4MDXA

Crystal structure of bacillus subtilis mazf in complex with rna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
b'SMIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA interferase EndoA
publication title Structural Basis of mRNA Recognition and Cleavage by Toxin MazF and Its Regulation by Antitoxin MazE in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase/rna
total genus 37
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mdxA00
1X75C 3JSCA 4MDXA 3TCJA 3G7ZA 4OF1A 4MZTA 3NFCA 5HKCA 5DLOA 5CKEA 2C06A 5CKBA 5HK3A 1UB4A 3JRZA 2VUBA 4MZMA 5CQXA 5CR2A 3VUBA 5CKFA 3HPWA 4MZPA 1NE8A 1M1FA 5CCAA 5CK9A 4ELYC 5HK0A 2MF2A 5CQYA 1VUBA 5CO7A 4ME7A 5CKDA 4HKEA 4ELZC 4VUBA 5CKHA 2KMTA
chains in the Genus database with same CATH superfamily
2PVGB 2MCNA 4EPCA 3JCMQ 1M27C 4B9WA 2X51A 3H0HA 3J7AF 2ATCB 2KY9A 2E41A 4EMKB 1Q86R 3OW2P 5CKBA 1YI2A 1IXDA 4JUVA 1VQNQ 2D9TA 4C5HA 5GAN2 2A7YA 1N5ZA 3G1JA 5CKFA 3OYEA 1W4SA 4FW2A 2XIDA 1NEGA 1S1NA 1AWJA 4C8QF 3BW1A 1YI2T 3M55A 3RKYA 4M78D 2DRMA 4M77A 4RCBA 1VQMT 1WJRA 4OB0B 8AT1B 2LJ3A 3RUXA 2B8AA 3LW5E 1QVGP 3VU3C 3OYLA 3CC2Q 1AEYA 4M7DB 3GPLA 3OY9A 1M90C 1D0XA 2QQSA 3QDFA 2EKHA 2XK0A 1TXQA 1QW1A 2KE9A 2PTKA 3JB9J 2GF7A 1AHJB 3OMGA 1I5OB 3OSVA 1YJWA 2L3RA 2O31A 1AZGB 3EG0A 3JAME 1S72A 4XTYA 4L5GA 1M9SA 2LTOA 4EMGA 3I5RA 4O6JA 2COWA 2AIRB 4EMHA 5I22A 5FU7B 4Z8AA 2CZ1B 3VJPA 5KYWA 4DEYA 3EFRA 1C1AA 3JCMc 4MDXA 3CC7A 1NG2A 2DL4A 2ZCFB 3CPWS 5M9OA 2LX9A 2ZPIB 5IXFA 3C12A 2HD0A 4FT2A 3EGDB 3HFNA 4LE9A 2H8HA 3CC7T 2E3HA 1KQ1A 2HSEB 2CKKA 3PGGA 5CO7A 2RMOA 2FG0A 3EG3A 3QSUA 2RJCA 1VQ8T 2D0NA 2CP2A 4JJNK 2QEXQ 1RABB 4PLIA 5IXBA 3ME9A 5HKCA 4X9CA 1LVKA 2PVOB 2J06A 2J6KA 4O5VA 4XU3A 1QCNA 3ZFJA 1RI0A 2RO0A 2KNBB 3OS2A 1VQNT 4PJLA 1V29B 5GAN3 3L2UA 2K79A 4RTWA 4D8KA 2KYBA 1X75C 5KYXA 2MMPA 1K8AR 1WHMA 2DK3A 2K5IA 1JJ2P 1PD0A 3CC2A 3JB9D 3OYJA 2VVKA 1FXXA 2LQNA 2ROTA 1KD1C 4M7DE 4IUPA 1RLQC 4PK4A 1UGSB 2KK4A 4M77F 3EG9B 2DVJA 3CC2T 1NBEB 1Q86U 2DFUA 2AKKA 1IHWA 4N0AC 3M4YA 1WHKA 4BDYA 5GANh 3A8MB 1YJNA 2A08A 1FMVA 2QG9B 4OMOA 2J05A 1PG5B 2HNIA 4M75B 2D8JA 4Y28E 2GQIA 4FT4A 4CC3A 1WGSA 5C0MA 4JS5A 1YJNT 3AT1B 5J3BA 3LLRA 1QKXA 2YDLA 1GL5A 2VGMA 3MEUA 1K9MR 1WQ7A 1RAFB 2YWWA 2K7AA 2SRCA 5CR2A 2V1QA 3M9QA 3PMTA 2NUPB 7AT1B 4M77C 1SRLA 2LZ6B 3OYCA 1KQSP 1JXOA 2EPDA 1SHFA 2NUTB 3BDLA 5LJ3h 2RI3A 1OQKA 4PJNA 3LWHA 3QZ9B 3A1PA 1BB9A 2HAXA 1YWOA 2JTEA 4J9GA 3OYYA 3CBMA 2YHTA 2YT6A 1JQQA 1E6HA 1YBYA 3O5ZA 2PUKB 3MCAB 2VXEA 3EGUA 1QVFS 1ZA2B 2JMCA 2RJFA 1N8RU 3WVDB 5EC7A 2JW4A 1OPKA 2E70A 3MO8A 2QI2A 3X26B 2DD4A 3DKMA 2GQVA 1M8VA 4E7ZA 5GAOm 2ENMA 2EQUA 2RK1A 2E10A 2XHCA 2L8DA 2H3EB 1E6GA 1AWXA 5KYUB 2RJEA 3HHTB 1UTIA 1UUEA 3G71Q 3CCVQ 2ZPGB 1BKBA 2YUPA 2QDYB 2MAMA 1TH7A 2K2VA 3FDRA 4R0KA 3R6NA 1Q7YC 1GXIE 1VQ5Q 1WIEA 1WQWA 4M75E 3OW2S 3AHUA 1KD1R 1OX8A 1I1JA 1K4US 1Y7XA 2WSEE 3OS5A 1X6BA 1ZUKA 3TEEA 3M56A 4B9XA 5DLQE 2NWMA 1AOJA 2K6DA 2KRNA 4MMLA 5GMKj 1JXMA 1NLOC 3CCLA 2RNAA 4KT0E 2DMOA 2VB6A 2DETA 3RESA 2DIQA 3CCRQ 5D7UA 2EJ9A 4FM4B 1WXBA 3VUBA 2GTOA 2RHYA 4FYVB 1QVGS 4EIKA 2ZZDA 3CCQQ 2O88A 1HXDA 1IREB 1SEMA 3CMAQ 4AG2C 1GCPA 1X69A 2JT4A 1JEGA 3ER0A 4JLIA 4L59A 3CCMA 3CXCP 1UEBA 1IGQA 1GCQA 3JCMf 1UGQB 4RTVA 1M90U 2KYMA 2DXBA 2BE9B 2HQHA 1WNLA 3JCMd 5GMKl 1Q82R 4J8OA 4PKCC 4KULA 5GMKe 3H41A 1YJ9Q 2L5QA 3NTKA 3NGPA 3JSCA 9ATCB 3NTHA 2KRMA 4HCZA 2EGAA 5AT1B 4EDUA 3JB9F 1LNXA 3E19A 1YIJQ 2YUQA 5FU6B 2KR3A 1OX9A 3S3MA 4DOVA 4ORZA 3FJ5A 1OYXA 3UDCA 3G71T 2P84A 2EGCA 3FRNA 4ANJA 1ZUUA 1QCFA 1YFNA 4EMKC 2NUZA 1U1TA 2NYSA 1VQ5T 3JCMX 1TTHB 2CH4A 3A8OB 1M3AA 1Q81C 1KC8C 2VGNA 1OEBA 3GLXA 3X25B 5LL6S 4CC2A 2HL5C 2EQJA 4E6RA 2EQKA 5KH6A 3CC4Q 1WXUA 5IN1A 3CCRA 1M2VA 4BB7A 4KH0B 5GMKm 1GFDA 4R56A 1JJ2S 4UC4A 1WDXA 4M4ZA 2WSFE 4B6MA 4MZPA 5C6SA 2CUDA 3I35A 1YHQA 1H8KA 1R77A 4OB2B 3OYBA 3VRYA 4OB3B 3CCRT 1VYUA 2JJ9A 4DBRA 4A54A 4M7DG 3CCQT 1PNJA 3LYIA 2QA4A 2GBQA 1KD1U 1YHQT 2RN8A 4ZTFA 3RIRA 3RKWA 5I2SA 1XQHA 1A0NB 3SWNB 4BD3A 4E7LA 1YJ9A 3L2WA 2CUBA 4OGEA 3EH2A 2DNUA 1LOJA 1Y57A 2M9UA 4QVCA 8ATCB 3VRZA 1D3BB 2WACA 3PTAA 1YJ9T 2ZPBB 1YIJA 2RK2A 1KJWA 1M3BA 2MYSA 1TUCA 2LX7A 3JCMV 2JUFA 2JS0A 1KSWA 3CEYA 4NOYA 2X4JA 3CBOA 1AZEA 3M54A 1C0MA 3QKJA 5LJ5f 1YIJT 4Z89A 5GAMf 2LCLA 3CCUA 1LCKA 4NL2A 2DJQA 2FB7A 5LJ5d 3REBB 1KQSS 4C5GA 4E7JA 4J6WA 3R6OA 5FRMA 2FZKB 2DAQA 1VQOA 2MK5A 3CQTA 3UT1A 4J7IA 4XQ3A 2PU9B 1IRXA 5AYFA 3TQ7P 4WF2A 3EFOB 4ZNXA 3D7SB 3CCSQ 1Y96A 3DLMA 2OTLQ 4M77D 5FWBA 2X4YA 1M1KC 4II1A 2E5KA 2E3IA 4M78B 3CC4A 4D8DA 4KUDK 3OBYA 5GMKi 4OF1A 1BIAA 4PL6A 1GCQC 3MHXA 5IHNA 2W0ZA 2HKNA 3CC4T 5GAN7 3J80E 3HPWA 1QKWA 1OULA 2EFIA 3SEMA 4IIMA 5HCKA 1Q81R 1V1CA 2RH2A 4N4HA 2E6NA 1PM3A 2BZYA 3HRTA 1IO6A 2AZVA 1ZBXA 3QG1A 1KG1A 4J9HA 1M30A 2KBTA 1T0HA 4N0AA 4GLKA 3A98A 2M1HA 2RB6A 3V8LA 3TVTA 2FPDA 3OMCA 5EG2A 1Q7YU 4M75G 4M75C 3TSZA 4HT8A 1LPLA 2DIGA 1D1AA 2LCCA 1B07A 1I81A 1G3WA 1Z9QA 2K4YA 2J7IA 1QP2A 4KGZB 1WHLA 1ABOA 3GNGA 2JM8A 2XDPA 3UATA 4C92G 4PFZA 1BBZA 1WHHA 1VQMA 1UHCA 3P8BB 4AFUC 2MOXA 1UG1A 4RCCA 4PJOG 1PWTA 2P4RA 2FRYA 1H641 3CCSA 2QQRA 3PIPA 4X34A 4C0DB 1JU5C 1BI0A 3CXCS 2JNGA 4OMMA 2JMAA 4M78E 2FEIA 2D8HA 1RL2A 2K3XA 1WFWA 3KXTA 3CCST 1MMNA 2XDBA 2IG0A 2DZCA 1YWPA 3I56Q 2DL7A 2DXUA 4JRPA 2V26A 1SSHA 5A2QE 4FYYB 4BY6B 1NJIC 5D6WA 1QP3A 4DOWA 2QASA 1N27A 1KHCA 2EYXA 5HY6A 3S6WA 3OYHA 2C0TA 3UPUA 1V76A 3HL8A 2M0OA 2OAWA 2DYBA 2LQ8A 4LD9K 1RAAB 3NFCA 1BI1A 3OYIA 5CVIA 1N8RR 2X3XD 5FWCA 4ZN1A 1VQ8A 1MHNA 1OPLA 4JZ4A 2DYIA 4D6WA 1BI2A 1PC0A 1RAGB 4E2FB 4E7KA 3JCMW 3QZ5B 3M53A 3V7SA 2YLCA 1W2BP 2Y90A 2Y4XA 1VQNA 2RHUA 5IAYA 5IHKA 4GY5A 2EWNA 1T3SA 1Y71A 1Q81U 1KC8U 1RUWA 1G3SA 5GJWB 4BUGA 1Z9ZA 1TSFA 3INZA 2J6FA 2YSQA 2RHZA 2C0OA 1NM7A 4QQGA 2V8JA 1KHIA 1WHJA 3VS5A 4KGVB 2COYA 4DBFA 1ZSZA 2PVDB 2IPOB 4QKUA 2F5TX 1U5SA 4JDSA 2M0YA 4J9BA 3LX7A 3VS7A 3PIOA 4E7SA 2X9HA 5GAOn 3PVLA 2LP5A 3I56A 2KSSA 4RG8A 3CCEQ 4KRTA 2DEQA 4OGCA 4J9IA 3KUFA 1MGQA 3EH1A 5GANg 1ZX6A 1VIEA 3I56T 3GP8A 1K0SA 2ZPEB 4F16A 3ASKA 4WTOB 1AVZC 2XG8D 2LJ0A 1TG0A 5I2MA 1TS9A 3T9NA 4OMNA 5L23A 1M90R 4LDXA 1TUGB 2Y4YA 5GAN5 1M5Q1 2FPEA 3M0UA 2E6ZA 3S3NA 4JJDA 1VQ7Q 4C92B 2EW3A 2HBWA 3M0PA 