4F14A

Structure of the sh3 domain of human nebulette in complex with a peptide of xirp2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
b'TYRAMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nebulette
publication title Identification of Xin-repeat proteins as novel ligands of the SH3 domains of nebulin and nebulette and analysis of their interaction during myofibril formation and remodeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Actin-binding protein/peptide
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2012-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4f14A00
2KROA 2XMFA 1WYXA 1U5SA 2J6KA 2NWMA 1VYVA 2B86A 3VRYA 3H0FA 1ZLMA 1UDLA 4J9BA 5IXBA 2A28A 1GBRA 3ULRB 2JM8A 1N5ZA 3NMZC 2SRCA 1Z9ZA 1SHFA 3U23A 1VYTA 2OJ2A 3M0UA 3I9QA 3GBQA 1AWOA 2F2WA 2KR3A 1PKTA 5IHKA 2ABLA 1EFNA 2RPNA 1M3AA 2J7IA 4AFQC 4ZNXA 2CSIA 4F14A 3RBBB 4HXJA 2GTJA 2KRSA 4HVWA 1YNZA 1OPKA 2ENMA 4HVVA 1B07A 1AEYA 2RQVA 2K6DA 4D8KA 1E6GA 2LJ0A 2L3SA 2J6OA 2DM1A 2PNIA 1HD3A 3EHRA 2JMAA 5HCKA 2V1QA 1V1CA 2KXDA 1BBZA 1SPKA 2VVKA 2YUPA 4M4ZA 1M8MA 2QDLA 4LE9A 3SHWA 1QLYA 1UGVA 1MV0B 2DNUA 2RQRA 3EHQA 3VS6A 1RUWA 2K7AA 2FG0A 1X2KA 1GCQA 4QT7A 3H0IA 2RQTA 1JXOA 2KRMA 1ZBJA 2ESWA 2MCNA 3TSZA 3H0HA 1G2BA 1T0JA 4R0KA 2KYMA 1XOVA 2GGRA 1FYNA 2H8HA 4CC3A 1ZSGA 2I0NA 1K0SA 2FPEA 1G83A 4K11A 4LUEA 1GCPA 4J9CA 2DL5A 2ED1A 4ORZA 2KXCA 1OV3A 2BZXA 2JTEA 4AG2C 1WDXA 2CH4W 2GTOA 2AZVA 3LH5A 2DVJA 4GBQA 4WCIA 3TSWA 1Y57A 2IIMA 2C0OA 1SRLA 2FRWA 2SEMA 2C0IA 1B3QA 2HBWA 3I35A 2P4RA 4JJBA 5FW9A 2JS0A 3NHNA 2LJ1A 3VS2A 3UF4A 3CQTA 1MV3A 1E7OA 3A98A 5ECAA 4IIOA 1X69A 2FRYA 3M0RA 4FSSA 1UJ0A 2CH4A 4OMMA 3SEMA 3KFVA 2L3PA 2V1RA 1NYFA 2LZ6B 2RQUA 1W1FA 4GLMA 2VWFA 4AFUC 2JW4A 5GJVB 4KRTA 1AVZC 1GBQA 4RUGA 1ARKA 4IIMA 4J9DA 1GRIA 2HDAA 4HCKA 2M0YA 2YUOA 3RNJA 1SSHA 4J9IA 4RTYA 4OMQA 1SRMA 2EVRA 2FPDA 1A0NB 3REAB 4LUDA 3FJ5A 2L3QA 2ED0A 2YSQA 1QKXA 2VKNA 2DYBA 4LN2A 2DBMA 1HSQA 1JEGA 4JZ3A 1ZUUA 1RLQC 3EGUA 2EPDA 2O9SA 2DRMA 3VS7A 2KEAA 2OI3A 2DL7A 1PKSA 1NLPC 1T3LA 3VS3A 1JXMA 4RTTA 4OMOA 4OMNA 2D1XA 4EIKA 2W10A 1LCKA 1GFDA 3PE0A 2DF6A 1AWWA 5IXFA 2D0NA 1JO8A 1K1ZA 2F2VA 1PWTA 4AG1C 1J3TA 2K9GA 4LNPA 1NYGA 3VS1A 1ABQA 2NUZA 1U3OA 2FPFA 1M27C 2DMOA 2HSPA 2DL8A 4AFSC 2DLPA 1UHFA 1SHGA 2EYZA 3NPFA 1NEGA 1WI7A 2EYXA 5I11A 1X2QA 2DX1A 1RLPC 2C0TA 2HEQA 3QWYA 2PZ1A 3THKA 2EBPA 5EC7A 4RTVA 2OAWA 4DEYA 2JM9A 5L23A 2JS2A 4JZ4A 1VYUA 1UTIA 1K0XA 1W6XA 2LX7A 2RNAA 2DBKA 5FWBA 2MOXA 3PVLA 1WX6A 1KIKA 2A08A 2GNCA 3IQLA 2J06A 1YN8A 1H92A 4RTXA 2YUQA 2LJ3A 3M0QA 2AK5A 4A63B 2EKHA 2RN8A 2F2XA 2J6FA 4JPBW 2EGCA 1AD5A 2LMJA 2L0AA 2X3XD 2A37A 1UJYA 1Z9QA 2LP5A 4CC2A 1H3HA 2CUBA 1NG2A 1KSWA 2KT1A 1M30A 2EQIA 1UECA 1WIEA 2GQIA 3M0TA 2E5KA 2EGEA 1X27A 2KE9A 1ZUYA 4Y92A 2LCSA 1E6HA 1NLOC 2CDTA 2L2PA 4DEXA 2PTKA 2YUNA 1K9AA 1ZX6A 1PRMC 2RF0A 2CREA 1KFZA 1S1NA 2CSQA 3UA7A 1FMKA 2LQNA 1JQQA 2YT6A 2JT4A 1NEBA 2J05A 1I1JA 1W70A 4Z8AA 1WA7A 3EG1A 3TVTA 1MUZA 4CC4B 4E6RA 2YDLA 1M3BA 2DILA 1X6BA 2DRKA 1T3SA 1ZUKA 5FWCA 2DA9A 4X1VA 2KT8A 1QCFA 1CSKA 2BZYA 2CT4A 2GBQA 5IHIA 3ZL7C 2KYBA 2AKKA 2O9VA 4J9EA 3REBB 3VS4A 3VS0A 1OEBA 4OMLA 5GJWB 1M3CA 1RI9A 2DL3A 2DL4A 2EYYA 1IO6A 1H8KA 3VRZA 4D8DA 2RMOA 2K3BA 1VA7A 3R6NA 4ESRA 2KRNA 1OOTA 2HCKA 4F16A 1GL5A 3I5RA 2KGTA 1CKBA 2ECZA 2KNBB 2O31A 1AWJA 3EG3A 4JJDA 3O5ZA 2ROLA 3VS5A 4RTWA 1Y0MA 3JV3A 3EG2A 1YWOA 2A36A 1GFCA 1UHCA 2EW3A 1PHTA 4AFZC 1YCSB 2G6FX 1AOJA 3UA6A 4JJCA 4J9HA 1QWFA 3M0SA 2O88A 2D8HA 3QWXX 1WXUA 2LNHB 2CUDA 1UFFA 1UG1A 2O2OA 2X3WD 1HJDA 2AKLA 1T0HA 1X6GA 1U06A 2FO0A 1BK2A 1GCQC 4RTUA 2EYWA 1YWPA 1WFWA 1BB9A 1QWEA 4Z89A 1WLPB 1K4US 3M0PA 5IHNA 4RTZA 1I07A 4HVUA 1ABOA 2W0ZA 2DJQA 1PNJA 2CT3A 2DE0X 4F17A 2BTTA 2EGAA 3EG0A 1PRLC 2RQWA 1I0CA 2FEIA 2LQWA 2K2MA 1CKAA 1BU1A 1TUDA 1OPLA 5IH2A 4J9FA 1X43A 2MIOA 2ROTA 2K79A 1QKWA 1AZEA 3PVQA 1AZGB 3UATA 2D8JA 1KJWA 1UUEA 1WXBA 2M51A 4J9GA 3C0CA 1TUCA 1WXTA 3I5SA 1SEMA 1UE9A 2KBTA 1K76A 2JXBA 3H41A 1JU5C 2JMCA 2BZ8A 1AWXA 3NGPA 5I22A 4Z88A 4CC7A 1TG0A 1YP5A 1NM7A 2AZSA 4OMPA
chains in the Genus database with same CATH superfamily
2V8KA 1OZ3A 4M77G 4M75G 3RKWA 2NWMA 4EMHA 3QYGB 3LW5E 1VYVA 1ZLMA 2O4XA 4OGCA 4E7KA 4J9BA 4OGEA 3LGFA 1K73C 3ULRB 3VV0A 1GXIE 2JM8A 3NMZC 1IRXA 3U23A 1SHFA 4XTVA 5CIUA 2NUTA 1YJWQ 2F2WA 3CCQT 3BDLA 3V7CA 2DAQA 5IAYA 4OB1B 3CXCP 4KGXB 3OYNA 1YITQ 1YJ9T 4BACA 5LJ3e 4MDXA 1H3ZA 2V8IA 4PJOG 4DBRA 1AEYA 2RQVA 4GLKA 4RKUE 3RIRA 1E6GA 1U8RA 2L3SA 2DM1A 2LX9A 1RAFB 5GAOp 2KSSA 2COYA 5HCKA 3CPFA 2ZGWA 2XICA 2KXDA 1OQKA 2VVKA 2COZA 1M8MA 3NTIA 3SHWA 4LE9A 4N4HA 3MP1A 4MZMA 4HT9A 5I2SA 3C12A 3ZEHA 2FG0A 1D0YA 1GCQA 2L3RA 3CCMA 4MZTA 4JLGA 4M7AA 3FDRA 5GAN8 1JXOA 4C92D 1MNEA 4M77B 4M75B 2CP6A 4M7DG 2MCNA 4MZPA 4TVRA 3TSZA 5LJ5g 3H0HA 4R0KA 1X75C 4FL6A 2KYMA 1IHWA 3EH2A 3JCMe 2H8HA 3ME9A 2AT1B 1K0SA 2D9TA 4C0DB 2YRCA 1M1KU 2QTVA 1MNDA 2HBPA 3M9QA 1M9SA 3CEYA 1OV3A 4EMKA 5GAOq 3CC4T 2DVJA 2QDYB 1V76A 1TUGB 1OYXA 1NBEB 2NLUA 5HKCA 1PM3A 2C0IA 3VKIA 5IN1A 2HBWA 4JJBA 2P4RA 4IURA 2JS0A 4PJOB 3X25B 3CXCS 5CAIA 1Q81C 4Z02A 4BD3A 3OBWA 1E7OA 2RH2A 3L1AA 1X69A 3OS2A 2DPPB 3EFOB 2XG8D 3URGA 1QVFP 2CH4A 2K5LA 3SEMA 2LVMA 1NPPA 1Q86R 5GAN7 2V1RA 3MJXA 2LZ6B 3PMIA 1VQKT 3RMSA 3CCUT 4XU2A 2BE7D 3OQ5A 4QQGA 3JCMW 5GANg 1K73U 2RHZA 5LJ5h 3H6ZA 5GJVB 1AT1B 4M7DB 1JBMA 1TTHB 4M75F 4OB3B 4IIMA 2HSEB 3CC2A 1BCMA 3JB9G 3V7RA 3BDUA 1SSHA 2LTOA 5LJ3g 2KMTA 4J9IA 3JAME 1BI1A 3CCQQ 2FL7A 2JZ2A 4M78A 3FJ5A 2ED0A 2YSQA 1QKXA 2R5MA 2VKNA 3GNGA 1RADB 3QDFA 5J26A 1YJ9Q 4JZ3A 1ZHIA 3EGUA 1KD1C 3PIOA 4HT8A 3MEAA 5KCOA 2DL7A 1PKSA 3OYMA 1T3LA 3M4GA 5CO7A 1JXMA 5FU7C 4OMOA 3N5BB 3JCMd 1WJRA 1VIFA 1N27A 2W10A 2YRDA 1AWWA 1M2OA 3WVEB 4ELYC 1R0BG 2M16A 2FVUA 1JO8A 3E9FA 2ZPHB 1OX8A 1OU9A 1J3TA 1HYOA 2K9GA 4WF2A 1QVFS 1H641 4C0GA 1D3BB 2EYQA 1Q82U 3J80E 4V2SA 4C8QE 3QJYA 1TU0B 1SHGA 4XU3A 3X20B 2RM4A 3NPFA 3G4ST 1KHCA 4II1A 3OY9A 4J6WA 3THKA 2EBPA 2XDPA 4DEYA 4M7DF 2X4JA 5LJ3h 4M77D 3OYLA 4M75D 2JS2A 1UTIA 2ZPBB 1WQWA 1ZBXA 3LWHA 2H3EB 2K4YA 3D7SB 5CK9A 3CC4Q 1M1KR 3IQLA 1R77A 2J06A 4C5HA 5KE3A 2DTHA 