4F14A

Structure of the sh3 domain of human nebulette in complex with a peptide of xirp2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
TYRAMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nebulette
publication title Identification of Xin-repeat proteins as novel ligands of the SH3 domains of nebulin and nebulette and analysis of their interaction during myofibril formation and remodeling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Actin-binding protein/peptide
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2012-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4f14A00
3ZL7C 3PE0A 3PVLA 3EG1A 4D8DA 1AD5A 2QDLA 3H0FA 4EIKA 4J9IA 2E5KA 1UECA 2FPDA 2VWFA 4JZ4A 2V1RA 1X2QA 1Z9QA 4WCIA 2A37A 1GBRA 1UUEA 2JS0A 3EG2A 1K9AA 1T3LA 1W1FA 1YN8A 4Y92A 1WLPB 2LJ1A 1KIKA 2KNBB 2HCKA 2CT3A 2EGCA 3M0SA 3SEMA 4RTTA 2KXDA 2SRCA 2X3WD 1EFNA 3C0CA 3NGPA 5FWCA 1ZBJA 3CQTA 2DF6A 1WXTA 2EKHA 1UDLA 1WIEA 1M27C 2FEIA 1U3OA 1GRIA 1ARKA 2CDTA 4GBQA 1K0XA 3U23A 4Z88A 4JJDA 1U06A 2KEAA 1CKBA 4CC2A 2JMAA 2RNAA 4F16A 2HBWA 3PVQA 5I11A 1WYXA 4J9BA 2C0OA 2LNHB 2OJ2A 2JM9A 2NWMA 1TUCA 1G83A 5L23A 1VYUA 1SHGA 2DL8A 1SRMA 1T0HA 1QKWA 1Y57A 2DA9A 2BZ8A 1AWJA 2HDAA 2AZSA 1TG0A 1W70A 2ECZA 4LUDA 2DX1A 2YSQA 2DM1A 2FO0A 4AG2C 2L3QA 1X6GA 2J7IA 2C0IA 2L3PA 2KBTA 2CUDA 1V1CA 2RQTA 1AZEA 5IH2A 1JO8A 4AFSC 1VYVA 2DILA 2DNUA 4RTWA 1SHFA 3RNJA 4RTZA 1U5SA 2L3SA 4GLMA 2W10A 1UE9A 2ED1A 4HCKA 2OAWA 2HEQA 3UA7A 1ZSGA 1BU1A 3VS7A 1NLOC 3TSZA 1QKXA 1QLYA 1OV3A 1OEBA 1T0JA 1J3TA 2EYWA 1XOVA 2L0AA 2L2PA 3KFVA 2K2MA 5FWBA 4JZ3A 4D8KA 2CREA 3REBB 1YP5A 2JTEA 4Z8AA 4KRTA 5IXBA 1M3CA 1E6GA 4LE9A 2B86A 1NEBA 2J05A 5GJVB 2EPDA 1QWEA 4OMLA 2CUBA 2D0NA 2RQRA 1MV3A 2YDLA 2YUNA 1UHFA 2O9VA 2AKKA 4QT7A 2OI3A 2JXBA 4OMQA 1K76A 2LJ0A 3VS5A 3M0RA 1NYGA 2M51A 1PHTA 2M0YA 2AK5A 2A28A 2ENMA 2KT8A 4IIOA 1M3BA 1GFDA 2KROA 2DVJA 3VS4A 1ZLMA 1IO6A 4ZNXA 3O5ZA 3VS3A 1AWXA 2RF0A 2EGEA 3A98A 2FG0A 4JJBA 1WX6A 1KSWA 2O31A 2CT4A 3QWXX 4FSSA 4HVVA 2ROLA 1ZUUA 2K79A 2KT1A 1T3SA 2AZVA 2PZ1A 1VA7A 4RTYA 1BBZA 2A08A 1CKAA 1Y0MA 2GTOA 1YCSB 2YUQA 2CH4A 3NPFA 1SRLA 2XMFA 1G2BA 2GTJA 3VRZA 3EHQA 2MIOA 1YWOA 1GCQC 4CC4B 2PTKA 1GCQA 3I35A 1GL5A 2DRMA 4OMPA 5IHIA 3VS6A 2LP5A 3M0QA 1AVZC 2LX7A 4OMMA 2EQIA 1X69A 4X1VA 4J9DA 2ROTA 2K9GA 1H92A 1NG2A 4HVUA 2BZYA 2GNCA 1OOTA 2DL7A 2K7AA 2NUZA 2RN8A 3QWYA 2KGTA 1N5ZA 1AOJA 4Z89A 5ECAA 4M4ZA 2DL3A 2CSQA 3SHWA 2KYBA 3M0UA 5FW9A 4IIMA 2C0TA 4E6RA 3I5SA 2EW3A 2EVRA 4RUGA 1PRMC 4R0KA 1WXUA 1UHCA 2RPNA 4CC7A 5HCKA 3NHNA 2ESWA 2ABLA 3EHRA 3I9QA 1X6BA 2JMCA 2D8JA 1JXOA 1AZGB 1FYNA 1M30A 2GQIA 4F17A 2FPFA 3UF4A 1QWFA 3RBBB 1HSQA 1I1JA 1PNJA 2JS2A 1B07A 3REAB 4DEXA 1QCFA 1GFCA 2BZXA 2J6FA 1UG1A 2EYXA 2MCNA 2JW4A 2O9SA 2JT4A 2GGRA 2W0ZA 2CH4W 2ED0A 2F2VA 1B3QA 1H8KA 1WXBA 1PKSA 1PWTA 3VS0A 1K1ZA 5IXFA 4JJCA 2KRNA 2DMOA 1NEGA 2YUOA 4K11A 1M8MA 2KRMA 1FMKA 2VVKA 1UJYA 5IHKA 1BK2A 2KE9A 2DYBA 1OPKA 2FRYA 2K6DA 1A0NB 1M3AA 1WA7A 2J06A 2X3XD 3FJ5A 2DBMA 1K4US 3H0IA 2EYYA 2P4RA 1UTIA 1RLQC 3H41A 1BB9A 3THKA 5GJWB 3UATA 1RLPC 2J6OA 1TUDA 1JEGA 2KR3A 2RQUA 2DLPA 2DBKA 4DEYA 3I5RA 1UJ0A 3JV3A 1ZUYA 4RTXA 1ABQA 4LN2A 2BTTA 1MV0B 2CSIA 4ORZA 1HD3A 2I0NA 2G6FX 1RI9A 2LCSA 4AFQC 2JM8A 4HVWA 4AFZC 3H0HA 3EGUA 3UA6A 4OMOA 2MOXA 2AKLA 2EGAA 3NMZC 4J9CA 2F2XA 1ABOA 4J9GA 4J9EA 4ESRA 1CSKA 1NM7A 2F2WA 2KXCA 1HJDA 2YUPA 2GBQA 2D1XA 1X27A 1OPLA 1AWWA 2K3BA 4LNPA 5EC7A 1PRLC 1UFFA 1JU5C 1YNZA 1KFZA 1I0CA 4RTVA 2DJQA 1E7OA 3LH5A 2HSPA 1WI7A 2EBPA 1AEYA 2LZ6B 1I07A 1VYTA 2VKNA 1E6HA 1SSHA 2RQVA 1S1NA 3ULRB 1WFWA 1ZUKA 2O2OA 1RUWA 2PNIA 4AFUC 3R6NA 1GBQA 5I22A 1PKTA 2DL5A 3IQLA 1WDXA 2DL4A 2O88A 1AWOA 1SEMA 2LMJA 1MUZA 1LCKA 2LQWA 3TSWA 2J6KA 3M0PA 3GBQA 4F14A 1X2KA 3TVTA 3VRYA 1K0SA 2RQWA 1SPKA 2FRWA 2SEMA 1KJWA 4CC3A 2LQNA 1JQQA 2EYZA 1JXMA 4AG1C 3EG0A 4JPBW 4OMNA 1W6XA 4A63B 3VS1A 3M0TA 5IHNA 1H3HA 1GCPA 2RMOA 4RTUA 3EG3A 1X43A 4HXJA 2V1QA 2DRKA 2H8HA 3VS2A 1Z9ZA 1YWPA 4J9FA 4LUEA 4J9HA 2YT6A 1NYFA 2IIMA 2KRSA 1NLPC 1UGVA 2FPEA 2KYMA 2DE0X 2LJ3A 1ZX6A 2A36A 2D8HA
chains in the Genus database with same CATH superfamily
3ZL7C 2E10A 2HQHA 1VIEA 4D8DA 2WSCE 3H0FA 2QDLA 1D3BA 3JRZA 3CC4Q 2X4XA 3MHXA 1VQ9A 4PL6A 2E5KA 1TUGB 4KGXB 2A37A 2QQBA 3EG2A 2K57A 2RHXA 1W1FA 3LH0A 3JB9H 4Y92A 3INZA 2NUPA 2QQRA 1VQ7A 5LJ3h 2QXFA 2KNBB 2HCKA 3I55T 1C0MA 4ZGEB 2F5TX 3QZ9B 2SRCA 2X3WD 4F7UA 4RCBA 3S6WA 1ZBJA 1NPPA 3G4SQ 1YJ9T 4C0ZA 4J83A 4X34A 1ARKA 2CDTA 4PJJA 3CMAQ 4Z88A 1CKBA 3JCMd 1MHNA 4L5GA 1M90C 4FU6A 4Y91A 3PVQA 2CZ1B 1OX9A 5I11A 3JCMW 1G83A 2NLUA 1SHGA 3HFNA 3P8BB 1T0HA 1QKWA 2DKGA 1WJSA 5CKFA 2HDAA 4XU1A 2ECZA 4LUDA 2DX1A 2VGNA 2JNGA 4XU3A 2EWNA 3QZ5B 2XKOC 4R56A 1P92A 2KMTA 2OTLA 2L3PA 2KBTA 1N8RC 5FRMA 2RQTA 2COZA 1KQ2A 3JCMc 5CAIA 4AFSC 2JTMA 1SHFA 1TH7A 4GLMA 2W10A 2MK5A 4XTZA 1S72Q 5KE3A 1BU1A 3VS7A 3TSZA 3QIIA 1QLYA 1VQNQ 2EYWA 1KQSP 5IT9E 3WVEB 2JTEA 2EKOA 1YJNA 4EMKC 2GQVA 4EMKA 2B86A 3KXTA 1PSFA 3OS1A 2D0NA 2RQRA 2YUNA 2O9VA 3PT9A 3QSUA 2AKKA 2JXBA 3MEWA 2NUTB 1FXXA 4OMQA 1G8XA 2QEXT 1M5Q1 2AK5A 1TU0B 2L5QA 1WHJA 2DVEA 2DXCA 3VS3A 4Y28E 3JCMV 1AWXA 4M7AB 4GLKA 6AT1B 2FG0A 1TWBA 2CGHA 4II1A 2PQWA 2CT4A 4HVVA 2DYIA 4MMLA 1T3SA 2AZVA 3H8ZA 4A4GA 1VA7A 4RTYA 1NZ9A 4X9DA 5CVIA 4M7AE 2FHDA 2Z0WA 5LJ5g 2FB7A 1YCSB 3QG1A 2AIRB 1QCNA 3DLMA 1YI2T 1YITQ 1KQSS 4JJNK 2MIOA 2GCXA 1YWOA 2F69A 3OS0A 1GL5A 4OMPA 2JN0A 1X75C 3M0QA 1M1GA 2CYZB 2EQIA 4X1VA 4J9DA 2ROTA 3SFMA 1IZ6A 2GFUA 2GNCA 5GAMd 2RN8A 1ZA2B 1VQLQ 3QDRB 3RKXA 1UGPB 4FL6A 2YHTA 5I21A 3CMEA 2JOYA 2VYTA 2P0QA 5GMKj 3M0UA 3BDLA 4IIMA 3PMTA 2RM4A 1KK7A 4RUGA 1WXUA 5HCKA 1VQKQ 4GY5A 3L2QA 4M7AG 1KG1A 1HXDA 2LCCA 2FPFA 3UF4A 2R5AA 1IHVA 2EQJA 2JS2A 2AHJB 1D1CA 1PSEA 5GAOm 1EX4A 1Q82R 2RJFA 2BZXA 2J6FA 3NFCA 3TQ7P 1QVFA 1H8KA 1PKSA 3CMET 1PWTA 5CKHA 3CCEA 5GANj 5IXFA 1NEGA 2YUOA 4K11A 1M8MA 4C8QB 5FROA 3FC3A 3CCMT 1FWZA 2PVGB 3PTAA 1OI1A 2VB6A 1M3AA 4FYVB 3OYDA 2J06A 2EAYA 2QA4A 4M7AD 4E47A 3H0IA 2P4RA 1U1SA 3H41A 4C8QE 1VQMT 3UATA 3PIPA 1X01A 2DBKA 3JV3A 4PKCC 4BY6B 2BTTA 3CBOA 5GMKl 3CBMA 3G6ET 3M58A 1RI9A 3QPHA 3I56Q 5LJ5e 