4DEXA

Crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav2.2 i-ii linker.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
289
Chain Sequence
b'EDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit beta-2
publication title The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
total genus 95
structure length 289
sequence length 317
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4dexA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dexA02
1Q12A 2P6UA 4Y0VA 2ZSAA 4XOIA 1UKEA 2ERYA 2XZPA 1MH1A 4P4SA 3AKYA 4TLBA 4D80A 4Q7MB 4FW9A 2NUZA 3NXSA 1XCMA 4RD2A 1Z08A 1JB1A 4JLDA 3GFTA 2JASA 4EAQA 1EWRA 5KSOA 1VIAA 4XH9B 1YZUA 4HB0A 3J81k 1RJ9A 1R5NA 2YC2C 2L0XA 4GNKA 4BZPA 3UMFA 2VP0A 3B1WA 2XITA 3OEEA 2F2WA 4IDPA 5M04A 2ZJYA 3VR5A 3X1ZA 3K70C 3M0PA 1SRLA 3M4YA 4LYJA 2WJYA 2ZM5A 1XXHB 2KGTA 5E4FA 1VCOA 4UNPA 4V0MA 1U90A 4IIOA 1MRSA 5L3QB 1OH6A 4X1VA 3UMRA 4C3ZA 1OT3A 4N0DA 4TL6A 3CZPA 2EYZA 3TUJC 1F2UB 3TR5A 3TUIC 2DPXA 4IW3B 2AK3A 1IY2A 1W46A 3TJZA 3AKDA 4ASUA 5D3MB 5F98A 1EX7A 4Q1EA 4OHVA 3A4LA 1RPZA 2V1RA 4J9GA 4RTWA 1SZPA 2OXCA 3QPUA 3MGCA 4MKGA 2QROA 2O0JA 2QUZA 4JL5A 3WBJA 4I1OA 3PFIA 3QXHA 4NPHA 2ZE7A 4B2PA 4PC6A 3KXLA 1G8GA 3K8YA 5FTNA 4MDEA 1G19A 1N3BA 1NBMA 1IN6A 1QVRA 4MQBA 1KO8A 3NHAA 2OT3B 2D7DA 1BS1A 1UKZA 5BYJA 4EPTA 4E5UA 1ZBJA 1EGAA 1O3YA 1WE2A 1DPFA 3MWKA 4Z54A 5EC7A 4NU0A 4RZUA 3X2SA 2GHIA 4DJTA 5EZ5A 3AF3A 2QMUA 2C9YA 4BWYA 4MKIA 3PVLA 4IEIA 3CQTA 4V0KA 2QQ0A 4GPTA 5G3YA 1KDRA 2V9PA 5BN3A 1T0JB 3U6BA 2RGCA 4DLVA 1RYFA 2W6ID 2C0IA 3NIBA 2PLRA 4Z88A 1XD2B 2BBWA 3JVUA 3HDTA 4BASA 4K46A 4Q5IA 2VP4A 4BRWA 4JZ4A 3QKSA 1ZBDA 1YU9A 4N0EA 2JJ8A 2XB4A 1W7AA 1K0XA 3U3KA 4PPGA 4BFWA 2VP9A 1AJEA 2CDTA 2ZJAA 1AIPA 3MSXA 3VR3A 2CL0X 2XZOA 1D6JA 1GL6A 1II0A 5FWBA 4M1YA 4RVCA 2AX4A 5KSZA 3VNVA 1EFUA 3MJHA 4LJ9A 4EKDA 3CWQA 1ELOA 4LX0A 4US2R 2OILA 2KXCA 2R6AA 1Q1EA 2Z43A 8OHMA 4BGDA 3QWYA 1X27A 2QT1A 2GKSA 2IYZA 5GVRA 2BBSA 1EFHA 1NF3A 2C78A 1JAIA 1E99A 3GFPA 1H92A 1OSNA 3BB4A 3ETLA 2JIZD 1XCGB 3GJ8A 4JL8A 4Q7LA 5DO9A 1Q0UA 3AVQA 1GDDA 3OF5A 4EJSC 2EFGA 4GOJA 4PZZA 4HCKA 1GKUB 3TQCA 1UF9A 1OV3A 2JLWA 1XWIA 1U3OA 3LDAA 3QXCA 5JJIA 4XWAA 4G5OA 5H1YA 4B48A 4TMWA 4MRSA 5BWMA 3LXXA 1NI3A 1PLLA 1GNPA 1N6PA 4F4CA 4LSGA 1QVAA 5IH2A 3I8XA 4TTQA 5C4GB 3U3OA 1E2PA 1Z6YA 4P4UA 1YKSA 1GRRA 2ZE8A 1XBTA 3QVUA 1WXQA 2DL8A 4JLAA 1XEXB 1BO6A 1E0SA 1KDTA 4Q4JA 3B1VA 4MYCA 5L3RA 5HPYB 1P2VA 1N5ZA 2OCAA 1IN4A 3Q85A 5KPDA 2ZPTX 2G1JA 4R9UC 3I9QA 4HAXA 3TE6A 3S1AA 4RKFA 1IXSB 2OXRA 2IEZA 4TYPA 4B2LA 1QF9A 1LCKA 1LTQA 2IYYA 1JQLB 1XOVA 1X6BA 4EQ6A 4NYJQ 4NKRA 1TL7C 3O8BA 4DIEA 1BMFD 1WDTA 4B71A 5KO2A 4O25A 3VFDA 4FMBB 1T0HB 1UBCA 1OXSC 2CEAA 2KYBA 4EUNA 4YQFA 4DDWA 4Q18A 4KI0A 4D4LA 4LRWA 3V4FA 3AUYA 4DEYA 3HWSA 3UK6A 4DKXA 3A58B 3AVPA 1FP7A 4NCHA 5CJ2A 1HE8B 4X8MA 2IWRA 2ODWA 2JJ1A 3IDQA 2IW3A 3I8SA 2GEUA 2D3WA 2QDLA 1G8HA 3AVOA 1MV3A 5AUNB 3FKQA 1S3GA 4B6EA 3RWOA 3VU9A 1SKYB 3GLFB 4E6RA 1WIEA 2OFOA 4QHYA 3RC8A 2RGNC 1E7OA 5IXBA 2J1LA 4WCIA 3LBIA 2OSBA 3T5DA 5JWHA 5SZHB 4ARZA 5DI3B 4MUBA 3AQ4A 2IYUA 5ANRB 1OH8A 2PH1A 3K9LA 3EA5A 1UEIA 1CR4A 1P73A 1DVRA 1WQ1R 5FTMA 3WRYC 1M34E 3QF7A 1G4UR 1NY5A 1ZM2A 2FZ4A 2J9RA 2G1KA 1E2KA 5FOSA 4WA7A 1I1JA 1UE9A 1FNMA 2IYRA 1I2MA 1JPNA 5DN6D 3I5YA 5CK4A 4YC7A 4RTXA 4M0LA 4GP7A 3QEJA 4CEHB 4KFUA 1TQ4A 2IYLD 3EASA 3GEEA 4A0FA 5JBQA 4HLUA 5EE1A 1JECA 2ZI6A 2IUUA 2GTJA 5K8IA 3OE7A 4IFEA 2QI9C 3KKPA 1XJCA 2GAOA 2ZYWX 1CXZA 1TADA 3K0AA 4PO8A 1W4CA 1G8YA 2ZXUA 2UZIR 4DC9A 1LW7A 4Q47A 1KOFA 5KNDA 3QF4B 5BQ5A 5J4LA 3EZFA 2JLQA 2V7QD 1E96A 5H68A 3QI2A 4M1SA 2OCBA 1GFIA 2F43B 2REXB 1P61B 2QZ4A 2XGJA 4JJZA 1SQ5A 4L15A 1M3BA 3CF2A 3NVAA 1Q1BA 4LYHA 2CUBA 2P2LA 3BH0A 3R7WA 4Q00A 2JM8A 4ZDWA 2ZYUX 4R98A 3T06B 1LF5A 3DMDA 2DE0X 4GLMA 1COWD 3CBQA 1ZMXA 1ESNA 2IUTA 3CNNA 4M4ZA 4NYMQ 3ZLJA 3U23A 1G17A 4DLWA 2GCNA 2WSMA 2GCPA 2CJWA 3H86A 4KAXA 4CF7A 1KZ7B 5BXQC 1CF4A 4HB2A 1AQUA 4ZNXA 2KRSA 2RQTA 4BZXA 3PEWA 1W0KA 1U06A 4LY6A 4Q4LA 2FFBA 3F5FA 4BPBA 1E79A 4XD7D 1XB2A 3IPYA 1H8HA 4UKDA 4WZ6A 3QKTA 2FSGA 3LX8A 1Z22A 1AZSC 3TR0A 1Z47A 2R6CA 2WOJA 4D2IA 1N6NA 3EIEA 4ZO4A 4URWR 4HLUC 3RRNA 3RS7A 5FOTA 721PA 3KUCA 4RTVA 1CULC 3FB4A 4AKGA 1NEBA 1PJRA 2BBOA 4HAZA 1KI3A 2FH5B 1R0WA 5IHKA 4WXPA 3KQKA 1ZD8A 2CHVA 4IRUB 5FBRB 3TQFA 1FMJA 1GAJA 2IK8A 2WJJA 3C14C 3R9IA 1U8YA 3M0EA 1QHNA 4LI0A 4YMTA 4Q1BA 3ND8A 5KNBA 1MABA 1CLUA 3EZ2A 2JJ2A 3IGFA 3K70D 3O5ZA 3K0CA 3CM0A 4A4DA 1T5IA 1W4RA 2FSIA 3NHBA 2YWGA 2ZYTX 4TYQA 2PCLA 4DRZA 1HT1E 3CO5A 4OKSA 5AJXA 1WYXA 3A1TA 1ZC4A 3IUYA 4TL8A 3EWSA 1VCIA 3QG1A 4FXPA 1AZEA 2HDNB 4D0LB 3EG3A 5IHNA 4RKEA 4B35A 4FMDF 4RFSA 3IBYA 4KHZA 2BIFA 3LH5A 5TDHA 3H0IA 5CYOA 1TUEA 3A36A 4I1SA 4M2LA 1PWTA 2BCJQ 3PITA 3SDZA 2WIAA 3IKJA 1Z6GA 1BU1A 2E87A 3RS4A 3IIKA 1ZRHA 3U61B 2G77B 2RGDA 3CF0A 2O8FA 1SGWA 3BXZA 4ZKEA 4KO8A 1NL3A 1TEXA 5A0FA 5B57C 5K8UA 4F14A 4PANA 1K6MA 3R9XA 4M9QA 1NRJB 2CLCX 1KO5A 3FOZA 3SFZA 3FVQA 4Q7KA 3FHTA 1IN8A 1JEGA 1SHZA 1NLFA 3I92A 4YDHB 4DLSA 1NY6A 3B9PA 5KHOC 2HUPA 3T15A 