4MDXA

Crystal structure of bacillus subtilis mazf in complex with rna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
SMIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords mRNA interferase EndoA
publication title Structural Basis of mRNA Recognition and Cleavage by Toxin MazF and Its Regulation by Antitoxin MazE in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 37
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mdxA00
4ME7A 4MZMA 3NFCA 4OF1A 5CQYA 5HKCA 1M1FA 3TCJA 2VUBA 4ELZC 1X75C 4VUBA 5CKDA 4HKEA 1NE8A 5CO7A 5CR2A 5CCAA 1VUBA 1UB4A 5CK9A 2KMTA 3JSCA 4MDXA 5CQXA 3JRZA 5CKBA 3G7ZA 5CKHA 5DLOA 4MZPA 4ELYC 5CKEA 5CKFA 3HPWA 5HK0A 5HK3A 4MZTA 3VUBA 2C06A 2MF2A
chains in the Genus database with same CATH superfamily
2KT8A 4O5VA 1T0JA 2AIRB 1YWPA 1FX7A 2XICA 4UC4A 3OBWA 2KDSA 2DXCA 1KQSA 3JCMX 1KQ2A 2WSEE 2JTFA 2CH4W 3V8LA 1YHQT 2KNBB 2DL7A 2E12A 4NOYA 4R0KA 1VQPA 4BI8B 2KYMA 1W2BS 1RAGB 4AT1B 2C0IA 3GLXA 1K0SA 3ZL7C 2JT4A 1WHKA 3CCUT 3HFNA 4LDVA 5IAYA 1VQNA 3JCMQ 2RN8A 4HXJA 1AEYA 1BK2A 1UGSB 3OYCA 3OS5A 2GFUA 2BZXA 1G8XA 2CSQA 4P5NA 4F7UE 4WTOB 2DFUA 1TUDA 4PJMA 3X24B 2K3BA 1PNJA 2E6ZA 4E6RA 1X6BA 1MMAA 1NYFA 3CCQQ 3CCMA 2AHJB 1M27C 3RKWA 4M75C 2OTLQ 2NYSA 3RDVA 3RKXA 4N4HA 3OYIA 5DM7R 3CD6Q 3M4YA 4PJOB 4CRIA 1XNIA 4EMKA 1G2BA 2VUBA 1AWWA 5GAOm 1LVKA 3G4SA 3JB9F 3N5BB 3HFOA 1N8RC 1PSFA 5FU7C 5GAOl 2FRYA 3CPWS 1U5SA 2RK1A 5KYYA 3QJYA 1VQ9A 1YIJQ 1GCPA 2L3RA 3CCJQ 5GANe 4HA8A 4BB7A 1EFNA 3ULRB 2QA4Q 5LJ3d 4D8KA 4MZPA 4Z88A 8ATCB 3G71A 4OGCA 1VQOQ 5GAN7 3U23A 3CC7Q 4M7AG 2R5MA 1PSEA 2K3XA 1A0NB 3NMZC 4ZN1A 2D8JA 5GANd 2HEQA 2FO0A 3G6EQ 4E7LA 1TUCA 3PE0A 3BW1A 3CCLQ 2PZ1A 2JW4A 1N5ZA 2EBPA 2CUDA 2P4RA 3I55A 1YITQ 4HKEA 2KROA 1I8FA 1S72Q 1RLPC 3LWHA 2J6OA 5CQXA 2JS2A 3RNJA 1YJ9A 3S6WA 4F7UB 3M53A 3GPLA 2GNCA 1U1SA 4LDUA 3PTAA 3I56T 1BB9A 1VQKT 2VVKA 4IIOA 4LUEA 1LPLA 1AHJB 1UHFA 2FRWA 2ROLA 1RUWA 3RERA 3OW2S 3J81E 4LE9A 2X9HA 4J6XA 2DZ9A 3CCUQ 3BY7A 3CBPA 2R5AA 1M2VB 3EGXA 3LH5A 2JMAA 2QASA 3DKMA 1YJNQ 4HVUA 1E7OA 2DL4A 2XI9A 1N9SA 2ZZDA 2CP2A 2FPDA 5J26A 4PJOG 4HVWA 3RR6A 1YWOA 2DIQA 4C92B 2LVMA 1MV0B 2DJZA 1FMWA 3CMEA 3I5RA 1JEGA 2LJ1A 3A8GB 4QQDA 2K5IA 3OS1A 2P84A 2ZGWA 4QVCA 1MNDA 2QDYB 2PQWA 4BE2A 5FRMA 1T0HA 4QT7A 4J9FA 4QVZA 2XDDA 1Q86U 1PM3A 2LX7A 5M9OA 4AFZC 4DEXA 5FU6C 2P4TA 2LTOA 1CSKA 2ZPHB 3GOXA 2MAMA 1OU8A 1W2BP 4B9WA 2QQBA 3SDZA 1BI3A 1RAEB 3JCMV 3JCMd 2JJ9A 4N4IA 2A0FB 2CP5A 5L23A 2YRDA 5GAOr 4N0AC 3T9NA 4C0DB 2JMCA 1VQ8A 3CC2T 1WQ7A 5FLXE 2MMPA 2C0OA 2QQRA 3A1PA 1F1BB 4IUQA 3A8MB 1SEMA 2ZCFB 2EJ9A 2QEXA 1IRXA 2Y4XA 2ED0A 3BFMA 2OAUA 2EW3A 4J9GA 2DNUA 4XTVA 2YDLA 1MNEA 4A4EA 2CS7A 1GRIA 1GFCA 3OYLA 1ZSZB 4M4ZA 3PMIA 4O6JA 2YWWA 4LUDA 4LDWA 1UGQB 2L3QA 3E2UA 3UWNA 2J6KA 5D6YA 5GAN6 1OV3A 1JU5C 4AMCA 1PKTA 3VUBA 3EH1A 4X9CA 1BCMA 2CREA 2DILA 3JB9J 5LJ3g 1SRLA 4BI4A 3CEYA 2WACA 3C12A 3SWNA 1YJWA 3M4GA 5LJ5g 3MPUB 4BY6C 1VQ6A 4J6WA 4DOWA 3RKYA 1M3AA 5LJ3f 3CPWP 1ZA1B 2EVRA 4J9DA 1VOMA 1WJRA 1ZUUA 4L5GA 4Q5WA 5CIUA 3I56Q 5GANg 2RHUA 1WIEA 1UGRB 2JTMA 4M78A 5LJ5f 2WSFE 1VQKQ 1PRLC 2DERA 3O5ZA 4RTXA 4C92G 1IXDA 1OOTA 1ACMB 1YFNA 2RQTA 5DY9A 2X4JA 2O4XB 2KRSA 5CK9A 5GANf 2RI2A 3NTIA 2B86A 2DM1A 3FRNA 3LLRA 3NTKA 4RG2A 1X2KA 2VASA 1TOVA 3CQTA 4AG1C 4M7DA 3RMQA 2VKNA 4OMFB 4ELYC 2HDAA 3EFOA 4QKUA 3OSSC 5FWBA 2LC4A 4EDUA 2MF2A 5GAMj 1JB0E 1VA7A 1Y96A 4WF2A 3CCRQ 1MV3A 2DE0X 2EJFA 3JB9H 2C0TA 2XG8D 2BE9B 3ZBDA 2JNGA 3HTRA 3QZ9B 2XKOC 2M02A 3M57A 2XMFA 2YRVA 1BIBA 2DX1A 2KBTA 3TQ7P 1NJIU 1WHHA 1D09B 3OYBA 2BUDA 2RQVA 3GF5A 4X9DA 4M78D 3H9NA 3QIIA 4ESRA 2CP0A 3HHTB 2LDMA 1M3CA 1BI2A 4E7IA 4M75G 2R57A 4OVAA 3UA7A 2BTTA 1Q81R 2W10A 1X43A 3OW2P 1K8AR 3I5SA 2QXFA 4KGXB 2L0AA 2ZAEA 1MMDA 1XJWB 1UECA 3TCJA 1HD3A 4MMLA 3QUIA 3LYIA 3CC2Q 2ED1A 3TSZA 2X4YA 5J39A 1X69A 3MJXA 4F16A 2O9VA 5FRNA 3AT1B 1KC8U 1W2BA 2DTHA 4FYXB 2MWOA 3QO3A 3D7SB 1HK9A 3CXCA 1OPKA 1QVPA 3IQLA 1R77A 4J9BA 4M78F 4MMKA 5HY6A 2KXDA 2FZCB 2QTXA 2CH4A 4PFZA 2JVVA 2E41A 3CCST 4LDYA 3M0TA 4XTWA 3JCMg 5GMKh 3QZ5B 4C0FA 4EMHA 2FEIA 2OTLA 3VS1A 2KSSA 2AK5A 2MCNA 4EMKB 2QYZA 4M7DF 2EYXA 5D6XA 4OB1B 3CD6A 2V26A 3JCMf 1JBMA 1SG5A 1IGQA 5KYYB 2L2PA 2CP6A 5KYNA 2DTOA 2L3PA 3KBGA 4L59A 3JB9G 4ZGEB 1G83A 4KH0B 5FROA 1KJWA 1YIJA 4E7JA 1EZZB 3CCJA 1R0BG 5IN1A 4BE1A 3I9QA 3VUZA 1QMCA 2W0ZA 5GAOn 1G3WA 3HRUA 2COZA 3DLLA 1GCQA 2YUQA 3LGLA 2QDLA 1VQOA 3CC7A 2RB6A 3REAB 1AD5A 2DXTA 3SHWA 4OB0B 4IUPA 2F5TX 2O88A 4M77C 2JOYA 2AZSA 2COYA 2D0NA 4QQ6A 3G6EA 4A4FA 2ATCB 2DD5A 1NEBA 2LMJA 2RQRA 1QVFA 3DB4A 4C92F 4ZGDB 1WI7A 4TVRA 5LL6S 5CCAA 4XTXA 2KRNA 3S3MA 2FVUA 3C95A 3M0UA 5GMKe 2RHIA 4PJOE 1VQ7T 2K7AA 3EG0A 2X35A 3CC4A 3NGPA 3DLMA 4ME7A 1RI0A 2RPNA 4R55A 1K73C 1NPPA 3RUXA 1D1CA 1K73U 1YCYA 2DPPB 1Q81C 4PL6A 3EAEA 4GLMA 2PVOB 2EYYA 5LJ3h 4RTWA 2DMOA 5CKHA 3MO8A 1BI0A 3X20B 2X3XD 2HKQB 3CCUA 3CBOA 1M30A 2F2WA 2DJQA 5HK3A 5LJ5h 3P8BB 1NYGA 2EQUA 2LNHB 3C0CA 4LNPA 1YJNA 3M0RA 1X2QA 2E10A 2A3LA 2D8HA 4RTYA 5C0MA 5GANh 4FT2A 3OW2A 2RHZA 4M75F 2EYZA 4BI3A 2DIGA 4DOVA 1U3OA 2NUPB 3SFMA 3CXCS 4C0ZA 2KVQG 1UDLA 2NLUA 2YUPA 1K0XA 3CCSQ 2AKKA 1CKAA 2GF7A 3L2QA 1XQHA 1TWBA 2EQMA 4HCZA 3QXEB 2YLCA 2CP3A 4JUVA 1MUZA 1ZBXA 4LD9K 3TU4K 1V1CA 4LXCA 1JRIA 2DF6A 2RM4A 3QYHB 3C94A 1G3YA 2ZPGB 2DKGA 3HPWA 1ZUKA 3J7AF 3FLGA 1BIAA 1RACB 2DL3A 1HXDA 2OAWA 1B3QA 2NUZA 4KGVB 2BZ8A 3HRSA 5IH2A 2E3HA 1NEGA 3UA6A 3CCEA 2HMAA 9ATCB 3PGGA 4YTLA 4IKFA 2KYBA 2OI3A 1VQPT 1GCQC 1JJ2S 2EYQA 5LJ3e 1VQLT 2CKKA 1Q86R 4C8QA 4N0AA 3S3NA 5LJ5e 3OYKA 1VQNT 3L42A 1QKXA 4J9EA 1YP5A 1KG1A 4C92E 4OP0A 3EG2A 1SHFA 3RBBB 2J05A 4OMOA 2LQWA 1NBEB 4J83A 3SWNB 1W70A 5LJ5d 1WX6A 1QVFS 1X75C 1GL5A 4DBHA 5DLQE 3OYHA 3CCMT 1ZHIA 1V29B 3X28B 4M78B 3L2WA 4NL2A 1KD1R 1KQ1A 3TVTA 1KFZA 2PUKB 4ANJA 2LNVA 1RABB 3OMCA 3JCMh 1CKBA 3MP6A 1VQKA 4RCCA 2HL5C 1AWJA 1AVZC 1R8OB 3KXTA 3TEEA 1SKUB 3ER0A 4C8QD 4M7DB 3EFOB 1LJOA 1K76A 5CKBA 1VQ9T 1Y96B 2P0PA 3E9GA 4M75E 3JCMJ 2CZ0B 1BU1A 4LDXA 3PVLA 1UE9A 3G71T 2MYSA 3CCRA 1TG0A 4Y92A 1TUGB 2XD0A 5GMKm 2ZPFB 4JLGA 4PNOA 4KT0E 5D7UA 1YHQQ 2X51A 1EX4A 5GMKl 3NHNA 2FL7A 2KAFA 2ECZA 3H8ZA 3JSCA 1OPLA 2KI7A 2DVJA 3NPFA 1AWOA 5FW9A 2ESWA 1P92A 1W6XA 