4DEXA

Crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav2.2 i-ii linker.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
289
Chain Sequence
EDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit beta-2
publication title The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
total genus 95
structure length 289
sequence length 317
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4dexA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dexA02
3EPJA 3GJXC 2IW3A 3I5RA 1XX6A 3QBTA 1VG8A 1E9CA 5HTKA 2DILA 3SJCA 2K2MA 3LLUA 1A2BA 4IDOA 4MDFA 4Q4AB 721PA 4GFDA 3TVTA 2GK7A 2NTYC 3MLEA 4B48A 2GDJA 3GFOA 2ODBA 4JL6A 2DLPA 1XB2A 2J7KA 1KSWA 2IUUA 2QM8A 4HDCA 4CC4B 2CLSA 3ASYA 5FL7A 5FW9A 1T0HB 2D06A 1YR8A 2DBKA 4Q9KA 3TRFA 1SRLA 2BC9A 3ULRB 1NRJB 3EWSA 1W0KD 5KSPA 2GEUA 3V4FA 4JPBW 5KSOA 2BJVA 2BKEA 1QCFA 2L3PA 3Q5DA 3ZZTA 2P6RA 2DE0X 1AD5A 2R2AA 3SFZA 2JT4A 1UKYA 5HCNA 2ODEA 5JCPA 4B6FA 1ANKA 2WVJA 4Q18A 1G19A 5J5CA 1AKYA 2GNOA 2SEMA 5HCKA 2VEDA 4A0GA 4HDQB 5SZIA 2VBCA 3TUIC 2ZREA 3DOFA 4JJCA 1NLYA 3LQQA 1M8PA 4BZPA 5G40A 3TGPA 2LX7A 1Z2AA 3OIUA 2JW4A 3B78A 2J05A 1FOEB 2JLRA 1QWFA 1DAHA 1S0UA 4WIAA 1U2RA 4UNPA 1SVMA 3OIYA 1NIPA 1G5TA 1E0KA 4FCTA 2JS0A 4MKHA 2QAGB 5KYKA 1G3QA 5FOTA 1KZGB 1UADA 3AF4A 2ZANA 1GNPA 1Q44A 4QFMA 5AJVB 5EE5B 2ZVPX 3BB1A 2RAPA 2FFBA 1ZU4A 2GCNA 1G3IA 4A63B 4CC7A 1W5TA 1YNZA 2QQ0A 5FI1B 5GVSA 1QVAA 1M3BA 2AL7A 2WJIA 2ZE8A 3MFYA 1P2VA 4H9GA 3HJNA 4MUBA 4Q7MB 4RCZA 5AJXA 3SR0A 4CVNA 4XWOA 2CJWA 4F14A 4RD1A 2ZR9A 3TNFA 1NBMA 1QRAA 3C14C 4LC0A 4OBEA 2FSGA 1B07A 3B1VA 5FPYA 4DWJA 5FPKA 1X27A 1WXQA 2HLDA 2PZ1A 1NN0A 2JIZA 3IO5A 4GZLA 4HVWA 1Q20A 1TU3A 1KO8A 1N6NA 4Z88A 1HT1E 2ECKA 5B30A 2XOKD 3BH7A 2CMKA 3BH6A 5F9HA 2HXYA 2JM8A 4XJXA 4U7DA 3U3MA 4Z8XA 5DYIA 1GBRA 4XH9B 2ASEA 4J9IA 4HAZA 2IEYA 1HH4A 5EXSA 2D8JA 2V8OA 4JJBA 1KFZA 5K8IA 2IYSA 2O0JA 2GHIA 4BLOA 2ECZA 3REBB 2QG6A 2YHSA 4Q66C 2EWVA 4LV6A 4M1WA 4Z1MA 3S1AB 3RC8A 1YZKA 3P4YA 1OHHD 4TZ0A 1M27C 1JR3A 4GRAA 2RMKA 3ZS9A 2Z5FA 1HURA 1ZNWA 3FPAA 2FF7A 3IIJA 3LV8A 4P0TA 4LSGA 4XSHA 2F3RA 1A4RA 2O8BA 3QNUA 4Q21A 4AURA 4D81A 4NCIA 2EFEB 1PKTA 2W83A 3M0EA 2HCJB 2IWRA 1RLPC 1KOFA 3SBEA 2DYBA 4OMQA 4GOKA 4KFTA 4DLRA 1R7RA 5AUPB 4EPWA 1WBDA 1QHHB 1AWWA 4M9ZA 5FUWA 3CQTA 2CLCX 1OH8A 1T0HA 1NKSA 3FHCB 2XNDA 1JXMA 3I3SR 3W3AA 1ZUNB 1C4OA 4LHVA 1VCMA 3JZMA 3E1SA 3VKWA 1XXHE 1KNQA 3P26A 2FH5B 3G0HA 4DDTA 2ZUBA 2W2XA 2R6DA 4NU0A 1US8B 3MSXA 2V3CC 3D6TB 2F6RA 4B3CA 2J6OA 2H92A 2YINC 3AV0B 3LBIA 4LJ4A 3ZQJA 5J4HA 2AHOA 5KO2A 2HYDA 1YWOA 2CL6X 1K76A 2O8CB 2HEQA 2OI3A 1Z5ZA 1JQQA 3DVLA 3NDBB 1E2MA 4Y92A 1G7RA 2PCLA 4R2IA 3CR7A 4G0NA 5AJZA 3RRNA 3OIWA 4MRRA 2KYMA 5DO9A 2A5YB 3TUJC 5E3HA 4CZ2A 5EE9A 4C0AC 4C2UA 3GLFE 4Q03A 4TQUS 1GIAA 5P21A 4EQ6B 3AP2A 5KHOC 2OCPA 3ADCA 2HCBA 2DWOA 1D8TA 1UGVA 5CLLA 4E07A 1OT3A 1GFIA 4P4UA 4YLGA 1XCGB 1XEXB 1COWA 4DSOA 1Z6XA 1KJWA 1GRQA 4AG5A 1LV7A 5KPJA 1RIFA 2JJ8A 1T3LA 1M34E 1W4AA 4BFZA 3B9PA 3P27A 1GBQA 2YUPA 1NF3A 3CH4B 5CYOA 2VQSA 4A2WA 1BBZA 5IHNA 1XEWY 2M51A 3NPFA 1T4GA 4NP6A 2KYBA 1CJTC 3A1SA 3SJAA 2CEAA 1W44A 1I2DA 2JA1A 2V4ZA 2QQEA 1XEWX 3JVVA 1OPLA 1GTVA 1UDLA 3DZ8A 2B8TA 1VYTA 1OIWA 1XEFA 4XVRA 4A4DA 1ZC4A 4LYJA 4RZXA 1EFHA 2FFHA 2PT7A 2ZI4A 4K46A 3K09A 2GTPA 2YUQA 1RZ3A 4V02A 4IXMA 2ZITA 4QGFA 5HKKD 3WRXC 3S1AA 4H1VA 3UWOA 4IDQA 2CSIA 2WTUA 1Y63A 3R8CA 2PBRA 4PAOA 5KSZA 3B5JA 4CIDA 2V55B 1XJ0A 3LBNA 4KLZA 3TUZC 1FQKA 2FEMA 1CRQA 3OIVA 2CHVA 4U02A 3BB4A 2C9YA 1G64A 3C5CA 1OYWA 2QBYA 2J7IA 2WKQA 3REGA 2NO0A 2PH1A 1Z6YA 2BM0A 2RH5A 2QP3A 2V7QD 2P5SA 2N42A 1Q3HA 1OF1A 3FHOA 4RY2A 4AC9A 3ZVMA 1IXSB 1E6HA 2J0SA 1T3SA 3VS0A 1EFRD 1QHHA 2QI9C 4KU4A 2P0EA 1QG2A 3TSWA 4MGKR 3HU2A 4MGYR 3U60B 1R5NA 1F2TB 4FIDA 4J9EA 1EFNA 1US8A 5CDFA 5G3ZA 4IFBA 1D2EA 3QKSB 4NMMA 2EFCB 1XTQA 3IEUA 4JMPA 4LGMA 1QHXA 5KSYA 1SXJC 2KT8A 2EU8A 3CF0A 1ZVQA 1NIJA 3VKGA 5EXTA 5FWBA 1K6MA 4UJ5A 3EG3A 3KKMA 1KJYA 4FCVA 2P2LA 3AKDA 2FGJA 1RVDA 2QZ4A 4A15A 1WP9A 1E3MA 2RGXA 4TTRA 1J99A 2J45A 3CNLA 1SXJA 3O8BA 5KU1A 4BPBA 2QDLA 1QVRA 3CPHA 4QM6A 1UBFA 4OQLA 1ZM7A 3AF2A 4E09A 4J9HA 1NY5A 2YOFA 2ENMA 2ZE5A 1NVVR 3OAAD 5AR1A 3W5JA 1E94E 4J9FA 1SVKA 3LVRE 2JAQA 1AZSC 2WZQA 2OE2A 3B8HA 3ZLJA 5EUQB 1W1WA 4ZDJA 1ESMA 1VPLA 4P4SA 1GL9B 2R6AA 2G77B 1D5CA 2FRWA 4PZZA 4L8GA 3VHXA 2AWNA 2OCAA 3Q7PA 2CCKA 1M3CA 4P32A 2QT1A 1NVVQ 3EZ2A 1VKJA 3U2QA 4TLCA 1UUEA 1A82A 1TAGA 4BEBA 1YZQA 2C98A 2EVRA 3A1VA 2J41A 1U0JA 4TT3D 4WXPA 1II8A 1H8KA 1Z0IA 5DI9A 3UA6A 1OB2A 4BLQA 2ANBA 3T5DA 1W47A 2KE5A 4ESHA 4RFVA 1XF9A 1OXUA 4QGGA 3CRRA 1OJLA 2F7SA 3VR1A 4GDFA 5A0FA 3GLIB 2YUNA 4GT1A 2Q3FA 5D3MA 4HI0E 4NYJQ 4D4LA 2WWYA 2FO0A 3R8FA 3SQWA 4US0R 2O5VA 1ZUUA 3JZAA 1LS6A 5JRJA 3BFKA 4LJAA 2ZE7A 3PITA 3BB3A 4JLBA 5DYGA 2YC2C 3QSYA 5JWOA 1GKYA 2HXSA 3I92A 5CDFE 3I4LA 2RN8A 2R6CA 3FHTA 1NJFA 5JS8A 3EPHA 1NG1A 1GKUB 4XTCS 3PVSA 4RSGA 2WSSD 1FTSA 1G8PA 4L15A 4OHXA 3L0OA 1WYXA 5HR5A 2Z4RA 2CE7A 4WZBE 5KUTA 3ASZA 1TUIA 1R2QA 2FU5C 2ZJ2A 1GKIA 2MSCB 1M1YE 3FMIA 2ZI7A 3OHMA 4DLUA 4JLKA 