1M3CA

Solution structure of a circular form of the n-terminal sh3 domain (e132c, e133g, r191g mutant) from oncogene protein c-crk
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
CGAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene C-crk
publication title Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 8
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m3cA00
2LJ0A 4K11A 1NEGA 2EYYA 2KYMA 1JQQA 2DBKA 2CUBA 2FPEA 2K2MA 2GTOA 1IO6A 1GCPA 1H3HA 2EBPA 2YT6A 1TUCA 4OMMA 2FEIA 2KRNA 5IHIA 2ESWA 2L3QA 2VVKA 2HCKA 1GCQC 4CC2A 1QWEA 2LP5A 3TSZA 1U5SA 1CSKA 1MV3A 1Y0MA 4CC7A 1PHTA 1VYTA 1WLPB 3M0UA 5I11A 1NEBA 1NLOC 3NMZC 1MV0B 1N5ZA 1ABQA 1Z9QA 3VS6A 3SEMA 3I5RA 1K76A 1TUDA 4RTUA 2AK5A 1I0CA 2RQVA 2ROLA 1SHGA 4JPBW 2EYZA 2W10A 2KYBA 4FSSA 3VRZA 2L0AA 1FYNA 3M0QA 3H0IA 1W70A 2ABLA 3M0TA 3M0RA 2YSQA 1BB9A 4OMQA 1QWFA 2O31A 2A36A 2LMJA 2ENMA 2SEMA 1UFFA 2IIMA 2EYXA 1AZGB 1GCQA 3JV3A 2JS0A 2JT4A 1E7OA 4JJCA 2CT4A 1T3SA 2JM9A 1NLPC 5GJWB 2D0NA 2FRYA 4JJBA 2JW4A 4KRTA 2C0OA 2YUQA 1V1CA 2EQIA 1K4US 4Z8AA 2XMFA 3UA6A 1HJDA 4CC3A 4RUGA 3NHNA 1UHCA 3EHQA 1T0HA 1WA7A 1QCFA 2EGCA 2NWMA 1X27A 3I5SA 2JM8A 2AZSA 1EFNA 2C0TA 2BTTA 3I9QA 5L23A 2OJ2A 2BZYA 2X3XD 1XOVA 4AFUC 1K0SA 2J05A 3FJ5A 1OEBA 1X69A 1SEMA 1RLPC 1S1NA 5I22A 1B07A 3O5ZA 2LZ6B 2FPDA 2DRKA 4JZ3A 2A37A 2FRWA 2GGRA 2J06A 2NUZA 2L2PA 2DL4A 2L3PA 1A0NB 2EYWA 4A63B 2HDAA 4AFQC 4LUDA 2KXDA 2VKNA 1M8MA 2DILA 1HD3A 1M3CA 1K0XA 4HVUA 1AEYA 3UA7A 4F16A 3VS2A 3A98A 3M0PA 4J9EA 2KRMA 1X2KA 2CT3A 1OOTA 2DVJA 1GFCA 2FO0A 2JS2A 1AWOA 2CREA 1BU1A 1X2QA 3H0FA 3H0HA 1NYGA 2DM1A 2D8JA 2KT8A 1NYFA 1WXBA 4RTXA 1PWTA 5EC7A 1JO8A 3U23A 3EG1A 4F17A 2EGAA 2LNHB 4OMNA 1PRLC 1WX6A 1UHFA 2KEAA 1I07A 1X6GA 2SRCA 3LH5A 2EKHA 4LN2A 2CH4W 4AFSC 1J3TA 4HXJA 3VS4A 2K79A 2KGTA 1UGVA 1M30A 2DX1A 2CUDA 4J9CA 2DL8A 2M0YA 1K9AA 2F2XA 5IHNA 1YWOA 4D8DA 3NPFA 2DL5A 1PRMC 1Z9ZA 1JEGA 1K1ZA 4GBQA 4RTVA 5IXBA 2JMAA 1SRLA 1VYUA 2M51A 4JZ4A 2J6FA 1UDLA 1G2BA 1U06A 1UTIA 2O9SA 1M3BA 1AD5A 2B86A 3RNJA 2JMCA 4DEXA 2PZ1A 2YUPA 1ZLMA 1SRMA 1RLQC 2LCSA 2D1XA 2D8HA 5FWCA 3SHWA 5FWBA 3C0CA 4J9FA 1OPKA 2DE0X 1B3QA 2BZ8A 2MIOA 2RQTA 1ZUUA 2G6FX 2DLPA 1M27C 1I1JA 1ZUYA 1YCSB 2A28A 4ESRA 3TVTA 1ZSGA 1KIKA 2O2OA 4DEYA 1GBQA 1GFDA 1GL5A 5IHKA 2K3BA 2KBTA 1ARKA 4HVWA 2EVRA 1NG2A 2J6OA 2KXCA 4RTTA 4CC4B 2J6KA 2AZVA 4RTZA 1KSWA 2KT1A 4R0KA 3TSWA 4OMOA 5HCKA 4AFZC 2YDLA 2DBMA 5FW9A 1UECA 1OV3A 2YUNA 1CKAA 4IIOA 3GBQA 2MOXA 2AKKA 1JXOA 2DNUA 2F2VA 2I0NA 1AZEA 2P4RA 4RTYA 1AWJA 1AOJA 3VS5A 2FPFA 3EHRA 4HVVA 1PNJA 1U3OA 2RQUA 2RN8A 2LQNA 4QT7A 1KFZA 2ROTA 3VS7A 4Y92A 2A08A 2LJ3A 1YNZA 1MUZA 1VA7A 2RPNA 2JTEA 1VYVA 4GLMA 2O88A 2KROA 1KJWA 4F14A 1NM7A 4LNPA 3VS3A 2GBQA 2E5KA 1T0JA 1W6XA 1WDXA 2CSQA 2PTKA 2FG0A 2DF6A 1FMKA 4Z89A 3NGPA 1RI9A 1T3LA 2MCNA 2OAWA 2HSPA 4ORZA 2ED1A 1E6HA 3EGUA 3I35A 3PVLA 2RNAA 4J9DA 2K6DA 2DL7A 1BK2A 2LX7A 4D8KA 1BBZA 4AG2C 3CQTA 1SSHA 1GRIA 2GQIA 2DYBA 4JJDA 4ZNXA 1H8KA 1RUWA 1AVZC 1WIEA 3ZL7C 1UE9A 4LE9A 3RBBB 1ABOA 1X43A 3EG0A 2C0IA 2KR3A 1SHFA 2LJ1A 3QWXX 4RTWA 4E6RA 2W0ZA 2ED0A 1X6BA 2KNBB 1G83A 3REBB 1Y57A 3VRYA 2CH4A 1WXTA 4J9GA 1CKBA 1W1FA 2YUOA 2DMOA 3ULRB 1WFWA 4IIMA 2CDTA 3REAB 1GBRA 2H8HA 1UG1A 1SPKA 2BZXA 2EW3A 2K7AA 4X1VA 3R6NA 2RF0A 2GNCA 4Z88A 3PE0A 5GJVB 2HBWA 2J7IA 1WI7A 4J9IA 4LUEA 2RQRA 1ZUKA 4M4ZA 5ECAA 1YN8A 1ZBJA 2ECZA 2DL3A 4OMLA 2F2WA 3EG3A 3VS1A 2OI3A 4AG1C 2RMOA 2X3WD 1UJYA 1AWWA 1H92A 2DA9A 1QKXA 2L3SA 1QLYA 1PKSA 2EPDA 3KFVA 3UATA 1AWXA 2V1QA 2EGEA 4J9BA 1JXMA 4WCIA 2CSIA 2KE9A 2QDLA 1E6GA 2KRSA 1LCKA 1UJ0A 2PNIA 1QKWA 3VS0A 4J9HA 1M3AA 2V1RA 2AKLA 3H41A 2DJQA 3QWYA 3UF4A 2GTJA 1WYXA 1YP5A 3PVQA 1TG0A 3THKA 4EIKA 1YWPA 1WXUA 4HCKA 1UUEA 4OMPA 2O9VA 3M0SA 3EG2A 1PKTA 5IXFA 1JU5C 1OPLA 2DRMA 2VWFA 3IQLA 5IH2A 1ZX6A 2JXBA 2LQWA 2RQWA 1HSQA 2HEQA 2K9GA
chains in the Genus database with same CATH superfamily
3V8JA 2D9TA 3CC7T 2CUBA 4RMOA 1OU8A 1IO6A 3JB9I 2KQWA 1GCPA 1TH7A 1H3HA 4C8QD 4DBFA 3OW2S 1NPPA 3CPWS 4FYXB 2KRNA 3RR6A 4DBRA 5IHIA 2VVKA 3M5AA 1Y71A 3C12A 1QWEA 1BI0A 5IN1A 2XK0A 1VYTA 1WLPB 2QXFA 5GMKi 3CD6Q 3CCVT 1LNXA 2L8DA 3NMZC 1MV0B 1G3WA 1ABQA 1BI2A 4FYVB 3I5RA 1TUDA 4IUQA 4F7UG 5LJ3j 4M75C 3BW1A 2RQVA 1YJWT 4PJOC 5A0GA 2L3RA 3WXMB 4JPBW 3FC3A 4FSSA 3RMSA 3OA6A 1WGSA 1W70A 2E64A 1EX4A 2EIFA 3M0RA 3NTIA 4ANJA 1Q82U 2YSQA 3TREA 1BB9A 4N4GA 5J39A 3CXCP 2LMJA 3CC4Q 3TCJA 3OYMA 1M1KU 3RKYA 1GCQA 5J3BA 5CKFA 1YI2T 2JS0A 2EQUA 3A8OB 4FU6A 4JJCA 3BDLA 2JM9A 1FMVA 3CCLA 3MHXA 4KH1B 5GMKj 2D0NA 5I21A 1JJ2A 5GAOp 1YJNQ 2DZCA 2JW4A 4KRTA 5KYWA 1VQ4T 4C92F 2EQIA 4Z8AA 2XMFA 3UA6A 2LTOA 5CVIA 2RK2A 5FU7B 3QZ9B 4ATOA 1QVGA 1WA7A 1QCFA 2EGCA 5GANf 3I5SA 2C0TA 3NTKA 2DD5A 2VGNA 3L2ZA 3CC2A 2OJ2A 3E19A 1MMNA 5KYWB 1BYMA 5EG2A 1SEMA 3O5ZA 2LZ6B 3JCMe 5LL6S 3X25B 2A37A 1NBEB 3J81E 2COWA 3JCMc 3L2WA 3HSBA 1UGQB 2EYWA 4ELZC 2KXDA 2QQBA 5HK0A 5FLXE 3E9FA 1MMAA 3QXEB 3MPUB 4JLIA 3M0PA 4J9EA 4M77A 2M02A 4XAXB 2DVJA 1DJ7B 4EMKC 1GFCA 1K73U 4M7AA 3V7CA 3HFNA 2JS2A 2MWPA 4C5GA 1AWOA 3QJ6A 5GAN7 2DK3A 1X2QA 3H0HA 1VQ7T 4JUVA 2A7YA 2D8JA 3TEEA 2KT8A 1NYFA 4PJOF 1JO8A 3U23A 4F17A 3HRSA 4OMNA 4M77B 4BI8B 1QVFS 1I07A 4E7HA 4M7AB 3LH5A 4JRQA 4LN2A 5GAN2 1ZHIA 5CKEA 2K79A 1UGSB 3JB9D 2RI2A 2RB6A 1IRXA 4IKFA 1M1GA 1K9AA 3V7SA 4A4GA 2XDDA 4E7KA 3NPFA 4PK4A 3PTAA 3C95A 1Z9ZA 3CCMQ 4XU3A 2HAXA 4RTVA 5GAMg 4M7DA 3X20B 3Q1JA 3C4SA 4A4EA 4JZ4A 3PMTA 4PJJA 1G2BA 1U06A 2RHIA 3EGDA 4HCZA 2JMCA 4DEXA 2KSSA 1SRMA 1RLQC 2HQHA 3OW2A 1ZA2B 5LJ3h 4M7DB 3CPWA 1B3QA 1N6AA 2P0PA 5DM7R 1YJNT 3JCMP 2AHJB 1I1JA 3EGDB 1X01A 1ZUYA 2FZCB 5AT1B 3PIPA 4HA8A 4ESRA 1ZQ1A 2CP5A 1SSFA 2E10A 3E2UA 1FWZA 4DEYA 1GBQA 5GAN8 2KI7A 3LYIA 2K3BA 2KBTA 4HVWA 3JCMQ 2MYSA 1LJOA 2F1LA 4FIBA 1JRIA 3G71A 2J6OA 4RTTA 4MZMA 5GMKh 3I55T 1KSWA 3OYAA 4F7UF 1LPLA 1NPRA 5FW9A 2RH2A 1OV3A 5CO7A 2DNUA 4BB7A 4LD9K 4KUIA 2I0NA 3FDRA 3MKDA 3HP9A 2VC8A 1SF9A 2PVDB 2P4RA 1VQKA 1MNEA 2E65A 4HVVA 2HSEB 2VYTA 1PNJA 2ROTA 2LJ3A 4L59A 1VQ9A 3LGFA 1VA7A 4MDWA 2RPNA 1WHMA 1VYVA 5AYFA 4F14A 1RAEB 1NM7A 3HL8A 3CCQA 2GBQA 1EZZB 3CPFA 