1Q86C 3TCJA 1TSFA 3UA6A 1K8AC 2MOXA 2AKLA 1NJIC 3DLLA 1QVGS 5HKCA 1ABOA 4M78E 3E2UA 4FYYB 1KHCA 4BI3A 1W2BP 3QJYA 4JLIA 8ATCB 2YUPA 2D1XA 1EIFA 1VQOQ 4F7UG 2DXUA 1RL2A 2K2VA 1OULA 3EAEA 4DQ2A 1Y71A 1K73C 4RTVA 2DJQA 3LH5A 3CCVA 2EBPA 2LDMA 2YRVA 4Z02A 1AEYA 4M75B 3C12A 2FZGB 3V8LA 1NJIU 2VXFA 4PLIA 1M2OA 3CC7Q 4DA4A 3ULRB 1UEBA 1V29B 1RUWA 2P84A 4AFUC 2XK0A 5I22A 3UDCA 4PJOB 1AWOA 3D7SB 4M75E 4OGEA 3LGLA 3V8JA 1K73U 2XHCA 2ZZDA 4KGVB 3BW1A 5LJ5d 3RKWA 7AT1B 1PG5B 3CPWP 2MYSA 3TSWA 3M0PA 1BI3A 2K3XA 3TVTA 4BB7A 3GIBA 1K0SA 3F70A 4M77E 2RI2A 2RQWA 4C8QF 4ZGDB 3BY7A 4M78G 4PJOE 4LXCA 4CC3A 2EYZA 4AG1C 5C0MA 5LJ3g 3CCJT 1W6XA 3FLGA 4BACA 1NJIR 1H3HA 2RMOA 1VQPQ 5M9OA 3G7ZA 1YWPA 2DZ9A 4J9FA 4LUEA 1YIJT 4PLLA 4E7JA 4J9HA 2PUOB 2DTOA 1W2BS 2LJ3A 2A36A 2E4HA 2D8HA 4Z8AA 2BE7D 1BI0A 1O9SA 4B9XA 3C95A 3HRUA 4C92B 3CPWA 1AD5A 4OGCA 1IXDA 3KUFA 3CCUQ 2E3IA 1B34A 4M75G 3P8DA 3CD6T 2FPDA 2Y4YA 2O4XB 1XJWB 2QASA 4O5VA 2VWFA 4JZ4A 3EH2A 4WCIA 5KYUA 2E1HA 1GBRA 1UUEA 4M78D 4JRQA 3VV0A 4O6JA 4ELYC 1YN8A 2JVVA 1WLPB 1G5VA 4M77G 4FW1A 2XDBA 1U8RA 3MCAB 4DOVA 2MI6A 3M59A 4J6WA 4RTTA 3NGPA 5FWCA 2CP5A 3LX7A 2DF6A 1WXTA 1Y96B 2CKKA 4ZGJB 1VQ6Q 2LX9A 3OB9A 1BIAA 4DBRA 2V26A 4CC2A 3OYKA 2RNAA 5KYWB 3TU4K 3CCSA 5L8RE 2R5MA 3OYLA 3GNGA 3J80E 3A1PA 3OS5A 3VJPA 4M7AC 4B9WA 4M7AA 3SWNC 5L23A 3P8HA 4PJOF 2FZCB 3EFOA 1PM3A 3JB9G 2DL8A 1SRMA 1PD1A 3JSCA 2DA9A 4LDWA 2BZ8A 3CC4T 1SF9A 1VQ5Q 5GAOn 1YHQA 4XQ3A 3JCMX 4M77D 2JJ9A 1WHHA 2DM1A 2FO0A 1X6GA 2J7IA 4FT4A 2C0IA 2DAQA 4RMOA 1YFNA 1JO8A 3S3MA 1OYXA 4KULA 2L3SA 1UE9A 4F04B 4N4GA 3UA7A 1N27A 1W4SA 2OTJQ 1OV3A 1OEBA 3G4ST 4A4HA 2XDDA 3G71Q 4ANJA 2L0AA 2PU9B 5LJ3e 3V7SA 2K2MA 2ZAEA 1FX7A 4FYWB 4LD9K 4OMFB 2CREA 4WTOB 1I8FA 3CMAT 3I55A 3MO8A 4C92F 3JB9D 4RG8A 1M3CA 1E6GA 1FMWA 4LE9A 3CCQA 1NEBA 4E7KA 2IVWA 4FIBA 1ZSZB 2J05A 4E7IA 1QP3A 3V7RA 4OMLA 2CUBA 1MV3A 3VKIA 3OYNA 3OS2A 4EPCA 4QT7A 2OI3A 2AT1B 1KD1R 2LJ0A 1AT1B 4E7SA 2EQKA 5GAMg 2M51A 2ENMA 2DVJA 2XU8A 2QGFB 4QVZA 1ZLMA 1IO6A 4C0GA 3O5ZA 4BI8B 2CS7A 2DXTA 3MEAA 3HFOA 5KCOA 4ELZC 4FYXB 3OSSC 3OYEA 1WX6A 5GMKh 3V8KA 4MZTA 4J8OA 2JTFA 2LC4A 2K79A 2LRQA 2DFUA 2RJEA 2QGGA 1VOMA 2PZ1A 1LVKA 3M5AA 3L1AA 3CCQT 2R58A 4MDWA 5LJ3d 3LWHA 1BBZA 5KYXB 3TREA 4C8QA 2RJCA 2CH4A 1SRLA 4BE0A 3O8VA 1G2BA 5A2QE 1M2VB 2L8DA 4CC4B 1GCQC 3QHSA 5I2MA 1GCQA 3I35A 5IHIA 3VS6A 3EFRA 3CCLQ 1JRIA 1I5OB 1AVZC 4OMMA 1X69A 4P5NA 4LDVA 1H92A 2A7YA 2NUZA 2KGTA 1N5ZA 5GANh 1AOJA 4Z89A 3OYHA 4M78C 2DL3A 3JCMb 4M78A 1JBMA 4BI4A 2EFIA 3L2WA 3QBYA 3I5SA 3RR6A 2QEXA 5GMKm 2DETA 3CCRA 2LCLA 3T9NA 3NHNA 2EJFA 2ESWA 5KE2A 2ABLA 5DLQE 2JMCA 1D0XA 1AZGB 1FYNA 3MP8A 4F17A 5HY6A 3RBBB 2E6NA 1I1JA 4YTLA 1UGRB 3REAB 4BD3A 2QQ9A 4DEXA 1QCFA 3A8OB 1RI0A 2JW4A 1LOJA 3EFSA 1XTDA 1YJ9Q 2MPXC 4M75A 1YJWQ 2F2VA 3RMQA 1B3QA 1WXBA 4QQGA 2DIGA 4BE1A 1K1ZA 1M8VA 4M7DB 2DMOA 1YI2A 5FU6B 4M77C 5A0GA 1FMKA 2VVKA 4M77A 5GAMe 4IUUA 1UJYA 3LYIA 3CCRT 4PJOA 4BDYA 5FU7C 2FRYA 1VQ9Q 2YWWA 2QQSA 1A0NB 3NTIA 2HL3A 5KYYA 1KQ1A 1KQSA 2X3XD 2QAZA 4KH0B 4HKEA 2DBMA 5GAN2 2HQXA 4M7DE 3OBYA 1UTIA 1RLQC 3THKA 1VQKT 3LGFA 3M9QA 2J6OA 3LW5E 1JJ2P 1VQ7Q 5J39A 2X4WA 1JEGA 2DLPA 2F1LA 3I5RA 4PFOA 2CSIA 4ORZA 2QQAA 3ME9A 1QW1A 2YLCA 1MNDA 1Q82C 2G6FX 2LCSA 4KUDK 3EGUA 4DBQA 1YBYA 2EGAA 3NMZC 4ATOA 2H3EB 4J9EA 4ESRA 3VU3C 1SSFA 2EIFA 2F2WA 2K5FA 3RUXA 5CK9A 1HJDA 4C0DB 3A8HB 1OPLA 1AWWA 1Q82U 1KFZA 2O4XA 5D6XA 1QQJA 4KUIA 1E7OA 3CBPA 3H9NA 1VYTA 2VKNA 2OTLQ 4FM4B 3OYBA 1E6HA 4LDUA 3CCMA 1WFWA 1ZUKA 2HKNA 4UC4A 1ZBXA 5AT1B 3QO3A 1BKBA 3JCMP 2EYQA 1PKTA 1Y96A 3M4GA 4EDUA 1G3TA 2DL5A 1WDXA 3IQLA 3RMSA 1SEMA 2DEUA 1LCKA 1VQMA 2LQWA 3CC2T 1D1AA 1QVGP 1JJ2S 1ZQ1A 5GAN3 1HYOA 5KYWA 4F14A 1BCMA 4M7DF 3E9FA 3JCMf 5IAYA 1YJNQ 2PVDB 1KJWA 4A4FA 2LQNA 1JQQA 4JPBW 3G6EA 1WZOA 4C5IA 2RI3A 3M0TA 5IHNA 4L6V5 3EG3A 1X43A 4HA8A 2H8HA 2IPOB 4JDSA 3DKMA 1UB4A 3N5BB 1Q95G 2DJZA 2A0FB 2KYMA 3CXCP 1Q81R 3EH1A 2YRDA 4QQDA 1EZZB 1QVGA 3PE0A 3PVLA 3EG1A 2O01E 3OMCA 1I5LA 1N9RA 3OYJA 1VQ4A 2RH2A 1UECA 1QP2A 3HTRA 2FYKA 3C94A 2L89A 2JS0A 1IREB 1GXIE 4XTWA 1K9AA 1T3LA 3NTKA 1VQ8A 1FMVA 4XTUA 2LJ1A 1KIKA 4ZN3A 1X6OA 2CT3A 3SEMA 5CR2A 1ZSZA 4HCCA 3DB4A 2R57A 3CQTA 1K9MU 4QVDA 1UDLA 1YCYA 1BI1A 4LD6A 1IGUA 1GRIA 1K0XA 2XIDA 4WF2A 5CKBA 1VIFA 5DM7R 4F16A 2HBWA 2HZYA 1H3ZA 2DXBA 3CCJA 1VQ4T 4J9BA 2LNHB 3L2ZA 2JM9A 1TUCA 3CMEQ 4C8QG 4KT0E 5CKEA 1WHLA 5KH6A 1YIJA 1Y57A 3OY9A 1NPRA 3CXCS 2LQ8A 2E64A 1VQ8T 1W70A 2IG0A 4EMKB 2YSQA 1K9MR 2M02A 1N6AA 2CUDA 1SG5A 2DD4A 1W2BA 2B8AA 5IH2A 5GAOq 5D6YA 2DILA 4XAXB 2DNUA 2K5IA 1F1BB 5I2SA 4LDXA 2MWOA 4RTWA 2VC8A 3CD6A 3LLRA 4RTZA 1U5SA 1M2VA 4QKUA 4HCKA 3VYHB 2OAWA 2HEQA 4LDYA 4ZTJA 1QKXA 3AT1B 2KVQG 1T0JA 3S3OA 1J3TA 2DZCA 1XOVA 3OW2P 5FWBA 4JZ3A 3REBB 1I81A 2E70A 4KRTA 4C8QD 3CCEQ 1WQ7A 2E41A 1V76A 5IXBA 5GAN7 3DB3A 3HKSA 5GAMf 4ZN1A 1C1AA 1BYMA 4IUTA 5GJVB 2EPDA 1QWEA 1RAHB 3QDFA 4VUBA 2YDLA 1UHFA 1MMAA 2DERA 2QA4Q 4BDZA 4A54A 4N4HA 1K76A 3VS5A 3M0RA 3HP9A 3PMIA 2M9UA 2M0YA 2A28A 2E5QA 2KT8A 1M3BA 4NOYA 2KROA 3E9GA 3VS4A 3A8MB 3M56A 4IUQA 2VUBA 1LPLA 2RF0A 2EGEA 5GANg 1AHJB 3CC4A 4C92E 3A5ZB 4A4KA 1MMDA 4MZPA 1KSWA 2O31A 3QWXX 4PJOG 2WSEE 5DLOA 2ROLA 1ZUUA 1XQHA 2RB6A 2ZPEB 1RAGB 1IRXA 2L3RA 2LT1A 2RHUA 1Q7YC 3EGDB 2OTJT 3G71T 1RADB 4BE2A 4M7DA 2DEQA 2I2LA 2NUTA 4JRKA 4R55A 2CZ6B 3OYYA 3RESA 2G3RA 2YUQA 2HKQB 1QCOA 1UGSB 4DBFA 2RK1A 1BCOA 3G4SA 3OW2S 3EHQA 2DRMA 1RAEB 1D0YA 3M4YA 4M75D 2DK3A 1M1FA 2LP5A 3GNFB 5GAOl 4XK8E 1Q7YU 3CMAA 1KD1C 3CCVQ 2RA2A 3ZFJA 4HVUA 2BZYA 2DL7A 2E12A 2GFAA 1M1KC 1N9SA 1R8OB 4BUGA 4PJOD 2YLBA 4C92G 3EG9B 3MP1A 1QVPA 2XD0A 2CSQA 3E1SA 3SHWA 5FW9A 1KHIA 2KY9A 3GLXA 2CP3A 4E6RA 3OMGA 1OZ2A 2EW3A 2EVRA 1KD1U 2QTXA 3MEVA 3RKYA 2KQWA 3I9QA 3PNWC 2D8JA 3HHTB 2CP6A 1M1KU 4PFPA 1B7TA 2GQIA 1OZ3A 4JS5A 3MPUB 4ZTFA 1Q7YR 4C0FA 4PFZA 3MKDA 1HSQA 2EQUA 4PK4A 1PNJA 1WQWA 1B07A 2DD5A 1S72A 2EYXA 2MCNA 2D6FA 3BDUA 4RKUE 2GGRA 1VQNA 2XDPA 2HBPA 3CCLT 1WJQA 4FW2A 4EMGA 4C92D 3SDZA 2KRNA 4OB2B 2VXEA 2KE9A 2XI9A 2DYBA 1OPKA 3BE3A 3EGXB 2K6DA 1M1KR 3HSBA 3HPWA 2P4TA 1K4US 4XTVA 4FSXA 2EYYA 5GANe 2BIVA 1R0BG 4JUVA 