4MDXA

Crystal structure of bacillus subtilis mazf in complex with rna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
SMIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA interferase EndoA
publication title Structural Basis of mRNA Recognition and Cleavage by Toxin MazF and Its Regulation by Antitoxin MazE in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase/rna
total genus 37
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mdxA00
4HKEA 4ELZC 5CKEA 5CKDA 5CO7A 5CKBA 4MDXA 3HPWA 3JRZA 1VUBA 4OF1A 4ME7A 5CQXA 2VUBA 5CKHA 2C06A 4MZTA 1UB4A 3TCJA 3NFCA 5HK0A 5CR2A 3JSCA 1X75C 5CK9A 5HKCA 5CQYA 5DLOA 1NE8A 2KMTA 1M1FA 4VUBA 4MZPA 4ELYC 5CCAA 3VUBA 3G7ZA 4MZMA 5HK3A 2MF2A 5CKFA
chains in the Genus database with same CATH superfamily
4MMLA 5I22A 2VYTA 2VASA 3PT9A 1YJWA 2J05A 4M78F 3QXEB 3JB9D 4JJNK 1G3WA 3CCUQ 3CCST 5GAOm 2L0AA 3EFOA 1X6OA 1NG2A 2RQVA 3NMZC 3NTIA 1YHQT 1EFNA 4N0AA 1BIBA 1JRIA 3CCQT 1M90U 2A7YA 1FMVA 4MZPA 3MP8A 2LJ1A 3PFSA 2NWMA 2I0NA 1D0ZA 2YXYA 2E5QA 2Y4YA 3CCVA 2LCLA 3BY7A 3C4SA 2CZ6B 2E10A 2P0PA 2KR3A 1UG1A 1VYVA 3H0FA 1QVFS 2PUKB 1UJ0A 2DBKA 3LW5E 2M51A 4C8QE 4M7AF 2BZYA 3P8BB 3BFMA 3OYBA 3CCRT 4FU6A 4C5IA 1NLOC 3CC7T 3V7SA 3CD6Q 2FVUA 2RO0A 1WPYA 3OY9A 4ME7A 4BI4A 2COZA 5GAMg 1N8RU 2MI6A 4WCIA 3REBB 2DFUA 3SB2A 1QP2A 2V8KA 4CC4B 1Q7YC 3JCMe 1WHGA 2K79A 3I56T 1W2BS 1QKXA 5KYNA 5GAOq 3PE0A 2RQTA 3JCMc 5IXBA 1VQNT 3QYGB 2ATCB 5KE3A 3G6EQ 3C95A 3H8ZA 4DEYA 4NOYA 3HHTB 1KJWA 1X2QA 5LJ5d 4ANJA 4C0GA 3DKMA 2K5FA 2OTLA 4FIBA 1NJIR 1VQLT 1Y07A 1KHIA 2CZ1B 1M90C 2KNBB 1VQKQ 2DEUA 5M9OA 3G4ST 1OEBA 2A37A 1I0CA 1Q86U 5IN1A 2CSIA 2DILA 2ZPIB 5A0GA 5C0MA 4PJLA 5GANj 4PFPA 5HKCA 3CCLT 4M75D 1BI3A 1LJOA 2JM9A 2LT1A 2CT4A 4JJDA 2O4XA 3R6NA 3RKWA 5GJWB 4JLIA 3M4GA 2AT1B 2M02A 1MNEA 1WFWA 4HXJA 1NZ9A 2RK2A 3EAEA 1NYFA 2K3YA 3NFCA 1N8RC 2FEIA 1ZSZB 2NUPA 4CC3A 1NYGA 5AYFA 1G3SA 2DL3A 2RJCA 1TWBA 2JJ9A 1VQMT 1VQOT 4BDYA 1WLPB 2XI9A 2BTTA 5I2MA 1SRLA 1RAAB 2EKHA 2Y4XA 3S3NA 1SRMA 2DXUA 4F04B 2HBPA 5KYUB 4X34A 4FSSA 3M0QA 4PLIA 4J8OA 1QW1A 1BIAA 4JRPA 2K4YA 2GFAA 5ECAA 2X3XD 2FPDA 2PNIA 3A1PA 1GRIA 1K0SA 2DPPB 3SEMA 3CCMT 1MMDA 2QXFA 1V29B 3CC4Q 1PSEA 5GAMj 2L3QA 3CMAT 3JCMd 2J6FA 2WSEE 2X3WD 1HSQA 2D6FA 4R56A 2HKQB 1YCYA 1KQSS 1I4K1 4QQDA 3VRYA 5KYWA 1Q82U 3M0SA 3GOXA 1MNDA 3E19A 1YN8A 2OX7A 1JJ2A 1D0YA 1WHMA 3OB9A 1B7TA 4ZGDB 1U3OA 4PJOF 5GMKh 1QVGA 1WJRA 5LJ3e 4PJOA 1H3HA 3CCEQ 5I21A 2YDLA 4BY6C 2K7AA 4V2SA 2KEAA 2QTXA 1IHVA 3O8VA 2ECZA 1WXTA 3URGA 5DY9A 1EX4A 2DKGA 1VYTA 2D0QB 5GAOn 4PJOG 1M5Q1 1VQPA 4EIKA 5CIUA 2WSCE 2ZPHB 4QVZA 2QEXA 5J26A 1VQ4Q 4M77A 1VQ6Q 1H641 3VRZA 3CC2T 2RA2A 2RMOA 4LDVA 5D6WA 4PK4A 4DBQA 4HCCA 3VU3C 1H8KA 5I2SA 3I55Q 1GXIE 1RAGB 4ESRA 3CCUT 3CMEA 3Q1JA 2ROLA 4M77G 1M2OA 2F1LA 1BI0A 3OYNA 1WQWA 2X9HA 2COWA 2E3IA 3ME9A 1D1CA 2RJFA 3QYHB 4RCCA 3AHUA 3H9NA 1HXDA 2P0QA 1UECA 4CC7A 1PD0A 2A08A 1Q82C 1AT1B 3ASKA 4M4ZA 2I2LA 1M4ZA 4BI3A 2CP7A 1ZUKA 2ENMA 1S72Q 2QG9B 4QW2A 5GMKi 1TOVA 2A0FB 1B34B 3RIRA 2QQBA 4E7HA 2QQRA 2HKNA 3QIIA 3I5SA 3FLGA 5FLXE 1BCMA 3OYKA 4OMOA 1ZA1B 3IQLA 1UTIA 1YITQ 3KBGA 3FB9A 3CD6T 5IXFA 2LT4A 2X4YA 1GCQC 3EG0A 1I1JA 3E1SA 5A0LA 1C1AA 2ESWA 4EMKB 2BZXA 3FEOA 5KYYB 2F2VA 5CR2A 5LJ3d 1HD3A 4N0AC 1M27C 2VVKA 1KD1U 3OYCA 4OMFB 2AZVA 3M59A 2CH4A 3OYMA 3ZL7C 3D7SB 3DLLA 1PD1A 2J7IA 3G6ET 5KYXB 5IHKA 2HBWA 1D1AA 4MDWA 2IVWA 1E6GA 1ZSZC 2VUBA 1QKWA 5GAOl 3NHNA 2O9VA 2EPDA 3J81E 1N27A 1K9MR 1AHJB 2FO0A 5J3BA 2MYSA 2EBPA 2JOYA 1VQKT 3A8GB 2XHCA 4E2FB 3M5AA 4IUVA 2XDDA 3MJXA 1QCNA 3RR6A 3S3OA 2C0IA 4RG2A 1IREB 4FYVB 1AZGB 2A28A 3MKDA 3VS6A 5EC7A 3GIBA 1FXXA 2HL5C 5LJ5j 1RAEB 2LQ8A 1LOJA 1R8OB 4PFZA 5CKBA 1AZEA 3QG1A 1IGUA 1LPLA 1YCSB 1IHWA 1PM3A 4MZTA 2E12A 2DIGA 4EMGA 2OI3A 3EGDB 1RL2A 1G3YA 4C5EA 3QZ9B 4F7UE 5CQYA 2P4TA 1QCOA 1KD1C 2K9GA 4J9DA 5GJVB 5GMKm 2J6OA 4CC2A 2V1RA 2LTOA 1WI7A 4PFOA 5HK0A 3QJ6A 3M4YA 5IT9E 1O9SA 2E5KA 4JRIA 5GAMd 3CC4T 1YJNQ 1FWZA 1QMCA 4LUEA 4C8QF 4C8QA 2HAXA 3EG3A 1MHNA 2GTOA 3LYIA 5D7UA 1KC8U 2DYIA 2KRSA 1KG1A 1AD5A 4PJOD 4XTVA 4II1A 4EPCA 2RHYA 3C0CA 3EH2A 4J5YA 1D0XA 2O9SA 1E6HA 2KY9A 2RHXA 4JZ4A 1Z9ZA 4N4IA 2X4XA 5FROA 4C8QG 4ZTJA 3CCET 2LX7A 2YRCA 3JB9H 3I5RA 2VKNA 3SD4A 3G71Q 2CDTA 1N9SA 1Y71A 2X4JA 3RKYA 1NEGA 2CS7A 3CMAQ 2QQ9A 4M77D 1Q81R 1C0MA 4JRKA 4QQGA 5GAN7 1OPKA 1VQ4T 2RQUA 3HRUA 4Z88A 4M7DA 4OB0B 5GAN5 1M2VA 2ZAEA 1VQ6T 1IRXA 1TG0A 2L8DA 2DVJA 2M16A 2GQIA 1K4US 4OP0A 2DA9A 2RM4A 4N4HA 3MPUB 1BI1A 2PZ1A 3EGXA 2EYYA 3I55T 1W1FA 1ABQA 2FL7A 2AKKA 4M7DG 3CXCA 3LH5A 4EMHA 1R0BG 3WVEB 2YUOA 2O01E 3OYGA 3OW2A 4E6RA 5GAN4 2EQUA 4D6WA 1Q7YR 1D09B 2NUTB 1QVPA 1K9AA 3ZEHA 2P4RA 4C92A 2DRMA 1X27A 1KC8C 3PNWC 4JDSA 2RHZA 4M75B 4DBHA 4R55A 2EQMA 4DBFA 1JXOA 1YJ9A 1HK9A 1TS9A 4FL6A 1S72T 4HVWA 2P0KA 3L2VA 2LP5A 4N4GA 1UHCA 3QZ5B 2DMOA 4O5VA 4C92G 4M77C 1VQ8A 1AEYA 4OVAA 1M90R 4M78A 3EG1A 3PTAA 1YI2A 3VS3A 3TCJA 1KFZA 4BE2A 1YITT 1T3LA 4BY6B 2JUFA 1UUEA 2LJ0A 1YJWQ 2QQSA 2EW3A 3BW1A 4XTUA 3OYFA 1QVFA 2IG0A 3VUBA 2KQWA 2E6NA 1U5SA 1PWTA 1RAFB 2CT3A 4M78G 2J6KA 2VV5A 1OU8A 2XG8D 4FYYB 1M1KR 3MEUA 1AVZC 2HEQA 1ZSGA 2KROA 3CCVQ 3O5ZA 4XU3A 1X01A 3EFSA 3OS5A 3RNJA 4M75E 1T0HA 1BI2A 4M7AA 3V8LA 4QKUA 3VJPA 5GAOr 2OAUA 1SF9A 1WXUA 1D3BB 1W2BA 1WX6A 1YFNA 2MIOA 1ZUUA 4DOVA 3T9NA 3VS7A 2LQWA 1NM7A 5CK9A 1JB0E 2MWOA 1PKSA 2JNGA 2MK5A 5IH2A 1OX8A 3DLMA 7AT1B 2NUZA 2ZGWA 2KVQG 4M7AG 5I11A 2LX9A 5LJ3j 2K57A 2DF6A 1Y7XA 3HP9A 3PGGA 4HCZA 2EAYA 1WQ7A 3A8MB 1R0CB 4JJCA 2RQRA 3PMIA 3LX7A 1X43A 1RI0A 1WJQA 2KI7A 2CZ0B 2MPXC 3SWNB 4AFUC 1AWOA 3I9QA 2K5LA 2M1HA 3CPWP 5KCHA 2KXDA 4FW2A 2ED0A 2D0NA 1EIFA 3MEVA 1M8MA 2HDAA 2M0OA 2YT6A 1M8VA 2WACA 2OTLQ 1EZZB 2YSQA 3QO3A 4ZTFA 3QHSA 4LD6A 3KXTA 1UE9A 3E9GA 3X25B 4RTZA 1NEBA 4ATOA 3RMQA 3EFOB 5DLOA 1UJYA 5GMKe 1VOMA 2RHUA 4A53A 2AKLA 1C6VX 1ZUYA 2IPOB 4FCYA 1VYUA 3GNGA 2PVGB 2PVDB 4KUIA 2RQWA 2LMJA 1I5OB 2HL3A 4KBMB 1ZA2B 4IIMA 4E7SA 2OTJA 4C8QD 2BUDA 2QGFB 1RAIB 2LQNA 1YJNT 4L59A 2ROTA 2RI2A 4A4GA 1AWXA 3NTHA 3BDLA 1OYXA 2FG0A 1VIFA 1VQ7A 4YTLA 5IHNA 3RERA 4HVVA 2QAZA 4DA4A 2F69A 3M53A 2D8JA 1QP3A 2EJ9A 4HT9A 2QA4A 1GBQA 1JQQA 1NE8A 2RI3A 2K3BA 1KQSA 2MMPA 3GLXA 1I8FA 1Y57A 