2YUQA 5GAOr 1G3WA 2AK5A 1MMDA 2RN8A 2CZ7B 4JPBW 1MHNA 1Q81U 2EGCA 2LMJA 1NZ9A 2L0AA 2X3XD 3MEVA 3CCJT 4IKFA 5GMKe 2AIRB 1W2BA 3JRZA 1PG5B 1VQNA 2NUPA 1QW1A 4JDSA 2EQIA 2EQKA 3LX7A 4PJOD 4FW2A 1KHIA 2QA4A 2EGEA 1KG1A 1E6HA 2PTKA 2BE9B 3E9GA 1PC0A 1VQKQ 2LQNA 3RERA 3CCUQ 2YT6A 3CCVT 4QKUA 1IGQA 4PFPA 3GPLA 1WA7A 3VYHB 3TVTA 2RHYA 4E6RA 4FCYA 1LVKA 4QW2A 2MYSA 5FWCA 4JJNK 2KT8A 2GBQA 4C0ZA 3ZL7C 2EQUA 3PGGA 4AT1B 5A2QE 3VS4A 1OEBA 1XTDA 2RK2A 4IUPA 5LL6S 5GJWB 2CP7A 4M7DD 1RI9A 1IO6A 1I5LA 2E6ZA 1H8KA 4D8DA 1IGUA 2QGGA 1FX7A 1M2VA 3ER0A 2YHTA 3RKXA 2KRNA 5LJ5j 4QVCA 2DO3A 1OI1A 3PMTA 4LD6A 3BE3A 3O5ZA 3VS5A 1VQ6T 2P0PA 3CCLA 1F1BB 1O9SA 2A36A 1UHCA 2EW3A 1Q95G 2E5QA 3SWNC 3M5AA 4M78E 3QWXX 2XK0A 2CS7A 4E47A 4XU0A 2X3WD 1T0HA 1X6GA 3A8GB 4OVAA 3TCJA 2V26A 3FLGA 5C6SA 1RI0A 3DLMA 1WFWA 1BB9A 4XTWA 3JCMf 2AHJB 1WLPB 3G4SQ 2IG0A 3RDVA 4M7AD 1PSEA 4RTZA 1Q82R 1I07A 4HVUA 2W0ZA 2E3HA 4PLIA 2CT3A 3DKMA 1VQ9Q 1MMAA 3FC3A 2BTTA 3EG0A 1PRLC 5CR2A 3DB4A 1I81A 2HD0A 5HK0A 1CKAA 5GMKi 4F7UF 1VOMA 3VJPA 5IH2A 4IUVA 3JB9D 2MIOA 1M1FA 2PUKB 3QYHB 1NPRA 1O75A 3M4YA 4B9XA 1K9MU 4LDXA 1UUEA 1Q86C 4C92G 3OMCA 5D7UA 5LJ3j 3CCJQ 1WXTA 1SEMA 3QG1A 4C5IA 2GQVA 2HQHA 2XU8A 3MP6A 3OB9A 3GP8A 4FM4B 5I22A 1TG0A 4J6YA 1HK9A 1VQPT 2J6KA 2X4XA 3I56T 1UGRB 4UC4A 3OSVA 4D6WA 3A1PA 3VRYA 3CCVQ 4FYXB 2LCLA 2G3RA 1GBRA 3JCMc 3CPWS 3JCMJ 1Z9ZA 3OW2A 3I9QA 2GFUA 4RG2A 5GAMf 5GAN3 1NJIU 2J7IA 3C95A 4AFQC 4ZNXA 2B8AA 2DXCA 2ZPFB 4NL3A 2DD5A 2KRSA 4HVWA 3I55T 1OX9A 1YNZA 5GMKh 4C8QC 1OPKA 5FU7B 4Q5WA 2J6OA 1Y96A 2PNIA 2MMPA 2JMAA 1VQ6Q 4C92B 4GY5A 2V1QA 2JN0A 1VQPA 1V1CA 3SWNA 1N9SA 2MAMA 4M4ZA 4MMLA 2QDLA 1IXDA 5GAN6 3L2UA 3OYDA 1MV0B 3VS6A 1VQ8T 3EAEA 4DBFA 2LQKA 1TH7A 1C0MA 3FJPA 2FZCB 3H0IA 1MMNA 2KRMA 4A54A 1BI0A 3JCMV 3SFMA 1ZBJA 1YITA 4LDUA 1D0ZA 2QASA 2RJDA 1G2BA 1M1KC 5IT9E 1ZSGA 3M58A 2M02A 4K11A 5J3BA 5KYXA 1HXDA 1VIEA 4FYYB 2ED1A 3JCMX 3J81E 1C6VX 2JTEA 2AZVA 4GBQA 4WCIA 1LPLA 5GAOm 2C0OA 1M90U 1SRLA 7AT1B 2PVOB 3I35A 5FW9A 1JJ2S 2KK4A 1Q7YR 2EIFA 2DXTA 3CQTA 1MV3A 4R56A 4IIOA 2IVWA 1N9RA 1MGQA 2FRYA 1K9MR 4FSSA 4C92F 2OTLT 2E4HA 2DZ9A 3JCMQ 5DY9A 1NYFA 1WHHA 2CZ6B 5FU6C 1VQPQ 2E6NA 3I56Q 2M0OA 2JW4A 3META 2RHXA 3MCAB 4KRTA 1AVZC 1R8OB 4XTXA 1B34A 1W2BP 4HCKA 3RNJA 2QQSA 1DJ7B 1M1GA 4M78C 3CPWA 4FYVB 3DB3A 1QMCA 3G7ZA 1WHMA 3RESA 4LUDA 4C8QA 2M1HA 2DYBA 4LN2A 2DBMA 1JEGA 3I55Q 2JOYA 4JS4A 1RLQC 2P4TA 2EPDA 4BDYA 2O9SA 3CMAT 3VS7A 2EJGA 2FZKB 1NJIR 1N8RU 1NLPC 1MMGA 2M9UA 3QJ6A 1RAGB 3MEWA 4RTTA 2P84A 4DQ2A 4EIKA 4XQ3A 2H3JA 2VUBA 3FRNA 4J8OA 1P92A 2DETA 2JTFA 2EQJA 3LLRA 1G3TA 2D0NA 1K1ZA 3EG9A 4L59A 2F2VA 1PWTA 1VQ8Q 4LNPA 1PD0A 5GMKj 1Q82C 3JB9H 1SKUB 4A4HA 4X9DA 3CCQA 5KYYA 3L42A 1XQHA 1M27C 3PFSA 5A0GA 3ZFJA 3V7SA 4ME7A 2ZCFB 2DLPA 1YI2T 3JB9J 2EYZA 2DYIA 1YJ9A 1NEGA 2EYXA 4E2FB 2VXFA 2DX1A 2C0TA 4EDUA 2HEQA 1WHLA 3QWYA 4BI4A 4RTVA 2OAWA 1RAIB 3M57A 2E64A 4KBMB 5KCHA 2O01E 3M53A 1K0XA 2FB7A 1KIKA 1W2BS 2GNCA 1H92A 1YN8A 3M59A 4RTXA 3E1SA 3M0QA 2HNIA 3EGDA 2J6FA 4A4KA 2HAXA 2CZ1B 5I2MA 1M90R 4E7SA 1TXQA 2R58A 3G71T 2LP5A 1JJ2A 1NG2A 4M7AG 1KSWA 1WIEA 2GQIA 3M0TA 1KQ2A 1VQLT 3HKSA 2C06A 1X27A 1N6AA 4Y92A 2QEXT 4PKCC 2OTLQ 1G3SA 4QQ6A 2O4XB 4NS5A 4DEXA 3QPHA 1K9AA 1ZX6A 1PRMC 1KFZA 1S1NA 3UA7A 4B9WA 5GANd 4M77F 3CC4A 3RMQA 2QAZA 2J05A 1VQ5T 2NUTB 2EFIA 3MO8A 2K5IA 1MUZA 1BI3A 4BE0A 2DILA 2HKQB 2DRKA 2DA9A 1QCFA 2RK1A 5GAMe 2KYBA 2AKKA 2O9VA 5A0LA 3S6WA 4XTZA 2HQXA 4OMLA 2JNGA 3SD4A 5C0MA 1IB8A 4JLIA 2EAYA 3G6EQ 2EYYA 4JUVA 1S72T 3QSUA 2QI2A 1ZA2B 4HCZA 1UB4A 3HRTA 3R6NA 4ESRA 3CMAQ 1LOJA 3S3NA 4F7UA 1GL5A 2HL5C 4PJOF 3CMET 1ZA1B 1VQKA 2NYSA 4JJDA 3RKYA 3CCUA 1XNIA 1EX4A 3EG2A 4LDYA 1YWOA 3EH1A 1GFCA 1Y7XA 1N8RR 1PHTA 4AFZC 4L5GA 4BY6B 1AOJA 4WTOB 4M7AB 2PUOB 3JCMg 1ZQ1A 3M0SA 2PVDB 2D8HA 2YXYA 4PLLA 4XK8E 2CGHA 1OU8A 2DKGA 1X6OA 4RTUA 2DIQA 2EYWA 1FMWA 3EGXA 1YWPA 1YI2Q 2EJ9A 1VQ9T 2RO0A 2ZPIB 3M0PA 5IHNA 4M78G 3EFSA 4EMKB 2XHCA 4F17A 2KDSA 2RQWA 5KYUA 2LQWA 3WXMB 1Q7YC 1BKBA 1UGPB 2JJ9A 1QP3A 1YIJT 2X35A 4LD9K 1YJNT 1WJQA 1RAEB 1X43A 2ROTA 2RJCA 2GCXA 1K9MC 1VQMT 2HMAA 4BI3A 5AYFA 1D1BA 2MWPA 1K8AU 1TUCA 3G71Q 2VGNA 1YHQQ 3G4SA 2LT1A 2YLCA 5GAMd 5GMKl 3NGPA 3F70A 1VQLQ 3JCMh 1VQ9A 5FU6B 4CC7A 2QEXQ 3QBYA 4OF1A 2QQ9A 3OW2S 4M7AF 4ELZC 4OMPA 1WJSA 1WYXA 1U5SA 5DM7R 2RHIA 4JS5A 3CCST 3H0FA 5HK3A 3INZA 5IXBA 1VQ5Q 2A3LA 2KY9A 3QXEB 6AT1B 2CP0A 2R57A 2E70A 4M78B 1VYTA 2E41A 2OJ2A 3M0UA 3JB9F 3NTHA 4HCBA 1NJIC 2DEQA 5IHKA 3CCJA 3CCRQ 2ABLA 1EFNA 2RPNA 3CC7Q 2XDDA 2R5AA 4HXJA 3QO3A 2GTJA 2RI2A 4DA4A 1S72Q 5GANf 5CKDA 1M5Q1 3E19A 2MF2A 3AHUA 2K6DA 2JVVA 2Y90A 3NFCA 1FWZA 2OTJT 3CMEQ 1HD3A 4J6XA 4C8QD 5I21A 2DXUA 3TU4K 3EHRA 2RD1A 3CCVA 2YLBA 4KGZB 5KYNA 4KGVB 3KBGA 1IHVA 1SPKA 2PQWA 2YUPA 4PJNA 4E7LA 1QLYA 3A8HB 2RQRA 3CPWP 1RUWA 2K7AA 2XKOC 1X2KA 4QT7A 2I2LA 3BW1A 2RQTA 3HRUA 2ESWA 4F7UE 4J7FA 2RA2A 1XOVA 2GGRA 2DERA 1FYNA 4CC3A 3LWIA 2I0NA 1G83A 3OYYA 3CD6T 4M75C 1GCPA 1FMVA 1Q7YU 1VQ6A 4BE1A 1VQ4T 2QYZA 2KXCA 4FT2A 1NE8A 3M55A 1WDXA 2CH4W 2GTOA 2WACA 1M90C 2MI6A 3LH5A 1RABB 2EWNA 3TSWA 1YIJQ 2IIMA 1YJNQ 4PJLA 2FRWA 3UT1A 5M9OA 3CBMA 4ZN1A 3OSSC 1VQMQ 2LJ1A 2NUPB 2BKDN 2MK5A 3VS2A 2GF7A 3GLXA 5ECAA 4DBHA 4IUUA 1D09B 2X51A 5GMKm 4PJOC 1UJ0A 3A8LB 2MPXC 5KYWA 4NOYA 3VUZA 2QG9B 1K8AR 1W1FA 4NL2A 2VWFA 3CCSQ 1D1CA 3EFRA 1VUBA 2LT4A 3OYIA 1GBQA 2DTIA 2OAUA 1LJOA 1GRIA 2VC8A 5KH6A 3CCET 2HDAA 1SF9A 2M0YA 2YUOA 1JJ2P 4RTYA 4PNOA 5FROA 3L2VA 5HY6A 2EVRA 1A0NB 1M2VB 3REAB 4M7DC 4KUIA 1QCNA 1HSQA 4M78D 1ZUUA 2K2VA 3V8JA 1N8RC 2DRMA 4E7JA 1KQSA 3UWNA 2KEAA 3NTKA 4DOWA 3HP9A 2OTJQ 3MKDA 2D6FA 3I56A 4O6JA 4OMNA 1TOVA 2D1XA 1VQ7T 4C5EA 2DF6A 1WHKA 4F04B 3L2QA 2WSEE 4B6MA 5IXFA 2EQMA 1D1AA 4AG1C 2KI7A 4BI8B 1NYGA 8AT1B 4JRIA 2NUZA 2FPFA 3OA6A 5GAN4 2HSPA 2DL8A 4Y28E 2QK0A 4AFSC 4QVZA 3SDZA 3I55A 1WI7A 3CBOA 2VASA 4YTLA 1RLPC 2ZZDA 4M77A 4M75A 2F69A 2F1LA 2FZGB 5EC7A 5CKFA 1JB0E 3OYJA 5L23A 3L2WA 1V29B 4FIBA 3CD6Q 4JZ4A 1OULA 2DBKA 3QKJA 1VQ4Q 1WX6A 3KXTA 1WGSA 4XAXB 4C92E 2E10A 2XI9A 3PTAA 2D0QB 4CI0C 2RJFA 1VQ8A 3V8LA 2EKHA 1FXXA 2F2XA 2ZPEB 2FYKA 1AD5A 3P8HA 3P8BB 