2LT4A

Cdnlnt from myxoccoccus xanthus
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
71
structure length
71
Chain Sequence
AGHMQTSFKTGDKAVYPGQGVGEVMGIEHTEVAGQRQSFYVLRILENGMRIMIPINKVGSVGLREIISEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, CarD family
publication title Structural Insights into RNA Polymerase Recognition and Essential Function of Myxococcus xanthus CdnL.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Transcription
total genus 5
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lt4A00
4KBMB 2LT4A 4XAXB 2LQKA 4L5GA 2LT1A 2EYQA
chains in the Genus database with same CATH superfamily
1FMVA 2LX7A 4BE2A 3VS0A 1WHHA 1YCYA 1K9AA 2KYBA 5KCHA 1BI0A 4EMHA 1JRIA 1QVPA 3GP8A 3JRZA 4NOYA 5GAOn 4FYWB 1M8VA 3CCRA 1OZ2A 1IHVA 3CCLA 1QKXA 1ZSZA 2L0AA 3GOXA 1KG1A 1JEGA 1C0MA 4PJOC 2DVJA 1O9SA 4HT8A 1MNEA 3CCEA 4XTZA 3OA6A 3QJYA 1NZ9A 1IGQA 2GFAA 3NHNA 1YHQT 2L89A 4M7AE 4M4ZA 1HJDA 2MMPA 2HKQB 1D3BA 3OYNA 1JJ2P 4KBMB 5GAOl 2R58A 2P4RA 3L2ZA 3BDUA 4MMLA 3KXTA 4JRKA 2X51A 1HXDA 5CQYA 3M0QA 2E6NA 3MP8A 1IHWA 1VQMT 2KT1A 1TUGB 2M02A 3SB2A 5KYNA 4M7AD 3ER0A 1ZQ1A 3JSCA 1NE8A 1XJWB 2DXTA 3JCMQ 4L6V5 3CMEQ 5I21A 2HQXA 4CC2A 4BY6C 1YITQ 4FYYB 1ZLMA 4JJDA 1ARKA 5LJ3d 3O8VA 2LCCA 4PKCC 1UFFA 3MEVA 2DKGA 3JCMd 4LDUA 2GQIA 4M77E 3L2UA 3CCQT 1I5LA 1M1GA 5FLXE 3AT1B 5LJ5j 4J5YA 2KE9A 5GANd 2DL3A 2X3WD 1BYMA 2XMFA 1VQKT 2QEXA 2RN8A 2AIRB 4JDSA 4A4KA 3HL8A 3KBGA 3OYDA 3PVLA 1YHQA 3PMIA 5KYUB 2JZ2A 5L8RE 3ZEHA 4PL6A 3UPUA 4C5GA 2CYZB 4M75C 4M77F 3AHUA 2DL8A 4JZ4A 4RKUE 1I0CA 1Z9ZA 2JMAA 4PJMA 2D8JA 2DX1A 3PT9A 1GFCA 3VS3A 5FU7C 3EGDA 2FZKB 2QG9B 1WDXA 2JT4A 1S72Q 1O75A 4KGVB 2GTOA 2JW4A 4B9WA 1I8FA 3CCUT 1PSEA 2J7IA 2EPDA 1D1AA 5GMKj 1Y71A 4DBRA 3TSWA 1VQ5A 3O5ZA 3NFCA 4Q5WA 4IKFA 1ABOA 2L2PA 1KSWA 1OU8A 1MGQA 2IPOB 2M16A 1D1CA 3WXMB 1YIJT 1QP2A 1QCNA 3L2WA 3V8KA 3CCJT 2CZ1B 2YRDA 4ELZC 2O4XB 5GAMh 5LJ3f 1IZ6A 3LX7A 3DB3A 2RJEA 1UG1A 1NJIC 3ME9A 3JCMf 2HD0A 2FL7A 2OTLA 2E5KA 2JTEA 1W4SA 3BDLA 3CBPA 1LOJA 2F2XA 5KH6A 5GANf 4RTXA 4J9BA 2VGMA 3FLGA 4OVAA 1RAHB 2RI2A 2P0KA 1K9MC 1QWFA 1VQ9Q 3EGXB 1HD3A 3G6EQ 3HPWA 2ABLA 3CCVT 4OB0B 2BZXA 1OU9A 5FU6B 1TS9A 4RG8A 1JJ2S 5GAOq 1JU5C 5I2MA 4BE0A 1Q95G 2KEAA 1CSKA 3PNWC 2HNIA 3C12A 4J8OA 5IN1A 2GTJA 2DETA 2LP5A 3CCUA 4RTYA 1T3SA 3OY9A 2A7YA 3C95A 2MWOA 1XQHA 2E64A 4E6RA 1Y7XA 2QI2A 4LE9A 4BACA 1G83A 1ZBJA 1VQ7Q 1VQPT 3EH2A 1HK9A 1RAFB 2QGFB 5CKHA 3J81E 3CMAQ 1F1BB 2CSQA 3CXCS 1OZ3A 1TWBA 3I55Q 4Z02A 4Y91A 4M7AC 4M7DB 3HKSA 3CC7T 3A1PA 2JOYA 4FU6A 4ATOA 2WSCE 1UGRB 3VV0A 3PE0A 1WZOA 2K5FA 1SRLA 2ZGWA 5J39A 2HQEA 1X2QA 2KSSA 4XAXB 2HZYA 4ZN3A 3LH5A 1JJ2A 1ZUUA 2G3RA 1JXOA 2JUFA 2DTOA 1OX8A 3SFMA 2AZVA 1WHKA 1N9RA 1VQOQ 2CZ7B 3T9NA 2DIGA 1UGSB 1AWOA 1T0JA 3PTAA 5KYUA 2VC8A 4ZGEB 3E2UA 3PVQA 2FPEA 5HK3A 2DK3A 1NPPA 4OB1B 3G1JA 2BKDN 5DLOA 2DE0X 4M7DE 4RTTA 4F7UB 2RQUA 1SSFA 5CKFA 4X9CA 2D0NA 3JAME 3UA6A 4KH0B 4C8QB 1WYXA 4N0AA 2M51A 2MOXA 3MPUB 1VQPA 3M54A 5KYXB 1Q86R 2EJ9A 2D6FA 2XDBA 4C92B 1ZA1B 2MF2A 4M7DF 3QHSA 3CBOA 3EG9B 1WPYA 2VGNA 5LJ5g 2VWFA 6AT1B 4M78D 4C8QG 3MEWA 4PJNA 1VQMQ 2O4XA 2P84A 3OW2P 2DXUA 2DBKA 5GAN3 4JZ3A 3OS5A 3OYIA 4F7UE 4C92G 5CK9A 3M0TA 1VQLT 4AG1C 4BE1A 5DM7R 2CSIA 5GAN6 3MO8A 4PJOE 3EGXA 2Y4XA 2MI6A 3CQTA 3CC4T 1XNIA 4C5HA 4BY6B 1CKAA 2YLCA 2CREA 3CCQQ 1RACB 1BCOA 4JRQA 4F7UF 2JJ9A 4MZTA 4R0KA 1QMCA 3DLMA 1Q82U 1VQKQ 5GAOr 4AFQC 4BI8B 1UE9A 1YI2T 1X6BA 4PJOD 3C94A 3I56T 4C8QF 1BI1A 1K8AU 3JB9J 1AWXA 2RK1A 4FW1A 1R0CB 2EBPA 4KUIA 5CKBA 3VS2A 1I4K1 3HTRA 1UGVA 3DB4A 4AFUC 1Q81R 4HCKA 4FCYA 1IO6A 5FWCA 1BI2A 5IH2A 4N4GA 4AFZC 3CBMA 5FWBA 2EAYA 4EDUA 3I5SA 3JCMe 3OYEA 2FRYA 1UJYA 4GLKA 1V1CA 4N0AC 2M9UA 2SRCA 1I1JA 5GANe 4EPCA 5GAMf 2LCLA 3C4SA 5I11A 2C0TA 2CUBA 2KR3A 4B9XA 2KBTA 2NYSA 4ZGDB 3CCSA 1QWEA 2RD1A 3EH1A 2DD5A 2CT3A 2KI7A 1R77A 5GAOm 1GL5A 3URGA 1YIJQ 2WSEE 1VQNT 1RLPC 3CCJQ 3FC3A 2IVWA 1PHTA 2A0FB 2EYZA 2RQRA 1PM3A 3THKA 4E47A 2CZ0B 4IURA 3FJPA 4EMKC 2CS7A 4RCCA 5GAN5 3ZL7C 1BK2A 4M75E 2X4XA 5GMKi 5IHIA 1YI2A 2OX7A 5LJ3h 2PVDB 1EFNA 1GXIE 4XTVA 2F1LA 2E41A 2KROA 3CCVQ 2YRVA 2WACA 2O9SA 4E7SA 3H9NA 3JB9F 3VKIA 3VS4A 1KHCA 4OMMA 2VVKA 1UB4A 4IIMA 2DYBA 2LNVA 2RQWA 3M57A 4C8QA 1G5VA 3TVTA 1PG5B 3CCRT 2VXEA 4M75D 3CCLT 3MP6A 5KYXA 4XTUA 5KCOA 1EZZB 4FT4A 1U5SA 1RUWA 1CKBA 1OPLA 4C92A 3ZFJA 3GNFB 3SWNC 1B34A 3CCET 5LJ5d 3EG9A 1W2BP 2QXFA 1GBQA 3VRYA 1MMGA 3G7ZA 1KQ1A 1H3HA 5IT9E 1AOJA 1Y96A 2YUQA 2OTJT 2J6OA 2DPPB 4M78C 3OBWA 2DTHA 3CCMT 1YJ9A 2OAUA 4ZN1A 2O2OA 3CC7Q 2LJ3A 1JXMA 2K3XA 2XK0A 4M7AB 5KYYB 1I5OB 4OMPA 5D6XA 1MMDA 1P92A 4DOVA 3CPWP 1FX7A 4QVDA 1RL2A 2XU8A 1NJIR 2DZCA 1VQ6A 2E3HA 3F70A 4KULA 2QA4T 3M4YA 1M90R 4M7AG 2HBWA 3E19A 2JS0A 1X2KA 4XU2A 1X01A 2CP2A 2ECZA 3OBYA 1R8OB 3V8LA 5HK0A 2HKNA 1MV0B 2V26A 1GRIA 4J7IA 2CP7A 2QEXT 4OMFB 1BCMA 1Y0MA 2VB6A 3A5ZB 5EG2A 1OI1A 2C06A 2LJ0A 4OMQA 1KHIA 1M3BA 2A37A 5LJ5f 3BY7A 3G71A 4M77B 2OTJA 2MCNA 5GMKl 2YRCA 4DBQA 1RI0A 1WA7A 3CCMA 3P8BB 2QDYB 4F17A 2E12A 2DF6A 2V8IA 2EIFA 1NEGA 3CEYA 3HHTB 4C0FA 1M2VA 3V7CA 4M7AF 4LDXA 5D7UA 1R0BG 4M77G 2BE7D 4PFOA 1M1KR 5KE2A 2LMJA 2PVOB 1VQ5T 2LX9A 2R5MA 4QVCA 2L5QA 3SEMA 2HDAA 2JTFA 4BB7A 3HP9A 3KUFA 1UEBA 3M0PA 1YJNA 2HBPA 3QO3A 3WVDB 3VU3C 3X20B 2QA4A 3EHRA 4CC3A 1VQLQ 2D1XA 4A54A 5J26A 2EQUA 4AFSC 4AT1B 1YWPA 2OI3A 5GAOp 1AWWA 3EG0A 2LTOA 2EWNA 4HVVA 2O9VA 1ABQA 3RMSA 3CC4Q 3M59A 3LGFA 1M30A 4IUQA 2OTLT 4NL3A 3CD6A 4R55A 4QQDA 3QYGB 2RHIA 1MUZA 9ATCB 5GAMe 2YLBA 1QQJA 1NEBA 2PU9B 1EX4A 2FG0A 1W2BS 2KRNA 2X35A 1LPLA 3RDVA 2P4TA 1YI2Q 1WQ7A 2X4JA 4Y92A 1B7TA 3I56Q 1UECA 1D0YA 1ZSZC 3OYKA 4OMLA 2RH2A 3UATA 4ORZA 1SHGA 3S3OA 1YNZA 3GNGA 3G4SA 5DY9A 2YHTA 2C0OA 2JM9A 2DJQA 3X28B 2DBMA 1AZEA 4D8KA 2PZ1A 3OYFA 3PIOA 3JCMc 4AMCA 2DVEA 2DL4A 2MK5A 4WF2A 1C1AA 1Q82C 3JB9H 4E7IA 5A0LA 4FSXA 1K8AC 2K6DA 2F5TX 4N4HA 1M4ZA 1NYFA 2F5KA 3L1AA 3RR6A 4WCIA 1WHLA 5KYYA 4II1A 1N8RR 4J9IA 1YJWT 1ZUYA 1KD1R 3BE3A 3OYJA 2LVMA 3VUBA 2VV5A 4R56A 1VQNQ 3H0HA 1QVGP 1OV3A 4IUTA 4MZMA 3CC2A 3JCMW 4DQ2A 1W2BA 4MMKA 3A8MB 3MJXA 4FL6A 4EMKB 1VA7A 1VIEA 3V8JA 4XU3A 3JCMX 1Q86U 4EMGA 1KC8R 4IUVA 