4RD0A 3IEVA 2O8EB 1S3SA 3WHKA 1BYIA 4PZLA 1ZM9A 5JJKA 5KSYA 1BOFA 3T1VA 2X19A 1N5KA 2E5KA 4P31A 4BFZA 2J0UB 2N1BA 4LDJA 4Z8XA 3QSYA 3TK1A 3MAAC 1VYTA 1G41A 1NIPA 3OEED 4UQOA 2DL7A 2QPTA 1M6NA 1ZUHA 1QCFA 1P7CA 2J45A 2PMDA 2REOA 4NP6A 3C41J 3K0CC 3RRYA 4Q9HA 2HYIC 1H8EA 2R2AA 4PC2A 2DYKA 5F9FA 2ZS9A 1G8PA 3I35A 1Q1QA 2Q9CA 1GBQA 2QPAA 5JS8A 1E69A 1IAQA 3H1TA 1R2QA 3H0FA 2JLRA 4KU4A 2BMDA 5E95A 5C18A 2QN6A 1DAKA 5L3QA 2L3PA 2D7CA 2FOLA 2ODEA 3W8NA 2CSQA 1F2UA 5TARA 1P60A 2H16A 4ZDJA 4URXR 1E98A 3AKCA 1N5JA 1E4YA 4NBSA 2ZRBA 2KR3A 5AR1A 1W70A 5FTJA 4MKHA 2WJGA 1FTSA 4O0MA 4U00A 1GILA 2DWQA 2FO0A 1YZLA 3HP1A 3QY0A 1IONA 1UBFA 1UUEA 5KUTA 1LNZA 3C7KA 4TYWA 421PA 4ZCIA 2IYVA 1SHKA 3K09A 5HE8A 4GL2A 1AS3A 4QJ4A 3KTAB 3EAQA 2KEAA 1P75A 3Q8XB 1U9IC 1SHGA 3NH6A 1G9XA 1MO6A 3VKHA 5KTYA 3DEFA 2QA5A 2DA9A 2XX3A 4XIGS 4EDHA 3ICQB 4PSAA 2CVHA 3GJ6A 4AYWA 2LJ1A 1HV8A 3CZQA 4TMKA 4D82A 3KQHA 5KNCA 1XPRA 4OI0A 1V5WA 5CDFA 1G7CA 2EW3A 2W0SA 4K11A 5DH9A 2QG6A 3B6EA 4GDFA 2WICA 1T0JA 3KKOA 5KYKA 2WZQA 4Z89A 1EK0A 1HEIA 3PUYA 1HSQA 1P9RA 4V0LA 5DYIA 2OLKA 4OMLA 2AFHE 2CSIA 1YZTA 4M8NE 2FPMA 4IIMA 2QSYA 4R7ZA 1ABOA 1NN3A 4RY2A 5F2EA 2ZSEA 4FMCB 1NN0A 2J0QA 4B76A 2FEOA 4FCTA 1GSIA 2AKAB 2F9MA 4KLNA 1LS1A 4N1AA 4HVVA 1Q20A 4PAQA 2VHCA 2D2EA 3B8HA 1T3HA 5G40A 2JAQA 3RC3A 4FIDA 2Y8EA 3W5JA 4AK9A 4QJ5A 1Z3IX 2OUKA 2K79A 2GXUA 2BDTA 5E7IA 4LC1A 3U3RA 2ABLA 4ERNA 1VTKA 3GJ5A 2VYFA 3VS0A 1C4OA 3IQXA 1G3IA 4OMQA 4XVQA 5FUYA 3THWB 1CRPA 2A5JA 2ZROA 4A8JC 3K09C 5FWCA 1GTVA 2QNRA 2QT0A 2QM7A 5I22A 3F0TA 3KB2A 4TTRA 3L0OA 1TU3A 1XZQA 3P4YA 4PHHA 3V9PA 1X6VA 3W3ZB 1DEKA 4B32A 1EXMA 2KXDA 3OEHA 1E1QA 1KY2A 1S96A 1B07A 1C9KA 1QDEA 1UDLA 2A3RA 2IXGA 3IO5A 4AKIA 1X2QA 3LWNA 1T9HA 1AS2A 1Z0JA 2BWJA 2EFHB 1ETUA 2MMGA 3E5HA 1X6GA 1G5TA 3VX4A 5IHPA 4Q9LA 1KI6B 1RLPC 4URZR 1G20E 4KLZA 4CEIB 4V0ME 3D6TB 3G0HA 1A2KC 1ZLMA 4S2EA 4PZYA 3IEUA 4DT1B 3I3SR 3FYHA 5B2ZA 1KAOA 1R0ZA 3ZS8A 4CIDA 2WV9A 2F1IA 1EFRA 1NKTA 2YINC 3EZ9A 2D8HA 3EC1A 3NGPA 1J3TA 1T0HA 2G9NA 2RGAA 2JATA 2CLDX 1JNYA 2PZGA 1CKBA 1KY3A 1OYYA 1MO5A 1A0NB 2WKPA 3A1WA 2XNDA 4LJ4A 2JLUA 3P4XA 4M1OA 2GBQA 2DFLA 4OHZA 4TYYA 4L4UA 3LA6A 1ZIOA 1WMSA 5C4MA 3ZIAA 5DNYB 3CUEF 1T4GA 2VHUA 1WF3A 1YE8A 3QG5A 2ZSFA 3AKEA 5AWFC 3ZYCA 1SXJC 1Q3TA 2OBNA 2KT8A 1KMHA 2AKYA 4KVGA 1Z07A 2PT7A 4DSOA 2AWOA 5JZVA 1M7GA 4E07A 1N6HA 2FN4A 1U5SA 2VTKA 1E4VA 5JRZA 3GJ4A 5A5GA 3CRMA 1XTIA 2C98A 2W2VA 3VS5A 2FF7A 4FN5A 3VHXA 5FBQB 3WNCA 5FW9A 4OQNA 5ELXA 3NDBB 1UADA 3F8TA 2WWWA 3JZMA 1NN5A 1CTQA 2ZR9A 4MGZR 4DUGA 3ZJYA 1FMKA 2YYZA 2A78A 3B2EA 3AGQA 3TRFA 1H65A 1NSTA 1XD8A 1ZJ6A 4YXWD 1ZUNB 4ZIRB 1AZTA 4NYJR 5FTLA 2OLJA 1P2TA 1XEFA 4XJXA 4D0GA 3VX3A 3ZGXA 4C0BA 3GP8A 5HKKD 1ZNYA 1J8YF 3FPAA 4CEHA 4E09A 2G0NA 1IN7A 2A30A 4R2IA 2ZIAA 1IJEA 1UECA 1MO3A 1A4RA 1VPLA 4LJ5A 3OESA 4RFVA 3RSLA 2IS2A 4BECA 4DWJA 1ZNWA 5JWOA 3THKA 2JLSA 2OCYC 1PV4A 1KMQA 2ZEJA 1UJYA 4US1R 3TKLA 3AVVA 1CBUA 4JS0A 3C5CA 1WLPB 1IY0A 4K8OA 5TB5A 1CJMA 4DB2A 2J7KA 1U98A 2CK3A 4X8HA 1G16A 2C03A 4JVSB 1N0VC 2QTVB 1N6LA 3AEZA 2LP5A 2F43A 1II9A 2A37A 1OHHA 4XSHA 1OLOA 3R9WA 4M9SA 2GZAA 4OHWA 3ASYA 1G7TA 1W1WA 4UJ3A 2DRMA 1HD3A 1CEEA 2GXQA 5TY0A 2WWXA 2D1XA 2BOVA 1ZINA 1X43A 3LX5A 2R6DA 4Q03A 4GBMA 5EE3A 2ZI7A 4LHYA 3M0UA 2H18A 4NH0A 3ZD7A 4CEJA 3VR2A 2O8CB 3NMZC 4F16A 2L2PA 1IXZA 3EHQA 2OZEA 4LZZA 1JXOA 1Y57A 4QGGA 1MO4A 4Q9KA 1K76A 2BC9A 2R6GA 3M1IA 4EFMA 2GWHA 1OH7A 1ODFA 3AB3A 4NMMA 2NMVA 1H8HD 2IUSA 1E2LA 1D9XA 4MRRA 2K6DA 2XNSA 2BMFA 3EZ6A 3IPXA 4MGIR 3VHLB 3NBXX 2YUQA 4HAYA 2F1HA 4IVPA 1WB9A 1P72A 3HR7A 1U2RA 4LK2A 4BLPA 1KGDA 5DGXA 2V6IA 4OMOA 1GFDA 2ANBA 3R8CA 4RZ3A 5DE3A 2DB3A 2LJ3A 3PVQA 2E1RA 2GF0A 4A36A 4GZMA 5KSPA 1W5SA 3OIYA 1JXMA 2LQWA 1R7RA 1YZNA 3B9QA 4CYMA 5AUPB 2EYUA 3O8CA 4XVRA 3ZVNA 3HPQA 3NWJA 1OPLA 1XMSA 3GBQA 2J7IA 1ZSGA 1F60A 2GGRA 1XFAA 2B7BA 2DR3A 3VTKA 5E3HA 1KI9A 3FDIA 4LYAA 1E32A 1QWEA 3C0CA 4YMUA 2EKHA 1TQDA 4URYR 1D5CA 2V55B 2J6KA 1NYFA 1OKKA 5F9HA 3BFVA 2BKUA 4TL9A 3NBFA 3GJ3A 4P0TA 3K0EA 1KSFX 2H92A 3QKRB 4NYMR 2QAGC 1A2BA 5FI0B 2VWFA 4C0JA 4Q1AA 5CB6A 2VLIA 1HQYE 2C8VA 2VP6A 4RJLA 1R5BA 5EE5B 5FR1A 3ADDA 2EQIA 1U0JA 3PCRB 2O0KA 1SSHA 4GP6A 4XTRA 4ZPXA 3H41A 1KNQA 5KDDA 2PCJA 1YCSB 1WI7A 2HT1A 3L8YA 1SHFA 2DBMA 2EPDA 2ZRCA 4GSYA 3GMTA 4UXJA 1GG2A 4ZV4A 1GCPA 4A6PA 3BC1A 2UKDA 4J9IA 2JXBA 2KBFA 3BERA 3EC2A 4TSFA 1QWFA 3RS2A 3L82B 4I81A 1HH4A 3UXMA 1QHXA 3CW2A 3DPUA 4Q4AB 2Q6TA 4C7OB 3M0SA 1E9DA 4JZ3A 4EIKA 4JLVA 3LVRE 1WRBA 4TQAA 1SVWA 4IHQA 4NL4H 4D0NA 1E9AA 1OXXK 2B6HA 1P2UA 3KJIA 4P33A 1NLOC 1KSHA 2HV8A 2NZ8A 4W5HA 4PAMA 1NMYA 1X1RA 1JQJC 1GL9B 1ZUUA 2OBMA 5IF9A 4YMWA 1CKAA 1NVVR 2FPLA 3B7GA 1QHHB 621PA 4M4SA 2ASEA 2A28A 3VRZA 4X8LA 2V1XA 3IBGA 4ZCLA 4Q4HB 3WMGA 2XOKA 3A8TA 221PA 4F93B 2IS6A 3GJ7A 4GI7A 1KO7A 3FTQA 4QKQA 2J0UA 1U99A 3B1ZA 3H4MA 4HLDA 3UATA 1H8ED 1E1RA 2WKQA 4GOKA 2NIPA 4EPWA 1ZUIA 2HJVA 1EFNA 3DZDA 4KFRA 5JECA 2K9GA 1JR3D 2EVWX 4CC3A 3GEHA 1OF1A 3RYTC 5JHGB 1W44A 2HLDA 2O8DB 2HEQA 4PR0A 2C5LA 1UBEA 1GKIA 1OPXA 1TPZA 