2QM7A 4O0MA 4QNMA 1JXOA 2JLQA 4B2LA 3AKCA 1ZAKA 1DAFA 3UWKA 4I99A 1OXSC 1X69A 2KRNA 1P73A 1XPRA 1N5KA 1F2TA 2ZR7A 5FTJA 4D4JA 4PPGA 1NLFA 2RQVA 1KJZA 4LRWA 3TR0A 1AM4D 5DSZA 1AWOA 2CHGA 1OFIA 3MAAC 5EE1A 2L2PA 4V0OA 5DHFA 2GXSA 3LXRA 1UFQA 3X1WA 3K1JA 3RABA 1ZNZA 2GK6A 1T5IA 2FPEA 1DAIA 1W4BA 2IXFA 5E7IA 1LNZA 4X8LA 2V1XA 5AUOB 4YDHB 4MRVA 4ABYA 4MDEA 4HB0A 1WB9A 2G3YA 4PPFA 3C7KA 1CP2A 1KNXA 2QPOA 2EVWX 4KXFB 2W0SA 4OHVA 3AP1A 4IOKA 4FMCF 1OYYA 1WRBA 5EZ6B 1E0AA 4B33A 3RS4A 3KQHA 1KI8A 4M0LA 3IIMA 3NTUA 4LK2A 4QNRA 4TMVA 3RRMA 2FPDA 4AFZC 1UAAA 1IJFA 3DDCA 3QG5A 1BYUA 1E6CA 4TMKA 1TADA 3RSLA 2ORIA 5CK4A 3ECCA 2L3SA 3GLHB 4YMVA 2R9VA 2A7QA 1U99A 4FMDB 3PUXA 4QBGB 1Z0FA 4DLSA 2VLIA 3LDAA 3AVUA 2DL8A 2A9KA 1E9RA 2WM9B 4PHGA 3VAAA 4Q4JA 2AKYA 2RGBA 4MYTA 4AY2A 2RCNA 4RCYA 5L3QB 5FR2A 1UM8A 3AH8A 4NCKA 3W9YA 1ZIOA 5GJWC 1E1QD 2BHRA 1GFCA 1NEBA 3MWKA 3RS7A 2ZRPA 1YZUA 4TMTA 4DLVA 2ORVA 1YU9A 3QXJA 3RNJA 2A5FA 3NHNA 1GP2A 2CBZA 4LJ7A 1FW6A 1DBSA 4AI6A 4NCHA 2B6HA 1YR7A 4ZKDA 1AGPA 2BBOA 1PKSA 4IOJA 3C41J 4RTXA 3SU8A 5JRZA 1FFHA 3HR7A 3KJHA 1LVGA 3GLIA 2PEYA 1X86B 3OEEA 4KAXA 4C0BA 4TL6A 5TXGA 3W34A 4OI2A 2GZAA 3W5IA 4I1SA 3W6OA 1LTQA 1XTKA 2OLKA 4I4LA 5M04A 3GJ3A 4G5QA 2ROLA 3TSOA 4DRZA 4OL0A 4ZV4A 1SKQA 4GMDA 1KIMA 4OK5A 4B44A 1G9XA 2XZOA 5AJWA 1OH5A 2FOLA 3ZD6A 1AQUA 2GJAA 4DSTA 3CLVA 3UANA 2BEJA 3KJEA 5B58C 4PC7A 2ED1A 1BH2A 2IYYA 3B82A 4LUCA 3TW4A 2LP5A 3VS2A 3K70B 2HDAA 4M9QA 2JLWA 2AD5A 1WF3A 2HV8A 5JECA 3RVBA 3AVYA 2W10A 2C0IA 1E9DA 3CB4A 4CEIA 3C4JA 1XD2B 4JLOA 1AS2A 4TL7A 1DG1G 2X8AA 2ZJAA 1VDZA 3GEIA 3C0CA 4RTWA 2GJSA 5B57C 2UVQA 1RRFA 2F1JA 1JO8A 5EXXA 1PJRA 5IDVA 2OFOA 5E7JA 5FL3A 3T12A 1XZPA 3Q3JB 3E70C 2D7DA 2DFLA 3TW8B 2WWIA 1W36B 1ZLMA 1N5LA 1AWJA 1HYQA 4OK3A 1UBGA 1WI7A 1CKEA 4ZI2A 4OMOA 5FI0B 2EYUA 2OM2A 4GLMA 4KJZA 2A37A 4DCNA 4A9AA 3X1XA 4RUGA 2IT1A 3QBVA 3LXXA 3LD9A 4Q1BA 4L4UA 4RKFA 2ONJA 2VTKA 3VR3A 1EFTA 2QP4A 4EAQA 2ZE6A 4PAMA 3QI2A 3AVVA 3K0CC 4PO9A 3H84A 4KRTA 3EAQA 5TARA 3EZ9A 1H8HD 1A2KC 1GAJA 1YZNA 2QTHA 4TL9A 4EKDA 1E99A 2H8HA 3KJIA 1R5BA 3T1OA 5LB2A 1SVWA 4E6RA 3DMDA 3K0CA 2UZIR 1CR1A 3X1YA 2HSPA 4F93B 2K6DA 3IHWA 3GLIE 1RI9A 1GOTA 2EFGA 4F4JA 4N1AA 1P9WA 4MRNA 2VHQA 5HE8A 1CXZA 3GLHA 2JLZA 2PZFA 4DEYA 1U9IC 4RZ2A 4XIGS 2AD1A 1I0CA 3W8RA 2LKCA 1UKEA 4A36A 5EJEA 3AUYA 3LVQE 3TMKA 2BTTA 2XB2A 1N6LA 1CR0A 2C9OA 2R44A 5EP2A 1NKTA 1HA3A 4AKEA 3V4RA 1QHGA 5AUNB 1WCV1 2PTKA 1U9IA 2A08A 5FBQB 2DBYA 2Z0MA 3H1TA 4HB2A 5C4MA 3THYA 2J5XA 4NYIQ 5L3QA 2JJ1D 3FDIA 3N5CA 3ZS8A 4DJTA 4M22A 3IBGA 2HUPA 2VPPA 2GGRA 1CIPA 1ZCBA 2A78A 2BMJA 4IVQA 3TE6A 2ZS8A 3ZDQA 4Q7LA 2WWFA 4C9BA 3IDQA 4J9GA 4XVUA 2QA5A 1II9A 3AEZA 3IIKA 1NLZA 3OFND 3IO3A 3LH5A 3PVLA 4Q1AA 1X43A 3F8TA 1JJVA 1P61B 1RRGA 5JWRA 2NO6A 1ETUA 1TX4B 2PMKA 3H0KA 4B6EA 3NH9A 2AKAB 3FB4A 4LE9A 2LJ1A 4B75A 3DM5A 1BO6A 1TG0A 1KI7A 1ZINA 2YSQA 2RGDA 2A36A 1JQJC 3AF0A 2YNMA 1GL5A 4Q47A 4IOLA 4BRWA 3KJGA 1F60A 3ADKA 4CC3A 521PA 1A0NB 2ZETA 2W6JA 4J9CA 2WKRA 2VP5A 5EUMA 4TTPA 3RNLA 4G3XA 2Q6TA 1I4TD 2EYWA 1KAGA 3GQBA 2NUZA 4Z51A 1E4YA 1ZP6A 2ONKA 2VVKA 4PHFA 4AFUC 2DCUA 2BKUA 4LBYA 1U90A 2IUSA 2YYZA 3IUYA 1MO6A 2VA8A 4OHYA 4BLTA 4M9XA 3JV3A 1I07A 4NDZA 1RYHA 3ZH9B 1M3AA 4FINA 1G291 2C03A 3BERA 2WHXA 1E2DA 2GXAA 2KNBB 2E87A 2WIBA 1KI6A 2WJJA 2JLXA 1DAGA 3MWYW 3OEHD 3EHRA 1ZU5A 4B3DA 4LYFA 1XBTA 2TMKA 2VP4A 3GLHE 2K79A 3I32A 3KKQA 2IEZA 2JEOA 4ZDKA 1G2BA 2IYVA 4QBHA 4RKEA 5EXPA 2AXPA 4Q7JB 2IF0A 1W2GA 1P2SA 3B6EA 5FFMA 2FPKA 5BQ5A 2W6ID 3IILA 4BFYA 4YONB 2EWWA 1D6JA 2ZRIA 4F16A 3GEHA 1FL9A 1I2MA 1N5ZA 2DFNA 2GXUA 2MMCA 3A1TA 3KB1A 4TYWA 3HWSA 1W1FA 2GNCA 1XTRA 2ZJZA 4R98A 5I11A 2HYIC 5FOXA 3KKNA 1KDPA 3T34A 2A30A 4WW0A 2IUTA 4Y0AA 3VX3A 4C3ZA 4TYNA 2I3BA 4ZCLA 2IS6A 3LW7A 4DUGD 2RGGA 3BE4A 4ORZA 5F3WB 4TSFA 2CCJA 1R8SA 2J7PA 1XMJA 1E2KA 2EGCA 1LCKA 2NO7A 4BFWA 3NMZC 1ZM2A 4QJ4A 1Z6TA 3ICEA 2D2FA 4PQRA 4DEXA 4JT2A 2JMCA 5C46F 2ATVA 3I8SA 4QJ3A 4CDGA 3T1TA 2JTEA 1BK2A 2P5TB 2Q0HA 2QROA 3K53A 4C4PA 2DB3A 4DB2A 1CJVC 2GAOA 1RRPA 4JZ3A 2WMOB 5F98A 2RHMA 3UATA 3UG6A 5FBVB 2ZRKA 2KRSA 2B7BA 1R0XA 4OI4A 5K8LA 1XP8A 2KBTA 3VKHA 4ESRA 1JBKA 1OE0A 2GWHA 3QKRA 4UXIA 5C18A 3GPLA 3ZL7C 1XD9A 2NZJA 2O8BB 3TVDA 2ZRNA 4A0HA 1CR4A 3AVPA 1GRNA 3M0SA 1OKKD 3RDPA 4NE2A 4KFSA 3VNVA 2GVZC 2H7VA 5K8UA 1PVOA 2REXB 1MOZA 2GZDA 2QGZA 3VS7A 2QPAA 3VTKA 2PZGA 2QE7D 3AVQA 4TLEA 1AOJA 1H8EA 2DYKA 4TLDA 2V1UA 3PVQA 4IDPA 3UKDA 2PL3A 2GJ9A 5EE3A 2VL7A 1U3OA 4DT1B 1N6RA 1GRIA 4JSTA 3H86A 4A0FA 3B9QA 4LHWA 1W0JD 1WBBA 1S9HA 3CUEF 3A8TA 4URZR 3ZVRA 4DIEA 1YZLA 1KI9A 5JJKA 3DL0A 2L3QA 1Q12A 3MJRA 5E95A 1EG7A 1G17A 1YRAA 2PX3A 2J06A 2OG2A 2QENA 3M4YA 2LJ3A 1GL7A 1P7CA 2OUKA 4DDUA 4GBQA 2JCSA 2XJ4A 3GJ0A 5C2JB 4R7ZA 1E6GA 4QHSA 2GRJA 1TF7A 1L8QA 4Y0VA 2NIPA 3K0EA 2XB4A 4HLUC 4R2HA 2GF0A 4IXNA 4U5XA 4BE7B 3SEAA 4BLSA 2BMFA 4PQYA 4WA7A 4A0RA 1G41A 4DVGA 2KB0A 3U3OA 1BS1A 3TH5A 4YQFA 1F3OA 4HLUA 1D2MA 2OEPA 4OKSA 2XSZA 1DARA 3QXXA 3BAFA 3BORA 4DHEA 4JZKA 2YT6A 4DLYA 2EYYA 3O8RA 1P6XA 1GFDA 4LDJA 1Z0KA 1QHSA 