4MDXA

Crystal structure of bacillus subtilis mazf in complex with rna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
SMIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA interferase EndoA
publication title Structural Basis of mRNA Recognition and Cleavage by Toxin MazF and Its Regulation by Antitoxin MazE in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase/rna
total genus 37
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mdxA00
5CKFA 4ME7A 4HKEA 2VUBA 3VUBA 5HKCA 1VUBA 4MDXA 3G7ZA 5CKHA 4VUBA 2KMTA 5CR2A 5CK9A 3HPWA 5CQYA 5CO7A 3JRZA 4ELZC 3TCJA 5HK0A 5CCAA 4MZTA 5CKBA 4MZPA 5DLOA 1UB4A 4MZMA 4OF1A 5CQXA 1M1FA 1NE8A 2C06A 5CKDA 4ELYC 1X75C 2MF2A 3NFCA 3JSCA 5HK3A 5CKEA
chains in the Genus database with same CATH superfamily
4E7IA 3PE0A 1UDLA 2OTLA 1Q81U 3NPFA 2F5TX 3AT1B 4HCCA 4FT4A 2XD0A 2EKHA 3A5ZB 2W0ZA 3SHWA 1Q82R 3CD6A 5KYNA 1JXMA 4F7UG 2EQKA 5GAMf 2RF0A 1LPLA 2NUPA 5C6SA 5CKHA 2DILA 3TSWA 2K4YA 2DVEA 2RQUA 1QCNA 2KQWA 3OYEA 3N5BB 2E64A 3QDRB 4PJMA 2FB7A 2MIOA 3H8ZA 2CP6A 3G4SA 1JBMA 2LMJA 3CD6Q 4C92F 5IT9E 2XHCA 1KQ2A 3HP9A 3IQLA 4J9HA 1LNXA 4OVAA 3M9QA 5D6XA 4JRPA 2FEIA 4E7SA 1WNLA 3EAEA 1CKBA 3OYDA 2OAUA 4J5YA 1SRLA 2YXYA 1LOJA 3U23A 1ZBXA 2XMFA 1YI2A 2CUBA 2PUKB 1RAEB 4DEYA 5GMKj 2MK5A 4MMLA 3CCUT 3HKSA 1EX4A 2QA4A 2DTHA 3CMEQ 3M0UA 1I8FA 1SRMA 5GMKi 3X24B 3VS2A 2ESWA 2LJ3A 2KY9A 1OQKA 2YDLA 4XTWA 5GAN3 4XTYA 1VQ8Q 2KRSA 3HHTB 4C92B 2J05A 4E7LA 3QSUA 4BACA 2CZ1B 1BCOA 1YI2Q 2EJFA 2PZ1A 1GCQC 1IGUA 3PVLA 3OYLA 4X9CA 2DVJA 2P4RA 3OB9A 5L8RE 4C8QC 1QVFS 4PJNA 3M59A 1WA7A 2PVGB 5KYWB 4OB1B 1RAHB 4JJDA 1V76A 2P0PA 4PK4A 4C5GA 4L59A 2F2WA 3X25B 1GCPA 1OZ3A 4XU2A 4C5HA 1MUZA 2HKNA 2FZKB 4II1A 3L1AA 3VRZA 4N0AA 2WACA 1QCFA 1ZQ1A 1IO6A 1OULA 2F2VA 1RLQC 5DM7R 1E6HA 2KXDA 1TOVA 2D8HA 2ZPEB 3UF4A 1K9MR 4C0DB 3CPWA 1QVGA 2J6OA 1I4K1 2KRMA 5FU6B 4RMOA 5IXBA 1EFNA 3CCUA 2XK0A 1NLOC 5CQXA 1KHCA 3SD4A 2E3HA 2DTIA 1X6GA 3A8OB 2MI6A 3OYBA 4MMKA 1M90C 4BI8B 2PTKA 2L5QA 2QGFB 2ZPHB 2BUDA 3E9FA 4M75F 1RADB 2IVWA 4J9BA 5DY9A 4GY5A 2DE0X 5GANe 4EPCA 1VQKA 2R5MA 3BY7A 2BZ8A 5FU7B 3CC2T 4CC2A 4LD6A 2XKOC 3JCMP 1KJWA 1Q82C 1K73U 4XTVA 3CCVA 1WHGA 1AWOA 2E41A 2E1HA 1DJ7B 3LWIA 2YUQA 3VS1A 2V8IA 2AT1B 5LJ5h 5CAIA 8AT1B 2E6NA 2JJ9A 4RTUA 1XNIA 1NYGA 2LQ8A 2E3IA 5A0GA 4PLLA 4Z8AA 3EG3A 2EYZA 3CCLT 4LE9A 1T3SA 2DETA 2KROA 1I5LA 4M75B 2L89A 2EYXA 2O9VA 2O31A 4N4IA 5GAMd 4MDXA 1VQPA 1B3QA 1OOTA 1WHLA 2HL3A 2RI5A 1HXDA 1UUEA 4IKFA 2E12A 2CH4A 4NL2A 5GAN2 3OS2A 4IUVA 2EVRA 3QG1A 4XQ3A 3H0IA 5FRMA 4QQDA 3J7AF 2EYYA 1H3ZA 4OGCA 3PIOA 2BKDN 2LNVA 5IXFA 1VOMA 3OBWA 1KG1A 1PSFA 1N9RA 4AFUC 3VU3C 3OMCA 3OYGA 2YRCA 4ZGDB 1WFWA 1BKBA 2VYTA 4E7HA 1N9SA 3EG9A 3CC2A 4KH0B 1VIFA 1YJ9Q 1M1KU 3RUXA 2VVKA 1Y96B 2BTTA 2K3BA 4GLMA 2RJFA 2I2LA 3H6ZA 4X1VA 2RJDA 1J3TA 5CVIA 5LJ3j 4RTXA 2LCLA 2KR3A 3FJ5A 1YBYA 1BB9A 4F16A 2FVUA 1A0NB 1QWFA 2XIDA 5LJ5g 1OEBA 1N8RU 3CCLA 4LDXA 4AG1C 2Z0WA 4HVUA 2QDLA 4QKUA 3R6NA 2KBTA 1F1BB 1M3BA 1M2OA 3M58A 2CT3A 3UPUA 1FYNA 3UDCA 1ZX6A 2HD0A 3EG0A 4OB0B 3RKWA 2E5KA 2QXFA 3UA6A 3URGA 3VKIA 2EJ9A 3CXCP 4BI4A 1UGRB 4KULA 3A1PA 1YIJQ 3JSCA 3SFMA 3PVQA 3CCLQ 2VV5A 2DERA 3H0HA 4D6WA 6AT1B 2QASA 2DK3A 4LUEA 1K1ZA 3PT9A 4IIOA 1QP2A 3NGPA 3QYHB 4M78B 2KSSA 2GF7A 4Y91A 2JS0A 3H41A 2RQTA 2J6FA 1G83A 5CKDA 1ZUKA 4CC3A 3JCMf 3RNJA 4J9FA 4F14A 1QQJA 4BD3A 3CMAT 1SHFA 3H0FA 3J80E 2M0YA 4N4HA 4F7UF 3M57A 1YP5A 3TU4K 2ATCB 3I56T 4ZN3A 3I55Q 4OMFB 3LW5E 4HCBA 1ARKA 2JOYA 1YFNA 3I5SA 1JO8A 4FSSA 1GCQA 2RJEA 3REBB 2ZPGB 1D3BB 2GQVA 3JCMW 2FO0A 3SWNB 2DBMA 2MWOA 4C8QA 2ROTA 2YLBA 1X69A 2RK2A 3VRYA 1C1AA 5CIUA 4HT9A 3FB9A 4DBRA 4J9EA 3OMGA 4OP0A 4E47A 2K5IA 3L2WA 2OTJT 4XTXA 3SWNA 4KUDK 4PJJA 1VYTA 4B6MA 3ZL7C 4LNPA 2G3RA 3I5RA 4KH1B 1YJWA 1W2BP 2G6FX 2YRVA 1Q82U 3O5ZA 4F7UB 2DF6A 3JB9D 2CZ0B 3GF5A 5EG2A 3LX7A 1YNZA 2JVVA 4M7AA 2PU9B 3L2QA 2QEXA 2QAZA 2RJCA 2RD1A 2E70A 2EWNA 2AKLA 5KCHA 2RB6A 4J9CA 4JJNK 3A8GB 1OV3A 4N0AC 2O88A 4OB3B 3CCJA 3CMAA 4M77A 2KVQG 2DMOA 4DQ2A 1AT1B 5A2QE 3EGXB 1Q86U 2LRQA 3G6ET 5GANh 4XTUA 3I56A 5KCOA 1Y7XA 1YITA 1ZSZB 2DXCA 4ZGEB 2DA9A 2X35A 4AT1B 3OYAA 4J7FA 1RAIB 3EGXA 2CDTA 2EQJA 1QVFA 2VB6A 2XICA 1AZGB 4OGEA 1AWXA 3CMAQ 1ZSZA 5D6YA 3FDRA 4C0FA 5FU6C 2AZSA 5J3BA 4QVZA 1TTHB 2JXBA 3I56Q 4J9GA 4IUUA 5EC7A 2WSFE 2ZCFB 4FYXB 2JMCA 3DLMA 1N5ZA 4M7DA 2EW3A 3V8LA 3LH0A 4KGZB 3MEAA 1H641 2VWFA 3RKXA 1G3YA 1OX9A 1CSKA 3BE3A 1XTDA 2OTLT 5I22A 3KFVA 2GGRA 3JB9I 3C94A 2XDPA 1G8XA 3JAME 2OTJQ 2K57A 1G3SA 4MZTA 1W70A 4KRTA 2CSIA 3OYIA 2OJ2A 1WQWA 4NOYA 3NTIA 1T0JA 1IHWA 1BIBA 3G6EA 1JXOA 3ER0A 1K9MU 1SG5A 1GBRA 2A3LA 2DD4A 2CSQA 3EHQA 5GANg 3GOXA 4LN2A 1S1NA 3CCST 3CCET 1OX8A 2F5KA 1TG0A 1W4SA 1QP3A 2E6ZA 4ESRA 4C8QD 2DL5A 3E1SA 2QQ9A 3OQ5A 3EFOA 3VS0A 1JEGA 5CQYA 3JCMJ 2LJ0A 1NJIR 2ZPBB 3M0PA 4BY6B 2COZA 1SKUB 4J7IA 5GAN6 1M90R 1H3HA 4RCCA 2HCKA 2QA4T 4C8QG 3OYCA 3I9QA 1KIKA 4RCBA 4CC4B 2KYMA 2C0OA 1M8VA 1GBQA 1Y57A 3TEEA 5FWBA 2H3EB 2H8HA 4PJOB 4BDZA 2ED1A 2RPNA 3FJPA 1PD1A 4PL6A 1K8AR 1KQSP 2KDSA 2KT1A 2DO3A 3NFCA 3RR6A 5GAOl 1R0CB 4DBHA 2DD5A 2OTLQ 1UTIA 4OMMA 4FYYB 2BE7D 4F04B 3OS1A 2KYBA 1ZUUA 4F17A 1KC8C 1QVPA 4OF1A 4KT0E 2H3JA 3CCEA 3CCSA 3M0RA 2Y4XA 3V7CA 3CC7A 1PC0A 5IN1A 4LDWA 2X3WD 1PWTA 2D0QB 2M1HA 1AWWA 1D0XA 2JM9A 1MMAA 2EYQA 1MNEA 4A4GA 5CCAA 1B07A 3EH2A 1GRIA 3FEOA 3QYGB 4M7DD 2RA2A 3G71A 1SSFA 3CCSQ 1IRXA 3CCEQ 1VQ7T 3QDFA 3G4SQ 4O5VA 1PRMC 4B9XA 3TQ7P 1QKWA 4XU1A 2DL8A 2FRYA 3OSVA 4PFPA 3S3OA 2YT6A 1AD5A 4IURA 4M78C 4JLGA 4J8OA 2P84A 2ABLA 2LP5A 3RDVA 3RKYA 2EGCA 1KQ1A 5LJ5j 2O4XB 4OMQA 4FIBA 2L3SA 4RTYA 4FU6A 1UEBA 2RK1A 1VQKT 2LCCA 2XI9A 2LDMA 1BCMA 1G3WA 2QA4Q 2VGNA 2Y4YA 4BI3A 1NLPC 4PLIA 2KAFA 4C92A 4CI0C 3CCVT 1VQ9A 1RACB 3GLXA 1PCXA 3HSBA 2M9UA 7AT1B 4E7KA 2YRDA 1KD1R 1YJNT 3SWNC 3WVEB 1PNJA 5KYWA 5FW9A 1I0CA 1JRIA 3CQTA 1LCKA 3ZFJA 1N27A 1WHKA 1AHJB 3V8KA 1LVKA 1TXQA 1WXUA 2EGAA 1VQPT 3HL8A 5GMKl 2HKQB 5LJ3e 4M7AC 1K9AA 1QMCA 3TCJA 3E19A 2RH2A 4OMPA 2JM8A 1K76A 1VQ7A 1NJIC 2LTOA 1VQNT 3PMTA 1E6GA 4M77C 1CKAA 4XU0A 1WI7A 1G3TA 1IREB 2J7IA 2V1QA 3M0TA 4A4EA 4IUTA 1WIEA 5GJVB 5KYUB 1D1AA 1OU8A 3V7RA 1M30A 4JDSA 2CH4W 1I07A 4JS4A 3GBQA 3CCUQ 2B8AA 