2LT4A

Cdnlnt from myxoccoccus xanthus
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
71
structure length
71
Chain Sequence
AGHMQTSFKTGDKAVYPGQGVGEVMGIEHTEVAGQRQSFYVLRILENGMRIMIPINKVGSVGLREIISEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator, CarD family
publication title Structural Insights into RNA Polymerase Recognition and Essential Function of Myxococcus xanthus CdnL.
pubmed doi rcsb
source organism Myxococcus xanthus
total genus 5
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lt4A00
2LT1A 4L5GA 4XAXB 2EYQA 4KBMB 2LQKA 2LT4A
chains in the Genus database with same CATH superfamily
1N8RC 3DB4A 5GANh 3L2RA 4IUQA 4KT0E 2DTOA 2KEAA 2O88A 4J7FA 1M2OA 2HMAA 4MMLA 2PVGB 5GMKh 2CP6A 2CSIA 2RK1A 3EFSA 1U5SA 4EPCA 2YWWA 1NEBA 2ZGWA 4M78E 2O31A 4KULA 1VQ4Q 1VQNT 2NUPB 2CP5A 1RI9A 3OYYA 1ZHIA 2C06A 2MMPA 2JMAA 2KQWA 3PIPA 2RF0A 4NS5A 3TSWA 3VS7A 3TQ7P 3QBYA 5CQYA 4C8QF 2B86A 4IUVA 2K5LA 2OJ2A 4LN2A 3PNWC 1QVPA 3OYMA 3QYGB 4Y28E 4F7UF 2E3HA 3X20B 5IH2A 4LNPA 2YUPA 1K0SA 1X2KA 4JUVA 4C0ZA 2E12A 3HSBA 4C92E 2DYIA 2QGFB 4CI0C 1BIBA 1YIJT 3PVLA 2LDMA 2D0NA 1KQSA 2YSQA 2CH4W 8ATCB 2LQNA 2NUPA 3MJXA 3OB9A 5FW9A 1AWOA 2LQWA 1WXTA 1Q86R 5J39A 1VQ7Q 1Q81R 4E7ZA 1YWOA 2RJEA 5LJ5j 1H8KA 2QAZA 3S3NA 1MNDA 2LTOA 2HDAA 5GAMg 3S3OA 4NL3A 2L8DA 2HEQA 5CCAA 1QVGP 5LJ5f 4ZN1A 4X9DA 4RTZA 3CCSQ 3RESA 1PWTA 3L2UA 2EQMA 4RKUE 2H3EB 3GF5A 1K9MU 5GAN6 4BE1A 5KCOA 3OSVA 3L2QA 2V1QA 2XKOC 4CC2A 4R55A 1N9SA 1UJYA 2M02A 1BI2A 1X6OA 2RA2A 3CCQQ 4M75E 3X24B 1YJNT 2YRCA 2FZCB 2D8HA 3MP8A 4L59A 2ROLA 4TVRA 2A08A 2NYSA 1W4SA 4IUPA 1YP5A 3M0SA 2C0TA 3UA6A 1Q7YR 3LWIA 1G3TA 1BYMA 3I5SA 1M30A 3HFOA 4Z89A 2KAFA 1M4ZA 4X1VA 1B7TA 3ZL7C 1VOMA 4HKEA 5L23A 3SB2A 2P0QA 5CKHA 3OW2P 1QLYA 3KFVA 2R58A 2K2VA 3CXCP 1QKXA 3LLRA 2ZPIB 1I4K1 3SFMA 3JCMf 1M90U 2QASA 4DA4A 3VS6A 2KVQG 3OS1A 1SEMA 3JCMV 1U8RA 1GL5A 5LJ3h 1YI2T 4OP0A 4LDWA 1J3TA 3FB9A 2Y4YA 4LXCA 1RAGB 2L3RA 2FL7A 4M7AE 1S72Q 1M8MA 4XU1A 2OTLQ 1KD1U 4JZ3A 4J6WA 3A1PA 3LH5A 1VQOT 3DLMA 5LJ5e 2XU8A 3Q1JA 2COYA 1HD3A 1KC8C 2NUTB 2JM8A 2ZPEB 4LDXA 2DBKA 2JXBA 3EHRA 2PUOB 2RH2A 4F7UB 1F1BB 2GNCA 1KG1A 5DM7R 5GANg 4JJNK 3OSSC 3G4SQ 3OYNA 2MI6A 2QTVA 1NPPA 4PJOC 2KT1A 1M9SA 5GAN7 4DOWA 5HCKA 4HT9A 4C5HA 3M4GA 3R6NA 4F04B 2LNHB 3H0HA 2DNUA 2AKLA 3WXMB 3H41A 2RQWA 2KNBB 3CCUA 2RO0A 3G71Q 2KY9A 1SF9A 4ZN3A 3CEYA 1LPLA 1WHKA 2ECZA 1QW1A 1EX4A 1K9MC 4LDUA 4RTYA 1ZUUA 4JLIA 2EKOA 4R56A 1VQ9A 4KBMB 3A5ZB 3I9QA 1OPKA 1AHJB 3JSCA 3JCMe 1MHNA 2NUTA 3PMIA 1Q82R 1VQ6A 3H9NA 3CCRA 1KHCA 2OI3A 4J6YA 5KYUB 2CZ7B 5D6XA 1QWFA 1TS9A 2HBWA 4RG2A 4A4FA 4EMKC 5KE3A 2HQEA 4PJNA 4J5YA 3J81E 3BE3A 2MF2A 4IUTA 4RMOA 3I55T 1R0CB 4JJDA 2PZ1A 4BD3A 3E2UA 5DLQE 1VQNQ 3E9FA 1WGSA 1MV3A 2BIVA 1YHQT 3PMTA 1M1KU 3QWYA 2VGMA 2L3QA 2HQXA 5GAMj 3TCJA 1EFNA 1QCOA 4E7SA 4E7JA 1HJDA 1BIAA 3ME9A 5GAMf 1CKAA 4FYWB 2RHUA 3LW5E 2X51A 2DZ9A 2ZPBB 4M77C 5DLOA 3OYDA 1KD1C 3ASKA 5KYUA 4HT8A 1GFCA 4JRQA 3A8HB 3OYHA 1X2QA 4A4GA 1YJWT 2DF6A 4JPBW 1WQ7A 2CZ1B 4YTLA 1KJWA 4FT4A 3V7RA 1YIJQ 1QVFP 2L3SA 1FMVA 1X01A 1WHJA 3RNJA 2X9HA 2DE0X 2Y90A 4C0DB 2CP7A 4C5IA 3OYJA 4C5GA 1BBZA 4N0AC 4PLLA 4FYXB 2KXCA 1VQ7T 3OYIA 4FSSA 3KUFA 1Z9QA 4LD6A 2JN0A 3CCSA 1VA7A 3ZBDA 3CCLT 4D8KA 5FU6C 2CGHA 2SEMA 1U1SA 1O9SA 5A0GA 2K79A 2WSFE 1JBMA 4C8QG 2CP3A 3O5ZA 5GAN8 4GBQA 3V8JA 3OS0A 1G2BA 2V1RA 2YUQA 4XTXA 1VQKA 4DBFA 3X26B 3P8HA 2CSQA 2LVMA 3CC2T 1TUCA 4BE2A 5LJ3g 1VYVA 2CP0A 1B34B 4BDZA 2QTXA 4MDXA 3OYBA 2K3YA 2QA4T 3CCQT 1YJNQ 2O9SA 4N4HA 2DM1A 3JV3A 3CC7Q 3CMEA 2ATCB 1UEBA 2LNVA 5GJVB 4LUDA 4M7DG 4Q5WA 5GMKl 2CKKA 2MPXC 4O6JA 3OW2A 2QEXT 4IIOA 3VYGA 5GAMe 5IXBA 4OMNA 1FXXA 3CXCA 1GRIA 3TREA 2M9UA 4HVWA 3OBYA 2M51A 2JS0A 5LJ5g 5GANj 3UATA 3EFRA 5KE2A 4OB3B 2JMCA 1IGUA 2YXYA 4DBQA 2XDDA 1X27A 3PGGA 1NM7A 2X4WA 2YUNA 1QVGS 2PQWA 5EG2A 5GANf 5GMKj 1QP3A 1Y7XA 4HVUA 2FB7A 4Y91A 2EKHA 1VQPT 3H0FA 2GFUA 3MHXA 4P5NA 1WNLA 8AT1B 4II1A 3BW1A 1WJQA 2R5AA 5CAIA 3VRYA 3RMQA 1NJIC 1B34A 1H3HA 4OMMA 4PJOE 2H3JA 1G3YA 1Q81U 4GLKA 3BFMA 3JB9J 2GQIA 1AD5A 4D6WA 5FRNA 4CC7A 4PFOA 2F5KA 3V7CA 4PKCC 4OB0B 2HCKA 1JJ2P 2QDYB 4XK8E 5L8RE 3VS5A 1H3ZA 2DD4A 2OTJT 4QVZA 1N5ZA 2ENMA 2RQTA 3KBGA 2XICA 4OGEA 2RHZA 1M27C 2Z0WA 4AFUC 3G4ST 1TOVA 2LT4A 2HKQB 3OW2S 3CXCS 1IRXA 4PJJA 1D0XA 4JS5A 4XTVA 1TG0A 1ZUYA 1UGSB 2L3PA 4E7HA 1B3QA 3PVQA 3MKDA 3EAEA 2EFIA 3M0RA 3UT1A 3EFOB 1UTIA 4F14A 3OYGA 2J7IA 1W2BP 4C8QD 3G71T 1Q7YU 2CREA 1E7OA 1FMWA 3QPHA 4PNOA 1PSFA 2L5QA 3M5AA 3QHSA 2K7AA 1ZUKA 4Y92A 1OZ3A 4OF1A 1YN8A 2X35A 2HKNA 5GANe 2JW4A 1W1FA 3ZEHA 4BACA 2DL7A 2JOYA 2EYZA 2VVKA 4VUBA 5J3BA 4ANJA 1Y71A 5FWCA 3CCET 4M7DD 3I56T 4F16A 1XJWB 5GMKe 1ZSZA 1K73R 1KK7A 3G6EA 2GF7A 3I55Q 2JVVA 2KR3A 2A3LA 1WJRA 1OQKA 4ELZC 3JB9G 3I5RA 4M77E 2PU9B 1OU9A 5LL6S 1LNXA 2WSEE 1YHQQ 3VUZA 2VWFA 1D3BA 2IG0A 1IZ6A 2C0OA 2C0IA 4J9FA 2JTMA 4JJCA 1CKBA 2EAYA 2W0ZA 5GAOn 1WXUA 3EGUA 1VUBA 1I8FA 1OOTA 1N8RR 1SSFA 4BUGA 2FYKA 3PIOA 1Q81C 3LYIA 4J9CA 3OYFA 1QVFA 3OYCA 2K3BA 2LRQA 2CS7A 4X34A 2AZSA 1IGQA 3BY7A 4XQ3A 1D1AA 1LCKA 1YJWQ 1SRLA 4PL6A 2M1HA 5LJ3j 4XTWA 5J26A 3P8DA 1UHFA 4XTUA 2WSCE 2HQHA 2LT1A 4M7DF 4RTXA 1EIFA 2EIFA 2E70A 2GGRA 3WVEB 3EGDB 4M78G 1VQMA 2AZVA 4XU2A 1NZ9A 5LJ3f 4AFZC 1YJ9A 3A8GB 4CRIA 3REBB 1YFNA 3HRTA 4XTYA 4IUUA 3S6WA 1NG2A 2MCNA 3INZA 3M0PA 4O5VA 4PLIA 1Q82U 1OPLA 1AVZC 3X28B 4EIKA 1W6XA 1K8AU 2RQRA 2DA9A 3CCLQ 3OY9A 3G7ZA 2QI2A 5I22A 3M0UA 5FLXE 5M9OA 2XIDA 1SPKA 1VQLA 1T0JA 3CBMA 3JCMb 3GIBA 4JRIA 1WYXA 1Q7YC 1ZBJA 1ZQ1A 3EG2A 3QG1A 2VV5A 1FMKA 2DVJA 3QWXX 3M59A 2P0PA 2LQ8A 1D0ZA 1T3LA 3CC2Q 4JLGA 2DILA 2E10A 4KGVB 2LJ3A 3CD6T 4C92G 2QA4Q 1QVFS 3EGDA 3ER0A 3CC7T 3M55A 1YITQ 4LDYA 1PG5B 2QDLA 3SD4A 2QEXQ 4AMCA 3NTHA 1PRLC 3UWNA 2EGCA 1BKBA 3BDLA 4RUGA 4E2FB 1A0NB 1SG5A 5CK9A 3EG1A 1SSHA 4BE0A 1QCNA 5GMKm 3JB9D 3I35A 2DL5A 3NFCA 2J6OA 2VB6A 4FYYB 3CMAQ 2NLUA 1D1BA 2FZKB 1YI2A 3MEUA 2KBTA 5IHNA 5LJ3e 2RI3A 3UF4A 2CDTA 1B07A 1VQPQ 3CCJA 3REAB 3FC3A 1VQ8A 4PJOF 2MOXA 2E1HA 3VKIA 1XOVA 5GAOl 2YRDA 2CZ0B 1VQOA 5I2MA 2LCCA 4M75G 1BI0A 2KRMA 1UE9A 4OMFB 1GBQA 3A8OB 3C12A 2DXTA 1NE8A 2YHTA 4C8QB 3MEWA 2CH4A 