3JB9I 3G71T 2DRKA 1YNZA 1Q82R 2QDYB 2J06A 4M75C 1XNIA 1Q86C 1YIJA 4M7DD 1QWEA 2C06A 1BKBA 1PG5B 2COYA 4F16A 3RKXA 1GFCA 2KYMA 3VS1A 2E6ZA 1YP5A 2Z0WA 3H0IA 2V8IA 4AFQC 2X35A 3MO8A 3TSWA 2YRDA 5HY6A 1VQ9A 3BDUA 3ULRB 5GMKl 2XU8A 2F2WA 1FYNA 2F5TX 1S1NA 4JUVA 2EQIA 1I07A 4A4FA 2CUBA 4KH1B 4AFZC 4OGCA 4C92D 1OPLA 3META 3FJPA 1OI1A 4PKCC 4CRIA 3VV0A 2DL5A 4NL3A 2O4XB 3OBYA 3I35A 3JV3A 3VYHB 1WA7A 1UB4A 3OSSC 2YUQA 9ATCB 1VQPQ 4FM4B 4M78D 1BCOA 4LUDA 2QEXQ 1NPRA 4F7UF 2NUPB 4F7UA 3MP1A 3M0PA 1HJDA 4B9WA 4LDUA 3UT1A 2CP3A 2RH2A 3OBWA 1VQ5A 2RPNA 5FRMA 2FPFA 3H6ZA 1X6BA 1TTHB 2X51A 1YJWT 1N9RA 1V1CA 3CMEQ 2BIVA 4J6YA 2EJGA 2GQVA 4F7UG 4LDXA 2CSQA 2KK4A 1Y96A 4C92C 4OGEA 4XAXB 2JVVA 5GAN6 3CCJA 5FWBA 1W70A 3OMGA 2CH4W 3EG9A 3G1JA 2FZGB 3SWNC 4M7AD 1H92A 2JS0A 3CCVT 4OMLA 2X4WA 2XD0A 2KDSA 4PLLA 2RJDA 3M56A 2DL8A 1WYXA 2HSEB 5AT1B 5KYWB 4PNOA 3V7RA 4J7IA 2D8HA 3M0TA 1XOVA 1K76A 3CCSA 1KD1R 1Z9QA 3U23A 3JCMb 1YHQA 4PJOB 2CZ7B 2RB6A 1ABOA 2EGEA 2ZCFB 2CREA 2H3EB 3CCQA 2SRCA 2CP6A 1IO6A 2JM8A 4K11A 3JB9F 1K73R 5HCKA 1PCXA 3EGUA 1GBRA 2DXBA 2HQXA 3RESA 3G7ZA 4IUTA 1OZ3A 4PL6A 1F1BB 1MMAA 2GGRA 1CKAA 2K5IA 3C94A 3HPWA 3ZBDA 2ZPGB 2MCNA 4Z02A 1M9SA 3LWIA 3TREA 4M77B 1UHFA 1KK7A 1OV3A 2JMAA 2KBTA 2KAFA 3L2ZA 3HFNA 3CCRA 2O2OA 1SKUB 2AZSA 3CC7A 3N5BB 3L2QA 4A63B 4M7AC 1PRLC 1G83A 2AK5A 4C5GA 2OTLT 1JBMA 2DZCA 2DIQA 5CKFA 4HKEA 2F5KA 3X20B 5KH6A 5GANh 3J7AF 3JRZA 2OJ2A 4LXCA 3E9FA 3PMTA 4OB1B 3L42A 4CI0C 2RNAA 5GAN3 2JS2A 3H0HA 4C0FA 1KQ2A 3QDRB 3BE3A 3UWNA 1G2BA 1MV0B 3QUIA 3I56A 3QKJA 5GAOp 1K0XA 1GL5A 2JTMA 1TH7A 1VQNA 1U1TA 1RACB 1UGVA 1K9MU 4E47A 3JAME 2CUDA 4A4HA 1M3AA 2DJQA 2PTKA 4A54A 3REAB 2CP0A 3JCMJ 1SSFA 1KIKA 1VQLA 2ZZDA 3UATA 1G8XA 3FDRA 3R6OA 5FRNA 4RMOA 3UPUA 2M0YA 2K3XA 2DE0X 3G4SA 4EDUA 3M0RA 1K8AR 4M77E 1XQHA 1QQJA 2FYKA 1LCKA 2FZKB 1MMGA 3HKSA 1JJ2P 3C12A 3CCLA 2DZ9A 2MAMA 1ZHIA 1D1BA 2YLBA 1B07A 2DK3A 2YWWA 1QVGP 1IGQA 4F14A 2QI2A 4XTYA 2EFIA 2CYZB 4NS5A 2KT8A 3S6WA 4X9CA 2D9TA 3GP8A 3VUZA 2W0ZA 1AOJA 2H3JA 2LQKA 3QDFA 4LE9A 4LN2A 4M75F 5KE2A 4X1VA 2O88A 3PVLA 1VQMA 1VQOA 2DYBA 2HMAA 4KH0B 3FIFA 2DL4A 2YHTA 4E7LA 4AFSC 4MZMA 3CPWS 1KHCA 1TUGB 3M58A 3LWHA 2Y90A 1K9MC 2B8AA 2L3SA 4RTXA 3CBMA 4OF1A 4XU2A 1BB9A 4GLMA 3GBQA 5CVIA 4JS4A 5FWCA 2QTVA 3ZFJA 1SSHA 2GNCA 3CBOA 2R5MA 1U8RA 4DBRA 1NPPA 2V8JA 2HQHA 3FC3A 1QLYA 1VQPT 3OYJA 5CKHA 5C6SA 1WHKA 8ATCB 2QEXT 3JSCA 2C0OA 3JCMX 4FW1A 3NGPA 4ZGJB 2FRYA 3QJYA 4Z8AA 4QQ6A 2EQKA 2DNUA 1UGQB 2MF2A 4PJOC 3P8DA 5CKEA 2BE9B 4A4KA 5J39A 1Q81U 4KT0E 3CMET 1T3SA 3LLRA 4LDWA 4AG2C 4IIOA 2HNIA 4TVRA 4AG1C 5GMKj 5GANf 2DX1A 3JCMQ 1BBZA 2EGCA 1OX9A 2VGMA 2OAWA 2ED1A 3A98A 1BYMA 3OYAA 2KT1A 2CGHA 4PJNA 1VA7A 4JJBA 1YJ9Q 1TXQA 4C8QB 2F2XA 2DAQA 2DM1A 1JU5C 4HCKA 4L5GA 3OQ5A 2XIDA 4XTWA 3L2RA 4HT8A 4J6WA 3CCUA 5IHIA 1VQ8Q 4FYXB 5GANg 4ELYC 1UFFA 3A8LB 3FJ5A 1I81A 3OYYA 4OB3B 1YI2Q 1SHFA 4FYWB 1RLQC 1V76A 5IAYA 1GCQA 3TEEA 2JN0A 2FB7A 1UDLA 4XTZA 4P5NA 5FU6C 4BD3A 3OYDA 1WZOA 3WXMB 1WDXA 1WNLA 2FHDA 3A8HB 1H3ZA 1JEGA 1N8RR 2LVMA 2EYWA 4M7DB 1M2VB 5GAMf 1Q81C 1WXBA 4Y91A 3VS0A 4ZGEB 3QBYA 1U1SA 1ZSZA 3EH1A 1SG5A 2XKOC 2DD4A 2GFUA 5DM7R 3CD6A 2NLUA 3ER0A 1SHGA 1JO8A 1Q95G 3EGXB 4RTUA 4F17A 4OB2B 1NLPC 1WJSA 3PIPA 1SEMA 1JXMA 5KYUA 1M1KU 1LVKA 4IUPA 2DTIA 2XICA 3OMCA 4XTXA 2M9UA 4C92B 5LJ5h 3FRNA 2L2PA 2CKKA 5LL6S 1NBEB 2KGTA 1Q86R 3G6EA 2RN8A 2EQJA 3E2UA 4VUBA 2QASA 3KFVA 4WF2A 3SFMA 2RHIA 3INZA 2YUPA 1RUWA 3L2WA 4BB7A 1KQ1A 2HQEA 4J9GA 1TUDA 1VQKA 4B9XA 2PU9B 1UGPB 4M78B 3HRSA 2VGNA 5EG2A 4L6V5 1X75C 3X28B 4M7DE 2L3PA 4Q5WA 2QGGA 1MV3A 2LNVA 4C5HA 2VB6A 1X69A 3F70A 4XK8E 1O75A 4DOWA 1LNXA 5D6YA 4J9FA 3QSUA 1NJIU 1ACMB 2YLCA 1T0JA 3GNFB 4J9EA 2H8HA 4XQ3A 3A5ZB 3X24B 4E7KA 4DQ2A 3OS0A 2SEMA 4AMCA 3PIOA 3TSZA 4C92E 3CBPA 3V8KA 2VXEA 1M1KC 2OTJQ 4MMKA 2LNHB 3EHQA 4BACA 4M7AB 2ZPBB 3L1AA 1QWFA 2P84A 4ORZA 5CQXA 3M54A 1PSFA 2JT4A 1VQ7Q 5A2QE 4C0DC 2E65A 1M3BA 1R77A 2QK0A 1PC0A 2EYQA 4M78E 2QA4Q 2KRMA 1X6GA 3QPHA 4KGXB 3JCMh 1XJWB 1M1GA 3CXCP 2DVEA 2RJEA 4FT2A 4JLGA 3MCAB 3CC4A 4Y28E 3OW2P 3JCMP 3M55A 3WVDB 3EG2A 4Z89A 4R0KA 2EKOA 3OYHA 1KSWA 1HYOA 3VYGA 4FSXA 1YIJQ 2W10A 3JB9J 4C8QC 1B34A 2EGAA 4OMQA 4B6MA 3S3MA 2MOXA 4J9HA 1NJIC 5FU7B 1B3QA 1VQ9Q 2KSSA 3KUFA 3OYEA 3CCEA 3V8JA 2R58A 4BDZA 4M7AE 2XK0A 5D6XA 3J80E 4J9IA 1FMKA 4JZ3A 4O6JA 4FT4A 3QWYA 2LCCA 2JTFA 2V1QA 5CO7A 4E7JA 2L89A 1ZLMA 4EMKA 5CAIA 4RUGA 5KYYA 3V7CA 3OYLA 3OYIA 3EFRA 3M0UA 4IUQA 1QVFP 1JJ2S 2FRWA 5DLQE 2PUOB 1WGSA 2BE7D 1VQ4A 1UGRB 4A4EA 2GBQA 1QVGS 1VQ6A 2QDLA 4BE0A 2RK1A 4JPBW 5CCAA 5KYXA 4M7DC 1YJ9T 2GTJA 1XTDA 5LJ5f 3A8OB 2DL7A 1VIEA 3GPLA 4M77F 4QVCA 2LC4A 1PRMC 1WHJA 3I55A 4J7FA 2KE9A 2RD1A 1IXDA 1VQ8T 1OOTA 2ZPFB 4ZN1A 3VS4A 1UEBA 2BZ8A 2PQWA 1N6AA 2C0TA 5GANe 1YI2T 1VQ5Q 2NYSA 3NPFA 1W2BP 2GCXA 5KCOA 2D1XA 2EVRA 1TU0B 5CKDA 5LJ5g 4MDXA 3SHWA 1OQKA 4KRTA 3UDCA 3JCMV 3CPFA 1S72A 3OSVA 2DEQA 2YRVA 3VS2A 1M3CA 4KULA 4D8KA 3MEWA 1ZBXA 2EYXA 2HSPA 1WHHA 1OZ2A 3TU4K 4ZNXA 2DLPA 3CCJQ 2MWPA 5GAN2 3OS1A 2E4HA 4BE1A 2BKDN 2K2VA 4M78C 1ZX6A 1MGQA 1YITA 2LRQA 4RTTA 3EGDA 1W6XA 3LGLA 1UGSB 4XU1A 5LJ3h 2KYBA 3UA7A 1OU9A 2HD0A 3CCSQ 4D8DA 4BUGA 2JTEA 1YHQQ 2FPEA 4E7ZA 2DTHA 2RI5A 3CCQQ 4QVDA 3LGFA 1VUBA 3HL8A 2EWNA 3GF5A 5GAMe 8AT1B 3HSBA 1TUCA 4JS5A 4XU0A 2PVOB 3JB9G 1ARKA 4X9DA 3LH0A 2XMFA 3JCMf 5FW9A 1DJ7B 2E41A 4J9CA 5GAN8 1OULA 3HRTA 2KXCA 4F7UB 1N5ZA 6AT1B 3THKA 2LJ3A 1IB8A 2O31A 1K73U 1P92A 3OS2A 2YUNA 5L8RE 3EHRA 3CCRQ 3CC7Q 4GY5A 2E70A 3M57A 2EJFA 2V26A 4LNPA 2G3RA 4C0ZA 1K1ZA 1G5VA 2DTOA 3M9QA 4PJOE 3JCMg 2RF0A 1RLPC 1A0NB 5FU6B 5HK3A 2QYZA 2QQAA 1MMNA 3NTKA 4ELZC 5GANd 4HCBA 3TQ7P 1Y96B 2DJZA 3UF4A 3I56Q 2XDBA 1KQSP 1VQNQ 2B86A 3X26B 2HCKA 4GLKA 3CEYA 4ZN3A 3EG9B 3AT1B 2DXTA 2KRNA 1G3TA 1RI9A 2OTJT 1Y0MA 2R57A 2WSFE 3VKIA 2E64A 3H41A 4RTWA 4GBQA 3RBBB 3QWXX 1VQLQ 2DO3A 5FU7C 1VQ7T 3RUXA 3SDZA 4NL2A 3G4SQ 1AWJA 4PJMA 1ZBJA 4BI8B 1CKBA 5A0DA 2QA4T 4JRQA 1M1FA 3MP6A 4UC4A 5GAMh 1KC8R 1U06A 2EYZA 2VWFA 1FMWA 3CCLQ 2L5QA 2NUTA 2XDPA 3UA6A 3HTRA 4J9BA 4IKFA 1IZ6A 4M75A 3CPWA 1K73C 1YJNA 3RDVA 4LD9K 2DXCA 1K8AU 4AT1B 2K2MA 4RKUE 1BK2A 1YIJT 2CP5A 4DEXA 1GCPA 4IUUA 1MUZA 1VQMQ 1VQOQ 4J6XA 4M75G 3RMSA 2VXFA 4HVUA 2IIMA 3OA6A 2LDMA 4RTVA 1VQ9T 4KUDK 1RAHB 4KGZB 4PJJA 1E7OA 5L23A 3CCMA 1YWOA 3G71A 2ABLA 3JCMW 2A36A 3CQTA 1RABB 4RG8A 4LDYA 3DB3A 5LJ3f 3CMAA 3TVTA 2K6DA 3CCMQ 2AIRB 4OMMA 4OMPA 1RADB 2DERA 2JW4A 1WIEA 4J83A 2ZPEB 1CSKA 1PNJA 2A3LA 1X2KA 2JXBA 1SPKA 1ZQ1A 1FX7A 1TSFA 1W4SA 1YWPA 4M7DF 3L2UA 2EIFA 2R5AA 3HFOA 1D3BA 3P8HA 4C0DB 1I5LA 5LJ3g 2DD5A 3PVQA 1M30A 4E7IA 2JZ2A 1K8AC 2G6FX 1VQ5T 1J3TA 4Y92A 3MHXA 2KMTA 4OMNA 3VS5A 1AWWA 2LCSA 2FZCB 2HZYA 2LZ6B 1YBYA 2E3HA 4QT7A 4EMKC 1PHTA 5LJ5e 4C92F 2GF7A 2E1HA 3CC2A 3DB4A 4RTYA 2L3RA 1GFDA 4WTOB 3CCJT 2AHJB 3SWNA 3CXCS 1WHLA 1QCFA 3MEAA 4KGVB 2CP2A 4RCBA 1PKTA 2DBMA 1Q7YU 2JMCA 3OW2S 3CC2Q 4HA8A 1BU1A 4IURA 2VC8A 2DETA
