4F14A

Structure of the sh3 domain of human nebulette in complex with a peptide of xirp2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
TYRAMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Actin-binding protein/peptide
molecule keywords Nebulette
publication title Identification of Xin-repeat proteins as novel ligands of the SH3 domains of nebulin and nebulette and analysis of their interaction during myofibril formation and remodeling.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2012-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4f14A00
2DL8A 2FPFA 5IXBA 2KE9A 2D0NA 1UG1A 2RN8A 2AKKA 2O2OA 4JJDA 1ABQA 1Z9ZA 2W0ZA 2MCNA 3VS1A 2DA9A 2KEAA 1H3HA 2NUZA 3UA6A 2EGAA 2KRSA 2YUQA 2M51A 2P4RA 4OMQA 2K7AA 2GNCA 1AZEA 1UHCA 2KRMA 3VRZA 3THKA 1VA7A 4OMOA 1VYUA 4RTYA 4RTUA 3VRYA 5IH2A 2DBMA 2DNUA 3QWXX 2EVRA 1ZUKA 2KROA 2J6FA 3NHNA 3ULRB 1K0SA 2DL5A 2KXDA 1UDLA 1IO6A 4AFUC 1OPKA 4OMLA 3M0TA 1WFWA 2EPDA 2KT1A 3FJ5A 4M4ZA 2A36A 2LJ3A 2LNHB 4HVUA 4J9FA 2ROTA 4LN2A 1SPKA 2GQIA 2CDTA 5IHNA 1HD3A 2RQWA 4JZ3A 2KBTA 2BTTA 1HJDA 1RLPC 2W10A 1NM7A 4FSSA 2HEQA 4OMMA 1PHTA 1W6XA 3EGUA 4HCKA 3EHRA 1G83A 1KFZA 1V1CA 2RQRA 2EGEA 1NYFA 2GTOA 1HSQA 2EYXA 1GBQA 3VS7A 2KGTA 2JM9A 2KYBA 4E6RA 5IXFA 1JU5C 1Z9QA 2L0AA 2FPDA 1Y0MA 1UECA 1NG2A 2KRNA 1T0HA 4HVWA 4RUGA 1YP5A 2G6FX 3U23A 3KFVA 4RTVA 2SEMA 1B3QA 2QDLA 2VWFA 2DRMA 3M0RA 1UJ0A 3ZL7C 4J9IA 1RUWA 1AD5A 1FYNA 2VVKA 1A0NB 4R0KA 1X6BA 2C0IA 2JTEA 3PVLA 2HBWA 4GLMA 1SSHA 2FG0A 3TSZA 4OMPA 2V1RA 1TG0A 2RPNA 2MIOA 1UHFA 2YSQA 4F14A 2ROLA 2C0TA 2DL7A 1BB9A 4GBQA 3EG2A 2JXBA 2OI3A 3NGPA 4HXJA 2DILA 1S1NA 2LJ1A 1SHFA 4X1VA 1T3LA 2KT8A 2A37A 2DL3A 1CKAA 4RTTA 2RNAA 1GCQC 4Y92A 2AZVA 4Z8AA 4LUDA 2YT6A 2L3QA 1K9AA 4OMNA 2D8JA 4A63B 3PVQA 5I22A 4QT7A 2LCSA 2OAWA 1SRMA 4LE9A 3EG0A 3GBQA 1JXOA 1AWWA 1TUDA 1JO8A 2EYZA 1BU1A 2KR3A 2E5KA 3UA7A 2BZXA 1KIKA 5FWBA 3R6NA 2GBQA 3SHWA 2KYMA 2LZ6B 1M30A 4CC4B 1K76A 1WXTA 1U3OA 2ED1A 1OOTA 1WLPB 4LUEA 1KSWA 2FRYA 1NEBA 1UJYA 4RTZA 1UE9A 4AG1C 4F17A 1GFDA 4F16A 4EIKA 1XOVA 2RQUA 3EG1A 3I35A 1AWOA 1BK2A 4ESRA 1PNJA 1WXBA 2L2PA 2FPEA 1QWFA 4Z89A 1K4US 3EHQA 2J05A 1EFNA 2RQVA 1M3BA 2YUNA 2GGRA 3LH5A 1G2BA 4JZ4A 2EBPA 2EYYA 1X6GA 2IIMA 2X3XD 2CSQA 1ARKA 2FEIA 1N5ZA 1M3AA 1T0JA 2AK5A 2F2VA 2KNBB 1B07A 4AG2C 4CC2A 1T3SA 4LNPA 1X2KA 1GL5A 3VS0A 2CH4A 2LQNA 3UATA 1K1ZA 1X43A 2JS2A 3NMZC 2V1QA 2X3WD 1AWXA 1KJWA 5GJWB 1NEGA 2HDAA 2C0OA 2M0YA 3M0UA 4AFQC 2DBKA 3PE0A 1E7OA 2LP5A 1E6HA 3JV3A 1ABOA 2DM1A 1AVZC 2KXCA 3VS3A 2AKLA 3UF4A 1JQQA 5GJVB 4JJBA 5ECAA 2K9GA 4CC7A 3TSWA 3SEMA 1GRIA 2BZ8A 2CH4W 2DLPA 2K2MA 1GCPA 1UUEA 2K79A 1NLOC 1I07A 4HVVA 4WCIA 1AZGB 2AZSA 1YNZA 2CT3A 3QWYA 1E6GA 1QLYA 2L3SA 1PRMC 3VS5A 2PNIA 2JMAA 1M3CA 4RTWA 3TVTA 5IHKA 1W1FA 4JJCA 2J7IA 2CT4A 1MUZA 2EW3A 2YUOA 4AFSC 4RTXA 1ZUUA 1ZBJA 2OJ2A 3VS6A 1H92A 1CKBA 2LX7A 1H8KA 3M0SA 1PKSA 4KRTA 3RBBB 2JMCA 5FW9A 1OPLA 1YCSB 1AEYA 1WDXA 5IHIA 2DL4A 3EG3A 1JEGA 2EGCA 2YDLA 2VKNA 2LMJA 1ZSGA 1NLPC 2DMOA 2A28A 1GCQA 1QKXA 4J9DA 1J3TA 1MV3A 2MOXA 2CUBA 1PWTA 5FWCA 3O5ZA 2YUPA 1M27C 2EYWA 1BBZA 1VYTA 1SRLA 2K3BA 1NYGA 2J06A 4ORZA 3I9QA 2A08A 2ABLA 4J9HA 1I1JA 5I11A 2JM8A 4J9EA 1FMKA 1PKTA 2FO0A 3H0HA 1U06A 1X27A 4D8KA 1SEMA 3M0QA 2JW4A 1X2QA 2FRWA 1UFFA 4J9BA 2GTJA 3I5RA 2HCKA 3REAB 2LQWA 1YWPA 4DEXA 2DJQA 1RI9A 1I0CA 2L3PA 2O9VA 1Y57A 1RLQC 3CQTA 2CREA 2K6DA 2PZ1A 3M0PA 4CC3A 1OV3A 2CUDA 2BZYA 1GBRA 3H0IA 4IIOA 3VS4A 5L23A 1JXMA 4J9GA 1QKWA 2DYBA 4AFZC 5EC7A 2DVJA 1ZUYA 1U5SA 3A98A 1YN8A 2LJ0A 3H41A 1YWOA 2O31A 4DEYA 1OEBA 1W70A 1QCFA 1LCKA 2RQTA 1ZLMA 1TUCA 3IQLA 1CSKA 4J9CA 4K11A 1AWJA 2D8HA 2O88A 1M8MA 1UGVA 1ZX6A 2ECZA 2RMOA 2CSIA 2I0NA 2J6KA 1WA7A 1WIEA 4JPBW 3H0FA 4Z88A 2JS0A 1X69A 3RNJA 2F2XA 4ZNXA 1WI7A 2DF6A 2DX1A 2XMFA 2B86A 2O9SA 4D8DA 2SRCA 3REBB 2ESWA 1WXUA 3NPFA 1QWEA 3I5SA 1K0XA 2J6OA 1SHGA 2RF0A 2HSPA 2DE0X 1WYXA 4IIMA 1WX6A 2D1XA 2H8HA 3C0CA 2NWMA 2JT4A 1AOJA 2DRKA 2ENMA 1UTIA 5HCKA 2ED0A 2EQIA 2F2WA 3VS2A 2PTKA 1GFCA 1VYVA 2EKHA 1MV0B 1PRLC
chains in the Genus database with same CATH superfamily
3VUBA 2FPFA 4A4FA 4PJNA 5IXBA 1M5Q1 4FYWB 2DZCA 1UG1A 3CD6T 4M75C 2AKKA 1ABQA 1Z9ZA 1MMGA 2QQ9A 5KYNA 4A4KA 4C5HA 3QZ5B 1ZHIA 3M57A 2KRSA 2E41A 1G3WA 3A8OB 1VQ8A 2M51A 2K5FA 3OYMA 4OMQA 1TOVA 2K7AA 3LGFA 4DQ2A 1VQPQ 2YLCA 4RTUA 3VRYA 4A4HA 2EVRA 1M2VA 2J6FA 1VQLA 2E1HA 1GXIE 4AFUC 4C92D 5LJ5e 1VQ5A 1OPKA 3DB4A 1WFWA 3CMAQ 3VJPA 3G4SQ 1BI1A 2A36A 3EFRA 2ROTA 2D0QB 4EMHA 1HD3A 1QVPA 3DKMA 4MDXA 2XU8A 2W10A 3HL8A 2DERA 4NOYA 1WQWA 4N4GA 2V26A 4FSSA 4GY5A 2HEQA 4OMMA 4DOVA 3CCVA 3EGUA 5DLOA 3EHRA 5GAOn 2EGEA 4C5IA 1NYFA 1HSQA 3VS7A 2GQVA 5KYWB 1K9MU 1U1TA 4BACA 3SWNC 5CKHA 4LXCA 1VQ6Q 1K9MR 4F7UA 3FDRA 2FPDA 1Y0MA 3KXTA 4IKFA 4PJMA 1NG2A 1RAGB 5GAOp 2C06A 1T0HA 1RAAB 2G6FX 3KFVA 2QQAA 2FVUA 2QA4Q 1Y7XA 3BE3A 5GAN6 1BIBA 4PL6A 1B3QA 3CPFA 2LDMA 1R8OB 4MZMA 2DRMA 1DJ7B 3QKJA 2LTOA 2G3RA 1FYNA 5KYXA 1X6BA 2C0IA 1VQ4A 2R58A 3V8JA 2QQRA 3RMSA 4ELYC 2HL5C 2ZPFB 4PFZA 2DZ9A 4GLKA 3CPWS 4OMPA 3CPWA 3JCMJ 1BIAA 2V1RA 4XTVA 1UHFA 4B9XA 1VQPT 1C0MA 3LGLA 7AT1B 2YHTA 2C0TA 1YIJA 1FXXA 3INZA 2A7YA 1M1KC 3CXCS 3BDLA 3CC2A 5HKCA 3CMAT 2RJDA 4HXJA 3G4ST 2DILA 1N8RU 3DLMA 4FYXB 4X1VA 1OQKA 3M59A 3DLLA 1GCQC 1N8RR 3G6EQ 2LX9A 4M78D 2L8DA 1MHNA 5J39A 4OMNA 2JN0A 2P0KA 3MP6A 3PNWC 1SRMA 3GBQA 2HMAA 4M75D 1IRXA 2EYZA 2DAQA 1BU1A 2KR3A 3E9GA 4KGVB 1QP3A 5FWBA 1VQ7Q 1EZZB 1Q81C 1W2BP 2OTJQ 1NZ9A 3TU4K 4QQDA 2ED1A 1Y71A 2DTIA 1VQ6T 1QMCA 1OI1A 1OOTA 2COZA 4LUEA 1NEBA 1UE9A 1GFDA 2BKDN 2OTLA 2RQUA 2Y4YA 4ESRA 2L2PA 1LPLA 2QA4T 4Z89A 2F5KA 3EHQA 4ZGDB 5GMKi 4JLIA 4KUIA 2DIGA 1WJQA 2VASA 2GGRA 3LH5A 5GAOq 2A3LA 3AT1B 3I55Q 5CQXA 1KQ2A 3BY7A 2RJCA 2CP2A 2FEIA 3META 2CZ6B 2RK1A 2KNBB 5KCOA 3CCMQ 2X4YA 3JCMe 1K1ZA 3EFOB 1G8XA 1PD1A 4KH1B 2HDAA 4AFQC 1Q86U 2DBKA 4ZTFA 2AT1B 2CP3A 1E7OA 2LP5A 1E6HA 2VGNA 1RAFB 1WPYA 1Q86R 3SD4A 4NS5A 2QXFA 1W4SA 1U1SA 3VKIA 4BUGA 2X51A 3G6ET 2VUBA 3OW2P 3X28B 1N6AA 4CC7A 3SEMA 1ZA2B 2FZGB 2WACA 2GF7A 1VQ7T 4HVVA 1V29B 4XQ3A 2CT3A 3V8LA 4JUVA 1KD1C 2OTJT 4BY6C 4RTWA 1S72Q 1M1FA 1W1FA 