3L0PA 4AG1C 1ESNA 2JDID 1IXRC 2PT5A 2ZRLA 1O87A 1AIPA 3KB2A 2HF8A 1EGAA 1Q1EA 1XCPA 4PO1A 4C0JA 3OE7D 1KMHB 3GEEA 3QUSA 4QHYA 5H68A 3K9NA 1G3RA 4QGHA 4WVFA 4C0LA 1V1CA 3KXIA 1B3QA 3ZVLA 4CGZA 1RC8A 1MT0A 1SVLA 3C5HA 3B1XA 4H1UA 1BYIA 2WJYA 4RFSB 4GOXA 5FOSA 5IHPA 1HT2E 1C1YA 1Q3TA 4MH0R 1XMIA 4BRUA 4EPRA 1Y57A 3ZZ0A 4HUQB 4S2EA 4CEJB 3EIHA 1IOZA 1WQ1R 3KL4A 4IIOA 1OXTA 1FP7A 2R8RA 2RGNC 2NPFA 5KDOA 5IK2A 4D4MA 1E2PA 3DPUA 4KHZA 1EX6A 2AKLA 3FFBA 1E4VA 1SVSA 4MGIR 2EQIA 2VWFA 1DE0A 2JJ2D 3R9XA 4ASUA 4B34A 1QHIA 3PUVA 1AKEA 2RGNA 1T91A 2ZS9A 3F0TA 4TMXA 2FN4A 2HBWA 2QORA 3MRSA 2ZJ5A 4A82A 4HZIA 2QBYB 4NBSA 1PZNA 1SKYB 1HQYE 2CDNA 2PNIA 1ZUHA 1G4AE 1ZW6A 1WFWA 2JM9A 2LJ0A 3NWJA 1QF9A 1E1RA 2WPDA 2ZRMA 3CM0A 4UXJA 1ZMXA 2H8KA 2CK3D 2V6JA 1TQ2A 4J0QA 1NVXQ 2KXDA 1E79A 3CKLA 4DT1A 2FRYA 2ANCA 2W00A 2VSXA 4XD7D 4FSSA 3TQCA 3B85A 3SOPA 3ZGXA 2IXGA 2CNWD 5FUXA 4AG2C 1Z47A 2F1IA 4OJQA 3WBJA 3K8YA 2RQWA 3N70A 3CBQA 3A36A 5AUQA 1HQCA 3HYTA 2BOVA 3CWQA 3EC1A 1RJ9A 3VS4A 2GJ8A 3EZFA 1NBME 4LBZA 5CM9C 3GP8A 3RLFA 1X8LA 4S35A 2NWMA 4WZ6A 4II7A 1X8JA 1CBUA 1VCNA 1NEGA 1QLYA 2O88A 5IHKA 1SXJB 3K9GA 2AN9A 2NQ2C 1E2GA 2CUBA 2ZIAA 5EP3A 5IT5A 4OI0A 1K8RA 1XD8A 4F4IA 1L4UA 1YJ5A 1M7BA 2WMNB 3LX5A 2F55A 4LN2A 1P75A 2CVFA 3FFAA 3WMEA 1DVRA 3GLGB 2A28A 4P4SB 2C9CA 5KNCA 4CEHA 3N2EA 3NEJA 1IN5A 4RD0A 4MYCA 1JR6A 4M1SA 3I61A 1QKWA 1CR2A 2CHQA 1G3UA 1JR3E 2GKSA 1T5LA 5IH2A 2PX0A 4C2TA 4DC9A 3ZVNA 2DL3A 2ODWA 5JSZB 1CJKC 1TQDA 1R0WA 2E1RA 1IBRA 4JLPA 3FGNA 1ZNYA 2DFKB 1KMHA 1XFAA 3SS8A 3UA7A 5EQTA 3A37A 4M1TA 3U44A 1SPKA 1II8B 2V6IA 1X1RA 3K0AB 3VU9B 4B2PA 3OF5A 3PQCA 1TF2A 5FOVA 5J4VA 2C77A 5J4YA 3QIAA 3SHWA 5UKDA 3N2IA 4RFSA 4PXAA 3THKA 1MV3A 4MKIA 2C99A 1R5OA 5D3MB 5KDLA 3TAHA 2VH5R 2FSFA 1UHFA 4IRUB 3FJ5A 5HPYB 2BZYA 4LUDA 3CW2A 3QJYA 1UECA 3QVVA 1YE8A 2RGAA 4HUQA 5FUYA 4CF7A 4CEJA 2V54A 2G1JA 2ZAMA 4C30A 4EJSB 2IXEA 1R0YA 5A4JA 3KFXA 1KAOA 1W0KA 1KHTA 3R6NA 3O8DA 1IHUA 3I35A 1Q0UA 3AF1A 3BBPA 5DNYB 2GCOB 3QG1A 1P2TA 1BMFD 3RS0A 1M8MA 4ACBA 4R71A 1G83A 1LW7A 4URWR 1Q1ZA 4I1OA 2WJVA 2YWHA 3QXCA 4Q01A 3CNOA 3V9PA 2K7AA 2QEQA 1E2FA 3VX4A 2REOA 3KX2A 2YOGA 1NLOC 1E9AA 1Q1QA 3KQLA 3QF7A 2V1RA 2OV2A 5FPTA 4BFXA 1FPMA 1Z3IX 2OCYC 3QPUA 4LHXA 4ZI3A 1OEBA 5IHIA 1ODFA 1UBEA 5FBLB 2OBNA 5IXFA 2WKPA 4I1UA 5SZKB 1F2UA 1VG9B 4ZKEA 2IIMA 2QY9A 221PA 1I1JA 2ERYA 4HAWA 2XMFA 2ZROA 3BC1A 2HT6A 1M74A 3F5FA 3PR1A 2M0YA 1U06A 4HCKA 1KI3A 4KV9A 3O5ZA 1T3HA 1HEIA 2FPFA 1VYVA 4RTYA 3MD0A 1QG4A 2AXNA 2FWRA 2OLJA 4ZPXA 5KTYA 2CH4W 1H65A 3PJRA 1OFHA 5J4KA 4J9DA 4DLTA 2MSDB 2GXQA 4A8JC 2QN6A 4Z8YA 2QU8A 4EIWA 1N5JA 3I5XA 3SZRA 1YZTA 4IJMA 4A92A 1UJ2A 4C0HA 2WSMA 1KK3A 4D8KA 4F4CA 4OQMA 1G4UR 4I1VA 1N6HA 2H5EA 3HYRA 4A8JA 1CEEA 2XOKA 1ONBA 2A5JA 2X2EA 4FMDF 1HJDA 2YZ2A 4FMBB 2K3BA 1E2QA 2EFDB 5B64A 3GLGA 4DKXA 1NMZA 1S4QA 3Q72A 2G9NA 1VTKA 1ZD1A 3NDPA 2DL5A 3NHAA 5HE9A 2VHJA 4LY6A 1SVIA 3DOEA 3K9HA 3VR6A 1E2EA 2XZPA 3CPJB 3L0SA 4NYJR 4Q4JB 1KSFX 1OHHA 3DHWC 3WHKA 4EFNA 5JSZA 4AKHA 1IM2A 4D6PA 1PRLC 4JKYA 1EFUA 4QRHA 4V0LA 1N0WA 3NIBA 4LOAA 1FZQA 2ZI3A 4DIDA 5L3SB 3K0AA 3SEMA 3VU9A 4O3MA 1SKYE 1IN8A 1P9RA 2F2XA 3H41A 5EC7A 3EA0A 1NSTA 5GJWB 2IA5A 3KXKA 4Z8AA 5TVKA 4OMLA 4EJSC 5KDDA 4JLMA 4P4TA 3KDSE 4E22A 3RS3A 4Q1CA 4BFVA 4DCSA 3C15C 1IQPA 4HAUA 1KDTA 1MO3A 2ZU0C 3FYHA 3LBHA 1G20E 1MKYA 2FG0A 4ZIRA 2VHCA 1E69A 4JL8A 4EJSA 3QQ5A 2QPTA 3ADBA 4O2LA 2EYZA 2QMEA 4QOSA 4V0NA 3UXMA 5CIWA 4PANA 4QJ5A 2WBLC 4FW9A 1EX7A 3NVAA 4RZ3A 1AVZC 2I4IA 2KE9A 3QPWA 3PEVA 4B32A 3U23A 4DCVA 4YMTA 2GCOA 2I1VB 1J70A 4UNNA 4B3BA 2GF9A 2NZ8A 5E4FA 4D0NA 2RNAA 2IYZA 4IW3B 3TQFA 3EPKA 2P67A 1AWXA 3CIOA 2F2WA 2O8EA 4YXWD 3IPYA 3THWA 3WRYC 2YVUA 3MUFA 4V0KA 4KFRA 3VRZA 5JEEA 4DDWA 1KZ7B 2C2HA 1SXJE 1QDEA 4D4KA 4CEIB 1YCSB 4XOIA 2V9PA 2FX3A 4KBGA 2BZ8A 3U3RA 3ZZUA 2EBPA 2RQUA 1S3GA 2H57A 3AKEA 1ZUIA 2F1RA 2D7CA 2P6UA 2AK5A 2O52A 2GBLC 4K81B 1CKBA 5IRCD 3GLGE 4GZMA 3UMFA 4FN5A 3BK7A 1UTIA 1E7OA 1Z06A 1E2IA 5L3VA 5CITA 5FTLA 1MRSA 2ZRGA 4G5OA 5CJ2A 3TAUA 4JYBA 4ZO4A 1FMLA 2O2OA 2BWJA 2GBLA 5JI3E 1SRMA 2WWGA 3GFPA 2E9SA 4M1OA 2WJGA 2VRWA 1SHGA 4MITA 4CT5A 1OH6A 4OI1A 2FG5A 3E2IA 1DTSA 2CH4A 1UF9A 4Q9JA 3EASA 2GAAA 1XPOA 5FTMA 3REFA 2DMOA 3A1UA 3HDTA 3EG2A 1YR9A 3CH5A 4MA4A 3VQTA 2Z6VA 1VHTA 2A3RA 1II0A 3H0FA 3Q85A 2CE2X 3SJBA 2QRNA 4Q02A 1EWRA 2C95A 4RZUA 1BIFA 1TUCA 1NL3A 1K5GA 4MUAA 2BVNA 2IYTA 3PEYA 1G7TA 4MGZR 4KI0A 5HKKA 2RQRA 4LI0A 1A7JA 3AGQA 2P65A 4AYWA 3A4MA 3VS3A 3DKVA 3THYB 2FFQA 5FWCA 2O9VA 4CRWB 1Z28A 2NPIA 5DN6D 1W36D 2EPDA 2EQBA 5L3SA 5CB8A 1HE8B 4D82A 1B0UA 2NOAA 4L9WA 2C0OA 1J2JA 5J40A 3PUYA 4IFEA 1PLKA 4JLJA 1TF5A 2W2TA 4FWIB 2O9SA 4BUJA 5L23A 1GM5A 2V7QA 2AX4A 4M9SA 3M0UA 4IKEA 4LYHA 4NCJA 3ZIAD 1S2MA 2G1KA 1IY0A 1VIAA 2MCNA 4CC2A 4PAQA 1EFRA 2QSZA 3RWOA 3BGWA 2G0NA 5KNBA 1P4SA 4K8OA 1MO4A 2IYLD 3PENA 4WBSA 1OH7A 3UMSA 1W4RA 4POAA 2ZRHA 3GBQA 4B47A 1KK1A 5J47A 1NM7A 4HAXA 1G21E 1CF4A 1E2NA 4DCTA 1JAIA 4F17A 4Q1DA 5SZJA 1UE9A 1TNDA 4A2PA 1NN5A 2I0NA 3M0TA 1AS0A 1FTNA 4OMNA 1NI3A 2JASA 