1M3CA

Solution structure of a circular form of the n-terminal sh3 domain (e132c, e133g, r191g mutant) from oncogene protein c-crk
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
CGAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain
rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Proto-oncogene C-crk
total genus 8
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m3cA00
2C0OA 1N5ZA 1Z9ZA 2DF6A 1AZGB 2GQIA 2LJ1A 1ZX6A 1PRLC 4JJDA 1AD5A 1AVZC 2CREA 1SRMA 2H8HA 4EIKA 2D1XA 4LUDA 3EGUA 2KYMA 3UATA 1WIEA 2O88A 3VRYA 2J6KA 2ROTA 4CC7A 2DM1A 2JS0A 1K4US 1ABOA 2FPFA 2FPEA 3THKA 2J6FA 3IQLA 3EG1A 2PZ1A 2GNCA 2EGAA 1MV0B 1E7OA 1ZUYA 1NM7A 2OJ2A 2V1RA 3KFVA 4ORZA 3REAB 5GJWB 4JPBW 4RTVA 1U06A 2RPNA 2LNHB 4E6RA 2RQVA 3H0HA 1H92A 2A36A 2XMFA 3PVLA 2DLPA 1AOJA 1FMKA 2VWFA 2OI3A 1WFWA 1BBZA 2CH4W 1W70A 2BZXA 4Z88A 5I11A 2KT1A 1I07A 2DL8A 2KYBA 2F2VA 3EG3A 1PWTA 3RNJA 1X2KA 1AEYA 1GFCA 1NLPC 1CKBA 4AG2C 1YCSB 1SHGA 1G83A 2YUOA 3VS5A 2F2XA 2KXCA 3NHNA 2LQWA 4K11A 3M0TA 4HVUA 3ZL7C 1MV3A 1GCQA 4RTUA 1BU1A 2KT8A 4JJCA 1WA7A 1JEGA 2KRSA 2W10A 2MIOA 1K76A 1BB9A 3LH5A 3U23A 1JU5C 1W6XA 2EGEA 4JZ3A 5I22A 1QWFA 2DRMA 2JTEA 4J9GA 1UTIA 4OMQA 3I5SA 2GGRA 1M3BA 5IH2A 2AZVA 4HVWA 2JMAA 4RTWA 2K9GA 1E6GA 2LJ3A 5FWBA 1PNJA 1T3LA 1WXTA 2DILA 1WYXA 4OMLA 1JXOA 1XOVA 2AK5A 2PTKA 2YT6A 2KXDA 1X43A 4J9DA 1PKTA 2KEAA 4J9EA 3PE0A 3H41A 2EYYA 4IIMA 3TSWA 1SSHA 3ULRB 1OOTA 4RUGA 1NG2A 2EBPA 2LMJA 3VS2A 2CUBA 3VS3A 2RNAA 2BZYA 4D8KA 2ED1A 2RQUA 3TVTA 1A0NB 4OMMA 1NLOC 1TUCA 1K9AA 2CSQA 1E6HA 4Y92A 3RBBB 4GBQA 1UJYA 1KSWA 1VYTA 1H8KA 2CT3A 2IIMA 2JW4A 1OPLA 5ECAA 2A37A 3NPFA 2JT4A 4D8DA 4IIOA 1RUWA 1X27A 2KRMA 2EGCA 2KGTA 2KNBB 4J9BA 4RTZA 2KBTA 2YUNA 5HCKA 2A08A 2DJQA 2DNUA 1V1CA 1UG1A 4DEYA 1GL5A 1BK2A 1VYVA 1NYGA 1GBQA 1HD3A 1PRMC 2CT4A 3I5RA 2CSIA 2D0NA 2JMCA 3M0SA 2A28A 2JS2A 1X6BA 2OAWA 4WCIA 1SPKA 4A63B 1OEBA 2LCSA 2HBWA 2DVJA 1CKAA 2QDLA 1Y0MA 2AKKA 2MOXA 1Z9QA 2EYZA 1K0XA 1I0CA 4AFUC 2CUDA 4ESRA 1TG0A 2X3XD 2HEQA 2RQRA 1ARKA 2FO0A 2LZ6B 1WXUA 3CQTA 2F2WA 1T0JA 1U5SA 2O9VA 4CC2A 2HDAA 2L3QA 2L0AA 2DBMA 4CC4B 3C0CA 1GBRA 2ED0A 2D8JA 2L2PA 1YWOA 1PHTA 3NMZC 3M0UA 2L3PA 2G6FX 1M3CA 1SHFA 1NEGA 1AWOA 1X6GA 2BTTA 2YSQA 4R0KA 2CH4A 2J06A 2J7IA 5L23A 2RN8A 2SEMA 4Z8AA 2P4RA 4AFZC 2K3BA 2DE0X 1MUZA 3I35A 2E5KA 2RMOA 3EG0A 1UGVA 3VS4A 1UE9A 1AZEA 4M4ZA 1SRLA 1T3SA 1H3HA 2D8HA 1YP5A 4HCKA 4RTXA 3VS0A 4J9HA 2ENMA 2J05A 1QWEA 2FG0A 1UHFA 5IXBA 1VYUA 4LUEA 3EHRA 4JJBA 2W0ZA 4J9IA 5FW9A 2M0YA 2RF0A 5IHKA 4AG1C 1U3OA 1QKXA 2NUZA 1M8MA 4F16A 1W1FA 3VRZA 4LN2A 1SEMA 2JM9A 1ABQA 1WLPB 2MCNA 4DEXA 4Z89A 1JXMA 1M3AA 4KRTA 1GFDA 1ZUUA 2LJ0A 4X1VA 2EQIA 2DL7A 3SEMA 1RI9A 3TSZA 2K7AA 2RQTA 1RLPC 4OMOA 2JXBA 1GRIA 1FYNA 2EYXA 3M0PA 1UDLA 1YNZA 1ZUKA 4LNPA 5FWCA 2EPDA 2NWMA 1B3QA 1ZLMA 1WDXA 1B07A 2DYBA 1WXBA 2EKHA 1CSKA 1QLYA 2FRWA 2O2OA 3VS7A 2ABLA 2DBKA 2GBQA 1JQQA 1K1ZA 1TUDA 1X69A 2HCKA 1GCPA 3UA7A 1X2QA 2EYWA 4FSSA 4J9FA 1AWJA 2DX1A 2K79A 2K6DA 2FPDA 1GCQC 2RQWA 2M51A 3PVQA 3I9QA 1Y57A 2DRKA 3EHQA 3JV3A 2K2MA 2VKNA 1NEBA 1M30A 2KROA 1ZSGA 2FEIA 5EC7A 4ZNXA 1WI7A 3VS6A 2YUPA 3REBB 4OMNA 1UECA 1OV3A 4HVVA 2GTOA 2HSPA 1K0SA 1AWXA 1G2BA 2VVKA 2CDTA 1NYFA 2B86A 1YN8A 5GJVB 2YUQA 2PNIA 5IHIA 3EG2A 3VS1A 4HXJA 2AZSA 2C0IA 4F17A 1KJWA 3O5ZA 1KFZA 2ESWA 4GLMA 1UFFA 2KR3A 2JM8A 2FRYA 2YDLA 3UF4A 2DL4A 1QCFA 1QKWA 2DA9A 2EVRA 2O31A 2EW3A 2V1QA 2KRNA 3H0FA 4QT7A 4AFQC 1ZBJA 2O9SA 3SHWA 2BZ8A 1AWWA 4OMPA 1UUEA 2DL5A 1I1JA 3FJ5A 4F14A 1J3TA 3M0QA 2C0TA 2ROLA 1EFNA 1HSQA 3UA6A 2ECZA 3H0IA 1T0HA 3QWYA 4RTTA 1KIKA 2L3SA 4J9CA 4AFSC 2J6OA 1IO6A 1UHCA 3A98A 1WX6A 2DL3A 3QWXX 1OPKA 1YWPA 1JO8A 2DMOA 2LQNA 3NGPA 4JZ4A 2KE9A 3GBQA 4RTYA 1LCKA 1PKSA 2GTJA 4LE9A 1M27C 4CC3A 1S1NA 2LP5A 1HJDA 2AKLA 1UJ0A 1VA7A 2X3WD 2LX7A 5IHNA 2I0NA 2SRCA 3M0RA 1RLQC 5IXFA 3R6NA
chains in the Genus database with same CATH superfamily
4PJMA 4M7DG 3QUIA 1QCNA 2R57A 5GANf 2E6ZA 2YRCA 1ZX6A 2EKOA 4C5EA 2QQAA 4HT9A 3CC2T 4A4KA 4JJDA 1AVZC 2CREA 4LUDA 4ZTJA 2DZ9A 2IPOB 2O88A 2ROTA 1N8RU 2DM1A 3FEOA 3DB4A 1G3TA 1VQLA 4M7AE 4BE1A 2HMAA 1M90C 1UGSB 1WHLA 1VQKA 4FIBA 1OZ2A 2FPEA 5CKBA 1MMGA 3OSVA 4BUGA 2P0PA 1LVKA 4O5VA 2QTVA 1YI2Q 1NM7A 3EAEA 4J8OA 2DIQA 1IXDA 1VUBA 3CD6T 1U06A 2RPNA 4E6RA 1D0YA 3JB9G 4A4HA 3I55T 2MI6A 3N5BB 4MZTA 3PVLA 3TQ7P 4LD6A 4FSXA 1AOJA 1W2BP 2VWFA 3RMQA 3CCSQ 2I2LA 5AT1B 3LW5E 5KYNA 1C0MA 2KT1A 1I07A 2CZ0B 4KBMB 1ZSZB 3EG3A 2MF2A 2VB6A 2EJFA 2BKDN 2RO0A 1NLPC 1Q7YU 3CEYA 1SHGA 1G83A 4OGEA 2XD0A 1RAFB 3ZL7C 1BU1A 3QYGB 1W2BS 2K5LA 2A0FB 4WF2A 3CXCP 1FMWA 3U23A 3I56A 5FRNA 3EH2A 2EGEA 5I22A 2QA4A 1QWFA 1KQSP 4J9GA 3LGLA 1VQKQ 3QG1A 4M7DC 1M90R 4GY5A 4ZN3A 2DERA 1VQ4Q 4HKEA 1VQ8Q 4M7AB 3G4SA 2DILA 3JCMJ 1M1KU 3T9NA 4N0AC 2Y4XA 1PKTA 1ZSZA 3PE0A 2X51A 3TREA 1SSHA 1YBYA 1YJNA 2XIDA 3CC4T 3VUBA 2EBPA 3OBYA 1RAIB 2HKNA 5GANe 4EDUA 1KHIA 2BZYA 4D8KA 2ED1A 5KH6A 2CP7A 1WZOA 1YFNA 4OMMA 1R0BG 3CCEQ 1E6HA 2LNVA 1HXDA 4GBQA 1M90U 3ASKA 1D09B 4C8QG 4IIOA 1RUWA 2LQ8A 4M75F 1KC8U 2FB7A 1PCXA 2KNBB 4FYVB 4IUQA 4M78D 2KBTA 2YUNA 2XICA 3E9FA 1VYVA 4PJOD 1GBQA 3OYCA 5CR2A 3I5RA 3V8LA 2DTOA 2D0NA 3V8JA 2OAWA 4WCIA 1BI1A 2XDDA 4LDUA 3OW2P 4M75C 4M78E 1Z9QA 2DK3A 3G6ET 5D6XA 3V7CA 3G4SQ 1OQKA 4ESRA 1D1AA 1TG0A 4C92E 2HEQA 2KQWA 3CMAT 1ARKA 4F04B 2F2WA 1T0JA 2O9VA 5GAN6 4JRPA 3JCMh 4A53A 2EWNA 4J6WA 2MYSA 2RJDA 3S3NA 2QGFB 1YHQT 5GAOl 3AT1B 4PJOC 1NEGA 2RHUA 4FYWB 2BTTA 2E41A 4Z8AA 5HY6A 1HK9A 4AFZC 4M75D 4PJJA 3G71Q 4QQ6A 1RAHB 2RMOA 5KCOA 2X4YA 3CC2A 1SRLA 3X26B 2EFIA 5HKCA 2D8HA 3JB9D 1RACB 1YP5A 4HCKA 4RTXA 1M1KC 1WJRA 4R56A 3VJPA 3KXTA 1QWEA 2AT1B 1UHFA 2FG0A 5DM7R 3PIPA 4PK4A 1VYUA 1VQPQ 1ZBXA 3TEEA 4E7HA 4C8QD 2M0YA 2RF0A 4LDXA 4HCBA 4AG1C 1VQ8T 1U3OA 2P0KA 5GAOn 