2E10A 4JJCA 4C8QD 2CT4A 1VQ9Q 4PJOG 2CGHA 5LJ3j 1YJ9A 2DPPB 5HK0A 4M7AG 2XG8D 1H92A 1KC8C 2H3JA 4BI3A 1H8KA 2XHCA 3A8GB 3CBOA 2DFUA 1OPLA 1YCSB 4ANJA 3I55T 4CRIA 1W2BA 3D7SB 3CC7A 1F1BB 1TTHB 2EGCA 2E65A 2YDLA 3FEOA 3CCMT 1ZSGA 1NJIC 2DMOA 2YRVA 4J9DA 1MV3A 1PWTA 4RG8A 1D1CA 1M27C 2CYZB 2DKGA 1K73C 3PT9A 4RCCA 2WSFE 2CP5A 3WVDB 2ATCB 4OB1B 1MMDA 1UB4A 4C0DB 5GAN3 2ABLA 4OB0B 2MAMA 1HK9A 3H0HA 1LJOA 2Y4XA 4E47A 4HCCA 1H641 2RHIA 2IVWA 2JW4A 4J9BA 4PJLA 3LYIA 2GTJA 1M4ZA 4L5GA 2F5TX 1Q95G 3MEUA 4DEXA 2DJQA 1I0CA 2L3PA 3RESA 4M7DG 4FIBA 4JRKA 2O4XB 2K3XA 4MZPA 1RLQC 4NL2A 1PSFA 1S72T 3OA6A 4CC3A 1VQ9T 2KI7A 2DK3A 3OW2A 3CCLA 2EWNA 4LDXA 4Z02A 1RACB 2DYBA 5DLQE 4AFZC 1U5SA 2E3HA 1TXQA 1YN8A 4HCBA 1WHJA 6AT1B 5I21A 1D3BB 8AT1B 1YWOA 4BE2A 2O31A 3UPUA 4M7AB 3EGDA 1ZLMA 2QTXA 2HZYA 4KGXB 4PJOA 4TVRA 3T9NA 2KVQG 2ECZA 3M4YA 2CSIA 2HQXA 1WZOA 3H0FA 4KH0B 2JS0A 1X69A 4N0AC 2F2XA 4ZNXA 1WI7A 2DETA 3LX7A 1X75C 1QCNA 1QWEA 5GAN4 4XU3A 1OZ3A 2DE0X 2XIDA 2EFIA 5KE2A 2CKKA 5IN1A 3JCMQ 4C8QB 4MDWA 2PVOB 2ENMA 3RKWA 4OVAA 3JCMh 3BFMA 3X26B 2DL8A 1M90C 2KE9A 2D0NA 1AT1B 4QQGA 3GIBA 2W0ZA 2MCNA 3JB9J 1IXDA 5I2MA 2KEAA 1VQKA 4QKUA 2K2VA 3EG9A 4QVCA 2NUPB 2RI5A 2P4RA 2X4JA 2GNCA 3NFCA 2KRMA 3VRZA 1VQKQ 3THKA 5GMKj 3HKSA 2LNVA 4VUBA 4Y91A 2DBMA 2KDSA 1QVFP 4QVZA 4M7DA 1IO6A 3CD6A 2QASA 1EIFA 2EYQA 3M0TA 2QTVA 2EPDA 4M4ZA 4LN2A 5IHNA 1SSFA 2RQWA 2BTTA 4IURA 3OSSC 3URGA 1BI2A 2VC8A 2LRQA 2MF2A 1W6XA 4L6V5 2JUFA 1KFZA 2RQRA 1Q7YC 5A0GA 1R77A 2FHDA 2GTOA 3ZFJA 2EYXA 3VYGA 4J7FA 2JM9A 2ZPBB 2COYA 2ZPGB 1ZSZB 2KYBA 2LVMA 3E9FA 1YHQQ 4BE0A 3S3NA 4E7IA 1QP2A 1RAEB 4J8OA 2L0AA 3TCJA 3QJYA 3G71Q 2E5QA 1UECA 1M1KU 4MMLA 1O75A 1YP5A 1K8AC 1M1KR 4JS4A 2XK0A 2SEMA 4A4GA 1Y96B 2QDLA 2BUDA 2CP6A 1IREB 1D0ZA 1PCXA 1BI0A 2E6NA 4A53A 1JRIA 2QDYB 3HPWA 3CC4A 2H3EB 1SSHA 2QI2A 2FG0A 4PJOF 4M77G 3MPUB 3TSZA 4B9WA 4PJOE 4XU0A 2YSQA 3OS1A 4J83A 4M7AF 5IT9E 1VQKT 3G7ZA 4M7AE 3CC4Q 3MKDA 1BB9A 1YFNA 2M9UA 5CKEA 5GAMh 3EG2A 2BE9B 3NGPA 5AYFA 2JOYA 3PGGA 1R0BG 1WJSA 2RA2A 1MMAA 1MGQA 4RTTA 4DBRA 4Z8AA 4E2FB 1K9AA 4FW2A 4DBHA 3P8DA 1ZA1B 2D8JA 3PVQA 3FIFA 1VQPA 4LE9A 2MI6A 3EG0A 1R0CB 1AWWA 3OYDA 4C0FA 5KYYB 3MP1A 1QVFA 3I56Q 1KIKA 3R6NA 2GBQA 3QZ9B 3SHWA 2KYMA 3CMAA 4CC4B 3G4SA 2HAXA 3S6WA 1YHQT 4FYVB 1WLPB 1KSWA 2FRYA 4F17A 3G71T 3JCMf 4F16A 2RD1A 1XOVA 4KULA 1AWOA 1BK2A 3QPHA 1WXBA 5GAN2 5CO7A 5GANh 1IGUA 2J05A 2RQVA 1M3BA 4ZTJA 3LLRA 3QDFA 3FC3A 5GAMg 3CBPA 4LD6A 3BDUA 2IIMA 1X6GA 2X3XD 4O5VA 2RHZA 4M7DF 4EPCA 4M7DE 1SKUB 3GLXA 3BW1A 3MEWA 5FU6B 1ARKA 2P4TA 1VQ6A 1T0JA 2AK5A 4CC2A 2CH4A 3UATA 1NBEB 1X43A 3JCMd 4BB7A 2HQEA 1WHGA 3RERA 1N27A 2QA4A 1KD1U 3CC4T 5LJ5j 2M0YA 3M0UA 4M77B 5KYWA 2O01E 4JRPA 1VQOQ 4EMKB 2E64A 3L2RA 1KD1R 2EJGA 4F7UB 3VU3C 2V8IA 3PTAA 4PJOC 3L2UA 1B34B 4E7ZA 1KC8U 3VS3A 2AKLA 1RAHB 4M7AC 5J26A 1IHWA 2BE7D 5GJVB 4AT1B 4ZN3A 2E3IA 1KC8R 2VXFA 2K9GA 2JTMA 3TSWA 2BZ8A 2CH4W 2FZCB 5GANg 3MO8A 4FU6A 2L5QA 5KYXB 3A5ZB 2KAFA 4EDUA 1UUEA 3I56T 2K79A 3GOXA 1I07A 4X9CA 4WCIA 3OYNA 1NJIU 3QWYA 1E6GA 4P5NA 4OGEA 2PNIA 1M3CA 4N4HA 3UDCA 1NJIR 4N0AA 2GFUA 5IHKA 4E7KA 2LC4A 1RAIB 3V7CA 3G6EA 1JBMA 2BIVA 1QVGA 5KYUA 4UC4A 4OF1A 4BD3A 2R57A 1ZBJA 2OJ2A 2LX7A 3M0SA 3RBBB 1VOMA 3VYHB 1VQ7A 1LOJA 1FX7A 4FSXA 2OTJA 3EG3A 4CI0C 3OBWA 5FROA 2DIQA 3RUXA 4OMFB 2LMJA 2M02A 4FT2A 1J3TA 2MOXA 1G3SA 2ZPEB 3O5ZA 5EG2A 5GAMf 1SRLA 4HCZA 3WXMB 5CK9A 3LWHA 1VQOT 4M7DC 1OX9A 3I55A 2K3BA 3MCAB 3E2UA 4ORZA 3OYYA 1H3ZA 3CCMA 1UGPB 3EFSA 1VUBA 3QIIA 1FMKA 4C92B 2JZ2A 4M78G 2FO0A 2MK5A 4IUPA 2M0OA 2NYSA 4PLIA 3HRUA 1QQJA 2ZCFB 2FRWA 1UFFA 3JB9H 2MYSA 3OYHA 3REAB 5GAMd 2LQWA 1YWPA 2O9VA 2KQWA 1NPPA 1HXDA 1IHVA 1YJNQ 2PZ1A 1OV3A 2BZYA 3X25B 2WSCE 3EFOA 3CMEA 3H0IA 1B7TA 5L23A 5GANf 4DA4A 1OU8A 1JXMA 1QKWA 3M4GA 1QW1A 5EC7A 1OULA 2NLUA 2VYTA 1M8VA 2E12A 4PJOD 3H41A 1XQHA 3CMEQ 1MMNA 2KMTA 1OEBA 1QCFA 1LCKA 1KK7A 1TUCA 1CSKA 2CS7A 1S72A 5CCAA 3A8HB 1VQ9A 2D8HA 4M77F 1M90U 1ZX6A 2DXTA 4M77E 2YLBA 2I0NA 2J6KA 5GANd 4Z88A 1M90R 1HYOA 1P92A 3RNJA 3QYGB 3P8HA 2DX1A 4AMCA 2O9SA 5CKFA 3REBB 3ER0A 1K9MC 3RDVA 4LD9K 1XJWB 3RMQA 2J6OA 3GP8A 2RF0A 3OYJA 3C0CA 4FYYB 3JCMP 5FU7C 4FCYA 1W2BS 2JT4A 1X01A 5HCKA 3VS2A 2LT1A 2QQSA 2PVDB 1VYVA 2EKHA 5CKBA 4E7LA 3OYFA 4KBMB 4M78B 2O2OA 4JJDA 2YXYA 4XU2A 3SFMA 1YJNT 2XI9A 1H3HA 4M75B 3PIOA 3UA6A 2YUQA 1Q7YU 4C8QG 3QXEB 1WHKA 1VQNA 9ATCB 1AZEA 1ACMB 4M7DD 2CP0A 1Q7YR 4HT8A 4OMOA 3QSUA 3M53A 4RTYA 3R6OA 5IH2A 2DNUA 2EAYA 3CMET 1K0SA 3ULRB 1TS9A 1VQNQ 3QO3A 2XDBA 4C5GA 3JSCA 1N8RC 3M56A 4HVUA 2LNHB 5GAMe 1SPKA 2GQIA 3MJXA 1PM3A 4OB2B 3CCQQ 1HJDA 1VQMQ 2F69A 2QEXQ 1PHTA 3M54A 4HCKA 5AT1B 4Q5WA 1YI2Q 4X34A 4N4IA 3OW2S 2O4XA 2KGTA 2COWA 1JJ2A 4V2SA 3H9NA 2D9TA 4E6RA 4M77C 5IXFA 2HNIA 1JU5C 3QHSA 1N9RA 3HRTA 1Z9QA 2DVEA 3KUFA 3SWNB 1O9SA 4LDWA 3V8KA 4RUGA 4FT4A 4RTVA 3OY9A 1D3BA 2ZPHB 3EGDB 2VWFA 3M0RA 4M7AA 3OQ5A 4IUUA 1UJ0A 4J9IA 5GANe 1AD5A 5GMKm 3X20B 1C1AA 1A0NB 3WVEB 2JTEA 3PVLA 5CKDA 4FM4B 4J6YA 1D0YA 2RJEA 2ZZDA 3JCMV 1TG0A 2RPNA 3OB9A 4F14A 3JCMX 2ROLA 3HSBA 1VQNT 3OYLA 4JRIA 2E6ZA 1S1NA 2FB7A 1SHFA 2XD0A 2CZ0B 1T3LA 2KT8A 3CCEQ 2JJ9A 1CKAA 3CCQT 2AZVA 1TWBA 4LUDA 2L3QA 1VQMT 4ZGEB 2QEXT 3JCMW 4A63B 5I22A 2K5IA 4QT7A 2RI2A 1YI2T 2LCSA 2OAWA 2K57A 2K5LA 1JXOA 1QCOA 1TUDA 2BZXA 3EG9B 3EH1A 2D6FA 1M30A 2JVVA 5CR2A 1UJYA 4RTZA 4AG1C 2KK4A 3CBMA 4XTUA 4EIKA 5LJ3h 4M78F 1ZQ1A 4M78E 2VGMA 2FPEA 3HTRA 1RL2A 2DEUA 3E1SA 2E4HA 3CCUQ 2YUNA 3N5BB 4YTLA 4J5YA 1G2BA 2EBPA 2EYYA 3X24B 1TSFA 1YHQA 3M9QA 3EH2A 1N5ZA 2F2VA 5GAOm 3QG1A 1FMWA 1T3SA 3G71A 1I5LA 3VS0A 5CIUA 3PMIA 3HRSA 2V1QA 3JCMb 2X3WD 1AWXA 4R55A 5GJWB 5A2QE 3EGXB 4QVDA 3FRNA 3FJPA 4BDYA 3SDZA 3PE0A 2NUTB 5DY9A 4J6WA 4E7JA 2OAUA 2DM1A 3CCET 5GAOr 3UF4A 1JB0E 4XTZA 5LJ3g 5ECAA 1KQSA 1I8FA 1UGQB 2MWPA 4IUTA 4J7IA 3NTIA 2DLPA 3RIRA 2EJFA 2K2MA 3GNFB 1GCPA 5GAN5 1Q81U 1AZGB 2AZSA 3LW5E 1YNZA 2P84A 1NPRA 2L3SA 1PRMC 4F7UG 2JMAA 3TVTA 2RB6A 1XNIA 1Q81R 3CEYA 3UT1A 2MPXC 1MUZA 5FRMA 2LQ8A 2EW3A 1SF9A 3CCRQ 2DXCA 3C4SA 1ZUUA 2P0QA 5IAYA 5D7UA 1PKSA 4KRTA 2LCLA 1WHMA 2MWOA 1M1GA 1WNLA 3CCUT 1QVGP 3I56A 3L2WA 