4DEXA

Crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav2.2 i-ii linker.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
289
Chain Sequence
EDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKEFKLTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a voltage-dependent Ca2+ channel intracellular linker: a structure-function analysis.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transport protein
molecule keywords Voltage-dependent L-type calcium channel subunit beta-2
total genus 95
structure length 289
sequence length 317
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4dexA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dexA02
4ORZA 1WP9A 1WBDA 1RLQC 3VR6A 3AVQA 5SZJA 2R6GA 3KXLA 3UIEA 4LPSA 2CBZA 2I1VB 2FEMA 1YWOA 4LBZA 4D81A 1F2TB 2BJWA 4YMWA 3Q5EA 4Q1BA 4G0NA 2GF0A 2EFCB 4OL0A 5C4GB 4CF7A 3VQTA 5JS8A 2IYLD 4WXRA 1W48A 1E4YA 2HEQA 4PO9A 2CCJA 4A6PA 2YV5A 1T6NA 4OJKA 2EWWA 5C18A 1OKKD 2OG2A 4NYMQ 2CEAA 4TT3D 3BGWA 2FH5B 2ESWA 4ASUA 2QRZA 1XCGB 1ANKA 5DGXA 1BB9A 4MGKR 5JMTA 4D4JA 5KPDA 4CC3A 1WQ1R 4B2PA 5KOYA 5JJIA 1OV3A 1RRGA 1BK2A 3D3QA 4TYQA 4UNNA 2EYQA 2IXGA 4M53A 1U8YA 3IO5A 5IH2A 4WZBE 3PE0A 4ZDWA 2J9RA 2FZ4A 2JASA 1KIMA 3T1VA 5KNBA 1JJ7A 3HWSA 1NG2A 5FUYA 821PA 1E6GA 3BIFA 2KR3A 1ZUHA 1AS2A 1F5NA 4LI0A 4PC1A 3TBKA 1A4RA 1G7SA 4D0LB 5L23A 2CNWA 1Q21A 2AKAB 1HY3A 4KITB 1XEXA 3GJ8A 1AKEA 1P6XA 2ZJ2A 5JEEA 2D8JA 2QZ4A 4KFRA 1UDLA 1OYYA 4JLBA 4TMTA 2V7QA 1XWIA 4QKQA 5BN4A 1A7JA 4KYUA 1E69A 4OHVA 4E07A 5AJVB 3QXSA 4RFSA 1NG1A 2WM9B 4MUBA 2A2ZA 1JR6A 3GLIB 1Z0JA 3EG1A 1U8ZA 4Q9HA 2J0SA 4HLUC 1RC8A 1KZGB 1QCFA 2ONKA 4F93B 5KDOA 4RFVA 3TUIC 2PJRA 1N5IA 3TIFA 3V4RA 3A1WA 4H1VA 4LDJA 1D2EA 4RD4A 2P5TB 2WMNB 4OMQA 2B7BA 2GZAA 2IHBA 2VTKA 4XTRA 3VRYA 1HT1E 1G64A 1TEVA 1YHNA 1R5OA 1S9HA 2CVFA 4LJ4A 5C4MA 1BU1A 2CUDA 4JYBA 3UMFA 2ZS7A 2CL7X 1FW6A 1MABA 1YE8A 4Q7LA 3B85A 1CULC 3K0CA 1GCQC 2JW4A 5FUWA 3IQLA 1OIVA 1SVSA 3VR3A 3REAB 3EARA 4XWOA 521PA 3WYAA 4KO8A 1G18A 2QG6A 3EGUA 1G16A 2HXYA 3KKNA 2PCLA 3QOFA 2CVHA 3I3SR 2ORIA 4PZLA 4QOSA 1O87A 5FPHA 4LUCA 2AHOA 3RDPA 1YR6A 1T9HA 1HEIA 4KJZA 5E7JA 1XTSA 4RTVA 2C98A 3IPXA 2ANCA 2XMFA 1EG7A 1ABOA 3B1WA 4UNRA 1GRNA 2BBOA 1CRQA 2BMDA 3LBNA 2KBTA 1KTVA 3FMFA 1HE1C 4DLWA 3DOEA 3WMEA 3U60B 4JIMA 1OHHA 2ATXA 1FPMA 4DBLC 2O8FB 2ZUDA 3EHRA 2PZFA 1MV3A 2DBYA 3CR8A 4JLNA 4PZYA 5AUPB 5E3HA 3EASA 2VHJA 2QP9X 3N2IA 3GLIE 2EKHA 2YWFA 3Q5DA 4QNMA 3FE2A 5E7MA 3OAAA 3FMOB 2KXDA 2C0TA 4HCKA 4JLJA 4PXAA 4Q1DA 2V1UA 3IIJA 3MRSA 3BXZA 3KQLA 1EGAA 3P1JA 1DO0A 3DDCA 3EZ2A 4FCVA 2MMCA 3MLEA 1BMFA 5JRZA 1XPRA 1Z83A 3NBYC 1G7TA 4M1TA 1AEYA 1P73A 3RSOA 2NWMA 5TY0A 1OPLA 4AFUC 4OI1A 2L3QA 1BYIA 3U4QB 3KJHA 1MO3A 4MUAA 1EFUA 2YDLA 1GNPA 2NOAA 4PPNA 2YWEA 4Z8YA 2JGNA 4JJCA 2MSDB 4JVLA 2ZSFA 1XU4A 3NHNA 3LX8A 4W5HA 4BFWA 2RMOA 3LXXA 1MV0B 2ZRGA 3IBGA 2ZS8A 4NH0A 4ARZA 2BMFA 3H2YA 5SZHB 4Q47A 3P4XA 5FWBA 1L7VC 4GLMA 3CR7A 4Q01A 4MDEA 4Z54A 1PKTA 1S4QA 3OIWA 2ZR7A 2JLVA 2JIZD 4Q1FA 2XB4A 3EPLA 3VR2A 2GRJA 4FI3C 5TV2A 3BFKA 3CRMA 2G9NA 2CJWA 1E6CA 3PUZA 1I07A 1XBTA 3W3ZB 4I1OA 4X1VA 4LJ6A 1U0HC 3Q8XB 2L3SA 1K76A 2MIOA 3WNBA 4GOJA 1Q1EA 4NYMR 1JQJC 2V6JA 1H8ED 2J1LA 2CHVA 3KFXA 4X8MA 1DELA 4A9AA 1NBME 1XZPA 3T15A 4LYJA 3RS4A 1ZSGA 1QWFA 5TXGA 1IN5A 1IOZA 1VCMA 5HTKA 4YLGA 3UXMA 2ZI3A 2XEXA 5HE8A 3SHFA 1NP6A 3THOA 3R9WA 1GRRA 1GP2A 1NYGA 1HUQA 2BEJA 1T91A 1Z8FA 3NPFA 1E32A 4YMSA 2O8CA 2KNBB 4HVWA 3OFND 2IBMA 1NLPC 1XZQA 4E22A 4J9FA 1ZX6A 2UZIR 3DOFA 1CR2A 2FEOA 1XTKA 4OQFA 5DYGA 4OQNA 1Z3IX 3ADBA 4IXMA 4WZ6A 5BN5A 2J41A 2EQBA 4OQXA 1PKSA 1II8B 4LHZA 2K3BA 4JZ4A 5L3SB 5GVSA 4CVNA 1WRBA 3K70B 5F9FA 5FPSA 3WYFA 1QRAA 4JLKA 3FMIA 3QXJA 1D2MA 1KK2A 2GZHA 4AG2C 1Z5ZA 3LVRE 1AJEA 2V3CC 1CJMA 2CT3A 2JLYA 1OPXA 3AP1A 1KK1A 4OMOA 1AWOA 2WHXA 1QHHB 3TR5A 4IJMA 1KDOA 2KYMA 1E2JA 2H57A 2OAWA 1TQ6A 3NDBB 4JBYA 4JSYA 4LC1A 5JCPA 2WMOB 3RS2A 1AOJA 3A8TA 1XEWY 3QWYA 5JHGB 3RNJA 2X77A 5CJPA 3CM0A 1ODFA 1XJQA 2RMKA 4A92A 5CK4A 3B9QA 1G291 4M9XA 3RC3A 2FDCA 1S2MA 2QPTA 3QG5A 3I35A 5FOSA 4LYFA 3B9PA 1VIYA 5KNDA 1QVRA 1X86B 1ZBDA 4RTXA 3IIMA 4WAUA 4DIDA 2QROA 3I4LA 4A82A 1RRPA 3VKGA 4HSEA 3QWXX 1K6MA 2RPNA 1KNXA 3R9IA 3IGFA 1W36C 3FFBA 3RC8A 1BBZA 1VHTA 2FJUA 2GAOA 3T12A 2VL7A 4CT5A 2J3EA 5TVKA 5TB5A 5HZHA 3SQXA 4MDFA 1AD5A 1K5DA 4HLUA 4A63B 1ZUYA 1H65A 2ZJYA 4LSGA 4B73A 2FN4A 4YXWA 2WTUA 2GK6A 4B47A 5IK2A 3OE7A 1KGDA 3GJ3A 4M1YA 1XPUA 4JLMA 4NYIQ 4DSOA 4KSCA 3C8UA 1US8A 3GPLA 3UMSA 2OZEA 3ETLA 4S2EA 1N5ZA 4WCIA 2FPMA 4PQFA 5EE0A 5EXSA 5JWRA 4O2RA 1EK0A 1R5BA 3K0CC 3IPYA 1WDXA 1IN6A 1L4UA 2J7IA 2VBCA 1LF0A 2ZRJA 3PVLA 4PZZA 2JCSA 1L2TA 3D31A 4DT1B 1JXOA 1NN0A 1W0KA 1GNQA 5JJKA 2IEZA 2H92A 4I1VA 4JVNA 3MWYW 2CT4A 1WB9A 4M0LA 3QKRB 1KNQA 4RTZA 1IXSB 4ERNA 5CITA 2JM9A 3PJRA 3M0EA 3BJIC 1P9NA 1CRPA 2IYSA 4ACAA 4A1FA 4TQ9A 2OT3B 1VHLA 2ZITA 2J6OA 3BK7A 4Q03A 4EQ6B 2V55B 1CJKC 4D8DA 2KSQA 4HAXA 3MG9A 2QTVB 2K7AA 3GMTA 4XIGS 1GTVA 1SXJE 1OW3B 3B60A 3P32A 3PENA 2IUUA 3LLUA 3LV8A 2HYDA 5JFGA 1OSNA 4TYPA 1PV4A 5FTKA 4BFTA 3SNHA 2AKLA 1ONBA 