4PJOA 1UJYA 1Z9QA 4AMCA 2CUBA 3E2UA 2VXEA 2KT1A 2F5KA 4XTUA 1UECA 2PU9B 1PCXA 3UPUA 2E5KA 2KE9A 3GIBA 2X9HA 3X28B 3EFOA 3CBPA 4ANJA 1PD1A 1NLOC 2CDTA 2XD0A 2L2PA 3G1JA 3A5ZB 4HCCA 2RF0A 2CREA 2CSQA 1JQQA 1EZZB 1I1JA 1W70A 4Z8AA 4FSXA 4DOVA 1ZSZC 3EG1A 2CP5A 4CC4B 3X26B 1ZUKA 3CCEQ 5GAOn 2L89A 5IHIA 5DLOA 1QVGS 3G6ET 4M7DA 4IUQA 3CCMT 3REBB 2DFUA 1WHGA 3TQ7P 3VS0A 3OYAA 2HZYA 1M3CA 5GANe 2ATCB 2DL3A 2DL4A 3VYGA 4ZN3A 2BUDA 4PJJA 2RMOA 1Y96B 1D0XA 1I8FA 2K3BA 3L2ZA 2OTLA 3PNWC 5CKHA 2KGTA 3OYGA 4OB2B 1CKBA 1ACMB 5A0DA 3SWNB 2O31A 1UGSB 2ROLA 3H9NA 4RTWA 3JV3A 1YFNA 3WVDB 3RR6A 4KH1B 5CKBA 5FLXE 4JRKA 1VQ7Q 3VU3C 2G6FX 3TEEA 4J9HA 2DIGA 1QWFA 2O88A 5KE2A 1WXUA 2CUDA 1JRIA 5LJ5d 1UG1A 2O2OA 1BCOA 1HJDA 4ZGDB 1BIAA 3G6EA 2ZAEA 1QVPA 1BK2A 3HFNA 2V8JA 4J7IA 4LDWA 1D3BA 1QWEA 4Z89A 5KYXB 1K4US 2YWWA 3CMAA 2QQAA 1WNLA 1B7TA 4PFOA 4C8QG 1ABOA 1M8VA 2DE0X 1M4ZA 2EGAA 3QZ9B 4C5GA 1I0CA 4X9CA 2K2MA 5CQYA 1BU1A 2E12A 1TUDA 3RUXA 4J9FA 2EKOA 3OYKA 4C0FA 2F5TX 1YBYA 1QKWA 3CC2T 4PL6A 3HPWA 1YHQT 1WXBA 3AT1B 1K8AC 4A4EA 2QQBA 1KC8R 3SB2A 4M77E 4M75E 1YI2A 2WSFE 3I5SA 1UE9A 2HKNA 2KBTA 2JXBA 3H41A 1JU5C 2YRVA 2QQRA 2BZ8A 5GAN5 4N0AC 1IZ6A 4Z88A 3JSCA 2DEUA 2AZSA 3HRSA 2KROA 2XMFA 4FT4A 2XIDA 4XTYA 3QIIA 1ZSZA 2B86A 2QTXA 1UDLA 1B34B 2A28A 5LJ3d 2L8DA 1SSFA 1N5ZA 3CCRT 3FB9A 2SRCA 4PJOE 3CC7T 3A8MB 4VUBA 3GBQA 4C8QB 1AWOA 2KR3A 1PKTA 1U1TA 1I5OB 3CCMQ 3G71A 1YHQA 1M3AA 2CSIA 3OS0A 4F14A 3RBBB 3BFMA 2K57A 1VQLA 3S3MA 1QVGA 1R0CB 4N4GA 2VV5A 1W4SA 2QEXA 2ENMA 4HVVA 5CQXA 1B07A 1PSFA 4ZTFA 3P8DA 4D8KA 2LJ0A 2E3IA 1I4K1 4A4FA 5J39A 1BI2A 3V8KA 3OW2P 3J7AF 2VB6A 1VQOT 3KUFA 3OS1A 3OYEA 3EG9B 1BBZA 1VQ5A 2LNVA 1TWBA 4M7DE 2QXFA 3OYHA 4MDWA 4MMKA 5KYYB 1UGVA 2DNUA 3EHQA 4KH0B 4C92C 3JB9I 3CCRA 3ZBDA 4BB7A 3BY7A 2JTMA 3CC7A 2DTOA 1RL2A 3JCMP 3T9NA 1KQSP 1S72A 3OBYA 1VQNT 1T0JA 4LXCA 2QA4T 5GANh 3LH0A 2X4WA 3CMEA 2FPEA 3OS5A 5D6YA 4LUEA 4J9CA 2DL5A 2DK3A 4F7UG 2DD4A 4ORZA 2BZXA 5LJ5f 4AG2C 4C8QF 4O5VA 1BIBA 3EGDB 5FRNA 1Y57A 1VQOA 2SEMA 3MHXA 2LRQA 2BIVA 1B3QA 4HA8A 1RAHB 3CC2Q 3NHNA 4M7AE 3UF4A 4A53A 2MWOA 2HL3A 3A98A 1WHJA 1EIFA 4N0AA 4PK4A 4RCCA 3M0RA 4ZGJB 4N4IA 2COWA 2KQWA 3MEUA 4OMMA 3LGLA 4ATOA 9ATCB 3KFVA 2L3PA 3CXCA 4KUDK 5AT1B 4E7HA 2RQUA 5GAMg 2QGFB 4Y91A 4GLMA 2LCCA 1ZSZB 3R6OA 3CCLT 4AFUC 1YIJA 1YJNA 1TS9A 4RUGA 4RCBA 1ARKA 5D6WA 1VQMA 4J9DA 1TSFA 1KQSS 3OMGA 4OMQA 1SRMA 4ZTJA 1UEBA 2FPDA 3A8OB 1RAAB 3MPUB 1K73R 1XJWB 3GF5A 4QQDA 4F7UB 2L3QA 4JRQA 4KULA 2RI3A 4HKEA 4CRIA 1OZ2A 5LJ3f 2OI3A 1RACB 4DBQA 1KD1U 1Y71A 1YCYA 4BDZA 3VS3A 3CCSA 1Y07A 5CVIA 4P5NA 5CCAA 3PT9A 2CYZB 4J5YA 1LCKA 1VQOQ 4BUGA 1GFDA 3PE0A 2CP3A 1WQ7A 4C92A 2P0KA 3PIPA 2HQEA 1KK7A 2LC4A 3Q1JA 3EGXB 3VS1A 1ABQA 1U3OA 2X4YA 5GAMh 1WPYA 3HFOA 2DMOA 1UHFA 5I11A 1VQNQ 1SG5A 1X2QA 4M77C 1IREB 1X01A 5KYUB 2PZ1A 3C94A 2CKKA 2QA4Q 2OTJA 2JM9A 4M78F 4RG8A 1QVFA 1VYUA 1W6XA 2LX7A 2RNAA 5FWBA 2MOXA 4C0DC 3PVLA 2A08A 1KC8C 2E1HA 2DJZA 2ZPGB 3L2RA 4E7IA 2LDMA 2LJ3A 4OB0B 5D6XA 4A63B 2A0FB 2RJEA 3HTRA 2K3YA 5GAOl 2OX7A 5GANj 2VYTA 4KT0E 2KVQG 2A37A 3C4SA 4E7ZA 1U1SA 4CC2A 1KQ1A 1H3HA 1M30A 3M54A 1AHJB 2Y4XA 1ZUYA 2LCSA 4FYWB 4J83A 1Q81R 3CD6A 2YUNA 3HL8A 1VQ4A 4A4GA 1FMKA 2CZ0B 2FHDA 3H8ZA 2JT4A 3CCLQ 1NEBA 4X34A 1G8XA 4LDVA 1LNXA 2YDLA 1M3BA 1X6BA 1T3SA 4X1VA 1YJWT 1CSKA 2BZYA 2CT4A 5DLQE 4J9EA 2A7YA 3OYBA 4IUTA 4JRPA 2JUFA 1YITT 3HSBA 4RMOA 3VRZA 1QQJA 2XDBA 3TREA 1VA7A 1G3YA 2Y4YA 1OOTA 2HCKA 5CKEA 4F16A 3I5RA 4ZGEB 2ECZA 2KNBB 3MP8A 4PFZA 2CP2A 1AWJA 3EG3A 2LQ8A 3FEOA 3UDCA 1Y0MA 4EMGA 4XU1A 3HHTB 4QVDA 3VUBA 2GFAA 2P0QA 2RHUA 1KD1R 1YCSB 4FW1A 3UA6A 4JJCA 3QDRB 2WSCE 3CCEA 3M56A 2LNHB 3OYCA 1UFFA 3S3OA 3O8VA 1QCOA 2AKLA 1BYMA 2KAFA 1QVGP 1YJWA 1U06A 2FO0A 4L6V5 2E65A 4EPCA 4BY6C 1GCQC 1WZOA 4PJMA 4M7AC 2RB6A 2IPOB 5L8RE 3GOXA 3X24B 4BE2A 8ATCB 2RI5A 2VGMA 1QP2A 2DJQA 1PNJA 3QHSA 2L5QA 5LJ5e 2FEIA 2DVEA 1C1AA 1VQ7A 2EJFA 1KC8U 5GAMj 1OPLA 1UGQB 4EMKC 4R55A 2Z0WA 2K79A 4FU6A 1AZEA 3PVQA 1AZGB 3UATA 2D8JA 4OMFB 5EG2A 3ASKA 5FRMA 1KJWA 2M51A 4J9GA 2K3XA 3C0CA 3DLLA 2PVGB 1Q86U 5KYWB 4OP0A 3OYFA 2DZCA 3LYIA 5GAN2 1K76A 3JCMb 2K5FA 2DXBA 2JMCA 1AWXA 3FIFA 3QUIA 1G5VA 1YP5A 1NM7A 3QZ5B 3GNFB
chains in the Genus database with same CATH topology
2KROA 2XMFA 1WYXA 1U5SA 2J6KA 2NWMA 1VYVA 2B86A 3VRYA 3H0FA 1ZLMA 1UDLA 4J9BA 5IXBA 2A28A 1GBRA 3ULRB 2JM8A 1N5ZA 3NMZC 2SRCA 1Z9ZA 1SHFA 3U23A 1VYTA 2OJ2A 3M0UA 3I9QA 3GBQA 1AWOA 2F2WA 2KR3A 1PKTA 5IHKA 2ABLA 1EFNA 2RPNA 1M3AA 2J7IA 4AFQC 4ZNXA 2CSIA 4F14A 3RBBB 4HXJA 2GTJA 2KRSA 4HVWA 1YNZA 1OPKA 2ENMA 4HVVA 1B07A 1AEYA 2RQVA 2K6DA 4D8KA 1E6GA 2LJ0A 2L3SA 2J6OA 2DM1A 2PNIA 1HD3A 3EHRA 2JMAA 5HCKA 2V1QA 1V1CA 2KXDA 1BBZA 1SPKA 2VVKA 2YUPA 4M4ZA 1M8MA 2QDLA 4LE9A 3SHWA 1QLYA 1UGVA 1MV0B 2DNUA 2RQRA 3EHQA 3VS6A 1RUWA 2K7AA 2FG0A 1X2KA 1GCQA 4QT7A 3H0IA 2RQTA 1JXOA 2KRMA 1ZBJA 2ESWA 2MCNA 3TSZA 3H0HA 1G2BA 1T0JA 4R0KA 2KYMA 1XOVA 2GGRA 1FYNA 2H8HA 4CC3A 1ZSGA 2I0NA 1K0SA 2FPEA 1G83A 4K11A 4LUEA 1GCPA 4J9CA 2DL5A 2ED1A 4ORZA 2KXCA 1OV3A 2BZXA 2JTEA 4AG2C 1WDXA 2CH4W 2GTOA 2AZVA 3LH5A 2DVJA 4GBQA 4WCIA 3TSWA 1Y57A 2IIMA 2C0OA 1SRLA 2FRWA 2SEMA 2C0IA 1B3QA 2HBWA 3I35A 2P4RA 4JJBA 5FW9A 2JS0A 3NHNA 2LJ1A 3VS2A 3UF4A 3CQTA 1MV3A 1E7OA 3A98A 5ECAA 4IIOA 1X69A 2FRYA 3M0RA 4FSSA 1UJ0A 2CH4A 4OMMA 3SEMA 3KFVA 2L3PA 2V1RA 1NYFA 2LZ6B 2RQUA 1W1FA 4GLMA 2VWFA 4AFUC 2JW4A 5GJVB 4KRTA 1AVZC 1GBQA 4RUGA 1ARKA 4IIMA 4J9DA 1GRIA 2HDAA 4HCKA 2M0YA 2YUOA 3RNJA 1SSHA 4J9IA 4RTYA 4OMQA 1SRMA 2EVRA 2FPDA 1A0NB 3REAB 4LUDA 3FJ5A 2L3QA 2ED0A 2YSQA 1QKXA 2VKNA 2DYBA 4LN2A 2DBMA 1HSQA 1JEGA 4JZ3A 1ZUUA 1RLQC 3EGUA 2EPDA 2O9SA 2DRMA 3VS7A 2KEAA 2OI3A 2DL7A 1PKSA 1NLPC 1T3LA 3VS3A 1JXMA 4RTTA 4OMOA 4OMNA 2D1XA 4EIKA 2W10A 1LCKA 1GFDA 3PE0A 2DF6A 1AWWA 5IXFA 2D0NA 1JO8A 1K1ZA 2F2VA 1PWTA 4AG1C 1J3TA 2K9GA 4LNPA 1NYGA 3VS1A 1ABQA 2NUZA 1U3OA 2FPFA 1M27C 2DMOA 2HSPA 2DL8A 4AFSC 2DLPA 1UHFA 1SHGA 2EYZA 3NPFA 1NEGA 1WI7A 2EYXA 5I11A 1X2QA 2DX1A 1RLPC 2C0TA 2HEQA 3QWYA 2PZ1A 3THKA 2EBPA 5EC7A 4RTVA 2OAWA 4DEYA 2JM9A 5L23A 2JS2A 4JZ4A 1VYUA 1UTIA 1K0XA 1W6XA 2LX7A 2RNAA 2DBKA 5FWBA 