3P8BB 1SG5A 1V76A 3OMGA 4BE1A 1QVFS 4OB3B 4LDUA 4C8QF 4C8QE 2DXBA 3CXCP 1Q82C 3OYIA 1PSEA 4II1A 5FWCA 5KYYA 2EYWA 1BBZA 1VYTA 3MEVA 4FW1A 1RABB 4C0DC 1M2VB 1NYGA 3L42A 4HA8A 3JB9G 2MMPA 3I9QA 2R5MA 2WSEE 4J9HA 1VQ8Q 5I11A 2JM8A 5GMKl 4ELZC 4PJJA 3L1AA 1X27A 5GAN8 3M0QA 2B8AA 1VQOA 3I5RA 1VQLQ 3ZEHA 1RI9A 2AIRB 1LNXA 1N9SA 1VQ5Q 3UWNA 3JB9I 1Y57A 2CREA 4DBQA 1M2OA 5LJ3f 1I4K1 5D6XA 2VB6A 4MMKA 1G3TA 3VUZA 2CUDA 3O8VA 3CCRT 3G1JA 4C92G 1PG5B 1YITA 4J9GA 3CCVQ 5L8RE 4M77A 5GMKh 2Z0WA 2DVJA 4XU1A 1WQ7A 4EMKA 4XAXB 2LJ0A 1UGSB 5CQYA 1UEBA 5KH6A 2YRDA 2RHUA 1B34A 3L2QA 1W70A 1YITQ 2RQTA 2RH2A 3IQLA 2M1HA 4IUQA 5A0DA 4K11A 5C6SA 1AWJA 1XTDA 5LJ3d 3OS5A 1M8MA 1UGVA 2X4XA 5M9OA 1PC0A 3NTKA 1WA7A 1U8RA 4JPBW 4RG2A 2HSEB 2P0PA 4OGCA 1RI0A 2QK0A 1K73U 1QVGS 2B86A 2LT4A 2SRCA 4PK4A 1WXUA 2HKQB 1K73R 4C0ZA 2CZ1B 1SHGA 4C8QC 5KYUB 1VQ4Q 1WX6A 2VV5A 2H8HA 2X35A 4KGZB 3OYCA 1FWZA 1VQ8T 2NWMA 1AOJA 3CXCA 3QDRB 2F2WA 2PTKA 3KBGA 1GFCA 4MZTA 1MV0B 1PRLC 5GAOl 2VXEA 3M58A 3GF5A 1YIJQ 2FL7A 1VQLT 3OYKA 5CVIA 1VQ5T 2RN8A 3OMCA 3CC2Q 4ATOA 5C0MA 2HBPA 2DA9A 4Y28E 3VS1A 3ZBDA 3RKXA 4BI8B 3C12A 2NUZA 2EGAA 2L89A 2FYKA 3C95A 3GNGA 5KCHA 2DD4A 3CCVT 1UHCA 3VV0A 1M9SA 1ZBXA 1VA7A 1X6OA 1VYUA 3F70A 3S3OA 3QWXX 1ZUKA 2KROA 3NHNA 3L2VA 2DL5A 3TQ7P 2KXDA 1UDLA 2FZKB 1YITT 3DB3A 1VIEA 4OMLA 2KT1A 3FJ5A 5J3BA 2LJ3A 1YJNA 2ZPIB 4J9FA 4WTOB 1OU9A 2EQMA 4M75G 2CDTA 1NE8A 4JZ3A 4PLLA 2X9HA 2KBTA 4C92A 2QQBA 3PMTA 3OYAA 1RLPC 2M16A 1KG1A 1NM7A 2OTLQ 4JJNK 1G83A 1VIFA 1V1CA 4C5EA 2YWWA 2RI3A 1ZSZC 2RM4A 4JDSA 3SB2A 5GAN7 1GBQA 2R5AA 2XKOC 1AHJB 1VQ4T 2PUKB 2A0FB 3NTHA 1BCMA 4XK8E 4EMGA 3TREA 1JJ2P 4M7AD 2KRNA 3CCSA 4HVWA 3U23A 5LJ3e 4DOWA 1D1AA 2LCCA 1YIJT 4KT0E 3ZL7C 2L3RA 3CCSQ 3CC2T 1RUWA 2VVKA 2ZGWA 4F7UF 8ATCB 4R0KA 3PFSA 4F7UE 4A54A 2QG9B 4PFOA 2HBWA 4GLMA 4PKCC 3CCJA 4B6MA 5I2SA 3J81E 2MIOA 4XTWA 4BDZA 1IB8A 3JAME 2AHJB 4C0GA 4F04B 5LJ5h 2DL7A 3CCJQ 4GBQA 1IGQA 1OZ2A 2JXBA 2OI3A 3FLGA 2DTHA 1TH7A 2X4WA 2LJ1A 3PIPA 3ME9A 2QAZA 2A37A 3QJ6A 2DL3A 1UGRB 5HK3A 2RNAA 1YJWA 4Y92A 1WGSA 1BYMA 1D1BA 2YT6A 4E7HA 1OYXA 2DTOA 3ASKA 2OTLT 1YJ9Q 2RK2A 1MNDA 2DJZA 3MP8A 1Y07A 1JO8A 1WHLA 2QGGA 3QYHB 2E5KA 4M78A 3UA7A 1KQ1A 1YJWQ 1FMVA 3RR6A 2LZ6B 1OX8A 4M75A 3CC7Q 1K76A 3JB9F 1WXTA 1U3OA 4HT9A 3CCQA 3QBYA 1G3YA 1VQMA 4RCBA 2V8JA 3EG1A 3I35A 2QEXA 1K8AU 2F1LA 1PNJA 5CAIA 1YI2A 1QWFA 1K4US 5LJ5g 4A4EA 1EFNA 1K8AR 3CCST 5FU6C 1WHHA 4JZ4A 1D0XA 3J80E 3C94A 2CSQA 1MNEA 3TEEA 4O6JA 1M3AA 1B07A 4AG2C 4LNPA 1X2KA 1GL5A 1JJ2S 2LQNA 3EAEA 4C92F 2JS2A 3NMZC 4C92E 2IG0A 2Y90A 4EMKC 3LWIA 1KJWA 5KE3A 1NEGA 3CCJT 2C0OA 1BCOA 5HY6A 2K3YA 2XICA 3GPLA 5GAMj 3JV3A 2RHXA 3HHTB 1ABOA 1D09B 1AVZC 3QUIA 2KXCA 3MHXA 3SWNA 4JLGA 3OS2A 1C6VX 4PJOB 3MEAA 3JCMc 1JQQA 4JJBA 1YJ9T 2QGFB 4WF2A 3CCLQ 1GRIA 2EKOA 3OSVA 2KSSA 4QQ6A 3A8MB 2I2LA 1I81A 1YJWT 5FRNA 1NLOC 1YBYA 1KQSP 1YCYA 3HFOA 1QLYA 3CC7T 2EJ9A 3L2ZA 1I5OB 3VS5A 3S3MA 1Q82U 1KHIA 3CCEA 2DXUA 1Q86C 1TU0B 4FL6A 2J7IA 3A1PA 1Q82R 4NL3A 3OYBA 2GCXA 2YUOA 4AFSC 4RTXA 3M5AA 3VS6A 1CKBA 4C8QA 5GANj 3AHUA 2EQJA 4PNOA 1G5VA 2JMCA 5FW9A 2PUOB 2RO0A 5GMKe 2XDDA 2KY9A 3V7SA 1AEYA 1WDXA 4HKEA 4QW2A 5IHIA 3H8ZA 2DL4A 2V8KA 1JEGA 4XTXA 4R56A 4J6XA 2XDPA 3OS0A 2VKNA 4ZGJB 1NLPC 2RHYA 2A28A 2DO3A 1GCQA 4L59A 1QKXA 5LJ5f 4OP0A 2CUBA 2YUPA 2NUPA 1IZ6A 2K4YA 3H6ZA 1BI3A 3CCUA 2HD0A 3V7RA 2RJFA 2CP7A 2PQWA 2J06A 4M7DB 3OYEA 4M75F 4C92C 2DYIA 2A08A 4M75E 4LDVA 2E70A 1I1JA 4J9EA 4XTYA 3CCLT 2HL3A 1PKTA 2PU9B 2QYZA 2YRCA 1U06A 3HP9A 1SEMA 3M55A 4D8KA 5LJ5d 3FB9A 4D6WA 1X2QA 5DM7R 3OBYA 2HCKA 5LL6S 2EQKA 3CD6Q 2HKNA 2JTFA 3JCMg 3CQTA 2K6DA 4M77D 1BKBA 3M0PA 4JS5A 1ZSZA 4ZN1A 5D6YA 1KHCA 1GBRA 3RKYA 3VS4A 4IIOA 4ME7A 3EGXA 1LVKA 4JRQA 1ZUYA 1RADB 2LQKA 2NUTA 1KQSS 3J7AF 2CZ7B 4DEYA 5A0LA 1Y96A 2PVGB 3A8LB 3Q1JA 4LDYA 4IUVA 4J9CA 4RMOA 2O88A 1PD0A 3CCRA 4BI4A 2RMOA 2DD5A 5FLXE 2HQHA 4X9DA 2ZAEA 1WIEA 4BY6B 2DF6A 2DEQA 2XMFA 4DBFA 3JRZA 4D8DA 2ESWA 1TUGB 3NPFA 4RKUE 4E7SA 3I5SA 1K0XA 4KUDK 3OYGA 2HSPA 4IIMA 1WYXA 2D1XA 2IPOB 3E19A 2EQUA 5D6WA 2GFAA 2EIFA 2JNGA 3CPWP 1EX4A 2DRKA 3HFNA 1UTIA 3LH0A 2ED0A 2EQIA 4PFPA 5FU7B 3JB9D 2OX7A 1WJRA 3A98A 4M78C
chains in the Genus database with same CATH topology
2DL8A 2FPFA 5IXBA 2KE9A 2D0NA 1UG1A 2RN8A 2AKKA 2O2OA 4JJDA 1ABQA 1Z9ZA 2W0ZA 2MCNA 3VS1A 2DA9A 2KEAA 1H3HA 2NUZA 3UA6A 2EGAA 2KRSA 2YUQA 2M51A 2P4RA 4OMQA 2K7AA 2GNCA 1AZEA 1UHCA 2KRMA 3VRZA 3THKA 1VA7A 4OMOA 1VYUA 4RTYA 4RTUA 3VRYA 5IH2A 2DBMA 2DNUA 3QWXX 2EVRA 1ZUKA 2KROA 2J6FA 3NHNA 3ULRB 1K0SA 2DL5A 2KXDA 1UDLA 1IO6A 4AFUC 1OPKA 4OMLA 3M0TA 1WFWA 2EPDA 2KT1A 3FJ5A 4M4ZA 2A36A 2LJ3A 2LNHB 4HVUA 4J9FA 2ROTA 4LN2A 1SPKA 2GQIA 2CDTA 5IHNA 1HD3A 2RQWA 4JZ3A 2KBTA 2BTTA 1HJDA 1RLPC 2W10A 1NM7A 4FSSA 2HEQA 4OMMA 1PHTA 1W6XA 3EGUA 4HCKA 3EHRA 1G83A 1KFZA 1V1CA 2RQRA 2EGEA 1NYFA 2GTOA 1HSQA 2EYXA 1GBQA 3VS7A 2KGTA 2JM9A 2KYBA 4E6RA 5IXFA 1JU5C 1Z9QA 2L0AA 2FPDA 1Y0MA 1UECA 1NG2A 2KRNA 1T0HA 4HVWA 4RUGA 1YP5A 2G6FX 3U23A 3KFVA 4RTVA 2SEMA 1B3QA 2QDLA 2VWFA 2DRMA 3M0RA 1UJ0A 3ZL7C 4J9IA 1RUWA 1AD5A 1FYNA 2VVKA 1A0NB 4R0KA 1X6BA 2C0IA 2JTEA 3PVLA 2HBWA 4GLMA 1SSHA 2FG0A 3TSZA 4OMPA 2V1RA 1TG0A 2RPNA 2MIOA 1UHFA 2YSQA 4F14A 2ROLA 2C0TA 2DL7A 1BB9A 4GBQA 3EG2A 2JXBA 2OI3A 3NGPA 4HXJA 2DILA 1S1NA 2LJ1A 1SHFA 4X1VA 1T3LA 2KT8A 2A37A 2DL3A 1CKAA 4RTTA 2RNAA 1GCQC 4Y92A 2AZVA 4Z8AA 4LUDA 2YT6A 2L3QA 1K9AA 4OMNA 2D8JA 4A63B 3PVQA 5I22A 4QT7A 2LCSA 2OAWA 1SRMA 4LE9A 3EG0A 3GBQA 1JXOA 1AWWA 1TUDA 1JO8A 2EYZA 1BU1A 2KR3A 2E5KA 3UA7A 2BZXA 1KIKA 5FWBA 3R6NA 2GBQA 3SHWA 2KYMA 2LZ6B 1M30A 4CC4B 1K76A 1WXTA 1U3OA 2ED1A 1OOTA 1WLPB 4LUEA 1KSWA 2FRYA 1NEBA 1UJYA 4RTZA 1UE9A 4AG1C 4F17A 1GFDA 4F16A 4EIKA 1XOVA 2RQUA 3EG1A 3I35A 1AWOA 1BK2A 4ESRA 1PNJA 1WXBA 2L2PA 2FPEA 1QWFA 4Z89A 1K4US 3EHQA 2J05A 1EFNA 2RQVA 1M3BA 2YUNA 2GGRA 3LH5A 1G2BA 4JZ4A 2EBPA 2EYYA 1X6GA 2IIMA 2X3XD 2CSQA 1ARKA 2FEIA 1N5ZA 1M3AA 1T0JA 2AK5A 2F2VA 2KNBB 1B07A 4AG2C 4CC2A 1T3SA 4LNPA 1X2KA 1GL5A 3VS0A 2CH4A 2LQNA 3UATA 1K1ZA 1X43A 2JS2A 3NMZC 2V1QA 2X3WD 1AWXA 1KJWA 5GJWB 1NEGA 2HDAA 2C0OA 2M0YA 3M0UA 4AFQC 2DBKA 