5LJ5j 4N4IA 5FRNA 5LJ5f 4PJLA 1TUDA 2QYZA 2Y4XA 2RQUA 1S72T 1SKUB 2ZPIB 2RHIA 1UJ0A 2X51A 1ABQA 4OB0B 1MV0B 2FL7A 1VQNT 2EQMA 1ZA1B 4C8QC 3LWIA 1XNIA 4AFQC 2JM8A 4AFZC 2BE9B 4PJMA 4MDXA 4OMOA 4EMHA 5HK0A 3CCSQ 4E7LA 3JCMh 1YJWT 4A4EA 3CPFA 3TEEA 4QQ6A 5FLXE 4KBMB 5DY9A 2GBQA 1X27A 1YITA 4DOWA 3OYAA 2K3BA 5EC7A 3VUZA 1YNZA 2HQEA 4BY6C 2LTOA 1YHQQ 1VQ9T 2HSPA 2COWA 1WI7A 3FDRA 2LZ6B 4XTXA 1MMGA 4JS4A 3GOXA 4JLGA 5GANd 3CEYA 4J6YA 1M4ZA 4OF1A 2VASA 1DJ7B 2O2OA 1VQLA 4E7ZA 2PNIA 3QUIA 2V8KA 1Y07A 1VQ7T 3JB9J 2VV5A 2V8JA 1GBQA 1M90U 3OA6A 1D09B 3BFMA 2LMJA 2EJ9A 1MUZA 1C6VX 1VQKA 3PIOA 2BKDN 3VUBA 2J6KA 1X2KA 3I55Q 1RABB 2OX7A 1LJOA 1JB0E 4KGZB 1YITT 1B34B 2SEMA 4M75C 1PCXA 3KBGA 1QMCA 3CCQQ 3EG0A 4OMNA 4XU2A 2HD0A 5KYUB 4OB1B 1N8RU 3FIFA 3META 1GCPA 5KYNA 2M0OA 5C6SA 4HXJA 4IUPA 3VS2A 2QDYB 2HAXA 1VQLT 2YT6A 4PJOC 1NYFA 2IIMA 3UWNA 1M90R 2FPEA 1RAAB 2D9TA 2DE0X 2A3LA 1ZX6A 2OTLT 4QVCA 2DPPB 2V8IA 1UGQB 3Q1JA 3HL8A 4EIKA 2M1HA 3X26B 3C4SA 4J9IA 4E7HA 2HSEB 8AT1B 3FEOA 2V1RA 4KH1B 2P0KA 1X2QA 1Z9QA 4V2SA 4HT8A 4HT9A 5A0LA 4A53A 2RD1A 3PGGA 2DO3A 3SWNB 1BIBA 1N8RR 3EFOB 5CKDA 5J3BA 4PJNA 2EGCA 3H6ZA 3M0SA 2KXDA 1YJNT 2DTIA 3UPUA 1EFNA 3C0CA 3JCMJ 2DIQA 2WSFE 3V7CA 3A8LB 2EKHA 3FJPA 2JZ2A 1WIEA 1M27C 1TTHB 3CC2A 2FEIA 1U3OA 2ZGWA 4C92C 1TOVA 4C92A 3I56A 3SD4A 4GBQA 2H3JA 3U23A 4AMCA 1WHMA 2F5KA 4IUVA 1U06A 4JJDA 2KEAA 2JMAA 2MAMA 1JJ2A 3SB2A 3QKJA 1G3WA 1Q81C 3R6OA 1WYXA 2KDSA 2C0OA 4RG2A 2OJ2A 2OAUA 4CI0C 3JB9I 2NWMA 5GAMh 3ER0A 4M7DG 1VYUA 1VQOA 2YRCA 3X28B 4HCBA 2QEXQ 1AWJA 2AZSA 1TG0A 3CCRQ 3EGDA 4AG2C 2L3QA 1Q81U 5LJ3j 1QVFP 1V1CA 1AZEA 2DTHA 3CC7A 5LJ3f 4CRIA 1VYVA 3I56T 1LNXA 2LT4A 3RNJA 4TVRA 1D3BB 1NE8A 5CCAA 2ED1A 3L2UA 1RACB 1ZSGA 2HNIA 4JRIA 1PC0A 3MEUA 1NLOC 4ME7A 2K3YA 4AT1B 1VUBA 3FB9A 5J26A 2L2PA 1OQKA 3KFVA 2CP2A 4D8KA 4M7DD 1YP5A 3AHUA 1VQOT 2NUPB 1YI2Q 3QYHB 3L42A 4DBHA 3EG9A 4F7UB 1HK9A 1WHKA 1VQPA 2EJGA 3HRSA 3CC7T 1G3YA 1MMNA 4M7AF 1MNEA 5GANf 3PFSA 1NYGA 1PHTA 3OSVA 1K9MC 1WJRA 2XG8D 4IIOA 1GFDA 4F7UE 3MP6A 1RAIB 4ZNXA 4IKFA 3L2RA 3A98A 3CCUA 4JJBA 2E65A 4E2FB 3G1JA 4FSSA 2QI2A 1ZSZC 4JRPA 1QVFS 2KT1A 3J81E 2BUDA 3CXCA 3M54A 5D6WA 4FT2A 1WNLA 4M78B 2A08A 1CKAA 1Y0MA 1Y7XA 2P0PA 3CC2Q 4OVAA 5CO7A 5GAN5 3OYMA 5GAN4 2X35A 1VQPT 2GTOA 3CCET 1RAFB 4MZMA 2LQKA 3NPFA 2ZCFB 2XMFA 3EGXA 2GTJA 3VRZA 1VQ6A 1I4K1 2X9HA 2PTKA 4J7IA 5CIUA 2LX7A 5D7UA 2NYSA 2CZ7B 3OYFA 2RK2A 2K9GA 2QA4T 5EG2A 1NG2A 3CCUT 1OOTA 2K7AA 3QWYA 3CCMQ 1Q86U 3RDVA 2HMAA 1ZHIA 3M53A 5ECAA 4M4ZA 5KYXA 1K8AU 2VGMA 2PVOB 2KYBA 3RIRA 2C0TA 2K5LA 3URGA 3S3NA 3ZEHA 1VQ5A 1PRMC 4R0KA 1VQMQ 2MMPA 1UHCA 2RPNA 4CC7A 3NTHA 2MF2A 2KI7A 5IN1A 2CP0A 3EHRA 4M77B 3E19A 1X6BA 3M55A 2M16A 5LJ5h 2FVUA 1JXOA 3WXMB 4RCCA 1IGQA 3J7AF 5FU7B 1TXQA 2RO0A 3GPLA 1M30A 1VQ6T 1TS9A 2RHYA 4F7UF 5KYYB 3X24B 1QWFA 4B6MA 3G6EQ 3OBWA 1U1TA 3GF5A 1IHWA 2ZPGB 1OX8A 4MMKA 5GAMj 1GFCA 1UG1A 1NBEB 1Q86R 4IURA 2OTJA 2LVMA 2JT4A 2O9SA 3JCMQ 3G71A 2W0ZA 1H641 4XU0A 2CH4W 3OYGA 4D6WA 1M9SA 1WGSA 2ZPFB 2JUFA 1K8AR 2ED0A 5AYFA 3CCVT 3VS0A 3QXEB 4JJCA 3JAME 3JCMg 2LNVA 2KRMA 2QK0A 1VQ5T 5GAN6 5GAOr 5IHKA 1BK2A 4C5EA 2QG9B 2COYA 1VQ4Q 2FZKB 2ATCB 2GF7A 5GMKi 3M57A 3OQ5A 3OW2A 1WA7A 3UT1A 1K73R 3FJ5A 4J5YA 4M78F 3MJXA 2E3HA 5CQXA 3VYGA 1BB9A 5GJWB 1VQ8Q 4QW2A 1RLPC 4N0AC 4N0AA 2KR3A 2KSSA 3OYIA 4DEYA 2PUKB 1ZUYA 4RTXA 4LN2A 1D1BA 4C5GA 2D0QB 1HD3A 4M7DC 2WACA 1G3SA 2I0NA 2XICA 5FU6C 2KK4A 1OU9A 4HVWA 3H0HA 1R77A 1ACMB 2CP7A 4J9CA 4X9CA 2F2XA 9ATCB 3CCJQ 2X4YA 4J9GA 1R0CB 3CPWS 2E6ZA 1CSKA 1NM7A 2QTVA 1KC8C 2K4YA 3L2VA 2KXCA 4M75F 1O75A 1OU8A 2X4JA 4LNPA 1YIJQ 1PRLC 1UFFA 5GAN8 4HCZA 1JU5C 3RERA 2CZ0B 2RI5A 1I0CA 3CCLA 4OP0A 5CQYA 4M77F 5GAOp 3FRNA 1I07A 4NL2A 3SWNA 4J7FA 1SSHA 2RQVA 1S1NA 2MWPA 3OYCA 1KC8U 2HL5C 5A0DA 4L59A 3R6NA 3CD6Q 1PD0A 4FCYA 3X25B 2DL4A 4NS5A 2O88A 2KAFA 3A8GB 3WVDB 2YXYA 4C0DC 5GMKe 2RJDA 3ASKA 4OB3B 1WPYA 5HK3A 3QYGB 3GBQA 3HRTA 3VRYA 2Y90A 5KCHA 1SPKA 1WHGA 5LL6S 4PNOA 2FRWA 3JB9F 1BI2A 2RHZA 3CCST 1JXMA 4J6XA 4Q5WA 1IB8A 4A63B 1MGQA 3VS1A 4C5HA 2C06A 4RTUA 3GP8A 3ZBDA 1KC8R 2V1QA 3X20B 2DRKA 3JCMe 1Z9ZA 2ZPHB 1YJ9A 1YJWA 2KRSA 4NL3A 1NLPC 1UGVA 1YHQT 1D0ZA 4XTYA 3QJ6A 2ZPBB
chains in the Genus database with same CATH topology
3ZL7C 3PE0A 3PVLA 3EG1A 4D8DA 1AD5A 2QDLA 3H0FA 4EIKA 4J9IA 2E5KA 1UECA 2FPDA 2VWFA 4JZ4A 2V1RA 1X2QA 1Z9QA 4WCIA 2A37A 1GBRA 1UUEA 2JS0A 3EG2A 1K9AA 1T3LA 1W1FA 1YN8A 4Y92A 1WLPB 2LJ1A 1KIKA 2KNBB 2HCKA 2CT3A 2EGCA 3M0SA 3SEMA 4RTTA 2KXDA 2SRCA 2X3WD 1EFNA 3C0CA 3NGPA 5FWCA 1ZBJA 3CQTA 2DF6A 1WXTA 2EKHA 1UDLA 1WIEA 1M27C 2FEIA 1U3OA 1GRIA 1ARKA 2CDTA 4GBQA 1K0XA 3U23A 4Z88A 4JJDA 1U06A 2KEAA 1CKBA 4CC2A 2JMAA 2RNAA 4F16A 2HBWA 3PVQA 5I11A 1WYXA 4J9BA 2C0OA 2LNHB 2OJ2A 2JM9A 2NWMA 1TUCA 1G83A 5L23A 1VYUA 1SHGA 2DL8A 1SRMA 1T0HA 1QKWA 1Y57A 2DA9A 2BZ8A 1AWJA 2HDAA 2AZSA 1TG0A 1W70A 2ECZA 4LUDA 2DX1A 2YSQA 2DM1A 2FO0A 4AG2C 2L3QA 1X6GA 2J7IA 2C0IA 2L3PA 2KBTA 2CUDA 1V1CA 2RQTA 1AZEA 5IH2A 1JO8A 4AFSC 1VYVA 2DILA 2DNUA 4RTWA 1SHFA 3RNJA 4RTZA 1U5SA 2L3SA 4GLMA 2W10A 1UE9A 2ED1A 4HCKA 2OAWA 2HEQA 3UA7A 1ZSGA 1BU1A 3VS7A 1NLOC 3TSZA 1QKXA 1QLYA 1OV3A 1OEBA 1T0JA 1J3TA 2EYWA 1XOVA 2L0AA 2L2PA 3KFVA 2K2MA 5FWBA 4JZ3A 4D8KA 2CREA 3REBB 1YP5A 2JTEA 4Z8AA 4KRTA 5IXBA 1M3CA 1E6GA 4LE9A 2B86A 1NEBA 2J05A 5GJVB 2EPDA 1QWEA 4OMLA 2CUBA 2D0NA 2RQRA 1MV3A 2YDLA 2YUNA 1UHFA 2O9VA 2AKKA 4QT7A 2OI3A 2JXBA 4OMQA 1K76A 2LJ0A 3VS5A 3M0RA 1NYGA 2M51A 1PHTA 2M0YA 2AK5A 2A28A 2ENMA 2KT8A 4IIOA 1M3BA 1GFDA 2KROA 2DVJA 3VS4A 1ZLMA 1IO6A 4ZNXA 3O5ZA 3VS3A 1AWXA 2RF0A 2EGEA 3A98A 2FG0A 4JJBA 1WX6A 1KSWA 2O31A 2CT4A 3QWXX 4FSSA 4HVVA 2ROLA 1ZUUA 2K79A 2KT1A 1T3SA 2AZVA 2PZ1A 1VA7A 4RTYA 1BBZA 2A08A 1CKAA 1Y0MA 2GTOA 1YCSB 2YUQA 2CH4A 3NPFA 1SRLA 2XMFA 1G2BA 2GTJA 3VRZA 3EHQA 2MIOA 1YWOA 1GCQC 4CC4B 2PTKA 1GCQA 3I35A 1GL5A 2DRMA 4OMPA 5IHIA 3VS6A 2LP5A 3M0QA 1AVZC 2LX7A 4OMMA 2EQIA 1X69A 4X1VA 4J9DA 2ROTA 2K9GA 1H92A 1NG2A 4HVUA 2BZYA 2GNCA 1OOTA 2DL7A 2K7AA 2NUZA 2RN8A 3QWYA 2KGTA 1N5ZA 1AOJA 4Z89A 5ECAA 4M4ZA 2DL3A 2CSQA 3SHWA 2KYBA 3M0UA 5FW9A 4IIMA 2C0TA 4E6RA 3I5SA 