4XK8E 2RH2A 2LT1A 4C5GA 4QQGA 4JJNK 3SEMA 2QTVA 4DA4A 3I55T 5GJWB 2RJFA 4N4GA 1WJSA 2BZYA 1M8VA 1M1KU 3FIFA 2KGTA 2EQJA 4E47A 6AT1B 2HKNA 1VQMA 2K5LA 5HK0A 1YJ9T 4HCKA 3VS4A 1RAAB 3CCVT 3PFSA 2O9SA 1N9RA 4KUIA 4OGEA 1IHVA 3RMSA 3JCMe 2K3YA 2LX9A 5CO7A 3OMGA 1OU9A 1Q86C 2RHXA 3JCMP 1NJIR 4JLIA 2DZCA 3EFRA 2OTJT 3QDFA 4B9XA 1VQPQ 2L89A 3OYYA 1LOJA 2V8JA 2CZ1B 1VQLQ 1T3SA 2C06A 2MK5A 5GAOq 4Z89A 2X3WD 4M78G 1Q7YU 5EC7A 3MEUA 3HRTA 4C8QC 5IXBA 1V76A 3CXCP 1I4K1 2K79A 4JRKA 1Z9ZA 1VUBA 3VKIA 4A53A 4HVVA 3PIPA 4M7DG 3PT9A 3NFCA 3CMET 3REBB 1ZA2B 2MI6A 4JRQA 1KD1C 3RESA 1KC8R 4M75B 1KD1U 4M7AD 2FB7A 4JRIA 2JUFA 3EG1A 1TU0B 3VS5A 4NS5A 2HSEB 5A0GA 2EGEA 2GQIA 2OJ2A 4KRTA 1UGVA 3A8HB 2QAZA 2XDPA 2LQ8A 2EAYA 1ZUYA 2PU9B 2F69A 1Y71A 5FU7B 1ZX6A 4PFPA 2GQVA 2COWA 1G3SA 3MCAB 4XAXB 2Y4YA 1XOVA 2JN0A 2GBQA 2LT4A 5J3BA 1HSQA 4AG2C 3CBMA 1VQ9Q 2LP5A 1QWEA 1VQ8T 2H3JA 2Y90A 1U1TA 2DEQA 1QLYA 2K2MA 1VQ5A 1K9MU 2QEXT 1FYNA 3M0QA 4ELZC 1YI2A 3ASKA 4ATOA 3M56A 1YBYA 2J6FA 1E6GA 1N6AA 4DBQA 3OS2A 3M9QA 1QVFP 2D0QB 4M77A 1UTIA 2FPEA 4EIKA 1M9SA 2DL8A 2R58A 4RG8A 2LCSA 2JZ2A 5CKFA 1UHCA 3QJ6A 2DRKA 3VS2A 1R0CB 5C6SA 3QDRB 3OYFA 3EGDA 3VJPA 4ZTJA 1QKWA 3VS0A 4RTVA 2ZPBB 3CMAA 3PMTA 3TREA 5ECAA 2BE7D 1UB4A 2QQSA 4PJOD 4A4HA 4XU0A 1YJ9Q 1SF9A 1WHMA 3VS7A 3CCVQ 1M90U 3H0HA 1NJIC 4M7AC 1ZQ1A 4MZMA 2XDBA 1JXMA 2G6FX 2XIDA 3EG3A 1I5LA 4F7UA 1AZEA 2CZ6B 1M3BA 1C1AA 1JO8A 4FIBA 2E65A 2OTJQ 4IUVA 3OYMA 3C4SA 2GCXA 2FG0A 4C5HA 4JZ4A 4R56A 1MMGA 2K9GA 1M4ZA 1K73R 1N27A 5I22A 4M77D 3UATA 1K1ZA 1KHCA 1T3LA 2D1XA 3CCSA 3PNWC 2H3EB 2P0QA 1U06A 2HBPA 5LJ3j 1ZBJA 2E3IA 1SSFA 1M2VA 2XK0A 4E7SA 3UF4A 2O01E 1KC8C 3GNFB 2ZPEB 2DD4A 1WHJA 2HD0A 4K11A 4DBRA 2CDTA 1OX8A 3GBQA 2D9TA 7AT1B 5GANj 5HKCA 4IUTA 5KE2A 3L2VA 3CCQA 1YN8A 3MP8A 2HQXA 5GAN4 1NE8A 2M16A 4FYVB 5A2QE 5FU6B 2RA2A 5GJVB 2KMTA 2QG9B 1X27A 3M0PA 4M77F 1GBRA 2DVEA 3QPHA 4FT4A 1BCOA 3UDCA 2RJEA 1M2OA 4J7IA 3HKSA 5A0LA 2VB6A 2LCLA 1VQ4T 5KYXA 2DETA 1NG2A 1KK7A 3X26B 2DA9A 1Q82U 3GNGA 4PJOC 3MEVA 4C5EA 1VQ8Q 4BUGA 3L2RA 5FWCA 2HL3A 3OB9A 1MMNA 4PJJA 3H6ZA 4MDXA 2GFAA 2LRQA 1UFFA 3G1JA 2V1QA 2QA4A 1JJ2A 3HL8A 2QI2A 2EQIA 4CC3A 1G5VA 4FM4B 4JPBW 1H92A 4RTUA 3SD4A 1RI9A 3THKA 1W4SA 4L6V5 3J80E 5I21A 2VGMA 2AZVA 4J5YA 2DK3A 5L8RE 1OZ3A 2CZ7B 2RMOA 2P0KA 2PTKA 5I2SA 3WVDB 2QQ9A 1NM7A 1NPRA 2ENMA 5HCKA 4GLKA 5DLOA 1ZLMA 3L2UA 3WVEB 2JTEA 2BIVA 3CCLA 3CD6T 4Z02A 4BY6B 1WQWA 1YITA 2M9UA 2DO3A 2RJDA 1S72A 3P8HA 3E9FA 1D3BA 3L2ZA 4PLLA 1YIJT 5GAN3 4D6WA 4RKUE 4E7KA 1IO6A 3NTHA 4RCBA 1WHGA 4OMLA 2D6FA 5IHIA 4XTYA 2SEMA 2DL5A 1YHQA 4FSSA 3QWXX 1IGUA 1YNZA 1MHNA 2DAQA 4A54A 1B34A 1OEBA 3VV0A 1PRMC 3M0SA 3LH0A 1GFDA 3EGXB 2EWNA 2JM9A 4E2FB 3H0FA 1NLPC 1E6HA 1WPYA 4OB2B 2YUNA 4C8QG 2PVDB 1TH7A 4VUBA 5GAN2 2V8IA 3QKJA 4M78E 3BDLA 1DJ7B 3META 2RI3A 3WXMB 4XU2A 2MPXC 3V7SA 2RHYA 1GBQA 1JQQA 4OMMA 5KYUA 5A0DA 2LQNA 1WGSA 2HQEA 2CT4A 4C92C 4J9IA 1WDXA 2K5FA 3CC4T 4RTTA 2MIOA 2I0NA 2DRMA 4M7DE 3MHXA 2YSQA 5CKDA 2RI5A 2ABLA 5GAMe 1H8KA 2SRCA 3OYGA 1VQLA 4RTZA 1NZ9A 1VQ4Q 4MZTA 1ABOA 2CUBA 2WSCE 2KK4A 2CP7A 3HSBA 2YLBA 3BDUA 2JXBA 1M1KR 1YJNT 1QCOA 1BI1A 2AKLA 3JB9D 2YXYA 5GAMd 3DB3A 1VIFA 2A37A 2V8KA 4C0DC 4BDYA 4BE0A 1K4US 2KXCA 1WXTA 2VC8A 3AHUA 2EKHA 2RQWA 1WFWA 4J7FA 4RUGA 1X6OA 1PC0A 4V2SA 2L5QA 1ZSZC 1KHIA 1Q7YR 2QGGA 4AFUC 1QQJA 2J7IA 1RAHB 1RADB 3INZA 1Y0MA 4CC2A 3QSUA 2DLPA 4KULA 1QVGA 2VGNA 4F14A 3LW5E 1N8RU 4AFSC 2EKOA 2F2VA 5KE3A 5KYWA 3OBYA 1QW1A 2LQKA 2GTOA 1VQ7Q 3CCET 5IHKA 4DQ2A 3R6NA 1NLOC 1RAIB 4IIMA 3OYJA 3PIOA 4PFOA 3I56A 3EHQA 3E1SA 4XTUA 2RK2A 2E5QA 4KGZB 2PUOB 2FPFA 3FB9A 4M77B 2CYZB 3UT1A 3FC3A 3V7CA 4CI0C 4HT8A 2K4YA 2NUTA 3G4ST 1ZSGA 4FU6A 1K9AA 3JRZA 1OQKA 3EGDB 2HZYA 5KCHA 2X4XA 1WLPB 2EIFA 4J9CA 3OYAA 2ROTA 5GAN5 2IVWA 2QQAA 2PVGB 3FJPA 3M5AA 4OMQA 1B07A 1XTDA 1SPKA 1O9SA 5CAIA 3Q1JA 3LWIA 1TS9A 1IB8A 1BKBA 1K9MR 1FWZA 2O31A 2FZGB 1IHWA 3GIBA 1I5OB 1RL2A 4C0GA 1QCNA 3CCVA 3CC4Q 2VXFA 1W1FA 2BKDN 2KY9A 2RO0A 3VS6A 1WXBA 1M8MA 4C8QF 2LJ3A 2DEUA 1OYXA 1KIKA 1AT1B 4LD6A 1KQSS 2OTJA 2FHDA 2KEAA 1RAFB 1M1KC 1SHGA 1D0YA 2Z0WA 3VS3A 4E7ZA 3EG9A 3SB2A 2IG0A 4M7AA 4MDWA 1G3TA 5AYFA 3CC2A 4JZ3A 5I2MA 3CCRT 2M1HA 1PKSA 1M90R 4LN2A 4XQ3A 2KRMA 4E7HA 4BDZA 2K6DA 4ZN3A 2QK0A 3JV3A 3KUFA 4BACA 2E4HA 1FXXA 4A4KA 1Q7YC 1WHLA 3H0IA 1VQNQ 2NUPA 3ZFJA 1TXQA 1D1AA 2ZPIB 2HQHA 2E5KA 2EFIA 5GMKi 4ZNXA 2XU8A 2O2OA 4M77G 5KYXB 4HCCA 3A8LB 1VIEA 2CGHA 3L1AA 4CC7A 4II1A 5GAMg 2LJ0A 1X01A 4OMPA 1H3ZA 2EYWA 4EMKC 1VQMT 1Y7XA 1Y57A 1IZ6A 4JJDA 1OULA 3CCMQ 4KBMB 1WJQA 4JS4A 3CCEQ 1ABQA 4X34A 5GAMf 1QVGS 2L8DA 1C0MA 2EGCA 4BD3A 1WXUA 2AT1B 2MWPA 3VRZA 3V7RA 2HBWA 5CQYA 5GMKj 3F70A 1UG1A 1JJ2P 2LZ6B 4F7UG 1H641 4PJOA 2A36A 3G4SQ 3A8OB 1M1GA 1SSHA 1UGPB 2E64A 4FW2A 3GP8A 4AFQC 2JS0A 3X25B 2RF0A 1GXIE 4EPCA 5CVIA 1HJDA 4JDSA 4QW2A 1Q82R 3OYNA 2G3RA 1PHTA 1K9MC 1LCKA 2H8HA 3QYGB 3G71Q 4M7AF 1BYMA 1MGQA 1UEBA 1D3BB 3EGUA 1OI1A 2HCKA 2EJGA 2B8AA 3R6OA 4QVDA 2A7YA 3FJ5A 2GGRA 4C8QE 1Q95G 4JJCA 2VXEA 2DYBA 2CT3A 1BBZA 3LGFA 2F5KA 1D0ZA 1S1NA 2PNIA 5D6WA 5KH6A 4JRPA 1B34B 3E19A 2HAXA 3I55Q 1I0CA 4A63B 2KR3A 3UPUA 2KQWA 2QGFB 2JM8A 3OS0A 2I2LA 4NL3A 1YJWT 2FZKB 1VQ6T 4ZTFA 3H41A 1Y07A 1M90C 3QHSA 1AZGB 1EIFA 4ZGJB 2DBMA 3M54A 3A98A 2HSPA 3FEOA 5IT9E 3A5ZB 2MOXA 1M1FA 2DBKA 4Y28E 1VQ5T 4JJBA 1U8RA 2J06A 4GBQA 5AT1B 4OB3B 2KE9A 1PG5B 4EMGA 1YI2T 5KYUB 4FSXA 3O8VA 1FMVA 3BE3A 4KH1B 1YCSB 2DTIA 3JAME 2KT1A 1M5Q1 4FYYB 2K57A 1VYVA 1SRMA 4Z8AA 4HCBA 3QBYA 4OF1A 2K2VA 2RD1A 2CSIA 2E1HA 2DXBA 4GY5A 4PJOF 2HNIA 3I35A 3V8JA 3CMAT 1I1JA 4D8DA 1PD0A 3URGA 5LJ5j 3S3OA 1KQSP 3MP1A 2VWFA 3M55A 3PVQA 1VQ4A 1VQMQ 1C6VX 3CMEQ 1WNLA 2RQUA 3QWYA 5GAN8 4M7DD 4C92A 3M58A 1AOJA 3RIRA 1I07A 1OZ2A 2NWMA 3EH2A 1HYOA 4J9HA 3EFSA 2L3SA 4X1VA 4PKCC 4FYWB 1VYTA 5KCOA 1O75A 1TSFA 3FDRA 4C5IA 4C8QB 5GAOp 1JXOA 1PCXA 4IURA 4PLIA 1Z9QA 3JCMc 3OY9A 2GTJA 1QCFA 1Q82C 8AT1B 4M7AE 4PJLA 2M51A 2VYTA 1UJ0A 2F1LA 3MEAA 2EQKA 2RJCA 1WA7A 2QEXQ 2A08A 1X6GA 3JB9I 3OYEA 3VYHB 1I81A 3MEWA 3P8DA 3VYGA 1KSWA 5KYWB 4F7UF 1QWFA 1LNXA 1RLQC 3OSVA 2EGAA 3SWNC 4C92D 5EG2A 2YHTA 3CCQT 3V8KA 4XTZA 2YUOA 4PK4A 2YT6A 4F04B 4M75A 1D0XA 1D1BA 1UJYA 1VQ7A 2EPDA 2DXUA 1ZSZA 2OX7A 3M59A 1QVGP 2OTLT 1H3HA 4J6YA 2IPOB 1IREB 2F2XA 1VYUA 4M78C 3EHRA 4ORZA 1J3TA 5IHNA 2NUTB 1OX9A 1WYXA 3OYDA 4XU3A 5IXFA 2V1RA 3CPWA 5CR2A 5GAMh 4FL6A 1YJWQ 2XHCA 3KFVA 2X4WA 3VRYA 1VQ6Q 2YRCA 2M0OA 4IUUA 3ZEHA 4M7DC 4OMNA 4DBFA 4F17A 3CCJT 1VQ5Q 2QA4T 1N8RR 1QP3A 3MKDA 2M0YA 3OA6A 1VQOT 4KUDK 3CC7T 2E70A 1YI2Q 4HT9A 1PWTA 3LX7A 2RNAA 4PJNA 1B7TA 1QP2A 4M75D 1TTHB 2O4XA 4RMOA 2LCCA 1WZOA 2FYKA 3ME9A 2E6NA 2VV5A 3G6ET 1AWXA 4J8OA 3TSWA 4CC4B 4B6MA 2IIMA 3CCLT 1K8AC 4DEYA 1Q81U 3CMAQ 1FMKA 4WCIA 1K8AU 3HP9A 2DYIA 3QG1A 4FW1A 5I11A 4Y91A 4JS5A 3JCMW 3CPFA 4A4GA 1YITT 3VU3C 4FCYA 3EG9B 2A28A 3JCMb 1S72T 4M7AB 1UUEA 3G7ZA 4XU1A 1ARKA 5CKEA 1PD1A 3OQ5A 4M77E