1NJIR 1VQKQ 2OTJQ 4JS4A 3M0QA 2P4TA 2GFUA 4M7AB 2DA9A 2L89A 1PRMC 4QVDA 3OYAA 4EMKA 1IZ6A 4PJOB 4FSXA 2QEXA 2KT1A 5LJ3g 5J26A 2HDAA 2CZ6B 4KUIA 3BE3A 3OB9A 2CZ0B 3I5SA 4AFQC 1HD3A 4ZGDB 2QEXT 5GANj 3VKIA 2XD0A 1M1KU 1PKTA 4Q5WA 2DJZA 4HA8A 1XJWB 3JCMh 3OYKA 2AT1B 2RA2A 3CCJQ 5ECAA 2LT4A 4LDYA 3THKA 2FL7A 2GTJA 2RQRA 3CPWA 1EIFA 3OYNA 4M7DA 3TREA 1NLPC 2MI6A 1BU1A 1B34B 4RTXA 3RKXA 2DPPB 2DL3A 3JCMP 3SWNC 4ESRA 2F2VA 1VYVA 4A4GA 1IB8A 3OYDA 3IQLA 3CCET 4J7FA 5LJ3j 2GFAA 3WXMB 2DRKA 5GANe 2LQWA 2CZ7B 4C0FA 2EJGA 3GBQA 2ZGWA 2K2MA 1BI3A 4C8QB 4M75D 3V7CA 1WXTA 3QHSA 1PKSA 3M5AA 4LNPA 3MP6A 4ME7A 2W10A 1VQ7A 1H92A 2V8IA 4KBMB 5KCHA 5CKHA 2X4WA 3U23A 4C92E 3EGDA 4OMFB 4BI4A 2OTJA 2MWPA 3A8LB 1M4ZA 3HFOA 4A4KA 4M7AE 2R5MA 4FU6A 2CSIA 1VQ7T 4MZMA 2LC4A 1VQ4Q 3FEOA 1O9SA 3EGXB 2XI9A 4JJBA 4PJOE 2DTHA 1AWOA 3PVQA 2OTJT 2L3SA 5GAOr 5KE3A 1K76A 1ZSZC 2G6FX 2RQUA 3EAEA 2DXCA 1VOMA 1NYGA 4AFZC 5LJ3e 3OYMA 4M78G 1D09B 2L3QA 2QTXA 4XTWA 2HCKA 2LMJA 2YUOA 2LQKA 2RPNA 1VQPQ 5GAN6 2DILA 4XU2A 1X2QA 2EBPA 1BIBA 1HSQA 2CP3A 2HBPA 4HVWA 4N4GA 1NZ9A 4K11A 3HRSA 1NJIU 2O4XA 3P8DA 1N9SA 1FMWA 2QGGA 2QTVA 3EG9A 3CCJT 1ZLMA 3DLLA 1X27A 2E1HA 3JRZA 1KIKA 3G71A 2RQWA 4F7UB 3CCVA 5GAN8 1G8XA 3L2ZA 2JVVA 4PJJA 2KXDA 2A3LA 1VQLQ 4FCYA 3FC3A 4M7DF 1UGVA 4XU0A 2V1RA 2KMTA 2YRVA 3BFMA 1OV3A 3CCVT 2P0KA 4AT1B 4M75A 1W2BS 1VQ5A 5LJ5h 2JTFA 4RTYA 5GAMh 4IUTA 3QYHB 4C8QE 3QXEB 1YITQ 3V8KA 2RHXA 2FO0A 4XTUA 4DEXA 2CH4W 5I11A 1QVFA 1K73C 2EIFA 5J39A 3OSSC 3MKDA 1QWFA 1W1FA 1Q95G 3S3OA 1BK2A 2NUPA 1Q7YR 3UA7A 3G4SQ 3MP1A 5HK3A 4PFPA 3TU4K 1TOVA 2NUTA 3WVEB 4M77B 3CCQA 3V8JA 2IIMA 4OMQA 4C0DC 3SHWA 3CMAA 1VQ4T 3SDZA 2YRCA 3QO3A 1OU9A 1VIFA 3VS2A 1H3HA 2JZ2A 1MV0B 4M7DC 5GAOq 2IVWA 1QLYA 3OS1A 2RD1A 1VQPA 1GRIA 1K0XA 2XMFA 3CMAT 2V8KA 2JS2A 3OW2A 2O9SA 4GBQA 5GJVB 1YNZA 3PMIA 1WYXA 1WI7A 2I2LA 1VQPT 2BZXA 2CP7A 4HKEA 1ZQ1A 1I5LA 2NLUA 5FU7C 5KYYA 5KYUA 4X9DA 4C0ZA 3GOXA 1MUZA 4J83A 5KYNA 3KBGA 4F7UE 2B86A 1SHGA 5KYWB 1BCOA 5CQXA 1YN8A 4IKFA 3QDRB 1QVGA 4JZ3A 1VQ9Q 4HCBA 2FZCB 5CIUA 1U3OA 5DY9A 1VQLT 2A37A 4ZTJA 2GCXA 2QYZA 1YITA 3DB3A 1M3CA 2F5KA 3BY7A 3E9FA 2JM9A 3GIBA 3M0RA 2F69A 3RMSA 2LRQA 2KVQG 1RAEB 2EVRA 1UE9A 1MNDA 5CK9A 4M75F 1YITT 2EKOA 3NPFA 4J9DA 4HCCA 4QQ6A 4A63B 1GFCA 1OZ3A 2MIOA 1PSFA 2DE0X 2KQWA 4C92F 2XDDA 4M77E 4DA4A 2CT3A 2HQEA 1QCOA 5KYXB 1VA7A 3F70A 1AD5A 4BE0A 3FB9A 2GGRA 4GLMA 4BI3A 1CKAA 5FRNA 1WX6A 2WSCE 4PJOF 1K73R 2AZSA 5CKDA 4IURA 1QQJA 3QYGB 3RMQA 1KC8R 4VUBA 2M02A 5DM7R 4HCKA 1RADB 2DX1A 3C94A 1UJYA 3I9QA 3I55Q 2LCSA 1I07A 1MMDA 1XOVA 4DBHA 1YJWQ 5FLXE 1S72Q 1G2BA 1CKBA 6AT1B 1QWEA 4JPBW 4JLGA 1WPYA 3LH5A 2QXFA 3EHRA 1TU0B 2XKOC 1HK9A 1R8OB 3GF5A 1JJ2A 4FYXB 1CSKA 5D6YA 2VASA 2CS7A 1MMGA 4C92C 4E7HA 2RJDA 4CC4B 2EJFA 2K3YA 4QT7A 2DLPA 4M7AG 4M7AC 1LJOA 1VQ9T 1K8AC 4WCIA 2ABLA 4RMOA 1FWZA 3G7ZA 4PJOC 2EQMA 1SF9A 4LXCA 1R0BG 1TUDA 4N4IA 3HTRA 3KFVA 5GAOp 2OTLA 1TWBA 4A4HA 2LJ1A 3MEVA 1D0ZA 2KAFA 1NE8A 2DBKA 3E9GA 1XTDA 3URGA 3VV0A 1T0JA 2R58A 3NMZC 1Y0MA 1W6XA 3MEAA 2QGFB 3QJYA 3ZEHA 3H8ZA 2OTLT 2CP0A 4F17A 2P0PA 3OYFA 3BDUA 1UB4A 3HRUA 1H3ZA 5CCAA 2KGTA 2RM4A 2OI3A 5CQYA 3Q1JA 1M1KR 4ZGJB 4QVZA 5FW9A 2L2PA 3I55A 3SWNA 4L6V5 1KQSA 1MMAA 1K9MC 3VUZA 3H9NA 2RI5A 1BYMA 2JOYA 3HSBA 2OAUA 1YJNQ 3I55T 3CMEQ 1D3BA 4YTLA 2EYQA 1YJWT 1K1ZA 1JB0E 2JN0A 4X1VA 1S72T 3PT9A 2AHJB 3C0CA 4C8QG 2KDSA 2XU8A 2FYKA 4C8QC 4A4FA 3JCMb 2DVEA 2E12A 3CD6Q 3UF4A 3META 5A0DA 2L3PA 1X01A 2K5FA 2DTOA 2BE7D 4V2SA 2BKDN 1HYOA 1K73U 4F7UF 1NPRA 3JV3A 4BE1A 1B7TA 3M58A 2PQWA 1PD1A 2KXCA 1C6VX 2VXFA 4PLLA 4A4EA 1BCMA 3QBYA 2EYYA 2QQ9A 3EFOA 4RTZA 2PZ1A 2E65A 4M78A 3O8VA 1JRIA 4FYWB 2DO3A 4M7DD 3OYGA 4BACA 1WJQA 1GBRA 2PUOB 4J6YA 5CAIA 1RAHB 2DF6A 4FW1A 2KROA 1I4K1 4OB1B 1RAIB 4QQDA 3UWNA 5I21A 1W70A 3MP8A 2O4XB 3FIFA 1FX7A 4IIOA 2HSPA 3SFMA 4F7UG 2RHIA 2LDMA 5FU6C 2VC8A 2PNIA 4Z88A 4QW2A 4MZTA 4F14A 2HMAA 4RTUA 3CMEA 1OOTA 2Z0WA 2R57A 3CXCA 4F04B 2ROLA 1YCYA 4AG1C 2XICA 1WHGA 1F1BB 2DL8A 2OJ2A 2DZ9A 2VYTA 2E4HA 2K57A 3PNWC 3VYGA 5HK0A 2MWOA 2DM1A 2FRWA 4DBQA 1E7OA 3QWXX 5GAOl 3CMET 3G6EQ 2O2OA 3LH0A 3CD6A 4XTZA 1IHVA 1NPPA 1UECA 3OA6A 2DL5A 3QPHA 1ZSGA 3L2VA 1SKUB 1SPKA 1OI1A 2CSQA 1I8FA 4XAXB 3A8HB 2O01E 1G83A 3CCLQ 3CD6T 2YLBA 1MV3A 2CGHA 4HXJA 1GBQA 1M8MA 1X6GA 4E47A 1Q82C 4FL6A 2QDLA 1M2VB 2EYZA 2K5LA 3JCMg 4A53A 3JB9I 3MEWA 3L1AA 1WJSA 4M77G 4AMCA 3SB2A 3HKSA 4ELZC 2RQVA 3EG2A 1D1BA 1NYFA 2D6FA 2EAYA 1VQ6Q 3HP9A 1EFNA 3CCMQ 4CI0C 4ZN3A 2RQTA 1T3LA 2DXTA 3EHQA 2DERA 1ARKA 1MNEA 3CCEA 2H3JA 1UDLA 2BUDA 5GMKh 3X20B 4RKUE 2JXBA 1EX4A 4XTXA 4M78F 4LN2A 4C5EA 4NS5A 2HEQA 1J3TA 3RERA 4PJMA 1WZOA 3VS0A 2C06A 3FJPA 4ATOA 5KYYB 4KH1B 2KT8A 1KFZA 4PNOA 1IGUA 4RTTA 3A5ZB 3JB9H 5GANf 2X4XA 4LD6A 2FVUA 3MPUB 1D1CA 3H0IA 3VS1A 2BTTA 2QQBA 5GANd 1VQKA 3M4GA 2SEMA 1OZ2A 4C92D 2CP6A 1UGPB 4Z02A 2F2XA 3PFSA 3ZL7C 3G6EA 3VS3A 4M7AD 4ELYC 1PCXA 1VQKT 3L2RA 1K8AU 2M16A 1JBMA 4IUQA 4J9CA 4PJOD 4ZGEB 4RUGA 1U1SA 3L42A 2ED0A 3RDVA 3TCJA 2QK0A 1Y96B 3G6ET 4M78C 4LDWA 3M57A 2CREA 3LGFA 3X24B 2DD5A 2RI2A 5LJ3f 1M1FA 4JRKA 3CCLT 4LUDA 3CCJA 1YHQQ 3JCMe 5LJ3d 5D6XA 3UA6A 1VQ6A 2LNVA 1ZHIA 1RACB 1SRMA 2A28A 3RBBB 2YUNA 2HQXA 4AFSC 1OU8A 2QA4Q 1FYNA 3VYHB 3EFSA 1VQ6T 3E1SA 2VKNA 3V7RA 1DJ7B 3CCMT 4OMPA 1QVPA 1D0YA 2G3RA 3EG1A 1K9MU 3QUIA 4HT9A 2CT4A 2I0NA 4LDVA 5LJ5g 1ABQA 2KEAA 2CP5A 3NHNA 1KQ2A 2CDTA 5GAMg 1G5VA 4HVVA 5DLOA 3QWYA 2DEUA 2O9VA 2VWFA 4JRIA 2LVMA 3NTIA 5A0GA 1P92A 1PSEA 4C8QD 3M0SA 1O75A 4C92A 2LNHB 5IT9E 5KCOA 1M2OA 3GNFB 4P5NA 3PE0A 3REAB 3CPWP 2K3BA 2A0FB 1X2KA 4M7AA 4DQ2A 4BI8B 3CCUQ 4XTVA 4LUEA 1VQ4A 1UJ0A 4PJOA 2CYZB 1RI9A 1B3QA 1FMKA 2A36A 4JJCA 4OVAA 4J9EA 1VQOQ 2AKLA 3OQ5A 2ZAEA 2FZGB 1VUBA 2HZYA 3RNJA 1N6AA 2YXYA 4FIBA 5KE2A 3H0FA 3DB4A 4TVRA 4IUVA 5CKEA 2JTMA 5GAN4 3C4SA 5LJ5j 3X28B 5GAMj 3RR6A 3QIIA 3JB9G 2M51A 4BY6C 4BE2A 2DTIA 4JRQA 3A8GB 1Y07A 2D1XA 1EZZB 4J5YA 1B34A 1Q86C 4C5IA 2F1LA 3SD4A 1X6OA 2BIVA 2C0IA 2VUBA 1UHFA 2HKQB 1VQLA 2MPXC 4Y91A 2ESWA 1UFFA 2QA4T 3LWIA 3L2QA 5IHIA 1VYTA 2HL3A 2FPFA 4C8QA 1N9RA 3J81E 2GNCA 5LJ5e 4IUUA 4PFOA 2ECZA 1U06A 5GAMe 4MMKA 4FSSA 3VS4A 1KK7A 1SSFA 3M59A 1YI2Q 3ULRB 2R5AA 1HJDA 4XU1A 3MJXA 5FROA 1VQMQ 3QJ6A 2F2WA 1AWWA 3ZBDA 1R0CB 2E5QA 2VV5A 4MDWA 3JCMJ 5L8RE 3EGXA 3G4SA 4KGXB 3TSWA 1AT1B 1RLPC 2K9GA 4XK8E 5GAMd 1XNIA 2ZPFB 2LT1A 1Q82U 4E7IA 2E64A 3CCUT 4C0GA 4CRIA 1ZSZB 3G4ST 4M7AF 3C95A 3CPFA 1PHTA 3OBWA 1VQOT 2RF0A 1ZA1B 2KRSA 3H6ZA 1M1GA 2DBMA 2BZ8A 4BDZA 1NEBA 1ACMB 1I0CA 1UGRB 1W2BA 2FHDA 4OMLA 5A0LA 2QAZA 2ED1A 4NL3A 1N8RC 1U8RA 1QMCA 4CC7A 2X35A 5IH2A 1G3TA 4J9FA 3OS0A 2OX7A 2AK5A 1QVFP 2KI7A 1K9AA 1JO8A 2MF2A 3CBPA 1X43A 2X3WD 3E2UA 3P8HA 2L0AA 3N5BB 2COZA 1G3YA 2J6OA 4F7UA 3VS6A 2EQIA 4J6XA 1PRLC 2EYWA 2EGEA 2P0QA 3CC7Q 1WLPB 1WA7A 4RG2A 1VQ9A 2QQAA 2D0QB 4Y92A 1SG5A 3M0TA 1YCSB 1YP5A 2DKGA 4LDUA 1ZUYA 4HVUA 4OP0A 1VQ8Q 1ZBJA 3LGLA 2YRDA 4R55A 2ZPHB 3FLGA