2COZA 1RAGB 2KQWA 4XK8E 3META 2D8HA 3LLRA 2BUDA 2PUOB 2FZCB 4ESRA 4DOWA 2ED1A 3JCMP 1B07A 1T3LA 2JXBA 4PFPA 1M9SA 3PMTA 2RHUA 2GNCA 3QBYA 4M77A 3V7RA 3OS2A 3CCRQ 3CCLQ 3CPWA 1UUEA 1V76A 4NL2A 1FYNA 1M3AA 2DXCA 3VS1A 5A0DA 1G3TA 2EFIA 5CIUA 3VS7A 2CUDA 3CCEQ 2V1RA 2CKKA 2A08A 3J80E 4FSSA 1BBZA 2BZ8A 2QQBA 1S1NA 2ZCFB 3E9GA 2KMTA 4HA8A 1WHGA 3SWNB 3VS6A 4GY5A 1PD1A 1YJWA 1PRLC 3RIRA 2OTJQ 1KJWA 4RTZA 5ECAA 2XI9A 4DBHA 4A63B 3JCMJ 1VOMA 1H641 2M0YA 2X3XD 1K73R 1NPRA 2EQIA 3A98A 2DL5A 5GANj 1OX9A 2COWA 1VYVA 1VQ4A 4C0GA 1N5ZA 4PLLA 1Q7YU 2F69A 3L2VA 2R5AA 1NLOC 4M7DG 2FHDA 3OYCA 1SF9A 2DLPA 2XD0A 1WLPB 1VQ8A 5AT1B 2MYSA 2LQWA 3UT1A 1BI3A 2E6ZA 2KGTA 1Q81U 3GPLA 2I0NA 1W6XA 2K5LA 4F16A 1NLPC 2ROTA 1QVFP 4YTLA 1OQKA 2K2VA 2KK4A 1JBMA 2DFUA 4L5GA 3UF4A 3GF5A 4J9CA 4J83A 4HXJA 2KXCA 1QKWA 4QQ6A 3L42A 4X34A 3KFVA 2QEXQ 3TREA 4M78E 1M27C 3BW1A 4JLGA 2EYXA 4RTWA 2D0QB 4PJOB 1G8XA 4OMNA 1YHQQ 4LDVA 3I35A 3UDCA 3M4GA 4F7UG 1AEYA 2EQMA 3NTKA 2RF0A 1FXXA 4IUUA 1QVGS 3VUZA 2E1HA 2RJFA 4NS5A 5LJ5h 1HSQA 2YWWA 4CI0C 2J6KA 4M78F 4PJOG 1BIAA 3LWIA 2K3BA 2RHYA 2EGAA 1U3OA 2NLUA 5HCKA 1NM7A 2KNBB 1RAEB 1OULA 2DYIA 1KQSP 4JRIA 1LNXA 3RMQA 3OYAA 1VQ5Q 4BI3A 4ELYC 3CCST 2O01E 1HYOA 4OGCA 3RERA 2BTTA 2FRWA 3QXEB 3CMET 3HRSA 4V2SA 5GAN2 2D9TA 3VYGA 2RQTA 4RTVA 1X6OA 3V7SA 2FEIA 4J6WA 4C0DC 1VYTA 1JB0E 5A2QE 4IUPA 3HFOA 3TQ7P 2E10A 5GMKh 2OTLQ 2HL5C 2QGGA 3C0CA 4PK4A 3S3MA 1BB9A 3QSUA 3HSBA 2K79A 4PJOF 2O88A 2K2MA 3QWXX 2B86A 4E7JA 2EVRA 5GAN4 3H0FA 3PGGA 3QZ5B 3X24B 2A28A 1QVGA 1H3ZA 3OQ5A 4PLIA 2YUOA 5LJ3e 1K0SA 2LNHB 3H6ZA 4M75B 2EYQA 2KAFA 1ZSZB 1TOVA 4JS4A 2DD4A 3JCMV 3EG3A 3CCUQ 1WJQA 3GBQA 4C92D 2MIOA 5FU7B 4M7DA 3EFRA 3JB9G 4PFZA 2EKOA 2EW3A 5FW9A 1IXDA 3EG2A 2DEQA 5CAIA 4A53A 2AKLA 3MEAA 3S6WA 1GBRA 3EGUA 2EGCA 1WJRA 2PVGB 4HT9A 3CMEA 1T0HA 4M75G 1WQWA 2H8HA 1M2OA 3REBB 5HKCA 5D6YA 1GCQA 1M90U 2LDMA 1SKUB 1YITA 4KT0E 1YJWQ 1YJ9T 3I5RA 2JMCA 4ZTJA 2ED0A 3DLLA 3WVEB 4BUGA 2DEUA 2FPDA 2LRQA 2JN0A 4QKUA 1NYGA 1IGUA 3RKYA 4LDYA 4ZGJB 2GFUA 1X43A 4WTOB 2YT6A 4P5NA 4F7UA 5J3BA 4CC4B 5LL6S 2IG0A 1YN8A 2X4YA 1VQ9T 1VQ6T 2ZAEA 3RBBB 1WJSA 4JRPA 3A8GB 2K4YA 3OYMA 2HMAA 3FJ5A 4M75F 3JCMg 2ENMA 1TXQA 2ATCB 2J06A 2J05A 3TU4K 2ZPHB 3OW2S 1YCSB 1QCOA 3QYHB 1D0XA 1WHMA 1ZA2B 5GANg 4D6WA 2CT4A 1M1KU 1S72A 5GAMj 2I2LA 1KQSS 1PC0A 2JTMA 1YBYA 4J6XA 1Q86C 2XICA 4JPBW 3G71T 5KYWB 1VQPQ 1QVFA 2V1QA 4ANJA 4IIOA 2RHZA 2DAQA 2NUPB 4DA4A 8ATCB 1UGPB 3EGDB 1VQ7T 4MDXA 2BE9B 1J3TA 3OYLA 3M0SA 1RAIB 3FB9A 1UTIA 1AT1B 2Y90A 4J9EA 1U1SA 2CP0A 2PUKB 2CDTA 2HEQA 3QDFA 4XTYA 1YJNT 1VQ9A 2DXBA 4RTUA 3G6EA 2QTXA 3OYYA 1K9MR 1IREB 2RI3A 3E9FA 2RO0A 3OW2A 4TVRA 3QIIA 2CZ6B 1SEMA 2YSQA 4BI4A 1KQSA 4HVWA 1VQOT 3CD6T 2OAWA 2LCSA 5C0MA 2DA9A 3U23A 2BZYA 1Q7YC 1XTDA 4A4FA 1H92A 4M75A 1PKSA 4EIKA 2F2WA 5EC7A 1WNLA 2COYA 2QQSA 3QZ9B 4C8QC 4GBQA 2KRSA 2XG8D 3TCJA 1AWJA 2V8KA 2H3JA 1Q81C 1M8MA 1N8RU 3VYHB 4PJLA 1KD1U 2L8DA 4LXCA 4C92C 4PNOA 1VQ7A 4LD9K 1WGSA 2P0PA 3G4ST 2HL3A 1ZUKA 2PQWA 5FRMA 3CMAA 2EKHA 3I55A 3M5AA 1WX6A 4E2FB 2MWPA 1YWOA 4C0ZA 2OJ2A 2DMOA 2DJZA 2VASA 1ZSGA 4N4IA 1X27A 4E7LA 1E7OA 2O31A 4Z8AA 3ZBDA 1KC8U 4LD6A 1WXBA 1NBEB 1ZHIA 2DRMA 5CQXA 4B6MA 1MMNA 3CCSQ 3M9QA 4D8DA 3A8HB 2G6FX 4ME7A 3GIBA 5CO7A 4VUBA 2MAMA 4XQ3A 4Z89A 1VQOA 1X6GA 3BFMA 3CC2T 2KDSA 1UHFA 8AT1B 1U1TA 2CH4W 4OP0A 4LDWA 4FM4B 3CXCP 2HSEB 4XTXA 1X69A 3A8LB 2EQKA 2ZPEB 1PWTA 3DKMA 3QUIA 3M58A 5AYFA 1PD0A 4C0DB 1N9SA 1Z9QA 3OSVA 4J9HA 5IXFA 1MMAA 3E1SA 3MHXA 3M55A 1AVZC 4OGEA 2E65A 1DJ7B 4MZPA 2QDLA 5CKEA 1UGQB 2NUZA 4Z88A 4QT7A 5CCAA 2QASA 3FIFA 3M0RA 4M77D 1K73U 2DIQA 5KYWA 2KY9A 2GQVA 3CPFA 2DM1A 2NUPA 3EAEA 3QPHA 3CPWS 3OB9A 1SRMA 3I9QA 4RUGA 4AG2C 1UJ0A 1UDLA 4Y28E 2PNIA 1ACMB 4A4HA 1VQMA 2P0QA 1VUBA 4K11A 2VUBA 3MEUA 4M7AA 2C0IA 3EG1A 2LQNA 2DTIA 2DO3A 2W0ZA 3GLXA 4KGXB 4BD3A 2EJFA 1KFZA 1YJ9Q 2YUNA 2WSFE 3QJ6A 2F2VA 3L2QA 1SG5A 1M5Q1 2IIMA 2L3PA 5GAMg 3S3NA 1TG0A 3CCQA 4MDWA 3FEOA 1VQ4T 2NWMA 2VXFA 3J7AF 2VKNA 2L3QA 2KRMA 3LYIA 3FRNA 2DNUA 2ZPGB 1QP3A 1AD5A 3M56A 2RNAA 1VQKA 1VQ8T 2AT1B 4KUDK 1M90C 2KT8A 3QG1A 1VQ6Q 3ULRB 1KK7A 1TU0B 5GJWB 1E6GA 2PTKA 2LT1A 2FPFA 2V8JA 3HRUA 1PRMC 4DEXA 2RMOA 3H0IA 2EYWA 3D7SB 3OMGA 1VIFA 4JLIA 2CP5A 4JUVA 4HCCA 1PCXA 1UHCA 1AZGB 1BIBA 1WI7A 3M53A 4GLMA 2EGEA 2X4WA 2J6FA 2K9GA 2QYZA 3QDRB 1RAAB 3OYBA 2RJDA 1EIFA 1H8KA 1RLQC 3G71Q 4J9FA 1NG2A 2HSPA 2GGRA 3NGPA 4RMOA 4A4GA 5LJ3j 2E4HA 4KH1B 3TSZA 3CCMQ 5CVIA 1YIJA 1RADB 1TUCA 2LQKA 5GJVB 3SD4A 4M78B 4HCZA 3CCJA 2KYMA 2JM8A 3ASKA 2K3YA 1M1KC 4E7KA 2HAXA 2HCKA 3RESA 2L3RA 4J9GA 2CP6A 5LJ5e 3X25B 1B3QA 2DZ9A 4JJBA 1E6HA 4XTWA 4CC7A 2MPXC 5C6SA 1YJNQ 3HRTA 1IB8A 4M78G 2RB6A 2QQ9A 3EFOB 5FROA 2R57A 2QAZA 2YUPA 3UA7A 3CCVA 2QA4Q 4OB2B 2ESWA 2RI5A 3INZA 3MP1A 1TTHB 2RHXA 2XDPA 5IHKA 3TEEA 1K0XA 2GCXA 4F14A 2ROLA 2SEMA 3RNJA 1M3CA 2ZPBB 4BDYA 3CD6Q 4QVZA 2XHCA 2A3LA 2XKOC 2HQHA 3M0UA 2L3SA 3PFSA 2ZPFB 2LZ6B 3VRZA 4JJNK 4RG2A 5GMKe 2VYTA 2DILA 2RM4A 4M77C 5CR2A 3Q1JA 4X9DA 2AK5A 2NUTB 4ZNXA 1BU1A 3IQLA 3MKDA 2ZZDA 3REAB 1GFDA 1OEBA 3CXCA 1RABB 3OS1A 2Z0WA 3G4SQ 1OOTA 2XDDA 3OYHA 4FW2A 5A0GA 3UWNA 2H3EB 3LGLA 1LJOA 1D1BA 2GF7A 2AKKA 5IAYA 4M7DD 4DBFA 2E5QA 2E70A 1M1FA 1TSFA 2M0OA 2YDLA 1B34B 3CC7A 2K57A 3RUXA 3N5BB 2LQ8A 4X1VA 4HCBA 1N27A 1VYUA 5GAMd 1N8RC 2K7AA 2CH4A 1Y96B 3JB9I 3P8DA 1KD1C 4EMKA 2DL7A 1QLYA 2Y4YA 1YITT 1IRXA 2ZPIB 4C5IA 3H8ZA 2AZSA 5KE3A 3QKJA 1K4US 1K1ZA 4RCBA 4C8QE 1SHFA 3CC2Q 2XIDA 4BDZA 5GAN7 1XOVA 1C6VX 1D0ZA 2CP3A 3L2RA 2LJ1A 4QW2A 2K5IA 2QK0A 1KC8C 1TH7A 4C92E 1PSFA 1G2BA 3OSSC 5D6WA 2FB7A 1ZX6A 3RKWA 1RI9A 1TUDA 4E7ZA 1U8RA 1QW1A 4J7FA 1MV3A 4C8QD 3R6OA 1Q7YR 3JCMb 2A36A 4LN2A 2EYYA 4FYXB 2RA2A 3SWNA 2LC4A 1MHNA 1Y57A 1WXUA 4FIBA 4C92F 4XU1A 1WIEA 4LUEA 4DEYA 1KQ2A 1S72T 1G3YA 3PIPA 5I2SA 4ZTFA 5L23A 1NJIU 3LW5E 4KRTA 4M78A 5GMKm 2FVUA 3JV3A 1D3BB 2RK2A 3NTHA 5DLQE 3QWYA 1YFNA 4C5EA 4OMOA 2X9HA 3EHQA 2QTVA 1G3WA 1K9MU 7AT1B 1QVFS 2JNGA 1X75C 5IHNA 1W70A 2EJGA 1K73C 2RPNA 1VQLA 3LWHA 4PJJA 4L59A 3EFOA 5FRNA 2M1HA 1M2VB 3CC4A 4O5VA 1A0NB 2FYKA 1WHJA 1FMWA 4FT2A 3H41A 2JS2A 3LH0A 4OB3B 1VQ4Q 1BKBA 1SPKA 4LUDA 5FU6C 5M9OA 1SSHA 1I07A 3OS0A 1K76A 4O6JA 1AHJB 5GAN8 3G6ET 2QQRA 4LNPA 1JO8A 3EFSA 1FWZA 1Y07A 1VQ8Q 5LJ3g 4PJOA 3I56A 4XU0A 1PKTA 1LVKA 3JCMh 2JVVA 3X26B 4A4EA 1JQQA 1ZBXA 3JB9D 2KXDA 2B8AA 4J6YA 2DRKA 4HVUA 2NUTA 3VJPA 2FZGB 2YXYA 5GANh 4HKEA 4JJCA 1GCPA 1FMKA 3NTIA 2BIVA 3OYGA 3P8HA 3SHWA 2CGHA 2LT4A 4QQGA 1PNJA 4F04B 1Q82R 2KVQG 3NPFA 1U06A 4M7DC 5I22A 1K8AR 3RKXA 5CKDA 1OYXA 3CMAT 2AHJB 1W1FA 2GBQA 3I55T 4UC4A 4OF1A 1QCFA 2RQVA 4JS5A 1MNDA 3FDRA 1VQNA 1OPKA 5HY6A 3NMZC 1WXTA 3OMCA 3VS5A 2DERA 4J9DA 1V29B 2FO0A 2RJCA 4E7HA 2W10A 1GCQC 1N6AA 1WFWA 5IXBA 3HFNA 1KIKA 1YP5A 1LCKA 2QQAA 1D09B 4KGZB 2EQJA 1I81A 3R6NA 2E3IA 4CRIA 4FYVB 3SDZA 3A8OB 3MCAB 1G3SA