3PE0A 1E7OA 2LP5A 1E6HA 3JV3A 1ABOA 2DM1A 1AVZC 2KXCA 3VS3A 2AKLA 3UF4A 1JQQA 5GJVB 4JJBA 5ECAA 2K9GA 4CC7A 3TSWA 3SEMA 1GRIA 2BZ8A 2CH4W 2DLPA 2K2MA 1GCPA 1UUEA 2K79A 1NLOC 1I07A 4HVVA 4WCIA 1AZGB 2AZSA 1YNZA 2CT3A 3QWYA 1E6GA 1QLYA 2L3SA 1PRMC 3VS5A 2PNIA 2JMAA 1M3CA 4RTWA 3TVTA 5IHKA 1W1FA 4JJCA 2J7IA 2CT4A 1MUZA 2EW3A 2YUOA 4AFSC 4RTXA 1ZUUA 1ZBJA 2OJ2A 3VS6A 1H92A 1CKBA 2LX7A 1H8KA 3M0SA 1PKSA 4KRTA 3RBBB 2JMCA 5FW9A 1OPLA 1YCSB 1AEYA 1WDXA 5IHIA 2DL4A 3EG3A 1JEGA 2EGCA 2YDLA 2VKNA 2LMJA 1ZSGA 1NLPC 2DMOA 2A28A 1GCQA 1QKXA 4J9DA 1J3TA 1MV3A 2MOXA 2CUBA 1PWTA 5FWCA 3O5ZA 2YUPA 1M27C 2EYWA 1BBZA 1VYTA 1SRLA 2K3BA 1NYGA 2J06A 4ORZA 3I9QA 2A08A 2ABLA 4J9HA 1I1JA 5I11A 2JM8A 4J9EA 1FMKA 1PKTA 2FO0A 3H0HA 1U06A 1X27A 4D8KA 1SEMA 3M0QA 2JW4A 1X2QA 2FRWA 1UFFA 4J9BA 2GTJA 3I5RA 2HCKA 3REAB 2LQWA 1YWPA 4DEXA 2DJQA 1RI9A 1I0CA 2L3PA 2O9VA 1Y57A 1RLQC 3CQTA 2CREA 2K6DA 2PZ1A 3M0PA 4CC3A 1OV3A 2CUDA 2BZYA 1GBRA 3H0IA 4IIOA 3VS4A 5L23A 1JXMA 4J9GA 1QKWA 2DYBA 4AFZC 5EC7A 2DVJA 1ZUYA 1U5SA 3A98A 1YN8A 2LJ0A 3H41A 1YWOA 2O31A 4DEYA 1OEBA 1W70A 1QCFA 1LCKA 2RQTA 1ZLMA 1TUCA 3IQLA 1CSKA 4J9CA 4K11A 1AWJA 2D8HA 2O88A 1M8MA 1UGVA 1ZX6A 2ECZA 2RMOA 2CSIA 2I0NA 2J6KA 1WA7A 1WIEA 4JPBW 3H0FA 4Z88A 2JS0A 1X69A 3RNJA 2F2XA 4ZNXA 1WI7A 2DF6A 2DX1A 2XMFA 2B86A 2O9SA 4D8DA 2SRCA 3REBB 2ESWA 1WXUA 3NPFA 1QWEA 3I5SA 1K0XA 2J6OA 1SHGA 2RF0A 2HSPA 2DE0X 1WYXA 4IIMA 1WX6A 2D1XA 2H8HA 3C0CA 2NWMA 2JT4A 1AOJA 2DRKA 2ENMA 1UTIA 5HCKA 2ED0A 2EQIA 2F2WA 3VS2A 2PTKA 1GFCA 1VYVA 2EKHA 1MV0B 1PRLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL8 A;  2FPF A;  5IXB A;  2KE9 A;  2D0N A;  1UG1 A;  2RN8 A;  2AKK A;  2O2O A;  4JJD A;  1ABQ A;  1Z9Z A;  2W0Z A;  2MCN A;  3VS1 A;  2DA9 A;  2KEA A;  1H3H A;  2NUZ A;  3UA6 A;  2EGA A;  2KRS A;  2YUQ A;  2M51 A;  2P4R A;  4OMQ A;  2K7A A;  2GNC A;  1AZE A;  1UHC A;  2KRM A;  3VRZ A;  3THK A;  1VA7 A;  4OMO A;  1VYU A;  4RTY A;  4RTU A;  3VRY A;  5IH2 A;  2DBM A;  2DNU A;  3QWX X;  2EVR A;  1ZUK A;  2KRO A;  2J6F A;  3NHN A;  3ULR B;  1K0S A;  2DL5 A;  2KXD A;  1UDL A;  1IO6 A;  4AFU C;  1OPK A;  4OML A;  3M0T A;  1WFW A;  2EPD A;  2KT1 A;  3FJ5 A;  4M4Z A;  2A36 A;  2LJ3 A;  2LNH B;  4HVU A;  4J9F A;  2ROT A;  4LN2 A;  1SPK A;  2GQI A;  2CDT A;  5IHN A;  1HD3 A;  2RQW A;  4JZ3 A;  2KBT A;  2BTT A;  1HJD A;  1RLP C;  2W10 A;  1NM7 A;  4FSS A;  2HEQ A;  4OMM A;  1PHT A;  1W6X A;  3EGU A;  4HCK A;  3EHR A;  1G83 A;  1KFZ A;  1V1C A;  2RQR A;  2EGE A;  1NYF A;  2GTO A;  1HSQ A;  2EYX A;  1GBQ A;  3VS7 A;  2KGT A;  2JM9 A;  2KYB A;  4E6R A;  5IXF A;  1JU5 C;  1Z9Q A;  2L0A A;  2FPD A;  1Y0M A;  1UEC A;  1NG2 A;  2KRN A;  1T0H A;  4HVW A;  4RUG A;  1YP5 A;  2G6F X;  3U23 A;  3KFV A;  4RTV A;  2SEM A;  1B3Q A;  2QDL A;  2VWF A;  2DRM A;  3M0R A;  1UJ0 A;  3ZL7 C;  4J9I A;  1RUW A;  1AD5 A;  1FYN A;  2VVK A;  1A0N B;  4R0K A;  1X6B A;  2C0I A;  2JTE A;  3PVL A;  2HBW A;  4GLM A;  1SSH A;  2FG0 A;  3TSZ A;  4OMP A;  2V1R A;  1TG0 A;  2RPN A;  2MIO A;  1UHF A;  2YSQ A;  4F14 A;  2ROL A;  2C0T A;  2DL7 A;  1BB9 A;  4GBQ A;  3EG2 A;  2JXB A;  2OI3 A;  3NGP A;  4HXJ A;  2DIL A;  1S1N A;  2LJ1 A;  1SHF A;  4X1V A;  1T3L A;  2KT8 A;  2A37 A;  2DL3 A;  1CKA A;  4RTT A;  2RNA A;  1GCQ C;  4Y92 A;  2AZV A;  4Z8A A;  4LUD A;  2YT6 A;  2L3Q A;  1K9A A;  4OMN A;  2D8J A;  4A63 B;  3PVQ A;  5I22 A;  4QT7 A;  2LCS A;  2OAW A;  1SRM A;  4LE9 A;  3EG0 A;  3GBQ A;  1JXO A;  1AWW A;  1TUD A;  1JO8 A;  2EYZ A;  1BU1 A;  2KR3 A;  2E5K A;  3UA7 A;  2BZX A;  1KIK A;  5FWB A;  3R6N A;  2GBQ A;  3SHW A;  2KYM A;  2LZ6 B;  1M30 A;  4CC4 B;  1K76 A;  1WXT A;  1U3O A;  2ED1 A;  1OOT A;  1WLP B;  4LUE A;  1KSW A;  2FRY A;  1NEB A;  1UJY A;  4RTZ A;  1UE9 A;  4AG1 C;  4F17 A;  1GFD A;  4F16 A;  4EIK A;  1XOV A;  2RQU A;  3EG1 A;  3I35 A;  1AWO A;  1BK2 A;  4ESR A;  1PNJ A;  1WXB A;  2L2P A;  2FPE A;  1QWF A;  4Z89 A;  1K4U S;  3EHQ A;  2J05 A;  1EFN A;  2RQV A;  1M3B A;  2YUN A;  2GGR A;  3LH5 A;  1G2B A;  4JZ4 A;  2EBP A;  2EYY A;  1X6G A;  2IIM A;  2X3X D;  2CSQ A;  1ARK A;  2FEI A;  1N5Z A;  1M3A A;  1T0J A;  2AK5 A;  2F2V A;  2KNB B;  1B07 A;  4AG2 C;  4CC2 A;  1T3S A;  4LNP A;  1X2K A;  1GL5 A;  3VS0 A;  2CH4 A;  2LQN A;  3UAT A;  1K1Z A;  1X43 A;  2JS2 A;  3NMZ C;  2V1Q A;  2X3W D;  1AWX A;  1KJW A;  5GJW B;  1NEG A;  2HDA A;  2C0O A;  2M0Y A;  3M0U A;  4AFQ C;  2DBK A;  3PE0 A;  1E7O A;  2LP5 A;  1E6H A;  3JV3 A;  1ABO A;  2DM1 A;  1AVZ C;  2KXC A;  3VS3 A;  2AKL A;  3UF4 A;  1JQQ A;  5GJV B;  4JJB A;  5ECA A;  2K9G A;  4CC7 A;  3TSW A;  3SEM A;  1GRI A;  2BZ8 A;  2CH4 W;  2DLP A;  2K2M A;  1GCP A;  1UUE A;  2K79 A;  1NLO C;  1I07 A;  4HVV A;  4WCI A;  1AZG B;  2AZS A;  1YNZ A;  2CT3 A;  3QWY A;  1E6G A;  1QLY A;  2L3S A;  1PRM C;  3VS5 A;  2PNI A;  2JMA A;  1M3C A;  4RTW A;  3TVT A;  5IHK A;  1W1F A;  4JJC A;  2J7I A;  2CT4 A;  1MUZ A;  2EW3 A;  2YUO A;  4AFS C;  4RTX A;  1ZUU A;  1ZBJ A;  2OJ2 A;  3VS6 A;  1H92 A;  1CKB A;  2LX7 A;  1H8K A;  3M0S A;  1PKS A;  4KRT A;  3RBB B;  2JMC A;  5FW9 A;  1OPL A;  1YCS B;  1AEY A;  1WDX A;  5IHI A;  2DL4 A;  3EG3 A;  1JEG A;  2EGC A;  2YDL A;  2VKN A;  2LMJ A;  1ZSG A;  1NLP C;  2DMO A;  2A28 A;  1GCQ A;  1QKX A;  4J9D A;  1J3T A;  1MV3 A;  2MOX A;  2CUB A;  1PWT A;  5FWC A;  3O5Z A;  2YUP A;  1M27 C;  2EYW A;  1BBZ A;  1VYT A;  1SRL A;  2K3B A;  1NYG A;  2J06 A;  4ORZ A;  3I9Q A;  2A08 A;  2ABL A;  4J9H A;  1I1J A;  5I11 A;  2JM8 A;  4J9E A;  1FMK A;  1PKT A;  2FO0 A;  3H0H A;  1U06 A;  1X27 A;  4D8K A;  1SEM A;  3M0Q A;  2JW4 A;  1X2Q A;  2FRW A;  1UFF A;  4J9B A;  2GTJ A;  3I5R A;  2HCK A;  3REA B;  2LQW A;  1YWP A;  4DEX A;  2DJQ A;  1RI9 A;  1I0C A;  2L3P A;  2O9V A;  1Y57 A;  1RLQ C;  3CQT A;  2CRE A;  2K6D A;  2PZ1 A;  3M0P A;  4CC3 A;  1OV3 A;  2CUD A;  2BZY A;  1GBR A;  3H0I A;  4IIO A;  3VS4 A;  5L23 A;  1JXM A;  4J9G A;  1QKW A;  2DYB A;  4AFZ C;  5EC7 A;  2DVJ A;  1ZUY A;  1U5S A;  3A98 A;  1YN8 A;  2LJ0 A;  3H41 A;  1YWO A;  2O31 A;  4DEY A;  1OEB A;  1W70 A;  1QCF A;  1LCK A;  2RQT A;  1ZLM A;  1TUC A;  3IQL A;  1CSK A;  4J9C A;  4K11 A;  1AWJ A;  2D8H A;  2O88 A;  1M8M A;  1UGV A;  1ZX6 A;  2ECZ A;  2RMO A;  2CSI A;  2I0N A;  2J6K A;  1WA7 A;  1WIE A;  4JPB W;  3H0F A;  4Z88 A;  2JS0 A;  1X69 A;  3RNJ A;  2F2X A;  4ZNX A;  1WI7 A;  2DF6 A;  2DX1 A;  2XMF A;  2B86 A;  2O9S A;  4D8D A;  2SRC A;  3REB B;  2ESW A;  1WXU A;  3NPF A;  1QWE A;  3I5S A;  1K0X A;  2J6O A;  1SHG A;  2RF0 A;  2HSP A;  2DE0 X;  1WYX A;  4IIM A;  1WX6 A;  2D1X A;  2H8H A;  3C0C A;  2NWM A;  2JT4 A;  1AOJ A;  2DRK A;  2ENM A;  1UTI A;  5HCK A;  2ED0 A;  2EQI A;  2F2W A;  3VS2 A;  2PTK A;  1GFC A;  1VYV A;  2EKH A;  1MV0 B;  1PRL C; 