3QZ9B 2OAWA 1K8AC 3REAB 1Y07A 2IG0A 2JUFA 5HKCA 1ZSZC 2BE9B 3FLGA 1R0BG 3VJPA 4YTLA 2RI3A 1QCOA 1YJNA 5LJ3f 4LD9K 5KYXB 3MP1A 3OYYA 3JB9F 2C0TA 4FL6A 4M7DC 3MCAB 5GAOq 1VQKQ 1M9SA 1M2VB 4GLKA 9ATCB 4HCZA 3MHXA 1QW1A 3CBOA 4HCKA 5D7UA 2LT1A 1Q81R 4Z02A 3CXCS 3CCVQ 2RO0A 1FMWA 3OS5A 5CR2A 4RTWA 3VS7A 1IXDA 2PVDB 4LXCA 1BU1A 3H9NA 3GP8A 1MV3A 5GAMh 4M75A 1VQNA 3EGDB 4J9IA 2FPEA 4BUGA 2LVMA 3A98A 4KUIA 1TWBA 2MAMA 3S6WA 3M0QA 1YWPA 3BFMA 4J6YA 3JCMc 3QXEB 4BDYA 1YHQT 1VQPQ 1OI1A 1YCSB 3L2RA 4J9DA 2XDDA 1PSEA 2KEAA 2IPOB 2X4YA 3ASKA 3EH1A 4KGXB 1KK7A 2XU8A 2ED0A 4C0GA 3MKDA 1ZUYA 2O9SA 1K0SA 1NEBA 3UA7A 2ROLA 4DOWA 2BZXA 4QT7A 4R56A 1RL2A 2KMTA 3VUZA 2AIRB 2DEQA 2XG8D 2NUTB 4HXJA 1OZ2A 1BI0A 1MMDA 4O6JA 2MWPA 3E2UA 1Y96A 3GNFB 1MHNA 4WTOB 2JTEA 1IZ6A 4RTVA 1NEGA 2ZPFB 1M1FA 1WDXA 3L2ZA 5AYFA 2DKGA 3JCMe 2I0NA 1KD1C 3CC2Q 3C0CA 3MEWA 3FC3A 2FG0A 4JJCA 1KFZA 2DJZA 4CRIA 1WJQA 3ULRB 2EYWA 2FHDA 2DXUA 3OY9A 3NTKA 3RERA 1ABOA 1PKSA 1R77A 2D0NA 4EIKA 1W2BS 5GJWB 4C8QE 3A8MB 4FT2A 3TVTA 1TH7A 3CCMA 2JNGA 3DB4A 3OW2P 5GAOm 3AHUA 4JRKA 1SPKA 1SEMA 1YJWT 4N4GA 4JRIA 3P8BB 5GAMg 4DOVA 4PJOC 2K3XA 2O01E 1YHQA 1Q7YR 1IGQA 1ZA2B 1MGQA 2CP0A 5M9OA 3OA6A 5GANj 1U5SA 2DZ9A 4C8QF 3QZ5B 4L5GA 2QEXT 2COYA 1W1FA 1G5VA 1OYXA 1VQ5T 3OBYA 4M7AE 4UC4A 5HCKA 5I11A 5J26A 4JS5A 3M54A 4OMNA 3CCJT 2EIFA 2YSQA 1M27C 1VQLT 3UT1A 3OYFA 1AEYA 4M78A 4M77E 1YHQQ 3UATA 2L2PA 1SSHA 1YITT 1PD0A 4HT8A 2JTMA 1ZBJA 3QIIA 2LJ1A 2RHYA 2QQBA 5HK3A 2MYSA 1M90U 2FL7A 1XOVA 1M5Q1 1M3CA 4RTZA 1JU5C 4XAXB 4C5IA 3CEYA 1Q81C 3QHSA 2X4JA 4A4FA 2LQWA 1D3BA 5LJ3d 3THKA 1VQ4T 3X28B 5GAOn 5CKBA 4XTZA 1W6XA 2VC8A 1K8AU 1X43A 2A7YA 3ZBDA 2HSPA 4J83A 2DX1A 1V29B 2ZGWA 1WHJA 2DRMA 1GXIE 3HTRA 1P92A 3L2UA 2FPFA 3S3MA 4C92C 4M7DE 1IB8A 1U1TA 2NWMA 3OYMA 5LL6S 3BDUA 4BE0A 1WJRA 2EPDA 1HD3A 1UJ0A 1NG2A 2JN0A 8ATCB 4MZPA 2CKKA 4LDUA 4F7UA 4AFQC 1UB4A 1VQ5A 1WHHA 2RQRA 3OYHA 1WQ7A 1GFCA 1YJWQ 2M51A 1QWEA 2QDYB 2RHIA 4HKEA 3UWNA 3VS4A 1VQLA 2O2OA 4Z88A 5I2MA 1RAFB 2LC4A 3QWYA 3JB9G 4M7DF 1KC8R 2LX7A 3E9GA 2DEUA 1U06A 3WXMB 4D8KA 4K11A 1QKXA 2DM1A 5DLOA 1TU0B 2QEXQ 3ZEHA 2V1RA 1PG5B 4C0DC 3PNWC 3FRNA 1X2KA 3CCJQ 2F1LA 4QQ6A 2X4XA 4EMHA 2QQAA 4XK8E 2PVOB 4ELZC 1VQ4A 2DZCA 3L42A 3PFSA 4OMLA 2SEMA 3OYKA 1MMNA 1YITQ 1UG1A 4DBQA 1BK2A 1MV0B 1NE8A 4ELYC 2R58A 1QVGP 3EG1A 1O9SA 2WSCE 3CCRA 1Y71A 3VS5A 4QQGA 3G7ZA 2HNIA 3HFNA 2CP2A 1KQSS 3JRZA 5FU7C 2QK0A 2K2VA 1UE9A 3RBBB 1H8KA 3A8LB 1Q7YC 1KD1U 4PNOA 3OS0A 2X51A 5GMKe 3PMIA 2RI2A 4PKCC 3HRTA 3M56A 5HY6A 1I5OB 2DIQA 4AMCA 2YLCA 5CKFA 1Z9QA 3RESA 1BI3A 1U1SA 5L23A 2BIVA 1K4US 3JCMb 4BB7A 2BZYA 3MEVA 4M78D 3NHNA 1WXTA 2D6FA 1UHFA 2DPPB 1HYOA 1UFFA 1XQHA 2QG9B 2QYZA 3QBYA 3R6OA 5LJ5e 4PJOE 4M75C 3MO8A 2MF2A 4KGVB 2HBPA 3EFRA 4ANJA 3JCMd 1X2QA 1B34B 4BE1A 1ABQA 3CC7T 2COWA 1GFDA 4QVCA 2K7AA 3G6EQ 5IAYA 2LX9A 3ME9A 3HPWA 1RLPC 4XU3A 2YHTA 3SDZA 2ECZA 4M78G 2DYBA 5FRNA 3M4YA 2L3RA 1U8RA 1NPRA 2YWWA 2JW4A 4IIMA 1JB0E 2X9HA 2KXCA 3A8HB 3G71T 2A37A 2VUBA 1N6AA 1K0XA 4DEXA 3CXCA 3NMZC 2RHZA 4HVVA 4C0ZA 1BIAA 4M7AD 1X27A 2RNAA 2K2MA 2VGMA 5LJ5f 2XDBA 2KE9A 2HBWA 1HK9A 3HRSA 5A0LA 4M77D 3X26B 1TUDA 3VYHB 2LT4A 4HVWA 3M55A 4JRQA 2A36A 4JJBA 2KGTA 4PJOA 1VQ9T 2D1XA 2MPXC 5IHIA 2NUPB 3QJ6A 2MMPA 2P4TA 1XJWB 4C92E 1TUGB 4Z89A 4M7AG 1T3LA 1ZA1B 2EJGA 3GIBA 1X6BA 3MEUA 2K6DA 2HQHA 2AKKA 3EFSA 1RABB 4IUQA 4M77G 2MOXA 4RG2A 1M8MA 4CC7A 5C0MA 5HK0A 1MMGA 3DLLA 4X9DA 3CMEA 1IHVA 2V8JA 4M4ZA 2JTFA 2AK5A 1M1KC 3JCMg 1WZOA 1NZ9A 4ME7A 2DL7A 2GCXA 2CP3A 2HEQA 2CYZB 3CPFA 1Q86R 1ZSGA 1VQ8A 2J06A 3CC7Q 1D09B 1W2BA 2M0OA 2NLUA 2YUOA 4FM4B 4EMKB 1AVZC 3Q1JA 1WX6A 3LGLA 4AFZC 1D0YA 3G71Q 1N8RC 2VXEA 4M7DG 3V7SA 4EMKA 1EZZB 2C0IA 5IHNA 2O4XA 5FROA 2DL4A 3LYIA 2GQIA 4J6XA 4LUDA 4OMOA 3JCMX 2QI2A 5AT1B 3OYJA 2E5QA 4R0KA 2C06A 1VYUA 3QUIA 3RMQA 4A63B 4WF2A 5GAMj 3CBPA 1WJSA 2K79A 3P8DA 2CGHA 5KYYB 4DA4A 2L8DA 2JMAA 2VKNA 1VIEA 3LLRA 1Q7YU 3SB2A 2QQRA 1VQ9Q 2OI3A 4NL3A 1AOJA 5GAOr 1WLPB 2K5LA 1G2BA 1BYMA 4EDUA 1JJ2S 5KYYA 1PRLC 2QGGA 2FZCB 2R57A 2OX7A 3C95A 5DLQE 4M75E 2CUDA 2X4WA 3CC4T 5KE2A 1C0MA 2P0QA 5FWCA 3PTAA 2E10A 1I1JA 1YJ9T 2CP5A 2DIGA 2EAYA 2GFAA 4PFOA 1FMKA 1X75C 2IIMA 2K3YA 1R8OB 1VQ7Q 5D6WA 1UJYA 5KYUA 5GAN8 2L3PA 1WPYA 4PJOD 4ATOA 4RKUE 1VQOT 1I81A 1VQMT 4FYWB 5GMKh 1Q95G 4ZTFA 1VQ6T 1WXBA 1LJOA 1EIFA 5LJ5d 4AFSC 1KHIA 2B86A 1VYVA 2HMAA 2AZVA 2A28A 2YUNA 3O8VA 5KYXA 4VUBA 3OW2S 1QVFP 3M53A 2WSEE 4PJOG 1S72T 2DFUA 4JLIA 1M2VA 3CCMT 1YJNQ 1YIJT 4A54A 2RQWA 4EMGA 1AWJA 2JZ2A 3L2VA 4WCIA 2P0KA 1HJDA 2J6KA 1JJ2P 2K9GA 2RN8A 2PQWA 2FRWA 1X01A 4E7JA 1Q86C 3CC4A 3DB3A 1T0HA 4ZNXA 1KC8U 1YJ9A 3EGDA 5I21A 1FMVA 4OB2B 4A4HA 5GANf 1UECA 4MZMA 1HSQA 2KT8A 2X3XD 5IH2A 2EGEA 3DKMA 4X34A 3EG9B 5CKEA 1VA7A 1VQNQ 1JQQA 1NPPA 2DJQA 2LZ6B 4C92D 1KQSA 2GTJA 3VS3A 1VQOA 1VQMA 3I55T 1VQ6A 4RG8A 4C5EA 3TSZA 3CC4Q 2E4HA 4RTTA 4TVRA 3OYNA 4DBFA 1NYFA 5ECAA 3HRUA 5GAN7 2QTXA 2EQIA 2DRKA 4M78E 5KE3A 3JV3A 4E7ZA 3TREA 1OPLA 2LNHB 1X6OA 1E7OA 4Y28E 2NUTA 4JZ4A 3F70A 2RHUA 4JPBW 3PGGA 1PHTA 2EFIA 4BY6C 1GL5A 3MJXA 2FZGB 5CO7A 1S72A 3T9NA 4C92G 1VQOQ 1VQMQ 1NM7A 1VQ6Q 3EG2A 3GNGA 1YIJA 2Y90A 2D8JA 3CCQT 4MDWA 1U3OA 3MP6A 1UGSB 2QTVA 4M78F 5GAN5 3QWXX 2DTOA 1ZHIA 2V26A 1ZLMA 2A08A 5A0DA 3WVDB 2CZ7B 1FWZA 2GBQA 1K9MC 5IHKA 5GAOp 1S72Q 1RI9A 3CCMQ 2CREA 4A53A 2DAQA 3SEMA 2M02A 2AHJB 2DNUA 2DXTA 4F7UE 2NYSA 3QO3A 4ZTJA 3KBGA 3I55A 2V8KA 3J81E 3QPHA 2VXFA 4PJLA 1NJIU 3MP8A 1UGPB 1OPKA 1KSWA 2EKOA 4LDYA 5GAN4 3D7SB 1UGQB 2QQSA 1D0ZA 3JB9J 4M7AF 3PIPA 4BE2A 2W10A 3CBMA 1RAGB 3VS6A 3FIFA 4C8QB 3G1JA 4P5NA 1BI1A 4NS5A 3CPWS 4R55A 3META 2HL5C 2M16A 3OSSC 1QVGS 2MCNA 1TUCA 4M77F 3CCQA 1UGVA 4M75D 1M3AA 2KI7A 1Y0MA 2F2XA 2HQXA 1K73R 2CT4A 2LQKA 1TSFA 4E6RA 4EMKC 3CCRT 5LJ3h 1WYXA 4FCYA 2YUPA 4FYVB 2RMOA 1YWOA 4FSXA 4B9WA 4Y92A 2DL3A 4LDVA 1O75A 3RIRA 2KK4A 1M4ZA 4GBQA 4M7AB 3M0SA 2HAXA 4FW2A 2NUZA 3CCQQ 2L3QA 2RQVA 3M4GA 3HFOA 2HSEB 4QVDA 3BDLA 2ZPIB 3QJYA 1RUWA 2EQMA 4M75G 2A0FB 3VUBA 1RI0A 1V1CA 1PKTA 4J6WA 4M77B 5GMKm 2PNIA 2ZZDA 4AG2C 1FX7A 2ENMA 2E65A 3I35A 5J39A 5GANd 2R5AA 3LH5A 3C12A 2RHXA 1VQ5Q 1MNDA 2CP7A 2L0AA 3C4SA 1ACMB 2EBPA 1H92A 4JZ3A 2EQUA 2GFUA 5KH6A 1C6VX 1WHMA 2PUOB 1VQLQ 1RAAB 4ORZA 2DXBA 3P8HA 1AZEA 1YCYA 3M5AA 1TS9A 1M1KR 3JCMQ 2LCSA 1QLYA 1YN8A 3RMSA 3CPWP 4FW1A 1UHCA 4A4KA 2SRCA 4QW2A 1M1GA 4M7DB 4HA8A 4PFZA 2LQNA 2FYKA 2D9TA 2OTJA 2CZ6B 3MPUB 3NTHA 2RM4A 3LWHA 2GTOA 3QKJA 5LJ3g 2JS2A 4ZN1A 1JJ2A 1VQ4Q 3KXTA 3S3NA 1N8RR 4JUVA 1SHGA 2FPDA 3V8JA 3EGUA 4L6V5 5I2SA 3CCRQ 1B7TA 2F69A 1SF9A 2JT4A 2KRNA 3X20B 4IUPA 2KNBB 4E2FB 4D8DA 2HZYA 1Z9ZA 2DYIA 3CD6T 1WGSA 3BW1A 1D1CA 1NBEB 1FXXA 1OU9A 2VASA 1PM3A 1BBZA 4Q5WA 3VV0A 3JCMV 5CK9A 2CS7A 5FLXE 3EFOB 4ZGJB 3JCMh 4V2SA 3KUFA 1B34A 3G4ST 3GPLA 2DLPA 2HDAA 4PJOF 3CMET 3LGFA 2K5FA 5GAMe 2HQEA 4KBMB 1D1BA 2ZAEA 1VUBA 1K73C 3OW2A 2GNCA 1VQ8T 3INZA 2DBKA 1YI2T 3JB9H 3EHRA 4RUGA 1BI2A 3VYGA