1M8MA 2F1LA 4BDYA 1D0ZA 2MPXC 5HK0A 3JCMb 1OX9A 1V29B 1WLPB 2DZCA 3NTKA 1QVGP 4PJOF 1GFDA 2LJ0A 3OYEA 1M4ZA 2DL7A 2EQIA 1RI9A 1W2BA 5C0MA 2K7AA 3G1JA 1WPYA 3D7SB 3UDCA 4C92A 4Q5WA 1BI3A 2EQKA 2DVEA 4M7DD 5GANd 5GAN4 1Q7YC 5FWCA 2NWMA 3CCJQ 2JVVA 4M7AC 4V2SA 1CSKA 3CC7A 5M9OA 2EYQA 2DBKA 2GBQA 1JQQA 1K1ZA 4QVCA 2QQBA 2LTOA 1EX4A 3MEWA 4M78C 4FSSA 2VGMA 4BB7A 4B9XA 3CC4Q 5KE2A 3J7AF 2E3HA 3LWIA 2DRKA 3JV3A 4LDVA 1KC8R 2KROA 2E12A 1VQNT 5KYWB 2YUPA 4EMKA 3REBB 1N6AA 3HHTB 4OMNA 2DETA 5KYUA 4HVVA 1MGQA 2F69A 1RI0A 2HSPA 1K0SA 1AWXA 4A4FA 4F7UA 1Y96B 3L42A 2B86A 2HKQB 1VQ9Q 2YUQA 2E4HA 2VASA 3EG2A 1I5OB 3M59A 4ZTFA 3VS1A 5CK9A 3QDRB 3CCRA 4HXJA 3VYHB 3O5ZA 4HCZA 2ESWA 1UFFA 2YDLA 3I56T 2V1QA 5LJ3d 4QT7A 2EQMA 4AFQC 4WTOB 2GQVA 1Q86R 1EIFA 3JCMe 1AWWA 1QVFP 3FJ5A 4RKUE 2V8JA 1VQ5T 1UEBA 2C0TA 3CD6Q 2FZKB 3URGA 3CCRQ 3UA6A 1T0HA 3CCLA 3L2ZA 1RABB 2FHDA 1Q82C 4EMKB 4XTUA 1IO6A 3QIIA 4ZGEB 1UHCA 3MP8A 2NUTA 5KYXA 2DL3A 3QWXX 2RHIA 1YWPA 2DMOA 3NGPA 2GFAA 1LCKA 1JJ2A 1S1NA 2MK5A 2RI3A 1UJ0A 2ZPGB 4M77A 5GAN5 1VQ9A 4BACA 2LX7A 2EAYA 3MP1A 2COWA 1AT1B 3A8LB 2HBPA 5IHNA 3WXMB 1RLQC 3X20B 5IXFA 3R6NA 3CC2Q 2C0OA 5LJ5e 1N5ZA 1Z9ZA 1NE8A 2WSEE 3QSUA 1AZGB 2ZAEA 2LJ1A 5FRMA 2DJZA 1OULA 3QDFA 3EGXA 2H8HA 2QEXA 1SRMA 4EIKA 2D1XA 5GAMe 1X6OA 1PD0A 5LJ3g 1MMDA 1WIEA 4E7SA 2J6KA 3NTIA 3CXCA 1YJ9T 3GNFB 2ATCB 1K4US 1BIAA 2E70A 3MEUA 4C0DB 1ABOA 1K9MC 3OYFA 2ZPIB 3CCVA 4ZN1A 2FPFA 5C6SA 2WACA 2DPPB 3EG1A 4C92F 1OYXA 3META 2GNCA 4C0GA 2RH2A 1VQ7Q 4QVZA 2L8DA 2RHXA 5GJWB 5GMKl 2M16A 4BY6B 3HSBA 1M9SA 4RTVA 2H3EB 2LNHB 4FW2A 2EQUA 2A36A 1PSEA 2Y4YA 2XMFA 1MHNA 1MMAA 4C92C 5KYUB 4F7UB 4Y28E 1PC0A 1WHJA 2BZXA 2FL7A 3M5AA 2EIFA 4Z88A 3CCMT 1GXIE 5GAOq 1R77A 3X24B 5GAOr 3EGDB 3CCEA 4FT4A 3HRTA 1GFCA 4FCYA 3VU3C 5GMKm 2HL3A 5A0LA 4XQ3A 4HVUA 4OB0B 2WSFE 2QEXQ 3V7SA 2CKKA 1YJ9A 4JJCA 1O75A 1WA7A 2KRSA 2MIOA 1VQ7A 1BB9A 2LT4A 1KK7A 2GFUA 4C5HA 2OTLA 1W6XA 3CBOA 2DTHA 4N4GA 2JTEA 1XTDA 1UTIA 3I5SA 1D3BA 4ATOA 4HVWA 1U8RA 2IG0A 1E6GA 2L3RA 3UWNA 5FWBA 3QYHB 1PNJA 1T3LA 1BI0A 3HP9A 4NL3A 3OYLA 1TS9A 4M75A 2PQWA 4PKCC 2BUDA 1B34B 2ZGWA 3CBPA 4QKUA 3PTAA 4OMLA 4A4EA 2E64A 1XOVA 3G7ZA 4II1A 2KXDA 4M77G 1X43A 4JRKA 4J9DA 4FM4B 1QVFA 3CXCS 1NBEB 1YIJT 3CCQA 2EYYA 1OOTA 4RUGA 1NG2A 3OYHA 2LMJA 3VS2A 2K4YA 2E10A 2RNAA 3EFSA 3MKDA 2DYIA 4FU6A 4FT2A 1K9MR 2LT1A 3OS5A 4UC4A 1NLOC 3V8KA 3MJXA 2E5QA 2KDSA 3BW1A 1VOMA 4Y92A 4N4IA 2NUPB 4C0ZA 2CT3A 2DFUA 2JW4A 1OPLA 3NPFA 3CMEA 2E1HA 1D3BB 3OY9A 2KGTA 1G5VA 3M57A 3CD6A 2EQJA 4RTZA 5D6YA 2X9HA 2RD1A 4FYXB 1V1CA 2R5AA 4DEYA 1VQNA 3CCQT 1XNIA 1NYGA 4XK8E 1HD3A 1PRMC 4PFPA 2CSIA 1UGQB 2JMCA 1N27A 4JLIA 2R5MA 1YI2A 2VXFA 1M1GA 2A28A 1QMCA 2QAZA 2V26A 2YXYA 4OB1B 1SPKA 3RDVA 3S6WA 3SWNA 3L2VA 4JLGA 1PG5B 2HBWA 2QDLA 1Y0MA 3VKIA 2MOXA 3OW2S 4AFUC 3CCUT 1WJQA 2LZ6B 4M77E 3CQTA 1U5SA 3JB9H 2L3QA 2L0AA 2DBMA 1VQ5Q 1GBRA 2ED0A 2COYA 4DOWA 1XQHA 1YWOA 4E2FB 3NMZC 4N0AA 2WSCE 2Y90A 1M3CA 1SHFA 1AWOA 3GOXA 1X6GA 4J6XA 2JJ9A 2J06A 2ZPEB 5FU6B 2P4RA 2V8IA 2K3BA 1NJIR 1Q7YR 3I35A 2E3IA 3QZ5B 3CC4A 3A1PA 1UGVA 4M4ZA 1Q82R 2O4XB 1G3SA 1LJOA 4MDXA 4J9HA 1VQ8A 5DLQE 2CP2A 4DBRA 4A54A 4E7IA 2DTIA 3EHRA 2EJ9A 4J9IA 5FW9A 1YI2T 4PJOB 3RKWA 3EFRA 1QKXA 3VRZA 3MEVA 2QA4Q 1JRIA 3QJ6A 5GAMh 1QW1A 2OTJT 4M7AA 1ZA1B 1ABQA 1O9SA 3VUZA 4DEXA 4IUUA 1BKBA 3R6OA 4KRTA 5GAOm 3JB9F 3G6EQ 2NYSA 3M4GA 3SD4A 5GAMd 3VYGA 3A8GB 2RQTA 1RLPC 1M1KR 4PFZA 2JXBA 3BFMA 3GNGA 1GRIA 1FYNA 4BI8B 2RK1A 1M5Q1 1IGQA 1YHQA 1YNZA 1ZUKA 4LNPA 3L2QA 2EPDA 1B3QA 2BIVA 1WDXA 1B07A 3EG9B 2M1HA 1WXBA 2EKHA 1VQPA 1QLYA 2XKOC 2KAFA 3PNWC 1OX8A 5I2MA 1YITA 2CZ1B 3JCMX 5KE3A 2QQ9A 2HCKA 1GCPA 4JS5A 1VQMA 4J9FA 3P8DA 3JCMd 2LVMA 5GAMg 3OS0A 4IUPA 1MNEA 2M51A 3OYGA 4M7DF 1VQ6A 1Y57A 3OSSC 2JTMA 4M7AF 1LOJA 2K2MA 1NEBA 1VQOT 5LJ5h 3M56A 1ZSGA 2FEIA 3LLRA 3FC3A 5CKDA 1WI7A 1KQSS 1OI1A 2DKGA 1OV3A 3QKJA 4M78F 1VQ7T 1YITQ 1G8XA 4IUTA 4KGXB 4OP0A 5IT9E 5CIUA 4L5GA 3INZA 3CPWA 4X9DA 5CQXA 1FX7A 1KJWA 4C92G 3A8MB 1KFZA 3MO8A 4BI3A 3OYYA 5DY9A 2QGGA 2JM8A 3I56Q 3FB9A 3UF4A 3RKXA 3C4SA 4M75E 1QCFA 1PD1A 1R8OB 2O31A 5CKHA 3JB9J 3C94A 4OB2B 2NLUA 3OYAA 2KRNA 4XTXA 4M7DB 2QG9B 2BE9B 4PJOG 1QVPA 1Q81C 1UUEA 3P8BB 4C8QC 1YJNQ 1I1JA 2PVGB 4NS5A 3JCMg 1C1AA 2ECZA 2V8KA 3PT9A 3C12A 3QWYA 1HYOA 1KIKA 2L3SA 4AFSC 1TWBA 2RHZA 1QVGA 3A98A 1WX6A 1M1FA 3JCMV 2JTFA 3OYJA 3EH1A 1JO8A 2M9UA 3GBQA 3BDLA 4KUIA 5LJ5g 5A0GA 2LP5A 2G3RA 2AKLA 1HJDA 1VA7A 4EPCA 3NFCA 4RG8A 3SWNC 3M0RA 4J6YA 3SFMA 4C5IA 3H8ZA 2DF6A 3I55Q 2GQIA 3NTHA 1Q82U 3S3OA 4M77F 1AD5A 1FMVA 4F7UG 3EGUA 4HCCA 1ZHIA 1VQ6T 4FL6A 3VRYA 2KK4A 8ATCB 2JS0A 2AIRB 4KGZB 3GIBA 1ACMB 3LX7A 4C0FA 3DKMA 3QBYA 5L8RE 4OMFB 4TVRA 2RJCA 1Q86U 3L1AA 2K5FA 2PZ1A 2EGAA 2KMTA 4PLLA 1M2VB 1MV0B 1BI2A 1E7OA 2OX7A 2HNIA 1I5LA 4JPBW 3EGXB 4A4GA 1RAEB 3L2UA 1PSFA 2RJEA 2DXUA 4RCBA 3CMET 3PIOA 3HTRA 5EG2A 3QXEB 5A0DA 2DLPA 5D6WA 3CCLT 2OI3A 1WFWA 4M77C 1NJIC 4GLKA 2CH4W 1W70A 5KYWA 2DL8A 3JB9I 2KYBA 3OB9A 4XTVA 2BE7D 3RNJA 1AEYA 2E65A 4DA4A 7AT1B 1K73C 1B34A 4AG2C 2E6NA 1YCSB 2YUOA 3G71T 1SG5A 3MHXA 3G6EA 3VS5A 2KXCA 3NHNA 2LQWA 1YIJQ 1QVGS 3M0TA 1MV3A 3M55A 1U1TA 4RTUA 3JCMW 4X9CA 4PJOA 2MAMA 1Y96A 3GLXA 2JN0A 4BDZA 1K76A 3LH5A 1TTHB 2XDPA 1K8AC 1JJ2P 2XG8D 2YWWA 4EMKC 1VQ4A 2ZCFB 5GMKi 2JMAA 2K9GA 3OYBA 4OF1A 4KT0E 4PNOA 2DO3A 1WXTA 3A8HB 3CCST 2FZGB 4M78G 2HQEA 2ZZDA 1JXOA 2KSSA 3OYNA 2YT6A 2YLBA 3FRNA 4F7UE 2XI9A 2F5TX 4N4HA 2X4JA 3HL8A 4VUBA 3SB2A 3H41A 3EG9A 3TSWA 3ULRB 5J39A 2XDBA 3BY7A 1D1CA 1K8AR 4R55A 3E1SA 3MEAA 4B9WA 4J5YA 1N8RC 3SWNB 1U1SA 1VQOQ 5D7UA 3OS1A 2QYZA 4XU2A 5LJ5d 2CSQA 3QZ9B 3OYDA 4F7UF 1RAGB 1VYTA 1H8KA 3CCQQ 5FU6C 2QQSA 4D8DA 4BE0A 2KRMA 2EGCA 3MP6A 2P0QA 1H3ZA 4J9BA 5HCKA 4MZPA 1M2VA 2DNUA 1UG1A 1BK2A 2XK0A 2CT4A 2QDYB 