chains in the Genus database with same CATH topology
5GAN5 2IVWA 2QQAA 4O5VA 4M78F 2PVGB 4MMKA 3FJPA 2PU9B 3M5AA 5HY6A 2F69A 1Y71A 5FU7B 2QTXA 1FX7A 2JVVA 1XTDA 2GQVA 2XICA 2KDSA 3OBWA 4UC4A 3MCAB 1G3SA 2E41A 1O9SA 3CCST 4XAXB 2DXCA 4LDYA 1KQSA 5CAIA 3JCMX 4XTWA 2Y4YA 1XOVA 3Q1JA 1KQ2A 2WSEE 2JN0A 2JTFA 3JCMg 5GMKh 3LWIA 2LT4A 3QZ5B 5J3BA 4C0FA 4EMHA 1BKBA 3V8LA 1YHQT 3CBMA 2OTLA 1FWZA 1VQ8T 2H3JA 2Y90A 2E12A 2KSSA 4NOYA 3GIBA 1VQPA 4BI8B 4EMKB 1W2BS 1U1TA 1RL2A 4C0GA 3CCVA 2DEQA 4M7DF 5D6XA 4OB1B 3CD6A 1VQ5A 2VXFA 3GLXA 3JCMf 1K9MU 2QEXT 1JBMA 2BKDN 2KY9A 2RO0A 3CCUT 3HFNA 4LDVA 5IAYA 1VQNA 3JCMQ 4C8QF 4ELZC 1YI2A 3ASKA 4ATOA 2DTOA 3KBGA 3M56A 4L59A 1YBYA 1OYXA 3JB9G 1UGSB 1N6AA 4LD6A 3OS5A 4ZGEB 3OS2A 2FHDA 3M9QA 3OYCA 2GFUA 5FROA 2OTJA 2D0QB 4F7UE 4P5NA 1YIJA 4M77A 4E7JA 3CCJA 1M1KC 5IN1A 4BE1A 1M9SA 3VUZA 2R58A 4RG8A 5GAOn 2JZ2A 1G3WA 3HRUA 5CKFA 3DLLA 3QJ6A 3LGLA 3X24B 3SB2A 2IG0A 3QDRB 5C6SA 3OYFA 3CC7A 2E6ZA 1VQOA 4M7AA 4MDWA 2RB6A 1G3TA 2DXTA 5AYFA 3VJPA 4ZTJA 2ZPBB 4OB0B 3CC2A 3CMAA 3CCMA 3PMTA 5I2MA 2AHJB 3TREA 3CCRT 4IUPA 1UB4A 2M1HA 3RKWA 2F5TX 2QQSA 4XQ3A 4M77C 4M75C 4E7HA 4PJOD 4BDZA 4A4HA 2JOYA 4ZN3A 4XU0A 4QQ6A 3G6EA 3RKXA 4N4HA 4A4FA 3OYIA 3KUFA 4BACA 5DM7R 1M90U 2DD5A 3M4YA 1NJIC 4M7AC 1ZQ1A 4MZMA 1FXXA 4A4KA 2XDBA 4PJOB 2XIDA 1XNIA 4CRIA 1Q7YC 4EMKA 1QVFA 1I5LA 3DB4A 4F7UA 4C92F 2CZ6B 2VUBA 4ZGDB 5GAOm 4TVRA 5LL6S 3ZFJA 3G4SA 3JB9F 3N5BB 4FIBA 3HFOA 5CCAA 1N8RC 1PSFA 5FU7C 2ZPIB 2E65A 5GAOl 4XTXA 4IUVA 2RK1A 3CPWS 2EFIA 5GMKi 3C4SA 3OYMA 3QJYA 2GCXA 3S3MA 1VQ9A 2XU8A 2FVUA 2L3RA 4C5HA 4M77G 4R56A 5GANe 4HA8A 4BB7A 1M4ZA 3C95A 5GMKe 1N27A 2RHIA 3A8LB 4HCCA 1VIEA 2CGHA 3L1AA 5LJ3d 1VQ7T 4PJOE 4M77D 4MZPA 2X35A 4II1A 5GAMg 1KHCA 1X01A 3CC4A 3G71A 4OGCA 3DLMA 4ME7A 1H3ZA 4EMKC 1RI0A 5GAN7 1VQMT 4R55A 3CCSA 1K73C 3PNWC 1NPPA 1Y7XA 4M7AG 3RUXA 2P0QA 1PSEA 1YCYA 2HBPA 2R5MA 1K73U 2DPPB 1Q81C 1IZ6A 2K3XA 5LJ3j 4PL6A 3EAEA 1SSFA 4KBMB 1WJQA 4JS4A 4ZN1A 4X34A 2XK0A 5GAMf 1QVGS 2PVOB 2L8DA 2O01E 5GANd 1KC8C 3GNFB 5LJ3h 5CKHA 2ZPEB 3MO8A 2DD4A 4BD3A 1BI0A 3X20B 3CCUA 2HD0A 4E7LA 3CBOA 5HK3A 5LJ5h 2MWPA 3P8BB 2D9TA 3BW1A 3V7RA 2EQUA 5GANj 5CQYA 5HKCA 5GMKj 3F70A 4IUTA 5KE2A 1YJNA 3L2VA 3CCQA 2E10A 4F7UG 1H641 2A3LA 3MP8A 3I55A 2HQXA 4HKEA 1NE8A 2M16A 5GAN4 4PJOA 3A8OB 5A2QE 5C0MA 1M1GA 5GANh 1I8FA 5FU6B 2RA2A 1UGPB 2E64A 3LWHA 3GP8A 4FT2A 3OW2A 2RHZA 2KMTA 3X25B 5CQXA 4M77F 4M75F 2DVEA 3QPHA 4FT4A 1GXIE 3UDCA 4EPCA 5CVIA 1YJ9A 4BI3A 3S6WA 4JDSA 2DIGA 4QW2A 4F7UB 4DOVA 3OYNA 2RJEA 4J7IA 2G3RA 3HKSA 3M53A 3SFMA 5A0LA 1K9MC 3QYGB 2LCLA 3CXCS 4LDUA 1U1SA 4C0ZA 3GPLA 2KVQG 3PTAA 1VQ4T 2NLUA 4M7AF 1BYMA 3I56T 1MGQA 1UEBA 3X26B 2GF7A 1D3BB 3L2QA 1XQHA 1Q82U 1VQKT 1OI1A 2EQMA 4HCZA 3GNGA 4PJOC 2EJGA 3QXEB 2B8AA 2YLCA 3MEVA 3R6OA 4JUVA 4C5EA 4QVDA 4BUGA 3L2RA 1ZBXA 2A7YA 4LD9K 3TU4K 3OB9A 1AHJB 4C8QE 3H6ZA 4MDXA 3RERA 2GFAA 1JRIA 2LRQA 3J81E 3OW2S 2RM4A 2QA4A 2VXEA 3QYHB 3C94A 1JJ2A 1G3YA 3HL8A 2ZPGB 2DKGA 2DZ9A 2QI2A 3BY7A 3HPWA 4J6XA 3LGFA 3CBPA 2F5KA 3J7AF 2R5AA 1G5VA 4FM4B 5D6WA 3FLGA 1BIAA 5KH6A 4JRPA 3DKMA 3SD4A 1B34B 1HXDA 1W4SA 3E19A 2XI9A 3HRSA 4L6V5 3J80E 2HAXA 5I21A 1N9SA 2VGMA 2ZZDA 4J5YA 2DK3A 5L8RE 5J26A 4PJOG 3UPUA 2KQWA 3CCEA 1OZ3A 2CZ7B 2P0KA 3OS0A 2I2LA 5I2SA 4NL3A 3PGGA 1YJWT 2DIQA 4YTLA 2QQ9A 1NPRA 3WVDB 4C92B 2LVMA 4IKFA 4GLKA 1VQ6T 2DJZA 5DLOA 3L2UA 4ZTFA 1Y07A 3CMEA 3QHSA 1EIFA 1M90C 1VQPT 1JJ2S 4ZGJB 2EYQA 3A8GB 3M54A 4QQDA 2K5IA 3WVEB 5LJ3e 3FEOA 2BIVA 5IT9E 1VQLT 3CCLA 3A5ZB 4Y28E 1M1FA 3OS1A 1VQ5T 2CKKA 3CD6T 4Z02A 4C8QA 4BY6B 1U8RA 4N0AA 3S3NA 5LJ5e 2ZGWA 1WQWA 4OB3B 4QVCA 2QDYB 3OYKA 2PQWA 4BE2A 1YITA 5FRMA 1VQNT 2M9UA 4QVZA 3L42A 1KG1A 4EMGA 4C92E 2DO3A 2RJDA 2XDDA 4FSXA 3O8VA 4OP0A 3P8HA 1YI2T 1S72A 3E9FA 1D3BA 3L2ZA 1Q86U 2DTIA 3JAME 4PLLA 5M9OA 1YIJT 1M5Q1 5GAN3 5FU6C 2K57A 4D6WA 2P4TA 2LTOA 4RKUE 4E7KA 3NTHA 2ZPHB 4RCBA 3GOXA 2MAMA 4HCBA 4B9WA 3QBYA 2QQBA 4J83A 3SDZA 3SWNB 1BI3A 4OF1A 3JCMV 3JCMd 2K2VA 2RD1A 4N4IA 5LJ5d 2D6FA 5GAOr 4N0AC 4XTYA 2E1HA 3T9NA 1QVFS 1X75C 4C0DB 2DXBA 1YHQA 4GY5A 4PJOF 2HNIA 5DLQE 3OYHA 1VQ8A 2DAQA 3CC2T 1MHNA 3V8JA 3CCMT 1WQ7A 4A54A 5FLXE 3CMAT 1ZHIA 1V29B 2MMPA 2QQRA 3X28B 1B34A 3URGA 5LJ5j 3S3OA 4M78B 3L2WA 4NL2A 4IUQA 3A8MB 3MP1A 3VV0A 3LH0A 2ZCFB 1KQ1A 2PUKB 3M55A 2EJ9A 2QEXA 2EWNA 1VQ4A 2Y4XA 3BFMA 2LNVA 3OMCA 3JCMh 2OAUA 1WNLA 5GAN8 3MP6A 1VQKA 4RCCA 4M7DD 1WPYA 4C92A 4XTVA 1M8VA 3M58A 4OB2B 1R8OB 3RIRA 4A4EA 2CS7A 4C8QG 2PVDB 3OYLA 3KXTA 1TH7A 4VUBA 3TEEA 2V8IA 5GAN2 3ER0A 3PMIA 3QKJA 4C8QD 4M78E 3BDLA 1OZ2A 4O6JA 4M7DB 1DJ7B 4LDWA 3META 1UGQB 2RI3A 3EFSA 4XU2A 1LJOA 3WXMB 4PKCC 1KQSS 3V7SA 5CKBA 2RHYA 3UWNA 5KCOA 1O75A 1VQ9T 1Y96B 3FDRA 2P0PA 3E9GA 5D6YA 4C5IA 4C8QB 5GAN6 5A0DA 5GAOp 4IURA 1WGSA 2HQEA 2CZ0B 4M75E 3VUBA 3JCMJ 4C92C 4PLIA 4X9CA 4LDXA 2K5FA 3JB9J 3JCMc 3CC4T 3OY9A 3G71T 5LJ3g 3CCRA 1Q82C 4M7DE 4BI4A 2XD0A 5GMKm 2ZPFB 3CEYA 3MHXA 5CKDA 2RI5A 2WACA 3C12A 4JLGA 4PNOA 3SWNA 4M7AE 4KT0E 1YJWA 3M4GA 5GMKl 5LJ5g 4BY6C 2FL7A 2KAFA 3H8ZA 1VQ6A 4J6WA 2VYTA 3JSCA 4DOWA 3RKYA 5GAMe 5LJ3f 3MEAA 3OYGA 2EQKA 1P92A 1WJRA 1VQLA 2RJCA 1NZ9A 4L5GA 4Q5WA 5CIUA 3HSBA 5GANg 4MZTA 2RHUA 1UGRB 5LJ5f 2WSCE 2JTMA 4M78A 3JB9I 3OYEA 2WSFE 2KK4A 3VYHB 4XK8E 2RH2A 1I81A 2LT1A 3MEWA 3P8DA 3VYGA 2YLBA 3BDUA 4C5GA 4QQGA 4C92G 4F7UF 4JJNK 1LNXA 1YJNT 3OSVA 4C92D 3SWNC 1BI1A 5EG2A 2YHTA 3CCQT 4DA4A 3V8KA 4XTZA 5DY9A 2X4JA 2O4XB 5CK9A 5GANf 2RI2A 3I55T 3JB9D 4M75A 