chains in the Genus database with same CATH topology
3OB9A 3UT1A 1BI3A 4GLKA 4N0AC 2E6ZA 4BE2A 2M9UA 1Q81U 3GPLA 4Y28E 1YCYA 5GANe 2K5LA 4A4HA 4EPCA 5GAMf 1VQMA 5KCHA 2P0QA 1BI0A 1VUBA 2LCLA 4EMHA 1JRIA 3C4SA 1QVPA 2VUBA 4YTLA 3MEUA 4M7AA 3GP8A 2K2VA 3JRZA 4NOYA 5GAOn 1M8VA 3CCRA 1OZ2A 1JBMA 2KK4A 4B9XA 4ZGDB 2RD1A 2DTIA 4L5GA 3CCSA 3CCLA 3GF5A 2DD5A 4J83A 3GOXA 2DO3A 1KG1A 1VQ8A 5GAOm 4QQ6A 3GLXA 3L42A 3URGA 4PJOC 4X34A 2WSEE 3TREA 4M78E 2EJFA 4BD3A 1VQNT 3BW1A 4JLGA 1O9SA 2D0QB 3FC3A 4HT8A 2IVWA 2WSFE 4PJOB 3QJ6A 3CCEA 4E47A 4XTZA 2CZ0B 3OA6A 4LDVA 3QJYA 4IURA 3FJPA 1NZ9A 4EMKC 3L2QA 2GFAA 1M5Q1 5GAMg 3S3NA 3UDCA 1YHQT 2L89A 3CCQA 3M4GA 3FEOA 2CS7A 4MDWA 2VXFA 2MMPA 4RCCA 4F7UG 5GAN5 1VQ4T 1D3BA 2EQMA 3LYIA 3FRNA 3NTKA 4IKFA 2ZPGB 3OYNA 1QP3A 4M75E 1FXXA 4KBMB 2X4XA 4IUUA 3M56A 3VUZA 5GMKi 1YI2A 2E1HA 1QVGS 5LJ3h 2PVDB 2RJFA 5GAOl 1VQKA 4NS5A 1GXIE 2R58A 4XTVA 5LJ5h 3L2ZA 1VQ8T 2E41A 3BDUA 4MMLA 4CI0C 3KXTA 4JRKA 4M78F 4KUDK 4PJOG 1M90C 1BIAA 2YRVA 3QG1A 3LWIA 1HXDA 5CQYA 2WACA 2RHYA 2E6NA 2NLUA 3MP8A 3JB9F 3VKIA 1VQMT 1KHCA 1UB4A 3SB2A 4M7AD 4JRIA 1LNXA 3ER0A 3RMQA 1ZQ1A 2LNVA 3JSCA 1NE8A 3M57A 4C8QA 2LT1A 4BI3A 2DXTA 3OYAA 4ELYC 3JCMQ 2V8JA 3CCRT 4L6V5 2VXEA 3CCST 4M75D 3CCLT 3HRUA 5I21A 2O01E 3MP6A 4XTUA 5KCOA 2HQXA 4OGCA 3RERA 3OMGA 3QXEB 4JLIA 1VIFA 4FT4A 4JUVA 4HCCA 3CMET 4BY6C 1BIBA 4C92A 3M53A 3ZFJA 2X4WA 3HRSA 4V2SA 5GAN2 2D9TA 3GNFB 3SWNC 1B34A 3VYGA 3QDRB 5LJ3d 3O8VA 3CCET 1X6OA 3V7SA 4J6WA 5LJ5d 3OYBA 2QXFA 4C0DC 2LCCA 2RJDA 1EIFA 4PKCC 1JB0E 3MEVA 2DKGA 3JCMd 3G7ZA 4IUPA 4LDUA 4M77E 5A2QE 3HFOA 3L2UA 3CCQT 2E10A 1I5LA 5GMKh 1KQ1A 1M1GA 4RMOA 4A4GA 5IT9E 5FLXE 5LJ3j 1Y96A 2OTJT 5LJ5j 4J5YA 5GANd 2DPPB 3S3MA 4M78C 5CVIA 1BYMA 3OBWA 3QSUA 2DTHA 1VQKT 1YIJA 3HSBA 3SD4A 2LQKA 4PJOF 3CCMT 4M78B 4HCZA 4JDSA 2QEXA 3CCJA 1YJ9A 2OAUA 3HL8A 4A4KA 4E7JA 3ASKA 5GAN4 3KBGA 3OYDA 3PGGA 2K3YA 4ZN1A 3QZ5B 1M1KC 1YHQA 3X24B 3PMIA 4E7KA 1QVGA 2JZ2A 5L8RE 3ZEHA 2HAXA 3OQ5A 1H3ZA 4PL6A 4PLIA 3UPUA 2K3XA 2XK0A 4C5GA 3RESA 4M7AB 2L3RA 2CYZB 5LJ3e 4M75C 4M77F 3AHUA 4RKUE 5D6XA 5LJ5e 1P92A 3X25B 3H6ZA 4DOVA 4M75B 2EYQA 3PT9A 2DZ9A 2KAFA 4JS4A 1FX7A 4QVDA 4XTWA 5FU7C 5C6SA 2DD4A 3JCMV 1RL2A 2XU8A 3HRTA 4M78G 2RB6A 2QQ9A 1WJQA 5FROA 2R57A 4C92D 2DZCA 5FU7B 3CCVA 4M7DA 3EFRA 1O75A 4B9WA 3CCUT 1I8FA 4OB2B 3JB9G 1VQ6A 1PSEA 2EKOA 2RI5A 3F70A 4KULA 3INZA 3M4YA 3MP1A 2QA4T 2RHXA 2XDPA 2DEQA 3TEEA 5CAIA 5GMKj 4A53A 1Y71A 4M7AG 3MEAA 3S6WA 2GCXA 3E19A 1VQ5A 3NFCA 1WJRA 2PVGB 4Q5WA 4HT9A 4XU2A 2ZPBB 1X01A 3CMEA 4BDYA 4QVZA 3OBYA 4M75G 1R8OB 3V8LA 5HK0A 2XHCA 1WQWA 2A3LA 2XKOC 1MGQA 2M16A 3WXMB 5HKCA 5D6YA 1M90U 4J7IA 2LDMA 1YIJT 1QP2A 1YITA 4KT0E 2QEXT 4OMFB 3L2WA 3V8KA 3CCJT 1YJ9T 3PFSA 2ZPFB 3A5ZB 2CZ1B 5EG2A 4RG2A 4ELZC 2O4XB 4JJNK 4ZTJA 1OI1A 2C06A 5GMKe 2VYTA 5GAMh 2RM4A 4M77C 5LJ3f 1KHIA 3DLLA 5CR2A 3Q1JA 4X9DA 1IZ6A 3WVEB 4BUGA 5LJ5f 3BY7A 3LX7A 3DB3A 2RJEA 1NJIC 3G71A 4M77B 3ME9A 2LRQA 2OTJA 3JCMf 2JN0A 2HD0A 2FL7A 2OTLA 5GMKl 2ZZDA 3RKYA 4LDYA 3CXCA 1RI0A 3OS1A 1W4SA 3BDLA 3CBPA 1LOJA 2GFUA 4ZGJB 3P8BB 2QDYB 5KH6A 5GANf 2XDDA 3OYHA 3CCMA 5A0GA 3UWNA 2VGMA 3FLGA 4OVAA 2E12A 3LGLA 4P5NA 5J3BA 2RI2A 1LJOA 2P0KA 4F7UA 1K9MC 2GF7A 5IAYA 2V8IA 2EIFA 5LL6S 3HPWA 2IG0A 3CCVT 4M7DD 3CEYA 2E5QA 2E70A 1M1FA 2X4YA 1VQ9T 4OB0B 2M0OA 1VQ6T 1B34B 3HHTB 5FU6B 4C0FA 3CC7A 2K57A 3RUXA 3N5BB 2LQ8A 1WJSA 3V7CA 4RG8A 4JRPA 4M7AF 4LDXA 1JJ2S 3A8GB 2K4YA 3OYMA 4M77G 5GAOq 4HCBA 1N27A 5KE2A 2PVOB 1VQ5T 2LX9A 2R5MA 5I2MA 4M75F 4QVCA 4BE0A 1G5VA 3JCMg 2L5QA 5GAMd 2JTFA 3PNWC 1N8RC 1Y96B 2HNIA 4BB7A 3P8DA 3JB9I 1KD1C 3C12A 2ZPHB 3HP9A 4J8OA 5IN1A 3OW2S 3QYHB 3TU4K 3KUFA 1UEBA 4EMKA 1YJNA 5GANg 2Y4YA 2HBPA 3CCUA 1YITT 4D6WA 3QO3A 2ZPIB 3WVDB 1M1KU 3VU3C 3X20B 2QA4A 1S72A 5GAMj 3OY9A 2I2LA 2A7YA 3C95A 4C5IA 1KQSS 3H8ZA 4A54A 2MWOA 5J26A 2JTMA 2EQUA 5KE3A 1YBYA 1XQHA 3QKJA 4J6XA 1Q86C 2E64A 5GAOp 2LTOA 4RCBA 2EWNA 1Y7XA 2QI2A 3RMSA 4C8QE 2XICA 3G71T 3M59A 4BACA 3LGFA 2XIDA 4BDZA 5GAN7 1QVFA 4IUQA 2OTLT 4NL3A 1XOVA 3CD6A 3L2RA 4QW2A 4R55A 2RHZA 1VQPT 4QQDA 1HK9A 2DAQA 2K5IA 3QYGB 1KC8C 1TH7A 2RHIA 5CKHA 4DA4A 4C92E 1PSFA 1UGPB 3J81E 1VQ7T 3OSSC 5GAMe 2YLBA 3CXCS 1OZ3A 2PU9B 1W2BS 4MDXA 2X35A 4Z02A 5D6WA 4Y91A 4M7AC 4M7DB 2FB7A 3RKWA 2P4TA 3OYLA 3HKSA 1WQ7A 2X4JA 3FB9A 3CC7T 1U8RA 2JOYA 1QW1A 4J7FA 4FU6A 4C8QD 3OYKA 3R6OA 4ATOA 2WSCE 3JCMb 2RH2A 1UGRB 2Y90A 3VV0A 1U1SA 3S3OA 2K5FA 2RA2A 2ZGWA 3GNGA 3SWNA 5J39A 2HQEA 3G4SA 5DY9A 2LC4A 2PUKB 1MHNA 2YHTA 3X28B 2KSSA 4XAXB 4FIBA 4XTYA 4ZN3A 3OYFA 4C92F 1YJNT 1JJ2A 4XU1A 1VQ9A 2DXBA 3PIOA 2G3RA 3JCMc 2DVEA 2QTXA 3G6EA 1KQ2A 2JUFA 2DTOA 1S72T 4WF2A 3OYYA 1G3YA 3PIPA 5I2SA 4ZTFA 1NJIU 1Q82C 1IREB 2RI3A 3LW5E 3E9FA 2RO0A 3OW2A 4M78A 4TVRA 3SFMA 3JB9H 4E7IA 5GMKm 3QIIA 2FVUA 1N9RA 2CZ6B 5A0LA 1D3BB 2RK2A 3NTHA 4FSXA 5DLQE 2CZ7B 3T9NA 1K8AC 2F5TX 2DIGA 1UGSB 4N4HA 4BI4A 4C5EA 3PTAA 1M4ZA 1KQSA 1VQOT 2VC8A 3CD6T 4ZGEB 5C0MA 2F5KA 1G3WA 5HK3A 1K9MU 2DK3A 1NPPA 3L1AA 4OB1B 1QVFS 2JNGA 1X75C 2BKDN 4II1A 5DLOA 1Q7YC 4M7DE 1XTDA 4A4FA 4F7UB 2EJGA 1K73C 1YJWT 4M75A 1SSFA 2LVMA 3OYJA 5CKFA 3VUBA 4X9CA 3LWHA 2VV5A 1VQLA 1WNLA 2QQSA 3QZ9B 4C8QC 4R56A 4L59A 2XG8D 3TCJA 3JAME 5FRNA 4IUTA 2M1HA 4MZMA 3CC4A 2V8KA 4O5VA 4C8QB 4N0AA 3CC2A 3JCMW 2FYKA 2H3JA 4DQ2A 1VQPA 4FT2A 1W2BA 3M54A 3VYHB 4MMKA 1Q81C 1N8RU 1KD1U 2L8DA 4C92C 4PNOA 3LH0A 4OB3B 1VQ7A 2EJ9A 4LD9K 2D6FA 1WGSA 2P0PA 1BKBA 3A8MB 