1RAGB 1T0JA 4DOVA 3LW5E 1FMKA 3MEUA 2QA4Q 3NGPA 4QVZA 2X4YA 2RNAA 1ZSZC 2EYQA 5GAOq 1OYXA 4M78G 1JBMA 2DJZA 3ZL7C 2DYBA 1RUWA 1AVZC 1O75A 3MEVA 4LE9A 1QW1A 3CCLT 1Y7XA 3KXTA 2LJ1A 4HCCA 1VOMA 4FSXA 4DQ2A 3EFRA 1S72Q 2VXEA 1G83A 3REBB 3OYBA 3JCMf 1YJ9Q 4J9GA 1K9MC 5IAYA 2E3HA 2YUOA 5C6SA 1UGPB 3HPWA 2CDTA 2FVUA 3QSUA 2H8HA 1UG1A 2B8AA 5GAOm 4Z88A 3CC2T 3OYCA 5GJVB 2LT1A 2E12A 4LUEA 4BI3A 3OBYA 1YI2A 1YN8A 3QDFA 4NL3A 3T9NA 4HKEA 1TTHB 2P4TA 3TQ7P 2F2WA 1QVFA 2RMOA 1PCXA 1QVPA 1AWWA 1H92A 3ZEHA 1X6OA 2DA9A 2L3SA 3M59A 5GANj 1M2OA 3KFVA 1R77A 3G4SQ 1M8VA 2K5IA 1E6GA 4KGXB 2KDSA 1OX9A 4FCYA 1D0YA 1VQPA 4J9HA 3N5BB 2DJQA 3UF4A 3O8VA 5KYUB 1IZ6A 1WYXA 4O6JA 2ZCFB 4C92E 3THKA 1YWPA 1PSFA 4HCKA 1UUEA 4OMPA 1M2VA 1SG5A 3M0SA 3V8LA 4XK8E 1OPLA 1NJIC 2VWFA 3JSCA 3EH1A 3IQLA 1YBYA 5IH2A 2KMTA 1YITQ 1R0BG 4M78C 3OYHA 4K11A 3OY9A 3J7AF 2DETA 2KYMA 1JQQA 5DLQE 2DBKA 2ZPBB 2FPEA 4C92D 4PFPA 2GTOA 2EKOA 1WZOA 2E5QA 2HMAA 4J7IA 4KGZB 1KC8C 1M2VB 2COZA 2JUFA 1KQ1A 2DVEA 2ESWA 3UWNA 4XTVA 4N4IA 1YIJA 5DY9A 3RUXA 1Y0MA 4FM4B 4CC7A 5I11A 1NEBA 1NLOC 4E7IA 1Z9QA 3VS6A 4JRIA 5HY6A 2CP3A 2DIGA 1I0CA 4MZTA 5KYXA 3A1PA 2EYZA 1XQHA 2W10A 2L0AA 3PGGA 2ZPHB 5GAOn 2ZPGB 4OMQA 1QWFA 3G1JA 2O31A 4DBHA 1BIBA 3CD6A 1VQOQ 2F69A 1VQNQ 4F04B 2IIMA 1V76A 5LJ5e 1E7OA 2LQKA 2O01E 2CT4A 5D6XA 5KYXB 1NLPC 3ZBDA 1K73R 1LOJA 3MO8A 1WJQA 2LCLA 2FRYA 4J6XA 2VASA 2VXFA 2C0OA 4M75A 4PJOA 1VQ8Q 3M56A 4CC3A 4PJMA 4PJOD 4RUGA 3CC4A 4J8OA 3EHQA 1U1SA 3CBOA 2ZGWA 2NWMA 4ME7A 3FJPA 2L89A 2BTTA 3I9QA 3CXCA 2BZYA 4FT2A 4AFUC 1K0SA 4FW2A 3FJ5A 4M75B 4PJOB 6AT1B 4N4HA 4M78F 1X75C 2GGRA 4LXCA 3L1AA 2NUZA 2DL4A 2L3PA 2RHUA 1D3BA 1A0NB 4GLKA 4A63B 2HDAA 4AFQC 2LDMA 3P8BB 1WNLA 5KH6A 1VQ9T 4J5YA 2DILA 4BD3A 5D6WA 1AEYA 3CCSQ 5M9OA 3CCQT 2P0KA 3LWIA 5GANh 4F16A 3VS2A 2QEXQ 3A98A 3PNWC 4XTWA 2EFIA 1X2KA 2HD0A 1OOTA 2GF7A 4ELYC 4C8QA 4D6WA 1XTDA 5GAOl 3OS2A 1D3BB 4VUBA 1BI1A 2CREA 1YITT 2D0QB 2GFUA 1WXBA 4BUGA 1TUGB 4F7UE 4RTXA 1OQKA 2E3IA 2RJFA 4E7ZA 2QQRA 2LNHB 1UHFA 5LJ3d 4EMGA 3H9NA 4C8QB 2CH4W 3RIRA 5LJ3g 3VS4A 5GAN6 5CR2A 2Y4XA 2KGTA 1JB0E 2MMPA 1M30A 2PQWA 4EMKA 2L5QA 3DB4A 3HTRA 4J9CA 3MP1A 3LWHA 2F2XA 1MGQA 1FXXA 1RAHB 2K57A 1Q86C 3G7ZA 5CIUA 3OMGA 3FB9A 5J26A 3PIOA 1EIFA 1MNDA 2O9SA 1UTIA 4C0ZA 2R5AA 3GOXA 3CEYA 1WQWA 1G8XA 2LC4A 2RM4A 2QTXA 3OSSC 5FWBA 3CCMA 2DE0X 1M1FA 2BIVA 1N9SA 3ASKA 1VQPT 1M27C 2BUDA 3CBMA 4MZPA 1YCSB 4J83A 3JB9H 4E2FB 3TVTA 1GFDA 2RA2A 3CCRQ 4C5IA 1GL5A 5IHKA 4FL6A 2HKQB 4BE2A 1VIFA 2KXCA 2AZVA 3RKWA 3G6EA 3UDCA 3BY7A 4DOWA 4OMOA 4XTYA 4BY6B 4AFZC 2YDLA 2YLCA 2OX7A 2DBMA 1Y96A 3CCJQ 3OB9A 2MOXA 1JXOA 1VQLA 2PU9B 1IGUA 1M90R 4C0GA 3A8MB 2OTLA 1AWJA 3OS0A 1VQMA 4X9DA 1OU9A 2FL7A 1YIJT 3CCST 2DTOA 4M77G 3V7RA 1KQ2A 3VJPA 2LQNA 2QEXT 3MEAA 1KK7A 1KFZA 3VS7A 1Y96B 4Y92A 2HKNA 1QCNA 4M7AG 1YNZA 4J6YA 2JTEA 4GLMA 5LJ5f 3RMQA 4LNPA 3VS3A 2GCXA 2E5KA 4TVRA 2CSQA 4MMLA 2LX9A 2MCNA 4ORZA 2HSPA 3SWNA 3KBGA 5FU7C 3F70A 2YRCA 3CD6T 2DL7A 3BDUA 2FB7A 3E1SA 2LRQA 1BBZA 4AG2C 1OI1A 1SSHA 1GRIA 2GQIA 3GF5A 1WIEA 2HBPA 3RBBB 1X43A 4RTWA 2ED0A 2X4JA 2KNBB 1Q7YC 2QA4A 5KYNA 2DYIA 3SWNB 2M16A 3VRYA 8ATCB 3ER0A 1W1FA 3L2QA 3EFSA 3CC4T 4M7DG 2JJ9A 2CS7A 3OYKA 1UEBA 4IIMA 1GBRA 1YFNA 3M53A 1D1CA 1ZSZA 2BZXA 3EAEA 3OYNA 2EW3A 1U8RA 4OF1A 2QQSA 3SD4A 4C0DB 3G6EQ 2J7IA 1TOVA 2DKGA 1S72A 1VUBA 2P84A 2YHTA 2ECZA 2DL3A 2NUPA 4B9XA 1YJ9A 4OMLA 3EG3A 2X3WD 1BI3A 1VQLQ 2QTVA 3JCMV 2XD0A 2OTLQ 2EPDA 3DKMA 3JCMh 3UATA 2V1QA 1VQMQ 4OB3B 3NTHA 2CSIA 4M77C 2KRSA 1C1AA 1KG1A 2WSCE 4A4FA 3VS0A 2NUPB 2AKLA 3H41A 2GTJA 5GAMe 3S3MA 3JCMW 2COYA 2EQKA 3GPLA 4DA4A 1YP5A 3QPHA 1QQJA 2ZPEB 4EMHA 1C6VX 4Z02A 3BFMA 1I8FA 2MWOA 1WXUA 4E7LA 3TU4K 1AHJB 3HRTA 3EG2A 4GY5A 3HFOA 4JJNK 1ZBXA 5FRMA 2XICA 3G4SA 2MPXC 3VYGA 3CCJT 2LT4A 2K9GA 1KD1C 2LJ0A 3QBYA 2EYYA 1RAIB 1D0XA 3A8GB 1FMWA 4M78E 2EBPA 3RKXA 1TUCA 3ZFJA 4OMMA 3LLRA 3A8LB 1HK9A 2BE9B 1R0CB 9ATCB 2L3QA 4NS5A 3PMIA 1WHLA 4M7DC 5KYYA 2LP5A 3TSZA 2V8KA 5DLOA 3JCMb 1YITA 2X35A 3CXCS 3GNGA 4HT8A 2H3EB 1N5ZA 2XDBA 4KBMB 2CKKA 3SEMA 3FLGA 1K76A 4B6MA 2RJEA 4J7FA 4RTUA 2AK5A 3OW2P 3QIIA 4M78D 1SHGA 2Y90A 2KYBA 3VRZA 1FYNA 5KYYB 2YXYA 3L42A 1BIAA 2RD1A 1M90U 4RG8A 5HKCA 3CCMT 2A36A 2ENMA 3I56Q 2XDPA 2KY9A 1AZGB 3M57A 2DXUA 1W2BP 4R55A 3JV3A 2JT4A 2OTJQ 2ATCB 2MI6A 2HQXA 5GJWB 2PUKB 2R57A 1QCOA 2DERA 5GANd 4M77F 2YUQA 1V1CA 1K4US 2H3JA 4MMKA 4M7AF 5GANg 1VQOA 3G6ET 1VQNA 1T0HA 3EFOA 1IREB 2JM8A 1K9MU 3MCAB 1EFNA 5L23A 3VKIA 3VV0A 2X3XD 1VQLT 1VQ6Q 1LVKA 2MF2A 3CCUQ 1OEBA 3SFMA 1X69A 2OTLT 1S1NA 5L8RE 5I22A 5GAMh 1WPYA 4JZ3A 2DRKA 3DLLA 3WVEB 1VQ8A 3ME9A 1VQMT 4OP0A 2FRWA 2J06A 1KHCA 2L2PA 3WVDB 2HZYA 4NL2A 2KVQG 4LUDA 1M8MA 2DAQA 1HD3A 2QGFB 1M3CA 1K0XA 3UA7A 1PD1A 2EJ9A 4RKUE 3E9GA 4C92A 4M7DF 2KAFA 2C06A 4J6WA 1BU1A 1V29B 2QK0A 1NYGA 1TXQA 2CP6A 3QZ5B 5LJ5j 1D1BA 1M4ZA 3CMAA 1PWTA 5EC7A 1MMDA 3CCSA 2EGAA 1Q86R 4KGVB 2RI3A 1PRLC 1WX6A 2DO3A 2QEXA 2X4XA 4C92B 2KEAA 3FIFA 1HXDA 3CCVQ 1IXDA 2QA4T 1OZ2A 1NJIU 1YHQA 2EKHA 1Q81C 5CKBA 4AFSC 1J3TA 2JVVA 2K4YA 4CRIA 4OVAA 1YJWQ 2DX1A 1UGRB 2CUDA 3EG9A 2IG0A 2DL8A 2M0YA 1W4SA 2FZKB 3JRZA 4D8DA 2DL5A 1PRMC 4PFZA 5GAOr 1S72T 1PC0A 4PJNA 1K8AC 1Q95G 3A5ZB 2XG8D 2CGHA 1UDLA 2J6FA 5GAMf 1YJ9T 2E6NA 1QP2A 3S3NA 1AD5A 2B86A 3RNJA 4WTOB 2DZ9A 4XTUA 3I56T 1D0ZA 4QQ6A 2E1HA 2YUPA 5I2SA 4Y91A 2LCSA 2OTJT 1VQ4Q 2WSFE 5FWCA 3SHWA 3C0CA 4J9FA 1OPKA 2XI9A 2DPPB 2CP2A 4RCCA 2BZ8A 4LDVA 1MMGA 2MIOA 1VQ5A 1ZUUA 4M75G 2DLPA 4PJOG 2DFUA 3M54A 5CCAA 2DXCA 2A28A 1N8RC 1G3YA 3OS5A 3SB2A 2RO0A 3OYDA 1RL2A 1KIKA 2O2OA 3OYGA 3MP6A 2CZ6B 5FU6C 3M58A 3VUBA 2WACA 3G4ST 2G3RA 4CC4B 2J6KA 1N27A 4RTZA 1VQ6T 4L5GA 2JTFA 2XU8A 5HCKA 4XU2A 3A8HB 3OMCA 2E4HA 3CBPA 2RJCA 3BE3A 3CMAQ 1UECA 2EJFA 1MHNA 3CCRA 4YTLA 2F2VA 4C5HA 1YHQQ 3M4GA 1TU0B 3OYLA 2A0FB 3QYGB 2VV5A 4LDXA 2K5LA 2AIRB 4A54A 2CZ7B 5IT9E 5A2QE 2LCCA 2JN0A 2RN8A 4V2SA 2XKOC 4C8QG 1VQ7Q 1KQSP 3QG1A 1MUZA 5GMKm 2PVOB 2JOYA 2EJGA 2RHXA 3CCJA 2KROA 4JRKA 2X4WA 1Q82C 2DXTA 3CCEQ 1TS9A 1WDXA 3R6OA 2FG0A 4MDXA 3M55A 4BACA 1Q7YR 1M1KC 4XTZA 2FYKA 1RI9A 1T3LA 3DLMA 2E70A 