5C0MA

Crystal structure of sgf29 tandem tudor domain in complex with a carba containing peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
174
Chain Sequence
b'GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 29 homolog
molecule tags Transcription
source organism Homo sapiens
publication title Chemical basis for the recognition of trimethyllysine by epigenetic reader proteins.
pubmed doi rcsb
total genus 39
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5c0mA02
2RJFA 2M0OA 3MP6A 2E5QA 4IURA 4IUTA 2B8AA 4IUVA 3LYIA 4L59A 1RI0A 2EQJA 4C5HA 4QW2A 3L42A 4PL6A 5KE3A 5CIUA 5J26A 3OYFA 2YRVA 5IN1A 3OYKA 4E7JA 4Z02A 2GFUA 3OS2A 2XK0A 2K3XA 2MWPA 2BIVA 3DB4A 4E7IA 3NTKA 3MP1A 4FL6A 3QIIA 4QVZA 3QBYA 3L2RA 3OS0A 3OB9A 3S3OA 2R5MA 5KCOA 4IKFA 3DB3A 2O4XB 2HQXA 3EAEA 3NTIA 4IUPA 4BDZA 3L2WA 1H3ZA 2PQWA 4OVAA 3GOXA 3OYBA 4BE1A 4ZTFA 2D9TA 2RI2A 1WJQA 4QQGA 3SD4A 4QQ6A 2E6NA 3L2VA 2X4YA 4FU6A 2LCCA 2EKOA 4NS5A 3FC3A 3OYEA 2L8DA 4E7LA 3FLGA 3LX7A 2L89A 2X4WA 2EQKA 2GF7A 1WJRA 2QQSA 3KUFA 1KHCA 5KH6A 3S3MA 1WJSA 2RJCA 4N4GA 2M1HA 2RHUA 4N4IA 1OZ3A 3OS1A 2GFAA 2O4XA 2RHYA 3OYNA 3FEOA 3OYCA 1MHNA 2QQRA 2VYTA 2CKKA 3BDLA 3CEYA 3F70A 3DLMA 4Q5WA 4A4EA 2K3YA 2RJEA 4A4FA 2XDPA 4IUUA 3S6WA 4C5IA 4PLIA 3MO8A 1G5VA 4CRIA 2RHXA 4X34A 2DIGA 2LRQA 3FDRA 3QKJA 5D6WA 4B9WA 2IG0A 3E9GA 3LH0A 2DIQA 5C0MA 5M9OA 3OYDA 2LTOA 3OMCA 4GY5A 4UC4A 3MP8A 2LDMA 2RHIA 1OZ2A 3NTHA 2R57A 2HQEA 2EQUA 4EDUA 5IAYA 2NLUA 4BDYA 4E7HA 3OYMA 2P0KA 3L2QA 3PMIA 3MEVA 2DAQA 2JZ2A 3OQ5A 2RI3A 3ASKA 4ZTJA 3UT1A 2RHZA 2X35A 3UWNA 4A4HA 5KE2A 5FRNA 3OYIA 1OI1A 4BE0A 3OYLA 3LGLA 3Q1JA 3OYHA 3LGFA 3LLRA 4RG2A 3OA6A 4B9XA 4II1A 4BD3A 2RI5A 1OYXA 3P8DA 5FROA 4BACA 2BKDN 5KCHA 3PMTA 2WACA 2BUDA 4C5EA 2MWOA 2X4XA 5FRMA 4IUQA 5C6SA 1WGSA 5J39A 2LVMA 3ZEHA 4PLLA 1XNIA 3P8HA 4BE2A 2F5KA 2RO0A 4N4HA 3OY9A 1SSFA 3OYJA 2M16A 2RJDA 3O8VA 4QQDA 3E9FA 3PNWC 3H8ZA 3OMGA 3MEWA 3M9QA 3QJ6A 3OYAA 3S3NA 2EQMA 2G3RA 3L2UA 3MEAA 5D6XA 5D6YA 3MEUA 2L3RA 4A4GA 4C5GA 2JTFA 3OYGA 4HCZA 3ME9A 3H6ZA 2EFIA 2FHDA 3META 3C4SA 4E7KA 4LD6A 1N27A 2R58A 3PFSA 2R5AA
chains in the Genus database with same CATH superfamily
3RBBB 1MMAA 5GAOr 3G6ET 2M0OA 4XTXA 2X3XD 1VUBA 1W2BA 1BBZA 2CP0A 5I2MA 1Q81U 3CCQA 1KC8C 2MWPA 4R0KA 1K73R 4PFZA 4JS4A 3HP9A 1YIJA 4C0FA 2CP3A 1AWXA 2VVKA 4C8QG 1JQQA 1QQJA 3C0CA 4JZ3A 2RI2A 1Q82R 1UGVA 3EG0A 4C92B 1VQOA 3CC7Q 1K76A 2CT4A 3G71Q 3S3MA 1QVFS 3SWNB 4HA8A 2P4TA 3EG9A 3FJ5A 5FU7B 1BI1A 2HL5C 1I81A 2DX1A 2QQAA 1IXDA 2NUTA 1N8RU 2HCKA 4J6YA 1WNLA 4M7AG 2RHIA 4PJMA 4EDUA 2A37A 1VQ9Q 2F1LA 4J9EA 3H9NA 1MV3A 1VA7A 3CPWA 2E12A 1N6AA 2NUPA 4ZGEB 3CCRQ 3UDCA 1WHLA 1O75A 1AEYA 4II1A 4EMKC 1VYTA 2MF2A 2KRMA 2KT1A 2PU9B 2BE9B 4M7DB 1Z9ZA 3NPFA 1PRMC 3O8VA 1QCOA 2K6DA 3H8ZA 3MEWA 3CCET 2KXCA 1IHWA 2QEXA 4LNPA 2QG9B 3THKA 2DTIA 3CMET 2E4HA 4MZPA 3I56T 2CSIA 5A2QE 5CAIA 4HT9A 4E7KA 4GLMA 3C4SA 2EKHA 1QVFP 4PJOA 3UA6A 3NHNA 1UFFA 2EIFA 3ER0A 2ROLA 2GCXA 1LCKA 2K4YA 2KNBB 3EGUA 1K73C 5GAMd 2CP2A 2PZ1A 3CCVA 2C0TA 2HZYA 2JMCA 2BIVA 1C1AA 4M77E 1M1FA 3QIIA 1D0XA 3VU3C 4KGZB 4QVZA 3QO3A 2F69A 3OS0A 1V1CA 2DL3A 3TSZA 3A98A 2M51A 4JLIA 4FYWB 1ZSGA 1D1CA 1KFZA 3KXTA 2KGTA 2RN8A 2DXTA 1K9MC 2AZSA 3OSSC 4QT7A 3G6EQ 3I56Q 3CPFA 2E5KA 1NYFA 2L5QA 2J06A 2PUOB 4M77C 1RAHB 3EGXA 3BDLA 4DBRA 3I5SA 3TEEA 2XDPA 3GNFB 2K5FA 3CBMA 5GAOq 2EYXA 5IT9E 1UGRB 4R55A 4ZN1A 4PJOF 3NTHA 3JCMP 4J9DA 3OS5A 1M30A 5IHKA 4D8KA 3UT1A 5FU7C 2EVRA 2D8JA 4M7AD 1VQKT 1OI1A 3QYHB 1M8MA 3P8DA 2K5LA 1ZX6A 3GLXA 5FLXE 2BZYA 3M58A 1E6HA 3OSVA 3R6OA 1SSFA 3OYJA 1PNJA 4QQDA 3OYAA 1R8OB 1TH7A 2A08A 5D6YA 4F14A 1MV0B 1YJWQ 1CKBA 4V2SA 4EMKB 3TU4K 2QA4Q 4B6MA 4C8QF 4M78C 3HFOA 1AWWA 4Y92A 1NEGA 2ZPFB 4IUTA 1BCOA 2NUZA 4PNOA 4HVWA 2ZPEB 2G6FX 4D8DA 1WA7A 1QWFA 5IN1A 2O01E 2JNGA 4KH1B 4DBQA 1H641 2O9VA 4XU3A 2QGFB 1VQPT 8ATCB 4OF1A 4E7IA 1G3WA 3QG1A 1T3SA 3QJYA 1K73U 2QGGA 3M55A 2FL7A 3JCMQ 2ZPBB 5CKBA 4EIKA 2LQ8A 1J3TA 3VYGA 2Y4XA 4ZTFA 3VS0A 5I22A 1AZEA 2L3QA 1PKTA 4VUBA 2JJ9A 2KVQG 4HVUA 1M2VA 1X43A 3M0RA 3OS1A 4KGVB 1JXMA 2FEIA 4AFZC 4XK8E 2O4XA 2ESWA 4Z8AA 1KHIA 1BI0A 3CEYA 3EGDB 3G4ST 2CP7A 1KQ1A 1OQKA 4M77D 2W0ZA 3S6WA 3CCJA 4F04B 2LC4A 3REAB 2RQWA 2JW4A 2DE0X 4CC2A 4MMKA 2JS2A 3G71A 5GMKl 1VQLT 3CC7A 1AZGB 1NLOC 4M7DE 4FT2A 4EMHA 3CCLA 1AWJA 3CQTA 4J6WA 1BU1A 4KGXB 1R0CB 1RAGB 3SWNC 4E2FB 5CKHA 1PM3A 1V76A 1GRIA 3BE3A 3QYGB 5IXBA 5GAMf 3CXCA 2FB7A 4J8OA 1U1SA 5GMKi 3RKXA 3META 3G4SQ 1Y96A 2A36A 1WHMA 1VQKA 2DKGA 2PNIA 1Z9QA 2VC8A 3CCEQ 2KT8A 2O2OA 4M7AF 2EGCA 3CMAQ 2DA9A 1UDLA 2MAMA 2FZCB 2LCSA 2IVWA 2LJ0A 4OB2B 1ZA1B 1Q81C 1FMVA 4MMLA 4M78B 3CBOA 2MK5A 1U8RA 3A5ZB 2HQXA 5EG2A 4FW2A 2QTXA 3CC2A 1VQ6A 2ENMA 4FW1A 3X20B 2DO3A 4L5GA 1M90R 1SSHA 5GANh 1UGSB 2FZGB 1VQNA 3CC4A 5L8RE 2EYYA 1WHGA 5LJ5e 2JMAA 4XU0A 4OMOA 2RHUA 2EYQA 2X3WD 2DVJA 2EJFA 2VASA 2PTKA 2YWWA 2RQTA 4A4EA 3VKIA 3F70A 2GTJA 4M78A 2K3YA 3RNJA 2FPDA 4C5IA 2FPFA 2DIGA 4RKUE 1BB9A 3CCQT 3WVEB 2DD5A 1VQMT 1VQ6T 1NYGA 2OTLA 2P0KA 3RMQA 1D1BA 4RTVA 1KSWA 4BE0A 1HXDA 4RG2A 2HL3A 2DXBA 5AYFA 1OULA 2EGAA 2HAXA 5KYXA 1OX8A 1Y7XA 1M3AA 2OTJA 3CXCS 3QJ6A 3M9QA 4EMGA 5L23A 1KG1A 3J81E 4F16A 2JM9A 2QXFA 4C5GA 2ED0A 3X28B 4M77A 3CCUQ 3MP6A 2HNIA 5FU6C 1B3QA 5LJ5j 3CC4T 2XMFA 2GQVA 5GANe 2NYSA 3GIBA 1UTIA 2WSCE 1QLYA 3OS2A 1P92A 1RAIB 4LDXA 1QCFA 4F7UB 3EH2A 2A3LA 3EGDA 3S3OA 1YJWA 4CC7A 2O4XB 1Y07A 2HBWA 1WI7A 2JN0A 3CPWS 2DL7A 5GAOp 4Y91A 3FRNA 1KQ2A 4RMOA 3QUIA 1M2VB 1MMGA 4RTYA 3FC3A 1FXXA 4QVDA 4XTZA 3KUFA 3MJXA 3OYYA 4N4GA 3JCMb 3TREA 1YIJT 1O9SA 2H3JA 3QSUA 1K9MR 4PJOD 5IHNA 5KYUB 3GPLA 4IUUA 4J9CA 2DL8A 2LRQA 3QKJA 2KDSA 3AT1B 4OP0A 5GANj 3CCMQ 4PKCC 3MP8A 3UATA 1ZQ1A 1TUDA 2DJZA 4EPCA 4O6JA 2PVGB 4HXJA 2QEXQ 3ZFJA 3CCSA 4J9FA 2F2WA 1ZUKA 1W2BP 4EMKA 1K8AU 4ELZC 4M7DF 4M77F 1I5LA 5FRMA 5C6SA 3ZEHA 4FCYA 4PLLA 5GMKm 2C06A 2QAZA 2HEQA 1ZUYA 1QVPA 5CCAA 1EZZB 3JB9I 5KYNA 1YWPA 2VV5A 3OYGA 2WSFE 3JB9F 2COYA 3M0SA 2QTVA 1D0ZA 3M56A 3GP8A 2YRVA 5CR2A 4PK4A 4E7JA 4Z02A 1Q7YU 3M4GA 5LJ5h 1TUGB 2LCLA 3JCMJ 3P8BB 4KRTA 3V7RA 1QVGA 2Z0WA 4P5NA 3CCJT 2MMPA 4C0DB 1TG0A 2ECZA 3JCMg 4C8QD 3EG3A 2JM8A 5GJVB 1OEBA 1OPKA 1WJQA 3EG1A 2EJGA 2JTMA 1WPYA 5LJ5g 2X4YA 4BI8B 4NL2A 5GAOn 3UPUA 3EFSA 3FLGA 1YJ9T 4JJCA 1NBEB 2DXCA 3M0PA 3QDRB 1IREB 4C8QC 4X9DA 1VQ9T 4J7IA 3CCMT 3DLMA 1M1KC 4JJNK 4JJBA 2L3PA 4X34A 2KRSA 1WXTA 3VS1A 3INZA 5M9OA 2O31A 3A8HB 1D3BB 1G3SA 2ZPIB 1D1AA 3R6NA 2NLUA 5IAYA 1VQ5Q 5LJ3f 1I8FA 1VQNQ 3UWNA 1YJWT 4PJOB 3RUXA 5CO7A 2E64A 3REBB 1SG5A 4MZTA 2V8IA 1UECA 1RAEB 2RI5A 2BZXA 1TU0B 5D7UA 5KCHA 4A53A 2ZPHB 3PMTA 4JRPA 3RESA 4C5EA 