1KD1U 4NL2A 1IB8A 3M0SA 3ER0A 1X6BA 1RL2A 2LCSA 4M75G 5GANg 2DVJA 2LCCA 1CKAA 2OAUA 2EYZA 3HRSA 1KQ1A 2KVQG 2HZYA 5FLXE 4C92D 3JAME 1K9MU 2CUDA 2JOYA 2RQRA 2FO0A 4QQGA 4CC2A 1I81A 2D6FA 2HDAA 5GMKe 1MNDA 2PUKB 5CAIA 4CC4B 2COZA 2FVUA 1KG1A 1W4SA 5CKFA 2L2PA 3BDUA 1VQOA 1PHTA 3M0UA 4XTYA 2D0QB 2X4WA 2DEQA 2YSQA 4R0KA 1KC8C 3JSCA 5CVIA 5L23A 2SEMA 1RAAB 3G71A 3CPFA 4KGVB 3AHUA 4JDSA 1MUZA 5GAMf 4YTLA 3VS4A 3RERA 1UE9A 1AZEA 2OTLT 1H3HA 1YJ9Q 2RK2A 4IKFA 3RUXA 1MMNA 2X35A 2J05A 2DAQA 3QHSA 5IXBA 3M4YA 4PFOA 2OTJQ 1Y71A 2W0ZA 2X4XA 1ZSZC 2K3YA 5IHKA 1S72A 2MWOA 2GF7A 2NUZA 4E47A 1X01A 2LRQA 4BD3A 4F16A 1W1FA 1SEMA 2M0OA 1UGPB 2YRDA 3OS2A 1K8AU 3OYIA 2MCNA 3SDZA 4X1VA 2H3JA 4O6JA 4MZMA 3TSZA 2CYZB 2MWPA 4OMOA 2CGHA 3M0PA 2C06A 4J83A 1UDLA 3KBGA 4PJNA 1K73U 1ZLMA 1VQMQ 1WHKA 1ZA2B 3QPHA 2DYBA 4DQ2A 2O2OA 3VS7A 2QK0A 4JJNK 2F5KA 4QQDA 1SSFA 1N9RA 1TUDA 2A3LA 4BE2A 4XTZA 3CCMA 1X69A 2JNGA 2RI5A 4BY6C 3UA7A 1NJIU 4ELYC 2K3XA 1X2QA 5CKEA 5LJ3e 4EMGA 4RG2A 2K6DA 4KUDK 2CP6A 2LCLA 5LJ3j 1QQJA 2L5QA 1RADB 2K5IA 3PVQA 1G3YA 1UGRB 2VKNA 1M30A 2PU9B 5EC7A 4ZNXA 5GAMj 3HFOA 1UECA 2GTOA 3RKYA 3CCJT 3WVDB 1VQ4T 3CCUA 1Q86C 3JRZA 1YN8A 3FLGA 5GJVB 5LJ5j 2PNIA 1OZ3A 1K73R 2XU8A 5IHIA 4C8QB 2IVWA 3EFOB 3HKSA 5GAN8 4C8QF 4RCCA 2PVOB 5I21A 5KYYA 4M7AD 4DBQA 1WNLA 3Q1JA 2KR3A 4XU3A 3QO3A 1QKWA 2DA9A 2EW3A 4C0DC 5DLOA 9ATCB 2DEUA 1QCOA 4MDWA 1ZBJA 3X28B 3O8VA 3SHWA 2HSEB 1TUGB 2DL5A 3PMTA 4F14A 1J3TA 4QVDA 1IHWA 2ROLA 2VUBA 1HSQA 3OYKA 3RESA 1VQMT 1N8RR 1H641 3PMIA 4RTTA 1YITT 5CQYA 4JRIA 4BI4A 2L89A 1OPKA 3CCUQ 3CCLQ 2FZCB 1FWZA 1TU0B 2DIGA 4M78A 2LQNA 1D1BA 2KE9A 1Y7XA 2A7YA 1PKSA 2DD5A 3S3MA 4LE9A 1M27C 4CC3A 3CPWS 1VQ5A 5IN1A 4XAXB 1Q81U 2I0NA 4C5GA 2R58A 2SRCA 2O4XA 4ELZC 4DBFA 3L2RA 3KUFA 1B7TA 4E7LA 1PRLC 4M77D 1N9SA 2EJGA 5GMKj 2P4TA 1AHJB 2KYMA 3UATA 4FW1A 4CC7A 1NPRA 5J3BA 5GMKh 1F1BB 1KD1R 4ZGDB 4P5NA 1OU8A 3THKA 2J6FA 3IQLA 4J7FA 3CMEQ 1S72Q 2OJ2A 1ZUYA 2DXTA 3KFVA 2V1RA 4ORZA 1VIEA 1WQ7A 3REAB 1IREB 4M78B 2ZPFB 3H6ZA 2OTJA 5HK3A 1YJNT 2RQVA 3H0HA 4ANJA 1H92A 1VIFA 4PJOE 4M75B 2CP3A 1BCOA 3MCAB 2FYKA 2RB6A 1FMKA 1EZZB 1BBZA 2DD4A 2VXEA 3E2UA 3G4ST 4LD9K 5I11A 1BCMA 1YJWT 3GP8A 1JB0E 3ZBDA 2DXBA 1JBMA 2F2VA 3EFOA 1PWTA 2DXCA 1X2KA 1D0XA 1CKBA 5CO7A 1YHQQ 1FXXA 2QEXT 3QJYA 2F2XA 3LWHA 1IHVA 4K11A 3UPUA 3OW2A 5J26A 1GCQA 2KT8A 3LH0A 2NUPA 3DLLA 2D9TA 3HPWA 4M7DE 1G3WA 1JEGA 2W10A 3JCMc 3FIFA 4XTWA 2B8AA 1JU5C 2HD0A 4JZ3A 2M02A 1WQWA 2DRMA 3GPLA 3E19A 3ZEHA 4OMQA 2GGRA 1M3BA 5IH2A 2AZVA 1NZ9A 3E9GA 1M8VA 4RTWA 4E7ZA 2LJ3A 2QA4T 3CCMQ 2JUFA 1YIJA 2KI7A 3L2WA 1IGUA 1BIBA 3OMGA 4OB3B 1WYXA 3OBWA 1JJ2S 2AK5A 2PTKA 2HL5C 1VQ9T 2KEAA 4C8QE 3P8HA 4J9EA 3X25B 1PM3A 4IIMA 4L6V5 2CUBA 3VS3A 4PL6A 1KQSA 3JCMf 3M58A 2JZ2A 3HRUA 2LQKA 3HFNA 2P84A 5LJ5f 4E7KA 2RQUA 2RHYA 3TVTA 1KD1C 1A0NB 1I8FA 3RIRA 3UT1A 1TUCA 1Q81R 1K9AA 3RR6A 2PVDB 3BE3A 1SKUB 4Y91A 1VQLT 4FYYB 3RBBB 3CC7Q 4OVAA 3J80E 1UJYA 1KSWA 2IIMA 1YCYA 5ECAA 5FROA 2A37A 2JT4A 1WJSA 3OMCA 1X27A 1LPLA 3OA6A 3C95A 3CCVQ 2RA2A 2QQRA 1WGSA 2A08A 2DJQA 1GL5A 1TXQA 2RM4A 3JCMQ 1I4K1 4J7IA 3FDRA 4LDYA 1WHMA 1IRXA 5A2QE 5GANh 2JS2A 1VQKT 5AYFA 1C6VX 4A63B 1OEBA 4RMOA 2QASA 3JCMP 5KYYB 4MMKA 2AKKA 1K0XA 3PFSA 4M7AG 2RJFA 1I0CA 3DLMA 4JRQA 2X3XD 5GANj 2O01E 3CBMA 1WXUA 2KY9A 3C0CA 2VV5A 2D8JA 3A5ZB 1WHHA 4LXCA 4D6WA 2PUOB 2CZ7B 4AMCA 2L3PA 2AHJB 2G6FX 2VYTA 2NUTB 5KYXB 2CH4A 4JS4A 2J7IA 2RN8A 3CC7T 4CI0C 1OU9A 2OTLQ 4ME7A 2VC8A 2DE0X 4X34A 2E5KA 1IZ6A 3EG0A 4PJLA 3LGFA 6AT1B 1T3SA 1P92A 2LX9A 1M2OA 3PGGA 2HQXA 1Y07A 4DBHA 3VS0A 4KH1B 2ENMA 4JUVA 5LJ3f 4C92B 2MMPA 4LUEA 3CCVT 2YLCA 2QI2A 1XJWB 2Z0WA 3OQ5A 4JJBA 3CCSA 3CPWP 1KHCA 4IUVA 2K2VA 3ME9A 4Z02A 3M53A 4LN2A 4L59A 8AT1B 3TCJA 2JM9A 3CMAQ 4Z89A 1S72T 1JXMA 1M3AA 1ZUUA 5GAOp 3FJPA 3SEMA 3DB3A 4B6MA 1QP3A 3OYMA 1TSFA 2ZPBB 3H9NA 5GAN3 5GAN7 2EYXA 4LDWA 3I55A 2CS7A 4PLIA 2CZ6B 3RMSA 4M7DA 2FRWA 3J81E 1BYMA 3MPUB 4C8QA 3V7RA 2ABLA 4HA8A 1YJWQ 2YHTA 2EYWA 1AWJA 1LNXA 5KCHA 2DX1A 2K79A 2HAXA 3EGDA 2FPDA 4MMLA 2VGNA 4DOVA 1GCQC 1ZQ1A 2RQWA 3I9QA 1DJ7B 2GCXA 1VQ6Q 3EHQA 3ZFJA 4OGCA 2YRVA 1V76A 4HT8A 2CP0A 3VS6A 2CP5A 5I2SA 1VQPT 1VQNQ 3CMAA 1G2BA 1SF9A 2VVKA 2CDTA 1NYFA 5CCAA 1VQLQ 3CCRT 2LDMA 4CRIA 1Q95G 3LYIA 2QXFA 4XU0A 4EMHA 2AZSA 4QW2A 2C0IA 4F17A 1UB4A 3TU4K 2RI2A 3M9QA 4GLMA 5LJ3h 5IAYA 1NPPA 4KH0B 3CCJA 2FRYA 2DL4A 4E7JA 2EVRA 2XHCA 5GAN2 2ZPHB 1YJWA 3H0FA 1QVFS 2O9SA 4M77B 2BZ8A 1KQ2A 4OMPA 2K57A 2QTXA 5FU7C 3GF5A 3M0QA 1WHGA 1EFNA 3M54A 3H0IA 4KULA 3WVEB 4J9CA 3F70A 2J6OA 1R0CB 3A8OB 5FU7B 3CCET 1TH7A 5LL6S 4NOYA 1TOVA 3VV0A 4JZ4A 4RTYA 4XU1A 2HQHA 2GTJA 1QP2A 2X3WD 2LC4A 4IURA 1X75C 4AT1B 4ZGJB
chains in the Genus database with same CATH topology
2C0OA 1N5ZA 1Z9ZA 2DF6A 1AZGB 2GQIA 2LJ1A 1ZX6A 1PRLC 4JJDA 1AD5A 1AVZC 2CREA 1SRMA 2H8HA 4EIKA 2D1XA 4LUDA 3EGUA 2KYMA 3UATA 1WIEA 2O88A 3VRYA 2J6KA 2ROTA 4CC7A 2DM1A 2JS0A 1K4US 1ABOA 2FPFA 2FPEA 3THKA 2J6FA 3IQLA 3EG1A 2PZ1A 2GNCA 2EGAA 1MV0B 1E7OA 1ZUYA 1NM7A 2OJ2A 2V1RA 3KFVA 4ORZA 3REAB 5GJWB 4JPBW 4RTVA 1U06A 2RPNA 2LNHB 4E6RA 2RQVA 3H0HA 1H92A 2A36A 2XMFA 3PVLA 2DLPA 1AOJA 1FMKA 2VWFA 2OI3A 1WFWA 1BBZA 2CH4W 1W70A 2BZXA 4Z88A 5I11A 2KT1A 1I07A 2DL8A 2KYBA 2F2VA 3EG3A 1PWTA 3RNJA 1X2KA 1AEYA 1GFCA 1NLPC 1CKBA 4AG2C 1YCSB 1SHGA 1G83A 2YUOA 3VS5A 2F2XA 2KXCA 3NHNA 2LQWA 4K11A 3M0TA 4HVUA 3ZL7C 1MV3A 1GCQA 4RTUA 1BU1A 2KT8A 4JJCA 1WA7A 1JEGA 2KRSA 2W10A 2MIOA 1K76A 1BB9A 3LH5A 3U23A 1JU5C 1W6XA 2EGEA 4JZ3A 5I22A 1QWFA 2DRMA 2JTEA 4J9GA 1UTIA 4OMQA 3I5SA 2GGRA 1M3BA 5IH2A 2AZVA 4HVWA 2JMAA 4RTWA 2K9GA 1E6GA 2LJ3A 5FWBA 1PNJA 1T3LA 1WXTA 2DILA 1WYXA 4OMLA 1JXOA 1XOVA 2AK5A 2PTKA 2YT6A 2KXDA 1X43A 4J9DA 1PKTA 2KEAA 4J9EA 3PE0A 3H41A 2EYYA 4IIMA 3TSWA 1SSHA 3ULRB 1OOTA 4RUGA 