3G4ST 2XDBA 4C92B 5FU6C 2PQWA 5M9OA 5FRMA 3CMAA 4FL6A 4EMKB 1VIEA 2MF2A 3M5AA 4O6JA 3OS0A 1AHJB 5GAN8 3I55A 4M7DF 3QHSA 2QQRA 4XU3A 3V8JA 3JCMX 4EMGA 3CBOA 4IUVA 3G6ET 1Q86U 2MWPA 1FWZA 2KQWA 1Y07A 3EFSA 4C0ZA 5LJ3g 4XK8E 1WPYA 3META 4PJOA 3I56A 2VGNA 2DJZA 4XU0A 5LJ5g 4M78D 3LLRA 4N4IA 4C8QG 2BUDA 3MEWA 2PUOB 4E7LA 3JCMh 2JVVA 3X26B 4A4EA 2O4XA 3ZBDA 4DOWA 1ZBXA 3JB9D 2DXUA 2B8AA 4J6YA 4LD6A 5GAN3 3JCMP 1KC8U 1ZHIA 5CQXA 3OS5A 1M9SA 3PMTA 3VJPA 3OYIA 2RHUA 3J7AF 5GANh 4HKEA 4F7UE 3QBYA 4M77A 3V7RA 4C92G 3OS2A 5CK9A 3M9QA 3CPWA 3A8HB 4NL2A 1VQLT 3NTIA 2BIVA 2DXCA 4ME7A 4BE1A 5A0DA 3OYGA 3GIBA 5CO7A 5DM7R 4VUBA 1G3TA 4M7AE 2EFIA 3MO8A 5GAN6 4PJOE 2MAMA 3P8HA 2CGHA 4XQ3A 2Y4XA 5CIUA 2LT4A 2MI6A 3CC4T 4QQGA 1VQOA 2CKKA 3BFMA 3CC2T 1XNIA 2KDSA 4C5HA 4BY6B 3J80E 2QQBA 1U1TA 4OP0A 2KVQG 2ZCFB 3E9GA 4LDWA 4FM4B 2KMTA 2YLCA 4HA8A 4XTXA 4M7DC 3A8LB 3SWNB 2EQKA 2ZPEB 3DKMA 4JRQA 4GY5A 3QUIA 3RKXA 4F7UF 1YJWA 3M58A 5CKDA 5AYFA 3RIRA 4MZTA 1OYXA 3CMAT 4C0DB 2AHJB 1N9SA 3DLMA 3OSVA 4UC4A 3I55T 4OF1A 2XI9A 1Q82U 5GAOr 4BI8B 4JS5A 3FDRA 3JCMJ 1YI2T 1VQNA 3E1SA 3C94A 3MHXA 3I56T 4C8QF 4PJOD 1H641 3M55A 1BI1A 5HY6A 1K8AU 3JB9J 4OGEA 1NPRA 2E65A 1DJ7B 3OMCA 1V29B 2RJCA 4MZPA 5CKEA 1UGQB 4E7HA 2RK1A 1N6AA 5GANj 4KUIA 5CCAA 3HFNA 5CKBA 1VQ4A 1I4K1 4C0GA 4PLLA 1Q7YU 2F69A 2QQAA 3DB4A 3FIFA 3L2VA 2R5AA 4M77D 1K73U 2DIQA 4M7DG 1BI2A 2EQJA 2FHDA 4N4GA 2KY9A 3OYCA 2GQVA 1I81A 3CBMA 3CPFA 2XD0A 2EAYA 4CRIA 4EDUA 3SDZA 3A8OB 3EAEA 3MCAB 3JCMe 3OYEA 3QPHA 1G3SA 3CPWS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KBM B;  2LT4 A;  4XAX B;  2LQK A;  4L5G A;  2LT1 A;  2EYQ A; 
#chains in the Genus database with same CATH topology
 1FMV A;  2LX7 A;  4BE2 A;  3VS0 A;  1WHH A;  1YCY A;  1K9A A;  2KYB A;  5KCH A;  1BI0 A;  4EMH A;  1JRI A;  1QVP A;  3GP8 A;  3JRZ A;  4NOY A;  5GAO n;  4FYW B;  1M8V A;  3CCR A;  1OZ2 A;  1IHV A;  3CCL A;  1QKX A;  1ZSZ A;  2L0A A;  3GOX A;  1KG1 A;  1JEG A;  1C0M A;  4PJO C;  2DVJ A;  1O9S A;  4HT8 A;  1MNE A;  3CCE A;  4XTZ A;  3OA6 A;  3QJY A;  1NZ9 A;  1IGQ A;  2GFA A;  3NHN A;  1YHQ T;  2L89 A;  4M7A E;  4M4Z A;  1HJD A;  2MMP A;  2HKQ B;  1D3B A;  3OYN A;  1JJ2 P;  4KBM B;  5GAO l;  2R58 A;  2P4R A;  3L2Z A;  3BDU A;  4MML A;  3KXT A;  4JRK A;  2X51 A;  1HXD A;  5CQY A;  3M0Q A;  2E6N A;  3MP8 A;  1IHW A;  1VQM T;  2KT1 A;  1TUG B;  2M02 A;  3SB2 A;  5KYN A;  4M7A D;  3ER0 A;  1ZQ1 A;  3JSC A;  1NE8 A;  1XJW B;  2DXT A;  3JCM Q;  4L6V 5;  3CME Q;  5I21 A;  2HQX A;  4CC2 A;  4BY6 C;  1YIT Q;  4FYY B;  1ZLM A;  4JJD A;  1ARK A;  5LJ3 d;  3O8V A;  2LCC A;  4PKC C;  1UFF A;  3MEV A;  2DKG A;  3JCM d;  4LDU A;  2GQI A;  4M77 E;  3L2U A;  3CCQ T;  1I5L A;  1M1G A;  5FLX E;  3AT1 B;  5LJ5 j;  4J5Y A;  2KE9 A;  5GAN d;  2DL3 A;  2X3W D;  1BYM A;  2XMF A;  1VQK T;  2QEX A;  2RN8 A;  2AIR B;  4JDS A;  4A4K A;  3HL8 A;  3KBG A;  3OYD A;  3PVL A;  1YHQ A;  3PMI A;  5KYU B;  2JZ2 A;  5L8R E;  3ZEH A;  4PL6 A;  3UPU A;  4C5G A;  2CYZ B;  4M75 C;  4M77 F;  3AHU A;  2DL8 A;  4JZ4 A;  4RKU E;  1I0C A;  1Z9Z A;  2JMA A;  4PJM A;  2D8J A;  2DX1 A;  3PT9 A;  1GFC A;  3VS3 A;  5FU7 C;  3EGD A;  2FZK B;  2QG9 B;  1WDX A;  2JT4 A;  1S72 Q;  1O75 A;  4KGV B;  2GTO A;  2JW4 A;  4B9W A;  1I8F A;  3CCU T;  1PSE A;  2J7I A;  2EPD A;  1D1A A;  5GMK j;  1Y71 A;  4DBR A;  3TSW A;  1VQ5 A;  3O5Z A;  3NFC A;  4Q5W A;  4IKF A;  1ABO A;  2L2P A;  1KSW A;  1OU8 A;  1MGQ A;  2IPO B;  2M16 A;  1D1C A;  3WXM B;  1YIJ T;  1QP2 A;  1QCN A;  3L2W A;  3V8K A;  3CCJ T;  2CZ1 B;  2YRD A;  4ELZ C;  2O4X B;  5GAM h;  5LJ3 f;  1IZ6 A;  3LX7 A;  3DB3 A;  2RJE A;  1UG1 A;  1NJI C;  3ME9 A;  3JCM f;  2HD0 A;  2FL7 A;  2OTL A;  2E5K A;  2JTE A;  1W4S A;  3BDL A;  3CBP A;  1LOJ A;  2F2X A;  5KH6 A;  5GAN f;  4RTX A;  4J9B A;  2VGM A;  3FLG A;  4OVA A;  1RAH B;  2RI2 A;  2P0K A;  1K9M C;  1QWF A;  1VQ9 Q;  3EGX B;  1HD3 A;  3G6E Q;  3HPW A;  2ABL A;  3CCV T;  4OB0 B;  2BZX A;  1OU9 A;  5FU6 B;  1TS9 A;  4RG8 A;  1JJ2 S;  5GAO q;  1JU5 C;  5I2M A;  4BE0 A;  1Q95 G;  2KEA A;  1CSK A;  3PNW C;  2HNI A;  3C12 A;  4J8O A;  5IN1 A;  2GTJ A;  2DET A;  2LP5 A;  3CCU A;  4RTY A;  1T3S A;  3OY9 A;  2A7Y A;  3C95 A;  2MWO A;  1XQH A;  2E64 A;  4E6R A;  1Y7X A;  2QI2 A;  4LE9 A;  4BAC A;  1G83 A;  1ZBJ A;  1VQ7 Q;  1VQP T;  3EH2 A;  1HK9 A;  1RAF B;  2QGF B;  5CKH A;  3J81 E;  3CMA Q;  1F1B B;  2CSQ A;  3CXC S;  1OZ3 A;  1TWB A;  3I55 Q;  4Z02 A;  4Y91 A;  4M7A C;  4M7D B;  3HKS A;  3CC7 T;  3A1P A;  2JOY A;  4FU6 A;  4ATO A;  2WSC E;  1UGR B;  3VV0 A;  3PE0 A;  1WZO A;  2K5F A;  1SRL A;  2ZGW A;  5J39 A;  2HQE A;  1X2Q A;  2KSS A;  4XAX B;  2HZY A;  4ZN3 A;  3LH5 A;  1JJ2 A;  1ZUU A;  2G3R A;  1JXO A;  2JUF A;  2DTO A;  1OX8 A;  3SFM A;  2AZV A;  1WHK A;  1N9R A;  1VQO Q;  2CZ7 B;  3T9N A;  2DIG A;  1UGS B;  1AWO A;  1T0J A;  3PTA A;  5KYU A;  2VC8 A;  4ZGE B;  3E2U A;  3PVQ A;  2FPE A;  5HK3 A;  2DK3 A;  1NPP A;  4OB1 B;  3G1J A;  2BKD N;  5DLO A;  2DE0 X;  4M7D E;  4RTT A;  4F7U B;  2RQU A;  1SSF A;  5CKF A;  4X9C A;  2D0N A;  3JAM E;  3UA6 A;  4KH0 B;  4C8Q B;  1WYX A;  4N0A A;  2M51 A;  2MOX A;  3MPU B;  1VQP A;  3M54 A;  5KYX B;  1Q86 R;  2EJ9 A;  2D6F A;  2XDB A;  4C92 B;  1ZA1 B;  2MF2 A;  4M7D F;  3QHS A;  3CBO A;  3EG9 B;  1WPY A;  2VGN A;  5LJ5 g;  2VWF A;  6AT1 B;  4M78 D;  4C8Q G;  3MEW A;  4PJN A;  1VQM Q;  2O4X A;  2P84 A;  3OW2 P;  2DXU A;  2DBK A;  5GAN 3;  4JZ3 A;  3OS5 A;  3OYI A;  4F7U E;  4C92 G;  5CK9 A;  3M0T A;  1VQL T;  4AG1 C;  4BE1 A;  5DM7 R;  2CSI A;  5GAN 6;  3MO8 A;  4PJO E;  3EGX A;  2Y4X A;  2MI6 A;  3CQT A;  3CC4 T;  1XNI A;  4C5H A;  4BY6 B;  1CKA A;  2YLC A;  2CRE A;  3CCQ Q;  1RAC B;  1BCO A;  4JRQ A;  4F7U F;  2JJ9 A;  4MZT A;  4R0K A;  1QMC A;  3DLM A;  1Q82 U;  1VQK Q;  5GAO r;  4AFQ C;  4BI8 B;  1UE9 A;  1YI2 T;  1X6B A;  4PJO D;  3C94 A;  3I56 T;  4C8Q F;  1BI1 A;  1K8A U;  3JB9 J;  1AWX A;  2RK1 A;  4FW1 A;  1R0C B;  2EBP A;  4KUI A;  5CKB A;  3VS2 A;  1I4K 1;  3HTR A;  1UGV A;  3DB4 A;  4AFU C;  1Q81 R;  4HCK A;  4FCY A;  1IO6 A;  5FWC A;  