chains in the Genus database with same CATH topology
4E7IA 2R57A 2KVQG 4DQ2A 2DJZA 2OTLA 4CRIA 1WJQA 3C95A 5DLQE 5A2QE 1Q86U 1Q81U 2LRQA 2FHDA 2DXUA 4M75E 2F5TX 3G6ET 3OY9A 4HCCA 2X4WA 3NTKA 3RERA 5GANh 4XTUA 4FT4A 3I56A 1W2BS 2XD0A 4C8QE 5KCOA 1Y7XA 3A8MB 4FT2A 1YITA 3CC4T 2DXCA 4ZGEB 5KE2A 3A5ZB 1TH7A 2P0QA 3CCMA 3PTAA 2E10A 2JNGA 1YJ9T 2X35A 3DB4A 3CD6A 3OYAA 2DIGA 4J7FA 5GAOm 4JRKA 2EAYA 2GFAA 3AHUA 1X75C 2K3YA 1YJWT 2EQJA 1QVFA 1R8OB 4F7UG 2XICA 4OGEA 4N4GA 5D6WA 2EQKA 5GAMf 4JRIA 3P8BB 5GAMg 4DOVA 5GAN8 5D6YA 5C6SA 5CKHA 3FDRA 1WPYA 5FU6C 4C0FA 4PJOC 2K3XA 2O01E 1YHQA 4PJOD 5J3BA 2K4YA 1MGQA 4ATOA 5M9OA 4RKUE 2DVEA 4QVZA 1I81A 3OA6A 5GMKh 1VQMT 1VQOT 2KQWA 5GANj 3OYEA 4ZTFA 1VQ6T 2DZ9A 1LJOA 3N5BB 4IUUA 2E64A 3QZ5B 4C8QF 2WSFE 1EIFA 2ZCFB 3QDRB 4L5GA 2QEXT 2FB7A 3H8ZA 3G4SA 3DLMA 4M7DA 1G5VA 1JBMA 1OYXA 5LJ5d 1VQ5T 3OBYA 4M7AE 4C92F 4UC4A 3V8LA 5IT9E 2XHCA 3LH0A 5J26A 4JS5A 1KQ2A 3HP9A 1H641 1KHIA 3MEAA 3M54A 1LNXA 3RKXA 4OVAA 3CCJT 1G3YA 3M9QA 2EIFA 5D6XA 4JRPA 1XTDA 1WNLA 1VQLT 3EAEA 2OTLT 3UT1A 3O8VA 4VUBA 3OYDA 2OAUA 4J5YA 3C94A 4M78A 3JB9I 3OYFA 3M53A 3CMAA 3OW2S 2XDPA 4M77E 1LOJA 3JAME 1ZBXA 1YI2A 2WSEE 4PJOG 2K57A 1S72T 1G3SA 4JLIA 2PUKB 1YITT 4MZTA 5GMKj 3CCMT 2JTMA 4HT8A 4MMLA 1YIJT 3CCUT 3HKSA 3QIIA 4A54A 2RHYA 2QQBA 5HK3A 2QA4A 2DTHA 3OYIA 2FL7A 1XOVA 1M5Q1 1WQWA 4NOYA 2JZ2A 1I8FA 4EMGA 3NTIA 3L2VA 2P0KA 5GMKi 3X24B 1BIBA 3G6EA 3ER0A 2KY9A 4XAXB 1K9MU 2PQWA 4XTWA 4C5IA 5GAN3 1X01A 4E7JA 4XTYA 3CEYA 1Q86C 1Q81C 3CC4A 3QHSA 3DB3A 3HHTB 1KC8U 4C92B 2X4JA 2A3LA 4A4FA 1YJ9A 4E7LA 1D3BA 5LJ3d 3QSUA 5I21A 4OB2B 4A4HA 4BACA 1VQ4T 2CZ1B 2DD4A 3X28B 5GAOn 5CKBA 4XTZA 5GANf 2EJFA 4MZMA 5GANg 3GOXA 2VC8A 3OYLA 4X9CA 1K8AU 3CCST 3CCET 2A7YA 3ZBDA 3DKMA 4X34A 2F5KA 4J83A 1W4SA 1QP3A 1V29B 2E6ZA 2ZGWA 4C8QC 3OB9A 5CKEA 5L8RE 4C8QD 1QVFS 1NPPA 1GXIE 3M59A 1P92A 2PVGB 3E1SA 3L2UA 3S3MA 2QQ9A 4OB1B 4C92C 4M7DE 1U1TA 3OQ5A 4C92D 2P0PA 1KQSA 1VQOA 1VQMA 3OYMA 3I55T 5LL6S 5CQYA 4L59A 4C5GA 1VQ6A 3BDUA 4RG8A 4C5EA 3JCMJ 3X25B 4BE0A 1WJRA 2ZPBB 1OZ3A 4XU2A 2JN0A 4TVRA 4C5HA 3OYNA 2CKKA 4LDUA 4MZPA 4II1A 3HRUA 1UB4A 4BY6B 4F7UA 5GAN7 1VQ5A 2QTXA 3L1AA 4M78E 4J7IA 5KE3A 3OYHA 1WQ7A 4N0AA 5GAN6 2WACA 3TREA 1ZQ1A 4RCCA 2QDYB 2RHIA 4HKEA 1X6OA 3UWNA 5DM7R 2QA4T 4Y28E 1VQLA 3F70A 5I2MA 2RHUA 4C8QG 2ZPEB 3OYCA 4C0DB 3PGGA 2LC4A 4RCBA 2EFIA 3CPWA 3JB9G 4M7DF 4BY6C 1QVGA 1M8VA 5CO7A 1S72A 3T9NA 3TEEA 3E9GA 4C92G 1I4K1 3WXMB 5FU6B 4RMOA 4PJOB 4BDZA 3FJPA 3GNGA 1YIJA 5DLOA 2XK0A 3CCUA 2Y90A 5CQXA 4PL6A 3ZEHA 3CCQT 4MDWA 2KDSA 3MP6A 1KHCA 1UGSB 2DO3A 3NFCA 3SD4A 1M90U 5GAOl 2DTIA 4M78F 4C0DC 3PNWC 3FRNA 3A8OB 2MI6A 5GAN5 3OYBA 4MMKA 1M90C 4QQ6A 2DD5A 2X4XA 2DTOA 1ZHIA 2QQAA 4BI8B 4EMHA 3CCJA 4XK8E 2L5QA 5A0DA 3WVDB 2PVOB 2ZPHB 2CZ7B 1FWZA 2BUDA 3E9FA 4M75F 4ELZC 1K9MC 2IVWA 5GAOp 3OS1A 1VQ4A 5DY9A 4GY5A 2DZCA 5GANe 4EPCA 3L42A 3PFSA 3OYKA 1KC8C 1VQKA 2R5MA 1QVPA 4OF1A 3BY7A 2H3JA 4KT0E 5FU7B 3CCEA 3CCSA 1NE8A 3CC2T 4A53A 4ELYC 2DAQA 2R58A 2Y4XA 3V7CA 1O9SA 4LD6A 2XKOC 3JCMP 2WSCE 1Q82C 2AHJB 1K73U 4XTVA 3CCRA 1Y71A 3CC7A 3CCVA 2DXTA 5IN1A 4F7UE 2E41A 3QO3A 2E1HA 4LDWA 1DJ7B 4QQGA 3G7ZA 2HNIA 3LWIA 2D0QB 4ZTJA 3KBGA 3HFNA 3I55A 2V8IA 2M1HA 1KQSS 2V8KA 3J81E 3QPHA 5LJ5h 2VXFA 3JRZA 5FU7C 5CAIA 2E6NA 2K2VA 2EYQA 3A8LB 1Q7YC 4A4GA 1XNIA 1KD1U 4PNOA 5CCAA 1NJIU 2LQ8A 3OS0A 3FEOA 3QYGB 5GMKe 3MP8A 1UGPB 4M7DD 3PMIA 2RA2A 2RI2A 3G71A 1SSFA 2EKOA 4PKCC 5A0GA 4LDYA 3HRTA 4PLLA 3M56A 1VQ7T 5HY6A 5GAN4 2DIQA 3CCLT 2YLCA 4O5VA 5CKFA 4B9XA 1UGQB 2QQSA 1I5LA 4XU1A 3JB9J 4M7AF 3PIPA 3OSVA 2L89A 4M75B 3RESA 4BE2A 1BI3A 1U1SA 4N4IA 3CBMA 5GAMd 3S3OA 4MDXA 2BIVA 1VQPA 4IURA 3JCMb 3FIFA 4BB7A 4C8QB 4M78C 4JLGA 3MEVA 2RI5A 4J8OA 4M78D 1HXDA 4P5NA 1BI1A 2D6FA 4NS5A 3CPWS 4IKFA 2E12A 4NL2A 3META 5GAN2 2M16A 4R55A 3OSSC 1QVGS 3RKYA 2DPPB 3OS2A 4IUVA 1KQ1A 3QG1A 5LJ5j 4M77F 4XQ3A 1XQHA 2O4XB 3QBYA 3R6OA 5LJ5e 3CCQA 5FRMA 4QQDA 4PJOE 4FIBA 3J7AF 4FU6A 1UEBA 4M75C 2RK1A 1H3ZA 3MO8A 4M75D 1VQKT 4OGCA 3PIOA 2LCCA 2MF2A 2XI9A 2BKDN 2HBPA 2HQXA 2LNVA 3EFRA 3JCMd 2LDMA 3OBWA 1KG1A 2LQKA 1B34B 1G3WA 1PSFA 4EMKC 2VGNA 2Y4YA 4BI3A 3CCRT 4BE1A 1N9RA 4PLIA 5LJ3h 2KAFA 4C92A 4CI0C 3CCVT 1VQ9A 3CC7T 4QVCA 3VU3C 3GLXA 5IAYA 2LX9A 3HSBA 3OMCA 3ME9A 3HPWA 4FSXA 4B9WA 2M9UA 3OYGA 4ZGDB 4XU3A 2YHTA 3SDZA 1BKBA 2VYTA 4LDVA 4E7HA 4M78G 4E7KA 1N9SA 1O75A 3SWNC 3RIRA 1YJNT 2KK4A 1M4ZA 3M4YA 5FRNA 2L3RA 1U8RA 4M7AB 3CC2A 1VIFA 1M1KU 2HAXA 1NPRA 3WVEB 3RUXA 3M4GA 1Y96B 1JB0E 3HFOA 3A8HB 3G71T 1JRIA 4QVDA 3BDLA 2ZPIB 3QJYA 2RJFA 2VUBA 2EQMA 4M75G 1N6AA 3VUBA 1RI0A 1N27A 3ZFJA 3CXCA 2I2LA 1AHJB 3H6ZA 2RHZA 4J6WA 4M77B 3V8KA 4C0ZA 5GMKm 2RJDA 5CVIA 1BIAA 5LJ3j 2ZZDA 1VQPT 1FX7A 2LCLA 3HL8A 5GMKl 5LJ3e 4M7AC 4M7AD 3TCJA 2E65A 3E19A 2RH2A 1YBYA 2VGMA 2FVUA 5J39A 5GANd 5LJ5f 2R5AA 2XIDA 5LJ5g 1VQ7A 2XDBA 1NJIC 3C12A 2LTOA 1N8RU 3CCLA 3HRSA 1HK9A 4LDXA 5A0LA 2RHXA 3PMTA 1VQNT 4M77C 3C4SA 4M77D 3X26B 3VYHB 2LT4A 4XU0A 1G3TA 1IREB 2EQUA 3M58A 2GFUA 3M55A 5KH6A 4JRQA 4A4EA 2PUOB 4IUTA 4PJOA 3UPUA 1VQ9T 3UDCA 2HD0A 4OB0B 3RKWA 2DXBA 2QXFA 3P8HA 3QJ6A 3URGA 2MMPA 3V7RA 2EJ9A 3VKIA 2P4TA 4BI4A 4C92E 1YCYA 3M5AA 4JDSA 4M7AG 3JCMQ 2EJGA 1UGRB 4KULA 4JS4A 3GIBA 3RMSA 3MEUA 3JSCA 2B8AA 3SFMA 4A4KA 3QZ9B 4QW2A 1M1GA 2VV5A 1K8AC 1Y07A 4M7DB 2IG0A 2JUFA 3EFSA 5HKCA 4HA8A 4IUQA 4D6WA 2FYKA 4M77G 3FLGA 2D9TA 2OTJA 2CZ6B 3VJPA 4YTLA 2DK3A 4RG2A 3PT9A 3NTHA 2RM4A 2RI3A 1QP2A 5C0MA 5HK0A 5LJ3f 