2EW3A 2EVRA 4RUGA 1PRMC 4R0KA 1WXUA 1UHCA 2RPNA 4CC7A 5HCKA 3NHNA 2ESWA 2ABLA 3EHRA 3I9QA 1X6BA 2JMCA 2D8JA 1JXOA 1AZGB 1FYNA 1M30A 2GQIA 4F17A 2FPFA 3UF4A 1QWFA 3RBBB 1HSQA 1I1JA 1PNJA 2JS2A 1B07A 3REAB 4DEXA 1QCFA 1GFCA 2BZXA 2J6FA 1UG1A 2EYXA 2MCNA 2JW4A 2O9SA 2JT4A 2GGRA 2W0ZA 2CH4W 2ED0A 2F2VA 1B3QA 1H8KA 1WXBA 1PKSA 1PWTA 3VS0A 1K1ZA 5IXFA 4JJCA 2KRNA 2DMOA 1NEGA 2YUOA 4K11A 1M8MA 2KRMA 1FMKA 2VVKA 1UJYA 5IHKA 1BK2A 2KE9A 2DYBA 1OPKA 2FRYA 2K6DA 1A0NB 1M3AA 1WA7A 2J06A 2X3XD 3FJ5A 2DBMA 1K4US 3H0IA 2EYYA 2P4RA 1UTIA 1RLQC 3H41A 1BB9A 3THKA 5GJWB 3UATA 1RLPC 2J6OA 1TUDA 1JEGA 2KR3A 2RQUA 2DLPA 2DBKA 4DEYA 3I5RA 1UJ0A 3JV3A 1ZUYA 4RTXA 1ABQA 4LN2A 2BTTA 1MV0B 2CSIA 4ORZA 1HD3A 2I0NA 2G6FX 1RI9A 2LCSA 4AFQC 2JM8A 4HVWA 4AFZC 3H0HA 3EGUA 3UA6A 4OMOA 2MOXA 2AKLA 2EGAA 3NMZC 4J9CA 2F2XA 1ABOA 4J9GA 4J9EA 4ESRA 1CSKA 1NM7A 2F2WA 2KXCA 1HJDA 2YUPA 2GBQA 2D1XA 1X27A 1OPLA 1AWWA 2K3BA 4LNPA 5EC7A 1PRLC 1UFFA 1JU5C 1YNZA 1KFZA 1I0CA 4RTVA 2DJQA 1E7OA 3LH5A 2HSPA 1WI7A 2EBPA 1AEYA 2LZ6B 1I07A 1VYTA 2VKNA 1E6HA 1SSHA 2RQVA 1S1NA 3ULRB 1WFWA 1ZUKA 2O2OA 1RUWA 2PNIA 4AFUC 3R6NA 1GBQA 5I22A 1PKTA 2DL5A 3IQLA 1WDXA 2DL4A 2O88A 1AWOA 1SEMA 2LMJA 1MUZA 1LCKA 2LQWA 3TSWA 2J6KA 3M0PA 3GBQA 4F14A 1X2KA 3TVTA 3VRYA 1K0SA 2RQWA 1SPKA 2FRWA 2SEMA 1KJWA 4CC3A 2LQNA 1JQQA 2EYZA 1JXMA 4AG1C 3EG0A 4JPBW 4OMNA 1W6XA 4A63B 3VS1A 3M0TA 5IHNA 1H3HA 1GCPA 2RMOA 4RTUA 3EG3A 1X43A 4HXJA 2V1QA 2DRKA 2H8HA 3VS2A 1Z9ZA 1YWPA 4J9FA 4LUEA 4J9HA 2YT6A 1NYFA 2IIMA 2KRSA 1NLPC 1UGVA 2FPEA 2KYMA 2DE0X 2LJ3A 1ZX6A 2A36A 2D8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZL7 C;  3PE0 A;  3PVL A;  3EG1 A;  4D8D A;  1AD5 A;  2QDL A;  3H0F A;  4EIK A;  4J9I A;  2E5K A;  1UEC A;  2FPD A;  2VWF A;  4JZ4 A;  2V1R A;  1X2Q A;  1Z9Q A;  4WCI A;  2A37 A;  1GBR A;  1UUE A;  2JS0 A;  3EG2 A;  1K9A A;  1T3L A;  1W1F A;  1YN8 A;  4Y92 A;  1WLP B;  2LJ1 A;  1KIK A;  2KNB B;  2HCK A;  2CT3 A;  2EGC A;  3M0S A;  3SEM A;  4RTT A;  2KXD A;  2SRC A;  2X3W D;  1EFN A;  3C0C A;  3NGP A;  5FWC A;  1ZBJ A;  3CQT A;  2DF6 A;  1WXT A;  2EKH A;  1UDL A;  1WIE A;  1M27 C;  2FEI A;  1U3O A;  1GRI A;  1ARK A;  2CDT A;  4GBQ A;  1K0X A;  3U23 A;  4Z88 A;  4JJD A;  1U06 A;  2KEA A;  1CKB A;  4CC2 A;  2JMA A;  2RNA A;  4F16 A;  2HBW A;  3PVQ A;  5I11 A;  1WYX A;  4J9B A;  2C0O A;  2LNH B;  2OJ2 A;  2JM9 A;  2NWM A;  1TUC A;  1G83 A;  5L23 A;  1VYU A;  1SHG A;  2DL8 A;  1SRM A;  1T0H A;  1QKW A;  1Y57 A;  2DA9 A;  2BZ8 A;  1AWJ A;  2HDA A;  2AZS A;  1TG0 A;  1W70 A;  2ECZ A;  4LUD A;  2DX1 A;  2YSQ A;  2DM1 A;  2FO0 A;  4AG2 C;  2L3Q A;  1X6G A;  2J7I A;  2C0I A;  2L3P A;  2KBT A;  2CUD A;  1V1C A;  2RQT A;  1AZE A;  5IH2 A;  1JO8 A;  4AFS C;  1VYV A;  2DIL A;  2DNU A;  4RTW A;  1SHF A;  3RNJ A;  4RTZ A;  1U5S A;  2L3S A;  4GLM A;  2W10 A;  1UE9 A;  2ED1 A;  4HCK A;  2OAW A;  2HEQ A;  3UA7 A;  1ZSG A;  1BU1 A;  3VS7 A;  1NLO C;  3TSZ A;  1QKX A;  1QLY A;  1OV3 A;  1OEB A;  1T0J A;  1J3T A;  2EYW A;  1XOV A;  2L0A A;  2L2P A;  3KFV A;  2K2M A;  5FWB A;  4JZ3 A;  4D8K A;  2CRE A;  3REB B;  1YP5 A;  2JTE A;  4Z8A A;  4KRT A;  5IXB A;  1M3C A;  1E6G A;  4LE9 A;  2B86 A;  1NEB A;  2J05 A;  5GJV B;  2EPD A;  1QWE A;  4OML A;  2CUB A;  2D0N A;  2RQR A;  1MV3 A;  2YDL A;  2YUN A;  1UHF A;  2O9V A;  2AKK A;  4QT7 A;  2OI3 A;  2JXB A;  4OMQ A;  1K76 A;  2LJ0 A;  3VS5 A;  3M0R A;  1NYG A;  2M51 A;  1PHT A;  2M0Y A;  2AK5 A;  2A28 A;  2ENM A;  2KT8 A;  4IIO A;  1M3B A;  1GFD A;  2KRO A;  2DVJ A;  3VS4 A;  1ZLM A;  1IO6 A;  4ZNX A;  3O5Z A;  3VS3 A;  1AWX A;  2RF0 A;  2EGE A;  3A98 A;  2FG0 A;  4JJB A;  1WX6 A;  1KSW A;  2O31 A;  2CT4 A;  3QWX X;  4FSS A;  4HVV A;  2ROL A;  1ZUU A;  2K79 A;  2KT1 A;  1T3S A;  2AZV A;  2PZ1 A;  1VA7 A;  4RTY A;  1BBZ A;  2A08 A;  1CKA A;  1Y0M A;  2GTO A;  1YCS B;  2YUQ A;  2CH4 A;  3NPF A;  1SRL A;  2XMF A;  1G2B A;  2GTJ A;  3VRZ A;  3EHQ A;  2MIO A;  1YWO A;  1GCQ C;  4CC4 B;  2PTK A;  1GCQ A;  3I35 A;  1GL5 A;  2DRM A;  4OMP A;  5IHI A;  3VS6 A;  2LP5 A;  3M0Q A;  1AVZ C;  2LX7 A;  4OMM A;  2EQI A;  1X69 A;  4X1V A;  4J9D A;  2ROT A;  2K9G A;  1H92 A;  1NG2 A;  4HVU A;  2BZY A;  2GNC A;  1OOT A;  2DL7 A;  2K7A A;  2NUZ A;  2RN8 A;  3QWY A;  2KGT A;  1N5Z A;  1AOJ A;  4Z89 A;  5ECA A;  4M4Z A;  2DL3 A;  2CSQ A;  3SHW A;  2KYB A;  3M0U A;  5FW9 A;  4IIM A;  2C0T A;  4E6R A;  3I5S A;  2EW3 A;  2EVR A;  4RUG A;  1PRM C;  4R0K A;  1WXU A;  1UHC A;  2RPN A;  4CC7 A;  5HCK A;  3NHN A;  2ESW A;  2ABL A;  3EHR A;  3I9Q A;  1X6B A;  2JMC A;  2D8J A;  1JXO A;  1AZG B;  1FYN A;  1M30 A;  2GQI A;  4F17 A;  2FPF A;  3UF4 A;  1QWF A;  3RBB B;  1HSQ A;  1I1J A;  1PNJ A;  2JS2 A;  1B07 A;  3REA B;  4DEX A;  1QCF A;  1GFC A;  2BZX A;  2J6F A;  1UG1 A;  2EYX A;  2MCN A;  2JW4 A;  2O9S A;  2JT4 A;  2GGR A;  2W0Z A;  2CH4 W;  2ED0 A;  2F2V A;  1B3Q A;  1H8K A;  1WXB A;  1PKS A;  1PWT A;  3VS0 A;  1K1Z A;  5IXF A;  4JJC A;  2KRN A;  2DMO A;  1NEG A;  2YUO A;  4K11 A;  1M8M A;  2KRM A;  1FMK A;  2VVK A;  1UJY A;  5IHK A;  1BK2 A;  2KE9 A;  2DYB A;  1OPK A;  2FRY A;  2K6D A;  1A0N B;  1M3A A;  1WA7 A;  2J06 A;  2X3X D;  3FJ5 A;  2DBM A;  1K4U S;  3H0I A;  2EYY A;  2P4R A;  1UTI A;  1RLQ C;  3H41 A;  1BB9 A;  3THK A;  5GJW B;  3UAT A;  1RLP C;  2J6O A;  1TUD A;  1JEG A;  2KR3 A;  2RQU A;  2DLP A;  2DBK A;  4DEY A;  3I5R A;  1UJ0 A;  3JV3 A;  1ZUY A;  4RTX A;  1ABQ A;  4LN2 A;  2BTT A;  1MV0 B;  2CSI A;  4ORZ A;  1HD3 A;  2I0N A;  2G6F X;  1RI9 A;  2LCS A;  4AFQ C;  2JM8 A;  4HVW A;  4AFZ C;  3H0H A;  3EGU A;  3UA6 A;  4OMO A;  2MOX A;  2AKL A;  2EGA A;  3NMZ C;  4J9C A;  2F2X A;  1ABO A;  4J9G A;  4J9E A;  4ESR A;  1CSK A;  1NM7 A;  2F2W A;  2KXC A;  1HJD A;  2YUP A;  2GBQ A;  2D1X A;  1X27 A;  1OPL A;  1AWW A;  2K3B A;  4LNP A;  5EC7 A;  1PRL C;  1UFF A;  1JU5 C;  1YNZ A;  1KFZ A;  1I0C A;  4RTV A;  2DJQ A;  1E7O A;  3LH5 A;  2HSP A;  1WI7 A;  2EBP A;  1AEY A;  2LZ6 B;  1I07 A;  1VYT A;  2VKN A;  1E6H A;  1SSH A;  2RQV A;  1S1N A;  3ULR B;  1WFW A;  1ZUK A;  2O2O A;  1RUW A;  2PNI A;  4AFU C;  3R6N A;  1GBQ A;  5I22 A;  1PKT A;  2DL5 A;  3IQL A;  1WDX A;  2DL4 A;  2O88 A;  1AWO A;  1SEM A;  2LMJ A;  1MUZ A;  1LCK A;  2LQW A;  3TSW A;  2J6K A;  3M0P A;  3GBQ A;  4F14 A;  1X2K A;  3TVT A;  3VRY A;  1K0S A;  2RQW A;  1SPK A;  2FRW A;  2SEM A;  1KJW A;  4CC3 A;  2LQN A;  1JQQ A;  2EYZ A;  1JXM A;  4AG1 C;  3EG0 A;  4JPB W;  4OMN A;  1W6X A;  4A63 B;  3VS1 A;  3M0T A;  5IHN A;  1H3H A;  1GCP A;  2RMO A;  4RTU A;  3EG3 A;  1X43 A;  4HXJ A;  2V1Q A;  2DRK A;  2H8H A;  3VS2 A;  1Z9Z A;  1YWP A;  4J9F A;  4LUE A;  4J9H A;  2YT6 A;  1NYF A;  2IIM A;  2KRS A;  1NLP C;  1UGV A;  2FPE A;  2KYM A;  2DE0 X;  2LJ3 A;  1ZX6 A;  2A36 A;  2D8H A; 