3F70A 3RKWA 2OTJQ 2QG9B 4WTOB 1X6BA 4M78D 2V8IA 4K11A 4GLMA 2A0FB 4R0KA 3PE0A 4J9BA 4KRTA 1RLQC 3J80E 5C6SA 3JB9H 2EJ9A 3DKMA 3RMSA 1MGQA 3JB9F 3VS0A 1Q82C 1W2BA 1K8AC 4M7DB 2D1XA 4C5EA 4WF2A 3CCMA 2GFAA 2CT4A 2JZ2A 1QKWA 4DEYA 1WZOA 1I81A 2QQAA 2XDBA 3RDVA 2P0KA 4M7AG 3JCMd 2A37A 4MMKA 2LZ6B 2IVWA 2LX9A 3EGXB 2JTEA 4EDUA 2MAMA 2KT8A 4C8QA 4E7KA 4RTWA 1SRMA 3BDUA 4C92D 2KDSA 1NYGA 3N5BB 1UGPB 3J7AF 1AZGB 1KC8R 2EBPA 3TU4K 2QGGA 3QIIA 4CC3A 1JJ2S 4Z88A 4XU3A 4DOVA 4LDVA 4F7UA 2GBQA 3CCEQ 3I56Q 3CCUT 1OI1A 2ZAEA 2DBMA 3I55A 1WLPB 1WHMA 2I2LA 2YLBA 1QQJA 4ME7A 1V76A 4M78F 2EGEA 4M77F 1VQ4A 2X3WD 1YWPA 1VQ9T 1AT1B 2EWNA 4L6V5 3RR6A 5KYYB 2X3XD 1M2VB 5KYNA 2W10A 3GPLA 1VQ6T 1WX6A 2HSEB 1VQ5T 1AWXA 3CCRT 5AT1B 2XDPA 2D0QB 1M90C 1HXDA 5CQXA 1W2BS 1K9MR 3VS4A 3OS2A 4AG1C 3L2WA 4QQ6A 3EGXA 2DXCA 1TH7A 2G3RA 4QQGA 2VUBA 1S1NA 2I0NA 3WVDB 2FRWA 1M8VA 1HK9A 4M75D 2IPOB 1H641 4BI4A 4B9WA 5AYFA 1FX7A 4C92F 2DEUA 1BK2A 4IKFA 2CUBA 3VJPA 2KXDA 2A36A 2QQRA 4J6XA 3VYHB 5GJWB 3GNFB 2MIOA 1QWEA 2EYQA 3AT1B 4OGCA 5KYYA 1M2VA 5GAN5 2J6KA 1VQ7A 3C4SA 1I5OB 3EG0A 1AWJA 2H8HA 4F7UE 2EYYA 2RI5A 3OMGA 4KUDK 1QVGA 3OYLA 1NBEB 3CC4T 3C95A 3FIFA 2FHDA 2HAXA 3SHWA 4HXJA 3TSZA 3O8VA 2E5QA 2JM9A 2AT1B 4DEXA 4ELYC 2RJFA 2ZPGB 3HRSA 5FU7B 1C1AA 2E6ZA 4PK4A 1UGVA 1IHVA 2EJGA 1ACMB 1UJ0A 3SEMA 2HSPA 1BB9A 1QP2A 3OBWA 1K73U 2MWPA 1NEGA 2E6NA 4M7AD 1HSQA 1LOJA 1KQSP 1C0MA 2VKNA 1KD1R 3HTRA 5I21A 1X75C 3MP1A 3E1SA 4X9CA 1UB4A 3HL8A 2JUFA 3CCQA 2BTTA 4M75F 3CD6Q 4FM4B 1ZSZC 1TSFA 2RQUA 1MNEA 5GAMd 2EQJA 4QQDA 1IXDA 1TWBA 1YITT 1BI1A 1MV0B 2K6DA 3JCMQ 2RJCA 1Y96B 2MK5A 2R57A 4ZTFA 1N8RU 1VQKT 1OX8A 2OAUA 4MZTA 3A98A 1T0HA 1RABB 3NHNA 3LGLA 3CMAT 1U06A 2L89A 3URGA 1M1KC 1UGRB 1GXIE 3CMET 4M78B 2G6FX 3UPUA 2VASA 1KIKA 1YCYA 4GY5A 1JU5C 2YDLA 4L5GA 2D6FA 7AT1B 1S72A 2BZYA 3H6ZA 4DQ2A 4M7AF 1G5VA 2OTLA 2KRSA 1VIEA 1IREB 1Q86U 1W70A 2JTFA 1N9RA 4PFZA 2KGTA 2AK5A 3M0TA 4FIBA 2RHIA 4RCCA 3MP6A 4UC4A 1T3SA 2VXFA 4FSXA 3OYEA 2DRKA 2GCXA 5GAOm 2ZZDA 2LJ0A 3QZ5B 1Y96A 3UDCA 1BCMA 1MMDA 1PCXA 1KQ1A 4FW1A 3G4SA 1R8OB 3M58A 2HZYA 2F1LA 1IHWA 2D9TA 1KQ2A 4C92B 4N4IA 1V1CA 1WHLA 3MEVA 3QKJA 3CCVT 4AT1B 1G83A 4JS4A 3RIRA 2IIMA 2RM4A 2K4YA 2PVOB 3VS2A 2OAWA 1UGQB 3L2ZA 2V8KA 3G71A 2P4RA 3QJYA 5ECAA 1PHTA 1OX9A 1WQWA 3HP9A 5EC7A 4AFSC 4J9DA 1NJIR 2V26A 1UFFA 3VU3C 3X25B 4ZGDB 1Z9ZA 2ZPHB 4PJOG 5CIUA 5GANd 5FWBA 2K9GA 2DAQA 4HVVA 4QVCA 2KRNA 3C94A 2QYZA 2HL5C 2P4TA 4OMLA 4HCZA 1QMCA 2D8JA 1I1JA 2DETA 2COZA 3OYKA 1WIEA 1BCOA 5IAYA 5CKEA 3CCUQ 4C92A 1ZLMA 2DTHA 1WHGA 2ESWA 3RKYA 1R0BG 1N27A 4M75B 2VYTA 1ABOA 3SWNB 2EQIA 2RHXA 1VQ9Q 1PRMC 4LUEA 1VQNA 3R6OA 1EZZB 1ABQA 3EFOA 1VQ6Q 2AIRB 1VQ5Q 1M5Q1 1K4US 2ZCFB 1MMAA 3CCRQ 2ED0A 2DKGA 3C0CA 3S3MA 2ABLA 2KROA 1WPYA 5CVIA 2BZXA 2KE9A 2NUZA 5A0DA 3G6ET 2FO0A 4HA8A 1KHIA 4BI8B 2EPDA 3EH1A 4LD9K 4J9GA 4LE9A 4FW2A 1Q86C 2F2XA 1JXMA 2EVRA 2JJ9A 5IT9E 2LP5A 4N4GA 3U23A 1YIJA 5GAN3 4FCYA 3HFNA 4B6MA 1VIFA 4M75A 5HY6A 3SWNA 4PFPA 4QKUA 4M7AB 3VS1A 3JCMX 4KGXB 3A8LB 4XAXB 2QQSA 3TEEA 3NTIA 2AHJB 2QK0A 3EG3A 4M77G 4MZPA 3FLGA 3T9NA 2JT4A 1PC0A 4OB2B 1RL2A 4M4ZA 1Q95G 3CC4Q 4C0GA 4BB7A 2SRCA 2Y4XA 1KC8U 3CBPA 3SDZA 2PTKA 3HPWA 4BY6B 1GCPA 4BDYA 4WCIA 4OB1B 3CQTA 4C8QC 1M3AA 2WACA 2YRVA 3DLLA 2FEIA 1VQMT 4QVDA 4PJOD 1JQQA 2ED1A 1NLOC 1AWWA 1CSKA 2LCLA 4J8OA 1YJ9T 3CD6A 1SKUB 4RTVA 3VS3A 2F2WA 2YLCA 1YJNA 3NGPA 1KFZA 1IO6A 1LVKA 4IIMA 2MWOA 3M54A 4M7AA 5I11A 3CC7A 1SHFA 2B8AA 1OEBA 2CUDA 3HRUA 3M9QA 4A54A 4OMQA 1P92A 2CZ6B 3CPFA 4DBRA 1LJOA 4Z8AA 4M7DC 4KUIA 1VQLT 2AKKA 5IXFA 3D7SB 1WDXA 2YUOA 3JRZA 1TU0B 2DD5A 2KI7A 3META 1R77A 1N6AA 1VQKQ 2KSSA 1X43A 3PT9A 1FWZA 2CYZB 5GAOr 1RUWA 5GAN2 3FDRA 3JCMJ 4OMPA 3QYHB 1NYFA 1WA7A 2DMOA 5LJ3d 5I2SA 1WI7A 3CMEQ 3QSUA 4FU6A 4KH0B 3L2VA 2LJ1A 1GCQC 2P84A 3L42A 1KQSS 2F5TX 2RB6A 2GTOA 1MMNA 3CPWP 3GOXA 1G8XA 1OV3A 2XK0A 2EQUA 2BKDN 3VV0A 2VC8A 1XQHA 3GNGA 4E47A 3LWHA 1JJ2A 5LJ5d 3GBQA 1TXQA 4ESRA 2DTIA 3VUBA 4EMGA 2K5IA 3JCMc 2DO3A 3QO3A 5HK3A 4A4EA 2EJFA 3V7SA 3QDFA 2DL4A 2K3XA 1X69A 2J6FA 1WFWA 2GQVA 2QXFA 3CCJT 1VQ8T 2A28A 1UDLA 2PVDB 4M77D 3FEOA 2R5MA 3MPUB 2FG0A 1NPRA 3CCVQ 2GTJA 4E6RA 1KSWA 4JRKA 5LJ5h 2DIQA 2DVEA 3M53A 3NPFA 4OMOA 3THKA 2E3IA 2V8JA 3JAME 2RN8A 4KH1B 1JO8A 3OS5A 2BE7D 2PNIA 2XD0A 2QQBA 2FVUA 6AT1B 2LCSA 1AZEA 3VRZA 5GAOp 2EYWA 3HKSA 2XHCA 3V8KA 1Y07A 4EMHA 5A0LA 2DXUA 4MDWA 4C0DC 3GP8A 2DXBA 1K9AA 1JB0E 5KYXB 2RJDA 2FPDA 4JRPA 1JXOA 2LC4A 4PJMA 4C0FA 4J9HA 4ZGEB 3LH0A 1M3CA 3CCMT 3RBBB 1ARKA 3AHUA 1G3SA 1D1CA 4HCCA 2L0AA 4A4HA 2FPFA 1OZ2A 2F69A 2JNGA 2YT6A 5FU7C 4XTZA 2EW3A 3RKXA 2LX7A 2DZCA 1PKTA 1BI3A 4AFQC 1VQ5A 1K8AR 4M7DA 3EG9B 3JCMh 2XMFA 1YHQA 1RAAB 3QUIA 5IN1A 2J05A 2M0OA 1GBRA 1ZA1B 2F2VA 2O2OA 2RNAA 3JB9I 1DJ7B 2M16A 2DK3A 4ORZA 1UHCA 2E4HA 5D7UA 3KXTA 3H0IA 4ZTJA 4J7IA 5CO7A 2BZ8A 4ATOA 2ZPFB 2HNIA 1K0XA 3G6EQ 9ATCB 5KYXA 1VQ4T 2DJZA 4FT2A 4DBHA 2E64A 4QT7A 3NTKA 3P8BB 4MZMA 1YJWA 1I0CA 1GCQA 3UA7A 1GFDA 1AOJA 3RERA 2CP2A 2RHYA 5CR2A 1NLPC 2RPNA 1MUZA 2RI2A 1RAFB 2K2MA 2O4XB 4PJOB 3M56A 5GAN4 1PD1A 1OULA 1NJIU 1K1ZA 3QZ9B 4HCKA 5CKFA 2VXEA 4C8QE 1FYNA 3EG9A 4M78C 1Y57A 5D6YA 2DL3A 3CC4A 1XNIA 2VGNA 3EHQA 3FJPA 2DL8A 5DY9A 4RCBA 3CCLA 2X4XA 1BU1A 2X4JA 1YBYA 1M90R 1U1TA 3QJ6A 3MEAA 4JJBA 3M0QA 4Z02A 1PSEA 2COWA 3PFSA 3M57A 1UUEA 2DYBA 1D0YA 2DIGA 2HBPA 1C6VX 4M7DE 1RI0A 2O9VA 4PJLA 1VQMQ 2HD0A 2XG8D 3OQ5A 1M1GA 1YJ9Q 2E41A 3A8MB 2O01E 3CC2A 5KYWB 2J06A 3PTAA 2QA4A 2O4XA 4PJOA 4C92C 4J9IA 1OU8A 2DJQA 2FPEA 4EMKB 3MO8A 2LQKA 2RMOA 4J9EA 4RTTA 4JDSA 2FRYA 1IB8A 5GAOq 1YNZA 1I07A 3CCST 5FROA 1YITA 4V2SA 1RAIB 4OVAA 4HCBA 1E6GA 2QEXA 2XI9A 1VQLQ 3NMZC 1K76A 2BUDA 4E7IA 5A2QE 1WHHA 3ZFJA 4F7UG 2DLPA 4J83A 1JEGA 2LMJA 3JCMP 5IHIA 1PD0A 1V29B 5IHKA 3CMAA 1H92A 5CKBA 2K57A 3QXEB 2DX1A 2L2PA 3EH2A 3ULRB 2E5KA 4XU0A 4ZGJB 2K5FA 2PUKB 1PNJA 1ZA2B 1HYOA 3CPWA 4FL6A 1VQPA 1ZX6A 5GAMh 1TTHB 1TUGB 5KYWA 1PKSA 4M77B 3QDRB 5KCHA 3H8ZA 1M3BA 1VYTA 4RG8A 4A63B 2OX7A 5HKCA 2DPPB 2BE9B 4A4KA 4FYVB 4EMKA 1I5LA 1WXBA 1JRIA 5CKDA 3OMCA 1X6GA 4JZ4A 2NWMA 4M75C 3SWNC 1VYUA 2HL3A 2M0YA 1QCFA 1M1FA 1E6HA 3FRNA 1AEYA 1MMGA 4BI3A 2E65A 4RTUA 2OTJA 1ZBXA 3MCAB 2RK2A 3OYAA 1YI2Q 3LX7A 3LGFA 4A53A 1ZSGA 2A7YA 1XTDA 4KGZB 3CCJQ 3M4YA 1VQ8Q 4IURA 2DEQA 2KYMA 3TVTA 3OA6A 1D09B 1S72T 3CCVA 2ROTA 2JS2A 2OTLT 4AG2C 5FU6B 4NL2A 1VQOQ 5FRMA 1RLPC 2KMTA 1M1KR 4M78A 1O75A 3DB3A 4M77A 1WJSA 5C0MA 1RACB 2MYSA 4ZNXA 2DFUA 3CBOA 4QW2A 3FJ5A 4B9XA 3JCMg 2X4YA 3RUXA 1UECA 1K73C 1ZSZB 3G1JA 3CPWS 3IQLA 4M7AC 2EYXA 1U3OA 5D6WA 3E9GA 5GMKi 2EQKA 2EGAA 1TUDA 2KK4A 3GLXA 4NOYA 1RADB 1PM3A 2FZGB 4N0AA 1RAHB 3L1AA 3HHTB 1SHGA 2CT3A 1RAEB 3E19A 3CCEA 3I56A 3CCMQ 5KH6A 1D3BB 1UG1A 1OYXA 3V8LA 2RQVA 4D8DA 2RD1A 1G3WA 1YCSB 2DERA 4E7LA 1Y0MA 2DRMA 4BY6C 4CC4B 5HK0A 3JCMW 2KYBA 4F17A 2QQ9A