2ED1A 3KUFA 2EQMA 4PLIA 3EGUA 1O9SA 4F7UA 1BK2A 2RHYA 4D8KA 1NE8A 4QKUA 5I2MA 3CQTA 4ZNXA 1H8KA 2CZ0B 2K5FA 3JCMd 1W2BS 1ABOA 4JS4A 2C0IA 3SDZA 5KE3A 1PSEA 1SHFA 3QWXX 2W0ZA 3QJYA 3JCMg 4ZTJA 1VQ5Q 1X6BA 3P8DA 5LJ5h 3S6WA 1Y57A 1WHKA 4EMKB 2VUBA 4F7UB 1IHVA 4Y28E 1VQOT 1VQNT 5D7UA 2JTMA 3REAB 1SPKA 3J80E 3H6ZA 2GNCA 3PE0A 2M0OA 2HBWA 1WI7A 3VUZA 2RQRA 1ZUKA 1ZBJA 2DEQA 4XQ3A 1NZ9A 2ZAEA 4JRPA 1Q86U 1BKBA 1VQ8T 4N0AC 3VS1A 2GQVA 2K3YA 5KCHA 3CMEQ 2HQEA 1UJYA 5LJ3e 4HT9A 1RACB 1WHGA 1PKSA 2R58A 5KE2A 2K3XA 2V26A 1WJRA 2BKDN 2O4XA 1I5LA 2KE9A 3QKJA 4X34A 1K73C 2LVMA 3RERA 3FEOA 1OX8A 2PNIA 3I55Q 2CZ1B 4C8QC 4RG2A 1M3AA 2V1RA 3OYYA 1YCYA 1KD1R 2V8IA 4ZGEB 4M77E 3PVQA 1FX7A 4EIKA 1XJWB 4M7AE 4IUPA 5GMKe 2QG9B 2O4XB 2VGMA 3VYHB 1PKTA 2CP7A 3UPUA 2QYZA 3CMAT 2CP0A 1D1AA 1ZX6A 2LQWA 3X24B 4OB1B 5CKDA 5D6YA 4NOYA 1YHQT 1NEGA 2V8JA 2ZPIB 4M77D 2K2MA 3INZA 1I5OB 4M7AD 2YT6A 4OB2B 2FEIA 4OB0B 1M9SA 5FRNA 3X28B 2HCKA 1GCQC 3QYHB 4M75F 4CC2A 1K9MR 1AT1B 1U5SA 5CKHA 1CSKA 4OGCA 4LDUA 1MV3A 3L2UA 3AHUA 1PHTA 3M0UA 1JJ2P 3CCET 3OBWA 3JB9G 1SKUB 4M7DE 3MP8A 4LDWA 1H3ZA 2F5KA 3CCLQ 2ROLA 1N9RA 1QVGP 4IUTA 3MEWA 4FW1A 2DTIA 3M0QA 3H0IA 2JNGA 4QW2A 2IVWA 2ABLA 3M0TA 1VIEA 5GAMd 5CQXA 3GP8A 2SEMA 1UFFA 4AT1B 5HK3A 4EPCA 2EYXA 4BY6C 1VQ5T 5GAMj 3M9QA 4QQDA 3LH0A 4M7DD 4ZN1A 3OYIA 4ZN3A 1T3SA 3OSVA 2YWWA 1M5Q1 3CC2Q 2Y4YA 4QVDA 1RI0A 4JJBA 4OMFB 2YRVA 2X9HA 1PM3A 2XHCA 2KK4A 5GMKl 3VU3C 1HJDA 4C8QF 3OYJA 2HL5C 3NHNA 1UHCA 4AMCA 3I56A 1Q7YU 1ZSZB 2QASA 2JZ2A 2CYZB 2OAUA 1X27A 4L6V5 2OTJA 4DBQA 2AZSA 1NJIR 4A4HA 2QQ9A 2NLUA 4PL6A 3CMET 2ZPFB 1XOVA 4M7AC 3CCRT 3JCMJ 2J05A 1W2BA 1RLPC 4E7JA 4LD6A 1B07A 2FPDA 3META 1IGQA 3HKSA 4XTXA 5CQYA 1RADB 2MAMA 1KC8R 4XU0A 2ZZDA 2NUTA 2RHZA 4FYWB 2LQ8A 4O5VA 2VKNA 3AT1B 4UC4A 4PFOA 4HVUA 1KQSS 1VQ6A 2P0QA 3CCUA 1PD0A 3JB9J 3SWNC 2KRMA 2NYSA 2CT3A 3C94A 2AT1B 1Q81R 4II1A 2FO0A 2NUTB 4FT4A 4BE1A 1RABB 2RK1A 4XU1A 4EDUA 2K2VA 3H0FA 2DM1A 4QVCA 3OQ5A 3LX7A 4C0DC 1PG5B 4A4KA 3EG1A 4BDYA 3S3OA 4LDYA 1M90C 3JCMX 1X6GA 4KUDK 1K8AR 2SRCA 2GFAA 3P8HA 3CC7A 4M78A 4HXJA 4JLGA 3CPWP 1ZA1B 3PT9A 2F5TX 1KD1U 1UGVA 5LJ3f 5IHNA 1YWOA 1BCOA 1Y07A 3QHSA 4E47A 3HRUA 1JEGA 1K1ZA 3EGXA 4GBQA 1R8OB 3CCVA 5FROA 5IXBA 2JMAA 1I4K1 5A0DA 1SRLA 1VYUA 4M78B 2M51A 2DEUA 4B9WA 3MJXA 1M3BA 2QDYB 3GNFB 1N8RR 1YJWA 2Z0WA 4HCBA 2PZ1A 1ZLMA 2D1XA 2D8HA 3JAME 2HL3A 4KH0B 3EGXB 3G71Q 2RI5A 2X51A 4E7SA 1IB8A 2RQTA 2G6FX 4ZTFA 3OS1A 1RAAB 5KYUA 4PKCC 1G5VA 4IUVA 1ZSGA 2YLBA 3RESA 1HYOA 1ARKA 1B7TA 1VQ4A 1H641 4BDZA 2EVRA 4X9CA 2PUOB 1VQKQ 3EFOB 3JB9F 1NG2A 3X26B 2KT1A 4R0KA 1WHJA 3TSWA 2E6ZA 2A3LA 2D6FA 1KHIA 1VQ9Q 4WF2A 7AT1B 4JS5A 2YUNA 4IIOA 1CKAA 3GBQA 1TWBA 2AKKA 4IUUA 1OZ3A 4PNOA 3CCQQ 1Q82R 2EQJA 2MK5A 1AZEA 1QMCA 3CC7Q 4RTYA 1AOJA 1M1KR 2YRDA 3VS5A 5LJ5d 3D7SB 2FPFA 3EHRA 4BE0A 1U3OA 4C92G 2RQUA 3GIBA 5LJ5g 4QT7A 4QQGA 5GANe 2A08A 8AT1B 1JJ2S 3NFCA 3HHTB 2O88A 1KJWA 3M4YA 1QP3A 1W6XA 2PTKA 2DD4A 2DF6A 4Z89A 5FU6B 3RDVA 5CAIA 1QVGS 5KCOA 2OAWA 3GLXA 1E6HA 1BCMA 3I35A 3PVLA 4J9DA 2K6DA 3OYFA 2FZGB 2LX7A 1OULA 1VQ7A 3LGLA 2I2LA 3QO3A 4KT0E 4ZGDB 4Q5WA 4JJDA 1KC8U 4FYYB 1UE9A 1QVFP 3EG0A 4OGEA 2HNIA 2KR3A 3CCEA 3V8KA 4E6RA 1U1TA 3EH2A 1YI2Q 1KQSA 2VB6A 2CH4A 2PVGB 1WXTA 1CKBA 4PJLA 5GAN4 1F1BB 4JDSA 2DMOA 3EG9B 4M75E 3ULRB 2WSEE 4A53A 1D09B 1I81A 4PJOE 1WFWA 5C0MA 2R5MA 1Q81U 3UT1A 2QGGA 2K7AA 4R56A 4X1VA 3R6NA 2RF0A 2IPOB 4J9IA 2M1HA 1TSFA 4M4ZA 2DXBA 5ECAA 5CK9A 4CI0C 4KULA 1VQPQ 1RAFB 2XIDA 4BI4A 1GXIE 4C5EA 1IHWA 2OI3A 4AG1C 2QAZA 5GAN3 3G71T 4M75D 1K8AU 3DB3A 4RCBA 4C0FA 1B34A 1QKXA 3FRNA 1QLYA 2M9UA 1P92A 5A0LA 1XNIA 4P5NA 2LNVA 1AWXA 3QDRB 3URGA 2EGEA 4J9BA 2BE7D 2EWNA 3H8ZA 1JXMA 1C0MA 1G3SA 4WCIA 2QDLA 4C92C 4PLLA 2QQAA 2QI2A 1LCKA 1UB4A 1UJ0A 1WQ7A 3CCUT 1QKWA 1YJNA 3QWYA 3L2VA 1WJSA 2RJDA 1G3TA 2E41A 1VQKT 3CMEA 1B34B 3PFSA 1TG0A 3L2RA 2DIQA 2DTHA 3QUIA 1ACMB 4C8QE 4N0AA 1WHHA 5GAN5 2O9VA 5IXFA 1JU5C 4ZGJB 1N8RU 2DRMA 2EAYA 4IURA 2JXBA 2FHDA 3OYEA 1YIJQ 3I55A 2RQWA 1HSQA 2HEQA
chains in the Genus database with same CATH topology
2LJ0A 4K11A 1NEGA 2EYYA 2KYMA 1JQQA 2DBKA 2CUBA 2FPEA 2K2MA 2GTOA 1IO6A 1GCPA 1H3HA 2EBPA 2YT6A 1TUCA 4OMMA 2FEIA 2KRNA 5IHIA 2ESWA 2L3QA 2VVKA 2HCKA 1GCQC 4CC2A 1QWEA 2LP5A 3TSZA 1U5SA 1CSKA 1MV3A 1Y0MA 4CC7A 1PHTA 1VYTA 1WLPB 3M0UA 5I11A 1NEBA 1NLOC 3NMZC 1MV0B 1N5ZA 1ABQA 1Z9QA 3VS6A 3SEMA 3I5RA 1K76A 1TUDA 4RTUA 2AK5A 1I0CA 2RQVA 2ROLA 1SHGA 4JPBW 2EYZA 2W10A 2KYBA 4FSSA 3VRZA 2L0AA 1FYNA 3M0QA 3H0IA 1W70A 2ABLA 3M0TA 3M0RA 2YSQA 1BB9A 4OMQA 1QWFA 2O31A 2A36A 2LMJA 2ENMA 2SEMA 1UFFA 2IIMA 2EYXA 1AZGB 1GCQA 3JV3A 2JS0A 2JT4A 1E7OA 4JJCA 2CT4A 1T3SA 2JM9A 1NLPC 5GJWB 2D0NA 2FRYA 4JJBA 2JW4A 4KRTA 2C0OA 2YUQA 1V1CA 2EQIA 1K4US 4Z8AA 2XMFA 3UA6A 1HJDA 4CC3A 4RUGA 3NHNA 1UHCA 3EHQA 1T0HA 1WA7A 1QCFA 2EGCA 2NWMA 1X27A 3I5SA 2JM8A 2AZSA 1EFNA 2C0TA 2BTTA 3I9QA 5L23A 2OJ2A 2BZYA 2X3XD 1XOVA 4AFUC 1K0SA 2J05A 3FJ5A 1OEBA 1X69A 1SEMA 1RLPC 1S1NA 5I22A 1B07A 3O5ZA 2LZ6B 2FPDA 2DRKA 4JZ3A 2A37A 2FRWA 2GGRA 2J06A 2NUZA 2L2PA 2DL4A 2L3PA 1A0NB 2EYWA 4A63B 2HDAA 4AFQC 4LUDA 2KXDA 2VKNA 1M8MA 2DILA 1HD3A 1M3CA 1K0XA 4HVUA 1AEYA 3UA7A 4F16A 3VS2A 3A98A 3M0PA 4J9EA 2KRMA 1X2KA 2CT3A 1OOTA 2DVJA 1GFCA 2FO0A 2JS2A 1AWOA 2CREA 1BU1A 1X2QA 3H0FA 3H0HA 1NYGA 2DM1A 2D8JA 2KT8A 1NYFA 1WXBA 4RTXA 1PWTA 5EC7A 1JO8A 3U23A 3EG1A 4F17A 2EGAA 2LNHB 4OMNA 1PRLC 1WX6A 1UHFA 2KEAA 1I07A 1X6GA 2SRCA 3LH5A 2EKHA 4LN2A 2CH4W 4AFSC 1J3TA 4HXJA 3VS4A 2K79A 2KGTA 1UGVA 1M30A 2DX1A 2CUDA 4J9CA 2DL8A 2M0YA 1K9AA 2F2XA 5IHNA 1YWOA 4D8DA 3NPFA 2DL5A 1PRMC 1Z9ZA 1JEGA 1K1ZA 4GBQA 4RTVA 5IXBA 2JMAA 1SRLA 1VYUA 2M51A 4JZ4A 2J6FA 1UDLA 1G2BA 1U06A 1UTIA 2O9SA 1M3BA 1AD5A 2B86A 3RNJA 2JMCA 4DEXA 2PZ1A 2YUPA 1ZLMA 1SRMA 1RLQC 2LCSA 2D1XA 2D8HA 5FWCA 3SHWA 5FWBA 3C0CA 4J9FA 1OPKA 2DE0X 1B3QA 2BZ8A 2MIOA 2RQTA 1ZUUA 2G6FX 2DLPA 1M27C 1I1JA 1ZUYA 1YCSB 2A28A 4ESRA 3TVTA 1ZSGA 1KIKA 2O2OA 4DEYA 1GBQA 1GFDA 1GL5A 5IHKA 2K3BA 2KBTA 1ARKA 4HVWA 2EVRA 1NG2A 2J6OA 2KXCA 4RTTA 4CC4B 2J6KA 2AZVA 4RTZA 1KSWA 2KT1A 4R0KA 3TSWA 4OMOA 