1XJWB 1RAAB 9ATCB 5J39A 2LVMA 4AG1C 1HK9A 5IXFA 1FYNA 3PVQA 1BCMA 3OMGA 3S3NA 4PFOA 3MEUA 2QI2A 3QWYA 2KROA 2EFIA 4M77G 3CCEA 4PJOE 1K8AR 1Q82C 1Q86R 2DNUA 2K5IA 3LYIA 1ZSZC 5J3BA 2EQJA 4RCCA 2HQHA 3RERA 1WIEA 5CIUA 1NG2A 5GAMh 4LE9A 2LQWA 1YJ9A 1MMNA 2QDYB 2HBPA 1NJIC 2IPOB 3EH1A 1X2QA 4OMPA 2XD0A 2DL4A 3JCMd 1GXIE 4IIOA 2XHCA 2AKLA 2OJ2A 1WLPB 4C92F 5GAN7 1BI2A 1VYVA 3SWNA 1IHVA 2EYWA 1VQ8T 3CCUA 3VV0A 3VS6A 1YFNA 5LJ5d 3CCLQ 4NS5A 2RQVA 1TXQA 4C92A 3U23A 4FYYB 4JPBW 1VQ4Q 3RDVA 5CQXA 2CH4W 1PD0A 3CXCP 4HCKA 1RABB 2CS7A 2DVEA 5FU6B 1YN8A 2RA2A 1VQ6Q 1AHJB 2E6ZA 1W2BS 3I56A 1VQ4A 4J83A 3RIRA 4CRIA 3CMEA 4QKUA 3OBWA 1Q7YR 2GBQA 2HKQB 2LTOA 5IH2A 2X51A 4OB0B 3CC2T 1M90U 1VQ7T 3RR6A 4D6WA 2YHTA 3ASKA 4ZTJA 1PSEA 2KQWA 2QQ9A 3OYLA 3JCMW 3HRTA 2XKOC 4J7FA 1IGUA 2FZKB 2K9GA 3OA6A 4J6XA 1XOVA 1M5Q1 4C8QA 2CUBA 3M0QA 2DILA 3PVLA 3M4YA 4OB1B 3RKWA 2RD1A 4BUGA 1Q81R 5GAOm 1KC8U 5GMKe 1Y57A 5A0GA 3LWIA 2LT4A 3DLLA 5D6XA 2GNCA 2MOXA 1EX4A 8AT1B 2EJ9A 1FX7A 3BDUA 4JZ4A 4LD6A 2E65A 4ZGDB 2ZZDA 1TS9A 2HMAA 2OAWA 4IUVA 2A0FB 4DEYA 4QW2A 1QWEA 2ABLA 6AT1B 1ZBXA 4JRQA 5ECAA 2KY9A 2GFUA 2KEAA 5FWBA 4M7AB 3MP1A 1JU5C 4JDSA 4DOWA 1S72Q 1M3CA 2ZGWA 3JB9D 3TQ7P 3HFNA 3G71T 2XG8D 1K4US 2V8KA 2PQWA 2YRCA 1AVZC 3GOXA 3OYBA 1YITQ 2DZCA 2V26A 1KQSA 1IRXA 1M3BA 1S1NA 2L2PA 2X4WA 4LDYA 3HHTB 4C92G 2K7AA 1NPPA 1C6VX 2M1HA 5GAMj 4ESRA 2CUDA 1MHNA 2QQRA 3VS5A 3TVTA 1G5VA 4RCBA 2DIQA 4OMLA 5IHIA 4A54A 1JJ2S 3OMCA 1QVGS 2DM1A 1M1KR 4C0DC 2AZVA 1B7TA 2CH4A 3RKYA 2CZ1B 2RHZA 3OW2A 4OMNA 2DXUA 1XQHA 2F2VA 1I5OB 1I4K1 4B9XA 4XU1A 2KXDA 4ELYC 1FMKA 1PC0A 4A63B 2X4XA 3JCMX 5I21A 1T0HA 2JOYA 2XDBA 4BE2A 2WSEE 4M4ZA 2KAFA 2RO0A 4N4HA 3H41A 1AD5A 2CT3A 1BI3A 1WX6A 4C8QB 1VQPQ 2DTOA 2ZCFB 2XIDA 1QP2A 2H3EB 3I55T 2B86A 4M7DD 1SEMA 2J7IA 4OMMA 3JCMc 1YWOA 3FB9A 3OYFA 1YHQA 2VWFA 3GBQA 5GAN5 4PJOC 1YJNQ 3SHWA 3JB9J 3DB4A 1HD3A 3MKDA 1Y71A 1KD1R 1PSFA 4KH0B 3CC7T 3EG2A 1H8KA 2AIRB 2PUKB 2L3SA 4DBHA 1H3ZA 3L2WA 1SKUB 4F7UF 4M75C 1YNZA 2XDDA 1SRLA 3L2VA 4ZGJB 2C0IA 5GAMe 3OYEA 1SHFA 2HKNA 1YJ9Q 3I35A 2GF7A 4FT4A 3VJPA 1KHCA 4JRKA 2A28A 5HK3A 3HL8A 1VQ9A 1OZ3A 2FVUA 2LP5A 1X2KA 4J9IA 2AKKA 2VYTA 2RJEA 4C92D 3CCRA 3CD6A 2DRMA 3O5ZA 1WQWA 3OYDA 1YHQT 1K1ZA 4AFQC 2K57A 1YCYA 1GBRA 4F7UE 2JZ2A 3HRUA 2KK4A 4C8QE 1M4ZA 1E6GA 2RK2A 2LT1A 3LGFA 1ABQA 4WCIA 1MMDA 1Q86C 5CVIA 1W6XA 4IUQA 3QZ5B 3J7AF 4M75E 1M1KU 1FMWA 1PG5B 2LQKA 2GTOA 3OW2P 1SPKA 2O9SA 1YJNA 1NEBA 4ZNXA 2VXEA 3PE0A 2JTFA 4LDUA 2KSSA 3HPWA 3DKMA 5DM7R 3X24B 4QVCA 1N27A 4DA4A 7AT1B 1K0XA 5A0DA 4M7AE 3JV3A 3H0IA 4HVVA 1D3BA 3AHUA 4M78F 2YUQA 1ZUUA 1YI2Q 1IGQA 1HYOA 3ZBDA 2JTEA 1X27A 2AT1B 2DMOA 2R5MA 1YI2T 4IUPA 2QASA 4LDVA 5GAN3 2JXBA 4QQGA 3SD4A 1Y0MA 4XAXB 2ROTA 1B07A 4Z88A 1RLPC 4PFPA 2P0QA 5KH6A 1T0JA 1WJRA 1AOJA 3GF5A 1KD1U 5LJ3g 2RHYA 3HRSA 4M75B 3PIPA 2O88A 4AG2C 2J6FA 2E3HA 2RQRA 3IQLA 3MO8A 2KMTA 4C92C 3E9GA 3EHQA 3LH0A 2M02A 4UC4A 4Z89A 3HTRA 4LUDA 1YCSB 1VQ5T 2DAQA 3M0TA 4M75G 4A4HA 1NJIR 5FRNA 4BI4A 1SRMA 5FROA 3X25B 2WACA 2HDAA 3CCVT 1Q95G 1JO8A 3A8GB 2QYZA 1KD1C 1OOTA 2M16A 2RNAA 3NGPA 2Y90A 1D09B 4RG8A 4A4GA 4OGEA 2ZPGB 1WYXA 1X01A 1JB0E 3PFSA 2OAUA 2E5QA 3A8OB 4Y28E 4L59A 1KIKA 1OU8A 4N0AC 5GJWB 1VQ7A 3M54A 1JRIA 2DBKA 4RTWA 2DF6A 1UE9A 2KRNA 3E2UA 4FL6A 2NWMA 2GGRA 4RTZA 5KYUA 3CCQQ 4MDXA 2KYBA 4E47A 1BIBA 4ATOA 2E1HA 3H0FA 1WXUA 3NTIA 5GAOl 3OBYA 4M7DG 2LZ6B 1S72T 3VS4A 1YBYA 4FU6A 2C0OA 2YUPA 3URGA 4C0GA 3PGGA 3FIFA 2OX7A 2V1QA 1VQ8A 2X9HA 1YHQQ 3I5RA 2GFAA 5LJ3d 2CDTA 1YI2A 1NE8A 4FM4B 2LX7A 1MUZA 2D8HA 1I0CA 4A4FA 2DERA 2OTLQ 4PLIA 4F7UA 1XTDA 2VXFA 1VQOT 2FO0A 1X6GA 4HT8A 2QEXT 2XU8A 1D0YA 2ATCB 1MNEA 2RI3A 3MPUB 4M77B 2LX9A 3L2ZA 1M2OA 1GBQA 5GAN6 3Q1JA 2E10A 3SB2A 3G1JA 1G3TA 1PD1A 3D7SB 1VQ7Q 1UHCA 1TUCA 2OTJQ 3VS3A 1WGSA 2EPDA 1QP3A 2QA4T 4KUIA 1UB4A 5KYXB 3CC2Q 1VQMA 1KJWA 1LJOA 1BYMA 3MHXA 4MDWA 1B34B 2ED1A 3V7SA 1VQLA 2LNVA 3QWXX 4DEXA 1IB8A 2DL5A 2RJFA 2MPXC 1QW1A 2KBTA 3M59A 5DY9A 1RI0A 1QCNA 3FJPA 1VQ5A 1YITT 4E7SA 2P84A 3A8MB 3LH5A 1VQ4T 3LW5E 4JUVA 1YP5A 4BY6B 3NTKA 3CCLT 3G4SA 4LUEA 3VRZA 3CCMA 2PVOB 1UGQB 2VKNA 3GNGA 3QBYA 3E1SA 1W1FA 5GAN2 3DB3A 3JCMh 4IIMA 2RQUA 4XTWA 2LNHB 1AT1B 4WF2A 2E6NA 3KBGA 2CZ7B 2K79A 2LCCA 2DYIA 2L8DA 1X6OA 1WDXA 1DJ7B 5HY6A 4E7ZA 3V8LA 3JRZA 4XTUA 4CC4B 2BZ8A 3G6EA 5GAMg 1QKWA 1V29B 2W10A 4Q5WA 2XICA 2FG0A 2D6FA 2AK5A 2KI7A 3JB9H 1JEGA 5D6WA 2VB6A 2FRWA 4M75F 4J9GA 4ZN3A 3PT9A 5GMKh 1OZ2A 2R57A 1K0SA 4BDYA 4JLGA 4E7HA 1HJDA 1PKSA 3JSCA 1K9AA 1NPRA 2FPEA 2FRYA 1Y96B 1Q7YC 1N9SA 2DLPA 2MI6A 4BB7A 2EYZA 1X6BA 1B34A 1OYXA 1LVKA 4LDWA 1OPLA 1WXBA 1RUWA 1NZ9A 1XNIA 3CC4Q 1VOMA 4HCBA 2M0YA 2RJDA 2DK3A 3E9FA 3I55Q 2FYKA 3SEMA 4FSSA 1RL2A 5HCKA 5CKDA 4XTVA 2EBPA 2P0PA 3VS7A 5CK9A 3OW2S 1RI9A 3N5BB 4C5HA 1VQ8Q 1I1JA 5J26A 1CKAA 1F1BB 3C95A 3PTAA 1VIFA 2XK0A 3CBPA 3BY7A 2LQNA 2L0AA 1GCQA 4C92E 1KK7A 3UF4A 4ANJA 2YDLA 5KCOA 1VIEA 4LD9K 1LPLA 3EAEA 1UEBA 1UG1A 1UJ0A 4QQ6A 3CCVQ 2YSQA 4M78D 4L6V5 1VQMQ 1JXOA 2QK0A 3CD6Q 2E41A 5DLOA 1TTHB 3ULRB 4BY6C 4KT0E 2VUBA 3LX7A 1M1GA 1NM7A 3X26B 2A7YA 2EAYA 4KULA 1ACMB 4AT1B 2D0QB 1U3OA 1NLPC 1WQ7A 1UHFA 3FEOA 1C0MA 4JS5A 2SEMA 1M9SA 2D0NA 4RTUA 4B9WA 1VYUA 1CSKA 3NMZC 2HSPA 1QVFA 1S72A 1M90C 3L2QA 2DFUA 3MEVA 3OQ5A 2KR3A 5KE2A 3LGLA 4ORZA 2J6KA 4M7AC 2HSEB 4BD3A 1U06A 4RTTA 2RK1A 2F2XA 2X4JA 3T9NA 1PHTA 2RMOA 5LL6S 2DEUA 2OTJT 2BE7D 4RTXA 2CZ6B 3NFCA 3P8HA 4C0ZA 1BIAA 2DBMA 1UJYA 3PNWC 3WXMB 3L2UA 1M8VA 1GCQC 2L3RA 5AT1B 5GAN8 3CCST 1QKXA 2R5AA 2AHJB 1K9MU 2DZ9A 1TSFA 2OI3A 2LJ3A 3BFMA 4PL6A 2K3BA 4JRIA 1R0BG 5KE3A 2RF0A 1WZOA 1VQOQ 4F7UG 3CCSQ 1RACB 4OB3B 1W4SA 2VGNA 2LMJA 3VRYA 4CI0C 4ME7A 3V8JA 4BI3A 1JJ2A 1GCPA 5GANd 5CKFA 1WFWA 4DBFA 3EGXB 4M75A 4IKFA 5I2SA 4J9BA 3C94A 4BE1A 2D9TA 4E6RA 1N8RR 1UUEA 2KE9A 4FIBA 2QQBA 1K8AC 4GBQA 2YUNA 2QQSA 1OX9A 2HD0A 3QZ9B 3CCUT 1EFNA 1WJSA 1KC8R 4NL3A 1GFCA 1X75C 3RMSA 2YLCA 1R77A 2RPNA 5GMKj 2BTTA 2F5TX 5LJ3j 1KQSP 3BW1A 1M27C 3JCMe 4X9CA 1LOJA 3FDRA 2IG0A 5C0MA 2EWNA 2XI9A 4GY5A 2LDMA 1BKBA 4FYXB 2IIMA 2EGEA 2HQEA 2JT4A 3PMIA 2KYMA 2LJ1A 3C12A 3WVDB 3LLRA 2VGMA 2H8HA 2V1RA 1IZ6A 2MCNA 2DEQA 1N8RC 4OGCA 1N9RA 2J05A 4M7DA 1ZHIA 1G3YA 2MIOA 1EIFA 3J80E 2EQMA 5EC7A 5LJ5f 1RAFB 2DPPB 2NUPB 3EFRA 3CMAA 1YJNT 4AMCA 4KUDK 3QDFA 2B8AA 3JCMf 2OTLT 3OYKA 3ZL7C 1WHHA 4AFUC 4JJDA 2NUTB 3V8KA 4K11A 1I07A 1A0NB 1PWTA 3I9QA 3OB9A 1MGQA 3EG9B 1VQKQ 5I11A 4BDZA 2K2MA 4OVAA 1Q86U 1WHJA 2YT6A 1G83A 2YUOA 1VQNT 3JCMV 2I0NA 3CMEQ 3LWHA 4AFSC 2EKOA 4X1VA 3M57A 3V7CA 3QXEB 2L89A 1PRLC 1UGPB 2MYSA 2RB6A 1NJIU 1E7OA 2RJCA 4WTOB 4M7DC 5FW9A 4PJOG 3KFVA 2RH2A 3OYNA 2CGHA 