1YJNA 3LWHA 3QKJA 3QYHB 5LJ3g 4LD9K 3MP1A 4M78B 2KSSA 3OYYA 4ZN1A 3DLLA 2GF7A 1JJ2A 4Y91A 3JB9F 4X9DA 3KXTA 3FC3A 2V8JA 5CKDA 2JTFA 4FL6A 3CMEA 3MCAB 3S3NA 4M7DC 5GAOq 3JCMf 1M9SA 4JUVA 1M1KC 3JCMg 1NZ9A 4GLKA 4HCZA 3MHXA 4ME7A 4BD3A 1QW1A 2GCXA 3CBOA 3CMAT 2CYZB 2LT1A 3CPFA 4L6V5 3V8JA 1VQ8A 5I2SA 3J80E 4Z02A 3CXCS 4N4HA 1W2BA 4F7UF 3M57A 2F69A 2RO0A 3OS5A 5CR2A 2M0OA 3TU4K 2NLUA 3X20B 4FM4B 4IUPA 4EMKB 3I56T 4ZN3A 2PVDB 3Q1JA 4OMFB 3LW5E 3LGLA 4HCBA 3GP8A 2JOYA 5GAMh 4M75A 3CD6T 1WGSA 2RJEA 2ZPGB 1VQNA 3BW1A 1D3BB 2GQVA 3JCMW 4BUGA 2LVMA 3SWNB 2MWOA 4C8QA 2YLBA 4KUIA 2MAMA 3S6WA 1FXXA 2RK2A 2VXEA 1N8RC 4M7DG 3V7SA 5CIUA 4EMKA 4HT9A 3BFMA 3FB9A 4J6YA 3JCMc 4OB3B 3QXEB 4Q5WA 2O4XA 3OMGA 4OP0A 5FROA 3VV0A 4BDYA 1YHQT 3LYIA 3JCMV 5CK9A 1OI1A 4E47A 2K5IA 3L2WA 4J6XA 2OTJT 4XTXA 2CS7A 5FLXE 3L2RA 2XDDA 3JCMX 1PSEA 4ZGJB 3SWNA 3JCMh 4KUDK 2QI2A 2X4YA 3OYJA 4V2SA 2G3RA 2E5QA 3KUFA 1YJWA 3MEWA 1B34A 3ASKA 2YRVA 1Q82U 2C06A 3G4ST 3QUIA 3RMQA 3GPLA 2XU8A 4PJOF 3CMET 4WF2A 5GAMj 3LGFA 4C0GA 2K5FA 4F7UB 5GAMe 2HQEA 4KBMB 3CBPA 1WJSA 3JB9D 2CZ0B 3P8DA 2CGHA 1VUBA 4DA4A 4DOWA 3GF5A 2L8DA 5EG2A 1K73C 3OW2A 1VIEA 1RL2A 4R56A 3LLRA 3LX7A 1VQ8T 2KMTA 3VUZA 1Q7YU 3SB2A 2DEQA 2JVVA 2XG8D 2QQRA 3INZA 1OZ2A 4M7AA 1BI0A 2PU9B 4O6JA 4NL3A 2MWPA 3L2QA 2QEXA 3GNFB 1Y96A 5GAOr 1MHNA 1YI2T 2RJCA 3JB9H 2RD1A 2E70A 2EWNA 2K5LA 1BYMA 4EDUA 1IZ6A 5KCHA 2RB6A 4JJNK 2ZPFB 1M1FA 3L2ZA 5AYFA 1JJ2S 3A8GB 2DKGA 3JCMe 1KD1C 4N0AC 1BI2A 3VYGA 4M77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKF A;  4ME7 A;  4HKE A;  2VUB A;  3VUB A;  5HKC A;  1VUB A;  4MDX A;  3G7Z A;  5CKH A;  4VUB A;  2KMT A;  5CR2 A;  5CK9 A;  3HPW A;  5CQY A;  5CO7 A;  3JRZ A;  4ELZ C;  3TCJ A;  5HK0 A;  5CCA A;  4MZT A;  5CKB A;  4MZP A;  5DLO A;  1UB4 A;  4MZM A;  4OF1 A;  5CQX A;  1M1F A;  1NE8 A;  2C06 A;  5CKD A;  4ELY C;  1X75 C;  2MF2 A;  3NFC A;  3JSC A;  5HK3 A;  5CKE A; 
#chains in the Genus database with same CATH topology
 4E7I A;  3PE0 A;  1UDL A;  2OTL A;  1Q81 U;  3NPF A;  2F5T X;  3AT1 B;  4HCC A;  4FT4 A;  2XD0 A;  2EKH A;  3A5Z B;  2W0Z A;  3SHW A;  1Q82 R;  3CD6 A;  5KYN A;  1JXM A;  4F7U G;  2EQK A;  5GAM f;  2RF0 A;  1LPL A;  2NUP A;  5C6S A;  5CKH A;  2DIL A;  3TSW A;  2K4Y A;  2DVE A;  2RQU A;  1QCN A;  2KQW A;  3OYE A;  3N5B B;  2E64 A;  3QDR B;  4PJM A;  2FB7 A;  2MIO A;  3H8Z A;  2CP6 A;  3G4S A;  1JBM A;  2LMJ A;  3CD6 Q;  4C92 F;  5IT9 E;  2XHC A;  1KQ2 A;  3HP9 A;  3IQL A;  4J9H A;  1LNX A;  4OVA A;  3M9Q A;  5D6X A;  4JRP A;  2FEI A;  4E7S A;  1WNL A;  3EAE A;  1CKB A;  3OYD A;  2OAU A;  4J5Y A;  1SRL A;  2YXY A;  1LOJ A;  3U23 A;  1ZBX A;  2XMF A;  1YI2 A;  2CUB A;  2PUK B;  1RAE B;  4DEY A;  5GMK j;  2MK5 A;  4MML A;  3CCU T;  3HKS A;  1EX4 A;  2QA4 A;  2DTH A;  3CME Q;  3M0U A;  1I8F A;  1SRM A;  5GMK i;  3X24 B;  3VS2 A;  2ESW A;  2LJ3 A;  2KY9 A;  1OQK A;  2YDL A;  4XTW A;  5GAN 3;  4XTY A;  1VQ8 Q;  2KRS A;  3HHT B;  4C92 B;  2J05 A;  4E7L A;  3QSU A;  4BAC A;  2CZ1 B;  1BCO A;  1YI2 Q;  2EJF A;  2PZ1 A;  1GCQ C;  1IGU A;  3PVL A;  3OYL A;  4X9C A;  2DVJ A;  2P4R A;  3OB9 A;  5L8R E;  4C8Q C;  1QVF S;  4PJN A;  3M59 A;  1WA7 A;  2PVG B;  5KYW B;  4OB1 B;  1RAH B;  4JJD A;  1V76 A;  2P0P A;  4PK4 A;  4C5G A;  4L59 A;  2F2W A;  3X25 B;  1GCP A;  1OZ3 A;  4XU2 A;  4C5H A;  1MUZ A;  2HKN A;  2FZK B;  4II1 A;  3L1A A;  3VRZ A;  4N0A A;  2WAC A;  1QCF A;  1ZQ1 A;  1IO6 A;  1OUL A;  2F2V A;  1RLQ C;  5DM7 R;  1E6H A;  2KXD A;  1TOV A;  2D8H A;  2ZPE B;  3UF4 A;  1K9M R;  4C0D B;  3CPW A;  1QVG A;  2J6O A;  1I4K 1;  2KRM A;  5FU6 B;  4RMO A;  5IXB A;  1EFN A;  3CCU A;  2XK0 A;  1NLO C;  5CQX A;  1KHC A;  3SD4 A;  2E3H A;  2DTI A;  1X6G A;  3A8O B;  2MI6 A;  3OYB A;  4MMK A;  1M90 C;  4BI8 B;  2PTK A;  2L5Q A;  2QGF B;  2ZPH B;  2BUD A;  3E9F A;  4M75 F;  1RAD B;  2IVW A;  4J9B A;  5DY9 A;  4GY5 A;  2DE0 X;  5GAN e;  4EPC A;  1VQK A;  2R5M A;  3BY7 A;  2BZ8 A;  5FU7 B;  3CC2 T;  4CC2 A;  4LD6 A;  2XKO C;  3JCM P;  1KJW A;  1Q82 C;  1K73 U;  4XTV A;  3CCV A;  1WHG A;  1AWO A;  2E41 A;  2E1H A;  1DJ7 B;  3LWI A;  2YUQ A;  3VS1 A;  2V8I A;  2AT1 B;  5LJ5 h;  5CAI A;  8AT1 B;  2E6N A;  2JJ9 A;  4RTU A;  1XNI A;  1NYG A;  2LQ8 A;  2E3I A;  5A0G A;  4PLL A;  4Z8A A;  3EG3 A;  2EYZ A;  3CCL T;  4LE9 A;  1T3S A;  2DET A;  2KRO A;  1I5L A;  4M75 B;  2L89 A;  2EYX A;  2O9V A;  2O31 A;  4N4I A;  5GAM d;  4MDX A;  1VQP A;  1B3Q A;  1OOT A;  1WHL A;  2HL3 A;  2RI5 A;  1HXD A;  1UUE A;  4IKF A;  2E12 A;  2CH4 A;  4NL2 A;  5GAN 2;  3OS2 A;  4IUV A;  2EVR A;  3QG1 A;  4XQ3 A;  3H0I A;  5FRM A;  4QQD A;  3J7A F;  2EYY A;  1H3Z A;  4OGC A;  3PIO A;  2BKD N;  2LNV A;  5IXF A;  1VOM A;  3OBW A;  1KG1 A;  1PSF A;  1N9R A;  4AFU C;  3VU3 C;  3OMC A;  3OYG A;  2YRC A;  4ZGD B;  1WFW A;  1BKB A;  2VYT A;  4E7H A;  1N9S A;  3EG9 A;  3CC2 A;  4KH0 B;  1VIF A;  1YJ9 Q;  1M1K U;  3RUX A;  2VVK A;  1Y96 B;  2BTT A;  2K3B A;  4GLM A;  2RJF A;  2I2L A;  3H6Z A;  4X1V A;  2RJD A;  1J3T A;  5CVI A;  5LJ3 j;  4RTX A;  2LCL A;  2KR3 A;  3FJ5 A;  1YBY A;  1BB9 A;  4F16 A;  2FVU A;  1A0N B;  1QWF A;  2XID A;  5LJ5 g;  1OEB A;  1N8R U;  3CCL A;  4LDX A;  4AG1 C;  2Z0W A;  4HVU A;  2QDL A;  4QKU A;  3R6N A;  2KBT A;  1F1B B;  1M3B A;  1M2O A;  3M58 A;  2CT3 A;  3UPU A;  1FYN A;  3UDC A;  1ZX6 A;  2HD0 A;  3EG0 A;  4OB0 B;  3RKW A;  2E5K A;  2QXF A;  3UA6 A;  3URG A;  3VKI A;  2EJ9 A;  3CXC P;  4BI4 A;  1UGR B;  4KUL A;  3A1P A;  1YIJ Q;  3JSC A;  3SFM A;  3PVQ A;  3CCL Q;  2VV5 A;  2DER A;  3H0H A;  4D6W A;  6AT1 B;  2QAS A;  2DK3 A;  4LUE A;  1K1Z A;  3PT9 A;  4IIO A;  1QP2 A;  3NGP A;  3QYH B;  4M78 B;  2KSS A;  2GF7 A;  4Y91 A;  2JS0 A;  3H41 A;  2RQT A;  2J6F A;  1G83 A;  5CKD A;  1ZUK A;  4CC3 A;  3JCM f;  3RNJ A;  4J9F A;  4F14 A;  1QQJ A;  4BD3 A;  3CMA T;  1SHF A;  3H0F A;  3J80 E;  2M0Y A;  4N4H A;  4F7U F;  3M57 A;  1YP5 A;  3TU4 K;  2ATC B;  3I56 T;  4ZN3 A;  3I55 Q;  4OMF B;  3LW5 E;  4HCB A;  1ARK A;  2JOY A;  1YFN A;  3I5S A;  1JO8 A;  4FSS A;  1GCQ A;  2RJE A;  3REB B;  2ZPG B;  1D3B B;  2GQV A;  3JCM W;  2FO0 A;  3SWN B;  2DBM A;  2MWO