5GAMd 3NTIA 3DB3A 2RJFA 3FRNA 1VIFA 2V8KA 2DXUA 1WJSA 4N4GA 4C0DC 3LLRA 4BDYA 3FIFA 4BE0A 1M1KU 3NTKA 2EQJA 3M59A 4RG2A 4E47A 2OTLT 4J6YA 4M7DA 3RMQA 4OMFB 4ELYC 1VQMA 1IREB 2K5LA 2VC8A 5HK0A 3OSSC 1YJ9T 2LC4A 4M78C 4EDUA 2MF2A 3AHUA 5GAMj 3CCVT 1JB0E 3PFSA 1N9RA 4KUIA 1Y96A 4OGEA 4WF2A 4J7FA 3RMSA 1X6OA 3JCMe 4XU3A 3OYDA 2EJFA 3JB9H 2K3YA 2LX9A 5CO7A 5CR2A 3OMGA 2XG8D 3CPWA 5GAMh 4FL6A 3ZBDA 2JNGA 2XHCA 3QZ9B 2XKOC 1Q86C 2RHXA 2X4WA 3JCMP 4V2SA 2L5QA 2M0OA 4IUUA 1KHIA 4JLIA 2DZCA 3EFRA 3ZEHA 2OTJT 3M57A 2YRVA 4B9XA 2L89A 1BIBA 3OYYA 4M7DC 1LOJA 2V8JA 2CZ1B 3CCJT 2QA4T 2C06A 5GAOq 1NJIU 1QP3A 1Q7YU 4M78G 3OYBA 2BUDA 3MEUA 3HRTA 4C8QC 3INZA 3GF5A 4X9DA 3OA6A 1VQOT 4KUDK 3CC7T 4M78D 2E70A 1I4K1 3QIIA 3QSUA 4HT9A 4KULA 4JRKA 3HHTB 1QVGA 2VGNA 1VUBA 3LW5E 3VKIA 1N8RU 2LDMA 2EKOA 4A53A 1BI2A 5KE3A 3LX7A 1QW1A 3OBYA 4E7IA 2LQKA 4M75G 3CCET 2R57A 4DQ2A 4OVAA 1QP2A 4M75D 2O4XA 4RMOA 3OYJA 2LCCA 3PIOA 2FYKA 3ME9A 2E6NA 3PIPA 4M7DG 2VV5A 2QXFA 3I56A 1VQ7A 3G6ET 4J8OA 3E1SA 4XTUA 2RK2A 3PT9A 3NFCA 3CMET 4JRQA 2E5QA 2MI6A 2PUOB 3FB9A 3TCJA 1KD1C 3RESA 3CCLT 4M77B 3QUIA 3LYIA 4M75B 4MMLA 1K8AC 1Q81U 1KD1U 2FB7A 4JRIA 4M7AD 2CYZB 1K8AU 2JUFA 3HP9A 3UT1A 3QG1A 2X4YA 4Y91A 5J39A 3FC3A 4JS5A 3JCMW 3V7CA 3CPFA 4CI0C 4A4GA 4HT8A 4NS5A 3VU3C 2K4YA 1YITT 5FRNA 5A0GA 3G4ST 3JCMb 1KC8U 4FU6A 3JRZA 1S72T 4M7AB 1W2BA 2DTHA 2MWOA 3G7ZA 4XU1A 3QO3A 3A8HB 5KCHA 1HK9A 3CXCA 2XDPA 1QVPA 2X4XA 5CKEA 2EIFA 2LQ8A 2EAYA 3OQ5A 3OYAA 4M77E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME7 A;  4MZM A;  3NFC A;  4OF1 A;  5CQY A;  5HKC A;  1M1F A;  3TCJ A;  2VUB A;  4ELZ C;  1X75 C;  4VUB A;  5CKD A;  4HKE A;  1NE8 A;  5CO7 A;  5CR2 A;  5CCA A;  1VUB A;  1UB4 A;  5CK9 A;  2KMT A;  3JSC A;  4MDX A;  5CQX A;  3JRZ A;  5CKB A;  3G7Z A;  5CKH A;  5DLO A;  4MZP A;  4ELY C;  5CKE A;  5CKF A;  3HPW A;  5HK0 A;  5HK3 A;  4MZT A;  3VUB A;  2C06 A;  2MF2 A; 
#chains in the Genus database with same CATH topology
 2KT8 A;  4O5V A;  1T0J A;  2AIR B;  1YWP A;  1FX7 A;  2XIC A;  4UC4 A;  3OBW A;  2KDS A;  2DXC A;  1KQS A;  3JCM X;  1KQ2 A;  2WSE E;  2JTF A;  2CH4 W;  3V8L A;  1YHQ T;  2KNB B;  2DL7 A;  2E12 A;  4NOY A;  4R0K A;  1VQP A;  4BI8 B;  2KYM A;  1W2B S;  1RAG B;  4AT1 B;  2C0I A;  3GLX A;  1K0S A;  3ZL7 C;  2JT4 A;  1WHK A;  3CCU T;  3HFN A;  4LDV A;  5IAY A;  1VQN A;  3JCM Q;  2RN8 A;  4HXJ A;  1AEY A;  1BK2 A;  1UGS B;  3OYC A;  3OS5 A;  2GFU A;  2BZX A;  1G8X A;  2CSQ A;  4P5N A;  4F7U E;  4WTO B;  2DFU A;  1TUD A;  4PJM A;  3X24 B;  2K3B A;  1PNJ A;  2E6Z A;  4E6R A;  1X6B A;  1MMA A;  1NYF A;  3CCQ Q;  3CCM A;  2AHJ B;  1M27 C;  3RKW A;  4M75 C;  2OTL Q;  2NYS A;  3RDV A;  3RKX A;  4N4H A;  3OYI A;  5DM7 R;  3CD6 Q;  3M4Y A;  4PJO B;  4CRI A;  1XNI A;  4EMK A;  1G2B A;  2VUB A;  1AWW A;  5GAO m;  1LVK A;  3G4S A;  3JB9 F;  3N5B B;  3HFO A;  1N8R C;  1PSF A;  5FU7 C;  5GAO l;  2FRY A;  3CPW S;  1U5S A;  2RK1 A;  5KYY A;  3QJY A;  1VQ9 A;  1YIJ Q;  1GCP A;  2L3R A;  3CCJ Q;  5GAN e;  4HA8 A;  4BB7 A;  1EFN A;  3ULR B;  2QA4 Q;  5LJ3 d;  4D8K A;  4MZP A;  4Z88 A;  8ATC B;  3G71 A;  4OGC A;  1VQO Q;  5GAN 7;  3U23 A;  3CC7 Q;  4M7A G;  2R5M A;  1PSE A;  2K3X A;  1A0N B;  3NMZ C;  4ZN1 A;  2D8J A;  5GAN d;  2HEQ A;  2FO0 A;  3G6E Q;  4E7L A;  1TUC A;  3PE0 A;  3BW1 A;  3CCL Q;  2PZ1 A;  2JW4 A;  1N5Z A;  2EBP A;  2CUD A;  2P4R A;  3I55 A;  1YIT Q;  4HKE A;  2KRO A;  1I8F A;  1S72 Q;  1RLP C;  3LWH A;  2J6O A;  5CQX A;  2JS2 A;  3RNJ A;  1YJ9 A;  3S6W A;  4F7U B;  3M53 A;  3GPL A;  2GNC A;  1U1S A;  4LDU A;  3PTA A;  3I56 T;  1BB9 A;  1VQK T;  2VVK A;  4IIO A;  4LUE A;  1LPL A;  1AHJ B;  1UHF A;  2FRW A;  2ROL A;  1RUW A;  3RER A;  3OW2 S;  3J81 E;  4LE9 A;  2X9H A;  4J6X A;  2DZ9 A;  3CCU Q;  3BY7 A;  3CBP A;  2R5A A;  1M2V B;  3EGX A;  3LH5 A;  2JMA A;  2QAS A;  3DKM A;  1YJN Q;  4HVU A;  1E7O A;  2DL4 A;  2XI9 A;  1N9S A;  2ZZD A;  2CP2 A;  2FPD A;  5J26 A;  4PJO G;  4HVW A;  3RR6 A;  1YWO A;  2DIQ A;  4C92 B;  2LVM A;  1MV0 B;  2DJZ A;  1FMW A;  3CME A;  3I5R A;  1JEG A;  2LJ1 A;  3A8G B;  4QQD A;  2K5I A;  3OS1 A;  2P84 A;  2ZGW A;  4QVC A;  1MND A;  2QDY B;  2PQW A;  4BE2 A;  5FRM A;  1T0H A;  4QT7 A;  4J9F A;  4QVZ A;  2XDD A;  1Q86 U;  1PM3 A;  2LX7 A;  5M9O A;  4AFZ C;  4DEX A;  5FU6 C;  2P4T A;  2LTO A;  1CSK A;  2ZPH B;  3GOX A;  2MAM A;  1OU8 A;  1W2B P;  4B9W A;  2QQB A;  3SDZ A;  1BI3 A;  1RAE B;  3JCM V;  3JCM d;  2JJ9 A;  4N4I A;  2A0F B;  2CP5 A;  5L23 A;  2YRD A;  5GAO r;  4N0A C;  3T9N A;  4C0D B;  2JMC A;  1VQ8 A;  3CC2 T;  1WQ7 A;  5FLX E;  2MMP A;  2C0O A;  2QQR A;  3A1P A;  1F1B B;  4IUQ A;  3A8M B;  1SEM A;  2ZCF B;  2EJ9 A;  2QEX A;  1IRX A;  2Y4X A;  2ED0 A;  3BFM A;  2OAU A;  2EW3 A;  4J9G A;  2DNU A;  4XTV A;  2YDL A;  1MNE A;  4A4E A;  2CS7 A;  1GRI A;  1GFC A;  3OYL A;  1ZSZ B;  4M4Z A;  3PMI A;  4O6J A;  2YWW A;  4LUD A;  4LDW A;  1UGQ B;  2L3Q A;  3E2U A;  3UWN A;  2J6K A;  5D6Y A;  5GAN 6;  1OV3 A;  1JU5 C;  4AMC A;  1PKT A;  3VUB A;  3EH1 A;  4X9C A;  1BCM A;  2CRE A;  2DIL A;  3JB9 J;  5LJ3 g;  1SRL A;  4BI4 A;  3CEY A;  2WAC A;  3C12 A;  3SWN A;  1YJW A;  3M4G A;  5LJ5 g;  3MPU B;  4BY6 C;  1VQ6 A;  4J6W A;  4DOW A;  3RKY A;  1M3A A;  5LJ3 f;  3CPW P;  1ZA1 B;  2EVR A;  4J9D A;  1VOM A;  1WJR A;  1ZUU A;  4L5G A;  4Q5W A;  5CIU A;  3I56 Q;  5GAN g;  2RHU A;  1WIE A;  1UGR B;  2JTM A;  4M78 A;  5LJ5 f;  2WSF E;  1VQK Q;  1PRL C;  2DER A;  3O5Z A;  4RTX A;  4C92 G;  1IXD A;  1OOT A;  1ACM B;  1YFN A;  2RQT A;  5DY9 A;  2X4J A;  2O4X B;  2KRS A;  5CK9 A;  5GAN f;  2RI2 A;  3NTI A;  2B86 A;  2DM1 A;  3FRN A;  3LLR A;  3NTK A;  4RG2 A;  1X2K A;  2VAS A;  1TOV A;  3CQT A;  4AG1 C;  4M7D A;  3RMQ A;  2VKN A;  4OMF B;  4ELY C;  2HDA A;  3EFO A;  4QKU A;  3OSS C;  5FWB A;  2LC4 A;  4EDU A;  2MF2 A;  5GAM j;  1JB0 E;  1VA7 A;  1Y96 A;  4WF2 A;  3CCR Q;  1MV3 A;  2DE0 X;  2EJF A;  3JB9 H;  2C0T A;  2XG8 D;  2BE9 B;  3ZBD A;  2JNG A;  3HTR A;  3QZ9 B;  2XKO C;  2M02 A;  3M57 A;  2XMF A;  2YRV A;  1BIB A;  2DX1 A;  2KBT A;  3TQ7 P;  1NJI U;  1WHH A;  1D09 B;  3OYB A;  2BUD A;  2RQV A;  3GF5 A;  