1WE2A 1T0JA 2Q9BA 2VF8A 2J59A 2X2FA 3LY5A 5TDHA 3SC3A 3FKSD 3FTQA 2H16A 4UQOA 2C96A 4PSAA 4MKGA 3K0FB 5H8WA 1NYFA 2B86A 2OXCA 1AEYA 2YOHA 5GJVC 3EC2A 2DJQA 1YZGA 1KI6B 2WWHA 4A6PA 4JJKA 3H2YA 3CRVA 4M4SA 1CRPA 3PUZA 3CF2A 5GADl 3BOSA 1OXVA 3I5SA 4TYPA 3OAAA 1ZJ6A 4EFLA 1E9SA 1HD3A 1G5RA 4HB3A 2RPNA 2BCGY 2OZEA 3I73A 1OW3B 5FH9A 4MQBA 4DDVA 2BDTA 1H3HA 4URXR 1GILA 2J0UA 5DI3A 2WOOA 2WICA 1SGWA 3EG0A 1N3BA 4PHHA 2OJ2A 3HR8A 4PTLA 2YKGA 2ERXA 2ZRJA 3LO5A 1IY1A 1RLQC 1E9EA 1MUZA 4GP7A 3CX6A 3X1DA 4C0QC 4LJ6A 1M7HA 5FL7D 3U5ZB 3L0IB 1TUDA 1DOAA 2DFTA 1HSQA 3PG5A 4TT3A 4GOJA 1P3JA 5LDDC 3NBYC 4NYIR 3SNHA 1QHNA 3J81k 3F3YA 1XJQA 1NG2A 1AA9A 2EYQA 5L8VA 3QKUA 2IX3A 2KRMA 4TQ9A 2SRCA 4DLZA 3VMFA 2DA9A 1WX6A 4US2R 2HT1A 1V5WA 4BEJA 4QL3A 2KJQA 2FPLA 4U00A 4E5UA 4EPYA 3L82B 1P60A 1SVOA 1XDBA 2X3XD 2IYQA 4LWZA 4A6XA 1VECA 4PZLA 1WXTA 1E0JA 3QOFA 3QWYA 2PLFA 2XZLA 2WSSA 3AGPA 4KYIB 4US1R 3QKRB 2XAUA 2ZYTX 4Q00A 2JLUA 1LFDB 3M0QA 2KBFA 1F5NA 1NSFA 1W49A 4JVMA 4HLCA 3SBDA 3SI7A 1NJGA 4GPTA 1YP5A 5FBWB 2IYRA 3ZQ6A 1K9AA 3REAB 1DPFA 1Q1BA 1U0HC 2PZEA 2ZRFA 1G3MA 2DWQA 3M6AA 3NBXX 4EPTA 4C0KA 1PWTA 4WZAE 2J6FA 4QBFA 1SHKA 1TEXA 2O31A 4TTQA 4KYUA 4RJLA 1NBMD 5JWHA 1E0SA 5C4GB 3CX8A 3EX7C 3A6PC 5TV2A 3VNUA 1X6VA 5FPSA 4JYCA 3AF3A 3E5HA 2HLDD 1JEGA 2JIZD 1WDTA 2WV9A 3A4LA 3GCGA 5JZVA 2PJZA 1G1MA 2O8DA 3WP0A 1PNJA 4JJDA 4AK9A 3O8CA 6Q21A 1B23P 4BQSA 4DB4A 2PJRA 4TQAA 3WBKA 3RHFA 1K0XA 2YWEA 3H0HA 1G6OA 3P32A 3SDZA 2OXRA 3C8UA 2H1LA 3K0FA 4JBXA 4DLXA 4Q48A 5JJIA 4Z1MD 1GNQA 1KMQA 2HEIA 4Q9HA 2CSQA 4MYHA 2J0VA 4L16A 3I62A 4I81A 1NN3A 4AYXA 2ZUCA 3CO5A 1JR3D 1E2JA 3RWMB 2HF9A 121PA 2VIIA 1OLOA 4LHYA 4W5HA 1NMYA 4F7WA 2IS4A 3HPQA 4ZCMA 2RMOA 3ND8A 3KFVA 2YWFA 4B76A 4UJ3A 1S3SA 4NPHA 1BOFA 4TWZA 1SULA 4GSYA 3T06B 4OQFA 4BLRA 3R7WB 2ZSBA 1NY6A 3A1WA 2FA9A 2ZTSA 2DHRA 2OESA 3M1IA 3U7EB 5J4LA 1E1QA 1VHLA 3WYAA 3THXA 2GESA 5A5GA 2XNDD 3CZQA 5FTNA 1U5SA 2KI5A 1W48A 3U3KA 1TPZA 1ZD9A 2ZU6A 1T8TA 3LNCA 1UHCA 1E2LA 3TR5A 3KTAA 2P3SA 5CB6A 1UEIA 1V43A 2EKHA 1JJ7A 4JLAA 2KBEA 1IO6A 2IF2A 3BFVA 5CJPA 3NH6A 2JXBA 1DO0A 3RSOA 4TLBA 1SHZA 3H0IA 2NG1A 4M1MA 1KSJA 4HB4A 3OESA 1ZM9A 2N1BA 2DRKA 5DLQC 1PV4A 2LWIA 1E9BA 1YWPA 4Q4LA 4KLNA 2GCPA 5K8TA 3IEVA 2ESWA 3LLMA 1LF0A 4RTTA 4O2RA 4AD8A 1GVNB 3NC0C 4IDHA 1G18A 4EPXA 3CR8A 4UXHA 1T6NA 3NGPA 1QWEA 2XITA 2EGAA 2GZHA 3K0SA 1KGDA 2ZYVX 3D7MA 4GMXA 4X8MA 5KOYA 1COWD 2DVJA 2KWIA 2A5DA 4HATA 3I72A 1U8AA 1Q21A 3Q8XB 3SYKA 1OSNA 1ZM3A 1F48A 4EDHA 1WDXA 3WNDA 3P1JA 3EGUA 4KSBA 4RD6A 4FD2A 2EW3A 4BASA 2ZUDA 2XTZA 1TTTA 4B2IA 2L0XA 1WXUA 4LNPA 4D2IA 3UK6A 4M53A 2UZ3A 3B1ZA 5EP4A 3UPUA 2FNAA 3SYNA 3T1VA 2CL7X 2YUOA 4LBWA 1X1SA 4L9SA 4LC1A 2FSIA 1N6KA 2IK8A 5ANRB 2FSHA 4PFSA 2Z83A 3CRMA 4HZUB 1RJ9B 2IBMA 3VR4A 4JS0A 1ARKA 1DADA 3UIEA 1ZCAA 1H8HA 1U8YA 1WXBA 1KO4A 1XTSA 4PR0A 3CX7A 4JBWA 3VFDA 1VCOA 2XXAB 1ZD8A 4GNKA 1PLLA 4D8DA 4GBMA 1VIYA 2UKDA 2BV3A 2JMAA 2RGEA 2XJ9A 1NNEA 2LQWA 1XZQA 3KKPA 1ZC3A 2XTNA 4N0DA 1TQ4A 1CS4C 1HY3A 3RS2A 3MCAA 4F91B 5B2ZA 4C0SA 1X3SA 2RB4A 4CEHB 2JLYA 1E96A 4M21A 3R7WA 1ZIPA 1NVWQ 3SFVA 2JJ1A 1NYGA 2B8WA 4QKQA 1SZPA 5EP1A 1KO7A 2AZSA 1S1CA 4A2QA 1N25A 3U44B 1NMXA 5DIFA 4RTZA 1JQLB 1P62B 3JVUA 5LBIA 3IQXA 1XXHA 2QMHA 3OFNA 2G0TA 2FMXA 1RW4A 1KKLA 2ZQ5A 3MWLA 3VR2A 4JL5A 2AR7A 3QE0A 4TYYA 1EXMA 2RF0A 3RS5A 4NYMR 2ZJ8A 4IVPA 1QZXA 1IONA 1N6IA 1FMJA 3ONWA 2YJTD 3EIEA 3T5GA 3WHLA 3BJIC 2VO1A 3FMFA 2GETA 4D0LB 4Q4HA 5F9FA 1BU1A 1QHYA 1OIXA 2DY1A 4ILEA 5FBRB 2GBQA 3CRW1 1SXJD 2RHDA 3BS4A 1NN1A 4PQFA 3WP1B 3NC1C 3GLFA 2CVHA 5BXQC 3SYLA 1Z9QA 2Z43A 4ACAA 1IY2A 4P31A 3HPRA 3M0RA 2D8HA 4NONA 4NYMQ 2KGTA 1YVDA 2GQIA 4G5SA 1KDRA 3WMGA 4HSEA 1FX0B 4CW7A 2VKNA 3P4XA 1T9HA 4XVQA 2C0TA 1XU4A 2J9RA 3U3JA 4DCUA 4Q9IA 5BYKA 3Q5EA 2QMOA 1MRNA 3U6BA 2OILA 3OEHA 1J3TA 3GJ7A 3R9IA 5BN3A 2IYXA 4XTRA 1DELA 1PUJA 4OQXA 1DAMA 5FR1A 4B35A 1F2UB 1G6HA 2Q3HA 4ZDWA 5JS7A 2VSFA 1M30A 4QT7A 3IQWA 3QKTA 2PLRA 1F6BA 4BFSA 1R10A 4ARZB 1U98A 2W6IA 4HYYA 1UKVY 1TUEA 3K9LA 5HCIA 1GUAA 1P2UA 3W6PA 1G8FA 5IXBA 1ZUKA 1GL6A 3NBZC 1IN7A 4Q4AA 2WWWA 4LV5B 5CLQA 3EW9A 2A2ZA 2F43B 1Z2CA 2DX1A 4HZUA 2AK2A 2ZR0A 3NBFA 2GJKA 4DXAA 1Z0AA 5G41A 1TMKA 3BD9A 1TEVA 4TMWA 4EIKA 2G6FX 2XXAA 4DUGA 1NLPC 3NG1A 2FFAA 1NG9A 4OK6A 1AZEA 3L2OB 4A8JB 1G8YA 3MJHA 2WJHA 1CJMA 2CL0X 4M8NE 4PSVA 2D62A 2KSQA 2HJGA 4NTZA 4BGDA 1S1MA 1ZBJA 3IHLA 3TBKA 5BN4A 3W90A 5JMTA 3NKVA 4JIMA 3SJZA 3Q9LA 1WA7A 1LB1B 4IIMA 3DZDA 3IQLA 2AZVA 2ZJOA 1JB1A 2VP9A 2DR3A 3PV0A 4X8HA 5JEDA 2L0AA 5H1YA 2QAGC 1AK2A 1Z22A 1ZBDA 4FXPA 4N3NA 1ZX6A 2J6KA 3HU3A 3RANA 4RVCA 1XCMA 2RQTA 4YDSA 1XNJA 1OIVA 1UEJA 4ESVA 2OAWA 4AWXA 5CYPA 2QAGA 4TN1A 1JNYA 1SSHA 4D0GA 5KNDA 1HUQA 4NL4H 1OPXA 3AVXA 4C7OB 4AKIA 2LCSA 4IOMA 1J8YF 3ND9A 4JVLA 2MIOA 1IN4A 1OKKA 2R62A 3DEFA 1R0ZA 3PCRB 4LCBA 2DRMA 1ELOA 3KKOA 2J46A 2QE7A 2RKOA 3LAWA 4ZIRB 3GJ8A 4EPVA 4JZ4A 3LQRA 1W5SA 2BBSA 1NP6A 3Q7QA 3UG7A 2D3WA 4Q9LA 5JJLA 4HUTA 2EGEA 4GP6A 1P9NA 4QHTA 1AQYA 4B73A 3K09C 4J9BA 3DM9B 2D1XA 2DL4A 1W0JA 3O47A 1EESA 2QSYA 