2MOXA 3PVLA 1WX6A 1KIKA 2A08A 2GNCA 3IQLA 2J06A 1YN8A 1H92A 4RTXA 2YUQA 2LJ3A 3M0QA 2AK5A 4A63B 2EKHA 2RN8A 2F2XA 2J6FA 4JPBW 2EGCA 1AD5A 2LMJA 2L0AA 2X3XD 2A37A 1UJYA 1Z9QA 2LP5A 4CC2A 1H3HA 2CUBA 1NG2A 1KSWA 2KT1A 1M30A 2EQIA 1UECA 1WIEA 2GQIA 3M0TA 2E5KA 2EGEA 1X27A 2KE9A 1ZUYA 4Y92A 2LCSA 1E6HA 1NLOC 2CDTA 2L2PA 4DEXA 2PTKA 2YUNA 1K9AA 1ZX6A 1PRMC 2RF0A 2CREA 1KFZA 1S1NA 2CSQA 3UA7A 1FMKA 2LQNA 1JQQA 2YT6A 2JT4A 1NEBA 2J05A 1I1JA 1W70A 4Z8AA 1WA7A 3EG1A 3TVTA 1MUZA 4CC4B 4E6RA 2YDLA 1M3BA 2DILA 1X6BA 2DRKA 1T3SA 1ZUKA 5FWCA 2DA9A 4X1VA 2KT8A 1QCFA 1CSKA 2BZYA 2CT4A 2GBQA 5IHIA 3ZL7C 2KYBA 2AKKA 2O9VA 4J9EA 3REBB 3VS4A 3VS0A 1OEBA 4OMLA 5GJWB 1M3CA 1RI9A 2DL3A 2DL4A 2EYYA 1IO6A 1H8KA 3VRZA 4D8DA 2RMOA 2K3BA 1VA7A 3R6NA 4ESRA 2KRNA 1OOTA 2HCKA 4F16A 1GL5A 3I5RA 2KGTA 1CKBA 2ECZA 2KNBB 2O31A 1AWJA 3EG3A 4JJDA 3O5ZA 2ROLA 3VS5A 4RTWA 1Y0MA 3JV3A 3EG2A 1YWOA 2A36A 1GFCA 1UHCA 2EW3A 1PHTA 4AFZC 1YCSB 2G6FX 1AOJA 3UA6A 4JJCA 4J9HA 1QWFA 3M0SA 2O88A 2D8HA 3QWXX 1WXUA 2LNHB 2CUDA 1UFFA 1UG1A 2O2OA 2X3WD 1HJDA 2AKLA 1T0HA 1X6GA 1U06A 2FO0A 1BK2A 1GCQC 4RTUA 2EYWA 1YWPA 1WFWA 1BB9A 1QWEA 4Z89A 1WLPB 1K4US 3M0PA 5IHNA 4RTZA 1I07A 4HVUA 1ABOA 2W0ZA 2DJQA 1PNJA 2CT3A 2DE0X 4F17A 2BTTA 2EGAA 3EG0A 1PRLC 2RQWA 1I0CA 2FEIA 2LQWA 2K2MA 1CKAA 1BU1A 1TUDA 1OPLA 5IH2A 4J9FA 1X43A 2MIOA 2ROTA 2K79A 1QKWA 1AZEA 3PVQA 1AZGB 3UATA 2D8JA 1KJWA 1UUEA 1WXBA 2M51A 4J9GA 3C0CA 1TUCA 1WXTA 3I5SA 1SEMA 1UE9A 2KBTA 1K76A 2JXBA 3H41A 1JU5C 2JMCA 2BZ8A 1AWXA 3NGPA 5I22A 4Z88A 4CC7A 1TG0A 1YP5A 1NM7A 2AZSA 4OMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRO A;  2XMF A;  1WYX A;  1U5S A;  2J6K A;  2NWM A;  1VYV A;  2B86 A;  3VRY A;  3H0F A;  1ZLM A;  1UDL A;  4J9B A;  5IXB A;  2A28 A;  1GBR A;  3ULR B;  2JM8 A;  1N5Z A;  3NMZ C;  2SRC A;  1Z9Z A;  1SHF A;  3U23 A;  1VYT A;  2OJ2 A;  3M0U A;  3I9Q A;  3GBQ A;  1AWO A;  2F2W A;  2KR3 A;  1PKT A;  5IHK A;  2ABL A;  1EFN A;  2RPN A;  1M3A A;  2J7I A;  4AFQ C;  4ZNX A;  2CSI A;  4F14 A;  3RBB B;  4HXJ A;  2GTJ A;  2KRS A;  4HVW A;  1YNZ A;  1OPK A;  2ENM A;  4HVV A;  1B07 A;  1AEY A;  2RQV A;  2K6D A;  4D8K A;  1E6G A;  2LJ0 A;  2L3S A;  2J6O A;  2DM1 A;  2PNI A;  1HD3 A;  3EHR A;  2JMA A;  5HCK A;  2V1Q A;  1V1C A;  2KXD A;  1BBZ A;  1SPK A;  2VVK A;  2YUP A;  4M4Z A;  1M8M A;  2QDL A;  4LE9 A;  3SHW A;  1QLY A;  1UGV A;  1MV0 B;  2DNU A;  2RQR A;  3EHQ A;  3VS6 A;  1RUW A;  2K7A A;  2FG0 A;  1X2K A;  1GCQ A;  4QT7 A;  3H0I A;  2RQT A;  1JXO A;  2KRM A;  1ZBJ A;  2ESW A;  2MCN A;  3TSZ A;  3H0H A;  1G2B A;  1T0J A;  4R0K A;  2KYM A;  1XOV A;  2GGR A;  1FYN A;  2H8H A;  4CC3 A;  1ZSG A;  2I0N A;  1K0S A;  2FPE A;  1G83 A;  4K11 A;  4LUE A;  1GCP A;  4J9C A;  2DL5 A;  2ED1 A;  4ORZ A;  2KXC A;  1OV3 A;  2BZX A;  2JTE A;  4AG2 C;  1WDX A;  2CH4 W;  2GTO A;  2AZV A;  3LH5 A;  2DVJ A;  4GBQ A;  4WCI A;  3TSW A;  1Y57 A;  2IIM A;  2C0O A;  1SRL A;  2FRW A;  2SEM A;  2C0I A;  1B3Q A;  2HBW A;  3I35 A;  2P4R A;  4JJB A;  5FW9 A;  2JS0 A;  3NHN A;  2LJ1 A;  3VS2 A;  3UF4 A;  3CQT A;  1MV3 A;  1E7O A;  3A98 A;  5ECA A;  4IIO A;  1X69 A;  2FRY A;  3M0R A;  4FSS A;  1UJ0 A;  2CH4 A;  4OMM A;  3SEM A;  3KFV A;  2L3P A;  2V1R A;  1NYF A;  2LZ6 B;  2RQU A;  1W1F A;  4GLM A;  2VWF A;  4AFU C;  2JW4 A;  5GJV B;  4KRT A;  1AVZ C;  1GBQ A;  4RUG A;  1ARK A;  4IIM A;  4J9D A;  1GRI A;  2HDA A;  4HCK A;  2M0Y A;  2YUO A;  3RNJ A;  1SSH A;  4J9I A;  4RTY A;  4OMQ A;  1SRM A;  2EVR A;  2FPD A;  1A0N B;  3REA B;  4LUD A;  3FJ5 A;  2L3Q A;  2ED0 A;  2YSQ A;  1QKX A;  2VKN A;  2DYB A;  4LN2 A;  2DBM A;  1HSQ A;  1JEG A;  4JZ3 A;  1ZUU A;  1RLQ C;  3EGU A;  2EPD A;  2O9S A;  2DRM A;  3VS7 A;  2KEA A;  2OI3 A;  2DL7 A;  1PKS A;  1NLP C;  1T3L A;  3VS3 A;  1JXM A;  4RTT A;  4OMO A;  4OMN A;  2D1X A;  4EIK A;  2W10 A;  1LCK A;  1GFD A;  3PE0 A;  2DF6 A;  1AWW A;  5IXF A;  2D0N A;  1JO8 A;  1K1Z A;  2F2V A;  1PWT A;  4AG1 C;  1J3T A;  2K9G A;  4LNP A;  1NYG A;  3VS1 A;  1ABQ A;  2NUZ A;  1U3O A;  2FPF A;  1M27 C;  2DMO A;  2HSP A;  2DL8 A;  4AFS C;  2DLP A;  1UHF A;  1SHG A;  2EYZ A;  3NPF A;  1NEG A;  1WI7 A;  2EYX A;  5I11 A;  1X2Q A;  2DX1 A;  1RLP C;  2C0T A;  2HEQ A;  3QWY A;  2PZ1 A;  3THK A;  2EBP A;  5EC7 A;  4RTV A;  2OAW A;  4DEY A;  2JM9 A;  5L23 A;  2JS2 A;  4JZ4 A;  1VYU A;  1UTI A;  1K0X A;  1W6X A;  2LX7 A;  2RNA A;  2DBK A;  5FWB A;  2MOX A;  3PVL A;  1WX6 A;  1KIK A;  2A08 A;  2GNC A;  3IQL A;  2J06 A;  1YN8 A;  1H92 A;  4RTX A;  2YUQ A;  2LJ3 A;  3M0Q A;  2AK5 A;  4A63 B;  2EKH A;  2RN8 A;  2F2X A;  2J6F A;  4JPB W;  2EGC A;  1AD5 A;  2LMJ A;  2L0A A;  2X3X D;  2A37 A;  1UJY A;  1Z9Q A;  2LP5 A;  4CC2 A;  1H3H A;  2CUB A;  1NG2 A;  1KSW A;  2KT1 A;  1M30 A;  2EQI A;  1UEC A;  1WIE A;  2GQI A;  3M0T A;  2E5K A;  2EGE A;  1X27 A;  2KE9 A;  1ZUY A;  4Y92 A;  2LCS A;  1E6H A;  1NLO C;  2CDT A;  2L2P A;  4DEX A;  2PTK A;  2YUN A;  1K9A A;  1ZX6 A;  1PRM C;  2RF0 A;  2CRE A;  1KFZ A;  1S1N A;  2CSQ A;  3UA7 A;  1FMK A;  2LQN A;  1JQQ A;  2YT6 A;  2JT4 A;  1NEB A;  2J05 A;  1I1J A;  1W70 A;  4Z8A A;  1WA7 A;  3EG1 A;  3TVT A;  1MUZ A;  4CC4 B;  4E6R A;  2YDL A;  1M3B A;  2DIL A;  1X6B A;  2DRK A;  1T3S A;  1ZUK A;  5FWC A;  2DA9 A;  4X1V A;  2KT8 A;  1QCF A;  1CSK A;  2BZY A;  2CT4 A;  2GBQ A;  5IHI A;  3ZL7 C;  2KYB A;  2AKK A;  2O9V A;  4J9E A;  3REB B;  3VS4 A;  3VS0 A;  1OEB A;  4OML A;  5GJW B;  1M3C A;  1RI9 A;  2DL3 A;  2DL4 A;  2EYY A;  1IO6 A;  1H8K A;  3VRZ A;  4D8D A;  2RMO A;  2K3B A;  1VA7 A;  3R6N A;  4ESR A;  2KRN A;  1OOT A;  2HCK A;  4F16 A;  1GL5 A;  3I5R A;  2KGT A;  1CKB A;  2ECZ A;  2KNB B;  2O31 A;  1AWJ A;  3EG3 A;  4JJD A;  3O5Z A;  2ROL A;  3VS5 A;  4RTW A;  1Y0M A;  3JV3 A;  3EG2 A;  1YWO A;  2A36 A;  1GFC A;  1UHC A;  2EW3 A;  1PHT A;  4AFZ C;  1YCS B;  2G6F X;  1AOJ A;  3UA6 A;  4JJC A;  4J9H A;  1QWF A;  3M0S A;  2O88 A;  2D8H A;  3QWX X;  1WXU A;  2LNH B;  2CUD A;  1UFF A;  1UG1 A;  2O2O A;  2X3W D;  1HJD A;  2AKL A;  1T0H A;  1X6G A;  1U06 A;  2FO0 A;  1BK2 A;  1GCQ C;  4RTU A;  2EYW A;  1YWP A;  1WFW A;  1BB9 A;  1QWE A;  4Z89 A;  1WLP B;  1K4U S;  3M0P A;  5IHN A;  4RTZ A;  1I07 A;  4HVU A;  1ABO A;  2W0Z A;  2DJQ A;  1PNJ A;  2CT3 A;  2DE0 X;  4F17 A;  2BTT A;  2EGA A;  3EG0 A;  1PRL C;  2RQW A;  1I0C A;  2FEI A;  2LQW A;  2K2M A;  1CKA A;  1BU1 A;  1TUD A;  1OPL A;  5IH2 A;  4J9F A;  1X43 A;  2MIO A;  2ROT A;  2K79 A;  1QKW A;  1AZE A;  3PVQ A;  1AZG B;  3UAT A;  2D8J A;  1KJW A;  1UUE A;  1WXB A;  2M51 A;  4J9G A;  3C0C A;  1TUC A;  1WXT A;  3I5S A;  1SEM A;  1UE9 A;  2KBT A;  1K76 A;  2JXB A;  3H41 A;  1JU5 C;  2JMC A;  2BZ8 A;  1AWX A;  3NGP A;  5I22 A;  4Z88 A;  4CC7 A;  1TG0 A;  1YP5 A;  1NM7 A;  2AZS A;  4OMP A; 