1NG2A 2EBPA 2LMJA 3VS2A 2CUBA 3VS3A 2RNAA 2BZYA 4D8KA 2ED1A 2RQUA 3TVTA 1A0NB 4OMMA 1NLOC 1TUCA 1K9AA 2CSQA 1E6HA 4Y92A 3RBBB 4GBQA 1UJYA 1KSWA 1VYTA 1H8KA 2CT3A 2IIMA 2JW4A 1OPLA 5ECAA 2A37A 3NPFA 2JT4A 4D8DA 4IIOA 1RUWA 1X27A 2KRMA 2EGCA 2KGTA 2KNBB 4J9BA 4RTZA 2KBTA 2YUNA 5HCKA 2A08A 2DJQA 2DNUA 1V1CA 1UG1A 4DEYA 1GL5A 1BK2A 1VYVA 1NYGA 1GBQA 1HD3A 1PRMC 2CT4A 3I5RA 2CSIA 2D0NA 2JMCA 3M0SA 2A28A 2JS2A 1X6BA 2OAWA 4WCIA 1SPKA 4A63B 1OEBA 2LCSA 2HBWA 2DVJA 1CKAA 2QDLA 1Y0MA 2AKKA 2MOXA 1Z9QA 2EYZA 1K0XA 1I0CA 4AFUC 2CUDA 4ESRA 1TG0A 2X3XD 2HEQA 2RQRA 1ARKA 2FO0A 2LZ6B 1WXUA 3CQTA 2F2WA 1T0JA 1U5SA 2O9VA 4CC2A 2HDAA 2L3QA 2L0AA 2DBMA 4CC4B 3C0CA 1GBRA 2ED0A 2D8JA 2L2PA 1YWOA 1PHTA 3NMZC 3M0UA 2L3PA 2G6FX 1M3CA 1SHFA 1NEGA 1AWOA 1X6GA 2BTTA 2YSQA 4R0KA 2CH4A 2J06A 2J7IA 5L23A 2RN8A 2SEMA 4Z8AA 2P4RA 4AFZC 2K3BA 2DE0X 1MUZA 3I35A 2E5KA 2RMOA 3EG0A 1UGVA 3VS4A 1UE9A 1AZEA 4M4ZA 1SRLA 1T3SA 1H3HA 2D8HA 1YP5A 4HCKA 4RTXA 3VS0A 4J9HA 2ENMA 2J05A 1QWEA 2FG0A 1UHFA 5IXBA 1VYUA 4LUEA 3EHRA 4JJBA 2W0ZA 4J9IA 5FW9A 2M0YA 2RF0A 5IHKA 4AG1C 1U3OA 1QKXA 2NUZA 1M8MA 4F16A 1W1FA 3VRZA 4LN2A 1SEMA 2JM9A 1ABQA 1WLPB 2MCNA 4DEXA 4Z89A 1JXMA 1M3AA 4KRTA 1GFDA 1ZUUA 2LJ0A 4X1VA 2EQIA 2DL7A 3SEMA 1RI9A 3TSZA 2K7AA 2RQTA 1RLPC 4OMOA 2JXBA 1GRIA 1FYNA 2EYXA 3M0PA 1UDLA 1YNZA 1ZUKA 4LNPA 5FWCA 2EPDA 2NWMA 1B3QA 1ZLMA 1WDXA 1B07A 2DYBA 1WXBA 2EKHA 1CSKA 1QLYA 2FRWA 2O2OA 3VS7A 2ABLA 2DBKA 2GBQA 1JQQA 1K1ZA 1TUDA 1X69A 2HCKA 1GCPA 3UA7A 1X2QA 2EYWA 4FSSA 4J9FA 1AWJA 2DX1A 2K79A 2K6DA 2FPDA 1GCQC 2RQWA 2M51A 3PVQA 3I9QA 1Y57A 2DRKA 3EHQA 3JV3A 2K2MA 2VKNA 1NEBA 1M30A 2KROA 1ZSGA 2FEIA 5EC7A 4ZNXA 1WI7A 3VS6A 2YUPA 3REBB 4OMNA 1UECA 1OV3A 4HVVA 2GTOA 2HSPA 1K0SA 1AWXA 1G2BA 2VVKA 2CDTA 1NYFA 2B86A 1YN8A 5GJVB 2YUQA 2PNIA 5IHIA 3EG2A 3VS1A 4HXJA 2AZSA 2C0IA 4F17A 1KJWA 3O5ZA 1KFZA 2ESWA 4GLMA 1UFFA 2KR3A 2JM8A 2FRYA 2YDLA 3UF4A 2DL4A 1QCFA 1QKWA 2DA9A 2EVRA 2O31A 2EW3A 2V1QA 2KRNA 3H0FA 4QT7A 4AFQC 1ZBJA 2O9SA 3SHWA 2BZ8A 1AWWA 4OMPA 1UUEA 2DL5A 1I1JA 3FJ5A 4F14A 1J3TA 3M0QA 2C0TA 2ROLA 1EFNA 1HSQA 3UA6A 2ECZA 3H0IA 1T0HA 3QWYA 4RTTA 1KIKA 2L3SA 4J9CA 4AFSC 2J6OA 1IO6A 1UHCA 3A98A 1WX6A 2DL3A 3QWXX 1OPKA 1YWPA 1JO8A 2DMOA 2LQNA 3NGPA 4JZ4A 2KE9A 3GBQA 4RTYA 1LCKA 1PKSA 2GTJA 4LE9A 1M27C 4CC3A 1S1NA 2LP5A 1HJDA 2AKLA 1UJ0A 1VA7A 2X3WD 2LX7A 5IHNA 2I0NA 2SRCA 3M0RA 1RLQC 5IXFA 3R6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0O A;  1N5Z A;  1Z9Z A;  2DF6 A;  1AZG B;  2GQI A;  2LJ1 A;  1ZX6 A;  1PRL C;  4JJD A;  1AD5 A;  1AVZ C;  2CRE A;  1SRM A;  2H8H A;  4EIK A;  2D1X A;  4LUD A;  3EGU A;  2KYM A;  3UAT A;  1WIE A;  2O88 A;  3VRY A;  2J6K A;  2ROT A;  4CC7 A;  2DM1 A;  2JS0 A;  1K4U S;  1ABO A;  2FPF A;  2FPE A;  3THK A;  2J6F A;  3IQL A;  3EG1 A;  2PZ1 A;  2GNC A;  2EGA A;  1MV0 B;  1E7O A;  1ZUY A;  1NM7 A;  2OJ2 A;  2V1R A;  3KFV A;  4ORZ A;  3REA B;  5GJW B;  4JPB W;  4RTV A;  1U06 A;  2RPN A;  2LNH B;  4E6R A;  2RQV A;  3H0H A;  1H92 A;  2A36 A;  2XMF A;  3PVL A;  2DLP A;  1AOJ A;  1FMK A;  2VWF A;  2OI3 A;  1WFW A;  1BBZ A;  2CH4 W;  1W70 A;  2BZX A;  4Z88 A;  5I11 A;  2KT1 A;  1I07 A;  2DL8 A;  2KYB A;  2F2V A;  3EG3 A;  1PWT A;  3RNJ A;  1X2K A;  1AEY A;  1GFC A;  1NLP C;  1CKB A;  4AG2 C;  1YCS B;  1SHG A;  1G83 A;  2YUO A;  3VS5 A;  2F2X A;  2KXC A;  3NHN A;  2LQW A;  4K11 A;  3M0T A;  4HVU A;  3ZL7 C;  1MV3 A;  1GCQ A;  4RTU A;  1BU1 A;  2KT8 A;  4JJC A;  1WA7 A;  1JEG A;  2KRS A;  2W10 A;  2MIO A;  1K76 A;  1BB9 A;  3LH5 A;  3U23 A;  1JU5 C;  1W6X A;  2EGE A;  4JZ3 A;  5I22 A;  1QWF A;  2DRM A;  2JTE A;  4J9G A;  1UTI A;  4OMQ A;  3I5S A;  2GGR A;  1M3B A;  5IH2 A;  2AZV A;  4HVW A;  2JMA A;  4RTW A;  2K9G A;  1E6G A;  2LJ3 A;  5FWB A;  1PNJ A;  1T3L A;  1WXT A;  2DIL A;  1WYX A;  4OML A;  1JXO A;  1XOV A;  2AK5 A;  2PTK A;  2YT6 A;  2KXD A;  1X43 A;  4J9D A;  1PKT A;  2KEA A;  4J9E A;  3PE0 A;  3H41 A;  2EYY A;  4IIM A;  3TSW A;  1SSH A;  3ULR B;  1OOT A;  4RUG A;  1NG2 A;  2EBP A;  2LMJ A;  3VS2 A;  2CUB A;  3VS3 A;  2RNA A;  2BZY A;  4D8K A;  2ED1 A;  2RQU A;  3TVT A;  1A0N B;  4OMM A;  1NLO C;  1TUC A;  1K9A A;  2CSQ A;  1E6H A;  4Y92 A;  3RBB B;  4GBQ A;  1UJY A;  1KSW A;  1VYT A;  1H8K A;  2CT3 A;  2IIM A;  2JW4 A;  1OPL A;  5ECA A;  2A37 A;  3NPF A;  2JT4 A;  4D8D A;  4IIO A;  1RUW A;  1X27 A;  2KRM A;  2EGC A;  2KGT A;  2KNB B;  4J9B A;  4RTZ A;  2KBT A;  2YUN A;  5HCK A;  2A08 A;  2DJQ A;  2DNU A;  1V1C A;  1UG1 A;  4DEY A;  1GL5 A;  1BK2 A;  1VYV A;  1NYG A;  1GBQ A;  1HD3 A;  1PRM C;  2CT4 A;  3I5R A;  2CSI A;  2D0N A;  2JMC A;  3M0S A;  2A28 A;  2JS2 A;  1X6B A;  2OAW A;  4WCI A;  1SPK A;  4A63 B;  1OEB A;  2LCS A;  2HBW A;  2DVJ A;  1CKA A;  2QDL A;  1Y0M A;  2AKK A;  2MOX A;  1Z9Q A;  2EYZ A;  1K0X A;  1I0C A;  4AFU C;  2CUD A;  4ESR A;  1TG0 A;  2X3X D;  2HEQ A;  2RQR A;  1ARK A;  2FO0 A;  2LZ6 B;  1WXU A;  3CQT A;  2F2W A;  1T0J A;  1U5S A;  2O9V A;  4CC2 A;  2HDA A;  2L3Q A;  2L0A A;  2DBM A;  4CC4 B;  3C0C A;  1GBR A;  2ED0 A;  2D8J A;  2L2P A;  1YWO A;  1PHT A;  3NMZ C;  3M0U A;  2L3P A;  2G6F X;  1M3C A;  1SHF A;  1NEG A;  1AWO A;  1X6G A;  2BTT A;  2YSQ A;  4R0K A;  2CH4 A;  2J06 A;  2J7I A;  5L23 A;  2RN8 A;  2SEM A;  4Z8A A;  2P4R A;  4AFZ C;  2K3B A;  2DE0 X;  1MUZ A;  3I35 A;  2E5K A;  2RMO A;  3EG0 A;  1UGV A;  3VS4 A;  1UE9 A;  1AZE A;  4M4Z A;  1SRL A;  1T3S A;  1H3H A;  2D8H A;  1YP5 A;  4HCK A;  4RTX A;  3VS0 A;  4J9H A;  2ENM A;  2J05 A;  1QWE A;  2FG0 A;  1UHF A;  5IXB A;  1VYU A;  4LUE A;  3EHR A;  4JJB A;  2W0Z A;  4J9I A;  5FW9 A;  2M0Y A;  2RF0 A;  5IHK A;  4AG1 C;  1U3O A;  1QKX A;  2NUZ A;  1M8M A;  4F16 A;  1W1F A;  3VRZ A;  4LN2 A;  1SEM A;  2JM9 A;  1ABQ A;  1WLP