A;  4C8Q A;  2ROT A;  2YLB A;  1X69 A;  2RK2 A;  3VRY A;  1C1A A;  5CIU A;  4HT9 A;  3FB9 A;  4DBR A;  4J9E A;  3OMG A;  4OP0 A;  4E47 A;  2K5I A;  3L2W A;  2OTJ T;  4XTX A;  3SWN A;  4KUD K;  4PJJ A;  1VYT A;  4B6M A;  3ZL7 C;  4LNP A;  2G3R A;  3I5R A;  4KH1 B;  1YJW A;  1W2B P;  2G6F X;  2YRV A;  1Q82 U;  3O5Z A;  4F7U B;  2DF6 A;  3JB9 D;  2CZ0 B;  3GF5 A;  5EG2 A;  3LX7 A;  1YNZ A;  2JVV A;  4M7A A;  2PU9 B;  3L2Q A;  2QEX A;  2QAZ A;  2RJC A;  2RD1 A;  2E70 A;  2EWN A;  2AKL A;  5KCH A;  2RB6 A;  4J9C A;  4JJN K;  3A8G B;  1OV3 A;  4N0A C;  2O88 A;  4OB3 B;  3CCJ A;  3CMA A;  4M77 A;  2KVQ G;  2DMO A;  4DQ2 A;  1AT1 B;  5A2Q E;  3EGX B;  1Q86 U;  2LRQ A;  3G6E T;  5GAN h;  4XTU A;  3I56 A;  5KCO A;  1Y7X A;  1YIT A;  1ZSZ B;  2DXC A;  4ZGE B;  2DA9 A;  2X35 A;  4AT1 B;  3OYA A;  4J7F A;  1RAI B;  3EGX A;  2CDT A;  2EQJ A;  1QVF A;  2VB6 A;  2XIC A;  1AZG B;  4OGE A;  1AWX A;  3CMA Q;  1ZSZ A;  5D6Y A;  3FDR A;  4C0F A;  5FU6 C;  2AZS A;  5J3B A;  4QVZ A;  1TTH B;  2JXB A;  3I56 Q;  4J9G A;  4IUU A;  5EC7 A;  2WSF E;  2ZCF B;  4FYX B;  2JMC A;  3DLM A;  1N5Z A;  4M7D A;  2EW3 A;  3V8L A;  3LH0 A;  4KGZ B;  3MEA A;  1H64 1;  2VWF A;  3RKX A;  1G3Y A;  1OX9 A;  1CSK A;  3BE3 A;  1XTD A;  2OTL T;  5I22 A;  3KFV A;  2GGR A;  3JB9 I;  3C94 A;  2XDP A;  1G8X A;  3JAM E;  2OTJ Q;  2K57 A;  1G3S A;  4MZT A;  1W70 A;  4KRT A;  2CSI A;  3OYI A;  2OJ2 A;  1WQW A;  4NOY A;  3NTI A;  1T0J A;  1IHW A;  1BIB A;  3G6E A;  1JXO A;  3ER0 A;  1K9M U;  1SG5 A;  1GBR A;  2A3L A;  2DD4 A;  2CSQ A;  3EHQ A;  5GAN g;  3GOX A;  4LN2 A;  1S1N A;  3CCS T;  3CCE T;  1OX8 A;  2F5K A;  1TG0 A;  1W4S A;  1QP3 A;  2E6Z A;  4ESR A;  4C8Q D;  2DL5 A;  3E1S A;  2QQ9 A;  3OQ5 A;  3EFO A;  3VS0 A;  1JEG A;  5CQY A;  3JCM J;  2LJ0 A;  1NJI R;  2ZPB B;  3M0P A;  4BY6 B;  2COZ A;  1SKU B;  4J7I A;  5GAN 6;  1M90 R;  1H3H A;  4RCC A;  2HCK A;  2QA4 T;  4C8Q G;  3OYC A;  3I9Q A;  1KIK A;  4RCB A;  4CC4 B;  2KYM A;  2C0O A;  1M8V A;  1GBQ A;  1Y57 A;  3TEE A;  5FWB A;  2H3E B;  2H8H A;  4PJO B;  4BDZ A;  2ED1 A;  2RPN A;  3FJP A;  1PD1 A;  4PL6 A;  1K8A R;  1KQS P;  2KDS A;  2KT1 A;  2DO3 A;  3NFC A;  3RR6 A;  5GAO l;  1R0C B;  4DBH A;  2DD5 A;  2OTL Q;  1UTI A;  4OMM A;  4FYY B;  2BE7 D;  4F04 B;  3OS1 A;  2KYB A;  1ZUU A;  4F17 A;  1KC8 C;  1QVP A;  4OF1 A;  4KT0 E;  2H3J A;  3CCE A;  3CCS A;  3M0R A;  2Y4X A;  3V7C A;  3CC7 A;  1PC0 A;  5IN1 A;  4LDW A;  2X3W D;  1PWT A;  2D0Q B;  2M1H A;  1AWW A;  1D0X A;  2JM9 A;  1MMA A;  2EYQ A;  1MNE A;  4A4G A;  5CCA A;  1B07 A;  3EH2 A;  1GRI A;  3FEO A;  3QYG B;  4M7D D;  2RA2 A;  3G71 A;  1SSF A;  3CCS Q;  1IRX A;  3CCE Q;  1VQ7 T;  3QDF A;  3G4S Q;  4O5V A;  1PRM C;  4B9X A;  3TQ7 P;  1QKW A;  4XU1 A;  2DL8 A;  2FRY A;  3OSV A;  4PFP A;  3S3O A;  2YT6 A;  1AD5 A;  4IUR A;  4M78 C;  4JLG A;  4J8O A;  2P84 A;  2ABL A;  2LP5 A;  3RDV A;  3RKY A;  2EGC A;  1KQ1 A;  5LJ5 j;  2O4X B;  4OMQ A;  4FIB A;  2L3S A;  4RTY A;  4FU6 A;  1UEB A;  2RK1 A;  1VQK T;  2LCC A;  2XI9 A;  2LDM A;  1BCM A;  1G3W A;  2QA4 Q;  2VGN A;  2Y4Y A;  4BI3 A;  1NLP C;  4PLI A;  2KAF A;  4C92 A;  4CI0 C;  3CCV T;  1VQ9 A;  1RAC B;  3GLX A;  1PCX A;  3HSB A;  2M9U A;  7AT1 B;  4E7K A;  2YRD A;  1KD1 R;  1YJN T;  3SWN C;  3WVE B;  1PNJ A;  5KYW A;  5FW9 A;  1I0C A;  1JRI A;  3CQT A;  1LCK A;  3ZFJ A;  1N27 A;  1WHK A;  1AHJ B;  3V8K A;  1LVK A;  1TXQ A;  1WXU A;  2EGA A;  1VQP T;  3HL8 A;  5GMK l;  2HKQ B;  5LJ3 e;  4M7A C;  1K9A A;  1QMC A;  3TCJ A;  3E19 A;  2RH2 A;  4OMP A;  2JM8 A;  1K76 A;  1VQ7 A;  1NJI C;  2LTO A;  1VQN T;  3PMT A;  1E6G A;  4M77 C;  1CKA A;  4XU0 A;  1WI7 A;  1G3T A;  1IRE B;  2J7I A;  2V1Q A;  3M0T A;  4A4E A;  4IUT A;  1WIE A;  5GJV B;  5KYU B;  1D1A A;  1OU8 A;  3V7R A;  1M30 A;  4JDS A;  2CH4 W;  1I07 A;  4JS4 A;  3GBQ A;  3CCU Q;  2B8A A;  3QZ9 B;  2OAW A;  1K8A C;  3REA B;  1Y07 A;  2IG0 A;  2JUF A;  5HKC A;  1ZSZ C;  2BE9 B;  3FLG A;  1R0B G;  3VJP A;  4YTL A;  2RI3 A;  1QCO A;  1YJN A;  5LJ3 f;  4LD9 K;  5KYX B;  3MP1 A;  3OYY A;  3JB9 F;  2C0T A;  4FL6 A;  4M7D C;  3MCA B;  5GAO q;  1VQK Q;  1M9S A;  1M2V B;  4GLK A;  9ATC B;  4HCZ A;  3MHX A;  1QW1 A;  3CBO A;  4HCK A;  5D7U A;  2LT1 A;  1Q81 R;  4Z02 A;  3CXC S;  3CCV Q;  2RO0 A;  1FMW A;  3OS5 A;  5CR2 A;  4RTW A;  3VS7 A;  1IXD A;  2PVD B;  4LXC A;  1BU1 A;  3H9N A;  3GP8 A;  1MV3 A;  5GAM h;  4M75 A;  1VQN A;  3EGD B;  4J9I A;  2FPE A;  4BUG A;  2LVM A;  3A98 A;  4KUI A;  1TWB A;  2MAM A;  3S6W A;  3M0Q A;  1YWP A;  3BFM A;  4J6Y A;  3JCM c;  3QXE B;  4BDY A;  1YHQ T;  1VQP Q;  1OI1 A;  1YCS B;  3L2R A;  4J9D A;  2XDD A;  1PSE A;  2KEA A;  2IPO B;  2X4Y A;  3ASK A;  3EH1 A;  4KGX B;  1KK7 A;  2XU8 A;  2ED0 A;  4C0G A;  3MKD A;  1ZUY A;  2O9S A;  1K0S A;  1NEB A;  3UA7 A;  2ROL A;  4DOW A;  2BZX A;  4QT7 A;  4R56 A;  1RL2 A;  2KMT A;  3VUZ A;  2AIR B;  2DEQ A;  2XG8 D;  2NUT B;  4HXJ A;  1OZ2 A;  1BI0 A;  1MMD A;  4O6J A;  2MWP A;  3E2U A;  1Y96 A;  3GNF B;  1MHN A;  4WTO B;  2JTE A;  1IZ6 A;  4RTV A;  1NEG A;  2ZPF B;  1M1F A;  1WDX A;  3L2Z A;  5AYF A;  2DKG A;  3JCM e;  2I0N A;  1KD1 C;  3CC2 Q;  3C0C A;  3MEW A;  3FC3 A;  2FG0 A;  4JJC A;  1KFZ A;  2DJZ A;  4CRI A;  1WJQ A;  3ULR B;  2EYW A;  2FHD A;  2DXU A;  3OY9 A;  3NTK A;  3RER A;  1ABO A;  1PKS A;  1R77 A;  2D0N A;  4EIK A;  1W2B S;  5GJW B;  4C8Q E;  3A8M B;  4FT2 A;  3TVT A;  1TH7 A;  3CCM A;  2JNG A;  3DB4 A;  3OW2 P;  5GAO m;  3AHU A;  4JRK A;  1SPK A;  1SEM A;  1YJW T;  4N4G A;  4JRI A;  3P8B B;  5GAM g;  4DOV A;  4PJO C;  2K3X A;  2O01 E;  1YHQ A;  1Q7Y R;  1IGQ A;  1ZA2 B;  1MGQ A;  2CP0 A;  5M9O A;  3OA6 A;  5GAN j;  1U5S A;  2DZ9 A;  4C8Q F;  3QZ5 B;  4L5G A;  2QEX T;  2COY A;  1W1F A;  1G5V A;  1OYX A;  1VQ5 T;  3OBY A;  4M7A E;  4UC4 A;  5HCK A;  5I11 A;  5J26 A;  4JS5 A;  3M54 A;  4OMN A;  3CCJ T;  2EIF A;  2YSQ A;  1M27 C;  1VQL T;  3UT1 A;  3OYF A;  1AEY A;  4M78 A;  4M77 E;  1YHQ Q;  3UAT A;  2L2P A;  1SSH A;  1YIT T;  1PD0 A;  4HT8 A;  2JTM A;  1ZBJ A;  3QII A;  2LJ1 A;  2RHY A;  2QQB A;  5HK3 A;  2MYS A;  1M90 U;  2FL7 A;  1XOV A;  1M5Q 1;  