4DEXA

Crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav2.2 i-ii linker.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
289
Chain Sequence
EDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
molecule keywords Voltage-dependent L-type calcium channel subunit beta-2
total genus 95
structure length 289
sequence length 317
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4dexA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dexA02
3SFZA 3VU9A 2AKKA 1NY6A 4ZIRA 2W2XA 2O8CA 4IVRA 3FKSD 4DLUA 1BMFD 2PT7A 2ZVQX 1SZPA 5KSOA 2EGAA 3GLFB 3KUCA 5LB4A 1U99A 1V43A 2GF9A 2OLKA 3A1WA 5C4MA 3IPXA 2J5XA 1SVOA 1DG3A 1LF0A 2ZU0C 4KSCA 1VECA 4CZ2A 3VR5A 2ZI5A 3W8RA 4D4JA 1BKDR 1Q3TA 1E9CA 5DIFA 4O3MA 2FGJA 4LNPA 3GLHB 4TL7A 2EYYA 1U5SA 3VKGA 3SYNA 1E9FA 2C0TA 3TK1A 1AD5A 4LUDA 1FZQA 1H92A 1QVAA 4Z8YA 4F4IA 1KY3A 5KDDA 4GL2A 3CLVA 3GJ0A 2Z0MA 1EG7A 1NVUQ 2XXAB 3I5YA 4FI3C 1P6XA 4C0LA 2D74A 1H8HA 1ETUA 4TSFA 2FN4A 1G7CA 2YOGA 3WRXC 2EKHA 1XCMA 2BEJA 4URXR 1SVWA 1U8YA 3SQXA 3FFBA 2L0XA 4NBSA 5HZHA 2DM1A 4A0FA 1L7VC 5FOVA 4B3DA 2Z43A 2GILA 2BZYA 4EAQA 5FPHA 4JKIA 1CXZA 4C0JA 1SKQA 4QHYA 2BEKA 3QBTA 5FBWB 4TL8A 4PC2A 2XZPA 2W0SA 5CIWA 1GCQC 2RHMA 3R9XA 1JO8A 1NVXQ 1XMSA 1W4AA 2XOKD 4LGMA 4M1TA 3TRFA 5IH2A 4LYJA 3WNDA 1GG2A 2PLFA 4DLTA 4TQUS 3CRRA 4AKGA 3UATA 2PZ1A 2YWEA 4GT1A 3AVWA 2AKAB 4R0KA 1U0LA 3K0CA 3OAAD 2PX0A 5UKDA 3U6KA 1IHUA 5EE0A 2KRSA 2A37A 4G1UC 3M0TA 1CTQA 2X3WD 1NY5A 2F2WA 2KBTA 1F2UA 1KYIA 1X6VA 2WIBA 3KX2A 2PJZA 3A1VA 2IYUA 2D7DA 2ZEJA 4LJ9A 5C46F 2C0IA 1Q44A 2P3SA 1GKIA 2WIAA 1GNRA 2ORVA 3GJ3A 4GMDA 4KYIB 4DLYA 2LJ3A 3U6BA 1JR3E 5B57C 2O8CB 2WBLC 3V4RA 1LS6A 3TKLA 1E94E 3IHWA 3TIFA 3I62A 2JS0A 1NKSA 1U2RA 4KFUA 5EE3A 5FTLA 4DRZA 2KEAA 2JJ1A 2ATVA 4DSUA 2W6JA 5FUWA 3VKHA 4OI2A 3ZL7C 1F2UB 1E6HA 1KTVA 2RHDA 4QGAA 4I1UA 2JIZA 4TT3A 4B47A 2QTVB 3ZJYA 1GCQA 4H1UA 1P72A 1AZSC 2LCFA 1A2BA 4DCSA 2VKNA 2H18A 4URYR 5IK2D 2VQSA 1YNZA 2KBEA 2HSPA 2HF8A 2OFWA 2CNWD 2ZSBA 2NO1A 3KXKA 3QKSB 4C7OA 4V0OA 3X2SA 2PTKA 1EX6A 2ZSFA 1KK0A 1A0NB 4JLJA 1P9RA 2QP9X 1KI1A 4M1SA 1U06A 1GIAA 1T91A 5K8LA 1PLKA 1AOJA 3UG7A 3P4XA 5FH9A 3UWOA 3ASZA 1E2GA 1NLOC 2O5VA 2PH1A 1WYXA 2J45A 3R7WB 3B9QA 3VFDA 3H2YA 3HJNA 3SU8A 2F7SA 5CJ2A 4HAYA 3AUYA 5GADl 4Q66C 4PPQA 1FNMA 3I4LA 4P0TA 1LFDB 2F43A 5FOXA 5AUOB 3KXIA 2C9YA 4BPBA 4FN5A 3QXJA 1OFUX 1ZNZA 2GAOA 4UXJA 1TF7A 1QZXA 2H16A 1DAGA 2JM9A 4DLVA 1TUCA 4NYMR 2FEOA 2WKQA 4A63B 3ZD6A 4ZI2A 2GJ8A 2ZR0A 2W6ID 3RAPR 2F9LA 3EG5A 4IRUB 3ADBA 3BB1A 3TBKA 4MYUA 2OILA 2VHUA 2F1IA 2AZVA 2JW4A 5FUXA 1WP9A 3KQKA 3VX4A 2CK3D 2DY1A 1E0JA 3FE2A 5JWRA 1G21E 4JJCA 1D5CA 2WZQA 1M34E 4AYWA 2EGEA 1YZLA 3QKUA 1T3HA 421PA 1S9DA 1OH7A 2GTPA 2JIZD 2V8OA 3CNLA 3BB4A 3LV8A 2YUOA 3PEUA 5AR1A 3KTAB 1N6HA 1CJTC 3P26A 5TARA 3AKDA 2DBMA 2WSSA 3DO6A 1WLPB 1RJ9B 1JEGA 1Q1BA 2QGNA 2NUZA 3EA0A 3OE7D 4Q00A 5FBLB 2HCKA 4LV8B 4NHOA 2HLDA 4OI4A 2YOFA 5IHPA 3EC1A 3MWKA 5KSPA 2CUBA 1U81A 4B3FX 5GJBA 2UZIR 5FR2A 1NN1A 1SXJC 1YZGA 1G291 2CH4W 1G16A 4LJ4A 2BMDA 1RW4A 1ZSGA 2D3WA 3M1IA 4OK3A 3PJRA 2IC5A 1N6OA 1IM2A 4DB2A 1K8RA 1KKMA 2LQNA 1US8A 5BWMA 1PWTA 1E1RD 4N1AA 2FFAA 2B86A 1UKVY 1N5KA 3CRVA 1G3IA 1N5JA 2RGDA 3W3ZB 1E2NA 5HKKD 5FTKA 3ZQ6A 3K9GA 1AQYA 2CVHA 4AY2A 4FW9A 3BK7A 2IEYA 4WIAA 1E2JA 3QF4B 1JXOA 4OMMA 2FX3A 2GEUA 2WJJA 2FSFA 2JLXA 1DOAA 2KXDA 2A08A 4U00A 1H8KA 3PE0A 5J4HA 1P7CA 2GA8A 3CPJB 2P5TB 5J5CA 4AG5A 3K0SA 3EG0A 3EAQA 1Y3AA 1SXJB 4AYTA 5C4GB 3T5DA 1RZ3A 4HVWA 2MIOA 1EESA 1W4CA 2Q0HA 3A36A 4LOAA 4TMWA 3EPHA 4GOJA 1QLYA 5JWOA 4J9DA 4M1YA 1CKEA 2QENA 3LBHA 1RUWA 2ROTA 2CL0X 2FFHA 5DISB 2D1XA 2CCJA 3WMGA 2J6OA 1E9DA 4GBMA 4B2PA 3QI2A 2KYMA 1QHSA 1SULA 2ZU6A 5LBIA 1N3BA 5JRZA 1COWD 3M0QA 5FBVB 1T0JA 1IN4A 3OF5A 3SYKA 4DXAA 3FMPB 2ZSAA 1GSIA 4EDHA 4DLWA 2QAGC 4H1VA 3NHBA 2ONJA 3IDQA 4XWOA 3DEFA 2Q3MA 1OE0A 2W6IA 4GP7A 1I4TD 1E4YA 1FOEB 1G20E 2AD1A 2QM8A 4A9AA 4DEXA 3EA5A 3B82A 4URUR 3QVVA 1SHKA 2V1QA 3THKA 2J3EA 2FH5B 4BFXA 2RB4A 2WWYA 3KFXA 2JJ8A 5EXXA 4UJ5A 2XOKA 4L16A 2J7KA 3VS1A 2IS1A 3M0SA 3PUZA 3ZIAA 5J4VA 2A2ZA 1O3YA 2H92A 4TZ6A 3CR8A 2R8RA 3GQBA 4IVQA 3SJZA 1AZEA 1QKXA 2NZ8A 4Q18A 1X69A 1KI2A 4TQ9A 1XMVA 4QM7A 2GQIA 3K53A 4D0NA 4YXWD 4QFMA 1WRBA 2FGKA 4NH0A 2ZRDA 5F3WB 1VIYA 1TEVA 3K8YA 4P3YA 3LD9A 2IYZA 1G3UA 1MR3F 1RLPC 3ADKA 4Q5IA 4Q4HB 2VYFA 3EX7C 2OAQ1 3EZ9A 4DC9A 5JS8A 4FCWA 2KI5A 1CR0A 3SEAA 4PO1A 4J9EA 3V00A 3P27A 1WDTA 2QMUA 2FWRA 1A7JA 2DILA 2ERXA 4JIMA 5SZIA 4ZKDA 3U7FB 3HU1A 2IS2A 2AWNA 3K0FB 3EGUA 3K9NA 4NYIR 1IONA 2PT5A 3S1AA 2IUSA 1KSFX 2OBLA 4QGFA 1S96A 2J59A 1BYIA 1Q1ZA 5BN5A 1JI0A 4LN2A 1Z9QA 1UDWA 1XRJA 3PQCA 2IS4A 2J41A 2AKLA 2OXRA 1NYFA 2YV5A 1VTKA 4U02A 2YUPA 2DFKB 1LCKA 3THOA 2ZS7A 1GFIA 4OI1A 1RC8A 2OCAA 1ZD1A 1OXSC 2IWHA 1NSTA 1OT3A 2IEZA 3ZVNA 5EUMA 4PC6A 3EPKA 3P4YA 2A9KA 2A5YB 3FDIA 4HAZA 4DCVA 1EXMA 2QU8A 3IBGA 5DGXA 4JZKA 2QTHA 4EPRA 3CIOA 2CLDX 2Q9BA 5DLQC 1ZVQA 2RN8A 2QPOA 1UE9A 4XD7A 5FL7A 3SC3A 4CW7A 1ZM2A 1CJMA 1ZUYA 4POAA 3FGNA 1NBMA 2YINC 4N3NA 1P61B 3VS0A 1UBCA 1Q20A 3KXLA 