B;  2MCN A;  4DEX A;  4Z89 A;  1JXM A;  1M3A A;  4KRT A;  1GFD A;  1ZUU A;  2LJ0 A;  4X1V A;  2EQI A;  2DL7 A;  3SEM A;  1RI9 A;  3TSZ A;  2K7A A;  2RQT A;  1RLP C;  4OMO A;  2JXB A;  1GRI A;  1FYN A;  2EYX A;  3M0P A;  1UDL A;  1YNZ A;  1ZUK A;  4LNP A;  5FWC A;  2EPD A;  2NWM A;  1B3Q A;  1ZLM A;  1WDX A;  1B07 A;  2DYB A;  1WXB A;  2EKH A;  1CSK A;  1QLY A;  2FRW A;  2O2O A;  3VS7 A;  2ABL A;  2DBK A;  2GBQ A;  1JQQ A;  1K1Z A;  1TUD A;  1X69 A;  2HCK A;  1GCP A;  3UA7 A;  1X2Q A;  2EYW A;  4FSS A;  4J9F A;  1AWJ A;  2DX1 A;  2K79 A;  2K6D A;  2FPD A;  1GCQ C;  2RQW A;  2M51 A;  3PVQ A;  3I9Q A;  1Y57 A;  2DRK A;  3EHQ A;  3JV3 A;  2K2M A;  2VKN A;  1NEB A;  1M30 A;  2KRO A;  1ZSG A;  2FEI A;  5EC7 A;  4ZNX A;  1WI7 A;  3VS6 A;  2YUP A;  3REB B;  4OMN A;  1UEC A;  1OV3 A;  4HVV A;  2GTO A;  2HSP A;  1K0S A;  1AWX A;  1G2B A;  2VVK A;  2CDT A;  1NYF A;  2B86 A;  1YN8 A;  5GJV B;  2YUQ A;  2PNI A;  5IHI A;  3EG2 A;  3VS1 A;  4HXJ A;  2AZS A;  2C0I A;  4F17 A;  1KJW A;  3O5Z A;  1KFZ A;  2ESW A;  4GLM A;  1UFF A;  2KR3 A;  2JM8 A;  2FRY A;  2YDL A;  3UF4 A;  2DL4 A;  1QCF A;  1QKW A;  2DA9 A;  2EVR A;  2O31 A;  2EW3 A;  2V1Q A;  2KRN A;  3H0F A;  4QT7 A;  4AFQ C;  1ZBJ A;  2O9S A;  3SHW A;  2BZ8 A;  1AWW A;  4OMP A;  1UUE A;  2DL5 A;  1I1J A;  3FJ5 A;  4F14 A;  1J3T A;  3M0Q A;  2C0T A;  2ROL A;  1EFN A;  1HSQ A;  3UA6 A;  2ECZ A;  3H0I A;  1T0H A;  3QWY A;  4RTT A;  1KIK A;  2L3S A;  4J9C A;  4AFS C;  2J6O A;  1IO6 A;  1UHC A;  3A98 A;  1WX6 A;  2DL3 A;  3QWX X;  1OPK A;  1YWP A;  1JO8 A;  2DMO A;  2LQN A;  3NGP A;  4JZ4 A;  2KE9 A;  3GBQ A;  4RTY A;  1LCK A;  1PKS A;  2GTJ A;  4LE9 A;  1M27 C;  4CC3 A;  1S1N A;  2LP5 A;  1HJD A;  2AKL A;  1UJ0 A;  1VA7 A;  2X3W D;  2LX7 A;  5IHN A;  2I0N A;  2SRC A;  3M0R A;  1RLQ C;  5IXF A;  3R6N A; 
#chains in the Genus database with same CATH topology
 4PJM A;  4M7D G;  3QUI A;  1QCN A;  2R57 A;  5GAN f;  2E6Z A;  2YRC A;  1ZX6 A;  2EKO A;  4C5E A;  2QQA A;  4HT9 A;  3CC2 T;  4A4K A;  4JJD A;  1AVZ C;  2CRE A;  4LUD A;  4ZTJ A;  2DZ9 A;  2IPO B;  2O88 A;  2ROT A;  1N8R U;  2DM1 A;  3FEO A;  3DB4 A;  1G3T A;  1VQL A;  4M7A E;  4BE1 A;  2HMA A;  1M90 C;  1UGS B;  1WHL A;  1VQK A;  4FIB A;  1OZ2 A;  2FPE A;  5CKB A;  1MMG A;  3OSV A;  4BUG A;  2P0P A;  1LVK A;  4O5V A;  2QTV A;  1YI2 Q;  1NM7 A;  3EAE A;  4J8O A;  2DIQ A;  1IXD A;  1VUB A;  3CD6 T;  1U06 A;  2RPN A;  4E6R A;  1D0Y A;  3JB9 G;  4A4H A;  3I55 T;  2MI6 A;  3N5B B;  4MZT A;  3PVL A;  3TQ7 P;  4LD6 A;  4FSX A;  1AOJ A;  1W2B P;  2VWF A;  3RMQ A;  3CCS Q;  2I2L A;  5AT1 B;  3LW5 E;  5KYN A;  1C0M A;  2KT1 A;  1I07 A;  2CZ0 B;  4KBM B;  1ZSZ B;  3EG3 A;  2MF2 A;  2VB6 A;  2EJF A;  2BKD N;  2RO0 A;  1NLP C;  1Q7Y U;  3CEY A;  1SHG A;  1G83 A;  4OGE A;  2XD0 A;  1RAF B;  3ZL7 C;  1BU1 A;  3QYG B;  1W2B S;  2K5L A;  2A0F B;  4WF2 A;  3CXC P;  1FMW A;  3U23 A;  3I56 A;  5FRN A;  3EH2 A;  2EGE A;  5I22 A;  2QA4 A;  1QWF A;  1KQS P;  4J9G A;  3LGL A;  1VQK Q;  3QG1 A;  4M7D C;  1M90 R;  4GY5 A;  4ZN3 A;  2DER A;  1VQ4 Q;  4HKE A;  1VQ8 Q;  4M7A B;  3G4S A;  2DIL A;  3JCM J;  1M1K U;  3T9N A;  4N0A C;  2Y4X A;  1PKT A;  1ZSZ A;  3PE0 A;  2X51 A;  3TRE A;  1SSH A;  1YBY A;  1YJN A;  2XID A;  3CC4 T;  3VUB A;  2EBP A;  3OBY A;  1RAI B;  2HKN A;  5GAN e;  4EDU A;  1KHI A;  2BZY A;  4D8K A;  2ED1 A;  5KH6 A;  2CP7 A;  1WZO A;  1YFN A;  4OMM A;  1R0B G;  3CCE Q;  1E6H A;  2LNV A;  1HXD A;  4GBQ A;  1M90 U;  3ASK A;  1D09 B;  4C8Q G;  4IIO A;  1RUW A;  2LQ8 A;  4M75 F;  1KC8 U;  2FB7 A;  1PCX A;  2KNB B;  4FYV B;  4IUQ A;  4M78 D;  2KBT A;  2YUN A;  2XIC A;  3E9F A;  1VYV A;  4PJO D;  1GBQ A;  3OYC A;  5CR2 A;  3I5R A;  3V8L A;  2DTO A;  2D0N A;  3V8J A;  2OAW A;  4WCI A;  1BI1 A;  2XDD A;  4LDU A;  3OW2 P;  4M75 C;  4M78 E;  1Z9Q A;  2DK3 A;  3G6E T;  5D6X A;  3V7C A;  3G4S Q;  1OQK A;  4ESR A;  1D1A A;  1TG0 A;  4C92 E;  2HEQ A;  2KQW A;  3CMA T;  1ARK A;  4F04 B;  2F2W A;  1T0J A;  2O9V A;  5GAN 6;  4JRP A;  3JCM h;  4A53 A;  2EWN A;  4J6W A;  2MYS A;  2RJD A;  3S3N A;  2QGF B;  1YHQ T;  5GAO l;  3AT1 B;  4PJO C;  1NEG A;  2RHU A;  4FYW B;  2BTT A;  2E41 A;  4Z8A A;  5HY6 A;  1HK9 A;  4AFZ C;  4M75 D;  4PJJ A;  3G71 Q;  4QQ6 A;  1RAH B;  2RMO A;  5KCO A;  2X4Y A;  3CC2 A;  1SRL A;  3X26 B;  2EFI A;  5HKC A;  2D8H A;  3JB9 D;  1RAC B;  1YP5 A;  4HCK A;  4RTX A;  1M1K C;  1WJR A;  4R56 A;  3VJP A;  3KXT A;  1QWE A;  2AT1 B;  1UHF A;  2FG0 A;  5DM7 R;  3PIP A;  4PK4 A;  1VYU A;  1VQP Q;  1ZBX A;  3TEE A;  4E7H A;  4C8Q D;  2M0Y A;  2RF0 A;  4LDX A;  4HCB A;  4AG1 C;  1VQ8 T;  1U3O A;  2P0K A;  5GAO n;  1M8M A;  2F1L A;  4BDY A;  1D0Z A;  2MPX C;  5HK0 A;  3JCM b;  1OX9 A;  1V29 B;  1WLP B;  2DZC A;  3NTK A;  1QVG P;  4PJO F;  1GFD A;  2LJ0 A;  3OYE A;  1M4Z A;  2DL7 A;  2EQI A;  1RI9 A;  1W2B A;  5C0M A;  2K7A A;  3G1J A;  1WPY A;  3D7S B;  3UDC A;  4C92 A;  4Q5W A;  1BI3 A;  2EQK A;  2DVE A;  4M7D D;  5GAN d;  5GAN 4;  1Q7Y C;  5FWC A;  2NWM A;  3CCJ Q;  2JVV A;  4M7A C;  4V2S A;  1CSK A;  3CC7 A;  5M9O A;  2EYQ A;  2DBK A;  2GBQ A;  1JQQ A;  1K1Z A;  4QVC A;  2QQB A;  2LTO A;  1EX4 A;  3MEW A;  4M78 C;  4FSS A;  2VGM A;  4BB7 A;  4B9X A;  3CC4 Q;  5KE2 A;  3J7A F;  2E3H A;  3LWI A;  2DRK A;  3JV3 A;  4LDV A;  1KC8 R;  2KRO A;  2E12 A;  1VQN T;  5KYW B;  2YUP A;  4EMK A;  3REB B;  1N6A A;  3HHT B;  4OMN A;  2DET A;  5KYU A;  4HVV A;  1MGQ A;  2F69 A;  1RI0 A;  2HSP A;  1K0S A;  1AWX A;  4A4F A;  4F7U A;  1Y96 B;  3L42 A;  2B86 A;  2HKQ B;  1VQ9 Q;  2YUQ A;  2E4H A;  2VAS A;  3EG2 A;  1I5O B;  3M59 A;  4ZTF A;  3VS1 A;  5CK9 A;  3QDR B;  3CCR A;  4HXJ A;  3VYH B;  3O5Z A;  4HCZ A;  2ESW A;  1UFF A;  2YDL