4FW9A 1XB2A 2OM2A 3GCGA 4BLOA 4TYYA 1E2DA 2Z83A 1JB1A 2G0TA 4NL4H 4P4SB 1UJ2A 4LE9A 2WAXA 2KXCA 2GXSA 3CF2A 5HCNA 3U7HB 2K79A 4TYWA 1NJFA 1QG2A 4MKFA 3A58B 4RD0A 5LB2A 3NWJA 1UAAA 2JM8A 1R0WA 2KI5A 1M1YE 3GJ6A 1IAQA 3X2SA 4PAQA 2V8OA 4MH0R 2WJJA 5HKKD 2XZPA 4BUJA 2Q3HA 1FNMA 2WPDA 3B8HA 4C0LA 3EPJA 1TU4A 4NDZA 4QT7A 2ZYVX 3GFOA 3MUFA 2AXPA 2B6HA 1E3MA 2PMDA 4RZ2A 2EGAA 3HYTA 1B0UA 3GLGB 4M22A 3H1TA 5SZKB 2Q3MA 2WJGA 4IFEA 4FMDB 1OLOA 2X8AA 2P3SA 3BB1A 4GMXA 2A08A 2KB0A 1WYXA 2FRYA 4UJ3A 4L16A 1E9RA 421PA 4A36A 2KRNA 2KEAA 4NONA 2GTJA 2FFQA 2RQUA 2OCAA 2ZJ5A 2BJVA 3SEAA 1N6IA 1QHGA 2KJQA 3KDSE 3Q9LA 1X2KA 4ZKEA 2YYZA 1O3YA 4HUQA 1M7GA 2G6BA 3EIQA 4KBGA 5GJWB 1AIPA 1E99A 5KDDA 1E1RA 1MKYA 1ZCAA 1ZM7A 2AFIE 3NH6A 1NN1A 3SZRA 3T34A 3P27A 4BECA 3TVDA 3G0HA 2ZI9A 2D3WA 1OH8A 3BB3A 3WHKA 2CH4W 4B34A 5LPNA 1Y57A 1J8MF 2QE7D 1IXZA 3QE0A 5E95A 1T0HB 3CRRA 3S1AA 3GD7A 2YC2C 2VVKA 4HB0A 3THXA 1AA9A 2EGCA 3BE4A 2OAP1 2V4ZA 3H86A 1GFDA 2O0JA 2REOA 4P4TA 1ZBJA 4P32A 4QGAA 1EFRD 4KFUA 1CF4A 2FRWA 2A5JA 3HR7A 2WWXA 1GITA 4B2IA 1E2NA 1VTKA 3OFNA 4LRWA 3X1DA 3R7WA 1M2OB 4DLUA 1OB2A 4IKEA 1J99A 2QENA 1QDEA 2DBMA 1OIXA 4F38A 1ZUKA 1E1QD 1JEEA 2J0UB 4KU4A 1WXUA 3H41A 3SYNA 4BFUA 1HJDA 1Q1QA 3LO5A 2ZUCA 3QBTA 2C99A 1NMXA 1VG8A 4MYHA 5KNCA 4JL8A 3TAUA 3I62A 2HCJB 3E1SA 1QBKC 2ZRAA 5LD2B 1N0VC 4W7SA 2W58A 2WAYA 4TWZA 2I3BA 5EP3A 4AD8A 4J9EA 4PPQA 2PZ1A 3CO5A 3RNLA 1DAGA 3AVXA 3VS5A 2WSMA 3UANA 3QPVA 1SQ5A 3E5HA 1GKYA 4V02A 3CB4A 4A4DA 3H0HA 2QAGA 3KQKA 4UQOA 4QHYA 2QPAA 3TKLA 3OEED 2EYYA 4Q66C 1X3SA 3WP0A 2RCNA 3ADKA 2LMJA 1F2UB 5CDFA 4HB4A 1TQDA 5IXBA 1W7AA 2IUTA 3GEHA 2BHRA 2ORVA 2QP3A 2WWFA 3PG5A 3SYLA 1TF5A 2VPPA 2ODBA 4QBFA 4JT4A 2VSXA 3CWZA 4AFQC 2DJQA 4Q18A 4N0EA 5EP1A 2X3XD 4A0GA 3U7EB 1QKXA 2K5UA 3EWAA 3ZYCA 4AYWA 2L0AA 4Z51A 2ATVA 1ESMA 1GL6A 2JJ1D 1ZD8A 4A0RA 1ZRHA 4DUGA 4B33A 5FFMA 4MKHA 5DN6D 4TYNA 3R9XA 2DNUA 5IRCD 1E9AA 4OI0A 1YRBA 4AKIA 4EIKA 2FV8A 4JJKA 3U44B 3VU9A 1CSKA 2KYBA 2VF8A 4P0TA 2Z6VA 3PEUA 2MCNA 3LY5A 1UEIA 3TUZC 4I81A 1PNJA 5LBIA 4GI7A 4AYTA 5HE9A 2W2TA 2BC9A 4D6PA 1QHXA 1NL3A 1M7BA 1YZNA 1R4AA 2GHIA 4OQLA 3EWSA 3D6TB 2D2FA 4UXIA 4A0FA 5KPJA 2ECKA 4B44A 5HZKA 2VRWA 1FMKA 1BO6A 5H8WA 4HVVA 2AWOA 3QVVA 1U90A 2AFHE 3KXKA 2ZYUX 4TLDA 3QQ5A 2R44A 4LV6A 5EUMA 2XOKD 2OJ2A 2NZ8A 3M1IA 5JS7A 1W1WA 2PLRA 4C0JA 3L0OA 1QHSA 2X19A 1CEEA 1OF1A 2OCBA 1G21E 4Z8AA 2GVDC 2VF7A 1VG0B 1LS1A 2D06A 3JZAA 3TSOA 4W5JA 2ZAMA 2OEPA 2VIIA 3ONWA 4Q4JA 3CIOA 1XFAA 3AVPA 4XWAA 4V0LA 1JR3D 1JBKA 1S3GA 1UG1A 2LKDA 5EJEA 2NPFA 4TL7A 2CCKA 4DLVA 2ODWA 3N70A 1R10A 4TL9A 5K8LA 5G3YA 1YRAA 2R2AA 4M1KA 1P7CA 2JLXA 1OIWA 3QNUA 3QXHA 3KFVA 4Q02A 2FFBA 1Z06A 4YMUA 3BH6A 1E94E 4B6FA 3MSXA 2HEIA 1KJZA 2ZI6A 2IYWA 1UHFA 1G8FA 2A9KA 3PV0A 2W6ID 3SJAA 3BFVA 4B3XA 1ABQA 1J90A 2CMKA 1TQ2A 1TPZA 2BCGY 2BMJA 3CNOA 4TQUS 5EE3A 2AK3A 2IS2A 1T0JB 2IF2A 4B76A 4LHXA 2KE9A 2AK5A 2W0ZA 3VRZA 2ZSBA 4D80A 4DLTA 4BEBA 3AGPA 4WIAA 1GRIA 3C41J 3SR0A 3VX3A 1Z9QA 3WRYC 5KHOC 1GUAA 4URZR 4B3DA 2D7DA 1KDPA 3BERA 4AFSC 4HUTA 3QPUA 2GA8A 2HT6A 2ZJBA 1ZD9A 1K4US 1HA3A 4WBSA 1W0JA 3DO6A 5IDVA 3GEIA 2VP5A 3TQCA 3ICEA 1X1SA 4ILEA 1YNZA 4PHTA 4WVFA 3A1TA 2NO0A 1NJGA 2P65A 2WWIA 4NTZA 4EAQA 4CEIB 3O47A 4EJSB 1XJ0A 2DWOA 3ZIAD 3GQBA 1SXJA 3EA0A 2O8EB 3NH9A 1KSJA 2DBKA 2GETA 2CUBA 1KY2A 2H1LA 3AF0A 3KB2A 1N0UA 2QMEA 3TW8B 5I11A 1DAEA 2WJYA 4PAMA 2V54A 2GJ8A 2BEKA 1G3UA 3BD9A 1UFQA 3ZQJA 4XH9B 2J6KA 3REGA 2NMVA 2EFHB 2ZRIA 1X2QA 2C0IA 3HR8A 4RD2A 1LW7A 1ZIPA 4NU0A 4EFLA 2YINC 1FMLA 3K0AA 3NC1C 3MD0A 2GCOB 4DSUA 3TSZA 2YZ2A 3F8TA 3THYB 1GFCA 1R7RA 1JJVA 2DB3A 1CS4C 2J46A 2IK8A 1S96A 2G1KA 3K9NA 4KSBA 3CH5A 3QPWA 3W8RA 1IY0A 4L8GA 1YJ5A 3EX7C 5E4FA 1PVOA 1NLZA 2C03A 2D4HA 2F1RA 5JZVA 3IHLA 2ZVQX 3LLMA 3FMPB 2DL8A 4HVUA 2E1RA 1MH1A 1P2UA 2J0VA 4LUDA 4FIDA 2J7PD 3GLFA 2OFOA 2VKNA 4UJ5A 4DT1A 4KFTA 2V1XA 4OHYA 1E9CA 2J7KA 3AGQA 3NIBA 3KX2A 4D26A 1RVDA 2ED1A 1G5RA 1E4VA 2QU8A 2QBYB 3LH5A 2WWHA 1UF9A 2EYUA 4BLSA 4KV9A 4RSGA 4JL6A 2F9MA 1GOTA 2ZQ5A 4F14A 1KO4A 3TGPA 2L3PA 2RQTA 2OV2A 2W10A 1SZPA 1CR1A 2ZRPA 2J59A 1KDRA 3KZ1E 2Z43A 1Q1ZA 4I99A 3VHLB 4LK2A 3VS6A 1XD2A 3CRQA 2YNMA 4Q00A 2GF9A 5BYKA 4DCTA 2OI3A 1J7KA 4N0DA 2O9VA 1UM8A 3O8DA 2YWGA 1IQPA 2RGNC 1XD8A 2P0EA 2RQRA 2W0SA 3K9LA 3QVUA 4OBEA 4IW3B 4A6XA 1T3LA 2LQWA 2BBWA 1E79D 4V0KA 4MGYR 1NEBA 3ZH9B 2RGDA 4PX9A 5DO9A 5EP2A 1XMJA 1Z2CA 2GCNA 3AF3A 4EPTA 1GBRA 2FPFA 4E6RA 3R20A 3PFIA 4ZCLA 4DJTA 2PL3A 4QRHA 3AKCA 4YDSA 1TUDA 5FR2A 4URYR 3TH5A 4BFVA 4B43A 5AR1A 1S0UA 1N5LA 4DLXA 1Q20A 4GNKA 2ZR9A 2WZQA 2A36A 4JL5A 1WDTA 4AK9A 1RJ9A 4G01B 3FPAA 4KAXA 4L9WA 2AK2A 4EPVA 2ZM5A 2NUZA 2FFAA 1SVOA 1W4CA 1FOEB 2KE5A 3GLGA 1G4AE 4OMLA 1DARA 4Q7MB 1T5LA 1ZMXA 3RLFA 3K0FB 2CLCX 3LQQA 2CK3D 3LX5A 1Z0AA 5DISB 2WSSD 1XTRA 2G3YA 5C2JB 3EXAA 3WYGA 1Z9ZA 1GG2A 4Z1MA 2LKCA 5HCIA 4RTTA 2XB2A 2ODEA 3X1XA 3G5UA 4I1SA 1KO8A 3IKJA 5D3MA 1CJUC 1W0JD 2FSIA 3ASYA 4OQMA 4R2IA 1IJFA 4G5GA 3OIYA 2ONJA 1T8UA 5G53C 1ZCBA 3SOPA 3U3KA 1AS3A 1R0ZA 2A5GA 2C2HA 2QNRA 4UXHA 5LD2C 1QLYA 1UE9A 2EPDA 4LV8B 