3RRYA 5G41A 1B07A 5EUQB 3RS0A 3A37A 3FKQA 1D2MA 1I07A 1XJCA 1ZJ6A 3LRPA 5DE3A 3GLHE 4HUTA 3QKRA 2DCUA 4RD4A 3VS3A 1FQJA 3SN6A 1Z29A 1SVLA 2ZI9A 3QKTA 5DI9A 4CC4B 1X43A 1MO5A 4JMPA 3UKDA 1IN6A 2UVQA 1Z5ZA 2OBNA 4HLCA 1RVDA 2JDIA 4O0MA 4TTRA 3GLIA 3VNVA 1CF4A 1U90A 4W5JA 2RGAA 2NQ2C 3KL4A 3PIRA 1KNXA 1TQ6A 4BEBA 2FA9A 3L8ZA 3QG5A 1OHHA 4EPTA 1JR3D 2J87A 3LFUA 4MGYR 1UJ0A 2R6GA 1YR9A 2O2OA 4RTXA 4JKYA 2KE9A 1GDDA 2IIMA 2BHRA 5HCNA 2LJ0A 1GFDA 3GJXC 1IAQA 4HLQB 1H8EA 2GESA 4C0QC 1CULC 4RTWA 3TSZA 4A1FA 3I92A 1AGRA 2TMKA 2J0UB 2VRWA 3UXMA 4HZUB 2IYYA 4IOLA 1TEXA 4RD0A 2EW3A 2EFGA 4WAUA 4G5OA 1Z6XA 2PMDA 3QPUA 1G7SA 1QVRA 4CEJA 3VNUA 2WJIA 2YKGA 3BH6A 3MD0A 4ESHA 5EC7A 121PA 2ZE6A 4M9QA 5DHFA 3RS2A 2RGEA 1Z2AA 2G0TA 3WMEA 4M22A 3O5ZA 1ODFA 1E2QA 1AN0A 1GUAA 4LPKA 3L0SA 1E9SA 2JLQA 1YHNA 3CQTA 4C0SA 3GLIE 4TYYA 4WZBE 1OV3A 5FWBA 2BIFA 3QPWA 3CRQA 4ERNA 4GNKA 2Q6TA 4FMCB 2M0YA 3U61B 4PFSA 1T3SA 4JZ4A 3I73A 4I99A 4A0GA 3FTQA 3WBKA 4AI6A 2CE2X 2FZ4A 4R7ZA 3ZLJA 1UBEA 4HDCA 3B1ZA 4W5WA 5H70A 2HV8A 3WYAA 2OFXA 4HAUA 2AZSA 1E0SA 4QJ3A 2F55A 3MG9A 3PEVA 4PHTA 3V9PA 4B3XA 4P4UA 4QG7A 2ZJ8A 1S4QA 1UM8A 4K46A 3I5XA 4AFSC 2QZ4A 3EPJA 3D6TB 3U7EB 2IUUA 3I5RA 2CUDA 2PCLA 5FTMA 4B44A 2H1LA 4NL4H 2B92A 1W6XA 2ODNA 2BM0A 2CMKA 1G4AE 2I1VB 4F4CA 2WVJA 2SEMA 1KI6A 2ZRHA 2DHRA 3FVQA 3CX7A 1G2BA 2FG5A 2BCJQ 1WDXA 1OSNA 4UNQA 2GK6A 5KPJA 4IOJA 2QE7D 4Q7MB 1IXSB 1N6LA 1W4RA 3EW9A 3W5JA 1AZTA 1T3LA 1QHGA 1ZUHA 1P4SA 2JMCA 3EZFA 4B35A 1KK2A 4BECA 3AF3A 3M6AA 3IILA 3OEED 1E4VA 821PA 1BOFA 2G1KA 1H8ED 2V1UA 1E1QA 1ZLMA 3VRZA 2JT4A 1YZUA 1UJ2A 2WAYA 1M3AA 4PSKA 3RS7A 3Q3JB 4KFSA 1U9IA 4CYMA 4KV9A 4L9SA 5CITA 1DTSA 1FP7A 3EZ6A 2IUTA 4JLKA 5IT5A 4WCIA 2B8TA 2FPKA 1ZYUA 3AGQA 2LKCA 3B7GA 3EWSA 3NH9A 5AJWA 3QUSA 1N2CE 2LP5A 1Z2CA 5FTJA 5TV2A 1G8YA 1XPOA 2A36A 1XTJA 2WJYA 5DO9A 1N6NA 2GK7A 3NH6A 3MLEA 5BYKA 1IQPA 2DL7A 2ZPTX 2KB0A 3DKPA 4MRRA 3TW4A 2OT3B 4XTRA 2GJ9A 1QG2A 2R44A 3N70A 3LQQA 4A6XA 2FSIA 1XEWY 1NMXA 1CU1A 2YWGA 3K09A 2KGTA 4TTQA 3L82B 1R0XA 5BN3A 3QWYA 4IW3B 2ZSDA 2G77B 1J8MF 4Y92A 1OEBA 3JVUA 4JJKA 4KBGA 5BQ5A 3W34A 1CJUC 1D9XA 2A5FA 2RMOA 2IF2A 4UNPA 1KDTA 2EFHB 5L3SA 1GCPA 1KJWA 2OUKA 2PX3A 3N5CA 1DADA 1WBBA 4LJ7A 3BWDD 3Q8XB 1LNZA 2RQUA 2C0OA 2UZ3A 3GJ8A 4IDOA 1IJEA 1T8TA 1E2KA 4FWIB 2BZXA 4DDTA 3ADDA 2GTOA 1T5IA 2CXXA 2GXUA 4YMSA 1PKSA 1RYHA 5FOTA 1CR1A 4YC7A 3KJEA 3K0AA 3KJGA 2Q9CA 2QI9C 1E9EA 1UPTA 1XDBA 4RD1A 3RLFA 1WB9A 2HEQA 5G40A 1Z6AA 4AKHA 5JWHA 1GWNA 2P6UA 4KITB 1PKTA 4QM6A 4RKEA 4DEYA 2C5LA 3QENA 3IHLA 5DYIA 3O8RA 4WXRA 2FOLA 3CRMA 1ZM7A 4BFZA 1MO4A 3B1WA 2ZRBA 5EP1A 4IXMA 1XD8A 1BIFA 5FWCA 1ZD9A 2CE7A 4Q01A 2LZ6B 1TQ2A 2BKUA 4A82A 1FW6A 4ZI3A 1N6RA 2F9MA 1NLFA 4TYWA 3L0PA 4DCNA 2ATXA 2NWMA 2HCJB 2E87A 2I3BA 2ORIA 4RVCA 4BRUA 3GLFE 5LD2B 3AVYA 5JJLA 1W2GA 4HB2A 1KZ7B 4KYUA 3TVDA 1JEEA 5L23A 3Q9LA 1VYVA 3NIBA 2FEMA 2XITA 4JBXA 4NCIA 4LYHA 3TAUA 1T4GA 4AURA 1W7AA 4A6PA 3OHMA 2HT6A 3I8XA 1FX0A 5EXTA 1ZM3A 4DUGD 1EFTA 2DPXA 2KYBA 3PVQA 2VBCA 2QT0A 2SHKA 1NM7A 4US1R 2QMOA 3QF4A 2GVZC 3U2QA 4GMXA 4R9UC 1GKUB 4LCBA 1U9IC 1Z06A 1AS0A 2G9NA 3U3RA 3C7KA 5FPKA 1NF3A 1I1JA 3A8TA 4RJLA 1AKEA 3RC3A 3T12A 3OIWA 2I4IA 3TUJC 1M8PA 3RC8A 1M2OB 2YT6A 2ZS8A 3A1UA 3GFPA 2N46A 521PA 5LDDC 2O8DB 2O8EB 5TDHA 4ASUD 3UA6A 1WF3A 1XCPA 1P2SA 2O8FA 1PLLA 3T06B 2R9VA 3NDPA 4DUGA 4MGZR 4JJZA 2RPNA 5CDFE 5K8IA 3M0UA 2RH5A 4BE7B 1CSKA 3D31A 3LO5A 3LX8A 2B7BA 3MAAC 1G8GA 1G3MA 3GEIA 1PUJA 4OBEA 4D26A 4QBHA 2ZITA 3I72A 2CL6X 1DAEA 4RSGA 2O8DA 1QHYA 2ZSEA 3E70C 4JJBA 4FD2A 1OH8A 1XJQA 1B3QA 4Y0AA 1EGAA 4KJZA 5FPTA 5AK0A 2EYQA 3SYLA 1NVVR 1ZD8A 1UFFA 4PSVA 3F0TA 3N2EA 4NZYA 4CEIA 2BC9A 1XF9A 1NVVQ 3RDPA 1R10A 4QRHA 3SBDA 1QKWA 4UNSA 1XBTA 5C18A 2QNRA 2FDCA 4BZQA 1MH1A 1AM4D 3VS2A 4OMOA 4TLBA 4YDSA 4Q4JB 5KOYA 2RGCA 4X8HA 1F2TA 1Q22A 2PZFA 3BFKA 1JALA 5A5GA 3QKRB 1FTSA 1VG8A 2ECKA 3OIVA 1E9RA 4QNRA 5IXFA 4MYTA 2V9PA 1ZM4A 4TMXA 2EYWA 5CLQA 4RZUA 2O9SA 3R20A 3NKVA 2YOHA 1SEMA 2R65A 2QA5A 2I1QA 4LHXA 1DPFA 5EXSA 1RRFA 3EC2A 4HLUA 4DDVA 4B32A 3BH0A 1AGPA 4ZNXA 4MGIR 4QHTA 4GP6A 1SRLA 3FYHA 1CJVC 1F2TB 4HAVA 3QEOA 4GZMA 1DAHA 1UKYA 4XTCS 1LS1A 2JCSA 2CT3A 2FFBA 4ASUA 3ZH9B 3CBQA 1UFQA 1II8A 4K81B 4IFBA 2V55B 1CLUA 4QBIA 1YQTA 1L2TA 1X1RA 1RIFA 4TQAA 3NDBB 5LB2A 2O88A 4DSOA 3BD9A 2BMJA 2BBWA 4G01B 4Q02A 3ONWA 2ONKA 1E2EA 1I4LD 2WSSD 1YRBA 4J9HA 4LUCA 1TMKA 1XEFA 5DI3A 2IW3A 1VCOA 4JYCA 3GEHA 2ZRGA 4LX0A 1DVRA 1NKTA 2A78A 1JR6A 2B21A 2UKDA 2CT4A 2G0NA 2FFQA 3E2IA 4G3XA 1Z0FA 3WHLA 2VO1A 3K0AB 1HQCA 1BBZA 2DFNA 2QSZA 4NCHA 4YQFA 2MCNA 3Q7QA 1ZNYA 5AUNB 2M51A 4TLEA 1K76A 1FPMA 2E5KA 3QG1A 4HEJA 1U0HC 1E79A 3NBXX 5CB8A 2WKPA 1G6OA 3AGPA 3U3KA 2D8HA 4IEEA 1G9XA 3CPEA 4F93B 3UIEA 2PZGA 2C98A 2WAXA 1E32A 4B74A 2EYZA 2AX4A 1AZGB 2NPFA 1OPLA 1IN5A 2EVRA 4RZ2A 1E9BA 1Z63A 2DWPA 1Q12A 2SRCA 2ROLA 4Q4AB 4LDJA 2ZUCA 2QP3A 5C2JB 2ZJOA 4KXFB 4AK9A 1E6CA 4DLSA 3EARA 3NG1A 3BJIC 3MJHA 1JECA 5FOUA 1AWOA 1DAMA 4GSYA 5KTYA 3K70C 1UEIA 4CC7A 2B6HA 2F1RA 4HDQB 3PENA 1XZQA 3MUFA 5F98A 1NJFA 