4V0NA 4NONA 2CT3A 1OXVA 3ZVMA 1DAIA 2Q0HA 1UTIA 1ARKA 2GZHA 2V3CC 4KYIB 1TX4B 3OIVA 2DCUA 4CC2A 1K4US 2V6JA 4LOAA 1NNEA 2HJGA 4DDTA 2FPDA 4JL6A 4TZ0A 2R44A 2PJZA 2H17A 2F1JA 1JALA 2D4HA 1DE0A 2KWIA 4HAVA 1U81A 2JA1A 4ITRC 2QMOA 1E6HA 1DARA 5FL7A 2GBLA 4LV6A 2DL5A 1YNZA 2QORA 3GJXC 4EFNA 1OB2A 1ESMA 3SC3A 1DAHA 4M1MA 1CRQA 4HDQB 2ZU0C 1HYQA 2ZI9A 3KTAA 3LD9A 2IC5A 2BV3A 2VRWA 1NLPC 3GD7A 3D7MA 1DAEA 2EU8A 1W0JA 4CT4B 2ZS7A 4TLEA 2Z6VA 2ATXA 4DB4A 2WOOA 1RW4A 2C96A 4GRAA 2XXAB 3SQXA 4CC7A 3U7GA 1WBBA 5IK2A 4XWOA 3HU1A 2OG2A 4Q1CA 1XTSA 2NO7A 3HYRA 1NMXA 2NO0A 2ZANA 3FJ5A 1M7BA 2L3QA 2JTEA 4MRNA 2P5TB 1XD9A 3C5HA 1CR1A 3LBNA 2NO9A 1GWNA 4HZIA 4Q1FA 1CIPA 3L0SA 4B44A 4MGYR 2HXYA 1II8B 3BORA 2LJ0A 1J7KA 4ACBA 1YHNA 2KBEA 4PC7A 2DX1A 1IXRC 5BN5A 4D4KA 1BH2A 3CX8A 4US0R 3TH5A 2YWHA 2X3WD 4QNMA 3EPHA 4LJ8A 1GCQA 3ZL7C 1NN1A 2QP9X 3BGWA 3EIQA 2BMEA 4PPQA 4OHYA 1DAFA 3R20A 3RBBB 2CCJA 1SXJD 1ABQA 3MRSA 2OESA 4L9SA 4C0QC 5AJZA 4IXMA 4HI0E 1LS6A 2GBLC 1UDWA 3EGUA 4L9WA 4LBWA 1R0YA 2ED1A 3EG0A 1Z2AA 2YHSA 3VR4A 3CRW1 4A6XA 1E9SA 1G3UA 3DO6A 4JT4A 1FYNA 5KPJA 4PQYA 3AUXA 1E2JA 2KT1A 2O5VA 4LBVA 2IS4A 3KXKA 1XEWX 3V4RA 3B1YA 4TMXA 3WMFA 4H1UA 4TT3D 1W5TA 3EPKA 4D4JA 5LD2C 5FOWA 3X1WA 2QMEA 1QBKC 1SKQA 4B3GA 2JDID 1NM7A 4TMZA 1UFFA 1KI6A 1UKVY 2C9OA 2JLZA 2FEIA 4CEIA 1U94A 1JR3E 4AG6A 2QTHA 2C2HA 1WBDA 4XVUA 1MV0B 5GJVB 2CH4A 3U44B 2GILA 1ANKA 1EFRD 1RFLA 4HB4A 4C30A 1EFTA 5C2JB 1JO8A 1XZPA 3A1UA 2H57A 2OAQ1 4LUCA 5FPHA 1ZC3A 1OIXA 2QE7D 4QBGB 1OIWA 1KIMA 1NEGA 4YONB 1AGPA 4C2UA 3FE2A 2OI3A 2XNDD 1U8ZA 4GT1A 1KHTA 4QHSA 1OE0A 4XTCS 5FFMA 1BK2A 3ZQ6A 3MWYW 5TXGA 3ZIAD 1UHFA 1L4YA 2BCGY 2CCGA 2GNOA 4AG5A 821PA 5FH9A 3SEMA 1GCQC 3IHLA 3C16C 4ABYA 4PHTA 4WZBE 3SQWA 1GRIA 2ZRPA 2R8RA 3HPRA 4BFVA 1RVDA 2CMKA 4J9CA 1S9HA 1TU4A 1KDOA 1HTWA 4Q66C 4YLGA 2CBZA 1E9BA 4DLXA 4FD2A 3MD0A 1NJGA 2F2XA 1QHGA 3AP2A 5SZKB 1QZXA 1S4QA 2Z0MA 2RQWA 2M0YA 3NC1C 4FI3C 2L0AA 5UKDA 1X2KA 2P65A 2GJ9A 4B43A 2ZR7A 1FQKA 2NWMA 4QRHA 4MGKR 3IO3A 2RGBA 1OYWA 4EFLA 4BLTA 3O47A 4PSKA 2PEZA 1JJVA 2PMKA 2EYWA 3I5RA 3IQLA 1E2QA 2WSSD 4ILEA 5LB4A 4ZIRA 1PVOA 2GQIA 2C95A 3OFND 4AKEA 3VKWA 5FPTA 3REFA 3CX6A 1GNQA 1E0KA 1CP2A 4HEJA 4DXAA 1M7HA 2C9CA 3NEJA 4GMDA 2F3RA 1R4AA 3FFAA 1TUCA 3ZQJA 2GESA 3KL4A 4G1UC 2PT5A 4BLQA 2H1LA 2HCKA 2YUPA 1FTNA 1JR6A 1JJ7A 1G6HA 2CK3D 3SJAA 3ZDQA 2FPKA 2QPOA 3D3QA 5FOUA 1G3MA 2ZRGA 1XPUA 1G5PA 1Z6AA 4Z8YA 5GJBA 3RS3A 5AJYA 3FKSD 1SXJE 3T12A 4TZ6A 3DMNA 4QL3A 4JLKA 2M51A 2I1VB 5LBIA 2GK6A 2LX7A 3N2EA 1E3MA 4J9HA 1S2MA 3W34A 2EWVA 2IXEA 1VCMA 4BRUA 3E1SA 4TMTA 2O88A 4LJ7A 2QP3A 1NMZA 3C8UA 1E2MA 1QG2A 2IBMA 2OEPA 4Z1MA 4CZ2A 4KFTA 3K53A 2PZEA 4NZYA 1GKYA 2XEXA 3SZRA 1KIKA 3EIHA 3GEIA 1Q22A 1GZSA 1OXUA 3AGPA 2NQ2C 2QAJA 3DM9B 1W36C 2O8CA 4F17A 2J41A 1NLYA 4JSYA 4HVUA 1WXUA 1VYVA 4MRPA 1NVVQ 2YUNA 2JGNA 3U4QA 3CRQA 2P3SA 1XU4A 3GCGA 2ZREA 3QXSA 2H8KA 4H1VA 4BFSA 1OFTA 5CITA 2VKNA 2QP4A 3QQ5A 4F91B 4M22A 3K70B 5FPSA 4DCVA 4LV5B 1XJQA 2P5SA 2ZRJA 1IHUA 3U60B 2JLVA 4KODA 4GFDA 1W48A 4YMVA 1Z0FA 3QIAA 3QVVA 4AFUC 2OBLA 2CH4W 2CT4A 5JWRA 5TV2A 5IDVA 1Z9ZA 2ED0A 2ZRLA 1Q21A 2ZVPX 4KYUA 1N2CE 1KI2A 4UXIA 1P5ZB 4A0RA 1AZGB 2CUDA 3GLHE 1UGVA 2DWOA 4J9BA 1I4DD 4JLJA 1AS0A 1WXBA 2VP2A 4LUDA 2DFTA 5CIWA 2XZLA 3M0TA 1XCPA 2SRCA 1XMIA 3QKRA 1EG7A 3BE4A 2ERXA 2KI5A 3I72A 5EUQB 4LJAA 5AUOB 2IT1A 2ZSBA 4ESVA 2LCFA 1QHIA 3P1JA 1Z28A 2REBA 4A9AA 3K1JA 4B73A 1F6BA 2LZ6B 1DG3A 2ORWA 2Q21A 1FX0B 1X8LA 2BMJA 2NG1A 1OXTA 1RJ9B 4AG2C 4PAOA 1NSFA 2WPDA 5J4HA 4B34A 2MMCA 5B30A 1DTSA 2G83A 1N25A 2ZSDA 4DLTA 3DVLA 1A5TA 3UIEA 2RB4A 3GLIE 4IVRA 2ZYVX 4KV9A 4BLRA 2C99A 4RTUA 2ZI4A 1S1NA 2R65A 4NCKA 1Z2CA 4TQUS 1WP9A 1KKLA 3RAPR 2ONJA 2HCJB 4G5QA 3T61A 5EJEA 5ECAA 1L2TA 2W83A 1XXHA 3L8ZA 4KVAA 5FTKA 2D06A 4DLZA 3D31A 1KFZA 3RWMB 2QY9A 1LVGA 1E9CA 4JKIA 1KDPA 5FI1B 4ASUD 1NG9A 5H8WA 2EYQA 4MYUA 1BKDR 4Q01A 4Q4HA 4AY2A 1CJTC 1AWWA 3KFVA 4V03A 5DYGA 2BTTA 2YOGA 2MSCB 2DFKB 2DRKA 4AG1C 1Q57A 5D3MA 1EWQA 4FWTA 2GA8A 1X86B 2W0MA 5IHIA 4QGHA 2YOFA 2HLDD 4KXFB 2D62A 2WJVA 1PNJA 4V02A 3AF1A 1NBMD 3CIOA 1NP6A 5HR5A 1YP5A 2Z5FA 3LLMA 1Z0IA 2FWRA 2O8DA 1XTJA 1K9AA 1D2NA 4IDOA 2VHJA 2GCOB 1CJUC 1PRLC 2GTOA 1AN0A 2XTZA 2OJ2A 3H84A 1KI1A 4A0GA 3KKNA 1ZNXA 3A37A 3FHCB 1B0UA 1P62B 1HT2E 3PUWA 3KKQA 3PENA 4NYIR 2V1QA 1NVWQ 4BFXA 1TAGA 4JLOA 2R6FA 4W7SA 1E0AA 2AK2A 4YMSA 2EFEB 1MOZA 2XJ9A 3WRXC 3UPUA 1NJFA 3PG5A 2P4RA 1TF5A 4AWXA 2A36A 4F38A 3SU8A 5HCIA 5AK0A 2NO1A 5EXTA 3CPJB 4AURA 3GLGB 1FQJA 3PE0A 2W6IA 3MMPA 3QKSB 1HURA 1Q3HA 3NG1A 2WBLC 1XD2A 1OOTA 3KXIA 1MRNA 1KK2A 2H8HA 1FZQA 1W0JD 2F1RA 2GRJA 1FL9A 5L3VA 5DSZA 5EE9A 1SVKA 1R8SA 2J59A 3BBPA 5FPYA 3EPLA 3PEVA 1YN8A 3Q9LA 4HSEA 2QGNA 2XXAA 2K2MA 1GIAA 1T8TA 4CT5A 1CJKC 2MOXA 3Q5EA 3TIFA 1ZD1A 2JS2A 3WP0A 4QGAA 5CM8B 1X8KA 1XNJA 1JEEA 3TNFA 2AXNA 4P32A 3U2QA 5EXXA 1X3SA 1ZCBA 4CC4B 1E0JA 3FMFA 2PL3A 3P26A 4LV8B 1Z83A 1WA5A 1TEVA 4UNNA 3AVWA 4QBIA 3DL0A 3RDPA 4M1TA 2ONKA 1II8A 2VSFA 3QUSA 5IT5A 1UHCA 1S9DA 4AYXA 3QBVA 2EWWA 1YRAA 4Z51A 2RMOA 1ZAKA 