chains in the Genus database with same CATH topology
2PVGB 2X4WA 4J6YA 4EPCA 4C92E 3JCMQ 4B9WA 3CCQT 4OMFB 4BI4A 2OTJA 3J7AF 2KY9A 3LYIA 5CAIA 2QA4A 1K73C 2E41A 2MWPA 4EMKB 4ZTFA 1YHQT 3A8LB 1I4K1 1M4ZA 3HFOA 4OB1B 3RIRA 4A54A 3RKWA 5CKBA 4A4KA 1YI2A 4M7AE 2R5MA 4FU6A 4JUVA 5I2SA 4QQDA 3UWNA 5I21A 2D9TA 1XQHA 4C5HA 4MZMA 2LC4A 1VQ7T 5GAN2 3MP8A 3SWNB 2A7YA 1O9SA 3FEOA 2XI9A 2O4XB 4BD3A 3FIFA 4PJOE 5CKFA 1FX7A 2DTHA 3OYEA 4E7LA 1YJ9A 1W4SA 2OTJT 2XIDA 3L2WA 5GAOr 4C8QF 4OGEA 3SFMA 4F7UG 5KE3A 3BW1A 1YI2T 2RHIA 2LDMA 3M55A 5FU6C 3RKYA 1LOJA 2M9UA 2DXCA 2VC8A 3EAEA 4M78D 4QVCA 4M77A 5LJ3e 3OYMA 4RCBA 1D3BB 4QW2A 4M78G 2WACA 4MZTA 1VQMT 3PTAA 1YJ9T 2ZPBB 1WJRA 1YIJA 2RK2A 4OB0B 2QTXA 4XTWA 3CMEA 3RUXA 3CXCA 2R57A 2B8AA 3LW5E 3JCMV 2JUFA 1YCYA 2LQKA 2XICA 3VU3C 5GAN6 3OYLA 4XU2A 3CEYA 4NOYA 2DZ9A 2VYTA 2X4JA 3CBOA 4M7DB 3M54A 3OY9A 2K57A 3GPLA 3PNWC 3QKJA 5LJ5f 3VYGA 2QQSA 2MWOA 5HK0A 1BIBA 5GAOl 1YIJT 1M90C 3CMET 3LH0A 5GAMf 2LCLA 2HBPA 4N4GA 3CD6A 2XK0A 1NZ9A 3CCUA 1QW1A 4XTZA 4NL2A 1NPPA 3OA6A 3JB9J 3HRSA 1NJIU 2FB7A 2GF7A 1AHJB 5LJ5d 3OMGA 2O4XA 1KQSS 4C5GA 3OSVA 3P8DA 3R6OA 4J6WA 4E7JA 2L3RA 1N9SA 3QPHA 3L2VA 1YJWA 1W2BA 2DAQA 3CCJT 1VQOA 1OI1A 1I8FA 3JAME 3UT1A 4J7IA 4XAXB 4XTYA 3DLLA 3A8HB 2O01E 2E1HA 4L5GA 4XQ3A 3JRZA 1M9SA 2LTOA 2PU9B 4EMGA 3CD6T 5AYFA 3G71A 4WF2A 2YLBA 4F7UB 2CGHA 3CCVA 5GAN8 1QVFS 4O6JA 1Y96A 3L2ZA 2JVVA 3DLMA 4E47A 1Q82C 4FL6A 4M77D 4EMHA 2A3LA 2K5LA 3JCMg 4A53A 3JB9I 5FU7B 2X4YA 3FC3A 4II1A 2CZ1B 3MEWA 3L1AA 1WJSA 3VJPA 1M1KC 4M77G 4M7DF 4M78B 3CC4A 4XU0A 3SB2A 3HKSA 3EFRA 4ELZC 2KMTA 4KUDK 2YRVA 3OBYA 3BFMA 3JCMc 5GMKi 4MDXA 4OF1A 2P0KA 3CC7A 1BIAA 3CCVT 2D6FA 4M75A 4PL6A 1W2BS 1VQ5A 2ZCFB 2EAYA 5LJ5h 3CPWS 3MHXA 2JTFA 5GAMh 3HP9A 4IUTA 5M9OA 1KD1U 3QYHB 3CC4T 2LX9A 3QXEB 4C8QE 2ZPIB 3C12A 4CI0C 5GAN7 2HD0A 4ZN3A 2DXTA 4FT2A 3J80E 3HFNA 3V8KA 5FRMA 3HPWA 3CCEA 2RHXA 4XTUA 3CC7T 2H3JA 1KQ1A 2EFIA 2CKKA 1QVFA 3PGGA 2BUDA 5CO7A 3X20B 2EIFA 5GMKh 2RH2A 3OSSC 4N4HA 4RKUE 5J39A 1S72A 4XTXA 2E6NA 3QSUA 2RJCA 1VQ8T 4M78F 3HRTA 3QG1A 4C5EA 1ZBXA 4NS5A 1KG1A 4JJNK 3S3OA 3RERA 4PLIA 3ME9A 5HKCA 4X9CA 2PVOB 3MP1A 2C06A 4O5VA 4XU3A 3FJPA 4N0AA 5HK3A 3ZFJA 3TU4K 1RI0A 4ATOA 4GLKA 2M1HA 3WVEB 4M77B 2RO0A 3OS2A 3CCQA 3V8JA 1VQNT 4PNOA 2RB6A 3V8LA 1V29B 4C0DC 3CMAA 5GAN3 3L2UA 1VQ4T 3A5ZB 3SDZA 3JB9H 3OMCA 5EG2A 5GANf 3QO3A 1Q7YU 4M75G 4M75C 2X4XA 1VIFA 4LD6A 4HT8A 1X75C 2FVUA 2JZ2A 4M7DC 2MMPA 5GAOq 2DIGA 2IVWA 2LCCA 2QQBA 5GANd 3OS1A 2DK3A 1I81A 3M4GA 1G3WA 2K5IA 2RD1A 1VQPA 1VQKA 2K4YA 3CC2A 3CMAT 1OZ2A 2V8KA 3OW2A 4C92D 1QP2A 3JB9D 3OYJA 4Z02A 1UGPB 3GNGA 1FXXA 1KD1C 2XDPA 4C92G 4M7DE 4IUPA 3PFSA 3PMIA 3G6EA 1UGSB 4M7AD 1VQMA 2KK4A 4M77F 4ELYC 1VQKT 3L2RA 2I2LA 2M16A 3P8BB 1VQPT 1JBMA 4IUQA 1K8AU 3CC2T 4PJOD 4ZGEB 1U1SA 4RCCA 1Q86U 4HKEA 1ZQ1A 3L42A 1I5LA 4PJOG 3TCJA 2NLUA 1Y96B 5FU7C 4N0AC 3M4YA 3G6ET 4X9DA 4C0ZA 4M78C 4LDWA 3GOXA 1H641 3M57A 4J83A 4BDYA 5GANh 3A8MB 3KBGA 4F7UE 1YJNA 3CCSA 2QQRA 3PIPA 4X34A 4C0DB 3LGFA 1BI0A 3X24B 5CQXA 3CXCS 2DD5A 2RI2A 2JNGA 4IKFA 3QDRB 1QVGA 2HNIA 4M75B 5LJ3f 4M78E 1M1FA 4Y28E 4JRKA 4HCBA 3CCLT 3CCJA 5CIUA 1RL2A 2K3XA 4FT4A 5C0MA 1WGSA 5DY9A 4JS5A 1YJNT 3KXTA 5J3BA 3JCMe 3CCST 2XDBA 5LJ3d 2IG0A 3LLRA 5D6XA 2DZCA 1VQ6A 1VQLT 2LNVA 2DXUA 4JRPA 1ZHIA 4ZTJA 2GCXA 1YITA 2VGMA 3DB3A 3MEUA 1WQ7A 5A2QE 2HQXA 2F5KA 3BY7A 3E9FA 4BY6B 5D6WA 1NJIC 3GIBA 1QP3A 4DOWA 1N27A 2F69A 1KHCA 3RMSA 2LRQA 2KVQG 3EFSA 3VYHB 5CR2A 1VQ6T 3M9QA 3PMTA 3E1SA 5HY6A 3S6WA 5CK9A 3OYHA 3UPUA 4M75F 1DJ7B 3V7RA 1YITT 3HL8A 3CCMT 2EKOA 1QVPA 2G3RA 1K9MU 4HCCA 4QQ6A 1OZ3A 3QUIA 2M0OA 4M77C 4HT9A 3OYCA 3BDLA 1PSFA 5LJ3h 2RI3A 4LDVA 3LWHA 2LQ8A 5LJ5g 3QZ9B 4LD9K 2KQWA 1KQ2A 3NFCA 1BI1A 3OYIA 5GAMg 1G5VA 2HAXA 5DLOA 5CVIA 4C92F 2XDDA 4M77E 3OYYA 3CBMA 4DA4A 4JRIA 4ZN1A 2YHTA 1VQ8A 2HQEA 1MHNA 2LVMA 3F70A 3NTIA 5A0GA 1P92A 1YBYA 4BE0A 4D6WA 1BI2A 3FB9A 1PSEA 4C8QD 2PUKB 3MCAB 2VXEA 5KCHA 1O75A 4C92A 4E7KA 4BI3A 5KCOA 5IT9E 3JCMW 4PJOF 2WSCE 3GNFB 5FRNA 3QZ5B 4P5NA 3M53A 3QYGB 4IURA 3RMQA 5CKDA 3V7SA 2YLCA 2RJFA 4VUBA 1N8RU 5DM7R 3WVDB 2Y90A 2E70A 4M7AA 3MO8A 4DQ2A 4BI8B 2Y4XA 1VQNA 2RHUA 4XTVA 3C94A 5IAYA 2QI2A 1VQ4A 3X26B 2DD4A 3DKMA 2GQVA 2CYZB 4GY5A 4PJOA 1M8VA 2EWNA 1XOVA 4OVAA 5GAOm 2EQUA 1Y71A 2RK1A 1Q81U 1KC8U 2E10A 2XHCA 2L8DA 5FLXE 3OQ5A 1G3SA 2RJEA 3HHTB 4BUGA 3INZA 2ZPGB 1BKBA 2RHZA 1VUBA 4JLGA 4QQGA 2V8JA 1KHIA 1N6AA 2QDYB 2MAMA 1WPYA 1TH7A 4FIBA 2K2VA 5KE2A 3FDRA 2QXFA 2PVDB 3DB4A 1Q7YC 4TVRA 2XKOC 4IUVA 1HK9A 1R8OB 2F5TX 1GXIE 3GF5A 2JTMA 4JDSA 5CKEA 1JJ2A 5GAN4 3C4SA 5LJ5j 1WQWA 4M75E 5D6YA 3LX7A 3OW2S 3AHUA 3PIOA 3X28B 5GAMj 2CS7A 3QIIA 4C92C 3JB9G 5GAOn 4E7HA 1Y7XA 2RJDA 2WSEE 3OS5A 4BY6C 3I56A 2KSSA 4RG8A 3TEEA 4BE2A 2DTIA 2EJFA 3M56A 4B9XA 2K3YA 4M7AG 4M7AC 5DLQE 2DEQA 1LJOA 4JRQA 4MMLA 4OGCA 1VQ9T 3A8GB 5GMKj 3KUFA 1Y07A 1K8AC 4RMOA 1FWZA 1MGQA 3G7ZA 4PJOC 2EQMA 1B34A 4J5YA 5GANg 1Q86C 4C5IA 3CCLA 1VIEA 3I56T 3GP8A 4KT0E 4N4IA 3SD4A 1X6OA 3RESA 2ZPEB 2BIVA 2DIQA 3ASKA 2VUBA 5GAOp 2OTLA 1VQLA 4Y91A 2EJ9A 4FM4B 3VUBA 4A4HA 3MEVA 2KAFA 2RHYA 1NE8A 2XG8D 2QA4T 1QVGS 3E9GA 3LWIA 3L2QA 5I2MA 1XTDA 3URGA 3VV0A 2ZZDA 3T9NA 2R58A 4LDXA 1HXDA 1IREB 2Y4YA 5GAN5 3MEAA 3ZEHA 3QJYA 3H8ZA 1M5Q1 2OTLT 2E6ZA 2P0PA 3S3NA 4C8QA 1N9RA 3J81E 3OYFA 3ER0A 4JLIA 4IUUA 4L59A 4C92B 5LJ5e 3CCMA 1UEBA 3BDUA 4M7DG 5GAMe 3JCMf 1UB4A 4JS4A 4MMKA 1UGQB 1M90U 2P4TA 2DXBA 3HRUA 2GFUA 4M7AB 3M59A 1SSFA 2L89A 