#chains in the Genus database with same CATH topology
 3VUB A;  2FPF A;  4A4F A;  4PJN A;  5IXB A;  1M5Q 1;  4FYW B;  2DZC A;  1UG1 A;  3CD6 T;  4M75 C;  2AKK A;  1ABQ A;  1Z9Z A;  1MMG A;  2QQ9 A;  5KYN A;  4A4K A;  4C5H A;  3QZ5 B;  1ZHI A;  3M57 A;  2KRS A;  2E41 A;  1G3W A;  3A8O B;  1VQ8 A;  2M51 A;  2K5F A;  3OYM A;  4OMQ A;  1TOV A;  2K7A A;  3LGF A;  4DQ2 A;  1VQP Q;  2YLC A;  4RTU A;  3VRY A;  4A4H A;  2EVR A;  1M2V A;  2J6F A;  1VQL A;  2E1H A;  1GXI E;  4AFU C;  4C92 D;  5LJ5 e;  1VQ5 A;  1OPK A;  3DB4 A;  1WFW A;  3CMA Q;  3VJP A;  3G4S Q;  1BI1 A;  2A36 A;  3EFR A;  2ROT A;  2D0Q B;  4EMH A;  1HD3 A;  1QVP A;  3DKM A;  4MDX A;  2XU8 A;  2W10 A;  3HL8 A;  2DER A;  4NOY A;  1WQW A;  4N4G A;  2V26 A;  4FSS A;  4GY5 A;  2HEQ A;  4OMM A;  4DOV A;  3CCV A;  3EGU A;  5DLO A;  3EHR A;  5GAO n;  2EGE A;  4C5I A;  1NYF A;  1HSQ A;  3VS7 A;  2GQV A;  5KYW B;  1K9M U;  1U1T A;  4BAC A;  3SWN C;  5CKH A;  4LXC A;  1VQ6 Q;  1K9M R;  4F7U A;  3FDR A;  2FPD A;  1Y0M A;  3KXT A;  4IKF A;  4PJM A;  1NG2 A;  1RAG B;  5GAO p;  2C06 A;  1T0H A;  1RAA B;  2G6F X;  3KFV A;  2QQA A;  2FVU A;  2QA4 Q;  1Y7X A;  3BE3 A;  5GAN 6;  1BIB A;  4PL6 A;  1B3Q A;  3CPF A;  2LDM A;  1R8O B;  4MZM A;  2DRM A;  1DJ7 B;  3QKJ A;  2LTO A;  2G3R A;  1FYN A;  5KYX A;  1X6B A;  2C0I A;  1VQ4 A;  2R58 A;  3V8J A;  2QQR A;  3RMS A;  4ELY C;  2HL5 C;  2ZPF B;  4PFZ A;  2DZ9 A;  4GLK A;  3CPW S;  4OMP A;  3CPW A;  3JCM J;  1BIA A;  2V1R A;  4XTV A;  1UHF A;  4B9X A;  1VQP T;  1C0M A;  3LGL A;  7AT1 B;  2YHT A;  2C0T A;  1YIJ A;  1FXX A;  3INZ A;  2A7Y A;  1M1K C;  3CXC S;  3BDL A;  3CC2 A;  5HKC A;  3CMA T;  2RJD A;  4HXJ A;  3G4S T;  2DIL A;  1N8R U;  3DLM A;  4FYX B;  4X1V A;  1OQK A;  3M59 A;  3DLL A;  1GCQ C;  1N8R R;  3G6E Q;  2LX9 A;  4M78 D;  2L8D A;  1MHN A;  5J39 A;  4OMN A;  2JN0 A;  2P0K A;  3MP6 A;  3PNW C;  1SRM A;  3GBQ A;  2HMA A;  4M75 D;  1IRX A;  2EYZ A;  2DAQ A;  1BU1 A;  2KR3 A;  3E9G A;  4KGV B;  1QP3 A;  5FWB A;  1VQ7 Q;  1EZZ B;  1Q81 C;  1W2B P;  2OTJ Q;  1NZ9 A;  3TU4 K;  4QQD A;  2ED1 A;  1Y71 A;  2DTI A;  1VQ6 T;  1QMC A;  1OI1 A;  1OOT A;  2COZ A;  4LUE A;  1NEB A;  1UE9 A;  1GFD A;  2BKD N;  2OTL A;  2RQU A;  2Y4Y A;  4ESR A;  2L2P A;  1LPL A;  2QA4 T;  4Z89 A;  2F5K A;  3EHQ A;  4ZGD B;  5GMK i;  4JLI A;  4KUI A;  2DIG A;  1WJQ A;  2VAS A;  2GGR A;  3LH5 A;  5GAO q;  2A3L A;  3AT1 B;  3I55 Q;  5CQX A;  1KQ2 A;  3BY7 A;  2RJC A;  2CP2 A;  2FEI A;  3MET A;  2CZ6 B;  2RK1 A;  2KNB B;  5KCO A;  3CCM Q;  2X4Y A;  3JCM e;  1K1Z A;  3EFO B;  1G8X A;  1PD1 A;  4KH1 B;  2HDA A;  4AFQ C;  1Q86 U;  2DBK A;  4ZTF A;  2AT1 B;  2CP3 A;  1E7O A;  2LP5 A;  1E6H A;  2VGN A;  1RAF B;  1WPY A;  1Q86 R;  3SD4 A;  4NS5 A;  2QXF A;  1W4S A;  1U1S A;  3VKI A;  4BUG A;  2X51 A;  3G6E T;  2VUB A;  3OW2 P;  3X28 B;  1N6A A;  4CC7 A;  3SEM A;  1ZA2 B;  2FZG B;  2WAC A;  2GF7 A;  1VQ7 T;  4HVV A;  1V29 B;  4XQ3 A;  2CT3 A;  3V8L A;  4JUV A;  1KD1 C;  2OTJ T;  4BY6 C;  4RTW A;  1S72 Q;  1M1F A;  1W1F A;  2E10 A;  4JJC A;  4C8Q D;  2CT4 A;  1VQ9 Q;  4PJO G;  2CGH A;  5LJ3 j;  1YJ9 A;  2DPP B;  5HK0 A;  4M7A G;  2XG8 D;  1H92 A;  1KC8 C;  2H3J A;  4BI3 A;  1H8K A;  2XHC A;  3A8G B;  3CBO A;  2DFU A;  1OPL A;  1YCS B;  4ANJ A;  3I55 T;  4CRI A;  1W2B A;  3D7S B;  3CC7 A;  1F1B B;  1TTH B;  2EGC A;  2E65 A;  2YDL A;  3FEO A;  3CCM T;  1ZSG A;  1NJI C;  2DMO A;  2YRV A;  4J9D A;  1MV3 A;  1PWT A;  4RG8 A;  1D1C A;  1M27 C;  2CYZ B;  2DKG A;  1K73 C;  3PT9 A;  4RCC A;  2WSF E;  2CP5 A;  3WVD B;  2ATC B;  4OB1 B;  1MMD A;  1UB4 A;  4C0D B;  5GAN 3;  2ABL A;  4OB0 B;  2MAM A;  1HK9 A;  3H0H A;  1LJO A;  2Y4X A;  4E47 A;  4HCC A;  1H64 1;  2RHI A;  2IVW A;  2JW4 A;  4J9B A;  4PJL A;  3LYI A;  2GTJ A;  1M4Z A;  4L5G A;  2F5T X;  1Q95 G;  3MEU A;  4DEX A;  2DJQ A;  1I0C A;  2L3P A;  3RES A;  4M7D G;  4FIB A;  4JRK A;  2O4X B;  2K3X A;  4MZP A;  1RLQ C;  4NL2 A;  1PSF A;  1S72 T;  3OA6 A;  4CC3 A;  1VQ9 T;  2KI7 A;  2DK3 A;  3OW2 A;  3CCL A;  2EWN A;  4LDX A;  4Z02 A;  1RAC B;  2DYB A;  5DLQ E;  4AFZ C;  1U5S A;  2E3H A;  1TXQ A;  1YN8 A;  4HCB A;  1WHJ A;  6AT1 B;  5I21 A;  1D3B B;  8AT1 B;  1YWO A;  4BE2 A;  2O31 A;  3UPU A;  4M7A B;  3EGD A;  1ZLM A;  2QTX A;  2HZY A;  4KGX B;  4PJO A;  4TVR A;  3T9N A;  2KVQ G;  2ECZ A;  3M4Y A;  2CSI A;  2HQX A;  1WZO A;  3H0F A;  4KH0 B;  2JS0 A;  1X69 A;  4N0A C;  2F2X A;  4ZNX A;  1WI7 A;  2DET A;  3LX7 A;  1X75 C;  1QCN A;  1QWE A;  5GAN 4;  4XU3 A;  1OZ3 A;  2DE0 X;  2XID A;  2EFI A;  5KE2 A;  2CKK A;  5IN1 A;  3JCM Q;  4C8Q B;  4MDW A;  2PVO B;  2ENM A;  3RKW A;  4OVA A;  3JCM h;  3BFM A;  3X26 B;  2DL8 A;  1M90 C;  2KE9 A;  2D0N A;  1AT1 B;  4QQG A;  3GIB A;  2W0Z A;  2MCN A;  3JB9 J;  1IXD A;  5I2M A;  2KEA A;  1VQK A;  4QKU A;  2K2V A;  3EG9 A;  4QVC A;  2NUP B;  2RI5 A;  2P4R A;  2X4J A;  2GNC A;  3NFC A;  2KRM A;  3VRZ A;  1VQK Q;  3THK A;  5GMK j;  3HKS A;  2LNV A;  4VUB A;  4Y91 A;  2DBM A;  2KDS A;  1QVF P;  4QVZ A;  4M7D A;  1IO6 A;  3CD6 A;  2QAS A;  1EIF A;  2EYQ A;  3M0T A;  2QTV A;  2EPD A;  4M4Z A;  4LN2 A;  5IHN A;  1SSF A;  2RQW A;  2BTT A;  4IUR A;  3OSS C;  3URG A;  1BI2 A;  2VC8 A;  2LRQ A;  2MF2 A;  1W6X A;  4L6V 5;  2JUF A;  1KFZ A;  2RQR A;  1Q7Y C;  5A0G A;  1R77 A;  2FHD A;  2GTO A;  3ZFJ A;  2EYX A;  3VYG A;  4J7F A;  2JM9 A;  2ZPB B;  2COY A;  2ZPG B;  1ZSZ B;  