3OYCA 2CZ0B 4TVRA 1RLQC 2COZA 1X69A 1Q82U 2DD4A 5GANf 2DETA 4YTLA 2JVVA 3A8LB 3M5AA 2YXYA 1G8XA 4KBMB 3G7ZA 2ZAEA 1U5SA 2I2LA 1SHGA 3JB9G 3OYIA 2YLBA 3CCJQ 3VUBA 1OU9A 1H3HA 1JBMA 3EHRA 4BACA 1T3LA 3MCAB 2D1XA 1TOVA 5KYWA 2BUDA 3H0HA 2MWOA 4M75D 1VQLQ 4O5VA 1U1TA 5DLQE 5LJ3h 2F5KA 3VS2A 3OY9A 3VYHB 1SF9A 1JJ2P 4RUGA 4HCCA 2G3RA 2SRCA 3MEAA 1OV3A 1MNDA 3EFOA 1QMCA 3ME9A 4HCZA 3TCJA 3HSBA 2FHDA 2Y4YA 3CD6T 2JUFA 2R58A 1BK2A 2DRKA 4DQ2A 3PIOA 5KYYA 4IURA 2DTHA 4N0AA 3L42A 2COWA 1AWOA 4CC3A 4GLKA 5GAN4 3QHSA 2K3XA 1FWZA 4M78E 5HKCA 2GQIA 3TSWA 2DJQA 4OMQA 4HKEA 1W70A 3CCRT 3L2RA 2EW3A 2M9UA 1IO6A 4FSXA 1N5ZA 4PJNA 1ZSZB 4LN2A 1H92A 4J9HA 4LXCA 3E19A 4PJJA 4OMFB 3QPHA 4DOVA 1RADB 4NOYA 4E7LA 1ZA2B 2EQKA 3M53A 3JAME 5CQYA 1YITA 1ZLMA 2QDLA 3M0UA 2CSQA 4N4IA 4XQ3A 1ZSZA 2CKKA 1VQPA 2EQIA 2J6OA 1YIJQ 4M7AA 2RHXA 2JS0A 3L1AA 2P4RA 2CP5A 2CP6A 5LJ3e 2CYZB 2E3IA 2E70A 5A0LA 2EQUA 3SDZA 2QA4A 1ARKA 3VUZA 3OYMA 1QVGP 5KYYB 3HKSA 1PCXA 2X35A 4FYVB 3UA7A 1WHKA 4MZMA 3OYHA 2CREA 3I55A 5FWCA 3EFOB 2BKDN 1KQSS 4R56A 1G2BA 2PVDB 2DYBA 5GANg 2YRDA 1GL5A 1HSQA 3CPWP 2K2VA 4PJLA 2RM4A 4F17A 1LNXA 4J5YA 5KYWB 1GFDA 1ABOA 3CMAT 2V8JA 3SFMA 4M78G 1TWBA 5CKEA 5HK0A 3H6ZA 3A1PA 4XU2A 1ZBJA 4XTYA 4A4KA
chains in the Genus database with same CATH topology
4M77A 5CK9A 3G6ET 2M0OA 3MP6A 3N5BB 2HNIA 4XTXA 5FU6C 3JCMc 3OW2S 1VUBA 4C5HA 3FB9A 5LJ5j 1W2BA 4M7DE 5J26A 3OYFA 3CC4T 2GQVA 5GANe 1YHQA 3GIBA 3C95A 2WSCE 3PTAA 1VIFA 5I2MA 5GAN5 2XK0A 1P92A 3OS2A 1Q81U 3CCQA 1KC8C 4PJOC 2MWPA 3CBPA 4LDXA 3JB9J 3DB4A 4F7UB 1Y71A 2A3LA 3BY7A 1PSFA 4JS4A 4C92E 3CC7T 3S3OA 1YJWA 5KCOA 1VIEA 2PUKB 4LD9K 2O4XB 1Y07A 3EAEA 1UEBA 3HP9A 4C0FA 4C8QG 1YIJA 1H3ZA 3L2WA 4F7UF 4M75C 2JN0A 2XDDA 3CPWS 5GAOp 2RI2A 4Y91A 3FRNA 1KQ2A 4QQ6A 4RMOA 3QUIA 3L2VA 4ZGJB 4M78D 4L6V5 3FC3A 2E41A 4C92B 5DLOA 1VQOA 1FXXA 5GAMe 4BY6C 4QVDA 3OYEA 4KT0E 4XTZA 2VUBA 3LX7A 3S3MA 1M1GA 2GF7A 4FT4A 3KUFA 2A7YA 1KHCA 2EAYA 4JRKA 4KULA 3SWNB 3VJPA 3X26B 5HK3A 3HL8A 4HA8A 1VQ9A 3OYYA 4N4GA 3JCMb 2D0QB 3TREA 1YIJT 2P4TA 1O9SA 2H3JA 1OZ3A 2FVUA 3QSUA 1WQ7A 3FEOA 5FU7B 1BI1A 4PJOD 4JS5A 2VYTA 1I81A 2RJEA 4C92D 3CCRA 3GPLA 4IUUA 3CD6A 1M9SA 2QQAA 2LRQA 3QKJA 4B9WA 2KDSA 1N8RU 4J6YA 4OP0A 5GANj 3OYDA 1WNLA 1WQWA 1YHQT 4M7AG 4PKCC 3MP8A 1S72A 2RHIA 1QVFA 4EDUA 1ZQ1A 2K57A 1YCYA 1M90C 3L2QA 3MEVA 3OQ5A 2JZ2A 2DJZA 3HRUA 4F7UE 2KK4A 4EPCA 4C8QE 1M4ZA 5KE2A 4O6JA 2RK2A 2PVGB 3CCSA 3ZFJA 3CPWA 2E12A 2LT1A 1N6AA 3LGLA 3LGFA 4ZGEB 3UDCA 1O75A 4M7AC 4II1A 4BD3A 4EMKA 4EMKC 1Q86C 4ELZC 1K8AU 4M7DF 4M77F 2RK1A 5CVIA 2MF2A 2X4JA 3T9NA 5LL6S 2PU9B 2OTJT 1I5LA 5FRMA 4IUQA 2CZ6B 5C6SA 3ZEHA 3NFCA 4PLLA 3P8HA 4C0ZA 3QZ5B 5GMKm 2C06A 3J7AF 4M7DB 1BIAA 4M75E 1M1KU 3O8VA 2LQKA 3PNWC 3WXMB 3H8ZA 1QVPA 3MEWA 3CCET 5CCAA 3L2UA 2QEXA 1YJNA 1M8VA 2VXEA 2L3RA 3JB9I 2DTIA 2JTFA 3CMET 3OYGA 2VV5A 2KSSA 3HPWA 4LDUA 2WSFE 3DKMA 4MZPA 5CAIA 5GAN8 5DM7R 3C4SA 5A2QE 3X24B 3CCST 4E7KA 3JB9F 4QVCA 1N27A 4DA4A 4PJOA 2R5AA 2AHJB 5A0DA 1K9MU 2DZ9A 4M7AE 2EIFA 3ER0A 2GCXA 3BFMA 2K4YA 4PL6A 4JRIA 5KE3A 1D3BA 3M56A 1K73C 3AHUA 5GAMd 4F7UG 3GP8A 2YRVA 4M78F 5CR2A 4E7JA 3CCVA 4Z02A 1Q7YU 4OB3B 1W4SA 3M4GA 2VGNA 5LJ5h 2BIVA 2LCLA 4CI0C 4M77E 4ME7A 3P8BB 1M1FA 3V8JA 3V7RA 4BI3A 4P5NA 3ZBDA 2MMPA 3CCJT 3QIIA 1QVGA 3VU3C 4C0DB 5GANd 1JJ2A 4QVZA 5CKFA 3QO3A 2F69A 3OS0A 2R5MA 3JCMg 4M75A 4C8QD 4IKFA 1YI2T 5I2SA 4IUPA 3C94A 3I56T 4LDVA 4BE1A 2D9TA 5GAN3 4JLIA 1WJQA 2EJGA 4QQGA 3SD4A 2JTMA 1WPYA 5LJ5g 4FIBA 4XAXB 2QQBA 3KXTA 2X4YA 4BI8B 4NL2A 5GAOn 3UPUA 1K8AC 2DXTA 3EFSA 1K9MC 3OSSC 3FLGA 1YJ9T 2P0QA 2QQSA 5KH6A 1WJRA 2HD0A 3QZ9B 3CCUT 1WJSA 3CPFA 3GF5A 4NL3A 1QVFS 1KD1U 1X75C 2DXCA 2L5QA 2PUOB 3RMSA 2YLCA 3QDRB 1IREB 4C8QC 2RHYA 3HRSA 2F5TX 4M75B 4M77C 4X9DA 5GMKj 5LJ3j 5LJ3g 4J7IA 3PIPA 3CCMT 3BW1A 3BDLA 1VQ9T 3DLMA 1M1KC 3TEEA 3JCMe 4JJNK 2XDPA 3GNFB 4X9CA 3MO8A 2KMTA 4X34A 4C92C 1LOJA 3FDRA 2IG0A 2K5FA 3CBMA 3E9GA 3INZA 3LH0A 5GAOq 5IT9E 5C0MA 2EWNA 5M9OA 1Q82U 1UGRB 2XI9A 4UC4A 4GY5A 4R55A 2LDMA 4ZN1A 4PJOF 1BKBA 3NTHA 3A8HB 1D3BB 1G3SA 2HQEA 2ZPIB 5IAYA 2NLUA 3JCMP 1VQ5T 5LJ3f 1I8FA 3OS5A 3PMIA 2DAQA 4M75G 3UT1A 3C12A 5FU7C 3UWNA 4A4HA 1YJWT 5FRNA 3WVDB 4M7AD 1VQKT 1OI1A 3RUXA 4BI4A 4PJOB 5CO7A 3QYHB 2E64A 3LLRA 4MZTA 2V8IA 2VGMA 2RI5A 5FROA 3P8DA 2K5LA 3X25B 1IZ6A 3GLXA 5KCHA 4A53A 2ZPHB 3PMTA 2WACA 5FLXE 4JRPA 3RESA 3CCVT 4C5EA 3M58A 2DEQA 1N8RC 3A8GB 4OGCA 5J39A 2LVMA 1N9RA 3OSVA 1KD1C 4M7DA 1ZHIA 3R6OA 1HK9A 1SSFA 1G3YA 2M16A 3OYJA 4QQDA 3OYAA 1EIFA 3OMGA 3J80E 3S3NA 1R8OB 2EQMA 1TH7A 2Y90A 5D6YA 3MEUA 4V2SA 4RG8A 4A4GA 4OGEA 2QI2A 2ZPGB 4EMKB 3TU4K 5LJ5f 3JCMJ 1X01A 2EFIA 4M77G 2DPPB 1JB0E 3EFRA 3CMAA 4C8QF 1YJNT 4M78C 3HFOA 3PFSA 2OAUA 3CCEA 4KUDK 4PJOE 2ZPFB 1Q82C 2E5QA 3A8OB 2K5IA 2B8AA 4IUTA 3LYIA 4L59A 4Y28E 4PNOA 5J3BA 2EQJA 2ZPEB 3JCMf 2OTLT 4RCCA 4N0AC 3RERA 1VQ7A 5CIUA 5GAOr 3M54A 5GAMh 5IN1A 1JRIA 3OYKA 1YJ9A 2O01E 2JNGA 2QDYB 1H641 2HBPA 4XU3A 1NJIC 1VQPT 4E7IA 4OF1A 1G3WA 3QG1A 3V8KA 4FL6A 4MDXA 3QJYA 3OB9A 2XD0A 1K73U 3JCMQ 3M55A 1MGQA 2FL7A 4E47A 3JCMd 1BIBA 4ATOA 2E1HA 2ZPBB 1GXIE 5CKBA 2XHCA 3NTIA 5GAOl 4BDZA 2LQ8A 3OBYA 4C92F 4OVAA 5GAN7 1BI2A 3VYGA 1Q86U 2Y4XA 4ZTFA 4M7DG 3SWNA 4HT9A 1VQNT 1S72T 1VQ8T 4VUBA 3CCUA 3JCMV 3VV0A 5LJ5d 1YBYA 3LWHA 4FU6A 4NS5A 2EKOA 4C92A 2KVQG 3M57A 3V7CA 3QXEB 3URGA 4C0GA 2L89A 3PGGA 3OS1A 3FIFA 5CQXA 1UGPB 1VQ8A 2RB6A 4XK8E 1NJIU 2CS7A 2RJCA 4M7DC 4PJOG 2DVEA 2RH2A 5FU6B 2GFAA 2O4XA 2RA2A 5LJ3d 3OYNA 1AHJB 1NE8A 2CGHA 3OYCA 2E6ZA 4FM4B 1KHIA 1YI2A 1BI0A 3CEYA 3G4ST 2CZ0B 4TVRA 1KQ1A 1W2BS 4M77D 4A4FA 3S6WA 4PLIA 4F7UA 3I56A 1XTDA 2VXFA 2DD4A 4J83A 3RIRA 4CRIA 2LC4A 3CMEA 3CCJA 1VQ4A 1VQOT 3OBWA 5GANf 4HT8A 2QEXT 4YTLA 2JVVA 2LTOA 2XU8A 3A8LB 3M5AA 4OB0B 3CC2T 4KBMB 1M90U 1VQ7T 4D6WA 3G7ZA 4MMKA 2YHTA 2RI3A 3ASKA 3G71A 4ZTJA 4M77B 2LX9A 2I2LA 3L2ZA 5GMKl 1VQLT 3CC7A 3JB9G 1PSEA 2YLBA 2KQWA 2QQ9A 3OYLA 3OYIA 3VUBA 4FT2A 3Q1JA 1JBMA 3HRTA 4EMHA 5GAN6 2E10A 2XKOC 3SB2A 3CCLA 4J7FA 3OA6A 1G3TA 4J6XA 4BACA 1XOVA 1M5Q1 3MCAB 4J6WA 2BUDA 2MWOA 4M75D 4C8QA 1WGSA 4O5VA 1U1TA 5DLQE 3SWNC 5LJ3h 2F5KA 3M4YA 4OB1B 3RKWA 2RD1A 1QP3A 5CKHA 4KUIA 4BUGA 5GAOm 1UB4A 3VYHB 3OY9A 2QA4T 1KC8U 5GMKe 5A0GA 3LWIA 3QYGB 2LT4A 1VQMA 3DLLA 5GAMf 4HCCA 2G3RA 3CXCA 3MEAA 5D6XA 1LJOA 2FB7A 4J8OA 3MHXA 1BYMA 4MDWA 1U1SA 1B34B 3ME9A 4HCZA 3TCJA 5GMKi 3HSBA 2FHDA 3META 3RKXA 2EJ9A 1FX7A 2Y4YA 2JUFA 3BDUA 4LD6A 3CD6T 1Y96A 2E65A 3V7SA 2R58A 2LNVA 1VQLA 4ZGDB 1VQKA 2DKGA 2ZZDA 2RJFA 4DQ2A 3PIOA 1QW1A 3M59A 4IURA 4IUVA 2DTHA 5DY9A 1RI0A 2VC8A 4N0AA 4QW2A 3L42A 3CC4A 4M7AF 3FJPA 1VQ5A 1ZBXA 