chains in the Genus database with same CATH topology
4MMLA 4C92C 2VYTA 4OGEA 2VXEA 3PT9A 1M1KC 4XAXB 4MMKA 2JVVA 5GMKm 1YJWA 4M78F 3QXEB 3JB9D 4HT8A 5GAN6 3CCJA 4M7AB 2ZPBB 3L1AA 4JJNK 1G3WA 4BACA 3OMGA 3CCST 5CQXA 5GAOm 3M54A 1X6OA 3SWNC 4M7AD 2LTOA 1PSFA 3CCVT 5HK0A 2X4WA 3QJ6A 2XD0A 3NTIA 1YHQT 2KDSA 3M4YA 4PLLA 5A2QE 5IT9E 4C0DC 2RJDA 2E65A 1O9SA 3M56A 4N0AA 1BIBA 1JRIA 3CCQT 4JRIA 2A7YA 1M90U 4MZPA 3MP8A 3PFSA 5GAMd 3CC4T 4PNOA 3V7RA 1FWZA 4J7IA 2EYQA 4M78E 1XOVA 3QPHA 4C8QF 3CCSA 2E5QA 4C8QA 2HAXA 4M7DG 3JCMh 2Y4YA 1MHNA 3CCVA 3LYIA 2LCLA 3BY7A 3C4SA 1M1GA 3JCMb 2CZ6B 2E10A 1YHQA 2P0PA 1KC8U 2CZ7B 4PJOB 2RB6A 2DVEA 2RJEA 4FT2A 2ZCFB 3MCAB 4JLGA 3CCQA 1KG1A 4PJOD 1QVFS 4XTVA 2PUKB 3CC4A 4II1A 4Y28E 3JCMP 3M55A 3WVDB 4EPCA 2RHYA 3JB9F 3LW5E 2EKOA 3OYHA 4J5YA 2DXBA 4C8QE 2HQXA 3RESA 1U8RA 4N4IA 2KY9A 2RHXA 1OZ3A 3G7ZA 4FSXA 2X4XA 4IUTA 4PL6A 5FROA 2K5IA 3P8BB 4C8QG 3BFMA 4C8QC 1B34A 3JB9J 4ZTJA 3OYBA 3CCRT 3JB9H 3C94A 4FU6A 4C5IA 3SD4A 3CC7T 3HPWA 3ZBDA 3V7SA 2FVUA 2RO0A 2ZPGB 1N9SA 4Z02A 3S3MA 1M9SA 3LWIA 1WPYA 1Y71A 2X4JA 3OY9A 4ME7A 3RKYA 4BI4A 3TREA 1NJIC 4M77B 5GAMg 1N8RU 2CS7A 5FU7B 2MI6A 1S72A 2QQ9A 2KSSA 3KUFA 3OYEA 4M77D 3CCEA 3L2ZA 2KAFA 3SB2A 1QP2A 2R58A 3V8JA 4BDZA 2XK0A 3HFNA 5D6XA 2V8KA 3J80E 1Q7YC 3CCRA 4M7AE 4JRKA 3JCMe 4QQGA 5GAN7 4O6JA 3N5BB 3L2QA 3CC7A 4M7AC 1VQ4T 3HRUA 4FT4A 4C5GA 1JBMA 2DZCA 2DIQA 4OB0B 5GAN5 5CKFA 2LCCA 4HKEA 3I56T 2F5KA 1W2BS 2JTFA 3X20B 5KH6A 5GANh 1VQ6T 5GAOq 5CO7A 3JCMc 4E7JA 2L89A 2L8DA 2M16A 4EMKA 5CAIA 1VQNT 3J7AF 3JRZA 3QYGB 5KE3A 3E9FA 3C95A 3PMTA 4OB1B 3V7CA 3OYLA 3L42A 3OYIA 4CI0C 3H8ZA 3EFRA 4IUQA 4NOYA 4OP0A 2RM4A 3HHTB 1JJ2S 5GAN3 4N4HA 4C0FA 1BI1A 5DLQE 4C0GA 2PUOB 3QDRB 5LJ5d 1KQ2A 3DKMA 2K5FA 3UWNA 1WGSA 3I55T 1VQ4A 1UGRB 4A4EA 3QUIA 2OTLA 4FIBA 3I56A 3QKJA 5GAOp 1QVGS 1VQ6A 2FL7A 4BE0A 1VQLT 2JTMA 1Y07A 2RK1A 1KHIA 5CCAA 3CXCA 1TH7A 2CZ1B 1M90C 4EMHA 1YJ9T 1VQNA 4M7DC 1U1TA 3WVEB 1XTDA 5LJ5f 1K9MU 3A8OB 1VIEA 2O01E 3OYGA 3OW2A 5M9OA 2EQUA 5GAN4 3G4ST 4D6WA 3GPLA 4M77F 3ZEHA 1QVPA 4E47A 4QVCA 3JAME 4C92A 4A4HA 1Q86U 2LC4A 4A54A 1KC8C 3I55A 5IN1A 4J7FA 3PNWC 3JCMJ 2RD1A 4JDSA 1SSFA 2ZPIB 5A0GA 5C0MA 1VQ8T 2RHZA 2ZPFB 4M75B 4ZN1A 1VQLA 2ZZDA 4R55A 2EQMA 1UEBA 2PQWA 5GANj 1YJ9A 1N6AA 1HK9A 3FDRA 3R6OA 4FL6A 5HKCA 4M75D 4RMOA 3CCLT 1BI3A 3UPUA 5GANe 1LJOA 2P0KA 1YI2T 2K3XA 3L2VA 1S72T 2LT1A 3G4SA 2O4XA 3RKWA 4EDUA 4N4GA 2GCXA 3QZ5B 4M77E 1XQHA 2FYKA 4O5VA 4JLIA 4C92G 5KCOA 4M77C 5CKDA 5LJ5g 1VQ8A 3M4GA 4MDXA 4OVAA 3HKSA 4M78A 4M7DA 3C12A 3UDCA 3CCLA 3JCMV 2DZ9A 1NZ9A 2RK2A 3CPFA 2MAMA 3EAEA 3PTAA 3OSVA 1ZHIA 2DEQA 1YI2A 2YRVA 2YLBA 3TCJA 2K3YA 3NFCA 4BE2A 1N8RC 1YITT 4KULA 2DK3A 3MEWA 4BY6B 1ZBXA 5AYFA 1G3SA 2JUFA 1OZ2A 2RJCA 3TU4K 2QI2A 2QQSA 1VQMT 1VQOT 3BW1A 4XTUA 4XTYA 2EFIA 4BDYA 2MWPA 3OYFA 2XI9A 2IG0A 3VUBA 2CYZB 2KQWA 1QVFA 2E6NA 4NS5A 5GAN2 3OS1A 5I2MA 3S6WA 4X9CA 2D9TA 3GP8A 3VUZA 4BE1A 2H3JA 2LQKA 4M78G 2Y4XA 2BKDN 4M75F 3S3NA 2DXUA 2K2VA 4M78C 2HBPA 1MGQA 4X34A 5KE2A 1YITA 2LRQA 2VV5A 4PLIA 4J8OA 3LGLA 1QW1A 1BIAA 1UGSB 4JRPA 2XG8D 4XU1A 5LJ3h 2K4YA 1VQMA 1VQOA 2GFAA 3MEUA 2HD0A 3FIFA 2YHTA 2DPPB 4E7LA 4BUGA 4XU3A 1X01A 3CCMT 3EFSA 3OS5A 4MZMA 4M75E 3CPWS 1BI2A 1KHCA 2DTHA 3M58A 2RI5A 2QXFA 3LWHA 2Y90A 3V8LA 1K9MC 4M7AA 4QVDA 2B8AA 3LGFA 1V29B 3VJPA 5GAOr 2OAUA 1PSEA 1VUBA 5GAMj 3HL8A 3CMAT 1D3BB 3JCMd 3CBMA 2EWNA 2WSEE 3GF5A 4OF1A 1W2BA 5GAMe 2D6FA 4XU2A 3HSBA 4R56A 4DOVA 1YCYA 1KQSS 1I4K1 4QQDA 5CVIA 3T9NA 4XU0A 4JS5A 2PVOB 5CK9A 4JS4A 3JB9G 1Q82U 3GOXA 1JB0E 2MWOA 2JNGA 4X9DA 3LH0A 3E19A 3JCMf 1JJ2A 3DLMA 3ZFJA 4M7AG 2ZGWA 2KVQG 3OB9A 1DJ7B 2E41A 5GAN8 4ZGDB 2LX9A 5LJ3j 2K57A 3CBOA 2R5MA 4PJOF 3HRTA 4F7UB 1Y7XA 1WJRA 5GMKh 5LJ3e 3HP9A 1QVGA 4PJOA 1NPPA 2V8JA 3PGGA 4HCZA 2EAYA 3FC3A 1K73U 1P92A 5I21A 1WQ7A 3A8MB 4BY6C 5L8RE 3OS2A 1VQPT 3OYJA 4V2SA 5CKHA 5C6SA 3PMIA 3LX7A 2QEXT 4GY5A 2QTXA 1RI0A 3JSCA 1WJQA 2E70A 3O8VA 3URGA 3M57A 2EJFA 3JCMX 5DY9A 2CZ0B 2G3RA 4C0ZA 1G5VA 2DTOA 3M9QA 3SWNB 2DKGA 4ZGJB 2D0QB 2K5LA 2M1HA 3QJYA 5KCHA 4QQ6A 4PJOE 3JCMg 5GAOn 2EQKA 5FU6B 1UGQB 4PJOG 5HK3A 2MF2A 1M5Q1 2QQAA 1EIFA 1VQPA 3MEVA 3P8DA 4PJOC 3NTKA 2M0OA 4ELZC 5CKEA 1M8VA 5CIUA 2WSCE 2ZPHB 5GANd 4QVZA 4HCBA 4A4KA 1Y96B 5J26A 4M77A 5J39A 2WACA 2DJZA 4KT0E 2QEXA 1Q81U 3QO3A 3CMET 3LLRA 4LDWA 4ZTFA 2XDBA 3QHSA 4LD6A 3KXTA 1H641 3CC2T 3E9GA 2RA2A 3X25B 3X26B 4GLKA 3CEYA 4ZN3A 2HNIA 4ATOA 4TVRA 5GMKj 5GANf 3RMQA 3JCMQ 5DLOA 2DXTA 5D6WA 4LDVA 1G3TA 5GMKe 2RHUA 2OTJT 2VGMA 2R57A 2WSFE 3VKIA 2E64A 4A53A 3VU3C 4HCCA 5I2SA 1BYMA 1GXIE 3OYAA 3CCUT 2CGHA 3CMEA 3Q1JA 4M77G 2DO3A 1BI0A 3OYNA 3GNGA 2PVGB 5FU7C 1WQWA 2PVDB 4KUIA 1VQ7T 4C8QB 3RUXA 2DAQA 3SDZA 4NL2A 4KBMB 3ME9A 4RCCA 2RJFA 3QYHB 3AHUA 2OTJA 1HXDA 4C8QD 4BI8B 3OQ5A 4L5GA 2XIDA 2BUDA 2P0QA 4XTWA 5A0DA 4J6WA 3L2RA 4L59A 1YJNT 2QA4T 1Q82C 3CCUA 3ASKA 4JRQA 1M1FA 3MP6A 4UC4A 2I2LA 5GAMh 5GANg 2RI2A 1M4ZA 4A4GA 4ELYC 3NTHA 3A8LB 4BI3A 3BDLA 1OYXA 2L5QA 1VIFA 1I81A 2XDPA 3OYYA 1VQ7A 4OB3B 4YTLA 3RERA 4QW2A 5GMKi 4IKFA 1IZ6A 5IAYA 4DA4A 2F69A 3M53A 4M75A 3TEEA 1B34B 3RIRA 2JN0A 2QQBA 3CPWA 2FB7A 1K73C 1QP3A 1YJNA 2EJ9A 4LD9K 2QA4A 2DXCA 4E7HA 1K8AU 2QQRA 4HT9A 4XTZA 4P5NA 3QIIA 5FU6C 3FLGA 4BD3A 5FLXE 4RKUE 3OYDA 3OYKA 1NE8A 3WXMB 1YIJT 1WNLA 2FHDA 2RI3A 1KQSA 3A8HB 1H3ZA 2MMPA 3GLXA 1I8FA 3FB9A 3KBGA 3JB9I 4IUUA 3G71T 3CD6T 2LT4A 2X4YA 2QDYB 4J6XA 4M75G 3RMSA 2LVMA 2VXFA 4M75C 4M7DB 3CCET 3E1SA 1XNIA 5GAMf 