2GVDC 4M1KA 1AN0A 4ZCIA 1VMAA 3AM1A 3B7GA 2OBMA 2IS2A 3LA6A 4HXJA 2EW1A 1G8GA 2O8EB 3THWB 1XTJA 1FX0A 2FDCA 4QBIA 4HVUA 1L7VC 1CKAA 4Z89A 4B3FX 821PA 1VA7A 3FKQA 5HZHA 4QM7A 2N46A 1X8KA 1DS6A 2ZYWX 4OQNA 4QG7A 3FWYA 1KYIA 5AJYA 5DH9A 1RFLA 1E32A 3A4NA 3CNNA 3ETLA 1AJEA 2ZSEA 4HLDA 1IXZA 3RAPR 3ICQB 2J1LA 1CU1A 2ATXA 2CCGA 5DGXA 2ZRCA 4ARZA 1Z63A 1KIKA 1FMKA 4JKIA 4AFQC 2BIFA 1J7KA 4BLPA 1ZNXA 2F1HA 4BWYA 1AZGB 4MRSA 4DZZA 1X6BA 1G7CA 2A5GA 1TU4A 4F38A 3DO6A 3OEED 2F43A 1KI1A 3EG5A 4QXAA 3AVWA 2W0ZA 2ZI6A 2IYUA 2QRZA 3WXMA 1N5IA 1H92A 1GCPA 2F9MA 5CM8B 2JDIA 4D26A 1ZSGA 3HP1A 5GJCA 4B71A 3OE7A 3VS6A 4CYMA 3GJ5A 1FP6A 2WAXA 2DNUA 3D3QA 1ZM4A 4URYR 2NO1A 3G5UA 1MV0B 1KO1A 2R6GA 3LRPA 3QEJA 2VHTA 4JLDA 2R65A 1N2CE 2BMEA 1BKDR 2F3TA 3MG9A 4JJZA 2G83A 1J90A 2O8CA 2LMJA 3WMFA 4BECA 3PEWA 1Y0MA 5TMPA 2ABLA 1FYNA 3TLXA 3KZ1E 3EIQA 4RTVA 4PC6A 2K5UA 5LPNA 1PUIA 5I22A 1UJYA 1UDWA 1Y3AA 1XPUA 2DWPA 1KDOA 4TLAA 4WXRA 2BJWA 1U94A 3T15A 1U81A 1UG1A 1Z08A 3EHQA 4EQ6A 3DKPA 2JGNA 3WYGA 1GWNA 2JJ2A 4MRPA 4C7OA 4PHTA 1DEKA 2OO7A 3EXAA 1OXXK 3VRYA 1UJ0A 1J8MF 4KITB 1KK0A 4YMSA 3M0PA 5F2EA 1XEXA 2ZSAA 3CRQA 3RRYA 1GDDA 5BN5A 2IHYA 4LZZA 1W2HA 2VSOA 4DSUA 2YDLA 2MSEB 3SN6A 2AKKA 1EK0A 2MMGA 2ODNA 3SE0A 2OAP1 3I9QA 3L43A 4ON9A 1R4AA 1IJEA 3P20A 4XSGA 1GITA 2ZS7A 2OFWA 1Z6AA 1UKZA 2DF6A 2IC5A 2LNHB 2CK3A 1P5ZB 2AFIE 1FUKA 2WIAA 3NHBA 4R9UC 3DMNA 4B3GA 1VCIA 2C8VA 2GEVA 2W2VA 4XD7A 4JLVA 4XWKA 4V03A 1N0VC 3WYFA 2C78A 2RGCA 1UDXA 2CNWA 1Z0JA 2KEAA 2XGJA 3U4QB 1UFFA 2OFXA 3PXGA 2ORWA 1M7GA 1DO2A 2D74A 5G3YA 3AVOA 1T0JB 1GZSA 4LX0A 4WOPA 4LV8B 3B13B 1XTIA 2Q9CA 1MABB 4HLQB 5JHGB 1E98A 2MOXA 1LS1A 2WOJA 1DG3A 3H4MA 1Z83A 1RYFA 1R6BX 1BB9A 2BMDA 4G1UC 2DPXA 3V00A 3D8BA 2Q3MA 4QGAA 2J0QA 5IF9A 2FPMA 3EZ7A 4WAUA 4PO8A 2VF7A 1KI2A 3LX8A 2BEKA 2VHUA 2F2VA 5GJVB 4M4ZA 4G5RA 5DE3A 2CT3A 3EZ6A 2D4HA 1CSKA 2XNSA 4DSNA 2J0UB 1DAKA 2VYFA 1FQJA 3GFTA 1Z07A 5DI3B 3VHLB 2LQNA 3VR5A 2G88A 3W8NA 3X2SA 2YWGA 2ZJYA 1K1ZA 3UF4A 3I1FA 1MR3F 4PC2A 4YMUA 4AKGA 4AFSC 1NVUQ 4X1VA 1OFTA 2JLSA 4LJ9A 4UNQA 4WCIA 2AFHE 2ZXUA 2PCJA 3KQNA 1Z29A 2R6FA 4Q5IA 4X8OA 2W6JD 4LBVA 2D0NA 2C5LA 3HU1A 4NHOA 5ELXA 2CREA 5AWFC 2V1QA 3PEUA 3QKSA 5TB5A 5LD2B 2AK3A 2H17A 2NO9A 2G6BA 2ZI5A 4A1FA 1VYUA 4KSCA 3PIRA 4JVSB 3K70D 2QGNA 1C9KA 4IDNA 2W58A 1N6OA 4R0KA 2HJVA 2XTMA 1PRMC 1RPZA 2DBMA 3PE0A 2ZJBA 2XEXA 4KFUA 4KVAA 5JHHB 2O0KA 4JVNA 3AP3A 4URVR 3I8XA 2OBLA 4Q1EA 4FWTA 4KO8A 1K4US 2GILA 4TMZA 4LPKA 2BCJQ 2HCKA 1IAQA 3IPXA 4G5GA 1E9FA 5FOUA 1BMFA 5TY0A 3FMOB 3AQ4A 1KSGA 4FI3C 4NZYA 4OHWA 5JFGA 4P3YA 2O8FB 1LF5A 2QTVB 2LKDA 4OMPA 1D9ZA 3GJ6A 4IVRA 3QEOA 1CTQA 5KPDA 1I4DD 4JT4A 4ERNA 4BFTA 2X3WD 4DLWA 2X19A 4M2LA 1KK2A 3VS1A 3KXLA 1M2OB 4PC3A 1JI0A 2C04A 3A98A 2PMDA 4ZNXA 4RTUA 3QVUA 2F9LA 2ZI9A 1GNRA 1Z6GA 2QL6A 4BFUA 3LWNA 3B60A 4JSYA 3FOZA 3CPEA 4JLNA 1W70A 3QPVA 3EG1A 3EWAA 1G8HA 4JBYA 2J7PD 4NCNA 4TSFD 4Z54A 3U4QA 2O8DB 3ADDA 1Q57A 3BWDD 3CF6R 2YC4C 4W9MC 1MABA 2IWHA 4XWAA 2KROA 2ZEJA 3KUCA 4G01B 1N6PA 1JPJA 4W5WA 1DAEA 3QWXX 2IYWA 1IN6A 1D2NA 1XOVA 4EFMA 2QNRA 4IEEA 1ABOA 3QENA 1W46A 2X1VA 3U7HB 4B43A 5DISB 2QTFA 1EWQA 4YMWA 5G53C 3TSZA 1X2KA 2CUDA 1WA5A 2B7CA 3MMPA 3PFIA 2OHFA 2IS1A 3EARA 3U61B 1OFUX 3PUWA 3BFXA 1YRBA 2EFHB 3QF4B 1GSIA 1ZUYA 1JAHA 3TJZA 1S9DA 4N0EA 4UKDA 1XMVA 1YN8A 3IBYA 3LW8A 1XWIA 2FZ4A 1OOTA 3SHFA 2BBTA 2ZSFA 1RE0A 4Q1FA 1L2TA 1SEMA 3AB3A 3L8ZA 2JATA 3RRZA 1W6XA 2SHKA 1H8ED 3OZXA 4B74A 3QXHA 2ZM5A 5LD2C 1P72A 3THXB 1X2QA 8OHMA 1S96A 3X1ZA 5C1BA 2ROTA 5FOWA 4TYQA 1XRJA 4PX9A 3U7GA 4LJYA 3ZJYA 2Z4SA 4EUNA 2QMUA 2REBA 4LJ5A 3A58B 4DBLC 4AG6A 4KCGA 3I5YA 5H70A 3KTAB 3ZD7A 621PA 1N0UA 4Q19A 1W7AA 1R8QA 1W4CA 1O3YA 1YQTA 3W3ZB 1PHTA 2EYXA 2OCBA 2OT3B 3T35A 1L4YA 3MWJA 2QUZA 3UMRA 1M6NA 2QAJA 2O0HA 2NMVA 1KY2A 3AUXA 4ITRC 2FV8A 4KODA 4FMCB 2ZAOA 3GMTA 1OV4A 1WIEA 4LPSA 5FPHA 1XMSA 4AIIA 2ZPTX 421PA 4D25A 4ZDIA 5DHAA 4V0MA 1FNNA 2E5KA 5FUVA 4B3XA 3VS5A 2ZVQX 4W7SA 4FCWA 2O8FA 1GG2A 1D9XA 1U0LA 4UNSA 3RC3A 4YXWA 2ED0A 3CWZA 2Q21A 2XSZD 3SQXA 2FE4A 3R9WA 2GA8A 3TIFA 2XX3A 4LYAA 4P33A 2LZ6B 4URUR 5AK0A 1Z8FA 1SQ5A 3L8YA 1E2HA 4LUEA 1QBKC 1TL7C 2CLDX 3CONA 4PZYA 2FEIA 4RD2A 1G16A 3KUDA 1OV3A 2B21A 2P4RA 4GL2A 4YC7A 3GJ4A 2FGKA 1SHFA 1KO5A 1MH1A 4E03A 2YV5A 4PPQA 1S8FA 2BM1A 2P6NA 1OB5A 1K0SA 2CDTA 2B92A 2CXXA 4OHZA 3IGFA 4LJ8A 1CJUC 3D31A 4QC2A 3R20A 5HZKA 1LY1A 3FVQA 5SZHB 2FZLA 3KQUA 1MO5A 2KXCA 5JLJA 4NH0A 1KSHA 1I4LD 2KR3A 4HVVA 2VP0A 2ZRAA 4HAYA 3T1QA 1OPKA 1JALA 4LHZA 5JBQA 4BZQA 1CULC 1EFCA 5IK2D 3IKJA 1FNMA 3K70C 2WWXA 4OMMA 4IEIA 1A1VA 4M1YA 5LB4A 3WNBA 5JI2E 2AWOA 2J3EA 3BRWD 4ASUD 3EA5A 2HDNB 1KKMA 3U6KA 3AVTA 3QF4A 2QP9X 3FE2A 1ABQA 4PSKA 4AYTA 3T61A 1YR6A 2BZXA 2ZSDA 3C16C 1VG1A 4MKFA 5CK5A 4PC1A 3THOA 1K5DA 3B1YA 3LFUA 1AGRA 4Q7KA 3WY9A 1YHNA 2Y8EA 1JU5C 2ZRDA 2NGRA 3W6NA 1W36C 1G7SA 2X77A 1JEEA 1XD2A 1ZRHA 3B2EA 5JCZA 3NXSA 1KY3A 4UNRA 5GVRA 4GI7A 3MGCA 1HE1C 1Q22A 2FEOA 1E1RD 2WPDD 3TK1A 4V0ME 3EPLA 4L5BA 3QY0A 5DN6A 4OJKA 5GJBA 4O25A 3BXZA 1E79D 1TQ6A 3RYTC 1GRRA 1AZTA 2OSBA 2ZYUX 2I1QA 1RKBA 4OYHA 2CT4A 2VP2A 4F92B 2KT1A 1XXHB 1JPNA 2H18A 2FJUA 1Z0DA 4KVGA 1WMSA 5L3RA 1GCQC 1RRCA 3BH0A 4D80A 4TL8A 3ZIAA 4KBFA 4BZXA 1A5TA 5D3QA 1HTWA 3B1WA 2K9GA 3QXSA 4PPNA 1CLUA 5BWMA 1UBCA 1KI4A 2GTJA 2CJWB 5FTKA 2JS2A 3GD7A 1FUUA 5EZ5A 3KQKA 4Q4HB 1GCQA 1VG0B 2IL1A 2DM1A 1ZYUA 3U7FB 4CT4B 2QT0A 3GLFB 4IHQA 4HEJA 1UPTA 5BW8A 1WLPB 2VP6A 4HDOB 1T8UA 3BIFA 1RUWA 1PLJA 4K11A 2WAYA 3FMPB 4TZ6A 5CIQA 5EE0A 2LCFA 3FKSA 4NKRA 1JEDA 1JECA 3WNCA 2W0MA 1Z9ZA 1S1NA 1KTVA 5E7MA 2PEZA 1G5PA 2GEDA 4RD4A 3TKLA 2DL7A 2ZRBA 2D2EA 3AKYA 1X6GA 2IHBA 5BYJA 2JLVA 4MYUA 1MV5A 3CZPA 1XJCA 3ZYCA 1HV8A 2J87A 3NEYA 2BBWA 4RD3A 1QKXA 1U8ZA 1AS3A 1YKSA 3G82C 2GTOA 2OAQ1 4HAVA 3RBBB 2Q9AA 4W5JA 5ECAA
