5C0MA

Crystal structure of sgf29 tandem tudor domain in complex with a carba containing peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
174
structure length
174
Chain Sequence
GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SAGA-associated factor 29 homolog
publication title Chemical basis for the recognition of trimethyllysine by epigenetic reader proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5c0mA02
4C5IA 2IG0A 2D9TA 1WJQA 3P8HA 3UWNA 4B9XA 4CRIA 2EQUA 3OYAA 3KUFA 2RHIA 2XK0A 3PNWC 4IURA 5KCOA 2K3XA 2O4XB 4A4EA 5J26A 3OYLA 4LD6A 4PLLA 4BDZA 4EDUA 1KHCA 3LX7A 5KE3A 1MHNA 3QIIA 2L89A 4GY5A 3MP8A 2GFAA 4L59A 3OY9A 3GOXA 4ZTFA 3LGFA 2GFUA 2G3RA 2M1HA 2O4XA 4E7JA 4A4GA 4FL6A 2RHUA 3LH0A 3L2UA 2PQWA 2M16A 3FLGA 3EAEA 2EFIA 3CEYA 2BKDN 2RI5A 2VYTA 3DB4A 4UC4A 3QKJA 4A4HA 3OYGA 3S3OA 2X4WA 2RHXA 3C4SA 3M9QA 4NS5A 3NTHA 3QBYA 4IUQA 3O8VA 3S3NA 3QJ6A 2CKKA 3L42A 3OYMA 2F5KA 3OB9A 3L2QA 2RI3A 2EQKA 3OQ5A 3L2WA 2RJDA 3OS1A 2JZ2A 1WJSA 3OYKA 1OI1A 4PL6A 4E7IA 3OA6A 1G5VA 5IAYA 5FROA 5M9OA 4C5EA 1N27A 2L8DA 3NTIA 3MEAA 2WACA 4PLIA 2NLUA 3H8ZA 3H6ZA 4IUVA 2QQSA 4QQDA 2FHDA 3ZEHA 3DLMA 3MP6A 2LRQA 3S6WA 3OYFA 3S3MA 4E7LA 3OYCA 2L3RA 4BACA 4QQGA 3PMIA 5D6XA 2MWPA 3OS2A 3E9FA 2BIVA 2R57A 2X4XA 4BDYA 2LVMA 2GF7A 2EQMA 2LTOA 3OS0A 5KE2A 4IUUA 4RG2A 2K3YA 2X4YA 4B9WA 4FU6A 2RJCA 2DAQA 4N4GA 3Q1JA 1OZ3A 2RJFA 5C6SA 4A4FA 3META 2BUDA 2M0OA 3LYIA 5D6YA 3MEWA 3SD4A 4BE0A 3L2RA 4QQ6A 3FEOA 3OYNA 2P0KA 4II1A 4QW2A 4ZTJA 4C5GA 4IUPA 3MEVA 3OYJA 3P8DA 4HCZA 1WJRA 1WGSA 4N4HA 5KCHA 1H3ZA 2MWOA 4BE2A 4E7HA 2XDPA 5J39A 5C0MA 3F70A 4C5HA 1OYXA 2DIQA 3BDLA 3PFSA 3OMGA 3OYEA 4E7KA 1SSFA 5D6WA 5FRMA 2R5AA 3ASKA 3UT1A 3OYBA 4IKFA 1RI0A 3NTKA 2RO0A 5CIUA 2E5QA 2RHYA 2YRVA 2E6NA 3MP1A 4Z02A 3DB3A 4Q5WA 3OYIA 3OMCA 2HQXA 2X35A 2LDMA 3MO8A 3LLRA 2EKOA 5FRNA 5KH6A 4OVAA 2R5MA 2JTFA 3PMTA 2HQEA 3E9GA 5IN1A 1XNIA 2DIGA 3L2VA 3ME9A 4BD3A 2LCCA 2RI2A 4X34A 2RHZA 4IUTA 2RJEA 2QQRA 1OZ2A 4N4IA 3OYDA 3FDRA 3LGLA 4QVZA 3MEUA 2EQJA 2R58A 2B8AA 4BE1A 3OYHA 3FC3A
chains in the Genus database with same CATH superfamily
5GAN3 3P8HA 2EQUA 3A8HB 3OYAA 2RHIA 2HKNA 2JMAA 1NPPA 2CH4W 2X3XD 2ZGWA 1VQ9Q 4JRQA 2RH2A 3FLGA 1UTIA 2EFIA 4UC4A 2VGMA 2DL3A 4NS5A 4LDYA 4AFZC 2KBTA 2EYZA 3CCVA 1ZBXA 4ORZA 4F04B 4M78F 1YNZA 3VS7A 4DBRA 1KD1R 3FRNA 1WPYA 2LZ6B 2EYQA 2OTJT 4Z89A 4ME7A 1I0CA 3VS4A 4FYVB 2XKOC 2NUPA 1MV0B 4ZGJB 2HL3A 3G4ST 4JS5A 3CPFA 2RJCA 2DAQA 4JUVA 2O01E 5CVIA 4A4FA 1UG1A 1YCYA 4DOVA 1I5OB 2K6DA 4QW2A 1RI9A 2PUKB 1HK9A 1QVGA 3CXCP 4HA8A 1MUZA 2MWOA 4KH1B 4M7DB 3EHRA 2E70A 4J9GA 1Z9QA 3BDLA 1K9AA 3OMGA 3OYEA 4BB7A 1ACMB 4RMOA 4M78C 2MK5A 4IKFA 3RR6A 1M27C 2KE9A 2DD4A 1VQMQ 1VA7A 4P5NA 1BK2A 2CT3A 4JJBA 1Y71A 1VQNT 1UGSB 8AT1B 4HVUA 1PKTA 5A0DA 3A5ZB 4M7DF 1NYGA 2KNBB 4O6JA 2MYSA 2CZ6B 2EQIA 2RI2A 5CKDA 5GMKi 3EGUA 4NOYA 3UATA 1QKXA 3EH1A 1VQPQ 1E6HA 1JJ2S 1BIBA 2F2VA 2EIFA 3CCVQ 8ATCB 4M7AB 1WJQA 3PNWC 2KXCA 2EWNA 4WTOB 3HFNA 5CQYA 3NGPA 3WVDB 3CCVT 4F7UG 4ZTFA 1MNDA 4M75A 3RMQA 2V8JA 4JJCA 2JTMA 3V7SA 4C8QF 1WXTA 5L23A 3WVEB 5FU6B 2X4WA 4HCKA 1Q81C 2CP0A 3S3NA 1KC8R 3M58A 4DBFA 3CCMA 1R0BG 4A4KA 1WHGA 3OB9A 1BB9A 4RCCA 4M7AF 1AZGB 1YJNA 4E7IA 3RKYA 4PLIA 1AZEA 1JJ2P 2LRQA 2LCSA 1M90C 2CREA 3CC2Q 1MMDA 4BDYA 1VQKA 5KE2A 1TSFA 1Y96A 2RMOA 2ZPIB 3PIOA 1KQ1A 2PVGB 3TU4K 4FCYA 2SRCA 4C92F 1BU1A 1D1CA 1M5Q1 4IUPA 4XTUA 3EG9B 1ZSGA 4X1VA 4D8DA 3JB9H 1ZUKA 5IT9E 4J9EA 4OMLA 3A1PA 5LJ3g 3F70A 3QDFA 4D6WA 3PGGA 4RUGA 3CPWA 1IZ6A 1NJIR 1EZZB 4EMGA 2MAMA 1AOJA 1M3BA 3LWIA 2X9HA 4ESRA 5GJVB 2OJ2A 3QXEB 3JAME 2ZPGB 1Q82C 3LGLA 1JB0E 4MMKA 4OMFB 2F2WA 2D6FA 1OPLA 2BTTA 2COWA 2RK1A 4C92C 4AFSC 4JLIA 2JJ9A 3T9NA 4DBHA 3RESA 1UEBA 1I07A 5AYFA 2YXYA 1K8AC 3CCMT 1QWFA 3JB9G 1YJNT 3E19A 3BFMA 1PHTA 3DLLA 4J9BA 3NPFA 3M9QA 2D8HA 1QQJA 2DVJA 5LJ5e 3V8LA 1VQKT 4LDWA 3R6NA 5FROA 2CS7A 1VQLA 2VC8A 1B3QA 1VQ7Q 3S3MA 3OYCA 1RAAB 1M3AA 2E12A 3CCEQ 2GF7A 5IXFA 1FX7A 2VVKA 4FT4A 1M1KR 2K3YA 1JXMA 1Q81U 4PFOA 3VS5A 2H8HA 2EW3A 2JM9A 3JCMP 2VB6A 3META 2ED1A 1K73C 2VXEA 1DJ7B 1W1FA 3EHQA 1YIJA 5GAN6 4KGXB 1YJ9Q 4LDUA 2ZPBB 2XDPA 1ABOA 4R0KA 4AG2C 1M90U 1UHFA 4C5HA 4M77C 1XQHA 3OW2A 2COZA 1QKWA 5FRMA 2FRWA 2VUBA 2FPEA 5GAMe 3HKSA 3QO3A 2DZ9A 3JCMe 1AD5A 1AWJA 3G1JA 2YRVA 3GPLA 3SWNB 1UJYA 1W4SA 4HCCA 2VGNA 3E9GA 3CCRQ 1U06A 2DA9A 3PIPA 1KHIA 4GBQA 3FDRA 4QVZA 2DBKA 4ANJA 2QDYB 3CBPA 1R8OB 5GAMg 2K79A 1J3TA 3JCMg 5GANg 1OQKA 4J9IA 5GANj 2LQKA 2ECZA 1VQLQ 5I2MA 2BZYA 3ULRB 3V7RA 1EIFA 2RI5A 2L2PA 2DMOA 1VQLT 3NTHA 3O8VA 1Q82U 1AWXA 1G2BA 2RJDA 1OI1A 2E4HA 3ZFJA 3QUIA 1VUBA 1D1AA 3ZEHA 1KSWA 3UF4A 3SFMA 3ER0A 3TSZA 3REBB 5LJ3h 1YP5A 2BIVA 2X4XA 2LTOA 1YIJT 1SHFA 2X4YA 5KYNA 1M1GA 3RKXA 4N4GA 2M0OA 1BCOA 4PKCC 5GAOr 1QLYA 4MMLA 3L2RA 1MV3A 2DYIA 3FEOA 4M75F 2EBPA 4ELZC 4HCZA 5LJ3f 5KCHA 2HBPA 4RG8A 3C12A 5HK3A 3JV3A 3NFCA 4DEYA 3VRYA 2RF0A 1U8RA 3PFSA 4XK8E 2W0ZA 4M7DA 1QCNA 2GTJA 4WF2A 1IXDA 1YWOA 3QSUA 2EYYA 3EG3A 2E5QA 1K0SA 1AWOA 2HQXA 5CK9A 2ATCB 3TEEA 5KH6A 3VS3A 3SHWA 3G71A 1M8MA 1YHQA 3PMTA 2DIGA 2G6FX 4EMKB 1R77A 2J6OA 3OYYA 2RJEA 2DFUA 3O5ZA 5FU7C 2E65A 1ARKA 3VJPA 3G6EA 4FSXA 1VQ4A 3KXTA 4M75C 1PSFA 3OYLA 4BDZA 4FM4B 2E5KA 3VS0A 2QGGA 1KHCA 3LX7A 1RUWA 4M7AA 1C1AA 1Q86U 4JS4A 2JN0A 1I8FA 2G3RA 1CKAA 3IQLA 2CSQA 3X26B 1W2BA 2J6FA 5LJ5d 1R0CB 4HT8A 1PRLC 3M4GA 1GBQA 2RI3A 3PE0A 3M55A 2JZ2A 3OYKA 4M78G 3KBGA 5GMKm 4PJOB 1ZSZA 2J7IA 2KGTA 2LJ3A 2DNUA 2X3WD 5I21A 1TU0B 2A28A 1IRXA 3OS0A 2ZPEB 4IUUA 1X6BA 4KT0E 1CKBA 2O9SA 4QVDA 2BUDA 2XDBA 3LH5A 3M56A 2DBMA 2Y4XA 3M59A 2AZVA 1GCQA 4F17A 2K3BA 1QCOA 2WSEE 4PJOF 3G71Q 3EFOB 1PM3A 1H3ZA 1RADB 1ZUUA 3EG9A 4F14A 1VQ9A 4E7KA 2YUQA 5D6WA 1JRIA 4J8OA 3G7ZA 1YITA 2QXFA 4OB1B 3G71T 3ASKA 1YHQT 1VQ4Q 1FMVA 3UT1A 5A0LA 5GANh 2PNIA 4AFQC 1VQOA 3CC4Q 1T0JA 2LQ8A 4E7ZA 3VUZA 3G6ET 5KYUB 1VQ4T 2KY9A 2W10A 1WLPB 3ME9A 2GCXA 5HKCA 4OB0B 4KH0B 4QVCA 2QQRA 1QVFA 3M0PA 3MEUA 5GMKj 5GAMf 2B8AA 2LJ1A 1GRIA 3JCMf 3JCMb 3RBBB 4D8KA 3ZL7C 3CCJQ 1TUDA 4MDWA 2C0TA 1UE9A 9ATCB 3OY9A 2LNHB 1LCKA 1HJDA 4E7JA 2DL8A 4MZMA 5A0GA 3CC7A 2J6KA 3DB4A 4C8QG 3OYGA 1YJWQ 1NBEB 2A3LA 2ZAEA 4XAXB 2LT1A 2DTOA 3C4SA 1RAEB 4PJNA 2YWWA 3JCMV 4F7UE 3L2QA 1SRLA 4QKUA 2ZPFB 2CP2A 4OMMA 3TVTA 4M7AG 5IAYA 4HVWA 1ABQA 1VQMA 4JLGA 2WACA 2Z0WA 5I2SA 3H6ZA 2AKKA 3OYFA 2FZCB 3QWYA 2PZ1A 1VQ8Q 3VYHB 2L3RA 4BACA 2I2LA 3OS2A 2CDTA 4CC3A 3CXCS 1YITQ 1X01A 1VQPA 1OX8A 1M2OA 1OX9A 3SD4A 3UA7A 5GAOl 1VQ9T 1VQOQ 4C92G 3OYNA 3ZBDA 2EJGA 2E3IA 4DEXA 1YITT 4KBMB 3P8BB 5J39A 4JPBW 2JW4A 2CP7A 1VQOT 2DTIA 1UB4A 4A54A 2DJZA 1P92A 3SDZA 1X69A 2IPOB 1Q7YU 