5A0LA 1Q81C 3OA6A 2LDMA 4Y91A 4ZGEB 3QBYA 1Q86C 1VQ9T 1U1SA 4KUDK 4EMKB 1YIJA 4M7DD 2XKOC 3FEOA 2C06A 1BKBA 2DD4A 3RKXA 5CR2A 2GFUA 5LJ3d 2E6ZA 4N0AC 5DM7R 3CCMA 3G71A 3CD6A 2NLUA 1KD1U 3ER0A 3OYCA 4OMFB 3JCMW 3M59A 2V8IA 3OYMA 2X35A 3MO8A 4OB2B 4RG8A 1WJSA 3DLLA 3PIPA 4LDYA 3DB3A 3G6ET 5LJ3f 5HY6A 3CMAA 1M1KU 1VQ9A 3BDUA 4IUPA 2DTIA 2XICA 3OMCA 4MDWA 5GMKl 2XU8A 2IVWA 4XTXA 2M9UA 4JUVA 2F5TX 4J83A 2ZPEB 4C92B 2VUBA 5LJ5h 5GAOl 3FRNA 3J81E 1N27A 2CKKA 5LL6S 1AHJB 4A4FA 5J3BA 2A3LA 4OGCA 4C92D 3META 3FJPA 2JOYA 1VQKT 3G6EA 1OI1A 2EQJA 4VUBA 4PKCC 4CRIA 3A8GB 3VV0A 1ZQ1A 1FX7A 1W4SA 4M7DF 3L2UA 2XHCA 4NL3A 2EIFA 2R5AA 3HFOA 1D3BA 3P8HA 2O4XB 4WF2A 3OBYA 3SFMA 4C0DB 2RHIA 3INZA 1I5LA 3M5AA 4IUVA 5LJ3g 2XDDA 2DD5A 3L2WA 4BB7A 3VYHB 5FRNA 3S3OA 1KQ1A 2HQEA 1VQKA 4B9XA 2PU9B 4E7IA 1UGPB 1UB4A 2JZ2A 4M78B 1K8AC 3HRSA 3OSSC 1VQ5T 2VGNA 5EG2A 4RG2A 4L6V5 1IREB 3MHXA 1X75C 3X28B 4FM4B 4M7DE 4M78D 2KMTA 4Q5WA 1NPRA 2LNVA 4F7UF 4F7UA 4C5HA 1FXXA 3MP1A 1YBYA 3GIBA 5LJ5j 3F70A 2LQ8A 4B9WA 4EMKC 1LOJA 4LDUA 4XK8E 1R8OB 3VYGA 5LJ5e 4C92F 5CKBA 3UT1A 1O75A 2GF7A 2RH2A 1LNXA 2E1HA 3OBWA 5D6YA 4DOWA 1VQ5A 3CC2A 3DB4A 3QG1A 5FRMA 3QSUA 2L3RA 1NJIU 3H6ZA 1YJWT 4MZTA 1N9RA 2YLCA 2E12A 2DIGA 3GNFB 3CCJT 2AHJB 3SWNA 3CXCS 4XQ3A 4EMGA 1RL2A 1G3YA 3MEAA 4RCBA 4M7AF 4C5EA 3QZ9B 2BIVA 3A5ZB 5CQYA 3X24B 4F7UE 4J6YA 4E7KA 4DQ2A 3OS0A 2P4TA 2EJGA 2GQVA 4F7UG 1Q7YU 1KD1C 3OW2S 2OTLT 4LDXA 4HA8A 3PIOA 4C92E 4IURA 2VC8A 3CBPA 2KK4A 1Y96A 3V8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKE A;  4ELZ C;  5CKE A;  5CKD A;  5CO7 A;  5CKB A;  4MDX A;  3HPW A;  3JRZ A;  1VUB A;  4OF1 A;  4ME7 A;  5CQX A;  2VUB A;  5CKH A;  2C06 A;  4MZT A;  1UB4 A;  3TCJ A;  3NFC A;  5HK0 A;  5CR2 A;  3JSC A;  1X75 C;  5CK9 A;  5HKC A;  5CQY A;  5DLO A;  1NE8 A;  2KMT A;  1M1F A;  4VUB A;  4MZP A;  4ELY C;  5CCA A;  3VUB A;  3G7Z A;  4MZM A;  5HK3 A;  2MF2 A;  5CKF A; 
#chains in the Genus database with same CATH topology
 4MML A;  5I22 A;  2VYT A;  2VAS A;  3PT9 A;  1YJW A;  2J05 A;  4M78 F;  3QXE B;  3JB9 D;  4JJN K;  1G3W A;  3CCU Q;  3CCS T;  5GAO m;  2L0A A;  3EFO A;  1X6O A;  1NG2 A;  2RQV A;  3NMZ C;  3NTI A;  1YHQ T;  1EFN A;  4N0A A;  1BIB A;  1JRI A;  3CCQ T;  1M90 U;  2A7Y A;  1FMV A;  4MZP A;  3MP8 A;  2LJ1 A;  3PFS A;  2NWM A;  2I0N A;  1D0Z A;  2YXY A;  2E5Q A;  2Y4Y A;  3CCV A;  2LCL A;  3BY7 A;  3C4S A;  2CZ6 B;  2E10 A;  2P0P A;  2KR3 A;  1UG1 A;  1VYV A;  3H0F A;  1QVF S;  2PUK B;  1UJ0 A;  2DBK A;  3LW5 E;  2M51 A;  4C8Q E;  4M7A F;  2BZY A;  3P8B B;  3BFM A;  3OYB A;  3CCR T;  4FU6 A;  4C5I A;  1NLO C;  3CC7 T;  3V7S A;  3CD6 Q;  2FVU A;  2RO0 A;  1WPY A;  3OY9 A;  4ME7 A;  4BI4 A;  2COZ A;  5GAM g;  1N8R U;  2MI6 A;  4WCI A;  3REB B;  2DFU A;  3SB2 A;  1QP2 A;  2V8K A;  4CC4 B;  1Q7Y C;  3JCM e;  1WHG A;  2K79 A;  3I56 T;  1W2B S;  1QKX A;  5KYN A;  5GAO q;  3PE0 A;  2RQT A;  3JCM c;  5IXB A;  1VQN T;  3QYG B;  2ATC B;  5KE3 A;  3G6E Q;  3C95 A;  3H8Z A;  4DEY A;  4NOY A;  3HHT B;  1KJW A;  1X2Q A;  5LJ5 d;  4ANJ A;  4C0G A;  3DKM A;  2K5F A;  2OTL A;  4FIB A;  1NJI R;  1VQL T;  1Y07 A;  1KHI A;  2CZ1 B;  1M90 C;  2KNB B;  1VQK Q;  2DEU A;  5M9O A;  3G4S T;  1OEB A;  2A37 A;  1I0C A;  1Q86 U;  5IN1 A;  2CSI A;  2DIL A;  2ZPI B;  5A0G A;  5C0M A;  4PJL A;  5GAN j;  4PFP A;  5HKC A;  3CCL T;  4M75 D;  1BI3 A;  1LJO A;  2JM9 A;  2LT1 A;  2CT4 A;  4JJD A;  2O4X A;  3R6N A;  3RKW A;  5GJW B;  4JLI A;  3M4G A;  2AT1 B;  2M02 A;  1MNE A;  1WFW A;  4HXJ A;  1NZ9 A;  2RK2 A;  3EAE A;  1NYF A;  2K3Y A;  3NFC A;  1N8R C;  2FEI A;  1ZSZ B;  2NUP A;  4CC3 A;  1NYG A;  5AYF A;  1G3S A;  2DL3 A;  2RJC A;  1TWB A;  2JJ9 A;  1VQM T;  1VQO T;  4BDY A;  1WLP B;  2XI9 A;  2BTT A;  5I2M A;  1SRL A;  1RAA B;  2EKH A;  2Y4X A;  3S3N A;  1SRM A;  2DXU A;  4F04 B;  2HBP A;  5KYU B;  4X34 A;  4FSS A;  3M0Q A;  4PLI A;  4J8O A;  1QW1 A;  1BIA A;  4JRP A;  2K4Y A;  2GFA A;  5ECA A;  2X3X D;  2FPD A;  2PNI A;  3A1P A;  1GRI A;  1K0S A;  2DPP B;  3SEM A;  3CCM T;  1MMD A;  2QXF A;  1V29 B;  3CC4 Q;  1PSE A;  5GAM j;  2L3Q A;  3CMA T;  3JCM d;  2J6F A;  2WSE E;  2X3W D;  1HSQ A;  2D6F A;  4R56 A;  2HKQ B;  1YCY A;  1KQS S;  1I4K 1;  4QQD A;  3VRY A;  5KYW A;  1Q82 U;  3M0S A;  3GOX A;  1MND A;  3E19 A;  1YN8 A;  2OX7 A;  1JJ2 A;  1D0Y A;  1WHM A;  3OB9 A;  1B7T A;  4ZGD B;  1U3O A;  4PJO F;  5GMK h;  1QVG A;  1WJR A;  5LJ3 e;  4PJO A;  1H3H A;  3CCE Q;  5I21 A;  2YDL A;  4BY6 C;  2K7A A;  4V2S A;  2KEA A;  2QTX A;  1IHV A;  3O8V A;  2ECZ A;  1WXT A;  3URG A;  5DY9 A;  1EX4 A;  2DKG A;  1VYT A;  2D0Q B;  5GAO n;  4PJO G;  1M5Q 1;  1VQP A;  4EIK A;  5CIU A;  2WSC E;  2ZPH B;  4QVZ A;  2QEX A;  5J26 A;  1VQ4 Q;  4M77 A;  1VQ6 Q;  1H64 1;  3VRZ A;  3CC2 T;  2RA2 A;  2RMO A;  4LDV A;  5D6W A;  4PK4 A;  4DBQ A;  4HCC A;  3VU3 C;  1H8K A;  5I2S A;  3I55 Q;  1GXI E;  1RAG B;  4ESR A;  3CCU T;  3CME A;  3Q1J A;  2ROL A;  4M77 G;  1M2O A;  2F1L A;  1BI0 A;  3OYN A;  1WQW A;  2X9H A;  2COW A;  2E3I A;  3ME9 A;  1D1C A;  2RJF A;  3QYH B;  4RCC A;  3AHU A;  3H9N A;  1HXD A;  2P0Q A;  1UEC A;  4CC7 A;  1PD0 A;  2A08 A;  1Q82 C;  1AT1 B;  3ASK A;  4M4Z A;  2I2L A;  1M4Z A;  4BI3 A;  2CP7 A;  1ZUK A;  2ENM A;  1S72 Q;  2QG9 B;  4QW2 A;  5GMK i;  1TOV A;  2A0F B;  1B34 B;  3RIR A;  2QQB A;  4E7H A;  2QQR A;  2HKN A;  3QII A;  3I5S A;  3FLG A;  5FLX E;  1BCM A;  3OYK A;  4OMO A;  1ZA1 B;  3IQL A;  1UTI A;  1YIT Q;  3KBG A;  3FB9 A;  3CD6 T;  5IXF A;  2LT4 A;  2X4Y A;  1GCQ C;  3EG0 A;  1I1J A;  3E1S A;  5A0L A;  1C1A A;  2ESW A;  4EMK B;  2BZX A;  3FEO A;  5KYY B;  2F2V A;  5CR2 A;  5LJ3 d;  1HD3 A;  4N0A C;  1M27 C;  2VVK A;  1KD1 U;  3OYC A;  4OMF B;  2AZV A;  3M59 A;  2CH4 A;  3OYM A;  3ZL7 C;  3D7S B;  3DLL A;  1PD1 A;  2J7I A;  3G6E T;  5KYX B;  5IHK A;  2HBW A;  1D1A A;  4MDW A;  2IVW A;  1E6G A;  1ZSZ C;  2VUB A;  1QKW A;  5GAO l;  3NHN A;  2O9V A;  2EPD A;  3J81 E;  1N27 A;  1K9M R;  1AHJ B;  2FO0 A;  5J3B A;  2MYS A;  2EBP A;  2JOY A;  1VQK T;  3A8G B;  2XHC A;  4E2F B;  3M5A A;  4IUV A;  2XDD A;  3MJX A;  1QCN A;  3RR6 A;  3S3O A;  2C0I A;  4RG2 