#chains in the Genus database with same CATH topology
 3ZL7 C;  2E10 A;  2HQH A;  1VIE A;  4D8D A;  2WSC E;  3H0F A;  2QDL A;  1D3B A;  3JRZ A;  3CC4 Q;  2X4X A;  3MHX A;  1VQ9 A;  4PL6 A;  2E5K A;  1TUG B;  4KGX B;  2A37 A;  2QQB A;  3EG2 A;  2K57 A;  2RHX A;  1W1F A;  3LH0 A;  3JB9 H;  4Y92 A;  3INZ A;  2NUP A;  2QQR A;  1VQ7 A;  5LJ3 h;  2QXF A;  2KNB B;  2HCK A;  3I55 T;  1C0M A;  4ZGE B;  2F5T X;  3QZ9 B;  2SRC A;  2X3W D;  4F7U A;  4RCB A;  3S6W A;  1ZBJ A;  1NPP A;  3G4S Q;  1YJ9 T;  4C0Z A;  4J83 A;  4X34 A;  1ARK A;  2CDT A;  4PJJ A;  3CMA Q;  4Z88 A;  1CKB A;  3JCM d;  1MHN A;  4L5G A;  1M90 C;  4FU6 A;  4Y91 A;  3PVQ A;  2CZ1 B;  1OX9 A;  5I11 A;  3JCM W;  1G83 A;  2NLU A;  1SHG A;  3HFN A;  3P8B B;  1T0H A;  1QKW A;  2DKG A;  1WJS A;  5CKF A;  2HDA A;  4XU1 A;  2ECZ A;  4LUD A;  2DX1 A;  2VGN A;  2JNG A;  4XU3 A;  2EWN A;  3QZ5 B;  2XKO C;  4R56 A;  1P92 A;  2KMT A;  2OTL A;  2L3P A;  2KBT A;  1N8R C;  5FRM A;  2RQT A;  2COZ A;  1KQ2 A;  3JCM c;  5CAI A;  4AFS C;  2JTM A;  1SHF A;  1TH7 A;  4GLM A;  2W10 A;  2MK5 A;  4XTZ A;  1S72 Q;  5KE3 A;  1BU1 A;  3VS7 A;  3TSZ A;  3QII A;  1QLY A;  1VQN Q;  2EYW A;  1KQS P;  5IT9 E;  3WVE B;  2JTE A;  2EKO A;  1YJN A;  4EMK C;  2GQV A;  4EMK A;  2B86 A;  3KXT A;  1PSF A;  3OS1 A;  2D0N A;  2RQR A;  2YUN A;  2O9V A;  3PT9 A;  3QSU A;  2AKK A;  2JXB A;  3MEW A;  2NUT B;  1FXX A;  4OMQ A;  1G8X A;  2QEX T;  1M5Q 1;  2AK5 A;  1TU0 B;  2L5Q A;  1WHJ A;  2DVE A;  2DXC A;  3VS3 A;  4Y28 E;  3JCM V;  1AWX A;  4M7A B;  4GLK A;  6AT1 B;  2FG0 A;  1TWB A;  2CGH A;  4II1 A;  2PQW A;  2CT4 A;  4HVV A;  2DYI A;  4MML A;  1T3S A;  2AZV A;  3H8Z A;  4A4G A;  1VA7 A;  4RTY A;  1NZ9 A;  4X9D A;  5CVI A;  4M7A E;  2FHD A;  2Z0W A;  5LJ5 g;  2FB7 A;  1YCS B;  3QG1 A;  2AIR B;  1QCN A;  3DLM A;  1YI2 T;  1YIT Q;  1KQS S;  4JJN K;  2MIO A;  2GCX A;  1YWO A;  2F69 A;  3OS0 A;  1GL5 A;  4OMP A;  2JN0 A;  1X75 C;  3M0Q A;  1M1G A;  2CYZ B;  2EQI A;  4X1V A;  4J9D A;  2ROT A;  3SFM A;  1IZ6 A;  2GFU A;  2GNC A;  5GAM d;  2RN8 A;  1ZA2 B;  1VQL Q;  3QDR B;  3RKX A;  1UGP B;  4FL6 A;  2YHT A;  5I21 A;  3CME A;  2JOY A;  2VYT A;  2P0Q A;  5GMK j;  3M0U A;  3BDL A;  4IIM A;  3PMT A;  2RM4 A;  1KK7 A;  4RUG A;  1WXU A;  5HCK A;  1VQK Q;  4GY5 A;  3L2Q A;  4M7A G;  1KG1 A;  1HXD A;  2LCC A;  2FPF A;  3UF4 A;  2R5A A;  1IHV A;  2EQJ A;  2JS2 A;  2AHJ B;  1D1C A;  1PSE A;  5GAO m;  1EX4 A;  1Q82 R;  2RJF A;  2BZX A;  2J6F A;  3NFC A;  3TQ7 P;  1QVF A;  1H8K A;  1PKS A;  3CME T;  1PWT A;  5CKH A;  3CCE A;  5GAN j;  5IXF A;  1NEG A;  2YUO A;  4K11 A;  1M8M A;  4C8Q B;  5FRO A;  3FC3 A;  3CCM T;  1FWZ A;  2PVG B;  3PTA A;  1OI1 A;  2VB6 A;  1M3A A;  4FYV B;  3OYD A;  2J06 A;  2EAY A;  2QA4 A;  4M7A D;  4E47 A;  3H0I A;  2P4R A;  1U1S A;  3H41 A;  4C8Q E;  1VQM T;  3UAT A;  3PIP A;  1X01 A;  2DBK A;  3JV3 A;  4PKC C;  4BY6 B;  2BTT A;  3CBO A;  5GMK l;  3CBM A;  3G6E T;  3M58 A;  1RI9 A;  3QPH A;  3I56 Q;  5LJ5 e;  1Q86 C;  3TCJ A;  1TSF A;  3UA6 A;  1K8A C;  2MOX A;  2AKL A;  1NJI C;  3DLL A;  1QVG S;  5HKC A;  1ABO A;  4M78 E;  3E2U A;  4FYY B;  1KHC A;  4BI3 A;  1W2B P;  3QJY A;  4JLI A;  8ATC B;  2YUP A;  2D1X A;  1EIF A;  1VQO Q;  4F7U G;  2DXU A;  1RL2 A;  2K2V A;  1OUL A;  3EAE A;  4DQ2 A;  1Y71 A;  1K73 C;  4RTV A;  2DJQ A;  3LH5 A;  3CCV A;  2EBP A;  2LDM A;  2YRV A;  4Z02 A;  1AEY A;  4M75 B;  3C12 A;  2FZG B;  3V8L A;  1NJI U;  2VXF A;  4PLI A;  1M2O A;  3CC7 Q;  4DA4 A;  3ULR B;  1UEB A;  1V29 B;  1RUW A;  2P84 A;  4AFU C;  2XK0 A;  5I22 A;  3UDC A;  4PJO B;  1AWO A;  3D7S B;  4M75 E;  4OGE A;  3LGL A;  3V8J A;  1K73 U;  2XHC A;  2ZZD A;  4KGV B;  3BW1 A;  5LJ5 d;  3RKW A;  7AT1 B;  1PG5 B;  3CPW P;  2MYS A;  3TSW A;  3M0P A;  1BI3 A;  2K3X A;  3TVT A;  4BB7 A;  3GIB A;  1K0S A;  3F70 A;  4M77 E;  2RI2 A;  2RQW A;  4C8Q F;  4ZGD B;  3BY7 A;  4M78 G;  4PJO E;  4LXC A;  4CC3 A;  2EYZ A;  4AG1 C;  5C0M A;  5LJ3 g;  3CCJ T;  1W6X A;  3FLG A;  4BAC A;  1NJI R;  1H3H A;  2RMO A;  1VQP Q;  5M9O A;  3G7Z A;  1YWP A;  2DZ9 A;  4J9F A;  4LUE A;  1YIJ T;  4PLL A;  4E7J A;  4J9H A;  2PUO B;  2DTO A;  1W2B S;  2LJ3 A;  2A36 A;  2E4H A;  2D8H A;  4Z8A A;  2BE7 D;  1BI0 A;  1O9S A;  4B9X A;  3C95 A;  3HRU A;  4C92 B;  3CPW A;  1AD5 A;  4OGC A;  1IXD A;  3KUF A;  3CCU Q;  2E3I A;  1B34 A;  4M75 G;  3P8D A;  3CD6 T;  2FPD A;  2Y4Y A;  2O4X B;  1XJW B;  2QAS A;  4O5V A;  2VWF A;  4JZ4 A;  3EH2 A;  4WCI A;  5KYU A;  2E1H A;  1GBR A;  1UUE A;  4M78 D;  4JRQ A;  3VV0 A;  4O6J A;  4ELY C;  1YN8 A;  2JVV A;  1WLP B;  1G5V A;  4M77 G;  4FW1 A;  2XDB A;  1U8R A;  3MCA B;  4DOV A;  2MI6 A;  3M59 A;  4J6W A;  4RTT A;  3NGP A;  5FWC A;  2CP5 A;  3LX7 A;  2DF6 A;  1WXT A;  1Y96 B;  2CKK A;  4ZGJ B;  1VQ6 Q;  2LX9 A;  3OB9 A;  1BIA A;  4DBR A;  2V26 A;  4CC2 A;  3OYK A;  2RNA A;  5KYW B;  3TU4 K;  3CCS A;  5L8R E;  2R5M A;  3OYL A;  3GNG A;  3J80 E;  3A1P A;  3OS5 A;  3VJP A;  4M7A C;  4B9W A;  4M7A A;  3SWN C;  5L23 A;  3P8H A;  4PJO F;  2FZC B;  3EFO A;  1PM3 A;  3JB9 G;  2DL8 A;  1SRM A;  1PD1 A;  3JSC A;  2DA9 A;  4LDW A;  2BZ8 A;  3CC4 T;  1SF9 A;  1VQ5 Q;  5GAO n;  1YHQ A;  4XQ3 A;  3JCM X;  4M77 D;  2JJ9 A;  1WHH A;  2DM1 A;  2FO0 A;  1X6G A;  2J7I A;  4FT4 A;  2C0I A;  2DAQ A;  4RMO A;  1YFN A;  1JO8 A;  3S3M A;  1OYX A;  4KUL A;  2L3S A;  1UE9 A;  4F04 B;  4N4G A;  3UA7 