4X9D A;  4M78 D;  3H9N A;  3QII A;  4ESR A;  2CP0 A;  3HHT B;  2LDM A;  1M3C A;  1BI2 A;  4E7I A;  4M75 G;  2R57 A;  4OVA A;  3UA7 A;  2BTT A;  1Q81 R;  2W10 A;  1X43 A;  3OW2 P;  1K8A R;  3I5S A;  2QXF A;  4KGX B;  2L0A A;  2ZAE A;  1MMD A;  1XJW B;  1UEC A;  3TCJ A;  1HD3 A;  4MML A;  3QUI A;  3LYI A;  3CC2 Q;  2ED1 A;  3TSZ A;  2X4Y A;  5J39 A;  1X69 A;  3MJX A;  4F16 A;  2O9V A;  5FRN A;  3AT1 B;  1KC8 U;  1W2B A;  2DTH A;  4FYX B;  2MWO A;  3QO3 A;  3D7S B;  1HK9 A;  3CXC A;  1OPK A;  1QVP A;  3IQL A;  1R77 A;  4J9B A;  4M78 F;  4MMK A;  5HY6 A;  2KXD A;  2FZC B;  2QTX A;  2CH4 A;  4PFZ A;  2JVV A;  2E41 A;  3CCS T;  4LDY A;  3M0T A;  4XTW A;  3JCM g;  5GMK h;  3QZ5 B;  4C0F A;  4EMH A;  2FEI A;  2OTL A;  3VS1 A;  2KSS A;  2AK5 A;  2MCN A;  4EMK B;  2QYZ A;  4M7D F;  2EYX A;  5D6X A;  4OB1 B;  3CD6 A;  2V26 A;  3JCM f;  1JBM A;  1SG5 A;  1IGQ A;  5KYY B;  2L2P A;  2CP6 A;  5KYN A;  2DTO A;  2L3P A;  3KBG A;  4L59 A;  3JB9 G;  4ZGE B;  1G83 A;  4KH0 B;  5FRO A;  1KJW A;  1YIJ A;  4E7J A;  1EZZ B;  3CCJ A;  1R0B G;  5IN1 A;  4BE1 A;  3I9Q A;  3VUZ A;  1QMC A;  2W0Z A;  5GAO n;  1G3W A;  3HRU A;  2COZ A;  3DLL A;  1GCQ A;  2YUQ A;  3LGL A;  2QDL A;  1VQO A;  3CC7 A;  2RB6 A;  3REA B;  1AD5 A;  2DXT A;  3SHW A;  4OB0 B;  4IUP A;  2F5T X;  2O88 A;  4M77 C;  2JOY A;  2AZS A;  2COY A;  2D0N A;  4QQ6 A;  3G6E A;  4A4F A;  2ATC B;  2DD5 A;  1NEB A;  2LMJ A;  2RQR A;  1QVF A;  3DB4 A;  4C92 F;  4ZGD B;  1WI7 A;  4TVR A;  5LL6 S;  5CCA A;  4XTX A;  2KRN A;  3S3M A;  2FVU A;  3C95 A;  3M0U A;  5GMK e;  2RHI A;  4PJO E;  1VQ7 T;  2K7A A;  3EG0 A;  2X35 A;  3CC4 A;  3NGP A;  3DLM A;  4ME7 A;  1RI0 A;  2RPN A;  4R55 A;  1K73 C;  1NPP A;  3RUX A;  1D1C A;  1K73 U;  1YCY A;  2DPP B;  1Q81 C;  4PL6 A;  3EAE A;  4GLM A;  2PVO B;  2EYY A;  5LJ3 h;  4RTW A;  2DMO A;  5CKH A;  3MO8 A;  1BI0 A;  3X20 B;  2X3X D;  2HKQ B;  3CCU A;  3CBO A;  1M30 A;  2F2W A;  2DJQ A;  5HK3 A;  5LJ5 h;  3P8B B;  1NYG A;  2EQU A;  2LNH B;  3C0C A;  4LNP A;  1YJN A;  3M0R A;  1X2Q A;  2E10 A;  2A3L A;  2D8H A;  4RTY A;  5C0M A;  5GAN h;  4FT2 A;  3OW2 A;  2RHZ A;  4M75 F;  2EYZ A;  4BI3 A;  2DIG A;  4DOV A;  1U3O A;  2NUP B;  3SFM A;  3CXC S;  4C0Z A;  2KVQ G;  1UDL A;  2NLU A;  2YUP A;  1K0X A;  3CCS Q;  2AKK A;  1CKA A;  2GF7 A;  3L2Q A;  1XQH A;  1TWB A;  2EQM A;  4HCZ A;  3QXE B;  2YLC A;  2CP3 A;  4JUV A;  1MUZ A;  1ZBX A;  4LD9 K;  3TU4 K;  1V1C A;  4LXC A;  1JRI A;  2DF6 A;  2RM4 A;  3QYH B;  3C94 A;  1G3Y A;  2ZPG B;  2DKG A;  3HPW A;  1ZUK A;  3J7A F;  3FLG A;  1BIA A;  1RAC B;  2DL3 A;  1HXD A;  2OAW A;  1B3Q A;  2NUZ A;  4KGV B;  2BZ8 A;  3HRS A;  5IH2 A;  2E3H A;  1NEG A;  3UA6 A;  3CCE A;  2HMA A;  9ATC B;  3PGG A;  4YTL A;  4IKF A;  2KYB A;  2OI3 A;  1VQP T;  1GCQ C;  1JJ2 S;  2EYQ A;  5LJ3 e;  1VQL T;  2CKK A;  1Q86 R;  4C8Q A;  4N0A A;  3S3N A;  5LJ5 e;  3OYK A;  1VQN T;  3L42 A;  1QKX A;  4J9E A;  1YP5 A;  1KG1 A;  4C92 E;  4OP0 A;  3EG2 A;  1SHF A;  3RBB B;  2J05 A;  4OMO A;  2LQW A;  1NBE B;  4J83 A;  3SWN B;  1W70 A;  5LJ5 d;  1WX6 A;  1QVF S;  1X75 C;  1GL5 A;  4DBH A;  5DLQ E;  3OYH A;  3CCM T;  1ZHI A;  1V29 B;  3X28 B;  4M78 B;  3L2W A;  4NL2 A;  1KD1 R;  1KQ1 A;  3TVT A;  1KFZ A;  2PUK B;  4ANJ A;  2LNV A;  1RAB B;  3OMC A;  3JCM h;  1CKB A;  3MP6 A;  1VQK A;  4RCC A;  2HL5 C;  1AWJ A;  1AVZ C;  1R8O B;  3KXT A;  3TEE A;  1SKU B;  3ER0 A;  4C8Q D;  4M7D B;  3EFO B;  1LJO A;  1K76 A;  5CKB A;  1VQ9 T;  1Y96 B;  2P0P A;  3E9G A;  4M75 E;  3JCM J;  2CZ0 B;  1BU1 A;  4LDX A;  3PVL A;  1UE9 A;  3G71 T;  2MYS A;  3CCR A;  1TG0 A;  4Y92 A;  1TUG B;  2XD0 A;  5GMK m;  2ZPF B;  4JLG A;  4PNO A;  4KT0 E;  5D7U A;  1YHQ Q;  2X51 A;  1EX4 A;  5GMK l;  3NHN A;  2FL7 A;  2KAF A;  2ECZ A;  3H8Z A;  3JSC A;  1OPL A;  2KI7 A;  2DVJ A;  3NPF A;  1AWO A;  5FW9 A;  2ESW A;  1P92 A;  1W6X A;  4XK8 E;  2RH2 A;  2LT1 A;  4C5G A;  4QQG A;  4JJN K;  3SEM A;  2QTV A;  4DA4 A;  3I55 T;  5GJW B;  2RJF A;  4N4G A;  1WJS A;  2BZY A;  1M8V A;  1M1K U;  3FIF A;  2KGT A;  2EQJ A;  4E47 A;  6AT1 B;  2HKN A;  1VQM A;  2K5L A;  5HK0 A;  1YJ9 T;  4HCK A;  3VS4 A;  1RAA B;  3CCV T;  3PFS A;  2O9S A;  1N9R A;  4KUI A;  4OGE A;  1IHV A;  3RMS A;  3JCM e;  2K3Y A;  2LX9 A;  5CO7 A;  3OMG A;  1OU9 A;  1Q86 C;  2RHX A;  3JCM P;  1NJI R;  4JLI A;  2DZC A;  3EFR A;  2OTJ T;  3QDF A;  4B9X A;  1VQP Q;  2L89 A;  3OYY A;  1LOJ A;  2V8J A;  2CZ1 B;  1VQL Q;  1T3S A;  2C06 A;  2MK5 A;  5GAO q;  4Z89 A;  2X3W D;  4M78 G;  1Q7Y U;  5EC7 A;  3MEU A;  3HRT A;  4C8Q C;  5IXB A;  1V76 A;  3CXC P;  1I4K 1;  2K79 A;  4JRK A;  1Z9Z A;  1VUB A;  3VKI A;  4A53 A;  4HVV A;  3PIP A;  4M7D G;  3PT9 A;  3NFC A;  3CME T;  3REB B;  1ZA2 B;  2MI6 A;  4JRQ A;  1KD1 C;  3RES A;  1KC8 R;  4M75 B;  1KD1 U;  4M7A D;  2FB7 A;  4JRI A;  2JUF A;  3EG1 A;  1TU0 B;  3VS5 A;  4NS5 A;  2HSE B;  5A0G A;  2EGE A;  2GQI A;  2OJ2 A;  4KRT A;  1UGV A;  3A8H B;  2QAZ A;  2XDP A;  2LQ8 A;  2EAY A;  1ZUY A;  2PU9 B;  2F69 A;  1Y71 A;  5FU7 B;  1ZX6 A;  4PFP A;  2GQV A;  2COW A;  1G3S A;  3MCA B;  4XAX B;  2Y4Y A;  1XOV A;  2JN0 A;  2GBQ A;  2LT4 A;  5J3B A;  1HSQ A;  4AG2 C;  3CBM A;  1VQ9 Q;  2LP5 A;  1QWE A;  1VQ8 T;  2H3J A;  2Y90 A;  1U1T A;  2DEQ A;  1QLY A;  2K2M A;  1VQ5 A;  1K9M U;  2QEX T;  1FYN A;  3M0Q A;  4ELZ C;  1YI2 A;  3ASK A;  4ATO A;  3M56 A;  1YBY A;  2J6F A;  1E6G A;  1N6A A;  4DBQ A;  3OS2 A;  3M9Q A;  1QVF P;  2D0Q B;  4M77 A;  1UTI A;  2FPE A;  4EIK A;  1M9S A;  2DL8 A;  2R58 A;  4RG8 A;  2LCS A;  2JZ2 A;  5CKF A;  1UHC A;  3QJ6 A;  2DRK A;  3VS2 A;  1R0C B;  5C6S A;  3QDR B;  3OYF A;  3EGD A;  3VJP A;  4ZTJ A;  1QKW A;  3VS0 A;  4RTV A;  2ZPB B;  3CMA A;  3PMT A;  3TRE A;  5ECA A;  2BE7 D;  1UB4 A;  2QQS A;  4PJO D;  4A4H A;  4XU0 A;  1YJ9 Q;  1SF9 A;  1WHM A;  3VS7 A;  3CCV Q;  1M90 U;  3H0H A;  1NJI C;  4M7A C;  1ZQ1 A;  4MZM A;  2XDB A;  1JXM A;  2G6F X;  2XID A;  3EG3 A;  1I5L A;  4F7U A;  1AZE A;  2CZ6 B;  1M3B A;  1C1A A;  1JO8 A;  4FIB A;  2E65 A;  2OTJ Q;  4IUV A;  3OYM A;  3C4S A;  2GCX A;  2FG0 A;  4C5H A;  4JZ4 A;  4R56 A;  1MMG A;  2K9G A;  1M4Z