#chains in the Genus database with same CATH topology
 2V8K A;  1OZ3 A;  4M77 G;  4M75 G;  3RKW A;  2NWM A;  4EMH A;  3QYG B;  3LW5 E;  1VYV A;  1ZLM A;  2O4X A;  4OGC A;  4E7K A;  4J9B A;  4OGE A;  3LGF A;  1K73 C;  3ULR B;  3VV0 A;  1GXI E;  2JM8 A;  3NMZ C;  1IRX A;  3U23 A;  1SHF A;  4XTV A;  5CIU A;  2NUT A;  1YJW Q;  2F2W A;  3CCQ T;  3BDL A;  3V7C A;  2DAQ A;  5IAY A;  4OB1 B;  3CXC P;  4KGX B;  3OYN A;  1YIT Q;  1YJ9 T;  4BAC A;  5LJ3 e;  4MDX A;  1H3Z A;  2V8I A;  4PJO G;  4DBR A;  1AEY A;  2RQV A;  4GLK A;  4RKU E;  3RIR A;  1E6G A;  1U8R A;  2L3S A;  2DM1 A;  2LX9 A;  1RAF B;  5GAO p;  2KSS A;  2COY A;  5HCK A;  3CPF A;  2ZGW A;  2XIC A;  2KXD A;  1OQK A;  2VVK A;  2COZ A;  1M8M A;  3NTI A;  3SHW A;  4LE9 A;  4N4H A;  3MP1 A;  4MZM A;  4HT9 A;  5I2S A;  3C12 A;  3ZEH A;  2FG0 A;  1D0Y A;  1GCQ A;  2L3R A;  3CCM A;  4MZT A;  4JLG A;  4M7A A;  3FDR A;  5GAN 8;  1JXO A;  4C92 D;  1MNE A;  4M77 B;  4M75 B;  2CP6 A;  4M7D G;  2MCN A;  4MZP A;  4TVR A;  3TSZ A;  5LJ5 g;  3H0H A;  4R0K A;  1X75 C;  4FL6 A;  2KYM A;  1IHW A;  3EH2 A;  3JCM e;  2H8H A;  3ME9 A;  2AT1 B;  1K0S A;  2D9T A;  4C0D B;  2YRC A;  1M1K U;  2QTV A;  1MND A;  2HBP A;  3M9Q A;  1M9S A;  3CEY A;  1OV3 A;  4EMK A;  5GAO q;  3CC4 T;  2DVJ A;  2QDY B;  1V76 A;  1TUG B;  1OYX A;  1NBE B;  2NLU A;  5HKC A;  1PM3 A;  2C0I A;  3VKI A;  5IN1 A;  2HBW A;  4JJB A;  2P4R A;  4IUR A;  2JS0 A;  4PJO B;  3X25 B;  3CXC S;  5CAI A;  1Q81 C;  4Z02 A;  4BD3 A;  3OBW A;  1E7O A;  2RH2 A;  3L1A A;  1X69 A;  3OS2 A;  2DPP B;  3EFO B;  2XG8 D;  3URG A;  1QVF P;  2CH4 A;  2K5L A;  3SEM A;  2LVM A;  1NPP A;  1Q86 R;  5GAN 7;  2V1R A;  3MJX A;  2LZ6 B;  3PMI A;  1VQK T;  3RMS A;  3CCU T;  4XU2 A;  2BE7 D;  3OQ5 A;  4QQG A;  3JCM W;  5GAN g;  1K73 U;  2RHZ A;  5LJ5 h;  3H6Z A;  5GJV B;  1AT1 B;  4M7D B;  1JBM A;  1TTH B;  4M75 F;  4OB3 B;  4IIM A;  2HSE B;  3CC2 A;  1BCM A;  3JB9 G;  3V7R A;  3BDU A;  1SSH A;  2LTO A;  5LJ3 g;  2KMT A;  4J9I A;  3JAM E;  1BI1 A;  3CCQ Q;  2FL7 A;  2JZ2 A;  4M78 A;  3FJ5 A;  2ED0 A;  2YSQ A;  1QKX A;  2R5M A;  2VKN A;  3GNG A;  1RAD B;  3QDF A;  5J26 A;  1YJ9 Q;  4JZ3 A;  1ZHI A;  3EGU A;  1KD1 C;  3PIO A;  4HT8 A;  3MEA A;  5KCO A;  2DL7 A;  1PKS A;  3OYM A;  1T3L A;  3M4G A;  5CO7 A;  1JXM A;  5FU7 C;  4OMO A;  3N5B B;  3JCM d;  1WJR A;  1VIF A;  1N27 A;  2W10 A;  2YRD A;  1AWW A;  1M2O A;  3WVE B;  4ELY C;  1R0B G;  2M16 A;  2FVU A;  1JO8 A;  3E9F A;  2ZPH B;  1OX8 A;  1OU9 A;  1J3T A;  1HYO A;  2K9G A;  4WF2 A;  1QVF S;  1H64 1;  4C0G A;  1D3B B;  2EYQ A;  1Q82 U;  3J80 E;  4V2S A;  4C8Q E;  3QJY A;  1TU0 B;  1SHG A;  4XU3 A;  3X20 B;  2RM4 A;  3NPF A;  3G4S T;  1KHC A;  4II1 A;  3OY9 A;  4J6W A;  3THK A;  2EBP A;  2XDP A;  4DEY A;  4M7D F;  2X4J A;  5LJ3 h;  4M77 D;  3OYL A;  4M75 D;  2JS2 A;  1UTI A;  2ZPB B;  1WQW A;  1ZBX A;  3LWH A;  2H3E B;  2K4Y A;  3D7S B;  5CK9 A;  3CC4 Q;  1M1K R;  3IQL A;  1R77 A;  2J06 A;  4C5H A;  5KE3 A;  2DTH A;  2YUQ A;  5GAO r;  1G3W A;  2AK5 A;  1MMD A;  2RN8 A;  2CZ7 B;  4JPB W;  1MHN A;  1Q81 U;  2EGC A;  2LMJ A;  1NZ9 A;  2L0A A;  2X3X D;  3MEV A;  3CCJ T;  4IKF A;  5GMK e;  2AIR B;  1W2B A;  3JRZ A;  1PG5 B;  1VQN A;  2NUP A;  1QW1 A;  4JDS A;  2EQI A;  2EQK A;  3LX7 A;  4PJO D;  4FW2 A;  1KHI A;  2QA4 A;  2EGE A;  1KG1 A;  1E6H A;  2PTK A;  2BE9 B;  3E9G A;  1PC0 A;  1VQK Q;  2LQN A;  3RER A;  3CCU Q;  2YT6 A;  3CCV T;  4QKU A;  1IGQ A;  4PFP A;  3GPL A;  1WA7 A;  3VYH B;  3TVT A;  2RHY A;  4E6R A;  4FCY A;  1LVK A;  4QW2 A;  2MYS A;  5FWC A;  4JJN K;  2KT8 A;  2GBQ A;  4C0Z A;  3ZL7 C;  2EQU A;  3PGG A;  4AT1 B;  5A2Q E;  3VS4 A;  1OEB A;  1XTD A;  2RK2 A;  4IUP A;  5LL6 S;  5GJW B;  2CP7 A;  4M7D D;  1RI9 A;  1IO6 A;  1I5L A;  2E6Z A;  1H8K A;  4D8D A;  1IGU A;  2QGG A;  1FX7 A;  1M2V A;  3ER0 A;  2YHT A;  3RKX A;  2KRN A;  5LJ5 j;  4QVC A;  2DO3 A;  1OI1 A;  3PMT A;  4LD6 A;  3BE3 A;  3O5Z A;  3VS5 A;  1VQ6 T;  2P0P A;  3CCL A;  1F1B B;  1O9S A;  2A36 A;  1UHC A;  2EW3 A;  1Q95 G;  2E5Q A;  3SWN C;  3M5A A;  4M78 E;  3QWX X;  2XK0 A;  2CS7 A;  4E47 A;  4XU0 A;  2X3W D;  1T0H A;  1X6G A;  3A8G B;  4OVA A;  3TCJ A;  2V26 A;  3FLG A;  5C6S A;  1RI0 A;  3DLM A;  1WFW A;  1BB9 A;  4XTW A;  3JCM f;  2AHJ B;  1WLP B;  3G4S Q;  2IG0 A;  3RDV A;  4M7A D;  1PSE A;  4RTZ A;  1Q82 R;  1I07 A;  4HVU A;  2W0Z A;  2E3H A;  4PLI A;  2CT3 A;  3DKM A;  1VQ9 Q;  1MMA A;  3FC3 A;  2BTT A;  3EG0 A;  1PRL C;  5CR2 A;  3DB4 A;  1I81 A;  2HD0 A;  5HK0 A;  1CKA A;  5GMK i;  4F7U F;  1VOM A;  3VJP A;  5IH2 A;  4IUV A;  3JB9 D;  2MIO A;  1M1F A;  2PUK B;  3QYH B;  1NPR A;  1O75 A;  3M4Y A;  4B9X A;  1K9M U;  4LDX A;  1UUE A;  1Q86 C;  4C92 G;  3OMC A;  5D7U A;  5LJ3 j;  3CCJ Q;  1WXT A;  1SEM A;  3QG1 A;  4C5I A;  2GQV A;  2HQH A;  2XU8 A;  3MP6 A;  3OB9 A;  3GP8 A;  4FM4 B;  5I22 A;  1TG0 A;  4J6Y A;  1HK9 A;  1VQP T;  2J6K A;  2X4X A;  3I56 T;  1UGR B;  4UC4 A;  3OSV A;  4D6W A;  3A1P A;  3VRY A;  3CCV Q;  4FYX B;  2LCL A;  2G3R A;  1GBR A;  3JCM c;  3CPW S;  3JCM J;  1Z9Z A;  3OW2 A;  3I9Q A;  2GFU A;  4RG2 A;  5GAM f;  5GAN 3;  1NJI U;  2J7I A;  3C95 A;  4AFQ C;  4ZNX A;  2B8A A;  2DXC A;  2ZPF B;  4NL3 A;  2DD5 A;  2KRS A;  4HVW A;  3I55 T;  1OX9 A;  1YNZ A;  5GMK h;  4C8Q C;  1OPK A;  5FU7 B;  4Q5W A;  2J6O A;  1Y96 A;  2PNI A;  2MMP A;  2JMA A;  1VQ6 Q;  4C92 B;  4GY5 