3H41A 2EAYA 4XU3A 4Q5WA 3OYIA 2CP5A 2DD5A 3CC7Q 3SWNA 3CC2A 1JBMA 4X34A 3QZ9B 4IUTA 1I4K1 2K9GA 2A0FB 2ENMA 2P0PA 1RL2A 2CZ1B 2ROTA 2D9TA 3LWHA 4XU1A 4CRIA 3CC7T 2QK0A 3HTRA 1QMCA 2O4XB 2KYMA 5J26A 3UDCA 2GFAA 1GFDA 2KMTA 3LGFA 1BI1A 1O75A 3CEYA 2YSQA 3VU3C 2AT1B 1VQMT 1VOMA 4M77G 3QJ6A 1QVGP 2AKLA 1WJSA 2HQHA 3BW1A 2P4TA 3GP8A 3JSCA 2DJQA 3NTIA 1VQPT 2K5LA 3MP6A 2YUOA 3JB9D 2DXUA 1H8KA 4QQGA 3EG2A 2MWPA 1Y0MA 3OSSC 2HKQB 4OF1A 1JJ2A 2SEMA 4XTYA 2DXBA 5C6SA 2L3PA 2PUOB 3REAB 1ZSZB 1JQQA 2K4YA 1VIEA 3CCQQ 4II1A 2HCKA 1Q81R 2HL5C 4N4HA 1WA7A 1MNEA 4C0DB 4BE2A 2V1QA 3CBOA 4M7DC 1T3SA 5LJ3e 3HFOA 3J81E 4MZTA 5CAIA 2DK3A 5GMKh 5FLXE 1HD3A 2KRSA 2AHJB 2M02A 1RI0A 2DKGA 3CC2T 1M90R 2XHCA 1V76A 3QYHB 5GAOq 3MJXA 4E7SA 3LLRA 1OU8A 2ZZDA 3A98A 4FYWB 1N8RR 1OOTA 2ABLA 1VQ7A 2E6ZA 4C8QC 4ELYC 1W6XA 1H641 1XNIA 1EX4A 4E6RA 3CCEA 2DPPB 2R58A 3OYHA 2E1HA 4EMKA 1OV3A 5I11A 4M7AC 5L8RE 4NL3A 1NJIC 2AZSA 2CP3A 4A4EA 2Y90A 6AT1B 3MP8A 5IHIA 4L59A 4PJMA 2HD0A 2PU9B 1YJ9A 1TG0A 2XU8A 4OMNA 2GTOA 1E7OA 2PQWA 2YRDA 2BKDN 3QKJA 5FU6C 4JZ3A 1M9SA 1AEYA 2F5KA 5GAOp 2ZCFB 4DA4A 3PVQA 3J80E 2HBWA 4PJJA 1K9MC 3L1AA 5HK0A 3A8LB 3H8ZA 4E47A 2QQSA 1NEGA 3S6WA 2K7AA 3I56Q 3D7SB 1UGPB 1WFWA 4GLMA 3CCRA 4PJOA 2RPNA 2DL4A 2KR3A 2MF2A 4MZPA 3CD6Q 1BBZA 1GCQC 1KIKA 4LE9A 2I0NA 2QGFB 4F7UB 4C5GA 1SG5A 4J6XA 4M75G 3J7AF 2MOXA 5C0MA 3QG1A 4ZN1A 3EFOA 5CKHA 1WI7A 1U1SA 1Y57A 3HP9A 1VQ7T 1K4US 2KRNA 5GAN7 1KQSA 3CCET 2C0OA 1SEMA 4CC7A 4J6WA 4FW2A 1GXIE 3M5AA 2JS2A 1WHLA 2H3EB 1AHJB 5FW9A 3WXMB 4OB3B 2QA4Q 5CQXA 3CCUA 2DEUA 4J9DA 1JEGA 3EH2A 4OMOA 1U5SA 1OZ2A 3OW2S 5KYUA 4BE1A 5LJ5j 2EJ9A 2O31A 2VV5A 4FT2A 4JJNK 1YJ9T 2OTLQ 1FWZA 4M4ZA 1D09B 1D0ZA 1M30A 2YDLA 4IURA 5GANe 2K3XA 3CMEQ 3MCAB 4EDUA 2DILA 4GY5A 4RTVA 4XU2A 1KK7A 2KAFA 3QHSA 2WSFE 3CCLQ 2C0IA 4OP0A 1Q86R 1G5VA 3CCRT 3JCMQ 5M9OA 1NJIU 4C0GA 1V29B 2DETA 3OW2P 3X20B 1M8VA 1QCFA 4K11A 4M78E 2EQMA 1G3YA 2YLBA 3M0QA 3I9QA 4HVVA 2XI9A 1LVKA 2NWMA 1UGRB 4M78D 2CGHA 4BE0A 2MIOA 2LQNA 2P0KA 4KGVB 4EMHA 1ZA1B 1W70A 1B34B 2VASA 4B6MA 1I1JA 1K9MU 1K8AU 2DEQA 4PJOG 4E7HA 1HXDA 3CCUQ 5LJ3d 2CUDA 1OYXA 2FEIA 1NE8A 2EGAA 3OBWA 2CZ7B 3EG1A 1TOVA 2JXBA 2OI3A 3CCUT 3HHTB 2RQUA 1OULA 3NHNA 3DB3A 1PSEA 1VQ5Q 3MO8A 1BCMA 2EKOA 4DQ2A 2QDLA 3JB9F 3CMAQ 4OVAA 2R5MA 3C94A 2LNVA 5EC7A 1UGQB 2BE7D 3M4YA 4JDSA 2KROA 2YHTA 3EGDB 2RHZA 2DX1A 3QJYA 2BZ8A 4XQ3A 2K5IA 2RK2A 4JZ4A 3LW5E 1X6OA 4B9XA 1N9SA 2P84A 2XK0A 2A7YA 1G83A 1O9SA 2OAUA 1K73U 1MHNA 3CCSA 3QYGB 1MMAA 2LT4A 1WQ7A 2O4XA 5IHKA 7AT1B 1C0MA 2IVWA 5CKBA 3AHUA 2RM4A 2HAXA 2HZYA 4E2FB 1KFZA 2KDSA 2XG8D 1MMNA 2CKKA 1C6VX 3OQ5A 1Q95G 4C8QE 1GCPA 3TQ7P 1VIFA 1IGQA 4DBQA 1UUEA 2EJFA 2M0YA 4OB2B 4L6V5 2NLUA 3CC4A 3VYGA 3DLMA 3TCJA 2QQ9A 5D6XA 4M7AE 4C8QD 2LQWA 5DLOA 2RB6A 2FPFA 1TUCA 1YBYA 3INZA 4HKEA 1W2BS 3R6OA 4PNOA 2CUBA 1HYOA 2EVRA 4M7AD 3RNJA 2QQBA 4HT9A 3CCJA 1XOVA 2DM1A 1KJWA 4NL2A 1WXBA 4QT7A 1FMWA 1OEBA 4C92E 2DE0X 4BY6B 1YJWA 1SSFA 2LX7A 3A8OB 2D0NA 3TREA 4OGCA 2NUZA 3EG0A 2AIRB 2RO0A 4C92D 2NYSA 4XTZA 2F2XA 3GNGA 2LDMA 4EIKA 3CCSQ 4J83A 2RNAA 2DO3A 1W2BP 4V2SA 1BYMA 1Q7YR 1IB8A 3HRSA 1VQ8A 4RKUE 1LNXA 2DXCA 4AT1B 5GMKe 4N4IA 3CCST 2QTXA 1E6GA 2HEQA 2K57A 4HCBA 3HPWA 2GQIA 1U1TA 5GAMd 4PFPA 2OX7A 4PK4A 4IIOA 3JCMd 2X51A 5KCOA 5FWBA 1UDLA 2D8JA 4LD6A 5HY6A 1RLQC 3H0IA 5CR2A 4LD9K 2ESWA 2GGRA 4FW1A 2M1HA 3DKMA 2CT4A 3L2UA 3EFRA 2XMFA 4M7DG 2F69A 3CC4T 1QVFS 1ZLMA 3OYMA 5GANf 4PFZA 2H3JA 2VWFA 3VUBA 4C0ZA 4JRIA 5DY9A 3FJ5A 5A2QE 1QWEA 4M77E 4JRPA 1RABB 5AT1B 4PJOC 3X24B 4RTTA 1ZQ1A 4O5VA 4ATOA 3JCMW 1QP2A 4L5GA 2R57A 1PCXA 1WZOA 3CCJT 4XTWA 2HNIA 4M77D 2HSEB 1NG2A 1X75C 2QEXQ 3A8GB 2IIMA 3PT9A 1YJWT 5D7UA 3MEVA 1QVFP 5KYXB 3I5RA 4ZGEB 4F7UA 5KYYB 2DIQA 2RN8A 1X27A 1QVPA 2DRMA 4M78B 1G3SA 5KYWB 1VQ8T 4X9CA 1WDXA 3HRUA 4Z02A 3QWXX 3M0TA 3OMCA 3VRZA 3VS2A 5FRNA 1U3OA 3V8JA 1FMKA 1GBRA 3JCMc 2LP5A 3RIRA 3L2VA 1KD1C 4N0AA 3OYDA 3CXCA 1UECA 4A63B 2EQJA 2E41A 2OTJQ 2V1RA 3QPHA 5CKEA 1SRMA 4LNPA 2IG0A 5ECAA 2P0QA 2XIDA 2P4RA 2QQAA 3G4SQ 2PVDB 1AT1B 2AK5A 3CCQA 1UGVA 1QVGS 2MI6A 2V8KA 5GMKl 1AVZC 1ZBJA 2M16A 3EAEA 4YTLA 2VYTA 4A4HA 2ED0A 1Y7XA 2KXDA 2LMJA 4IUQA 1BKBA 1YFNA 4IIMA 2KSSA 1BIAA 1IHVA 3CBMA 2QTVA 4RTXA 5DM7R 1NYFA 2M51A 5CKFA 4RTWA 4KRTA 3OS5A 5GAN2 2NUTB 4Y91A 1Z9ZA 1PNJA 2L3QA 1Y07A 1VQNQ 4XTVA 2KRMA 5DLQE 3Q1JA 2RJFA 1V1CA 3LYIA 3MEWA 1D1BA 2E10A 1WHKA 1M3CA 2EYWA 1NLPC 3OYJA 1G8XA 1B7TA 2ZPHB 3VKIA 4C8QB 3PTAA 4KGZB 4WCIA 2OAWA 2K2MA 1B34A 2YLCA 3OBYA 1PG5B 5CCAA 4M75E 4KUDK 2YUPA 3BE3A 5FWCA 3UA6A 3NTKA 1RACB 3MP1A 3M0SA 4M75D 1KC8C 4LXCA 1WQWA 2KYBA 3FIFA 1B07A 1G3TA 2YRCA 3U23A 1BI0A 3FB9A 2JTFA 3I56A 1RAIB 2Y4YA 1AWWA 1QW1A 2E64A 4J9CA 3CCQT 1TUGB 4FSSA 1WYXA 2VKNA 4RTYA 2F1LA 3EGXB 2JVVA 1F1BB 4C92B 4C5IA 5GAN5 1YI2A 3UWNA 3CD6A 3EGDA 2CSIA 1T3LA 4J9HA 1RAGB 2F5TX 4PLLA 3GLXA 4Y28E 2PVOB 1VYTA 3HL8A 3V7CA 4OMPA 2COYA 4A4GA 3FJPA 4FL6A 4AFUC 2GNCA 1UJ0A 2J05A 4LDXA 1SHGA 1K1ZA 1KD1U 4FIBA 1PC0A 4ZGDB 1N8RC 2RHXA 2KVQG 3EFSA 3QBYA 3BY7A 1JXOA 3A8MB 3CPWS 2JNGA 3URGA 1JU5C 2L5QA 3JCMX 1WHJA 2CYZB 4PL6A 1M2VB 2XDDA 2FPDA 4GLKA 1D3BB 3E1SA 3H0HA 2L8DA 2FB7A 3OSVA 4QQDA 1WNLA 1NZ9A 2YUNA 1K0XA 5LJ3j 2FG0A 1LPLA 2QA4A 2LVMA 1X2QA 4RG2A 2RQVA 4B9WA 4BI8B 1OZ3A 3N5BB 5IHNA 1IHWA 4F16A 2QAZA 2OTLA 3RKWA 1ZSZC 1N9RA 3X25B 5GAOn 3CMEA 2HDAA 1WGSA 1Q82R 3CPWP 4C0DC 4M77B 2DL5A 4XTXA 2DL7A 5IXBA 2BZXA 3X28B 1I5LA 1BI2A 1ZHIA 2QI2A 3CCLA 3CCMQ 1K9MR 1H3HA 4PJOE 3KFVA 1YI2Q 1K8AR 3VV0A 5CO7A 1YJNQ 2J06A 2JM8A 3OYBA 1TWBA 3I56T 3M0UA 2JMCA 5CIUA 4Y92A 4RCBA 1RAHB 2KT1A 3M0RA 4LUDA 2E3HA 4C0FA 4PJOD 1YI2T 3CD6T 1M4ZA 1VQKQ 2BE9B 4M77F 1S72A 4ZN3A 3KUFA 1UFFA 1M1KC 1KQSS 2LC4A 2LCLA 2A37A 2LX9A 5KE3A 1KC8U 4F7UF 3GOXA 1PRMC 2DYBA 2GFUA 3GIBA 3MHXA 2QASA 2RHUA 2MCNA 1KG1A 2DZCA 4J9FA 5LJ5g 1K73R 3I5SA 3M53A 1PD1A 3L42A 3SB2A 2CH4A 4X9DA 5J3BA 4J5YA 2C06A 2QA4T 3OA6A 2QG9B 1SPKA 4C5EA 1N27A 2DVEA 2FRYA 3VS6A 2KK4A 2NUPB 2PTKA 3NMZC 2FHDA 1VQ5A 3SEMA 3PMIA 1D0XA 1VYUA 5GJWB 3CMAA 2OTLT 2DLPA 2JOYA 3UPUA 3HSBA 1SKUB 4BI4A 3CMET 1KQSP 1A0NB 1N8RU 4AG1C 1NEBA 1WIEA 3H0FA 5EG2A 5D6YA 4ZTJA 3CCLT 1Q86C 2EGEA 2GQVA 1SF9A 4DOWA 2L3SA 3QZ5B 2KT8A 1S72Q 5KYXA 1XJWB 2XD0A 1WX6A 4AMCA 5KYYA 5GAMj 1H92A 4J7IA 1S72T 2K5FA 1N5ZA 4M78A 5KYWA 5GAN4 1VQ6A 4N0AC 3E2UA 3M54A 1M1FA 4MDXA 4CC2A 4R55A 3CQTA 2FVUA 3THKA 1IGUA 3MKDA 2LJ0A 2MPXC 4RTUA 5FU7B 2FO0A 1VYVA 2KI7A 1XTDA 2JT4A 2EGCA 4M75B 1JO8A 1YIJQ 2QYZA 1EFNA 2V26A 3GF5A 2DERA 3QIIA 1I81A 3SWNC 1FXXA 1PD0A 3H9NA 3JB9J 3RUXA 4LN2A 5IH2A 1VQ5T 5LL6S 1QP3A 2KEAA 3CMAT 4KULA 3L2WA 1BI3A 2DTHA 4RTZA 3OS1A 