A;  1N27 A;  1W4S A;  2OTJ Q;  1OV3 A;  1OEB A;  3G4S T;  4A4H A;  2XDD A;  3G71 Q;  4ANJ A;  2L0A A;  2PU9 B;  5LJ3 e;  3V7S A;  2K2M A;  2ZAE A;  1FX7 A;  4FYW B;  4LD9 K;  4OMF B;  2CRE A;  4WTO B;  1I8F A;  3CMA T;  3I55 A;  3MO8 A;  4C92 F;  3JB9 D;  4RG8 A;  1M3C A;  1E6G A;  1FMW A;  4LE9 A;  3CCQ A;  1NEB A;  4E7K A;  2IVW A;  4FIB A;  1ZSZ B;  2J05 A;  4E7I A;  1QP3 A;  3V7R A;  4OML A;  2CUB A;  1MV3 A;  3VKI A;  3OYN A;  3OS2 A;  4EPC A;  4QT7 A;  2OI3 A;  2AT1 B;  1KD1 R;  2LJ0 A;  1AT1 B;  4E7S A;  2EQK A;  5GAM g;  2M51 A;  2ENM A;  2DVJ A;  2XU8 A;  2QGF B;  4QVZ A;  1ZLM A;  1IO6 A;  4C0G A;  3O5Z A;  4BI8 B;  2CS7 A;  2DXT A;  3MEA A;  3HFO A;  5KCO A;  4ELZ C;  4FYX B;  3OSS C;  3OYE A;  1WX6 A;  5GMK h;  3V8K A;  4MZT A;  4J8O A;  2JTF A;  2LC4 A;  2K79 A;  2LRQ A;  2DFU A;  2RJE A;  2QGG A;  1VOM A;  2PZ1 A;  1LVK A;  3M5A A;  3L1A A;  3CCQ T;  2R58 A;  4MDW A;  5LJ3 d;  3LWH A;  1BBZ A;  5KYX B;  3TRE A;  4C8Q A;  2RJC A;  2CH4 A;  1SRL A;  4BE0 A;  3O8V A;  1G2B A;  5A2Q E;  1M2V B;  2L8D A;  4CC4 B;  1GCQ C;  3QHS A;  5I2M A;  1GCQ A;  3I35 A;  5IHI A;  3VS6 A;  3EFR A;  3CCL Q;  1JRI A;  1I5O B;  1AVZ C;  4OMM A;  1X69 A;  4P5N A;  4LDV A;  1H92 A;  2A7Y A;  2NUZ A;  2KGT A;  1N5Z A;  5GAN h;  1AOJ A;  4Z89 A;  3OYH A;  4M78 C;  2DL3 A;  3JCM b;  4M78 A;  1JBM A;  4BI4 A;  2EFI A;  3L2W A;  3QBY A;  3I5S A;  3RR6 A;  2QEX A;  5GMK m;  2DET A;  3CCR A;  2LCL A;  3T9N A;  3NHN A;  2EJF A;  2ESW A;  5KE2 A;  2ABL A;  5DLQ E;  2JMC A;  1D0X A;  1AZG B;  1FYN A;  3MP8 A;  4F17 A;  5HY6 A;  3RBB B;  2E6N A;  1I1J A;  4YTL A;  1UGR B;  3REA B;  4BD3 A;  2QQ9 A;  4DEX A;  1QCF A;  3A8O B;  1RI0 A;  2JW4 A;  1LOJ A;  3EFS A;  1XTD A;  1YJ9 Q;  2MPX C;  4M75 A;  1YJW Q;  2F2V A;  3RMQ A;  1B3Q A;  1WXB A;  4QQG A;  2DIG A;  4BE1 A;  1K1Z A;  1M8V A;  4M7D B;  2DMO A;  1YI2 A;  5FU6 B;  4M77 C;  5A0G A;  1FMK A;  2VVK A;  4M77 A;  5GAM e;  4IUU A;  1UJY A;  3LYI A;  3CCR T;  4PJO A;  4BDY A;  5FU7 C;  2FRY A;  1VQ9 Q;  2YWW A;  2QQS A;  1A0N B;  3NTI A;  2HL3 A;  5KYY A;  1KQ1 A;  1KQS A;  2X3X D;  2QAZ A;  4KH0 B;  4HKE A;  2DBM A;  5GAN 2;  2HQX A;  4M7D E;  3OBY A;  1UTI A;  1RLQ C;  3THK A;  1VQK T;  3LGF A;  3M9Q A;  2J6O A;  3LW5 E;  1JJ2 P;  1VQ7 Q;  5J39 A;  2X4W A;  1JEG A;  2DLP A;  2F1L A;  3I5R A;  4PFO A;  2CSI A;  4ORZ A;  2QQA A;  3ME9 A;  1QW1 A;  2YLC A;  1MND A;  1Q82 C;  2G6F X;  2LCS A;  4KUD K;  3EGU A;  4DBQ A;  1YBY A;  2EGA A;  3NMZ C;  4ATO A;  2H3E B;  4J9E A;  4ESR A;  3VU3 C;  1SSF A;  2EIF A;  2F2W A;  2K5F A;  3RUX A;  5CK9 A;  1HJD A;  4C0D B;  3A8H B;  1OPL A;  1AWW A;  1Q82 U;  1KFZ A;  2O4X A;  5D6X A;  1QQJ A;  4KUI A;  1E7O A;  3CBP A;  3H9N A;  1VYT A;  2VKN A;  2OTL Q;  4FM4 B;  3OYB A;  1E6H A;  4LDU A;  3CCM A;  1WFW A;  1ZUK A;  2HKN A;  4UC4 A;  1ZBX A;  5AT1 B;  3QO3 A;  1BKB A;  3JCM P;  2EYQ A;  1PKT A;  1Y96 A;  3M4G A;  4EDU A;  1G3T A;  2DL5 A;  1WDX A;  3IQL A;  3RMS A;  1SEM A;  2DEU A;  1LCK A;  1VQM A;  2LQW A;  3CC2 T;  1D1A A;  1QVG P;  1JJ2 S;  1ZQ1 A;  5GAN 3;  1HYO A;  5KYW A;  4F14 A;  1BCM A;  4M7D F;  3E9F A;  3JCM f;  5IAY A;  1YJN Q;  2PVD B;  1KJW A;  4A4F A;  2LQN A;  1JQQ A;  4JPB W;  3G6E A;  1WZO A;  4C5I A;  2RI3 A;  3M0T A;  5IHN A;  4L6V 5;  3EG3 A;  1X43 A;  4HA8 A;  2H8H A;  2IPO B;  4JDS A;  3DKM A;  1UB4 A;  3N5B B;  1Q95 G;  2DJZ A;  2A0F B;  2KYM A;  3CXC P;  1Q81 R;  3EH1 A;  2YRD A;  4QQD A;  1EZZ B;  1QVG A;  3PE0 A;  3PVL A;  3EG1 A;  2O01 E;  3OMC A;  1I5L A;  1N9R A;  3OYJ A;  1VQ4 A;  2RH2 A;  1UEC A;  1QP2 A;  3HTR A;  2FYK A;  3C94 A;  2L89 A;  2JS0 A;  1IRE B;  1GXI E;  4XTW A;  1K9A A;  1T3L A;  3NTK A;  1VQ8 A;  1FMV A;  4XTU A;  2LJ1 A;  1KIK A;  4ZN3 A;  1X6O A;  2CT3 A;  3SEM A;  5CR2 A;  1ZSZ A;  4HCC A;  3DB4 A;  2R57 A;  3CQT A;  1K9M U;  4QVD A;  1UDL A;  1YCY A;  1BI1 A;  4LD6 A;  1IGU A;  1GRI A;  1K0X A;  2XID A;  4WF2 A;  5CKB A;  1VIF A;  5DM7 R;  4F16 A;  2HBW A;  2HZY A;  1H3Z A;  2DXB A;  3CCJ A;  1VQ4 T;  4J9B A;  2LNH B;  3L2Z A;  2JM9 A;  1TUC A;  3CME Q;  4C8Q G;  4KT0 E;  5CKE A;  1WHL A;  5KH6 A;  1YIJ A;  1Y57 A;  3OY9 A;  1NPR A;  3CXC S;  2LQ8 A;  2E64 A;  1VQ8 T;  1W70 A;  2IG0 A;  4EMK B;  2YSQ A;  1K9M R;  2M02 A;  1N6A A;  2CUD A;  1SG5 A;  2DD4 A;  1W2B A;  2B8A A;  5IH2 A;  5GAO q;  5D6Y A;  2DIL A;  4XAX B;  2DNU A;  2K5I A;  1F1B B;  5I2S A;  4LDX A;  2MWO A;  4RTW A;  2VC8 A;  3CD6 A;  3LLR A;  4RTZ A;  1U5S A;  1M2V A;  4QKU A;  4HCK A;  3VYH B;  2OAW A;  2HEQ A;  4LDY A;  4ZTJ A;  1QKX A;  3AT1 B;  2KVQ G;  1T0J A;  3S3O A;  1J3T A;  2DZC A;  1XOV A;  3OW2 P;  5FWB A;  4JZ3 A;  3REB B;  1I81 A;  2E70 A;  4KRT A;  4C8Q D;  3CCE Q;  1WQ7 A;  2E41 A;  1V76 A;  5IXB A;  5GAN 7;  3DB3 A;  3HKS A;  5GAM f;  4ZN1 A;  1C1A A;  1BYM A;  4IUT A;  5GJV B;  2EPD A;  1QWE A;  1RAH B;  3QDF A;  4VUB A;  2YDL A;  1UHF A;  1MMA A;  2DER A;  2QA4 Q;  4BDZ A;  4A54 A;  4N4H A;  1K76 A;  3VS5 A;  3M0R A;  3HP9 A;  3PMI A;  2M9U A;  2M0Y A;  2A28 A;  2E5Q A;  2KT8 A;  1M3B A;  4NOY A;  2KRO A;  3E9G A;  3VS4 A;  3A8M B;  3M56 A;  4IUQ A;  2VUB A;  1LPL A;  2RF0 A;  2EGE A;  5GAN g;  1AHJ B;  3CC4 A;  4C92 E;  3A5Z B;  4A4K A;  1MMD A;  4MZP A;  1KSW A;  2O31 A;  3QWX X;  4PJO G;  2WSE E;  5DLO A;  2ROL A;  1ZUU A;  1XQH A;  2RB6 A;  2ZPE B;  1RAG B;  1IRX A;  2L3R A;  2LT1 A;  2RHU A;  1Q7Y C;  3EGD B;  2OTJ T;  3G71 T;  1RAD B;  4BE2 A;  4M7D A;  2DEQ A;  2I2L A;  2NUT A;  4JRK A;  4R55 A;  2CZ6 B;  3OYY A;  3RES A;  2G3R A;  2YUQ A;  2HKQ B;  1QCO A;  1UGS B;  4DBF A;  2RK1 A;  1BCO A;  3G4S A;  3OW2 S;  3EHQ A;  2DRM A;  1RAE B;  1D0Y A;  3M4Y A;  4M75 D;  2DK3 A;  1M1F A;  2LP5 A;  3GNF B;  5GAO l;  4XK8 E;  1Q7Y U;  3CMA A;  1KD1 C;  3CCV Q;  2RA2 A;  3ZFJ A;  4HVU A;  2BZY A;  2DL7 A;  2E12 A;  2GFA A;  1M1K C;  1N9S A;  1R8O B;  4BUG A;  4PJO D;  2YLB A;  4C92 G;  3EG9 B;  3MP1 A;  1QVP A;  2XD0 A;  2CSQ A;  3E1S A;  3SHW A;  5FW9 A;  1KHI A;  2KY9 A;  3GLX A;  2CP3 A;  4E6R A;  3OMG A;  1OZ2 A;  