1BI2 A;  5IH2 A;  4N4G A;  4AFZ C;  3CBM A;  5FWB A;  2EAY A;  4EDU A;  3I5S A;  3JCM e;  3OYE A;  2FRY A;  1UJY A;  4GLK A;  1V1C A;  4N0A C;  2M9U A;  2SRC A;  1I1J A;  5GAN e;  4EPC A;  5GAM f;  2LCL A;  3C4S A;  5I11 A;  2C0T A;  2CUB A;  2KR3 A;  4B9X A;  2KBT A;  2NYS A;  4ZGD B;  3CCS A;  1QWE A;  2RD1 A;  3EH1 A;  2DD5 A;  2CT3 A;  2KI7 A;  1R77 A;  5GAO m;  1GL5 A;  3URG A;  1YIJ Q;  2WSE E;  1VQN T;  1RLP C;  3CCJ Q;  3FC3 A;  2IVW A;  1PHT A;  2A0F B;  2EYZ A;  2RQR A;  1PM3 A;  3THK A;  4E47 A;  2CZ0 B;  4IUR A;  3FJP A;  4EMK C;  2CS7 A;  4RCC A;  5GAN 5;  3ZL7 C;  1BK2 A;  4M75 E;  2X4X A;  5GMK i;  5IHI A;  1YI2 A;  2OX7 A;  5LJ3 h;  2PVD B;  1EFN A;  1GXI E;  4XTV A;  2F1L A;  2E41 A;  2KRO A;  3CCV Q;  2YRV A;  2WAC A;  2O9S A;  4E7S A;  3H9N A;  3JB9 F;  3VKI A;  3VS4 A;  1KHC A;  4OMM A;  2VVK A;  1UB4 A;  4IIM A;  2DYB A;  2LNV A;  2RQW A;  3M57 A;  4C8Q A;  1G5V A;  3TVT A;  1PG5 B;  3CCR T;  2VXE A;  4M75 D;  3CCL T;  3MP6 A;  5KYX A;  4XTU A;  5KCO A;  1EZZ B;  4FT4 A;  1U5S A;  1RUW A;  1CKB A;  1OPL A;  4C92 A;  3ZFJ A;  3GNF B;  3SWN C;  1B34 A;  3CCE T;  5LJ5 d;  3EG9 A;  1W2B P;  2QXF A;  1GBQ A;  3VRY A;  1MMG A;  3G7Z A;  1KQ1 A;  1H3H A;  5IT9 E;  1AOJ A;  1Y96 A;  2YUQ A;  2OTJ T;  2J6O A;  2DPP B;  4M78 C;  3OBW A;  2DTH A;  3CCM T;  1YJ9 A;  2OAU A;  4ZN1 A;  2O2O A;  3CC7 Q;  2LJ3 A;  1JXM A;  2K3X A;  2XK0 A;  4M7A B;  5KYY B;  1I5O B;  4OMP A;  5D6X A;  1MMD A;  1P92 A;  4DOV A;  3CPW P;  1FX7 A;  4QVD A;  1RL2 A;  2XU8 A;  1NJI R;  2DZC A;  1VQ6 A;  2E3H A;  3F70 A;  4KUL A;  2QA4 T;  3M4Y A;  1M90 R;  4M7A G;  2HBW A;  3E19 A;  2JS0 A;  1X2K A;  4XU2 A;  1X01 A;  2CP2 A;  2ECZ A;  3OBY A;  1R8O B;  3V8L A;  5HK0 A;  2HKN A;  1MV0 B;  2V26 A;  1GRI A;  4J7I A;  2CP7 A;  2QEX T;  4OMF B;  1BCM A;  1Y0M A;  2VB6 A;  3A5Z B;  5EG2 A;  1OI1 A;  2C06 A;  2LJ0 A;  4OMQ A;  1KHI A;  1M3B A;  2A37 A;  5LJ5 f;  3BY7 A;  3G71 A;  4M77 B;  2OTJ A;  2MCN A;  5GMK l;  2YRC A;  4DBQ A;  1RI0 A;  1WA7 A;  3CCM A;  3P8B B;  2QDY B;  4F17 A;  2E12 A;  2DF6 A;  2V8I A;  2EIF A;  1NEG A;  3CEY A;  3HHT B;  4C0F A;  1M2V A;  3V7C A;  4M7A F;  4LDX A;  5D7U A;  1R0B G;  4M77 G;  2BE7 D;  4PFO A;  1M1K R;  5KE2 A;  2LMJ A;  2PVO B;  1VQ5 T;  2LX9 A;  2R5M A;  4QVC A;  2L5Q A;  3SEM A;  2HDA A;  2JTF A;  4BB7 A;  3HP9 A;  3KUF A;  1UEB A;  3M0P A;  1YJN A;  2HBP A;  3QO3 A;  3WVD B;  3VU3 C;  3X20 B;  2QA4 A;  3EHR A;  4CC3 A;  1VQL Q;  2D1X A;  4A54 A;  5J26 A;  2EQU A;  4AFS C;  4AT1 B;  1YWP A;  2OI3 A;  5GAO p;  1AWW A;  3EG0 A;  2LTO A;  2EWN A;  4HVV A;  2O9V A;  1ABQ A;  3RMS A;  3CC4 Q;  3M59 A;  3LGF A;  1M30 A;  4IUQ A;  2OTL T;  4NL3 A;  3CD6 A;  4R55 A;  4QQD A;  3QYG B;  2RHI A;  1MUZ A;  9ATC B;  5GAM e;  2YLB A;  1QQJ A;  1NEB A;  2PU9 B;  1EX4 A;  2FG0 A;  1W2B S;  2KRN A;  2X35 A;  1LPL A;  3RDV A;  2P4T A;  1YI2 Q;  1WQ7 A;  2X4J A;  4Y92 A;  1B7T A;  3I56 Q;  1UEC A;  1D0Y A;  1ZSZ C;  3OYK A;  4OML A;  2RH2 A;  3UAT A;  4ORZ A;  1SHG A;  3S3O A;  1YNZ A;  3GNG A;  3G4S A;  5DY9 A;  2YHT A;  2C0O A;  2JM9 A;  2DJQ A;  3X28 B;  2DBM A;  1AZE A;  4D8K A;  2PZ1 A;  3OYF A;  3PIO A;  3JCM c;  4AMC A;  2DVE A;  2DL4 A;  2MK5 A;  4WF2 A;  1C1A A;  1Q82 C;  3JB9 H;  4E7I A;  5A0L A;  4FSX A;  1K8A C;  2K6D A;  2F5T X;  4N4H A;  1M4Z A;  1NYF A;  2F5K A;  3L1A A;  3RR6 A;  4WCI A;  1WHL A;  5KYY A;  4II1 A;  1N8R R;  4J9I A;  1YJW T;  1ZUY A;  1KD1 R;  3BE3 A;  3OYJ A;  2LVM A;  3VUB A;  2VV5 A;  4R56 A;  1VQN Q;  3H0H A;  1QVG P;  1OV3 A;  4IUT A;  4MZM A;  3CC2 A;  3JCM W;  4DQ2 A;  1W2B A;  4MMK A;  3A8M B;  3MJX A;  4FL6 A;  4EMK B;  1VA7 A;  1VIE A;  3V8J A;  4XU3 A;  3JCM X;  1Q86 U;  4EMG A;  1KC8 R;  4IUV A;  2COZ A;  1RAG B;  2KQW A;  4XK8 E;  3MET A;  2D8H A;  3LLR A;  2BUD A;  2PUO B;  2FZC B;  4ESR A;  4DOW A;  2ED1 A;  3JCM P;  1B07 A;  1T3L A;  2JXB A;  4PFP A;  1M9S A;  3PMT A;  2RHU A;  2GNC A;  3QBY A;  4M77 A;  3V7R A;  3OS2 A;  3CCR Q;  3CCL Q;  3CPW A;  1UUE A;  1V76 A;  4NL2 A;  1FYN A;  1M3A A;  2DXC A;  3VS1 A;  5A0D A;  1G3T A;  2EFI A;  5CIU A;  3VS7 A;  2CUD A;  3CCE Q;  2V1R A;  2CKK A;  2A08 A;  3J80 E;  4FSS A;  1BBZ A;  2BZ8 A;  2QQB A;  1S1N A;  2ZCF B;  3E9G A;  2KMT A;  4HA8 A;  1WHG A;  3SWN B;  3VS6 A;  4GY5 A;  1PD1 A;  1YJW A;  1PRL C;  3RIR A;  2OTJ Q;  1KJW A;  4RTZ A;  5ECA A;  2XI9 A;  4DBH A;  4A63 B;  3JCM J;  1VOM A;  1H64 1;  2M0Y A;  2X3X D;  1K73 R;  1NPR A;  2EQI A;  3A98 A;  2DL5 A;  5GAN j;  1OX9 A;  2COW A;  1VYV A;  1VQ4 A;  4C0G A;  1N5Z A;  4PLL A;  1Q7Y U;  2F69 A;  3L2V A;  2R5A A;  1NLO C;  4M7D G;  2FHD A;  3OYC A;  1SF9 A;  2DLP A;  2XD0 A;  1WLP B;  1VQ8 A;  5AT1 B;  2MYS A;  2LQW A;  3UT1 A;  1BI3 A;  2E6Z A;  2KGT A;  1Q81 U;  3GPL A;  2I0N A;  1W6X A;  2K5L A;  4F16 A;  1NLP C;  2ROT A;  1QVF P;  4YTL A;  1OQK A;  2K2V A;  2KK4 A;  1JBM A;  2DFU A;  4L5G A;  3UF4 A;  3GF5 A;  4J9C A;  4J83 A;  4HXJ A;  2KXC A;  1QKW A;  4QQ6 A;  3L42 A;  4X34 A;  3KFV A;  2QEX Q;  3TRE A;  4M78 E;  1M27 C;  3BW1 A;  4JLG A;  2EYX A;  4RTW A;  2D0Q B;  4PJO B;  1G8X A;  4OMN A;  1YHQ Q;  4LDV A;  3I35 A;  3UDC A;  3M4G A;  4F7U G;  1AEY A;  2EQM A;  3NTK A;  2RF0 A;  1FXX A;  4IUU A;  1QVG S;  3VUZ A;  2E1H A;  2RJF A;  4NS5 A;  5LJ5 h;  1HSQ A;  2YWW A;  4CI0 C;  2J6K A;  4M78 F;  4PJO G;  1BIA A;  3LWI A;  2K3B A;  2RHY A;  2EGA A;  1U3O A;  2NLU A;  5HCK A;  1NM7 A;  2KNB B;  1RAE B;  1OUL A;  2DYI A;  1KQS P;  4JRI A;  1LNX A;  3RMQ A;  3OYA A;  1VQ5 Q;  4BI3 A;  4ELY C;  3CCS T;  2O01 E;  1HYO A;  4OGC A;  3RER A;  2BTT A;  2FRW A;  3QXE B;  3CME T;  3HRS A;  4V2S A;  5GAN 2;  2D9T A;  3VYG A;  2RQT A;  4RTV A;  1X6O A;  3V7S A;  2FEI A;  4J6W A;  4C0D C;  1VYT A;  1JB0 E;  5A2Q E;  4IUP A;  3HFO A;  3TQ7 P;  2E10 A;  5GMK h;  2OTL Q;  2HL5 C;  2QGG A;  3C0C A;  4PK4 A;  3S3M A;  1BB9 A;  3QSU A;  3HSB A;  2K79 A;  4PJO F;  2O88 A;  2K2M A;  3QWX X;  2B86 A;  4E7J A;  2EVR A;  5GAN 4;  3H0F A;  3PGG A;  3QZ5 B;  3X24 B;  2A28 A;  1QVG A;  1H3Z A;  3OQ5 