2CP6A 4LUEA 4M7DE 3GNFB 1M1KU 3BDUA 2DXTA 2FZGB 1OPKA 4IUVA 1IO6A 1D0YA 1Y96B 2DRKA 4CC4B 1ZX6A 3E9FA 3MPUB 4M7DD 4J7FA 2XICA 2HMAA 2RD1A 1FYNA 1K76A 1ZUYA 4XU0A 1MGQA 4EPCA 4PJLA 2NUTA 4VUBA 3I35A 4Z8AA 3HRTA 2M9UA 1NLOC 3RMSA 3C95A 1VQ6Q 2MMPA 4OGEA 1KQ2A 3GBQA 2EPDA 1G3WA 2RQWA 4A53A 4JRKA 4C8QA 5GAOm 1VQ6T 1TS9A 3VS1A 2KQWA 1MMGA 2R5AA 1T0HA 2B86A 3RDVA 4R56A 3JB9I 2RHYA 3TSWA 4J6YA 2O9VA 1WXUA 2X35A 2FYKA 2RA2A 5I22A 2K2VA 2HQEA 1SSHA 2LCCA 1RLPC 3JRZA 2EKHA 3I55A 5LJ5h 2ROLA 3L2ZA 3FC3A 2QEXA 2A36A 2FZKB 2X4JA 2FL7A 3EGXA 1GFCA 1TXQA 4C92A 1X6GA 2L89A 2O2OA 5GAN8 4FYYB 1IREB 3LH0A 3S3OA 5LJ5f 4EMKC 1Q7YC 4LDVA 2EQKA 3V8KA 4BUGA 1UHCA 5GANd 1ZA2B 3JCMJ 2JTEA 3MEAA 4HXJA 4BI3A 1YHQQ 1M2VA 4E7LA 3AT1B 4OMQA 4FYXB 2EYXA 1D3BA 1X2KA 2V8IA 3C0CA 3RERA 1CSKA 2RQRA 5HCKA 1OU9A 4FU6A 2VXFA 2CZ0B 3PVLA 3G6EQ 5GAMh 1WHMA 1TH7A 2JUFA 2OTJA 3JCMh 1LOJA 1LJOA 4KUIA 4QQ6A 1NM7A 4Z88A 3P8DA 3G4SA 1WJRA 1PKSA 1YCSB 1S1NA 1X43A 1YWPA 2A08A 2D0QB 1NPRA 2RQTA 3M57A 4BY6C 3I55Q 4M77A 2DF6A 1HSQA 1WHHA 2D1XA 2O88A 2E6NA 2GBQA 4JJDA 4CI0C 2YT6A 3I55T 1YN8A 3QDRB 1GL5A 4TVRA 2QEXT 1N6AA 2L0AA 5IN1A 2HSPA 1TTHB 4BD3A 2JS0A 4ZNXA 1PWTA 1RAFB 2WSCE 1VQNA
chains in the Genus database with same CATH topology
4C5IA 1FWZA 4FSXA 3P8HA 3UWNA 5GAN3 5GAN5 3G6EA 1VQ4A 2EQUA 3A8HB 3OYAA 3CD6A 5GANe 4IURA 2RHIA 3KXTA 4M75C 2K3XA 2F5TX 1PSFA 3OYLA 4PLLA 3GLXA 4FM4B 3MCAB 4Y28E 4EDUA 4BDZA 1KHCA 2PVOB 3LX7A 1NPPA 3HL8A 4M7AA 4GY5A 3V7CA 4XU2A 1Q86U 4JS4A 2ZGWA 2JN0A 1I8FA 2G3RA 2KAFA 4A4GA 3FJPA 4FL6A 4JRQA 3QHSA 2RH2A 3FLGA 4UC4A 2EFIA 2WSFE 2VGMA 4LDXA 3X26B 1KD1U 4FIBA 1N8RC 4ZGDB 1W2BA 2RHXA 2KVQG 4NS5A 4LDYA 1YJ9T 3EFSA 3QBYA 3BY7A 5LJ5d 3A8MB 3CPWS 4HT8A 2JNGA 3M4GA 4OP0A 3URGA 3CCVA 2RI3A 3M55A 2L5QA 3JCMX 1ZBXA 2JZ2A 4M78F 3OYKA 2CYZB 4PL6A 1G5VA 2XDDA 4M78G 3CCRT 3KBGA 4GLKA 3JCMQ 5GMKm 5M9OA 1D3BB 3E1SA 1NJIU 2L8DA 2FB7A 1V29B 3FRNA 4C0GA 3OSVA 1WPYA 4PJOB 4QQDA 1WNLA 3X20B 1NZ9A 1M8VA 2EYQA 2OTJT 4ME7A 5LJ3j 4M78E 5I21A 2XKOC 2QA4A 2LVMA 2EQMA 3OS0A 2ZPEB 4IUUA 1G3YA 2YLBA 4RG2A 4ZGJB 4B9WA 3G4ST 4JS5A 4KT0E 4BI8B 3CPFA 2XI9A 2RJCA 2DAQA 4JUVA 1OZ3A 2O01E 3N5BB 5CVIA 4A4FA 4QVDA 2BUDA 2XDBA 1UGRB 1YCYA 4M78D 3M56A 4DOVA 2Y4XA 2CGHA 3RKWA 4BE0A 2OTLA 1N9RA 3M59A 2P0KA 4QW2A 3X25B 4EMHA 5GAOn 2PUKB 1B34B 1HK9A 3CMEA 1QVGA 1K9MU 4HA8A 1WGSA 2WSEE 4PJOF 1H3ZA 1K8AU 2DEQA 4PJOG 2MWOA 4M7DB 4E7HA 4C0DC 1HXDA 5LJ3d 2E70A 4M77B 4XTXA 1OYXA 3X28B 1I5LA 1VQ9A 3BDLA 3OMGA 1BI2A 1NE8A 1ZHIA 2QI2A 3OBWA 5D6WA 3OYEA 1JRIA 4E7KA 2CZ7B 3CCLA 4J8OA 4BB7A 3G7ZA 1YITA 2QXFA 4OB1B 3G71T 4PJOE 3ASKA 1YHQT 4RMOA 3VV0A 4M78C 5CO7A 3UT1A 3OYBA 3CCUT 5A0LA 3I56T 4IKFA 3HHTB 5CIUA 5GANh 2DD4A 3DB3A 1VQOA 4RCBA 1PSEA 4P5NA 3MO8A 2LQ8A 2EKOA 4DQ2A 3JB9F 4C0FA 1Y71A 3VUZA 1VQNT 1UGSB 4PJOD 4OVAA 1YI2T 3G6ET 2R5MA 3C94A 3CD6T 1M4ZA 2LNVA 1VQ4T 5A0DA 1UGQB 3A5ZB 4M7DF 2KY9A 3M4YA 4JDSA 4O6JA 3ME9A 2YHTA 4M77F 2GCXA 2CZ6B 2RI2A 2RHZA 4OB0B 4QVCA 2QQRA 4NOYA 5CKDA 5HKCA 5GMKi 1S72A 1QVFA 3MEUA 5GMKj 5GAMf 1JJ2S 1BIBA 2B8AA 2EIFA 3QJYA 3JCMf 3JCMb 4XQ3A 4M7AB 2K5IA 2RK2A 4ZN3A 3LW5E 1WJQA 1X6OA 4B9XA 1N9SA 3KUFA 2XK0A 2A7YA 3PNWC 1M1KC 1KQSS 2EWNA 1O9SA 2LC4A 2OAUA 4MDWA 2LCLA 3HFNA 2LX9A 1K73U 5CQYA 5KE3A 1MHNA 3CCSA 3QYGB 1KC8U 4F7UF 2LT4A 3WVDB 3OY9A 3CCVT 4F7UG 3GOXA 3RMQA 4M75A 4ZTFA 1WQ7A 2GFUA 4E7JA 2O4XA 2V8JA 3MHXA 3GIBA 2JTMA 2RHUA 4MZMA 3V7SA 4C8QF 5A0GA 3WVEB 3CC7A 1KG1A 3DB4A 5FU6B 2DZCA 2IVWA 4C8QG 4XAXB 2A3LA 5CKBA 3OYGA 2LT1A 2X4WA 2RM4A 2HAXA 2DTOA 3C4SA 5LJ5g 1Q81C 3AHUA 2KDSA 2XG8D 3S3NA 3M53A 3JCMV 4F7UE 2CKKA 3L42A 3M58A 3CCMA 4A4KA 3L2QA 3OB9A 2ZPFB 3OQ5A 4RCCA 3SB2A 4X9DA 5J3BA 4M7AF 4J5YA 4C8QE 1YJNA 2QA4T 4E7IA 3OA6A 2C06A 4M7AG 1VIFA 5IAYA 3RKYA 2EJFA 4C5EA 1N27A 2DVEA 4OB2B 4JLGA 1VQMA 2WACA 5I2SA 4L6V5 2KK4A 2NLUA 3H6ZA 4PLIA 3CC4A 3VYGA 2FHDA 3OYFA 3DLMA 1VQ5A 2LRQA 3TCJA 2QQ9A 3VYHB 2L3RA 4BACA 2I2LA 3PMIA 1M90C 3CMAA 2OTLT 5D6XA 4M7AE 2JOYA 4C8QD 3OS2A 4BDYA 3UPUA 1VQKA 5DLOA 2RB6A 5KE2A 3HSBA 4BI4A 3CMET 1Y96A 1YBYA 3INZA 2ZPIB 4HKEA 1W2BS 3PIOA 3CXCS 1N8RU 1KQ1A 1X01A 2PVGB 3R6OA 4PNOA 3TU4K 1VQPA 5EG2A 4M7AD 2QQBA 5D6YA 3SD4A 4C92F 5GAOl 1VQ9T 4HT9A 4C92G 3OYNA 1XOVA 3CCJA 4ZTJA 3CCLT 1M5Q1 4IUPA 2EJGA 4XTUA 3ZBDA 1Q86C 2GQVA 4NL2A 1YITT 3JB9H 4DOWA 5IT9E 4KBMB 5LJ3g 3P8BB 5J39A 3F70A 4D6WA 3QZ5B 3PGGA 4C92E 1VQOT 2DTIA 4BY6B 1UB4A 4A54A 1YJWA 1SSFA 3CPWA 1IZ6A 2DJZA 1P92A 3A8OB 2XD0A 3SDZA 3TREA 4EMGA 1Q7YU 4OGCA 2MAMA 5GAMj 2RO0A 4C92D 2EAYA 4J7IA 4XU3A 3LWIA 4XTZA 4Q5WA 3OYIA 1S72T 2K5FA 3GNGA 2LDMA 4M78A 2DD5A 4J83A 4N0AC 5GAN4 1VQ6A 2DO3A 3M54A 4V2SA 1BYMA 1M1FA 3HRSA 4MDXA 4R55A 1VQ8A 2FVUA 4RKUE 3SWNA 1LNXA 3CC2A 3QXEB 2DXCA 1JBMA 4X34A 3JAME 2ZPGB 3QZ9B 4IUTA 5GMKe 1Q82C 4N4IA 3LGLA 1I4K1 3CCST 1JB0E 5FU7B 2QTXA 2K57A 4MMKA 4OMFB 4HCBA 2P0PA 1RL2A 3HPWA 2D6FA 2CZ1B 1U1TA 2RK1A 5GAMd 2D9TA 4C92C 3LWHA 4XU1A 4CRIA 1XTDA 4JLIA 3CC7T 3T9NA 3JCMd 4M75B 5KCOA 2O4XB 3RESA 1UEBA 5J26A 3UDCA 4LD6A 5HY6A 5AYFA 5CR2A 4LD9K 1K8AC 3GF5A 3QIIA 1I81A 3SWNC 2GFAA 3CCMT 2KMTA 3LGFA 3JB9G 1FXXA 2M1HA 1BI1A 3DKMA 1YJNT 3E19A 3L2UA 3EFRA 3BFMA 3JB9J 3RUXA 1O75A 3CEYA 3DLLA 4M7DG 3VU3C 4JJNK 1VQMT 2F69A 3M9QA 4M77G 3CC4T 1QVFS 1VQ5T 3QJ6A 5LJ5e 5LL6S 1QP3A 3OYMA 3V8LA 3CMAT 5GANf 4KULA 3L2WA 1BI3A 2DTHA 3OS1A 2H3JA 1WJSA 3VUBA 4C0ZA 3BW1A 1VQKT 4JRIA 3GNFB 4M7DE 5DY9A 2P4TA 4LDWA 5FROA 5A2QE 3GP8A 4M77E 3JSCA 4JRPA 3BDUA 1M1KU 2CS7A 3NTIA 2DXTA 1VQLA 2VC8A 4IUVA 1VQPT 2K5LA 4PJOC 3MP6A 3S3MA 3JB9D 2DXUA 1Y96B 1YI2A 3X24B 3OYCA 1ZQ1A 4QQGA 4O5VA 4ATOA 2MWPA 3JCMW 1QP2A 3E9FA 4L5GA 2E12A 2R57A 3OSSC 4M7DD 4J7FA 3CCJT 4OF1A 2GF7A 4XTWA 2HNIA 2XICA 1JJ2A 2RD1A 4M77D 4XTYA 1FX7A 4FT4A 2K3YA 1Q81U 1X75C 2DXBA 4XU0A 1MGQA 4EPCA 3JCMP 5C6SA 2PUOB 3META 3A8GB 4VUBA 3HRTA 3PT9A 1K73C 2M9UA 2VXEA 3RMSA 2K4YA 1VIEA 1DJ7B 1YJWT 4II1A 3C95A 3MEVA 5GAN6 1YIJA 2MMPA 4N4HA 4LDUA 4OGEA 2ZPBB 4C0DB 4BE2A 1KQ2A 2XDPA 3CBOA 4M7DC 4ZGEB 3HFOA 4F7UA 5LJ3e 1M90U 3J81E 4C5HA 4MZTA 4M77C 1G3WA 2DIQA 4A53A 1XQHA 3OW2A 5CAIA 2DK3A 4JRKA 5GMKh 4C8QA 5GAOm 1VQ6T 5FLXE 5FRMA 1QVPA 2VUBA 2AHJB 2KQWA 2R5AA 4M78B 5GAMe 3HKSA 1G3SA 1VQ8T 3QO3A 2DZ9A 3JCMe 1RI0A 2DKGA 4R56A 4X9CA 3JB9I 3CC2T 3HRUA 2RHYA 2XHCA 2YRVA 4Z02A 3QYHB 3OMCA 4J6YA 5GAOq 3GPLA 2X35A 3SWNB 2FYKA 2RA2A 3LLRA 5FRNA 2ZZDA 2K2VA 1VQ7A 1W4SA 3V8JA 2E6ZA 4HCCA 4C8QC 2HQEA 2VGNA 3E9GA 4ELYC 3JCMc 3PIPA 1H641 1XNIA 3RIRA 3L2VA 4N0AA 1KHIA 1KD1C 2LCCA 3OYDA 3CXCA 3CCEA 3FDRA 4QVZA 2DPPB 2QDYB 3JRZA 2EQJA 3I55A 2R58A 3CBPA 5LJ5h 2E41A 1R8OB 5GAMg 3OYHA 2E1HA 3L2ZA 5CKEA 3QPHA 