2EW3 A;  2EVR A;  1KD1 U;  2QTX A;  3MEV A;  3RKY A;  2KQW A;  3I9Q A;  3PNW C;  2D8J A;  3HHT B;  2CP6 A;  1M1K U;  4PFP A;  1B7T A;  2GQI A;  1OZ3 A;  4JS5 A;  3MPU B;  4ZTF A;  1Q7Y R;  4C0F A;  4PFZ A;  3MKD A;  1HSQ A;  2EQU A;  4PK4 A;  1PNJ A;  1WQW A;  1B07 A;  2DD5 A;  1S72 A;  2EYX A;  2MCN A;  2D6F A;  3BDU A;  4RKU E;  2GGR A;  1VQN A;  2XDP A;  2HBP A;  3CCL T;  1WJQ A;  4FW2 A;  4EMG A;  4C92 D;  3SDZ A;  2KRN A;  4OB2 B;  2VXE A;  2KE9 A;  2XI9 A;  2DYB A;  1OPK A;  3BE3 A;  3EGX B;  2K6D A;  1M1K R;  3HSB A;  3HPW A;  2P4T A;  1K4U S;  4XTV A;  4FSX A;  2EYY A;  5GAN e;  2BIV A;  1R0B G;  4JUV A;  5LJ5 j;  4N4I A;  5FRN A;  5LJ5 f;  4PJL A;  1TUD A;  2QYZ A;  2Y4X A;  2RQU A;  1S72 T;  1SKU B;  2ZPI B;  2RHI A;  1UJ0 A;  2X51 A;  1ABQ A;  4OB0 B;  1MV0 B;  2FL7 A;  1VQN T;  2EQM A;  1ZA1 B;  4C8Q C;  3LWI A;  1XNI A;  4AFQ C;  2JM8 A;  4AFZ C;  2BE9 B;  4PJM A;  4MDX A;  4OMO A;  4EMH A;  5HK0 A;  3CCS Q;  4E7L A;  3JCM h;  1YJW T;  4A4E A;  3CPF A;  3TEE A;  4QQ6 A;  5FLX E;  4KBM B;  5DY9 A;  2GBQ A;  1X27 A;  1YIT A;  4DOW A;  3OYA A;  2K3B A;  5EC7 A;  3VUZ A;  1YNZ A;  2HQE A;  4BY6 C;  2LTO A;  1YHQ Q;  1VQ9 T;  2HSP A;  2COW A;  1WI7 A;  3FDR A;  2LZ6 B;  4XTX A;  1MMG A;  4JS4 A;  3GOX A;  4JLG A;  5GAN d;  3CEY A;  4J6Y A;  1M4Z A;  4OF1 A;  2VAS A;  1DJ7 B;  2O2O A;  1VQL A;  4E7Z A;  2PNI A;  3QUI A;  2V8K A;  1Y07 A;  1VQ7 T;  3JB9 J;  2VV5 A;  2V8J A;  1GBQ A;  1M90 U;  3OA6 A;  1D09 B;  3BFM A;  2LMJ A;  2EJ9 A;  1MUZ A;  1C6V X;  1VQK A;  3PIO A;  2BKD N;  3VUB A;  2J6K A;  1X2K A;  3I55 Q;  1RAB B;  2OX7 A;  1LJO A;  1JB0 E;  4KGZ B;  1YIT T;  1B34 B;  2SEM A;  4M75 C;  1PCX A;  3KBG A;  1QMC A;  3CCQ Q;  3EG0 A;  4OMN A;  4XU2 A;  2HD0 A;  5KYU B;  4OB1 B;  1N8R U;  3FIF A;  3MET A;  1GCP A;  5KYN A;  2M0O A;  5C6S A;  4HXJ A;  4IUP A;  3VS2 A;  2QDY B;  2HAX A;  1VQL T;  2YT6 A;  4PJO C;  1NYF A;  2IIM A;  3UWN A;  1M90 R;  2FPE A;  1RAA B;  2D9T A;  2DE0 X;  2A3L A;  1ZX6 A;  2OTL T;  4QVC A;  2DPP B;  2V8I A;  1UGQ B;  3Q1J A;  3HL8 A;  4EIK A;  2M1H A;  3X26 B;  3C4S A;  4J9I A;  4E7H A;  2HSE B;  8AT1 B;  3FEO A;  2V1R A;  4KH1 B;  2P0K A;  1X2Q A;  1Z9Q A;  4V2S A;  4HT8 A;  4HT9 A;  5A0L A;  4A53 A;  2RD1 A;  3PGG A;  2DO3 A;  3SWN B;  1BIB A;  1N8R R;  3EFO B;  5CKD A;  5J3B A;  4PJN A;  2EGC A;  3H6Z A;  3M0S A;  2KXD A;  1YJN T;  2DTI A;  3UPU A;  1EFN A;  3C0C A;  3JCM J;  2DIQ A;  2WSF E;  3V7C A;  3A8L B;  2EKH A;  3FJP A;  2JZ2 A;  1WIE A;  1M27 C;  1TTH B;  3CC2 A;  2FEI A;  1U3O A;  2ZGW A;  4C92 C;  1TOV A;  4C92 A;  3I56 A;  3SD4 A;  4GBQ A;  2H3J A;  3U23 A;  4AMC A;  1WHM A;  2F5K A;  4IUV A;  1U06 A;  4JJD A;  2KEA A;  2JMA A;  2MAM A;  1JJ2 A;  3SB2 A;  3QKJ A;  1G3W A;  1Q81 C;  3R6O A;  1WYX A;  2KDS A;  2C0O A;  4RG2 A;  2OJ2 A;  2OAU A;  4CI0 C;  3JB9 I;  2NWM A;  5GAM h;  3ER0 A;  4M7D G;  1VYU A;  1VQO A;  2YRC A;  3X28 B;  4HCB A;  2QEX Q;  1AWJ A;  2AZS A;  1TG0 A;  3CCR Q;  3EGD A;  4AG2 C;  2L3Q A;  1Q81 U;  5LJ3 j;  1QVF P;  1V1C A;  1AZE A;  2DTH A;  3CC7 A;  5LJ3 f;  4CRI A;  1VYV A;  3I56 T;  1LNX A;  2LT4 A;  3RNJ A;  4TVR A;  1D3B B;  1NE8 A;  5CCA A;  2ED1 A;  3L2U A;  1RAC B;  1ZSG A;  2HNI A;  4JRI A;  1PC0 A;  3MEU A;  1NLO C;  4ME7 A;  2K3Y A;  4AT1 B;  1VUB A;  3FB9 A;  5J26 A;  2L2P A;  1OQK A;  3KFV A;  2CP2 A;  4D8K A;  4M7D D;  1YP5 A;  3AHU A;  1VQO T;  2NUP B;  1YI2 Q;  3QYH B;  3L42 A;  4DBH A;  3EG9 A;  4F7U B;  1HK9 A;  1WHK A;  1VQP A;  2EJG A;  3HRS A;  3CC7 T;  1G3Y A;  1MMN A;  4M7A F;  1MNE A;  5GAN f;  3PFS A;  1NYG A;  1PHT A;  3OSV A;  1K9M C;  1WJR A;  2XG8 D;  4IIO A;  1GFD A;  4F7U E;  3MP6 A;  1RAI B;  4ZNX A;  4IKF A;  3L2R A;  3A98 A;  3CCU A;  4JJB A;  2E65 A;  4E2F B;  3G1J A;  4FSS A;  2QI2 A;  1ZSZ C;  4JRP A;  1QVF S;  2KT1 A;  3J81 E;  2BUD A;  3CXC A;  3M54 A;  5D6W A;  4FT2 A;  1WNL A;  4M78 B;  2A08 A;  1CKA A;  1Y0M A;  1Y7X A;  2P0P A;  3CC2 Q;  4OVA A;  5CO7 A;  5GAN 5;  3OYM A;  5GAN 4;  2X35 A;  1VQP T;  2GTO A;  3CCE T;  1RAF B;  4MZM A;  2LQK A;  3NPF A;  2ZCF B;  2XMF A;  3EGX A;  2GTJ A;  3VRZ A;  1VQ6 A;  1I4K 1;  2X9H A;  2PTK A;  4J7I A;  5CIU A;  2LX7 A;  5D7U A;  2NYS A;  2CZ7 B;  3OYF A;  2RK2 A;  2K9G A;  2QA4 T;  5EG2 A;  1NG2 A;  3CCU T;  1OOT A;  2K7A A;  3QWY A;  3CCM Q;  1Q86 U;  3RDV A;  2HMA A;  1ZHI A;  3M53 A;  5ECA A;  4M4Z A;  5KYX A;  1K8A U;  2VGM A;  2PVO B;  2KYB A;  3RIR A;  2C0T A;  2K5L A;  3URG A;  3S3N A;  3ZEH A;  1VQ5 A;  1PRM C;  4R0K A;  1VQM Q;  2MMP A;  1UHC A;  2RPN A;  4CC7 A;  3NTH A;  2MF2 A;  2KI7 A;  5IN1 A;  2CP0 A;  3EHR A;  4M77 B;  3E19 A;  1X6B A;  3M55 A;  2M16 A;  5LJ5 h;  2FVU A;  1JXO A;  3WXM B;  4RCC A;  1IGQ A;  3J7A F;  5FU7 B;  1TXQ A;  2RO0 A;  3GPL A;  1M30 A;  1VQ6 T;  1TS9 A;  2RHY A;  4F7U F;  5KYY B;  3X24 B;  1QWF A;  4B6M A;  3G6E Q;  3OBW A;  1U1T A;  3GF5 A;  1IHW A;  2ZPG B;  1OX8 A;  4MMK A;  5GAM j;  1GFC A;  1UG1 A;  1NBE B;  1Q86 R;  4IUR A;  2OTJ A;  2LVM A;  2JT4 A;  2O9S A;  3JCM Q;  3G71 A;  2W0Z A;  1H64 1;  4XU0 A;  2CH4 W;  3OYG A;  4D6W A;  1M9S A;  1WGS A;  2ZPF B;  2JUF A;  1K8A R;  2ED0 A;  5AYF A;  3CCV T;  3VS0 A;  3QXE B;  4JJC A;  3JAM E;  3JCM g;  2LNV A;  2KRM A;  2QK0 A;  1VQ5 T;  5GAN 6;  5GAO r;  5IHK A;  1BK2 A;  4C5E A;  2QG9 B;  2COY A;  1VQ4 Q;  2FZK B;  2ATC B;  2GF7 A;  5GMK i;  3M57 A;  3OQ5 A;  3OW2 A;  1WA7 A;  3UT1 A;  1K73 R;  3FJ5 A;  4J5Y A;  4M78 F;  3MJX A;  2E3H A;  5CQX A;  3VYG A;  1BB9 A;  5GJW B;  1VQ8 Q;  4QW2 A;  1RLP C;  4N0A C;  4N0A A;  2KR3 A;  2KSS A;  3OYI A;  4DEY A;  2PUK B;  1ZUY A;  4RTX A;  4LN2 A;  1D1B A;  4C5G A;  2D0Q B;  1HD3 A;  4M7D C;  2WAC A;  1G3S A;  2I0N A;  2XIC A;  5FU6 C;  2KK4 A;  1OU9 A;  4HVW A;  3H0H A;  1R77 A;  1ACM B;  2CP7 A;  4J9C A;  4X9C A;  2F2X A;  9ATC B;  3CCJ Q;  2X4Y A;  4J9G A;  1R0C B;  3CPW S;  2E6Z A;  1CSK A;  1NM7 A;  2QTV A;  1KC8 C;  2K4Y A;  3L2V A;  2KXC A;  4M75 F;  1O75 A;  1OU8 A;  2X4J A;  4LNP A;  1YIJ Q;  1PRL C;  1UFF A;  5GAN 8;  4HCZ A;  1JU5 C;  3RER A;  2CZ0 B;  2RI5 A;  1I0C A;  3CCL A;  4OP0 A;  5CQY A;  4M77 F;  5GAO p;  3FRN A;  1I07 A;  4NL2 A;  3SWN A;  4J7F A;  1SSH A;  2RQV A;  1S1N A;  2MWP A;  3OYC A;  1KC8 U;  2HL5 C;  5A0D A;  4L59 A;  3R6N A;  3CD6 Q;  1PD0 A;  4FCY A;  3X25 B;  2DL4 A;  4NS5 A;  2O88 A;  2KAF A;  3A8G B;  3WVD B;  2YXY A;  4C0D C;  5GMK e;  2RJD A;  3ASK A;  4OB3 B;  1WPY A;  5HK3 A;  3QYG B;  3GBQ A;  3HRT A;  3VRY A;  2Y90 A;  5KCH A;  1SPK A;  1WHG A;  5LL6 S;  4PNO A;  2FRW A;  3JB9 F;  1BI2 A;  2RHZ A;  3CCS T;  1JXM A;  4J6X A;  4Q5W A;  1IB8 A;  4A63 B;  1MGQ A;  3VS1 A;  4C5H A;  2C06 A;  4RTU A;  3GP8 A;  3ZBD A;  1KC8 R;  2V1Q A;  3X20 B;  2DRK A;  3JCM e;  1Z9Z A;  2ZPH B;  1YJ9 A;  1YJW A;  2KRS A;  4NL3 A;  1NLP C;  1UGV A;  1YHQ T;  1D0Z A;  4XTY A;  3QJ6 A;  2ZPB B; 