1M3C A;  4RTZ A;  1JU5 C;  4XAX B;  4C5I A;  3CEY A;  1Q81 C;  3QHS A;  2X4J A;  4A4F A;  2LQW A;  1D3B A;  5LJ3 d;  3THK A;  1VQ4 T;  3X28 B;  5GAO n;  5CKB A;  4XTZ A;  1W6X A;  2VC8 A;  1K8A U;  1X43 A;  2A7Y A;  3ZBD A;  2HSP A;  4J83 A;  2DX1 A;  1V29 B;  2ZGW A;  1WHJ A;  2DRM A;  1GXI E;  3HTR A;  1P92 A;  3L2U A;  2FPF A;  3S3M A;  4C92 C;  4M7D E;  1IB8 A;  1U1T A;  2NWM A;  3OYM A;  5LL6 S;  3BDU A;  4BE0 A;  1WJR A;  2EPD A;  1HD3 A;  1UJ0 A;  1NG2 A;  2JN0 A;  8ATC B;  4MZP A;  2CKK A;  4LDU A;  4F7U A;  4AFQ C;  1UB4 A;  1VQ5 A;  1WHH A;  2RQR A;  3OYH A;  1WQ7 A;  1GFC A;  1YJW Q;  2M51 A;  1QWE A;  2QDY B;  2RHI A;  4HKE A;  3UWN A;  3VS4 A;  1VQL A;  2O2O A;  4Z88 A;  5I2M A;  1RAF B;  2LC4 A;  3QWY A;  3JB9 G;  4M7D F;  1KC8 R;  2LX7 A;  3E9G A;  2DEU A;  1U06 A;  3WXM B;  4D8K A;  4K11 A;  1QKX A;  2DM1 A;  5DLO A;  1TU0 B;  2QEX Q;  3ZEH A;  2V1R A;  1PG5 B;  4C0D C;  3PNW C;  3FRN A;  1X2K A;  3CCJ Q;  2F1L A;  4QQ6 A;  2X4X A;  4EMH A;  2QQA A;  4XK8 E;  2PVO B;  4ELZ C;  1VQ4 A;  2DZC A;  3L42 A;  3PFS A;  4OML A;  2SEM A;  3OYK A;  1MMN A;  1YIT Q;  1UG1 A;  4DBQ A;  1BK2 A;  1MV0 B;  1NE8 A;  4ELY C;  2R58 A;  1QVG P;  3EG1 A;  1O9S A;  2WSC E;  3CCR A;  1Y71 A;  3VS5 A;  4QQG A;  3G7Z A;  2HNI A;  3HFN A;  2CP2 A;  1KQS S;  3JRZ A;  5FU7 C;  2QK0 A;  2K2V A;  1UE9 A;  3RBB B;  1H8K A;  3A8L B;  1Q7Y C;  1KD1 U;  4PNO A;  3OS0 A;  2X51 A;  5GMK e;  3PMI A;  2RI2 A;  4PKC C;  3HRT A;  3M56 A;  5HY6 A;  1I5O B;  2DIQ A;  4AMC A;  2YLC A;  5CKF A;  1Z9Q A;  3RES A;  1BI3 A;  1U1S A;  5L23 A;  2BIV A;  1K4U S;  3JCM b;  4BB7 A;  2BZY A;  3MEV A;  4M78 D;  3NHN A;  1WXT A;  2D6F A;  1UHF A;  2DPP B;  1HYO A;  1UFF A;  1XQH A;  2QG9 B;  2QYZ A;  3QBY A;  3R6O A;  5LJ5 e;  4PJO E;  4M75 C;  3MO8 A;  2MF2 A;  4KGV B;  2HBP A;  3EFR A;  4ANJ A;  3JCM d;  1X2Q A;  1B34 B;  4BE1 A;  1ABQ A;  3CC7 T;  2COW A;  1GFD A;  4QVC A;  2K7A A;  3G6E Q;  5IAY A;  2LX9 A;  3ME9 A;  3HPW A;  1RLP C;  4XU3 A;  2YHT A;  3SDZ A;  2ECZ A;  4M78 G;  2DYB A;  5FRN A;  3M4Y A;  2L3R A;  1U8R A;  1NPR A;  2YWW A;  2JW4 A;  4IIM A;  1JB0 E;  2X9H A;  2KXC A;  3A8H B;  3G71 T;  2A37 A;  2VUB A;  1N6A A;  1K0X A;  4DEX A;  3CXC A;  3NMZ C;  2RHZ A;  4HVV A;  4C0Z A;  1BIA A;  4M7A D;  1X27 A;  2RNA A;  2K2M A;  2VGM A;  5LJ5 f;  2XDB A;  2KE9 A;  2HBW A;  1HK9 A;  3HRS A;  5A0L A;  4M77 D;  3X26 B;  1TUD A;  3VYH B;  2LT4 A;  4HVW A;  3M55 A;  4JRQ A;  2A36 A;  4JJB A;  2KGT A;  4PJO A;  1VQ9 T;  2D1X A;  2MPX C;  5IHI A;  2NUP B;  3QJ6 A;  2MMP A;  2P4T A;  1XJW B;  4C92 E;  1TUG B;  4Z89 A;  4M7A G;  1T3L A;  1ZA1 B;  2EJG A;  3GIB A;  1X6B A;  3MEU A;  2K6D A;  2HQH A;  2AKK A;  3EFS A;  1RAB B;  4IUQ A;  4M77 G;  2MOX A;  4RG2 A;  1M8M A;  4CC7 A;  5C0M A;  5HK0 A;  1MMG A;  3DLL A;  4X9D A;  3CME A;  1IHV A;  2V8J A;  4M4Z A;  2JTF A;  2AK5 A;  1M1K C;  3JCM g;  1WZO A;  1NZ9 A;  4ME7 A;  2DL7 A;  2GCX A;  2CP3 A;  2HEQ A;  2CYZ B;  3CPF A;  1Q86 R;  1ZSG A;  1VQ8 A;  2J06 A;  3CC7 Q;  1D09 B;  1W2B A;  2M0O A;  2NLU A;  2YUO A;  4FM4 B;  4EMK B;  1AVZ C;  3Q1J A;  1WX6 A;  3LGL A;  4AFZ C;  1D0Y A;  3G71 Q;  1N8R C;  2VXE A;  4M7D G;  3V7S A;  4EMK A;  1EZZ B;  2C0I A;  5IHN A;  2O4X A;  5FRO A;  2DL4 A;  3LYI A;  2GQI A;  4J6X A;  4LUD A;  4OMO A;  3JCM X;  2QI2 A;  5AT1 B;  3OYJ A;  2E5Q A;  4R0K A;  2C06 A;  1VYU A;  3QUI A;  3RMQ A;  4A63 B;  4WF2 A;  5GAM j;  3CBP A;  1WJS A;  2K79 A;  3P8D A;  2CGH A;  5KYY B;  4DA4 A;  2L8D A;  2JMA A;  2VKN A;  1VIE A;  3LLR A;  1Q7Y U;  3SB2 A;  2QQR A;  1VQ9 Q;  2OI3 A;  4NL3 A;  1AOJ A;  5GAO r;  1WLP B;  2K5L A;  1G2B A;  1BYM A;  4EDU A;  1JJ2 S;  5KYY A;  1PRL C;  2QGG A;  2FZC B;  2R57 A;  2OX7 A;  3C95 A;  5DLQ E;  4M75 E;  2CUD A;  2X4W A;  3CC4 T;  5KE2 A;  1C0M A;  2P0Q A;  5FWC A;  3PTA A;  2E10 A;  1I1J A;  1YJ9 T;  2CP5 A;  2DIG A;  2EAY A;  2GFA A;  4PFO A;  1FMK A;  1X75 C;  2IIM A;  2K3Y A;  1R8O B;  1VQ7 Q;  5D6W A;  1UJY A;  5KYU A;  5GAN 8;  2L3P A;  1WPY A;  4PJO D;  4ATO A;  4RKU E;  1VQO T;  1I81 A;  1VQM T;  4FYW B;  5GMK h;  1Q95 G;  4ZTF A;  1VQ6 T;  1WXB A;  1LJO A;  1EIF A;  5LJ5 d;  4AFS C;  1KHI A;  2B86 A;  1VYV A;  2HMA A;  2AZV A;  2A28 A;  2YUN A;  3O8V A;  5KYX A;  4VUB A;  3OW2 S;  1QVF P;  3M53 A;  2WSE E;  4PJO G;  1S72 T;  2DFU A;  4JLI A;  1M2V A;  3CCM T;  1YJN Q;  1YIJ T;  4A54 A;  2RQW A;  4EMG A;  1AWJ A;  2JZ2 A;  3L2V A;  4WCI A;  2P0K A;  1HJD A;  2J6K A;  1JJ2 P;  2K9G A;  2RN8 A;  2PQW A;  2FRW A;  1X01 A;  4E7J A;  1Q86 C;  3CC4 A;  3DB3 A;  1T0H A;  4ZNX A;  1KC8 U;  1YJ9 A;  3EGD A;  5I21 A;  1FMV A;  4OB2 B;  4A4H A;  5GAN f;  1UEC A;  4MZM A;  1HSQ A;  2KT8 A;  2X3X D;  5IH2 A;  2EGE A;  3DKM A;  4X34 A;  3EG9 B;  5CKE A;  1VA7 A;  1VQN Q;  1JQQ A;  1NPP A;  2DJQ A;  2LZ6 B;  4C92 D;  1KQS A;  2GTJ A;  3VS3 A;  1VQO A;  1VQM A;  3I55 T;  1VQ6 A;  4RG8 A;  4C5E A;  3TSZ A;  3CC4 Q;  2E4H A;  4RTT A;  4TVR A;  3OYN A;  4DBF A;  1NYF A;  5ECA A;  3HRU A;  5GAN 7;  2QTX A;  2EQI A;  2DRK A;  4M78 E;  5KE3 A;  3JV3 A;  4E7Z A;  3TRE A;  1OPL A;  2LNH B;  1X6O A;  1E7O A;  4Y28 E;  2NUT A;  4JZ4 A;  3F70 A;  2RHU A;  4JPB W;  3PGG A;  1PHT A;  2EFI A;  4BY6 C;  1GL5 A;  3MJX A;  2FZG B;  5CO7 A;  1S72 A;  3T9N A;  4C92 G;  1VQO Q;  1VQM Q;  1NM7 A;  1VQ6 Q;  3EG2 A;  3GNG A;  1YIJ A;  2Y90 A;  2D8J A;  3CCQ T;  4MDW A;  1U3O A;  3MP6 A;  1UGS B;  2QTV A;  4M78 F;  5GAN 5;  3QWX X;  2DTO A;  1ZHI A;  2V26 A;  1ZLM A;  2A08 A;  5A0D A;  3WVD B;  2CZ7 B;  1FWZ A;  2GBQ A;  1K9M C;  5IHK A;  5GAO p;  1S72 Q;  1RI9 A;  3CCM Q;  2CRE A;  4A53 A;  2DAQ A;  3SEM A;  2M02 A;  2AHJ B;  2DNU A;  2DXT A;  4F7U E;  2NYS A;  3QO3 A;  4ZTJ A;  3KBG A;  3I55 A;  2V8K A;  3J81 E;  3QPH A;  2VXF A;  4PJL A;  1NJI U;  3MP8 A;  1UGP B;  1OPK A;  1KSW A;  2EKO A;  4LDY A;  5GAN 4;  3D7S B;  1UGQ B;  2QQS A;  1D0Z A;  3JB9 J;  4M7A F;  3PIP A;  4BE2 A;  2W10 A;  3CBM A;  1RAG B;  3VS6 A;  3FIF A;  4C8Q B;  3G1J A;  4P5N A;  1BI1 A;  4NS5 A;  3CPW S;  4R55 A;  3MET A;  2HL5 C;  2M16 A;  3OSS C;  1QVG S;  2MCN A;  1TUC