4QC2A 2ANBA 4JL6A 2L0AA 1CS4C 3SS8A 3X1YA 4ABYA 2Q9AA 2JAQA 2P6NA 4HZIA 1PNJA 3QIAA 3IPYA 1J90A 2EFCB 3C5CA 2JS2A 1PLJA 4KLNA 4M53A 3VR2A 1UHFA 5EQTA 2DL4A 2QEQA 2ZYVX 1XJ0A 4C9BA 4CDGA 1KK3A 4D0LB 4M4ZA 3CNNA 3PUYA 1G4UR 4KSBA 2ZTSA 1R4AA 3VHLB 5IK2A 4DLXA 1OF1A 5EE1A 2GXSA 3H4MA 4CT5A 5KYKA 3EPLA 2BM1A 4AG6A 2XNSA 1B23P 5IDVA 4IVPA 1KDRA 2VA8A 4R98A 1GNPA 1M6NA 4TT3D 3I61A 2QQ0A 3RWOA 1GL5A 2ZR9A 5E7JA 3RABA 2LKDA 4WZ6A 4B33A 4EIWA 4I1SA 5DNYB 3RS3A 1HE1C 1C4OA 4I1VA 2XGJA 1MO6A 1YP5A 3WNCA 1P5ZB 5L3VA 5FR1A 1AS2A 1QCFA 4JLNA 4M2LA 3U5ZB 2QGZA 1D2NA 1TX4B 3E1SA 2L3PA 2PL3A 4JL5A 1Q57A 5JBQA 4A36A 1N6PA 2VEDA 3BORA 2CJWB 2PMKA 1M7GA 4K8OA 3UMRA 4YMVA 4CC2A 3OEEA 3NWJA 3W3AA 4B43A 4JBWA 1NG1A 3CWZA 1YWPA 4HLUC 4L5BA 4PPNA 2WJHA 1SRMA 2D8JA 2ED1A 4HCKA 4M1MA 1KI4A 1Y57A 5EXPA 3GFOA 1OFIA 5JI3E 1NYGA 1TTTA 2VTKA 4X1VA 1NN3A 3R8CA 1OIXA 3KB1A 1R5BA 3HYRA 1J7KA 1ESMA 1SQ5A 4HSEA 4V02A 3O47A 4XWAA 4DB4A 3PG5A 4OQLA 4K11A 1DEKA 4HYYA 4LC1A 2OJ2A 1E2IA 2ZIAA 3RSLA 1KI6B 2NZJA 4YXWA 4DHEA 3HWSA 2VP9A 1SVSA 2ZQ5A 4M9ZA 3SZRA 1GFCA 4IOMA 5KDOA 2ZRJA 4NONA 4A0RA 1YRAA 4TYNA 1E9AA 4AC9A 1XXHB 2AFIE 2RGBA 1R0ZA 1HQYE 5ELXA 3THYA 1NLZA 3TQCA 4JVLA 5IHIA 2XZOA 5A4JA 2C99A 1YZKA 4V03A 1CBUA 3DL0A 1W5SA 3W6PA 4B76A 4EJSA 3V4FA 4PZLA 1Y63A 4FMDF 2Z4RA 3AKEA 1Q0UA 1F5NA 4IDHA 4FWTA 4QJ5A 3GEEA 2WICA 3LAWA 1RRGA 1IN8A 3ZS8A 4B3BA 2J46A 1MRSA 3RYTC 3TUZC 2DF6A 1DO2A 4UKDA 1PRLC 2KBFA 1ZNWA 1X2KA 2V1RA 1KI9A 2IYTA 3F5FA 3LA6A 3ND9A 5B30A 2VPPA 2V6JA 5KHOC 1A82A 1OXUA 1ZU5A 2G1JA 1TQDA 3GJ6A 2XJ4A 5FI1B 1JAHA 1P9NA 5J4KA 3ADCA 4EJSB 4A0HA 1JJVA 3BXZA 2VIIA 3T1VA 1GNQA 2AD5A 2HYDA 5FTNA 1HH4A 1OYYA 4D2IA 4Q1FA 2P2LA 4OK5A 3R9IA 4F91B 4YDHB 2GWHA 1WE2A 1M1YE 1NG9A 3HU2A 3D3QA 2N42A 2OHFA 4ACAA 1DELA 5GJWB 3IKJA 2BMEA 4WXPA 5GJVC 4WVFA 3IBYA 4UXHA 1VYUA 1FP6A 1HD3A 2VVKA 1MABA 2BKEA 2K2MA 1X8LA 3KUDA 2CH4A 1QHHB 1FUUA 3EASA 2F1HA 3EXAA 5HTKA 8OHMA 1HEIA 2A7QA 2GCPA 4AFZC 3AP2A 2ODEA 2QAGA 1N25A 4NYJR 1OPXA 2GBQA 4ZDWA 4RD3A 4QT7A 4OJKA 1IY1A 2V7QD 5BW8A 2WMNB 4KU4A 1KNQA 5AWFC 1OFTA 3LH5A 1SGWA 4Q1CA 2V4ZA 4BLRA 1LVGA 5FUYA 4DDUA 4IIMA 2ZE5A 3G82C 3HR8A 4Q4LA 2DFLA 3A4MA 4LBWA 1O87A 4TL9A 2WPDD 4V0NA 4DWJA 3CF6R 2ZM5A 4A2QA 5DSZA 3RRMA 3ICQB 1XTKA 3GLHA 4TMTA 1Q1QA 3ZS9A 3I5SA 3G0HA 4O2LA 1QDEA 3AV0B 4NDZA 1W0JA 5EP2A 2K5UA 1SXJD 3PITA 5DN6D 1HT2E 2J0UA 3QOFA 2PBRA 2F2VA 1GTVA 2F2XA 4MUBA 4BUJA 4EJSC 3B1XA 4XD7D 2XSZD 1ZIOA 1COWA 2MSEB 4PO8A 5JRJA 2FV8A 2X77A 2C2HA 3KB2A 3CH5A 2VLIA 4A8JC 2F3RA 4LV6A 3FMIA 3HDTA 1OXTA 2ZI7A 5KSYA 1VHTA 1ZBJA 4LHVA 3SDZA 3EZ7A 4LHWA 4URZR 5JEDA 2W58A 2EWWA 4Q21A 3T1TA 4AG1C 1LB1B 3QXSA 2HDNB 2ZRPA 4HXJA 1BS1A 2OCBA 2QDLA 1W36C 4BFYA 4BLPA 2C9CA 4AFUC 3QF7A 3K09C 2EYXA 3GMTA 1KIMA 1S1CA 2K7AA 1L4UA 2A5JA 1DG1G 1ZIPA 2HUPA 2OAP1 2KE5A 2QPTA 3B2EA 3L0IB 2EBPA 4PAOA 4ZCIA 2J06A 2EQBA 4PQFA 3EG1A 2CJWA 4JLMA 4MGKR 4NYMQ 3AVUA 1WMSA 4TLDA 1M30A 3GD7A 1I2MA 1GVNB 2WPDA 2EFEB 1WA5A 4ZO4A 3HYTA 1M27C 1OKKD 1NSFA 4P4SB 2OSBA 4V0KA 2JMAA 3AF2A 4B2IA 3TJZA 1W48A 1GZSA 3NHNA 2REXB 2NMVA 1PUIA 1PZNA 1LV7A 4MYHA 4PQRA 3U3JA 1FFHA 5KDLA 3I9QA 4UNRA 1B0UA 3KJHA 2IHYA 1OV4A 3AKCA 3FMFA 3IEVA 2AWOA 4QHSA 1II9A 3TR5A 4UQOA 2QUZA 2OO7A 3ZIAD 1TU3A 5KNCA 4I81A 2VL7A 3M0PA 2REBA 4GI7A 4Q9JA 1XTIA 4B48A 2HYIC 1ZUKA 5HPYB 5FI0B 1NMYA 2OCPA 4AKEA 2OCYC 2XEXA 4JL8A 4LPSA 2QTFA 1G8HA 3PUXA 5CK4A 2J7PA 2DRMA 3OIYA 1SKYB 4HDOB 1NNEA 1VCIA 3CH4B 2RGXA 3QQ5A 1TUIA 2AKYA 3K70D 1YR6A 2XB4A 1E79D 3EG2A 4BQSA 1KSJA 3C16C 4XVQA 4BFUA 1HUQA 2OESA 4JT4A 3GLFA 4MDEA 1A4RA 4LBYA 4JLBA 3SFVA 4JZ3A 5G3ZA 1CP2A 4HUQA 1TF2A 5LPNA 1XPUA 1KK1A 5KNBA 1GBQA 2G83A 4JBYA 1W36B 1M3BA 2EGCA 4QJ4A 1Z9ZA 4AD8A 1ZNXA 1KJZA 1W44A 4KVGA 5EE9A 4TLAA 4KHZA 1NEBA 5JI2E 3G5UA 1JAIA 2X8AA 1PJRA 4FIDA 3FHOA 3MFYA 1D6JA 1U8ZA 4OKSA 3S1AB 4BFTA 2QBYB 2E9SA 3GLIB 1UUEA 4QXAA 4ZCLA 1QF9A 3SI7A 2MMGA 4JJDA 1CR2A 2F43B 4QOSA 2VP6A 4KI0A 2MMCA 1ZU4A 3F8TA 2FZLA 2B7CA 4DCUA 1DE0A 1P2UA 1X1SA 3NBYC 4KFTA 4US0R 4W7SA 4MDFA 2QT1A 5CM9C 4MA4A 2R6DA 4JLDA 3IQWA 1NLYA 3MGCA 3GLGB 3AF0A 1E7OA 1UTIA 1YZTA 1HY3A 2XJ9A 2H57A 4KCGA 2DYKA 5SZKB 3LW8A 4XVRA 1DAKA 1TNDA 4OHWA 1GBRA 1GRNA 1Q21A 2C8VA 1X86B 2WOJA 4I4LA 2GAAA 4ZPXA 4D0GA 3CX8A 3AUXA 4NPHA 2RKOA 2R62A 3MWJA 2QP4A 3AP1A 4HI0E 4Q7KA 2ZRCA 2DBYA 4RY2A 1W0KD 2CNWA 2C78A 2PEYA 2ZJAA 4NE2A 2BOVA 1X3SA 1HURA 3UK6A 1OXVA 1YZQA 2GBLC 2QMEA 4B75A 1C1YA 1OYWA 1X6BA 2FEIA 3MRSA 2R6AA 4OL0A 3KTAA 3PCRB 2IYWA 4US2R 5JSZA 4IJMA 2ZI3A 1F60A 2OLJA 5CLLA 2NOAA 2JLYA 4LSGA 1XMIA 1SHGA 4LYAA 3CO5A 1VG1A 1ZCBA 2O0KA 3H0HA 3ECCA 2FPFA 1VIAA 4GOKA 4OHZA 2ZR7A 3K0FA 3CM0A 4PAMA 5CYPA 5IXBA 2B8WA 3CRW1 3T1QA 1G41A 1KIKA 1AS3A 4F4JA 3JZMA 1I0CA 1ABQA 3VS4A 3VKWA 3ZQJA 1KFZA 1MV5A 221PA 5DYGA 4W9MC 2H17A 1VMAA 4ON9A 5D3QA 2AHOA 3AP3A 5TB5A 1VHLA 5I11A 1XMJA 1Y0MA 1ZUIA 4XWKA 3A4LA 1S3GA 1NG2A 2O0HA 2IA5A 2DVJA 4NP6A 2BBOA 4B3CA 2CHGA 4NKRA 3I8SA 2RMKA 3EG3A 5FFMA 1R0WA 1FYNA 1YZNA 4B6FA 1M7HA 5DHAA 2OE2A 4BFSA 1FQKA 3U23A 2FE4A 2DL3A 2RQVA 4P33A 5KPDA 3P1JA 