A;  1K73 R;  1N27 A;  5I22 A;  4M77 D;  3UAT A;  1K1Z A;  1KHC A;  1T3L A;  2D1X A;  3CCS A;  3PNW C;  2H3E B;  2P0Q A;  1U06 A;  2HBP A;  5LJ3 j;  1ZBJ A;  2E3I A;  1SSF A;  1M2V A;  2XK0 A;  4E7S A;  3UF4 A;  2O01 E;  1KC8 C;  3GNF B;  2ZPE B;  2DD4 A;  1WHJ A;  2HD0 A;  4K11 A;  4DBR A;  2CDT A;  1OX8 A;  3GBQ A;  2D9T A;  7AT1 B;  5GAN j;  5HKC A;  4IUT A;  5KE2 A;  3L2V A;  3CCQ A;  1YN8 A;  3MP8 A;  2HQX A;  5GAN 4;  1NE8 A;  2M16 A;  4FYV B;  5A2Q E;  5FU6 B;  2RA2 A;  5GJV B;  2KMT A;  2QG9 B;  1X27 A;  3M0P A;  4M77 F;  1GBR A;  2DVE A;  3QPH A;  4FT4 A;  1BCO A;  3UDC A;  2RJE A;  1M2O A;  4J7I A;  3HKS A;  5A0L A;  2VB6 A;  2LCL A;  1VQ4 T;  5KYX A;  2DET A;  1NG2 A;  1KK7 A;  3X26 B;  2DA9 A;  1Q82 U;  3GNG A;  4PJO C;  3MEV A;  4C5E A;  1VQ8 Q;  4BUG A;  3L2R A;  5FWC A;  2HL3 A;  3OB9 A;  1MMN A;  4PJJ A;  3H6Z A;  4MDX A;  2GFA A;  2LRQ A;  1UFF A;  3G1J A;  2V1Q A;  2QA4 A;  1JJ2 A;  3HL8 A;  2QI2 A;  2EQI A;  4CC3 A;  1G5V A;  4FM4 B;  4JPB W;  1H92 A;  4RTU A;  3SD4 A;  1RI9 A;  3THK A;  1W4S A;  4L6V 5;  3J80 E;  5I21 A;  2VGM A;  2AZV A;  4J5Y A;  2DK3 A;  5L8R E;  1OZ3 A;  2CZ7 B;  2RMO A;  2P0K A;  2PTK A;  5I2S A;  3WVD B;  2QQ9 A;  1NM7 A;  1NPR A;  2ENM A;  5HCK A;  4GLK A;  5DLO A;  1ZLM A;  3L2U A;  3WVE B;  2JTE A;  2BIV A;  3CCL A;  3CD6 T;  4Z02 A;  4BY6 B;  1WQW A;  1YIT A;  2M9U A;  2DO3 A;  2RJD A;  1S72 A;  3P8H A;  3E9F A;  1D3B A;  3L2Z A;  4PLL A;  1YIJ T;  5GAN 3;  4D6W A;  4RKU E;  4E7K A;  1IO6 A;  3NTH A;  4RCB A;  1WHG A;  4OML A;  2D6F A;  5IHI A;  4XTY A;  2SEM A;  2DL5 A;  1YHQ A;  4FSS A;  3QWX X;  1IGU A;  1YNZ A;  1MHN A;  2DAQ A;  4A54 A;  1B34 A;  1OEB A;  3VV0 A;  1PRM C;  3M0S A;  3LH0 A;  1GFD A;  3EGX B;  2EWN A;  2JM9 A;  4E2F B;  3H0F A;  1NLP C;  1E6H A;  1WPY A;  4OB2 B;  2YUN A;  4C8Q G;  2PVD B;  1TH7 A;  4VUB A;  5GAN 2;  2V8I A;  3QKJ A;  4M78 E;  3BDL A;  1DJ7 B;  3MET A;  2RI3 A;  3WXM B;  4XU2 A;  2MPX C;  3V7S A;  2RHY A;  1GBQ A;  1JQQ A;  4OMM A;  5KYU A;  5A0D A;  2LQN A;  1WGS A;  2HQE A;  2CT4 A;  4C92 C;  4J9I A;  1WDX A;  2K5F A;  3CC4 T;  4RTT A;  2MIO A;  2I0N A;  2DRM A;  4M7D E;  3MHX A;  2YSQ A;  5CKD A;  2RI5 A;  2ABL A;  5GAM e;  1H8K A;  2SRC A;  3OYG A;  1VQL A;  4RTZ A;  1NZ9 A;  1VQ4 Q;  4MZT A;  1ABO A;  2CUB A;  2WSC E;  2KK4 A;  2CP7 A;  3HSB A;  2YLB A;  3BDU A;  2JXB A;  1M1K R;  1YJN T;  1QCO A;  1BI1 A;  2AKL A;  3JB9 D;  2YXY A;  5GAM d;  3DB3 A;  1VIF A;  2A37 A;  2V8K A;  4C0D C;  4BDY A;  4BE0 A;  1K4U S;  2KXC A;  1WXT A;  2VC8 A;  3AHU A;  2EKH A;  2RQW A;  1WFW A;  4J7F A;  4RUG A;  1X6O A;  1PC0 A;  4V2S A;  2L5Q A;  1ZSZ C;  1KHI A;  1Q7Y R;  2QGG A;  4AFU C;  1QQJ A;  2J7I A;  1RAH B;  1RAD B;  3INZ A;  1Y0M A;  4CC2 A;  3QSU A;  2DLP A;  4KUL A;  1QVG A;  2VGN A;  4F14 A;  3LW5 E;  1N8R U;  4AFS C;  2EKO A;  2F2V A;  5KE3 A;  5KYW A;  3OBY A;  1QW1 A;  2LQK A;  2GTO A;  1VQ7 Q;  3CCE T;  5IHK A;  4DQ2 A;  3R6N A;  1NLO C;  1RAI B;  4IIM A;  3OYJ A;  3PIO A;  4PFO A;  3I56 A;  3EHQ A;  3E1S A;  4XTU A;  2RK2 A;  2E5Q A;  4KGZ B;  2PUO B;  2FPF A;  3FB9 A;  4M77 B;  2CYZ B;  3UT1 A;  3FC3 A;  3V7C A;  4CI0 C;  4HT8 A;  2K4Y A;  2NUT A;  3G4S T;  1ZSG A;  4FU6 A;  1K9A A;  3JRZ A;  1OQK A;  3EGD B;  2HZY A;  5KCH A;  2X4X A;  1WLP B;  2EIF A;  4J9C A;  3OYA A;  2ROT A;  5GAN 5;  2IVW A;  2QQA A;  2PVG B;  3FJP A;  3M5A A;  4OMQ A;  1B07 A;  1XTD A;  1SPK A;  1O9S A;  5CAI A;  3Q1J A;  3LWI A;  1TS9 A;  1IB8 A;  1BKB A;  1K9M R;  1FWZ A;  2O31 A;  2FZG B;  1IHW A;  3GIB A;  1I5O B;  1RL2 A;  4C0G A;  1QCN A;  3CCV A;  3CC4 Q;  2VXF A;  1W1F A;  2BKD N;  2KY9 A;  2RO0 A;  3VS6 A;  1WXB A;  1M8M A;  4C8Q F;  2LJ3 A;  2DEU A;  1OYX A;  1KIK A;  1AT1 B;  4LD6 A;  1KQS S;  2OTJ A;  2FHD A;  2KEA A;  1RAF B;  1M1K C;  1SHG A;  1D0Y A;  2Z0W A;  3VS3 A;  4E7Z A;  3EG9 A;  3SB2 A;  2IG0 A;  4M7A A;  4MDW A;  1G3T A;  5AYF A;  3CC2 A;  4JZ3 A;  5I2M A;  3CCR T;  2M1H A;  1PKS A;  1M90 R;  4LN2 A;  4XQ3 A;  2KRM A;  4E7H A;  4BDZ A;  2K6D A;  4ZN3 A;  2QK0 A;  3JV3 A;  3KUF A;  4BAC A;  2E4H A;  1FXX A;  4A4K A;  1Q7Y C;  1WHL A;  3H0I A;  1VQN Q;  2NUP A;  3ZFJ A;  1TXQ A;  1D1A A;  2ZPI B;  2HQH A;  2E5K A;  2EFI A;  5GMK i;  4ZNX A;  2XU8 A;  2O2O A;  4M77 G;  5KYX B;  4HCC A;  3A8L B;  1VIE A;  2CGH A;  3L1A A;  4CC7 A;  4II1 A;  5GAM g;  2LJ0 A;  1X01 A;  4OMP A;  1H3Z A;  2EYW A;  4EMK C;  1VQM T;  1Y7X A;  1Y57 A;  1IZ6 A;  4JJD A;  1OUL A;  3CCM Q;  4KBM B;  1WJQ A;  4JS4 A;  3CCE Q;  1ABQ A;  4X34 A;  5GAM f;  1QVG S;  2L8D A;  1C0M A;  2EGC A;  4BD3 A;  1WXU A;  2AT1 B;  2MWP A;  3VRZ A;  3V7R A;  2HBW A;  5CQY A;  5GMK j;  3F70 A;  1UG1 A;  1JJ2 P;  2LZ6 B;  4F7U G;  1H64 1;  4PJO A;  2A36 A;  3G4S Q;  3A8O B;  1M1G A;  1SSH A;  1UGP B;  2E64 A;  4FW2 A;  3GP8 A;  4AFQ C;  2JS0 A;  3X25 B;  2RF0 A;  1GXI E;  4EPC A;  5CVI A;  1HJD A;  4JDS A;  4QW2 A;  1Q82 R;  3OYN A;  2G3R A;  1PHT A;  1K9M C;  1LCK A;  2H8H A;  3QYG B;  3G71 Q;  4M7A F;  1BYM A;  1MGQ A;  1UEB A;  1D3B B;  3EGU A;  1OI1 A;  2HCK A;  2EJG A;  2B8A A;  3R6O A;  4QVD A;  2A7Y A;  3FJ5 A;  2GGR A;  4C8Q E;  1Q95 G;  4JJC A;  2VXE A;  2DYB A;  2CT3 A;  1BBZ A;  3LGF A;  2F5K A;  1D0Z A;  1S1N A;  2PNI A;  5D6W A;  5KH6 A;  4JRP A;  1B34 B;  3E19 A;  2HAX A;  3I55 Q;  1I0C A;  4A63 B;  2KR3 A;  3UPU A;  2KQW A;  2QGF B;  2JM8 A;  3OS0 A;  2I2L A;  4NL3 A;  1YJW T;  2FZK B;  1VQ6 T;  4ZTF A;  3H41 A;  1Y07 A;  1M90 C;  3QHS A;  1AZG B;  1EIF A;  4ZGJ B;  2DBM A;  3M54 A;  3A98 A;  2HSP A;  3FEO A;  5IT9 E;  3A5Z B;  2MOX A;  1M1F A;  2DBK A;  4Y28 E;  1VQ5 T;  4JJB A;  1U8R A;  2J06 A;  4GBQ A;  5AT1 B;  4OB3 B;  2KE9 A;  1PG5 B;  4EMG A;  1YI2 T;  5KYU B;  4FSX A;  3O8V A;  1FMV A;  3BE3 A;  4KH1 B;  1YCS B;  2DTI A;  3JAM E;  2KT1 A;  1M5Q 1;  4FYY B;  2K57 A;  1VYV A;  1SRM A;  4Z8A A;  4HCB A;  3QBY A;  4OF1 A;  2K2V A;  2RD1 A;  2CSI A;  2E1H A;  2DXB A;  4GY5 A;  4PJO F;  2HNI A;  3I35 A;  3V8J A;  3CMA T;  1I1J A;  4D8D A;  1PD0 A;  3URG A;  5LJ5 j;  3S3O A;  1KQS P;  3MP1 A;  2VWF A;  3M55 A;  3PVQ A;  1VQ4 A;  