A;  4M77 F;  3CCQ A;  1UGV A;  4M75 D;  1M3A A;  2KI7 A;  1Y0M A;  2F2X A;  2HQX A;  1K73 R;  2CT4 A;  2LQK A;  1TSF A;  4E6R A;  4EMK C;  3CCR T;  5LJ3 h;  1WYX A;  4FCY A;  2YUP A;  4FYV B;  2RMO A;  1YWO A;  4FSX A;  4B9W A;  4Y92 A;  2DL3 A;  4LDV A;  1O75 A;  3RIR A;  2KK4 A;  1M4Z A;  4GBQ A;  4M7A B;  3M0S A;  2HAX A;  4FW2 A;  2NUZ A;  3CCQ Q;  2L3Q A;  2RQV A;  3M4G A;  3HFO A;  2HSE B;  4QVD A;  3BDL A;  2ZPI B;  3QJY A;  1RUW A;  2EQM A;  4M75 G;  2A0F B;  3VUB A;  1RI0 A;  1V1C A;  1PKT A;  4J6W A;  4M77 B;  5GMK m;  2PNI A;  2ZZD A;  4AG2 C;  1FX7 A;  2ENM A;  2E65 A;  3I35 A;  5J39 A;  5GAN d;  2R5A A;  3LH5 A;  3C12 A;  2RHX A;  1VQ5 Q;  1MND A;  2CP7 A;  2L0A A;  3C4S A;  1ACM B;  2EBP A;  1H92 A;  4JZ3 A;  2EQU A;  2GFU A;  5KH6 A;  1C6V X;  1WHM A;  2PUO B;  1VQL Q;  1RAA B;  4ORZ A;  2DXB A;  3P8H A;  1AZE A;  1YCY A;  3M5A A;  1TS9 A;  1M1K R;  3JCM Q;  2LCS A;  1QLY A;  1YN8 A;  3RMS A;  3CPW P;  4FW1 A;  1UHC A;  4A4K A;  2SRC A;  4QW2 A;  1M1G A;  4M7D B;  4HA8 A;  4PFZ A;  2LQN A;  2FYK A;  2D9T A;  2OTJ A;  2CZ6 B;  3MPU B;  3NTH A;  2RM4 A;  3LWH A;  2GTO A;  3QKJ A;  5LJ3 g;  2JS2 A;  4ZN1 A;  1JJ2 A;  1VQ4 Q;  3KXT A;  3S3N A;  1N8R R;  4JUV A;  1SHG A;  2FPD A;  3V8J A;  3EGU A;  4L6V 5;  5I2S A;  3CCR Q;  1B7T A;  2F69 A;  1SF9 A;  2JT4 A;  2KRN A;  3X20 B;  4IUP A;  2KNB B;  4E2F B;  4D8D A;  2HZY A;  1Z9Z A;  2DYI A;  3CD6 T;  1WGS A;  3BW1 A;  1D1C A;  1NBE B;  1FXX A;  1OU9 A;  2VAS A;  1PM3 A;  1BBZ A;  4Q5W A;  3VV0 A;  3JCM V;  5CK9 A;  2CS7 A;  5FLX E;  3EFO B;  4ZGJ B;  3JCM h;  4V2S A;  3KUF A;  1B34 A;  3G4S T;  3GPL A;  2DLP A;  2HDA A;  4PJO F;  3CME T;  3LGF A;  2K5F A;  5GAM e;  2HQE A;  4KBM B;  1D1B A;  2ZAE A;  1VUB A;  1K73 C;  3OW2 A;  2GNC A;  1VQ8 T;  3INZ A;  2DBK A;  1YI2 T;  3JB9 H;  3EHR A;  4RUG A;  1BI2 A;  3VYG A; 
#chains in the Genus database with same CATH homology
 4E7I A;  2R57 A;  2KVQ G;  4DQ2 A;  2DJZ A;  2OTL A;  4CRI A;  1WJQ A;  3C95 A;  5DLQ E;  5A2Q E;  1Q86 U;  1Q81 U;  2LRQ A;  2FHD A;  2DXU A;  4M75 E;  2F5T X;  3G6E T;  3OY9 A;  4HCC A;  2X4W A;  3NTK A;  3RER A;  5GAN h;  4XTU A;  4FT4 A;  3I56 A;  1W2B S;  2XD0 A;  4C8Q E;  5KCO A;  1Y7X A;  3A8M B;  4FT2 A;  1YIT A;  3CC4 T;  2DXC A;  4ZGE B;  5KE2 A;  3A5Z B;  1TH7 A;  2P0Q A;  3CCM A;  3PTA A;  2E10 A;  2JNG A;  1YJ9 T;  2X35 A;  3DB4 A;  3CD6 A;  3OYA A;  2DIG A;  4J7F A;  5GAO m;  4JRK A;  2EAY A;  2GFA A;  3AHU A;  1X75 C;  2K3Y A;  1YJW T;  2EQJ A;  1QVF A;  1R8O B;  4F7U G;  2XIC A;  4OGE A;  4N4G A;  5D6W A;  2EQK A;  5GAM f;  4JRI A;  3P8B B;  5GAM g;  4DOV A;  5GAN 8;  5D6Y A;  5C6S A;  5CKH A;  3FDR A;  1WPY A;  5FU6 C;  4C0F A;  4PJO C;  2K3X A;  2O01 E;  1YHQ A;  4PJO D;  5J3B A;  2K4Y A;  1MGQ A;  4ATO A;  5M9O A;  4RKU E;  2DVE A;  4QVZ A;  1I81 A;  3OA6 A;  5GMK h;  1VQM T;  1VQO T;  2KQW A;  5GAN j;  3OYE A;  4ZTF A;  1VQ6 T;  2DZ9 A;  1LJO A;  3N5B B;  4IUU A;  2E64 A;  3QZ5 B;  4C8Q F;  2WSF E;  1EIF A;  2ZCF B;  3QDR B;  4L5G A;  2QEX T;  2FB7 A;  3H8Z A;  3G4S A;  3DLM A;  4M7D A;  1G5V A;  1JBM A;  1OYX A;  5LJ5 d;  1VQ5 T;  3OBY A;  4M7A E;  4C92 F;  4UC4 A;  3V8L A;  5IT9 E;  2XHC A;  3LH0 A;  5J26 A;  4JS5 A;  1KQ2 A;  3HP9 A;  1H64 1;  1KHI A;  3MEA A;  3M54 A;  1LNX A;  3RKX A;  4OVA A;  3CCJ T;  1G3Y A;  3M9Q A;  2EIF A;  5D6X A;  4JRP A;  1XTD A;  1WNL A;  1VQL T;  3EAE A;  2OTL T;  3UT1 A;  3O8V A;  4VUB A;  3OYD A;  2OAU A;  4J5Y A;  3C94 A;  4M78 A;  3JB9 I;  3OYF A;  3M53 A;  3CMA A;  3OW2 S;  2XDP A;  4M77 E;  1LOJ A;  3JAM E;  1ZBX A;  1YI2 A;  2WSE E;  4PJO G;  2K57 A;  1S72 T;  1G3S A;  4JLI A;  2PUK B;  1YIT T;  4MZT A;  5GMK j;  3CCM T;  2JTM A;  4HT8 A;  4MML A;  1YIJ T;  3CCU T;  3HKS A;  3QII A;  4A54 A;  2RHY A;  2QQB A;  5HK3 A;  2QA4 A;  2DTH A;  3OYI A;  2FL7 A;  1XOV A;  1M5Q 1;  1WQW A;  4NOY A;  2JZ2 A;  1I8F A;  4EMG A;  3NTI A;  3L2V A;  2P0K A;  5GMK i;  3X24 B;  1BIB A;  3G6E A;  3ER0 A;  2KY9 A;  4XAX B;  1K9M U;  2PQW A;  4XTW A;  4C5I A;  5GAN 3;  1X01 A;  4E7J A;  4XTY A;  3CEY A;  1Q86 C;  1Q81 C;  3CC4 A;  3QHS A;  3DB3 A;  3HHT B;  1KC8 U;  4C92 B;  2X4J A;  2A3L A;  4A4F A;  1YJ9 A;  4E7L A;  1D3B A;  5LJ3 d;  3QSU A;  5I21 A;  4OB2 B;  4A4H A;  4BAC A;  1VQ4 T;  2CZ1 B;  2DD4 A;  3X28 B;  5GAO n;  5CKB A;  4XTZ A;  5GAN f;  2EJF A;  4MZM A;  5GAN g;  3GOX A;  2VC8 A;  3OYL A;  4X9C A;  1K8A U;  3CCS T;  3CCE T;  2A7Y A;  3ZBD A;  3DKM A;  4X34 A;  2F5K A;  4J83 A;  1W4S A;  1QP3 A;  1V29 B;  2E6Z A;  2ZGW A;  4C8Q C;  3OB9 A;  5CKE A;  5L8R E;  4C8Q D;  1QVF S;  1NPP A;  1GXI E;  3M59 A;  1P92 A;  2PVG B;  3E1S A;  3L2U A;  3S3M A;  2QQ9 A;  4OB1 B;  4C92 C;  4M7D E;  1U1T A;  3OQ5 A;  4C92 D;  2P0P A;  1KQS A;  1VQO A;  1VQM A;  3OYM A;  3I55 T;  5LL6 S;  5CQY A;  4L59 A;  4C5G A;  1VQ6 A;  3BDU A;  4RG8 A;  4C5E A;  3JCM J;  3X25 B;  4BE0 A;  1WJR A;  2ZPB B;  1OZ3 A;  4XU2 A;  2JN0 A;  4TVR A;  4C5H A;  3OYN A;  2CKK A;  4LDU A;  4MZP A;  4II1 A;  3HRU A;  1UB4 A;  4BY6 B;  4F7U A;  5GAN 7;  1VQ5 A;  2QTX A;  3L1A A;  4M78 E;  4J7I A;  5KE3 A;  3OYH A;  1WQ7 A;  4N0A A;  5GAN 6;  2WAC A;  3TRE A;  1ZQ1 A;  4RCC A;  2QDY B;  2RHI A;  4HKE A;  1X6O A;  3UWN A;  5DM7 R;  2QA4 T;  4Y28 E;  1VQL A;  3F70 A;  5I2M A;  2RHU A;  4C8Q G;  2ZPE B;  3OYC A;  4C0D B;  3PGG A;  2LC4 A;  4RCB A;  2EFI A;  3CPW A;  3JB9 G;  4M7D F;  4BY6 C;  1QVG A;  1M8V A;  5CO7 A;  1S72 A;  3T9N A;  3TEE A;  3E9G A;  4C92 G;  1I4K 1;  3WXM B;  5FU6 B;  4RMO A;  4PJO B;  4BDZ A;  3FJP A;  3GNG A;  1YIJ A;  5DLO A;  2XK0 A;  3CCU A;  2Y90 A;  5CQX A;  4PL6 A;  3ZEH A;  3CCQ T;  4MDW A;  2KDS A;  3MP6 A;  1KHC A;  1UGS B;  2DO3 A;  3NFC A;  3SD4 A;  1M90 U;  5GAO l;  2DTI A;  4M78 F;  4C0D C;  3PNW C;  3FRN A;  3A8O B;  2MI6 A;  5GAN 5;  3OYB A;  4MMK A;  1M90 C;  4QQ6 A;  2DD5 A;  2X4X A;  2DTO A;  1ZHI A;  2QQA A;  4BI8 B;  4EMH A;  3CCJ A;  4XK8 E;  2L5Q A;  5A0D A;  3WVD B;  2PVO B;  2ZPH B;  2CZ7 B;  1FWZ A;  2BUD A;  3E9F A;  4M75 F;  4ELZ C;  1K9M C;  2IVW A;  5GAO p;  3OS1 A;  1VQ4 A;  5DY9 A;  4GY5 A;  2DZC A;  