4WZAE 4M53A 3X1DA 1XEXA 1M27C 1OIVA 1VHLA 3BK7A 1S8FA 5K8LA 1G18A 2C0OA 4YDSA 2NTYC 2VH5R 4JBXA 3I62A 2HT6A 3LO5A 3L0PA 2OO7A 1GM5A 1WXTA 3LLUA 4ESHA 4OK5A 2A9KA 2GJ8A 2CNWA 2IWHA 1T3SA 3OHMA 1E6GA 5J4VA 1M2OB 2VA8A 1BMFA 3W9YA 1AVZC 2V54A 3AF4A 3PEYA 1VMAA 2XSZA 3AF0A 1OFIA 4Q7JB 2YT6A 4QHTA 3P27A 4RD6A 4D8DA 2NOAA 1VG1A 1EESA 1S1MA 4HVWA 2JJ1D 2GXSA 3BRWD 3PXGA 4BUJA 4QT7A 3AP3A 3TVDA 4EIWA 1VDZA 1Z0KA 4KRTA 1RUWA 2D2FA 4IEEA 1NBME 4MH0R 4UNQA 1I4TD 5FUXA 4EPRA 2KE5A 4C0SA 2JLYA 1E2GA 2P6NA 5C46F 3CB4A 4LYFA 4S35A 3U44A 2DF6A 4DCUA 3SYKA 3X1YA 3G5UA 2IF0A 3GLFA 2DL3A 1OV4A 4O2LA 2BZYA 1TG0A 3R7WB 2PLFA 1M3AA 4PXAA 2O9SA 4BLOA 2P0EA 3VS3A 4JVLA 2J3EA 2RQVA 2WWIA 4PC1A 1IY1A 1T5LA 3RNLA 1YZGA 5JEEA 1G4AE 2VBCA 3DOFA 2FG0A 5GJWB 5DI3A 1AM4D 1K1ZA 1M74A 1AKYA 2BEJA 1RIFA 4LN2A 2CCKA 3U5ZB 4F4JA 1FPMA 4GOXA 4RSGA 4DCNA 2IS1A 2EFDB 4FCWA 4D8KA 1RI9A 1F48A 4MDFA 1WCV1 2VVKA 3LW8A 1YWPA 1OW3B 3OIWA 1D9ZA 1N6KA 1N5IA 3BIFA 3DOEA 2YC4C 2YOHA 3OE7D 3RRZA 4IOMA 2ZVQX 3THXB 1GP2A 3ZH9B 1W36D 4FCVA 3AP1A 1KJYA 3VS4A 1MR3F 1PKTA 2G6FX 4QXAA 4D6PA 5CYPA 4C0KA 4PHFA 2RGEA 2FRWA 4RTYA 4R71A 5B64A 1D2MA 2WAXA 2RNAA 1RRFA 2TMKA 6Q21A 1WX6A 2WTUA 3QF4A 1VG8A 1W4AA 1YR7A 3HJNA 2GEDA 2RF0A 2CDNA 3SJZA 2J0SA 3B82A 1W1FA 2AN9A 4HB3A 4IOLA 4JSTA 4OK6A 4BFTA 2V7QA 1P9NA 2B92A 2ZR0A 2RAPA 3QXJA 3FWYA 1KZGB 1R10A 4R2HA 1R0XA 1GL5A 2HCBA 5AUQA 5EUMA 3SNHA 5GJVC 2W6JA 2DY1A 1XTKA 4MITA 2CL7X 2I3BA 2DHRA 5TVKA 4M1WA 4LGMA 1QKWA 2DMOA 2YUOA 3LQQA 2F2VA 1DO0A 1XRJA 1SVLA 2IYSA 2RPNA 3BFXA 3BOSA 5FUVA 4A2WA 2F7SA 1AA9A 2LNHB 1IJFA 2QGZA 3RS0A 5JLJA 4AYTA 1COWA 2HYDA 3K0FB 5J40A 2BVNA 4B3BA 4NCNA 2DWPA 1P2SA 3AV0B 3A4NA 2VPPA 2ZE5A 1W0KD 3ZZ0A 3WHLA 5JS7A 3X1XA 4QJ3A 4UXHA 1E79D 2PNIA 1LB1B 2WWHA 3EARA 2V1UA 5LPNA 1D8TA 5AJVB 1M8PA 4HUTA 3JZAA 1QRAA 1FUUA 1DBSA 4DLRA 4HLCA 3MFYA 1SVIA 2KYMA 4OMMA 1FP6A 1GFCA 4I99A 5G3ZA 1KSGA 4JT2A 4RCZA 4OHXA 4C2TA 3REAB 1CKEA 1G7RA 3PV0A 1PUJA 4MUAA 3T1TA 1E2NA 2LKDA 3AM1A 1G64A 1SEMA 1D2EA 4G01B 3CONA 1WFWA 5B58C 3NBYC 3OIUA 2B86A 1RZ3A 2PX0A 5D3QA 2JMCA 1ZM7A 2F6RA 2C77A 3BH7A 3SYLA 2JJ2D 1MABB 1ZW6A 1ZYUA 2ZITA 3K0SA 3FGNA 1AD5A 5P21A 4BZQA 5EXSA 2AZSA 1E6CA 1ZM3A 5JHHB 2OFXA 3CR8A 4M21A 3W6OA 3AVUA 1I0CA 4A63B 2KNBB 1GRNA 2ECZA 3JV3A 2ZUCA 2Q9BA 2WMNB 5BW8A 2J6OA 1DADA 1DG1G 2BEKA 4MYHA 4PHGA 4OQXA 1I07A 1UJ2A 2O8BB 4IKEA 1S1CA 4U7DA 2A5DA 1KAGA 4LC0A 3LXRA 2WHXA 2OE2A 2QL6A 2VHTA 1JPJA 1RE0A 5FBVB 3RHFA 2J5XA 5KDOA 3KZ1E 1UKYA 2O8FB 3U7EB 2AKLA 4K81B 5JSZB 5DI9A 4OMNA 3PQCA 4NYIQ 1ZD9A 4JIMA 3UKDA 1YJ5A 2PZFA 4UNRA 2FMXA 4KJZA 1CSKA 2A7QA 3QOFA 3Q7PA 4QM6A 3UA6A 3TMKA 3B78A 3RANA 1J99A 4FINA 2O8EA 2AD1A 2GEVA 2WPDD 4PC3A 3THOA 2ZJ8A 4JJCA 2RHDA 5CJPA 1YQTA 1FX0A 3H0HA 2EYXA 4H9GA 5G53C 4ZI2A 1O87A 3LRPA 1YR9A 4EPYA 1RKBA 4A2QA 2X77A 4U02A 5CLLA 2ZI3A 1KSJA 2X2FA 2BBTA 2A5YB 3MWLA 4JVNA 1PRMC 3Q72A 2GXAA 1UJ0A 2KBTA 4TYNA 2QU8A 2GJAA 3BD9A 1YRBA 1U0HC 2FX3A 2WJIA 4MA4A 5CLQA 2MSDB 5JFGA 4EPVA 3MUFA 3WXMA 1KK3A 2IA5A 1KI7A 4AFZC 1P9WA 4X8OA 3VS1A 2IEYA 3CPHA 1NKSA 2EQBA 2KSQA 3JVVA 4CVNA 2G0TA 4V0OA 3ZD6A 1A7JA 2ZJ5A 3CWZA 1F3OA 2JW4A 2G88A 1FNNA 2AXPA 4R0KA 4LBYA 1KNXA 5KOYA 3LQRA 3EG1A 4OMPA 1GBRA 2ANCA 3PEUA 4A8JB 5J47A 3B1XA 1IOZA 3MG9A 3Q7QA 1Y3AA 2GZDA 4C0HA 2G3YA 3KB1A 3SS8A 2RH5A 4D81A 2ZUDA 1QKXA 2GCOA 1RYHA 2ZJOA 5EP2A 1E2DA 1G1MA 2RN8A 5CM9C 2HDAA 2JS0A 3UWOA 3WP1B 4B6FA 2RGXA 3SFVA 1VHTA 1W6XA 2IYQA 3HU3A 3QE0A 2FA9A 3D8BA 5FL3A 3AVTA 1N6IA 5SZIA 1NYGA 3ADKA 3LAWA 1XEWY 3K9HA 2P6RA 3TBKA 1B3QA 3UWKA 2FV8A 2BJVA 2FE4A 4KBFA 2IF2A 2AR7A 2I1QA 4MKFA 4HATA 3TLXA 1RRCA 1V1CA 5JMTA 2J06A 3GLGA 1DS6A 1WDXA 3KJEA 4KBGA 1YZKA 4WVFA 3P20A 3QXXA 4B33A 2IXFA 1BB9A 1I4LD 1OEBA 2FG5A 4HZUB 2MIOA 5J5CA 3MWJA 3T1OA 3CX7A 2YDLA 3W90A 2MSEB 3CLVA 3EG2A 5EP1A 3M6AA 3WNDA 2Z4SA 4FMCF 1T3LA 3VS7A 3QPVA 1R6BX 2PX3A 3QJYA 2KROA 4DSNA 1UFQA 5LDDC 1K5DA 3PUZA 3ONWA 4AIIA 5AJWA 2VHQA 2ZS8A 3KFXA 1IO6A 1AGRA 1KI8A 1SXJB 2ZRIA 2RQUA 3UG7A 1Z9QA 1TNDA 4I1VA 5CK5A 1UEJA 2WM9B 3SEAA 2J6FA 1TF2A 2KJQA 3THWA 4AKHA 1C1YA 2GF9A 3UG6A 2O2OA 3BWDD 2RGNA 4I4LA 1L8QA 3OEHD 1E1QD 2C04A 4GBQA 2GDJA 1GVNB 3LVQE 2UVQA 3U6KA 4B3CA 1N6RA 5DISB 3VKGA 2NGRA 1PLJA 1LF0A 3BB3A 3GFOA 4HXJA 1XX6A 2ZRKA 1ZUKA 3WMEA 1F2TB 2ESWA 3ZVRA 3VS6A 1BBZA 2ZUBA 4LPSA 2ATVA 2JT4A 2IYWA 4C0LA 3O8RA 2IHBA 4FWIB 1XXHE 2B21A 3BFKA 2O9VA 5E7MA 2KB0A 5JEDA 4RTZA 1DELA 2DBYA 3SHWA 3EXAA 1A1VA 2YNMA 4G5SA 1PUIA 1W49A 1LY1A 2CNWD 2Z83A 1Z63A 2KRMA 4HDCA 3GJ0A 4JJKA 1TUDA 3WYFA 5GVSA 1Z6XA 3ULRB 2J0VA 2K5UA 3C15C 4DT1A 3THYB 1YVDA 3M0RA 3OZXA 4QFMA 4L5BA 4TMVA 3I73A 4U5XA 2XSZD 2ZRDA 4PPNA 2FNAA 4IOJA 2BHRA 4DSTA 5FUWA 4E03A 1E2FA 4JLNA 5A4JA 4CDGA 5FPKA 3PVSA 3TAUA 5I11A 1US8B 2YVUA 3QENA 2WVJA 1N0UA 2J7PA 2VSXA 3SJCA 3QEOA 4IXNA 4O2RA 4QM7A 1E9EA 2ZRHA 5C1BA 2ZRNA 2X3XD 2QENA 2YV5A 3GLHB 1KMHB 1E2EA 3EA0A 1KJWA 3DKPA 3ZZUA 1PZNA 1ZCAA 2I4IA 1V43A 4IDHA 4HDOB 1X69A 3EWAA 4LE9A 2GTPA 4OJKA 2EFCB 5FR2A 2WWFA 3U7HB 4L16A 2OV2A 3SBEA 3SN6A 2D8JA 1IM2A 1E2HA 1F5NA 3NTUA 4BEBA 