1SRMA 3I8XA 5FTNA 5F9HA 2TMKA 1AZSC 2RH5A 2ZRLA 3R8FA 2P6RA 3EZ9A 3EZ7A 2XXAA 1ZNYA 1TNDA 2BV3A 3CNLA 3KXIA 3WBKA 3D8BA 3UPUA 3AP3A 4CC2A 1MO6A 1NF3A 4IOKA 4HAUA 4DLZA 1G1MA 3ZLJA 4LGMA 3DVLA 5C46F 2J05A 1MV5A 1ZM2A 2OXCA 4HDQB 4QGGA 2IYYA 1A2KC 1A5TA 1NIPA 4Q5IA 1R8QA 3VKHA 3A36A 3WBJA 2FPDA 3QUSA 4GT1A 4ZDKA 5E7IA 3J81k 2VA8A 3K0SA 4CEHA 4W9MC 4QHSA 1FP6A 2BCJQ 4RTUA 1OXXK 2IXFA 3PVQA 4QL3A 2WWGA 4DLSA 2XX3A 4XTCS 3SYKA 1E9BA 3NBXX 4LJ8A 3FHOA 5JWOA 5GJCA 4ZO4A 3RRMA 1AM4D 4TZ6A 4II7A 4J9HA 2LJ1A 4PSAA 1PLKA 2CSQA 4P31A 3IILA 3EPKA 4BFYA 1E2PA 1OT3A 1GL7A 2H8KA 4Z88A 4P3YA 1Q57A 4NPHA 3TAHA 1N3BA 3I5RA 2ZAOA 1IXRC 1VG9B 3BH7A 2OCYC 2I0NA 3VNUA 2C77A 1S8FA 4TLBA 2FPEA 3NBFA 5ELXA 1AZGB 4GDFA 3LD9A 2Y8EA 3L8ZA 3QKUA 2GVZC 2O31A 2R65A 2ODNA 5J47A 3Q7PA 2X1VA 4E09A 3K1JA 4F16A 1E9DA 5AJWA 3RWMB 1H92A 2PEZA 4DLYA 3NGPA 1XXHE 2D0NA 1SXJD 1FL9A 4KHZA 1E9EA 2Q9CA 2ZJ8A 4D0GA 3EG3A 2N46A 3PCRB 4G5OA 1GAJA 121PA 2C9OA 2YOGA 1TUEA 1V43A 3L2OB 3EA5A 4J9GA 3EW9A 3VR1A 2HF8A 3IDQA 1SXJC 4RD3A 1IN4A 3SQWA 1NKSA 1NRJB 1JPNA 1R2QA 4TTPA 4YMVA 2YWHA 1F3OA 2QQEA 2XAUA 5K8TA 5EUQB 2WOJA 2KRSA 4XJXA 1NN3A 2F55A 1W4RA 2O8FA 5JSZA 1QHYA 1ZUNB 4IOLA 5GVRA 5KYKA 3M0TA 2GNCA 3VS4A 2QP4A 8OHMA 5IHPA 5DNYB 4NMMA 5J40A 2DYBA 4HDOB 3P26A 1KI4A 2ZS9A 4FCWA 3CZQA 3CX7A 3ZIAA 3U7FB 3MWKA 1TMKA 3CLVA 5DI9A 1JAIA 4J9BA 1WXTA 2R6FA 1C9KA 1R5NA 4LX0A 3PIRA 3TRFA 4RD6A 4V0MA 1KHTA 1UADA 1XDBA 3TR0A 5HKKA 2HBWA 1OH5A 3AKDA 4JZKA 5J4LA 1RRCA 2C5LA 3E70C 3BORA 3N2EA 1FFHA 4R71A 3M4YA 3MJRA 4BZPA 2XTMA 4GBQA 1KK3A 3CUEF 3D7MA 5G3ZA 4DSTA 1BMFD 3L0SA 4TLEA 1FX0A 2Q21A 4HB3A 2AZVA 1N5KA 2WJIA 2ZJOA 2JATA 1HE8B 3BFXA 4BLPA 4UKDA 4NCHA 1PUIA 3PITA 4P4UA 4O0MA 1XPOA 4GP6A 5CYOA 2EWVA 4LJYA 4OI4A 3A4LA 5FPKA 1C4OA 5J4VA 2L2PA 1N5JA 1KSFX 1E6HA 3V00A 4EJSC 5JI3E 2G88A 1U0JA 2W6IA 5A4JA 1U5SA 2SRCA 2O8DB 3R6NA 1HURA 2EFGA 2ZTSA 3EAQA 4RY2A 3AVUA 2AZSA 2DFLA 2LJ0A 2FPKA 4IDPA 1IONA 2XSZA 3HDTA 2ZRNA 2K9GA 2E87A 4MYCA 4ZIRA 2PCJA 2C78A 1J3TA 2RKOA 4FXPA 1M8MA 2CH4A 2DX1A 3O5ZA 3UG7A 2YUQA 1KMHA 4DEXA 2JAQA 3BB4A 3HPRA 2O0HA 2ABLA 1EFRA 1OFHA 1OEBA 2OBNA 3T06B 2ROLA 1F2TA 4QGHA 3AVYA 3G82C 4ESVA 3B82A 3NHBA 1Q22A 1QG4A 1BOFA 2YOHA 1RI9A 1Z0FA 1SULA 4LWZA 3BH0A 2AWNA 1E1QA 2C95A 1NY5A 1P4SA 4KI0A 1S1MA 4GZLA 3QIAA 4JJBA 1WA5A 5BXQC 4CYMA 5JCZA 1UEJA 2H8HA 5DH9A 5DIFA 5GJBA 1TQ4A 1X6GA 2ZSDA 4FMDF 5J4YA 4NCKA 1FNNA 3FTQA 4AKEA 5I22A 4FWTA 2GK7A 3KUDA 5F3WB 4IIMA 1TF2A 5DE3A 1SHZA 1B23P 2CREA 1FYNA 2RNAA 1QHNA 2DFTA 3I1FA 3Q7QA 2E5KA 4C0SA 1G17A 4L15A 3EHQA 2IWRA 2JMCA 3AQ4A 3CPJB 2VWFA 1QF9A 5CK5A 4U02A 1Z0IA 3C15C 3MJHA 2XZLA 3H84A 2P2LA 3VR5A 2GTPA 1Y3AA 3EC2A 2FSGA 2O88A 4EKDA 1J70A 5ANRB 4F4JA 1U2RA 1ZM9A 2ROTA 4UNSA 1GILA 4R2HA 4W5WA 2OE2A 2QMOA 4AFZC 1XEWX 2WICA 5FOTA 1W4BA 2ZRDA 4JPBW 721PA 2G1JA 2C9CA 1EFCA 3K0AB 2ZYTX 4QM7A 5EP4A 1NIJA 3MCAA 2CCGA 1G8HA 3GLIA 2CLDX 2A37A 1VYUA 4XSHA 3THYA 1G6HA 3AP2A 4D8KA 2W83A 5KSOA 3QBVA 2F2WA 4B3CA 4TMZA 2FO0A 2NGRA 3CKLA 1JQQA 3M0RA 4Q9KA 1XF9A 2QGZA 1SRLA 2K2MA 3F5FA 1EWRA 4LUEA 2CNWD 2J45A 4PPFA 2JIZA 1Z2AA 1MABB 5FW9A 3ZL7C 2FFHA 2EYZA 1AN0A 2ZRHA 3B1YA 2D74A 5IK2D 2D1XA 5FR1A 1GZSA 1CKEA 2FOLA 3NXSA 4FMBB 2GJKA 1HD3A 1KI6A 1U81A 2DLPA 2JTEA 2ZJAA 2GKSA 1P9RA 4Q7KA 3GJ7A 4EFMA 2WV9A 3JVUA 2XZOA 2GBQA 2H5EA 2FPLA 2VHTA 4M4SA 1COWA 1H8EA 4AURA 1Y63A 1W0KD 4RCYA 2V9PA 5FUXA 1EXMA 4GZMA 1U99A 3A6PC 4KCGA 2FGJA 4JZ3A 3W8NA 4BZXA 2GJSA 4MKGA 4PC3A 1E2FA 2VYFA 2Q6TA 1SHGA 3CRW1 1HQCA 4OMMA 1KSWA 3VU9B 4CIDA 4RZXA 1YKSA 3L0PA 4K46A 4OKSA 3HP1A 4HI0E 1LF5A 1F60A 2GAAA 4GRAA 4PO1A 4IDNA 4E03A 3O8CA 1TTTA 1D8TA 1ZW6A 3RRNA 2B21A 4DSNA 1AWWA 2DFNA 1KOFA 4M8NE 3U6BA 2MSEB 3T1QA 1WFWA 2F3TA 2JJ2D 5FBQB 3K9GA 1G3QA 3THWB 5J4HA 2EYWA 3U3OA 2QEQA 3ZS8A 3FGNA 1I4LD 1MRNA 3UKDA 1KY3A 1G7CA 2HDNB 1YZUA 2RHDA 4JVMA 1W36B 1M3CA 3VKWA 3MGCA 3GJ4A 5DI3A 3K8YA 3GLHE 4C0HA 5GJVC 3I92A 1N6OA 3GJXC 2J87A 1JI0A 2G6FX 1KI8A 1KIKA 3PVSA 4Q4JB 1KFZA 3RANA 4Q4AA 3IEUA 5G40A 1NMZA 3ZD6A 4P4SA 1DE0A 1P72A 1NNEA 3H4MA 1EX7A 3W6PA 1LCKA 1OYWA 3L0IB 2HDAA 4C7OB 1GRQA 5BYJA 4JYCA 4JS0A 1YZLA 2KBEA 3AM1A 3CH4B 3QXXA 2W6JA 5BW8A 1LV7A 2PT5A 5CYPA 1TAGA 3DMNA 2WVJA 1N6LA 3FOZA 1KI2A 2EW3A 1R0YA 4ON9A 1M3BA 4DB4A 2XTZA 4Q19A 4A8JA 4RUGA 3RRYA 1HYQA 2FNAA 3RYTC 3TQFA 3ZZTA 1PUJA 1HQYE 1HT2E 2EW1A 2FE4A 2NPIA 3ZD7A 4J0QA 4MQBA 1D5CA 4BRUA 4ZKDA 1II0A 2UVQA 2WBLC 1WA7A 2HLDD 4B3BA 3LNCA 1XRJA 2PTKA 4R0KA 4BWYA 2R6DA 1VCNA 1XNJA 3NEJA 2A5DA 2F3RA 2ZE8A 2CXXA 1J8YF 3WY9A 4LNPA 1RZ3A 2FWRA 4LHWA 3U3RA 3ADDA 1GNRA 2GNOA 4XSGA 3NDPA 2XOKA 4NHOA 2Q9BA 2BM0A 2DM1A 1W1FA 2WSSA 3CNNA 4F92B 3K09A 3BAFA 1T4GA 4GOXA 4TSFA 5D3QA 1DAIA 2QTFA 1S3SA 4AG1C 1E9SA 4ZCMA 4BEJA 3QF4A 4Q4HA 4LHYA 1XCPA 1Z6YA 4IEIA 1II8A 1XXHA 4TQAA 5L3SA 1E7OA 3OIVA 2ZSAA 1QVAA 1VDZA 5FTJA 1SVKA 5KDLA 4F7WA 3AKYA 2B86A 3GLGE 2DL4A 4DVGA 3KTAA 4LV5B 3UK6A 1W47A 1B07A 1TU3A 3C16C 4UNQA 3R7WB 1JEDA 2VP6A 2G0NA 3TMKA 3DPUA 1G3RA 1WCV1 2NIPA 5DN6A 2PZGA 3CF6R 2ZREA 2N1BA 3KL4A 5C1BA 2GESA 1XP8A 3FB4A 4HLQB 4IOMA 4PANA 5FPYA 3DM5A 3VR4A 