1YITT 2MAMA 4GLKA 3A8MB 2IVWA 4JRQA 2KY9A 2GFUA 5GAN4 3QHSA 2K3XA 1FWZA 1VQ4T 4OB2B 3LW5E 4M78E 5HKCA 1Q81C 4JUVA 4M7AB 4BY6B 3NTKA 3MP1A 4MMLA 4HKEA 4JDSA 4DOWA 3G4SA 3CCLT 4M78B 2PVOB 3CBOA 3CCMA 1UGQB 3GNGA 3QBYA 3L2RA 2ZGWA 3CCRT 2M9UA 3E1SA 3JCMW 3JB9D 1U8RA 4FSXA 3A5ZB 3HFNA 3DB3A 5GAN2 3G71T 2HQXA 3JCMh 2XG8D 2V8KA 5EG2A 2PQWA 2QTXA 3GOXA 3E19A 3OYBA 3CC2A 4XTWA 4OMFB 3QPHA 1VQ6A 4DOVA 4WF2A 3X20B 2E6NA 3KBGA 2DO3A 2CZ7B 2DZCA 4L5GA 1KQSA 2LCCA 4NOYA 5GANh 2L8DA 1X6OA 4E7LA 1UGSB 1VQNA 2X4WA 4LDYA 2EQKA 3M53A 3JAME 5CQYA 1DJ7B 3HHTB 5HY6A 5L8RE 4C92G 3V8LA 3JRZA 1YITA 5LJ5e 4XTUA 4XU0A 1NPPA 2M1HA 2RHUA 2EYQA 4N4IA 4XQ3A 5GAMj 3G6EA 5GAMg 2EJFA 1MHNA 1V29B 2QQRA 4A4EA 2CKKA 3VKIA 3F70A 4Q5WA 4M78A 2K3YA 2XICA 1VQPA 4C5IA 2D6FA 3JB9H 4M7AA 1G5VA 2RHXA 5D6WA 2DIGA 3L1AA 4RCBA 4M75F 4RKUE 2DIQA 5LJ3e 4ZN3A 3CCQT 2CYZB 3WVEB 2DD5A 2E70A 4A54A 3PT9A 3OMCA 5A0LA 1VQMT 1JJ2S 1VQ6T 1QVGS 5GMKh 1OZ2A 4C0DC 2R57A 2EQUA 3SDZA 2QA4A 4JLGA 4BDYA 2OTLA 3RKYA 3VUZA 4E7HA 3OYMA 2P0KA 3RMQA 3HKSA 2CZ1B 2RHZA 2X35A 3JSCA 3OW2A 1NPRA 4BE0A 2DXUA 1Y96B 1XQHA 4MZMA 1Q7YC 3OYHA 1N9SA 1I4K1 2MI6A 4BB7A 3I55A 1HXDA 4RG2A 1B34A 4B9XA 2DXBA 5AYFA 1OYXA 4XU1A 2BKDN 4LDWA 1KQSS 4R56A 4ELYC 3JCMX 2PVDB 2X4XA 2HAXA 5GANg 1NZ9A 5I21A 2JOYA 2XDBA 4BE2A 2WSEE 1Y7XA 1XNIA 2KAFA 2RO0A 4HCBA 4N4HA 2K2VA 2OTJA 2RJDA 1BI3A 2DK3A 3E9FA 4C8QB 3CXCS 3QJ6A 3M9QA 2RM4A 1LNXA 4J5YA 2FYKA 4EMGA 1KG1A 3J81E 3CMAT 2DTOA 2QXFA 4C5GA 2V8JA 2ZCFB 1RL2A 3SFMA 4M78G 5CKEA 2XIDA 1QP2A 5HK0A 3H6ZA 4XU2A 3X28B 5CKDA 3I55T 4XTVA 2P0PA 4XTYA 4A4KA 4M7DD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJF A;  2M0O A;  3MP6 A;  2E5Q A;  4IUR A;  4IUT A;  2B8A A;  4IUV A;  3LYI A;  4L59 A;  1RI0 A;  2EQJ A;  4C5H A;  4QW2 A;  3L42 A;  4PL6 A;  5KE3 A;  5CIU A;  5J26 A;  3OYF A;  2YRV A;  5IN1 A;  3OYK A;  4E7J A;  4Z02 A;  2GFU A;  3OS2 A;  2XK0 A;  2K3X A;  2MWP A;  2BIV A;  3DB4 A;  4E7I A;  3NTK A;  3MP1 A;  4FL6 A;  3QII A;  4QVZ A;  3QBY A;  3L2R A;  3OS0 A;  3OB9 A;  3S3O A;  2R5M A;  5KCO A;  4IKF A;  3DB3 A;  2O4X B;  2HQX A;  3EAE A;  3NTI A;  4IUP A;  4BDZ A;  3L2W A;  1H3Z A;  2PQW A;  4OVA A;  3GOX A;  3OYB A;  4BE1 A;  4ZTF A;  2D9T A;  2RI2 A;  1WJQ A;  4QQG A;  3SD4 A;  4QQ6 A;  2E6N A;  3L2V A;  2X4Y A;  4FU6 A;  2LCC A;  2EKO A;  4NS5 A;  3FC3 A;  3OYE A;  2L8D A;  4E7L A;  3FLG A;  3LX7 A;  2L89 A;  2X4W A;  2EQK A;  2GF7 A;  1WJR A;  2QQS A;  3KUF A;  1KHC A;  5KH6 A;  3S3M A;  1WJS A;  2RJC A;  4N4G A;  2M1H A;  2RHU A;  4N4I A;  1OZ3 A;  3OS1 A;  2GFA A;  2O4X A;  2RHY A;  3OYN A;  3FEO A;  3OYC A;  1MHN A;  2QQR A;  2VYT A;  2CKK A;  3BDL A;  3CEY A;  3F70 A;  3DLM A;  4Q5W A;  4A4E A;  2K3Y A;  2RJE A;  4A4F A;  2XDP A;  4IUU A;  3S6W A;  4C5I A;  4PLI A;  3MO8 A;  1G5V A;  4CRI A;  2RHX A;  4X34 A;  2DIG A;  2LRQ A;  3FDR A;  3QKJ A;  5D6W A;  4B9W A;  2IG0 A;  3E9G A;  3LH0 A;  2DIQ A;  5C0M A;  5M9O A;  3OYD A;  2LTO A;  3OMC A;  4GY5 A;  4UC4 A;  3MP8 A;  2LDM A;  2RHI A;  1OZ2 A;  3NTH A;  2R57 A;  2HQE A;  2EQU A;  4EDU A;  5IAY A;  2NLU A;  4BDY A;  4E7H A;  3OYM A;  2P0K A;  3L2Q A;  3PMI A;  3MEV A;  2DAQ A;  2JZ2 A;  3OQ5 A;  2RI3 A;  3ASK A;  4ZTJ A;  3UT1 A;  2RHZ A;  2X35 A;  3UWN A;  4A4H A;  5KE2 A;  5FRN A;  3OYI A;  1OI1 A;  4BE0 A;  3OYL A;  3LGL A;  3Q1J A;  3OYH A;  3LGF A;  3LLR A;  4RG2 A;  3OA6 A;  4B9X A;  4II1 A;  4BD3 A;  2RI5 A;  1OYX A;  3P8D A;  5FRO A;  4BAC A;  2BKD N;  5KCH A;  3PMT A;  2WAC A;  2BUD A;  4C5E A;  2MWO A;  2X4X A;  5FRM A;  4IUQ A;  5C6S A;  1WGS A;  5J39 A;  2LVM A;  3ZEH A;  4PLL A;  1XNI A;  3P8H A;  4BE2 A;  2F5K A;  2RO0 A;  4N4H A;  3OY9 A;  1SSF A;  3OYJ A;  2M16 A;  2RJD A;  3O8V A;  4QQD A;  3E9F A;  3PNW C;  3H8Z A;  3OMG A;  3MEW A;  3M9Q A;  3QJ6 A;  3OYA A;  3S3N A;  2EQM A;  2G3R A;  3L2U A;  3MEA A;  5D6X A;  5D6Y A;  3MEU A;  2L3R A;  4A4G A;  4C5G A;  2JTF A;  3OYG A;  4HCZ A;  3ME9 A;  3H6Z A;  2EFI A;  2FHD A;  3MET A;  3C4S A;  4E7K A;  4LD6 A;  1N27 A;  2R58 A;  3PFS A;  2R5A A; 
#chains in the Genus database with same CATH topology
 3RBB B;  1MMA A;  5GAO r;  3G6E T;  2M0O A;  4XTX A;  2X3X D;  1VUB A;  1W2B A;  1BBZ A;  2CP0 A;  5I2M A;  1Q81 U;  3CCQ A;  1KC8 C;  2MWP A;  4R0K A;  1K73 R;  4PFZ A;  4JS4 A;  3HP9 A;  1YIJ A;  4C0F A;  2CP3 A;  1AWX A;  2VVK A;  4C8Q G;  1JQQ A;  1QQJ A;  3C0C A;  4JZ3 A;  2RI2 A;  1Q82 R;  1UGV A;  3EG0 A;  4C92 B;  1VQO A;  3CC7 Q;  1K76 A;  2CT4 A;  3G71 Q;  3S3M A;  1QVF S;  3SWN B;  4HA8 A;  2P4T A;  3EG9 A;  3FJ5 A;  5FU7 B;  1BI1 A;  2HL5 C;  1I81 A;  2DX1 A;  2QQA A;  1IXD A;  2NUT A;  1N8R U;  2HCK A;  4J6Y A;  1WNL A;  4M7A G;  2RHI A;  4PJM A;  4EDU A;  2A37 A;  1VQ9 Q;  2F1L A;  4J9E A;  3H9N A;  1MV3 A;  1VA7 A;  3CPW A;  2E12 A;  1N6A A;  2NUP A;  4ZGE B;  3CCR Q;  3UDC A;  1WHL A;  1O75 A;  1AEY A;  4II1 A;  4EMK C;  1VYT A;  2MF2 A;  2KRM A;  2KT1 A;  2PU9 B;  2BE9 B;  4M7D B;  1Z9Z A;  3NPF A;  1PRM C;  3O8V A;  1QCO A;  2K6D A;  3H8Z A;  3MEW A;  3CCE T;  2KXC A;  1IHW A;  2QEX A;  4LNP A;  2QG9 B;  3THK A;  2DTI A;  3CME T;  2E4H A;  4MZP A;  3I56 T;  2CSI A;  5A2Q E;  5CAI A;  4HT9 A;  4E7K A;  4GLM A;  3C4S A;  2EKH A;  1QVF P;  4PJO A;  3UA6 A;  3NHN A;  1UFF A;  2EIF A;  3ER0 A;  2ROL A;  2GCX A;  1LCK A;  2K4Y A;  2KNB B;  3EGU A;  1K73 C;  5GAM d;  2CP2 A;  2PZ1 A;  3CCV A;  2C0T A;  2HZY A;  2JMC A;  2BIV A;  1C1A A;  4M77 E;  1M1F A;  3QII A;  1D0X A;  3VU3 C;  4KGZ B;  4QVZ A;  3QO3 A;  2F69 A;  3OS0 A;  1V1C A;  2DL3 A;  3TSZ A;  3A98 A;  2M51 A;  4JLI A;  4FYW B;  1ZSG A;  1D1C A;  1KFZ A;  3KXT A;  2KGT A;  2RN8 A;  2DXT A;  1K9M C;  2AZS A;  3OSS C;  4QT7 A;  3G6E Q;  3I56 Q;  3CPF A;  2E5K A;  1NYF A;  2L5Q A;  2J06 A;  2PUO B;  4M77 C;  1RAH B;  3EGX A;  3BDL A;  4DBR A;  3I5S A;  3TEE A;  2XDP A;  3GNF B;  2K5F A;  3CBM A;  5GAO q;  2EYX A;  5IT9 E;  1UGR B;  4R55 A;  4ZN1 A;  4PJO F;  3NTH A;  3JCM P;  4J9D A;  3OS5 A;  1M30 A;  5IHK A;  4D8K A;  3UT1 A;  5FU7 C;  2EVR A;  2D8J A;  4M7A D;  1VQK T;  1OI1 A;  3QYH B;  1M8M A;  3P8D A;  2K5L A;  1ZX6 A;  3GLX A;  5FLX E;  2BZY A;  3M58 A;  1E6H A;  3OSV A;  3R6O A;  1SSF A;  3OYJ A;  1PNJ A;  4QQD A;  3OYA A;  1R8O B;  1TH7 A;  2A08 A;  5D6Y A;  4F14 A;  1MV0 B;  1YJW Q;  1CKB A;  4V2S A;  4EMK B;  3TU4 K;  2QA4 Q;  4B6M A;  4C8Q F;  4M78 C;  3HFO A;  1AWW A;  4Y92 A;  1NEG A;  2ZPF B;  4IUT A;  1BCO A;  2NUZ A;  4PNO A;  4HVW A;  2ZPE B;  2G6F X;  4D8D A;  1WA7 A;  1QWF A;  5IN1 A;  2O01 E;  2JNG A;  4KH1 B;  4DBQ A;  