4QVDA 3OYAA 1WNLA 2R5AA 1H3ZA 5CCAA 3JCMd 4EMKA 5GMKl 4J8OA 2RM4A 1IZ6A 4XU1A 4PKCC 4FSXA 5CQYA 4PJOB 3Q1JA 4KULA 5FROA 5GMKe 3QJ6A 4ZGJB 4QVZA 2QEXA 3ZBDA 2E5QA 4MDWA 2L5QA 2VV5A 3NTKA 5LJ3g 3JCMJ 3I55A 3SWNA 4L6V5 3JSCA 5L8RE 3G4SA 1KQSA 3NTHA 1K9MC 4HCZA 5J26A 4XK8E 5GAMd 2CZ6B 4KUIA 1XNIA 2ZPFB 3VUZA 3OB9A 2CZ0B 2RI5A 1BYMA 2LT1A 2JOYA 4ZGDB 4E7IA 4EDUA 1Q82U 2E64A 3JB9F 2QEXT 1LNXA 2OAUA 3VKIA 3CCUT 5GANj 3E19A 2XD0A 3HSBA 1M1KU 4C0GA 4CRIA 3I55T 4Q5WA 3G4ST 2DJZA 4HA8A 5FU6B 1D3BA 4YTLA 2EYQA 3C95A 3CPFA 1YJWT 4M7AF 3OBWA 3S3MA 4DOVA 1JB0E 1VQOT 3JCMh 3OYKA 3H6ZA 2JN0A 1S72T 1M1GA 3PT9A 1OYXA 2AHJB 4C8QG 4C8QC 2KDSA 2RA2A 2FYKA 2XU8A 3UDCA 3G71T 4BDZA 2LT4A 4LDYA 1UGRB 2FL7A 4A4FA 2FHDA 2DVEA 5A0LA 2E12A 3JCMb 3CPWA 3FRNA 1EIFA 3OYNA 4NL3A 3META 5A0DA 4M7DA 1N8RC 1X01A 2K5FA 1U8RA 3TREA 2DTOA 2X35A 4V2SA 4EMKC 2BKDN 1G3TA 1U1TA 1K73U 2MI6A 1NPRA 4F7UF 1B34B 1VQ5T 3JCMX 3RKXA 3OS0A 2DPPB 4BE1A 3JCMP 3A8OB 3M58A 3SWNC 2PQWA 2MF2A 1Q81C 3CBPA 1KC8C 2VGNA 3GLXA 4A4GA 3X25B 5LL6S 3P8HA 3OYDA 2VXFA 2EQJA 3N5BB 3QBYA 4PLLA 1G3YA 2EQKA 2QQ9A 4A4EA 4F7UA 5KH6A 3CCET 4J7FA 5IN1A 5LJ3j 2GFAA 4J6XA 3CCRA 4BB7A 3WXMB 5GMKm 2E65A 2P0QA 5GANe 4R56A 1JJ2S 2CZ7B 4C0FA 4UC4A 4M78A 4RG2A 1VQ9A 2EJGA 2QQAA 2D0QB 2ZGWA 2WSFE 1BI3A 4MZPA 5C6SA 2DKGA 4LDUA 4C8QB 3O8VA 4M75D 4OP0A 3V7CA 1YHQA 3QHSA 4OB2B 3M5AA 1JRIA 3OYBA 3CCRT 4OB3B 2DO3A 3LGLA 3MP6A 4M7DD 4ME7A 3OYGA 4BACA 1VQ7A 1WJQA 4R55A 2V8IA 4KBMB 2PUOB 5CKHA 2ZPHB 3FLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X75 C;  3JSC A;  4MDX A;  3TCJ A;  3G7Z A;  4OF1 A;  4MZT A;  3NFC A;  5HKC A;  5DLO A;  5CKE A;  2C06 A;  5CKB A;  5HK3 A;  1UB4 A;  3JRZ A;  2VUB A;  4MZM A;  5CQX A;  5CR2 A;  3VUB A;  5CKF A;  3HPW A;  4MZP A;  1NE8 A;  1M1F A;  5CCA A;  5CK9 A;  4ELY C;  5HK0 A;  2MF2 A;  5CQY A;  1VUB A;  5CO7 A;  4ME7 A;  5CKD A;  4HKE A;  4ELZ C;  4VUB A;  5CKH A;  2KMT A; 
#chains in the Genus database with same CATH topology
 2PVG B;  2MCN A;  4EPC A;  3JCM Q;  1M27 C;  4B9W A;  2X51 A;  3H0H A;  3J7A F;  2ATC B;  2KY9 A;  2E41 A;  4EMK B;  1Q86 R;  3OW2 P;  5CKB A;  1YI2 A;  1IXD A;  4JUV A;  1VQN Q;  2D9T A;  4C5H A;  5GAN 2;  2A7Y A;  1N5Z A;  3G1J A;  5CKF A;  3OYE A;  1W4S A;  4FW2 A;  2XID A;  1NEG A;  1S1N A;  1AWJ A;  4C8Q F;  3BW1 A;  1YI2 T;  3M55 A;  3RKY A;  4M78 D;  2DRM A;  4M77 A;  4RCB A;  1VQM T;  1WJR A;  4OB0 B;  8AT1 B;  2LJ3 A;  3RUX A;  2B8A A;  3LW5 E;  1QVG P;  3VU3 C;  3OYL A;  3CC2 Q;  1AEY A;  4M7D B;  3GPL A;  3OY9 A;  1M90 C;  1D0X A;  2QQS A;  3QDF A;  2EKH A;  2XK0 A;  1TXQ A;  1QW1 A;  2KE9 A;  2PTK A;  3JB9 J;  2GF7 A;  1AHJ B;  3OMG A;  1I5O B;  3OSV A;  1YJW A;  2L3R A;  2O31 A;  1AZG B;  3EG0 A;  3JAM E;  1S72 A;  4XTY A;  4L5G A;  1M9S A;  2LTO A;  4EMG A;  3I5R A;  4O6J A;  2COW A;  2AIR B;  4EMH A;  5I22 A;  5FU7 B;  4Z8A A;  2CZ1 B;  3VJP A;  5KYW A;  4DEY A;  3EFR A;  1C1A A;  3JCM c;  4MDX A;  3CC7 A;  1NG2 A;  2DL4 A;  2ZCF B;  3CPW S;  5M9O A;  2LX9 A;  2ZPI B;  5IXF A;  3C12 A;  2HD0 A;  4FT2 A;  3EGD B;  3HFN A;  4LE9 A;  2H8H A;  3CC7 T;  2E3H A;  1KQ1 A;  2HSE B;  2CKK A;  3PGG A;  5CO7 A;  2RMO A;  2FG0 A;  3EG3 A;  3QSU A;  2RJC A;  1VQ8 T;  2D0N A;  2CP2 A;  4JJN K;  2QEX Q;  1RAB B;  4PLI A;  5IXB A;  3ME9 A;  5HKC A;  4X9C A;  1LVK A;  2PVO B;  2J06 A;  2J6K A;  4O5V A;  4XU3 A;  1QCN A;  3ZFJ A;  1RI0 A;  2RO0 A;  2KNB B;  3OS2 A;  1VQN T;  4PJL A;  1V29 B;  5GAN 3;  3L2U A;  2K79 A;  4RTW A;  4D8K A;  2KYB A;  1X75 C;  5KYX A;  2MMP A;  1K8A R;  1WHM A;  2DK3 A;  2K5I A;  1JJ2 P;  1PD0 A;  3CC2 A;  3JB9 D;  3OYJ A;  2VVK A;  1FXX A;  2LQN A;  2ROT A;  1KD1 C;  4M7D E;  4IUP A;  1RLQ C;  4PK4 A;  1UGS B;  2KK4 A;  4M77 F;  3EG9 B;  2DVJ A;  3CC2 T;  1NBE B;  1Q86 U;  2DFU A;  2AKK A;  1IHW A;  4N0A C;  3M4Y A;  1WHK A;  4BDY A;  5GAN h;  3A8M B;  1YJN A;  2A08 A;  1FMV A;  2QG9 B;  4OMO A;  2J05 A;  1PG5 B;  2HNI A;  4M75 B;  2D8J A;  4Y28 E;  2GQI A;  4FT4 A;  4CC3 A;  1WGS A;  5C0M A;  4JS5 A;  1YJN T;  3AT1 B;  5J3B A;  3LLR A;  1QKX A;  2YDL A;  1GL5 A;  2VGM A;  3MEU A;  1K9M R;  1WQ7 A;  1RAF B;  2YWW A;  2K7A A;  2SRC A;  5CR2 A;  2V1Q A;  3M9Q A;  3PMT A;  2NUP B;  7AT1 B;  4M77 C;  1SRL A;  2LZ6 B;  3OYC A;  1KQS P;  1JXO A;  2EPD A;  1SHF A;  2NUT B;  3BDL A;  5LJ3 h;  2RI3 A;  1OQK A;  4PJN A;  3LWH A;  3QZ9 B;  3A1P A;  1BB9 A;  2HAX A;  1YWO A;  2JTE A;  4J9G A;  3OYY A;  3CBM A;  2YHT A;  2YT6 A;  1JQQ A;  1E6H A;  1YBY A;  3O5Z A;  2PUK B;  3MCA B;  2VXE A;  3EGU A;  1QVF S;  1ZA2 B;  2JMC A;  2RJF A;  1N8R U;  3WVD B;  5EC7 A;  2JW4 A;  1OPK A;  2E70 A;  3MO8 A;  2QI2 A;  3X26 B;  2DD4 A;  3DKM A;  2GQV A;  1M8V A;  4E7Z A;  5GAO m;  2ENM A;  2EQU A;  2RK1 A;  2E10 A;  2XHC A;  2L8D A;  2H3E B;  1E6G A;  1AWX A;  5KYU B;  2RJE A;  3HHT B;  1UTI A;  1UUE A;  3G71 Q;  3CCV Q;  2ZPG B;  1BKB A;  2YUP A;  2QDY B;  2MAM A;  1TH7 A;  2K2V A;  3FDR A;  4R0K A;  3R6N A;  1Q7Y C;  1GXI E;  1VQ5 Q;  1WIE A;  1WQW A;  4M75 E;  3OW2 S;  3AHU A;  1KD1 R;  1OX8 A;  1I1J A;  1K4U S;  1Y7X A;  2WSE E;  3OS5 A;  1X6B A;  1ZUK A;  3TEE A;  3M56 A;  4B9X A;  5DLQ E;  2NWM A;  1AOJ A;  2K6D A;  2KRN A;  4MML A;  5GMK j;  1JXM A;  1NLO C;  3CCL A;  2RNA A;  4KT0 E;  2DMO A;  2VB6 A;  2DET A;  3RES A;  2DIQ A;  3CCR Q;  5D7U A;  2EJ9 A;  4FM4 B;  1WXB A;  3VUB A;  2GTO A;  2RHY A;  4FYV B;  1QVG S;  4EIK A;  2ZZD A;  3CCQ Q;  2O88 A;  1HXD A;  1IRE B;  1SEM A;  3CMA Q;  4AG2 C;  1GCP A;  1X69 A;  2JT4 A;  1JEG A;  3ER0 A;  4JLI A;  4L59 A;  3CCM A;  3CXC P;  1UEB A;  1IGQ A;  1GCQ A;  3JCM f;  1UGQ B;  4RTV A;  1M90 U;  2KYM A;  2DXB A;  2BE9 B;  2HQH A;  1WNL A;  3JCM d;  5GMK l;  1Q82 R;  4J8O A;  4PKC C;  4KUL A;  5GMK e;  3H41 A;  1YJ9 Q;  2L5Q A;  3NTK A;  3NGP A;  3JSC A;  9ATC B;  3NTH A;  2KRM A;  4HCZ A;  2EGA A;  5AT1 B;  4EDU A;  3JB9 F;  1LNX A;  3E19 A;  1YIJ Q;  2YUQ A;  5FU6 B;  2KR3 A;  1OX9 A;  3S3M A;  4DOV A;  4ORZ A;  3FJ5 A;  1OYX A;  3UDC A;  3G71 T;  2P84 A;  2EGC A;  3FRN A;  4ANJ A;  1ZUU A;  1QCF A;  1YFN A;  4EMK C;  2NUZ A;  1U1T A;  2NYS A;  1VQ5 T;  3JCM