5HCKA 4AFZC 2YDLA 2DBMA 5FW9A 1UECA 1OV3A 2YUNA 1CKAA 4IIOA 3GBQA 2MOXA 2AKKA 1JXOA 2DNUA 2F2VA 2I0NA 1AZEA 2P4RA 4RTYA 1AWJA 1AOJA 3VS5A 2FPFA 3EHRA 4HVVA 1PNJA 1U3OA 2RQUA 2RN8A 2LQNA 4QT7A 1KFZA 2ROTA 3VS7A 4Y92A 2A08A 2LJ3A 1YNZA 1MUZA 1VA7A 2RPNA 2JTEA 1VYVA 4GLMA 2O88A 2KROA 1KJWA 4F14A 1NM7A 4LNPA 3VS3A 2GBQA 2E5KA 1T0JA 1W6XA 1WDXA 2CSQA 2PTKA 2FG0A 2DF6A 1FMKA 4Z89A 3NGPA 1RI9A 1T3LA 2MCNA 2OAWA 2HSPA 4ORZA 2ED1A 1E6HA 3EGUA 3I35A 3PVLA 2RNAA 4J9DA 2K6DA 2DL7A 1BK2A 2LX7A 4D8KA 1BBZA 4AG2C 3CQTA 1SSHA 1GRIA 2GQIA 2DYBA 4JJDA 4ZNXA 1H8KA 1RUWA 1AVZC 1WIEA 3ZL7C 1UE9A 4LE9A 3RBBB 1ABOA 1X43A 3EG0A 2C0IA 2KR3A 1SHFA 2LJ1A 3QWXX 4RTWA 4E6RA 2W0ZA 2ED0A 1X6BA 2KNBB 1G83A 3REBB 1Y57A 3VRYA 2CH4A 1WXTA 4J9GA 1CKBA 1W1FA 2YUOA 2DMOA 3ULRB 1WFWA 4IIMA 2CDTA 3REAB 1GBRA 2H8HA 1UG1A 1SPKA 2BZXA 2EW3A 2K7AA 4X1VA 3R6NA 2RF0A 2GNCA 4Z88A 3PE0A 5GJVB 2HBWA 2J7IA 1WI7A 4J9IA 4LUEA 2RQRA 1ZUKA 4M4ZA 5ECAA 1YN8A 1ZBJA 2ECZA 2DL3A 4OMLA 2F2WA 3EG3A 3VS1A 2OI3A 4AG1C 2RMOA 2X3WD 1UJYA 1AWWA 1H92A 2DA9A 1QKXA 2L3SA 1QLYA 1PKSA 2EPDA 3KFVA 3UATA 1AWXA 2V1QA 2EGEA 4J9BA 1JXMA 4WCIA 2CSIA 2KE9A 2QDLA 1E6GA 2KRSA 1LCKA 1UJ0A 2PNIA 1QKWA 3VS0A 4J9HA 1M3AA 2V1RA 2AKLA 3H41A 2DJQA 3QWYA 3UF4A 2GTJA 1WYXA 1YP5A 3PVQA 1TG0A 3THKA 4EIKA 1YWPA 1WXUA 4HCKA 1UUEA 4OMPA 2O9VA 3M0SA 3EG2A 1PKTA 5IXFA 1JU5C 1OPLA 2DRMA 2VWFA 3IQLA 5IH2A 1ZX6A 2JXBA 2LQWA 2RQWA 1HSQA 2HEQA 2K9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ0 A;  4K11 A;  1NEG A;  2EYY A;  2KYM A;  1JQQ A;  2DBK A;  2CUB A;  2FPE A;  2K2M A;  2GTO A;  1IO6 A;  1GCP A;  1H3H A;  2EBP A;  2YT6 A;  1TUC A;  4OMM A;  2FEI A;  2KRN A;  5IHI A;  2ESW A;  2L3Q A;  2VVK A;  2HCK A;  1GCQ C;  4CC2 A;  1QWE A;  2LP5 A;  3TSZ A;  1U5S A;  1CSK A;  1MV3 A;  1Y0M A;  4CC7 A;  1PHT A;  1VYT A;  1WLP B;  3M0U A;  5I11 A;  1NEB A;  1NLO C;  3NMZ C;  1MV0 B;  1N5Z A;  1ABQ A;  1Z9Q A;  3VS6 A;  3SEM A;  3I5R A;  1K76 A;  1TUD A;  4RTU A;  2AK5 A;  1I0C A;  2RQV A;  2ROL A;  1SHG A;  4JPB W;  2EYZ A;  2W10 A;  2KYB A;  4FSS A;  3VRZ A;  2L0A A;  1FYN A;  3M0Q A;  3H0I A;  1W70 A;  2ABL A;  3M0T A;  3M0R A;  2YSQ A;  1BB9 A;  4OMQ A;  1QWF A;  2O31 A;  2A36 A;  2LMJ A;  2ENM A;  2SEM A;  1UFF A;  2IIM A;  2EYX A;  1AZG B;  1GCQ A;  3JV3 A;  2JS0 A;  2JT4 A;  1E7O A;  4JJC A;  2CT4 A;  1T3S A;  2JM9 A;  1NLP C;  5GJW B;  2D0N A;  2FRY A;  4JJB A;  2JW4 A;  4KRT A;  2C0O A;  2YUQ A;  1V1C A;  2EQI A;  1K4U S;  4Z8A A;  2XMF A;  3UA6 A;  1HJD A;  4CC3 A;  4RUG A;  3NHN A;  1UHC A;  3EHQ A;  1T0H A;  1WA7 A;  1QCF A;  2EGC A;  2NWM A;  1X27 A;  3I5S A;  2JM8 A;  2AZS A;  1EFN A;  2C0T A;  2BTT A;  3I9Q A;  5L23 A;  2OJ2 A;  2BZY A;  2X3X D;  1XOV A;  4AFU C;  1K0S A;  2J05 A;  3FJ5 A;  1OEB A;  1X69 A;  1SEM A;  1RLP C;  1S1N A;  5I22 A;  1B07 A;  3O5Z A;  2LZ6 B;  2FPD A;  2DRK A;  4JZ3 A;  2A37 A;  2FRW A;  2GGR A;  2J06 A;  2NUZ A;  2L2P A;  2DL4 A;  2L3P A;  1A0N B;  2EYW A;  4A63 B;  2HDA A;  4AFQ C;  4LUD A;  2KXD A;  2VKN A;  1M8M A;  2DIL A;  1HD3 A;  1M3C A;  1K0X A;  4HVU A;  1AEY A;  3UA7 A;  4F16 A;  3VS2 A;  3A98 A;  3M0P A;  4J9E A;  2KRM A;  1X2K A;  2CT3 A;  1OOT A;  2DVJ A;  1GFC A;  2FO0 A;  2JS2 A;  1AWO A;  2CRE A;  1BU1 A;  1X2Q A;  3H0F A;  3H0H A;  1NYG A;  2DM1 A;  2D8J A;  2KT8 A;  1NYF A;  1WXB A;  4RTX A;  1PWT A;  5EC7 A;  1JO8 A;  3U23 A;  3EG1 A;  4F17 A;  2EGA A;  2LNH B;  4OMN A;  1PRL C;  1WX6 A;  1UHF A;  2KEA A;  1I07 A;  1X6G A;  2SRC A;  3LH5 A;  2EKH A;  4LN2 A;  2CH4 W;  4AFS C;  1J3T A;  4HXJ A;  3VS4 A;  2K79 A;  2KGT A;  1UGV A;  1M30 A;  2DX1 A;  2CUD A;  4J9C A;  2DL8 A;  2M0Y A;  1K9A A;  2F2X A;  5IHN A;  1YWO A;  4D8D A;  3NPF A;  2DL5 A;  1PRM C;  1Z9Z A;  1JEG A;  1K1Z A;  4GBQ A;  4RTV A;  5IXB A;  2JMA A;  1SRL A;  1VYU A;  2M51 A;  4JZ4 A;  2J6F A;  1UDL A;  1G2B A;  1U06 A;  1UTI A;  2O9S A;  1M3B A;  1AD5 A;  2B86 A;  3RNJ A;  2JMC A;  4DEX A;  2PZ1 A;  2YUP A;  1ZLM A;  1SRM A;  1RLQ C;  2LCS A;  2D1X A;  2D8H A;  5FWC A;  3SHW A;  5FWB A;  3C0C A;  4J9F A;  1OPK A;  2DE0 X;  1B3Q A;  2BZ8 A;  2MIO A;  2RQT A;  1ZUU A;  2G6F X;  2DLP A;  1M27 C;  1I1J A;  1ZUY A;  1YCS B;  2A28 A;  4ESR A;  3TVT A;  1ZSG A;  1KIK A;  2O2O A;  4DEY A;  1GBQ A;  1GFD A;  1GL5 A;  5IHK A;  2K3B A;  2KBT A;  1ARK A;  4HVW A;  2EVR A;  1NG2 A;  2J6O A;  2KXC A;  4RTT A;  4CC4 B;  2J6K A;  2AZV A;  4RTZ A;  1KSW A;  2KT1 A;  4R0K A;  3TSW A;  4OMO A;  5HCK A;  4AFZ C;  2YDL A;  2DBM A;  5FW9 A;  1UEC A;  1OV3 A;  2YUN A;  1CKA A;  4IIO A;  3GBQ A;  2MOX A;  2AKK A;  1JXO A;  2DNU A;  2F2V A;  2I0N A;  1AZE A;  2P4R A;  4RTY A;  1AWJ A;  1AOJ A;  3VS5 A;  2FPF A;  3EHR A;  4HVV A;  1PNJ A;  1U3O A;  2RQU A;  2RN8 A;  2LQN A;  4QT7 A;  1KFZ A;  2ROT A;  3VS7 A;  4Y92 A;  2A08 A;  2LJ3 A;  1YNZ A;  1MUZ A;  1VA7 A;  2RPN A;  2JTE A;  1VYV A;  4GLM A;  2O88 A;  2KRO A;  1KJW A;  4F14 A;  1NM7 A;  4LNP A;  3VS3 A;  2GBQ A;  2E5K A;  1T0J A;  1W6X A;  1WDX A;  2CSQ A;  2PTK A;  2FG0 A;  2DF6 A;  1FMK A;  4Z89 A;  3NGP A;  1RI9 A;  1T3L A;  2MCN A;  2OAW A;  2HSP A;  4ORZ A;  2ED1 A;  1E6H A;  3EGU A;  3I35 A;  3PVL A;  2RNA A;  4J9D A;  2K6D A;  2DL7 A;  1BK2 A;  2LX7 A;  4D8K A;  1BBZ A;  4AG2 C;  3CQT A;  1SSH A;  1GRI A;  2GQI A;  2DYB A;  4JJD A;  4ZNX A;  1H8K A;  1RUW A;  1AVZ C;  1WIE A;  3ZL7 C;  1UE9 A;  4LE9 A;  3RBB B;  1ABO A;  1X43 A;  3EG0 A;  2C0I A;  2KR3 A;  1SHF A;  2LJ1 A;  3QWX X;  4RTW A;  4E6R A;  2W0Z A;  2ED0 A;  1X6B A;  2KNB B;  1G83 A;  3REB B;  1Y57 A;  3VRY A;  2CH4 A;  1WXT A;  4J9G A;  1CKB A;  1W1F A;  2YUO A;  2DMO A;  3ULR B;  1WFW A;  4IIM A;  2CDT A;  3REA B;  1GBR A;  2H8H A;  1UG1 A;  1SPK A;  2BZX A;  2EW3 A;  2K7A A;  4X1V A;  3R6N A;  2RF0 A;  2GNC A;  4Z88 A;  3PE0 A;  5GJV B;  2HBW A;  2J7I A;  1WI7 A;  4J9I A;  4LUE A;  2RQR A;  1ZUK A;  4M4Z A;  5ECA A;  1YN8 A;  1ZBJ A;  2ECZ A;  2DL3 A;  4OML A;  2F2W A;  3EG3 A;  3VS1 A;  2OI3 A;  4AG1 C;  2RMO A;  2X3W D;  1UJY A;  1AWW A;  1H92 A;  2DA9 A;  1QKX A;  2L3S A;  1QLY A;  1PKS A;  2EPD A;  3KFV A;  3UAT A;  1AWX A;  2V1Q A;  2EGE A;  4J9B A;  1JXM A;  4WCI A;  2CSI A;  2KE9 A;  2QDL A;  1E6G A;  2KRS A;  1LCK A;  1UJ0 A;  2PNI A;  1QKW A;  3VS0 A;  4J9H A;  1M3A A;  2V1R A;  2AKL A;  3H41 A;  2DJQ A;  3QWY A;  3UF4 A;  2GTJ A;  1WYX A;  1YP5 A;  3PVQ A;  1TG0 A;  3THK A;  4EIK A;  1YWP A;  1WXU A;  4HCK A;  1UUE A;  4OMP A;  2O9V A;  3M0S A;  3EG2 A;  1PKT A;  5IXF A;  1JU5 C;  1OPL A;  2DRM A;  2VWF A;  3IQL A;  5IH2 A;  1ZX6 A;  2JXB A;  2LQW A;  2RQW A;  1HSQ A;  2HEQ A;  2K9G A; 