3EPHA 4LJ9A 2ZI5A 1VECA 5JI2E 1CKBA 4PQRA 4PSVA 4Y0VA 1IJEA 1NKTA 1OH6A 5HPYB 1M8PA 2W0MA 3TJZA 1SKQA 4EIWA 4QNRA 4C0KA 4S35A 3N5CA 4DIEA 1PLLA 1UKYA 4GFDA 5LB4A 1N6PA 3KQUA 4LBWA 1NLYA 1G8YA 5CLLA 3FVQA 1DADA 2ZRBA 3CWQA 1PLJA 5FI0B 2IUSA 3B1ZA 3U23A 1OJLA 2IYQA 3REFA 2ENMA 1FP7A 4HAWA 4LJ5A 5EXXA 5FBLB 4MRRA 1K1ZA 2J5XA 2VHQA 3A1SA 2RN8A 1GL5A 2QE7A 5CIWA 3VHXA 4DDVA 5JHHB 1E2KA 5J4KA 1HH4A 3MFYA 3SFZA 1TEXA 1GSIA 2DCUA 1I0CA 2YC4C 3L82B 2X2EA 4NBSA 4CZ2A 5JECA 1SEMA 4F17A 5CDFE 1Z0DA 4WXPA 2IYXA 3HJNA 1FTNA 1NI3A 2LQNA 1IN7A 3RS7A 3FKSD 4HAZA 2KGTA 2PZEA 2QTHA 4US2R 1EWQA 1XEFA 1CR0A 1AGPA 1UJYA 3T5DA 3VS1A 3ZDQA 1B3QA 4TLCA 5EE1A 2BDTA 3X1WA 1CTQA 2AN9A 2HSPA 2Z5FA 1NYFA 2QT1A 1ZNZA 4PPGA 4B3GA 2CL6X 1GIAA 1UBGA 2BKEA 2AKYA 2C0OA 2XNDA 2ZE5A 2QSYA 4G1UC 2QA5A 1WXQA 1G6OA 4Q9IA 5AK0A 4B3FX 1AWXA 3T1OA 1U8AA 3RABA 5CB8A 4EQ6A 1KO5A 3ZGXA 2IIMA 1I4TD 2DILA 2IHYA 3BC1A 3LA6A 4TT3A 3SJBA 4MA4A 2BTTA 4ZPXA 4DDWA 2F43B 1UKEA 1YWPA 2NG1A 1U9IA 2Q0HA 1ZU5A 3ICQB 1A82A 1VKJA 3RS5A 5JLJA 1DAMA 1W5TA 1YZTA 1ZINA 2BKUA 4XWKA 3QJYA 3IUYA 2C9YA 5JEDA 3A1UA 4JKIA 5IHNA 1Z63A 1P2SA 1H8HA 2JLRA 1T3SA 3IQXA 1EFHA 1JNYA 2PH1A 4FCTA 4IVPA 1NBMD 2WWYA 3B6EA 4G5QA 2WJHA 4URWR 5CLQA 1GBQA 1R8SA 1Q44A 3WMFA 2BZ8A 4J9DA 4DC9A 3PQCA 3B1VA 2OILA 3MWLA 2XXAB 4HATA 3FHTA 1DPFA 1RYFA 5DHAA 1OB5A 3GLHB 3C5HA 4AC9A 5KSYA 4Y92A 2D62A 3PEWA 1RYHA 3A4MA 4LCBA 1MRSA 1TL7C 4C2UA 3I32A 2BZYA 3OHMA 3T61A 1G20E 3I72A 1VPLA 4TN1A 1UECA 4BPBA 4ZDIA 2AKKA 2YJTD 5AUQA 1KO7A 2OAQ1 4PC2A 1PHTA 4FMCF 2V7QD 3KKQA 3SEMA 1NSFA 3WXMA 5GADl 2G77B 5LDDC 1OFUX 2HJVA 2VLIA 2J06A 1ZUIA 4IOJA 4JT2A 4LBYA 4DDUA 3NVAA 2JJ8A 3PUYA 4K81B 1W5SA 3CQTA 1IBRA 2GEVA 3U3MA 4PTLA 1XTIA 2FSHA 3FHCB 4PHHA 5JRJA 2O8CB 3H0KA 3THKA 5J5CA 1AZEA 3WMGA 4DUGD 3U3JA 4CEHB 1H8KA 2DMOA 1OFIA 4HZUA 1I2MA 1W46A 2GGRA 2MSCB 4RTYA 4F4IA 3KB1A 4NYIR 1D9XA 1SVWA 3ZVNA 1TUCA 3A4NA 2VP9A 2PLFA 4HAVA 4Z89A 4XVRA 2BIFA 1T0HA 2HXSA 2J7PA 3TUJC 4K11A 4A8JC 4BRWA 4EPXA 3THXB 3M6AA 4HZIA 4CEIA 4FD2A 4BFXA 4CGZA 4PQYA 3C0CA 3IBYA 1CP2A 2EFDB 1KZ7B 4C30A 4CC4B 2GQIA 4OHZA 1P2TA 3ZVRA 2R62A 4B75A 3O8RA 2F2XA 3VS2A 4Q1EA 2YOFA 5G41A 5AWFC 1XEXB 2ZUBA 2BBSA 1PWTA 4PSKA 3ND9A 1F6BA 3RBBB 2JDIA 4D25A 5EZ5A 1JU5C 2CE2X 2IXEA 2NO6A 5FOXA 1X69A 5FPTA 1PRLC 2IT1A 2OBMA 3OEHA 1Z6XA 2EFEB 2QMUA 1E0JA 1G8PA 2QUZA 1IM2A 2EGEA 2XTNA 4RFSB 4ESHA 3P4YA 5B58C 4YXWD 1YU9A 1N25A 1P9WA 3MAAC 2R6AA 1AZTA 3NMZC 3KQHA 1DG3A 1ZVQA 5AUOB 1I4DD 1N6HA 1Z07A 1ZD1A 2BBTA 4TL8A 4CDGA 3FJ5A 4B35A 5H1YA 1K0SA 2LJ3A 1K8RA 2VHCA 1Z6AA 5FH9A 3FYHA 1OKKA 1DG1G 1YZKA 4NCNA 5CM8B 3AUXA 4URXR 2O5VA 4FSSA 1TX4B 3IHWA 1D9ZA 4AG6A 4AWXA 4LBVA 2BZXA 1YR9A 4OK6A 5EE9A 4D2IA 3Q85A 1ZJ6A 1RPZA 1ZC4A 4N1AA 2HV8A 2ZETA 2DRMA 1LFDB 5ECAA 1M30A 3SU8A 3GLFB 1L8QA 2C8VA 3H0FA 4I1UA 2G83A 2B7CA 4IDHA 3AV0B 4OHXA 4RKFA 4BLRA 4BGDA 1E2MA 1YR7A 3IIKA 3VS0A 1CIPA 2RHMA 1AWJA 2Q9AA 3DEFA 4A2QA 5L3RA 4BASA 6Q21A 4A2WA 5IT5A 2I4IA 2LWIA 1N6RA 1X8KA 2QL6A 4IEEA 3W90A 4M4ZA 2FG5A 1K0XA 2IEYA 2VP2A 3Q72A 2VQSA 2RGNA 4US0R 3W6NA 2AD5A 4JSTA 4A15A 4H1UA 5HCKA 2IYTA 1UJ0A 2KROA 2REXB 3F0TA 4US1R 1VMAA 3TK1A 2EBPA 621PA 2O0KA 1PRMC 1PJRA 3UWOA 2PJZA 4HDCA 4U00A 1OXTA 5FWCA 3ZZUA 4HYYA 1NVVQ 1T3HA 5L8VA 4G5SA 1UDWA 1X43A 2R8RA 4YC7A 3HU1A 3GFPA 4URVR 2CDNA 3LDAA 4D4MA 3VFDA 3I61A 2ZR0A 1XOVA 1TG0A 4Q4AB 1E2EA 1TF7A 2D7CA 2EVWX 4L5BA 4PHGA 2DR3A 3V9PA 1MO5A 2ZRKA 1OHHD 1WI7A 2RAPA 3T1TA 4JMPA 1IY1A 2O8DA 3U2QA 4CT4B 4EDHA 3AEZA 2K6DA 3KKPA 1GCPA 3MMPA 3SC3A 4JJZA 2IA5A 1ELOA 1MUZA 3M0QA 1N6NA 4AY2A 3QEOA 3U4QA 5IHKA 1DAFA 4BFSA 3RAPR 3UMRA 4LOAA 3REBB 1RE0A 2DFKB 3GJ0A 4MGZR 4TZ0A 2SHKA 4CEJA 1K5GA 1PZNA 5H68A 3QKSB 4DCNA 4ARZB 5CB6A 5F98A 1G7RA 1ZP6A 1XJCA 4IFBA 1M6NA 4NZYA 2HYIC 4WA7A 3AVVA 2IW3A 5M04A 4JVSB 4OK5A 3X1ZA 4RZUA 1Z6TA 3GJ5A 3LW8A 5AUNB 2OHFA 2H16A 1BS1A 1KKLA 4TMVA 5TDHA 1E1RD 4C2TA 2GEUA 3CX8A 2P67A 2CJWB 2YVUA 4DXAA 1YZGA 1OPKA 3ND8A 4KLZA 2OESA 3ZQ6A 4JJDA 2XITA 4V03A 2HF9A 2RF0A 4MRNA 2WKRA 1GKIA 4C0QC 4NP6A 5KU1A 2Z4RA 2DL5A 1SGWA 1AKYA 2ANBA 1T0JA 3GBQA 3LQRA 2BVNA 3DM9B 1W4AA 2ASEA 3JVVA 4QGFA 4M21A 3LAWA 4BE7B 1XXHB 4O25A 1XCMA 1I1JA 2YT6A 1VCOA 4MRSA 2R9VA 1DS6A 4BLTA 3QI2A 5IHIA 4H9GA 4M9SA 4EPRA 4Q21A 1AGRA 4GOKA 2W2VA 2JS0A 5JBQA 2KBFA 2PX3A 3GEEA 2PX0A 4E5UA 1YN8A 4LJ7A 3WNCA 2IC5A 3AB3A 1NVWQ 1ETUA 2NO1A 4L4UA 1W36D 4Z1MD 4B6EA 4F91B 4C0BA 2JMAA 3VX4A 3IEVA 3QXCA 3OIUA 2A3RA 2L0XA 2BM1A 2P6UA 4KLNA 3M0UA 4TLAA 4YONB 4OK3A 4DCSA 2FGKA 5L3QA 5A0FA 2X3WD 2KT8A 4OHWA 1H8HD 1GFIA 1LNZA 1BKDR 2Q3FA 2GZDA 4MYTA 5HR5A 1XTQA 3AF4A 2YSQA 1DAKA 2VSFA 1MR3F 4HLDA 2NQ2C 1SXJB 2GBLC 4KXFB 4DCUA 4LN2A 3H0IA 2D8HA 4KRTA 2YHSA 5FL7D 1E79A 5K8UA 1UUEA 1NY6A 1ZC3A 2QM8A 4OI2A 1Z0KA 3SS8A 2W00A 1P61B 1JECA 4ZI2A 4LHVA 4EUNA 1JXMA 1UGVA 1CJVC 4R9UC 2HJGA 3C4JA 2J0UA 2ZXUA 4Q1CA 3PUWA 1IO6A 1A0NB 1QHHA 4WW0A 1N0WA 1UBCA 2A7QA 2ZROA 1VA7A 3VTKA 4M9ZA 1E9FA 1YP5A 1G5TA 2ZSEA 3W3AA 3ZVLA 1RUWA 4PR0A 3AH8A 3RS3A 5EXTA 4B48A 3SFVA 5KTYA 2DWQA 2IYZA 4WZAE 4AG5A 1W6XA 2YUNA 4KVGA 2B8TA 1DTSA 2GXAA 