chains in the Genus database with same CATH topology
3CCQT 1N8RC 3DB4A 4N4HA 3JRZA 2DD5A 1OI1A 3CCUT 1KD1C 3META 1N6AA 3I55A 3CMEA 5GANh 1UEBA 2I2LA 2YLBA 2KSSA 2LNVA 3L2RA 3PT9A 4ME7A 4IUQA 4KT0E 4M78F 1FWZA 4Q5WA 4M7DG 2CYZB 5GAOr 5GMKl 2CKKA 4O6JA 3OW2A 2DTOA 2QEXT 5GAN2 3VYGA 5GAMe 4J7FA 4M77F 1FXXA 3CXCA 3FDRA 3JCMJ 1VQ4A 3TREA 4MMLA 1VQ9T 2PVGB 2M9UA 3QYHB 3OBYA 2EWNA 5LJ3d 4L6V5 5GMKh 2RK1A 5LJ5g 3EFSA 5GANj 5I2SA 3GPLA 1VQ6T 4EPCA 3EFRA 5KE2A 4OB3B 1VQ5T 3QSUA 4FU6A 3CCRT 2ZGWA 4M78E 3L2VA 4KULA 2XDPA 2XDDA 2D0QB 1M90C 1HXDA 3PGGA 5CQXA 1W2BS 3L42A 2X4WA 2F5TX 1KQSS 1QVGS 2RB6A 3L2WA 3OS2A 1VQNT 4QQ6A 2PQWA 5EG2A 5GANf 5GMKj 3OYYA 2DXCA 1QP3A 1ZHIA 1Y7XA 3GOXA 1TH7A 2G3RA 4QQGA 2FB7A 2C06A 2MMPA 2VUBA 4Y91A 2XK0A 2EQUA 2BKDN 3VV0A 2KQWA 2VC8A 1XQHA 3GNGA 4E47A 3PIPA 3LWHA 2GFUA 5LJ5d 1VQPT 1JJ2A 3MHXA 4P5NA 1WNLA 4NS5A 4II1A 2DTIA 3BW1A 3VUBA 3WVDB 4EMGA 1WJQA 2K5IA 3QBYA 2R5AA 5CQYA 3JCMc 5CAIA 1HK9A 1M8VA 4M75D 2DO3A 4C8QF 3QO3A 3RMQA 1NJIC 1B34A 1H641 5HK3A 4A4EA 4PJOE 2H3JA 1G3YA 4BI4A 4B9WA 1Q81U 4GLKA 2EJFA 2K5LA 4IUVA 5AYFA 3V7SA 1FX7A 3PNWC 4C92F 3BFMA 3JB9J 1QVPA 3OYMA 4IKFA 2K3XA 4D6WA 3QYGB 5FRNA 2GQVA 4Y28E 2QXFA 3VJPA 2F5KA 4F7UF 3CCJT 3V7CA 4PKCC 3X20B 1VQ8T 2QQRA 4J6XA 4OB0B 3VYHB 4JUVA 3GNFB 2PVDB 4C0ZA 2E12A 2EYQA 2QDYB 4M77D 3FEOA 4XK8E 2R5MA 4OGCA 5L8RE 3HSBA 1H3ZA 2DD4A 4C92E 5GAN5 2OTJT 4QVZA 1VQ7A 4CI0C 1NPRA 3C4SA 1BIBA 1YIJT 3KBGA 2XICA 4JRKA 5LJ5h 4F7UE 2DIQA 2RI5A 2DVEA 3M53A 3OMGA 2LDMA 4KUDK 1KQSA 4OGEA 1QVGA 3OYLA 2RHZA 3G4ST 3CC4T 3OW2S 2LT4A 2V8JA 3C95A 3FIFA 3JAME 3CXCS 2FHDA 3OB9A 2HAXA 4JS5A 4XTVA 3OS5A 2XD0A 1UGSB 3O8VA 4E7HA 5J39A 2E5QA 4ELYC 2QQBA 2RJFA 2RJEA 5LJ5j 2ZPGB 2FVUA 3HRSA 3EAEA 2EFIA 2E6ZA 5FU7B 3S3NA 2EJGA 3UT1A 2LTOA 3OBWA 5GAOp 1QP2A 5GAMg 3HKSA 1K73U 2XHCA 3S3OA 2MWPA 3V8KA 1Y07A 4EMHA 5A0LA 2DXUA 2E6NA 4M7AD 4MDWA 3OYGA 1LOJA 4NL3A 2L8DA 4C0DC 4C8QD 3G71T 5CCAA 3GP8A 1Q7YU 2DXBA 5LJ5f 1JB0E 4ZN1A 4X9DA 5I21A 1X75C 3MP1A 2RJDA 3E1SA 4X9CA 4JRPA 3RESA 1UB4A 3HL8A 2JUFA 3CCQA 2LC4A 3L2UA 2EQMA 3QPHA 4M75F 4RKUE 4C0FA 3GF5A 3LH0A 4PNOA 4ZGEB 4FM4B 5GAN6 1K9MU 1PSFA 3CCMT 2L5QA 3AHUA 3M5AA 3QHSA 1G3SA 4BE1A 1OZ3A 4OF1A 3OSVA 5KCOA 3L2QA 4A4HA 4HCCA 2X35A 5GANe 5GAMd 1OZ2A 2XKOC 2EQJA 2F69A 2JNGA 3ZEHA 4R55A 4BACA 1N9SA 2JOYA 4VUBA 4QQDA 5J3BA 1BI2A 1YITT 1X6OA 2RA2A 1BI1A 5FU7C 4XTZA 3JCMQ 2RJCA 4M75E 3X24B 3RKXA 1Y96B 1YJNT 1Y71A 2DZCA 3CCET 4M7DD 3I56T 2R57A 1BI3A 4ZTFA 1VQ5A 3MP8A 4M7DA 5GMKe 3JCMh 4L59A 4TVRA 1N8RU 1YHQA 3QUIA 1VQKT 5IN1A 2M0OA 1W4SA 2OAUA 4IUPA 3G6EA 2GF7A 4MZTA 3JB9I 1DJ7B 2JVVA 3LWIA 2M16A 1G3TA 1BYMA 2A3LA 1WJRA 2DK3A 3HFOA 2KAFA 1M4ZA 3LGLA 4ELZC 3JB9G 4M77E 3CMAT 2PU9B 2L89A 3URGA 4HKEA 1M1KC 3KXTA 5LL6S 1LNXA 1UGRB 4ZTJA 3SB2A 4J7IA 2P0QA 2WSEE 5CO7A 5CKHA 4M78B 3CMET 1GXIE 2R58A 3VUZA 3UPUA 2K2VA 4ATOA 1YCYA 1D3BA 2HNIA 2ZPFB 4GY5A 2IG0A 1IZ6A 3LLRA 4L5GA 2D6FA 2ZPIB 1VQ4T 2JTMA 1I4K1 3SFMA 2DJZA 3JCMf 4FT2A 1M90U 1S72A 4DA4A 2E64A 3H6ZA 4M7AF 4DQ2A 3NTKA 2KVQG 2EAYA 3P8BB 3OS1A 4MZMA 2OTLA 4PJOC 1G5VA 1YJWA 1IREB 1VIEA 5GAOn 1Q86U 3RERA 1VUBA 3JCMV 1U8RA 2RHYA 2JTFA 1I8FA 1N9RA 5LJ3h 1KQ2A 4FIBA 1YI2T 1SSFA 2RHIA 4OP0A 4BUGA 2FYKA 5CR2A 3PIOA 1Q81C 3LYIA 4LDWA 4RCCA 3MP6A 4UC4A 3FB9A 2VXFA 2RI2A 4FSXA 2Y4YA 3OYFA 2GCXA 2O4XB 5GAOm 3OYCA 3OYEA 1QVFA 2ZZDA 2LRQA 4PJOB 2CS7A 3M56A 3QZ5B 1Y96A 2L3RA 2FL7A 4X34A 3UDCA 5GAN4 4M7AE 1NJIU 3QZ9B 3BY7A 2VXEA 5CKFA 4XQ3A 4XU1A 4C8QE 4M78C 1KD1U 4PL6A 2M1HA 5D6YA 5LJ3j 1KQ1A 4XTWA 4J6WA 5J26A 1VQOT 3DLMA 3P8DA 3G4SA 5LJ5e 3CC4A 4XTUA 1R8OB 1XNIA 2WSCE 2XU8A 2VGNA 3M58A 3Q1JA 2LT1A 4M7DF 3FJPA 1KC8C 2D9TA 1EIFA 2EIFA 2E70A 5DY9A 3WVEB 2ZPEB 4M78G 4RCBA 2X4XA 4N4IA 4XU2A 4C92B 2QA4T 1NZ9A 5LJ3f 3CCLA 4LDXA 2X4JA 1YBYA 3MEVA 3QKJA 1U1TA 1YJ9A 3QJ6A 3A8GB 3MEAA 3CCVT 2PUOB 2RH2A 4CRIA 4F7UB 1KG1A 4Z02A 1PSEA 5DM7R 3PFSA 5GANg 4JJNK 1VQMA 4JS4A 3HRTA 3M57A 3OSSC 4IUUA 4XTYA 3RIRA 2K4YA 2PVOB 2DIGA 2RM4A 2HBPA 2MI6A 3S6WA 1NPPA 3INZA 3OYNA 1UGQB 4O5VA 4PLIA 1RI0A 4M7DE 3L2ZA 1Q82U 2V8KA 1M9SA 3G71A 3X28B 1K8AU 3QJYA 5GAN7 4DOWA 2HD0A 2XG8D 1WQWA 3HP9A 3OQ5A 3OY9A 3G7ZA 2QI2A 4HT9A 1M1GA 4C5HA 5FLXE 5M9OA 3M4GA 2E41A 3VU3C 3X25B 3A8MB 2O01E 4ZGDB 3CC2A 2XIDA 2ZPHB 4PJOG 1VQLA 3CBMA 3JCMb 3GIBA 4JRIA 3WXMB 3PTAA 5CIUA 1Q7YC 2QA4A 5GANd 2O4XA 4PJOA 1ZQ1A 4C92C 2RO0A 3CCUA 4QVCA 2DAQA 2KY9A 3QG1A 2VV5A 3C94A 2LQKA 3MO8A 4EMKB 4ZN3A 2P4TA 5GAOq 4JDSA 3CEYA 3M59A 1QW1A 4HCZA 3CCST 2P0PA 5FROA 1YITA 1K9MC 4V2SA 4LDUA 2LQ8A 4OVAA 4HCBA 2QEXA 2XI9A 4JLIA 4JLGA 2E10A 3CD6T 2EKOA 4R56A 1VQ9A 4C92G 4KBMB 3OYKA 3A5ZB 2BUDA 5IAYA 5CKEA 4E7IA 5A2QE 1AHJB 3JSCA 3JCMe 1MHNA 1QVFS 3ZFJA 4C92A 3PMIA 4F7UG 1VQ6A 2DTHA 4J83A 3ER0A 3CC7T 3RKYA 3JCMP 3M55A 3CCRA 1N27A 1V29B 4M75B 2VYTA 4LDYA 1KHCA 3SWNB 3SD4A 3CMAA 2RHXA 4J6YA 2CZ7B 3NTHA 5D6XA 5CKBA 2K57A 4RG2A 3UWNA 1VQNA 3QXEB 4A4FA 3R6OA 1BKBA 3BDLA 4EMKC 5KE3A 2HQEA 5CK9A 4XU0A 4J5YA 4ZGJB 3J81E 2K5FA 2MF2A 4BE0A 2PUKB 5GMKm 1M5Q1 3CPWA 2ZCFB 4FL6A 4IUTA 3JB9D 1VQPA 4RMOA 3I55T 2DKGA 5GAMh 3NFCA 3S3MA 4M77B 4BD3A 3QDRB 1WPYA 5KCHA 5DLQE 3H8ZA 2NLUA 4RG8A 5CVIA 3E9FA 1WGSA 5HKCA 2DPPB 4A4KA 2BIVA 4EMKA 1YHQT 1YI2A 5A0DA 1I5LA 3MEUA 3PMTA 1M1KU 1JRIA 5CKDA 2VGMA 3OMCA 5LJ3e 3G6ET 2RI3A 2HQXA 4M75C 4HA8A 5GAMj 1KHIA 3SWNC 3TCJA 3CCJA 4BI8B 3FC3A 1VQ8A 4PJOF 4LD9K 1Q86C 2E1HA 1M1FA 3FRNA 3VKIA 1XOVA 5GAOl 4E7JA 5IT9E 2CZ0B 1BIAA 4BI3A 