#chains in the Genus database with same CATH topology
 3V8J A;  2D9T A;  3CC7 T;  2CUB A;  4RMO A;  1OU8 A;  1IO6 A;  3JB9 I;  2KQW A;  1GCP A;  1TH7 A;  1H3H A;  4C8Q D;  4DBF A;  3OW2 S;  1NPP A;  3CPW S;  4FYX B;  2KRN A;  3RR6 A;  4DBR A;  5IHI A;  2VVK A;  3M5A A;  1Y71 A;  3C12 A;  1QWE A;  1BI0 A;  5IN1 A;  2XK0 A;  1VYT A;  1WLP B;  2QXF A;  5GMK i;  3CD6 Q;  3CCV T;  1LNX A;  2L8D A;  3NMZ C;  1MV0 B;  1G3W A;  1ABQ A;  1BI2 A;  4FYV B;  3I5R A;  1TUD A;  4IUQ A;  4F7U G;  5LJ3 j;  4M75 C;  3BW1 A;  2RQV A;  1YJW T;  4PJO C;  5A0G A;  2L3R A;  3WXM B;  4JPB W;  3FC3 A;  4FSS A;  3RMS A;  3OA6 A;  1WGS A;  1W70 A;  2E64 A;  1EX4 A;  2EIF A;  3M0R A;  3NTI A;  4ANJ A;  1Q82 U;  2YSQ A;  3TRE A;  1BB9 A;  4N4G A;  5J39 A;  3CXC P;  2LMJ A;  3CC4 Q;  3TCJ A;  3OYM A;  1M1K U;  3RKY A;  1GCQ A;  5J3B A;  5CKF A;  1YI2 T;  2JS0 A;  2EQU A;  3A8O B;  4FU6 A;  4JJC A;  3BDL A;  2JM9 A;  1FMV A;  3CCL A;  3MHX A;  4KH1 B;  5GMK j;  2D0N A;  5I21 A;  1JJ2 A;  5GAO p;  1YJN Q;  2DZC A;  2JW4 A;  4KRT A;  5KYW A;  1VQ4 T;  4C92 F;  2EQI A;  4Z8A A;  2XMF A;  3UA6 A;  2LTO A;  5CVI A;  2RK2 A;  5FU7 B;  3QZ9 B;  4ATO A;  1QVG A;  1WA7 A;  1QCF A;  2EGC A;  5GAN f;  3I5S A;  2C0T A;  3NTK A;  2DD5 A;  2VGN A;  3L2Z A;  3CC2 A;  2OJ2 A;  3E19 A;  1MMN A;  5KYW B;  1BYM A;  5EG2 A;  1SEM A;  3O5Z A;  2LZ6 B;  3JCM e;  5LL6 S;  3X25 B;  2A37 A;  1NBE B;  3J81 E;  2COW A;  3JCM c;  3L2W A;  3HSB A;  1UGQ B;  2EYW A;  4ELZ C;  2KXD A;  2QQB A;  5HK0 A;  5FLX E;  3E9F A;  1MMA A;  3QXE B;  3MPU B;  4JLI A;  3M0P A;  4J9E A;  4M77 A;  2M02 A;  4XAX B;  2DVJ A;  1DJ7 B;  4EMK C;  1GFC A;  1K73 U;  4M7A A;  3V7C A;  3HFN A;  2JS2 A;  2MWP A;  4C5G A;  1AWO A;  3QJ6 A;  5GAN 7;  2DK3 A;  1X2Q A;  3H0H A;  1VQ7 T;  4JUV A;  2A7Y A;  2D8J A;  3TEE A;  2KT8 A;  1NYF A;  4PJO F;  1JO8 A;  3U23 A;  4F17 A;  3HRS A;  4OMN A;  4M77 B;  4BI8 B;  1QVF S;  1I07 A;  4E7H A;  4M7A B;  3LH5 A;  4JRQ A;  4LN2 A;  5GAN 2;  1ZHI A;  5CKE A;  2K79 A;  1UGS B;  3JB9 D;  2RI2 A;  2RB6 A;  1IRX A;  4IKF A;  1M1G A;  1K9A A;  3V7S A;  4A4G A;  2XDD A;  4E7K A;  3NPF A;  4PK4 A;  3PTA A;  3C95 A;  1Z9Z A;  3CCM Q;  4XU3 A;  2HAX A;  4RTV A;  5GAM g;  4M7D A;  3X20 B;  3Q1J A;  3C4S A;  4A4E A;  4JZ4 A;  3PMT A;  4PJJ A;  1G2B A;  1U06 A;  2RHI A;  3EGD A;  4HCZ A;  2JMC A;  4DEX A;  2KSS A;  1SRM A;  1RLQ C;  2HQH A;  3OW2 A;  1ZA2 B;  5LJ3 h;  4M7D B;  3CPW A;  1B3Q A;  1N6A A;  2P0P A;  5DM7 R;  1YJN T;  3JCM P;  2AHJ B;  1I1J A;  3EGD B;  1X01 A;  1ZUY A;  2FZC B;  5AT1 B;  3PIP A;  4HA8 A;  4ESR A;  1ZQ1 A;  2CP5 A;  1SSF A;  2E10 A;  3E2U A;  1FWZ A;  4DEY A;  1GBQ A;  5GAN 8;  2KI7 A;  3LYI A;  2K3B A;  2KBT A;  4HVW A;  3JCM Q;  2MYS A;  1LJO A;  2F1L A;  4FIB A;  1JRI A;  3G71 A;  2J6O A;  4RTT A;  4MZM A;  5GMK h;  3I55 T;  1KSW A;  3OYA A;  4F7U F;  1LPL A;  1NPR A;  5FW9 A;  2RH2 A;  1OV3 A;  5CO7 A;  2DNU A;  4BB7 A;  4LD9 K;  4KUI A;  2I0N A;  3FDR A;  3MKD A;  3HP9 A;  2VC8 A;  1SF9 A;  2PVD B;  2P4R A;  1VQK A;  1MNE A;  2E65 A;  4HVV A;  2HSE B;  2VYT A;  1PNJ A;  2ROT A;  2LJ3 A;  4L59 A;  1VQ9 A;  3LGF A;  1VA7 A;  4MDW A;  2RPN A;  1WHM A;  1VYV A;  5AYF A;  4F14 A;  1RAE B;  1NM7 A;  3HL8 A;  3CCQ A;  2GBQ A;  1EZZ B;  3CPF A;  1RAG B;  1T0J A;  4DOV A;  3LW5 E;  1FMK A;  3MEU A;  2QA4 Q;  3NGP A;  4QVZ A;  2X4Y A;  2RNA A;  1ZSZ C;  2EYQ A;  5GAO q;  1OYX A;  4M78 G;  1JBM A;  2DJZ A;  3ZL7 C;  2DYB A;  1RUW A;  1AVZ C;  1O75 A;  3MEV A;  4LE9 A;  1QW1 A;  3CCL T;  1Y7X A;  3KXT A;  2LJ1 A;  4HCC A;  1VOM A;  4FSX A;  4DQ2 A;  3EFR A;  1S72 Q;  2VXE A;  1G83 A;  3REB B;  3OYB A;  3JCM f;  1YJ9 Q;  4J9G A;  1K9M C;  5IAY A;  2E3H A;  2YUO A;  5C6S A;  1UGP B;  3HPW A;  2CDT A;  2FVU A;  3QSU A;  2H8H A;  1UG1 A;  2B8A A;  5GAO m;  4Z88 A;  3CC2 T;  3OYC A;  5GJV B;  2LT1 A;  2E12 A;  4LUE A;  4BI3 A;  3OBY A;  1YI2 A;  1YN8 A;  3QDF A;  4NL3 A;  3T9N A;  4HKE A;  1TTH B;  2P4T A;  3TQ7 P;  2F2W A;  1QVF A;  2RMO A;  1PCX A;  1QVP A;  1AWW A;  1H92 A;  3ZEH A;  1X6O A;  2DA9 A;  2L3S A;  3M59 A;  5GAN j;  1M2O A;  3KFV A;  1R77 A;  3G4S Q;  1M8V A;  2K5I A;  1E6G A;  4KGX B;  2KDS A;  1OX9 A;  4FCY A;  1D0Y A;  1VQP A;  4J9H A;  3N5B B;  2DJQ A;  3UF4 A;  3O8V A;  5KYU B;  1IZ6 A;  1WYX A;  4O6J A;  2ZCF B;  4C92 E;  3THK A;  1YWP A;  1PSF A;  4HCK A;  1UUE A;  4OMP A;  1M2V A;  1SG5 A;  3M0S A;  3V8L A;  4XK8 E;  1OPL A;  1NJI C;  2VWF A;  3JSC A;  3EH1 A;  3IQL A;  1YBY A;  5IH2 A;  2KMT A;  1YIT Q;  1R0B G;  4M78 C;  3OYH A;  4K11 A;  3OY9 A;  3J7A F;  2DET A;  2KYM A;  1JQQ A;  5DLQ E;  2DBK A;  2ZPB B;  2FPE A;  4C92 D;  4PFP A;  2GTO A;  2EKO A;  1WZO A;  2E5Q A;  2HMA A;  4J7I A;  4KGZ B;  1KC8 C;  1M2V B;  2COZ A;  2JUF A;  1KQ1 A;  2DVE A;  2ESW A;  3UWN A;  4XTV A;  4N4I A;  1YIJ A;  5DY9 A;  3RUX A;  1Y0M A;  4FM4 B;  4CC7 A;  5I11 A;  1NEB A;  1NLO C;  4E7I A;  1Z9Q A;  3VS6 A;  4JRI A;  5HY6 A;  2CP3 A;  2DIG A;  1I0C A;  4MZT A;  5KYX A;  3A1P A;  2EYZ A;  1XQH A;  2W10 A;  2L0A A;  3PGG A;  2ZPH B;  5GAO n;  2ZPG B;  4OMQ A;  1QWF A;  3G1J A;  2O31 A;  4DBH A;  1BIB A;  3CD6 A;  1VQO Q;  2F69 A;  1VQN Q;  4F04 B;  2IIM A;  1V76 A;  5LJ5 e;  1E7O A;  2LQK A;  2O01 E;  2CT4 A;  5D6X A;  5KYX B;  1NLP C;  3ZBD A;  1K73 R;  1LOJ A;  3MO8 A;  1WJQ A;  2LCL A;  2FRY A;  4J6X A;  2VAS A;  2VXF A;  2C0O A;  4M75 A;  4PJO A;  1VQ8 Q;  3M56 A;  4CC3 A;  4PJM A;  4PJO