3FKSA 2JLWA 2AR7A 3P20A 1WX6A 1CJTC 1I2DA 1W2GA 3OEHD 1S1NA 2QAGB 1OV4A 2IS1A 1FUKA 3HU3A 4UXJA 4A2PA 1NG9A 2WIBA 4WOPA 1ZLMA 5JJLA 3SI7A 1NSTA 3LVQE 2M0YA 5EC7A 3T35A 3KJGA 2ERXA 2H18A 4UNPA 2FF7A 4PO8A 1IY2A 3RWOA 5KUTA 3TE6A 4RTWA 3RVBA 4NE2A 3K70C 3DL0A 2GXUA 2FX3A 2IYRA 3BBPA 4IDQA 4N3NA 4X8LA 5FTMA 4DRZA 5TMPA 1LB1B 3DKPA 1ESNA 1XX6A 1EESA 2ED0A 1CBUA 2FU5C 3F3YA 1UFFA 2O8BA 1RKBA 2M51A 5FOWA 1YCSB 1RW4A 2GJ9A 2F9LA 3TW4A 1E98A 1X1RA 3UWKA 1CXZA 1WXBA 3AF1A 2GJAA 4QJ4A 4XVUA 1LTQA 1M34E 4MGIR 1G2BA 3NHAA 5DI3B 4DZZA 2OXRA 2F43A 3QF7A 2R6CA 5BQ5A 4GMDA 5F2EA 1JALA 1TUIA 1GVNB 1MOZA 4RZ3A 4L9SA 5EXPA 1X8JA 2HLDA 4LPKA 4OJQA 1EX6A 1FUUA 3CX6A 3OZXA 4ITRC 4LJAA 2I1QA 2XNDD 4GSYA 1W2HA 3GP8A 4M9QA 2CHGA 4EPWA 1UKVY 4QBIA 1XMIA 2F2VA 4ESRA 1G3IA 1VYTA 4C7OA 1G41A 1Q1BA 1DOAA 2D2EA 3CZPA 2VH5R 1BH2A 1KJWA 3SDZA 1Q3TA 4QFMA 2GTOA 4POAA 2ZYWX 3GLHA 5AJYA 2QGNA 2DF6A 4TMWA 4TTRA 2DPXA 4BLQA 2XSZD 2BWJA 1WE2A 4JLAA 1WMSA 1NLOC 4XOIA 3UF4A 2GEDA 2ZI7A 5IF9A 5BWMA 1JAHA 4ZV4A 2V1RA 1E96A 4HEJA 2X2FA 3K09C 2ZRFA 2DE0X 5B64A 1ZUUA 3LFUA 1ZNWA 4LY6A 1JPJA 3SBEA 1M3AA 3EG0A 2UKDA 4Q9LA 1KK0A 2JLSA 5KO2A 3W5JA 3OEEA 2QPOA 2VO1A 1HTWA 1U9IC 1QHIA 1FQJA 2P6NA 3A1VA 1E2IA 2HT1A 3W9YA 3L8YA 4ZI3A 2ERYA 4Y0AA 4C0AC 4DB2A 1S9DA 3SHWA 1UPTA 1M7HA 1E2HA 1FMJA 4ABYA 3LRPA 1U3OA 1GDDA 3I5SA 2HCKA 1SKYE 1AVZC 2WKPA 3B5JA 4HZUB 4I4LA 2VEDA 3QEJA 3VMFA 1CKAA 2AXNA 2EQIA 3RHFA 5UKDA 1ZYUA 4QBHA 2ECZA 2ZU0C 4ACBA 2PEYA 2OUKA 1XMVA 3OESA 2PMKA 2WWWA 4X8HA 1NLFA 5AJXA 4IXNA 2PBRA 2OO7A 2VHUA 1AK2A 2ZU6A 4KVAA 1ZNXA 2XJ9A 4DDTA 4D0NA 4IRUB 2IL1A 1U98A 3SJZA 3W6OA 3PEYA 3QENA 3UG6A 3JZMA 2ORWA 2BOVA 2W2XA 1G8GA 2JEOA 3K53A 3KTAB 3SN6A 1M27C 4HXJA 1D6JA 2FSFA 1WF3A 3BOSA 4HAYA 2JLZA 1NM7A 2CSIA 2ZVPX 4PC6A 2P4RA 1SHFA 1T8TA 1NEGA 1P3JA 1A2BA 3UATA 1C1YA 4XD7D 1JO8A 2LNHB 1BYUA 2XGJA 1TADA 2QM7A 1YZQA 1OOTA 1AQYA 1JQLB 4M1SA 4FMCB 3AVOA 4QJ3A 4NYJQ 1P62B 4OYHA 4ASUD 3CONA 1ZIOA 3O8BA 2NTYC 3I9QA 3WP1B 2QAJA 1E2QA 1KAGA 4GL2A 2J0QA 3B7GA 1FQKA 1X8LA 2NO9A 4RD1A 1KAOA 1SPKA 3KKMA 3ASZA 2OLJA 4JKYA 2WPDD 4TMXA 2C96A 3KJEA 1Z22A 1EFTA 1SKYB 2RB4A 4RKEA 3KKOA 4D82A 4JLDA 4ZNXA 5FBRB 3B2EA 1JEGA 4Q48A 1CLUA 1RRFA 4M1OA 1L4YA 2RGGA 3RRZA 2VP4A 4G3XA 2O2OA 3FKQA 1LS6A 3ZS9A 1KI6B 1R6BX 3ECCA 4HB2A 3EZ6A 4OMNA 4B71A 3QKTA 2JJ1A 3U61B 4QHTA 3FFAA 1KSGA 1N6KA 1ZAKA 4HLCA 1U0LA 1XTJA 2SEMA 2VP0A 5JWHA 3EC1A 4DKXA 2LCFA 2RGBA 2FA9A 4GP7A 1YVDA 2DHRA 2Z0MA 2F1HA 5P21A 1G83A 2F1JA 1OXUA 4QG7A 4CC7A 2FZLA 4LYAA 2Z4SA 2JXBA 2NO7A 2DA9A 1KMQA 2DYKA 1X27A 2DL7A 4CW7A 5JSZB 1WBBA 4YQFA 4O2LA 2ZE6A 3HU2A 1RIFA 3AUYA 1F2UA 4QC2A 1SVMA 4U5XA 5K8IA 1YR8A 2ZANA 3T5GA 3K0EA 1SHKA 2EU8A 2JLUA 4TMKA 4QJ5A 3HYRA 2FMXA 4D4KA 4AKGA 2XJ4A 4DEYA 1NVVR 1UDXA 2RQVA 3KQNA 2F6RA 1IHUA 1KSHA 1SVLA 1XD9A 2WIAA 5DSZA 3M0PA 4AI6A 1II9A 1E2GA 2EYXA 1YQTA 2HUPA 4FWIB 4C4PA 3PEVA 2GXQA 2QSZA 3OAAD 1P5ZB 3U7GA 3B78A 2QQ0A 2JLQA 3GFTA 3L43A 1A1VA 3GLFE 3TSWA 5CIQA 4DLRA 1XD2B 3C7KA 5DLQC 3MWJA 5FL3A 1KYIA 2BMEA 2OCPA 3SBDA 2QMHA 3I5YA 3CF0A 1KI7A 3DHWC 2ZEJA 4CEJB 2WOOA 2KWIA 4AYXA 4EPYA 5B2ZA 2QT0A 2HCBA 3IO3A 4LYHA 1AQUA 2IWHA 2DWPA 4QM6A 3AF2A 3QKRA 4JBWA 4KFSA 221PA 1GM5A 1VYVA 2QAGC 1VIAA 1Q3HA 1QKWA 2YUOA 2A30A 3RSLA 3CPHA 3R8CA 1HSQA 4JBXA 4AKHA 4NCJA 1Z47A 3QY0A 1Z6GA 1QZXA 2XNSA 4IVRA 3KJIA 2QN6A 3NBZC 4MYUA 3BS4A 3TVTA 2JJ2A 4V0NA 3HPQA 3EIHA 3OE7D 5BN3A 3WNDA 3OF5A 3Q3JB 1RJ9B 3EIEA 5TARA 1H3HA 1P60A 2E9SA 3LWNA 2RGCA 1G3MA 1J2JA 3SJCA 4KYIB 1JR3A 4A8JB 2A5FA 2IYVA 5FBVB 2F7SA 2ZPTX 2IYUA 4RVCA 1NVXQ 1NN5A 1OXSC 1V5WA 1VG1A 2P5SA 1ARKA 3K0FA 3NTUA 3U6KA 1LVGA 4V0ME 2B92A 5AJZA 1IN8A 3WRXC 1NVUQ 4FN5A 3LBIA 4TSFD 5SZIA 1ZU4A 5GJVB 2JDID 1OH7A 3E2IA 3RS0A 1G5PA 1E0SA 3LW7A 3TLXA 4TL6A 2IS4A 1SSHA 1DVRA 1D2NA 2IX3A 3VNVA 4RJLA 3EG2A 1OXVA 2PT7A 1U06A 4FINA 5D3MB 4PHFA 4XD7A 4D4LA 1UBFA 4C3ZA 2KRMA 2JT4A 1COWD 1R0XA 1W70A 2QI9C 1UBEA 4YDHB 4IHQA 3FWYA 4B32A 2JS2A 1OE0A 2OFXA 3PUVA 1N2CE 4A0HA 5A5GA 2CE7A 5L3QB 3ADCA 3CBQA 4JLPA 3PXGA 4X8OA 3W34A 1V1CA 2RGXA 3QF4B 4Q4HB 4V0OA 4LZZA 3SE0A 3CPEA 4OMPA 5DHFA 3ZJYA 2A78A 2GWHA 3I73A 4RCZA 1ZM3A 1S1CA 5KSPA 4GPTA 4R98A 3UA7A 1Z29A 4IDOA 1NMYA 1ZM4A 4B74A 4HUQB 3NKVA 2LX7A 1OFTA 2W6JD 1DAHA 4ZDJA 3PUXA 2YKGA 3JV3A 5EZ6B 1CR4A 2EVRA 4QBGB 2N42A 2OSBA 4PFSA 4R7ZA 3IQWA 2WJVA 4J9IA 1HV8A 4BZQA 4BQSA 1KO1A 4BFZA 1LY1A 3S1AB 4Q7JB 5FL7A 1KI1A 1Z28A 5B30A 1W44A 2LP5A 3LBHA 4EJSA 1MT0A 2O8EA 1MO4A 1AS0A 5KSZA 2VSOA 5B57C 2REBA 3AVWA 2JA1A 2GDJA 1UHCA 4MRPA 4NKRA 3EG5A 1E2LA 2FEIA 1RFLA 2IF0A 3DKVA 1CU1A 3EZFA 1G19A 1X6VA 1M74A 2LZ6B 3VS7A 3K70D 2ZJZA 4AIIA 3C14C 2GBLA 3FDIA 1GCQA 4NYJR 5FOUA 3QSYA 2CLSA 3VAAA 4NCIA 3LXRA 1UTIA 2A28A 4K8OA 3ZZ0A 2QY9A 3WHLA 2PNIA 2AX4A 2GCOA 4KODA 2ZI4A 2A5YB 1KI9A 2CHQA 2FG0A 1E0AA 2C04A 4Q4LA 2CL0X 5EQTA 2O8BB 2YUPA 2O9SA 1BIFA 5IXFA 1DEKA 1GL9B 2AD1A 4ZCIA 1JR3E 4U7DA 2F1IA 4GBMA 1GKUB 4JLOA 3B1XA 2QDLA 2RGAA 3DZDA 3PR1A 1VCIA 4M2LA 3W5IA 4C9BA 3A37A 5FBWB 1F48A 1G4UR 2DY1A 4DWJA 5CM9C 2H17A 4MITA 5FUVA 3VS3A 2OFWA 2WKQA 2AL7A 4F4CA 3BWDD 1P2VA 