A;  1IRE B;  4FYV B;  1AZG B;  2A28 A;  3MKD A;  3VS6 A;  5EC7 A;  3GIB A;  1FXX A;  2HL5 C;  5LJ5 j;  1RAE B;  2LQ8 A;  1LOJ A;  1R8O B;  4PFZ A;  5CKB A;  1AZE A;  3QG1 A;  1IGU A;  1LPL A;  1YCS B;  1IHW A;  1PM3 A;  4MZT A;  2E12 A;  2DIG A;  4EMG A;  2OI3 A;  3EGD B;  1RL2 A;  1G3Y A;  4C5E A;  3QZ9 B;  4F7U E;  5CQY A;  2P4T A;  1QCO A;  1KD1 C;  2K9G A;  4J9D A;  5GJV B;  5GMK m;  2J6O A;  4CC2 A;  2V1R A;  2LTO A;  1WI7 A;  4PFO A;  5HK0 A;  3QJ6 A;  3M4Y A;  5IT9 E;  1O9S A;  2E5K A;  4JRI A;  5GAM d;  3CC4 T;  1YJN Q;  1FWZ A;  1QMC A;  4LUE A;  4C8Q F;  4C8Q A;  2HAX A;  3EG3 A;  1MHN A;  2GTO A;  3LYI A;  5D7U A;  1KC8 U;  2DYI A;  2KRS A;  1KG1 A;  1AD5 A;  4PJO D;  4XTV A;  4II1 A;  4EPC A;  2RHY A;  3C0C A;  3EH2 A;  4J5Y A;  1D0X A;  2O9S A;  1E6H A;  2KY9 A;  2RHX A;  4JZ4 A;  1Z9Z A;  4N4I A;  2X4X A;  5FRO A;  4C8Q G;  4ZTJ A;  3CCE T;  2LX7 A;  2YRC A;  3JB9 H;  3I5R A;  2VKN A;  3SD4 A;  3G71 Q;  2CDT A;  1N9S A;  1Y71 A;  2X4J A;  3RKY A;  1NEG A;  2CS7 A;  3CMA Q;  2QQ9 A;  4M77 D;  1Q81 R;  1C0M A;  4JRK A;  4QQG A;  5GAN 7;  1OPK A;  1VQ4 T;  2RQU A;  3HRU A;  4Z88 A;  4M7D A;  4OB0 B;  5GAN 5;  1M2V A;  2ZAE A;  1VQ6 T;  1IRX A;  1TG0 A;  2L8D A;  2DVJ A;  2M16 A;  2GQI A;  1K4U S;  4OP0 A;  2DA9 A;  2RM4 A;  4N4H A;  3MPU B;  1BI1 A;  2PZ1 A;  3EGX A;  2EYY A;  3I55 T;  1W1F A;  1ABQ A;  2FL7 A;  2AKK A;  4M7D G;  3CXC A;  3LH5 A;  4EMH A;  1R0B G;  3WVE B;  2YUO A;  2O01 E;  3OYG A;  3OW2 A;  4E6R A;  5GAN 4;  2EQU A;  4D6W A;  1Q7Y R;  1D09 B;  2NUT B;  1QVP A;  1K9A A;  3ZEH A;  2P4R A;  4C92 A;  2DRM A;  1X27 A;  1KC8 C;  3PNW C;  4JDS A;  2RHZ A;  4M75 B;  4DBH A;  4R55 A;  2EQM A;  4DBF A;  1JXO A;  1YJ9 A;  1HK9 A;  1TS9 A;  4FL6 A;  1S72 T;  4HVW A;  2P0K A;  3L2V A;  2LP5 A;  4N4G A;  1UHC A;  3QZ5 B;  2DMO A;  4O5V A;  4C92 G;  4M77 C;  1VQ8 A;  1AEY A;  4OVA A;  1M90 R;  4M78 A;  3EG1 A;  3PTA A;  1YI2 A;  3VS3 A;  3TCJ A;  1KFZ A;  4BE2 A;  1YIT T;  1T3L A;  4BY6 B;  2JUF A;  1UUE A;  2LJ0 A;  1YJW Q;  2QQS A;  2EW3 A;  3BW1 A;  4XTU A;  3OYF A;  1QVF A;  2IG0 A;  3VUB A;  2KQW A;  2E6N A;  1U5S A;  1PWT A;  1RAF B;  2CT3 A;  4M78 G;  2J6K A;  2VV5 A;  1OU8 A;  2XG8 D;  4FYY B;  1M1K R;  3MEU A;  1AVZ C;  2HEQ A;  1ZSG A;  2KRO A;  3CCV Q;  3O5Z A;  4XU3 A;  1X01 A;  3EFS A;  3OS5 A;  3RNJ A;  4M75 E;  1T0H A;  1BI2 A;  4M7A A;  3V8L A;  4QKU A;  3VJP A;  5GAO r;  2OAU A;  1SF9 A;  1WXU A;  1D3B B;  1W2B A;  1WX6 A;  1YFN A;  2MIO A;  1ZUU A;  4DOV A;  3T9N A;  3VS7 A;  2LQW A;  1NM7 A;  5CK9 A;  1JB0 E;  2MWO A;  1PKS A;  2JNG A;  2MK5 A;  5IH2 A;  1OX8 A;  3DLM A;  7AT1 B;  2NUZ A;  2ZGW A;  2KVQ G;  4M7A G;  5I11 A;  2LX9 A;  5LJ3 j;  2K57 A;  2DF6 A;  1Y7X A;  3HP9 A;  3PGG A;  4HCZ A;  2EAY A;  1WQ7 A;  3A8M B;  1R0C B;  4JJC A;  2RQR A;  3PMI A;  3LX7 A;  1X43 A;  1RI0 A;  1WJQ A;  2KI7 A;  2CZ0 B;  2MPX C;  3SWN B;  4AFU C;  1AWO A;  3I9Q A;  2K5L A;  2M1H A;  3CPW P;  5KCH A;  2KXD A;  4FW2 A;  2ED0 A;  2D0N A;  1EIF A;  3MEV A;  1M8M A;  2HDA A;  2M0O A;  2YT6 A;  1M8V A;  2WAC A;  2OTL Q;  1EZZ B;  2YSQ A;  3QO3 A;  4ZTF A;  3QHS A;  4LD6 A;  3KXT A;  1UE9 A;  3E9G A;  3X25 B;  4RTZ A;  1NEB A;  4ATO A;  3RMQ A;  3EFO B;  5DLO A;  1UJY A;  5GMK e;  1VOM A;  2RHU A;  4A53 A;  2AKL A;  1C6V X;  1ZUY A;  2IPO B;  4FCY A;  1VYU A;  3GNG A;  2PVG B;  2PVD B;  4KUI A;  2RQW A;  2LMJ A;  1I5O B;  2HL3 A;  4KBM B;  1ZA2 B;  4IIM A;  4E7S A;  2OTJ A;  4C8Q D;  2BUD A;  2QGF B;  1RAI B;  2LQN A;  1YJN T;  4L59 A;  2ROT A;  2RI2 A;  4A4G A;  1AWX A;  3NTH A;  3BDL A;  1OYX A;  2FG0 A;  1VIF A;  1VQ7 A;  4YTL A;  5IHN A;  3RER A;  4HVV A;  2QAZ A;  4DA4 A;  2F69 A;  3M53 A;  2D8J A;  1QP3 A;  2EJ9 A;  4HT9 A;  2QA4 A;  1GBQ A;  1JQQ A;  1NE8 A;  2RI3 A;  2K3B A;  1KQS A;  2MMP A;  3GLX A;  1I8F A;  1Y57 A;  3JB9 I;  3G71 T;  2DRK A;  1YNZ A;  1Q82 R;  2QDY B;  2J06 A;  4M75 C;  1XNI A;  1Q86 C;  1YIJ A;  4M7D D;  1QWE A;  2C06 A;  1BKB A;  1PG5 B;  2COY A;  4F16 A;  3RKX A;  1GFC A;  2KYM A;  3VS1 A;  2E6Z A;  1YP5 A;  2Z0W A;  3H0I A;  2V8I A;  4AFQ C;  2X35 A;  3MO8 A;  3TSW A;  2YRD A;  5HY6 A;  1VQ9 A;  3BDU A;  3ULR B;  5GMK l;  2XU8 A;  2F2W A;  1FYN A;  2F5T X;  1S1N A;  4JUV A;  2EQI A;  1I07 A;  4A4F A;  2CUB A;  4KH1 B;  4AFZ C;  4OGC A;  4C92 D;  1OPL A;  3MET A;  3FJP A;  1OI1 A;  4PKC C;  4CRI A;  3VV0 A;  2DL5 A;  4NL3 A;  2O4X B;  3OBY A;  3I35 A;  3JV3 A;  3VYH B;  1WA7 A;  1UB4 A;  3OSS C;  2YUQ A;  9ATC B;  1VQP Q;  4FM4 B;  4M78 D;  1BCO A;  4LUD A;  2QEX Q;  1NPR A;  4F7U F;  2NUP B;  4F7U A;  3MP1 A;  3M0P A;  1HJD A;  4B9W A;  4LDU A;  3UT1 A;  2CP3 A;  2RH2 A;  3OBW A;  1VQ5 A;  2RPN A;  5FRM A;  2FPF A;  3H6Z A;  1X6B A;  1TTH B;  2X51 A;  1YJW T;  1N9R A;  1V1C A;  3CME Q;  2BIV A;  4J6Y A;  2EJG A;  2GQV A;  4F7U G;  4LDX A;  2CSQ A;  2KK4 A;  1Y96 A;  4C92 C;  4OGE A;  4XAX B;  2JVV A;  5GAN 6;  3CCJ A;  5FWB A;  1W70 A;  3OMG A;  2CH4 W;  3EG9 A;  3G1J A;  2FZG B;  3SWN C;  4M7A D;  1H92 A;  2JS0 A;  3CCV T;  4OML A;  2X4W A;  2XD0 A;  2KDS A;  4PLL A;  2RJD A;  3M56 A;  2DL8 A;  1WYX A;  2HSE B;  5AT1 B;  5KYW B;  4PNO A;  3V7R A;  4J7I A;  2D8H A;  3M0T A;  1XOV A;  1K76 A;  3CCS A;  1KD1 R;  1Z9Q A;  3U23 A;  3JCM b;  1YHQ A;  4PJO B;  2CZ7 B;  2RB6 A;  1ABO A;  2EGE A;  2ZCF B;  2CRE A;  2H3E B;  3CCQ A;  2SRC A;  2CP6 A;  1IO6 A;  2JM8 A;  4K11 A;  3JB9 F;  1K73 R;  5HCK A;  1PCX A;  3EGU A;  1GBR A;  2DXB A;  2HQX A;  3RES A;  3G7Z A;  4IUT A;  1OZ3 A;  4PL6 A;  1F1B B;  1MMA A;  2GGR A;  1CKA A;  2K5I A;  3C94 A;  3HPW A;  3ZBD A;  2ZPG B;  2MCN A;  4Z02 A;  1M9S A;  3LWI A;  3TRE A;  4M77 B;  1UHF A;  1KK7 A;  1OV3 A;  2JMA A;  2KBT A;  2KAF A;  3L2Z A;  3HFN A;  3CCR A;  2O2O A;  1SKU B;  2AZS A;  3CC7 A;  3N5B B;  3L2Q A;  4A63 B;  4M7A C;  1PRL C;  1G83 A;  2AK5 A;  4C5G A;  2OTL T;  1JBM A;  2DZC A;  2DIQ A;  5CKF A;  4HKE A;  2F5K A;  3X20 B;  5KH6 A;  5GAN h;  3J7A F;  3JRZ A;  2OJ2 A;  4LXC A;  3E9F A;  3PMT A;  4OB1 B;  3L42 A;  4CI0 C;  2RNA A;  5GAN 3;  2JS2 A;  3H0H A;  4C0F A;  1KQ2 A;  3QDR B;  