#chains in the Genus database with same CATH homology
 3ZL7 C;  3PE0 A;  3PVL A;  3EG1 A;  4D8D A;  1AD5 A;  2QDL A;  3H0F A;  4EIK A;  4J9I A;  2E5K A;  1UEC A;  2FPD A;  2VWF A;  4JZ4 A;  2V1R A;  1X2Q A;  1Z9Q A;  4WCI A;  2A37 A;  1GBR A;  1UUE A;  2JS0 A;  3EG2 A;  1K9A A;  1T3L A;  1W1F A;  1YN8 A;  4Y92 A;  1WLP B;  2LJ1 A;  1KIK A;  2KNB B;  2HCK A;  2CT3 A;  2EGC A;  3M0S A;  3SEM A;  4RTT A;  2KXD A;  2SRC A;  2X3W D;  1EFN A;  3C0C A;  3NGP A;  5FWC A;  1ZBJ A;  3CQT A;  2DF6 A;  1WXT A;  2EKH A;  1UDL A;  1WIE A;  1M27 C;  2FEI A;  1U3O A;  1GRI A;  1ARK A;  2CDT A;  4GBQ A;  1K0X A;  3U23 A;  4Z88 A;  4JJD A;  1U06 A;  2KEA A;  1CKB A;  4CC2 A;  2JMA A;  2RNA A;  4F16 A;  2HBW A;  3PVQ A;  5I11 A;  1WYX A;  4J9B A;  2C0O A;  2LNH B;  2OJ2 A;  2JM9 A;  2NWM A;  1TUC A;  1G83 A;  5L23 A;  1VYU A;  1SHG A;  2DL8 A;  1SRM A;  1T0H A;  1QKW A;  1Y57 A;  2DA9 A;  2BZ8 A;  1AWJ A;  2HDA A;  2AZS A;  1TG0 A;  1W70 A;  2ECZ A;  4LUD A;  2DX1 A;  2YSQ A;  2DM1 A;  2FO0 A;  4AG2 C;  2L3Q A;  1X6G A;  2J7I A;  2C0I A;  2L3P A;  2KBT A;  2CUD A;  1V1C A;  2RQT A;  1AZE A;  5IH2 A;  1JO8 A;  4AFS C;  1VYV A;  2DIL A;  2DNU A;  4RTW A;  1SHF A;  3RNJ A;  4RTZ A;  1U5S A;  2L3S A;  4GLM A;  2W10 A;  1UE9 A;  2ED1 A;  4HCK A;  2OAW A;  2HEQ A;  3UA7 A;  1ZSG A;  1BU1 A;  3VS7 A;  1NLO C;  3TSZ A;  1QKX A;  1QLY A;  1OV3 A;  1OEB A;  1T0J A;  1J3T A;  2EYW A;  1XOV A;  2L0A A;  2L2P A;  3KFV A;  2K2M A;  5FWB A;  4JZ3 A;  4D8K A;  2CRE A;  3REB B;  1YP5 A;  2JTE A;  4Z8A A;  4KRT A;  5IXB A;  1M3C A;  1E6G A;  4LE9 A;  2B86 A;  1NEB A;  2J05 A;  5GJV B;  2EPD A;  1QWE A;  4OML A;  2CUB A;  2D0N A;  2RQR A;  1MV3 A;  2YDL A;  2YUN A;  1UHF A;  2O9V A;  2AKK A;  4QT7 A;  2OI3 A;  2JXB A;  4OMQ A;  1K76 A;  2LJ0 A;  3VS5 A;  3M0R A;  1NYG A;  2M51 A;  1PHT A;  2M0Y A;  2AK5 A;  2A28 A;  2ENM A;  2KT8 A;  4IIO A;  1M3B A;  1GFD A;  2KRO A;  2DVJ A;  3VS4 A;  1ZLM A;  1IO6 A;  4ZNX A;  3O5Z A;  3VS3 A;  1AWX A;  2RF0 A;  2EGE A;  3A98 A;  2FG0 A;  4JJB A;  1WX6 A;  1KSW A;  2O31 A;  2CT4 A;  3QWX X;  4FSS A;  4HVV A;  2ROL A;  1ZUU A;  2K79 A;  2KT1 A;  1T3S A;  2AZV A;  2PZ1 A;  1VA7 A;  4RTY A;  1BBZ A;  2A08 A;  1CKA A;  1Y0M A;  2GTO A;  1YCS B;  2YUQ A;  2CH4 A;  3NPF A;  1SRL A;  2XMF A;  1G2B A;  2GTJ A;  3VRZ A;  3EHQ A;  2MIO A;  1YWO A;  1GCQ C;  4CC4 B;  2PTK A;  1GCQ A;  3I35 A;  1GL5 A;  2DRM A;  4OMP A;  5IHI A;  3VS6 A;  2LP5 A;  3M0Q A;  1AVZ C;  2LX7 A;  4OMM A;  2EQI A;  1X69 A;  4X1V A;  4J9D A;  2ROT A;  2K9G A;  1H92 A;  1NG2 A;  4HVU A;  2BZY A;  2GNC A;  1OOT A;  2DL7 A;  2K7A A;  2NUZ A;  2RN8 A;  3QWY A;  2KGT A;  1N5Z A;  1AOJ A;  4Z89 A;  5ECA A;  4M4Z A;  2DL3 A;  2CSQ A;  3SHW A;  2KYB A;  3M0U A;  5FW9 A;  4IIM A;  2C0T A;  4E6R A;  3I5S A;  2EW3 A;  2EVR A;  4RUG A;  1PRM C;  4R0K A;  1WXU A;  1UHC A;  2RPN A;  4CC7 A;  5HCK A;  3NHN A;  2ESW A;  2ABL A;  3EHR A;  3I9Q A;  1X6B A;  2JMC A;  2D8J A;  1JXO A;  1AZG B;  1FYN A;  1M30 A;  2GQI A;  4F17 A;  2FPF A;  3UF4 A;  1QWF A;  3RBB B;  1HSQ A;  1I1J A;  1PNJ A;  2JS2 A;  1B07 A;  3REA B;  4DEX A;  1QCF A;  1GFC A;  2BZX A;  2J6F A;  1UG1 A;  2EYX A;  2MCN A;  2JW4 A;  2O9S A;  2JT4 A;  2GGR A;  2W0Z A;  2CH4 W;  2ED0 A;  2F2V A;  1B3Q A;  1H8K A;  1WXB A;  1PKS A;  1PWT A;  3VS0 A;  1K1Z A;  5IXF A;  4JJC A;  2KRN A;  2DMO A;  1NEG A;  2YUO A;  4K11 A;  1M8M A;  2KRM A;  1FMK A;  2VVK A;  1UJY A;  5IHK A;  1BK2 A;  2KE9 A;  2DYB A;  1OPK A;  2FRY A;  2K6D A;  1A0N B;  1M3A A;  1WA7 A;  2J06 A;  2X3X D;  3FJ5 A;  2DBM A;  1K4U S;  3H0I A;  2EYY A;  2P4R A;  1UTI A;  1RLQ C;  3H41 A;  1BB9 A;  3THK A;  5GJW B;  3UAT A;  1RLP C;  2J6O A;  1TUD A;  1JEG A;  2KR3 A;  2RQU A;  2DLP A;  2DBK A;  4DEY A;  3I5R A;  1UJ0 A;  3JV3 A;  1ZUY A;  4RTX A;  1ABQ A;  4LN2 A;  2BTT A;  1MV0 B;  2CSI A;  4ORZ A;  1HD3 A;  2I0N A;  2G6F X;  1RI9 A;  2LCS A;  4AFQ C;  2JM8 A;  4HVW A;  4AFZ C;  3H0H A;  3EGU A;  3UA6 A;  4OMO A;  2MOX A;  2AKL A;  2EGA A;  3NMZ C;  4J9C A;  2F2X A;  1ABO A;  4J9G A;  4J9E A;  4ESR A;  1CSK A;  1NM7 A;  2F2W A;  2KXC A;  1HJD A;  2YUP A;  2GBQ A;  2D1X A;  1X27 A;  1OPL A;  1AWW A;  2K3B A;  4LNP A;  5EC7 A;  1PRL C;  1UFF A;  1JU5 C;  1YNZ A;  1KFZ A;  1I0C A;  4RTV A;  2DJQ A;  1E7O A;  3LH5 A;  2HSP A;  1WI7 A;  2EBP A;  1AEY A;  2LZ6 B;  1I07 A;  1VYT A;  2VKN A;  1E6H A;  1SSH A;  2RQV A;  1S1N A;  3ULR B;  1WFW A;  1ZUK A;  2O2O A;  1RUW A;  2PNI A;  4AFU C;  3R6N A;  1GBQ A;  5I22 A;  1PKT A;  2DL5 A;  3IQL A;  1WDX A;  2DL4 A;  2O88 A;  1AWO A;  1SEM A;  2LMJ A;  1MUZ A;  1LCK A;  2LQW A;  3TSW A;  2J6K A;  3M0P A;  3GBQ A;  4F14 A;  1X2K A;  3TVT A;  3VRY A;  1K0S A;  2RQW A;  1SPK A;  2FRW A;  2SEM A;  1KJW A;  4CC3 A;  2LQN A;  1JQQ A;  2EYZ A;  1JXM A;  4AG1 C;  3EG0 A;  4JPB W;  4OMN A;  1W6X A;  4A63 B;  3VS1 A;  3M0T A;  5IHN A;  1H3H A;  1GCP A;  2RMO A;  4RTU A;  3EG3 A;  1X43 A;  4HXJ A;  2V1Q A;  2DRK A;  2H8H A;  3VS2 A;  1Z9Z A;  1YWP A;  4J9F A;  4LUE A;  4J9H A;  2YT6 A;  1NYF A;  2IIM A;  2KRS A;  1NLP C;  1UGV A;  2FPE A;  2KYM A;  2DE0 X;  2LJ3 A;  1ZX6 A;  2A36 A;  2D8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...