5FTLA 3U5ZB 1Y0MA 2NZJA 2DL3A 4MKIA 3V4FA 4YMTA 1KI3A 2CK3A 2B8WA 4B2LA 4KBFA 1E0KA 1Q0UA 3NG1A 4PAOA 1FTSA 3KUCA 1GWNA 5GJWC 3X1YA 2GILA 2QBYA 5H70A 4CRWB 2MOXA 3CRVA 3I8SA 1G9XA 4O3MA 2H7VA 1WIEA 4J9CA 3THWA 2CDTA 2OLKA 4M1WA 5EE5B 1DO2A 4DHEA 4JLVA 1WLPB 2RGEA 3UA6A 4EFNA 3AVTA 3DMDA 2V1QA 3A98A 1DBSA 1NBMA 1Q12A 1US8B 4XVQA 3U44A 3B13B 1U94A 1KDTA 3C5CA 3NC0C 4Q9JA 4IIOA 1FX0B 4DCVA 2IS6A 3ZVMA 5FI1B 2O52A 1X6BA 2RQWA 2KT1A 2QORA 4Z8XA 2UZ3A 3NEYA 3QKSA 3M0SA 1T5IA 2DRKA 2ZRMA 4TTQA 2DVJA 5CJ2A 1KJYA 1SVIA 3I5XA 5DYIA 2LCSA 1W49A 4M1MA 3CW2A 4QXAA 1RLPC 4LC0A 3ULRB 3QG1A 3BRWD 4MRVA 1P75A 2V6IA 2ZE7A 2J6FA 2MMGA 1FZQA 3K9HA 2ZIAA 4G5RA 4PC7A 4Q1AA 1K9AA 1KKMA 2ZRCA 1Z08A 2OBLA 5FOVA 1EFNA 3TNFA 4ZIRB 5L3VA 3AKEA 4IVQA 1UKZA 2QRNA 1QWEA 4URUR 4P33A 3DZ8A 1XMSA 2GCPA 1KMHB
chains in the Genus database with same CATH superfamily
4ORZA 2F8MA 1Y37A 4M36A 3VR6A 3TU4K 1P7WA 5BOSA 3PR2B 2PG3A 1AC5A 1M8KA 2I1VB 2Q5JA 4H60A 1A9PA 4LBZA 4TWBA 4D81A 1JRLA 2X1LA 2Q3BA 2WHQA 2XLCA 1AV6A 3Q5EA 4KMSA 4OL0A 1VKNA 2GF0A 5KYVA 5HK9A 2DVEA 4KXXA 4WKPA 5JS8A 2QXUA 4Z4FA 4ZQIA 5B6IA 2ECFA 3E22B 4FP9A 3W4KA 1UKBA 1ZEMA 5CTAA 4HFMA 4ID9A 2VRCD 3WK7A 1AXEA 4A6PA 1LUAA 2QX9A 4WXHA 2UZAA 3DCJA 2G9QA 4LQCA 2FR8A 2OBYA 4PLVA 1T3TA 2OG2A 1YIDA 1A2QA 1TKBA 4KQKA 2CEAA 2ONZA 3L8DA 3LL4A 4YHBA 1AVTA 1XCGB 1ANKA 5JXJA 5J2UA 1OYOA 4YUYA 5K3OA 2ZYHA 4CC3A 7AT1A 3MCVA 1QQBA 4I3GA 5JJIA 1OV3A 1L5SA 1BK2A 1PT5A 1TTQB 4KSYA 4PRYA 5H82A 3UK7A 4BXOB 3BA6A 4M53A 3R4CA 4N01A 3AERB 3U31A 3DL4A 1GL3A 2PXXA 4QU8A 1DC3A 3JD4A 4REMA 3BIFA 1ZUHA 1F5NA 2XY4A 5K3FB 4D0LB 1A4RA 1G7SA 5L23A 1JTVA 4I5FA 1Q21A 3EXG2 4N9QA 4FFBB 1P6QA 2JHFA 5GONB 4KITB 1EQ2A 5DCWA 3GJ8A 1A0OA 1AKEA 1L8AA 1M6HA 2BAGA 4OPMA 5CRIA 1AB5A 4A6DA 5JXHA 3KSBC 1UDLA 2Q3EA 3MKDA 4YJFA 3IUPA 4QKQA 2ZUSA 4W4TA 1AGNA 1ZQ1A 3OZRA 3OP1A 2EIFA 3ZGYA 3LLVA 1SUEA 2ERCA 4HMQA 4K2AA 4U7WA 5KCZA 3ZCPA 1ZK1A 2QVYX 3LX4A 3VHRA 5IJ9A 2J0SA 4EP1A 2UU9B 2X6TA 3LKZA 4HLUC 4G37A 1RC8A 4GXRA 1XGKA 4JP1A 4IQ8A 2ZZKA 1SBYA 4O4HA 1W88B 3A1WA 4LF7B 1R9GA 3HL4A 3L6DA 2C2ZA 2IHBA 4L1KA 3VRYA 1TEVA 4A54A 2PUCA 1S7GA 3INRA 5FYQA 1PJSA 4W1RA 4ZVKA 1V0JA 4M7DA 4JYBA 2C7PA 1K7FB 1FW6A 4C21A 4ZYZA 2UXDB 3GLKA 1MNAA 2XA9A 4C6TB 1UBUS 3R3XA 5CVEA 3KR1A 2HAXA 4YIKA 3UYKA 5JYEA 2IBTA 2X13A 3JARA 4BC1A 5AW7A 4ZI7A 4RA6A 1BW9A 3REAB 4LY9A 4UDYX 4XWOA 1ITZA 1G16A 1TFUA 3N0TA 3QOFA 4HNQA 3O4VA 2CZ7B 2ORIA 4IUYA 1DBQA 1VGQA 2GF2A 2JBWA 2O2XA 4CV1A 5C5DA 4LE0A 1U5AA 3SVZA 4LUCA 4B3RB 4LDUA 2AHOA 1PZXA 1YR6A 1TTPB 4MR8B 1J24A 5JD6A 4ZEMA 2Y1XA 5E7JA 2XHZA 1J0BA 5JADA 2ANCA 5F2NA 1OXMA 1HDGO 3JWGA 3QHAA 4RF3A 1ABOA 5JD3A 4UNRA 2RM4A 3CCEQ 3E15A 3O1JC 4PZPA 1THZA 1CRQA 1I3KA 4LOLA 1IOWA 1HE1C 5BQPA 3K15A 3D6FA 4H59A 3WMEA 1Q6YA 2BTEA 3SLGA 3U60B 4Q34A 4R2JA 4YLYA 4KE9A 4G23A 1B3RA 1OI7A 1DC7A 2YYAA 4HGYA 3I0ZA 5AM3A 3M57A 3CR8A 3GUCA 3P2OA 2C7BA 5F5NA 3S2YA 3CH7A 3A1NA 5AUPB 3OW2S 1V7QA 4NE7A 3GLIE 2VHJA 1Q1GA 4TKZA 1CVIA 4AKSA 4G2NA 3AR2A 1K2WA 4N5NA 4JX9A 3C7AA 2XCTB 1WKVA 4Z6KA 1HLGA 2XHCA 3NT5A 2C0TA 4PXAA 4I6JA 3PHGA 3IIJA 3OOWA 4L4XA 3YASA 4UU1A 4WPGA 2L89A 3BXZA 5C1OA 2GCIA 4X84A 3F6RA 4QFCA 4F6RA 3KQLA 3P1JA 1DO0A 3LWBA 3N9IA 1T5HX 4FCVA 5CCDA 3MLEA 4F3TA 3BZUA 3FFXA 2K2VA 2DU8A 1MIOB 4FOLA 1C9MA 1G7TA 1VIFA 1UMDA 1JDVA 1L1EA 1P73A 1PL8A 2GFIA 2UUPA 4AFUC 4OI1A 2L3QA 4NIMA 3RC2A 1QP8A 4JP5A 1KOJA 4PPNA 3FWNA 1R3DA 2JGNA 2E4VA 2Y9PB 4JNCA 5LQKA 1NQXA 1W1IA 3LOQA 5I7SA 2XK0A 1Z12A 1SM4A 3LX8A 3RB8A 5L7TA 5COBA 4TV9F 4D42A 1MV0B 3EWNA 1L5WA 3IBGA 3L04A 1BE6A 4YAFA 4JJEA 1B2LA 1XXLA 4GLMA 1HDEA 3CR7A 2HQHA 1JHRA 3ROGA 1S4QA 2WYWA 3OIWA 4YT2A 4UAJA 2ZR7A 4Q1FA 2XB4A 6ABPA 2CV0A 1GNLA 1XQ1A 2NUAB 2NLOA 4FI3C 3JQAB 2HKIA 4COOA 1C7JA 3QFFA 3OU7A 1N0IA 4B46A 5E6RA 1SRRA 4J1TA 2P79A 2VPZA 5DASA 2W4MA 1Z6QA 5L6LB 2FQWA 2ZCVA 3NS7A 2X0NA 1SWVA 4FFDA 2E48A 1XBTA 4ANFA 1U0HC 2J6BA 3Q8XB 4JSRA 3E4DA 2WJ6A 4U7GA 2MIOA 1E1CB 3WNBA 5GANd 2H7XA 3S3MA 3UHJA 1JQJC 2XEDA 5KTNA 1FDTA 2V6JA 1H8ED 3JR7A 1CYEA 3LCCA 3SC2B 2CHVA 1XAIA 4D45A 5TGZA 2O5EA 1V1RB 4WVLA 4P84A 1ZSGA 4MQ6A 3H11B 4HDSB 4TZKA 1PF7E 1JTFA 2VAPA 1YQXA 4F85A 1VCMA 4IV0A 4LC9A 3AY6A 4UUMA 3TD6A 2P0AA 4MUJA 3R9WA 2DM6A 3D2CA 3VNRA 4LWQA 3ZI0A 1Z8FA 4IIJB 4GC9A 1NQOA 2QD1A 1E8MA 3RNOA 4E3ZA 3RESA 1NXSA 3P71T 3OFND 4JUFA 1IM5A 4B4KA 2XA1A 4L4SA 3OQMA 2IBMA 4E22A 2UZIR 3EEBA 4Z5XA 1E6UA 4MQEA 1J2TA 2L17A 4RVUA 3CJTA 2HD0A 2RARA 1P0MA 3E0XA 2I80A 1WPRA 4FNGA 3KS9A 4UC0A 3OT4A 2C5FA 5BN5A 1JB9A 6REQB 2JKZA 1FLDA 3FYCA 4O4JB 4BV9A 3HDGA 1JLMA 4JZ4A 4G8BA 3TDMA 3H8VA 4EUEA 1U7ZA 3ROKA 4H08A 1TUGA 1TZ2A 1TZCA 3CKMA 4CLEA 1NNLA 4HA8A 3FMIA 3TLGA 4PQGA 3QXJA 1JIIA 3V4VB 2PY6A 2L5QA 3LVRE 4ILKA 4R84A 2H9IA 3C1TA 2R7AA 4FFRA 1KPGA 3QU5A 1L7PA 2HNKA 2QOEA 2ZBPA 2CT3A 2GFUA 1JUDA 1RQPA 3K9WA 4YI5A 1Z4OA 1P5RA 2YZGA 1DBRA 3ABSB 3L93A 2C0QA 2FETA 3GLRA 1NLUA 5AI8A 1EU1A 1TJNA 3ZTWA 3ZLUA 4BQEA 1DJNA 2RHCA 2ZIZA 1D7OA 4L75A 3WGIA 7GPBA 2CZGA 3FOEC 4TV8A 1K6EA 4W82A 5JCPA 1Q0RA 5FPKA 1HTTA 2IODA 4EG1A 3QOXA 4LGVA 1YJWA 5ESDA 3NM6B 