3FC3A 4EMKA 2IG0A 3JCMg 5GANg 5L8RE 2QEXA 4M7AC 4NL3A 1NJIC 2X4JA 5GANj 2FL7A 4A4EA 2LQKA 2P0QA 2XIDA 2Y90A 2QQAA 2PVDB 5I2MA 4C92A 3CCQA 2L89A 3MP8A 4L59A 5GAN8 1QVGS 2MI6A 2HD0A 3V7RA 2PU9B 2V8KA 1YJ9A 5GMKl 2XU8A 1IREB 3LH0A 2PQWA 2M16A 1EIFA 3EAEA 3S3OA 2BKDN 2RI5A 2VYTA 4YTLA 4A4HA 1Y7XA 3QKJA 5FU6C 5LJ5f 4EMKC 1VQLT 1Q7YC 3NTHA 4IUQA 3O8VA 4LDVA 1Q82U 1M9SA 1BKBA 2F5KA 2EQKA 3V8KA 4BUGA 2RJDA 5GAOp 2ZCFB 1OI1A 4DA4A 3ZFJA 3QUIA 2KSSA 5GANd 1BIAA 1VUBA 3CBMA 3J80E 3JCMJ 1K9MC 3L1AA 3MEAA 5HK0A 3A8LB 3H8ZA 3ZEHA 4E47A 2QQSA 5DM7R 3SFMA 4BI3A 3S6WA 4E7LA 3ER0A 5CKFA 1D3BA 1UGPB 5LJ3h 2V8IA 2BIVA 2X4XA 3OS5A 5GAN2 3CCRA 4PJOA 2LTOA 1VQNA 1YIJT 4Y91A 3RERA 2MF2A 2X4YA 4MZPA 4FU6A 1Y07A 2VXFA 2CZ0B 4XTVA 1M1GA 3RKXA 4N4GA 5DLQE 3Q1JA 2RJFA 5GAMh 1TH7A 2JUFA 2M0OA 2OTJA 4PKCC 3JCMh 5GAOr 1LOJA 3LYIA 3MEWA 1LJOA 2E10A 4MMLA 3L2RA 4KUIA 4QQ6A 3FEOA 4M75F 4F7UB 4C5GA 4M75G 4J6XA 3OYJA 3P8DA 3J7AF 4ELZC 4HCZA 1WJRA 5LJ3f 3G4SA 2ZPHB 3VKIA 2HBPA 4C8QB 5KCHA 4RG8A 3PTAA 5C0MA 3QG1A 3C12A 5HK3A 3NFCA 1B34A 2YLCA 3OBYA 4ZN1A 2D0QB 1NPRA 3M57A 3PFSA 4BY6C 5CCAA 1U8RA 4XK8E 4M75E 5CKHA 4M7DA 4KUDK 1U1SA 4M77A 3HP9A 1VQ7T 4WF2A 5GAN7 3QSUA 3NTKA 1KQSA 2E5QA 2E6NA 3MP1A 3CCET 4CI0C 2HQXA 4M75D 5CK9A 1KC8C 3I55T 1WQWA 4J6WA 1GXIE 3FIFA 3M5AA 3QDRB 3TEEA 5KH6A 1G3TA 1BI0A 4TVRA 3G71A 2QEXT 3FB9A 1YHQA 1N6AA 1AHJB 2JTFA 3PMTA 3WXMB 4OB3B 5CQXA 3CCUA 5IN1A 3I56A 2DIGA 2Y4YA 4EMKB 4BD3A 3OYYA 2RJEA 1QW1A 1OZ2A 2E64A 3OW2S 3CCQT 4BE1A 2WSCE 5FU7C 2E65A 2EJ9A 5LJ5j 2VV5A 4FT2A 2JVVA 3VJPA 4C92B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5I A;  2IG0 A;  2D9T A;  1WJQ A;  3P8H A;  3UWN A;  4B9X A;  4CRI A;  2EQU A;  3OYA A;  3KUF A;  2RHI A;  2XK0 A;  3PNW C;  4IUR A;  5KCO A;  2K3X A;  2O4X B;  4A4E A;  5J26 A;  3OYL A;  4LD6 A;  4PLL A;  4BDZ A;  4EDU A;  1KHC A;  3LX7 A;  5KE3 A;  1MHN A;  3QII A;  2L89 A;  4GY5 A;  3MP8 A;  2GFA A;  4L59 A;  3OY9 A;  3GOX A;  4ZTF A;  3LGF A;  2GFU A;  2G3R A;  2M1H A;  2O4X A;  4E7J A;  4A4G A;  4FL6 A;  2RHU A;  3LH0 A;  3L2U A;  2PQW A;  2M16 A;  3FLG A;  3EAE A;  2EFI A;  3CEY A;  2BKD N;  2RI5 A;  2VYT A;  3DB4 A;  4UC4 A;  3QKJ A;  4A4H A;  3OYG A;  3S3O A;  2X4W A;  2RHX A;  3C4S A;  3M9Q A;  4NS5 A;  3NTH A;  3QBY A;  4IUQ A;  3O8V A;  3S3N A;  3QJ6 A;  2CKK A;  3L42 A;  3OYM A;  2F5K A;  3OB9 A;  3L2Q A;  2RI3 A;  2EQK A;  3OQ5 A;  3L2W A;  2RJD A;  3OS1 A;  2JZ2 A;  1WJS A;  3OYK A;  1OI1 A;  4PL6 A;  4E7I A;  3OA6 A;  1G5V A;  5IAY A;  5FRO A;  5M9O A;  4C5E A;  1N27 A;  2L8D A;  3NTI A;  3MEA A;  2WAC A;  4PLI A;  2NLU A;  3H8Z A;  3H6Z A;  4IUV A;  2QQS A;  4QQD A;  2FHD A;  3ZEH A;  3DLM A;  3MP6 A;  2LRQ A;  3S6W A;  3OYF A;  3S3M A;  4E7L A;  3OYC A;  2L3R A;  4BAC A;  4QQG A;  3PMI A;  5D6X A;  2MWP A;  3OS2 A;  3E9F A;  2BIV A;  2R57 A;  2X4X A;  4BDY A;  2LVM A;  2GF7 A;  2EQM A;  2LTO A;  3OS0 A;  5KE2 A;  4IUU A;  4RG2 A;  2K3Y A;  2X4Y A;  4B9W A;  4FU6 A;  2RJC A;  2DAQ A;  4N4G A;  3Q1J A;  1OZ3 A;  2RJF A;  5C6S A;  4A4F A;  3MET A;  2BUD A;  2M0O A;  3LYI A;  5D6Y A;  3MEW A;  3SD4 A;  4BE0 A;  3L2R A;  4QQ6 A;  3FEO A;  3OYN A;  2P0K A;  4II1 A;  4QW2 A;  4ZTJ A;  4C5G A;  4IUP A;  3MEV A;  3OYJ A;  3P8D A;  4HCZ A;  1WJR A;  1WGS A;  4N4H A;  5KCH A;  1H3Z A;  2MWO A;  4BE2 A;  4E7H A;  2XDP A;  5J39 A;  5C0M A;  3F70 A;  4C5H A;  1OYX A;  2DIQ A;  3BDL A;  3PFS A;  3OMG A;  3OYE A;  4E7K A;  1SSF A;  5D6W A;  5FRM A;  2R5A A;  3ASK A;  3UT1 A;  3OYB A;  4IKF A;  1RI0 A;  3NTK A;  2RO0 A;  5CIU A;  2E5Q A;  2RHY A;  2YRV A;  2E6N A;  3MP1 A;  4Z02 A;  3DB3 A;  4Q5W A;  3OYI A;  3OMC A;  2HQX A;  2X35 A;  2LDM A;  3MO8 A;  3LLR A;  2EKO A;  5FRN A;  5KH6 A;  4OVA A;  2R5M A;  2JTF A;  3PMT A;  2HQE A;  3E9G A;  5IN1 A;  1XNI A;  2DIG A;  3L2V A;  3ME9 A;  4BD3 A;  2LCC A;  2RI2 A;  4X34 A;  2RHZ A;  4IUT A;  2RJE A;  2QQR A;  1OZ2 A;  4N4I A;  3OYD A;  3FDR A;  3LGL A;  4QVZ A;  3MEU A;  2EQJ A;  2R58 A;  2B8A A;  4BE1 A;  3OYH A;  3FC3 A; 
#chains in the Genus database with same CATH topology
 5GAN 3;  3P8H A;  2EQU A;  3A8H B;  3OYA A;  2RHI A;  2HKN A;  2JMA A;  1NPP A;  2CH4 W;  2X3X D;  2ZGW A;  1VQ9 Q;  4JRQ A;  2RH2 A;  3FLG A;  1UTI A;  2EFI A;  4UC4 A;  2VGM A;  2DL3 A;  4NS5 A;  4LDY A;  4AFZ C;  2KBT A;  2EYZ A;  3CCV A;  1ZBX A;  4ORZ A;  4F04 B;  4M78 F;  1YNZ A;  3VS7 A;  4DBR A;  1KD1 R;  3FRN A;  1WPY A;  2LZ6 B;  2EYQ A;  2OTJ T;  4Z89 A;  4ME7 A;  1I0C A;  3VS4 A;  4FYV B;  2XKO C;  2NUP A;  1MV0 B;  4ZGJ B;  2HL3 A;  3G4S T;  4JS5 A;  3CPF A;  2RJC A;  2DAQ A;  4JUV A;  2O01 E;  5CVI A;  4A4F A;  1UG1 A;  1YCY A;  4DOV A;  1I5O B;  2K6D A;  4QW2 A;  1RI9 A;  2PUK B;  1HK9 A;  1QVG A;  3CXC P;  4HA8 A;  1MUZ A;  2MWO A;  4KH1 B;  4M7D B;  3EHR A;  2E70 A;  4J9G A;  1Z9Q A;  3BDL A;  1K9A A;  3OMG A;  3OYE A;  4BB7 A;  1ACM B;  4RMO A;  4M78 C;  2MK5 A;  4IKF A;  3RR6 A;  1M27 C;  2KE9 A;  2DD4 A;  1VQM Q;  1VA7 A;  4P5N A;  1BK2 A;  2CT3 A;  4JJB A;  1Y71 A;  1VQN T;  1UGS B;  8AT1 B;  4HVU A;  1PKT A;  5A0D A;  3A5Z B;  4M7D F;  1NYG A;  2KNB B;  4O6J A;  2MYS A;  2CZ6 B;  2EQI A;  2RI2 A;  5CKD A;  5GMK i;  3EGU A;  4NOY A;  3UAT A;  1QKX A;  3EH1 A;  1VQP Q;  1E6H A;  1JJ2 S;  1BIB A;  2F2V A;  2EIF A;  3CCV Q;  8ATC B;  4M7A B;  1WJQ A;  3PNW C;  2KXC A;  2EWN A;  4WTO B;  3HFN A;  5CQY A;  3NGP A;  3WVD B;  3CCV T;  4F7U G;  4ZTF A;  1MND A;  4M75 A;  3RMQ A;  2V8J A;  4JJC A;  2JTM A;  3V7S A;  4C8Q F;  1WXT A;  5L23 A;  3WVE B;  5FU6 B;  2X4W A;  4HCK A;  1Q81 C;  2CP0 A;  3S3N A;  1KC8 R;  3M58 A;  4DBF A;  3CCM A;  1R0B G;  4A4K A;  1WHG A;  3OB9 A;  1BB9 A;  4RCC A;  4M7A F;  1AZG B;  1YJN A;  4E7I A;  3RKY A;  4PLI A;  1AZE A;  1JJ2 P;  2LRQ A;  2LCS A;  1M90 C;  2CRE A;  3CC2 Q;  1MMD A;  4BDY A;  1VQK A;  5KE2 A;  1TSF A;  1Y96 A;  2RMO A;  2ZPI B;  3PIO A;  1KQ1 A;  2PVG B;  3TU4 K;  4FCY A;  2SRC A;  4C92 F;  1BU1 A;  1D1C A;  1M5Q 1;  4IUP A;  4XTU A;  3EG9 B;  1ZSG A;  4X1V A;  4D8D A;  3JB9 H;  1ZUK A;  5IT9 E;  4J9E A;  4OML A;  3A1P A;  5LJ3 g;  3F70 A;  3QDF A;  4D6W A;  3PGG A;  4RUG A;  3CPW A;  1IZ6 A;  1NJI R;  1EZZ B;  4EMG A;  2MAM A;  1AOJ A;  1M3B A;  3LWI A;  2X9H A;  4ESR A;  5GJV B;  2OJ2 A;  3QXE B;  3JAM E;  2ZPG B;  1Q82 C;  3LGL A;  1JB0 E;  4MMK A;  4OMF B;  2F2W A;  2D6F A;  1OPL A;  2BTT A;  2COW A;  2RK1 A;  4C92 C;  4AFS C;  4JLI A;  2JJ9 A;  3T9N A;  4DBH A;  3RES A;  1UEB A;  1I07 A;  5AYF A;  2YXY A;  1K8A C;  3CCM T;  1QWF A;  3JB9 G;  1YJN T;  3E19 A;  3BFM A;  