D;  4RUG A;  3CC4 A;  4J8O A;  3EHQ A;  1U1S A;  3CBO A;  2ZGW A;  2NWM A;  4ME7 A;  3FJP A;  2L89 A;  2BTT A;  3I9Q A;  3CXC A;  2BZY A;  4FT2 A;  4AFU C;  1K0S A;  4FW2 A;  3FJ5 A;  4M75 B;  4PJO B;  6AT1 B;  4N4H A;  4M78 F;  1X75 C;  2GGR A;  4LXC A;  3L1A A;  2NUZ A;  2DL4 A;  2L3P A;  2RHU A;  1D3B A;  1A0N B;  4GLK A;  4A63 B;  2HDA A;  4AFQ C;  2LDM A;  3P8B B;  1WNL A;  5KH6 A;  1VQ9 T;  4J5Y A;  2DIL A;  4BD3 A;  5D6W A;  1AEY A;  3CCS Q;  5M9O A;  3CCQ T;  2P0K A;  3LWI A;  5GAN h;  4F16 A;  3VS2 A;  2QEX Q;  3A98 A;  3PNW C;  4XTW A;  2EFI A;  1X2K A;  2HD0 A;  1OOT A;  2GF7 A;  4ELY C;  4C8Q A;  4D6W A;  1XTD A;  5GAO l;  3OS2 A;  1D3B B;  4VUB A;  1BI1 A;  2CRE A;  1YIT T;  2D0Q B;  2GFU A;  1WXB A;  4BUG A;  1TUG B;  4F7U E;  4RTX A;  1OQK A;  2E3I A;  2RJF A;  4E7Z A;  2QQR A;  2LNH B;  1UHF A;  5LJ3 d;  4EMG A;  3H9N A;  4C8Q B;  2CH4 W;  3RIR A;  5LJ3 g;  3VS4 A;  5GAN 6;  5CR2 A;  2Y4X A;  2KGT A;  1JB0 E;  2MMP A;  1M30 A;  2PQW A;  4EMK A;  2L5Q A;  3DB4 A;  3HTR A;  4J9C A;  3MP1 A;  3LWH A;  2F2X A;  1MGQ A;  1FXX A;  1RAH B;  2K57 A;  1Q86 C;  3G7Z A;  5CIU A;  3OMG A;  3FB9 A;  5J26 A;  3PIO A;  1EIF A;  1MND A;  2O9S A;  1UTI A;  4C0Z A;  2R5A A;  3GOX A;  3CEY A;  1WQW A;  1G8X A;  2LC4 A;  2RM4 A;  2QTX A;  3OSS C;  5FWB A;  3CCM A;  2DE0 X;  1M1F A;  2BIV A;  1N9S A;  3ASK A;  1VQP T;  1M27 C;  2BUD A;  3CBM A;  4MZP A;  1YCS B;  4J83 A;  3JB9 H;  4E2F B;  3TVT A;  1GFD A;  2RA2 A;  3CCR Q;  4C5I A;  1GL5 A;  5IHK A;  4FL6 A;  2HKQ B;  4BE2 A;  1VIF A;  2KXC A;  2AZV A;  3RKW A;  3G6E A;  3UDC A;  3BY7 A;  4DOW A;  4OMO A;  4XTY A;  4BY6 B;  4AFZ C;  2YDL A;  2YLC A;  2OX7 A;  2DBM A;  1Y96 A;  3CCJ Q;  3OB9 A;  2MOX A;  1JXO A;  1VQL A;  2PU9 B;  1IGU A;  1M90 R;  4C0G A;  3A8M B;  2OTL A;  1AWJ A;  3OS0 A;  1VQM A;  4X9D A;  1OU9 A;  2FL7 A;  1YIJ T;  3CCS T;  2DTO A;  4M77 G;  3V7R A;  1KQ2 A;  3VJP A;  2LQN A;  2QEX T;  3MEA A;  1KK7 A;  1KFZ A;  3VS7 A;  1Y96 B;  4Y92 A;  2HKN A;  1QCN A;  4M7A G;  1YNZ A;  4J6Y A;  2JTE A;  4GLM A;  5LJ5 f;  3RMQ A;  4LNP A;  3VS3 A;  2GCX A;  2E5K A;  4TVR A;  2CSQ A;  4MML A;  2LX9 A;  2MCN A;  4ORZ A;  2HSP A;  3SWN A;  3KBG A;  5FU7 C;  3F70 A;  2YRC A;  3CD6 T;  2DL7 A;  3BDU A;  2FB7 A;  3E1S A;  2LRQ A;  1BBZ A;  4AG2 C;  1OI1 A;  1SSH A;  1GRI A;  2GQI A;  3GF5 A;  1WIE A;  2HBP A;  3RBB B;  1X43 A;  4RTW A;  2ED0 A;  2X4J A;  2KNB B;  1Q7Y C;  2QA4 A;  5KYN A;  2DYI A;  3SWN B;  2M16 A;  3VRY A;  8ATC B;  3ER0 A;  1W1F A;  3L2Q A;  3EFS A;  3CC4 T;  4M7D G;  2JJ9 A;  2CS7 A;  3OYK A;  1UEB A;  4IIM A;  1GBR A;  1YFN A;  3M53 A;  1D1C A;  1ZSZ A;  2BZX A;  3EAE A;  3OYN A;  2EW3 A;  1U8R A;  4OF1 A;  2QQS A;  3SD4 A;  4C0D B;  3G6E Q;  2J7I A;  1TOV A;  2DKG A;  1S72 A;  1VUB A;  2P84 A;  2YHT A;  2ECZ A;  2DL3 A;  2NUP A;  4B9X A;  1YJ9 A;  4OML A;  3EG3 A;  2X3W D;  1BI3 A;  1VQL Q;  2QTV A;  3JCM V;  2XD0 A;  2OTL Q;  2EPD A;  3DKM A;  3JCM h;  3UAT A;  2V1Q A;  1VQM Q;  4OB3 B;  3NTH A;  2CSI A;  4M77 C;  2KRS A;  1C1A A;  1KG1 A;  2WSC E;  4A4F A;  3VS0 A;  2NUP B;  2AKL A;  3H41 A;  2GTJ A;  5GAM e;  3S3M A;  3JCM W;  2COY A;  2EQK A;  3GPL A;  4DA4 A;  1YP5 A;  3QPH A;  1QQJ A;  2ZPE B;  4EMH A;  1C6V X;  4Z02 A;  3BFM A;  1I8F A;  2MWO A;  1WXU A;  4E7L A;  3TU4 K;  1AHJ B;  3HRT A;  3EG2 A;  4GY5 A;  3HFO A;  4JJN K;  1ZBX A;  5FRM A;  2XIC A;  3G4S A;  2MPX C;  3VYG A;  3CCJ T;  2LT4 A;  2K9G A;  1KD1 C;  2LJ0 A;  3QBY A;  2EYY A;  1RAI B;  1D0X A;  3A8G B;  1FMW A;  4M78 E;  2EBP A;  3RKX A;  1TUC A;  3ZFJ A;  4OMM A;  3LLR A;  3A8L B;  1HK9 A;  2BE9 B;  1R0C B;  9ATC B;  2L3Q A;  4NS5 A;  3PMI A;  1WHL A;  4M7D C;  5KYY A;  2LP5 A;  3TSZ A;  2V8K A;  5DLO A;  3JCM b;  1YIT A;  2X35 A;  3CXC S;  3GNG A;  4HT8 A;  2H3E B;  1N5Z A;  2XDB A;  4KBM B;  2CKK A;  3SEM A;  3FLG A;  1K76 A;  4B6M A;  2RJE A;  4J7F A;  4RTU A;  2AK5 A;  3OW2 P;  3QII A;  4M78 D;  1SHG A;  2Y90 A;  2KYB A;  3VRZ A;  1FYN A;  5KYY B;  2YXY A;  3L42 A;  1BIA A;  2RD1 A;  1M90 U;  4RG8 A;  5HKC A;  3CCM T;  2A36 A;  2ENM A;  3I56 Q;  2XDP A;  2KY9 A;  1AZG B;  3M57 A;  2DXU A;  1W2B P;  4R55 A;  3JV3 A;  2JT4 A;  2OTJ Q;  2ATC B;  2MI6 A;  2HQX A;  5GJW B;  2PUK B;  2R57 A;  1QCO A;  2DER A;  5GAN d;  4M77 F;  2YUQ A;  1V1C A;  1K4U S;  2H3J A;  4MMK A;  4M7A F;  5GAN g;  1VQO A;  3G6E T;  1VQN A;  1T0H A;  3EFO A;  1IRE B;  2JM8 A;  1K9M U;  3MCA B;  1EFN A;  5L23 A;  3VKI A;  3VV0 A;  2X3X D;  1VQL T;  1VQ6 Q;  1LVK A;  2MF2 A;  3CCU Q;  1OEB A;  3SFM A;  1X69 A;  2OTL T;  1S1N A;  5L8R E;  5I22 A;  5GAM h;  1WPY A;  4JZ3 A;  2DRK A;  3DLL A;  3WVE B;  1VQ8 A;  3ME9 A;  1VQM T;  4OP0 A;  2FRW A;  2J06 A;  1KHC A;  2L2P A;  3WVD B;  2HZY A;  4NL2 A;  2KVQ G;  4LUD A;  1M8M A;  2DAQ A;  1HD3 A;  2QGF B;  1M3C A;  1K0X A;  3UA7 A;  1PD1 A;  2EJ9 A;  4RKU E;  3E9G A;  4C92 A;  4M7D F;  2KAF A;  2C06 A;  4J6W A;  1BU1 A;  1V29 B;  2QK0 A;  1NYG A;  1TXQ A;  2CP6 A;  3QZ5 B;  5LJ5 j;  1D1B A;  1M4Z A;  3CMA A;  1PWT A;  5EC7 A;  1MMD A;  3CCS A;  2EGA A;  1Q86 R;  4KGV B;  2RI3 A;  1PRL C;  1WX6 A;  2DO3 A;  2QEX A;  2X4X A;  4C92 B;  2KEA A;  3FIF A;  1HXD A;  3CCV Q;  1IXD A;  2QA4 T;  1OZ2 A;  1NJI U;  1YHQ A;  2EKH A;  1Q81 C;  5CKB A;  4AFS C;  1J3T A;  2JVV A;  2K4Y A;  4CRI A;  4OVA A;  1YJW Q;  2DX1 A;  1UGR B;  2CUD A;  3EG9 A;  2IG0 A;  2DL8 A;  2M0Y A;  1W4S A;  2FZK B;  3JRZ A;  4D8D A;  2DL5 A;  1PRM C;  4PFZ A;  5GAO r;  1S72 T;  1PC0 A;  4PJN A;  1K8A C;  1Q95 G;  3A5Z B;  2XG8 D;  2CGH A;  1UDL A;  2J6F A;  5GAM f;  1YJ9 T;  2E6N A;  1QP2 A;  3S3N A;  1AD5 A;  2B86 A;  3RNJ A;  4WTO B;  2DZ9 A;  4XTU A;  3I56 T;  1D0Z A;  4QQ6 A;  2E1H A;  2YUP A;  5I2S A;  4Y91 A;  2LCS A;  2OTJ T;  1VQ4 Q;  2WSF E;  5FWC A;  3SHW A;  3C0C A;  4J9F A;  1OPK A;  2XI9 A;  2DPP B;  2CP2 A;  4RCC A;  2BZ8 A;  4LDV A;  1MMG A;  2MIO A;  1VQ5 A;  1ZUU A;  4M75 G;  2DLP A;  4PJO G;  2DFU A;  3M54 A;  5CCA A;  2DXC A;  2A28 A;  1N8R C;  1G3Y A;  