chains in the Genus database with same CATH superfamily
2I6XA 4O29A 1XJWA 3DUFB 3Q0IA 3TVTA 4FFVA 3UH1A 4B48A 4IF4A 1A8UA 5TEWA 3F5QA 4CC4B 4ND4A 2DBKA 4RG8A 1VUBA 2WF6A 3HKSA 4WN9A 4EKEA 2UYYA 1NRJB 5KSOA 4N4HA 4F11A 4PXYA 3TMAA 4AMCA 2QUHA 2X8JA 4BZPA 2OR3A 4ZV7A 4G0MA 1DAHA 4MKHA 2IOYA 4DA9A 5F2KA 3BB1A 3URMA 2FFBA 1ZU4A 2I7CA 3Q3GE 1IUPA 2ORED 5AJXA 4RPHA 3JALB 2CJWA 4F14A 2ZR9A 3Q3CA 4XWGA 4OBEA 3KHSA 1HFKA 5F9HA 4IINA 2H3EB 2IEYA 4BNIA 4H0CA 3H65A 3NBUA 4RCCA 1VQ7T 4GRAA 4L0CA 3TTVA 2AJTA 3IURA 4YO7A 2W83A 4E12A 4E5KA 1HT3A 2M9UA 4NSNA 3WXMB 2ZXEA 4R68A 4P7KA 1WOMA 4UUOA 3VUEA 1E5VA 4AS1A 1DPGA 2H92A 2YINC 3AETB 3LBIA 4EMUA 1YWOA 1Z5ZA 4Y92A 4G0NA 2WC1A 3FTCA 3OWXA 3G13A 1KJIA 5M3BA 3CBMA 1EYZA 3QPAA 3Q0EA 3PQ2A 3QIIA 4QQDA 1GFIA 1K2VN 3Q9SA 2P75A 2MINB 2EJUA 2QTCA 2PQWA 4BFZA 2OTJA 1BXRB 2PG3A 3UJNA 3L1KA 3JALA 1Z4KA 1N5DA 1AVTA 1H4TA 3L84A 2CEAA 4N6OA 4ZAGA 1OWNA 2I0FA 2JA1A 3CVUA 4HD8A 1ZJ4A 1OIWA 4EB6B 4RZXA 5DSTA 4BAZA 2Q1SA 1X87A 4UTRA 3OH8A 4QG3A 3H9EO 2E6KA 4L02A 5D1HA 4LRTB 3JCMc 2QUIA 3TOZA 1RJGA 2P2ZA 1CQWA 1N8SA 1C7FA 3UT5B 4LZOA 3IE2A 2C9DA 4O4LB 4QNNA 3CUTA 1Y3BE 4HQ0A 1FQWA 2VOEA 3AETA 3D1VA 4IUCS 1B34B 3IEUA 5CR9A 4IKOA 2DZCA 1K6MA 5BUSA 4JIGA 4W1QA 5BOVA 2CXTA 4LXUA 2I6UA 2XB6A 3BQNB 4DEVA 2JC3A 3EG9B 2OCKA 2MINA 3MYRA 3WKCA 4ZAYA 3FMVA 2EQJA 1OBHA 2R6ZA 3OKCA 1U0JA 5CGQB 1FSSA 2PWPA 2F7SA 4GDFA 4EMKB 2P7IA 5AK6A 1T8PA 2QAIA 1LD3A 3QSYA 4JP2A 2HXSA 2ZWAA 2CFCA 2P1ZA 2DTOA 4XW2A 2I5PO 1P7WA 4JI2B 3UT5A 1R2QA 1YJBA 5GAMj 3TF5A 3BT7A 4QNMA 4B2LA 1XVIA 4PKCC 4D4JA 1EE1A 3K6RA 4V0OA 4RPJA 1UFQA 3FCAA 1IREB 1B34A 4FMPA 1FTWA 1QIGA 4W5QA 1ZCJA 2V4UA 2B8JA 5I4BA 3OHPA 3RS4A 5LP6C 1GUDA 1M9NA 2JJMA 4OIMA 1ISJA 1RPNA 4YMVA 1Z0FA 1EHCA 2A9KA 4PHGA 2OAGA 1NEBA 1YZUA 4D0RA 4EVSA 3T8YA 4ZKDA 1AQNA 4NFYA 1K8AC 2FMIA 3W2TA 2BH2A 4P83A 2XDBA 1NZDA 5FDFA 2IQ5A 1E1KA 5HXAA 1NDHA 3KJEA 1D2CA 1QRRA 1R00A 4G85A 4TXHA 1EQ2A 1AXEA 2C0IA 3I9MA 3PVZA 4P4NA 1KETA 1TXGA 3I0NA 1OZ3A 2QM0A 4WZAA 1R9NA 3VNBA 5B1SA 1RXEA 1OI3A 4BX0A 3AVVA 1VE9A 4PO9A 3ZY3A 3H84A 3MSCA 3VR4D 4R1UA 1PR9A 1N2HA 3PYLA 1WQWA 1SVWA 4IHAA 3HWRA 1CF9A 2XVZA 1FJXA 2PXAA 1I0CA 4CHTA 5E4JA 2MWMA 3LVQE 4AKEA 5EP2A 1Q1AA 5A6SA 1QHGA 5DHTA 4NYIQ 3RYHA 2C3OA 2PUFA 1II9A 2W8BB 2CD7A 1FMCA 3VR2D 1F8GA 2IZOA 4E2XA 1QB7A 4ZN3A 1TG0A 4XUDA 4XPIB 4G3XA 4S3MA 2Z95A 3JV3A 3O8LA 1I7SB 2WJJA 4EWLA 4MTLA 3K35A 1MGOA 5K5EA 4NOLA 5K2MA 1ES9A 3OCVA 1L8LA 2DBZA 3A1TA 2GNCA 1IY9A 3EVFA 4LA4A 4BDSA 3DTVD 3VX3A 1JT9A 4DUGD 4JKOA 3ZKWA 4E7IA 2JFHA 3EEFA 4ENVA 4PQRA 1LLCA 3A8GB 3I8SA 2EDAA 1GGJA 3VPFA 3B52X 1M0SA 4FK8A 2P4SA 5GAMe 2FE1A 3VKHA 1N2XA 3QKRA 2C0CA 3BGDA 5A3QA 4C4RA 3LW5E 1GCOA 4QAJA 1L5ZA 3E7PA 2Y2VA 1MHNA 3OP1A 3AVQA 4TLDA 3VU8A 3PVQA 3OSVA 2PVPA 1ONSA 1Q12A 1RKXA 5E95A 4NE7A 1QRDA 5GZ1A 3VNQA 1R66A 1CZHA 5T57A 2O4UX 3GP3A 4BE7B 3SEAA 4DVGA 1JHRA 3D8HA 5BNWA 1IATA 4YQFA 4FZ5A 4KXWA 4BO7A 3NUQA 3SKVA 1RC1A 3GJYA 4N3BA 4HQOA 4FNAA 4WK4B 1JF8A 4A03A 1IM5A 3UWSA 2QPLA 3UK7A 1XDDA 4EUFA 4QGHA 4WVFA 1P3Y1 4LC9A 2D5CA 1XRPA 1TJYA 1CDOA 2BUAA 3QELB 3DZGA 2R8RA 2XUZA 4X7BA 3QRWA 4ECEA 2EBWA 4ASUA 4TM8A 1AKEA 3F0TA 3LCJA 2ZJ5A 1P5HA 3UMCA 2INGX 2OHGA 3TQSA 4G1MB 3TLBA 1HQDA 1P6UA 4FGKA 3AEQA 2DWCA 3CM0A 4I1YA 4JOBA 4YWHA 5ES4B 4RZQA 4YCBA 4LD9K 5ABPA 3TQCA 1GL3A 1RI0A 2CNWD 2HC9A 3WBJA 1H1DA 2IHZA 3DWIA 3L4EA 4C87A 4A91A 1LJLA 4LBZA 5CM9C 2IVFA 4FOLA 2JZOA 2CXSA 3NHJA 4MQ6A 4EA6A 4OI0A 3MQFA 4UHCA 4N40A 3Q6IA 2F55A 5BXYA 1DVRA 4X34A 1CR2A 2HQSA 5IH2A 1N2GA 1A3CA 4HG2A 1QCDA 3UA7A 2CV1A 1RRVA 1XVVA 3OPVA 4QUIA 4MW6A 3OOWA 1TMOA 5D7UA 2Q5IA 3DR5A 4BBAA 4F97A 3OJXA 3EXFA 1DMSA 2GCOB 1T9AA 2LRHA 1ACLA 2YWHA 2ZUUA 4BFXA 1EGVB 3TRDA 1WMFA 1UBEA 3RARA 2FEXA 3CPWA 2WE7A 4JC0A 1D7OA 2D54A 1VQ8Q 2ZROA 3B36A 5F23A 3PR1A 3UWNA 5AW0A 1DUSA 5H81A 4OFXA 1G21B 3UMVA 2RB6A 4IIEA 4K87A 2BTQB 3I01M 4GAEA 1HJDA 2ADMA 3OFJA 3ZEIA 4CU5A 2YASA 2G9NA 1ZD1A 2ZVDA 1H85A 5JJBA 3ZX5A 4N6GA 2GN2A 5KYNA 5E9QA 4F5EA 3SEMA 4C29A 2FFJA 4B4WA 4GUDA 5TVKA 5F1YA 2CKKA 5AJHA 4FC7A 2K2WA 3L01A 3BMXA 4G8BA 4XQ3A 5IVHA 2XQJA 4PANA 4FW9A 1YIOA 2GCOA 5I4IA 4D3SA 4N18A 4YXWD 4DDWA 3ELBA 3ZZUA 2BISA 4HX5A 2O01E 2VQ6A 3BX1A 4WGFA 3AL0C 4GZMA 4TTTS 3BK7A 4Y3UA 4G5OA 1G21A 4JYBA 4DF3A 1M10A 2HBPA 1DRVA 1VL8A 3A8OB 2X14A 