1PHT A;  3DLL A;  4J9B A;  3NPF A;  3M9Q A;  2D8H A;  1QQJ A;  2DVJ A;  5LJ5 e;  3V8L A;  1VQK T;  4LDW A;  3R6N A;  5FRO A;  2CS7 A;  1VQL A;  2VC8 A;  1B3Q A;  1VQ7 Q;  3S3M A;  3OYC A;  1RAA B;  1M3A A;  2E12 A;  3CCE Q;  2GF7 A;  5IXF A;  1FX7 A;  2VVK A;  4FT4 A;  1M1K R;  2K3Y A;  1JXM A;  1Q81 U;  4PFO A;  3VS5 A;  2H8H A;  2EW3 A;  2JM9 A;  3JCM P;  2VB6 A;  3MET A;  2ED1 A;  1K73 C;  2VXE A;  1DJ7 B;  1W1F A;  3EHQ A;  1YIJ A;  5GAN 6;  4KGX B;  1YJ9 Q;  4LDU A;  2ZPB B;  2XDP A;  1ABO A;  4R0K A;  4AG2 C;  1M90 U;  1UHF A;  4C5H A;  4M77 C;  1XQH A;  3OW2 A;  2COZ A;  1QKW A;  5FRM A;  2FRW A;  2VUB A;  2FPE A;  5GAM e;  3HKS A;  3QO3 A;  2DZ9 A;  3JCM e;  1AD5 A;  1AWJ A;  3G1J A;  2YRV A;  3GPL A;  3SWN B;  1UJY A;  1W4S A;  4HCC A;  2VGN A;  3E9G A;  3CCR Q;  1U06 A;  2DA9 A;  3PIP A;  1KHI A;  4GBQ A;  3FDR A;  4QVZ A;  2DBK A;  4ANJ A;  2QDY B;  3CBP A;  1R8O B;  5GAM g;  2K79 A;  1J3T A;  3JCM g;  5GAN g;  1OQK A;  4J9I A;  5GAN j;  2LQK A;  2ECZ A;  1VQL Q;  5I2M A;  2BZY A;  3ULR B;  3V7R A;  1EIF A;  2RI5 A;  2L2P A;  2DMO A;  1VQL T;  3NTH A;  3O8V A;  1Q82 U;  1AWX A;  1G2B A;  2RJD A;  1OI1 A;  2E4H A;  3ZFJ A;  3QUI A;  1VUB A;  1D1A A;  3ZEH A;  1KSW A;  3UF4 A;  3SFM A;  3ER0 A;  3TSZ A;  3REB B;  5LJ3 h;  1YP5 A;  2BIV A;  2X4X A;  2LTO A;  1YIJ T;  1SHF A;  2X4Y A;  5KYN A;  1M1G A;  3RKX A;  4N4G A;  2M0O A;  1BCO A;  4PKC C;  5GAO r;  1QLY A;  4MML A;  3L2R A;  1MV3 A;  2DYI A;  3FEO A;  4M75 F;  2EBP A;  4ELZ C;  4HCZ A;  5LJ3 f;  5KCH A;  2HBP A;  4RG8 A;  3C12 A;  5HK3 A;  3JV3 A;  3NFC A;  4DEY A;  3VRY A;  2RF0 A;  1U8R A;  3PFS A;  4XK8 E;  2W0Z A;  4M7D A;  1QCN A;  2GTJ A;  4WF2 A;  1IXD A;  1YWO A;  3QSU A;  2EYY A;  3EG3 A;  2E5Q A;  1K0S A;  1AWO A;  2HQX A;  5CK9 A;  2ATC B;  3TEE A;  5KH6 A;  3VS3 A;  3SHW A;  3G71 A;  1M8M A;  1YHQ A;  3PMT A;  2DIG A;  2G6F X;  4EMK B;  1R77 A;  2J6O A;  3OYY A;  2RJE A;  2DFU A;  3O5Z A;  5FU7 C;  2E65 A;  1ARK A;  3VJP A;  3G6E A;  4FSX A;  1VQ4 A;  3KXT A;  4M75 C;  1PSF A;  3OYL A;  4BDZ A;  4FM4 B;  2E5K A;  3VS0 A;  2QGG A;  1KHC A;  3LX7 A;  1RUW A;  4M7A A;  1C1A A;  1Q86 U;  4JS4 A;  2JN0 A;  1I8F A;  2G3R A;  1CKA A;  3IQL A;  2CSQ A;  3X26 B;  1W2B A;  2J6F A;  5LJ5 d;  1R0C B;  4HT8 A;  1PRL C;  3M4G A;  1GBQ A;  2RI3 A;  3PE0 A;  3M55 A;  2JZ2 A;  3OYK A;  4M78 G;  3KBG A;  5GMK m;  4PJO B;  1ZSZ A;  2J7I A;  2KGT A;  2LJ3 A;  2DNU A;  2X3W D;  5I21 A;  1TU0 B;  2A28 A;  1IRX A;  3OS0 A;  2ZPE B;  4IUU A;  1X6B A;  4KT0 E;  1CKB A;  2O9S A;  4QVD A;  2BUD A;  2XDB A;  3LH5 A;  3M56 A;  2DBM A;  2Y4X A;  3M59 A;  2AZV A;  1GCQ A;  4F17 A;  2K3B A;  1QCO A;  2WSE E;  4PJO F;  3G71 Q;  3EFO B;  1PM3 A;  1H3Z A;  1RAD B;  1ZUU A;  3EG9 A;  4F14 A;  1VQ9 A;  4E7K A;  2YUQ A;  5D6W A;  1JRI A;  4J8O A;  3G7Z A;  1YIT A;  2QXF A;  4OB1 B;  3G71 T;  3ASK A;  1YHQ T;  1VQ4 Q;  1FMV A;  3UT1 A;  5A0L A;  5GAN h;  2PNI A;  4AFQ C;  1VQO A;  3CC4 Q;  1T0J A;  2LQ8 A;  4E7Z A;  3VUZ A;  3G6E T;  5KYU B;  1VQ4 T;  2KY9 A;  2W10 A;  1WLP B;  3ME9 A;  2GCX A;  5HKC A;  4OB0 B;  4KH0 B;  4QVC A;  2QQR A;  1QVF A;  3M0P A;  3MEU A;  5GMK j;  5GAM f;  2B8A A;  2LJ1 A;  1GRI A;  3JCM f;  3JCM b;  3RBB B;  4D8K A;  3ZL7 C;  3CCJ Q;  1TUD A;  4MDW A;  2C0T A;  1UE9 A;  9ATC B;  3OY9 A;  2LNH B;  1LCK A;  1HJD A;  4E7J A;  2DL8 A;  4MZM A;  5A0G A;  3CC7 A;  2J6K A;  3DB4 A;  4C8Q G;  3OYG A;  1YJW Q;  1NBE B;  2A3L A;  2ZAE A;  4XAX B;  2LT1 A;  2DTO A;  3C4S A;  1RAE B;  4PJN A;  2YWW A;  3JCM V;  4F7U E;  3L2Q A;  1SRL A;  4QKU A;  2ZPF B;  2CP2 A;  4OMM A;  3TVT A;  4M7A G;  5IAY A;  4HVW A;  1ABQ A;  1VQM A;  4JLG A;  2WAC A;  2Z0W A;  5I2S A;  3H6Z A;  2AKK A;  3OYF A;  2FZC B;  3QWY A;  2PZ1 A;  1VQ8 Q;  3VYH B;  2L3R A;  4BAC A;  2I2L A;  3OS2 A;  2CDT A;  4CC3 A;  3CXC S;  1YIT Q;  1X01 A;  1VQP A;  1OX8 A;  1M2O A;  1OX9 A;  3SD4 A;  3UA7 A;  5GAO l;  1VQ9 T;  1VQO Q;  4C92 G;  3OYN A;  3ZBD A;  2EJG A;  2E3I A;  4DEX A;  1YIT T;  4KBM B;  3P8B B;  5J39 A;  4JPB W;  2JW4 A;  2CP7 A;  1VQO T;  2DTI A;  1UB4 A;  4A54 A;  2DJZ A;  1P92 A;  3SDZ A;  1X69 A;  2IPO B;  1Q7Y U;  3H41 A;  2EAY A;  4XU3 A;  4Q5W A;  3OYI A;  2CP5 A;  2DD5 A;  3CC7 Q;  3SWN A;  3CC2 A;  1JBM A;  4X34 A;  3QZ9 B;  4IUT A;  1I4K 1;  2K9G A;  2A0F B;  2ENM A;  2P0P A;  1RL2 A;  2CZ1 B;  2ROT A;  2D9T A;  3LWH A;  4XU1 A;  4CRI A;  3CC7 T;  2QK0 A;  3HTR A;  1QMC A;  2O4X B;  2KYM A;  5J26 A;  3UDC A;  2GFA A;  1GFD A;  2KMT A;  3LGF A;  1BI1 A;  1O75 A;  3CEY A;  2YSQ A;  3VU3 C;  2AT1 B;  1VQM T;  1VOM A;  4M77 G;  3QJ6 A;  1QVG P;  2AKL A;  1WJS A;  2HQH A;  3BW1 A;  2P4T A;  3GP8 A;  3JSC A;  2DJQ A;  3NTI A;  1VQP T;  2K5L A;  3MP6 A;  2YUO A;  3JB9 D;  2DXU A;  1H8K A;  4QQG A;  3EG2 A;  2MWP A;  1Y0M A;  3OSS C;  2HKQ B;  4OF1 A;  1JJ2 A;  2SEM A;  4XTY A;  2DXB A;  5C6S A;  2L3P A;  2PUO B;  3REA B;  1ZSZ B;  1JQQ A;  2K4Y A;  1VIE A;  3CCQ Q;  4II1 A;  2HCK A;  1Q81 R;  2HL5 C;  4N4H A;  1WA7 A;  1MNE A;  4C0D B;  4BE2 A;  2V1Q A;  3CBO A;  4M7D C;  1T3S A;  5LJ3 e;  3HFO A;  3J81 E;  4MZT A;  5CAI A;  2DK3 A;  5GMK h;  5FLX E;  1HD3 A;  2KRS A;  2AHJ B;  2M02 A;  1RI0 A;  2DKG A;  3CC2 T;  1M90 R;  2XHC A;  1V76 A;  3QYH B;  5GAO q;  3MJX A;  4E7S A;  3LLR A;  1OU8 A;  2ZZD A;  3A98 A;  4FYW B;  1N8R R;  1OOT A;  2ABL A;  1VQ7 A;  2E6Z A;  4C8Q C;  4ELY C;  1W6X A;  1H64 1;  1XNI A;  1EX4 A;  4E6R A;  3CCE A;  2DPP B;  2R58 A;  3OYH A;  2E1H A;  4EMK A;  1OV3 A;  5I11 A;  4M7A C;  5L8R E;  4NL3 A;  1NJI C;  2AZS A;  2CP3 A;  4A4E A;  2Y90 A;  6AT1 B;  3MP8 A;  5IHI A;  4L59 A;  4PJM A;  2HD0 A;  2PU9 B;  1YJ9 A;  1TG0 A;  2XU8 A;  4OMN A;  2GTO A;  1E7O A;  2PQW A;  2YRD A;  2BKD N;  3QKJ A;  5FU6 C;  4JZ3 A;  1M9S A;  1AEY A;  2F5K A;  5GAO p;  2ZCF B;  4DA4 A;  3PVQ A;  3J80 E;  2HBW A;  4PJJ A;  1K9M C;  3L1A A;  5HK0 A;  3A8L B;  3H8Z A;  4E47 A;  2QQS A;  1NEG A;  3S6W A;  2K7A A;  3I56 Q;  3D7S B;  1UGP B;  1WFW A;  4GLM A;  3CCR A;  4PJO A;  2RPN A;  2DL4 A;  2KR3 A;  2MF2 A;  4MZP A;  3CD6 Q;  1BBZ A;  1GCQ C;  1KIK A;  4LE9 A;  2I0N A;  2QGF B;  4F7U B;  4C5G A;  1SG5 A;  4J6X A;  4M75 G;  3J7A F;  2MOX A;  5C0M A;  3QG1 A;  4ZN1 A;  3EFO A;  5CKH A;  1WI7 A;  1U1S A;  1Y57 A;  3HP9 A;  1VQ7 T;  1K4U S;  2KRN A;  5GAN 7;  1KQS A;  3CCE T;  2C0O A;  1SEM A;  4CC7 A;  4J6W A;  4FW2 A;  1GXI E;  3M5A A;  2JS2 A;  1WHL A;  2H3E B;  1AHJ B;  5FW9 A;  3WXM B;  4OB3 B;  2QA4 Q;  5CQX A;  3CCU A;  2DEU A;  4J9D A;  1JEG