A;  2V1Q A;  2JN0 A;  1VQP A;  1V1C A;  3SWN A;  1N9S A;  2MAM A;  4M4Z A;  4MML A;  2QDL A;  1IXD A;  5GAN 6;  3L2U A;  3OYD A;  1MV0 B;  3VS6 A;  1VQ8 T;  3EAE A;  4DBF A;  2LQK A;  1TH7 A;  1C0M A;  3FJP A;  2FZC B;  3H0I A;  1MMN A;  2KRM A;  4A54 A;  1BI0 A;  3JCM V;  3SFM A;  1ZBJ A;  1YIT A;  4LDU A;  1D0Z A;  2QAS A;  2RJD A;  1G2B A;  1M1K C;  5IT9 E;  1ZSG A;  3M58 A;  2M02 A;  4K11 A;  5J3B A;  5KYX A;  1HXD A;  1VIE A;  4FYY B;  2ED1 A;  3JCM X;  3J81 E;  1C6V X;  2JTE A;  2AZV A;  4GBQ A;  4WCI A;  1LPL A;  5GAO m;  2C0O A;  1M90 U;  1SRL A;  7AT1 B;  2PVO B;  3I35 A;  5FW9 A;  1JJ2 S;  2KK4 A;  1Q7Y R;  2EIF A;  2DXT A;  3CQT A;  1MV3 A;  4R56 A;  4IIO A;  2IVW A;  1N9R A;  1MGQ A;  2FRY A;  1K9M R;  4FSS A;  4C92 F;  2OTL T;  2E4H A;  2DZ9 A;  3JCM Q;  5DY9 A;  1NYF A;  1WHH A;  2CZ6 B;  5FU6 C;  1VQP Q;  2E6N A;  3I56 Q;  2M0O A;  2JW4 A;  3MET A;  2RHX A;  3MCA B;  4KRT A;  1AVZ C;  1R8O B;  4XTX A;  1B34 A;  1W2B P;  4HCK A;  3RNJ A;  2QQS A;  1DJ7 B;  1M1G A;  4M78 C;  3CPW A;  4FYV B;  3DB3 A;  1QMC A;  3G7Z A;  1WHM A;  3RES A;  4LUD A;  4C8Q A;  2M1H A;  2DYB A;  4LN2 A;  2DBM A;  1JEG A;  3I55 Q;  2JOY A;  4JS4 A;  1RLQ C;  2P4T A;  2EPD A;  4BDY A;  2O9S A;  3CMA T;  3VS7 A;  2EJG A;  2FZK B;  1NJI R;  1N8R U;  1NLP C;  1MMG A;  2M9U A;  3QJ6 A;  1RAG B;  3MEW A;  4RTT A;  2P84 A;  4DQ2 A;  4EIK A;  4XQ3 A;  2H3J A;  2VUB A;  3FRN A;  4J8O A;  1P92 A;  2DET A;  2JTF A;  2EQJ A;  3LLR A;  1G3T A;  2D0N A;  1K1Z A;  3EG9 A;  4L59 A;  2F2V A;  1PWT A;  1VQ8 Q;  4LNP A;  1PD0 A;  5GMK j;  1Q82 C;  3JB9 H;  1SKU B;  4A4H A;  4X9D A;  3CCQ A;  5KYY A;  3L42 A;  1XQH A;  1M27 C;  3PFS A;  5A0G A;  3ZFJ A;  3V7S A;  4ME7 A;  2ZCF B;  2DLP A;  1YI2 T;  3JB9 J;  2EYZ A;  2DYI A;  1YJ9 A;  1NEG A;  2EYX A;  4E2F B;  2VXF A;  2DX1 A;  2C0T A;  4EDU A;  2HEQ A;  1WHL A;  3QWY A;  4BI4 A;  4RTV A;  2OAW A;  1RAI B;  3M57 A;  2E64 A;  4KBM B;  5KCH A;  2O01 E;  3M53 A;  1K0X A;  2FB7 A;  1KIK A;  1W2B S;  2GNC A;  1H92 A;  1YN8 A;  3M59 A;  4RTX A;  3E1S A;  3M0Q A;  2HNI A;  3EGD A;  2J6F A;  4A4K A;  2HAX A;  2CZ1 B;  5I2M A;  1M90 R;  4E7S A;  1TXQ A;  2R58 A;  3G71 T;  2LP5 A;  1JJ2 A;  1NG2 A;  4M7A G;  1KSW A;  1WIE A;  2GQI A;  3M0T A;  1KQ2 A;  1VQL T;  3HKS A;  2C06 A;  1X27 A;  1N6A A;  4Y92 A;  2QEX T;  4PKC C;  2OTL Q;  1G3S A;  4QQ6 A;  2O4X B;  4NS5 A;  4DEX A;  3QPH A;  1K9A A;  1ZX6 A;  1PRM C;  1KFZ A;  1S1N A;  3UA7 A;  4B9W A;  5GAN d;  4M77 F;  3CC4 A;  3RMQ A;  2QAZ A;  2J05 A;  1VQ5 T;  2NUT B;  2EFI A;  3MO8 A;  2K5I A;  1MUZ A;  1BI3 A;  4BE0 A;  2DIL A;  2HKQ B;  2DRK A;  2DA9 A;  1QCF A;  2RK1 A;  5GAM e;  2KYB A;  2AKK A;  2O9V A;  5A0L A;  3S6W A;  4XTZ A;  2HQX A;  4OML A;  2JNG A;  3SD4 A;  5C0M A;  1IB8 A;  4JLI A;  2EAY A;  3G6E Q;  2EYY A;  4JUV A;  1S72 T;  3QSU A;  2QI2 A;  1ZA2 B;  4HCZ A;  1UB4 A;  3HRT A;  3R6N A;  4ESR A;  3CMA Q;  1LOJ A;  3S3N A;  4F7U A;  1GL5 A;  2HL5 C;  4PJO F;  3CME T;  1ZA1 B;  1VQK A;  2NYS A;  4JJD A;  3RKY A;  3CCU A;  1XNI A;  1EX4 A;  3EG2 A;  4LDY A;  1YWO A;  3EH1 A;  1GFC A;  1Y7X A;  1N8R R;  1PHT A;  4AFZ C;  4L5G A;  4BY6 B;  1AOJ A;  4WTO B;  4M7A B;  2PUO B;  3JCM g;  1ZQ1 A;  3M0S A;  2PVD B;  2D8H A;  2YXY A;  4PLL A;  4XK8 E;  2CGH A;  1OU8 A;  2DKG A;  1X6O A;  4RTU A;  2DIQ A;  2EYW A;  1FMW A;  3EGX A;  1YWP A;  1YI2 Q;  2EJ9 A;  1VQ9 T;  2RO0 A;  2ZPI B;  3M0P A;  5IHN A;  4M78 G;  3EFS A;  4EMK B;  2XHC A;  4F17 A;  2KDS A;  2RQW A;  5KYU A;  2LQW A;  3WXM B;  1Q7Y C;  1BKB A;  1UGP B;  2JJ9 A;  1QP3 A;  1YIJ T;  2X35 A;  4LD9 K;  1YJN T;  1WJQ A;  1RAE B;  1X43 A;  2ROT A;  2RJC A;  2GCX A;  1K9M C;  1VQM T;  2HMA A;  4BI3 A;  5AYF A;  1D1B A;  2MWP A;  1K8A U;  1TUC A;  3G71 Q;  2VGN A;  1YHQ Q;  3G4S A;  2LT1 A;  2YLC A;  5GAM d;  5GMK l;  3NGP A;  3F70 A;  1VQL Q;  3JCM h;  1VQ9 A;  5FU6 B;  4CC7 A;  2QEX Q;  3QBY A;  4OF1 A;  2QQ9 A;  3OW2 S;  4M7A F;  4ELZ C;  4OMP A;  1WJS A;  1WYX A;  1U5S A;  5DM7 R;  2RHI A;  4JS5 A;  3CCS T;  3H0F A;  5HK3 A;  3INZ A;  5IXB A;  1VQ5 Q;  2A3L A;  2KY9 A;  3QXE B;  6AT1 B;  2CP0 A;  2R57 A;  2E70 A;  4M78 B;  1VYT A;  2E41 A;  2OJ2 A;  3M0U A;  3JB9 F;  3NTH A;  4HCB A;  1NJI C;  2DEQ A;  5IHK A;  3CCJ A;  3CCR Q;  2ABL A;  1EFN A;  2RPN A;  3CC7 Q;  2XDD A;  2R5A A;  4HXJ A;  3QO3 A;  2GTJ A;  2RI2 A;  4DA4 A;  1S72 Q;  5GAN f;  5CKD A;  1M5Q 1;  3E19 A;  2MF2 A;  3AHU A;  2K6D A;  2JVV A;  2Y90 A;  3NFC A;  1FWZ A;  2OTJ T;  3CME Q;  1HD3 A;  4J6X A;  4C8Q D;  5I21 A;  2DXU A;  3TU4 K;  3EHR A;  2RD1 A;  3CCV A;  2YLB A;  4KGZ B;  5KYN A;  4KGV B;  3KBG A;  1IHV A;  1SPK A;  2PQW A;  2YUP A;  4PJN A;  4E7L A;  1QLY A;  3A8H B;  2RQR A;  3CPW P;  1RUW A;  2K7A A;  2XKO C;  1X2K A;  4QT7 A;  2I2L A;  3BW1 A;  2RQT A;  3HRU A;  2ESW A;  4F7U E;  4J7F A;  2RA2 A;  1XOV A;  2GGR A;  2DER A;  1FYN A;  4CC3 A;  3LWI A;  2I0N A;  1G83 A;  3OYY A;  3CD6 T;  4M75 C;  1GCP A;  1FMV A;  1Q7Y U;  1VQ6 A;  4BE1 A;  1VQ4 T;  2QYZ A;  2KXC A;  4FT2 A;  1NE8 A;  3M55 A;  1WDX A;  2CH4 W;  2GTO A;  2WAC A;  1M90 C;  2MI6 A;  3LH5 A;  1RAB B;  2EWN A;  3TSW A;  1YIJ Q;  2IIM A;  1YJN Q;  4PJL A;  2FRW A;  3UT1 A;  5M9O A;  3CBM A;  4ZN1 A;  3OSS C;  1VQM Q;  2LJ1 A;  2NUP B;  2BKD N;  2MK5 A;  3VS2 A;  2GF7 A;  3GLX A;  5ECA A;  4DBH A;  4IUU A;  1D09 B;  2X51 A;  5GMK m;  4PJO C;  1UJ0 A;  3A8L B;  2MPX C;  5KYW A;  4NOY A;  3VUZ A;  2QG9 B;  1K8A R;  1W1F A;  4NL2 A;  2VWF A;  3CCS Q;  1D1C A;  3EFR A;  1VUB A;  2LT4 A;  3OYI A;  1GBQ A;  2DTI A;  2OAU A;  1LJO A;  1GRI A;  2VC8 A;  5KH6 A;  3CCE T;  2HDA A;  1SF9 A;  2M0Y A;  2YUO A;  1JJ2 P;  4RTY A;  4PNO A;  5FRO A;  3L2V A;  5HY6 A;  2EVR A;  1A0N B;  1M2V B;  3REA B;  4M7D C;  4KUI A;  1QCN A;  1HSQ A;  4M78 D;  1ZUU A;  2K2V A;  3V8J A;  1N8R C;  2DRM A;  4E7J A;  1KQS A;  3UWN A;  2KEA A;  3NTK A;  4DOW A;  3HP9 A;  2OTJ Q;  3MKD A;  2D6F A;  3I56 A;  4O6J A;  4OMN A;  1TOV A;  2D1X A;  1VQ7 T;  4C5E A;  2DF6 A;  1WHK A;  4F04 B;  3L2Q A;  