3OS5 A;  3SB2 A;  2RO0 A;  3OYD A;  1RL2 A;  1KIK A;  2O2O A;  3OYG A;  3MP6 A;  2CZ6 B;  5FU6 C;  3M58 A;  3VUB A;  2WAC A;  3G4S T;  2G3R A;  4CC4 B;  2J6K A;  1N27 A;  4RTZ A;  1VQ6 T;  4L5G A;  2JTF A;  2XU8 A;  5HCK A;  4XU2 A;  3A8H B;  3OMC A;  2E4H A;  3CBP A;  2RJC A;  3BE3 A;  3CMA Q;  1UEC A;  2EJF A;  1MHN A;  3CCR A;  4YTL A;  2F2V A;  4C5H A;  1YHQ Q;  3M4G A;  1TU0 B;  3OYL A;  2A0F B;  3QYG B;  2VV5 A;  4LDX A;  2K5L A;  2AIR B;  4A54 A;  2CZ7 B;  5IT9 E;  5A2Q E;  2LCC A;  2JN0 A;  2RN8 A;  4V2S A;  2XKO C;  4C8Q G;  1VQ7 Q;  1KQS P;  3QG1 A;  1MUZ A;  5GMK m;  2PVO B;  2JOY A;  2EJG A;  2RHX A;  3CCJ A;  2KRO A;  4JRK A;  2X4W A;  1Q82 C;  2DXT A;  3CCE Q;  1TS9 A;  1WDX A;  3R6O A;  2FG0 A;  4MDX A;  3M55 A;  4BAC A;  1Q7Y R;  1M1K C;  4XTZ A;  2FYK A;  1RI9 A;  1T3L A;  3DLM A;  2E70 A;  2ED1 A;  3KUF A;  2EQM A;  4PLI A;  3EGU A;  1O9S A;  4F7U A;  1BK2 A;  2RHY A;  4D8K A;  1NE8 A;  4QKU A;  5I2M A;  3CQT A;  4ZNX A;  1H8K A;  2CZ0 B;  2K5F A;  3JCM d;  1W2B S;  1ABO A;  4JS4 A;  2C0I A;  3SDZ A;  5KE3 A;  1PSE A;  1SHF A;  3QWX X;  2W0Z A;  3QJY A;  3JCM g;  4ZTJ A;  1VQ5 Q;  1X6B A;  3P8D A;  5LJ5 h;  3S6W A;  1Y57 A;  1WHK A;  4EMK B;  2VUB A;  4F7U B;  1IHV A;  4Y28 E;  1VQO T;  1VQN T;  5D7U A;  2JTM A;  3REA B;  1SPK A;  3J80 E;  3H6Z A;  2GNC A;  3PE0 A;  2M0O A;  2HBW A;  1WI7 A;  3VUZ A;  2RQR A;  1ZUK A;  1ZBJ A;  2DEQ A;  4XQ3 A;  1NZ9 A;  2ZAE A;  4JRP A;  1Q86 U;  1BKB A;  1VQ8 T;  4N0A C;  3VS1 A;  2GQV A;  2K3Y A;  5KCH A;  3CME Q;  2HQE A;  1UJY A;  5LJ3 e;  4HT9 A;  1RAC B;  1WHG A;  1PKS A;  2R58 A;  5KE2 A;  2K3X A;  2V26 A;  1WJR A;  2BKD N;  2O4X A;  1I5L A;  2KE9 A;  3QKJ A;  4X34 A;  1K73 C;  2LVM A;  3RER A;  3FEO A;  1OX8 A;  2PNI A;  3I55 Q;  2CZ1 B;  4C8Q C;  4RG2 A;  1M3A A;  2V1R A;  3OYY A;  1YCY A;  1KD1 R;  2V8I A;  4ZGE B;  4M77 E;  3PVQ A;  1FX7 A;  4EIK A;  1XJW B;  4M7A E;  4IUP A;  5GMK e;  2QG9 B;  2O4X B;  2VGM A;  3VYH B;  1PKT A;  2CP7 A;  3UPU A;  2QYZ A;  3CMA T;  2CP0 A;  1D1A A;  1ZX6 A;  2LQW A;  3X24 B;  4OB1 B;  5CKD A;  5D6Y A;  4NOY A;  1YHQ T;  1NEG A;  2V8J A;  2ZPI B;  4M77 D;  2K2M A;  3INZ A;  1I5O B;  4M7A D;  2YT6 A;  4OB2 B;  2FEI A;  4OB0 B;  1M9S A;  5FRN A;  3X28 B;  2HCK A;  1GCQ C;  3QYH B;  4M75 F;  4CC2 A;  1K9M R;  1AT1 B;  1U5S A;  5CKH A;  1CSK A;  4OGC A;  4LDU A;  1MV3 A;  3L2U A;  3AHU A;  1PHT A;  3M0U A;  1JJ2 P;  3CCE T;  3OBW A;  3JB9 G;  1SKU B;  4M7D E;  3MP8 A;  4LDW A;  1H3Z A;  2F5K A;  3CCL Q;  2ROL A;  1N9R A;  1QVG P;  4IUT A;  3MEW A;  4FW1 A;  2DTI A;  3M0Q A;  3H0I A;  2JNG A;  4QW2 A;  2IVW A;  2ABL A;  3M0T A;  1VIE A;  5GAM d;  5CQX A;  3GP8 A;  2SEM A;  1UFF A;  4AT1 B;  5HK3 A;  4EPC A;  2EYX A;  4BY6 C;  1VQ5 T;  5GAM j;  3M9Q A;  4QQD A;  3LH0 A;  4M7D D;  4ZN1 A;  3OYI A;  4ZN3 A;  1T3S A;  3OSV A;  2YWW A;  1M5Q 1;  3CC2 Q;  2Y4Y A;  4QVD A;  1RI0 A;  4JJB A;  4OMF B;  2YRV A;  2X9H A;  1PM3 A;  2XHC A;  2KK4 A;  5GMK l;  3VU3 C;  1HJD A;  4C8Q F;  3OYJ A;  2HL5 C;  3NHN A;  1UHC A;  4AMC A;  3I56 A;  1Q7Y U;  1ZSZ B;  2QAS A;  2JZ2 A;  2CYZ B;  2OAU A;  1X27 A;  4L6V 5;  2OTJ A;  4DBQ A;  2AZS A;  1NJI R;  4A4H A;  2QQ9 A;  2NLU A;  4PL6 A;  3CME T;  2ZPF B;  1XOV A;  4M7A C;  3CCR T;  3JCM J;  2J05 A;  1W2B A;  1RLP C;  4E7J A;  4LD6 A;  1B07 A;  2FPD A;  3MET A;  1IGQ A;  3HKS A;  4XTX A;  5CQY A;  1RAD B;  2MAM A;  1KC8 R;  4XU0 A;  2ZZD A;  2NUT A;  2RHZ A;  4FYW B;  2LQ8 A;  4O5V A;  2VKN A;  3AT1 B;  4UC4 A;  4PFO A;  4HVU A;  1KQS S;  1VQ6 A;  2P0Q A;  3CCU A;  1PD0 A;  3JB9 J;  3SWN C;  2KRM A;  2NYS A;  2CT3 A;  3C94 A;  2AT1 B;  1Q81 R;  4II1 A;  2FO0 A;  2NUT B;  4FT4 A;  4BE1 A;  1RAB B;  2RK1 A;  4XU1 A;  4EDU A;  2K2V A;  3H0F A;  2DM1 A;  4QVC A;  3OQ5 A;  3LX7 A;  4C0D C;  1PG5 B;  4A4K A;  3EG1 A;  4BDY A;  3S3O A;  4LDY A;  1M90 C;  3JCM X;  1X6G A;  4KUD K;  1K8A R;  2SRC A;  2GFA A;  3P8H A;  3CC7 A;  4M78 A;  4HXJ A;  4JLG A;  3CPW P;  1ZA1 B;  3PT9 A;  2F5T X;  1KD1 U;  1UGV A;  5LJ3 f;  5IHN A;  1YWO A;  1BCO A;  1Y07 A;  3QHS A;  4E47 A;  3HRU A;  1JEG A;  1K1Z A;  3EGX A;  4GBQ A;  1R8O B;  3CCV A;  5FRO A;  5IXB A;  2JMA A;  1I4K 1;  5A0D A;  1SRL A;  1VYU A;  4M78 B;  2M51 A;  2DEU A;  4B9W A;  3MJX A;  1M3B A;  2QDY B;  3GNF B;  1N8R R;  1YJW A;  2Z0W A;  4HCB A;  2PZ1 A;  1ZLM A;  2D1X A;  2D8H A;  3JAM E;  2HL3 A;  4KH0 B;  3EGX B;  3G71 Q;  2RI5 A;  2X51 A;  4E7S A;  1IB8 A;  2RQT A;  2G6F X;  4ZTF A;  3OS1 A;  1RAA B;  5KYU A;  4PKC C;  1G5V A;  4IUV A;  1ZSG A;  2YLB A;  3RES A;  1HYO A;  1ARK A;  1B7T A;  1VQ4 A;  1H64 1;  4BDZ A;  2EVR A;  4X9C A;  2PUO B;  1VQK Q;  3EFO B;  3JB9 F;  1NG2 A;  3X26 B;  2KT1 A;  4R0K A;  1WHJ A;  3TSW A;  2E6Z A;  2A3L A;  2D6F A;  1KHI A;  1VQ9 Q;  4WF2 A;  7AT1 B;  4JS5 A;  2YUN A;  4IIO A;  1CKA A;  3GBQ A;  1TWB A;  2AKK A;  4IUU A;  1OZ3 A;  4PNO A;  3CCQ Q;  1Q82 R;  2EQJ A;  2MK5 A;  1AZE A;  1QMC A;  3CC7 Q;  4RTY A;  1AOJ A;  1M1K R;  2YRD A;  3VS5 A;  5LJ5 d;  3D7S B;  2FPF A;  3EHR A;  4BE0 A;  1U3O A;  4C92 G;  2RQU A;  3GIB A;  5LJ5 g;  4QT7 A;  4QQG A;  5GAN e;  2A08 A;  8AT1 B;  1JJ2 S;  3NFC A;  3HHT B;  2O88 A;  1KJW A;  3M4Y A;  1QP3 A;  1W6X A;  2PTK A;  2DD4 A;  2DF6 A;  4Z89 A;  5FU6 B;  3RDV A;  5CAI A;  1QVG S;  5KCO A;  2OAW A;  3GLX A;  1E6H A;  1BCM A;  3I35 A;  3PVL A;  4J9D A;  2K6D A;  3OYF A;  2FZG B;  2LX7 A;  1OUL A;  1VQ7 A;  3LGL A;  2I2L A;  3QO3 A;  4KT0 E;  4ZGD B;  4Q5W A;  4JJD A;  1KC8 U;  4FYY B;  1UE9 A;  1QVF P;  3EG0 A;  4OGE A;  2HNI A;  2KR3 A;  3CCE A;  3V8K A;  4E6R A;  1U1T A;  3EH2 A;  1YI2 Q;  1KQS A;  2VB6 A;  2CH4 A;  2PVG B;  1WXT A;  1CKB A;  4PJL A;  5GAN 4;  1F1B B;  4JDS A;  2DMO A;  3EG9 B;  4M75 E;  3ULR B;  2WSE E;  4A53 A;  1D09 B;  1I81 A;  4PJO E;  1WFW A;  5C0M A;  2R5M A;  1Q81 U;  3UT1 A;  2QGG A;  2K7A A;  4R56 A;  4X1V A;  3R6N A;  2RF0 A;  2IPO B;  4J9I A;  2M1H A;  1TSF A;  4M4Z A;  2DXB A;  5ECA A;  5CK9 A;  4CI0 C;  4KUL A;  1VQP Q;  1RAF B;  2XID A;  4BI4 A;  1GXI E;  4C5E A;  1IHW A;  2OI3 A;  4AG1 C;  2QAZ A;  5GAN 3;  3G71 T;  4M75 D;  1K8A U;  3DB3 A;  4RCB A;  4C0F A;  1B34 A;  1QKX A;  3FRN A;  1QLY A;  2M9U A;  1P92 A;  5A0L A;  1XNI A;  4P5N A;  2LNV A;  1AWX A;  3QDR B;  3URG A;  2EGE A;  4J9B A;  2BE7 D;  2EWN A;  3H8Z A;  1JXM A;  1C0M A;  1G3S A;  4WCI A;  2QDL A;  4C92 C;  4PLL A;  2QQA A;  2QI2 A;  1LCK A;  1UB4 A;  1UJ0 A;  1WQ7 A;  3CCU T;  1QKW A;  1YJN A;  3QWY A;  3L2V A;  1WJS A;  2RJD A;  1G3T A;  2E41 A;  1VQK T;  3CME A;  1B34 B;  3PFS A;  1TG0 A;  3L2R A;  2DIQ A;  2DTH A;  3QUI A;  1ACM B;  4C8Q E;  4N0A A;  1WHH A;  5GAN 5;  2O9V A;  5IXF A;  1JU5 C;  4ZGJ B;  1N8R U;  2DRM A;  2EAY A;  4IUR A;  2JXB A;  2FHD A;  3OYE A;  1YIJ Q;  3I55 A;  2RQW A;  1HSQ A;  2HEQ A; 