1H64 1;  2O9V A;  4XU3 A;  2QGF B;  1VQP T;  8ATC B;  4OF1 A;  4E7I A;  1G3W A;  3QG1 A;  1T3S A;  3QJY A;  1K73 U;  2QGG A;  3M55 A;  2FL7 A;  3JCM Q;  2ZPB B;  5CKB A;  4EIK A;  2LQ8 A;  1J3T A;  3VYG A;  2Y4X A;  4ZTF A;  3VS0 A;  5I22 A;  1AZE A;  2L3Q A;  1PKT A;  4VUB A;  2JJ9 A;  2KVQ G;  4HVU A;  1M2V A;  1X43 A;  3M0R A;  3OS1 A;  4KGV B;  1JXM A;  2FEI A;  4AFZ C;  4XK8 E;  2O4X A;  2ESW A;  4Z8A A;  1KHI A;  1BI0 A;  3CEY A;  3EGD B;  3G4S T;  2CP7 A;  1KQ1 A;  1OQK A;  4M77 D;  2W0Z A;  3S6W A;  3CCJ A;  4F04 B;  2LC4 A;  3REA B;  2RQW A;  2JW4 A;  2DE0 X;  4CC2 A;  4MMK A;  2JS2 A;  3G71 A;  5GMK l;  1VQL T;  3CC7 A;  1AZG B;  1NLO C;  4M7D E;  4FT2 A;  4EMH A;  3CCL A;  1AWJ A;  3CQT A;  4J6W A;  1BU1 A;  4KGX B;  1R0C B;  1RAG B;  3SWN C;  4E2F B;  5CKH A;  1PM3 A;  1V76 A;  1GRI A;  3BE3 A;  3QYG B;  5IXB A;  5GAM f;  3CXC A;  2FB7 A;  4J8O A;  1U1S A;  5GMK i;  3RKX A;  3MET A;  3G4S Q;  1Y96 A;  2A36 A;  1WHM A;  1VQK A;  2DKG A;  2PNI A;  1Z9Q A;  2VC8 A;  3CCE Q;  2KT8 A;  2O2O A;  4M7A F;  2EGC A;  3CMA Q;  2DA9 A;  1UDL A;  2MAM A;  2FZC B;  2LCS A;  2IVW A;  2LJ0 A;  4OB2 B;  1ZA1 B;  1Q81 C;  1FMV A;  4MML A;  4M78 B;  3CBO A;  2MK5 A;  1U8R A;  3A5Z B;  2HQX A;  5EG2 A;  4FW2 A;  2QTX A;  3CC2 A;  1VQ6 A;  2ENM A;  4FW1 A;  3X20 B;  2DO3 A;  4L5G A;  1M90 R;  1SSH A;  5GAN h;  1UGS B;  2FZG B;  1VQN A;  3CC4 A;  5L8R E;  2EYY A;  1WHG A;  5LJ5 e;  2JMA A;  4XU0 A;  4OMO A;  2RHU A;  2EYQ A;  2X3W D;  2DVJ A;  2EJF A;  2VAS A;  2PTK A;  2YWW A;  2RQT A;  4A4E A;  3VKI A;  3F70 A;  2GTJ A;  4M78 A;  2K3Y A;  3RNJ A;  2FPD A;  4C5I A;  2FPF A;  2DIG A;  4RKU E;  1BB9 A;  3CCQ T;  3WVE B;  2DD5 A;  1VQM T;  1VQ6 T;  1NYG A;  2OTL A;  2P0K A;  3RMQ A;  1D1B A;  4RTV A;  1KSW A;  4BE0 A;  1HXD A;  4RG2 A;  2HL3 A;  2DXB A;  5AYF A;  1OUL A;  2EGA A;  2HAX A;  5KYX A;  1OX8 A;  1Y7X A;  1M3A A;  2OTJ A;  3CXC S;  3QJ6 A;  3M9Q A;  4EMG A;  5L23 A;  1KG1 A;  3J81 E;  4F16 A;  2JM9 A;  2QXF A;  4C5G A;  2ED0 A;  3X28 B;  4M77 A;  3CCU Q;  3MP6 A;  2HNI A;  5FU6 C;  1B3Q A;  5LJ5 j;  3CC4 T;  2XMF A;  2GQV A;  5GAN e;  2NYS A;  3GIB A;  1UTI A;  2WSC E;  1QLY A;  3OS2 A;  1P92 A;  1RAI B;  4LDX A;  1QCF A;  4F7U B;  3EH2 A;  2A3L A;  3EGD A;  3S3O A;  1YJW A;  4CC7 A;  2O4X B;  1Y07 A;  2HBW A;  1WI7 A;  2JN0 A;  3CPW S;  2DL7 A;  5GAO p;  4Y91 A;  3FRN A;  1KQ2 A;  4RMO A;  3QUI A;  1M2V B;  1MMG A;  4RTY A;  3FC3 A;  1FXX A;  4QVD A;  4XTZ A;  3KUF A;  3MJX A;  3OYY A;  4N4G A;  3JCM b;  3TRE A;  1YIJ T;  1O9S A;  2H3J A;  3QSU A;  1K9M R;  4PJO D;  5IHN A;  5KYU B;  3GPL A;  4IUU A;  4J9C A;  2DL8 A;  2LRQ A;  3QKJ A;  2KDS A;  3AT1 B;  4OP0 A;  5GAN j;  3CCM Q;  4PKC C;  3MP8 A;  3UAT A;  1ZQ1 A;  1TUD A;  2DJZ A;  4EPC A;  4O6J A;  2PVG B;  4HXJ A;  2QEX Q;  3ZFJ A;  3CCS A;  4J9F A;  2F2W A;  1ZUK A;  1W2B P;  4EMK A;  1K8A U;  4ELZ C;  4M7D F;  4M77 F;  1I5L A;  5FRM A;  5C6S A;  3ZEH A;  4FCY A;  4PLL A;  5GMK m;  2C06 A;  2QAZ A;  2HEQ A;  1ZUY A;  1QVP A;  5CCA A;  1EZZ B;  3JB9 I;  5KYN A;  1YWP A;  2VV5 A;  3OYG A;  2WSF E;  3JB9 F;  2COY A;  3M0S A;  2QTV A;  1D0Z A;  3M56 A;  3GP8 A;  2YRV A;  5CR2 A;  4PK4 A;  4E7J A;  4Z02 A;  1Q7Y U;  3M4G A;  5LJ5 h;  1TUG B;  2LCL A;  3JCM J;  3P8B B;  4KRT A;  3V7R A;  1QVG A;  2Z0W A;  4P5N A;  3CCJ T;  2MMP A;  4C0D B;  1TG0 A;  2ECZ A;  3JCM g;  4C8Q D;  3EG3 A;  2JM8 A;  5GJV B;  1OEB A;  1OPK A;  1WJQ A;  3EG1 A;  2EJG A;  2JTM A;  1WPY A;  5LJ5 g;  2X4Y A;  4BI8 B;  4NL2 A;  5GAO n;  3UPU A;  3EFS A;  3FLG A;  1YJ9 T;  4JJC A;  1NBE B;  2DXC A;  3M0P A;  3QDR B;  1IRE B;  4C8Q C;  4X9D A;  1VQ9 T;  4J7I A;  3CCM T;  3DLM A;  1M1K C;  4JJN K;  4JJB A;  2L3P A;  4X34 A;  2KRS A;  1WXT A;  3VS1 A;  3INZ A;  5M9O A;  2O31 A;  3A8H B;  1D3B B;  1G3S A;  2ZPI B;  1D1A A;  3R6N A;  2NLU A;  5IAY A;  1VQ5 Q;  5LJ3 f;  1I8F A;  1VQN Q;  3UWN A;  1YJW T;  4PJO B;  3RUX A;  5CO7 A;  2E64 A;  3REB B;  1SG5 A;  4MZT A;  2V8I A;  1UEC A;  1RAE B;  2RI5 A;  2BZX A;  1TU0 B;  5D7U A;  5KCH A;  4A53 A;  2ZPH B;  3PMT A;  4JRP A;  3RES A;  4C5E A;  1XJW B;  1RAA B;  9ATC B;  5J39 A;  2LVM A;  4AG1 C;  1HK9 A;  5IXF A;  1FYN A;  3PVQ A;  1BCM A;  3OMG A;  3S3N A;  4PFO A;  3MEU A;  2QI2 A;  3QWY A;  2KRO A;  2EFI A;  4M77 G;  3CCE A;  4PJO E;  1K8A R;  1Q82 C;  1Q86 R;  2DNU A;  2K5I A;  3LYI A;  1ZSZ C;  5J3B A;  2EQJ A;  4RCC A;  2HQH A;  3RER A;  1WIE A;  5CIU A;  1NG2 A;  5GAM h;  4LE9 A;  2LQW A;  1YJ9 A;  1MMN A;  2QDY B;  2HBP A;  1NJI C;  2IPO B;  3EH1 A;  1X2Q A;  4OMP A;  2XD0 A;  2DL4 A;  3JCM d;  1GXI E;  4IIO A;  2XHC A;  2AKL A;  2OJ2 A;  1WLP B;  4C92 F;  5GAN 7;  1BI2 A;  1VYV A;  3SWN A;  1IHV A;  2EYW A;  1VQ8 T;  3CCU A;  3VV0 A;  3VS6 A;  1YFN A;  5LJ5 d;  3CCL Q;  4NS5 A;  2RQV A;  1TXQ A;  4C92 A;  3U23 A;  4FYY B;  4JPB W;  1VQ4 Q;  3RDV A;  5CQX A;  2CH4 W;  1PD0 A;  3CXC P;  4HCK A;  1RAB B;  2CS7 A;  2DVE A;  5FU6 B;  1YN8 A;  2RA2 A;  1VQ6 Q;  1AHJ B;  2E6Z A;  1W2B S;  3I56 A;  1VQ4 A;  4J83 A;  3RIR A;  4CRI A;  3CME A;  4QKU A;  3OBW A;  1Q7Y R;  2GBQ A;  2HKQ B;  2LTO A;  5IH2 A;  2X51 A;  4OB0 B;  3CC2 T;  1M90 U;  1VQ7 T;  3RR6 A;  4D6W A;  2YHT A;  3ASK A;  4ZTJ A;  1PSE A;  2KQW A;  2QQ9 A;  3OYL A;  3JCM W;  3HRT A;  2XKO C;  4J7F A;  1IGU A;  2FZK B;  2K9G A;  3OA6 A;  4J6X A;  1XOV A;  1M5Q 1;  4C8Q A;  2CUB A;  3M0Q A;  2DIL A;  3PVL A;  3M4Y A;  4OB1 B;  3RKW A;  2RD1 A;  4BUG A;  1Q81 R;  5GAO m;  1KC8 U;  5GMK e;  1Y57 A;  5A0G A;  3LWI A;  2LT4 A;  3DLL A;  5D6X A;  2GNC A;  2MOX A;  1EX4 A;  8AT1 B;  2EJ9 A;  1FX7 A;  3BDU A;  4JZ4 A;  4LD6 A;  2E65 A;  4ZGD B;  2ZZD A;  1TS9 A;  2HMA A;  2OAW A;  4IUV A;  2A0F B;  4DEY A;  4QW2 A;  1QWE A;  2ABL A;  6AT1 B;  1ZBX A;  4JRQ A;  5ECA A;  2KY9 A;  2GFU A;  2KEA A;  5FWB A;  4M7A B;  3MP1 A;  1JU5 C;  4JDS A;  4DOW A;  1S72 Q;  1M3C A;  2ZGW A;  3JB9 D;  3TQ7 P;  3HFN A;  3G71 T;  2XG8 D;  1K4U S;  2V8K A;  2PQW A;  2YRC A;  1AVZ C;  3GOX A;  3OYB A;  1YIT Q;  2DZC A;  2V26 A;  1KQS A;  1IRX A;  1M3B A;  1S1N A;  2L2P A;  2X4W A;  4LDY A;  3HHT B;  4C92 G;  2K7A A;  1NPP A;  1C6V X;  2M1H A;  5GAM j;  4ESR A;  2CUD A;  1MHN A;  2QQR A;  3VS5 A;  3TVT A;  1G5V A;  4RCB A;  2DIQ A;  4OML A;  5IHI A;  4A54 A;  1JJ2 S;  3OMC A;  1QVG S;  2DM1 A;  1M1K R;  4C0D C;  2AZV A;  1B7T A;  2CH4 A;  3RKY A;  2CZ1 B;  2RHZ A;  3OW2 A;  4OMN A;  2DXU A;  1XQH A;  2F2V A;  1I5O B;  1I4K 1;  4B9X A;  4XU1 A;  2KXD A;  4ELY C;  1FMK A;  1PC0 A;  4A63 B;  