4DT1A 4PR0A 2FPEA 1J70A 3LLUA 5SZHB 1KMHB 3DVLA 4Q19A 1CJKC 3H0FA 3VR4A 4JLPA 1ESNA 2X3XD 4Q9LA 2ZRKA 2CLCX 4I1OA 2GXAA 2HJVA 4CEIB 1VA7A 5FOWA 1MUZA 1JQJC 4DDWA 3H1TA 4DSNA 2W0ZA 2C96A 3H84A 1UKEA 1XPRA 1OLOA 3CUEF 1XEWX 1T0JB 3JV3A 2JJ2D 2CK3A 3FB4A 3M4YA 1GITA 3U7HB 5TY0A 1GL7A 3REFA 1HJDA 2DMOA 4C30A 3L8YA 2KRMA 2C04A 1KSWA 4CIDA 2NO9A 1GAJA 2H5EA 3C8UA 1XEXB 4CC3A 4G5QA 3GCGA 1YE8A 5EZ6B 1OB2A 4IKEA 2KT8A 2HXYA 1EWRA 1JNYA 5KO2A 1SVIA 4LJAA 2ENMA 1LY1A 1N0VC 2IYQA 4MKIA 4RZ3A 4LYFA 2W6JD 3EIEA 4LRWA 4TYPA 5BYJA 4Z54A 2GNOA 3FMOB 2CLSA 3JZAA 3UMFA 2JJ1D 4ACBA 3PEWA 1H65A 1A1VA 2O8BA 4Q48A 1FTNA 3LVQE 3T61A 1AEYA 1XWIA 4WW0A 4OYHA 4NCJA 2LJ1A 4ESRA 1KJYA 3E5HA 3MJRA 4MRVA 3R8FA 1EFNA 5FUVA 3PVLA 1NIPA 2D0NA 3FPAA 5J4YA 2FF7A 3LDAA 1WXBA 2C03A 1H3HA 3IIJA 3VX3A 1K5DA 1VCNA 3TNFA 5E7IA 5CDFA 2ZAOA 4L15A 1Z0AA 3FFAA 3A4NA 3NVAA 2VP4A 5B2ZA 4C7OB 2J0QA 2IXFA 5CK5A 2ANCA 4ILEA 3LBIA 2QORA 2WWGA 1R6BX 4URWR 2YNMA 3VTKA 1FMJA 3NBFA 4LI0A 4OHXA 1WA7A 4JSYA 4MRNA 1G19A 1A2KC 1IO6A 4Q7LA 3AVXA 3I1FA 1E2DA 2QPAA 1MRNA 2HCBA 1G5TA 2YUQA 2Z5FA 3WYFA 3TAHA 1SXJE 2NG1A 1R5NA 3W8NA 1EX7A 4ZCMA 4TN1A 3RS4A 3AVOA 1CKAA 1D9ZA 4LJ5A 3LXXA 2HLDD 4PANA 1AWXA 5TVKA 2JA1A 3EZ2A 1DS6A 2ZYUX 1KO7A 4G5GA 1RRCA 2NGRA 4EQ6A 1VG0B 3ZVLA 2W2TA 3BFVA 1U98A 4LZZA 2IWRA 5JMTA 1HSQA 1JU5C 1EFRD 4E22A 1ONBA 2DFTA 3U60B 3K70B 2FMXA 1A5TA 1X2QA 1T0HB 3P32A 5E95A 1TPZA 3NTUA 1G7TA 4V0MA 4LY6A 1LW7A 5FOSA 3KQLA 4Z51A 1JR3A 2HT1A 1ZUNB 2XB2A 4NYIQ 5E7MA 1N6KA 1WXQA 6Q21A 1IXRC 5JHHB 1FL9A 2Q3HA 4D4MA 2VP2A 3LW7A 4GOXA 1OXXK 3GJ5A 2V6IA 4Z8XA 3LQRA 1ZP6A 4PHHA 1R2QA 2BDTA 3VHXA 2AL7A 3W6NA 3AM1A 3FHTA 1W0JD 3A1TA 2P65A 2YYZA 5AUQA 1Z0DA 2QRZA 5JECA 2FU5C 4BLOA 1WBDA 2WOOA 4LK2A 3C4JA 4TL6A 1Z6GA 4MITA 4V0LA 2DR3A 1ELOA 4IHQA 4OQNA 4IOKA 4JVSB 1NBMD 1JXMA 4MYCA 3B78A 4MKHA 4XVUA 2ZJ2A 4HB0A 2V7QA 4LBZA 1E3MA 2O31A 2GCOB 3P20A 3FKSA 2QAJA 3HPQA 4R2IA 1Z0KA 3TQFA 4M1OA 3KFVA 3O8CA 3T5GA 2FO0A 2FPDA 4H9GA 1OW3B 5H68A 2F3TA 4GDFA 2PNIA 4JLOA 2FRWA 4ZV4A 1N5ZA 3FJ5A 2K6DA 2PEZA 3KQUA 1IN7A 3K9HA 1OOTA 1I2DA 4PAQA 3O8BA 4CF7A 4QGHA 2ZE8A 3NMZC 3MMPA 1XTSA 1AWJA 1W46A 2IHBA 3TMKA 2AK2A 2GZDA 2GJSA 2QL6A 3N2IA 4C4PA 2KXCA 1RYFA 2BJWA 3VR3A 1E0AA 4WOPA 3QBVA 3GLGE 2F1JA 1Q3HA 1G8FA 2GHIA 4A2PA 1QWEA 4A8JB 2NPIA 2FG0A 2K3BA 4AG2C 1NJGA 2RQTA 1T6NA 2A3RA 1IJFA 4GRAA 2XZLA 1UJYA 2IS6A 2VH5R 1ZX6A 1S1MA 5AJVB 1RI9A 2RQWA 4Q9KA 5HCIA 4JT2A 1NL3A 4Q1AA 3W9YA 4DJTA 1K0SA 5P21A 1BB9A 4LHYA 3H86A 1EWQA 3AF4A 2D2EA 2HDAA 4XSGA 3WMFA 3NC1C 4HB3A 2G6FX 3B8HA 3C14C 1GRRA 1WXUA 4M0LA 5GVRA 2GEVA 2AK5A 2X2EA 1EK0A 3BERA 2VF8A 4PTLA 1DAIA 1OJLA 3VRYA 1OHHD 1XP8A 4P32A 2VSFA 3I35A 2OV2A 3H0IA 4EFMA 1F3OA 1KAOA 1G64A 1ZINA 5FPSA 1J99A 1E96A 5EZ5A 4DT1B 3SJBA 3TVTA 3D8BA 4BFVA 1OKKA 2WV9A 3THYB 2IT1A 2PZEA 5KU1A 4IXNA 2HEIA 1E98A 4YMWA 2EW1A 1UG1A 4WA7A 2ZJ5A 4WZAE 2D7CA 2QQEA 1SVMA 1XD2B 3GFTA 1E99A 3VR6A 4A92A 1GL9B 1GRQA 3T35A 4PQYA 1WCV1 2IYXA 4Z8AA 3IO3A 4MKFA 2YUNA 1HT1E 5JCZA 1C9KA 1R0YA 2BZ8A 2BWJA 1ZMXA 1G3QA 1BU1A 1U0JA 2X1VA 4M9XA 2VWFA 2IBMA 5EP3A 1NVWQ 2AXPA 4B6EA 2HXSA 2GCOA 4OHVA 1TUEA 2XNDA 1K1ZA 2GBLA 3C15C 3B85A 3AQ4A 3X1DA 3RRNA 4ZDKA 4TZ0A 1VYTA 4TMKA 1P60A 5E3HA 2GRJA 1BH2A 4IFEA 1DBSA 3QWXX 2J0VA 3CF2A 2ODBA 1S1NA 3SJAA 4JLAA 4X8OA 2OAWA 4LJYA 3X1XA 4CEHB 5IRCD 5JFGA 2CSIA 4QL3A 2WWHA 3LBNA 1ARKA 1ZCAA 2GJAA 2JLRA 3VAAA 4TSFD 1G6HA 1HE8B 1UADA 2QBYA 1Z6YA 4YLGA 721PA 2VSXA 2IYSA 3K0CC 1K0XA 4Q1EA 3UWKA 3AVPA 2LWIA 2OG2A 4GLMA 1KKLA 3PUVA 1R8QA 2WJVA 3PUWA 5DN6A 4A4DA 4RD2A 2KR3A 4J9CA 1YKSA 3BFXA 1KGDA 1NP6A 3OFNA 3U3MA 3UMSA 2WWXA 3TE6A 4JS0A 4MRSA 4L8GA 5HKKA 1G17A 3U44A 1V1CA 1Z0JA 1DO0A 4QBGB 1RRPA 2RGGA 2F6RA 5F9FA 2AFHE 3HP1A 4OMQA 2VHTA 5IHNA 1E1RA 3B6EA 3SJCA 2PLRA 1AQUA 2Y8EA 1MO3A 3JVVA 1VDZA 1EFCA 4XSHA 3O8DA 5CM8B 2BTTA 3H41A 1P73A 4OHYA 4HLDA 1BMFA 1NEGA 1N5LA 4M9SA 4AIIA 4BGDA 4R71A 5TXGA 2QG6A 4ARZB 1NN0A 2EVWX 1N6IA 3DOEA 1GKYA 5HZKA 2EQIA 2BBSA 3I3SR 1XU4A 4PHFA 3REGA 1W49A 4C0AC 3DOFA 5FBQB 1XCGB 4DLZA 4X8LA 4F16A 4KO8A 2IXGA 4E07A 1JEDA 1D2EA 4Q1BA 4EQ6B 5BXQC 1OH6A 1LTQA 4ZDJA 1LF5A 5CB6A 2CDNA 4NYJQ 3AF1A 3HR7A 4XIGS 4DZZA 3UF4A 2KWIA 2WKRA 2GDJA 1M7BA 3IUYA 1P75A 2GKSA 4FMBB 4QNMA 2ZUDA 1SHFA 2R2AA 2A5GA 1PVOA 2NO0A 2ZJBA 4C3ZA 3TH5A 1P3JA 2YDLA 2K9GA 2E1RA 3X1ZA 3LXRA 4CT4B 2WTUA 5JHGB 2JTEA 3REAB 4OQMA 1VG9B 5M04A 2YC4C 3KQHA 1TUDA 2FNAA 2L2PA 2JASA 1FUKA 4NMMA 4TTPA 5IHKA 2GJKA 1OB5A 2J6FA 1XXHA 4GZLA 4XH9B 1G8PA 2RAPA 3CPHA 5GJWC 2J7IA 2QM7A 2OM2A 1JPJA 1W1WA 1KI8A 3CWQA 5J40A 4PC7A 2JLWA 2AN9A 4F7WA 1KO5A 1S0UA 2PCJA 1G7RA 3UPUA 4OMNA 4DBLC 1GOTA 1J3TA 2WMOB 3EIHA 4CGZA 1IY0A 4P4SA 2DWQA 3LLMA 2KNBB 2XNDD 5F2EA 2JLUA 1CRPA 1E6GA 4JYBA 4KAXA 2XSZA 2G6BA 2XXAA 4MQBA 4EPYA 5H8WA 1I4DD 1JJ7A 1N0UA 1QWFA 1R7RA 3NHAA 1TF5A 4E6RA 3OIUA 1GM5A 2G88A 2OXCA 3BOSA 3QY0A 4G0NA 3FOZA 3QE0A 2ZANA 3CB4A 3NGPA 4N0EA 2RF0A 4PHGA 4LV5B 2WJGA 3BH7A 5FW9A 1W36D 4OI0A 4U7DA 3MSXA 4PC3A 5JS7A 3RSOA 1NRJB 1YCSB 2DWOA 3BBPA 4J9FA 4IDPA 5FBRB 2O8BB 1AIPA 1DARA 