5CDFE 1GUAA 3I4LA 4DUGD 4B47A 121PA 2QEQA 5BYKA 3N2IA 3UMSA 1MKYA 3SOPA 3T35A 5HZKA 1JI0A 2AK5A 3E70C 4KITB 2G6BA 3BB1A 3TUZC 1Y0MA 2IYXA 3FMPB 3U3MA 1TMKA 4HUQB 4Q9JA 3RLFA 4IOKA 1BIFA 4LCBA 2FGJA 2X1VA 3VS2A 1J70A 2D74A 4YXWA 2B8WA 5E7JA 4P3YA 3ND9A 3N70A 2F55A 1Z0DA 3T34A 3TW8B 4L8GA 3WBKA 1HJDA 3THXA 5HKKA 3KX2A 3GLIB 2Q3HA 4JBWA 1T6NA 2DVJA 4EJSB 2QBYB 5FBWB 2PJRA 1UAAA 4GZLA 4CRWB 5HCNA 3BAFA 1DO2A 1VKJA 2FFHA 4WBSA 4ON9A 2RMKA 1DAMA 1OHHD 1RRGA 3A1SA 5EZ6B 1GOTA 2W6JD 1HA3A 4QG7A 1FFHA 1CS4C 2W10A 1JAHA 2Z4RA 4A92A 3HR8A 2LQNA 2DJQA 4DVGA 2QAGB 1K5GA 2JLXA 1Q44A 2GJSA 2AFIE 3LBHA 2K3BA 3CRRA 3LFUA 2JEOA 1CR0A 2V4ZA 2CHGA 2NPFA 4LHZA 2FJUA 1R5OA 4CEJB 3ECCA 4IDNA 5L3SB 3KJGA 4ZI3A 1AKEA 1T8UA 4Q9IA 4OJQA 3FMIA 3K0FA 2HF9A 3NEYA 1ZUYA 5GJWC 4BLSA 3WNBA 1RRPA 3O8DA 5KU1A 1J8MF 4URVR 2L3SA 3OAAA 1RLQC 3IIJA 1G3QA 1E2IA 2Q9AA 3VQTA 3L43A 1G7SA 3KUDA 2MCNA 2BM1A 2RHMA 3W8RA 2EGCA 3ICEA 4LUEA 2ZJ2A 5EXPA 3KJHA 4QC2A 2FFAA 5FBLB 4AI6A 2ORVA 3CF6R 2RGGA 2PTKA 2DYBA 1YWOA 2O31A 5FOVA 1TTTA 1KSWA 1TQ2A 2OAP1 1MUZA 4M9ZA 2I0NA 1UDXA 4A0HA 1VECA 2GAAA 1OH5A 1OKKD 4DDUA 3C4JA 2OAWA 1XMVA 1G3RA 1SKYE 1GRQA 1IBRA 1X8JA 2OM2A 2W58A 4Y0AA 3GLFE 1M3CA 3I61A 1JEDA 2Q3MA 1CR2A 2NO6A 4DLYA 2AD5A 2H7VA 2VL7A 4AC9A 2IL1A 2PBRA 3G82C 2ZQ5A 3IILA 4JVMA 3F3YA 1GL7A 3LY5A 4P4SB 3GPLA 4M9XA 3CKLA 1NG1A 2AWNA 1A82A 2HXSA 2AZVA 2DLPA 5IRCD 1VCNA 4G3XA 2DL4A 4TSFD 4D26A 3SJBA 2O8BA 1QLYA 4J9DA 1HQCA 4QBHA 4TLAA 3KKMA 1L4UA 3W3AA 2JCSA 2ZETA 4LHXA 4UJ5A 2BZXA 4WIAA 2C0TA 3KQNA 2QQEA 3CR7A 3IIMA 2ZJZA 1P4SA 1Z29A 3Q3JB 2DNUA 3EZ7A 3MJRA 5JSZA 3PJRA 4Q4AA 4Y92A 4C7OA 3NDPA 3QKUA 5K8TA 4W5WA 4BQSA 1KJZA 3LNCA 1NG2A 3W6NA 5EE0A 1NLZA 4MRVA 3I32A 2E9SA 4RZXA 5J4YA 1B23P 4PQRA 3U7FB 4D25A 1Z6TA 4DEXA 1ZM4A 5KDLA 4RD4A 4B3FX 3E2IA 2XOKD 1U9IA 3AF2A 2CL6X 1QHHA 1VIYA 4A2PA 1QG4A 1W47A 4TQ9A 3VMFA 1JU5C 1VG9B 4WXRA 1CJVC 3Q5DA 4WOPA 3T5GA 3PR1A 4N3NA 1E1RD 1G5RA 4NHOA 3B5JA 4KSBA 4AD8A 1W2GA 4JJBA 1XP8A 1ZU5A 2EGEA 2WWGA 4XSGA 4RUGA 1KK1A 1G6OA 1JQQA 3N5CA 3KDSE 3EHRA 4JBYA 3I1FA 4JYBA 5SZJA 3AH8A 4C9BA 2JMAA 5DHFA 4OK3A 2W0ZA 2J46A 1K8RA 5FOXA 1N5LA 1X1SA 1EX6A 3VRYA 1OJLA 3ADBA 5EP3A 3TVTA 2ZI5A 4JLMA 3NHNA 1JR3A 2F9LA 2RQRA 4QBFA 2ROTA 2B7CA 4OI1A 1E9RA 3CNOA 1NVXQ 4DHEA 3REBB 2O52A 1HE1C 4JMPA 4NE2A 5H70A 1VG0B 2ORIA 3DKVA 2A08A 5JI2E 5CIQA 5CB8A 1J90A 5JCPA 2VO1A 1UBGA 3L0IB 2NPIA 2HEIA 1QHSA 3NH9A 1Z06A 3PUXA 5FL7D 1PLKA 2ZRFA 4F4IA 4C4PA 4LHVA 2ZE6A 1SVSA 4RZ2A 1Z5ZA 1SPKA 2YSQA 2WIBA 4DIDA 4A8JA 1IQPA 3NBZC 1H8KA 4TLCA 1H3HA 2ROLA 4JLBA 5DHAA 4E22A 5DLQC 3W6PA 1CU1A 2WWYA 2JM9A 2CE7A 3TSOA 4BE7B 2FEMA 5LD2B 1FW6A 2FPEA 2W00A 3ZVLA 1FMLA 5LB2A 3VR6A 3SBDA 4PFSA 4DSUA 4EPXA 5IK2D 5EP4A 4O3MA 1YR6A 1Z8FA 4WAUA 4IVQA 1YZQA 2R62A 2P67A 1FOEB 3WYGA 2UZ3A 2A5FA 2CXXA 2LMJA 3MCAA 4ESRA 2HSPA 5JJLA 4TLDA 2QRNA 2LKCA 4HYYA 4KSCA 4B75A 3A6PC 2GVDC 5J4KA 2ZAMA 1OFHA 3IHWA 3BJIC 3H0KA 4A1FA 4DBLC 2JIZA 4J9FA 1Y63A 3SE0A 4HZUA 2AHOA 2LCSA 3FMOB 4PO9A 1SULA 3EG5A 2ODBA 5BN4A 3FFBA 2CVFA 4B2IA 1XPOA 4BFYA 2EGAA 2QMHA 3LV8A 4ZCMA 2CREA 4Q4JB 3H2YA 2V8OA 4KCGA 1ZU4A 2KE9A 4XWKA 3AVYA 2W2TA 3S1AB 2SEMA 3R6NA 2K7AA 2AKKA 3REGA 4Z8AA 5HCKA 1SXJA 4II7A 3K9NA 3SYNA 3RRMA 3FHOA 1MT0A 4OI2A 4EQ6B 5GADl 3EPJA 1I2DA 4G5RA 4JKYA 2A5GA 2J87A 2VSOA 1BYUA 1KTVA 1ZX6A 4JYCA 4BFUA 2PZ1A 2EW1A 1AWOA 2XTMA 1DOAA 1HY3A 1TQ6A 1VYUA 2YKGA 1UG1A 2XMFA 2EYYA 1KO4A 3CPEA 3DHWC 5DIFA 3DM5A 4QNRA 3U3JA 3B85A 3ZZTA 3UF4A 1F2TA 1SVOA 4TT3A 4DZZA 1RC8A 2N42A 1G8FA 1AWXA 1NVUQ 2GETA 3K9GA 2YWEA 3IQWA 3RVBA 4ZDIA 4HAUA 1G21E 4JJDA 2BJWA 2ZTSA 2IIMA 4OQFA 1XTQA 2JDIA 4J0QA 1N0WA 3RS5A 4OL0A 5L23A 2EVRA 4Q21A 4W9MC 4CW7A 2ECKA 1OB5A 4JPBW 4ORZA 3VU9B 4LNPA 1JBKA 1FUKA 1OFUX 2RCNA 4OBEA 4OQLA 3VAAA 4LPKA 1N6OA 4LBZA 3THYA 4QOSA 2YZ2A 2VQSA 4I1UA 2WMOB 1TUIA 1TF7A 2W2XA 2QE7A 2J7PD 4G0NA 2FSFA 1OPKA 1E94E 4ARZB 2VF8A 3TW4A 2GJKA 3B13B 2GK7A 1LV7A 2VP5A 1LFDB 2DILA 1P3JA 1US8A 1XTRA 2PEYA 1NIJA 4NCIA 3L2OB 1E9FA 5JI3E 2QSZA 1G2BA 3QPWA 1KYIA 3B60A 2ZRAA 1QHYA 3RSOA 2ZJBA 521PA 2BZ8A 2FPFA 3QBTA 4POAA 3GQBA 4WW0A 3T1QA 3QWXX 3GLHA 1M8MA 2FU5C 1XMJA 1U0LA 2WAYA 3DZ8A 4Q48A 5DN6A 4IJMA 4FSSA 3CH4B 1KI4A 3W5IA 3K0AB 2FGKA 1W36B 3UANA 1HUQA 2SHKA 3NKVA 3V00A 2YWFA 3CNLA 3I5XA 1U8AA 1AEYA 4NTZA 4TWZA 3VNUA 2R9VA 4JZKA 3UA7A 5L8VA 3GLGE 2DFNA 2H5EA 4TN1A 3R8FA 1PHTA 2N46A 1ZNZA 1J2JA 4ACAA 1T91A 4HUQA 5HZHA 2ZU6A 4DDVA 2O0HA 1AQYA 4J9EA 2QM8A 2RKOA 3ASZA 2VEDA 1XDBA 2BM0A 2WSSA 2XAUA 4Q1DA 4TL7A 1Z0AA 2IHYA 1KK0A 3OFNA 4PO1A 2NZJA 2GNCA 3P32A 3EX7C 1UM8A 3KQLA 4LJ6A 3A4MA 4RCYA 1GITA 3PIRA 3GLIA 4GMXA 3BS4A 2CJWB 4EJSA 2QBYA 4LWZA 4RD1A 2EBPA 2KRNA 3TSWA 1SVMA 5GJCA 3PUVA 2XJ4A 4OI4A 3ADCA 3A1VA 4B3DA 3TGPA 4QGFA 3SHFA 1ZIPA 4M1KA 4NCJA 4LJYA 3WYAA 1P6XA 3CH5A 3MLEA 3EW9A 2VF7A 3FKSA 4ZKDA 1M30A 2FZLA 5IXFA 1EFCA 4DCSA 5TMPA 4W5JA 4OQMA 2QAGA 4Z1MD 3M0QA 3NPFA 4UNSA 4RTTA 2AL7A 1ONBA 3NC0C 4KFSA 4LHWA 4Q02A 3RNJA 2HBWA 1IN5A 1ZP6A 4TTPA 4XD7A 2X8AA 3WY9A 3I5SA 5G41A 1W4BA 4NDZA 3BH6A 1DAGA 2VIIA 2DBKA 4JLPA 4Q19A 2J05A 2GVZC 5F3WB 5HTKA 5L3SA 2Q3FA 2OHFA 1VA7A 4DLUA 4G5GA 2LWIA 2ENMA 1AOJA 3TSZA 4MYTA 3OAAD 2DM1A 3ZS9A 1M1YE 2OFWA 2YJTD 4B3XA 1G291 3TAHA 4C0AC 4F7WA 3A98A 4AFQC 4F92B 3U4QB 2FSHA 4HAWA 4CGZA 4PX9A 2F3TA 2QRZA 2ZRMA 3HYTA 3KQUA 3HU2A 2CHQA 5HE9A 2ODNA 4HLQB 1UPTA 3CRVA 2XTNA 1G83A 4B74A 1R8QA 1W2HA 4PQFA 1XJ0A 2CLSA 2ZAOA 4IDQA 4FMDB 1K0SA 4PPFA 3RABA 1MV5A 4A82A 2FRYA 4BEJA 1KO1A 4ZDKA 2QTFA 1WA7A 4RFSB 1AWJA 1S0UA 5EQTA 1PKSA 1Q1ZA 1ZVQA 2WJHA 2IX3A 3SR0A 4RD3A 2B8TA 4IFBA 2BKEA 1GNRA 1L7VC 2D0NA 4AFSC 4PSVA 2HF8A 1KKMA 3QNUA 4P4TA 2OCPA 3DDCA 5JCZA 1AK2A 2WKRA 4OYHA 1SRMA 3AVXA 3SI7A 1XF9A 1YR8A 4DCTA 3VR1A 4URUR 2FFQA 2XB2A 5JRJA 2CE2X 4PTLA 3LW7A 2FDCA 2X2EA 2A2ZA 4A15A 4D4MA 2IYTA