A;  3I56 T;  2V1Q A;  5LJ3 d;  4QT7 A;  2EQM A;  4AFQ C;  4WTO B;  2GQV A;  1Q86 R;  1EIF A;  3JCM e;  1AWW A;  1QVF P;  3FJ5 A;  4RKU E;  2V8J A;  1VQ5 T;  1UEB A;  2C0T A;  3CD6 Q;  2FZK B;  3URG A;  3CCR Q;  3UA6 A;  1T0H A;  3CCL A;  3L2Z A;  1RAB B;  2FHD A;  1Q82 C;  4EMK B;  4XTU A;  1IO6 A;  3QII A;  4ZGE B;  1UHC A;  3MP8 A;  2NUT A;  5KYX A;  2DL3 A;  3QWX X;  2RHI A;  1YWP A;  2DMO A;  3NGP A;  2GFA A;  1LCK A;  1JJ2 A;  1S1N A;  2MK5 A;  2RI3 A;  1UJ0 A;  2ZPG B;  4M77 A;  5GAN 5;  1VQ9 A;  4BAC A;  2LX7 A;  2EAY A;  3MP1 A;  2COW A;  1AT1 B;  3A8L B;  2HBP A;  5IHN A;  3WXM B;  1RLQ C;  3X20 B;  5IXF A;  3R6N A;  3CC2 Q;  2C0O A;  5LJ5 e;  1N5Z A;  1Z9Z A;  1NE8 A;  2WSE E;  3QSU A;  1AZG B;  2ZAE A;  2LJ1 A;  5FRM A;  2DJZ A;  1OUL A;  3QDF A;  3EGX A;  2H8H A;  2QEX A;  1SRM A;  4EIK A;  2D1X A;  5GAM e;  1X6O A;  1PD0 A;  5LJ3 g;  1MMD A;  1WIE A;  4E7S A;  2J6K A;  3NTI A;  3CXC A;  1YJ9 T;  3GNF B;  2ATC B;  1K4U S;  1BIA A;  2E70 A;  3MEU A;  4C0D B;  1ABO A;  1K9M C;  3OYF A;  2ZPI B;  3CCV A;  4ZN1 A;  2FPF A;  5C6S A;  2WAC A;  2DPP B;  3EG1 A;  4C92 F;  1OYX A;  3MET A;  2GNC A;  4C0G A;  2RH2 A;  1VQ7 Q;  4QVZ A;  2L8D A;  2RHX A;  5GJW B;  5GMK l;  2M16 A;  4BY6 B;  3HSB A;  1M9S A;  4RTV A;  2H3E B;  2LNH B;  4FW2 A;  2EQU A;  2A36 A;  1PSE A;  2Y4Y A;  2XMF A;  1MHN A;  1MMA A;  4C92 C;  5KYU B;  4F7U B;  4Y28 E;  1PC0 A;  1WHJ A;  2BZX A;  2FL7 A;  3M5A A;  2EIF A;  4Z88 A;  3CCM T;  1GXI E;  5GAO q;  1R77 A;  3X24 B;  5GAO r;  3EGD B;  3CCE A;  4FT4 A;  3HRT A;  1GFC A;  4FCY A;  3VU3 C;  5GMK m;  2HL3 A;  5A0L A;  4XQ3 A;  4HVU A;  4OB0 B;  2WSF E;  2QEX Q;  3V7S A;  2CKK A;  1YJ9 A;  4JJC A;  1O75 A;  1WA7 A;  2KRS A;  2MIO A;  1VQ7 A;  1BB9 A;  2LT4 A;  1KK7 A;  2GFU A;  4C5H A;  2OTL A;  1W6X A;  3CBO A;  2DTH A;  4N4G A;  2JTE A;  1XTD A;  1UTI A;  3I5S A;  1D3B A;  4ATO A;  4HVW A;  1U8R A;  2IG0 A;  1E6G A;  2L3R A;  3UWN A;  5FWB A;  3QYH B;  1PNJ A;  1T3L A;  1BI0 A;  3HP9 A;  4NL3 A;  3OYL A;  1TS9 A;  4M75 A;  2PQW A;  4PKC C;  2BUD A;  1B34 B;  2ZGW A;  3CBP A;  4QKU A;  3PTA A;  4OML A;  4A4E A;  2E64 A;  1XOV A;  3G7Z A;  4II1 A;  2KXD A;  4M77 G;  1X43 A;  4JRK A;  4J9D A;  4FM4 B;  1QVF A;  3CXC S;  1NBE B;  1YIJ T;  3CCQ A;  2EYY A;  1OOT A;  4RUG A;  1NG2 A;  3OYH A;  2LMJ A;  3VS2 A;  2K4Y A;  2E10 A;  2RNA A;  3EFS A;  3MKD A;  2DYI A;  4FU6 A;  4FT2 A;  1K9M R;  2LT1 A;  3OS5 A;  4UC4 A;  1NLO C;  3V8K A;  3MJX A;  2E5Q A;  2KDS A;  3BW1 A;  1VOM A;  4Y92 A;  4N4I A;  2NUP B;  4C0Z A;  2CT3 A;  2DFU A;  2JW4 A;  1OPL A;  3NPF A;  3CME A;  2E1H A;  1D3B B;  3OY9 A;  2KGT A;  1G5V A;  3M57 A;  3CD6 A;  2EQJ A;  4RTZ A;  5D6Y A;  2X9H A;  2RD1 A;  4FYX B;  1V1C A;  2R5A A;  4DEY A;  1VQN A;  3CCQ T;  1XNI A;  1NYG A;  4XK8 E;  1HD3 A;  1PRM C;  4PFP A;  2CSI A;  1UGQ B;  2JMC A;  1N27 A;  4JLI A;  2R5M A;  1YI2 A;  2VXF A;  1M1G A;  2A28 A;  1QMC A;  2QAZ A;  2V26 A;  2YXY A;  4OB1 B;  1SPK A;  3RDV A;  3S6W A;  3SWN A;  3L2V A;  4JLG A;  1PG5 B;  2HBW A;  2QDL A;  1Y0M A;  3VKI A;  2MOX A;  3OW2 S;  4AFU C;  3CCU T;  1WJQ A;  2LZ6 B;  4M77 E;  3CQT A;  1U5S A;  3JB9 H;  2L3Q A;  2L0A A;  2DBM A;  1VQ5 Q;  1GBR A;  2ED0 A;  2COY A;  4DOW A;  1XQH A;  1YWO A;  4E2F B;  3NMZ C;  4N0A A;  2WSC E;  2Y90 A;  1M3C A;  1SHF A;  1AWO A;  3GOX A;  1X6G A;  4J6X A;  2JJ9 A;  2J06 A;  2ZPE B;  5FU6 B;  2P4R A;  2V8I A;  2K3B A;  1NJI R;  1Q7Y R;  3I35 A;  2E3I A;  3QZ5 B;  3CC4 A;  3A1P A;  1UGV A;  4M4Z A;  1Q82 R;  2O4X B;  1G3S A;  1LJO A;  4MDX A;  4J9H A;  1VQ8 A;  5DLQ E;  2CP2 A;  4DBR A;  4A54 A;  4E7I A;  2DTI A;  3EHR A;  2EJ9 A;  4J9I A;  5FW9 A;  1YI2 T;  4PJO B;  3RKW A;  3EFR A;  1QKX A;  3VRZ A;  3MEV A;  2QA4 Q;  1JRI A;  3QJ6 A;  5GAM h;  1QW1 A;  2OTJ T;  4M7A A;  1ZA1 B;  1ABQ A;  1O9S A;  3VUZ A;  4DEX A;  4IUU A;  1BKB A;  3R6O A;  4KRT A;  5GAO m;  3JB9 F;  3G6E Q;  2NYS A;  3M4G A;  3SD4 A;  5GAM d;  3VYG A;  3A8G B;  2RQT A;  1RLP C;  1M1K R;  4PFZ A;  2JXB A;  3BFM A;  3GNG A;  1GRI A;  1FYN A;  4BI8 B;  2RK1 A;  1M5Q 1;  1IGQ A;  1YHQ A;  1YNZ A;  1ZUK A;  4LNP A;  3L2Q A;  2EPD A;  1B3Q A;  2BIV A;  1WDX A;  1B07 A;  3EG9 B;  2M1H A;  1WXB A;  2EKH A;  1VQP A;  1QLY A;  2XKO C;  2KAF A;  3PNW C;  1OX8 A;  5I2M A;  1YIT A;  2CZ1 B;  3JCM X;  5KE3 A;  2QQ9 A;  2HCK A;  1GCP A;  4JS5 A;  1VQM A;  4J9F A;  3P8D A;  3JCM d;  2LVM A;  5GAM g;  3OS0 A;  4IUP A;  1MNE A;  2M51 A;  3OYG A;  4M7D F;  1VQ6 A;  1Y57 A;  3OSS C;  2JTM A;  4M7A F;  1LOJ A;  2K2M A;  1NEB A;  1VQO T;  5LJ5 h;  3M56 A;  1ZSG A;  2FEI A;  3LLR A;  3FC3 A;  5CKD A;  1WI7 A;  1KQS S;  1OI1 A;  2DKG A;  1OV3 A;  3QKJ A;  4M78 F;  1VQ7 T;  1YIT Q;  1G8X A;  4IUT A;  4KGX B;  4OP0 A;  5IT9 E;  5CIU A;  4L5G A;  3INZ A;  3CPW A;  4X9D A;  5CQX A;  1FX7 A;  1KJW A;  4C92 G;  3A8M B;  1KFZ A;  3MO8 A;  4BI3 A;  3OYY A;  5DY9 A;  2QGG A;  2JM8 A;  3I56 Q;  3FB9 A;  3UF4 A;  3RKX A;  3C4S A;  4M75 E;  1QCF A;  1PD1 A;  1R8O B;  2O31 A;  5CKH A;  3JB9 J;  3C94 A;  4OB2 B;  2NLU A;  3OYA A;  2KRN A;  4XTX A;  4M7D B;  2QG9 B;  2BE9 B;  4PJO G;  1QVP A;  1Q81 C;  1UUE A;  3P8B B;  4C8Q C;  1YJN Q;  1I1J A;  2PVG B;  4NS5 A;  3JCM g;  1C1A A;  2ECZ A;  2V8K A;  3PT9 A;  3C12 A;  3QWY A;  1HYO A;  1KIK A;  2L3S A;  4AFS C;  1TWB A;  2RHZ A;  1QVG A;  3A98 A;  1WX6 A;  1M1F A;  3JCM V;  2JTF A;  3OYJ A;  3EH1 A;  1JO8 A;  2M9U A;  3GBQ A;  3BDL A;  4KUI A;  5LJ5 g;  5A0G A;  2LP5 A;  2G3R A;  2AKL A;  1HJD A;  1VA7 A;  4EPC A;  3NFC A;  4RG8 A;  3SWN C;  3M0R A;  4J6Y A;  3SFM A;  4C5I A;  3H8Z A;  2DF6 A;  3I55 Q;  2GQI A;  3NTH A;  1Q82 U;  3S3O A;  4M77 F;  1AD5 A;  1FMV A;  4F7U