A;  4PLI A;  2YUO A;  5LJ3 e;  1K0S A;  2LNH B;  3H6Z A;  4M75 B;  2EYQ A;  2KAF A;  1ZSZ B;  1TOV A;  4JS4 A;  2DD4 A;  3JCM V;  3EG3 A;  3CCU Q;  1WJQ A;  3GBQ A;  4C92 D;  2MIO A;  5FU7 B;  4M7D A;  3EFR A;  3JB9 G;  4PFZ A;  2EKO A;  2EW3 A;  5FW9 A;  1IXD A;  3EG2 A;  2DEQ A;  5CAI A;  4A53 A;  2AKL A;  3MEA A;  3S6W A;  1GBR A;  3EGU A;  2EGC A;  1WJR A;  2PVG B;  4HT9 A;  3CME A;  1T0H A;  4M75 G;  1WQW A;  2H8H A;  1M2O A;  3REB B;  5HKC A;  5D6Y A;  1GCQ A;  1M90 U;  2LDM A;  1SKU B;  1YIT A;  4KT0 E;  1YJW Q;  1YJ9 T;  3I5R A;  2JMC A;  4ZTJ A;  2ED0 A;  3DLL A;  3WVE B;  4BUG A;  2DEU A;  2FPD A;  2LRQ A;  2JN0 A;  4QKU A;  1NYG A;  1IGU A;  3RKY A;  4LDY A;  4ZGJ B;  2GFU A;  1X43 A;  4WTO B;  2YT6 A;  4P5N A;  4F7U A;  5J3B A;  4CC4 B;  5LL6 S;  2IG0 A;  1YN8 A;  2X4Y A;  1VQ9 T;  1VQ6 T;  2ZAE A;  3RBB B;  1WJS A;  4JRP A;  3A8G B;  2K4Y A;  3OYM A;  2HMA A;  3FJ5 A;  4M75 F;  3JCM g;  2ENM A;  1TXQ A;  2ATC B;  2J06 A;  2J05 A;  3TU4 K;  2ZPH B;  3OW2 S;  1YCS B;  1QCO A;  3QYH B;  1D0X A;  1WHM A;  1ZA2 B;  5GAN g;  4D6W A;  2CT4 A;  1M1K U;  1S72 A;  5GAM j;  2I2L A;  1KQS S;  1PC0 A;  2JTM A;  1YBY A;  4J6X A;  1Q86 C;  2XIC A;  4JPB W;  3G71 T;  5KYW B;  1VQP Q;  1QVF A;  2V1Q A;  4ANJ A;  4IIO A;  2RHZ A;  2DAQ A;  2NUP B;  4DA4 A;  8ATC B;  1UGP B;  3EGD B;  1VQ7 T;  4MDX A;  2BE9 B;  1J3T A;  3OYL A;  3M0S A;  1RAI B;  3FB9 A;  1UTI A;  1AT1 B;  2Y90 A;  4J9E A;  1U1S A;  2CP0 A;  2PUK B;  2CDT A;  2HEQ A;  3QDF A;  4XTY A;  1YJN T;  1VQ9 A;  2DXB A;  4RTU A;  3G6E A;  2QTX A;  3OYY A;  1K9M R;  1IRE B;  2RI3 A;  3E9F A;  2RO0 A;  3OW2 A;  4TVR A;  3QII A;  2CZ6 B;  1SEM A;  2YSQ A;  4BI4 A;  1KQS A;  4HVW A;  1VQO T;  3CD6 T;  2OAW A;  2LCS A;  5C0M A;  2DA9 A;  3U23 A;  2BZY A;  1Q7Y C;  1XTD A;  4A4F A;  1H92 A;  4M75 A;  1PKS A;  4EIK A;  2F2W A;  5EC7 A;  1WNL A;  2COY A;  2QQS A;  3QZ9 B;  4C8Q C;  4GBQ A;  2KRS A;  2XG8 D;  3TCJ A;  1AWJ A;  2V8K A;  2H3J A;  1Q81 C;  1M8M A;  1N8R U;  3VYH B;  4PJL A;  1KD1 U;  2L8D A;  4LXC A;  4C92 C;  4PNO A;  1VQ7 A;  4LD9 K;  1WGS A;  2P0P A;  3G4S T;  2HL3 A;  1ZUK A;  2PQW A;  5FRM A;  3CMA A;  2EKH A;  3I55 A;  3M5A A;  1WX6 A;  4E2F B;  2MWP A;  1YWO A;  4C0Z A;  2OJ2 A;  2DMO A;  2DJZ A;  2VAS A;  1ZSG A;  4N4I A;  1X27 A;  4E7L A;  1E7O A;  2O31 A;  4Z8A A;  3ZBD A;  1KC8 U;  4LD6 A;  1WXB A;  1NBE B;  1ZHI A;  2DRM A;  5CQX A;  4B6M A;  1MMN A;  3CCS Q;  3M9Q A;  4D8D A;  3A8H B;  2G6F X;  4ME7 A;  3GIB A;  5CO7 A;  4VUB A;  2MAM A;  4XQ3 A;  4Z89 A;  1VQO A;  1X6G A;  3BFM A;  3CC2 T;  2KDS A;  1UHF A;  8AT1 B;  1U1T A;  2CH4 W;  4OP0 A;  4LDW A;  4FM4 B;  3CXC P;  2HSE B;  4XTX A;  1X69 A;  3A8L B;  2EQK A;  2ZPE B;  1PWT A;  3DKM A;  3QUI A;  3M58 A;  5AYF A;  1PD0 A;  4C0D B;  1N9S A;  1Z9Q A;  3OSV A;  4J9H A;  5IXF A;  1MMA A;  3E1S A;  3MHX A;  3M55 A;  1AVZ C;  4OGE A;  2E65 A;  1DJ7 B;  4MZP A;  2QDL A;  5CKE A;  1UGQ B;  2NUZ A;  4Z88 A;  4QT7 A;  5CCA A;  2QAS A;  3FIF A;  3M0R A;  4M77 D;  1K73 U;  2DIQ A;  5KYW A;  2KY9 A;  2GQV A;  3CPF A;  2DM1 A;  2NUP A;  3EAE A;  3QPH A;  3CPW S;  3OB9 A;  1SRM A;  3I9Q A;  4RUG A;  4AG2 C;  1UJ0 A;  1UDL A;  4Y28 E;  2PNI A;  1ACM B;  4A4H A;  1VQM A;  2P0Q A;  1VUB A;  4K11 A;  2VUB A;  3MEU A;  4M7A A;  2C0I A;  3EG1 A;  2LQN A;  2DTI A;  2DO3 A;  2W0Z A;  3GLX A;  4KGX B;  4BD3 A;  2EJF A;  1KFZ A;  1YJ9 Q;  2YUN A;  2WSF E;  3QJ6 A;  2F2V A;  3L2Q A;  1SG5 A;  1M5Q 1;  2IIM A;  2L3P A;  5GAM g;  3S3N A;  1TG0 A;  3CCQ A;  4MDW A;  3FEO A;  1VQ4 T;  2NWM A;  2VXF A;  3J7A F;  2VKN A;  2L3Q A;  2KRM A;  3LYI A;  3FRN A;  2DNU A;  2ZPG B;  1QP3 A;  1AD5 A;  3M56 A;  2RNA A;  1VQK A;  1VQ8 T;  2AT1 B;  4KUD K;  1M90 C;  2KT8 A;  3QG1 A;  1VQ6 Q;  3ULR B;  1KK7 A;  1TU0 B;  5GJW B;  1E6G A;  2PTK A;  2LT1 A;  2FPF A;  2V8J A;  3HRU A;  1PRM C;  4DEX A;  2RMO A;  3H0I A;  2EYW A;  3D7S B;  3OMG A;  1VIF A;  4JLI A;  2CP5 A;  4JUV A;  4HCC A;  1PCX A;  1UHC A;  1AZG B;  1BIB A;  1WI7 A;  3M53 A;  4GLM A;  2EGE A;  2X4W A;  2J6F A;  2K9G A;  2QYZ A;  3QDR B;  1RAA B;  3OYB A;  2RJD A;  1EIF A;  1H8K A;  1RLQ C;  3G71 Q;  4J9F A;  1NG2 A;  2HSP A;  2GGR A;  3NGP A;  4RMO A;  4A4G A;  5LJ3 j;  2E4H A;  4KH1 B;  3TSZ A;  3CCM Q;  5CVI A;  1YIJ A;  1RAD B;  1TUC A;  2LQK A;  5GJV B;  3SD4 A;  4M78 B;  4HCZ A;  3CCJ A;  2KYM A;  2JM8 A;  3ASK A;  2K3Y A;  1M1K C;  4E7K A;  2HAX A;  2HCK A;  3RES A;  2L3R A;  4J9G A;  2CP6 A;  5LJ5 e;  3X25 B;  1B3Q A;  2DZ9 A;  4JJB A;  1E6H A;  4XTW A;  4CC7 A;  2MPX C;  5C6S A;  1YJN Q;  3HRT A;  1IB8 A;  4M78 G;  2RB6 A;  2QQ9 A;  3EFO B;  5FRO A;  2R57 A;  2QAZ A;  2YUP A;  3UA7 A;  3CCV A;  2QA4 Q;  4OB2 B;  2ESW A;  2RI5 A;  3INZ A;  3MP1 A;  1TTH B;  2RHX A;  2XDP A;  5IHK A;  3TEE A;  1K0X A;  2GCX A;  4F14 A;  2ROL A;  2SEM A;  3RNJ A;  1M3C A;  2ZPB B;  4BDY A;  3CD6 Q;  4QVZ A;  2XHC A;  2A3L A;  2XKO C;  2HQH A;  3M0U A;  2L3S A;  3PFS A;  2ZPF B;  2LZ6 B;  3VRZ A;  4JJN K;  4RG2 A;  5GMK e;  2VYT A;  2DIL A;  2RM4 A;  4M77 C;  5CR2 A;  3Q1J A;  4X9D A;  2AK5 A;  2NUT B;  4ZNX A;  1BU1 A;  3IQL A;  3MKD A;  2ZZD A;  3REA B;  1GFD A;  1OEB A;  3CXC A;  1RAB B;  3OS1 A;  2Z0W A;  3G4S Q;  1OOT A;  2XDD A;  3OYH A;  4FW2 A;  5A0G A;  3UWN A;  2H3E B;  3LGL A;  1LJO A;  1D1B A;  2GF7 A;  2AKK A;  5IAY A;  4M7D D;  4DBF A;  2E5Q A;  2E70 A;  1M1F A;  1TSF A;  2M0O A;  2YDL A;  1B34 B;  3CC7 A;  2K57 A;  3RUX A;  3N5B B;  2LQ8 A;  4X1V A;  4HCB A;  1N27 A;  1VYU A;  5GAM d;  1N8R C;  2K7A A;  2CH4 A;  1Y96 B;  3JB9 I;  3P8D A;  1KD1 C;  4EMK A;  2DL7 A;  1QLY A;  2Y4Y A;  1YIT T;  1IRX A;  2ZPI B;  4C5I A;  3H8Z A;  2AZS A;  5KE3 A;  3QKJ A;  1K4U S;  1K1Z A;  4RCB A;  4C8Q E;  1SHF A;  3CC2 Q;  2XID A;  4BDZ A;  5GAN 7;  1XOV A;  1C6V X;  1D0Z A;  2CP3 A;  3L2R A;  2LJ1 A;  4QW2 A;  2K5I A;  2QK0 A;  1KC8 C;  1TH7 A;  4C92 E;  1PSF A;  1G2B A;  3OSS C;  5D6W A;  2FB7 A;  1ZX6 A;  3RKW A;  1RI9 A;  1TUD A;  4E7Z A;  1U8R A;  1QW1 A;  4J7F A;  1MV3 A;  4C8Q D;  3R6O A;  