chains in the Genus database with same CATH superfamily
2MSLA 4XOIA 2C2MA 1U7ZA 1VQPQ 4EAQA 1EWRA 1VIAA 3OYDA 4XH9B 1Y6FA 3LWDA 4ZAGA 4BZPA 4B6RA 1EGHA 1XRPA 5ABPA 3GCDA 4TTAA 4Q7QA 1P6UA 3S44A 2DYIA 4DDMA 4C3ZA 4L4XA 1FSSA 3I01M 1IY2A 3TJZA 1NPDA 3KAKA 2UXBB 4BS9A 4RTWA 4U2DA 4UBIA 5HKOA 3OP1A 4I1OA 1V96A 4TKZA 4KKXB 4PC6A 1G8GA 3PEEA 1KO8A 1CUBA 4N8EA 1DPFA 4G2NA 1YOVA 4NU0A 4KPFC 3CKYA 3NP9A 4IEIA 2QQ0A 4UHEA 1JQAA 3KXDA 1AMUA 4K46A 1W7AA 2PU7A 2LCCA 2XZOA 1QAOA 2VUIB 1GGMA 4MGEA 1L5VA 1ELOA 4KKVA 4US2R 2C1XA 3L4KA 4CTKA 1M5Q1 4UUPA 4CL0A 2XT9A 1OSNA 2C4NA 4FVTA 3T1YB 1A9YA 3SYRA 3HDHA 2I9PA 4X90A 4QREA 1Y8ZA 2FF5A 2JFQA 4QPPA 1GRRA 3V2IA 3B1VA 4MYCA 2DUUA 3GVHA 2CFOA 1QZTA 4YROA 2WWRA 3N5BB 4EQ6A 5C8VA 3IA2A 1N78A 5JC8A 4QQKA 3WVEB 1TFRA 4Q18A 4D44A 5CLIA 3AUYA 1AH2A 4MCHA 3AL3A 2Q1WA 2QQFA 2XNCA 3IDAA 2YWBA 5D00A 4FTWA 1SKYB 1YVRA 4MV5A 2RGNC 1TK2A 2D00A 5FRMA 5SZHB 2VQFB 5GAOp 3K9LA 3I56A 1E60A 3FRNA 1E1CB 1AY0A 2J9GA 2YHIB 2QD2A 1PR0A 2ZI6A 4LDRA 3K0AA 2UZIR 1QIGA 1T35A 2GO1A 4C5HA 1BCOA 1O8CA 4M9CA 3R7WA 2V7GA 5D84A 1QCOA 2C4UA 1ONOA 1ZLXA 2AZ4A 4GLMA 2IUTA 1ESNA 4M4ZA 1ZH4A 2GCNA 5BXYA 1GZHB 2QL9A 1QH8B 4J07A 3RUAA 1L5ZA 2KRSA 4DA6A 3QV1A 1U06A 1A96A 4LY6A 1E79A 1C30B 4K1LA 4D2IA 3DE4X 3EIEA 2IH2A 1QK5A 1IGUA 5IKMA 4LXCA 2X41A 4RGYA 4AKGA 3FDFA 1KI3A 3ED1A 1R0WA 3P2IA 3HCBA 5KOIA 2AT1B 4C2AA 2JJ2A 1K9MU 4KC0A 1Y3BE 3CO5A 3CZAA 3HLTA 3PIPA 5IHNA 3DVAA 4GLLA 4X71A 3RVRA 2CL5A 3LH5A 5CYOA 2CHFA 3RBAA 2ZUUA 5I9TA 4PFQA 5KTTA 5FNVA 3C3AA 4ZTZB 2B7LA 4RD0A 3MFQA 3IXMA 4QO8A 1RLOA 4ZMBA 2WFLA 5JS1A 1J2YA 1YB4A 4R9NA 4BO9A 3TF5A 3FOAA 1P7CA 3MOSA 3T38A 3C41J 2XMPA 2HLPA 2PUOB 4OV6B 3LUBA 3WOVA 3N87A 4KU4A 1V8OA 1N8RC 2H16A 2WUDA 1E98A 3TTTA 1K6XA 2VNHA 3IBTA 4I1RA 1KEZA 3DCIA 1NVKA 5BSRA 2IRWA 2JN0A 4E2YA 1KEEB 3K09A 4PIVA 2WM3A 3EXHC 4J4HA 3TRJA 4MW1A 1C9MA 4K86A 4EDHA 3KQHA 4WTOB 2G7MC 1S7GA 2EW3A 2VBIA 2R5WA 1BGWA 5DLPA 1Q50A 2WQZA 3U7RA 4LDZA 4FMCB 4NMWA 2FEOA 4CFYA 4C7JA 4FR2A 1H2ZA 3QYPA 1QR6A 3QDFA 1Y34E 1GZUA 2R7AA 3GFQA 1FE8A 3QWAA 3K09C 3KZMA 4DR4B 4Q34A 3F0TA 1DMRA 2IEBA 3HB4X 4RTNA 4PAWA 4OQPA 3HKBA 2DT8A 3CUTA 4EB8A 5K0EA 4X9CA 1R0ZA 1BVYF 3PR2B 2ZB4A 1NKTA 1PSDA 2RHZA 1YHQQ 1CKBA 4M1OA 3AJ8A 5EHZA 3NGLA 3V8LA 5AWFC 1O96A 1PVVA 1SXJC 2K7FA 2AKYA 4Y30A 1Z07A 3P2MA 1N2ZA 1N6HA 2VTKA 1J8QA 2HM7A 5FBQB 3ZY6A 4BO6A 3G6ET 2O7QA 1UADA 3AHJA 2VDLB 5ENDA 3QMPA 2YYZA 3KEFA 2WKSA 3Q7SA 1KYZA 1ZW1A 2BUAA 2PKYX 1J8YF 4CEHA 1Z33A 1SQ6A 1UECA 4TOIA 3L9XA 4DWJA 3THKA 3WBFA 3TKLA 2E6NA 4P92A 4K6FA 3JCMg 3E9NA 4O2BB 4JVSB 5IP5A 4V39A 2QTVB 1M0EA 2COZA 1FCJA 1YJNQ 4RVSA 3BRQA 1HD3A 4TSRA 4CEJA 3NMZC 2L2PA 5FI1B 5EINA 4W1SA 4EG7A 3VHLB 3PLRA 2F1HA 3M59A 2ADMA 5TRTA 4YT8A 1V47A 3WWZA 2P40A 1X1QA 3KVVA 1JWLA 1PQUA 2OHVA 1F2DA 1BFUA 2D0QB 5JSFA 2XUPA 2A0KA 3AIMA 2HDHA 3PGA1 4BX0A 3C0CA 1PBNA 3A6JA 3N74A 2GKOA 3ESYA 2GCXA 4JJNK 2OO5A 3PCRB 1U0JA 3M57A 1PNOA 1GCPA 3BC1A 4IKPA 5FPPA 3RYIA 2I91A 3SSOA 1L5MA 1BHJA 3OIDA 2ECFA 2W2NA 2Z5VA 4WBNB 3FSGA 2FPWA 4FL6A 2P90A 1I36A 4E7HA 3B7GA 4I4IA 2V1XA 3G2PA 221PA 1V6CA 1THTA 2C54A 2FEXA 4D6XA 1UC5B 1E1RA 3JQ8A 1YQDA 1EFNA 4OGLA 1N9ZA 1OF1A 2OO5C 5JHGB 1GKIA 1H2YA 4OB0B 1NR7A 4LOAA 4MZDA 1O0BA 1O9HA 2R44A 2F1JA 1KD1U 4BO8A 1W9MA 1YNZA 4ZVLA 1NRWA 1OU4A 1KH1A 1CRQA 1L5KA 4FT2A 2JIOA 4YMLA 5IPFA 3FSRA 2OC9A 4ZI7A 3ZEIA 1W0JA 2ZS7A 4BI8B 4L4SA 3EAEA 2HQEA 4GRAA 3WGVA 2OG2A 4JCOA 1P0FA 1M7BA 1T2VA 4KNWA 3ZBUA 2FQQA 1CR1A 2NO9A 2RHLA 5AHWA 3AEUA 3AFOA 4MGYR 3MEAA 2VHVA 3RC1A 1PFUA 1N2BA 3NHFA 1FDOA 3ZL7C 3SVTA 2QP9X 2KLHA 3EUEA 3Q4GA 2OESA 4YI5A 1YXMA 2VBFA 1ND5A 3OY2A 3OF2A 2JCXA 4TT3D 5EJ9A 3EFRA 4EZEA 3DXXA 4L51A 2OHOA 5J1SB 1SKQA 1UFRA 5SY4A 3OBIA 3NWPA 2C9OA 1IQ0A 3IAM6 2JZNA 3LQ4A 2QSJA 1VQ8A 4HB4A 4BKRA 3MZ0A 5HBGA 1L7DA 4BV8A 3KOYA 2VJKA 3LHSA 3RJMA 3JRNA 3C4SA 2BCGY 5FH9A 5C53B 3E23A 4D8YA 2G70A 3PHLA 1J23A 3CEPB 1LI5A 3L7LA 4FD2A 3MD0A 4BMXA 4LJRA 3LQYA 2G63A 2OV6A 5KH6A 2YVQA 2XRMA 1R0RE 2GFUA 2WSSD 2NLUA 3T7JA 2C95A 1CUDA 9ATCA 5BWLA 5FPTA 4CBVA 1KJNA 3FFAA 1TUCA 1KHHA 4K8RB 4NOLA 4GGPA 1C8KA 1J97A 1WNLA 1SXJE 3KL2A 3T12A 2XZTA 2GK6A 4ZQHA 3UJPA 1OU8A 1W87A 1KJ9A 1UBNA 3W8DA 3ELYA 2YY5A 2D2VA 4MUGA 1XU4A 2O7RA 4F86A 2VQ3A 1PNTA 2ZRJA 1GLVA 1GCOA 2CHUA 3OPVA 3JQRA 3L2QA 4JUFA 1ODTC 