4DRXB 2WSBA 3FB1A 1DJLA 1JIJA 3D6UA 3UN1A 6PFKA 2PM8A 4J9VA 2JF0A 4A92A 3B9QA 1G291 2FDCA 4OEHA 5IVIA 4DNQA 2PMWB 4L51A 1S2MA 2PVSA 2XXBA 1Z0SA 4RLSA 4NG5A 2QQ9A 4X62B 3AX6A 4L95C 3CCVA 1PEKE 3UAOA 4X85A 1SWWA 4OF1A 1Y9JA 1ZBDA 3R77A 3ONEA 4K40A 2QROA 1TU0B 5BSUA 4L8LA 5IF3A 4EGFA 1HT0A 1RRPA 4A82A 1K6MA 2RPNA 2VN8A 3T7TA 4RS4A 3FWZA 4C7BA 3FFBA 1W36C 4N12A 3MP8A 4NNJA 3K71B 3UFXB 4KO1S 1I6KA 3KYIB 4G97A 2W8BA 4O2BB 4XARA 5TB5A 3SQXA 4HCBA 2B37A 4MDFA 4U6SA 1FQOA 1PGOA 1FSSA 1K5DA 1K8XB 3NAGA 1LDBA 2W2NA 4HLUA 4LSGA 2WLSA 5EIHA 3W3AH 3KALA 1T9CA 4I50B 4B47A 3HWWA 1QX4A 4D5GA 2WTUA 4U8GA 3BQNB 3S2IA 4IGFA 5AHOA 3KLOA 2P75A 3FUVA 5GY7A 3RD5A 1WB6A 3VBEA 1PK7A 4JLMA 4F4HA 1E1DA 2ZTVA 5B55A 3SQMA 3GPLA 2B25A 3T8YA 2TECE 2XIQA 4HLNA 4S2EA 4UUAA 2O06A 5IDXA 5JWRA 1YS2X 2OV1A 1EK0A 2ROQA 3ODGA 4MO9A 1IBMB 3IPYA 1WDXA 1IN6A 1RWMA 1NXTA 3PC8A 1T4DA 4RDCA 4RJTA 1LI7A 1Z4NA 4PZZA 3PVLA 3ZKAA 4L6CA 4EVRA 5AW3A 2V97A 2QZPA 5E9AA 1JXOA 3F9CA 3HR4A 4IO1A 4KVZA 1MXHA 1NN0A 2QX6A 3L8GA 5D6YA 3PKIA 2RH9B 5YASA 4UFPA 4I1VA 4FOTA 4N39A 4R68A 4X34A 2G4CA 2QVBA 3MHPA 3QKRB 1CSEE 4EVSA 3H05A 3RADC 3PJRA 4KR2A 1YJNQ 3QHSA 5TC4A 4BO2A 4LFAB 5IASA 4ACAA 1GUFA 1NR1A 5JO0A 3DNMA 5TRTA 4XAXB 3ZBDA 1CR6A 1L7QA 4X65B 4Q03A 4EQ6B 2G07A 1ULBA 2QRHA 1CJKC 2YN2A 3G7SA 3JYLA 2DC1A 2H9YA 4JENA 3W2GA 2Z6QA 3MG9A 2F69A 1BCMA 3GELA 1QCCA 3GMTA 4XIGS 4FS8A 3JB9I 1TMYA 1GEGA 1WUJS 3PENA 3LV8A 2HYDA 2WYVA 5PGMA 1DBPA 2W2PA 1QVVA 3O3MB 4BFTA 4BCBA 3FVWA 4BLOA 1WWKA 2OM2A 2WF8A 2ZYGA 3GCGA 3KT6A 5IG2A 1SBHA 4TYYA 2QZZA 3BDIA 2WEKA 1Z3CA 3D6MA 3KCQA 4NL4H 4P4SB 4XJVA 1EIWA 4WXYB 4LE9A 1GTMA 4ZU3A 4DFDA 5DRTA 1D0ZA 2K79A 1QG2A 4I08A 1L5KA 5BV1A 2N3ZA 3N05A 4BKUA 2YXPX 4UUPA 2ATCB 3GJ6A 1JG3A 1IAQA 2AG1A 3X2SA 3VSDA 1M1FA 3ZUGA 2V8OA 1JLKA 2WJJA 3JCMJ 3IULA 3P2IA 3S2FA 5HZMA 2VDMB 4GNRA 1KVRA 4LZPA 3B8HA 1IWBB 3IAXA 5DW0A 4C92A 3NAQA 4NC9A 4UDXX 2E70A 3DMGA 3OYLA 1TU4A 4KMMA 3U3DA 4LXTA 1HZZA 2X8LA 2H51A 3ABRB 2I99A 5LMUB 2AHJB 1YDHA 1TK2A 2C3PA 3DW3X 3VPAA 2PMDA 4LX8A 4WERA 1K9MU 3ABOB 4D7AA 5G1NA 3PE4A 1S72T 2WJGA 1X01A 5LJ3j 2EHDA 2OD7A 2P3SA 3F70A 2CB9A 3IV6A 3P0JA 2A08A 3DUFB 4OMDA 2FRYA 1R12A 1GLGA 1YVEI 2XQGA 4L16A 4R0VA 1WQWA 4UJ3A 3UB4A 421PA 3JZIA 1DEAA 2G40A 3KM0A 3L05A 4K28A 3S70A 1FDIA 1OC2A 2GTJA 1C0PA 2ZJ5A 4A6EA 2BJVA 3DEJA 4N7MA 1U8TA 3EFHA 2KJQA 1HYEA 2EZ8A 4YT5A 2C7GA 5B7GA 3BK2A 3FJ1A 5FO1A 2E55A 3KOOA 2X9GA 4C7XA 1E60A 1O3YA 4HUQA 5CFPA 2DAQA 2G6BA 5AVUA 2QLMA 5GJWB 1AIPA 2JNWA 3H65A 1ND6A 3LUGA 4H4DA 3NH6A 1X15A 4UTVA 3RK1A 2ZI9A 2D3WA 4BB5A 1OH8A 1RM0A 1F1JA 4PCAA 3B1KA 2ZPFB 4R9SA 1K92A 3DDUA 1CV2A 4WLNA 1Y57A 2LVBA 2AFHB 2FVXA 4HX5A 3QE0A 4P3KA 4RMHA 3S1AA 2J3LA 2PRKA 4O4LF 5IM5A 3THXA 3I9NA 1AA9A 2CP0A 3BE4A 1QVPA 2V4ZA 1LRJA 1GFDA 3FZGA 3FNFA 4P4TA 3W7VA 1ZD3A 3RVDA 5JBIA 3S81A 2OSVA 5ES3A 1SK8A 1I7LA 1EFRD 1XKQA 2FRWA 3HR7A 3IDAA 3JRXA 2E4YA 1GITA 1E2NA 1VTKA 4PKCC 3GH1A 3P9NA 3R7BA 3X1DA 3EG9B 1A88A 3OIGA 2Z9BA 3K4HA 4DLUA 1L8LA 1OXKB 1SXHA 4BQNA 2ZAIA 3EGOA 1ZUKA 1SUCA 4IINA 2P4EA 1TO6A 4OUKX 5BSTA 3WZLA 5KQMA 2XNKA 2MTBA 2YZMA 3QBTA 4YGXB 4RA9B 3SMQA 1THGA 1X9GA 2J6HA 4UE6A 5EZQA 5KNCA 2HCJB 3UMGA 1V95A 5E2BA 5I21A 4EB3A 4N7BA 1VI5A 5CKDA 4TKUA 1YA6A 4W7SA 4DQLA 2WAYA 2I3BA 3H9NA 2AJ8A 2C9MA 1PR9A 1DAGA 2RHWA 1DRKA 1QO9A 3CO5A 2FX2A 3D4BA 2R7KA 3H3JA 1BD3A 2J08A 3E84A 3Q0TA 2OA0A 3TNYA 2FI1A 3UANA 1PSZA 4V02A 3E5HA 1GKYA 1GKLA 4C6HA 3QELB 3DLPX 3H0HA 3ORSA 3AUFA 4O5OA 4UQOA 1QW1A 3TX2A 4DIUA 4MEJA 1MJHA 3ASUA 1KA9H 4RK0A 4XIIA 3WP0A 5BSVA 3HKDA 2F1OA 3ADKA 4PWYA 4HB4A 4PJOF 4EMKC 1T15A 5AJTA 2PUEA 3BMCB 5DNWA 1W7AA 3DDSA 1WO8A 4JAVC 2H0QA 2QP3A 2WWFA 5LNK1 4LVCA 4YR9A 2Q6LA 2FJ0A 1EE1A 5CMLA 4KOEC 1YCYA 1XZAA 2R97A 2QR5A 4Q18A 1I5EA 1RC0A 1O58A 4KR0A 4MPTA 3WMXA 4B1FA 4FDLA 4B81A 2CNLA 2I0FA 4YRZA 4WCFA 1OULA 1O5OA 4KWTA 5A6VA 4Y18A 1EHIA 3A6JA 3IAM1 2FZ5A 4UMDA 4B33A 1GN8A 5FFMA 1X19A 3R9XA 4H7IA 5KYXB 1XHEA 2IKSA 2ZYSA 3PD7A 4QT0A 5I7FA 2AXEA 4KWIA 2P4UA 4O4IA 3TKYA 4IDBA 1PN3A 3DCYA 2P11A 1LNXA 2MCNA 1ADGA 2CBGA 2BUAA 5LBIA 3LUKA 4FKBA 5KCOA 1RE1A 1YMUA 5KQGA 2W2TA 2QQRA 1NYQA 5CT5A 4EJSC 4QICA 2QD2A 4TVKA 4CV2A 2RBGA 2IZZA 1AO3A 1YIAA 2HBQA 5A3SA 4G0YA 4NOMA 5DGCA 3DOIA 4DWOA 1HI9A 4WACA 4F4UA 2ECPA 3M4GA 3L2RA 1XQVA 2AWOA 2AJLI 3HM2A 4B6QA 3QVVA 5KYGA 1U90A 2XCUA 2AFHE 1W52X 4E5PA 1UC8A 4TLDA 2H4XA 4JD5A 3CC2A 1G9TA 4IIVA 3QQ5A 3ZXUB 3HKBA 2VZLA 2PSHA 4C92D 1EE9A 1R0LA 2XOKD 3M1IA 1W1WA 4WWHA 5IBPA 3UMVA 3ZHQA 1XNIA 3INNA 3L0OA 5C81A 5KYYA 3C5WP 1OF1A 4HDRB 4I9UA 1X7XB 3IP9A 5JNSA 3F6CA 2BEVA 2QTZA 3DLTA 1I81A 5AKJA 2GVDC 2VF7A 4G1MB 1Z5VA 1I9GA 1LS1A 4R0MA 1ABEA 1RU3A 1SVNA 2AOTA 2OTJQ 3B9RA 2ZAMA 4J2OA 3TSOA 1Q81C 1LX7A 2VIIA 4BMNA 5C8YB 1XFAA 1GZHB 1PR2A 3S68A 1WXGA 4CLOB 2OGUA 3JQBA 1ZVMA 3FYUA 4GYKA 3AVPA 5KX5F 1GLNA 3GU3A 4R2MA 5BOSB 1D07A 1UG1A 2LKDA 3OY2A 5JZOA 2Z9CA 5K8LA 3E9MA 3HRIA 2D8AA 4ZVMA 4DGSA 4AZ0A 4XJTA 4E1AA 2NO4A 1H1LB 3I6MA 1PTKA 1T13A 4BYMA 5AVZA 2JLXA 1ZXBA 1TYDE 5A4IS 4JRQA 1F0YA 3KFVA 4JUBA 2FFBA 4C07A 3VVLA 3R74A 1E94E 2HBPA 