2X4X A;  3JCM X;  5I21 A;  1T0H A;  2JOY A;  2XDB A;  4BE2 A;  2WSE E;  4M4Z A;  2KAF A;  2RO0 A;  4N4H A;  3H41 A;  1AD5 A;  2CT3 A;  1BI3 A;  1WX6 A;  4C8Q B;  1VQP Q;  2DTO A;  2ZCF B;  2XID A;  1QP2 A;  2H3E B;  3I55 T;  2B86 A;  4M7D D;  1SEM A;  2J7I A;  4OMM A;  3JCM c;  1YWO A;  3FB9 A;  3OYF A;  1YHQ A;  2VWF A;  3GBQ A;  5GAN 5;  4PJO C;  1YJN Q;  3SHW A;  3JB9 J;  3DB4 A;  1HD3 A;  3MKD A;  1Y71 A;  1KD1 R;  1PSF A;  4KH0 B;  3CC7 T;  3EG2 A;  1H8K A;  2AIR B;  2PUK B;  2L3S A;  4DBH A;  1H3Z A;  3L2W A;  1SKU B;  4F7U F;  4M75 C;  1YNZ A;  2XDD A;  1SRL A;  3L2V A;  4ZGJ B;  2C0I A;  5GAM e;  3OYE A;  1SHF A;  2HKN A;  1YJ9 Q;  3I35 A;  2GF7 A;  4FT4 A;  3VJP A;  1KHC A;  4JRK A;  2A28 A;  5HK3 A;  3HL8 A;  1VQ9 A;  1OZ3 A;  2FVU A;  2LP5 A;  1X2K A;  4J9I A;  2AKK A;  2VYT A;  2RJE A;  4C92 D;  3CCR A;  3CD6 A;  2DRM A;  3O5Z A;  1WQW A;  3OYD A;  1YHQ T;  1K1Z A;  4AFQ C;  2K57 A;  1YCY A;  1GBR A;  4F7U E;  2JZ2 A;  3HRU A;  2KK4 A;  4C8Q E;  1M4Z A;  1E6G A;  2RK2 A;  2LT1 A;  3LGF A;  1ABQ A;  4WCI A;  1MMD A;  1Q86 C;  5CVI A;  1W6X A;  4IUQ A;  3QZ5 B;  3J7A F;  4M75 E;  1M1K U;  1FMW A;  1PG5 B;  2LQK A;  2GTO A;  3OW2 P;  1SPK A;  2O9S A;  1YJN A;  1NEB A;  4ZNX A;  2VXE A;  3PE0 A;  2JTF A;  4LDU A;  2KSS A;  3HPW A;  3DKM A;  5DM7 R;  3X24 B;  4QVC A;  1N27 A;  4DA4 A;  7AT1 B;  1K0X A;  5A0D A;  4M7A E;  3JV3 A;  3H0I A;  4HVV A;  1D3B A;  3AHU A;  4M78 F;  2YUQ A;  1ZUU A;  1YI2 Q;  1IGQ A;  1HYO A;  3ZBD A;  2JTE A;  1X27 A;  2AT1 B;  2DMO A;  2R5M A;  1YI2 T;  4IUP A;  2QAS A;  4LDV A;  5GAN 3;  2JXB A;  4QQG A;  3SD4 A;  1Y0M A;  4XAX B;  2ROT A;  1B07 A;  4Z88 A;  1RLP C;  4PFP A;  2P0Q A;  5KH6 A;  1T0J A;  1WJR A;  1AOJ A;  3GF5 A;  1KD1 U;  5LJ3 g;  2RHY A;  3HRS A;  4M75 B;  3PIP A;  2O88 A;  4AG2 C;  2J6F A;  2E3H A;  2RQR A;  3IQL A;  3MO8 A;  2KMT A;  4C92 C;  3E9G A;  3EHQ A;  3LH0 A;  2M02 A;  4UC4 A;  4Z89 A;  3HTR A;  4LUD A;  1YCS B;  1VQ5 T;  2DAQ A;  3M0T A;  4M75 G;  4A4H A;  1NJI R;  5FRN A;  4BI4 A;  1SRM A;  5FRO A;  3X25 B;  2WAC A;  2HDA A;  3CCV T;  1Q95 G;  1JO8 A;  3A8G B;  2QYZ A;  1KD1 C;  1OOT A;  2M16 A;  2RNA A;  3NGP A;  2Y90 A;  1D09 B;  4RG8 A;  4A4G A;  4OGE A;  2ZPG B;  1WYX A;  1X01 A;  1JB0 E;  3PFS A;  2OAU A;  2E5Q A;  3A8O B;  4Y28 E;  4L59 A;  1KIK A;  1OU8 A;  4N0A C;  5GJW B;  1VQ7 A;  3M54 A;  1JRI A;  2DBK A;  4RTW A;  2DF6 A;  1UE9 A;  2KRN A;  3E2U A;  4FL6 A;  2NWM A;  2GGR A;  4RTZ A;  5KYU A;  3CCQ Q;  4MDX A;  2KYB A;  4E47 A;  1BIB A;  4ATO A;  2E1H A;  3H0F A;  1WXU A;  3NTI A;  5GAO l;  3OBY A;  4M7D G;  2LZ6 B;  1S72 T;  3VS4 A;  1YBY A;  4FU6 A;  2C0O A;  2YUP A;  3URG A;  4C0G A;  3PGG A;  3FIF A;  2OX7 A;  2V1Q A;  1VQ8 A;  2X9H A;  1YHQ Q;  3I5R A;  2GFA A;  5LJ3 d;  2CDT A;  1YI2 A;  1NE8 A;  4FM4 B;  2LX7 A;  1MUZ A;  2D8H A;  1I0C A;  4A4F A;  2DER A;  2OTL Q;  4PLI A;  4F7U A;  1XTD A;  2VXF A;  1VQO T;  2FO0 A;  1X6G A;  4HT8 A;  2QEX T;  2XU8 A;  1D0Y A;  2ATC B;  1MNE A;  2RI3 A;  3MPU B;  4M77 B;  2LX9 A;  3L2Z A;  1M2O A;  1GBQ A;  5GAN 6;  3Q1J A;  2E10 A;  3SB2 A;  3G1J A;  1G3T A;  1PD1 A;  3D7S B;  1VQ7 Q;  1UHC A;  1TUC A;  2OTJ Q;  3VS3 A;  1WGS A;  2EPD A;  1QP3 A;  2QA4 T;  4KUI A;  1UB4 A;  5KYX B;  3CC2 Q;  1VQM A;  1KJW A;  1LJO A;  1BYM A;  3MHX A;  4MDW A;  1B34 B;  2ED1 A;  3V7S A;  1VQL A;  2LNV A;  3QWX X;  4DEX A;  1IB8 A;  2DL5 A;  2RJF A;  2MPX C;  1QW1 A;  2KBT A;  3M59 A;  5DY9 A;  1RI0 A;  1QCN A;  3FJP A;  1VQ5 A;  1YIT T;  4E7S A;  2P84 A;  3A8M B;  3LH5 A;  1VQ4 T;  3LW5 E;  4JUV A;  1YP5 A;  4BY6 B;  3NTK A;  3CCL T;  3G4S A;  4LUE A;  3VRZ A;  3CCM A;  2PVO B;  1UGQ B;  2VKN A;  3GNG A;  3QBY A;  3E1S A;  1W1F A;  5GAN 2;  3DB3 A;  3JCM h;  4IIM A;  2RQU A;  4XTW A;  2LNH B;  1AT1 B;  4WF2 A;  2E6N A;  3KBG A;  2CZ7 B;  2K79 A;  2LCC A;  2DYI A;  2L8D A;  1X6O A;  1WDX A;  1DJ7 B;  5HY6 A;  4E7Z A;  3V8L A;  3JRZ A;  4XTU A;  4CC4 B;  2BZ8 A;  3G6E A;  5GAM g;  1QKW A;  1V29 B;  2W10 A;  4Q5W A;  2XIC A;  2FG0 A;  2D6F A;  2AK5 A;  2KI7 A;  3JB9 H;  1JEG A;  5D6W A;  2VB6 A;  2FRW A;  4M75 F;  4J9G A;  4ZN3 A;  3PT9 A;  5GMK h;  1OZ2 A;  2R57 A;  1K0S A;  4BDY A;  4JLG A;  4E7H A;  1HJD A;  1PKS A;  3JSC A;  1K9A A;  1NPR A;  2FPE A;  2FRY A;  1Y96 B;  1Q7Y C;  1N9S A;  2DLP A;  2MI6 A;  4BB7 A;  2EYZ A;  1X6B A;  1B34 A;  1OYX A;  1LVK A;  4LDW A;  1OPL A;  1WXB A;  1RUW A;  1NZ9 A;  1XNI A;  3CC4 Q;  1VOM A;  4HCB A;  2M0Y A;  2RJD A;  2DK3 A;  3E9F A;  3I55 Q;  2FYK A;  3SEM A;  4FSS A;  1RL2 A;  5HCK A;  5CKD A;  4XTV A;  2EBP A;  2P0P A;  3VS7 A;  5CK9 A;  3OW2 S;  1RI9 A;  3N5B B;  4C5H A;  1VQ8 Q;  1I1J A;  5J26 A;  1CKA A;  1F1B B;  3C95 A;  3PTA A;  1VIF A;  2XK0 A;  3CBP A;  3BY7 A;  2LQN A;  2L0A A;  1GCQ A;  4C92 E;  1KK7 A;  3UF4 A;  4ANJ A;  2YDL A;  5KCO A;  1VIE A;  4LD9 K;  1LPL A;  3EAE A;  1UEB A;  1UG1 A;  1UJ0 A;  4QQ6 A;  3CCV Q;  2YSQ A;  4M78 D;  4L6V 5;  1VQM Q;  1JXO A;  2QK0 A;  3CD6 Q;  2E41 A;  5DLO A;  1TTH B;  3ULR B;  4BY6 C;  4KT0 E;  2VUB A;  3LX7 A;  1M1G A;  1NM7 A;  3X26 B;  2A7Y A;  2EAY A;  4KUL A;  1ACM B;  4AT1 B;  2D0Q B;  1U3O A;  1NLP C;  1WQ7 A;  1UHF A;  3FEO A;  1C0M A;  4JS5 A;  2SEM A;  1M9S A;  2D0N A;  4RTU A;  4B9W A;  1VYU A;  1CSK A;  3NMZ C;  2HSP A;  1QVF A;  1S72 A;  1M90 C;  3L2Q A;  2DFU A;  3MEV A;  3OQ5 A;  2KR3 A;  5KE2 A;  3LGL A;  4ORZ A;  2J6K A;  4M7A C;  2HSE B;  4BD3 A;  1U06 A;  4RTT A;  2RK1 A;  2F2X A;  2X4J A;  3T9N A;  1PHT A;  2RMO A;  5LL6 S;  2DEU A;  2OTJ T;  2BE7 D;  4RTX A;  2CZ6 B;  3NFC A;  3P8H A;  4C0Z A;  1BIA A;  2DBM A;  1UJY A;  3PNW C;  3WXM B;  3L2U A;  1M8V A;  1GCQ C;  2L3R A;  5AT1 B;  5GAN 8;  3CCS T;  1QKX A;  2R5A A;  2AHJ B;  1K9M U;  2DZ9 A;  1TSF A;  2OI3 A;  2LJ3 A;  3BFM A;  4PL6 A;  2K3B A;  4JRI A;  1R0B G;  5KE3 A;  2RF0 A;  1WZO A;  1VQO Q;  4F7U G;  3CCS Q;  1RAC B;  4OB3 B;  1W4S A;  2VGN A;  2LMJ A;  3VRY A;  4CI0 C;  4ME7 A;  3V8J A;  4BI3 A;  1JJ2 A;  1GCP A;  5GAN d;  5CKF A;  1WFW A;  4DBF A;  3EGX B;  4M75 A;  4IKF A;  5I2S A;  4J9B A;  3C94 A;  4BE1 A;  2D9T A;  4E6R A;  1N8R R;  1UUE A;  2KE9 A;  4FIB A;  2QQB A;  1K8A C;  4GBQ A;  2YUN A;  2QQS A;  1OX9 A;  2HD0 A;  3QZ9 B;  3CCU T;  1EFN A;  1WJS A;  1KC8 R;  4NL3 A;  1GFC A;  1X75 C;  3RMS A;  2YLC A;  1R77 A;  2RPN A;  5GMK j;  2BTT A;  2F5T X;  5LJ3 j;  1KQS P;  3BW1 A;  1M27 C;  3JCM e;  4X9C A;  1LOJ A;  3FDR A;  2IG0 A;  5C0M A;  2EWN A;  2XI9 A;  4GY5 A;  2LDM A;  1BKB A;  4FYX B;  2IIM A;  