G;  3EGU A;  4HCC A;  1ZHI A;  1VQ6 T;  4FL6 A;  3VRY A;  2KK4 A;  8ATC B;  2JS0 A;  2AIR B;  4KGZ B;  3GIB A;  1ACM B;  3LX7 A;  4C0F A;  3DKM A;  3QBY A;  5L8R E;  4OMF B;  4TVR A;  2RJC A;  1Q86 U;  3L1A A;  2K5F A;  2PZ1 A;  2EGA A;  2KMT A;  4PLL A;  1M2V B;  1MV0 B;  1BI2 A;  1E7O A;  2OX7 A;  2HNI A;  1I5L A;  4JPB W;  3EGX B;  4A4G A;  1RAE B;  3L2U A;  1PSF A;  2RJE A;  2DXU A;  4RCB A;  3CME T;  3PIO A;  3HTR A;  5EG2 A;  3QXE B;  5A0D A;  2DLP A;  5D6W A;  3CCL T;  2OI3 A;  1WFW A;  4M77 C;  1NJI C;  4GLK A;  2CH4 W;  1W70 A;  5KYW A;  2DL8 A;  3JB9 I;  2KYB A;  3OB9 A;  4XTV A;  2BE7 D;  3RNJ A;  1AEY A;  2E65 A;  4DA4 A;  7AT1 B;  1K73 C;  1B34 A;  4AG2 C;  2E6N A;  1YCS B;  2YUO A;  3G71 T;  1SG5 A;  3MHX A;  3G6E A;  3VS5 A;  2KXC A;  3NHN A;  2LQW A;  1YIJ Q;  1QVG S;  3M0T A;  1MV3 A;  3M55 A;  1U1T A;  4RTU A;  3JCM W;  4X9C A;  4PJO A;  2MAM A;  1Y96 A;  3GLX A;  2JN0 A;  4BDZ A;  1K76 A;  3LH5 A;  1TTH B;  2XDP A;  1K8A C;  1JJ2 P;  2XG8 D;  2YWW A;  4EMK C;  1VQ4 A;  2ZCF B;  5GMK i;  2JMA A;  2K9G A;  3OYB A;  4OF1 A;  4KT0 E;  4PNO A;  2DO3 A;  1WXT A;  3A8H B;  3CCS T;  2FZG B;  4M78 G;  2HQE A;  2ZZD A;  1JXO A;  2KSS A;  3OYN A;  2YT6 A;  2YLB A;  3FRN A;  4F7U E;  2XI9 A;  2F5T X;  4N4H A;  2X4J A;  3HL8 A;  4VUB A;  3SB2 A;  3H41 A;  3EG9 A;  3TSW A;  3ULR B;  5J39 A;  2XDB A;  3BY7 A;  1D1C A;  1K8A R;  4R55 A;  3E1S A;  3MEA A;  4B9W A;  4J5Y A;  1N8R C;  3SWN B;  1U1S A;  1VQO Q;  5D7U A;  3OS1 A;  2QYZ A;  4XU2 A;  5LJ5 d;  2CSQ A;  3QZ9 B;  3OYD A;  4F7U F;  1RAG B;  1VYT A;  1H8K A;  3CCQ Q;  5FU6 C;  2QQS A;  4D8D A;  4BE0 A;  2KRM A;  2EGC A;  3MP6 A;  2P0Q A;  1H3Z A;  4J9B A;  5HCK A;  4MZP A;  1M2V A;  2DNU A;  1UG1 A;  1BK2 A;  2XK0 A;  2CT4 A;  2QDY B;  1KD1 U;  4NL2 A;  1IB8 A;  3M0S A;  3ER0 A;  1X6B A;  1RL2 A;  2LCS A;  4M75 G;  5GAN g;  2DVJ A;  2LCC A;  1CKA A;  2OAU A;  2EYZ A;  3HRS A;  1KQ1 A;  2KVQ G;  2HZY A;  5FLX E;  4C92 D;  3JAM E;  1K9M U;  2CUD A;  2JOY A;  2RQR A;  2FO0 A;  4QQG A;  4CC2 A;  1I81 A;  2D6F A;  2HDA A;  5GMK e;  1MND A;  2PUK B;  5CAI A;  4CC4 B;  2COZ A;  2FVU A;  1KG1 A;  1W4S A;  5CKF A;  2L2P A;  3BDU A;  1VQO A;  1PHT A;  3M0U A;  4XTY A;  2D0Q B;  2X4W A;  2DEQ A;  2YSQ A;  4R0K A;  1KC8 C;  3JSC A;  5CVI A;  5L23 A;  2SEM A;  1RAA B;  3G71 A;  3CPF A;  4KGV B;  3AHU A;  4JDS A;  1MUZ A;  5GAM f;  4YTL A;  3VS4 A;  3RER A;  1UE9 A;  1AZE A;  2OTL T;  1H3H A;  1YJ9 Q;  2RK2 A;  4IKF A;  3RUX A;  1MMN A;  2X35 A;  2J05 A;  2DAQ A;  3QHS A;  5IXB A;  3M4Y A;  4PFO A;  2OTJ Q;  1Y71 A;  2W0Z A;  2X4X A;  1ZSZ C;  2K3Y A;  5IHK A;  1S72 A;  2MWO A;  2GF7 A;  2NUZ A;  4E47 A;  1X01 A;  2LRQ A;  4BD3 A;  4F16 A;  1W1F A;  1SEM A;  2M0O A;  1UGP B;  2YRD A;  3OS2 A;  1K8A U;  3OYI A;  2MCN A;  3SDZ A;  4X1V A;  2H3J A;  4O6J A;  4MZM A;  3TSZ A;  2CYZ B;  2MWP A;  4OMO A;  2CGH A;  3M0P A;  2C06 A;  4J83 A;  1UDL A;  3KBG A;  4PJN A;  1K73 U;  1ZLM A;  1VQM Q;  1WHK A;  1ZA2 B;  3QPH A;  2DYB A;  4DQ2 A;  2O2O A;  3VS7 A;  2QK0 A;  4JJN K;  2F5K A;  4QQD A;  1SSF A;  1N9R A;  1TUD A;  2A3L A;  4BE2 A;  4XTZ A;  3CCM A;  1X69 A;  2JNG A;  2RI5 A;  4BY6 C;  3UA7 A;  1NJI U;  4ELY C;  2K3X A;  1X2Q A;  5CKE A;  5LJ3 e;  4EMG A;  4RG2 A;  2K6D A;  4KUD K;  2CP6 A;  2LCL A;  5LJ3 j;  1QQJ A;  2L5Q A;  1RAD B;  2K5I A;  3PVQ A;  1G3Y A;  1UGR B;  2VKN A;  1M30 A;  2PU9 B;  5EC7 A;  4ZNX A;  5GAM j;  3HFO A;  1UEC A;  2GTO A;  3RKY A;  3CCJ T;  3WVD B;  1VQ4 T;  3CCU A;  1Q86 C;  3JRZ A;  1YN8 A;  3FLG A;  5GJV B;  5LJ5 j;  2PNI A;  1OZ3 A;  1K73 R;  2XU8 A;  5IHI A;  4C8Q B;  2IVW A;  3EFO B;  3HKS A;  5GAN 8;  4C8Q F;  4RCC A;  2PVO B;  5I21 A;  5KYY A;  4M7A D;  4DBQ A;  1WNL A;  3Q1J A;  2KR3 A;  4XU3 A;  3QO3 A;  1QKW A;  2DA9 A;  2EW3 A;  4C0D C;  5DLO A;  9ATC B;  2DEU A;  1QCO A;  4MDW A;  1ZBJ A;  3X28 B;  3O8V A;  3SHW A;  2HSE B;  1TUG B;  2DL5 A;  3PMT A;  4F14 A;  1J3T A;  4QVD A;  1IHW A;  2ROL A;  2VUB A;  1HSQ A;  3OYK A;  3RES A;  1VQM T;  1N8R R;  1H64 1;  3PMI A;  4RTT A;  1YIT T;  5CQY A;  4JRI A;  4BI4 A;  2L89 A;  1OPK A;  3CCU Q;  3CCL Q;  2FZC B;  1FWZ A;  1TU0 B;  2DIG A;  4M78 A;  2LQN A;  1D1B A;  2KE9 A;  1Y7X A;  2A7Y A;  1PKS A;  2DD5 A;  3S3M A;  4LE9 A;  1M27 C;  4CC3 A;  3CPW S;  1VQ5 A;  5IN1 A;  4XAX B;  1Q81 U;  2I0N A;  4C5G A;  2R58 A;  2SRC A;  2O4X A;  4ELZ C;  4DBF A;  3L2R A;  3KUF A;  1B7T A;  4E7L A;  1PRL C;  4M77 D;  1N9S A;  2EJG A;  5GMK j;  2P4T A;  1AHJ B;  2KYM A;  3UAT A;  4FW1 A;  4CC7 A;  1NPR A;  5J3B A;  5GMK h;  1F1B B;  1KD1 R;  4ZGD B;  4P5N A;  1OU8 A;  3THK A;  2J6F A;  3IQL A;  4J7F A;  3CME Q;  1S72 Q;  2OJ2 A;  1ZUY A;  2DXT A;  3KFV A;  2V1R A;  4ORZ A;  1VIE A;  1WQ7 A;  3REA B;  1IRE B;  4M78 B;  2ZPF B;  3H6Z A;  2OTJ A;  5HK3 A;  1YJN T;  2RQV A;  3H0H A;  4ANJ A;  1H92 A;  1VIF A;  4PJO E;  4M75 B;  2CP3 A;  1BCO A;  3MCA B;  2FYK A;  2RB6 A;  1FMK A;  1EZZ B;  1BBZ A;  2DD4 A;  2VXE A;  3E2U A;  3G4S T;  4LD9 K;  5I11 A;  1BCM A;  1YJW T;  3GP8 A;  1JB0 E;  3ZBD A;  2DXB A;  1JBM A;  2F2V A;  3EFO A;  1PWT A;  2DXC A;  1X2K A;  1D0X A;  1CKB A;  5CO7 A;  1YHQ Q;  1FXX A;  2QEX T;  3QJY A;  2F2X A;  3LWH A;  1IHV A;  4K11 A;  3UPU A;  3OW2 A;  5J26 A;  1GCQ A;  2KT8 A;  3LH0 A;  2NUP A;  3DLL A;  2D9T A;  3HPW A;  4M7D E;  1G3W A;  1JEG A;  2W10 A;  3JCM c;  3FIF A;  4XTW A;  2B8A A;  1JU5 C;  2HD0 A;  4JZ3 A;  2M02 A;  1WQW A;  2DRM A;  3GPL A;  3E19 A;  3ZEH A;  4OMQ A;  2GGR A;  1M3B A;  5IH2 A;  2AZV A;  1NZ9 A;  3E9G A;  1M8V A;  4RTW A;  4E7Z A;  2LJ3 A;  2QA4 T;  3CCM Q;  2JUF A;  1YIJ A;  2KI7 A;  3L2W A;  1IGU A;  1BIB A;  3OMG A;  4OB3 B;  1WYX A;  