A;  3EH2 A;  4OMO A;  1U5S A;  1OZ2 A;  3OW2 S;  5KYU A;  4BE1 A;  5LJ5 j;  2EJ9 A;  2O31 A;  2VV5 A;  4FT2 A;  4JJN K;  1YJ9 T;  2OTL Q;  1FWZ A;  4M4Z A;  1D09 B;  1D0Z A;  1M30 A;  2YDL A;  4IUR A;  5GAN e;  2K3X A;  3CME Q;  3MCA B;  4EDU A;  2DIL A;  4GY5 A;  4RTV A;  4XU2 A;  1KK7 A;  2KAF A;  3QHS A;  2WSF E;  3CCL Q;  2C0I A;  4OP0 A;  1Q86 R;  1G5V A;  3CCR T;  3JCM Q;  5M9O A;  1NJI U;  4C0G A;  1V29 B;  2DET A;  3OW2 P;  3X20 B;  1M8V A;  1QCF A;  4K11 A;  4M78 E;  2EQM A;  1G3Y A;  2YLB A;  3M0Q A;  3I9Q A;  4HVV A;  2XI9 A;  1LVK A;  2NWM A;  1UGR B;  4M78 D;  2CGH A;  4BE0 A;  2MIO A;  2LQN A;  2P0K A;  4KGV B;  4EMH A;  1ZA1 B;  1W70 A;  1B34 B;  2VAS A;  4B6M A;  1I1J A;  1K9M U;  1K8A U;  2DEQ A;  4PJO G;  4E7H A;  1HXD A;  3CCU Q;  5LJ3 d;  2CUD A;  1OYX A;  2FEI A;  1NE8 A;  2EGA A;  3OBW A;  2CZ7 B;  3EG1 A;  1TOV A;  2JXB A;  2OI3 A;  3CCU T;  3HHT B;  2RQU A;  1OUL A;  3NHN A;  3DB3 A;  1PSE A;  1VQ5 Q;  3MO8 A;  1BCM A;  2EKO A;  4DQ2 A;  2QDL A;  3JB9 F;  3CMA Q;  4OVA A;  2R5M A;  3C94 A;  2LNV A;  5EC7 A;  1UGQ B;  2BE7 D;  3M4Y A;  4JDS A;  2KRO A;  2YHT A;  3EGD B;  2RHZ A;  2DX1 A;  3QJY A;  2BZ8 A;  4XQ3 A;  2K5I A;  2RK2 A;  4JZ4 A;  3LW5 E;  1X6O A;  4B9X A;  1N9S A;  2P84 A;  2XK0 A;  2A7Y A;  1G83 A;  1O9S A;  2OAU A;  1K73 U;  1MHN A;  3CCS A;  3QYG B;  1MMA A;  2LT4 A;  1WQ7 A;  2O4X A;  5IHK A;  7AT1 B;  1C0M A;  2IVW A;  5CKB A;  3AHU A;  2RM4 A;  2HAX A;  2HZY A;  4E2F B;  1KFZ A;  2KDS A;  2XG8 D;  1MMN A;  2CKK A;  1C6V X;  3OQ5 A;  1Q95 G;  4C8Q E;  1GCP A;  3TQ7 P;  1VIF A;  1IGQ A;  4DBQ A;  1UUE A;  2EJF A;  2M0Y A;  4OB2 B;  4L6V 5;  2NLU A;  3CC4 A;  3VYG A;  3DLM A;  3TCJ A;  2QQ9 A;  5D6X A;  4M7A E;  4C8Q D;  2LQW A;  5DLO A;  2RB6 A;  2FPF A;  1TUC A;  1YBY A;  3INZ A;  4HKE A;  1W2B S;  3R6O A;  4PNO A;  2CUB A;  1HYO A;  2EVR A;  4M7A D;  3RNJ A;  2QQB A;  4HT9 A;  3CCJ A;  1XOV A;  2DM1 A;  1KJW A;  4NL2 A;  1WXB A;  4QT7 A;  1FMW A;  1OEB A;  4C92 E;  2DE0 X;  4BY6 B;  1YJW A;  1SSF A;  2LX7 A;  3A8O B;  2D0N A;  3TRE A;  4OGC A;  2NUZ A;  3EG0 A;  2AIR B;  2RO0 A;  4C92 D;  2NYS A;  4XTZ A;  2F2X A;  3GNG A;  2LDM A;  4EIK A;  3CCS Q;  4J83 A;  2RNA A;  2DO3 A;  1W2B P;  4V2S A;  1BYM A;  1Q7Y R;  1IB8 A;  3HRS A;  1VQ8 A;  4RKU E;  1LNX A;  2DXC A;  4AT1 B;  5GMK e;  4N4I A;  3CCS T;  2QTX A;  1E6G A;  2HEQ A;  2K57 A;  4HCB A;  3HPW A;  2GQI A;  1U1T A;  5GAM d;  4PFP A;  2OX7 A;  4PK4 A;  4IIO A;  3JCM d;  2X51 A;  5KCO A;  5FWB A;  1UDL A;  2D8J A;  4LD6 A;  5HY6 A;  1RLQ C;  3H0I A;  5CR2 A;  4LD9 K;  2ESW A;  2GGR A;  4FW1 A;  2M1H A;  3DKM A;  2CT4 A;  3L2U A;  3EFR A;  2XMF A;  4M7D G;  2F69 A;  3CC4 T;  1QVF S;  1ZLM A;  3OYM A;  5GAN f;  4PFZ A;  2H3J A;  2VWF A;  3VUB A;  4C0Z A;  4JRI A;  5DY9 A;  3FJ5 A;  5A2Q E;  1QWE A;  4M77 E;  4JRP A;  1RAB B;  5AT1 B;  4PJO C;  3X24 B;  4RTT A;  1ZQ1 A;  4O5V A;  4ATO A;  3JCM W;  1QP2 A;  4L5G A;  2R57 A;  1PCX A;  1WZO A;  3CCJ T;  4XTW A;  2HNI A;  4M77 D;  2HSE B;  1NG2 A;  1X75 C;  2QEX Q;  3A8G B;  2IIM A;  3PT9 A;  1YJW T;  5D7U A;  3MEV A;  1QVF P;  5KYX B;  3I5R A;  4ZGE B;  4F7U A;  5KYY B;  2DIQ A;  2RN8 A;  1X27 A;  1QVP A;  2DRM A;  4M78 B;  1G3S A;  5KYW B;  1VQ8 T;  4X9C A;  1WDX A;  3HRU A;  4Z02 A;  3QWX X;  3M0T A;  3OMC A;  3VRZ A;  3VS2 A;  5FRN A;  1U3O A;  3V8J A;  1FMK A;  1GBR A;  3JCM c;  2LP5 A;  3RIR A;  3L2V A;  1KD1 C;  4N0A A;  3OYD A;  3CXC A;  1UEC A;  4A63 B;  2EQJ A;  2E41 A;  2OTJ Q;  2V1R A;  3QPH A;  5CKE A;  1SRM A;  4LNP A;  2IG0 A;  5ECA A;  2P0Q A;  2XID A;  2P4R A;  2QQA A;  3G4S Q;  2PVD B;  1AT1 B;  2AK5 A;  3CCQ A;  1UGV A;  1QVG S;  2MI6 A;  2V8K A;  5GMK l;  1AVZ C;  1ZBJ A;  2M16 A;  3EAE A;  4YTL A;  2VYT A;  4A4H A;  2ED0 A;  1Y7X A;  2KXD A;  2LMJ A;  4IUQ A;  1BKB A;  1YFN A;  4IIM A;  2KSS A;  1BIA A;  1IHV A;  3CBM A;  2QTV A;  4RTX A;  5DM7 R;  1NYF A;  2M51 A;  5CKF A;  4RTW A;  4KRT A;  3OS5 A;  5GAN 2;  2NUT B;  4Y91 A;  1Z9Z A;  1PNJ A;  2L3Q A;  1Y07 A;  1VQN Q;  4XTV A;  2KRM A;  5DLQ E;  3Q1J A;  2RJF A;  1V1C A;  3LYI A;  3MEW A;  1D1B A;  2E10 A;  1WHK A;  1M3C A;  2EYW A;  1NLP C;  3OYJ A;  1G8X A;  1B7T A;  2ZPH B;  3VKI A;  4C8Q B;  3PTA A;  4KGZ B;  4WCI A;  2OAW A;  2K2M A;  1B34 A;  2YLC A;  3OBY A;  1PG5 B;  5CCA A;  4M75 E;  4KUD K;  2YUP A;  3BE3 A;  5FWC A;  3UA6 A;  3NTK A;  1RAC B;  3MP1 A;  3M0S A;  4M75 D;  1KC8 C;  4LXC A;  1WQW A;  2KYB A;  3FIF A;  1B07 A;  1G3T A;  2YRC A;  3U23 A;  1BI0 A;  3FB9 A;  2JTF A;  3I56 A;  1RAI B;  2Y4Y A;  1AWW A;  1QW1 A;  2E64 A;  4J9C A;  3CCQ T;  1TUG B;  4FSS A;  1WYX A;  2VKN A;  4RTY A;  2F1L A;  3EGX B;  2JVV A;  1F1B B;  4C92 B;  4C5I A;  5GAN 5;  1YI2 A;  3UWN A;  3CD6 A;  3EGD A;  2CSI A;  1T3L A;  4J9H A;  1RAG B;  2F5T X;  4PLL A;  3GLX A;  4Y28 E;  2PVO B;  1VYT A;  3HL8 A;  3V7C A;  4OMP A;  2COY A;  4A4G A;  3FJP A;  4FL6 A;  4AFU C;  2GNC A;  1UJ0 A;  2J05 A;  4LDX A;  1SHG A;  1K1Z A;  1KD1 U;  4FIB A;  1PC0 A;  4ZGD B;  1N8R C;  2RHX A;  2KVQ G;  3EFS A;  3QBY A;  3BY7 A;  1JXO A;  3A8M B;  3CPW S;  2JNG A;  3URG A;  1JU5 C;  2L5Q A;  3JCM X;  1WHJ A;  2CYZ B;  4PL6 A;  1M2V B;  2XDD A;  2FPD A;  4GLK A;  1D3B B;  3E1S A;  3H0H A;  2L8D A;  2FB7 A;  3OSV A;  4QQD A;  1WNL A;  1NZ9 A;  2YUN A;  1K0X A;  5LJ3 j;  2FG0 A;  1LPL A;  2QA4 A;  2LVM A;  1X2Q A;  4RG2 A;  2RQV A;  4B9W A;  4BI8 B;  1OZ3 A;  3N5B B;  5IHN A;  1IHW A;  4F16 A;  2QAZ A;  2OTL A;  3RKW A;  1ZSZ C;  1N9R A;  3X25 B;  5GAO n;  3CME A;  2HDA A;  1WGS A;  1Q82 R;  3CPW P;  4C0D C;  4M77 B;  2DL5 A;  4XTX A;  2DL7 A;  5IXB A;  2BZX A;  3X28 B;  1I5L A;  1BI2 A;  1ZHI A;  2QI2 A;  3CCL A;  3CCM Q;  1K9M R;  1H3H A;  4PJO E;  3KFV A;  1YI2 Q;  1K8A R;  3VV0 A;  5CO7 A;  1YJN Q;  2J06 A;  2JM8 A;  3OYB A;  1TWB A;  3I56 T;  3M0U A;  2JMC A;  5CIU A;  4Y92 A;  4RCB A;  1RAH B;  2KT1 A;  3M0R A;  4LUD A;  2E3H A;  4C0F A;  4PJO D;  1YI2 T;  3CD6 T;  1M4Z A;  1VQK Q;  2BE9 B;  4M77 F;  1S72 A;  4ZN3 A;  3KUF A;  1UFF A;  1M1K C;  1KQS S;  2LC4 A;  2LCL A;  2A37 A;  2LX9 A;  5KE3 A;  1KC8 U;  4F7U F;  3GOX A;  1PRM C;  2DYB A;  2GFU A;  3GIB A;  3MHX A;  2QAS A;  2RHU A;  2MCN A;  1KG1 A;  2DZC A;  4J9F A;  5LJ5 g;  1K73 R;  3I5S A;  3M53 A;  1PD1 A;  3L42 A;  3SB2 A;  2CH4 A;  4X9D A;  5J3B A;  4J5Y A;  2C06 A;  2QA4 T;  3OA6 A;  2QG9 B;  1SPK A;  4C5E A;  1N27 A;  2DVE A;  2FRY A;  3VS6 A;  2KK4 A;  2NUP B;  2PTK A;  3NMZ C;  2FHD A;  1VQ5 A;  3SEM A;  3PMI A;  1D0X A;  1VYU