2KYB A;  2LVM A;  3E9F A;  1YHQ Q;  4BE0 A;  3S3N A;  4E7I A;  1QP2 A;  1RAE B;  4J8O A;  2L0A A;  3TCJ A;  3QJY A;  3G71 Q;  2E5Q A;  1UEC A;  1M1K U;  4MML A;  1O75 A;  1YP5 A;  1K8A C;  1M1K R;  4JS4 A;  2XK0 A;  2SEM A;  4A4G A;  1Y96 B;  2QDL A;  2BUD A;  2CP6 A;  1IRE B;  1D0Z A;  1PCX A;  1BI0 A;  2E6N A;  4A53 A;  1JRI A;  2QDY B;  3HPW A;  3CC4 A;  2H3E B;  1SSH A;  2QI2 A;  2FG0 A;  4PJO F;  4M77 G;  3MPU B;  3TSZ A;  4B9W A;  4PJO E;  4XU0 A;  2YSQ A;  3OS1 A;  4J83 A;  4M7A F;  5IT9 E;  1VQK T;  3G7Z A;  4M7A E;  3CC4 Q;  3MKD A;  1BB9 A;  1YFN A;  2M9U A;  5CKE A;  5GAM h;  3EG2 A;  2BE9 B;  3NGP A;  5AYF A;  2JOY A;  3PGG A;  1R0B G;  1WJS A;  2RA2 A;  1MMA A;  1MGQ A;  4RTT A;  4DBR A;  4Z8A A;  4E2F B;  1K9A A;  4FW2 A;  4DBH A;  3P8D A;  1ZA1 B;  2D8J A;  3PVQ A;  3FIF A;  1VQP A;  4LE9 A;  2MI6 A;  3EG0 A;  1R0C B;  1AWW A;  3OYD A;  4C0F A;  5KYY B;  3MP1 A;  1QVF A;  3I56 Q;  1KIK A;  3R6N A;  2GBQ A;  3QZ9 B;  3SHW A;  2KYM A;  3CMA A;  4CC4 B;  3G4S A;  2HAX A;  3S6W A;  1YHQ T;  4FYV B;  1WLP B;  1KSW A;  2FRY A;  4F17 A;  3G71 T;  3JCM f;  4F16 A;  2RD1 A;  1XOV A;  4KUL A;  1AWO A;  1BK2 A;  3QPH A;  1WXB A;  5GAN 2;  5CO7 A;  5GAN h;  1IGU A;  2J05 A;  2RQV A;  1M3B A;  4ZTJ A;  3LLR A;  3QDF A;  3FC3 A;  5GAM g;  3CBP A;  4LD6 A;  3BDU A;  2IIM A;  1X6G A;  2X3X D;  4O5V A;  2RHZ A;  4M7D F;  4EPC A;  4M7D E;  1SKU B;  3GLX A;  3BW1 A;  3MEW A;  5FU6 B;  1ARK A;  2P4T A;  1VQ6 A;  1T0J A;  2AK5 A;  4CC2 A;  2CH4 A;  3UAT A;  1NBE B;  1X43 A;  3JCM d;  4BB7 A;  2HQE A;  1WHG A;  3RER A;  1N27 A;  2QA4 A;  1KD1 U;  3CC4 T;  5LJ5 j;  2M0Y A;  3M0U A;  4M77 B;  5KYW A;  2O01 E;  4JRP A;  1VQO Q;  4EMK B;  2E64 A;  3L2R A;  1KD1 R;  2EJG A;  4F7U B;  3VU3 C;  2V8I A;  3PTA A;  4PJO C;  3L2U A;  1B34 B;  4E7Z A;  1KC8 U;  3VS3 A;  2AKL A;  1RAH B;  4M7A C;  5J26 A;  1IHW A;  2BE7 D;  5GJV B;  4AT1 B;  4ZN3 A;  2E3I A;  1KC8 R;  2VXF A;  2K9G A;  2JTM A;  3TSW A;  2BZ8 A;  2CH4 W;  2FZC B;  5GAN g;  3MO8 A;  4FU6 A;  2L5Q A;  5KYX B;  3A5Z B;  2KAF A;  4EDU A;  1UUE A;  3I56 T;  2K79 A;  3GOX A;  1I07 A;  4X9C A;  4WCI A;  3OYN A;  1NJI U;  3QWY A;  1E6G A;  4P5N A;  4OGE A;  2PNI A;  1M3C A;  4N4H A;  3UDC A;  1NJI R;  4N0A A;  2GFU A;  5IHK A;  4E7K A;  2LC4 A;  1RAI B;  3V7C A;  3G6E A;  1JBM A;  2BIV A;  1QVG A;  5KYU A;  4UC4 A;  4OF1 A;  4BD3 A;  2R57 A;  1ZBJ A;  2OJ2 A;  2LX7 A;  3M0S A;  3RBB B;  1VOM A;  3VYH B;  1VQ7 A;  1LOJ A;  1FX7 A;  4FSX A;  2OTJ A;  3EG3 A;  4CI0 C;  3OBW A;  5FRO A;  2DIQ A;  3RUX A;  4OMF B;  2LMJ A;  2M02 A;  4FT2 A;  1J3T A;  2MOX A;  1G3S A;  2ZPE B;  3O5Z A;  5EG2 A;  5GAM f;  1SRL A;  4HCZ A;  3WXM B;  5CK9 A;  3LWH A;  1VQO T;  4M7D C;  1OX9 A;  3I55 A;  2K3B A;  3MCA B;  3E2U A;  4ORZ A;  3OYY A;  1H3Z A;  3CCM A;  1UGP B;  3EFS A;  1VUB A;  3QII A;  1FMK A;  4C92 B;  2JZ2 A;  4M78 G;  2FO0 A;  2MK5 A;  4IUP A;  2M0O A;  2NYS A;  4PLI A;  3HRU A;  1QQJ A;  2ZCF B;  2FRW A;  1UFF A;  3JB9 H;  2MYS A;  3OYH A;  3REA B;  5GAM d;  2LQW A;  1YWP A;  2O9V A;  2KQW A;  1NPP A;  1HXD A;  1IHV A;  1YJN Q;  2PZ1 A;  1OV3 A;  2BZY A;  3X25 B;  2WSC E;  3EFO A;  3CME A;  3H0I A;  1B7T A;  5L23 A;  5GAN f;  4DA4 A;  1OU8 A;  1JXM A;  1QKW A;  3M4G A;  1QW1 A;  5EC7 A;  1OUL A;  2NLU A;  2VYT A;  1M8V A;  2E12 A;  4PJO D;  3H41 A;  1XQH A;  3CME Q;  1MMN A;  2KMT A;  1OEB A;  1QCF A;  1LCK A;  1KK7 A;  1TUC A;  1CSK A;  2CS7 A;  1S72 A;  5CCA A;  3A8H B;  1VQ9 A;  2D8H A;  4M77 F;  1M90 U;  1ZX6 A;  2DXT A;  4M77 E;  2YLB A;  2I0N A;  2J6K A;  5GAN d;  4Z88 A;  1M90 R;  1HYO A;  1P92 A;  3RNJ A;  3QYG B;  3P8H A;  2DX1 A;  4AMC A;  2O9S A;  5CKF A;  3REB B;  3ER0 A;  1K9M C;  3RDV A;  4LD9 K;  1XJW B;  3RMQ A;  2J6O A;  3GP8 A;  2RF0 A;  3OYJ A;  3C0C A;  4FYY B;  3JCM P;  5FU7 C;  4FCY A;  1W2B S;  2JT4 A;  1X01 A;  5HCK A;  3VS2 A;  2LT1 A;  2QQS A;  2PVD B;  1VYV A;  2EKH A;  5CKB A;  4E7L A;  3OYF A;  4KBM B;  4M78 B;  2O2O A;  4JJD A;  2YXY A;  4XU2 A;  3SFM A;  1YJN T;  2XI9 A;  1H3H A;  4M75 B;  3PIO A;  3UA6 A;  2YUQ A;  1Q7Y U;  4C8Q G;  3QXE B;  1WHK A;  1VQN A;  9ATC B;  1AZE A;  1ACM B;  4M7D D;  2CP0 A;  1Q7Y R;  4HT8 A;  4OMO A;  3QSU A;  3M53 A;  4RTY A;  3R6O A;  5IH2 A;  2DNU A;  2EAY A;  3CME T;  1K0S A;  3ULR B;  1TS9 A;  1VQN Q;  3QO3 A;  2XDB A;  4C5G A;  3JSC A;  1N8R C;  3M56 A;  4HVU A;  2LNH B;  5GAM e;  1SPK A;  2GQI A;  3MJX A;  1PM3 A;  4OB2 B;  3CCQ Q;  1HJD A;  1VQM Q;  2F69 A;  2QEX Q;  1PHT A;  3M54 A;  4HCK A;  5AT1 B;  4Q5W A;  1YI2 Q;  4X34 A;  4N4I A;  3OW2 S;  2O4X A;  2KGT A;  2COW A;  1JJ2 A;  4V2S A;  3H9N A;  2D9T A;  4E6R A;  4M77 C;  5IXF A;  2HNI A;  1JU5 C;  3QHS A;  1N9R A;  3HRT A;  1Z9Q A;  2DVE A;  3KUF A;  3SWN B;  1O9S A;  4LDW A;  3V8K A;  4RUG A;  4FT4 A;  4RTV A;  3OY9 A;  1D3B A;  2ZPH B;  3EGD B;  2VWF A;  3M0R A;  4M7A A;  3OQ5 A;  4IUU A;  1UJ0 A;  4J9I A;  5GAN e;  1AD5 A;  5GMK m;  3X20 B;  1C1A A;  1A0N B;  3WVE B;  2JTE A;  3PVL A;  5CKD A;  4FM4 B;  4J6Y A;  1D0Y A;  2RJE A;  2ZZD A;  3JCM V;  1TG0 A;  2RPN A;  3OB9 A;  4F14 A;  3JCM X;  2ROL A;  3HSB A;  1VQN T;  3OYL A;  4JRI A;  2E6Z A;  1S1N A;  2FB7 A;  1SHF A;  2XD0 A;  2CZ0 B;  1T3L A;  2KT8 A;  3CCE Q;  2JJ9 A;  1CKA A;  3CCQ T;  2AZV A;  1TWB A;  4LUD A;  2L3Q A;  1VQM T;  4ZGE B;  2QEX T;  3JCM W;  4A63 B;  5I22 A;  2K5I A;  4QT7 A;  2RI2 A;  1YI2 T;  2LCS A;  2OAW A;  2K57 A;  2K5L A;  1JXO A;  1QCO A;  1TUD A;  2BZX A;  3EG9 B;  3EH1 A;  2D6F A;  1M30 A;  2JVV A;  5CR2 A;  1UJY A;  4RTZ A;  4AG1 C;  2KK4 A;  3CBM A;  4XTU A;  4EIK A;  5LJ3 h;  4M78 F;  1ZQ1 A;  4M78 E;  2VGM A;  2FPE A;  3HTR A;  1RL2 A;  2DEU A;  3E1S A;  2E4H A;  3CCU Q;  2YUN A;  3N5B B;  4YTL A;  4J5Y A;  1G2B A;  2EBP A;  2EYY A;  3X24 B;  1TSF A;  1YHQ A;  3M9Q A;  3EH2 A;  1N5Z A;  2F2V A;  5GAO m;  3QG1 A;  1FMW A;  1T3S A;  3G71 A;  1I5L A;  3VS0 A;  5CIU A;  3PMI A;  3HRS A;  2V1Q A;  3JCM b;  2X3W D;  1AWX A;  4R55 A;  5GJW B;  5A2Q E;  3EGX B;  4QVD A;  3FRN A;  