4D4KA 4IIOA 3IO5A 2OEPA 4A8JA 2QROA 2DX1A 3RNJA 2WSMA 3FWYA 3TSOA 1G18A 3THWA 1G5PA 4R2HA 3L2OB 1AVZC 4IDQA 4M8NE 1KAGA 3T15A 2VP0A 3RHFA 2P6RA 4C0KA 1K9AA 1M74A 3GJ4A 3LNCA 1QHIA 1JQLB 2HJGA 4C0HA 2NIPA 2Z6VA 1MOZA 3GJ7A 2DB3A 2ZJZA 1YU9A 1X6GA 2QSYA 3WP0A 1E2HA 2REOA 4J9IA 4GBQA 1EFHA 1IBRA 1QG4A 4HATA 3PFIA 4KLZA 4J0QA 2ZXUA 4Q4JA 4PZZA 2Z83A 4F92B 1SKYE 4UNNA 4Q9HA 2ORWA 4C2TA 1EFUA 2G3YA 4EUNA 5GJVB 2FSGA 2XTNA 4F38A 3C0CA 2W10A 3THWB 2VF7A 1ZRHA 1Z3IX 3RS5A 2EU8A 4FMCF 2LNHB 1E0KA 4G5SA 4LUEA 1S9HA 1KSGA 2O9VA 3OEHA 5C1BA 1QHNA 5JCPA 2DBKA 4ORZA 3EIQA 4CVNA 2DLPA 5B58C 4YMUA 4FSSA 4PC1A 3BIFA 3QEJA 4P4TA 2NO6A 3Q5EA 3NXSA 4Y0VA 1UKZA 3KKPA 2JLSA 2KT1A 2RGNC 3IIMA 1L4YA 3K0EA 3L0OA 3GLGA 2ODWA 2C9OA 2RGNA 1OPKA 2O52A 5EJEA 3CZPA 1CR4A 3M0EA 2IYVA 4TMZA 1WQ1R 2J9RA 4TWZA 2OFOA 4LC0A 4LWZA 3BC1A 3GPLA 3SQWA 2P4RA 1SSHA 1OIWA 1TAGA 1ZBDA 3U4QA 3A6PC 1F6BA 4AFQC 2JGNA 3SE0A 1MKYA 1UDLA 5KNDA 1KSHA 1NN5A 3WP1B 1UDXA 1WXTA 4KRTA 4NCNA 1YN8A 3BE4A 3GP8A 1UBFA 1YR7A 3DPUA 2AK3A 4BWYA 4HAXA 1QRAA 2EYUA 1F48A 4HAWA 3R9WA 1IY2A 1X8JA 1N5IA 2X19A 3X1WA 1UGVA 2R6CA 3OESA 3NEYA 2FJUA 2GVDC 5D3MB 5B64A 3ZVMA 4M4SA 3DZDA 2CREA 5I22A 4D80A 1CKBA 3OZXA 2IF0A 3AVTA 2ESWA 4RZXA 2JLVA 1P2VA 4B34A 3QXCA 2VP5A 2WHXA 4E03A 4URVR 4RTYA 2A30A 4RCZA 2EWVA 2QY9A 3K1JA 3KKMA 4JVMA 3K9LA 2CCGA 2BV3A 2OI3A 4B2LA 2BMFA 5L3RA 1Z08A 4LHZA 3M0RA 1T9HA 1KY2A 1XNJA 3MWLA 3VQTA 3KDSE 4RD6A 2IXEA 2D06A 4RTTA 2KJQA 2W2VA 2P5SA 4MKGA 1P62B 4HB4A 4XOIA 1FMLA 1XD2A 1KI3A 3J81k 1NI3A 2P0EA 3Q5DA 2YVUA 1Z6TA 1KOFA 4ARZA 2XTMA 3U3OA 1Z47A 1Z0IA 2ABLA 3RBBB 1SHZA 2CL7X 1T8UA 4ZIRB 1Z07A 2VHJA 1OH5A 1RKBA 1W47A 4M1WA 2CSQA 4S35A 3KKQA 1W0KA 4TYQA 2OBMA 1KO8A 4ZDIA 4TLCA 3EHRA 3U7GA 3QJYA 4RTVA 1AWWA 2RNAA 1KMQA 1KMHA 3B5JA 2VHCA 2ZE7A 3DZ8A 2CVFA 4Q4HA 1PRMC 2DJQA 1WIEA 4PX9A 1ZM9A 4RTUA 3OAAA 4D81A 1K6MA 3LWNA 4DVGA 4G5RA 1WI7A 2GETA 3BGWA 3TW8B 4D4LA 5FPYA 1N0WA 4J9BA 1ANKA 2J1LA 1KDPA 4TMVA 4BZXA 3KJIA 3CZQA 2IK8A 2FPLA 3AB3A 3UANA 3PEYA 2ERYA 4M1KA 1P9WA 3RRZA 4C2UA 3OE7A 4EPVA 1TL7C 1PHTA 4HUQB 4RCYA 1VCMA 2ZJYA 4DIDA 2RQRA 3WNBA 3WYGA 2H8KA 1XEXA 3ZZTA 1UAAA 2O8FB 1V5WA 1X27A 4LE9A 4D8KA 1K4US 1GP2A 3A1SA 1TADA 2LX7A 2C77A 3NC0C 2J05A 4BZPA 2GZHA 4N0DA 3Q72A 1W70A 4E09A 5JJIA 2YWHA 1IXZA 3C41J 2WWIA 5D3MA 5BN4A 1YJ5A 1KHTA 1FNNA 2JM8A 1SVKA 4EFNA 2MSDB 3QXXA 4O2RA 3QVUA 1WFWA 3THXB 4B71A 2XMFA 1NIJA 3OEHD 2X2FA 3PV0A 4DSTA 5JLJA 4DLRA 3VS5A 3ZD7A 2IYRA 1KDOA 2NO7A 2FPMA 1Z22A 1E2LA 2QAGB 3Q7PA 4J9GA 5CYOA 4X8MA 4DKXA 1QHXA 1T0HA 1XXHE 2ECZA 2ASEA 3SHWA 4QKQA 2ZRIA 1HTWA 5KUTA 2GNCA 4RFVA 5JSZB 1CIPA 2WWFA 1US8B 4KBFA 3WHKA 1RPZA 2P67A 4IDNA 5SZJA 2A28A 3DHWC 4HZUA 3PXGA 3UG6A 3AKYA 2IL1A 4JVNA 1L8QA 3F3YA 4BASA 2DE0X 2FSHA 4Q9IA 4NTZA 3TLXA 1NLPC 2GF0A 4KVAA 2Q21A 1ZC3A 5L8VA 1NBME 3B1VA 2WWWA 2ZAMA 1BYUA 2ZYWX 4RKFA 1KZGB 3QKSA 2GXQA 3B9PA 2D2FA 1UF9A 1Z83A 1X8KA 1BK2A 1G1MA 4FXPA 4GFDA 1ZW6A 5G3YA 4GPTA 1M8MA 1ZAKA 4Q7JB 3IQXA 3ZYCA 4YONB 2ZI4A 2BVNA 2GZAA 2W83A 1D8TA 4NU0A 4DIEA 1AK2A 1VPLA 5CIQA 1RLQC 2JLZA 3DDCA 5AJZA 3VS6A 4O25A 1ABOA 3RWMB 2LMJA 4PPFA 3WRYC 4EPXA 4Z1MD 3NPFA 3ETLA 2O8EA 1Z28A 3QPVA 2ZREA 4A15A 1U3OA 4PSAA 1Z8FA 3ICEA 3B1YA 2I0NA 5J47A 1T5LA 4II7A 2QRNA 2KRNA 4P31A 4V0ME 3REBB 2DL8A 3SNHA 4ZKEA 5A0FA 1E2MA 5L3QB 2C95A 2GGRA 2DNUA 2LCSA 1U94A 1G3RA 1UBGA 4PO9A 4RFSA 5AJYA 3A98A 4DCTA 2JXBA 1HA3A 2IYLD 2DA9A 3CW2A 4BFWA 3CNOA 4B3GA 1XFAA 4HVUA 1J8YF 2LQWA 1S8FA 1TU4A 3W6OA 5LD2C 3ZGXA 3R7WA 3KKNA 2V54A 3NBZC 5G53C 4L9WA 1FMKA 2BJVA 2Q3FA 2ZRMA 4WBSA 4U5XA 3MCAA 4JPBW 2H8HA 2A5DA 2MSCB 4BLSA 2GCNA 2JJ2A 3ASYA 3TSWA 4JSTA 3T34A 2JATA 2EPDA 2QE7A 2ZROA 3W5IA 4OMLA 3THXA 5L3QA 2BBTA 2Z4SA 1E2PA 2CBZA 4FCVA 2CHVA 1JQQA 4RFSB 3R6NA 1BO6A 4HVVA 2ZRLA 2GTJA 1IOZA 2ZRFA 2ZYTX 3VU9B 2YWFA 2QMHA 3BS4A 5HCKA 5ECAA 2W0MA 3W90A 3WXMA 5GJCA 4OK6A 1QBKC 1W2HA 3KKOA 1OIVA 3QSYA 5F9HA 2L3QA 2XAUA 5EP4A 1XOVA 4QBFA 3AH8A 3EWAA 3SOPA 2PJRA 2N1BA 4C0BA 2R6FA 3AEZA 4PPGA 4W5HA 1MV0B 1E2FA 1YR8A 3FHCB 3LY5A 1SPKA 5KSZA 1W1FA 2D4HA 3BRWD 3PR1A 3QNUA 1GRIA 1RE0A 4UJ3A 2RCNA 1JPNA 5IF9A 3ULRB 1MV3A 5HE9A 2L3SA 3VS7A 4BLTA 3DM5A 1XTQA 1E1QD 1AA9A 3ND8A 2BCGY 4LJ8A 1Q1EA 1GL6A 2AR7A 1XZPA 2DYBA 2AXNA 1RJ9A 3ZVRA 5L3SB 1ZUUA 4EFLA 4JLVA 5ANRB 1II8B 3SBEA 1XD9A 1FX0B 4M21A 2MOXA 1MABB 4KFRA 3DKVA 1G83A 5E4FA 3BB3A 3OFND 4D6PA 2XTZA 621PA 4Q03A 1DAFA 1MT0A 4F14A 4FMDB 5JZVA 1CRQA 3IEUA 2VSOA 3BAFA 2FRYA 4Z1MA 3HU3A 1XB2A 3IGFA 2DRKA 3VR1A 4FCTA 5DI3B 3CX6A 5DH9A 3TR0A 3WBJA 1G5RA 4CEHA 1AJEA 1YVDA 3DMNA 4OQFA 4LJ6A 4AKIA 4ESVA 3AVVA 4D82A 2J0SA 4XJXA 3I32A 3ZZ0A 1TG0A 3B13B 4Q47A 2DL5A 1ZC4A 5GVSA 3TUIC 1W4BA 2ED0A 2ZS9A 1JB1A 3SEMA 3D7MA 2NTYC 2V3CC 2KROA 2D62A 1U8AA 3QXHA 3NEJA 5CJPA 2ZUBA 3CR7A 4CEJB 1UHCA 4Q1DA 5J4LA 4MUAA 3IQLA 3L43A 4BLQA 4F17A 2CHQA 4KODA 3DM9B 5K8UA 3U44B 3HPRA 2JDID 3EHQA 4AWXA 4AYXA 5AJXA 4Q4AA 3KQNA 5JEEA 1XX6A 3ZDQA 1S2MA 2K79A 2XX3A 4OJQA 5HE8A 2ZRNA 4Z89A 2CDTA 2ZVPX 2YJTD 1NMZA 5FL3A 1CEEA 4A2WA 2EFDB 2HBWA 2V1XA 4FINA 2OZEA 4LBVA 4BRWA 2IX3A 4PZYA 2J6KA 1UECA 2O0JA 1KO4A 3IIKA 5JJKA 4OMPA 4NCKA 1YWOA 4OQXA 4CRWB 1HV8A 4YMTA 1K5GA 2QN6A 2YSQA 3AVQA 3Q85A 4MRPA 4RTZA 1UEJA 1R8SA 3VMFA 3SR0A 2ZRAA 3B60A 4EKDA 1EFRA 1E69A 3MWYW 4IEIA 4S2EA 1M3CA 1TQ4A 3KZ1E 1H8HD 3UA7A 3U4QB 2KSQA 2H7VA 3RVBA 2YZ2A 2YC2C 3DMDA 5EE5B 1VKJA 4MH0R 2W00A 4D8DA 4B73A 1P2TA 1XTRA 1KI7A 3CF0A 3PVSA 4E5UA 1S3SA 5K8TA 1J2JA 1SXJA 1HYQA 2WM9B 4UXIA 1WX6A 3SHFA 4BEJA 1PV4A 2HF9A 2CEAA 2ZETA 3CKLA 1AKYA 1OFHA 5H1YA 2J7PD 3T1OA 1GILA 4PXAA 3C5HA 1RFLA 4EIKA 4EPWA 5TMPA 3GBQA 1KO1A 3ZZUA 3LVRE 3TGPA 5HR5A 3RANA 4RUGA 4Z88A 5AUPB 1II0A 2YHSA 4QGGA 1JBKA 2VHQA 5FL7D 2JEOA 2ZI6A 1R5OA 3A58B 3LX5A 2CCKA 3RNLA 3CONA 4ITRC 4D25A 1QHHA 2GEDA 1W5TA 3H0KA 4L4UA 3WY9A