A;  5GJW B;  3CMA A;  2OTL T;  2DLP A;  2JOY A;  3UPU A;  3HSB A;  1SKU B;  4BI4 A;  3CME T;  1KQS P;  1A0N B;  1N8R U;  4AG1 C;  1NEB A;  1WIE A;  3H0F A;  5EG2 A;  5D6Y A;  4ZTJ A;  3CCL T;  1Q86 C;  2EGE A;  2GQV A;  1SF9 A;  4DOW A;  2L3S A;  3QZ5 B;  2KT8 A;  1S72 Q;  5KYX A;  1XJW B;  2XD0 A;  1WX6 A;  4AMC A;  5KYY A;  5GAM j;  1H92 A;  4J7I A;  1S72 T;  2K5F A;  1N5Z A;  4M78 A;  5KYW A;  5GAN 4;  1VQ6 A;  4N0A C;  3E2U A;  3M54 A;  1M1F A;  4MDX A;  4CC2 A;  4R55 A;  3CQT A;  2FVU A;  3THK A;  1IGU A;  3MKD A;  2LJ0 A;  2MPX C;  4RTU A;  5FU7 B;  2FO0 A;  1VYV A;  2KI7 A;  1XTD A;  2JT4 A;  2EGC A;  4M75 B;  1JO8 A;  1YIJ Q;  2QYZ A;  1EFN A;  2V26 A;  3GF5 A;  2DER A;  3QII A;  1I81 A;  3SWN C;  1FXX A;  1PD0 A;  3H9N A;  3JB9 J;  3RUX A;  4LN2 A;  5IH2 A;  1VQ5 T;  5LL6 S;  1QP3 A;  2KEA A;  3CMA T;  4KUL A;  3L2W A;  1BI3 A;  2DTH A;  4RTZ A;  3OS1 A;  2CP6 A;  4LUE A;  4M7D E;  3GNF B;  1M1K U;  3BDU A;  2DXT A;  2FZG B;  1OPK A;  4IUV A;  1IO6 A;  1D0Y A;  1Y96 B;  2DRK A;  4CC4 B;  1ZX6 A;  3E9F A;  3MPU B;  4M7D D;  4J7F A;  2XIC A;  2HMA A;  2RD1 A;  1FYN A;  1K76 A;  1ZUY A;  4XU0 A;  1MGQ A;  4EPC A;  4PJL A;  2NUT A;  4VUB A;  3I35 A;  4Z8A A;  3HRT A;  2M9U A;  1NLO C;  3RMS A;  3C95 A;  1VQ6 Q;  2MMP A;  4OGE A;  1KQ2 A;  3GBQ A;  2EPD A;  1G3W A;  2RQW A;  4A53 A;  4JRK A;  4C8Q A;  5GAO m;  1VQ6 T;  1TS9 A;  3VS1 A;  2KQW A;  1MMG A;  2R5A A;  1T0H A;  2B86 A;  3RDV A;  4R56 A;  3JB9 I;  2RHY A;  3TSW A;  4J6Y A;  2O9V A;  1WXU A;  2X35 A;  2FYK A;  2RA2 A;  5I22 A;  2K2V A;  2HQE A;  1SSH A;  2LCC A;  1RLP C;  3JRZ A;  2EKH A;  3I55 A;  5LJ5 h;  2ROL A;  3L2Z A;  3FC3 A;  2QEX A;  2A36 A;  2FZK B;  2X4J A;  2FL7 A;  3EGX A;  1GFC A;  1TXQ A;  4C92 A;  1X6G A;  2L89 A;  2O2O A;  5GAN 8;  4FYY B;  1IRE B;  3LH0 A;  3S3O A;  5LJ5 f;  4EMK C;  1Q7Y C;  4LDV A;  2EQK A;  3V8K A;  4BUG A;  1UHC A;  5GAN d;  1ZA2 B;  3JCM J;  2JTE A;  3MEA A;  4HXJ A;  4BI3 A;  1YHQ Q;  1M2V A;  4E7L A;  3AT1 B;  4OMQ A;  4FYX B;  2EYX A;  1D3B A;  1X2K A;  2V8I A;  3C0C A;  3RER A;  1CSK A;  2RQR A;  5HCK A;  1OU9 A;  4FU6 A;  2VXF A;  2CZ0 B;  3PVL A;  3G6E Q;  5GAM h;  1WHM A;  1TH7 A;  2JUF A;  2OTJ A;  3JCM h;  1LOJ A;  1LJO A;  4KUI A;  4QQ6 A;  1NM7 A;  4Z88 A;  3P8D A;  3G4S A;  1WJR A;  1PKS A;  1YCS B;  1S1N A;  1X43 A;  1YWP A;  2A08 A;  2D0Q B;  1NPR A;  2RQT A;  3M57 A;  4BY6 C;  3I55 Q;  4M77 A;  2DF6 A;  1HSQ A;  1WHH A;  2D1X A;  2O88 A;  2E6N A;  2GBQ A;  4JJD A;  4CI0 C;  2YT6 A;  3I55 T;  1YN8 A;  3QDR B;  1GL5 A;  4TVR A;  2QEX T;  1N6A A;  2L0A A;  5IN1 A;  2HSP A;  1TTH B;  4BD3 A;  2JS0 A;  4ZNX A;  1PWT A;  1RAF B;  2WSC E;  1VQN A; 
#chains in the Genus database with same CATH homology
 4C5I A;  1FWZ A;  4FSX A;  3P8H A;  3UWN A;  5GAN 3;  5GAN 5;  3G6E A;  1VQ4 A;  2EQU A;  3A8H B;  3OYA A;  3CD6 A;  5GAN e;  4IUR A;  2RHI A;  3KXT A;  4M75 C;  2K3X A;  2F5T X;  1PSF A;  3OYL A;  4PLL A;  3GLX A;  4FM4 B;  3MCA B;  4Y28 E;  4EDU A;  4BDZ A;  1KHC A;  2PVO B;  3LX7 A;  1NPP A;  3HL8 A;  4M7A A;  4GY5 A;  3V7C A;  4XU2 A;  1Q86 U;  4JS4 A;  2ZGW A;  2JN0 A;  1I8F A;  2G3R A;  2KAF A;  4A4G A;  3FJP A;  4FL6 A;  4JRQ A;  3QHS A;  2RH2 A;  3FLG A;  4UC4 A;  2EFI A;  2WSF E;  2VGM A;  4LDX A;  3X26 B;  1KD1 U;  4FIB A;  1N8R C;  4ZGD B;  1W2B A;  2RHX A;  2KVQ G;  4NS5 A;  4LDY A;  1YJ9 T;  3EFS A;  3QBY A;  3BY7 A;  5LJ5 d;  3A8M B;  3CPW S;  4HT8 A;  2JNG A;  3M4G A;  4OP0 A;  3URG A;  3CCV A;  2RI3 A;  3M55 A;  2L5Q A;  3JCM X;  1ZBX A;  2JZ2 A;  4M78 F;  3OYK A;  2CYZ B;  4PL6 A;  1G5V A;  2XDD A;  4M78 G;  3CCR T;  3KBG A;  4GLK A;  3JCM Q;  5GMK m;  5M9O A;  1D3B B;  3E1S A;  1NJI U;  2L8D A;  2FB7 A;  1V29 B;  3FRN A;  4C0G A;  3OSV A;  1WPY A;  4PJO B;  4QQD A;  1WNL A;  3X20 B;  1NZ9 A;  1M8V A;  2EYQ A;  2OTJ T;  4ME7 A;  5LJ3 j;  4M78 E;  5I21 A;  2XKO C;  2QA4 A;  2LVM A;  2EQM A;  3OS0 A;  2ZPE B;  4IUU A;  1G3Y A;  2YLB A;  4RG2 A;  4ZGJ B;  4B9W A;  3G4S T;  4JS5 A;  4KT0 E;  4BI8 B;  3CPF A;  2XI9 A;  2RJC A;  2DAQ A;  4JUV A;  1OZ3 A;  2O01 E;  3N5B B;  5CVI A;  4A4F A;  4QVD A;  2BUD A;  2XDB A;  1UGR B;  1YCY A;  4M78 D;  3M56 A;  4DOV A;  2Y4X A;  2CGH A;  3RKW A;  4BE0 A;  2OTL A;  1N9R A;  3M59 A;  2P0K A;  4QW2 A;  3X25 B;  4EMH A;  5GAO n;  2PUK B;  1B34 B;  1HK9 A;  3CME A;  1QVG A;  1K9M U;  4HA8 A;  1WGS A;  2WSE E;  4PJO F;  1H3Z A;  1K8A U;  2DEQ A;  4PJO G;  2MWO A;  4M7D B;  4E7H A;  4C0D C;  1HXD A;  5LJ3 d;  2E70 A;  4M77 B;  4XTX A;  1OYX A;  3X28 B;  1I5L A;  1VQ9 A;  3BDL A;  3OMG A;  1BI2 A;  1NE8 A;  1ZHI A;  2QI2 A;  3OBW A;  5D6W A;  3OYE A;  1JRI A;  4E7K A;  2CZ7 B;  3CCL A;  4J8O A;  4BB7 A;  3G7Z A;  1YIT A;  2QXF A;  4OB1 B;  3G71 T;  4PJO E;  3ASK A;  1YHQ T;  4RMO A;  3VV0 A;  4M78 C;  5CO7 A;  3UT1 A;  3OYB A;  3CCU T;  5A0L A;  3I56 T;  4IKF A;  3HHT B;  5CIU A;  5GAN h;  2DD4 A;  3DB3 A;  1VQO A;  4RCB A;  1PSE A;  4P5N A;  3MO8 A;  2LQ8 A;  2EKO A;  4DQ2 A;  3JB9 F;  4C0F A;  1Y71 A;  3VUZ A;  1VQN T;  1UGS B;  4PJO D;  4OVA A;  1YI2 T;  3G6E T;  2R5M A;  3C94 A;  3CD6 T;  1M4Z A;  2LNV A;  1VQ4 T;  5A0D A;  1UGQ B;  3A5Z B;  4M7D F;  2KY9 A;  3M4Y A;  4JDS A;  4O6J A;  3ME9 A;  2YHT A;  4M77 F;  2GCX A;  2CZ6 B;  2RI2 A;  2RHZ A;  4OB0 B;  4QVC A;  2QQR A;  4NOY A;  5CKD A;  5HKC A;  5GMK i;  1S72 A;  1QVF A;  3MEU A;  5GMK j;  5GAM f;  1JJ2 S;  1BIB A;  2B8A A;  2EIF A;  3QJY A;  3JCM f;  3JCM b;  4XQ3 A;  4M7A B;  2K5I A;  2RK2 A;  4ZN3 A;  3LW5 E;  1WJQ A;  1X6O A;  4B9X A;  1N9S A;  3KUF A;  2XK0 A;  2A7Y A;  3PNW C;  1M1K C;  1KQS S;  2EWN A;  1O9S A;  2LC4 A;  2OAU A;  4MDW A;  2LCL A;  3HFN A;  2LX9 A;  1K73 U;  5CQY A;  5KE3 A;  1MHN A;  3CCS A;  3QYG B;  1KC8 U;  4F7U F;  2LT4 A;  3WVD B;  3OY9 A;  3CCV T;  4F7U G;  3GOX A;  3RMQ A;  4M75 A;  4ZTF A;  1WQ7 A;  2GFU A;  4E7J A;  2O4X A;  2V8J A;  3MHX A;  3GIB A;  2JTM A;  2RHU A;  4MZM A;  3V7S A;  4C8Q F;  5A0G A;  3WVE B;  3CC7 A;  1KG1 A;  3DB4 A;  5FU6 B;  2DZC A;  2IVW A;  4C8Q G;  4XAX B;  2A3L A;  5CKB A;  3OYG A;  2LT1 A;  2X4W A;  2RM4 A;  2HAX A;  2DTO A;  3C4S A;  5LJ5 g;  1Q81 C;  3AHU A;  2KDS A;  2XG8 D;  3S3N A;  3M53 A;  3JCM V;  4F7U E;  2CKK A;  3L42 A;  3M58 A;  3CCM A;  4A4K A;  3L2Q A;  3OB9 A;  2ZPF B;  3OQ5 A;  4RCC A;  3SB2 A;  4X9D A;  5J3B A;  4M7A F;  4J5Y A;  4C8Q E;  1YJN A;  2QA4 T;  4E7I A;  3OA6 A;  2C06 A;  4M7A G;  1VIF A;  5IAY A;  3RKY A;  2EJF A;  4C5E A;  1N27 A;  2DVE A;  4OB2 B;  4JLG A;  1VQM A;  2WAC