4N4GA 2E65A 1VQOA 5I2MA 2OTJA 2LCCA 1ZBXA 3MCAB 3ME9A 2RK2A 3OYAA 4M75G 5GAMf 3LX7A 1YIJA 5GAN3 3LGFA 2RHUA 4A53A 1BI0A 2A7YA 3LW5E 1XTDA 3HFNA 2DZ9A 1VIFA 2ZPBB 4OMFB 4M75A 4M77C 3M4YA 5HY6A 3SWNA 5DLOA 3OYDA 3ASKA 4IURA 4M7AB 3JCMX 2DEQA 3A8OB 3C12A 2DXTA 1NE8A 4HT8A 3OA6A 2YHTA 3A8LB 3A8HB 3MEWA 4C8QB 4XAXB 3OYHA 4JRQA 1S72T 3CCVA 2QQSA 3TEEA 3F70A 4A4GA 3NTIA 2OTLT 1YJWT 5FU6B 2AHJB 4NL2A 3RKWA 5FRMA 1WQ7A 2CZ1B 4YTLA 4FT4A 3V7RA 4M77G 4M78D 2KMTA 4MZPA 3FLGA 2V8IA 4M78A 3T9NA 1X01A 1O75A 4OB2B 1RL2A 3DB3A 4M77A 1WJSA 5C0MA 2Y90A 4C0DB 4C0GA 4BB7A 2Y4XA 1KC8U 3J80E 5C6SA 3JB9H 3CBOA 2EJ9A 4QW2A 4C5IA 3DKMA 3RMSA 1MGQA 3JB9F 4B9XA 3OYJA 3JCMg 3CBPA 4C5GA 3SDZA 1Q82C 2X4YA 3RUXA 4N0AC 1W2BA 1K8AC 4PLLA 3HPWA 4BY6B 1VQ7T 3OYIA 4M7DB 1K73C 4C5EA 4WF2A 3CPWS 4M7AC 3KUFA 3CCMA 4BDYA 4OB1B 4LD6A 2GFAA 2JZ2A 4C8QC 2JN0A 2WACA 2YRVA 5D6WA 3DLLA 1VQMT 3CCSA 4QVDA 3ZBDA 3CCLT 4PJOD 5FU6C 2LCLA 3E9GA 2CGHA 5GMKi 2EQKA 1I81A 2QQAA 1U1SA 2KK4A 4J8OA 1YJ9T 1O9SA 3GLXA 4NOYA 5A0GA 2XDBA 3CD6A 2P0KA 2WSFE 2YLCA 4M7AG 4N0AA 1JBMA 3JCMd 3L1AA 3HHTB 4MMKA 4C8QG 1YJNA 3E19A 5GAN8 2IVWA 3CCEA 2LX9A 3V8JA 4EDUA 3I56A 3OS0A 2MWOA 3M54A 4M7AA 2MAMA 5KH6A 1D3BB 3CC7A 4C8QA 4E7KA 4XTXA 1OYXA 1VQKA 2B8AA 3HRUA 3M9QA 3BDUA 3V8LA 4A54A 4C92D 2KDSA 3N5BB 1P92A 2RD1A 1UGPB 1G3WA 3J7AF 2CZ6B 4E7LA 3X26B 3TU4K 3P8HA 3CPFA 2LVMA 3QIIA 4BY6C 1LJOA 1JJ2S 3CC2T 4M7DC 4BE2A 4XU3A 4KUIA 5HK0A 5LJ3g 1VQLT 3JCMW 1B34B 4LDVA 2QTXA 4DOVA 4BDZA 4MDXA 4F7UA 3OYBA 2K3YA 2QQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT1 A;  4L5G A;  4XAX B;  2EYQ A;  4KBM B;  2LQK A;  2LT4 A; 
#chains in the Genus database with same CATH topology
 1N8R C;  3DB4 A;  5GAN h;  3L2R A;  4IUQ A;  4KT0 E;  2DTO A;  2KEA A;  2O88 A;  4J7F A;  1M2O A;  2HMA A;  4MML A;  2PVG B;  5GMK h;  2CP6 A;  2CSI A;  2RK1 A;  3EFS A;  1U5S A;  4EPC A;  2YWW A;  1NEB A;  2ZGW A;  4M78 E;  2O31 A;  4KUL A;  1VQ4 Q;  1VQN T;  2NUP B;  2CP5 A;  1RI9 A;  3OYY A;  1ZHI A;  2C06 A;  2MMP A;  2JMA A;  2KQW A;  3PIP A;  2RF0 A;  4NS5 A;  3TSW A;  3VS7 A;  3TQ7 P;  3QBY A;  5CQY A;  4C8Q F;  2B86 A;  4IUV A;  2K5L A;  2OJ2 A;  4LN2 A;  3PNW C;  1QVP A;  3OYM A;  3QYG B;  4Y28 E;  4F7U F;  2E3H A;  3X20 B;  5IH2 A;  4LNP A;  2YUP A;  1K0S A;  1X2K A;  4JUV A;  4C0Z A;  2E12 A;  3HSB A;  4C92 E;  2DYI A;  2QGF B;  4CI0 C;  1BIB A;  1YIJ T;  3PVL A;  2LDM A;  2D0N A;  1KQS A;  2YSQ A;  2CH4 W;  8ATC B;  2LQN A;  2NUP A;  3MJX A;  3OB9 A;  5FW9 A;  1AWO A;  2LQW A;  1WXT A;  1Q86 R;  5J39 A;  1VQ7 Q;  1Q81 R;  4E7Z A;  1YWO A;  2RJE A;  5LJ5 j;  1H8K A;  2QAZ A;  3S3N A;  1MND A;  2LTO A;  2HDA A;  5GAM g;  3S3O A;  4NL3 A;  2L8D A;  2HEQ A;  5CCA A;  1QVG P;  5LJ5 f;  4ZN1 A;  4X9D A;  4RTZ A;  3CCS Q;  3RES A;  1PWT A;  3L2U A;  2EQM A;  4RKU E;  2H3E B;  3GF5 A;  1K9M U;  5GAN 6;  4BE1 A;  5KCO A;  3OSV A;  3L2Q A;  2V1Q A;  2XKO C;  4CC2 A;  4R55 A;  1N9S A;  1UJY A;  2M02 A;  1BI2 A;  1X6O A;  2RA2 A;  3CCQ Q;  4M75 E;  3X24 B;  1YJN T;  2YRC A;  2FZC B;  2D8H A;  3MP8 A;  4L59 A;  2ROL A;  4TVR A;  2A08 A;  2NYS A;  1W4S A;  4IUP A;  1YP5 A;  3M0S A;  2C0T A;  3UA6 A;  1Q7Y R;  3LWI A;  1G3T A;  1BYM A;  3I5S A;  1M30 A;  3HFO A;  4Z89 A;  2KAF A;  1M4Z A;  4X1V A;  1B7T A;  3ZL7 C;  1VOM A;  4HKE A;  5L23 A;  3SB2 A;  2P0Q A;  5CKH A;  3OW2 P;  1QLY A;  3KFV A;  2R58 A;  2K2V A;  3CXC P;  1QKX A;  3LLR A;  2ZPI B;  1I4K 1;  3SFM A;  3JCM f;  1M90 U;  2QAS A;  4DA4 A;  3VS6 A;  2KVQ G;  3OS1 A;  1SEM A;  3JCM V;  1U8R A;  1GL5 A;  5LJ3 h;  1YI2 T;  4OP0 A;  4LDW A;  1J3T A;  3FB9 A;  2Y4Y A;  4LXC A;  1RAG B;  2L3R A;  2FL7 A;  4M7A E;  1S72 Q;  1M8M A;  4XU1 A;  2OTL Q;  1KD1 U;  4JZ3 A;  4J6W A;  3A1P A;  3LH5 A;  1VQO T;  3DLM A;  5LJ5 e;  2XU8 A;  3Q1J A;  2COY A;  1HD3 A;  1KC8 C;  2NUT B;  2JM8 A;  2ZPE B;  4LDX A;  2DBK A;  2JXB A;  3EHR A;  2PUO B;  2RH2 A;  4F7U B;  1F1B B;  2GNC A;  1KG1 A;  5DM7 R;  5GAN g;  4JJN K;  3OSS C;  3G4S Q;  3OYN A;  2MI6 A;  2QTV A;  1NPP A;  4PJO C;  2KT1 A;  1M9S A;  5GAN 7;  4DOW A;  5HCK A;  4HT9 A;  4C5H A;  3M4G A;  3R6N A;  4F04 B;  2LNH B;  3H0H A;  2DNU A;  2AKL A;  3WXM B;  3H41 A;  2RQW A;  2KNB B;  3CCU A;  2RO0 A;  3G71 Q;  2KY9 A;  1SF9 A;  4ZN3 A;  3CEY A;  1LPL A;  1WHK A;  2ECZ A;  1QW1 A;  1EX4 A;  1K9M C;  4LDU A;  4RTY A;  1ZUU A;  4JLI A;  2EKO A;  4R56 A;  1VQ9 A;  4KBM B;  3A5Z B;  3I9Q A;  1OPK A;  1AHJ B;  3JSC A;  3JCM e;  1MHN A;  2NUT A;  3PMI A;  1Q82 R;  1VQ6 A;  3H9N A;  3CCR A;  1KHC A;  2OI3 A;  4J6Y A;  5KYU B;  2CZ7 B;  5D6X A;  1QWF A;  1TS9 A;  2HBW A;  4RG2 A;  4A4F A;  4EMK C;  5KE3 A;  2HQE A;  4PJN A;  4J5Y A;  3J81 E;  3BE3 A;  2MF2 A;  4IUT A;  4RMO A;  3I55 T;  1R0C B;  4JJD A;  2PZ1 A;  4BD3 A;  3E2U A;  5DLQ E;  1VQN Q;  3E9F A;  1WGS A;  1MV3 A;  2BIV A;  1YHQ T;  3PMT A;  1M1K U;  3QWY A;  2VGM A;  2L3Q A;  2HQX A;  5GAM j;  3TCJ A;  1EFN A;  1QCO A;  4E7S A;  4E7J A;  1HJD A;  1BIA A;  3ME9 A;  5GAM f;  1CKA A;  4FYW B;  2RHU A;  3LW5 E;  2X51 A;  2DZ9 A;  2ZPB B;  4M77 C;  5DLO A;  3OYD A;  1KD1 C;  3ASK A;  5KYU A;  4HT8 A;  1GFC A;  4JRQ A;  3A8H B;  3OYH A;  1X2Q A;  4A4G A;  1YJW T;  2DF6 A;  4JPB W;  1WQ7 A;  2CZ1 B;  4YTL A;  1KJW A;  4FT4 A;  3V7R A;  1YIJ Q;  1QVF P;  2L3S A;  1FMV A;  1X01 A;  1WHJ A;  3RNJ A;  2X9H A;  2DE0 X;  2Y90 A;  4C0D B;  2CP7 A;  4C5I A;  3OYJ A;  4C5G A;  1BBZ A;  4N0A C;  4PLL A;  4FYX B;  2KXC A;  1VQ7 T;  3OYI A;  4FSS A;  3KUF A;  1Z9Q A;  4LD6 A;  2JN0 A;  3CCS A;  1VA7 A;  3ZBD A;  3CCL T;  4D8K A;  5FU6 C;  2CGH A;  2SEM A;  1U1S A;  1O9S A;  5A0G A;  2K79 A;  2WSF E;  1JBM A;  4C8Q G;  2CP3 A;  3O5Z A;  5GAN 8;  4GBQ A;  3V8J A;  3OS0 A;  1G2B A;  2V1R A;  2YUQ A;  4XTX A;  1VQK A;  4DBF A;  3X26 B;  3P8H A;  2CSQ A;  2LVM A;  3CC2 T;  1TUC A;  4BE2 A;  5LJ3 g;  1VYV A;  2CP0 A;  1B34 B;  4BDZ A;  2QTX A;  4MDX A;  3OYB A;  2K3Y A;  2QA4 T;  3CCQ T;  1YJN Q;  2O9S A;  4N4H A;  2DM1 A;  3JV3 A;  3CC7 Q;  3CME A;  2ATC B;  1UEB A;  2LNV A;  5GJV B;  4LUD A;  4M7D G;  4Q5W