X;  1TTH B;  2CH4 A;  3A8O B;  1M3A A;  1Q81 C;  1KC8 C;  2VGN A;  1OEB A;  3GLX A;  3X25 B;  5LL6 S;  4CC2 A;  2HL5 C;  2EQJ A;  4E6R A;  2EQK A;  5KH6 A;  3CC4 Q;  1WXU A;  5IN1 A;  3CCR A;  1M2V A;  4BB7 A;  4KH0 B;  5GMK m;  1GFD A;  4R56 A;  1JJ2 S;  4UC4 A;  1WDX A;  4M4Z A;  2WSF E;  4B6M A;  4MZP A;  5C6S A;  2CUD A;  3I35 A;  1YHQ A;  1H8K A;  1R77 A;  4OB2 B;  3OYB A;  3VRY A;  4OB3 B;  3CCR T;  1VYU A;  2JJ9 A;  4DBR A;  4A54 A;  4M7D G;  3CCQ T;  1PNJ A;  3LYI A;  2QA4 A;  2GBQ A;  1KD1 U;  1YHQ T;  2RN8 A;  4ZTF A;  3RIR A;  3RKW A;  5I2S A;  1XQH A;  1A0N B;  3SWN B;  4BD3 A;  4E7L A;  1YJ9 A;  3L2W A;  2CUB A;  4OGE A;  3EH2 A;  2DNU A;  1LOJ A;  1Y57 A;  2M9U A;  4QVC A;  8ATC B;  3VRZ A;  1D3B B;  2WAC A;  3PTA A;  1YJ9 T;  2ZPB B;  1YIJ A;  2RK2 A;  1KJW A;  1M3B A;  2MYS A;  1TUC A;  2LX7 A;  3JCM V;  2JUF A;  2JS0 A;  1KSW A;  3CEY A;  4NOY A;  2X4J A;  3CBO A;  1AZE A;  3M54 A;  1C0M A;  3QKJ A;  5LJ5 f;  1YIJ T;  4Z89 A;  5GAM f;  2LCL A;  3CCU A;  1LCK A;  4NL2 A;  2DJQ A;  2FB7 A;  5LJ5 d;  3REB B;  1KQS S;  4C5G A;  4E7J A;  4J6W A;  3R6O A;  5FRM A;  2FZK B;  2DAQ A;  1VQO A;  2MK5 A;  3CQT A;  3UT1 A;  4J7I A;  4XQ3 A;  2PU9 B;  1IRX A;  5AYF A;  3TQ7 P;  4WF2 A;  3EFO B;  4ZNX A;  3D7S B;  3CCS Q;  1Y96 A;  3DLM A;  2OTL Q;  4M77 D;  5FWB A;  2X4Y A;  1M1K C;  4II1 A;  2E5K A;  2E3I A;  4M78 B;  3CC4 A;  4D8D A;  4KUD K;  3OBY A;  5GMK i;  4OF1 A;  1BIA A;  4PL6 A;  1GCQ C;  3MHX A;  5IHN A;  2W0Z A;  2HKN A;  3CC4 T;  5GAN 7;  3J80 E;  3HPW A;  1QKW A;  1OUL A;  2EFI A;  3SEM A;  4IIM A;  5HCK A;  1Q81 R;  1V1C A;  2RH2 A;  4N4H A;  2E6N A;  1PM3 A;  2BZY A;  3HRT A;  1IO6 A;  2AZV A;  1ZBX A;  3QG1 A;  1KG1 A;  4J9H A;  1M30 A;  2KBT A;  1T0H A;  4N0A A;  4GLK A;  3A98 A;  2M1H A;  2RB6 A;  3V8L A;  3TVT A;  2FPD A;  3OMC A;  5EG2 A;  1Q7Y U;  4M75 G;  4M75 C;  3TSZ A;  4HT8 A;  1LPL A;  2DIG A;  1D1A A;  2LCC A;  1B07 A;  1I81 A;  1G3W A;  1Z9Q A;  2K4Y A;  2J7I A;  1QP2 A;  4KGZ B;  1WHL A;  1ABO A;  3GNG A;  2JM8 A;  2XDP A;  3UAT A;  4C92 G;  4PFZ A;  1BBZ A;  1WHH A;  1VQM A;  1UHC A;  3P8B B;  4AFU C;  2MOX A;  1UG1 A;  4RCC A;  4PJO G;  1PWT A;  2P4R A;  2FRY A;  1H64 1;  3CCS A;  2QQR A;  3PIP A;  4X34 A;  4C0D B;  1JU5 C;  1BI0 A;  3CXC S;  2JNG A;  4OMM A;  2JMA A;  4M78 E;  2FEI A;  2D8H A;  1RL2 A;  2K3X A;  1WFW A;  3KXT A;  3CCS T;  1MMN A;  2XDB A;  2IG0 A;  2DZC A;  1YWP A;  3I56 Q;  2DL7 A;  2DXU A;  4JRP A;  2V26 A;  1SSH A;  5A2Q E;  4FYY B;  4BY6 B;  1NJI C;  5D6W A;  1QP3 A;  4DOW A;  2QAS A;  1N27 A;  1KHC A;  2EYX A;  5HY6 A;  3S6W A;  3OYH A;  2C0T A;  3UPU A;  1V76 A;  3HL8 A;  2M0O A;  2OAW A;  2DYB A;  2LQ8 A;  4LD9 K;  1RAA B;  3NFC A;  1BI1 A;  3OYI A;  5CVI A;  1N8R R;  2X3X D;  5FWC A;  4ZN1 A;  1VQ8 A;  1MHN A;  1OPL A;  4JZ4 A;  2DYI A;  4D6W A;  1BI2 A;  1PC0 A;  1RAG B;  4E2F B;  4E7K A;  3JCM W;  3QZ5 B;  3M53 A;  3V7S A;  2YLC A;  1W2B P;  2Y90 A;  2Y4X A;  1VQN A;  2RHU A;  5IAY A;  5IHK A;  4GY5 A;  2EWN A;  1T3S A;  1Y71 A;  1Q81 U;  1KC8 U;  1RUW A;  1G3S A;  5GJW B;  4BUG A;  1Z9Z A;  1TSF A;  3INZ A;  2J6F A;  2YSQ A;  2RHZ A;  2C0O A;  1NM7 A;  4QQG A;  2V8J A;  1KHI A;  1WHJ A;  3VS5 A;  4KGV B;  2COY A;  4DBF A;  1ZSZ A;  2PVD B;  2IPO B;  4QKU A;  2F5T X;  1U5S A;  4JDS A;  2M0Y A;  4J9B A;  3LX7 A;  3VS7 A;  3PIO A;  4E7S A;  2X9H A;  5GAO n;  3PVL A;  2LP5 A;  3I56 A;  2KSS A;  4RG8 A;  3CCE Q;  4KRT A;  2DEQ A;  4OGC A;  4J9I A;  3KUF A;  1MGQ A;  3EH1 A;  5GAN g;  1ZX6 A;  1VIE A;  3I56 T;  3GP8 A;  1K0S A;  2ZPE B;  4F16 A;  3ASK A;  4WTO B;  1AVZ C;  2XG8 D;  2LJ0 A;  1TG0 A;  5I2M A;  1TS9 A;  3T9N A;  4OMN A;  5L23 A;  1M90 R;  4LDX A;  1TUG B;  2Y4Y A;  5GAN 5;  1M5Q 1;  2FPE A;  3M0U A;  2E6Z A;  3S3N A;  4JJD A;  1VQ7 Q;  4C92 B;  2EW3 A;  2HBW A;  3M0P A;  1NJI R;  1VQK Q;  2OTJ Q;  4JS4 A;  3M0Q A;  2P4T A;  2GFU A;  4M7A B;  2DA9 A;  2L89 A;  1PRM C;  4QVD A;  3OYA A;  4EMK A;  1IZ6 A;  4PJO B;  4FSX A;  2QEX A;  2KT1 A;  5LJ3 g;  5J26 A;  2HDA A;  2CZ6 B;  4KUI A;  3BE3 A;  3OB9 A;  2CZ0 B;  3I5S A;  4AFQ C;  1HD3 A;  4ZGD B;  2QEX T;  5GAN j;  3VKI A;  2XD0 A;  1M1K U;  1PKT A;  4Q5W A;  2DJZ A;  4HA8 A;  1XJW B;  3JCM h;  3OYK A;  2AT1 B;  2RA2 A;  3CCJ Q;  5ECA A;  2LT4 A;  4LDY A;  3THK A;  2FL7 A;  2GTJ A;  2RQR A;  3CPW A;  1EIF A;  3OYN A;  4M7D A;  3TRE A;  1NLP C;  2MI6 A;  1BU1 A;  1B34 B;  4RTX A;  3RKX A;  2DPP B;  2DL3 A;  3JCM P;  3SWN C;  4ESR A;  2F2V A;  1VYV A;  4A4G A;  1IB8 A;  3OYD A;  3IQL A;  3CCE T;  4J7F A;  5LJ3 j;  2GFA A;  3WXM B;  2DRK A;  5GAN e;  2LQW A;  2CZ7 B;  4C0F A;  2EJG A;  3GBQ A;  2ZGW A;  2K2M A;  1BI3 A;  4C8Q B;  4M75 D;  3V7C A;  1WXT A;  3QHS A;  1PKS A;  3M5A A;  4LNP A;  3MP6 A;  4ME7 A;  2W10 A;  1VQ7 A;  1H92 A;  2V8I A;  4KBM B;  5KCH A;  5CKH A;  2X4W A;  3U23 A;  4C92 E;  3EGD A;  4OMF B;  4BI4 A;  2OTJ A;  2MWP A;  3A8L B;  1M4Z A;  3HFO A;  4A4K A;  4M7A E;  2R5M A;  4FU6 A;  2CSI A;  1VQ7 T;  4MZM A;  2LC4 A;  1VQ4 Q;  3FEO A;  1O9S A;  3EGX B;  2XI9 A;  4JJB A;  4PJO E;  2DTH A;  1AWO A;  3PVQ A;  2OTJ T;  2L3S A;  5GAO r;  5KE3 A;  1K76 A;  1ZSZ C;  2G6F X;  2RQU A;  3EAE A;  2DXC A;  1VOM A;  1NYG A;  4AFZ C;  5LJ3 e;  3OYM A;  4M78 G;  1D09 B;  2L3Q A;  2QTX A;  4XTW A;  2HCK A;  2LMJ A;  2YUO A;  2LQK A;  2RPN A;  1VQP Q;  5GAN 6;  2DIL A;  4XU2 A;  1X2Q A;  2EBP A;  1BIB A;  1HSQ A;  2CP3 A;  2HBP A;  4HVW A;  4N4G A;  1NZ9 A;  4K11 A;  3HRS A;  1NJI U;  2O4X A;  3P8D A;  1N9S A;  1FMW A;  2QGG A;  2QTV A;  3EG9 A;  3CCJ T;  1ZLM A;  3DLL A;  1X27 A;  2E1H A;  3JRZ A;  1KIK A;  3G71 A;  2RQW A;  4F7U B;  3CCV A;  5GAN 8;  1G8X A;  3L2Z A;  2JVV A;  4PJJ A;  2KXD A;  2A3L A;  1VQL Q;  4FCY A;  3FC3 A;  4M7D F;  1UGV A;  4XU0 A;  2V1R A;  2KMT A;  2YRV A;  3BFM A;  1OV3 A;  3CCV T;  2P0K A;  4AT1 B;  4M75 A;  1W2B S;  1VQ5 A;  5LJ5 h;  2JTF A;  4RTY A;  5GAM h;  4IUT A;  3QYH B;  4C8Q E;  3QXE B;  1YIT Q;  3V8K A;  2RHX A;  2FO0 A;  4XTU A;  4DEX A;  2CH4 W;  5I11 A;  1QVF A;  1K73 C;  2EIF A;  5J39 A;  3OSS C;  3MKD A;  1QWF A;  