1Q7Y R;  3JCM b;  2A36 A;  4LN2 A;  2EYY A;  4FYX B;  2RA2 A;  3SWN A;  2LC4 A;  1MHN A;  1Y57 A;  1WXU A;  4FIB A;  4C92 F;  4XU1 A;  1WIE A;  4LUE A;  4DEY A;  1KQ2 A;  1S72 T;  1G3Y A;  3PIP A;  5I2S A;  4ZTF A;  5L23 A;  1NJI U;  3LW5 E;  4KRT A;  4M78 A;  5GMK m;  2FVU A;  3JV3 A;  1D3B B;  2RK2 A;  3NTH A;  5DLQ E;  3QWY A;  1YFN A;  4C5E A;  4OMO A;  2X9H A;  3EHQ A;  2QTV A;  1G3W A;  1K9M U;  7AT1 B;  1QVF S;  2JNG A;  1X75 C;  5IHN A;  1W70 A;  2EJG A;  1K73 C;  2RPN A;  1VQL A;  3LWH A;  4PJJ A;  4L59 A;  3EFO A;  5FRN A;  2M1H A;  1M2V B;  3CC4 A;  4O5V A;  1A0N B;  2FYK A;  1WHJ A;  1FMW A;  4FT2 A;  3H41 A;  2JS2 A;  3LH0 A;  4OB3 B;  1VQ4 Q;  1BKB A;  1SPK A;  4LUD A;  5FU6 C;  5M9O A;  1SSH A;  1I07 A;  3OS0 A;  1K76 A;  4O6J A;  1AHJ B;  5GAN 8;  3G6E T;  2QQR A;  4LNP A;  1JO8 A;  3EFS A;  1FWZ A;  1Y07 A;  1VQ8 Q;  5LJ3 g;  4PJO A;  3I56 A;  4XU0 A;  1PKT A;  1LVK A;  3JCM h;  2JVV A;  3X26 B;  4A4E A;  1JQQ A;  1ZBX A;  3JB9 D;  2KXD A;  2B8A A;  4J6Y A;  2DRK A;  4HVU A;  2NUT A;  3VJP A;  2FZG B;  2YXY A;  5GAN h;  4HKE A;  4JJC A;  1GCP A;  1FMK A;  3NTI A;  2BIV A;  3OYG A;  3P8H A;  3SHW A;  2CGH A;  2LT4 A;  4QQG A;  1PNJ A;  4F04 B;  1Q82 R;  2KVQ G;  3NPF A;  1U06 A;  4M7D C;  5I22 A;  1K8A R;  3RKX A;  5CKD A;  1OYX A;  3CMA T;  2AHJ B;  1W1F A;  2GBQ A;  3I55 T;  4UC4 A;  4OF1 A;  1QCF A;  2RQV A;  4JS5 A;  1MND A;  3FDR A;  1VQN A;  1OPK A;  5HY6 A;  3NMZ C;  1WXT A;  3OMC A;  3VS5 A;  2DER A;  4J9D A;  1V29 B;  2FO0 A;  2RJC A;  4E7H A;  2W10 A;  1GCQ C;  1N6A A;  1WFW A;  5IXB A;  3HFN A;  1KIK A;  1YP5 A;  1LCK A;  2QQA A;  1D09 B;  4KGZ B;  2EQJ A;  1I81 A;  3R6N A;  2E3I A;  4CRI A;  4FYV B;  3SDZ A;  3A8O B;  3MCA B;  1G3S A; 
#chains in the Genus database with same CATH homology
 3OB9 A;  3UT1 A;  1BI3 A;  4GLK A;  4N0A C;  2E6Z A;  4BE2 A;  2M9U A;  1Q81 U;  3GPL A;  4Y28 E;  1YCY A;  5GAN e;  2K5L A;  4A4H A;  4EPC A;  5GAM f;  1VQM A;  5KCH A;  2P0Q A;  1BI0 A;  1VUB A;  2LCL A;  4EMH A;  1JRI A;  3C4S A;  1QVP A;  2VUB A;  4YTL A;  3MEU A;  4M7A A;  3GP8 A;  2K2V A;  3JRZ A;  4NOY A;  5GAO n;  1M8V A;  3CCR A;  1OZ2 A;  1JBM A;  2KK4 A;  4B9X A;  4ZGD B;  2RD1 A;  2DTI A;  4L5G A;  3CCS A;  3CCL A;  3GF5 A;  2DD5 A;  4J83 A;  3GOX A;  2DO3 A;  1KG1 A;  1VQ8 A;  5GAO m;  4QQ6 A;  3GLX A;  3L42 A;  3URG A;  4PJO C;  4X34 A;  2WSE E;  3TRE A;  4M78 E;  2EJF A;  4BD3 A;  1VQN T;  3BW1 A;  4JLG A;  1O9S A;  2D0Q B;  3FC3 A;  4HT8 A;  2IVW A;  2WSF E;  4PJO B;  3QJ6 A;  3CCE A;  4E47 A;  4XTZ A;  2CZ0 B;  3OA6 A;  4LDV A;  3QJY A;  4IUR A;  3FJP A;  1NZ9 A;  4EMK C;  3L2Q A;  2GFA A;  1M5Q 1;  5GAM g;  3S3N A;  3UDC A;  1YHQ T;  2L89 A;  3CCQ A;  3M4G A;  3FEO A;  2CS7 A;  4MDW A;  2VXF A;  2MMP A;  4RCC A;  4F7U G;  5GAN 5;  1VQ4 T;  1D3B A;  2EQM A;  3LYI A;  3FRN A;  3NTK A;  4IKF A;  2ZPG B;  3OYN A;  1QP3 A;  4M75 E;  1FXX A;  4KBM B;  2X4X A;  4IUU A;  3M56 A;  3VUZ A;  5GMK i;  1YI2 A;  2E1H A;  1QVG S;  5LJ3 h;  2PVD B;  2RJF A;  5GAO l;  1VQK A;  4NS5 A;  1GXI E;  2R58 A;  4XTV A;  5LJ5 h;  3L2Z A;  1VQ8 T;  2E41 A;  3BDU A;  4MML A;  4CI0 C;  3KXT A;  4JRK A;  4M78 F;  4KUD K;  4PJO G;  1M90 C;  1BIA A;  2YRV A;  3QG1 A;  3LWI A;  1HXD A;  5CQY A;  2WAC A;  2RHY A;  2E6N A;  2NLU A;  3MP8 A;  3JB9 F;  3VKI A;  1VQM T;  1KHC A;  1UB4 A;  3SB2 A;  4M7A D;  4JRI A;  1LNX A;  3ER0 A;  3RMQ A;  1ZQ1 A;  2LNV A;  3JSC A;  1NE8 A;  3M57 A;  4C8Q A;  2LT1 A;  4BI3 A;  2DXT A;  3OYA A;  4ELY C;  3JCM Q;  2V8J A;  3CCR T;  4L6V 5;  2VXE A;  3CCS T;  4M75 D;  3CCL T;  3HRU A;  5I21 A;  2O01 E;  3MP6 A;  4XTU A;  5KCO A;  2HQX A;  4OGC A;  3RER A;  3OMG A;  3QXE B;  4JLI A;  1VIF A;  4FT4 A;  4JUV A;  4HCC A;  3CME T;  4BY6 C;  1BIB A;  4C92 A;  3M53 A;  3ZFJ A;  2X4W A;  3HRS A;  4V2S A;  5GAN 2;  2D9T A;  3GNF B;  3SWN C;  1B34 A;  3VYG A;  3QDR B;  5LJ3 d;  3O8V A;  3CCE T;  1X6O A;  3V7S A;  4J6W A;  5LJ5 d;  3OYB A;  2QXF A;  4C0D C;  2LCC A;  2RJD A;  1EIF A;  4PKC C;  1JB0 E;  3MEV A;  2DKG A;  3JCM d;  3G7Z A;  4IUP A;  4LDU A;  4M77 E;  5A2Q E;  3HFO A;  3L2U A;  3CCQ T;  2E10 A;  1I5L A;  5GMK h;  1KQ1 A;  1M1G A;  4RMO A;  4A4G A;  5IT9 E;  5FLX E;  5LJ3 j;  1Y96 A;  2OTJ T;  5LJ5 j;  4J5Y A;  5GAN d;  2DPP B;  3S3M A;  4M78 C;  5CVI A;  1BYM A;  3OBW A;  3QSU A;  2DTH A;  1VQK T;  1YIJ A;  3HSB A;  3SD4 A;  2LQK A;  4PJO F;  3CCM T;  4M78 B;  4HCZ A;  4JDS A;  2QEX A;  3CCJ A;  1YJ9 A;  2OAU A;  3HL8 A;  4A4K A;  4E7J A;  3ASK A;  5GAN 4;  3KBG A;  3OYD A;  3PGG A;  2K3Y A;  4ZN1 A;  3QZ5 B;  1M1K C;  1YHQ A;  3X24 B;  3PMI A;  4E7K A;  1QVG A;  2JZ2 A;  5L8R E;  3ZEH A;  2HAX A;  3OQ5 A;  1H3Z A;  4PL6 A;  4PLI A;  3UPU A;  2K3X A;  2XK0 A;  4C5G A;  3RES A;  4M7A B;  2L3R A;  2CYZ B;  5LJ3 e;  4M75 C;  4M77 F;  3AHU A;  4RKU E;  5D6X A;  5LJ5 e;  1P92 A;  3X25 B;  3H6Z A;  4DOV A;  4M75 B;  2EYQ A;  3PT9 A;  2DZ9 A;  2KAF A;  4JS4 A;  1FX7 A;  4QVD A;  4XTW A;  5FU7 C;  5C6S A;  2DD4 A;  3JCM V;  1RL2 A;  2XU8 A;  3HRT A;  4M78 G;  2RB6 A;  2QQ9 A;  1WJQ A;  5FRO A;  2R57 A;  4C92 D;  2DZC A;  5FU7 B;  3CCV A;  4M7D A;  3EFR A;  1O75 A;  4B9W A;  3CCU T;  1I8F A;  4OB2 B;  3JB9 G;  1VQ6 A;  1PSE A;  2EKO A;  2RI5 A;  3F70 A;  4KUL A;  3INZ A;  3M4Y A;  3MP1 A;  2QA4 T;  2RHX A;  2XDP A;  2DEQ A;  3TEE A;  5CAI A;  5GMK j;  4A53 A;  1Y71 A;  4M7A G;  3MEA A;  3S6W A;  2GCX A;  3E19 A;  1VQ5 A;  3NFC A;  1WJR A;  2PVG B;  4Q5W A;  4HT9 A;  4XU2 A;  2ZPB B;  1X01 A;  3CME A;  4BDY A;  4QVZ A;  3OBY A;  4M75 G;  1R8O B;  3V8L A;  5HK0 A;  2XHC A;  1WQW A;  2A3L A;  2XKO C;  1MGQ A;  2M16 A;  3WXM B;  5HKC A;  5D6Y A;  1M90 U;  4J7I A;  2LDM A;  1YIJ T;  1QP2 A;  1YIT A;  4KT0 E;  2QEX T;  4OMF B;  3L2W A;  3V8K A;  3CCJ T;  1YJ9 T;  3PFS A;  2ZPF B;  3A5Z B;  2CZ1 B;  5EG2 A;  4RG2 A;  4ELZ C;  2O4X B;  4JJN K;  4ZTJ A;  1OI1 A;  2C06 A;  5GMK e;  2VYT A;  5GAM h;  2RM4 A;  4M77 C;  5LJ3 f;  1KHI A;  3DLL A;  5CR2 A;  3Q1J A;  4X9D A;  1IZ6 A;  3WVE B;  4BUG A;  5LJ5 f;  3BY7 A;  3LX7 