3FJP A;  4BDY A;  3SDZ A;  3PE0 A;  2NUT B;  5DY9 A;  4J6W A;  4E7J A;  2OAU A;  2DM1 A;  3CCE T;  5GAO r;  3UF4 A;  1JB0 E;  4XTZ A;  5LJ3 g;  5ECA A;  1KQS A;  1I8F A;  1UGQ B;  2MWP A;  4IUT A;  4J7I A;  3NTI A;  2DLP A;  3RIR A;  2EJF A;  2K2M A;  3GNF B;  1GCP A;  5GAN 5;  1Q81 U;  1AZG B;  2AZS A;  3LW5 E;  1YNZ A;  2P84 A;  1NPR A;  2L3S A;  1PRM C;  4F7U G;  2JMA A;  3TVT A;  2RB6 A;  1XNI A;  1Q81 R;  3CEY A;  3UT1 A;  2MPX C;  1MUZ A;  5FRM A;  2LQ8 A;  2EW3 A;  1SF9 A;  3CCR Q;  2DXC A;  3C4S A;  1ZUU A;  2P0Q A;  5IAY A;  5D7U A;  1PKS A;  4KRT A;  2LCL A;  1WHM A;  2MWO A;  1M1G A;  1WNL A;  3CCU T;  1QVG P;  3I56 A;  3L2W A;  3P8B B;  1SG5 A;  1V76 A;  3OMG A;  4BE1 A;  1QVF S;  4OB3 B;  4LDU A;  4C8Q F;  4C8Q E;  2DXB A;  3CXC P;  1Q82 C;  3OYI A;  1PSE A;  4II1 A;  5FWC A;  5KYY A;  2EYW A;  1BBZ A;  1VYT A;  3MEV A;  4FW1 A;  1RAB B;  4C0D C;  1M2V B;  1NYG A;  3L42 A;  4HA8 A;  3JB9 G;  2MMP A;  3I9Q A;  2R5M A;  2WSE E;  4J9H A;  1VQ8 Q;  5I11 A;  2JM8 A;  5GMK l;  4ELZ C;  4PJJ A;  3L1A A;  1X27 A;  5GAN 8;  3M0Q A;  2B8A A;  1VQO A;  3I5R A;  1VQL Q;  3ZEH A;  1RI9 A;  2AIR B;  1LNX A;  1N9S A;  1VQ5 Q;  3UWN A;  3JB9 I;  1Y57 A;  2CRE A;  4DBQ A;  1M2O A;  5LJ3 f;  1I4K 1;  5D6X A;  2VB6 A;  4MMK A;  1G3T A;  3VUZ A;  2CUD A;  3O8V A;  3CCR T;  3G1J A;  4C92 G;  1PG5 B;  1YIT A;  4J9G A;  3CCV Q;  5L8R E;  4M77 A;  5GMK h;  2Z0W A;  2DVJ A;  4XU1 A;  1WQ7 A;  4EMK A;  4XAX B;  2LJ0 A;  1UGS B;  5CQY A;  1UEB A;  5KH6 A;  2YRD A;  2RHU A;  1B34 A;  3L2Q A;  1W70 A;  1YIT Q;  2RQT A;  2RH2 A;  3IQL A;  2M1H A;  4IUQ A;  5A0D A;  4K11 A;  5C6S A;  1AWJ A;  1XTD A;  5LJ3 d;  3OS5 A;  1M8M A;  1UGV A;  2X4X A;  5M9O A;  1PC0 A;  3NTK A;  1WA7 A;  1U8R A;  4JPB W;  4RG2 A;  2HSE B;  2P0P A;  4OGC A;  1RI0 A;  2QK0 A;  1K73 U;  1QVG S;  2B86 A;  2LT4 A;  2SRC A;  4PK4 A;  1WXU A;  2HKQ B;  1K73 R;  4C0Z A;  2CZ1 B;  1SHG A;  4C8Q C;  5KYU B;  1VQ4 Q;  1WX6 A;  2VV5 A;  2H8H A;  2X35 A;  4KGZ B;  3OYC A;  1FWZ A;  1VQ8 T;  2NWM A;  1AOJ A;  3CXC A;  3QDR B;  2F2W A;  2PTK A;  3KBG A;  1GFC A;  4MZT A;  1MV0 B;  1PRL C;  5GAO l;  2VXE A;  3M58 A;  3GF5 A;  1YIJ Q;  2FL7 A;  1VQL T;  3OYK A;  5CVI A;  1VQ5 T;  2RN8 A;  3OMC A;  3CC2 Q;  4ATO A;  5C0M A;  2HBP A;  2DA9 A;  4Y28 E;  3VS1 A;  3ZBD A;  3RKX A;  4BI8 B;  3C12 A;  2NUZ A;  2EGA A;  2L89 A;  2FYK A;  3C95 A;  3GNG A;  5KCH A;  2DD4 A;  3CCV T;  1UHC A;  3VV0 A;  1M9S A;  1ZBX A;  1VA7 A;  1X6O A;  1VYU A;  3F70 A;  3S3O A;  3QWX X;  1ZUK A;  2KRO A;  3NHN A;  3L2V A;  2DL5 A;  3TQ7 P;  2KXD A;  1UDL A;  2FZK B;  1YIT T;  3DB3 A;  1VIE A;  4OML A;  2KT1 A;  3FJ5 A;  5J3B A;  2LJ3 A;  1YJN A;  2ZPI B;  4J9F A;  4WTO B;  1OU9 A;  2EQM A;  4M75 G;  2CDT A;  1NE8 A;  4JZ3 A;  4PLL A;  2X9H A;  2KBT A;  4C92 A;  2QQB A;  3PMT A;  3OYA A;  1RLP C;  2M16 A;  1KG1 A;  1NM7 A;  2OTL Q;  4JJN K;  1G83 A;  1VIF A;  1V1C A;  4C5E A;  2YWW A;  2RI3 A;  1ZSZ C;  2RM4 A;  4JDS A;  3SB2 A;  5GAN 7;  1GBQ A;  2R5A A;  2XKO C;  1AHJ B;  1VQ4 T;  2PUK B;  2A0F B;  3NTH A;  1BCM A;  4XK8 E;  4EMG A;  3TRE A;  1JJ2 P;  4M7A D;  2KRN A;  3CCS A;  4HVW A;  3U23 A;  5LJ3 e;  4DOW A;  1D1A A;  2LCC A;  1YIJ T;  4KT0 E;  3ZL7 C;  2L3R A;  3CCS Q;  3CC2 T;  1RUW A;  2VVK A;  2ZGW A;  4F7U F;  8ATC B;  4R0K A;  3PFS A;  4F7U E;  4A54 A;  2QG9 B;  4PFO A;  2HBW A;  4GLM A;  4PKC C;  3CCJ A;  4B6M A;  5I2S A;  3J81 E;  2MIO A;  4XTW A;  4BDZ A;  1IB8 A;  3JAM E;  2AHJ B;  4C0G A;  4F04 B;  5LJ5 h;  2DL7 A;  3CCJ Q;  4GBQ A;  1IGQ A;  1OZ2 A;  2JXB A;  2OI3 A;  3FLG A;  2DTH A;  1TH7 A;  2X4W A;  2LJ1 A;  3PIP A;  3ME9 A;  2QAZ A;  2A37 A;  3QJ6 A;  2DL3 A;  1UGR B;  5HK3 A;  2RNA A;  1YJW A;  4Y92 A;  1WGS A;  1BYM A;  1D1B A;  2YT6 A;  4E7H A;  1OYX A;  2DTO A;  3ASK A;  2OTL T;  1YJ9 Q;  2RK2 A;  1MND A;  2DJZ A;  3MP8 A;  1Y07 A;  1JO8 A;  1WHL A;  2QGG A;  3QYH B;  2E5K A;  4M78 A;  3UA7 A;  1KQ1 A;  1YJW Q;  1FMV A;  3RR6 A;  2LZ6 B;  1OX8 A;  4M75 A;  3CC7 Q;  1K76 A;  3JB9 F;  1WXT A;  1U3O A;  4HT9 A;  3CCQ A;  3QBY A;  1G3Y A;  1VQM A;  4RCB A;  2V8J A;  3EG1 A;  3I35 A;  2QEX A;  1K8A U;  2F1L A;  1PNJ A;  5CAI A;  1YI2 A;  1QWF A;  1K4U S;  5LJ5 g;  4A4E A;  1EFN A;  1K8A R;  3CCS T;  5FU6 C;  1WHH A;  4JZ4 A;  1D0X A;  3J80 E;  3C94 A;  2CSQ A;  1MNE A;  3TEE A;  4O6J A;  1M3A A;  1B07 A;  4AG2 C;  4LNP A;  1X2K A;  1GL5 A;  1JJ2 S;  2LQN A;  3EAE A;  4C92 F;  2JS2 A;  3NMZ C;  4C92 E;  2IG0 A;  2Y90 A;  4EMK C;  3LWI A;  1KJW A;  5KE3 A;  1NEG A;  3CCJ T;  2C0O A;  1BCO A;  5HY6 A;  2K3Y A;  2XIC A;  3GPL A;  5GAM j;  3JV3 A;  2RHX A;  3HHT B;  1ABO A;  1D09 B;  1AVZ C;  3QUI A;  2KXC A;  3MHX A;  3SWN A;  4JLG A;  3OS2 A;  1C6V X;  4PJO B;  3MEA A;  3JCM c;  1JQQ A;  4JJB A;  1YJ9 T;  2QGF B;  4WF2 A;  3CCL Q;  1GRI A;  2EKO A;  3OSV A;  2KSS A;  4QQ6 A;  3A8M B;  2I2L A;  1I81 A;  1YJW T;  5FRN A;  1NLO C;  1YBY A;  1KQS P;  1YCY A;  3HFO A;  1QLY A;  3CC7 T;  2EJ9 A;  3L2Z A;  1I5O B;  3VS5 A;  3S3M A;  1Q82 U;  1KHI A;  3CCE A;  2DXU A;  1Q86 C;  1TU0 B;  4FL6 A;  2J7I A;  3A1P A;  1Q82 R;  4NL3 A;  3OYB A;  2GCX A;  2YUO A;  4AFS C;  4RTX A;  3M5A A;  3VS6 A;  1CKB A;  4C8Q A;  5GAN j;  3AHU A;  2EQJ A;  4PNO A;  1G5V A;  2JMC A;  5FW9 A;  2PUO B;  2RO0 A;  5GMK e;  2XDD A;  2KY9 A;  3V7S A;  1AEY A;  1WDX A;  4HKE A;  4QW2 A;  5IHI A;  3H8Z A;  2DL4 A;  2V8K A;  1JEG A;  4XTX A;  4R56 A;  4J6X A;  2XDP A;  3OS0 A;  2VKN A;  4ZGJ B;  1NLP C;  2RHY A;  2A28 A;  2DO3 A;  1GCQ A;  4L59 A;  1QKX A;  5LJ5 f;  4OP0 A;  2CUB A;  2YUP A;  2NUP A;  1IZ6 A;  2K4Y A;  3H6Z A;  1BI3 A;  3CCU A;  2HD0 A;  3V7R A;  2RJF A;  2CP7 A;  2PQW A;  2J06 A;  4M7D B;  3OYE A;  4M75 F;  4C92 C;  2DYI A;  2A08 A;  4M75 E;  4LDV A;  2E70 A;  1I1J A;  4J9E A;  4XTY A;  3CCL T;  2HL3 A;  1PKT A;  2PU9 B;  2QYZ A;  2YRC A;  1U06 A;  3HP9 A;  1SEM A;  3M55 A;  4D8K A;  5LJ5 d;  3FB9 A;  4D6W A;  1X2Q A;  5DM7 R;  3OBY A;  2HCK A;  5LL6 S;  2EQK A;  3CD6 Q;  2HKN A;  2JTF A;  3JCM g;  3CQT A;  2K6D A;  4M77 D;  1BKB A;  3M0P A;  4JS5 A;  1ZSZ A;  4ZN1 A;  5D6Y A;  1KHC A;  1GBR A;  3RKY A;  3VS4 A;  4IIO A;  4ME7 A;  3EGX A;  1LVK A;  4JRQ A;  1ZUY A;  1RAD B;  2LQK A;  2NUT A;  1KQS S;  3J7A F;  2CZ7 B;  4DEY A;  5A0L A;  1Y96 A;  2PVG B;  3A8L B;  3Q1J A;  4LDY A;  4IUV A;  4J9C A;  4RMO A;  2O88 A;  1PD0 A;  3CCR A;  4BI4 A;  2RMO A;  2DD5 A;  5FLX E;  2HQH A;  4X9D A;  2ZAE A;  1WIE A;  4BY6 B;  2DF6 A;  2DEQ A;  2XMF A;  4DBF A;  3JRZ A;  4D8D A;  2ESW A;  1TUG B;  3NPF A;  4RKU E;  4E7S A;  3I5S A;  1K0X A;  4KUD K;  3OYG A;  2HSP A;  4IIM A;  1WYX A;  2D1X A;  2IPO B;  3E19 A;  2EQU A;  5D6W A;  2GFA A;  2EIF A;  2JNG A;  3CPW P;  1EX4 A;  2DRK A;  3HFN A;  1UTI A;  3LH0 A;  2ED0 A;  2EQI A;  4PFP A;  5FU7 B;  3JB9 D;  2OX7 A;  1WJR A;  3A98 A;  4M78 C; 