A;  5I2S A;  4L6V 5;  2KK4 A;  2NLU A;  3H6Z A;  4PLI A;  3CC4 A;  3VYG A;  2FHD A;  3OYF A;  3DLM A;  1VQ5 A;  2LRQ A;  3TCJ A;  2QQ9 A;  3VYH B;  2L3R A;  4BAC A;  2I2L A;  3PMI A;  1M90 C;  3CMA A;  2OTL T;  5D6X A;  4M7A E;  2JOY A;  4C8Q D;  3OS2 A;  4BDY A;  3UPU A;  1VQK A;  5DLO A;  2RB6 A;  5KE2 A;  3HSB A;  4BI4 A;  3CME T;  1Y96 A;  1YBY A;  3INZ A;  2ZPI B;  4HKE A;  1W2B S;  3PIO A;  3CXC S;  1N8R U;  1KQ1 A;  1X01 A;  2PVG B;  3R6O A;  4PNO A;  3TU4 K;  1VQP A;  5EG2 A;  4M7A D;  2QQB A;  5D6Y A;  3SD4 A;  4C92 F;  5GAO l;  1VQ9 T;  4HT9 A;  4C92 G;  3OYN A;  1XOV A;  3CCJ A;  4ZTJ A;  3CCL T;  1M5Q 1;  4IUP A;  2EJG A;  4XTU A;  3ZBD A;  1Q86 C;  2GQV A;  4NL2 A;  1YIT T;  3JB9 H;  4DOW A;  5IT9 E;  4KBM B;  5LJ3 g;  3P8B B;  5J39 A;  3F70 A;  4D6W A;  3QZ5 B;  3PGG A;  4C92 E;  1VQO T;  2DTI A;  4BY6 B;  1UB4 A;  4A54 A;  1YJW A;  1SSF A;  3CPW A;  1IZ6 A;  2DJZ A;  1P92 A;  3A8O B;  2XD0 A;  3SDZ A;  3TRE A;  4EMG A;  1Q7Y U;  4OGC A;  2MAM A;  5GAM j;  2RO0 A;  4C92 D;  2EAY A;  4J7I A;  4XU3 A;  3LWI A;  4XTZ A;  4Q5W A;  3OYI A;  1S72 T;  2K5F A;  3GNG A;  2LDM A;  4M78 A;  2DD5 A;  4J83 A;  4N0A C;  5GAN 4;  1VQ6 A;  2DO3 A;  3M54 A;  4V2S A;  1BYM A;  1M1F A;  3HRS A;  4MDX A;  4R55 A;  1VQ8 A;  2FVU A;  4RKU E;  3SWN A;  1LNX A;  3CC2 A;  3QXE B;  2DXC A;  1JBM A;  4X34 A;  3JAM E;  2ZPG B;  3QZ9 B;  4IUT A;  5GMK e;  1Q82 C;  4N4I A;  3LGL A;  1I4K 1;  3CCS T;  1JB0 E;  5FU7 B;  2QTX A;  2K57 A;  4MMK A;  4OMF B;  4HCB A;  2P0P A;  1RL2 A;  3HPW A;  2D6F A;  2CZ1 B;  1U1T A;  2RK1 A;  5GAM d;  2D9T A;  4C92 C;  3LWH A;  4XU1 A;  4CRI A;  1XTD A;  4JLI A;  3CC7 T;  3T9N A;  3JCM d;  4M75 B;  5KCO A;  2O4X B;  3RES A;  1UEB A;  5J26 A;  3UDC A;  4LD6 A;  5HY6 A;  5AYF A;  5CR2 A;  4LD9 K;  1K8A C;  3GF5 A;  3QII A;  1I81 A;  3SWN C;  2GFA A;  3CCM T;  2KMT A;  3LGF A;  3JB9 G;  1FXX A;  2M1H A;  1BI1 A;  3DKM A;  1YJN T;  3E19 A;  3L2U A;  3EFR A;  3BFM A;  3JB9 J;  3RUX A;  1O75 A;  3CEY A;  3DLL A;  4M7D G;  3VU3 C;  4JJN K;  1VQM T;  2F69 A;  3M9Q A;  4M77 G;  3CC4 T;  1QVF S;  1VQ5 T;  3QJ6 A;  5LJ5 e;  5LL6 S;  1QP3 A;  3OYM A;  3V8L A;  3CMA T;  5GAN f;  4KUL A;  3L2W A;  1BI3 A;  2DTH A;  3OS1 A;  2H3J A;  1WJS A;  3VUB A;  4C0Z A;  3BW1 A;  1VQK T;  4JRI A;  3GNF B;  4M7D E;  5DY9 A;  2P4T A;  4LDW A;  5FRO A;  5A2Q E;  3GP8 A;  4M77 E;  3JSC A;  4JRP A;  3BDU A;  1M1K U;  2CS7 A;  3NTI A;  2DXT A;  1VQL A;  2VC8 A;  4IUV A;  1VQP T;  2K5L A;  4PJO C;  3MP6 A;  3S3M A;  3JB9 D;  2DXU A;  1Y96 B;  1YI2 A;  3X24 B;  3OYC A;  1ZQ1 A;  4QQG A;  4O5V A;  4ATO A;  2MWP A;  3JCM W;  1QP2 A;  3E9F A;  4L5G A;  2E12 A;  2R57 A;  3OSS C;  4M7D D;  4J7F A;  3CCJ T;  4OF1 A;  2GF7 A;  4XTW A;  2HNI A;  2XIC A;  1JJ2 A;  2RD1 A;  4M77 D;  4XTY A;  1FX7 A;  4FT4 A;  2K3Y A;  1Q81 U;  1X75 C;  2DXB A;  4XU0 A;  1MGQ A;  4EPC A;  3JCM P;  5C6S A;  2PUO B;  3MET A;  3A8G B;  4VUB A;  3HRT A;  3PT9 A;  1K73 C;  2M9U A;  2VXE A;  3RMS A;  2K4Y A;  1VIE A;  1DJ7 B;  1YJW T;  4II1 A;  3C95 A;  3MEV A;  5GAN 6;  1YIJ A;  2MMP A;  4N4H A;  4LDU A;  4OGE A;  2ZPB B;  4C0D B;  4BE2 A;  1KQ2 A;  2XDP A;  3CBO A;  4M7D C;  4ZGE B;  3HFO A;  4F7U A;  5LJ3 e;  1M90 U;  3J81 E;  4C5H A;  4MZT A;  4M77 C;  1G3W A;  2DIQ A;  4A53 A;  1XQH A;  3OW2 A;  5CAI A;  2DK3 A;  4JRK A;  5GMK h;  4C8Q A;  5GAO m;  1VQ6 T;  5FLX E;  5FRM A;  1QVP A;  2VUB A;  2AHJ B;  2KQW A;  2R5A A;  4M78 B;  5GAM e;  3HKS A;  1G3S A;  1VQ8 T;  3QO3 A;  2DZ9 A;  3JCM e;  1RI0 A;  2DKG A;  4R56 A;  4X9C A;  3JB9 I;  3CC2 T;  3HRU A;  2RHY A;  2XHC A;  2YRV A;  4Z02 A;  3QYH B;  3OMC A;  4J6Y A;  5GAO q;  3GPL A;  2X35 A;  3SWN B;  2FYK A;  2RA2 A;  3LLR A;  5FRN A;  2ZZD A;  2K2V A;  1VQ7 A;  1W4S A;  3V8J A;  2E6Z A;  4HCC A;  4C8Q C;  2HQE A;  2VGN A;  3E9G A;  4ELY C;  3JCM c;  3PIP A;  1H64 1;  1XNI A;  3RIR A;  3L2V A;  4N0A A;  1KHI A;  1KD1 C;  2LCC A;  3OYD A;  3CXC A;  3CCE A;  3FDR A;  4QVZ A;  2DPP B;  2QDY B;  3JRZ A;  2EQJ A;  3I55 A;  2R58 A;  3CBP A;  5LJ5 h;  2E41 A;  1R8O B;  5GAM g;  3OYH A;  2E1H A;  3L2Z A;  5CKE A;  3QPH A;  3FC3 A;  4EMK A;  2IG0 A;  3JCM g;  5GAN g;  5L8R E;  2QEX A;  4M7A C;  4NL3 A;  1NJI C;  2X4J A;  5GAN j;  2FL7 A;  4A4E A;  2LQK A;  2P0Q A;  2XID A;  2Y90 A;  2QQA A;  2PVD B;  5I2M A;  4C92 A;  3CCQ A;  2L89 A;  3MP8 A;  4L59 A;  5GAN 8;  1QVG S;  2MI6 A;  2HD0 A;  3V7R A;  2PU9 B;  2V8K A;  1YJ9 A;  5GMK l;  2XU8 A;  1IRE B;  3LH0 A;  2PQW A;  2M16 A;  1EIF A;  3EAE A;  3S3O A;  2BKD N;  2RI5 A;  2VYT A;  4YTL A;  4A4H A;  1Y7X A;  3QKJ A;  5FU6 C;  5LJ5 f;  4EMK C;  1VQL T;  1Q7Y C;  3NTH A;  4IUQ A;  3O8V A;  4LDV A;  1Q82 U;  1M9S A;  1BKB A;  2F5K A;  2EQK A;  3V8K A;  4BUG A;  2RJD A;  5GAO p;  2ZCF B;  1OI1 A;  4DA4 A;  3ZFJ A;  3QUI A;  2KSS A;  5GAN d;  1BIA A;  1VUB A;  3CBM A;  3J80 E;  3JCM J;  1K9M C;  3L1A A;  3MEA A;  5HK0 A;  3A8L B;  3H8Z A;  3ZEH A;  4E47 A;  2QQS A;  5DM7 R;  3SFM A;  4BI3 A;  3S6W A;  4E7L A;  3ER0 A;  5CKF A;  1D3B A;  1UGP B;  5LJ3 h;  2V8I A;  2BIV A;  2X4X A;  3OS5 A;  5GAN 2;  3CCR A;  4PJO A;  2LTO A;  1VQN A;  1YIJ T;  4Y91 A;  3RER A;  2MF2 A;  2X4Y A;  4MZP A;  4FU6 A;  1Y07 A;  2VXF A;  2CZ0 B;  4XTV A;  1M1G A;  3RKX A;  4N4G A;  5DLQ E;  3Q1J A;  2RJF A;  5GAM h;  1TH7 A;  2JUF A;  2M0O A;  2OTJ A;  4PKC C;  3JCM h;  5GAO r;  1LOJ A;  3LYI A;  3MEW A;  1LJO A;  2E10 A;  4MML A;  3L2R A;  4KUI A;  4QQ6 A;  3FEO A;  4M75 F;  4F7U B;  4C5G A;  4M75 G;  4J6X A;  3OYJ A;  3P8D A;  3J7A F;  4ELZ C;  4HCZ A;  1WJR A;  5LJ3 f;  3G4S A;  2ZPH B;  3VKI A;  2HBP A;  4C8Q B;  5KCH A;  4RG8 A;  3PTA A;  5C0M A;  3QG1 A;  3C12 A;  5HK3 A;  3NFC A;  1B34 A;  2YLC A;  3OBY A;  4ZN1 A;  2D0Q B;  1NPR A;  3M57 A;  3PFS A;  4BY6 C;  5CCA A;  1U8R A;  4XK8 E;  4M75 E;  5CKH A;  4M7D A;  4KUD K;  1U1S A;  4M77 A;  3HP9 A;  1VQ7 T;  4WF2 A;  5GAN 7;  3QSU A;  3NTK A;  1KQS A;  2E5Q A;  2E6N A;  3MP1 A;  3CCE T;  4CI0 C;  2HQX A;  4M75 D;  5CK9 A;  1KC8 C;  3I55 T;  1WQW A;  4J6W A;  1GXI E;  3FIF A;  3M5A A;  3QDR B;  3TEE A;  5KH6 A;  1G3T A;  1BI0 A;  4TVR A;  3G71 A;  2QEX T;  3FB9 A;  1YHQ A;  1N6A A;  1AHJ B;  2JTF A;  3PMT A;  3WXM B;  4OB3 B;  5CQX A;  3CCU A;  5IN1 A;  3I56 A;  2DIG A;  2Y4Y A;  4EMK B;  4BD3 A;  3OYY A;  2RJE A;  1QW1 A;  1OZ2 A;  2E64 A;  3OW2 S;  3CCQ T;  4BE1 A;  2WSC E;  5FU7 C;  2E65 A;  2EJ9 A;  5LJ5 j;  2VV5 A;  4FT2 A;  2JVV A;  3VJP A;  4C92 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...