A;  5GMK l;  2CKK A;  2MPX C;  4O6J A;  3OW2 A;  2QEX T;  4IIO A;  3VYG A;  5GAM e;  5IXB A;  4OMN A;  1FXX A;  3CXC A;  1GRI A;  3TRE A;  2M9U A;  4HVW A;  3OBY A;  2M51 A;  2JS0 A;  5LJ5 g;  5GAN j;  3UAT A;  3EFR A;  5KE2 A;  4OB3 B;  2JMC A;  1IGU A;  2YXY A;  4DBQ A;  2XDD A;  1X27 A;  3PGG A;  1NM7 A;  2X4W A;  2YUN A;  1QVG S;  2PQW A;  5EG2 A;  5GAN f;  5GMK j;  1QP3 A;  1Y7X A;  4HVU A;  2FB7 A;  4Y91 A;  2EKH A;  1VQP T;  3H0F A;  2GFU A;  3MHX A;  4P5N A;  1WNL A;  8AT1 B;  4II1 A;  3BW1 A;  1WJQ A;  2R5A A;  5CAI A;  3VRY A;  3RMQ A;  1NJI C;  1B34 A;  1H3H A;  4OMM A;  4PJO E;  2H3J A;  1G3Y A;  1Q81 U;  4GLK A;  3BFM A;  3JB9 J;  2GQI A;  1AD5 A;  4D6W A;  5FRN A;  4CC7 A;  4PFO A;  2F5K A;  3V7C A;  4PKC C;  4OB0 B;  2HCK A;  1JJ2 P;  2QDY B;  4XK8 E;  5L8R E;  3VS5 A;  1H3Z A;  2DD4 A;  2OTJ T;  4QVZ A;  1N5Z A;  2ENM A;  2RQT A;  3KBG A;  2XIC A;  4OGE A;  2RHZ A;  1M27 C;  2Z0W A;  4AFU C;  3G4S T;  1TOV A;  2LT4 A;  2HKQ B;  3OW2 S;  3CXC S;  1IRX A;  4PJJ A;  1D0X A;  4JS5 A;  4XTV A;  1TG0 A;  1ZUY A;  1UGS B;  2L3P A;  4E7H A;  1B3Q A;  3PVQ A;  3MKD A;  3EAE A;  2EFI A;  3M0R A;  3UT1 A;  3EFO B;  1UTI A;  4F14 A;  3OYG A;  2J7I A;  1W2B P;  4C8Q D;  3G71 T;  1Q7Y U;  2CRE A;  1E7O A;  1FMW A;  3QPH A;  4PNO A;  1PSF A;  2L5Q A;  3M5A A;  3QHS A;  2K7A A;  1ZUK A;  4Y92 A;  1OZ3 A;  4OF1 A;  1YN8 A;  2X35 A;  2HKN A;  5GAN e;  2JW4 A;  1W1F A;  3ZEH A;  4BAC A;  2DL7 A;  2JOY A;  2EYZ A;  2VVK A;  4VUB A;  5J3B A;  4ANJ A;  1Y71 A;  5FWC A;  3CCE T;  4M7D D;  3I56 T;  4F16 A;  1XJW B;  5GMK e;  1ZSZ A;  1K73 R;  1KK7 A;  3G6E A;  2GF7 A;  3I55 Q;  2JVV A;  2KR3 A;  2A3L A;  1WJR A;  1OQK A;  4ELZ C;  3JB9 G;  3I5R A;  4M77 E;  2PU9 B;  1OU9 A;  5LL6 S;  1LNX A;  2WSE E;  1YHQ Q;  3VUZ A;  2VWF A;  1D3B A;  2IG0 A;  1IZ6 A;  2C0O A;  2C0I A;  4J9F A;  2JTM A;  4JJC A;  1CKB A;  2EAY A;  2W0Z A;  5GAO n;  1WXU A;  3EGU A;  1VUB A;  1I8F A;  1OOT A;  1N8R R;  1SSF A;  4BUG A;  2FYK A;  3PIO A;  1Q81 C;  3LYI A;  4J9C A;  3OYF A;  1QVF A;  3OYC A;  2K3B A;  2LRQ A;  2CS7 A;  4X34 A;  2AZS A;  1IGQ A;  3BY7 A;  4XQ3 A;  1D1A A;  1LCK A;  1YJW Q;  1SRL A;  4PL6 A;  2M1H A;  5LJ3 j;  4XTW A;  5J26 A;  3P8D A;  1UHF A;  4XTU A;  2WSC E;  2HQH A;  2LT1 A;  4M7D F;  4RTX A;  1EIF A;  2EIF A;  2E70 A;  2GGR A;  3WVE B;  3EGD B;  4M78 G;  1VQM A;  2AZV A;  4XU2 A;  1NZ9 A;  5LJ3 f;  4AFZ C;  1YJ9 A;  3A8G B;  4CRI A;  3REB B;  1YFN A;  3HRT A;  4XTY A;  4IUU A;  3S6W A;  1NG2 A;  2MCN A;  3INZ A;  3M0P A;  4O5V A;  4PLI A;  1Q82 U;  1OPL A;  1AVZ C;  3X28 B;  4EIK A;  1W6X A;  1K8A U;  2RQR A;  2DA9 A;  3CCL Q;  3OY9 A;  3G7Z A;  2QI2 A;  5I22 A;  3M0U A;  5FLX E;  5M9O A;  2XID A;  1SPK A;  1VQL A;  1T0J A;  3CBM A;  3JCM b;  3GIB A;  4JRI A;  1WYX A;  1Q7Y C;  1ZBJ A;  1ZQ1 A;  3EG2 A;  3QG1 A;  2VV5 A;  1FMK A;  2DVJ A;  3QWX X;  3M59 A;  2P0P A;  2LQ8 A;  1D0Z A;  1T3L A;  3CC2 Q;  4JLG A;  2DIL A;  2E10 A;  4KGV B;  2LJ3 A;  3CD6 T;  4C92 G;  2QA4 Q;  1QVF S;  3EGD A;  3ER0 A;  3CC7 T;  3M55 A;  1YIT Q;  4LDY A;  1PG5 B;  2QDL A;  3SD4 A;  2QEX Q;  4AMC A;  3NTH A;  1PRL C;  3UWN A;  2EGC A;  1BKB A;  3BDL A;  4RUG A;  4E2F B;  1A0N B;  1SG5 A;  5CK9 A;  3EG1 A;  1SSH A;  4BE0 A;  1QCN A;  5GMK m;  3JB9 D;  3I35 A;  2DL5 A;  3NFC A;  2J6O A;  2VB6 A;  4FYY B;  3CMA Q;  2NLU A;  1D1B A;  2FZK B;  1YI2 A;  3MEU A;  2KBT A;  5IHN A;  5LJ3 e;  2RI3 A;  3UF4 A;  2CDT A;  1B07 A;  1VQP Q;  3CCJ A;  3REA B;  3FC3 A;  1VQ8 A;  4PJO F;  2MOX A;  2E1H A;  3VKI A;  1XOV A;  5GAO l;  2YRD A;  2CZ0 B;  1VQO A;  5I2M A;  2LCC A;  4M75 G;  1BI0 A;  2KRM A;  1UE9 A;  4OMF B;  1GBQ A;  3A8O B;  3C12 A;  2DXT A;  1NE8 A;  2YHT A;  4C8Q B;  3MEW A;  2CH4 A;  3F70 A;  3RKW A;  2OTJ Q;  2QG9 B;  4WTO B;  1X6B A;  4M78 D;  2V8I A;  4K11 A;  4GLM A;  2A0F B;  4R0K A;  3PE0 A;  4J9B A;  4KRT A;  1RLQ C;  3J80 E;  5C6S A;  3JB9 H;  2EJ9 A;  3DKM A;  3RMS A;  1MGQ A;  3JB9 F;  3VS0 A;  1Q82 C;  1W2B A;  1K8A C;  4M7D B;  2D1X A;  4C5E A;  4WF2 A;  3CCM A;  2GFA A;  2CT4 A;  2JZ2 A;  1QKW A;  4DEY A;  1WZO A;  1I81 A;  2QQA A;  2XDB A;  3RDV A;  2P0K A;  4M7A G;  3JCM d;  2A37 A;  4MMK A;  2LZ6 B;  2IVW A;  2LX9 A;  3EGX B;  2JTE A;  4EDU A;  2MAM A;  2KT8 A;  4C8Q A;  4E7K A;  4RTW A;  1SRM A;  3BDU A;  4C92 D;  2KDS A;  1NYG A;  3N5B B;  1UGP B;  3J7A F;  1AZG B;  1KC8 R;  2EBP A;  3TU4 K;  2QGG A;  3QII A;  4CC3 A;  1JJ2 S;  4Z88 A;  4XU3 A;  4DOV A;  4LDV A;  4F7U A;  2GBQ A;  3CCE Q;  3I56 Q;  3CCU T;  1OI1 A;  2ZAE A;  2DBM A;  3I55 A;  1WLP B;  1WHM A;  2I2L A;  2YLB A;  1QQJ A;  4ME7 A;  1V76 A;  4M78 F;  2EGE A;  4M77 F;  1VQ4 A;  2X3W D;  1YWP A;  1VQ9 T;  1AT1 B;  2EWN A;  4L6V 5;  3RR6 A;  5KYY B;  2X3X D;  1M2V B;  5KYN A;  2W10 A;  3GPL A;  1VQ6 T;  1WX6 A;  2HSE B;  1VQ5 T;  1AWX A;  3CCR T;  5AT1 B;  2XDP A;  2D0Q B;  1M90 C;  1HXD A;  5CQX A;  1W2B S;  1K9M R;  3VS4 A;  3OS2 A;  4AG1 C;  3L2W A;  4QQ6 A;  3EGX A;  2DXC A;  1TH7 A;  2G3R A;  4QQG A;  2VUB A;  1S1N A;  2I0N A;  3WVD B;  2FRW A;  1M8V A;  1HK9 A;  4M75 D;  2IPO B;  1H64 1;  4BI4 A;  4B9W A;  5AYF A;  1FX7 A;  4C92 F;  2DEU A;  1BK2 A;  4IKF A;  2CUB A;  3VJP A;  2KXD A;  2A36 A;  2QQR A;  4J6X A;  3VYH B;  5GJW B;  3GNF B;  2MIO A;  1QWE A;  2EYQ A;  3AT1 B;  4OGC A;  5KYY A;  1M2V A;  5GAN 5;  2J6K A;  1VQ7 A;  3C4S A;  1I5O B;  3EG0 A;  1AWJ A;  2H8H A;  4F7U E;  2EYY A;  2RI5 A;  3OMG A;  4KUD K;  1QVG A;  3OYL A;  1NBE B;  3CC4 T;  3C95 A;  3FIF A;  2FHD A;  2HAX A;  3SHW A;  4HXJ A;  3TSZ A;  3O8V A;  2E5Q A;  2JM9 A;  2AT1 B;  4DEX A;  4ELY C;  2RJF A;  2ZPG B;  3HRS A;  5FU7 B;  1C1A A;  2E6Z A;  4PK4 A;  1UGV A;  1IHV A;  2EJG A;  1ACM B;  1UJ0 A;  3SEM A;  2HSP A;  1BB9 A;  1QP2 A;  3OBW A;  1K73 U;  2MWP A;  1NEG A;  2E6N A;  4M7A D;  1HSQ A;  1LOJ A;  1KQS P;  1C0M A;  2VKN A;  1KD1 R;  3HTR A;  5I21 A;  1X75 C;  3MP1 A;  3E1S A;  4X9C A;  1UB4 A;  3HL8 A;  2JUF A;  3CCQ A;  2BTT A;  4M75 F;  3CD6 Q;  4FM4 B;  1ZSZ C;  1TSF A;  2RQU A;  1MNE A;  