1VQM Q;  1C6V X;  3CME Q;  1WNL A;  2RQU A;  3QWY A;  5GAN 8;  4M7D D;  4C92 A;  3M58 A;  1AOJ A;  3RIR A;  1I07 A;  1OZ2 A;  2NWM A;  3EH2 A;  1HYO A;  4J9H A;  3EFS A;  2L3S A;  4X1V A;  4PKC C;  4FYW B;  1VYT A;  5KCO A;  1O75 A;  1TSF A;  3FDR A;  4C5I A;  4C8Q B;  5GAO p;  1JXO A;  1PCX A;  4IUR A;  4PLI A;  1Z9Q A;  3JCM c;  3OY9 A;  2GTJ A;  1QCF A;  1Q82 C;  8AT1 B;  4M7A E;  4PJL A;  2M51 A;  2VYT A;  1UJ0 A;  2F1L A;  3MEA A;  2EQK A;  2RJC A;  1WA7 A;  2QEX Q;  2A08 A;  1X6G A;  3JB9 I;  3OYE A;  3VYH B;  1I81 A;  3MEW A;  3P8D A;  3VYG A;  1KSW A;  5KYW B;  4F7U F;  1QWF A;  1LNX A;  1RLQ C;  3OSV A;  2EGA A;  3SWN C;  4C92 D;  5EG2 A;  2YHT A;  3CCQ T;  3V8K A;  4XTZ A;  2YUO A;  4PK4 A;  2YT6 A;  4F04 B;  4M75 A;  1D0X A;  1D1B A;  1UJY A;  1VQ7 A;  2EPD A;  2DXU A;  1ZSZ A;  2OX7 A;  3M59 A;  1QVG P;  2OTL T;  1H3H A;  4J6Y A;  2IPO B;  1IRE B;  2F2X A;  1VYU A;  4M78 C;  3EHR A;  4ORZ A;  1J3T A;  5IHN A;  2NUT B;  1OX9 A;  1WYX A;  3OYD A;  4XU3 A;  5IXF A;  2V1R A;  3CPW A;  5CR2 A;  5GAM h;  4FL6 A;  1YJW Q;  2XHC A;  3KFV A;  2X4W A;  3VRY A;  1VQ6 Q;  2YRC A;  2M0O A;  4IUU A;  3ZEH A;  4M7D C;  4OMN A;  4DBF A;  4F17 A;  3CCJ T;  1VQ5 Q;  2QA4 T;  1N8R R;  1QP3 A;  3MKD A;  2M0Y A;  3OA6 A;  1VQO T;  4KUD K;  3CC7 T;  2E70 A;  1YI2 Q;  4HT9 A;  1PWT A;  3LX7 A;  2RNA A;  4PJN A;  1B7T A;  1QP2 A;  4M75 D;  1TTH B;  2O4X A;  4RMO A;  2LCC A;  1WZO A;  2FYK A;  3ME9 A;  2E6N A;  2VV5 A;  3G6E T;  1AWX A;  4J8O A;  3TSW A;  4CC4 B;  4B6M A;  2IIM A;  3CCL T;  1K8A C;  4DEY A;  1Q81 U;  3CMA Q;  1FMK A;  4WCI A;  1K8A U;  3HP9 A;  2DYI A;  3QG1 A;  4FW1 A;  5I11 A;  4Y91 A;  4JS5 A;  3JCM W;  3CPF A;  4A4G A;  1YIT T;  3VU3 C;  4FCY A;  3EG9 B;  2A28 A;  3JCM b;  1S72 T;  4M7A B;  1UUE A;  3G7Z A;  4XU1 A;  1ARK A;  5CKE A;  1PD1 A;  3OQ5 A;  4M77 E; 
#chains in the Genus database with same CATH homology
 5GAN 5;  2IVW A;  2QQA A;  4O5V A;  4M78 F;  2PVG B;  4MMK A;  3FJP A;  2PU9 B;  3M5A A;  5HY6 A;  2F69 A;  1Y71 A;  5FU7 B;  2QTX A;  1FX7 A;  2JVV A;  1XTD A;  2GQV A;  2XIC A;  2KDS A;  3OBW A;  4UC4 A;  3MCA B;  1G3S A;  2E41 A;  1O9S A;  3CCS T;  4XAX B;  2DXC A;  4LDY A;  1KQS A;  5CAI A;  3JCM X;  4XTW A;  2Y4Y A;  1XOV A;  3Q1J A;  1KQ2 A;  2WSE E;  2JN0 A;  2JTF A;  3JCM g;  5GMK h;  3LWI A;  2LT4 A;  3QZ5 B;  5J3B A;  4C0F A;  4EMH A;  1BKB A;  3V8L A;  1YHQ T;  3CBM A;  2OTL A;  1FWZ A;  1VQ8 T;  2H3J A;  2Y90 A;  2E12 A;  2KSS A;  4NOY A;  3GIB A;  1VQP A;  4BI8 B;  4EMK B;  1W2B S;  1U1T A;  1RL2 A;  4C0G A;  3CCV A;  2DEQ A;  4M7D F;  5D6X A;  4OB1 B;  3CD6 A;  1VQ5 A;  2VXF A;  3GLX A;  3JCM f;  1K9M U;  2QEX T;  1JBM A;  2BKD N;  2KY9 A;  2RO0 A;  3CCU T;  3HFN A;  4LDV A;  5IAY A;  1VQN A;  3JCM Q;  4C8Q F;  4ELZ C;  1YI2 A;  3ASK A;  4ATO A;  2DTO A;  3KBG A;  3M56 A;  4L59 A;  1YBY A;  1OYX A;  3JB9 G;  1UGS B;  1N6A A;  4LD6 A;  3OS5 A;  4ZGE B;  3OS2 A;  2FHD A;  3M9Q A;  3OYC A;  2GFU A;  5FRO A;  2OTJ A;  2D0Q B;  4F7U E;  4P5N A;  1YIJ A;  4M77 A;  4E7J A;  3CCJ A;  1M1K C;  5IN1 A;  4BE1 A;  1M9S A;  3VUZ A;  2R58 A;  4RG8 A;  5GAO n;  2JZ2 A;  1G3W A;  3HRU A;  5CKF A;  3DLL A;  3QJ6 A;  3LGL A;  3X24 B;  3SB2 A;  2IG0 A;  3QDR B;  5C6S A;  3OYF A;  3CC7 A;  2E6Z A;  1VQO A;  4M7A A;  4MDW A;  2RB6 A;  1G3T A;  2DXT A;  5AYF A;  3VJP A;  4ZTJ A;  2ZPB B;  4OB0 B;  3CC2 A;  3CMA A;  3CCM A;  3PMT A;  5I2M A;  2AHJ B;  3TRE A;  3CCR T;  4IUP A;  1UB4 A;  2M1H A;  3RKW A;  2F5T X;  2QQS A;  4XQ3 A;  4M77 C;  4M75 C;  4E7H A;  4PJO D;  4BDZ A;  4A4H A;  2JOY A;  4ZN3 A;  4XU0 A;  4QQ6 A;  3G6E A;  3RKX A;  4N4H A;  4A4F A;  3OYI A;  3KUF A;  4BAC A;  5DM7 R;  1M90 U;  2DD5 A;  3M4Y A;  1NJI C;  4M7A C;  1ZQ1 A;  4MZM A;  1FXX A;  4A4K A;  2XDB A;  4PJO B;  2XID A;  1XNI A;  4CRI A;  1Q7Y C;  4EMK A;  1QVF A;  1I5L A;  3DB4 A;  4F7U A;  4C92 F;  2CZ6 B;  2VUB A;  4ZGD B;  5GAO m;  4TVR A;  5LL6 S;  3ZFJ A;  3G4S A;  3JB9 F;  3N5B B;  4FIB A;  3HFO A;  5CCA A;  1N8R C;  1PSF A;  5FU7 C;  2ZPI B;  2E65 A;  5GAO l;  4XTX A;  4IUV A;  2RK1 A;  3CPW S;  2EFI A;  5GMK i;  3C4S A;  3OYM A;  3QJY A;  2GCX A;  3S3M A;  1VQ9 A;  2XU8 A;  2FVU A;  2L3R A;  4C5H A;  4M77 G;  4R56 A;  5GAN e;  4HA8 A;  4BB7 A;  1M4Z A;  3C95 A;  5GMK e;  1N27 A;  2RHI A;  3A8L B;  4HCC A;  1VIE A;  2CGH A;  3L1A A;  5LJ3 d;  1VQ7 T;  4PJO E;  4M77 D;  4MZP A;  2X35 A;  4II1 A;  5GAM g;  1KHC A;  1X01 A;  3CC4 A;  3G71 A;  4OGC A;  3DLM A;  4ME7 A;  1H3Z A;  4EMK C;  1RI0 A;  5GAN 7;  1VQM T;  4R55 A;  3CCS A;  1K73 C;  3PNW C;  1NPP A;  1Y7X A;  4M7A G;  3RUX A;  2P0Q A;  1PSE A;  1YCY A;  2HBP A;  2R5M A;  1K73 U;  2DPP B;  1Q81 C;  1IZ6 A;  2K3X A;  5LJ3 j;  4PL6 A;  3EAE A;  1SSF A;  4KBM B;  1WJQ A;  4JS4 A;  4ZN1 A;  4X34 A;  2XK0 A;  5GAM f;  1QVG S;  2PVO B;  2L8D A;  2O01 E;  5GAN d;  1KC8 C;  3GNF B;  5LJ3 h;  5CKH A;  2ZPE B;  3MO8 A;  2DD4 A;  4BD3 A;  1BI0 A;  3X20 B;  3CCU A;  2HD0 A;  4E7L A;  3CBO A;  5HK3 A;  5LJ5 h;  2MWP A;  3P8B B;  2D9T A;  3BW1 A;  3V7R A;  2EQU A;  5GAN j;  5CQY A;  5HKC A;  5GMK j;  3F70 A;  4IUT A;  5KE2 A;  1YJN A;  3L2V A;  3CCQ A;  2E10 A;  4F7U G;  1H64 1;  2A3L A;  3MP8 A;  3I55 A;  2HQX A;  4HKE A;  1NE8 A;  2M16 A;  5GAN 4;  4PJO A;  3A8O B;  5A2Q E;  5C0M A;  1M1G A;  5GAN h;  1I8F A;  5FU6 B;  2RA2 A;  1UGP B;  2E64 A;  3LWH A;  3GP8 A;  4FT2 A;  3OW2 A;  2RHZ A;  2KMT A;  3X25 B;  5CQX A;  4M77 F;  4M75 F;  2DVE A;  3QPH A;  4FT4 A;  1GXI E;  3UDC A;  4EPC A;  5CVI A;  1YJ9 A;  4BI3 A;  3S6W A;  4JDS A;  2DIG A;  4QW2 A;  4F7U B;  4DOV A;  3OYN A;  2RJE A;  4J7I A;  2G3R A;  3HKS A;  3M53 A;  3SFM A;  5A0L A;  1K9M C;  3QYG B;  2LCL A;  3CXC S;  4LDU A;  1U1S A;  4C0Z A;  3GPL A;  2KVQ G;  3PTA A;  1VQ4 T;  2NLU A;  4M7A F;  1BYM A;  3I56 T;  1MGQ A;  1UEB A;  3X26 B;  2GF7 A;  1D3B B;  3L2Q A;  1XQH A;  1Q82 U;  1VQK T;  1OI1 A;  2EQM A;  4HCZ A;  3GNG A;  4PJO C;  2EJG A;  3QXE B;  2B8A A;  2YLC A;  3MEV A;  3R6O A;  4JUV A;  4C5E A;  4QVD A;  4BUG A;  3L2R A;  1ZBX A;  2A7Y A;  4LD9 K;  3TU4 K;  3OB9 A;  1AHJ B;  4C8Q