3BE3 A;  3UWN A;  1G2B A;  1MV0 B;  3QUI A;  3I56 A;  3QKJ A;  5GAO p;  1K0X A;  1GL5 A;  2JTM A;  1TH7 A;  1VQN A;  1U1T A;  1RAC B;  1UGV A;  1K9M U;  4E47 A;  3JAM E;  2CUD A;  4A4H A;  1M3A A;  2DJQ A;  2PTK A;  4A54 A;  3REA B;  2CP0 A;  3JCM J;  1SSF A;  1KIK A;  1VQL A;  2ZZD A;  3UAT A;  1G8X A;  3FDR A;  3R6O A;  5FRN A;  4RMO A;  3UPU A;  2M0Y A;  2K3X A;  2DE0 X;  3G4S A;  4EDU A;  3M0R A;  1K8A R;  4M77 E;  1XQH A;  1QQJ A;  2FYK A;  1LCK A;  2FZK B;  1MMG A;  3HKS A;  1JJ2 P;  3C12 A;  3CCL A;  2DZ9 A;  2MAM A;  1ZHI A;  1D1B A;  2YLB A;  1B07 A;  2DK3 A;  2YWW A;  1QVG P;  1IGQ A;  4F14 A;  2QI2 A;  4XTY A;  2EFI A;  2CYZ B;  4NS5 A;  2KT8 A;  3S6W A;  4X9C A;  2D9T A;  3GP8 A;  3VUZ A;  2W0Z A;  1AOJ A;  2H3J A;  2LQK A;  3QDF A;  4LE9 A;  4LN2 A;  4M75 F;  5KE2 A;  4X1V A;  2O88 A;  3PVL A;  1VQM A;  1VQO A;  2DYB A;  2HMA A;  4KH0 B;  3FIF A;  2DL4 A;  2YHT A;  4E7L A;  4AFS C;  4MZM A;  3CPW S;  1KHC A;  1TUG B;  3M58 A;  3LWH A;  2Y90 A;  1K9M C;  2B8A A;  2L3S A;  4RTX A;  3CBM A;  4OF1 A;  4XU2 A;  1BB9 A;  4GLM A;  3GBQ A;  5CVI A;  4JS4 A;  5FWC A;  2QTV A;  3ZFJ A;  1SSH A;  2GNC A;  3CBO A;  2R5M A;  1U8R A;  4DBR A;  1NPP A;  2V8J A;  2HQH A;  3FC3 A;  1QLY A;  1VQP T;  3OYJ A;  5CKH A;  5C6S A;  1WHK A;  8ATC B;  2QEX T;  3JSC A;  2C0O A;  3JCM X;  4FW1 A;  3NGP A;  4ZGJ B;  2FRY A;  3QJY A;  4Z8A A;  4QQ6 A;  2EQK A;  2DNU A;  1UGQ B;  2MF2 A;  4PJO C;  3P8D A;  5CKE A;  2BE9 B;  4A4K A;  5J39 A;  1Q81 U;  4KT0 E;  3CME T;  1T3S A;  3LLR A;  4LDW A;  4AG2 C;  4IIO A;  2HNI A;  4TVR A;  4AG1 C;  5GMK j;  5GAN f;  2DX1 A;  3JCM Q;  1BBZ A;  2EGC A;  1OX9 A;  2VGM A;  2OAW A;  2ED1 A;  3A98 A;  1BYM A;  3OYA A;  2KT1 A;  2CGH A;  4PJN A;  1VA7 A;  4JJB A;  1YJ9 Q;  1TXQ A;  4C8Q B;  2F2X A;  2DAQ A;  2DM1 A;  1JU5 C;  4HCK A;  4L5G A;  3OQ5 A;  2XID A;  4XTW A;  3L2R A;  4HT8 A;  4J6W A;  3CCU A;  5IHI A;  1VQ8 Q;  4FYX B;  5GAN g;  4ELY C;  1UFF A;  3A8L B;  3FJ5 A;  1I81 A;  3OYY A;  4OB3 B;  1YI2 Q;  1SHF A;  4FYW B;  1RLQ C;  1V76 A;  5IAY A;  1GCQ A;  3TEE A;  2JN0 A;  2FB7 A;  1UDL A;  4XTZ A;  4P5N A;  5FU6 C;  4BD3 A;  3OYD A;  1WZO A;  3WXM B;  1WDX A;  1WNL A;  2FHD A;  3A8H B;  1H3Z A;  1JEG A;  1N8R R;  2LVM A;  2EYW A;  4M7D B;  1M2V B;  5GAM f;  1Q81 C;  1WXB A;  4Y91 A;  3VS0 A;  4ZGE B;  3QBY A;  1U1S A;  1ZSZ A;  3EH1 A;  1SG5 A;  2XKO C;  2DD4 A;  2GFU A;  5DM7 R;  3CD6 A;  2NLU A;  3ER0 A;  1SHG A;  1JO8 A;  1Q95 G;  3EGX B;  4RTU A;  4F17 A;  4OB2 B;  1NLP C;  1WJS A;  3PIP A;  1SEM A;  1JXM A;  5KYU A;  1M1K U;  1LVK A;  4IUP A;  2DTI A;  2XIC A;  3OMC A;  4XTX A;  2M9U A;  4C92 B;  5LJ5 h;  3FRN A;  2L2P A;  2CKK A;  5LL6 S;  1NBE B;  2KGT A;  1Q86 R;  3G6E A;  2RN8 A;  2EQJ A;  3E2U A;  4VUB A;  2QAS A;  3KFV A;  4WF2 A;  3SFM A;  2RHI A;  3INZ A;  2YUP A;  1RUW A;  3L2W A;  4BB7 A;  1KQ1 A;  2HQE A;  4J9G A;  1TUD A;  1VQK A;  4B9X A;  2PU9 B;  1UGP B;  4M78 B;  3HRS A;  2VGN A;  5EG2 A;  4L6V 5;  1X75 C;  3X28 B;  4M7D E;  2L3P A;  4Q5W A;  2QGG A;  1MV3 A;  2LNV A;  4C5H A;  2VB6 A;  1X69 A;  3F70 A;  4XK8 E;  1O75 A;  4DOW A;  1LNX A;  5D6Y A;  4J9F A;  3QSU A;  1NJI U;  1ACM B;  2YLC A;  1T0J A;  3GNF B;  4J9E A;  2H8H A;  4XQ3 A;  3A5Z B;  3X24 B;  4E7K A;  4DQ2 A;  3OS0 A;  2SEM A;  4AMC A;  3PIO A;  3TSZ A;  4C92 E;  3CBP A;  3V8K A;  2VXE A;  1M1K C;  2OTJ Q;  4MMK A;  2LNH B;  3EHQ A;  4BAC A;  4M7A B;  2ZPB B;  3L1A A;  1QWF A;  2P84 A;  4ORZ A;  5CQX A;  3M54 A;  1PSF A;  2JT4 A;  1VQ7 Q;  5A2Q E;  4C0D C;  2E65 A;  1M3B A;  1R77 A;  2QK0 A;  1PC0 A;  2EYQ A;  4M78 E;  2QA4 Q;  2KRM A;  1X6G A;  3QPH A;  4KGX B;  3JCM h;  1XJW B;  1M1G A;  3CXC P;  2DVE A;  2RJE A;  4FT2 A;  4JLG A;  3MCA B;  3CC4 A;  4Y28 E;  3OW2 P;  3JCM P;  3M55 A;  3WVD B;  3EG2 A;  4Z89 A;  4R0K A;  2EKO A;  3OYH A;  1KSW A;  1HYO A;  3VYG A;  4FSX A;  1YIJ Q;  2W10 A;  3JB9 J;  4C8Q C;  1B34 A;  2EGA A;  4OMQ A;  4B6M A;  3S3M A;  2MOX A;  4J9H A;  1NJI C;  5FU7 B;  1B3Q A;  1VQ9 Q;  2KSS A;  3KUF A;  3OYE A;  3CCE A;  3V8J A;  2R58 A;  4BDZ A;  4M7A E;  2XK0 A;  5D6X A;  3J80 E;  4J9I A;  1FMK A;  4JZ3 A;  4O6J A;  4FT4 A;  3QWY A;  2LCC A;  2JTF A;  2V1Q A;  5CO7 A;  4E7J A;  2L89 A;  1ZLM A;  4EMK A;  5CAI A;  4RUG A;  5KYY A;  3V7C A;  3OYL A;  3OYI A;  3EFR A;  3M0U A;  4IUQ A;  1QVF P;  1JJ2 S;  2FRW A;  5DLQ E;  2PUO B;  1WGS A;  2BE7 D;  1VQ4 A;  1UGR B;  4A4E A;  2GBQ A;  1QVG S;  1VQ6 A;  2QDL A;  4BE0 A;  2RK1 A;  4JPB W;  5CCA A;  5KYX A;  4M7D C;  1YJ9 T;  2GTJ A;  1XTD A;  5LJ5 f;  3A8O B;  2DL7 A;  1VIE A;  3GPL A;  4M77 F;  4QVC A;  2LC4 A;  1PRM C;  1WHJ A;  3I55 A;  4J7F A;  2KE9 A;  2RD1 A;  1IXD A;  1VQ8 T;  1OOT A;  2ZPF B;  4ZN1 A;  3VS4 A;  1UEB A;  2BZ8 A;  2PQW A;  1N6A A;  2C0T A;  5GAN e;  1YI2 T;  1VQ5 Q;  2NYS A;  3NPF A;  1W2B P;  2GCX A;  5KCO A;  2D1X A;  2EVR A;  1TU0 B;  5CKD A;  5LJ5 g;  4MDX A;  3SHW A;  1OQK A;  4KRT A;  3UDC A;  3JCM V;  3CPF A;  1S72 A;  3OSV A;  2DEQ A;  2YRV A;  3VS2 A;  1M3C A;  4KUL A;  4D8K A;  3MEW A;  1ZBX A;  2EYX A;  2HSP A;  1WHH A;  1OZ2 A;  3TU4 K;  4ZNX A;  2DLP A;  3CCJ Q;  2MWP A;  5GAN 2;  3OS1 A;  2E4H A;  4BE1 A;  2BKD N;  2K2V A;  4M78 C;  1ZX6 A;  1MGQ A;  1YIT A;  2LRQ A;  4RTT A;  3EGD A;  1W6X A;  3LGL A;  1UGS B;  4XU1 A;  5LJ3 h;  2KYB A;  3UA7 A;  1OU9 A;  2HD0 A;  3CCS Q;  4D8D A;  4BUG A;  2JTE A;  1YHQ Q;  2FPE A;  4E7Z A;  2DTH A;  2RI5 A;  3CCQ Q;  4QVD A;  3LGF A;  1VUB A;  3HL8 A;  2EWN A;  3GF5 A;  5GAM e;  8AT1 B;  3HSB A;  1TUC A;  4JS5 A;  4XU0 A;  2PVO B;  3JB9 G;  1ARK A;  4X9D A;  3LH0 A;  2XMF A;  3JCM f;  5FW9 A;  1DJ7 B;  2E41 A;  4J9C A;  5GAN 8;  1OUL A;  3HRT A;  2KXC A;  4F7U B;  1N5Z A;  6AT1 B;  3THK A;  2LJ3 A;  1IB8 A;  2O31 A;  1K73 U;  1P92 A;  3OS2 A;  2YUN A;  5L8R E;  3EHR A;  3CCR Q;  3CC7 Q;  4GY5 A;  2E70 A;  3M57 A;  2EJF A;  2V26 A;  4LNP A;  2G3R A;  4C0Z A;  1K1Z A;  1G5V A;  2DTO A;  3M9Q A;  4PJO E;  3JCM g;  2RF0 A;  1RLP C;  1A0N B;  5FU6 B;  5HK3 A;  2QYZ A;  2QQA A;  1MMN A;  3NTK A;  4ELZ C;  5GAN d;  4HCB A;  3TQ7 P;  1Y96 