3A9CA 2OQVA 4EO4A 1V7ZA 3G6EA 3OQPA 5B37A 2BTQA 3CH5A 1WOYA 3FJ1A 2MHCA 1VJ1A 3X0DA 4J6XA 4RZUA 1Z9BA 2RD1A 3ZDYB 4KI0A 1E3WB 1BX1A 2FFQA 3MQ4A 3H4VA 2V45A 2EPDA 1NJ1A 4D82A 1XE3A 2V65A 4IIHA 3EIOA 3PUYA 4W7IA 2VJKA 4IGAA 3ZIAD 4MPPA 1W6UA 2MCNA 4M7DE 4W1PA 3PIDA 1OLSB 5EWMA 1Q0SA 2G9RA 1N2IA 2J9ZB 4IR7A 1UE9A 1UQTA 3PLRA 3DB1A 3LT2A 3FKSD 4AL4A 4WF2A 2JA2A 2V7PA 1NYFA 4ETNA 3SXJA 3SM9A 4A6PA 1KI6B 4JJKA 2H4FA 5JXGA 1D6MA 1IN1A 2PMBA 2UYOA 2Y1DA 1OXVA 2HAEA 3PC8C 2QXFA 2DG2A 4DDVA 3R0ZA 1U1GA 3O0TA 1IY1A 1MTZA 1M7HA 1L0BA 3CC7A 2WD9A 3S8MA 2PX4A 1GZVA 1KQSA 2WTMA 3J81k 5WRFA 2EYQA 4M83A 2IX3A 1E3WA 2GPTA 2IYQA 1IU9A 1CYEA 3QWYA 4P86A 3RQIA 2KBFA 3TQIA 3SI7A 2CDBA 3G4SA 3SHOA 3D6NB 5JOQA 3G49A 3G9UA 5AW8A 3J80E 2XQKA 2H9YA 1H2WA 3H9JA 1IHDA 4BKUA 2PJRA 4JSRA 3SDZA 4LYDA 4DLXA 4MQFB 4Q48A 3NTVA 4L51A 1SPBS 4O6JA 3CO5A 2V74B 3A4TA 4GKBA 3SBXA 1DQNA 2OHIA 3U62A 1V6CA 4UJ3A 1NC1A 3MCAB 4TYMA 3ZDZB 4CF6A 3TQ7P 1EAYA 4OQFA 2A59A 3JQDA 3M89A 5FTNA 4S1TA 2IBTA 2XUPA 2YFHA 5CJPA 1EFKA 4PM4A 3Q6NA 4C8QE 1AUQA 4GR5A 1Y33E 2GCPA 1VKRA 1BU8A 4NENB 4ZTZB 1TFRA 4EGAA 3KKEA 1WUTA 4C4ZA 1Z13A 4K8RB 1Y48E 1S3IA 4O5AA 3WMWA 1FUYB 1NPTO 4IHJA 3HN6A 1Y89A 4NOMA 1KC8U 4BP3A 2FSHA 1QQ6A 1T2UA 2XCUA 4MQFA 1XMOB 4M99A 3UA4A 1L5MA 1J00A 4GNKA 4D8DA 4RF3A 4JT8A 1SQSA 2B34A 4DNOA 1DEAA 3GVIA 3MCAA 3ROMA 2RB4A 1HMYA 2X0RA 5LMZA 1H66A 2AJLI 1IXYA 5EP1A 4DIOA 4E13A 3GAMA 3SZGA 2GFAA 3AINA 2WA1A 3KYBA 3ZOZA 1XHLA 2ZQ5A 1ZDMA 1NURA 3LWHA 1N6IA 3FMFA 4OP3A 2QA4Q 1UJ4A 4C4TA 1OR8A 3KCNA 1NLUA 4AP5A 4NENA 4P31A 4DC0A 3HPRA 1OILA 1YVDA 1NF2A 2XKBA 5B7NA 2EWNA 3MXOA 3SX4A 1ZIDA 4I3FA 3P4XA 4D8YA 1J2EA 3Q5EA 3UNXA 4LQDA 4ZYLA 4FYYA 3MT7A 5KYVA 1ZW1A 3K9LA 2TMYA 4BGVA 1ZFNA 1TMGE 1N9ZA 4CTJA 2DX1A 1Y82A 2ZXFA 3TX6A 1Z0AA 3BD9A 1WZUA 1T5BA 4OK6A 3LHFA 2BKXA 4PSVA 2HHAA 2AZVA 1RAFA 10MHA 4M8IA 3EBLA 2Y6UA 1XCMA 4GMHA 4M8LA 4Y9SA 4TN1A 4YUYA 1I4OA 1P18A 1WV1A 4LCBA 2HA7A 3VNSA 4FQ7A 3RUDA 3LQRA 4QUKA 2BBSA 4LDQA 5FV7A 3OFVA 2LX9A 1WKVA 4M1KA 1AN0A 3D6FA 4XLTA 3TKYA 1GA4A 1IPFA 1HKHA 5DBFA 2O8EB 1XTJA 2LQ8A 1B43A 3DAPA 4FUTA 1BFKA 4QM7A 3Q3HA 4HGNA 4W8HA 2B8NA 4O4JF 1O9BA 3I58A 4GX1A 4QUAA 2XK0A 4E11A 3DO6A 4QXAA 2W0ZA 3RIXA 2HLHA 1VM6A 5CM8B 3OWHA 1L5OA 3N28A 2AV6A 3K2IA 3GPCA 4HTFB 1DIAA 3CCUT 4Y2QA 1QIEA 4JLDA 1T43A 5KX5F 2BGGA 1JKIA 1GKKA 1TW3A 2GM4A 1GFZA 1KEVA 3AIIA 2AXEA 1KDOA 5BR7A 4IQGA 1UG1A 3EN0A 5DBHX 4DIUA 1BWQA 1GDDA 1XAGA 2MSEB 2AKKA 5A3SA 1UKBA 2FHDA 2OFWA 5FJIA 4YS6A 4B3GA 4P6VF 1QGED 3STYA 1JA9A 2WG0A 5C8XA 2QB5A 4Q4CA 2HNKA 2XCLA 3ROKA 2NUTB 3GT3A 3WV5A 4LX0A 1BSVA 1EXWA 3A04A 4MW0A 3I9V6 4O1HA 4YRQA 1RYFA 1Z3CA 3EH2A 1CEXA 1NI5A 1Y8QB 1AQJA 2W4QA 3X24B 4NCAA 5HJ7A 1CSKA 1LPPA 3D5TA 3PKZA 3VR5A 5DNAA 4QTTB 2HJWA 5KNBH 1JJIA 4JC4A 1GZ6A 3C0KA 4WCIA 2LC4A 4X8OA 4HTFA 5ALEA 2ZSIA 1MJGM 1BI3A 3LIIA 1Q86U 1MVLA 4L85A 3NJRA 5EQFA 3NRCA 1C0EA 1F14A 4L27A 2XHEA 3RVKA 4B6SA 1BMFA 2FPGB 1NNI1 2I9PA 1WHMA 3UWMA 3RAFC 1M2OB 3CF4A 4OBXA 4ROTA 4FJ1A 3OM8A 1G8HA 2O8DB 2NUTA 4NAHA 3CF6R 3T7JA 1MXFA 1L4BA 5HDQA 2ZEJA 4BKPA 4W5WA 4R8SA 1C3XA 4EBBA 1UEBA 1XOVA 4WKBA 1Y8QA 1EWQA 4PG7A 4WRRA 4YMWA 3L7JA 5CT5A 1MW9X 3BFXA 3B1JA 5AVQA 2PAFA 4NRDA 2FZ4A 1PNVA 2PUVA 4OP2A 3ZBUA 5J23A 3ISVA 1T9CA 1S96A 2BL4A 1CUAA 5ADHA 2CVQA 2QMUA 4EG0A 3I5YA 3RFCA 3BL5A 1VCHA 1XO1A 1N8NA 5FWNA 5K05A 1GUBA 4FLMA 3T3NA 3PNOA 2P41A 2WHRA 3ICVA 3WVEB 4AIIA 1VA4A 4Y9DA 3K5PA 5DK4A 3Q87B 5KHAA 1H4VB 2ED0A 3QP9A 3SQXA 1X9IA 2OV4A 1PD1A 1QBKC 1G16A 1M2OA 2DYIA 1L7XA 4IIBA 5AQ1A 3NHRA 1H6CA 4A53A 5KWIA 3LC7O 3EPPA 4JS5A 3WXBA 5SZHB 1WJSA 5JLJA 4U7HA 3TFWA 3L7IA 4GX2A 4MZTA 1JALA 3I83A 3JW8A 3DFUA 3IKJA 5AH0A 4J1SA 4TTSA 4XGRA 1I2ZA 4E6EA 1JHVA 1NVFA 5I9NA 2ORYA 4JR0A 3RR2A 2FUKA 4P5DA 1GPJA 4A4KA 5GVRA 2KW5A 4DM3A 1YQ9A 1TCAA 3QY0A 3ZD9A 4BNWA 5D5HA 4NVRA 4BZXA 5AXCA 5BWMA 1KI4A 2GTJA 1USKA 2CZGA 4XSVA 2FUEA 5AK5A 2ILVA 4CMGA 4KQKA 2OYCA 4ZN6A 1HDGO 2ABWA 5GAOm 2YHIB 5CIQA 5AT1B 2MDTA 5EQDA 1CVIA 2DOKA 3Q9UA 4MYUA 2P30A 2ZJ7A 3CMAQ 3VSBA 3UXYA 2IW3A 4B5KA 4FOSA 2EBUA 3FB1A 3IAS6 3WQBA 5JG7A 2AYXA 2PVSA 3HGMA 4JL6A 3ZVKA 4NFHA 3ASYA 5DWQA 4RK1A 1NFFA 2GEUA 2L3PA 2P6RA 4BB7A 4L1KA 1U2DC 5FLYA 2IHKA 4V38A 2WG2A 4UU1A 4RHXA 2ZREA 3TLCA 5BSMA 4E0BA 4MGHA 5JJCA 2JLRA 4BCBA 4DSZA 1S0UA 4L3WA 1NIPA 1RABA 1ETHA 3H9BA 5KYKA 5KVVA 5AJVB 4WDQA 4DHWA 5C0OE 3VU3A 4C1BA 1W5TA 1ZXBA 4KQ2A 1QVAA 1N1DA 4CVNA 3W2HA 4IL5A 3C14C 1X9HA 2ISQA 1K2WA 4S04A 4JB2A 4LDNA 4ENPA 2YHIA 5I8WA 5EXSA 5IDQA 3H1GA 2VAMA 4YP7A 4KVZA 3UB2A 1VBNA 4EKNB 4FB5A 3P9CA 3BE6A 4QYIA 5D5PA 1HLFA 4XSHA 2EFEB 4PS1A 2P62A 3V4VB 2HCJB 1WBDA 2BT4A 4HDRB 1TTHA 3W3AA 2HNAA 2XKAA 1MLDA 1JDPA 3ZQJA 4R8KA 1MO2A 2HYDA 1JJFA 2WSYB 2YJ6A 1IQRA 3T4PA 2NUBA 3TUJC 1PVVA 5IN4A 1PU2A 1RZRD 5CT4A 3R3XA 3AP2A 5KHOC 1Y4UA 1OT3A 1DKOA 4W5RA 3JPWA 3R4CA 1P0FA 5IT0A 5KPJA 1RLJA 3JCMg 3B9PA 4NECA 5H83A 4A2WA 2PSDA 5THKA 1Z4LA 5A0TA 3DTTA 2XQVA 2X76A 3PPIA 1L4FA 3EIFA 4NNJA 4UC0A 1JDNA 3K09A 3VYRB 1ZMRA 5YASA 4KKVA 3DFFA 5JH7F 2ETVA 1Y9ZA 3BB4A 1KEZA 1XZAA 3NAZA 4IXWA 