZA 4M0CA 4D26A 1WUJS 1UJBA 5JH7F 3RVJA 2DO3A 4E1BA 4J7AA 4MUYA 1AKRA 9ATCB 2WIGA 4OMFG 1TVKB 1Q84A 5I9IA 4JJBA 4WNAB 2PNIA 3UA4A 2RC5A 3ZZNA 3RERA 4BP3A 4M8SA 3RMQA 4DLRA 2J09A 4NS4A 1VCHA 4NU5A 5KPDA 2UZAA 3CBGA 4IHKA 2CSQA 2REOA 5FQNA 1KNQA 3VAZA 3JQDA 1T1RA 4MUAA 5K0JA 2EZ9A 3VA7A 5G1NA 2C58A 1JEQB 2JGDA 4KCGA 2BE9B 1F8YA 4E6RA 1YNSA 3TJRA 2HXSA 1HE1C 4DMUB 1O97D 3GMIA 2CDNA 5AKJA