1W1F A;  1Q95 G;  3S3O A;  1BK2 A;  2NUP A;  1Q7Y R;  3UA7 A;  3G4S Q;  3MP1 A;  5HK3 A;  4PFP A;  3TU4 K;  1TOV A;  2NUT A;  3WVE B;  4M77 B;  3CCQ A;  3V8J A;  2IIM A;  4OMQ A;  4C0D C;  3SHW A;  3CMA A;  1VQ4 T;  3SDZ A;  2YRC A;  3QO3 A;  1OU9 A;  1VIF A;  3VS2 A;  1H3H A;  2JZ2 A;  1MV0 B;  4M7D C;  5GAO q;  2IVW A;  1QLY A;  3OS1 A;  2RD1 A;  1VQP A;  1GRI A;  1K0X A;  2XMF A;  3CMA T;  2V8K A;  2JS2 A;  3OW2 A;  2O9S A;  4GBQ A;  5GJV B;  1YNZ A;  3PMI A;  1WYX A;  1WI7 A;  2I2L A;  1VQP T;  2BZX A;  2CP7 A;  4HKE A;  1ZQ1 A;  1I5L A;  2NLU A;  5FU7 C;  5KYY A;  5KYU A;  4X9D A;  4C0Z A;  3GOX A;  1MUZ A;  4J83 A;  5KYN A;  3KBG A;  4F7U E;  2B86 A;  1SHG A;  5KYW B;  1BCO A;  5CQX A;  1YN8 A;  4IKF A;  3QDR B;  1QVG A;  4JZ3 A;  1VQ9 Q;  4HCB A;  2FZC B;  5CIU A;  1U3O A;  5DY9 A;  1VQL T;  2A37 A;  4ZTJ A;  2GCX A;  2QYZ A;  1YIT A;  3DB3 A;  1M3C A;  2F5K A;  3BY7 A;  3E9F A;  2JM9 A;  3GIB A;  3M0R A;  2F69 A;  3RMS A;  2LRQ A;  2KVQ G;  1RAE B;  2EVR A;  1UE9 A;  1MND A;  5CK9 A;  4M75 F;  1YIT T;  2EKO A;  3NPF A;  4J9D A;  4HCC A;  4QQ6 A;  4A63 B;  1GFC A;  1OZ3 A;  2MIO A;  1PSF A;  2DE0 X;  2KQW A;  4C92 F;  2XDD A;  4M77 E;  4DA4 A;  2CT3 A;  2HQE A;  1QCO A;  5KYX B;  1VA7 A;  3F70 A;  1AD5 A;  4BE0 A;  3FB9 A;  2GGR A;  4GLM A;  4BI3 A;  1CKA A;  5FRN A;  1WX6 A;  2WSC E;  4PJO F;  1K73 R;  2AZS A;  5CKD A;  4IUR A;  1QQJ A;  3QYG B;  3RMQ A;  1KC8 R;  4VUB A;  2M02 A;  5DM7 R;  4HCK A;  1RAD B;  2DX1 A;  3C94 A;  1UJY A;  3I9Q A;  3I55 Q;  2LCS A;  1I07 A;  1MMD A;  1XOV A;  4DBH A;  1YJW Q;  5FLX E;  1S72 Q;  1G2B A;  1CKB A;  6AT1 B;  1QWE A;  4JPB W;  4JLG A;  1WPY A;  3LH5 A;  2QXF A;  3EHR A;  1TU0 B;  2XKO C;  1HK9 A;  1R8O B;  3GF5 A;  1JJ2 A;  4FYX B;  1CSK A;  5D6Y A;  2VAS A;  2CS7 A;  1MMG A;  4C92 C;  4E7H A;  2RJD A;  4CC4 B;  2EJF A;  2K3Y A;  4QT7 A;  2DLP A;  4M7A G;  4M7A C;  1LJO A;  1VQ9 T;  1K8A C;  4WCI A;  2ABL A;  4RMO A;  1FWZ A;  3G7Z A;  4PJO C;  2EQM A;  1SF9 A;  4LXC A;  1R0B G;  1TUD A;  4N4I A;  3HTR A;  3KFV A;  5GAO p;  2OTL A;  1TWB A;  4A4H A;  2LJ1 A;  3MEV A;  1D0Z A;  2KAF A;  1NE8 A;  2DBK A;  3E9G A;  1XTD A;  3URG A;  3VV0 A;  1T0J A;  2R58 A;  3NMZ C;  1Y0M A;  1W6X A;  3MEA A;  2QGF B;  3QJY A;  3ZEH A;  3H8Z A;  2OTL T;  2CP0 A;  4F17 A;  2P0P A;  3OYF A;  3BDU A;  1UB4 A;  3HRU A;  1H3Z A;  5CCA A;  2KGT A;  2RM4 A;  2OI3 A;  5CQY A;  3Q1J A;  1M1K R;  4ZGJ B;  4QVZ A;  5FW9 A;  2L2P A;  3I55 A;  3SWN A;  4L6V 5;  1KQS A;  1MMA A;  1K9M C;  3VUZ A;  3H9N A;  2RI5 A;  1BYM A;  2JOY A;  3HSB A;  2OAU A;  1YJN Q;  3I55 T;  3CME Q;  1D3B A;  4YTL A;  2EYQ A;  1YJW T;  1K1Z A;  1JB0 E;  2JN0 A;  4X1V A;  1S72 T;  3PT9 A;  2AHJ B;  3C0C A;  4C8Q G;  2KDS A;  2XU8 A;  2FYK A;  4C8Q C;  4A4F A;  3JCM b;  2DVE A;  2E12 A;  3CD6 Q;  3UF4 A;  3MET A;  5A0D A;  2L3P A;  1X01 A;  2K5F A;  2DTO A;  2BE7 D;  4V2S A;  2BKD N;  1HYO A;  1K73 U;  4F7U F;  1NPR A;  3JV3 A;  4BE1 A;  1B7T A;  3M58 A;  2PQW A;  1PD1 A;  2KXC A;  1C6V X;  2VXF A;  4PLL A;  4A4E A;  1BCM A;  3QBY A;  2EYY A;  2QQ9 A;  3EFO A;  4RTZ A;  2PZ1 A;  2E65 A;  4M78 A;  3O8V A;  1JRI A;  4FYW B;  2DO3 A;  4M7D D;  3OYG A;  4BAC A;  1WJQ A;  1GBR A;  2PUO B;  4J6Y A;  5CAI A;  1RAH B;  2DF6 A;  4FW1 A;  2KRO A;  1I4K 1;  4OB1 B;  1RAI B;  4QQD A;  3UWN A;  5I21 A;  1W70 A;  3MP8 A;  2O4X B;  3FIF A;  1FX7 A;  4IIO A;  2HSP A;  3SFM A;  4F7U G;  2RHI A;  2LDM A;  5FU6 C;  2VC8 A;  2PNI A;  4Z88 A;  4QW2 A;  4MZT A;  4F14 A;  2HMA A;  4RTU A;  3CME A;  1OOT A;  2Z0W A;  2R57 A;  3CXC A;  4F04 B;  2ROL A;  1YCY A;  4AG1 C;  2XIC A;  1WHG A;  1F1B B;  2DL8 A;  2OJ2 A;  2DZ9 A;  2VYT A;  2E4H A;  2K57 A;  3PNW C;  3VYG A;  5HK0 A;  2MWO A;  2DM1 A;  2FRW A;  4DBQ A;  1E7O A;  3QWX X;  5GAO l;  3CME T;  3G6E Q;  2O2O A;  3LH0 A;  3CD6 A;  4XTZ A;  1IHV A;  1NPP A;  1UEC A;  3OA6 A;  2DL5 A;  3QPH A;  1ZSG A;  3L2V A;  1SKU B;  1SPK A;  1OI1 A;  2CSQ A;  1I8F A;  4XAX B;  3A8H B;  2O01 E;  1G83 A;  3CCL Q;  3CD6 T;  2YLB A;  1MV3 A;  2CGH A;  4HXJ A;  1GBQ A;  1M8M A;  1X6G A;  4E47 A;  1Q82 C;  4FL6 A;  2QDL A;  1M2V B;  2EYZ A;  2K5L A;  3JCM g;  4A53 A;  3JB9 I;  3MEW A;  3L1A A;  1WJS A;  4M77 G;  4AMC A;  3SB2 A;  3HKS A;  4ELZ C;  2RQV A;  3EG2 A;  1D1B A;  1NYF A;  2D6F A;  2EAY A;  1VQ6 Q;  3HP9 A;  1EFN A;  3CCM Q;  4CI0 C;  4ZN3 A;  2RQT A;  1T3L A;  2DXT A;  3EHQ A;  2DER A;  1ARK A;  1MNE A;  3CCE A;  2H3J A;  1UDL A;  2BUD A;  5GMK h;  3X20 B;  4RKU E;  2JXB A;  1EX4 A;  4XTX A;  4M78 F;  4LN2 A;  4C5E A;  4NS5 A;  2HEQ A;  1J3T A;  3RER A;  4PJM A;  1WZO A;  3VS0 A;  2C06 A;  3FJP A;  4ATO A;  5KYY B;  4KH1 B;  2KT8 A;  1KFZ A;  4PNO A;  1IGU A;  4RTT A;  3A5Z B;  3JB9 H;  5GAN f;  2X4X A;  4LD6 A;  2FVU A;  3MPU B;  1D1C A;  3H0I A;  3VS1 A;  2BTT A;  2QQB A;  5GAN d;  1VQK A;  3M4G A;  2SEM A;  1OZ2 A;  4C92 D;  2CP6 A;  1UGP B;  4Z02 A;  2F2X A;  3PFS A;  3ZL7 C;  3G6E A;  3VS3 A;  4M7A D;  4ELY C;  1PCX A;  1VQK T;  3L2R A;  1K8A U;  2M16 A;  1JBM A;  4IUQ A;  4J9C A;  4PJO D;  4ZGE B;  4RUG A;  1U1S A;  3L42 A;  2ED0 A;  3RDV A;  3TCJ A;  2QK0 A;  1Y96 B;  3G6E T;  4M78 C;  4LDW A;  3M57 A;  2CRE A;  3LGF A;  3X24 B;  2DD5 A;  2RI2 A;  5LJ3 f;  1M1F A;  4JRK A;  3CCL T;  4LUD A;  3CCJ A;  1YHQ Q;  3JCM e;  5LJ3 d;  5D6X A;  3UA6 A;  1VQ6 A;  2LNV A;  1ZHI A;  1RAC B;  1SRM A;  2A28 A;  3RBB B;  2YUN A;  2HQX A;  4AFS C;  1OU8 A;  2QA4 Q;  1FYN A;  3VYH B;  3EFS A;  1VQ6 T;  3E1S A;  2VKN A;  3V7R A;  1DJ7 B;  3CCM T;  4OMP A;  1QVP A;  1D0Y A;  2G3R A;  3EG1 A;  1K9M U;  3QUI A;  4HT9 A;  2CT4 A;  2I0N A;  4LDV A;  5LJ5 g;  1ABQ A;  2KEA A;  2CP5 A;  3NHN A;  1KQ2 A;  2CDT A;  5GAM g;  1G5V A;  4HVV A;  5DLO A;  3QWY A;  2DEU A;  2O9V A;  2VWF A;  4JRI A;  2LVM A;  3NTI A;  5A0G A;  1P92 A;  1PSE A;  4C8Q D;  3M0S A;  1O75 A;  4C92 A;  2LNH B;  5IT9 E;  5KCO A;  1M2O A;  3GNF B;  4P5N A;  3PE0 A;  3REA B;  3CPW P;  2K3B A;  2A0F B;  1X2K A;  4M7A A;  4DQ2 A;  4BI8 B;  3CCU Q;  4XTV A;  4LUE A;  1VQ4 A;  1UJ0 A;  4PJO A;  2CYZ B;  1RI9 A;  1B3Q A;  1FMK