#chains in the Genus database with same CATH homology
 2DL8 A;  2FPF A;  5IXB A;  2KE9 A;  2D0N A;  1UG1 A;  2RN8 A;  2AKK A;  2O2O A;  4JJD A;  1ABQ A;  1Z9Z A;  2W0Z A;  2MCN A;  3VS1 A;  2DA9 A;  2KEA A;  1H3H A;  2NUZ A;  3UA6 A;  2EGA A;  2KRS A;  2YUQ A;  2M51 A;  2P4R A;  4OMQ A;  2K7A A;  2GNC A;  1AZE A;  1UHC A;  2KRM A;  3VRZ A;  3THK A;  1VA7 A;  4OMO A;  1VYU A;  4RTY A;  4RTU A;  3VRY A;  5IH2 A;  2DBM A;  2DNU A;  3QWX X;  2EVR A;  1ZUK A;  2KRO A;  2J6F A;  3NHN A;  3ULR B;  1K0S A;  2DL5 A;  2KXD A;  1UDL A;  1IO6 A;  4AFU C;  1OPK A;  4OML A;  3M0T A;  1WFW A;  2EPD A;  2KT1 A;  3FJ5 A;  4M4Z A;  2A36 A;  2LJ3 A;  2LNH B;  4HVU A;  4J9F A;  2ROT A;  4LN2 A;  1SPK A;  2GQI A;  2CDT A;  5IHN A;  1HD3 A;  2RQW A;  4JZ3 A;  2KBT A;  2BTT A;  1HJD A;  1RLP C;  2W10 A;  1NM7 A;  4FSS A;  2HEQ A;  4OMM A;  1PHT A;  1W6X A;  3EGU A;  4HCK A;  3EHR A;  1G83 A;  1KFZ A;  1V1C A;  2RQR A;  2EGE A;  1NYF A;  2GTO A;  1HSQ A;  2EYX A;  1GBQ A;  3VS7 A;  2KGT A;  2JM9 A;  2KYB A;  4E6R A;  5IXF A;  1JU5 C;  1Z9Q A;  2L0A A;  2FPD A;  1Y0M A;  1UEC A;  1NG2 A;  2KRN A;  1T0H A;  4HVW A;  4RUG A;  1YP5 A;  2G6F X;  3U23 A;  3KFV A;  4RTV A;  2SEM A;  1B3Q A;  2QDL A;  2VWF A;  2DRM A;  3M0R A;  1UJ0 A;  3ZL7 C;  4J9I A;  1RUW A;  1AD5 A;  1FYN A;  2VVK A;  1A0N B;  4R0K A;  1X6B A;  2C0I A;  2JTE A;  3PVL A;  2HBW A;  4GLM A;  1SSH A;  2FG0 A;  3TSZ A;  4OMP A;  2V1R A;  1TG0 A;  2RPN A;  2MIO A;  1UHF A;  2YSQ A;  4F14 A;  2ROL A;  2C0T A;  2DL7 A;  1BB9 A;  4GBQ A;  3EG2 A;  2JXB A;  2OI3 A;  3NGP A;  4HXJ A;  2DIL A;  1S1N A;  2LJ1 A;  1SHF A;  4X1V A;  1T3L A;  2KT8 A;  2A37 A;  2DL3 A;  1CKA A;  4RTT A;  2RNA A;  1GCQ C;  4Y92 A;  2AZV A;  4Z8A A;  4LUD A;  2YT6 A;  2L3Q A;  1K9A A;  4OMN A;  2D8J A;  4A63 B;  3PVQ A;  5I22 A;  4QT7 A;  2LCS A;  2OAW A;  1SRM A;  4LE9 A;  3EG0 A;  3GBQ A;  1JXO A;  1AWW A;  1TUD A;  1JO8 A;  2EYZ A;  1BU1 A;  2KR3 A;  2E5K A;  3UA7 A;  2BZX A;  1KIK A;  5FWB A;  3R6N A;  2GBQ A;  3SHW A;  2KYM A;  2LZ6 B;  1M30 A;  4CC4 B;  1K76 A;  1WXT A;  1U3O A;  2ED1 A;  1OOT A;  1WLP B;  4LUE A;  1KSW A;  2FRY A;  1NEB A;  1UJY A;  4RTZ A;  1UE9 A;  4AG1 C;  4F17 A;  1GFD A;  4F16 A;  4EIK A;  1XOV A;  2RQU A;  3EG1 A;  3I35 A;  1AWO A;  1BK2 A;  4ESR A;  1PNJ A;  1WXB A;  2L2P A;  2FPE A;  1QWF A;  4Z89 A;  1K4U S;  3EHQ A;  2J05 A;  1EFN A;  2RQV A;  1M3B A;  2YUN A;  2GGR A;  3LH5 A;  1G2B A;  4JZ4 A;  2EBP A;  2EYY A;  1X6G A;  2IIM A;  2X3X D;  2CSQ A;  1ARK A;  2FEI A;  1N5Z A;  1M3A A;  1T0J A;  2AK5 A;  2F2V A;  2KNB B;  1B07 A;  4AG2 C;  4CC2 A;  1T3S A;  4LNP A;  1X2K A;  1GL5 A;  3VS0 A;  2CH4 A;  2LQN A;  3UAT A;  1K1Z A;  1X43 A;  2JS2 A;  3NMZ C;  2V1Q A;  2X3W D;  1AWX A;  1KJW A;  5GJW B;  1NEG A;  2HDA A;  2C0O A;  2M0Y A;  3M0U A;  4AFQ C;  2DBK A;  3PE0 A;  1E7O A;  2LP5 A;  1E6H A;  3JV3 A;  1ABO A;  2DM1 A;  1AVZ C;  2KXC A;  3VS3 A;  2AKL A;  3UF4 A;  1JQQ A;  5GJV B;  4JJB A;  5ECA A;  2K9G A;  4CC7 A;  3TSW A;  3SEM A;  1GRI A;  2BZ8 A;  2CH4 W;  2DLP A;  2K2M A;  1GCP A;  1UUE A;  2K79 A;  1NLO C;  1I07 A;  4HVV A;  4WCI A;  1AZG B;  2AZS A;  1YNZ A;  2CT3 A;  3QWY A;  1E6G A;  1QLY A;  2L3S A;  1PRM C;  3VS5 A;  2PNI A;  2JMA A;  1M3C A;  4RTW A;  3TVT A;  5IHK A;  1W1F A;  4JJC A;  2J7I A;  2CT4 A;  1MUZ A;  2EW3 A;  2YUO A;  4AFS C;  4RTX A;  1ZUU A;  1ZBJ A;  2OJ2 A;  3VS6 A;  1H92 A;  1CKB A;  2LX7 A;  1H8K A;  3M0S A;  1PKS A;  4KRT A;  3RBB B;  2JMC A;  5FW9 A;  1OPL A;  1YCS B;  1AEY A;  1WDX A;  5IHI A;  2DL4 A;  3EG3 A;  1JEG A;  2EGC A;  2YDL A;  2VKN A;  2LMJ A;  1ZSG A;  1NLP C;  2DMO A;  2A28 A;  1GCQ A;  1QKX A;  4J9D A;  1J3T A;  1MV3 A;  2MOX A;  2CUB A;  1PWT A;  5FWC A;  3O5Z A;  2YUP A;  1M27 C;  2EYW A;  1BBZ A;  1VYT A;  1SRL A;  2K3B A;  1NYG A;  2J06 A;  4ORZ A;  3I9Q A;  2A08 A;  2ABL A;  4J9H A;  1I1J A;  5I11 A;  2JM8 A;  4J9E A;  1FMK A;  1PKT A;  2FO0 A;  3H0H A;  1U06 A;  1X27 A;  4D8K A;  1SEM A;  3M0Q A;  2JW4 A;  1X2Q A;  2FRW A;  1UFF A;  4J9B A;  2GTJ A;  3I5R A;  2HCK A;  3REA B;  2LQW A;  1YWP A;  4DEX A;  2DJQ A;  1RI9 A;  1I0C A;  2L3P A;  2O9V A;  1Y57 A;  1RLQ C;  3CQT A;  2CRE A;  2K6D A;  2PZ1 A;  3M0P A;  4CC3 A;  1OV3 A;  2CUD A;  2BZY A;  1GBR A;  3H0I A;  4IIO A;  3VS4 A;  5L23 A;  1JXM A;  4J9G A;  1QKW A;  2DYB A;  4AFZ C;  5EC7 A;  2DVJ A;  1ZUY A;  1U5S A;  3A98 A;  1YN8 A;  2LJ0 A;  3H41 A;  1YWO A;  2O31 A;  4DEY A;  1OEB A;  1W70 A;  1QCF A;  1LCK A;  2RQT A;  1ZLM A;  1TUC A;  3IQL A;  1CSK A;  4J9C A;  4K11 A;  1AWJ A;  2D8H A;  2O88 A;  1M8M A;  1UGV A;  1ZX6 A;  2ECZ A;  2RMO A;  2CSI A;  2I0N A;  2J6K A;  1WA7 A;  1WIE A;  4JPB W;  3H0F A;  4Z88 A;  2JS0 A;  1X69 A;  3RNJ A;  2F2X A;  4ZNX A;  1WI7 A;  2DF6 A;  2DX1 A;  2XMF A;  2B86 A;  2O9S A;  4D8D A;  2SRC A;  3REB B;  2ESW A;  1WXU A;  3NPF A;  1QWE A;  3I5S A;  1K0X A;  2J6O A;  1SHG A;  2RF0 A;  2HSP A;  2DE0 X;  1WYX A;  4IIM A;  1WX6 A;  2D1X A;  2H8H A;  3C0C A;  2NWM A;  2JT4 A;  1AOJ A;  2DRK A;  2ENM A;  1UTI A;  5HCK A;  2ED0 A;  2EQI A;  2F2W A;  3VS2 A;  2PTK A;  1GFC A;  1VYV A;  2EKH A;  1MV0 B;  1PRL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...