5GAN e;  4EPC A;  3L42 A;  3PFS A;  3OYK A;  1KC8 C;  1VQK A;  2R5M A;  1QVP A;  4OF1 A;  3BY7 A;  2H3J A;  4KT0 E;  5FU7 B;  3CCE A;  3CCS A;  1NE8 A;  3CC2 T;  4A53 A;  4ELY C;  2DAQ A;  2R58 A;  2Y4X A;  3V7C A;  1O9S A;  4LD6 A;  2XKO C;  3JCM P;  2WSC E;  1Q82 C;  2AHJ B;  1K73 U;  4XTV A;  3CCR A;  1Y71 A;  3CC7 A;  3CCV A;  2DXT A;  5IN1 A;  4F7U E;  2E41 A;  3QO3 A;  2E1H A;  4LDW A;  1DJ7 B;  4QQG A;  3G7Z A;  2HNI A;  3LWI A;  2D0Q B;  4ZTJ A;  3KBG A;  3HFN A;  3I55 A;  2V8I A;  2M1H A;  1KQS S;  2V8K A;  3J81 E;  3QPH A;  5LJ5 h;  2VXF A;  3JRZ A;  5FU7 C;  5CAI A;  2E6N A;  2K2V A;  2EYQ A;  3A8L B;  1Q7Y C;  4A4G A;  1XNI A;  1KD1 U;  4PNO A;  5CCA A;  1NJI U;  2LQ8 A;  3OS0 A;  3FEO A;  3QYG B;  5GMK e;  3MP8 A;  1UGP B;  4M7D D;  3PMI A;  2RA2 A;  2RI2 A;  3G71 A;  1SSF A;  2EKO A;  4PKC C;  5A0G A;  4LDY A;  3HRT A;  4PLL A;  3M56 A;  1VQ7 T;  5HY6 A;  5GAN 4;  2DIQ A;  3CCL T;  2YLC A;  4O5V A;  5CKF A;  4B9X A;  1UGQ B;  2QQS A;  1I5L A;  4XU1 A;  3JB9 J;  4M7A F;  3PIP A;  3OSV A;  2L89 A;  4M75 B;  3RES A;  4BE2 A;  1BI3 A;  1U1S A;  4N4I A;  3CBM A;  5GAM d;  3S3O A;  4MDX A;  2BIV A;  1VQP A;  4IUR A;  3JCM b;  3FIF A;  4BB7 A;  4C8Q B;  4M78 C;  4JLG A;  3MEV A;  2RI5 A;  4J8O A;  4M78 D;  1HXD A;  4P5N A;  1BI1 A;  2D6F A;  4NS5 A;  3CPW S;  4IKF A;  2E12 A;  4NL2 A;  3MET A;  5GAN 2;  2M16 A;  4R55 A;  3OSS C;  1QVG S;  3RKY A;  2DPP B;  3OS2 A;  4IUV A;  1KQ1 A;  3QG1 A;  5LJ5 j;  4M77 F;  4XQ3 A;  1XQH A;  2O4X B;  3QBY A;  3R6O A;  5LJ5 e;  3CCQ A;  5FRM A;  4QQD A;  4PJO E;  4FIB A;  3J7A F;  4FU6 A;  1UEB A;  4M75 C;  2RK1 A;  1H3Z A;  3MO8 A;  4M75 D;  1VQK T;  4OGC A;  3PIO A;  2LCC A;  2MF2 A;  2XI9 A;  2BKD N;  2HBP A;  2HQX A;  2LNV A;  3EFR A;  3JCM d;  2LDM A;  3OBW A;  1KG1 A;  2LQK A;  1B34 B;  1G3W A;  1PSF A;  4EMK C;  2VGN A;  2Y4Y A;  4BI3 A;  3CCR T;  4BE1 A;  1N9R A;  4PLI A;  5LJ3 h;  2KAF A;  4C92 A;  4CI0 C;  3CCV T;  1VQ9 A;  3CC7 T;  4QVC A;  3VU3 C;  3GLX A;  5IAY A;  2LX9 A;  3HSB A;  3OMC A;  3ME9 A;  3HPW A;  4FSX A;  4B9W A;  2M9U A;  3OYG A;  4ZGD B;  4XU3 A;  2YHT A;  3SDZ A;  1BKB A;  2VYT A;  4LDV A;  4E7H A;  4M78 G;  4E7K A;  1N9S A;  1O75 A;  3SWN C;  3RIR A;  1YJN T;  2KK4 A;  1M4Z A;  3M4Y A;  5FRN A;  2L3R A;  1U8R A;  4M7A B;  3CC2 A;  1VIF A;  1M1K U;  2HAX A;  1NPR A;  3WVE B;  3RUX A;  3M4G A;  1Y96 B;  1JB0 E;  3HFO A;  3A8H B;  3G71 T;  1JRI A;  4QVD A;  3BDL A;  2ZPI B;  3QJY A;  2RJF A;  2VUB A;  2EQM A;  4M75 G;  1N6A A;  3VUB A;  1RI0 A;  1N27 A;  3ZFJ A;  3CXC A;  2I2L A;  1AHJ B;  3H6Z A;  2RHZ A;  4J6W A;  4M77 B;  3V8K A;  4C0Z A;  5GMK m;  2RJD A;  5CVI A;  1BIA A;  5LJ3 j;  2ZZD A;  1VQP T;  1FX7 A;  2LCL A;  3HL8 A;  5GMK l;  5LJ3 e;  4M7A C;  4M7A D;  3TCJ A;  2E65 A;  3E19 A;  2RH2 A;  1YBY A;  2VGM A;  2FVU A;  5J39 A;  5GAN d;  5LJ5 f;  2R5A A;  2XID A;  5LJ5 g;  1VQ7 A;  2XDB A;  1NJI C;  3C12 A;  2LTO A;  1N8R U;  3CCL A;  3HRS A;  1HK9 A;  4LDX A;  5A0L A;  2RHX A;  3PMT A;  1VQN T;  4M77 C;  3C4S A;  4M77 D;  3X26 B;  3VYH B;  2LT4 A;  4XU0 A;  1G3T A;  1IRE B;  2EQU A;  3M58 A;  2GFU A;  3M55 A;  5KH6 A;  4JRQ A;  4A4E A;  2PUO B;  4IUT A;  4PJO A;  3UPU A;  1VQ9 T;  3UDC A;  2HD0 A;  4OB0 B;  3RKW A;  2DXB A;  2QXF A;  3P8H A;  3QJ6 A;  3URG A;  2MMP A;  3V7R A;  2EJ9 A;  3VKI A;  2P4T A;  4BI4 A;  4C92 E;  1YCY A;  3M5A A;  4JDS A;  4M7A G;  3JCM Q;  2EJG A;  1UGR B;  4KUL A;  4JS4 A;  3GIB A;  3RMS A;  3MEU A;  3JSC A;  2B8A A;  3SFM A;  4A4K A;  3QZ9 B;  4QW2 A;  1M1G A;  2VV5 A;  1K8A C;  1Y07 A;  4M7D B;  2IG0 A;  2JUF A;  3EFS A;  5HKC A;  4HA8 A;  4IUQ A;  4D6W A;  2FYK A;  4M77 G;  3FLG A;  2D9T A;  2OTJ A;  2CZ6 B;  3VJP A;  4YTL A;  2DK3 A;  4RG2 A;  3PT9 A;  3NTH A;  2RM4 A;  2RI3 A;  1QP2 A;  5C0M A;  5HK0 A;  5LJ3 f;  1YJN A;  3LWH A;  3QKJ A;  3QYH B;  5LJ3 g;  4LD9 K;  3MP1 A;  4M78 B;  2KSS A;  3OYY A;  4ZN1 A;  3DLL A;  2GF7 A;  1JJ2 A;  4Y91 A;  3JB9 F;  4X9D A;  3KXT A;  3FC3 A;  2V8J A;  5CKD A;  2JTF A;  4FL6 A;  3CME A;  3MCA B;  3S3N A;  4M7D C;  5GAO q;  3JCM f;  1M9S A;  4JUV A;  1M1K C;  3JCM g;  1NZ9 A;  4GLK A;  4HCZ A;  3MHX A;  4ME7 A;  4BD3 A;  1QW1 A;  2GCX A;  3CBO A;  3CMA T;  2CYZ B;  2LT1 A;  3CPF A;  4L6V 5;  3V8J A;  1VQ8 A;  5I2S A;  3J80 E;  4Z02 A;  3CXC S;  4N4H A;  1W2B A;  4F7U F;  3M57 A;  2F69 A;  2RO0 A;  3OS5 A;  5CR2 A;  2M0O A;  3TU4 K;  2NLU A;  3X20 B;  4FM4 B;  4IUP A;  4EMK B;  3I56 T;  4ZN3 A;  2PVD B;  3Q1J A;  4OMF B;  3LW5 E;  3LGL A;  4HCB A;  3GP8 A;  2JOY A;  5GAM h;  4M75 A;  3CD6 T;  1WGS A;  2RJE A;  2ZPG B;  1VQN A;  3BW1 A;  1D3B B;  2GQV A;  3JCM W;  4BUG A;  2LVM A;  3SWN B;  2MWO A;  4C8Q A;  2YLB A;  4KUI A;  2MAM A;  3S6W A;  1FXX A;  2RK2 A;  2VXE A;  1N8R C;  4M7D G;  3V7S A;  5CIU A;  4EMK A;  4HT9 A;  3BFM A;  3FB9 A;  4J6Y A;  3JCM c;  4OB3 B;  3QXE B;  4Q5W A;  2O4X A;  3OMG A;  4OP0 A;  5FRO A;  3VV0 A;  4BDY A;  1YHQ T;  3LYI A;  3JCM V;  5CK9 A;  1OI1 A;  4E47 A;  2K5I A;  3L2W A;  4J6X A;  2OTJ T;  4XTX A;  2CS7 A;  5FLX E;  3L2R A;  2XDD A;  3JCM X;  1PSE A;  4ZGJ B;  3SWN A;  3JCM h;  4KUD K;  2QI2 A;  2X4Y A;  3OYJ A;  4V2S A;  2G3R A;  2E5Q A;  3KUF A;  1YJW A;  3MEW A;  1B34 A;  3ASK A;  2YRV A;  1Q82 U;  2C06 A;  3G4S T;  3QUI A;  3RMQ A;  3GPL A;  2XU8 A;  4PJO F;  3CME T;  4WF2 A;  5GAM j;  3LGF A;  4C0G A;  2K5F A;  4F7U B;  5GAM e;  2HQE A;  4KBM B;  3CBP A;  1WJS A;  3JB9 D;  2CZ0 B;  3P8D A;  2CGH A;  1VUB A;  4DA4 A;  4DOW A;  3GF5 A;  2L8D A;  5EG2 A;  1K73 C;  3OW2 A;  1VIE A;  1RL2 A;  4R56 A;  3LLR A;  3LX7 A;  1VQ8 T;  2KMT A;  3VUZ A;  1Q7Y U;  3SB2 A;  2DEQ A;  2JVV A;  2XG8 D;  2QQR A;  3INZ A;  1OZ2 A;  4M7A A;  1BI0 A;  2PU9 B;  4O6J A;  4NL3 A;  2MWP A;  3L2Q A;  2QEX A;  3GNF B;  1Y96 A;  5GAO r;  1MHN A;  1YI2 T;  2RJC A;  3JB9 H;  2RD1 A;  2E70 A;  2EWN A;  2K5L A;  1BYM A;  4EDU A;  1IZ6 A;  5KCH A;  2RB6 A;  4JJN K;  2ZPF B;  1M1F A;  3L2Z A;  5AYF A;  1JJ2 S;  3A8G B;  2DKG A;  3JCM e;  1KD1 C;  4N0A C;  1BI2 A;  3VYG A;  4M77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...