B;  2DJZ A;  3UF4 A;  3I56 Q;  2XDB A;  1KQS P;  1VQN Q;  2B86 A;  3X26 B;  2HCK A;  4GLK A;  3CEY A;  4ZN3 A;  3EG9 B;  3AT1 B;  2DXT A;  2KRN A;  1G3T A;  1RI9 A;  2OTJ T;  1Y0M A;  2R57 A;  2WSF E;  3VKI A;  2E64 A;  3H41 A;  4RTW A;  4GBQ A;  3RBB B;  3QWX X;  1VQL Q;  2DO3 A;  5FU7 C;  1VQ7 T;  3RUX A;  3SDZ A;  4NL2 A;  3G4S Q;  1AWJ A;  4PJM A;  1ZBJ A;  4BI8 B;  1CKB A;  5A0D A;  2QA4 T;  4JRQ A;  1M1F A;  3MP6 A;  4UC4 A;  5GAM h;  1KC8 R;  1U06 A;  2EYZ A;  2VWF A;  1FMW A;  3CCL Q;  2L5Q A;  2NUT A;  2XDP A;  3UA6 A;  3HTR A;  4J9B A;  4IKF A;  1IZ6 A;  4M75 A;  3CPW A;  1K73 C;  1YJN A;  3RDV A;  4LD9 K;  2DXC A;  1K8A U;  4AT1 B;  2K2M A;  4RKU E;  1BK2 A;  1YIJ T;  2CP5 A;  4DEX A;  1GCP A;  4IUU A;  1MUZ A;  1VQM Q;  1VQO Q;  4J6X A;  4M75 G;  3RMS A;  2VXF A;  4HVU A;  2IIM A;  3OA6 A;  2LDM A;  4RTV A;  1VQ9 T;  4KUD K;  1RAH B;  4KGZ B;  4PJJ A;  1E7O A;  5L23 A;  3CCM A;  1YWO A;  3G71 A;  2ABL A;  3JCM W;  2A36 A;  3CQT A;  1RAB B;  4RG8 A;  4LDY A;  3DB3 A;  5LJ3 f;  3CMA A;  3TVT A;  2K6D A;  3CCM Q;  2AIR B;  4OMM A;  4OMP A;  1RAD B;  2DER A;  2JW4 A;  1WIE A;  4J83 A;  2ZPE B;  1CSK A;  1PNJ A;  2A3L A;  1X2K A;  2JXB A;  1SPK A;  1ZQ1 A;  1FX7 A;  1TSF A;  1W4S A;  1YWP A;  4M7D F;  3L2U A;  2EIF A;  2R5A A;  3HFO A;  1D3B A;  3P8H A;  4C0D B;  1I5L A;  5LJ3 g;  2DD5 A;  3PVQ A;  1M30 A;  4E7I A;  2JZ2 A;  1K8A C;  2G6F X;  1VQ5 T;  1J3T A;  4Y92 A;  3MHX A;  2KMT A;  4OMN A;  3VS5 A;  1AWW A;  2LCS A;  2FZC B;  2HZY A;  2LZ6 B;  1YBY A;  2E3H A;  4QT7 A;  4EMK C;  1PHT A;  5LJ5 e;  4C92 F;  2GF7 A;  2E1H A;  3CC2 A;  3DB4 A;  4RTY A;  2L3R A;  1GFD A;  4WTO B;  3CCJ T;  2AHJ B;  3SWN A;  3CXC S;  1WHL A;  1QCF A;  3MEA A;  4KGV B;  2CP2 A;  4RCB A;  1PKT A;  2DBM A;  1Q7Y U;  2JMC A;  3OW2 S;  3CC2 Q;  4HA8 A;  1BU1 A;  4IUR A;  2VC8 A;  2DET A; 
#chains in the Genus database with same CATH homology
 4MML A;  4C92 C;  2VYT A;  4OGE A;  2VXE A;  3PT9 A;  1M1K C;  4XAX B;  4MMK A;  2JVV A;  5GMK m;  1YJW A;  4M78 F;  3QXE B;  3JB9 D;  4HT8 A;  5GAN 6;  3CCJ A;  4M7A B;  2ZPB B;  3L1A A;  4JJN K;  1G3W A;  4BAC A;  3OMG A;  3CCS T;  5CQX A;  5GAO m;  3M54 A;  1X6O A;  3SWN C;  4M7A D;  2LTO A;  1PSF A;  3CCV T;  5HK0 A;  2X4W A;  3QJ6 A;  2XD0 A;  3NTI A;  1YHQ T;  2KDS A;  3M4Y A;  4PLL A;  5A2Q E;  5IT9 E;  4C0D C;  2RJD A;  2E65 A;  1O9S A;  3M56 A;  4N0A A;  1BIB A;  1JRI A;  3CCQ T;  4JRI A;  2A7Y A;  1M90 U;  4MZP A;  3MP8 A;  3PFS A;  5GAM d;  3CC4 T;  4PNO A;  3V7R A;  1FWZ A;  4J7I A;  2EYQ A;  4M78 E;  1XOV A;  3QPH A;  4C8Q F;  3CCS A;  2E5Q A;  4C8Q A;  2HAX A;  4M7D G;  3JCM h;  2Y4Y A;  1MHN A;  3CCV A;  3LYI A;  2LCL A;  3BY7 A;  3C4S A;  1M1G A;  3JCM b;  2CZ6 B;  2E10 A;  1YHQ A;  2P0P A;  1KC8 U;  2CZ7 B;  4PJO B;  2RB6 A;  2DVE A;  2RJE A;  4FT2 A;  2ZCF B;  3MCA B;  4JLG A;  3CCQ A;  1KG1 A;  4PJO D;  1QVF S;  4XTV A;  2PUK B;  3CC4 A;  4II1 A;  4Y28 E;  3JCM P;  3M55 A;  3WVD B;  4EPC A;  2RHY A;  3JB9 F;  3LW5 E;  2EKO A;  3OYH A;  4J5Y A;  2DXB A;  4C8Q E;  2HQX A;  3RES A;  1U8R A;  4N4I A;  2KY9 A;  2RHX A;  1OZ3 A;  3G7Z A;  4FSX A;  2X4X A;  4IUT A;  4PL6 A;  5FRO A;  2K5I A;  3P8B B;  4C8Q G;  3BFM A;  4C8Q C;  1B34 A;  3JB9 J;  4ZTJ A;  3OYB A;  3CCR T;  3JB9 H;  3C94 A;  4FU6 A;  4C5I A;  3SD4 A;  3CC7 T;  3HPW A;  3ZBD A;  3V7S A;  2FVU A;  2RO0 A;  2ZPG B;  1N9S A;  4Z02 A;  3S3M A;  1M9S A;  3LWI A;  1WPY A;  1Y71 A;  2X4J A;  3OY9 A;  4ME7 A;  3RKY A;  4BI4 A;  3TRE A;  1NJI C;  4M77 B;  5GAM g;  1N8R U;  2CS7 A;  5FU7 B;  2MI6 A;  1S72 A;  2QQ9 A;  2KSS A;  3KUF A;  3OYE A;  4M77 D;  3CCE A;  3L2Z A;  2KAF A;  3SB2 A;  1QP2 A;  2R58 A;  3V8J A;  4BDZ A;  2XK0 A;  3HFN A;  5D6X A;  2V8K A;  3J80 E;  1Q7Y C;  3CCR A;  4M7A E;  4JRK A;  3JCM e;  4QQG A;  5GAN 7;  4O6J A;  3N5B B;  3L2Q A;  3CC7 A;  4M7A C;  1VQ4 T;  3HRU A;  4FT4 A;  4C5G A;  1JBM A;  2DZC A;  2DIQ A;  4OB0 B;  5GAN 5;  5CKF A;  2LCC A;  4HKE A;  3I56 T;  2F5K A;  1W2B S;  2JTF A;  3X20 B;  5KH6 A;  5GAN h;  1VQ6 T;  5GAO q;  5CO7 A;  3JCM c;  4E7J A;  2L89 A;  2L8D A;  2M16 A;  4EMK A;  5CAI A;  1VQN T;  3J7A F;  3JRZ A;  3QYG B;  5KE3 A;  3E9F A;  3C95 A;  3PMT A;  4OB1 B;  3V7C A;  3OYL A;  3L42 A;  3OYI A;  4CI0 C;  3H8Z A;  3EFR A;  4IUQ A;  4NOY A;  4OP0 A;  2RM4 A;  3HHT B;  1JJ2 S;  5GAN 3;  4N4H A;  4C0F A;  1BI1 A;  5DLQ E;  4C0G A;  2PUO B;  3QDR B;  5LJ5 d;  1KQ2 A;  3DKM A;  2K5F A;  3UWN A;  1WGS A;  3I55 T;  1VQ4 A;  1UGR B;  4A4E A;  3QUI A;  2OTL A;  4FIB A;  3I56 A;  3QKJ A;  5GAO p;  1QVG S;  1VQ6 A;  2FL7 A;  4BE0 A;  1VQL T;  2JTM A;  1Y07 A;  2RK1 A;  1KHI A;  5CCA A;  3CXC A;  1TH7 A;  2CZ1 B;  1M90 C;  4EMH A;  1YJ9 T;  1VQN A;  4M7D C;  1U1T A;  3WVE B;  1XTD A;  5LJ5 f;  1K9M U;  3A8O B;  1VIE A;  2O01 E;  3OYG A;  3OW2 A;  5M9O A;  2EQU A;  5GAN 4;  3G4S T;  4D6W A;  3GPL A;  4M77 F;  3ZEH A;  1QVP A;  4E47 A;  4QVC A;  3JAM E;  4C92 A;  4A4H A;  1Q86 U;  2LC4 A;  4A54 A;  1KC8 C;  3I55 A;  5IN1 A;  4J7F A;  3PNW C;  3JCM J;  2RD1 A;  4JDS A;  1SSF A;  2ZPI B;  5A0G A;  5C0M A;  1VQ8 T;  2RHZ A;  2ZPF B;  4M75 B;  4ZN1 A;  1VQL A;  2ZZD A;  4R55 A;  2EQM A;  1UEB A;  2PQW A;  5GAN j;  1YJ9 A;  1N6A A;  1HK9 A;  3FDR A;  3R6O A;  4FL6 A;  5HKC A;  4M75 D;  4RMO A;  3CCL T;  1BI3 A;  3UPU A;  5GAN e;  1LJO A;  2P0K A;  1YI2 T;  2K3X A;  3L2V A;  1S72 T;  2LT1 A;  3G4S A;  2O4X A;  3RKW A;  4EDU A;  4N4G A;  2GCX A;  3QZ5 B;  4M77 E;  1XQH A;  2FYK A;  4O5V A;  4JLI A;  4C92 G;  5KCO A;  4M77 C;  5CKD A;  5LJ5 g;  1VQ8 A;  3M4G A;  4MDX A;  4OVA A;  3HKS A;  4M78 A;  4M7D A;  3C12 A;  3UDC A;  3CCL A;  3JCM V;  2DZ9 A;  1NZ9 A;  2RK2 A;  3CPF A;  2MAM A;  3EAE A;  3PTA A;  3OSV A;  1ZHI A;  2DEQ A;  1YI2 A;  2YRV A;  2YLB A;  3TCJ A;  2K3Y A;  3NFC A;  4BE2 A;  1N8R C;  1YIT T;  4KUL A;  2DK3 A;  3MEW A;  4BY6 B;  1ZBX A;  5AYF A;  1G3S A;  2JUF A;  1OZ2 A;  2RJC A;  3TU4 K;  2QI2 A;  2QQS A;  1VQM T;  1VQO T;  3BW1 A;  4XTU A;  4XTY A;  2EFI A;  4BDY A;  2MWP A;  3OYF A;  2XI9 A;  2IG0 A;  3VUB A;  2CYZ B;  2KQW A;  1QVF A;  2E6N A;  