2EGE A;  2HQE A;  2JT4 A;  3PMI A;  2KYM A;  2LJ1 A;  3C12 A;  3WVD B;  3LLR A;  2VGM A;  2H8H A;  2V1R A;  1IZ6 A;  2MCN A;  2DEQ A;  1N8R C;  4OGC A;  1N9R A;  2J05 A;  4M7D A;  1ZHI A;  1G3Y A;  2MIO A;  1EIF A;  3J80 E;  2EQM A;  5EC7 A;  5LJ5 f;  1RAF B;  2DPP B;  2NUP B;  3EFR A;  3CMA A;  1YJN T;  4AMC A;  4KUD K;  3QDF A;  2B8A A;  3JCM f;  2OTL T;  3OYK A;  3ZL7 C;  1WHH A;  4AFU C;  4JJD A;  2NUT B;  3V8K A;  4K11 A;  1I07 A;  1A0N B;  1PWT A;  3I9Q A;  3OB9 A;  1MGQ A;  3EG9 B;  1VQK Q;  5I11 A;  4BDZ A;  2K2M A;  4OVA A;  1Q86 U;  1WHJ A;  2YT6 A;  1G83 A;  2YUO A;  1VQN T;  3JCM V;  2I0N A;  3CME Q;  3LWH A;  4AFS C;  2EKO A;  4X1V A;  3M57 A;  3V7C A;  3QXE B;  2L89 A;  1PRL C;  1UGP B;  2MYS A;  2RB6 A;  1NJI U;  1E7O A;  2RJC A;  4WTO B;  4M7D C;  5FW9 A;  4PJO G;  3KFV A;  2RH2 A;  3OYN A;  2CGH A;  3OYC A;  2CZ0 B;  4TVR A;  1RLQ C;  2COZ A;  1X69 A;  1Q82 U;  2DD4 A;  5GAN f;  2DET A;  4YTL A;  2JVV A;  3A8L B;  3M5A A;  2YXY A;  1G8X A;  4KBM B;  3G7Z A;  2ZAE A;  1U5S A;  2I2L A;  1SHG A;  3JB9 G;  3OYI A;  2YLB A;  3CCJ Q;  3VUB A;  1OU9 A;  1H3H A;  1JBM A;  3EHR A;  4BAC A;  1T3L A;  3MCA B;  2D1X A;  1TOV A;  5KYW A;  2BUD A;  3H0H A;  2MWO A;  4M75 D;  1VQL Q;  4O5V A;  1U1T A;  5DLQ E;  5LJ3 h;  2F5K A;  3VS2 A;  3OY9 A;  3VYH B;  1SF9 A;  1JJ2 P;  4RUG A;  4HCC A;  2G3R A;  2SRC A;  3MEA A;  1OV3 A;  1MND A;  3EFO A;  1QMC A;  3ME9 A;  4HCZ A;  3TCJ A;  3HSB A;  2FHD A;  2Y4Y A;  3CD6 T;  2JUF A;  2R58 A;  1BK2 A;  2DRK A;  4DQ2 A;  3PIO A;  5KYY A;  4IUR A;  2DTH A;  4N0A A;  3L42 A;  2COW A;  1AWO A;  4CC3 A;  4GLK A;  5GAN 4;  3QHS A;  2K3X A;  1FWZ A;  4M78 E;  5HKC A;  2GQI A;  3TSW A;  2DJQ A;  4OMQ A;  4HKE A;  1W70 A;  3CCR T;  3L2R A;  2EW3 A;  2M9U A;  1IO6 A;  4FSX A;  1N5Z A;  4PJN A;  1ZSZ B;  4LN2 A;  1H92 A;  4J9H A;  4LXC A;  3E19 A;  4PJJ A;  4OMF B;  3QPH A;  4DOV A;  1RAD B;  4NOY A;  4E7L A;  1ZA2 B;  2EQK A;  3M53 A;  3JAM E;  5CQY A;  1YIT A;  1ZLM A;  2QDL A;  3M0U A;  2CSQ A;  4N4I A;  4XQ3 A;  1ZSZ A;  2CKK A;  1VQP A;  2EQI A;  2J6O A;  1YIJ Q;  4M7A A;  2RHX A;  2JS0 A;  3L1A A;  2P4R A;  2CP5 A;  2CP6 A;  5LJ3 e;  2CYZ B;  2E3I A;  2E70 A;  5A0L A;  2EQU A;  3SDZ A;  2QA4 A;  1ARK A;  3VUZ A;  3OYM A;  1QVG P;  5KYY B;  3HKS A;  1PCX A;  2X35 A;  4FYV B;  3UA7 A;  1WHK A;  4MZM A;  3OYH A;  2CRE A;  3I55 A;  5FWC A;  3EFO B;  2BKD N;  1KQS S;  4R56 A;  1G2B A;  2PVD B;  2DYB A;  5GAN g;  2YRD A;  1GL5 A;  1HSQ A;  3CPW P;  2K2V A;  4PJL A;  2RM4 A;  4F17 A;  1LNX A;  4J5Y A;  5KYW B;  1GFD A;  1ABO A;  3CMA T;  2V8J A;  3SFM A;  4M78 G;  1TWB A;  5CKE A;  5HK0 A;  3H6Z A;  3A1P A;  4XU2 A;  1ZBJ A;  4XTY A;  4A4K A; 
#chains in the Genus database with same CATH homology
 4M77 A;  5CK9 A;  3G6E T;  2M0O A;  3MP6 A;  3N5B B;  2HNI A;  4XTX A;  5FU6 C;  3JCM c;  3OW2 S;  1VUB A;  4C5H A;  3FB9 A;  5LJ5 j;  1W2B A;  4M7D E;  5J26 A;  3OYF A;  3CC4 T;  2GQV A;  5GAN e;  1YHQ A;  3GIB A;  3C95 A;  2WSC E;  3PTA A;  1VIF A;  5I2M A;  5GAN 5;  2XK0 A;  1P92 A;  3OS2 A;  1Q81 U;  3CCQ A;  1KC8 C;  4PJO C;  2MWP A;  3CBP A;  4LDX A;  3JB9 J;  3DB4 A;  4F7U B;  1Y71 A;  2A3L A;  3BY7 A;  1PSF A;  4JS4 A;  4C92 E;  3CC7 T;  3S3O A;  1YJW A;  5KCO A;  1VIE A;  2PUK B;  4LD9 K;  2O4X B;  1Y07 A;  3EAE A;  1UEB A;  3HP9 A;  4C0F A;  4C8Q G;  1YIJ A;  1H3Z A;  3L2W A;  4F7U F;  4M75 C;  2JN0 A;  2XDD A;  3CPW S;  5GAO p;  2RI2 A;  4Y91 A;  3FRN A;  1KQ2 A;  4QQ6 A;  4RMO A;  3QUI A;  3L2V A;  4ZGJ B;  4M78 D;  4L6V 5;  3FC3 A;  2E41 A;  4C92 B;  5DLO A;  1VQO A;  1FXX A;  5GAM e;  4BY6 C;  4QVD A;  3OYE A;  4KT0 E;  4XTZ A;  2VUB A;  3LX7 A;  3S3M A;  1M1G A;  2GF7 A;  4FT4 A;  3KUF A;  2A7Y A;  1KHC A;  2EAY A;  4JRK A;  4KUL A;  3SWN B;  3VJP A;  3X26 B;  5HK3 A;  3HL8 A;  4HA8 A;  1VQ9 A;  3OYY A;  4N4G A;  3JCM b;  2D0Q B;  3TRE A;  1YIJ T;  2P4T A;  1O9S A;  2H3J A;  1OZ3 A;  2FVU A;  3QSU A;  1WQ7 A;  3FEO A;  5FU7 B;  1BI1 A;  4PJO D;  4JS5 A;  2VYT A;  1I81 A;  2RJE A;  4C92 D;  3CCR A;  3GPL A;  4IUU A;  3CD6 A;  1M9S A;  2QQA A;  2LRQ A;  3QKJ A;  4B9W A;  2KDS A;  1N8R U;  4J6Y A;  4OP0 A;  5GAN j;  3OYD A;  1WNL A;  1WQW A;  1YHQ T;  4M7A G;  4PKC C;  3MP8 A;  1S72 A;  2RHI A;  1QVF A;  4EDU A;  1ZQ1 A;  2K57 A;  1YCY A;  1M90 C;  3L2Q A;  3MEV A;  3OQ5 A;  2JZ2 A;  2DJZ A;  3HRU A;  4F7U E;  2KK4 A;  4EPC A;  4C8Q E;  1M4Z A;  5KE2 A;  4O6J A;  2RK2 A;  2PVG B;  3CCS A;  3ZFJ A;  3CPW A;  2E12 A;  2LT1 A;  1N6A A;  3LGL A;  3LGF A;  4ZGE B;  3UDC A;  1O75 A;  4M7A C;  4II1 A;  4BD3 A;  4EMK A;  4EMK C;  1Q86 C;  4ELZ C;  1K8A U;  4M7D F;  4M77 F;  2RK1 A;  5CVI A;  2MF2 A;  2X4J A;  3T9N A;  5LL6 S;  2PU9 B;  2OTJ T;  1I5L A;  5FRM A;  4IUQ A;  2CZ6 B;  5C6S A;  3ZEH A;  3NFC A;  4PLL A;  3P8H A;  4C0Z A;  3QZ5 B;  5GMK m;  2C06 A;  3J7A F;  4M7D B;  1BIA A;  4M75 E;  1M1K U;  3O8V A;  2LQK A;  3PNW C;  3WXM B;  3H8Z A;  1QVP A;  3MEW A;  3CCE T;  5CCA A;  3L2U A;  2QEX A;  1YJN A;  1M8V A;  2VXE A;  2L3R A;  3JB9 I;  2DTI A;  2JTF A;  3CME T;  3OYG A;  2VV5 A;  2KSS A;  3HPW A;  4LDU A;  2WSF E;  3DKM A;  4MZP A;  5CAI A;  5GAN 8;  5DM7 R;  3C4S A;  5A2Q E;  3X24 B;  3CCS T;  4E7K A;  3JB9 F;  4QVC A;  1N27 A;  4DA4 A;  4PJO A;  2R5A A;  2AHJ B;  5A0D A;  1K9M U;  2DZ9 A;  4M7A E;  2EIF A;  3ER0 A;  2GCX A;  3BFM A;  2K4Y A;  4PL6 A;  4JRI A;  5KE3 A;  1D3B A;  3M56 A;  1K73 C;  3AHU A;  5GAM d;  4F7U G;  3GP8 A;  2YRV A;  4M78 F;  5CR2 A;  4E7J A;  3CCV A;  4Z02 A;  1Q7Y U;  4OB3 B;  1W4S A;  3M4G A;  2VGN A;  5LJ5 h;  2BIV A;  2LCL A;  4CI0 C;  4M77 E;  4ME7 A;  3P8B B;  1M1F A;  3V8J A;  3V7R A;  4BI3 A;  4P5N A;  3ZBD A;  2MMP A;  3CCJ T;  3QII A;  1QVG A;  3VU3 C;  4C0D B;  5GAN d;  1JJ2 A;  4QVZ A;  5CKF A;  3QO3 A;  2F69 A;  3OS0 A;  2R5M A;  3JCM g;  4M75 A;  4C8Q D;  4IKF A;  1YI2 T;  5I2S A;  4IUP A;  3C94 A;  3I56 T;  4LDV A;  4BE1 A;  2D9T A;  5GAN 3;  4JLI A;  1WJQ A;  2EJG A;  4QQG A;  3SD4 A;  2JTM A;  1WPY A;  5LJ5 g;  4FIB A;  4XAX B;  2QQB A;  3KXT A;  2X4Y A;  4BI8 B;  4NL2 A;  5GAO n;  3UPU A;  1K8A C;  2DXT A;  3EFS A;  1K9M C;  3OSS C;  3FLG A;  1YJ9 T;  2P0Q A;  2QQS A;  5KH6 A;  1WJR A;  2HD0 A;  3QZ9 B;  3CCU T;  1WJS A;  3CPF A;  3GF5 A;  4NL3 A;  1QVF S;  1KD1 U;  1X75 C;  2DXC A;  2L5Q A;  2PUO B;  3RMS A;  2YLC A;  3QDR B;  1IRE B;  4C8Q C;  2RHY A;  3HRS A;  2F5T X;  4M75 B;  4M77 C;  4X9D A;  5GMK j;  5LJ3 j;  5LJ3 g;  4J7I A;  3PIP A;  3CCM T;  3BW1 A;  3BDL A;  1VQ9 T;  3DLM A;  1M1K C;  3TEE A;  