5GAM d;  2EQJ A;  4QQD A;  1IXD A;  1TWB A;  1YIT T;  1BI1 A;  1MV0 B;  2K6D A;  3JCM Q;  2RJC A;  1Y96 B;  2MK5 A;  2R57 A;  4ZTF A;  1N8R U;  1VQK T;  1OX8 A;  2OAU A;  4MZT A;  3A98 A;  1T0H A;  1RAB B;  3NHN A;  3LGL A;  3CMA T;  1U06 A;  2L89 A;  3URG A;  1M1K C;  1UGR B;  1GXI E;  3CME T;  4M78 B;  2G6F X;  3UPU A;  2VAS A;  1KIK A;  1YCY A;  4GY5 A;  1JU5 C;  2YDL A;  4L5G A;  2D6F A;  7AT1 B;  1S72 A;  2BZY A;  3H6Z A;  4DQ2 A;  4M7A F;  1G5V A;  2OTL A;  2KRS A;  1VIE A;  1IRE B;  1Q86 U;  1W70 A;  2JTF A;  1N9R A;  4PFZ A;  2KGT A;  2AK5 A;  3M0T A;  4FIB A;  2RHI A;  4RCC A;  3MP6 A;  4UC4 A;  1T3S A;  2VXF A;  4FSX A;  3OYE A;  2DRK A;  2GCX A;  5GAO m;  2ZZD A;  2LJ0 A;  3QZ5 B;  1Y96 A;  3UDC A;  1BCM A;  1MMD A;  1PCX A;  1KQ1 A;  4FW1 A;  3G4S A;  1R8O B;  3M58 A;  2HZY A;  2F1L A;  1IHW A;  2D9T A;  1KQ2 A;  4C92 B;  4N4I A;  1V1C A;  1WHL A;  3MEV A;  3QKJ A;  3CCV T;  4AT1 B;  1G83 A;  4JS4 A;  3RIR A;  2IIM A;  2RM4 A;  2K4Y A;  2PVO B;  3VS2 A;  2OAW A;  1UGQ B;  3L2Z A;  2V8K A;  3G71 A;  2P4R A;  3QJY A;  5ECA A;  1PHT A;  1OX9 A;  1WQW A;  3HP9 A;  5EC7 A;  4AFS C;  4J9D A;  1NJI R;  2V26 A;  1UFF A;  3VU3 C;  3X25 B;  4ZGD B;  1Z9Z A;  2ZPH B;  4PJO G;  5CIU A;  5GAN d;  5FWB A;  2K9G A;  2DAQ A;  4HVV A;  4QVC A;  2KRN A;  3C94 A;  2QYZ A;  2HL5 C;  2P4T A;  4OML A;  4HCZ A;  1QMC A;  2D8J A;  1I1J A;  2DET A;  2COZ A;  3OYK A;  1WIE A;  1BCO A;  5IAY A;  5CKE A;  3CCU Q;  4C92 A;  1ZLM A;  2DTH A;  1WHG A;  2ESW A;  3RKY A;  1R0B G;  1N27 A;  4M75 B;  2VYT A;  1ABO A;  3SWN B;  2EQI A;  2RHX A;  1VQ9 Q;  1PRM C;  4LUE A;  1VQN A;  3R6O A;  1EZZ B;  1ABQ A;  3EFO A;  1VQ6 Q;  2AIR B;  1VQ5 Q;  1M5Q 1;  1K4U S;  2ZCF B;  1MMA A;  3CCR Q;  2ED0 A;  2DKG A;  3C0C A;  3S3M A;  2ABL A;  2KRO A;  1WPY A;  5CVI A;  2BZX A;  2KE9 A;  2NUZ A;  5A0D A;  3G6E T;  2FO0 A;  4HA8 A;  1KHI A;  4BI8 B;  2EPD A;  3EH1 A;  4LD9 K;  4J9G A;  4LE9 A;  4FW2 A;  1Q86 C;  2F2X A;  1JXM A;  2EVR A;  2JJ9 A;  5IT9 E;  2LP5 A;  4N4G A;  3U23 A;  1YIJ A;  5GAN 3;  4FCY A;  3HFN A;  4B6M A;  1VIF A;  4M75 A;  5HY6 A;  3SWN A;  4PFP A;  4QKU A;  4M7A B;  3VS1 A;  3JCM X;  4KGX B;  3A8L B;  4XAX B;  2QQS A;  3TEE A;  3NTI A;  2AHJ B;  2QK0 A;  3EG3 A;  4M77 G;  4MZP A;  3FLG A;  3T9N A;  2JT4 A;  1PC0 A;  4OB2 B;  1RL2 A;  4M4Z A;  1Q95 G;  3CC4 Q;  4C0G A;  4BB7 A;  2SRC A;  2Y4X A;  1KC8 U;  3CBP A;  3SDZ A;  2PTK A;  3HPW A;  4BY6 B;  1GCP A;  4BDY A;  4WCI A;  4OB1 B;  3CQT A;  4C8Q C;  1M3A A;  2WAC A;  2YRV A;  3DLL A;  2FEI A;  1VQM T;  4QVD A;  4PJO D;  1JQQ A;  2ED1 A;  1NLO C;  1AWW A;  1CSK A;  2LCL A;  4J8O A;  1YJ9 T;  3CD6 A;  1SKU B;  4RTV A;  3VS3 A;  2F2W A;  2YLC A;  1YJN A;  3NGP A;  1KFZ A;  1IO6 A;  1LVK A;  4IIM A;  2MWO A;  3M54 A;  4M7A A;  5I11 A;  3CC7 A;  1SHF A;  2B8A A;  1OEB A;  2CUD A;  3HRU A;  3M9Q A;  4A54 A;  4OMQ A;  1P92 A;  2CZ6 B;  3CPF A;  4DBR A;  1LJO A;  4Z8A A;  4M7D C;  4KUI A;  1VQL T;  2AKK A;  5IXF A;  3D7S B;  1WDX A;  2YUO A;  3JRZ A;  1TU0 B;  2DD5 A;  2KI7 A;  3MET A;  1R77 A;  1N6A A;  1VQK Q;  2KSS A;  1X43 A;  3PT9 A;  1FWZ A;  2CYZ B;  5GAO r;  1RUW A;  5GAN 2;  3FDR A;  3JCM J;  4OMP A;  3QYH B;  1NYF A;  1WA7 A;  2DMO A;  5LJ3 d;  5I2S A;  1WI7 A;  3CME Q;  3QSU A;  4FU6 A;  4KH0 B;  3L2V A;  2LJ1 A;  1GCQ C;  2P84 A;  3L42 A;  1KQS S;  2F5T X;  2RB6 A;  2GTO A;  1MMN A;  3CPW P;  3GOX A;  1G8X A;  1OV3 A;  2XK0 A;  2EQU A;  2BKD N;  3VV0 A;  2VC8 A;  1XQH A;  3GNG A;  4E47 A;  3LWH A;  1JJ2 A;  5LJ5 d;  3GBQ A;  1TXQ A;  4ESR A;  2DTI A;  3VUB A;  4EMG A;  2K5I A;  3JCM c;  2DO3 A;  3QO3 A;  5HK3 A;  4A4E A;  2EJF A;  3V7S A;  3QDF A;  2DL4 A;  2K3X A;  1X69 A;  2J6F A;  1WFW A;  2GQV A;  2QXF A;  3CCJ T;  1VQ8 T;  2A28 A;  1UDL A;  2PVD B;  4M77 D;  3FEO A;  2R5M A;  3MPU B;  2FG0 A;  1NPR A;  3CCV Q;  2GTJ A;  4E6R A;  1KSW A;  4JRK A;  5LJ5 h;  2DIQ A;  2DVE A;  3M53 A;  3NPF A;  4OMO A;  3THK A;  2E3I A;  2V8J A;  3JAM E;  2RN8 A;  4KH1 B;  1JO8 A;  3OS5 A;  2BE7 D;  2PNI A;  2XD0 A;  2QQB A;  2FVU A;  6AT1 B;  2LCS A;  1AZE A;  3VRZ A;  5GAO p;  2EYW A;  3HKS A;  2XHC A;  3V8K A;  1Y07 A;  4EMH A;  5A0L A;  2DXU A;  4MDW A;  4C0D C;  3GP8 A;  2DXB A;  1K9A A;  1JB0 E;  5KYX B;  2RJD A;  2FPD A;  4JRP A;  1JXO A;  2LC4 A;  4PJM A;  4C0F A;  4J9H A;  4ZGE B;  3LH0 A;  1M3C A;  3CCM T;  3RBB B;  1ARK A;  3AHU A;  1G3S A;  1D1C A;  4HCC A;  2L0A A;  4A4H A;  2FPF A;  1OZ2 A;  2F69 A;  2JNG A;  2YT6 A;  5FU7 C;  4XTZ A;  2EW3 A;  3RKX A;  2LX7 A;  2DZC A;  1PKT A;  1BI3 A;  4AFQ C;  1VQ5 A;  1K8A R;  4M7D A;  3EG9 B;  3JCM h;  2XMF A;  1YHQ A;  1RAA B;  3QUI A;  5IN1 A;  2J05 A;  2M0O A;  1GBR A;  1ZA1 B;  2F2V A;  2O2O A;  2RNA A;  3JB9 I;  1DJ7 B;  2M16 A;  2DK3 A;  4ORZ A;  1UHC A;  2E4H A;  5D7U A;  3KXT A;  3H0I A;  4ZTJ A;  4J7I A;  5CO7 A;  2BZ8 A;  4ATO A;  2ZPF B;  2HNI A;  1K0X A;  3G6E Q;  9ATC B;  5KYX A;  1VQ4 T;  2DJZ A;  4FT2 A;  4DBH A;  2E64 A;  4QT7 A;  3NTK A;  3P8B B;  4MZM A;  1YJW A;  1I0C A;  1GCQ A;  3UA7 A;  1GFD A;  1AOJ A;  3RER A;  2CP2 A;  2RHY A;  5CR2 A;  1NLP C;  2RPN A;  1MUZ A;  2RI2 A;  1RAF B;  2K2M A;  2O4X B;  4PJO B;  3M56 A;  5GAN 4;  1PD1 A;  1OUL A;  1NJI U;  1K1Z A;  3QZ9 B;  4HCK A;  5CKF A;  2VXE A;  4C8Q E;  1FYN A;  3EG9 A;  4M78 C;  1Y57 A;  5D6Y A;  2DL3 A;  3CC4 A;  1XNI A;  2VGN A;  3EHQ A;  3FJP A;  2DL8 A;  5DY9 A;  4RCB A;  3CCL A;  2X4X A;  1BU1 A;  2X4J A;  1YBY A;  1M90 R;  1U1T A;  3QJ6 A;  3MEA A;  4JJB A;  3M0Q A;  4Z02 A;  1PSE A;  2COW A;  3PFS A;  3M57 A;  1UUE A;  2DYB A;  1D0Y A;  2DIG A;  2HBP A;  1C6V X;  4M7D E;  1RI0 A;  2O9V A;  4PJL A;  1VQM Q;  2HD0 A;  2XG8 D;  3OQ5 A;  1M1G A;  1YJ9 Q;  2E41 A;  3A8M B;  2O01 E;  3CC2 A;  5KYW B;  2J06 A;  3PTA A;  2QA4 A;  2O4X A;  4PJO A;  4C92 C;  4J9I A;  1OU8 A;  2DJQ A;  2FPE A;  4EMK B;  3MO8 A;  2LQK A;  2RMO A;  4J9E A;  4RTT A;  4JDS A;  2FRY A;  1IB8 A;  5GAO q;  1YNZ A;  1I07 A;  3CCS T;  5FRO A;  1YIT A;  4V2S A;  1RAI B;  4OVA A;  4HCB A;  1E6G A;  