3R3UA 2ZVPX 4KYUA 2B9EA 1BU5A 2W42A 4A0RA 4H16A 1CB7A 4PQGA 3QFHA 3HBNA 4XCXA 3HBMA 1JTVA 3EHEA 3N8GA 2VYND 1F6BA 2WT8A 4CLEA 3NTQA 2OMKA 4Z9XA 4BLRA 4D46A 2Q0SA 4TQUS 2O2IA 3ZPXA 5AKXA 4E7IA 3FZNA 1LVGA 1NG9A 5K3AA 4MYUA 1Q1AA 2QV7A 1AWWA 4N6NA 1YC2A 1SPBS 2QDKA 4FWTA 2R0QC 5IHIA 4X6YA 1BE6A 3PYLA 4WUVA 3D9QX 2HFJA 3S8MA 1CY4A 3U26A 3DP7A 3HRUA 5GAN2 1CD5A 3ZU2A 2XBMA 4FYHA 1X7ZB 2OB2A 1I6WA 4AFNA 4U0JA 4BFXA 5BN3B 4PFZA 1CUSA 4Z4FA 4G07A 3KWFA 2XCQA 1NJFA 1B6RA 2OENG 1TQ8A 5JY6A 4G2TA 3QKSB 2XB9A 2H9AA 3WAKA 1Q3HA 4JJIA 2WBLC 1KK2A 2H8HA 1JHDA 1ZOPA 1QCDA 4HDMA 3VH4A 1GAXA 2VDPB 3R6LA 1NV9A 1ZD1A 1XNJA 1YDFA 4EK9A 5BWOA 3U2QA 4NAHA 4BIIA 1QFMA 4QBIA 3ORFA 4M1TA 4B6QA 1QGDA 5EJGA 5I9LA 1FX1A 5JD6A 2IOFA 3PIDA 5CXXA 1VB5A 4DC1A 4JB8A 1AUXA 4JBXA 2HT6A 1R00A 3D3JA 4FQ7A 5A62A 3S6JA 4AN1A 1C29B 1GPAA 1Z0SA 1OFIA 2CW5A 4DPKA 3F5QA 4KRTA 3OTQA 3F5MA 3BGOS 4J7IA 2RHJA 4YJDA 3A11A 3LOPA 3RUEA 3C74A 3P9PA 3U5ZB 3C3KA 4KQIA 1RI9A 1F51E 1TFUA 3LW8A 2YWCA 3BIFA 4EQZA 1NI5A 2FCAA 1Y8AA 4ERXA 3VA7A 4ZJUA 2RGEA 2QRVB 6Q21A 4IZIA 4XB6B 1BDMA 4N8SA 4R2HA 1XZNA 1ZL0A 1QE3A 4LGMA 2X7JA 2F2VA 2QA4T 1MORA 3BOSA 2RPNA 2X1HA 4XW2A 1VQ6Q 4B3BA 4V2SA 1N2HA 3WHLA 5CP8A 5L6MB 4QJ3A 4IUCS 2B34A 2PUCA 1LW6E 3RG2A 4HUTA 4PLHA 3SQOA 1JVNA 2WD7A 2QN9A 1T9GR 4C2TA 4MUAA 3JATB 3KQTA 2BKLA 5I3ZA 3HA2A 1ZM7A 4MZMA 4J6FA 2VKTA 1GQSA 1ZYUA 1VQMA 4FYPA 3IV7A 4BL5A 1KAHA 2TECE 4FE3A 3TTYA 4N49A 2VXYA 5BW8A 1C7FA 4JR0A 4LRXA 4KJXA 4Y1EA 2WHXA 5IKOA 5FBVB 3VYUB 3NKFA 2XQKA 3B51X 1PN3A 1IXYA 4UNRA 1NUAA 2RH4A 4KJZA 3TIIA 3WS7A 1FVOA 4KGDA 4NWIA 4CUZA 5K0NA 2CYBA 2RHDA 3WL5A 1TIBA 2UYYA 3KJFA 2ECQA 4REQA 1PGNA 2ZI3A 1IB0A 1NVTA 2BBTA 2A5YB 3Q72A 1M2VB 3H2SA 4EPVA 1GZVA 2ZDHA 3WLTA 3MJDA 1RQLA 3OKPA 5J47A 3L01A 1RBYA 3CVVA 1W94A 3FTPA 1CDZA 2E1HA 2AOUB 2XAAA 2G82A 5FL3A 3BXXA 1R1DA 4F7UB 3ADKA 1T24A 3VJLA 2ZP1A 3HVJA 2BJVA 3CC2Q 4JKOA 3JARA 1RM5A 4DVJA 1YA6A 1XCBA 2ZIXB 3RVKA 3MWJA 5EP1A 4WCFA 5GMKe 3C7CB 1K5DA 2VHQA 2AMVA 1AGRA 4WFQA 1JJ2S 3RTEA 4FU6A 3CNBA 2NXNA 2OTCA 4UZEA 1QWOA 4N54A 1Q1GA 1SHJA 3RUHA 4B3CA 5GMKi 3FMGA 3WGYA 4RBNA 4UZFA 1BBZA 3CD6A 2JT4A 5E7MA 4RTZA 2IVWA 4RVFA 4PLIA 3VYGA 2O3RA 2RO0A 4JJKA 4XZ3A 4OQZA 4WNAA 4J4BA 2EGGA 4WCFC 2V5AA 4WT7A 3S28A 3H1AA 1MG5A 1I3NA 3S7ZA 2WYWA 2I4IA 4L16A 4UDNA 5BYKA 2NTVA 3UMSA 3LQFA 4ENSA 1JLRA 3E70C 4KITB 1YJNA 4O8ZA 1XZHA 3H8VA 4AJEA 1IHWA 5BV1A 4WOJA 4DC0A 4TRNA 2UVPA 2MYTA 3WBKA 2O2SA 2I3GA 4R6WA 2H29A 3AHEA 4WBXC 3VZRA 2DOKA 2XWJI 3WLSA 5IBCA 4MO2A 2JEOA 4GECA 1TMOA 3VO9A 2HREA 3WB0A 5BUSA 5L3SB 3AHCA 2OKGA 3FYDA 4URVR 3DNMA 1G3QA 3UK7A 4BNWA 2MCNA 3BICA 4WXEA 1HDCA 4AY5A 1Y6RA 3IEKA 1DDOA 5BMOA 4AI6A 3ZV4A 1FB5A 5ADHA 1E1MA 2LP4Y 3FIUA 1I5EA 4AM8A 3GFRA 1NF8A 1MH9A 2OM2A 5EYPB 3C6BA 1SURA 2YJGA 3H0EA 3QVLA 5JE8A 1G38A 1GL7A 3H3XA 1G2IA 4WD3A 2ZYDA 1A82A 3W06A 2DL4A 4QBHA 1RXWA 5ALTA 2JCSA 2BZXA 3VI3B 3JSCA 3DQQA 5DHQA 4RH0A 4XB2A 4H7FA 1KJIA 3EYAA 4PQRA 1T8SA 4B3FX 3LM8A 3IJEB 3ZHRA 1JU5C 3PR1A 2HSZA 5EA2A 4NHOA 1KK1A 3MEVA 1RZRA 3I58A 4C4XA 3I1FA 2OBXA 1MIOA 2RC5A 1EX6A 3EXFB 4XLZA 2G09A 5LBTA 1OLSA 4BNNA 1M2HA 3IAXA 5IMSA 5KYVA 4IXTA 1QLHA 1QUEA 4UULA 3PUXA 3HL0A 1XG5A 5GIOE 5KYWA 1NONA 1GLGA 3G0IA 4F6LA 2DAQA 4CMAA 3DW3X 5CYFA 3ESXA 4IYRA 1GG9A 4HEA6 2I6QA 1GJRA 3PPWA 2G76A 4IVQA 1Q0LA 1E5VA 1JUDA 1ZESA 3G9TA 4L0DA 2HNBA 2HSPA 3DAYA 3CRZA 3IHWA 1OFHA 3BJIC 2GAJA 2PWAA 3O7WA 3A9SA 3EG5A 4LY0A 3N05A 2GTHA 4ZT4A 3H2YA 3LI2A 2R6ZA 2KE9A 4XWKA 3BAZA 3KJXA 3WE7A 5LQJA 2AKKA 2Q5JA 4R8MA 1KIAA 3AIKA 3VU8A 1KKUA 4K7JA 4IUYA 2XMFA 2XB8A 1ADFA 1HFEL 1G8FA 3JD3A 1NVUQ 4X7PA 3UGKA 3WMWA 4OQFA 4YJ2F 3OPNA 1FUKA 1DKOA 3OSSC 4MQFB 1GL3A 1IDOA 5E2IA 2NYAA 4MS4B 1IBKB 1BDHA 1XRLA 5DYYA 2J7PD 3OYLA 4HXEB 3MNFA 3V7FA 3ESBA 5EIFA 1DKRA 4RM3A 3DZ8A 2LDBA 3W4JA 2HSEB 3UANA 3G2MA 1H6DA 2ACKA 3E9RA 1I6KA 2BP7B 1Z74A 1G60A 2BAGA 1K5PA 4EJSA 4EO4A 2XJ4A 5B4VA 1ISIA 4BNIA 2JBAA 3VUFA 4U2EA 2A35A 3QI7A 1ZP6A 5G41A 3R7DA 1L5LA 1W4BA 4IQGA 1A88A 1ZH0A 1AOJA 4IF6A 2AOWA 2JJYA 2YYYA 3ZS9A 3HP4A 3IT3A 4C8QD 1PV2A 2EW8A 2Q07A 1B8VA 3FZGA 3M83A 2XA2A 1MENA 3E18A 4F2DA 3JVIA 1WQ3A 1W96A 3OMXA 3CZ4A 3QNUA 1YULA 1X87A 2BI4A 1VKOA 1VJRA 3TG2A 2XB2A 1LLQA 5I2SA 4ISBA 4FW9A 5A6VA 4H18A 1KAEA 4EUSA 3MYYA 2QL7A 2QEXA 2ZAIA 1GYRA 2CMDA 3E3AA 4Y1RB 2V26A 3WVNA 1HORA 3LXMA 4BE9A 3VOBA 1MQAA 2IPLA 1E18A 1UAGA 1WD5A 4CNQA 3D8SA 2QXYA 2O1EA 3IVMA 3VR4H 2V5UA 3QXHA 3NAGA 1NBMA 1QVRA 4OHBA 5C3UA 3OZCA 2QN2A 2CMGA 4BVHA 5KVCA 1WQ7A 1Q0PA 1RQNA 3H97A 1TQHA 4XQCA 1VPWA 4UVHA 3GNFB 2GHRA 4CQMD 4BASA 3LPAA 1H69A 1I0IA 1HNZB 4CHGA 3VNVA 3U19A 2KSSA 3OC0A 2BBSA 5ALWA 4IQFA 2Z4TA 1PX0A 5JPIA 3E3OA 1UF9A 2JVIA 2G40A 4XWAA 1K88A 2KQUA 2LPMA 2I6FA 3OS5A 4FGJA 2BHSA 5C4GB 3UHFA 4JT8A 4RY8A 4N3CA 1L5GB 1EZZA 3HCWA 5KPDA 3GR6A 2QYTA 5JAOA 4MUXA 4OYRA 1XOVA 2H2FA 2OGUA 2VAWA 4C01A 2O8NA 3EMBA 3OURA 3P0RA 5B58T 4I2VA 2IWRA 1USWA 2D3WA 1ZGBA 2HBYA 1MV3A 5AUNB 1SZCA 4HXFB 3VU9A 3R3XA 1WIEA 1EUDB 1Z4LA 3ICPA 3HDVA 2W8BB 4RPGA 2MOKA 2BTOA 1GU7A 1WLSA 2F8SA 3AJAA 1LQUA 