chains in the Genus database with same CATH superfamily
1YHQA 5JZ9A 4KDCA 3H5RA 4XPIB 5EOVA 4ZIRA 1F3LA 1QCZA 2W2XA 2V8JA 4IVRA 3KPUA 4N0PA 3LOUA 3R75A 1NPYA 3QUBA 5BWOA 2OVFA 5LKRA 3GLFB 5LB4A 1RWXA 1U99A 1V43A 3A1WA 3GCZA 4YQYA 1M66A 1EGHA 1ATIA 4ZVUA 2X51A 1VMDA 2J5XA 1SVOA 3KT6A 3L5OA 3Q11A 4H27A 3JCMW 3H3XA 3ZHUA 4D8YA 3GIBA 3V7WA 5K05A 1KAHA 3VR5A 4NABA 3AIKA 5KYKA 1E9CA 5DULA 3CB2A 4XUCA 1SUDA 3AW9A 3GLHB 2P4TA 4TL7A 4BU1A 4F7DA 2EYYA 2YMMA 2ETXA 4C0DB 3WLHA 3VKGA 3TDKA 1TKBA 1EP3B 2PUWA 4FX5A 5CA0B 3URKA 4J3NA 1FZQA 4P58A 2DH6A 3BMXA 2PO5A 4Z8YA 5BSTA 4F4IA 1KY3A 4IJUA 5KDDA 4GL2A 1U31A 5BOSA 2JKVA 4UW9A 2Z0MA 2JCXA 1NASA 4LY0A 3C3WA 4QSMA 4AT1A 4AKSA 3I5YA 2QTRA 4YUZA 1P6XA 2X3YA 4KWEA 4RVFA 4H16A 2XGGA 1IUKA 1YJXA 3GU3A 1RQLA 2CB9A 4B4DA 1K6EA 1CQXA 2J3MA 1A9XA 1T2DA 3JV7A 3L9XA 5EPEA 2Q2QA 3AHHA 3FFBA 1BWSA 2L0XA 3ZWXA 1L5KA 4FQ7A 2AI2A 3SWNA 1J0AA 1VSQA 1L7VC 2RB5A 1U7UA 4KPGA 3E2PA 3ND5A 4L8WB 5FOVA 3STWA 4B3DA 5FPHA 3HN2A 1DCTA 3UT6A 5ADWA 3C6XA 3EUWA 2EIHA 4XAXB 3ZTYA 4E2YA 3S3TA 1PGJA 1W5AA 3WQHA 4AULA 1GCQC 2HZYA 1Q7YR 4DYVA 3Q88A 4PG4A 2QUBA 3RH0A 4E5KA 3ZDRA 1XZ8A 3G7UA 4K6OA 2HA6A 5AVJA 2B9VA 4M1TA 1W4AA 2XOKD 3CEAA 4MUEA 4RK5A 3UJAA 2K7FA 3TRFA 1DIHA 3WLMA 1HYGA 5IH2A 1MTZA 2HM7A 3QPBA 2C4HA 5HEKA 2VRNA 3MD9A 4HS9A 4W1PA 3QXEB 4M78G 1XZCA 1QDUA 3INRA 4DIOA 5LR6A 5DFAA 3W5CA 5K3AA 5UKDA 2RJNA 2IGTA 5HIJA 1IHUA 3U6KA 1JPVA 4D3XA 3I83A 5AK3A 1JAXA 4ND3A 4I1RA 3L2VA 5TQ2B 5AVQA 1CTQA 3VU0A 3ZV3A 2PM8A 2X3WD 2LR0A 1IBMB 4L2IA 1DQRA 1ORTA 1F2UA 1X6VA 2WIBA 3T7KA 4E2FA 5MN4A 2IYUA 2VDNB 5JH7F 1GZ3A 1UAYA 2DQKA 1JIQA 1QE3A 2ZEJA 3A05A 3MIZA 4OGKA 5C46F 2C0IA 1Q44A 1RC0A 3GJ3A 2P9GA 2XDYA 4BNIA 3DKRA 1XTPA 3RSCA 1JR3E 4FFPA 1ZWLA 4WZBB 2AOXA 5PGMA 4IDCA 5DBFA 5IXJA 1U3CA 4UC4A 1OBCA 4MS1A 2XCTB 3KYCA 1QFYA 2BFDA 4TWIA 3RVDA 2Z5GA 1QFZA 3KR9A 1UZLA 5FTLA 4MDYA 2FPSA 2KEAA 2JJ1A 1D07A 3V1NA 2ATVA 4QVCA 1TECE 2XY4A 3IB3A 4J75A 4Y2RA 1UXHA 2CNOA 1H1LB 4DSUA 3L49A 3S3OA 1OBVA 3VU3A 1NZFA 1KIAA 2Q6OA 1K3FA 1KC3A 3HGQA 2YMLA 1TM4E 1JU9A 4HX2A 4QXOA 4U0KA 3AB7A 3W5VA 2RHDA 5CFOA 4JXZA 4J6WA 3P5BA 4X1KB 4BO3A 4H6PA 2NTVA 2WHPB 1D0SA 1IM5A 1H4QA 1GQFA 1AZSC 2H2HA 2NVUA 1N32B 1HQDA 2JNWA 5IK2D 2DTXA 5CK9A 1LDEA 2VQSA 4KGXA 4RABA 3ECSA 5BV1A 5LQJA 2ZSBA 2DT5A 2X4JA 3WKDA 4G8CA 4EYKA 4JRIA 2QD4A 1NU8A 4V0OA 2PTKA 1EX6A 3JAKA 1KK0A 4EYOA 3O8OA 5INTA 1QQBA 4M1SA 3CCLQ 2GFUA 1FJXA 2IPOA 3UH0A 1MA3A 4JJNK 4LRXA 3SWWA 1NI4B 1HDYA 3UWOA 4Y6OA 1E2GA 1NLOC 2O5VA 3PFNA 5TQVA 2OUIA 1Z25A 3EQ6A 4L8VA 4R3NA 2WAAA 2PU7A 3R7WB 4QE3A 4R2KA 1WV1A 1TJPB 4BE4A 1V35A 1KR2A 3IDOA 4JOQA 4OHFA 3SS9X 4QTXA 4AS3A 5ICCA 2VC2B 4MXDA 4Q66C 4PPQA 3KC2A 1LX6A 1FNMA 1L7EA 5KTNA 4X66B 2F43A 5FOXA 1R6VA 3KXIA 1TLFA 1UFRA 2C9YA 4R1OA 2FWNA 3W04A 3QXJA 4YPVA 6YASA 3GT4A 4QKUA 4LFAB 3VC1A 1SBCA 3WOVA 4FYVB 1TU0A 1ZNZA 1ZSNA 2GAOA 2QZPA 2H16A 2HWUA 5EMKA 5MGBA 4H3SA 2FWAA 4MI1A 2LDMA 4EYQA 2YJGA 4AZ3B 2ZIZA 5J2TF 4DLVA 5C35A 1CQZA 3WK5A 4CQMD 1TUCA 1PHPA 3RG2A 2FEOA 4MQEB 4A63B 2EQMA 2IVWA 5A2QE 3JQFC 3QTTA 4TROA 3H11A 3RAPR 2WIGA 4MQ5A 4B9AA 1KEZA 3A3NA 5JBNA 1IWOA 3ZQUA 2F1IA 2AZVA 2JW4A 4UU0A 2IHKA 2Q3LA 1F1BA 4MNTA 3DKKA 4QVDA 2SKCA 3R6TA 5BP7A 3T7DA 2VZ0A 4C0XA 2DY1A 2CKKA 5A0LA 2G17A 3PNKA 1SU7A 4KK3A 5HRAA 2GRAA 3FE2A 4J0GA 5IF3A 1D8AA 4J8OA 3E5RA 4NI5A 4EAAA 5KKCA 3ANXA 4HT8A 5G0SA 3DW1X 2I2FA 5CMLA 1K88A 5AM0A 1EINA 3BSSA 1OH7A 2GTPA 4RS3A 4UU7A 4D46A 3CNLA 2AJ8A 4CQMA 1PDOA 3AY7A 5TARA 3P26A 3AKDA 3OYLA 3C4QA 3UJ3X 2QSJA 3CMAQ 1WLPB 2RARA 1QP3A 3L2ZA 1ORRA 1RAGA 4JI1B 1JEGA 1JU4A 2XUAA 4F3CA 5JR3A 1HKHA 4HDSA 4BRSA 1JAZA 1ACMA 2O3TA 5KYYB 3KZCA 2HLDA 4LJRA 1Y9JA 4Y6GB 5AVYA 2BEVA 2YOFA 4XA8A 5IHPA 4Y7DA 2CUBA 1U81A 2ECQA 3MLAA 4QPJC 1QF6A 2XAAA 4XKJA 2BI8A 5A5DA 5KOHA 4NR0A 1G16A 3RBXA 1ZSGA 2FK7A 3BE5A 3M1IA 2YRVA 4N39A 1I7LA 3DKIA 2CLHB 5LQKA 3DKMA 1RI1A 1G66A 4KC0A 2G06A 1KKMA 4ZOLF 3UZUA 1PTJC 1QFXA 2IP4A 1Y0BA 2HU8A 3JTEA 4H1TA 1LU9A 1RFGE 1A8HA 2O48X 3JZFA 3CV3A 3KTDA 2PVGB 1M1XB 4QDKA 5C53B 4Z4FA 4KRFA 1UKVY 3CRVA 1H2EA 2IPAB 2PXHA 3OFJA 4XLLA 1T43A 3UOGA 1TUBB 3W3ZB 3ZQ6A 3DDNA 3TIGA 5DWVA 3KE9A 4CUZA 4AY2A 4UHBA 1NUPA 1OU9A 1OX5A 4Y2TA 4YP7A 1MAHA 5DOZA 2ESRA 5F5LA 3D8SA 1JXOA 4PF1A 1XWFA 4PICA 1VE9A 3REQB 2RC5A 4MJXA 1U2DC 1CQIB 5AXBA 2KXDA 