4NS5 A;  5GAN 2;  3OS1 A;  5I2M A;  3S6W A;  4X9C A;  2D9T A;  3GP8 A;  3VUZ A;  4BE1 A;  2H3J A;  2LQK A;  4M78 G;  2Y4X A;  2BKD N;  4M75 F;  3S3N A;  2DXU A;  2K2V A;  4M78 C;  2HBP A;  1MGQ A;  4X34 A;  5KE2 A;  1YIT A;  2LRQ A;  2VV5 A;  4PLI A;  4J8O A;  3LGL A;  1QW1 A;  1BIA A;  1UGS B;  4JRP A;  2XG8 D;  4XU1 A;  5LJ3 h;  2K4Y A;  1VQM A;  1VQO A;  2GFA A;  3MEU A;  2HD0 A;  3FIF A;  2YHT A;  2DPP B;  4E7L A;  4BUG A;  4XU3 A;  1X01 A;  3CCM T;  3EFS A;  3OS5 A;  4MZM A;  4M75 E;  3CPW S;  1BI2 A;  1KHC A;  2DTH A;  3M58 A;  2RI5 A;  2QXF A;  3LWH A;  2Y90 A;  3V8L A;  1K9M C;  4M7A A;  4QVD A;  2B8A A;  3LGF A;  1V29 B;  3VJP A;  5GAO r;  2OAU A;  1PSE A;  1VUB A;  5GAM j;  3HL8 A;  3CMA T;  1D3B B;  3JCM d;  3CBM A;  2EWN A;  2WSE E;  3GF5 A;  4OF1 A;  1W2B A;  5GAM e;  2D6F A;  4XU2 A;  3HSB A;  4R56 A;  4DOV A;  1YCY A;  1KQS S;  1I4K 1;  4QQD A;  5CVI A;  3T9N A;  4XU0 A;  4JS5 A;  2PVO B;  5CK9 A;  4JS4 A;  3JB9 G;  1Q82 U;  3GOX A;  1JB0 E;  2MWO A;  2JNG A;  4X9D A;  3LH0 A;  3E19 A;  3JCM f;  1JJ2 A;  3DLM A;  3ZFJ A;  4M7A G;  2ZGW A;  2KVQ G;  3OB9 A;  1DJ7 B;  2E41 A;  5GAN 8;  4ZGD B;  2LX9 A;  5LJ3 j;  2K57 A;  3CBO A;  2R5M A;  4PJO F;  3HRT A;  4F7U B;  1Y7X A;  1WJR A;  5GMK h;  5LJ3 e;  3HP9 A;  1QVG A;  4PJO A;  1NPP A;  2V8J A;  3PGG A;  4HCZ A;  2EAY A;  3FC3 A;  1K73 U;  1P92 A;  5I21 A;  1WQ7 A;  3A8M B;  4BY6 C;  5L8R E;  3OS2 A;  1VQP T;  3OYJ A;  4V2S A;  5CKH A;  5C6S A;  3PMI A;  3LX7 A;  2QEX T;  4GY5 A;  2QTX A;  1RI0 A;  3JSC A;  1WJQ A;  2E70 A;  3O8V A;  3URG A;  3M57 A;  2EJF A;  3JCM X;  5DY9 A;  2CZ0 B;  2G3R A;  4C0Z A;  1G5V A;  2DTO A;  3M9Q A;  3SWN B;  2DKG A;  4ZGJ B;  2D0Q B;  2K5L A;  2M1H A;  3QJY A;  5KCH A;  4QQ6 A;  4PJO E;  3JCM g;  5GAO n;  2EQK A;  5FU6 B;  1UGQ B;  4PJO G;  5HK3 A;  2MF2 A;  1M5Q 1;  2QQA A;  1EIF A;  1VQP A;  3MEV A;  3P8D A;  4PJO C;  3NTK A;  2M0O A;  4ELZ C;  5CKE A;  1M8V A;  5CIU A;  2WSC E;  2ZPH B;  5GAN d;  4QVZ A;  4HCB A;  4A4K A;  1Y96 B;  5J26 A;  4M77 A;  5J39 A;  2WAC A;  2DJZ A;  4KT0 E;  2QEX A;  1Q81 U;  3QO3 A;  3CME T;  3LLR A;  4LDW A;  4ZTF A;  2XDB A;  3QHS A;  4LD6 A;  3KXT A;  1H64 1;  3CC2 T;  3E9G A;  2RA2 A;  3X25 B;  3X26 B;  4GLK A;  3CEY A;  4ZN3 A;  2HNI A;  4ATO A;  4TVR A;  5GMK j;  5GAN f;  3RMQ A;  3JCM Q;  5DLO A;  2DXT A;  5D6W A;  4LDV A;  1G3T A;  5GMK e;  2RHU A;  2OTJ T;  2VGM A;  2R57 A;  2WSF E;  3VKI A;  2E64 A;  4A53 A;  3VU3 C;  4HCC A;  5I2S A;  1BYM A;  1GXI E;  3OYA A;  3CCU T;  2CGH A;  3CME A;  3Q1J A;  4M77 G;  2DO3 A;  1BI0 A;  3OYN A;  3GNG A;  2PVG B;  5FU7 C;  1WQW A;  2PVD B;  4KUI A;  1VQ7 T;  4C8Q B;  3RUX A;  2DAQ A;  3SDZ A;  4NL2 A;  4KBM B;  3ME9 A;  4RCC A;  2RJF A;  3QYH B;  3AHU A;  2OTJ A;  1HXD A;  4C8Q D;  4BI8 B;  3OQ5 A;  4L5G A;  2XID A;  2BUD A;  2P0Q A;  4XTW A;  5A0D A;  4J6W A;  3L2R A;  4L59 A;  1YJN T;  2QA4 T;  1Q82 C;  3CCU A;  3ASK A;  4JRQ A;  1M1F A;  3MP6 A;  4UC4 A;  2I2L A;  5GAM h;  5GAN g;  2RI2 A;  1M4Z A;  4A4G A;  4ELY C;  3NTH A;  3A8L B;  4BI3 A;  3BDL A;  1OYX A;  2L5Q A;  1VIF A;  1I81 A;  2XDP A;  3OYY A;  1VQ7 A;  4OB3 B;  4YTL A;  3RER A;  4QW2 A;  5GMK i;  4IKF A;  1IZ6 A;  5IAY A;  4DA4 A;  2F69 A;  3M53 A;  4M75 A;  3TEE A;  1B34 B;  3RIR A;  2JN0 A;  2QQB A;  3CPW A;  2FB7 A;  1K73 C;  1QP3 A;  1YJN A;  2EJ9 A;  4LD9 K;  2QA4 A;  2DXC A;  4E7H A;  1K8A U;  2QQR A;  4HT9 A;  4XTZ A;  4P5N A;  3QII A;  5FU6 C;  3FLG A;  4BD3 A;  5FLX E;  4RKU E;  3OYD A;  3OYK A;  1NE8 A;  3WXM B;  1YIJ T;  1WNL A;  2FHD A;  2RI3 A;  1KQS A;  3A8H B;  1H3Z A;  2MMP A;  3GLX A;  1I8F A;  3FB9 A;  3KBG A;  3JB9 I;  4IUU A;  3G71 T;  3CD6 T;  2LT4 A;  2X4Y A;  2QDY B;  4J6X A;  4M75 G;  3RMS A;  2LVM A;  2VXF A;  4M75 C;  4M7D B;  3CCE T;  3E1S A;  1XNI A;  5GAM f;  5A0L A;  1Q81 C;  3OA6 A;  2LDM A;  4Y91 A;  4ZGE B;  3QBY A;  1Q86 C;  1VQ9 T;  1U1S A;  4KUD K;  4EMK B;  1YIJ A;  4M7D D;  2XKO C;  3FEO A;  2C06 A;  1BKB A;  2DD4 A;  3RKX A;  5CR2 A;  2GFU A;  5LJ3 d;  2E6Z A;  4N0A C;  5DM7 R;  3CCM A;  3G71 A;  3CD6 A;  2NLU A;  1KD1 U;  3ER0 A;  3OYC A;  4OMF B;  3JCM W;  3M59 A;  2V8I A;  3OYM A;  2X35 A;  3MO8 A;  4OB2 B;  4RG8 A;  1WJS A;  3DLL A;  3PIP A;  4LDY A;  3DB3 A;  3G6E T;  5LJ3 f;  5HY6 A;  3CMA A;  1M1K U;  1VQ9 A;  3BDU A;  4IUP A;  2DTI A;  2XIC A;  3OMC A;  4MDW A;  5GMK l;  2XU8 A;  2IVW A;  4XTX A;  2M9U A;  4JUV A;  2F5T X;  4J83 A;  2ZPE B;  4C92 B;  2VUB A;  5LJ5 h;  5GAO l;  3FRN A;  3J81 E;  1N27 A;  2CKK A;  5LL6 S;  1AHJ B;  4A4F A;  5J3B A;  2A3L A;  4OGC A;  4C92 D;  3MET A;  3FJP A;  2JOY A;  1VQK T;  3G6E A;  1OI1 A;  2EQJ A;  4VUB A;  4PKC C;  4CRI A;  3A8G B;  3VV0 A;  1ZQ1 A;  1FX7 A;  1W4S A;  4M7D F;  3L2U A;  2XHC A;  4NL3 A;  2EIF A;  2R5A A;  3HFO A;  1D3B A;  3P8H A;  2O4X B;  4WF2 A;  3OBY A;  3SFM A;  4C0D B;  2RHI A;  3INZ A;  1I5L A;  3M5A A;  4IUV A;  5LJ3 g;  2XDD A;  2DD5 A;  3L2W A;  4BB7 A;  3VYH B;  5FRN A;  3S3O A;  1KQ1 A;  2HQE A;  1VQK A;  4B9X A;  2PU9 B;  4E7I A;  1UGP B;  1UB4 A;  2JZ2 A;  4M78 B;  1K8A C;  3HRS A;  3OSS C;  1VQ5 T;  2VGN A;  5EG2 A;  4RG2 A;  4L6V 5;  1IRE B;  3MHX A;  1X75 C;  3X28 B;  4FM4 B;  4M7D E;  4M78 D;  2KMT A;  4Q5W A;  1NPR A;  2LNV A;  4F7U F;  4F7U A;  4C5H A;  1FXX A;  3MP1 A;  1YBY A;  3GIB A;  5LJ5 j;  3F70 A;  2LQ8 A;  4B9W A;  4EMK C;  1LOJ A;  4LDU A;  4XK8 E;  1R8O B;  3VYG A;  5LJ5 e;  4C92 F;  5CKB A;  3UT1 A;  1O75 A;  2GF7 A;  2RH2 A;  1LNX A;  2E1H A;  3OBW A;  5D6Y A;  4DOW A;  1VQ5 A;  3CC2 A;  3DB4 A;  3QG1 A;  5FRM A;  3QSU A;  2L3R A;  1NJI U;  3H6Z A;  1YJW T;  4MZT A;  1N9R A;  2YLC A;  2E12 A;  2DIG A;  3GNF B;  3CCJ T;  2AHJ B;  3SWN A;  3CXC S;  4XQ3 A;  4EMG A;  1RL2 A;  1G3Y A;  3MEA A;  4RCB A;  4M7A F;  4C5E A;  3QZ9 B;  2BIV A;  3A5Z B;  5CQY A;  3X24 B;  4F7U E;  4J6Y A;  4E7K A;  4DQ2 A;  3OS0 A;  2P4T A;  2EJG A;  2GQV A;  4F7U G;  1Q7Y U;  1KD1 C;  3OW2 S;  2OTL T;  4LDX A;  4HA8 A;  3PIO A;  4C92 E;  4IUR A;  2VC8 A;  3CBP A;  2KK4 A;  1Y96 A;  3V8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...