A;  2A36 A;  4JJC A;  4OVA A;  4J9E A;  1VQO Q;  2AKL A;  3OQ5 A;  2ZAE A;  2FZG B;  1VUB A;  2HZY A;  3RNJ A;  1N6A A;  2YXY A;  4FIB A;  5KE2 A;  3H0F A;  3DB4 A;  4TVR A;  4IUV A;  5CKE A;  2JTM A;  5GAN 4;  3C4S A;  5LJ5 j;  3X28 B;  5GAM j;  3RR6 A;  3QII A;  3JB9 G;  2M51 A;  4BY6 C;  4BE2 A;  2DTI A;  4JRQ A;  3A8G B;  1Y07 A;  2D1X A;  1EZZ B;  4J5Y A;  1B34 A;  1Q86 C;  4C5I A;  2F1L A;  3SD4 A;  1X6O A;  2BIV A;  2C0I A;  2VUB A;  1UHF A;  2HKQ B;  1VQL A;  2MPX C;  4Y91 A;  2ESW A;  1UFF A;  2QA4 T;  3LWI A;  3L2Q A;  5IHI A;  1VYT A;  2HL3 A;  2FPF A;  4C8Q A;  1N9R A;  3J81 E;  2GNC A;  5LJ5 e;  4IUU A;  4PFO A;  2ECZ A;  1U06 A;  5GAM e;  4MMK A;  4FSS A;  3VS4 A;  1KK7 A;  1SSF A;  3M59 A;  1YI2 Q;  3ULR B;  2R5A A;  1HJD A;  4XU1 A;  3MJX A;  5FRO A;  1VQM Q;  3QJ6 A;  2F2W A;  1AWW A;  3ZBD A;  1R0C B;  2E5Q A;  2VV5 A;  4MDW A;  3JCM J;  5L8R E;  3EGX A;  3G4S A;  4KGX B;  3TSW A;  1AT1 B;  1RLP C;  2K9G A;  4XK8 E;  5GAM d;  1XNI A;  2ZPF B;  2LT1 A;  1Q82 U;  4E7I A;  2E64 A;  3CCU T;  4C0G A;  4CRI A;  1ZSZ B;  3G4S T;  4M7A F;  3C95 A;  3CPF A;  1PHT A;  3OBW A;  1VQO T;  2RF0 A;  1ZA1 B;  2KRS A;  3H6Z A;  1M1G A;  2DBM A;  2BZ8 A;  4BDZ A;  1NEB A;  1ACM B;  1I0C A;  1UGR B;  1W2B A;  2FHD A;  4OML A;  5A0L A;  2QAZ A;  2ED1 A;  4NL3 A;  1N8R C;  1U8R A;  1QMC A;  4CC7 A;  2X35 A;  5IH2 A;  1G3T A;  4J9F A;  3OS0 A;  2OX7 A;  2AK5 A;  1QVF P;  2KI7 A;  1K9A A;  1JO8 A;  2MF2 A;  3CBP A;  1X43 A;  2X3W D;  3E2U A;  3P8H A;  2L0A A;  3N5B B;  2COZ A;  1G3Y A;  2J6O A;  4F7U A;  3VS6 A;  2EQI A;  4J6X A;  1PRL C;  2EYW A;  2EGE A;  2P0Q A;  3CC7 Q;  1WLP B;  1WA7 A;  4RG2 A;  1VQ9 A;  2QQA A;  2D0Q B;  4Y92 A;  1SG5 A;  3M0T A;  1YCS B;  1YP5 A;  2DKG A;  4LDU A;  1ZUY A;  4HVU A;  4OP0 A;  1VQ8 Q;  1ZBJ A;  3LGL A;  2YRD A;  4R55 A;  2ZPH B;  3FLG A; 
#chains in the Genus database with same CATH homology
 2PVG B;  2X4W A;  4J6Y A;  4EPC A;  4C92 E;  3JCM Q;  4B9W A;  3CCQ T;  4OMF B;  4BI4 A;  2OTJ A;  3J7A F;  2KY9 A;  3LYI A;  5CAI A;  2QA4 A;  1K73 C;  2E41 A;  2MWP A;  4EMK B;  4ZTF A;  1YHQ T;  3A8L B;  1I4K 1;  1M4Z A;  3HFO A;  4OB1 B;  3RIR A;  4A54 A;  3RKW A;  5CKB A;  4A4K A;  1YI2 A;  4M7A E;  2R5M A;  4FU6 A;  4JUV A;  5I2S A;  4QQD A;  3UWN A;  5I21 A;  2D9T A;  1XQH A;  4C5H A;  4MZM A;  2LC4 A;  1VQ7 T;  5GAN 2;  3MP8 A;  3SWN B;  2A7Y A;  1O9S A;  3FEO A;  2XI9 A;  2O4X B;  4BD3 A;  3FIF A;  4PJO E;  5CKF A;  1FX7 A;  2DTH A;  3OYE A;  4E7L A;  1YJ9 A;  1W4S A;  2OTJ T;  2XID A;  3L2W A;  5GAO r;  4C8Q F;  4OGE A;  3SFM A;  4F7U G;  5KE3 A;  3BW1 A;  1YI2 T;  2RHI A;  2LDM A;  3M55 A;  5FU6 C;  3RKY A;  1LOJ A;  2M9U A;  2DXC A;  2VC8 A;  3EAE A;  4M78 D;  4QVC A;  4M77 A;  5LJ3 e;  3OYM A;  4RCB A;  1D3B B;  4QW2 A;  4M78 G;  2WAC A;  4MZT A;  1VQM T;  3PTA A;  1YJ9 T;  2ZPB B;  1WJR A;  1YIJ A;  2RK2 A;  4OB0 B;  2QTX A;  4XTW A;  3CME A;  3RUX A;  3CXC A;  2R57 A;  2B8A A;  3LW5 E;  3JCM V;  2JUF A;  1YCY A;  2LQK A;  2XIC A;  3VU3 C;  5GAN 6;  3OYL A;  4XU2 A;  3CEY A;  4NOY A;  2DZ9 A;  2VYT A;  2X4J A;  3CBO A;  4M7D B;  3M54 A;  3OY9 A;  2K57 A;  3GPL A;  3PNW C;  3QKJ A;  5LJ5 f;  3VYG A;  2QQS A;  2MWO A;  5HK0 A;  1BIB A;  5GAO l;  1YIJ T;  1M90 C;  3CME T;  3LH0 A;  5GAM f;  2LCL A;  2HBP A;  4N4G A;  3CD6 A;  2XK0 A;  1NZ9 A;  3CCU A;  1QW1 A;  4XTZ A;  4NL2 A;  1NPP A;  3OA6 A;  3JB9 J;  3HRS A;  1NJI U;  2FB7 A;  2GF7 A;  1AHJ B;  5LJ5 d;  3OMG A;  2O4X A;  1KQS S;  4C5G A;  3OSV A;  3P8D A;  3R6O A;  4J6W A;  4E7J A;  2L3R A;  1N9S A;  3QPH A;  3L2V A;  1YJW A;  1W2B A;  2DAQ A;  3CCJ T;  1VQO A;  1OI1 A;  1I8F A;  3JAM E;  3UT1 A;  4J7I A;  4XAX B;  4XTY A;  3DLL A;  3A8H B;  2O01 E;  2E1H A;  4L5G A;  4XQ3 A;  3JRZ A;  1M9S A;  2LTO A;  2PU9 B;  4EMG A;  3CD6 T;  5AYF A;  3G71 A;  4WF2 A;  2YLB A;  4F7U B;  2CGH A;  3CCV A;  5GAN 8;  1QVF S;  4O6J A;  1Y96 A;  3L2Z A;  2JVV A;  3DLM A;  4E47 A;  1Q82 C;  4FL6 A;  4M77 D;  4EMH A;  2A3L A;  2K5L A;  3JCM g;  4A53 A;  3JB9 I;  5FU7 B;  2X4Y A;  3FC3 A;  4II1 A;  2CZ1 B;  3MEW A;  3L1A A;  1WJS A;  3VJP A;  1M1K C;  4M77 G;  4M7D F;  4M78 B;  3CC4 A;  4XU0 A;  3SB2 A;  3HKS A;  3EFR A;  4ELZ C;  2KMT A;  4KUD K;  2YRV A;  3OBY A;  3BFM A;  3JCM c;  5GMK i;  4MDX A;  4OF1 A;  2P0K A;  3CC7 A;  1BIA A;  3CCV T;  2D6F A;  4M75 A;  4PL6 A;  1W2B S;  1VQ5 A;  2ZCF B;  2EAY A;  5LJ5 h;  3CPW S;  3MHX A;  2JTF A;  5GAM h;  3HP9 A;  4IUT A;  5M9O A;  1KD1 U;  3QYH B;  3CC4 T;  2LX9 A;  3QXE B;  4C8Q E;  2ZPI B;  3C12 A;  4CI0 C;  5GAN 7;  2HD0 A;  4ZN3 A;  2DXT A;  4FT2 A;  3J80 E;  3HFN A;  3V8K A;  5FRM A;  3HPW A;  3CCE A;  2RHX A;  4XTU A;  3CC7 T;  2H3J A;  1KQ1 A;  2EFI A;  2CKK A;  1QVF A;  3PGG A;  2BUD A;  5CO7 A;  3X20 B;  2EIF A;  5GMK h;  2RH2 A;  3OSS C;  4N4H A;  4RKU E;  5J39 A;  1S72 A;  4XTX A;  2E6N A;  3QSU A;  2RJC A;  1VQ8 T;  4M78 F;  3HRT A;  3QG1 A;  4C5E A;  1ZBX A;  4NS5 A;  1KG1 A;  4JJN K;  3S3O A;  3RER A;  4PLI A;  3ME9 A;  5HKC A;  4X9C A;  2PVO B;  3MP1 A;  2C06 A;  4O5V A;  4XU3 A;  3FJP A;  4N0A A;  5HK3 A;  3ZFJ A;  3TU4 K;  1RI0 A;  4ATO A;  4GLK A;  2M1H A;  3WVE B;  4M77 B;  2RO0 A;  3OS2 A;  3CCQ A;  3V8J A;  1VQN T;  4PNO A;  2RB6 A;  3V8L A;  1V29 B;  4C0D C;  3CMA A;  5GAN 3;  3L2U A;  1VQ4 T;  3A5Z B;  3SDZ A;  3JB9 H;  3OMC A;  5EG2 A;  5GAN f;  3QO3 A;  1Q7Y U;  4M75 G;  4M75 C;  2X4X A;  1VIF A;  4LD6 A;  4HT8 A;  1X75 C;  2FVU A;  2JZ2 A;  4M7D C;  2MMP A;  5GAO q;  2DIG A;  2IVW A;  2LCC A;  2QQB A;  5GAN d;  3OS1 A;  2DK3 A;  1I81 A;  3M4G A;  1G3W A;  2K5I A;  2RD1 A;  1VQP A;  1VQK A;  2K4Y A;  3CC2 A;  3CMA T;  1OZ2 A;  2V8K A;  3OW2 A;  4C92 D;  1QP2 A;  3JB9 D;  3OYJ A;  4Z02 A;  1UGP B;  3GNG A;  1FXX A;  1KD1 C;  2XDP A;  4C92 G;  4M7D E;  4IUP A;  3PFS A;  3PMI A;  3G6E A;  1UGS B;  4M7A D;  1VQM A;  2KK4 A;  4M77 F;  4ELY C;  1VQK T;  3L2R A;  2I2L A;  2M16 A;  3P8B B;  1VQP T;  1JBM A;  4IUQ A;  1K8A U;  3CC2 T;  4PJO D;  4ZGE B;  1U1S A;  4RCC A;  1Q86 U;  4HKE A;  1ZQ1 A;  3L42 A;  1I5L A;  4PJO G;  3TCJ A;  2NLU A;  1Y96 B;  