2Z2IA 1ZA1A 3D8RA 4AT1A 1F0NA 2OL4A 5T57A 5JZSA 3G8BA 3PDWA 5LUBA 1GQRA 4BNGA 3MJSA 1VQ6A 5JSQA 4HCJA 3DFFA 3V34A 1KY4A 3W79A 5CFRA 2WABA 4LISA 1Q81U 1SF9A 3DOIA 3ZOZA 2V74B 3WGKA 1ODLA 1AUQA 3BKXA 5KJ1A 3CNNA 2WSMA 3GN2A 3H7IA 2D5LA 5BXQC 1EH5A 3ZWKA 4UHKA 1IIBA 5CEJA 4ADSG 2VWQA 3F5FA 3IE0A 1AZSC 5GAMj 1N6NA 2VHEA 4HTFB 3IULA 4YRZA 1UXJA 3TQFA 3UM9A 2JEYA 3R9IA 4EKNB 4YMTA 3LTNC 4R1OA 1PD0A 3OZDA 2QVYX 4L28A 1QK4A 4A4DA 3CVUA 2YWGA 5AW1A 4OKSA 1JJBA 3QG1A 4FXPA 4E7LA 4B35A 1RC1A 2NUPA 2VPQA 2E3IA 4KGVA 1E4EA 1UODA 1PWTA 3SDZA 4R40A 1ZRHA 3RFVA 4YNBA 4M7DG 3H2JA 2K87A 4BQRA 1K6MA 2NADA 1NRJB 1R0KA 4PJOC 3W2FA 3IAS6 2JFYA 3LWZA 5B12A 2IYOA 1WHMA 4BFZA 2TMYA 5JH7A 4PE5B 4LDJA 2JFZA 3AJRA 1ULHA 4RJKA 1NOJA 1Y8CA 4BNYA 4J1TA 5JSYA 2QIPA 4ALLA 1HG0A 2Z9DA 3W8NA 2OCIA 1EDBA 1P60A 3RSCA 1TJ3A 4S3MA 4ZYWA 1WUKS 1TKCA 3KOZA 1C9JA 2CNDA 4MIKA 4LZJA 3MVEA 2YXDA 4JRPA 9MHTA 1QH0A 3Q8XB 3EK2A 3WGMA 1ZOOA 5B1DA 1G7CA 3KKOA 5COAA 4IMIB 4J1TC 4R7ZA 5I4KA 3B3QA 3GEBA 4LI3X 5BN5B 3WLFA 1ZXLA 1N1MA 3BYZA 3RC3A 4L73A 3MOIA 2Y1DA 3OLYA 2OD2A 4PN3A 2DQZA 5T6BA 2PGXA 1KY2A 1DG9A 1S96A 3RESA 3MCZA 2X0KA 4XJTA 4AKIA 3OW2A 2EFHB 3K4QA 3E5HA 2BFAA 1GA6A 3FNBA 1ZLMA 3ABQB 3CJRA 4CM6A 4IL5A 3D2AA 3KOUA 4CTMA 3IBFA 1ML3A 1J0BA 1VE9A 1A0NB 2ZYSA 1KH2A 1ZIOA 2BGMA 5K3FA 4FKZA 2XCSB 1DT3A 1JQKA 1FDIA 2P2SA 2CFRA 3IVCA 1T9CA 5CKBA 2AEEA 2UYCA 4Y2YA 2R1VA 1NN5A 5AI8A 1U1CA 3RS8A 2E5QA 3HN7A 1UOOA 3F3KA 2OLJA 1PKEA 1P7VA 3CW9A 1MO3A 2GBPA 2WZBA 5DB4A 1ABFA 3ITEA 1B2LA 4JS0A 4RELA 4YT4A 2D1RA 1CJMA 2CP0A 2CK3A 1Q2UA 3OJOA 2F43A 2NXCA 3GVXA 5AW0A 4EUEA 1I0LA 4DMLA 1ZINA 5C8YF 1H94A 3DCNA 5EE3A 1WD7A 3D2CA 4M9UA 1YUNA 2QYSA 2R4QA 2XNSA 2YUQA 1JDVA 4HAYA 3I55T 4HR7A 1K27A 4KMRA 4NK4A 3P4UA 4KE6A 4X5OA 3S8YA 5B3LA 5KSPA 3OIYA 4BGVA 1AVTA 3DR3A 1PSEA 3B53X 1D5CA 4ZANA 1AZWA 4BNXA 4YBRA 4EUKA 2FN3A 3OS1A 1KNQA 5FBZA 1SB8A 4ATNA 2IXDA 2WAMA 2Q5OA 4KAFA 2QX8A 3RS2A 3JQBA 3M0SA 1AKTA 2NSLA 4TQAA 5GOZA 3T94A 3G71A 3V8JA 2VQEB 3MRXA 4CKBA 1DCMA 4TWRA 1H23A 3V97A 2CFTA 1CUEA 2HJVA 3FETA 4KFRA 2K9GA 3V3TA 2YH2A 3KXTA 4WI1A 2C5LA 4B3HA 1M2JA 1D0ZA 3I0MA 3VM6A 1GKKA 4C0GA 4KYIB 2YJ4A 3IIEA 3OD1A 4O2AA 3WK4A 2OZVA 2BEVB 2D4HA 4PJOE 1E6HA 5E6SA 5LZ5A 1Z16A 1UJCA 1YL7A 5CVJA 3DLIA 4EHHA 3IOEA 1MHPA 2A9FA 4IIBA 4N76A 1VLVA 4JQCA 3DD1A 3CXCA 2JTEA 2JTFA 2MSKA 4H7KA 3L0SA 2Q7DA 2X3WD 3SQDA 2Q0XA 4AO7A 1NN1A 4NU8X 1DAFA 5HMMA 2PMCA 1J00A 1LS6A 1OI2A 4QLBA 1UDWA 4L9WA 1JSCA 2FW9A 4HQLA 4FT4A 4M83A 3SYMA 4Y6PA 1UPBA 4G67A 5ITVA 4B3GA 4J2OA 3TQ7P 4PEVA 2YWXA 3VDXA 4Y2VA 4FGKA 4CLDA 1X74A 5AI5A 1Z37A 2XIQA 5IHXA 1U8TA 5EJAA 5FFMA 5JCOA 2X0EA 2CYZB 3C16C 2OP0A 2DVMA 4BFVA 3NT4A 1WY5A 5HVNA 2CBZA 4UAJA 3LUDA 2OCGA 3AP2A 2ORED 4ID3A 3EXEB 5ALXA 3NC1C 1PTKA 4FI3C 2L0AA 2J3DA 4IICA 3FOWA 4N0AA 3TQHA 1INLA 5ALNA 1U9YA 2JGKA 3ZHXA 4JA2A 1UIRA 2GQIA 5FB3A 2DMRA 1E0KA 2XODA 5LJ5h 3BL5A 2H2HA 2FPKA 5JCOC 1ZMTA 1U6KA 3RS3A 3CCUQ 1QDLB 2FPGA 2EWVA 1VCMA 2WU3A 4LHSA 1ORIA 4QTYA 1T0IA 4AS1A 4KQXA 1RABA 1NLYA 5GAMf 2Y71A 3I2JA 4N0AC 4A26A 3OQ1A 1XDDA 3C7AA 2XDDA 1D04A 1MW8X 3SWNB 3E8XA 2ED0A 3F7TA 3QTLA 2BI8A 2PD6A 5CIWA 2OHIA 3WO0A 4NCXA 1UMBA 1R3UA 2MYPA 1TIKA 3ZOKA 5FNVF 2C61A 1I80A 5TC4A 2PK3A 1SVNA 4N0PA 2B5VA 3ZC3A 2OYCA 1A5TA 4KIUA 2XU8A 2GWRA 5L40A 4EY6A 4IVRA 1E77A 3F8WA 2XCTB 2REQA 4MWDA 3WA6A 2WM8A 5EWLA 1ULAA 2ONZA 3OEWA 4CF6A 3KFVA 2GZSA 2MSCB 2DRKA 1G8KA 4KXQA 4XDZA 2P41A 4KQ6A 4EEXA 3V4VB 1K9AA 4IDOA 2VHJA 4A0GA 1MC4A 2XRZA 2OBFA 4W7SA 2AK2A 4YMSA 1JEJA 1Z4IA 4YUXA 3IBCA 1M4ZA 3K20A 3TLGB 4YLEA 4B3IA 2O7VA 2F1RA 1K8YB 1L8AA 1LLFA 3FJPA 3KYJB 5THKA 3DTNA 3ZG6A 4JOQA 4PZUA 4KN8A 1WXGA 2JS2A 1ZVJA 1QGOA 3MWGA 1RQXA 5DLEA 2WF9A 4ZVUA 1U7PA 3Q3IA 2WHPA 2VR1A 1YRWA 4M1EA 1X7WB 2FEWB 4MUFA 3BDLA 3VGPA 4R31A 1Q86C 1DDIA 2AN3A 1EB8A 3EGCA 4FIZA 3P94A 4OK5A 4U2BA 4RTJA 2DU8A 3C6QA 1TTHB 1M2OB 2DX7A 8ADHA 3IAFA 4WVLA 3P2YA 1I8FA 2JJ1D 4K6KA 4QT7A 3TVDA 3HNOA 3TBHA 2P6NA 1T5OA 4JJ8A 1D09A 4S35A 2VKQA 5H4GA 1UBUS 3IPRA 4FGSA 2WWIA 3VNRA 4EHIA 2QASA 3GJRA 3D6VA 2DKOA 2DKGA 3G23A 5KHLB 3VC2A 1BCSA 1OX4B 1TLFA 2EL9A 4XQ0A 3HZZA 1YITT 2F1LA 1GPJA 1TEHA 3BCRA 2X4DA 4C0KA 3KG2A 4MIEA 2BFFA 4WXMA 1W1FA 1YFNA 1VL6A 2ZR0A 2C7VA 3AL0C 3EQ9A 3I39X 1XTKA 1QKKA 4WH0A 4M1WA 3PXUA 1JEQA 1DO0A 5FUVA 2QGZA 4XAXB 4BGIA 4AYTA 4XASA 4V24A 2FUEA 4YCDA 3FM9A 4OXIA 1NU8A 1ICIA 2XWBF 4HMPA 4NVRA 3GUVA 4XGKA 3HRIA 3REAB 5IM4F 5J26A 1G7RA 3BF7A 4CL8A 2P2CA 3DVSX 4LZOA 4XTYA 3W8FA 3R3ZA 4FZVA 1FJ2A 3K0SA 5A9TA 2A7XA 1GQQA 3PT5A 4BZQA 5EXSA 5K3BA 4O4JA 4R9VA 4K03A 4RTOA 3C43A 4C3UA 5HW0A 4UHBA 2O8FB 1RQGA 4IIHA 5DI9A 4AJOA 3P2KA 2P78A 1QYIA 1C3XA 2PQWA 5K0ZA 1OFGA 1U0GA 3DPIA 1FDSA 2Q3DA 1QK3A 4PC3A 1R74A 5FWYB 4XX0A 4GPZA 2P0PA 1TAUA 2DAPA 4TS4A 1KSJA 4PGHA 2X2FA 2NP7A 1RAHB 1YS7A 2BFOA 3TJRA 4AP5A 5CLQA 1SA0B 3L79A 3A6LA 3MUFA 3EVCA 4YV1A 3ZCTA 4CVNA 2JW4A 2V6GA 3UQZA 3EG1A 2X4GA 1UBMS 2DZDA 2OKCA 1BI2A 1A9TA 4B6FA 2I4LA 4EY7A 3D6HA 4ZI7F 4IXDA 3DTVB 2FE4A 3AUSA 4KWTA 1RQPA 4MKFA 1Q82U 5GZ3A 3A3NA 3EG2A 3TQQA 1V1RB 3FW1