2WSE E;  4B6M A;  5IXF A;  2EQM A;  1D1A A;  4AG1 C;  2KI7 A;  4BI8 B;  1NYG A;  8AT1 B;  4JRI A;  2NUZ A;  2FPF A;  3OA6 A;  5GAN 4;  2HSP A;  2DL8 A;  4Y28 E;  2QK0 A;  4AFS C;  4QVZ A;  3SDZ A;  3I55 A;  1WI7 A;  3CBO A;  2VAS A;  4YTL A;  1RLP C;  2ZZD A;  4M77 A;  4M75 A;  2F69 A;  2F1L A;  2FZG B;  5EC7 A;  5CKF A;  1JB0 E;  3OYJ A;  5L23 A;  3L2W A;  1V29 B;  4FIB A;  3CD6 Q;  4JZ4 A;  1OUL A;  2DBK A;  3QKJ A;  1VQ4 Q;  1WX6 A;  3KXT A;  1WGS A;  4XAX B;  4C92 E;  2E10 A;  2XI9 A;  3PTA A;  2D0Q B;  4CI0 C;  2RJF A;  1VQ8 A;  3V8L A;  2EKH A;  1FXX A;  2F2X A;  2ZPE B;  2FYK A;  1AD5 A;  3P8H A;  3P8B B;  4PJO A;  1UJY A;  1Z9Q A;  4AMC A;  2CUB A;  3E2U A;  2VXE A;  2KT1 A;  2F5K A;  4XTU A;  1UEC A;  2PU9 B;  1PCX A;  3UPU A;  2E5K A;  2KE9 A;  3GIB A;  2X9H A;  3X28 B;  3EFO A;  3CBP A;  4ANJ A;  1PD1 A;  1NLO C;  2CDT A;  2XD0 A;  2L2P A;  3G1J A;  3A5Z B;  4HCC A;  2RF0 A;  2CRE A;  2CSQ A;  1JQQ A;  1EZZ B;  1I1J A;  1W70 A;  4Z8A A;  4FSX A;  4DOV A;  1ZSZ C;  3EG1 A;  2CP5 A;  4CC4 B;  3X26 B;  1ZUK A;  3CCE Q;  5GAO n;  2L89 A;  5IHI A;  5DLO A;  1QVG S;  3G6E T;  4M7D A;  4IUQ A;  3CCM T;  3REB B;  2DFU A;  1WHG A;  3TQ7 P;  3VS0 A;  3OYA A;  2HZY A;  1M3C A;  5GAN e;  2ATC B;  2DL3 A;  2DL4 A;  3VYG A;  4ZN3 A;  2BUD A;  4PJJ A;  2RMO A;  1Y96 B;  1D0X A;  1I8F A;  2K3B A;  3L2Z A;  2OTL A;  3PNW C;  5CKH A;  2KGT A;  3OYG A;  4OB2 B;  1CKB A;  1ACM B;  5A0D A;  3SWN B;  2O31 A;  1UGS B;  2ROL A;  3H9N A;  4RTW A;  3JV3 A;  1YFN A;  3WVD B;  3RR6 A;  4KH1 B;  5CKB A;  5FLX E;  4JRK A;  1VQ7 Q;  3VU3 C;  2G6F X;  3TEE A;  4J9H A;  2DIG A;  1QWF A;  2O88 A;  5KE2 A;  1WXU A;  2CUD A;  1JRI A;  5LJ5 d;  1UG1 A;  2O2O A;  1BCO A;  1HJD A;  4ZGD B;  1BIA A;  3G6E A;  2ZAE A;  1QVP A;  1BK2 A;  3HFN A;  2V8J A;  4J7I A;  4LDW A;  1D3B A;  1QWE A;  4Z89 A;  5KYX B;  1K4U S;  2YWW A;  3CMA A;  2QQA A;  1WNL A;  1B7T A;  4PFO A;  4C8Q G;  1ABO A;  1M8V A;  2DE0 X;  1M4Z A;  2EGA A;  3QZ9 B;  4C5G A;  1I0C A;  4X9C A;  2K2M A;  5CQY A;  1BU1 A;  2E12 A;  1TUD A;  3RUX A;  4J9F A;  2EKO A;  3OYK A;  4C0F A;  2F5T X;  1YBY A;  1QKW A;  3CC2 T;  4PL6 A;  3HPW A;  1YHQ T;  1WXB A;  3AT1 B;  1K8A C;  4A4E A;  2QQB A;  1KC8 R;  3SB2 A;  4M77 E;  4M75 E;  1YI2 A;  2WSF E;  3I5S A;  1UE9 A;  2HKN A;  2KBT A;  2JXB A;  3H41 A;  1JU5 C;  2YRV A;  2QQR A;  2BZ8 A;  5GAN 5;  4N0A C;  1IZ6 A;  4Z88 A;  3JSC A;  2DEU A;  2AZS A;  3HRS A;  2KRO A;  2XMF A;  4FT4 A;  2XID A;  4XTY A;  3QII A;  1ZSZ A;  2B86 A;  2QTX A;  1UDL A;  1B34 B;  2A28 A;  5LJ3 d;  2L8D A;  1SSF A;  1N5Z A;  3CCR T;  3FB9 A;  2SRC A;  4PJO E;  3CC7 T;  3A8M B;  4VUB A;  3GBQ A;  4C8Q B;  1AWO A;  2KR3 A;  1PKT A;  1U1T A;  1I5O B;  3CCM Q;  3G71 A;  1YHQ A;  1M3A A;  2CSI A;  3OS0 A;  4F14 A;  3RBB B;  3BFM A;  2K57 A;  1VQL A;  3S3M A;  1QVG A;  1R0C B;  4N4G A;  2VV5 A;  1W4S A;  2QEX A;  2ENM A;  4HVV A;  5CQX A;  1B07 A;  1PSF A;  4ZTF A;  3P8D A;  4D8K A;  2LJ0 A;  2E3I A;  1I4K 1;  4A4F A;  5J39 A;  1BI2 A;  3V8K A;  3OW2 P;  3J7A F;  2VB6 A;  1VQO T;  3KUF A;  3OS1 A;  3OYE A;  3EG9 B;  1BBZ A;  1VQ5 A;  2LNV A;  1TWB A;  4M7D E;  2QXF A;  3OYH A;  4MDW A;  4MMK A;  5KYY B;  1UGV A;  2DNU A;  3EHQ A;  4KH0 B;  4C92 C;  3JB9 I;  3CCR A;  3ZBD A;  4BB7 A;  3BY7 A;  2JTM A;  3CC7 A;  2DTO A;  1RL2 A;  3JCM P;  3T9N A;  1KQS P;  1S72 A;  3OBY A;  1VQN T;  1T0J A;  4LXC A;  2QA4 T;  5GAN h;  3LH0 A;  2X4W A;  3CME A;  2FPE A;  3OS5 A;  5D6Y A;  4LUE A;  4J9C A;  2DL5 A;  2DK3 A;  4F7U G;  2DD4 A;  4ORZ A;  2BZX A;  5LJ5 f;  4AG2 C;  4C8Q F;  4O5V A;  1BIB A;  3EGD B;  5FRN A;  1Y57 A;  1VQO A;  2SEM A;  3MHX A;  2LRQ A;  2BIV A;  1B3Q A;  4HA8 A;  1RAH B;  3CC2 Q;  3NHN A;  4M7A E;  3UF4 A;  4A53 A;  2MWO A;  2HL3 A;  3A98 A;  1WHJ A;  1EIF A;  4N0A A;  4PK4 A;  4RCC A;  3M0R A;  4ZGJ B;  4N4I A;  2COW A;  2KQW A;  3MEU A;  4OMM A;  3LGL A;  4ATO A;  9ATC B;  3KFV A;  2L3P A;  3CXC A;  4KUD K;  5AT1 B;  4E7H A;  2RQU A;  5GAM g;  2QGF B;  4Y91 A;  4GLM A;  2LCC A;  1ZSZ B;  3R6O A;  3CCL T;  4AFU C;  1YIJ A;  1YJN A;  1TS9 A;  4RUG A;  4RCB A;  1ARK A;  5D6W A;  1VQM A;  4J9D A;  1TSF A;  1KQS S;  3OMG A;  4OMQ A;  1SRM A;  4ZTJ A;  1UEB A;  2FPD A;  3A8O B;  1RAA B;  3MPU B;  1K73 R;  1XJW B;  3GF5 A;  4QQD A;  4F7U B;  2L3Q A;  4JRQ A;  4KUL A;  2RI3 A;  4HKE A;  4CRI A;  1OZ2 A;  5LJ3 f;  2OI3 A;  1RAC B;  4DBQ A;  1KD1 U;  1Y71 A;  1YCY A;  4BDZ A;  3VS3 A;  3CCS A;  1Y07 A;  5CVI A;  4P5N A;  5CCA A;  3PT9 A;  2CYZ B;  4J5Y A;  1LCK A;  1VQO Q;  4BUG A;  1GFD A;  3PE0 A;  2CP3 A;  1WQ7 A;  4C92 A;  2P0K A;  3PIP A;  2HQE A;  1KK7 A;  2LC4 A;  3Q1J A;  3EGX B;  3VS1 A;  1ABQ A;  1U3O A;  2X4Y A;  5GAM h;  1WPY A;  3HFO A;  2DMO A;  1UHF A;  5I11 A;  1VQN Q;  1SG5 A;  1X2Q A;  4M77 C;  1IRE B;  1X01 A;  5KYU B;  2PZ1 A;  3C94 A;  2CKK A;  2QA4 Q;  2OTJ A;  2JM9 A;  4M78 F;  4RG8 A;  1QVF A;  1VYU A;  1W6X A;  2LX7 A;  2RNA A;  5FWB A;  2MOX A;  4C0D C;  3PVL A;  2A08 A;  1KC8 C;  2E1H A;  2DJZ A;  2ZPG B;  3L2R A;  4E7I A;  2LDM A;  2LJ3 A;  4OB0 B;  5D6X A;  4A63 B;  2A0F B;  2RJE A;  3HTR A;  2K3Y A;  5GAO l;  2OX7 A;  5GAN j;  2VYT A;  4KT0 E;  2KVQ G;  2A37 A;  3C4S A;  4E7Z A;  1U1S A;  4CC2 A;  1KQ1 A;  1H3H A;  1M30 A;  3M54 A;  1AHJ B;  2Y4X A;  1ZUY A;  2LCS A;  4FYW B;  4J83 A;  1Q81 R;  3CD6 A;  2YUN A;  3HL8 A;  1VQ4 A;  4A4G A;  1FMK A;  2CZ0 B;  2FHD A;  3H8Z A;  2JT4 A;  3CCL Q;  1NEB A;  4X34 A;  1G8X A;  4LDV A;  1LNX A;  2YDL A;  1M3B A;  1X6B A;  1T3S A;  4X1V A;  1YJW T;  1CSK A;  2BZY A;  2CT4 A;  5DLQ E;  4J9E A;  2A7Y A;  3OYB A;  4IUT A;  4JRP A;  2JUF A;  1YIT T;  3HSB A;  4RMO A;  3VRZ A;  1QQJ A;  2XDB A;  3TRE A;  1VA7 A;  1G3Y A;  2Y4Y A;  1OOT A;  2HCK A;  5CKE A;  4F16 A;  3I5R A;  4ZGE B;  2ECZ A;  2KNB B;  3MP8 A;  4PFZ A;  2CP2 A;  1AWJ A;  3EG3 A;  2LQ8 A;  3FEO A;  3UDC A;  1Y0M A;  4EMG A;  4XU1 A;  3HHT B;  4QVD A;  3VUB A;  2GFA A;  2P0Q A;  2RHU A;  1KD1 R;  1YCS B;  4FW1 A;  3UA6 A;  4JJC A;  3QDR B;  2WSC E;  3CCE A;  3M56 A;  2LNH B;  3OYC A;  1UFF A;  3S3O A;  3O8V A;  1QCO A;  2AKL A;  1BYM A;  2KAF A;  1QVG P;  1YJW A;  1U06 A;  2FO0 A;  4L6V 5;  2E65 A;  4EPC A;  4BY6 C;  1GCQ C;  1WZO A;  4PJM A;  4M7A C;  2RB6 A;  2IPO B;  5L8R E;  3GOX A;  3X24 B;  4BE2 A;  8ATC B;  2RI5 A;  2VGM A;  1QP2 A;  2DJQ A;  1PNJ A;  3QHS A;  2L5Q A;  5LJ5 e;  2FEI A;  2DVE A;  1C1A A;  1VQ7 A;  2EJF A;  1KC8 U;  5GAM j;  1OPL A;  1UGQ B;  4EMK C;  4R55 A;  2Z0W A;  2K79 A;  4FU6 A;  1AZE A;  3PVQ A;  1AZG B;  3UAT A;  2D8J A;  4OMF B;  5EG2 A;  3ASK A;  5FRM A;  1KJW A;  2M51 A;  4J9G A;  2K3X A;  3C0C A;  3DLL A;  2PVG B;  1Q86 U;  5KYW B;  4OP0 A;  3OYF A;  2DZC A;  3LYI A;  5GAN 2;  1K76 A;  3JCM b;  2K5F A;  2DXB A;  2JMC A;  1AWX A;  3FIF A;  3QUI A;  1G5V A;  1YP5 A;  1NM7 A;  3QZ5 B;  3GNF B; 