2QEX A;  2XI9 A;  1VQL Q;  3NMZ C;  1K76 A;  2BUD A;  4E7I A;  5A2Q E;  1WHH A;  3ZFJ A;  4F7U G;  2DLP A;  4J83 A;  1JEG A;  2LMJ A;  3JCM P;  5IHI A;  1PD0 A;  1V29 B;  5IHK A;  3CMA A;  1H92 A;  5CKB A;  2K57 A;  3QXE B;  2DX1 A;  2L2P A;  3EH2 A;  3ULR B;  2E5K A;  4XU0 A;  4ZGJ B;  2K5F A;  2PUK B;  1PNJ A;  1ZA2 B;  1HYO A;  3CPW A;  4FL6 A;  1VQP A;  1ZX6 A;  5GAM h;  1TTH B;  1TUG B;  5KYW A;  1PKS A;  4M77 B;  3QDR B;  5KCH A;  3H8Z A;  1M3B A;  1VYT A;  4RG8 A;  4A63 B;  2OX7 A;  5HKC A;  2DPP B;  2BE9 B;  4A4K A;  4FYV B;  4EMK A;  1I5L A;  1WXB A;  1JRI A;  5CKD A;  3OMC A;  1X6G A;  4JZ4 A;  2NWM A;  4M75 C;  3SWN C;  1VYU A;  2HL3 A;  2M0Y A;  1QCF A;  1M1F A;  1E6H A;  3FRN A;  1AEY A;  1MMG A;  4BI3 A;  2E65 A;  4RTU A;  2OTJ A;  1ZBX A;  3MCA B;  2RK2 A;  3OYA A;  1YI2 Q;  3LX7 A;  3LGF A;  4A53 A;  1ZSG A;  2A7Y A;  1XTD A;  4KGZ B;  3CCJ Q;  3M4Y A;  1VQ8 Q;  4IUR A;  2DEQ A;  2KYM A;  3TVT A;  3OA6 A;  1D09 B;  1S72 T;  3CCV A;  2ROT A;  2JS2 A;  2OTL T;  4AG2 C;  5FU6 B;  4NL2 A;  1VQO Q;  5FRM A;  1RLP C;  2KMT A;  1M1K R;  4M78 A;  1O75 A;  3DB3 A;  4M77 A;  1WJS A;  5C0M A;  1RAC B;  2MYS A;  4ZNX A;  2DFU A;  3CBO A;  4QW2 A;  3FJ5 A;  4B9X A;  3JCM g;  2X4Y A;  3RUX A;  1UEC A;  1K73 C;  1ZSZ B;  3G1J A;  3CPW S;  3IQL A;  4M7A C;  2EYX A;  1U3O A;  5D6W A;  3E9G A;  5GMK i;  2EQK A;  2EGA A;  1TUD A;  2KK4 A;  3GLX A;  4NOY A;  1RAD B;  1PM3 A;  2FZG B;  4N0A A;  1RAH B;  3L1A A;  3HHT B;  1SHG A;  2CT3 A;  1RAE B;  3E19 A;  3CCE A;  3I56 A;  3CCM Q;  5KH6 A;  1D3B B;  1UG1 A;  1OYX A;  3V8L A;  2RQV A;  4D8D A;  2RD1 A;  1G3W A;  1YCS B;  2DER A;  4E7L A;  1Y0M A;  2DRM A;  4BY6 C;  4CC4 B;  5HK0 A;  3JCM W;  2KYB A;  4F17 A;  2QQ9 A; 
#chains in the Genus database with same CATH homology
 3CCQ T;  1N8R C;  3DB4 A;  4N4H A;  3JRZ A;  2DD5 A;  1OI1 A;  3CCU T;  1KD1 C;  3MET A;  1N6A A;  3I55 A;  3CME A;  5GAN h;  1UEB A;  2I2L A;  2YLB A;  2KSS A;  2LNV A;  3L2R A;  3PT9 A;  4ME7 A;  4IUQ A;  4KT0 E;  4M78 F;  1FWZ A;  4Q5W A;  4M7D G;  2CYZ B;  5GAO r;  5GMK l;  2CKK A;  4O6J A;  3OW2 A;  2DTO A;  2QEX T;  5GAN 2;  3VYG A;  5GAM e;  4J7F A;  4M77 F;  1FXX A;  3CXC A;  3FDR A;  3JCM J;  1VQ4 A;  3TRE A;  4MML A;  1VQ9 T;  2PVG B;  2M9U A;  3QYH B;  3OBY A;  2EWN A;  5LJ3 d;  4L6V 5;  5GMK h;  2RK1 A;  5LJ5 g;  3EFS A;  5GAN j;  5I2S A;  3GPL A;  1VQ6 T;  4EPC A;  3EFR A;  5KE2 A;  4OB3 B;  1VQ5 T;  3QSU A;  4FU6 A;  3CCR T;  2ZGW A;  4M78 E;  3L2V A;  4KUL A;  2XDP A;  2XDD A;  2D0Q B;  1M90 C;  1HXD A;  3PGG A;  5CQX A;  1W2B S;  3L42 A;  2X4W A;  2F5T X;  1KQS S;  1QVG S;  2RB6 A;  3L2W A;  3OS2 A;  1VQN T;  4QQ6 A;  2PQW A;  5EG2 A;  5GAN f;  5GMK j;  3OYY A;  2DXC A;  1QP3 A;  1ZHI A;  1Y7X A;  3GOX A;  1TH7 A;  2G3R A;  4QQG A;  2FB7 A;  2C06 A;  2MMP A;  2VUB A;  4Y91 A;  2XK0 A;  2EQU A;  2BKD N;  3VV0 A;  2KQW A;  2VC8 A;  1XQH A;  3GNG A;  4E47 A;  3PIP A;  3LWH A;  2GFU A;  5LJ5 d;  1VQP T;  1JJ2 A;  3MHX A;  4P5N A;  1WNL A;  4NS5 A;  4II1 A;  2DTI A;  3BW1 A;  3VUB A;  3WVD B;  4EMG A;  1WJQ A;  2K5I A;  3QBY A;  2R5A A;  5CQY A;  3JCM c;  5CAI A;  1HK9 A;  1M8V A;  4M75 D;  2DO3 A;  4C8Q F;  3QO3 A;  3RMQ A;  1NJI C;  1B34 A;  1H64 1;  5HK3 A;  4A4E A;  4PJO E;  2H3J A;  1G3Y A;  4BI4 A;  4B9W A;  1Q81 U;  4GLK A;  2EJF A;  2K5L A;  4IUV A;  5AYF A;  3V7S A;  1FX7 A;  3PNW C;  4C92 F;  3BFM A;  3JB9 J;  1QVP A;  3OYM A;  4IKF A;  2K3X A;  4D6W A;  3QYG B;  5FRN A;  2GQV A;  4Y28 E;  2QXF A;  3VJP A;  2F5K A;  4F7U F;  3CCJ T;  3V7C A;  4PKC C;  3X20 B;  1VQ8 T;  2QQR A;  4J6X A;  4OB0 B;  3VYH B;  4JUV A;  3GNF B;  2PVD B;  4C0Z A;  2E12 A;  2EYQ A;  2QDY B;  4M77 D;  3FEO A;  4XK8 E;  2R5M A;  4OGC A;  5L8R E;  3HSB A;  1H3Z A;  2DD4 A;  4C92 E;  5GAN 5;  2OTJ T;  4QVZ A;  1VQ7 A;  4CI0 C;  1NPR A;  3C4S A;  1BIB A;  1YIJ T;  3KBG A;  2XIC A;  4JRK A;  5LJ5 h;  4F7U E;  2DIQ A;  2RI5 A;  2DVE A;  3M53 A;  3OMG A;  2LDM A;  4KUD K;  1KQS A;  4OGE A;  1QVG A;  3OYL A;  2RHZ A;  3G4S T;  3CC4 T;  3OW2 S;  2LT4 A;  2V8J A;  3C95 A;  3FIF A;  3JAM E;  3CXC S;  2FHD A;  3OB9 A;  2HAX A;  4JS5 A;  4XTV A;  3OS5 A;  2XD0 A;  1UGS B;  3O8V A;  4E7H A;  5J39 A;  2E5Q A;  4ELY C;  2QQB A;  2RJF A;  2RJE A;  5LJ5 j;  2ZPG B;  2FVU A;  3HRS A;  3EAE A;  2EFI A;  2E6Z A;  5FU7 B;  3S3N A;  2EJG A;  3UT1 A;  2LTO A;  3OBW A;  5GAO p;  1QP2 A;  5GAM g;  3HKS A;  1K73 U;  2XHC A;  3S3O A;  2MWP A;  3V8K A;  1Y07 A;  4EMH A;  5A0L A;  2DXU A;  2E6N A;  4M7A D;  4MDW A;  3OYG A;  1LOJ A;  4NL3 A;  2L8D A;  4C0D C;  4C8Q D;  3G71 T;  5CCA A;  3GP8 A;  1Q7Y U;  2DXB A;  5LJ5 f;  1JB0 E;  4ZN1 A;  4X9D A;  5I21 A;  1X75 C;  3MP1 A;  2RJD A;  3E1S A;  4X9C A;  4JRP A;  3RES A;  1UB4 A;  3HL8 A;  2JUF A;  3CCQ A;  2LC4 A;  3L2U A;  2EQM A;  3QPH A;  4M75 F;  4RKU E;  4C0F A;  3GF5 A;  3LH0 A;  4PNO A;  4ZGE B;  4FM4 B;  5GAN 6;  1K9M U;  1PSF A;  3CCM T;  2L5Q A;  3AHU A;  3M5A A;  3QHS A;  1G3S A;  4BE1 A;  1OZ3 A;  4OF1 A;  3OSV A;  5KCO A;  3L2Q A;  4A4H A;  4HCC A;  2X35 A;  5GAN e;  5GAM d;  1OZ2 A;  2XKO C;  2EQJ A;  2F69 A;  2JNG A;  3ZEH A;  4R55 A;  4BAC A;  1N9S A;  2JOY A;  4VUB A;  4QQD A;  5J3B A;  1BI2 A;  1YIT T;  1X6O A;  2RA2 A;  1BI1 A;  5FU7 C;  4XTZ A;  3JCM Q;  2RJC A;  4M75 E;  3X24 B;  3RKX A;  1Y96 B;  1YJN T;  1Y71 A;  2DZC A;  3CCE T;  4M7D D;  3I56 T;  2R57 A;  1BI3 A;  4ZTF A;  1VQ5 A;  3MP8 A;  4M7D A;  5GMK e;  3JCM h;  4L59 A;  4TVR A;  1N8R U;  1YHQ A;  3QUI A;  1VQK T;  5IN1 A;  2M0O A;  1W4S A;  2OAU A;  4IUP A;  3G6E A;  2GF7 A;  4MZT A;  3JB9 I;  1DJ7 B;  2JVV A;  3LWI A;  2M16 A;  1G3T A;  1BYM A;  2A3L A;  1WJR A;  2DK3 A;  3HFO A;  2KAF A;  1M4Z A;  3LGL A;  4ELZ C;  3JB9 G;  4M77 E;  3CMA T;  2PU9 B;  2L89 A;  3URG A;  4HKE A;  1M1K C;  3KXT A;  5LL6 S;  1LNX A;  1UGR B;  4ZTJ A;  3SB2 A;  4J7I A;  2P0Q A;  2WSE E;  5CO7 A;  5CKH A;  4M78 B;  3CME T;  1GXI E;  2R58 A;  3VUZ A;  3UPU A;  2K2V A;  4ATO A;  1YCY A;  1D3B A;  2HNI A;  2ZPF B;  4GY5 A;  2IG0 A;  1IZ6 A;  3LLR