5CGZA 3HJFA 1OF1A 3ZVMA 1GPH1 1E6HA 4HDRA 2X51A 3QBJA 2QTMA 3A3YA 3LLSA 3CF0A 4RKUE 2P2LA 3AKDA 5KYUB 4M1EA 1Z73A 2YOFA 1HDZA 4GECA 3PC3A 4GDMA 4ZEXA 3H4TA 2QJRA 2WZCA 1W0CA 4P4SA 3DVSX 3DYIA 4B4KA 3KQYA 2P2CA 1ZHHA 1E60A 1XK7A 4P93A 5JANA 2EVRA 2J41A 3DZJA 4AU1A 4NAVA 1OXUA 1PX2A 2DQ4A 4KACA 2FO0A 1Z4JA 3TZLA 3N05A 5IM5A 5HEKA 1YGYA 1Z7GA 1IOWA 2ZE7A 3OZ7A 3K6SB 1V16A 2WSSD 4D8XA 4OF1A 2Q28A 3KWLA 4RJTA 2ZJ2A 4GOND 2ZI7A 1M73E 2C31A 5FROA 4BRSA 3RVRA 3UMJA 3QNMA 3F97A 1OYOA 2XMRA 4X8LA 4BX8A 1NRXA 4MRVA 1GARA 1OASA 2VNJA 2YIVX 5EZ6B 1IWOA 3P9YA 2BKLA 4X41A 2XKJE 2HIMA 4CI0C 2WHQA 4K3UA 1QP3A 1HK7A 3EVNA 4XR9A 5IXYA 3RJTA 3GRKA 3HPWA 3AVUA 4KXUA 1P0MA 1RQ2A 4Q4JA 4RCYA 5L3QB 5COAA 2WU4A 1Z16A 4BEWA 1GFCA 4NU5A 4DLVA 2CBZA 4DBRA 3P2OA 1ECLA 1PKSA 1FLDA 5JNSA 1KPHA 3UC5A 4PLTA 3S5UA 4TL6A 4KQ6A 1LTQA 4X85A 1N4AA 3OQ5A 4P3PA 1A4XA 3ZHCA 2GJAA 3IPAA 3PI6A 4AF8A 3NTOA 3QUCA 2HDAA 3V1LA 2AD5A 3KZKA 2G09A 3RVBA 4ND8B 3CB4A 4JLOA 1DG1G 3GEIA 1VDZA 1U5AA 1OX9A 5E7JA 2CHUA 4OHMA 4R8LA 3HTXA 3F49S 4Q82A 3I56Q 1YR1A 1P7VA 1EJ2A 2RK1A 3WMXA 2QXUA 1F12A 3ETHA 3ZGZA 5I9LA 1KYTA 3OPNA 1CR1A 5F21A 1HGXA 1R8XA 4LHSA 3WYDA 3ZIDA 4BNJA 4XIGS 2X4WA 2R44A 3VRHA 4MLPA 5L3QA 2GAIA 2AMYA 4KR2A 1ZCBA 3TE6A 3TQTA 3PVLA 1ULSA 1P61B 4PLIA 4R2LA 1ETUA 1FXUA 1NOKA 1KI7A 1ZINA 5HRAA 4Q34A 2M1XA 5I47A 3GDGA 3Q0TA 2EYWA 1K7EB 5C37A 3L42A 5IXJA 2CP2A 4GLBA 3LIPA 2YYZA 2D4AA 2QHXA 4M9XA 1RYHA 2FOXA 1B93A 2E87A 1ZH4A 2WZBA 3S28A 1HE5A 2DXTA 3UJDA 2Z5VA 1CSEE 3B6IA 13PKA 1RYEA 1OJ7A 3ZJUA 4L73A 3MGBA 1CZKA 2HYIC 3ROTA 4R1LA 1OREA 5ALKA 4IEFB 1BDMA 4Y98A 3NETA 2D2FA 5EKXA 3IP9A 3KPUA 1BXKA 1R0XA 3P94A 3R9XB 4C4XA 1XD9A 4MVJG 2C59A 4G24A 1BQ4A 1FDTA 2GH1A 3R76A 2QGZA 5C81A 4B81A 3E7FA 4BO1A 1JI3A 3KNZA 1QQTA 3UKDA 2JVIA 1S9HA 3MZ0A 4S05A 1OX8A 2PX3A 3M4YA 2D1QA 4GBQA 1D8AA 4HWRA 1E6GA 3DT6A 3EUAA 5T6BA 1RI1A 3D8NA 1C0KA 1SXHA 1Q86R 4Z4IA 4A0RA 2DQKA 2VUUA 1ORWA 1DARA 1YC5A 4MCHA 1PTJC 1YV9A 4PO1A 3OE7D 5A0DA 2PVDB 3NBMA 2VHZA 2B36A 1T0PA 3QH4A 3F5MA 2Z3VA 1CUIA 3WGJA 3ZZ0A 4G8DA 3STVA 5ALGA 4IIOA 1FP7A 2FVYA 3TDNA 3R7AA 3R9XA 2EG5A 4NBUA 1UPXA 4NBSA 1PZNA 4FUQA 3HZOA 5B1IA 5IEJA 4MR7B 1WPRA 1PK8A 3BF8A 3QYAA 1NYRA 4CMAA 2C4MA 2R84A 2MTBA 5IDWA 4FSSA 3SOPA 3NHZA 3RJZA 3NT4A 3WGQA 3H3FA 2XYQA 4N5HX 3HYTA 4LOJA 4DR2B 1I7DA 1NBME 3RLFA 4S35A 3R5HA 2QD4A 1RYDA 1UJBA 4ZGDB 4Q93A 2AN9A 1P17A 4UBJA 2HY7A 3CUVA 1P75A 3UUGA 1R8OB 4AVYA 4RK7A 4MUJA 2VYND 2VV5A 3ILYA 4RD0A 4MYCA 4RK4A 4BL5A 1OTYA 1X1CA 3COWA 4IH9A 1SUIA 4RE6A 1KD1C 1ISPA 2J3MA 3PQCA 5J4VA 4MUYA 5J4YA 2VI5A 2C99A 1EKXA 1QLJA 5LLSA 2YW9A 2PTHA 3QVVA 1YE8A 3CVWA 3CGGA 5DP1A 4M60A 1SNYA 3KFLA 1GA1A 4NS5A 1VOMA 3BFJA 1Q0UA 1EZZA 3QG1A 1Z5OA 3RS0A 3VZPA 4DTCA 4PINA 3CBGA 2XOEA 4XIJA 2X9NA 2Y1GA 3CIFA 4MR7A 4BQFA 2BFPA 2CLEB 4FQ5A 4PLVA 2OO5A 1CUZA 2QVCA 2Q1YA 4II2A 3LPAA 3LC1O 2ERYA 2AFIA 2NO4A 1DX4A 3V4PB 4HCKA 5BUCA 4BVLA 3U4GA 3PJRA 1WXFA 1P8JA 2QU8A 4EIWA 3E1GA 3G9TA 1VP9A 2PE5A 3J81E 3GA7A 1ONBA 4FMDF 2FZKB 3W5AA 3MPUB 3PNPA 2HEGA 1J20A 1VTKA 2DL5A 2O2GA 1KSFX 4MB0A 3DHWC 1FDWA 4DIDA 2ZI3A 1NXSA 3O91A 4X94A 3H41A 4Z8AA 2FWAA 5DTEA 4WUVA 4DCVA 4Z7JA 1J70A 5HBGA 2IITA 4A27A 5HUQA 1A8HA 4IIXA 2IIQA 1YCSB 3H0CA 2I6GA 2YBEA 4PU0A 3EGDB 1L5HB 3TL6A 1P9OA 5K0BA 4BNFA 4ZO4A 5JI3E 3ZCTA 1VHQA 5TMBA 5BOSB 1C1AA 1VJ5A 3VVLA 3HBJA 4MA4A 2CUKA 3CEPB 3OW2P 4E30A 4DWVA 3AOEC 4YAGA 1OCEA 2FZKA 2Q3EA 3MPUA 2LW7A 3PEYA 2AW3A 1W2BP 2P65A 1IY8A 3HA3A 4KUHA 2HZ7A 3BAZA 1W36D 3E9EA 3T9CA 5H3HA 4HL6A 3WB9A 3V8BA 4IFEA 1JX6A 1YIDA 2C5HA 2V7QA 4RL6A 2I33A 1IDN1 1TKCA 3BSFA 1EFRA 1M75A 2ZRHA 5J43A 2OCGA 5J47A 3OFSA 3AHEA 4GNRA 5JVDB 1GAEO 5PGMA 5E1BA 3G71Q 2A9OA 2X2FA 2VF8A 3LY5A 5AKKA 3RD5A 1O5TA 2QUKA 4PSAA 2RJCA 1Q81R 1IB8A 1G2IA 4I4NA 2HWXA 1ZJ6A 1XU7A 3EGDA 4J7XA 1KS9A 2FRDC 1NAHA 2DECA 4N9WA 1VE5A 3PX7A 1R6TA 2NO5A 4K2HA 1UUFA 1VLLA 5BOSA 1UC9A 2DFTA 4P22A 1AKVA 3R0IA 3VPGA 4IDCA 1U5BB 5K0CA 3L1UA 1TLTA 4DLZA 3EJ6A 4MS1B 1DBRA 3L40A 1F8XA 3X20B 4YRBA 1ZHOA 2WUVA 3BCUA 3QLJA 1NSFA 1Z7BA 4QU8A 3PA8A 4C0DC 3QXGA 2OFFA 4Z9XA 1TYAE 4QBFA 4Q37A 3V1MA 5TV2A 2JIZD 4FIBA 1JZTA 5JVDA 2AE2A 5GIPE 3ED5A 4OPMA 4DN6A 1SY7A 3NS7A 4XEUA 2OXRA 3UHJA 3VDRA 4RPGA 1GQ2A 5GAJA 4C1NA 1UBUS 1T9GS 2VEOA 2K7ZA 1QV6A 3IESA 2NW6A 2R4UA 2Q4TA 2ZIZA 1S3SA 4TWZA 3MTEA 4BLRA 1RNLA 1VHLA 3KZNA 3OHSX 2XNDD 5GAN8 4KRXA 2QUAA 2QN3A 2R1VB 1N78A 2ZU6A 1I7NA 2B0JA 5TVGA 4RLQA 4BGEA 1UEIA 5KQGA 2NM0A 2PVGB 3NH6A 4H2DA 2ACKA 4MS1A 2HJ9A 5BWLA 3H0IA 3DF7A 1W52X 3OESA 2YZGA 1ZCZA 4ZVLA 1XDSA 1T9ZA 4XTVA 1Z6QA 3NC0C 1T6NA 1X39A 2ZYVX 4GMXA 3EWIA 1ZH8A 5F77A 2FWMX 2YH2A 3OOJA 3OMGA 1L7PA 4MUNA 3SYKA 4TXLA 3HVIA 3FZYA 3AR2A 3UW1A 3CUSA 3LM8A 2OP0A 3TPZA 4B2IA 1VJ0A 4FDVA 2C3UA 4IAOA 5L53A 4CF5A 2ZAYA 4OB6A 2Z83A 3CRMA 5AVYA 3HEMA 3S7TA 4C92E 4C3OB 1CUDA 1K7CA 3M57A 3ZW9A 1XZQA 5CQYA 5F2OA 4CXMA 4CKBB 3WGTA 1FBNA 1EGQA 2BE7D 2UYHA 5JTTA 4A2QA 2R1VA 4H7EA 1JLSA 3T52A 2FMXA 3CVVA 2YL2A 1QZXA 4Q4HA 3SHQA 3QWBA 5CH3A 3NC1C 4PWYA 2BGJA 3GLFA 1XHFA 3LQFA 3T5CA 1TT5B 1HNZB