3HN6A 3JQBC 5T5QA 5AM1A 5JDCC 4CWAA 4E7KA 3IVCA 2O5EA 1RQXA 2GA8A 2VK1A 5B12A 3EG9B 3T3EA 3PX7A 2EJ9A 1VKRA 1SNYA 3IXMA 3PDWA 1RZ3A 5AXCA 4HGOA 4UZFA 1CIJA 4WACA 1W4CA 2GZ1A 2Q0HA 2QZJA 3BEOA 4X7BA 4YMIA 5A05A 5AVXA 1RJEA 4CDMA 4J9DA 4MPJA 4B82A 2IHUA 4X54A 3W5HA 1O58A 2OO3A 1RZRD 2IU3A 1SBHA 2D1XA 2CCJA 1FXWA 3WI7A 4DC0A 2PAAA 1HDCA 3QI2A 2CZ6B 5FWAA 1TOVA 2QZZA 5LBIA 2IV2X 1Q81C 3M0QA 2PVPA 3ICOA 1PJCA 2ZT8A 3LLCA 4UUOA 1BA2A 1AURA 2R96A 3FZYA 3JQ8B 4ZVRA 1AB5A 4DXAA 3FMPB 2ON6A 1GSIA 3BQMB 4EDHA 4DLWA 4DN6A 4H1VA 3NHBA 3MRXA 2HSJA 5EY5B 2E12A 1RWVA 4HV4A 2Q3MA 1GPH1 2CVZA 1CUDA 3LVFO 4JODA 2FEAA 3U4GA 1I4TD 2QA4A 5E2IA 2HX1A 3PNMA 4DEXA 3B12A 2J5RA 3R6GA 3M57A 4L57A 3ISTA 4MIOA 4REMA 5D86A 1QYVA 1WCIB 1K2WA 1SHKA 2F3PA 3KL2A 1SD2A 3PUJA 3QVVA 5CA1F 3D1VA 3OTWA 3H83A 1JUDA 1QB7A 4K8RB 1VP3A 4IV0A 5HBGA 2VQEB 1R77A 1M1UA 3ZH2A 1BNCA 5DNAA 3SX4A 4JRPA 1C14A 1EUCB 1NONA 1RNLA 2XOKA 4RAOA 4UJ5A 5AKHA 4ALNA 3VS1A 5IJ9A 1J1IA 2IS1A 3M0SA 1B8OA 3PFHA 5K09A 3EXFB 3DF9A 2A2ZA 4KGZB 2PIAA 3FI9A 4LHSA 3C1UA 2YY5A 1L1QA 4U9HS 5CW1A 3K5WA 1TT5B 3S1SA 2P6OA 3HQ4O 1YIOA 1OLSA 4D0NA 4QFMA 1WRBA 2FGKA 4I9NA 2PQMA 1L7XA 2ZAEA 1NBWB 2L69A 2WJPA 4RZHA 4X1YB 3HKDB 5KREA 4P3YA 3LD9A 4QJBA 1G3UA 1NYRA 4M77F 4Q5IA 4Q4HB 2E4AA 1JJBA 4B46A 1KK7A 3PQ4A 1L6RA 3I52A 1I3MA 3ZX5A 2Q27A 4J9EA 1JIIA 1B7GO 1QSGA 3A70A 5DBEX 5E9JA 3AUSA 2DILA 3Q0EA 4JIMA 4PSVA 4KR3A 3Q7EA 3DQPA 1RADB 4CDRA 1OTXA 5K0LA 4YAUA 2GLUA 2PDAA 4TXMA 2GPTA 4FYPA 5D2CA 4OLBA 4L8FA 2QSUA 5BQFA 4I1IA 1ZSZA 2PTHA 3CQ9A 5DTJA 3S1AA 3OYMA 5JADA 2E85A 4A4FA 8ATCB 3DE1X 1S8AA 4R2MA 1S96A 5ESRA 4D44A 3KKZA 1BYIA 2QX8A 4LN2A 1DC7A 3M6FA 2D1QA 1UDWA 3PQCA 1F38A 5I9IA 5CVTA 1NYFA 1QB8A 5IP5A 2X5OA 3TZKA 4LYDA 1UUFA 1LCKA 4IDFA 3SJ7A 3C94A 1GFIA 2PVDB 2OCAA 3OYAA 1T4CA 4RELA 2F69A 3WYCA 2ZQYA 3O93A 1OT3A 3UFXA 3W6UA 3TPFA 7ABPA 1VQMT 1Q84A 3X25B 5REQB 3G2QA 1B93A 1Q0PA 2Z6UA 1OI4A 2QU8A 2AOUA 2MWMA 1WR8A 5DGXA 3CC7A 1FFWA 4EPRA 3NYQA 2CLDX 2Q9BA 4PYQA 5I9MA 3RVJA 1UE9A 2NXCA 4ARAA 1ZM2A 4OGCA 4POAA 4LCEA 8AT1A 2EQKA 4N3NA 1P61B 5CIUA 3VS0A 3ET5A 3BA6A 4RZIA 5J63A 1NKVA 3D43A 4PLTA 1K92A 4GYWA 1VSVA 3ESDA 4GQAA 3RS0A 3T7CA 4PRZA 2XYPA 3U4AA 3WG9A 2XXJA 5IH3A 3KJXA 3LRPA 3TLMA 3OUUA 5CXUA 1N9SA 1ICIA 4RD4A 2O7SA 3EXHC 4JT8A 5EI5A 3TKYA 4QPNA 5DYWA 1SVLA 2GFQA 3DVSX 5AHKA 4WT7A 1MO5A 1Z5ZA 3QWFA 5CVJA 1KQSA 4YJ2A 3H2GA 5DCYA 2JGMA 1TWBA 4FEYA 1I6LA 1OR8A 2VNAA 3PI6A 5D84A 4M78D 3JW8A 3G6WA 4KGZA 2FA9A 3L8ZA 4HEHA 2AUNA 4BEBA 4D9JA 3N74A 5FEUA 1N0HA 1XCBA 3GZNA 1JQ5A 4MGYR 4EPTA 1ZY2A 1QZZA 1TVMA 2O2OA 4JKYA 1JZTA 4B3HA 1NBEA 1XVAA 3RVPA 1SOMA 2RG1A 5DLDA 5LP6F 1H2HA 1IAQA 3IXLA 4ETMA 3AK4A 1NX6A 3WL5A 4BP1A 4A1FA 3FUVA 3Q3IA 3WQSB 1AGRA 4LF4B 1R3DA 2ORED 4P36A 2EKOA 3FEOA 1UQUA 4RSRA 4BE0A 2AX3A 2R7NA 3L0CA 1AGNA 4HZUB 1G3SA 3B38A 3DL7A 3O4HA 3L2UA 2PWAA 1SZJG 3P9ZA 3U9TA 3VJPA 3QPUA 3V7UA 4KAAA 1FVFA 3IMGA 4RJKA 1QU3A 3BH6A 3JQGB 2HSDA 4CG3A 2QLNA 4M9QA 1V96A 3RS2A 3QZUA 3MWFA 1GG5A 1MEOA 4M22A 1M0EA 1QRUA 1OWOA 2E4XA 3O8QB 1Y96B 1HKUA 1AN0A 4AZWA 1NDHA 2QDKA 4MAFA 2B3DA 4RA9A 3HV2A 3AOEA 3CQTA 1C81A 4C0SA 3GLIE 5IXYA 2LRQA 3PBKA 3HA7A 5U9CA 3QPWA 5BYBA 3GUCA 3CCRA 1CFJA 3O9ZA 3STYA 4ERNA 2IUYA 4K03A 5B6IA 5JISA 1U6IA 3P2IA 4PFSA 4JZ4A 1PJAA 4B6MA 3ACDA 4N18A 1DDGA 4AI6A 2KQUA 1H05A 2CE2X 4PLHA 2ILVA 1ZICA 5CX1B 1YBAA 3ZLJA 4RDHA 3EZNA 3GWGA 4IRMA 4W5WA 2DTOA 1WUTA 3WYAA 1U7ZA 3H16A 4HAUA 3MBIA 1XZEA 4QVKA 4KXYA 3MTJA 4LMRA 4PHTA 4B3XA 1UXJA 2VDWB 5DNEA 4TTVA 4CM8B 4HJXA 2ZJ8A 2QRKA 3LXMA 4F6RB 3EPJA 2QZ4A 1OI7A 1ULHA 4GKVA 3HY3A 2GKGA 3QFTA 1HYHA 2CUDA 1WSBA 2XDQB 4W6ZA 4E7HA 4LK3A 4YWJA 4YV0A 5IWCA 1YCFA 3K6JA 4ZN6A 3U9SA 2XE4A 2Z9BA 4JP1A 4QNNA 2BFEA 5GZ1A 1QDLB 3FOFC 2ODNA 3LDFA 2Y1EA 2PPLA 1I7PA 2BM0A 2CMKA 2CC2A 2VQ3A 1MORA 5FLKA 4F4CA 4ZV7A 2ZRHA 4YP9A 3FVQA 2DHRA 4FYXB 3LE8A 3VC7A 2H1VA 5C1PA 4UNQA 2HRZA 3MRTA 4IOJA 3MS2A 3QZ9B 3JRZA 2IVZA 4Q7MB 4M75B 1N6LA 3EW9A 5TMPA 1R0BG 4WXEA 2XYQA 2RH4A 3AW8A 1PT9A 2WJWA 2BFCA 4MR8B 3W5JA 1ZUHA 3LSYA 4V0QA 1P4SA 5ALXA 1UFKA 1STOA 2VUHB 1NV8A 1CUJA 3IILA 1BOFA 1H8ED 2G36A 4JWKA 4V39A 3VXKA 4E7ZA 2SBTA 2CSXA 3S2IA 1M3AA 4PSKA 3RS7A 2CD9A 4KFSA 2VP3A 3N28A 4KV9A 2ID4A 4L9SA 1A76A 2GDZA 2C2XA 2YFHA 3KSZO 5DSXA 4EG0A 5IT5A 3EVEA 4KWCA 4Q3CA 2ZOSA 4BO5A 3NH9A 1FSPA 3QUSA 4QZVA 3E3NA 4N0AC 5DO9A 1YOVB 2GK7A 3GUUA 3MLEA 4LISA 2ZPTX 3J7AF 2R7LA 4XEUA 5A3SA 1IBSA 4ZC1A 5KVAA 4NJMB 3TW4A 2GJ9A 1QG2A 1M6EX 4A6XA 2ECPA 1G2OA 2JS7A 1PEKE 3HXLA 2B37A 1AXEA 3VTFA 1WSWA 3L82B 3AZOA 4ID9A 2NU8A 2OYRA 1R0XA 4A03A 2HO4A 3BTSA 3H5NA 3QWYA 1XWWA 4BB5A 3UY4A 4E0BA 2G77B 2IP2A 3R5FA 4QW2A 3L7CA 1VBKA 4Y92A 1OEBA 2QR2A 3I58A 5EFZA 4BMNA 1D9XA 5L3SA 4DDMA 5ERXA 5EWJA 3QELB 4EUSA 2PX3A 3N5CA 1A8UA 5K9ZA 2C7OA 2DHQA 4LDVA 2AMJA 5EJIA 1MX3A 2RQUA 2HMWA 3UO8B 4KE8A 3OOJA 3JWGA 3P0EA 4V2SA 4C4AA 4LTNA 1F7UA 3BFMA 4YTEA 1NRWA 4YMSA 3MJXA 2V0NA 1PKSA 5FOTA 2NSYA 1QQJA 1H66A 3HRTA 3VC2A 2FW1A 3KJGA 2P2CA 5JAPA 1PGNA 1Y80A 3QK7A 3RLFA 2HN9A 4ARVA 1U9YA 1Z6AA 2XQFA 1Y4ZA 5EJ2A 