#chains in the Genus database with same CATH homology
 2LJ0 A;  4K11 A;  1NEG A;  2EYY A;  2KYM A;  1JQQ A;  2DBK A;  2CUB A;  2FPE A;  2K2M A;  2GTO A;  1IO6 A;  1GCP A;  1H3H A;  2EBP A;  2YT6 A;  1TUC A;  4OMM A;  2FEI A;  2KRN A;  5IHI A;  2ESW A;  2L3Q A;  2VVK A;  2HCK A;  1GCQ C;  4CC2 A;  1QWE A;  2LP5 A;  3TSZ A;  1U5S A;  1CSK A;  1MV3 A;  1Y0M A;  4CC7 A;  1PHT A;  1VYT A;  1WLP B;  3M0U A;  5I11 A;  1NEB A;  1NLO C;  3NMZ C;  1MV0 B;  1N5Z A;  1ABQ A;  1Z9Q A;  3VS6 A;  3SEM A;  3I5R A;  1K76 A;  1TUD A;  4RTU A;  2AK5 A;  1I0C A;  2RQV A;  2ROL A;  1SHG A;  4JPB W;  2EYZ A;  2W10 A;  2KYB A;  4FSS A;  3VRZ A;  2L0A A;  1FYN A;  3M0Q A;  3H0I A;  1W70 A;  2ABL A;  3M0T A;  3M0R A;  2YSQ A;  1BB9 A;  4OMQ A;  1QWF A;  2O31 A;  2A36 A;  2LMJ A;  2ENM A;  2SEM A;  1UFF A;  2IIM A;  2EYX A;  1AZG B;  1GCQ A;  3JV3 A;  2JS0 A;  2JT4 A;  1E7O A;  4JJC A;  2CT4 A;  1T3S A;  2JM9 A;  1NLP C;  5GJW B;  2D0N A;  2FRY A;  4JJB A;  2JW4 A;  4KRT A;  2C0O A;  2YUQ A;  1V1C A;  2EQI A;  1K4U S;  4Z8A A;  2XMF A;  3UA6 A;  1HJD A;  4CC3 A;  4RUG A;  3NHN A;  1UHC A;  3EHQ A;  1T0H A;  1WA7 A;  1QCF A;  2EGC A;  2NWM A;  1X27 A;  3I5S A;  2JM8 A;  2AZS A;  1EFN A;  2C0T A;  2BTT A;  3I9Q A;  5L23 A;  2OJ2 A;  2BZY A;  2X3X D;  1XOV A;  4AFU C;  1K0S A;  2J05 A;  3FJ5 A;  1OEB A;  1X69 A;  1SEM A;  1RLP C;  1S1N A;  5I22 A;  1B07 A;  3O5Z A;  2LZ6 B;  2FPD A;  2DRK A;  4JZ3 A;  2A37 A;  2FRW A;  2GGR A;  2J06 A;  2NUZ A;  2L2P A;  2DL4 A;  2L3P A;  1A0N B;  2EYW A;  4A63 B;  2HDA A;  4AFQ C;  4LUD A;  2KXD A;  2VKN A;  1M8M A;  2DIL A;  1HD3 A;  1M3C A;  1K0X A;  4HVU A;  1AEY A;  3UA7 A;  4F16 A;  3VS2 A;  3A98 A;  3M0P A;  4J9E A;  2KRM A;  1X2K A;  2CT3 A;  1OOT A;  2DVJ A;  1GFC A;  2FO0 A;  2JS2 A;  1AWO A;  2CRE A;  1BU1 A;  1X2Q A;  3H0F A;  3H0H A;  1NYG A;  2DM1 A;  2D8J A;  2KT8 A;  1NYF A;  1WXB A;  4RTX A;  1PWT A;  5EC7 A;  1JO8 A;  3U23 A;  3EG1 A;  4F17 A;  2EGA A;  2LNH B;  4OMN A;  1PRL C;  1WX6 A;  1UHF A;  2KEA A;  1I07 A;  1X6G A;  2SRC A;  3LH5 A;  2EKH A;  4LN2 A;  2CH4 W;  4AFS C;  1J3T A;  4HXJ A;  3VS4 A;  2K79 A;  2KGT A;  1UGV A;  1M30 A;  2DX1 A;  2CUD A;  4J9C A;  2DL8 A;  2M0Y A;  1K9A A;  2F2X A;  5IHN A;  1YWO A;  4D8D A;  3NPF A;  2DL5 A;  1PRM C;  1Z9Z A;  1JEG A;  1K1Z A;  4GBQ A;  4RTV A;  5IXB A;  2JMA A;  1SRL A;  1VYU A;  2M51 A;  4JZ4 A;  2J6F A;  1UDL A;  1G2B A;  1U06 A;  1UTI A;  2O9S A;  1M3B A;  1AD5 A;  2B86 A;  3RNJ A;  2JMC A;  4DEX A;  2PZ1 A;  2YUP A;  1ZLM A;  1SRM A;  1RLQ C;  2LCS A;  2D1X A;  2D8H A;  5FWC A;  3SHW A;  5FWB A;  3C0C A;  4J9F A;  1OPK A;  2DE0 X;  1B3Q A;  2BZ8 A;  2MIO A;  2RQT A;  1ZUU A;  2G6F X;  2DLP A;  1M27 C;  1I1J A;  1ZUY A;  1YCS B;  2A28 A;  4ESR A;  3TVT A;  1ZSG A;  1KIK A;  2O2O A;  4DEY A;  1GBQ A;  1GFD A;  1GL5 A;  5IHK A;  2K3B A;  2KBT A;  1ARK A;  4HVW A;  2EVR A;  1NG2 A;  2J6O A;  2KXC A;  4RTT A;  4CC4 B;  2J6K A;  2AZV A;  4RTZ A;  1KSW A;  2KT1 A;  4R0K A;  3TSW A;  4OMO A;  5HCK A;  4AFZ C;  2YDL A;  2DBM A;  5FW9 A;  1UEC A;  1OV3 A;  2YUN A;  1CKA A;  4IIO A;  3GBQ A;  2MOX A;  2AKK A;  1JXO A;  2DNU A;  2F2V A;  2I0N A;  1AZE A;  2P4R A;  4RTY A;  1AWJ A;  1AOJ A;  3VS5 A;  2FPF A;  3EHR A;  4HVV A;  1PNJ A;  1U3O A;  2RQU A;  2RN8 A;  2LQN A;  4QT7 A;  1KFZ A;  2ROT A;  3VS7 A;  4Y92 A;  2A08 A;  2LJ3 A;  1YNZ A;  1MUZ A;  1VA7 A;  2RPN A;  2JTE A;  1VYV A;  4GLM A;  2O88 A;  2KRO A;  1KJW A;  4F14 A;  1NM7 A;  4LNP A;  3VS3 A;  2GBQ A;  2E5K A;  1T0J A;  1W6X A;  1WDX A;  2CSQ A;  2PTK A;  2FG0 A;  2DF6 A;  1FMK A;  4Z89 A;  3NGP A;  1RI9 A;  1T3L A;  2MCN A;  2OAW A;  2HSP A;  4ORZ A;  2ED1 A;  1E6H A;  3EGU A;  3I35 A;  3PVL A;  2RNA A;  4J9D A;  2K6D A;  2DL7 A;  1BK2 A;  2LX7 A;  4D8K A;  1BBZ A;  4AG2 C;  3CQT A;  1SSH A;  1GRI A;  2GQI A;  2DYB A;  4JJD A;  4ZNX A;  1H8K A;  1RUW A;  1AVZ C;  1WIE A;  3ZL7 C;  1UE9 A;  4LE9 A;  3RBB B;  1ABO A;  1X43 A;  3EG0 A;  2C0I A;  2KR3 A;  1SHF A;  2LJ1 A;  3QWX X;  4RTW A;  4E6R A;  2W0Z A;  2ED0 A;  1X6B A;  2KNB B;  1G83 A;  3REB B;  1Y57 A;  3VRY A;  2CH4 A;  1WXT A;  4J9G A;  1CKB A;  1W1F A;  2YUO A;  2DMO A;  3ULR B;  1WFW A;  4IIM A;  2CDT A;  3REA B;  1GBR A;  2H8H A;  1UG1 A;  1SPK A;  2BZX A;  2EW3 A;  2K7A A;  4X1V A;  3R6N A;  2RF0 A;  2GNC A;  4Z88 A;  3PE0 A;  5GJV B;  2HBW A;  2J7I A;  1WI7 A;  4J9I A;  4LUE A;  2RQR A;  1ZUK A;  4M4Z A;  5ECA A;  1YN8 A;  1ZBJ A;  2ECZ A;  2DL3 A;  4OML A;  2F2W A;  3EG3 A;  3VS1 A;  2OI3 A;  4AG1 C;  2RMO A;  2X3W D;  1UJY A;  1AWW A;  1H92 A;  2DA9 A;  1QKX A;  2L3S A;  1QLY A;  1PKS A;  2EPD A;  3KFV A;  3UAT A;  1AWX A;  2V1Q A;  2EGE A;  4J9B A;  1JXM A;  4WCI A;  2CSI A;  2KE9 A;  2QDL A;  1E6G A;  2KRS A;  1LCK A;  1UJ0 A;  2PNI A;  1QKW A;  3VS0 A;  4J9H A;  1M3A A;  2V1R A;  2AKL A;  3H41 A;  2DJQ A;  3QWY A;  3UF4 A;  2GTJ A;  1WYX A;  1YP5 A;  3PVQ A;  1TG0 A;  3THK A;  4EIK A;  1YWP A;  1WXU A;  4HCK A;  1UUE A;  4OMP A;  2O9V A;  3M0S A;  3EG2 A;  1PKT A;  5IXF A;  1JU5 C;  1OPL A;  2DRM A;  2VWF A;  3IQL A;  5IH2 A;  1ZX6 A;  2JXB A;  2LQW A;  2RQW A;  1HSQ A;  2HEQ A;  2K9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...