A;  3DB3 A;  2RJE A;  1NJI C;  3G71 A;  4M77 B;  3ME9 A;  2LRQ A;  2OTJ A;  3JCM f;  2JN0 A;  2HD0 A;  2FL7 A;  2OTL A;  5GMK l;  2ZZD A;  3RKY A;  4LDY A;  3CXC A;  1RI0 A;  3OS1 A;  1W4S A;  3BDL A;  3CBP A;  1LOJ A;  2GFU A;  4ZGJ B;  3P8B B;  2QDY B;  5KH6 A;  5GAN f;  2XDD A;  3OYH A;  3CCM A;  5A0G A;  3UWN A;  2VGM A;  3FLG A;  4OVA A;  2E12 A;  3LGL A;  4P5N A;  5J3B A;  2RI2 A;  1LJO A;  2P0K A;  4F7U A;  1K9M C;  2GF7 A;  5IAY A;  2V8I A;  2EIF A;  5LL6 S;  3HPW A;  2IG0 A;  3CCV T;  4M7D D;  3CEY A;  2E5Q A;  2E70 A;  1M1F A;  2X4Y A;  1VQ9 T;  4OB0 B;  2M0O A;  1VQ6 T;  1B34 B;  3HHT B;  5FU6 B;  4C0F A;  3CC7 A;  2K57 A;  3RUX A;  3N5B B;  2LQ8 A;  1WJS A;  3V7C A;  4RG8 A;  4JRP A;  4M7A F;  4LDX A;  1JJ2 S;  3A8G B;  2K4Y A;  3OYM A;  4M77 G;  5GAO q;  4HCB A;  1N27 A;  5KE2 A;  2PVO B;  1VQ5 T;  2LX9 A;  2R5M A;  5I2M A;  4M75 F;  4QVC A;  4BE0 A;  1G5V A;  3JCM g;  2L5Q A;  5GAM d;  2JTF A;  3PNW C;  1N8R C;  1Y96 B;  2HNI A;  4BB7 A;  3P8D A;  3JB9 I;  1KD1 C;  3C12 A;  2ZPH B;  3HP9 A;  4J8O A;  5IN1 A;  3OW2 S;  3QYH B;  3TU4 K;  3KUF A;  1UEB A;  4EMK A;  1YJN A;  5GAN g;  2Y4Y A;  2HBP A;  3CCU A;  1YIT T;  4D6W A;  3QO3 A;  2ZPI B;  3WVD B;  1M1K U;  3VU3 C;  3X20 B;  2QA4 A;  1S72 A;  5GAM j;  3OY9 A;  2I2L A;  2A7Y A;  3C95 A;  4C5I A;  1KQS S;  3H8Z A;  4A54 A;  2MWO A;  5J26 A;  2JTM A;  2EQU A;  5KE3 A;  1YBY A;  1XQH A;  3QKJ A;  4J6X A;  1Q86 C;  2E64 A;  5GAO p;  2LTO A;  4RCB A;  2EWN A;  1Y7X A;  2QI2 A;  3RMS A;  4C8Q E;  2XIC A;  3G71 T;  3M59 A;  4BAC A;  3LGF A;  2XID A;  4BDZ A;  5GAN 7;  1QVF A;  4IUQ A;  2OTL T;  4NL3 A;  1XOV A;  3CD6 A;  3L2R A;  4QW2 A;  4R55 A;  2RHZ A;  1VQP T;  4QQD A;  1HK9 A;  2DAQ A;  2K5I A;  3QYG B;  1KC8 C;  1TH7 A;  2RHI A;  5CKH A;  4DA4 A;  4C92 E;  1PSF A;  1UGP B;  3J81 E;  1VQ7 T;  3OSS C;  5GAM e;  2YLB A;  3CXC S;  1OZ3 A;  2PU9 B;  1W2B S;  4MDX A;  2X35 A;  4Z02 A;  5D6W A;  4Y91 A;  4M7A C;  4M7D B;  2FB7 A;  3RKW A;  2P4T A;  3OYL A;  3HKS A;  1WQ7 A;  2X4J A;  3FB9 A;  3CC7 T;  1U8R A;  2JOY A;  1QW1 A;  4J7F A;  4FU6 A;  4C8Q D;  3OYK A;  3R6O A;  4ATO A;  2WSC E;  3JCM b;  2RH2 A;  1UGR B;  2Y90 A;  3VV0 A;  1U1S A;  3S3O A;  2K5F A;  2RA2 A;  2ZGW A;  3GNG A;  3SWN A;  5J39 A;  2HQE A;  3G4S A;  5DY9 A;  2LC4 A;  2PUK B;  1MHN A;  2YHT A;  3X28 B;  2KSS A;  4XAX B;  4FIB A;  4XTY A;  4ZN3 A;  3OYF A;  4C92 F;  1YJN T;  1JJ2 A;  4XU1 A;  1VQ9 A;  2DXB A;  3PIO A;  2G3R A;  3JCM c;  2DVE A;  2QTX A;  3G6E A;  1KQ2 A;  2JUF A;  2DTO A;  1S72 T;  4WF2 A;  3OYY A;  1G3Y A;  3PIP A;  5I2S A;  4ZTF A;  1NJI U;  1Q82 C;  1IRE B;  2RI3 A;  3LW5 E;  3E9F A;  2RO0 A;  3OW2 A;  4M78 A;  4TVR A;  3SFM A;  3JB9 H;  4E7I A;  5GMK m;  3QII A;  2FVU A;  1N9R A;  2CZ6 B;  5A0L A;  1D3B B;  2RK2 A;  3NTH A;  4FSX A;  5DLQ E;  2CZ7 B;  3T9N A;  1K8A C;  2F5T X;  2DIG A;  1UGS B;  4N4H A;  4BI4 A;  4C5E A;  3PTA A;  1M4Z A;  1KQS A;  1VQO T;  2VC8 A;  3CD6 T;  4ZGE B;  5C0M A;  2F5K A;  1G3W A;  5HK3 A;  1K9M U;  2DK3 A;  1NPP A;  3L1A A;  4OB1 B;  1QVF S;  2JNG A;  1X75 C;  2BKD N;  4II1 A;  5DLO A;  1Q7Y C;  4M7D E;  1XTD A;  4A4F A;  4F7U B;  2EJG A;  1K73 C;  1YJW T;  4M75 A;  1SSF A;  2LVM A;  3OYJ A;  5CKF A;  3VUB A;  4X9C A;  3LWH A;  2VV5 A;  1VQL A;  1WNL A;  2QQS A;  3QZ9 B;  4C8Q C;  4R56 A;  4L59 A;  2XG8 D;  3TCJ A;  3JAM E;  5FRN A;  4IUT A;  2M1H A;  4MZM A;  3CC4 A;  2V8K A;  4O5V A;  4C8Q B;  4N0A A;  3CC2 A;  3JCM W;  2FYK A;  2H3J A;  4DQ2 A;  1VQP A;  4FT2 A;  1W2B A;  3M54 A;  3VYH B;  4MMK A;  1Q81 C;  1N8R U;  1KD1 U;  2L8D A;  4C92 C;  4PNO A;  3LH0 A;  4OB3 B;  1VQ7 A;  2EJ9 A;  4LD9 K;  2D6F A;  1WGS A;  2P0P A;  1BKB A;  3A8M B;  3G4S T;  2XDB A;  4C92 B;  5FU6 C;  2PQW A;  5M9O A;  5FRM A;  3CMA A;  4FL6 A;  4EMK B;  1VIE A;  2MF2 A;  3M5A A;  4O6J A;  3OS0 A;  1AHJ B;  5GAN 8;  3I55 A;  4M7D F;  3QHS A;  2QQR A;  4XU3 A;  3V8J A;  3JCM X;  4EMG A;  3CBO A;  4IUV A;  3G6E T;  1Q86 U;  2MWP A;  1FWZ A;  2KQW A;  1Y07 A;  3EFS A;  4C0Z A;  5LJ3 g;  4XK8 E;  1WPY A;  3MET A;  4PJO A;  3I56 A;  2VGN A;  2DJZ A;  4XU0 A;  5LJ5 g;  4M78 D;  3LLR A;  4N4I A;  4C8Q G;  2BUD A;  3MEW A;  2PUO B;  4E7L A;  3JCM h;  2JVV A;  3X26 B;  4A4E A;  2O4X A;  3ZBD A;  4DOW A;  1ZBX A;  3JB9 D;  2DXU A;  2B8A A;  4J6Y A;  4LD6 A;  5GAN 3;  3JCM P;  1KC8 U;  1ZHI A;  5CQX A;  3OS5 A;  1M9S A;  3PMT A;  3VJP A;  3OYI A;  2RHU A;  3J7A F;  5GAN h;  4HKE A;  4F7U E;  3QBY A;  4M77 A;  3V7R A;  4C92 G;  3OS2 A;  5CK9 A;  3M9Q A;  3CPW A;  3A8H B;  4NL2 A;  1VQL T;  3NTI A;  2BIV A;  2DXC A;  4ME7 A;  4BE1 A;  5A0D A;  3OYG A;  3GIB A;  5CO7 A;  5DM7 R;  4VUB A;  1G3T A;  4M7A E;  2EFI A;  3MO8 A;  5GAN 6;  4PJO E;  2MAM A;  3P8H A;  2CGH A;  4XQ3 A;  2Y4X A;  5CIU A;  2LT4 A;  2MI6 A;  3CC4 T;  4QQG A;  1VQO A;  2CKK A;  3BFM A;  3CC2 T;  1XNI A;  2KDS A;  4C5H A;  4BY6 B;  3J80 E;  2QQB A;  1U1T A;  4OP0 A;  2KVQ G;  2ZCF B;  3E9G A;  4LDW A;  4FM4 B;  2KMT A;  2YLC A;  4HA8 A;  4XTX A;  4M7D C;  3A8L B;  3SWN B;  2EQK A;  2ZPE B;  3DKM A;  4JRQ A;  4GY5 A;  3QUI A;  3RKX A;  4F7U F;  1YJW A;  3M58 A;  5CKD A;  5AYF A;  3RIR A;  4MZT A;  1OYX A;  3CMA T;  4C0D B;  2AHJ B;  1N9S A;  3DLM A;  3OSV A;  4UC4 A;  3I55 T;  4OF1 A;  2XI9 A;  1Q82 U;  5GAO r;  4BI8 B;  4JS5 A;  3FDR A;  3JCM J;  1YI2 T;  1VQN A;  3E1S A;  3C94 A;  3MHX A;  3I56 T;  4C8Q F;  4PJO D;  1H64 1;  3M55 A;  1BI1 A;  5HY6 A;  1K8A U;  3JB9 J;  4OGE A;  1NPR A;  2E65 A;  1DJ7 B;  3OMC A;  1V29 B;  2RJC A;  4MZP A;  5CKE A;  1UGQ B;  4E7H A;  2RK1 A;  1N6A A;  5GAN j;  4KUI A;  5CCA A;  3HFN A;  5CKB A;  1VQ4 A;  1I4K 1;  4C0G A;  4PLL A;  1Q7Y U;  2F69 A;  2QQA A;  3DB4 A;  3FIF A;  3L2V A;  2R5A A;  4M77 D;  1K73 U;  2DIQ A;  4M7D G;  1BI2 A;  2EQJ A;  2FHD A;  4N4G A;  2KY9 A;  3OYC A;  2GQV A;  1I81 A;  3CBM A;  3CPF A;  2XD0 A;  2EAY A;  4CRI A;  4EDU A;  3SDZ A;  3A8O B;  3EAE A;  3MCA B;  3JCM e;  3OYE A;  3QPH A;  1G3S A;  3CPW S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...