5FU7 C;  4N0A C;  3M4Y A;  3G6E T;  4X9D A;  4C0Z A;  4M78 C;  4LDW A;  3GOX A;  1H64 1;  3M57 A;  4J83 A;  4BDY A;  5GAN h;  3A8M B;  3KBG A;  4F7U E;  1YJN A;  3CCS A;  2QQR A;  3PIP A;  4X34 A;  4C0D B;  3LGF A;  1BI0 A;  3X24 B;  5CQX A;  3CXC S;  2DD5 A;  2RI2 A;  2JNG A;  4IKF A;  3QDR B;  1QVG A;  2HNI A;  4M75 B;  5LJ3 f;  4M78 E;  1M1F A;  4Y28 E;  4JRK A;  4HCB A;  3CCL T;  3CCJ A;  5CIU A;  1RL2 A;  2K3X A;  4FT4 A;  5C0M A;  1WGS A;  5DY9 A;  4JS5 A;  1YJN T;  3KXT A;  5J3B A;  3JCM e;  3CCS T;  2XDB A;  5LJ3 d;  2IG0 A;  3LLR A;  5D6X A;  2DZC A;  1VQ6 A;  1VQL T;  2LNV A;  2DXU A;  4JRP A;  1ZHI A;  4ZTJ A;  2GCX A;  1YIT A;  2VGM A;  3DB3 A;  3MEU A;  1WQ7 A;  5A2Q E;  2HQX A;  2F5K A;  3BY7 A;  3E9F A;  4BY6 B;  5D6W A;  1NJI C;  3GIB A;  1QP3 A;  4DOW A;  1N27 A;  2F69 A;  1KHC A;  3RMS A;  2LRQ A;  2KVQ G;  3EFS A;  3VYH B;  5CR2 A;  1VQ6 T;  3M9Q A;  3PMT A;  3E1S A;  5HY6 A;  3S6W A;  5CK9 A;  3OYH A;  3UPU A;  4M75 F;  1DJ7 B;  3V7R A;  1YIT T;  3HL8 A;  3CCM T;  2EKO A;  1QVP A;  2G3R A;  1K9M U;  4HCC A;  4QQ6 A;  1OZ3 A;  3QUI A;  2M0O A;  4M77 C;  4HT9 A;  3OYC A;  3BDL A;  1PSF A;  5LJ3 h;  2RI3 A;  4LDV A;  3LWH A;  2LQ8 A;  5LJ5 g;  3QZ9 B;  4LD9 K;  2KQW A;  1KQ2 A;  3NFC A;  1BI1 A;  3OYI A;  5GAM g;  1G5V A;  2HAX A;  5DLO A;  5CVI A;  4C92 F;  2XDD A;  4M77 E;  3OYY A;  3CBM A;  4DA4 A;  4JRI A;  4ZN1 A;  2YHT A;  1VQ8 A;  2HQE A;  1MHN A;  2LVM A;  3F70 A;  3NTI A;  5A0G A;  1P92 A;  1YBY A;  4BE0 A;  4D6W A;  1BI2 A;  3FB9 A;  1PSE A;  4C8Q D;  2PUK B;  3MCA B;  2VXE A;  5KCH A;  1O75 A;  4C92 A;  4E7K A;  4BI3 A;  5KCO A;  5IT9 E;  3JCM W;  4PJO F;  2WSC E;  3GNF B;  5FRN A;  3QZ5 B;  4P5N A;  3M53 A;  3QYG B;  4IUR A;  3RMQ A;  5CKD A;  3V7S A;  2YLC A;  2RJF A;  4VUB A;  1N8R U;  5DM7 R;  3WVD B;  2Y90 A;  2E70 A;  4M7A A;  3MO8 A;  4DQ2 A;  4BI8 B;  2Y4X A;  1VQN A;  2RHU A;  4XTV A;  3C94 A;  5IAY A;  2QI2 A;  1VQ4 A;  3X26 B;  2DD4 A;  3DKM A;  2GQV A;  2CYZ B;  4GY5 A;  4PJO A;  1M8V A;  2EWN A;  1XOV A;  4OVA A;  5GAO m;  2EQU A;  1Y71 A;  2RK1 A;  1Q81 U;  1KC8 U;  2E10 A;  2XHC A;  2L8D A;  5FLX E;  3OQ5 A;  1G3S A;  2RJE A;  3HHT B;  4BUG A;  3INZ A;  2ZPG B;  1BKB A;  2RHZ A;  1VUB A;  4JLG A;  4QQG A;  2V8J A;  1KHI A;  1N6A A;  2QDY B;  2MAM A;  1WPY A;  1TH7 A;  4FIB A;  2K2V A;  5KE2 A;  3FDR A;  2QXF A;  2PVD B;  3DB4 A;  1Q7Y C;  4TVR A;  2XKO C;  4IUV A;  1HK9 A;  1R8O B;  2F5T X;  1GXI E;  3GF5 A;  2JTM A;  4JDS A;  5CKE A;  1JJ2 A;  5GAN 4;  3C4S A;  5LJ5 j;  1WQW A;  4M75 E;  5D6Y A;  3LX7 A;  3OW2 S;  3AHU A;  3PIO A;  3X28 B;  5GAM j;  2CS7 A;  3QII A;  4C92 C;  3JB9 G;  5GAO n;  4E7H A;  1Y7X A;  2RJD A;  2WSE E;  3OS5 A;  4BY6 C;  3I56 A;  2KSS A;  4RG8 A;  3TEE A;  4BE2 A;  2DTI A;  2EJF A;  3M56 A;  4B9X A;  2K3Y A;  4M7A G;  4M7A C;  5DLQ E;  2DEQ A;  1LJO A;  4JRQ A;  4MML A;  4OGC A;  1VQ9 T;  3A8G B;  5GMK j;  3KUF A;  1Y07 A;  1K8A C;  4RMO A;  1FWZ A;  1MGQ A;  3G7Z A;  4PJO C;  2EQM A;  1B34 A;  4J5Y A;  5GAN g;  1Q86 C;  4C5I A;  3CCL A;  1VIE A;  3I56 T;  3GP8 A;  4KT0 E;  4N4I A;  3SD4 A;  1X6O A;  3RES A;  2ZPE B;  2BIV A;  2DIQ A;  3ASK A;  2VUB A;  5GAO p;  2OTL A;  1VQL A;  4Y91 A;  2EJ9 A;  4FM4 B;  3VUB A;  4A4H A;  3MEV A;  2KAF A;  2RHY A;  1NE8 A;  2XG8 D;  2QA4 T;  1QVG S;  3E9G A;  3LWI A;  3L2Q A;  5I2M A;  1XTD A;  3URG A;  3VV0 A;  2ZZD A;  3T9N A;  2R58 A;  4LDX A;  1HXD A;  1IRE B;  2Y4Y A;  5GAN 5;  3MEA A;  3ZEH A;  3QJY A;  3H8Z A;  1M5Q 1;  2OTL T;  2E6Z A;  2P0P A;  3S3N A;  4C8Q A;  1N9R A;  3J81 E;  3OYF A;  3ER0 A;  4JLI A;  4IUU A;  4L59 A;  4C92 B;  5LJ5 e;  3CCM A;  1UEB A;  3BDU A;  4M7D G;  5GAM e;  3JCM f;  1UB4 A;  4JS4 A;  4MMK A;  1UGQ B;  1M90 U;  2P4T A;  2DXB A;  3HRU A;  2GFU A;  4M7A B;  3M59 A;  1SSF A;  2L89 A;  4QVD A;  3OYA A;  1WNL A;  2R5A A;  1H3Z A;  5CCA A;  3JCM d;  4EMK A;  5GMK l;  4J8O A;  2RM4 A;  1IZ6 A;  4XU1 A;  4PKC C;  4FSX A;  5CQY A;  4PJO B;  3Q1J A;  4KUL A;  5FRO A;  5GMK e;  3QJ6 A;  4ZGJ B;  4QVZ A;  2QEX A;  3ZBD A;  2E5Q A;  4MDW A;  2L5Q A;  2VV5 A;  3NTK A;  5LJ3 g;  3JCM J;  3I55 A;  3SWN A;  4L6V 5;  3JSC A;  5L8R E;  3G4S A;  1KQS A;  3NTH A;  1K9M C;  4HCZ A;  5J26 A;  4XK8 E;  5GAM d;  2CZ6 B;  4KUI A;  1XNI A;  2ZPF B;  3VUZ A;  3OB9 A;  2CZ0 B;  2RI5 A;  1BYM A;  2LT1 A;  2JOY A;  4ZGD B;  4E7I A;  4EDU A;  1Q82 U;  2E64 A;  3JB9 F;  2QEX T;  1LNX A;  2OAU A;  3VKI A;  3CCU T;  5GAN j;  3E19 A;  2XD0 A;  3HSB A;  1M1K U;  4C0G A;  4CRI A;  3I55 T;  4Q5W A;  3G4S T;  2DJZ A;  4HA8 A;  5FU6 B;  1D3B A;  4YTL A;  2EYQ A;  3C95 A;  3CPF A;  1YJW T;  4M7A F;  3OBW A;  3S3M A;  4DOV A;  1JB0 E;  1VQO T;  3JCM h;  3OYK A;  3H6Z A;  2JN0 A;  1S72 T;  1M1G A;  3PT9 A;  1OYX A;  2AHJ B;  4C8Q G;  4C8Q C;  2KDS A;  2RA2 A;  2FYK A;  2XU8 A;  3UDC A;  3G71 T;  4BDZ A;  2LT4 A;  4LDY A;  1UGR B;  2FL7 A;  4A4F A;  2FHD A;  2DVE A;  5A0L A;  2E12 A;  3JCM b;  3CPW A;  3FRN A;  1EIF A;  3OYN A;  4NL3 A;  3MET A;  5A0D A;  4M7D A;  1N8R C;  1X01 A;  2K5F A;  1U8R A;  3TRE A;  2DTO A;  2X35 A;  4V2S A;  4EMK C;  2BKD N;  1G3T A;  1U1T A;  1K73 U;  2MI6 A;  1NPR A;  4F7U F;  1B34 B;  1VQ5 T;  3JCM X;  3RKX A;  3OS0 A;  2DPP B;  4BE1 A;  3JCM P;  3A8O B;  3M58 A;  3SWN C;  2PQW A;  2MF2 A;  1Q81 C;  3CBP A;  1KC8 C;  2VGN A;  3GLX A;  4A4G A;  3X25 B;  5LL6 S;  3P8H A;  3OYD A;  2VXF A;  2EQJ A;  3N5B B;  3QBY A;  4PLL A;  1G3Y A;  2EQK A;  2QQ9 A;  4A4E A;  4F7U A;  5KH6 A;  3CCE T;  4J7F A;  5IN1 A;  5LJ3 j;  2GFA A;  4J6X A;  3CCR A;  4BB7 A;  3WXM B;  5GMK m;  2E65 A;  2P0Q A;  5GAN e;  4R56 A;  1JJ2 S;  2CZ7 B;  4C0F A;  4UC4 A;  4M78 A;  4RG2 A;  1VQ9 A;  2EJG A;  2QQA A;  2D0Q B;  2ZGW A;  2WSF E;  1BI3 A;  4MZP A;  5C6S A;  2DKG A;  4LDU A;  4C8Q B;  3O8V A;  4M75 D;  4OP0 A;  3V7C A;  1YHQ A;  3QHS A;  4OB2 B;  3M5A A;  1JRI A;  3OYB A;  3CCR T;  4OB3 B;  2DO3 A;  3LGL A;  3MP6 A;  4M7D D;  4ME7 A;  3OYG A;  4BAC A;  1VQ7 A;  1WJQ A;  4R55 A;  2V8I A;  4KBM B;  2PUO B;  5CKH A;  2ZPH B;  3FLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...