3JCM e;  4JJN K;  2XDP A;  3GNF B;  4X9C A;  3MO8 A;  2KMT A;  4X34 A;  4C92 C;  1LOJ A;  3FDR A;  2IG0 A;  2K5F A;  3CBM A;  3E9G A;  3INZ A;  3LH0 A;  5GAO q;  5IT9 E;  5C0M A;  2EWN A;  5M9O A;  1Q82 U;  1UGR B;  2XI9 A;  4UC4 A;  4GY5 A;  4R55 A;  2LDM A;  4ZN1 A;  4PJO F;  1BKB A;  3NTH A;  3A8H B;  1D3B B;  1G3S A;  2HQE A;  2ZPI B;  5IAY A;  2NLU A;  3JCM P;  1VQ5 T;  5LJ3 f;  1I8F A;  3OS5 A;  3PMI A;  2DAQ A;  4M75 G;  3UT1 A;  3C12 A;  5FU7 C;  3UWN A;  4A4H A;  1YJW T;  5FRN A;  3WVD B;  4M7A D;  1VQK T;  1OI1 A;  3RUX A;  4BI4 A;  4PJO B;  5CO7 A;  3QYH B;  2E64 A;  3LLR A;  4MZT A;  2V8I A;  2VGM A;  2RI5 A;  5FRO A;  3P8D A;  2K5L A;  3X25 B;  1IZ6 A;  3GLX A;  5KCH A;  4A53 A;  2ZPH B;  3PMT A;  2WAC A;  5FLX E;  4JRP A;  3RES A;  3CCV T;  4C5E A;  3M58 A;  2DEQ A;  1N8R C;  3A8G B;  4OGC A;  5J39 A;  2LVM A;  1N9R A;  3OSV A;  1KD1 C;  4M7D A;  1ZHI A;  3R6O A;  1HK9 A;  1SSF A;  1G3Y A;  2M16 A;  3OYJ A;  4QQD A;  3OYA A;  1EIF A;  3OMG A;  3J80 E;  3S3N A;  1R8O B;  2EQM A;  1TH7 A;  2Y90 A;  5D6Y A;  3MEU A;  4V2S A;  4RG8 A;  4A4G A;  4OGE A;  2QI2 A;  2ZPG B;  4EMK B;  3TU4 K;  5LJ5 f;  3JCM J;  1X01 A;  2EFI A;  4M77 G;  2DPP B;  1JB0 E;  3EFR A;  3CMA A;  4C8Q F;  1YJN T;  4M78 C;  3HFO A;  3PFS A;  2OAU A;  3CCE A;  4KUD K;  4PJO E;  2ZPF B;  1Q82 C;  2E5Q A;  3A8O B;  2K5I A;  2B8A A;  4IUT A;  3LYI A;  4L59 A;  4Y28 E;  4PNO A;  5J3B A;  2EQJ A;  2ZPE B;  3JCM f;  2OTL T;  4RCC A;  4N0A C;  3RER A;  1VQ7 A;  5CIU A;  5GAO r;  3M54 A;  5GAM h;  5IN1 A;  1JRI A;  3OYK A;  1YJ9 A;  2O01 E;  2JNG A;  2QDY B;  1H64 1;  2HBP A;  4XU3 A;  1NJI C;  1VQP T;  4E7I A;  4OF1 A;  1G3W A;  3QG1 A;  3V8K A;  4FL6 A;  4MDX A;  3QJY A;  3OB9 A;  2XD0 A;  1K73 U;  3JCM Q;  3M55 A;  1MGQ A;  2FL7 A;  4E47 A;  3JCM d;  1BIB A;  4ATO A;  2E1H A;  2ZPB B;  1GXI E;  5CKB A;  2XHC A;  3NTI A;  5GAO l;  4BDZ A;  2LQ8 A;  3OBY A;  4C92 F;  4OVA A;  5GAN 7;  1BI2 A;  3VYG A;  1Q86 U;  2Y4X A;  4ZTF A;  4M7D G;  3SWN A;  4HT9 A;  1VQN T;  1S72 T;  1VQ8 T;  4VUB A;  3CCU A;  3JCM V;  3VV0 A;  5LJ5 d;  1YBY A;  3LWH A;  4FU6 A;  4NS5 A;  2EKO A;  4C92 A;  2KVQ G;  3M57 A;  3V7C A;  3QXE B;  3URG A;  4C0G A;  2L89 A;  3PGG A;  3OS1 A;  3FIF A;  5CQX A;  1UGP B;  1VQ8 A;  2RB6 A;  4XK8 E;  1NJI U;  2CS7 A;  2RJC A;  4M7D C;  4PJO G;  2DVE A;  2RH2 A;  5FU6 B;  2GFA A;  2O4X A;  2RA2 A;  5LJ3 d;  3OYN A;  1AHJ B;  1NE8 A;  2CGH A;  3OYC A;  2E6Z A;  4FM4 B;  1KHI A;  1YI2 A;  1BI0 A;  3CEY A;  3G4S T;  2CZ0 B;  4TVR A;  1KQ1 A;  1W2B S;  4M77 D;  4A4F A;  3S6W A;  4PLI A;  4F7U A;  3I56 A;  1XTD A;  2VXF A;  2DD4 A;  4J83 A;  3RIR A;  4CRI A;  2LC4 A;  3CME A;  3CCJ A;  1VQ4 A;  1VQO T;  3OBW A;  5GAN f;  4HT8 A;  2QEX T;  4YTL A;  2JVV A;  2LTO A;  2XU8 A;  3A8L B;  3M5A A;  4OB0 B;  3CC2 T;  4KBM B;  1M90 U;  1VQ7 T;  4D6W A;  3G7Z A;  4MMK A;  2YHT A;  2RI3 A;  3ASK A;  3G71 A;  4ZTJ A;  4M77 B;  2LX9 A;  2I2L A;  3L2Z A;  5GMK l;  1VQL T;  3CC7 A;  3JB9 G;  1PSE A;  2YLB A;  2KQW A;  2QQ9 A;  3OYL A;  3OYI A;  3VUB A;  4FT2 A;  3Q1J A;  1JBM A;  3HRT A;  4EMH A;  5GAN 6;  2E10 A;  2XKO C;  3SB2 A;  3CCL A;  4J7F A;  3OA6 A;  1G3T A;  4J6X A;  4BAC A;  1XOV A;  1M5Q 1;  3MCA B;  4J6W A;  2BUD A;  2MWO A;  4M75 D;  4C8Q A;  1WGS A;  4O5V A;  1U1T A;  5DLQ E;  3SWN C;  5LJ3 h;  2F5K A;  3M4Y A;  4OB1 B;  3RKW A;  2RD1 A;  1QP3 A;  5CKH A;  4KUI A;  4BUG A;  5GAO m;  1UB4 A;  3VYH B;  3OY9 A;  2QA4 T;  1KC8 U;  5GMK e;  5A0G A;  3LWI A;  3QYG B;  2LT4 A;  1VQM A;  3DLL A;  5GAM f;  4HCC A;  2G3R A;  3CXC A;  3MEA A;  5D6X A;  1LJO A;  2FB7 A;  4J8O A;  3MHX A;  1BYM A;  4MDW A;  1U1S A;  1B34 B;  3ME9 A;  4HCZ A;  3TCJ A;  5GMK i;  3HSB A;  2FHD A;  3MET A;  3RKX A;  2EJ9 A;  1FX7 A;  2Y4Y A;  2JUF A;  3BDU A;  4LD6 A;  3CD6 T;  1Y96 A;  2E65 A;  3V7S A;  2R58 A;  2LNV A;  1VQL A;  4ZGD B;  1VQK A;  2DKG A;  2ZZD A;  2RJF A;  4DQ2 A;  3PIO A;  1QW1 A;  3M59 A;  4IUR A;  4IUV A;  2DTH A;  5DY9 A;  1RI0 A;  2VC8 A;  4N0A A;  4QW2 A;  3L42 A;  3CC4 A;  4M7A F;  3FJP A;  1VQ5 A;  1ZBX A;  1YIT T;  2MAM A;  4GLK A;  3A8M B;  2IVW A;  4JRQ A;  2KY9 A;  2GFU A;  5GAN 4;  3QHS A;  2K3X A;  1FWZ A;  1VQ4 T;  4OB2 B;  3LW5 E;  4M78 E;  5HKC A;  1Q81 C;  4JUV A;  4M7A B;  4BY6 B;  3NTK A;  3MP1 A;  4MML A;  4HKE A;  4JDS A;  4DOW A;  3G4S A;  3CCL T;  4M78 B;  2PVO B;  3CBO A;  3CCM A;  1UGQ B;  3GNG A;  3QBY A;  3L2R A;  2ZGW A;  3CCR T;  2M9U A;  3E1S A;  3JCM W;  3JB9 D;  1U8R A;  4FSX A;  3A5Z B;  3HFN A;  3DB3 A;  5GAN 2;  3G71 T;  2HQX A;  3JCM h;  2XG8 D;  2V8K A;  5EG2 A;  2PQW A;  2QTX A;  3GOX A;  3E19 A;  3OYB A;  3CC2 A;  4XTW A;  4OMF B;  3QPH A;  1VQ6 A;  4DOV A;  4WF2 A;  3X20 B;  2E6N A;  3KBG A;  2DO3 A;  2CZ7 B;  2DZC A;  4L5G A;  1KQS A;  2LCC A;  4NOY A;  5GAN h;  2L8D A;  1X6O A;  4E7L A;  1UGS B;  1VQN A;  2X4W A;  4LDY A;  2EQK A;  3M53 A;  3JAM E;  5CQY A;  1DJ7 B;  3HHT B;  5HY6 A;  5L8R E;  4C92 G;  3V8L A;  3JRZ A;  1YIT A;  5LJ5 e;  4XTU A;  4XU0 A;  1NPP A;  2M1H A;  2RHU A;  2EYQ A;  4N4I A;  4XQ3 A;  5GAM j;  3G6E A;  5GAM g;  2EJF A;  1MHN A;  1V29 B;  2QQR A;  4A4E A;  2CKK A;  3VKI A;  3F70 A;  4Q5W A;  4M78 A;  2K3Y A;  2XIC A;  1VQP A;  4C5I A;  2D6F A;  3JB9 H;  4M7A A;  1G5V A;  2RHX A;  5D6W A;  2DIG A;  3L1A A;  4RCB A;  4M75 F;  4RKU E;  2DIQ A;  5LJ3 e;  4ZN3 A;  3CCQ T;  2CYZ B;  3WVE B;  2DD5 A;  2E70 A;  4A54 A;  3PT9 A;  3OMC A;  5A0L A;  1VQM T;  1JJ2 S;  1VQ6 T;  1QVG S;  5GMK h;  1OZ2 A;  4C0D C;  2R57 A;  2EQU A;  3SDZ A;  2QA4 A;  4JLG A;  4BDY A;  2OTL A;  3RKY A;  3VUZ A;  4E7H A;  3OYM A;  2P0K A;  3RMQ A;  3HKS A;  2CZ1 B;  2RHZ A;  2X35 A;  3JSC A;  3OW2 A;  1NPR A;  4BE0 A;  2DXU A;  1Y96 B;  1XQH A;  4MZM A;  1Q7Y C;  3OYH A;  1N9S A;  1I4K 1;  2MI6 A;  4BB7 A;  3I55 A;  1HXD A;  4RG2 A;  1B34 A;  4B9X A;  2DXB A;  5AYF A;  1OYX A;  4XU1 A;  2BKD N;  4LDW A;  1KQS S;  4R56 A;  4ELY C;  3JCM X;  2PVD B;  2X4X A;  2HAX A;  5GAN g;  1NZ9 A;  5I21 A;  2JOY A;  2XDB A;  4BE2 A;  2WSE E;  1Y7X A;  1XNI A;  2KAF A;  2RO0 A;  4HCB A;  4N4H A;  2K2V A;  2OTJ A;  2RJD A;  1BI3 A;  2DK3 A;  3E9F A;  4C8Q B;  3CXC S;  3QJ6 A;  3M9Q A;  2RM4 A;  1LNX A;  4J5Y A;  2FYK A;  4EMG A;  1KG1 A;  3J81 E;  3CMA T;  2DTO A;  2QXF A;  4C5G A;  2V8J A;  2ZCF B;  1RL2 A;  3SFM A;  4M78 G;  5CKE A;  2XID A;  1QP2 A;  5HK0 A;  3H6Z A;  4XU2 A;  3X28 B;  5CKD A;  3I55 T;  4XTV A;  2P0P A;  4XTY A;  4A4K A;  4M7D D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...