A;  4L5G A;  2D6F A;  2ZPI B;  1VQ4 T;  2JTM A;  1I4K 1;  3SFM A;  2DJZ A;  3JCM f;  4FT2 A;  1M90 U;  1S72 A;  4DA4 A;  2E64 A;  3H6Z A;  4M7A F;  4DQ2 A;  3NTK A;  2KVQ G;  2EAY A;  3P8B B;  3OS1 A;  4MZM A;  2OTL A;  4PJO C;  1G5V A;  1YJW A;  1IRE B;  1VIE A;  5GAO n;  1Q86 U;  3RER A;  1VUB A;  3JCM V;  1U8R A;  2RHY A;  2JTF A;  1I8F A;  1N9R A;  5LJ3 h;  1KQ2 A;  4FIB A;  1YI2 T;  1SSF A;  2RHI A;  4OP0 A;  4BUG A;  2FYK A;  5CR2 A;  3PIO A;  1Q81 C;  3LYI A;  4LDW A;  4RCC A;  3MP6 A;  4UC4 A;  3FB9 A;  2VXF A;  2RI2 A;  4FSX A;  2Y4Y A;  3OYF A;  2GCX A;  2O4X B;  5GAO m;  3OYC A;  3OYE A;  1QVF A;  2ZZD A;  2LRQ A;  4PJO B;  2CS7 A;  3M56 A;  3QZ5 B;  1Y96 A;  2L3R A;  2FL7 A;  4X34 A;  3UDC A;  5GAN 4;  4M7A E;  1NJI U;  3QZ9 B;  3BY7 A;  2VXE A;  5CKF A;  4XQ3 A;  4XU1 A;  4C8Q E;  4M78 C;  1KD1 U;  4PL6 A;  2M1H A;  5D6Y A;  5LJ3 j;  1KQ1 A;  4XTW A;  4J6W A;  5J26 A;  1VQO T;  3DLM A;  3P8D A;  3G4S A;  5LJ5 e;  3CC4 A;  4XTU A;  1R8O B;  1XNI A;  2WSC E;  2XU8 A;  2VGN A;  3M58 A;  3Q1J A;  2LT1 A;  4M7D F;  3FJP A;  1KC8 C;  2D9T A;  1EIF A;  2EIF A;  2E70 A;  5DY9 A;  3WVE B;  2ZPE B;  4M78 G;  4RCB A;  2X4X A;  4N4I A;  4XU2 A;  4C92 B;  2QA4 T;  1NZ9 A;  5LJ3 f;  3CCL A;  4LDX A;  2X4J A;  1YBY A;  3MEV A;  3QKJ A;  1U1T A;  1YJ9 A;  3QJ6 A;  3A8G B;  3MEA A;  3CCV T;  2PUO B;  2RH2 A;  4CRI A;  4F7U B;  1KG1 A;  4Z02 A;  1PSE A;  5DM7 R;  3PFS A;  5GAN g;  4JJN K;  1VQM A;  4JS4 A;  3HRT A;  3M57 A;  3OSS C;  4IUU A;  4XTY A;  3RIR A;  2K4Y A;  2PVO B;  2DIG A;  2RM4 A;  2HBP A;  2MI6 A;  3S6W A;  1NPP A;  3INZ A;  3OYN A;  1UGQ B;  4O5V A;  4PLI A;  1RI0 A;  4M7D E;  3L2Z A;  1Q82 U;  2V8K A;  1M9S A;  3G71 A;  3X28 B;  1K8A U;  3QJY A;  5GAN 7;  4DOW A;  2HD0 A;  2XG8 D;  1WQW A;  3HP9 A;  3OQ5 A;  3OY9 A;  3G7Z A;  2QI2 A;  4HT9 A;  1M1G A;  4C5H A;  5FLX E;  5M9O A;  3M4G A;  2E41 A;  3VU3 C;  3X25 B;  3A8M B;  2O01 E;  4ZGD B;  3CC2 A;  2XID A;  2ZPH B;  4PJO G;  1VQL A;  3CBM A;  3JCM b;  3GIB A;  4JRI A;  3WXM B;  3PTA A;  5CIU A;  1Q7Y C;  2QA4 A;  5GAN d;  2O4X A;  4PJO A;  1ZQ1 A;  4C92 C;  2RO0 A;  3CCU A;  4QVC A;  2DAQ A;  2KY9 A;  3QG1 A;  2VV5 A;  3C94 A;  2LQK A;  3MO8 A;  4EMK B;  4ZN3 A;  2P4T A;  5GAO q;  4JDS A;  3CEY A;  3M59 A;  1QW1 A;  4HCZ A;  3CCS T;  2P0P A;  5FRO A;  1YIT A;  1K9M C;  4V2S A;  4LDU A;  2LQ8 A;  4OVA A;  4HCB A;  2QEX A;  2XI9 A;  4JLI A;  4JLG A;  2E10 A;  3CD6 T;  2EKO A;  4R56 A;  1VQ9 A;  4C92 G;  4KBM B;  3OYK A;  3A5Z B;  2BUD A;  5IAY A;  5CKE A;  4E7I A;  5A2Q E;  1AHJ B;  3JSC A;  3JCM e;  1MHN A;  1QVF S;  3ZFJ A;  4C92 A;  3PMI A;  4F7U G;  1VQ6 A;  2DTH A;  4J83 A;  3ER0 A;  3CC7 T;  3RKY A;  3JCM P;  3M55 A;  3CCR A;  1N27 A;  1V29 B;  4M75 B;  2VYT A;  4LDY A;  1KHC A;  3SWN B;  3SD4 A;  3CMA A;  2RHX A;  4J6Y A;  2CZ7 B;  3NTH A;  5D6X A;  5CKB A;  2K57 A;  4RG2 A;  3UWN A;  1VQN A;  3QXE B;  4A4F A;  3R6O A;  1BKB A;  3BDL A;  4EMK C;  5KE3 A;  2HQE A;  5CK9 A;  4XU0 A;  4J5Y A;  4ZGJ B;  3J81 E;  2K5F A;  2MF2 A;  4BE0 A;  2PUK B;  5GMK m;  1M5Q 1;  3CPW A;  2ZCF B;  4FL6 A;  4IUT A;  3JB9 D;  1VQP A;  4RMO A;  3I55 T;  2DKG A;  5GAM h;  3NFC A;  3S3M A;  4M77 B;  4BD3 A;  3QDR B;  1WPY A;  5KCH A;  5DLQ E;  3H8Z A;  2NLU A;  4RG8 A;  5CVI A;  3E9F A;  1WGS A;  5HKC A;  2DPP B;  4A4K A;  2BIV A;  4EMK A;  1YHQ T;  1YI2 A;  5A0D A;  1I5L A;  3MEU A;  3PMT A;  1M1K U;  1JRI A;  5CKD A;  2VGM A;  3OMC A;  5LJ3 e;  3G6E T;  2RI3 A;  2HQX A;  4M75 C;  4HA8 A;  5GAM j;  1KHI A;  3SWN C;  3TCJ A;  3CCJ A;  4BI8 B;  3FC3 A;  1VQ8 A;  4PJO F;  4LD9 K;  1Q86 C;  2E1H A;  1M1F A;  3FRN A;  3VKI A;  1XOV A;  5GAO l;  4E7J A;  5IT9 E;  2CZ0 B;  1BIA A;  4BI3 A;  4N4G A;  2E65 A;  1VQO A;  5I2M A;  2OTJ A;  2LCC A;  1ZBX A;  3MCA B;  3ME9 A;  2RK2 A;  3OYA A;  4M75 G;  5GAM f;  3LX7 A;  1YIJ A;  5GAN 3;  3LGF A;  2RHU A;  4A53 A;  1BI0 A;  2A7Y A;  3LW5 E;  1XTD A;  3HFN A;  2DZ9 A;  1VIF A;  2ZPB B;  4OMF B;  4M75 A;  4M77 C;  3M4Y A;  5HY6 A;  3SWN A;  5DLO A;  3OYD A;  3ASK A;  4IUR A;  4M7A B;  3JCM X;  2DEQ A;  3A8O B;  3C12 A;  2DXT A;  1NE8 A;  4HT8 A;  3OA6 A;  2YHT A;  3A8L B;  3A8H B;  3MEW A;  4C8Q B;  4XAX B;  3OYH A;  4JRQ A;  1S72 T;  3CCV A;  2QQS A;  3TEE A;  3F70 A;  4A4G A;  3NTI A;  2OTL T;  1YJW T;  5FU6 B;  2AHJ B;  4NL2 A;  3RKW A;  5FRM A;  1WQ7 A;  2CZ1 B;  4YTL A;  4FT4 A;  3V7R A;  4M77 G;  4M78 D;  2KMT A;  4MZP A;  3FLG A;  2V8I A;  4M78 A;  3T9N A;  1X01 A;  1O75 A;  4OB2 B;  1RL2 A;  3DB3 A;  4M77 A;  1WJS A;  5C0M A;  2Y90 A;  4C0D B;  4C0G A;  4BB7 A;  2Y4X A;  1KC8 U;  3J80 E;  5C6S A;  3JB9 H;  3CBO A;  2EJ9 A;  4QW2 A;  4C5I A;  3DKM A;  3RMS A;  1MGQ A;  3JB9 F;  4B9X A;  3OYJ A;  3JCM g;  3CBP A;  4C5G A;  3SDZ A;  1Q82 C;  2X4Y A;  3RUX A;  4N0A C;  1W2B A;  1K8A C;  4PLL A;  3HPW A;  4BY6 B;  1VQ7 T;  3OYI A;  4M7D B;  1K73 C;  4C5E A;  4WF2 A;  3CPW S;  4M7A C;  3KUF A;  3CCM A;  4BDY A;  4OB1 B;  4LD6 A;  2GFA A;  2JZ2 A;  4C8Q C;  2JN0 A;  2WAC A;  2YRV A;  5D6W A;  3DLL A;  1VQM T;  3CCS A;  4QVD A;  3ZBD A;  3CCL T;  4PJO D;  5FU6 C;  2LCL A;  3E9G A;  2CGH A;  5GMK i;  2EQK A;  1I81 A;  2QQA A;  1U1S A;  2KK4 A;  4J8O A;  1YJ9 T;  1O9S A;  3GLX A;  4NOY A;  5A0G A;  2XDB A;  3CD6 A;  2P0K A;  2WSF E;  2YLC A;  4M7A G;  4N0A A;  1JBM A;  3JCM d;  3L1A A;  3HHT B;  4MMK A;  4C8Q G;  1YJN A;  3E19 A;  5GAN 8;  2IVW A;  3CCE A;  2LX9 A;  3V8J A;  4EDU A;  3I56 A;  3OS0 A;  2MWO A;  3M54 A;  4M7A A;  2MAM A;  5KH6 A;  1D3B B;  3CC7 A;  4C8Q A;  4E7K A;  4XTX A;  1OYX A;  1VQK A;  2B8A A;  3HRU A;  3M9Q A;  3BDU A;  3V8L A;  4A54 A;  4C92 D;  2KDS A;  3N5B B;  1P92 A;  2RD1 A;  1UGP B;  1G3W A;  3J7A F;  2CZ6 B;  4E7L A;  3X26 B;  3TU4 K;  3P8H A;  3CPF A;  2LVM A;  3QII A;  4BY6 C;  1LJO A;  1JJ2 S;  3CC2 T;  4M7D C;  4BE2 A;  4XU3 A;  4KUI A;  5HK0 A;  5LJ3 g;  1VQL T;  3JCM W;  1B34 B;  4LDV A;  2QTX A;  4DOV A;  4BDZ A;  4MDX A;  4F7U A;  3OYB A;  2K3Y A;  2QQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...