E;  3H6Z A;  4MDX A;  3RER A;  2GFA A;  1JRI A;  2LRQ A;  3J81 E;  3OW2 S;  2RM4 A;  2QA4 A;  2VXE A;  3QYH B;  3C94 A;  1JJ2 A;  1G3Y A;  3HL8 A;  2ZPG B;  2DKG A;  2DZ9 A;  2QI2 A;  3BY7 A;  3HPW A;  4J6X A;  3LGF A;  3CBP A;  2F5K A;  3J7A F;  2R5A A;  1G5V A;  4FM4 B;  5D6W A;  3FLG A;  1BIA A;  5KH6 A;  4JRP A;  3DKM A;  3SD4 A;  1B34 B;  1HXD A;  1W4S A;  3E19 A;  2XI9 A;  3HRS A;  4L6V 5;  3J80 E;  2HAX A;  5I21 A;  1N9S A;  2VGM A;  2ZZD A;  4J5Y A;  2DK3 A;  5L8R E;  5J26 A;  4PJO G;  3UPU A;  2KQW A;  3CCE A;  1OZ3 A;  2CZ7 B;  2P0K A;  3OS0 A;  2I2L A;  5I2S A;  4NL3 A;  3PGG A;  1YJW T;  2DIQ A;  4YTL A;  2QQ9 A;  1NPR A;  3WVD B;  4C92 B;  2LVM A;  4IKF A;  4GLK A;  1VQ6 T;  2DJZ A;  5DLO A;  3L2U A;  4ZTF A;  1Y07 A;  3CME A;  3QHS A;  1EIF A;  1M90 C;  1VQP T;  1JJ2 S;  4ZGJ B;  2EYQ A;  3A8G B;  3M54 A;  4QQD A;  2K5I A;  3WVE B;  5LJ3 e;  3FEO A;  2BIV A;  5IT9 E;  1VQL T;  3CCL A;  3A5Z B;  4Y28 E;  1M1F A;  3OS1 A;  1VQ5 T;  2CKK A;  3CD6 T;  4Z02 A;  4C8Q A;  4BY6 B;  1U8R A;  4N0A A;  3S3N A;  5LJ5 e;  2ZGW A;  1WQW A;  4OB3 B;  4QVC A;  2QDY B;  3OYK A;  2PQW A;  4BE2 A;  1YIT A;  5FRM A;  1VQN T;  2M9U A;  4QVZ A;  3L42 A;  1KG1 A;  4EMG A;  4C92 E;  2DO3 A;  2RJD A;  2XDD A;  4FSX A;  3O8V A;  4OP0 A;  3P8H A;  1YI2 T;  1S72 A;  3E9F A;  1D3B A;  3L2Z A;  1Q86 U;  2DTI A;  3JAM E;  4PLL A;  5M9O A;  1YIJ T;  1M5Q 1;  5GAN 3;  5FU6 C;  2K57 A;  4D6W A;  2P4T A;  2LTO A;  4RKU E;  4E7K A;  3NTH A;  2ZPH B;  4RCB A;  3GOX A;  2MAM A;  4HCB A;  4B9W A;  3QBY A;  2QQB A;  4J83 A;  3SDZ A;  3SWN B;  1BI3 A;  4OF1 A;  3JCM V;  3JCM d;  2K2V A;  2RD1 A;  4N4I A;  5LJ5 d;  2D6F A;  5GAO r;  4N0A C;  4XTY A;  2E1H A;  3T9N A;  1QVF S;  1X75 C;  4C0D B;  2DXB A;  1YHQ A;  4GY5 A;  4PJO F;  2HNI A;  5DLQ E;  3OYH A;  1VQ8 A;  2DAQ A;  3CC2 T;  1MHN A;  3V8J A;  3CCM T;  1WQ7 A;  4A54 A;  5FLX E;  3CMA T;  1ZHI A;  1V29 B;  2MMP A;  2QQR A;  3X28 B;  1B34 A;  3URG A;  5LJ5 j;  3S3O A;  4M78 B;  3L2W A;  4NL2 A;  4IUQ A;  3A8M B;  3MP1 A;  3VV0 A;  3LH0 A;  2ZCF B;  1KQ1 A;  2PUK B;  3M55 A;  2EJ9 A;  2QEX A;  2EWN A;  1VQ4 A;  2Y4X A;  3BFM A;  2LNV A;  3OMC A;  3JCM h;  2OAU A;  1WNL A;  5GAN 8;  3MP6 A;  1VQK A;  4RCC A;  4M7D D;  1WPY A;  4C92 A;  4XTV A;  1M8V A;  3M58 A;  4OB2 B;  1R8O B;  3RIR A;  4A4E A;  2CS7 A;  4C8Q G;  2PVD B;  3OYL A;  3KXT A;  1TH7 A;  4VUB A;  3TEE A;  2V8I A;  5GAN 2;  3ER0 A;  3PMI A;  3QKJ A;  4C8Q D;  4M78 E;  3BDL A;  1OZ2 A;  4O6J A;  4M7D B;  1DJ7 B;  4LDW A;  3MET A;  1UGQ B;  2RI3 A;  3EFS A;  4XU2 A;  1LJO A;  3WXM B;  4PKC C;  1KQS S;  3V7S A;  5CKB A;  2RHY A;  3UWN A;  5KCO A;  1O75 A;  1VQ9 T;  1Y96 B;  3FDR A;  2P0P A;  3E9G A;  5D6Y A;  4C5I A;  4C8Q B;  5GAN 6;  5A0D A;  5GAO p;  4IUR A;  1WGS A;  2HQE A;  2CZ0 B;  4M75 E;  3VUB A;  3JCM J;  4C92 C;  4PLI A;  4X9C A;  4LDX A;  2K5F A;  3JB9 J;  3JCM c;  3CC4 T;  3OY9 A;  3G71 T;  5LJ3 g;  3CCR A;  1Q82 C;  4M7D E;  4BI4 A;  2XD0 A;  5GMK m;  2ZPF B;  3CEY A;  3MHX A;  5CKD A;  2RI5 A;  2WAC A;  3C12 A;  4JLG A;  4PNO A;  3SWN A;  4M7A E;  4KT0 E;  1YJW A;  3M4G A;  5GMK l;  5LJ5 g;  4BY6 C;  2FL7 A;  2KAF A;  3H8Z A;  1VQ6 A;  4J6W A;  2VYT A;  3JSC A;  4DOW A;  3RKY A;  5GAM e;  5LJ3 f;  3MEA A;  3OYG A;  2EQK A;  1P92 A;  1WJR A;  1VQL A;  2RJC A;  1NZ9 A;  4L5G A;  4Q5W A;  5CIU A;  3HSB A;  5GAN g;  4MZT A;  2RHU A;  1UGR B;  5LJ5 f;  2WSC E;  2JTM A;  4M78 A;  3JB9 I;  3OYE A;  2WSF E;  2KK4 A;  3VYH B;  4XK8 E;  2RH2 A;  1I81 A;  2LT1 A;  3MEW A;  3P8D A;  3VYG A;  2YLB A;  3BDU A;  4C5G A;  4QQG A;  4C92 G;  4F7U F;  4JJN K;  1LNX A;  1YJN T;  3OSV A;  4C92 D;  3SWN C;  1BI1 A;  5EG2 A;  2YHT A;  3CCQ T;  4DA4 A;  3V8K A;  4XTZ A;  5DY9 A;  2X4J A;  2O4X B;  5CK9 A;  5GAN f;  2RI2 A;  3I55 T;  3JB9 D;  4M75 A;  5GAM d;  3NTI A;  3DB3 A;  2RJF A;  3FRN A;  1VIF A;  2V8K A;  2DXU A;  1WJS A;  4N4G A;  4C0D C;  3LLR A;  4BDY A;  3FIF A;  4BE0 A;  1M1K U;  3NTK A;  2EQJ A;  3M59 A;  4RG2 A;  4E47 A;  2OTL T;  4J6Y A;  4M7D A;  3RMQ A;  4OMF B;  4ELY C;  1VQM A;  1IRE B;  2K5L A;  2VC8 A;  5HK0 A;  3OSS C;  1YJ9 T;  2LC4 A;  4M78 C;  4EDU A;  2MF2 A;  3AHU A;  5GAM j;  3CCV T;  1JB0 E;  3PFS A;  1N9R A;  4KUI A;  1Y96 A;  4OGE A;  4WF2 A;  4J7F A;  3RMS A;  1X6O A;  3JCM e;  4XU3 A;  3OYD A;  2EJF A;  3JB9 H;  2K3Y A;  2LX9 A;  5CO7 A;  5CR2 A;  3OMG A;  2XG8 D;  3CPW A;  5GAM h;  4FL6 A;  3ZBD A;  2JNG A;  2XHC A;  3QZ9 B;  2XKO C;  1Q86 C;  2RHX A;  2X4W A;  3JCM P;  4V2S A;  2L5Q A;  2M0O A;  4IUU A;  1KHI A;  4JLI A;  2DZC A;  3EFR A;  3ZEH A;  2OTJ T;  3M57 A;  2YRV A;  4B9X A;  2L89 A;  1BIB A;  3OYY A;  4M7D C;  1LOJ A;  2V8J A;  2CZ1 B;  3CCJ T;  2QA4 T;  2C06 A;  5GAO q;  1NJI U;  1QP3 A;  1Q7Y U;  4M78 G;  3OYB A;  2BUD A;  3MEU A;  3HRT A;  4C8Q C;  3INZ A;  3GF5 A;  4X9D A;  3OA6 A;  1VQO T;  4KUD K;  3CC7 T;  4M78 D;  2E70 A;  1I4K 1;  3QII A;  3QSU A;  4HT9 A;  4KUL A;  4JRK A;  3HHT B;  1QVG A;  2VGN A;  1VUB A;  3LW5 E;  3VKI A;  1N8R U;  2LDM A;  2EKO A;  4A53 A;  1BI2 A;  5KE3 A;  3LX7 A;  1QW1 A;  3OBY A;  4E7I A;  2LQK A;  4M75 G;  3CCE T;  2R57 A;  4DQ2 A;  4OVA A;  1QP2 A;  4M75 D;  2O4X A;  4RMO A;  3OYJ A;  2LCC A;  3PIO A;  2FYK A;  3ME9 A;  2E6N A;  3PIP A;  4M7D G;  2VV5 A;  2QXF A;  3I56 A;  1VQ7 A;  3G6E T;  4J8O A;  3E1S A;  4XTU A;  2RK2 A;  3PT9 A;  3NFC A;  3CME T;  4JRQ A;  2E5Q A;  2MI6 A;  2PUO B;  3FB9 A;  3TCJ A;  1KD1 C;  3RES A;  3CCL T;  4M77 B;  3QUI A;  3LYI A;  4M75 B;  4MML A;  1K8A C;  1Q81 U;  1KD1 U;  2FB7 A;  4JRI A;  4M7A D;  2CYZ B;  1K8A U;  2JUF A;  3HP9 A;  3UT1 A;  3QG1 A;  2X4Y A;  4Y91 A;  5J39 A;  3FC3 A;  4JS5 A;  3JCM W;  3V7C A;  3CPF A;  4CI0 C;  4A4G A;  4HT8 A;  4NS5 A;  3VU3 C;  2K4Y A;  1YIT T;  5FRN A;  5A0G A;  3G4S T;  3JCM b;  1KC8 U;  4FU6 A;  3JRZ A;  1S72 T;  4M7A B;  1W2B A;  2DTH A;  2MWO A;  3G7Z A;  4XU1 A;  3QO3 A;  3A8H B;  5KCH A;  1HK9 A;  3CXC A;  2XDP A;  1QVP A;  2X4X A;  5CKE A;  2EIF A;  2LQ8 A;  2EAY A;  3OQ5 A;  3OYA A;  4M77 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...