2HSEA 3AESA 4EB6A 3MSXA 4Y1EA 1JN0A 1Q83A 2IYWA 1QH8B 2XMDA 2A9KA 2ETXA 3SJAA 1KVSA 3BFVA 1ABQA 2Z2YA 3K6RA 3LFHA 5T3UA 2DPPB 3DSRA 2CMKA 1TQ2A 1NQAO 2Y2VA 1WXWA 2DRIA 3ICOA 3NWOA 3TQ7P 4U2DA 5LJIA 5EE3A 5KINB 4BRSA 2AK3A 2QGGA 3MEWA 5AYFA 1T0JB 2IF2A 3TRKA 2V5UA 1ISIA 3FOFC 2OD9A 2H08A 2YIDA 4J4TA 4AAYA 3MP1A 3ZJTA 3VRZA 2A3NA 3HVUA 1H2EA 1O08A 4ZZ2A 2RK6A 4PLYA 2V7BA 1IATA 4WIAA 1LI4A 3V3KA 4R5MA 3KAJA 5KHOC 3BJRA 3JTMA 2LTOA 2DPHA 3PTZA 4GKJB 1IHXA 3CSUA 3KR2A 5AK5A 3OCXA 5F77A 5FD8A 4JJGA 1F6WA 3I55A 3QLTA 3HI6A 4HUTA 4ZCTA 2ZJBA 4CTJA 1TECE 1W0JA 1BX1A 1PJZA 3AO0B 1IHOA 4BIMA 2Q4RA 3F46A 1NU6A 2OFFA 2EKQA 4PHTA 5AT1A 4WVFA 1U6IA 1C6VX 5DM7R 3A1TA 1CZHA 2YHIB 3A4YA 1H1TA 2FE1A 2IPAB 3DFMA 1F0NA 4HEA6 1XE3A 4NBUA 3U7JA 4EAQA 1D5WA 3QPAA 3WQRA 4EJSB 4CEIB 3HFGA 2G5PA 3GCWA 2ZPIB 1KSJA 2GETA 3LBAA 4OSPA 5TIIA 2FWIA 5IP5A 2HBYA 1N0UA 2QD3A 5I11A 1O96A 2WJYA 3R23A 2AQIA 2X41A 3CC7A 1TJPB 1I1OA 2OO5C 3EOZA 1G3UA 2VEOA 4X1KB 3V48A 5HF9A 2JFHA 4BJ1A 3ZQJA 2ACEA 3CF4A 5SYMA 3HCOA 3LKVA 3OA2A 4U0KA 1JYFA 1V7ZA 2ZRIA 4TS9A 1X2QA 1XA0A 2QIOA 2QTNA 5C8XA 1LW7A 1ZIPA 3M6MD 1E61A 3T3MB 2VDRB 1BW9B 5WRFA 4M7AE 1ZHHA 2B9VA 1ES9A 1F0KA 3LFTA 4DR3B 2F8TA 2YRDA 4N47A 4B5KA 4L0QA 2PT9A 4N8SA 2GCOB 4M75A 1ZESA 1ZWLA 3L40A 3TSZA 4HNUA 1ZISA 2YZ2A 1GFCA 4MR8A 3HDHA 4FYXB 1ODSA 1U1TA 1CS4C 1PYDA 2I76A 3TLAA 2IK8A 4UM5A 1JQ3A 2G1KA 2VXEA 3K9NA 4D57A 1HDXA 4KSBA 1LNSA 4C0GA 2JH8A 5CAEB 3ZY2A 3O75A 4Q7EA 1YJ5A 3PFGA 4J76A 2Q4TA 5EUBA 3UF0A 5FAXA 3CCET 3QV2A 1NYTA 5AI0A 1PVOA 2C03A 1C1AA 2D4HA 4QRDA 5AESA 3SQWA 4IHJA 1AHHA 3FMPB 2OV4A 3JQ8A 2ECQA 2J0VA 2RAUA 1N7JA 3UJCA 3ZNPA 2VJYA 4ZYWA 3UVEA 2VKNA 4QOIA 4KFTA 2V1XA 1JR4A 1WMDA 5BNTA 3LKBA 1Q1AA 1Q6ZA 2OZLB 3GLQA 4C7KA 5EMJA 2VJAA 2JFBA 1QANA 1EX1A 2QTMA 5JZBA 4GOOD 2IYOA 2EEZA 2OZPA 3KHKA 2QU8A 5THKA 3FNIA 4MUFA 1UF9A 2EYUA 4HRYA 4KV9A 2Z0WA 2A9PA 2QMYA 3BREA 3JQ7B 3NATA 4MRMA 4WFQA 4XCVA 3JCMg 4F6RB 1VQMA 1H0RA 4EMUA 2GPNA 4I99A 3PC6A 1Q1ZA 4LK2A 5HKOA 2IEGA 3CRQA 1H4VB 1Y6QA 1OJ7A 1Y33E 4GDMA 4N0DA 4BGVA 2O9VA 2VOJA 1AHPA 1NRXA 1UM8A 1J1IA 1YDWA 2YWGA 3F9IA 3RVJA 2FLWA 1NZFA 1RLIA 2P0EA 5IM4A 1M73E 4A6XA 3K6SA 2BBWA 5CKHA 1E79D 2DZCA 2BGNA 4V0KA 4F84A 1GPLA 4ITVA 3OYJA 2RGDA 5DO9A 1T25A 3FNHA 2KQWA 2I71A 1JA0A 4L0DA 4EPTA 2FPFA 4ZCLA 2ZBUA 1VPDA 3AKCA 3LGLA 3W78A 4EL0A 1OYVA 1TUDA 2NUAA 4RV4A 4BV3A 2ZWAA 4OHRA 3TH5A 5E6RB 4M0CA 1QQTA 1ISSA 2RHGB 2Z2IA 4DLXA 1QIFA 4YQYA 4AN1A 1ORRA 3A8LB 3JYOA 1RJ9A 3NAMA 6LDHA 1O7JA 2G7ZA 4L9WA 1N2ZA 5I4BA 1JHOA 1UB4A 1GN9A 1SVOA 1MVOA 3E58A 1P1KA 3I01M 1FOEB 3SX4A 3NWBA 1FMTA 3LYAA 5FB3A 3SCZA 1ZMXA 3RLFA 1RCUA 4GBED 1P1RA 1T0IA 3IIIA 2CK3D 3LQQA 1H6AA 4YJDA 1Z0AA 2X5XA 2WSSD 4LDYA 4LA4A 5DISB 1Y8ZA 2VAWA 5C2JB 1V1RA 1JS1X 1GQ2A 5KQLA 2D5LA 2OB2A 4INAA 3WC4A 5AVRA 1XL0A 3L1KA 5GIPE 2OGZA 1TLLA 5B3KA 3K9QO 1YRLA 2VF4X 4RTTA 3BFPA 3R3WA 4FTWA 3FYSA 4XYBA 5BRNA 5CA1A 2XB2A 3VNSA 2HLNA 3DFUA 1KZ6A 4MWCA 4BFLA 4CM4B 1CJUC 2A5LA 2FXIA 2PX5A 3ASYA 4OQMA 1TO2E 2XMRA 3QMMA 2AEMA 4G5GA 1T8UA 5G53C 3C8MA 5KVQA 4BNNA 3RJ5A 4EAAA 2V5AA 1OX4A 1NX9A 2QU7A 1NU8A 3JD2A 5CT8A 4CT0A 1PZFA 4PAWA 3QVSA 5H59A 4YYZA 4W63A 2AKEA 3K9CA 1MPXA 2DUNA 3EZ9A 2ZT5A 3EZ7A 1TNDA 3L92A 3Q3GE 4CC2A 4U2GA 1DXQA 2Q50A 5G02A 1U8CB 3VTFA 2EZUA 1N2BA 1SG9A 4E5SA 3UPTA 3ZLJA 4IUQA 1LK5A 2GGSA 2Q3JA 3I39X 4HG2A 3N7AA 4ZU6X 4AQ7A 4QGGA 4QXOA 1PKEA 1HMPA 3NFCA 4CLRB 4DCJA 1WZEA 1EFKA 1GTL1 1KJ8A 3DOCA 4I19A 4JELA 2OGWA 3CCRT 1VL8A 3GP3A 4MA5A 3SWNB 4Q5IA 4X1IB 3WBJA 4YT4A 5FWNA 3B6IA 1NZJA 3U09A 1MZVA 3ESDA 1CF2O 3J81k 2VA8A 4CEHA 2O19A 4YRIA 4QHSA 1VLMA 3TTTA 3PNWC 2IXFA 4DCPA 3ELWA 2J5KA 2MT9A 4XTCS 1I01A 3RS9A 2KK4A 3SYKA 3FZNA 5LJ3f 3CO0S 3DONA 3K8ZA 2D9TA 3FIFA 4RTRA 4ZO4A 2QNBA 5I7UA 4II7A 5LZ9A 2LJ1A 1DIRA 4P31A 5HBGA 2BY4A 4FCCA 3H13A 4BFYA 1GL7A 4FNOA 4Z88A 3D0OA 1IMOA 1T1IA 4NPHA 2FPSA 3DDOA 1N3BA 2ZAOA 4L9RA 5CIYA 2QAZA 4XIJA 2I0NA 3BTUA 5IC5A 4TLBA 3TXXA 5ELXA 4MX8A 1JYSA 3WGHA 2R8YA 2XHEA 3L8ZA 1JTEA 1TB4A 1TIPA 2R65A 2VPQA 1BCRA 3H1BA 3VR5D 3BW1A 1E9DA 3AHGA 2LVMA 4A4KA 5KYNA 1F0PA 2M9UA 3CLRD 3ED5A 3PNVA 4IIDA 4YP5A 3G5AA 2PIAA 2XMSA 1WDMA 5LC1A 1PR3A 1FL9A 2Z57A 1GR1A 1E9EA 2Q9CA 4CNQA 4XEHA 4E2FB 1YQDA 5DXJA 3LYIA 3EG3A 2N46A 4CKEB 3C85A 4Y67A 1GAJA 2PX6A 5K3CA 1RS0A 3WFIA 1SD1A 1TUEA 3IOCA 5J9FA 1LPLA 3IMFA 3FEOA 3EW9A 3IMGA 4HH1A 1MOQA 2HF8A 2WYIA 3A9SA 1X94A 3IDQA 2AF3C 4UUBA 3S8MA 1NKSA 2B82A 1JPNA 2GMWA 2P1RA 3FCYA 3KD3A 1R6UA 3M83A 3S7TA 1PZGA 3HO1A 2YWHA 3OWHA 3W5AA 4M7AG 5KH6A 2NU7B 3CXUA 5EUQB 2DKOA 2BGIA 4J4HA 2WOJA 2KRSA 4XJXA 3O3OB 4RETA 1FXUA 1W4RA 4YJ2F 5JSZA 1OAOC 2MI6A 2PMBA 5KYKA 1LEHA 2OTCA 4CKYA 2BL4A 3WWEA 3EVTA 1JT9A 1FYVA 3VS4A 2QP4A 1WJSA 1YASA 4RC9A 4ZARA 2VSYA 5BUQA 5EHZA 4EHNA 4U7JA 3AHJA 1F4LA 4JQCA 4TXJA 1AF4A 4F2PA 2AV6A 4GBGA 3ZIAA 4WEOA 2WG2A 1NAIA 1T5TA 1TMKA 1XCOA 2JGEA 3K6KA 1JAIA 5CW1A 3KQHA 1FB5A 2DLCX 2IU3A 4HXFB 1WXTA 2V8IA 5AQEA 1R5NA 3PIRA 2A0FB 1KHTA 3RERA 1Z4IA 5EXDA 2HBWA 3IAM6 1RRCA 2C5LA 3E70C 4BO0A 1XTBA 3PEEA 1FFHA 3MJRA 5HMMA 2O2HA 1NVBA 4KQFA 2Y67A 4EHKA 4DV7B