1GWNA 1WB9A 5HJEA 2GUGA 3J80E 2EWMA 3K16A 2JEYA 1U1TA 2XRZA 5BMVA 3HH8A 3O8RA 2WV7A 3R3SA 1JEQB 1T1IA 4BFZA 3HI6A 4ERXA 2R1VB 5TF4A 5EP1A 4IXMA 1L6IA 2FZWA 4YXFA 3FYUA 4AY3A 3VZCA 3VV0A 4F1KA 1BIFA 3DBLA 4M46A 4Q01A 2LZ6B 1BVYF 1WL8A 3CXUA 3FDXA 3GP5A 3QPCA 5K0FA 3AF6A 1Y89A 3SKYA 1C7EA 4C3VA 5T6MA 1QQAA 3ZBTA 1U9JA 2Q1XA 4IUBS 3V8NA 1YI0A 1ZK4A 4RVCA 2QJTA 1YQDA 4BRUA 4LOKA 5A02A 1OTYA 2BGUA 3G68A 4LXQA 1NVGA 3EXEB 4IIYA 4KYUA 2J3IA 3A6KA 4ZOCA 4Y9DA 1BI1A 1UBJS 3TVDA 5C31A 2EG9A 4F4HA 1VYVA 1B0ZA 4LYHA 1T4GA 2VKQA 1GZ4A 4A6PA 5LZ4A 3JYNA 3OHMA 4POOA 2Q3BA 2VYND 2Z6QA 1NE7A 2O4CA 5C5EA 2VBCA 3PVQA 1M2GA 3A5ZB 5F1KA 1XEAA 1Q0ZA 1YITA 3EAGA 3U2QA 3N8KA 3USCS 4D92A 4CF6A 4DQKA 2O3QA 3DVRX 5ALUA 2FZCB 3IRVA 5ECGC 1VA5A 3VZRA 4E94A 4EGFA 1I1JA 1WULS 1OWPA 1THMA 2WYHA 3FVRA 3K0KA 4QU9A 1D0IA 2ZIXB 3NGMA 5EMMA 4I2VA 4JYZA 4MZXA 3RC8A 2W8BA 3GJTA 3PNBA 2YT6A 1DKNA 2O8DB 3DC7A 3SVZA 1Z15A 1F17A 3Q41A 4KX5A 4D0RA 4FDUA 4OHUA 3UAXA 4O2AB 5AW1A 1XCPA 1P2SA 5HS4A 3K9QO 4C92F 1PLLA 1GGMA 2XT0A 4HQRA 1IZ7A 4PYRA 3PGLA 2FSVC 1N5DA 2RPNA 2OTJQ 1E60A 1AQJA 4IQ4A 1B8PA 1FUYB 3V1LA 1AMNA 1O77A 1OUMA 1PFGA 1A71A 2RH5A 3E15A 4F9TA 4FYYB 1QE5A 2KI7A 3FBWA 1RBMA 4ZVNA 2B7BA 5D1HA 4NS5A 4G0ZA 3WL3A 6REQB 5E0KB 2J09A 3GEIA 4HGYA 4N5LA 2VDWA 3U80A 4GLFA 1OWNA 4HC4A 3RFXA 4QQFA 3MYRA 4DC1A 1DAEA 1M2OA 1UMBA 4JB2A 4M1EA 5KVCA 4OQ4A 1OH8A 1FLDA 5DGDA 3PS9A 2AHJB 3B9RA 5DP2A 3AHDA 1JJFA 4M8KA 3MINA 5M34A 3T94A 3CUSA 1TJ3A 1WY5A 4C0FA 3EBLA 4W1RA 1OC4A 1SZDA 1UFFA 2W42A 4IHAA 4NZYA 3QLEA 2CZQA 2BC9A 4CEIA 3RDPA 3ZBUA 5ICFA 1QKWA 1DC8A 1XBTA 2YBDA 5C18A 4FLFA 4I9FA 3HCPA 4XRGA 2QUAA 2R1UA 2VJPA 1DWOA 4MARA 2PH7A 4TLBA 4BTEA 5JFGA 4X8HA 3HXTA 1Q7CA 1F2TA 1N6AA 1Q22A 1L4BA 2FE1A 3BFKA 3BMNA 4GDMA 4J4BA 4MYRA 5KINB 4CMCA 1L7NA 3AU8A 4FJ1A 2K5IA 3DP7A 1L5FA 4QNRA 3CRZA 1JA9A 1YMUA 3SG0A 1NVEA 1QC5A 1IXDA 3OC0A 2GHQA 4TMXA 1W4SA 1XMXA 4RZUA 3HL4A 3R20A 3RRXA 3QVGA 5GONB 2R65A 4GS5A 2OOKA 2I1QA 1I81A 2WTAA 1DPFA 4GVPA 1O95C 1GXSA 4LHXA 1NYTA 2LQKA 1MLDA 3E03A 3ESCA 3BH0A 2ZYRA 4GLBA 1WX1A 1V8PA 3RS8A 9LDTA 3ND6A 2FZGB 3MWEB 4MGIR 1IB6A 4MS3B 3CN9A 2XICA 3ELWA 3T6KA 1SRLA 1CJVC 1XOIA 3NHKA 1BCSA 3KPWA 2ZB3A 1E1NA 1YACA 1DAHA 4JXKA 1CUUA 1QRDA 5TQJA 4DUZB 4KR9A 5CA1A 1TYZA 2FFBA 4XM0A 2WFAA 4C92D 4AJLA 3CBQA 4BJ3A 4P22A 2OG1A 1N7GA 3QE3A 3QU4A 4GZ6A 1LBHA 4FZ5A 4LGCA 5HF5A 3L8CA 1II8A 4B80A 1XZKA 3D5TA 1EVJA 1FWZA 1W1UA 4QBIA 1TFUA 1RIFA 1C3OB 2J6HA 2RCYA 1RCUA 4U2FA 5LB2A 3QEAZ 5EIAA 2W8BB 4A4EA 1M8JA 2H9IA 4M7DD 4D1YA 4GLKA 2V8IA 2EJTA 3HZRA 4G37A 2ONKA 5EWJB 3C12A 2CJPA 2AQ8A 3GDGA 1RHJA 4G1BA 2QL9A 5DI3A 4JYCA 2XZTA 3GEHA 4KYTA 2ZRGA 4LX0A 4RESA 1I94B 5EWLB 2CZ1B 5BV2P 1NJ8A 3JRNA 4LW8A 3CCQT 3OZUA 3QYPA 1RABB 4K88A 5A7GA 4CODB 1Z0FA 4HPJB 2VO1A 3ABOB 1HQCA 2RONA 4FGWA 2VC8A 1FRZA 1RTKA 2MCNA 2QSZA 4NCHA 5K5EA 4Q3OA 2OPBA 3C6YA 4HJRA 4RZSA 1ZCJA 3UK0A 1N1MA 4PL6A 1R0KA 2RJCA 1E79A 1THTA 1U0HC 1E77A 1VPEA 2WKPA 2XYRA 4UU1A 5TMEA 2X14A 2D8HA 4TV9B 3CCQA 1CZKA 3IV7A 4GI3A 1WIWA 3L42A 4EHJA 5FYQA 5ECYA 1RZRA 5AW3A 2WAXA 5H9VA 5HS6A 3ZDZB 3OUTA 2XD9A 1RBQA 5KTRA 1R0BA 1AZGB 5GAOm 2EG5A 3I28A 3K9CA 4FVTA 1IN5A 2EVRA 2Y0BA 4RZ2A 1CUEA 3DBLB 3W79A 4HXEB 3QIIA 3HI4A 3HUFA 1CWUA 2ROLA 1W19A 3NT4A 5ALIA 1TM7E 1ZA1A 2QP3A 1KG1A 4KXFB 2F62A 4AK9A 1BN6A 4FDVA 5LYJA 1E8DA 3UN1A 2I3ZA 4QTYA 5AVOA 4G0VA 2VWQA 1QZ3A 3PC4A 4OSPA 1YH3A 4RVHA 5U1PA 2QTVA 5JAIA 5JMPA 5JO0A 2FQWA 2VA9A 1UEIA 1FUEA 4NOJA 4HDQB 3M33A 5CM2Z 2JIMA 3PENA 3OURA 2FETA 4HAIA 1D1SA 3D0OA 4L76A 2AG8A 2QGFA 3W7AA 3AETA 3IAS6 2UZAA 4OXQA 1T36A 3LQ2A 3QIAA 2ZJ7A 3IPYA 1NM5A 1JLKA 3ADPA 1OX4A 1PLJA 4ZQCB 4MWSA 4TVKA 3NONA 3RDVA 2ZYVX 1P45A 5KIAA 2EZUA 4AFNA 4ZT7A 4B4KA 1KK3A 3T9AA 3N7UA 4D0LB 3DYIA 2HKNA 3ETDA 3GX1A 3ZXXA 4KSBA 1CJBA 4NZNA 3VHLB 2EJWA 2HAEA 3MTQA 4RADA 5CKHA 4TXJA 1JG4A 1A1SA 1MP0A 2LXNA 1HDRA 1JIJA 1MEEA 1NQTA 3NB0A 4G5YA 5EE1A 4AG6A 5EIWA 4IVPA 2VA8A 2QXTA 2C5HA 4R81A 3PQ6A 5FOSA 5BOVA 3L8HA 3D8TA 3V8MA 4B87A 4EDFA 1GL5A 2FVYA 2Z09A 1JKMA 2PSFA 2A6PA 1HF3A 3OZDA 2QEXQ 2Z98A 3MJ4A 3T0GA 4MR9B 1JR4A 3WNCA 3CVJA 3S2FA 3L07A 1L7RA 4JLNA 5FR1A 2PPVA 4ZYUA 1XVIA 5F3RA 3K6SA 1IDN1 4L8LA 1Q57A 3ETJA 3QVTA 4GX5A 2AFVA 1NW8A 2CJWB 1G3WA 2PMKA 4ILKA 1Z36A 3OEEA 3W3AA 4NG4A 1OX6A 2G82A 4RK4A 4DY6A 4JBWA 3ZXYA 1YWPA 1PFQA 2CMHA 2WJHA 1SRMA 2D8JA 1D2CA 3I5AA 3HKSA 1FXUA 1M2NA 4RO0A 1ZVKA 4EP1A 4AJOA 1YF3A 1KYZA 3GG9A 2CZCA 4ISCA 2BFDB 4XW2A 1JIXA 1U28A 3SC2A 2MK5A 1JEJA 3A4VA 3NUZA 5JI3E 1TTTA 3FRIA 3PSHA 4MR9A 2A0FA 2E70A 4RDXA 3TMYA 2ZAGA 4TUYA 3VJKA 3IUSA 1SUWA 1EA5A 2VBGA 4DB4A 2BDEA 4YUXA 4FW2A 4ZTUB 3OYIA 3PG5A 3U4CA 4OQLA 1FTQA 1VQ9A 1VL1A 5ETJA 3HRHA 3W78A 4N54A 3QHSA 2YHTA 2OTJA 1QQ6A 1XVTA 3LU1A 4XQCA 1VQ4Q 2CLOB 3NOVA 4QUJA 5FBKA 1Y8RB 2XI4A 1BKSB 1RPJA 2VP9A 2YW9A 3AEKA 4KIFA 4BWFB 4RM2A 3GL9A 4IOMA 4E3ZA 7ADHA 5KDOA 1WUHS 1BHJA 2WIJA 1RHRA 1VQ9T 2ZRJA 1Z4KA 1YRAA 4HWRA 5LJ5e 1E9AA 4R1QA 3V48A 2AT1A 3BHIA 4F4UA 4LDRA 1B42A 3BK1A 3B3GA 4JVLA 3DGFC 5JV5A 5FWXA 4N3CA 5BV0A 1MT3A 1CBUA 2IIBA