#chains in the Genus database with same CATH homology
 2KRO A;  2XMF A;  1WYX A;  1U5S A;  2J6K A;  2NWM A;  1VYV A;  2B86 A;  3VRY A;  3H0F A;  1ZLM A;  1UDL A;  4J9B A;  5IXB A;  2A28 A;  1GBR A;  3ULR B;  2JM8 A;  1N5Z A;  3NMZ C;  2SRC A;  1Z9Z A;  1SHF A;  3U23 A;  1VYT A;  2OJ2 A;  3M0U A;  3I9Q A;  3GBQ A;  1AWO A;  2F2W A;  2KR3 A;  1PKT A;  5IHK A;  2ABL A;  1EFN A;  2RPN A;  1M3A A;  2J7I A;  4AFQ C;  4ZNX A;  2CSI A;  4F14 A;  3RBB B;  4HXJ A;  2GTJ A;  2KRS A;  4HVW A;  1YNZ A;  1OPK A;  2ENM A;  4HVV A;  1B07 A;  1AEY A;  2RQV A;  2K6D A;  4D8K A;  1E6G A;  2LJ0 A;  2L3S A;  2J6O A;  2DM1 A;  2PNI A;  1HD3 A;  3EHR A;  2JMA A;  5HCK A;  2V1Q A;  1V1C A;  2KXD A;  1BBZ A;  1SPK A;  2VVK A;  2YUP A;  4M4Z A;  1M8M A;  2QDL A;  4LE9 A;  3SHW A;  1QLY A;  1UGV A;  1MV0 B;  2DNU A;  2RQR A;  3EHQ A;  3VS6 A;  1RUW A;  2K7A A;  2FG0 A;  1X2K A;  1GCQ A;  4QT7 A;  3H0I A;  2RQT A;  1JXO A;  2KRM A;  1ZBJ A;  2ESW A;  2MCN A;  3TSZ A;  3H0H A;  1G2B A;  1T0J A;  4R0K A;  2KYM A;  1XOV A;  2GGR A;  1FYN A;  2H8H A;  4CC3 A;  1ZSG A;  2I0N A;  1K0S A;  2FPE A;  1G83 A;  4K11 A;  4LUE A;  1GCP A;  4J9C A;  2DL5 A;  2ED1 A;  4ORZ A;  2KXC A;  1OV3 A;  2BZX A;  2JTE A;  4AG2 C;  1WDX A;  2CH4 W;  2GTO A;  2AZV A;  3LH5 A;  2DVJ A;  4GBQ A;  4WCI A;  3TSW A;  1Y57 A;  2IIM A;  2C0O A;  1SRL A;  2FRW A;  2SEM A;  2C0I A;  1B3Q A;  2HBW A;  3I35 A;  2P4R A;  4JJB A;  5FW9 A;  2JS0 A;  3NHN A;  2LJ1 A;  3VS2 A;  3UF4 A;  3CQT A;  1MV3 A;  1E7O A;  3A98 A;  5ECA A;  4IIO A;  1X69 A;  2FRY A;  3M0R A;  4FSS A;  1UJ0 A;  2CH4 A;  4OMM A;  3SEM A;  3KFV A;  2L3P A;  2V1R A;  1NYF A;  2LZ6 B;  2RQU A;  1W1F A;  4GLM A;  2VWF A;  4AFU C;  2JW4 A;  5GJV B;  4KRT A;  1AVZ C;  1GBQ A;  4RUG A;  1ARK A;  4IIM A;  4J9D A;  1GRI A;  2HDA A;  4HCK A;  2M0Y A;  2YUO A;  3RNJ A;  1SSH A;  4J9I A;  4RTY A;  4OMQ A;  1SRM A;  2EVR A;  2FPD A;  1A0N B;  3REA B;  4LUD A;  3FJ5 A;  2L3Q A;  2ED0 A;  2YSQ A;  1QKX A;  2VKN A;  2DYB A;  4LN2 A;  2DBM A;  1HSQ A;  1JEG A;  4JZ3 A;  1ZUU A;  1RLQ C;  3EGU A;  2EPD A;  2O9S A;  2DRM A;  3VS7 A;  2KEA A;  2OI3 A;  2DL7 A;  1PKS A;  1NLP C;  1T3L A;  3VS3 A;  1JXM A;  4RTT A;  4OMO A;  4OMN A;  2D1X A;  4EIK A;  2W10 A;  1LCK A;  1GFD A;  3PE0 A;  2DF6 A;  1AWW A;  5IXF A;  2D0N A;  1JO8 A;  1K1Z A;  2F2V A;  1PWT A;  4AG1 C;  1J3T A;  2K9G A;  4LNP A;  1NYG A;  3VS1 A;  1ABQ A;  2NUZ A;  1U3O A;  2FPF A;  1M27 C;  2DMO A;  2HSP A;  2DL8 A;  4AFS C;  2DLP A;  1UHF A;  1SHG A;  2EYZ A;  3NPF A;  1NEG A;  1WI7 A;  2EYX A;  5I11 A;  1X2Q A;  2DX1 A;  1RLP C;  2C0T A;  2HEQ A;  3QWY A;  2PZ1 A;  3THK A;  2EBP A;  5EC7 A;  4RTV A;  2OAW A;  4DEY A;  2JM9 A;  5L23 A;  2JS2 A;  4JZ4 A;  1VYU A;  1UTI A;  1K0X A;  1W6X A;  2LX7 A;  2RNA A;  2DBK A;  5FWB A;  2MOX A;  3PVL A;  1WX6 A;  1KIK A;  2A08 A;  2GNC A;  3IQL A;  2J06 A;  1YN8 A;  1H92 A;  4RTX A;  2YUQ A;  2LJ3 A;  3M0Q A;  2AK5 A;  4A63 B;  2EKH A;  2RN8 A;  2F2X A;  2J6F A;  4JPB W;  2EGC A;  1AD5 A;  2LMJ A;  2L0A A;  2X3X D;  2A37 A;  1UJY A;  1Z9Q A;  2LP5 A;  4CC2 A;  1H3H A;  2CUB A;  1NG2 A;  1KSW A;  2KT1 A;  1M30 A;  2EQI A;  1UEC A;  1WIE A;  2GQI A;  3M0T A;  2E5K A;  2EGE A;  1X27 A;  2KE9 A;  1ZUY A;  4Y92 A;  2LCS A;  1E6H A;  1NLO C;  2CDT A;  2L2P A;  4DEX A;  2PTK A;  2YUN A;  1K9A A;  1ZX6 A;  1PRM C;  2RF0 A;  2CRE A;  1KFZ A;  1S1N A;  2CSQ A;  3UA7 A;  1FMK A;  2LQN A;  1JQQ A;  2YT6 A;  2JT4 A;  1NEB A;  2J05 A;  1I1J A;  1W70 A;  4Z8A A;  1WA7 A;  3EG1 A;  3TVT A;  1MUZ A;  4CC4 B;  4E6R A;  2YDL A;  1M3B A;  2DIL A;  1X6B A;  2DRK A;  1T3S A;  1ZUK A;  5FWC A;  2DA9 A;  4X1V A;  2KT8 A;  1QCF A;  1CSK A;  2BZY A;  2CT4 A;  2GBQ A;  5IHI A;  3ZL7 C;  2KYB A;  2AKK A;  2O9V A;  4J9E A;  3REB B;  3VS4 A;  3VS0 A;  1OEB A;  4OML A;  5GJW B;  1M3C A;  1RI9 A;  2DL3 A;  2DL4 A;  2EYY A;  1IO6 A;  1H8K A;  3VRZ A;  4D8D A;  2RMO A;  2K3B A;  1VA7 A;  3R6N A;  4ESR A;  2KRN A;  1OOT A;  2HCK A;  4F16 A;  1GL5 A;  3I5R A;  2KGT A;  1CKB A;  2ECZ A;  2KNB B;  2O31 A;  1AWJ A;  3EG3 A;  4JJD A;  3O5Z A;  2ROL A;  3VS5 A;  4RTW A;  1Y0M A;  3JV3 A;  3EG2 A;  1YWO A;  2A36 A;  1GFC A;  1UHC A;  2EW3 A;  1PHT A;  4AFZ C;  1YCS B;  2G6F X;  1AOJ A;  3UA6 A;  4JJC A;  4J9H A;  1QWF A;  3M0S A;  2O88 A;  2D8H A;  3QWX X;  1WXU A;  2LNH B;  2CUD A;  1UFF A;  1UG1 A;  2O2O A;  2X3W D;  1HJD A;  2AKL A;  1T0H A;  1X6G A;  1U06 A;  2FO0 A;  1BK2 A;  1GCQ C;  4RTU A;  2EYW A;  1YWP A;  1WFW A;  1BB9 A;  1QWE A;  4Z89 A;  1WLP B;  1K4U S;  3M0P A;  5IHN A;  4RTZ A;  1I07 A;  4HVU A;  1ABO A;  2W0Z A;  2DJQ A;  1PNJ A;  2CT3 A;  2DE0 X;  4F17 A;  2BTT A;  2EGA A;  3EG0 A;  1PRL C;  2RQW A;  1I0C A;  2FEI A;  2LQW A;  2K2M A;  1CKA A;  1BU1 A;  1TUD A;  1OPL A;  5IH2 A;  4J9F A;  1X43 A;  2MIO A;  2ROT A;  2K79 A;  1QKW A;  1AZE A;  3PVQ A;  1AZG B;  3UAT A;  2D8J A;  1KJW A;  1UUE A;  1WXB A;  2M51 A;  4J9G A;  3C0C A;  1TUC A;  1WXT A;  3I5S A;  1SEM A;  1UE9 A;  2KBT A;  1K76 A;  2JXB A;  3H41 A;  1JU5 C;  2JMC A;  2BZ8 A;  1AWX A;  3NGP A;  5I22 A;  4Z88 A;  4CC7 A;  1TG0 A;  1YP5 A;  1NM7 A;  2AZS A;  4OMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...