3OBW A;  1JJ2 S;  2AK5 A;  2PTK A;  2HL5 C;  1VQ9 T;  2KEA A;  4C8Q E;  3P8H A;  4J9E A;  3X25 B;  1PM3 A;  4IIM A;  4L6V 5;  2CUB A;  3VS3 A;  4PL6 A;  1KQS A;  3JCM f;  3M58 A;  2JZ2 A;  3HRU A;  2LQK A;  3HFN A;  2P84 A;  5LJ5 f;  4E7K A;  2RQU A;  2RHY A;  3TVT A;  1KD1 C;  1A0N B;  1I8F A;  3RIR A;  3UT1 A;  1TUC A;  1Q81 R;  1K9A A;  3RR6 A;  2PVD B;  3BE3 A;  1SKU B;  4Y91 A;  1VQL T;  4FYY B;  3RBB B;  3CC7 Q;  4OVA A;  3J80 E;  1UJY A;  1KSW A;  2IIM A;  1YCY A;  5ECA A;  5FRO A;  2A37 A;  2JT4 A;  1WJS A;  3OMC A;  1X27 A;  1LPL A;  3OA6 A;  3C95 A;  3CCV Q;  2RA2 A;  2QQR A;  1WGS A;  2A08 A;  2DJQ A;  1GL5 A;  1TXQ A;  2RM4 A;  3JCM Q;  1I4K 1;  4J7I A;  3FDR A;  4LDY A;  1WHM A;  1IRX A;  5A2Q E;  5GAN h;  2JS2 A;  1VQK T;  5AYF A;  1C6V X;  4A63 B;  1OEB A;  4RMO A;  2QAS A;  3JCM P;  5KYY B;  4MMK A;  2AKK A;  1K0X A;  3PFS A;  4M7A G;  2RJF A;  1I0C A;  3DLM A;  4JRQ A;  2X3X D;  5GAN j;  2O01 E;  3CBM A;  1WXU A;  2KY9 A;  3C0C A;  2VV5 A;  2D8J A;  3A5Z B;  1WHH A;  4LXC A;  4D6W A;  2PUO B;  2CZ7 B;  4AMC A;  2L3P A;  2AHJ B;  2G6F X;  2VYT A;  2NUT B;  5KYX B;  2CH4 A;  4JS4 A;  2J7I A;  2RN8 A;  3CC7 T;  4CI0 C;  1OU9 A;  2OTL Q;  4ME7 A;  2VC8 A;  2DE0 X;  4X34 A;  2E5K A;  1IZ6 A;  3EG0 A;  4PJL A;  3LGF A;  6AT1 B;  1T3S A;  1P92 A;  2LX9 A;  1M2O A;  3PGG A;  2HQX A;  1Y07 A;  4DBH A;  3VS0 A;  4KH1 B;  2ENM A;  4JUV A;  5LJ3 f;  4C92 B;  2MMP A;  4LUE A;  3CCV T;  2YLC A;  2QI2 A;  1XJW B;  2Z0W A;  3OQ5 A;  4JJB A;  3CCS A;  3CPW P;  1KHC A;  4IUV A;  2K2V A;  3ME9 A;  4Z02 A;  3M53 A;  4LN2 A;  4L59 A;  8AT1 B;  3TCJ A;  2JM9 A;  3CMA Q;  4Z89 A;  1S72 T;  1JXM A;  1M3A A;  1ZUU A;  5GAO p;  3FJP A;  3SEM A;  3DB3 A;  4B6M A;  1QP3 A;  3OYM A;  1TSF A;  2ZPB B;  3H9N A;  5GAN 3;  5GAN 7;  2EYX A;  4LDW A;  3I55 A;  2CS7 A;  4PLI A;  2CZ6 B;  3RMS A;  4M7D A;  2FRW A;  3J81 E;  1BYM A;  3MPU B;  4C8Q A;  3V7R A;  2ABL A;  4HA8 A;  1YJW Q;  2YHT A;  2EYW A;  1AWJ A;  1LNX A;  5KCH A;  2DX1 A;  2K79 A;  2HAX A;  3EGD A;  2FPD A;  4MML A;  2VGN A;  4DOV A;  1GCQ C;  1ZQ1 A;  2RQW A;  3I9Q A;  1DJ7 B;  2GCX A;  1VQ6 Q;  3EHQ A;  3ZFJ A;  4OGC A;  2YRV A;  1V76 A;  4HT8 A;  2CP0 A;  3VS6 A;  2CP5 A;  5I2S A;  1VQP T;  1VQN Q;  3CMA A;  1G2B A;  1SF9 A;  2VVK A;  2CDT A;  1NYF A;  5CCA A;  1VQL Q;  3CCR T;  2LDM A;  4CRI A;  1Q95 G;  3LYI A;  2QXF A;  4XU0 A;  4EMH A;  2AZS A;  4QW2 A;  2C0I A;  4F17 A;  1UB4 A;  3TU4 K;  2RI2 A;  3M9Q A;  4GLM A;  5LJ3 h;  5IAY A;  1NPP A;  4KH0 B;  3CCJ A;  2FRY A;  2DL4 A;  4E7J A;  2EVR A;  2XHC A;  5GAN 2;  2ZPH B;  1YJW A;  3H0F A;  1QVF S;  2O9S A;  4M77 B;  2BZ8 A;  1KQ2 A;  4OMP A;  2K57 A;  2QTX A;  5FU7 C;  3GF5 A;  3M0Q A;  1WHG A;  1EFN A;  3M54 A;  3H0I A;  4KUL A;  3WVE B;  4J9C A;  3F70 A;  2J6O A;  1R0C B;  3A8O B;  5FU7 B;  3CCE T;  1TH7 A;  5LL6 S;  4NOY A;  1TOV A;  3VV0 A;  4JZ4 A;  4RTY A;  4XU1 A;  2HQH A;  2GTJ A;  1QP2 A;  2X3W D;  2LC4 A;  4IUR A;  1X75 C;  4AT1 B;  4ZGJ B; 
#chains in the Genus database with same CATH homology
 2C0O A;  1N5Z A;  1Z9Z A;  2DF6 A;  1AZG B;  2GQI A;  2LJ1 A;  1ZX6 A;  1PRL C;  4JJD A;  1AD5 A;  1AVZ C;  2CRE A;  1SRM A;  2H8H A;  4EIK A;  2D1X A;  4LUD A;  3EGU A;  2KYM A;  3UAT A;  1WIE A;  2O88 A;  3VRY A;  2J6K A;  2ROT A;  4CC7 A;  2DM1 A;  2JS0 A;  1K4U S;  1ABO A;  2FPF A;  2FPE A;  3THK A;  2J6F A;  3IQL A;  3EG1 A;  2PZ1 A;  2GNC A;  2EGA A;  1MV0 B;  1E7O A;  1ZUY A;  1NM7 A;  2OJ2 A;  2V1R A;  3KFV A;  4ORZ A;  3REA B;  5GJW B;  4JPB W;  4RTV A;  1U06 A;  2RPN A;  2LNH B;  4E6R A;  2RQV A;  3H0H A;  1H92 A;  2A36 A;  2XMF A;  3PVL A;  2DLP A;  1AOJ A;  1FMK A;  2VWF A;  2OI3 A;  1WFW A;  1BBZ A;  2CH4 W;  1W70 A;  2BZX A;  4Z88 A;  5I11 A;  2KT1 A;  1I07 A;  2DL8 A;  2KYB A;  2F2V A;  3EG3 A;  1PWT A;  3RNJ A;  1X2K A;  1AEY A;  1GFC A;  1NLP C;  1CKB A;  4AG2 C;  1YCS B;  1SHG A;  1G83 A;  2YUO A;  3VS5 A;  2F2X A;  2KXC A;  3NHN A;  2LQW A;  4K11 A;  3M0T A;  4HVU A;  3ZL7 C;  1MV3 A;  1GCQ A;  4RTU A;  1BU1 A;  2KT8 A;  4JJC A;  1WA7 A;  1JEG A;  2KRS A;  2W10 A;  2MIO A;  1K76 A;  1BB9 A;  3LH5 A;  3U23 A;  1JU5 C;  1W6X A;  2EGE A;  4JZ3 A;  5I22 A;  1QWF A;  2DRM A;  2JTE A;  4J9G A;  1UTI A;  4OMQ A;  3I5S A;  2GGR A;  1M3B A;  5IH2 A;  2AZV A;  4HVW A;  2JMA A;  4RTW A;  2K9G A;  1E6G A;  2LJ3 A;  5FWB A;  1PNJ A;  1T3L A;  1WXT A;  2DIL A;  1WYX A;  4OML A;  1JXO A;  1XOV A;  2AK5 A;  2PTK A;  2YT6 A;  2KXD A;  1X43 A;  4J9D A;  1PKT A;  2KEA A;  4J9E A;  3PE0 A;  3H41 A;  2EYY A;  4IIM A;  3TSW A;  1SSH A;  3ULR B;  1OOT A;  4RUG A;  1NG2 A;  2EBP A;  2LMJ A;  3VS2 A;  2CUB A;  3VS3 A;  2RNA A;  2BZY A;  4D8K A;  2ED1 A;  2RQU A;  3TVT A;  1A0N B;  4OMM A;  1NLO C;  1TUC A;  1K9A A;  2CSQ A;  1E6H A;  4Y92 A;  3RBB B;  4GBQ A;  1UJY A;  1KSW A;  1VYT A;  1H8K A;  2CT3 A;  2IIM A;  2JW4 A;  1OPL A;  5ECA A;  2A37 A;  3NPF A;  2JT4 A;  4D8D A;  4IIO A;  1RUW A;  1X27 A;  2KRM A;  2EGC A;  2KGT A;  2KNB B;  4J9B A;  4RTZ A;  2KBT A;  2YUN A;  5HCK A;  2A08 A;  2DJQ A;  2DNU A;  1V1C A;  1UG1 A;  4DEY A;  1GL5 A;  1BK2 A;  1VYV A;  1NYG A;  1GBQ A;  1HD3 A;  1PRM C;  2CT4 A;  3I5R A;  2CSI A;  2D0N A;  2JMC A;  3M0S A;  2A28 A;  2JS2 A;  1X6B A;  2OAW A;  4WCI A;  1SPK A;  4A63 B;  1OEB A;  2LCS A;  2HBW A;  2DVJ A;  1CKA A;  2QDL A;  1Y0M A;  2AKK A;  2MOX A;  1Z9Q A;  2EYZ A;  1K0X A;  1I0C A;  4AFU C;  2CUD A;  4ESR A;  1TG0 A;  2X3X D;  2HEQ A;  2RQR A;  1ARK A;  2FO0 A;  2LZ6 B;  1WXU A;  3CQT A;  2F2W A;  1T0J A;  1U5S A;  2O9V A;  4CC2 A;  2HDA A;  2L3Q A;  2L0A A;  2DBM A;  4CC4 B;  3C0C A;  1GBR A;  2ED0 A;  2D8J A;  2L2P A;  1YWO A;  1PHT A;  3NMZ C;  3M0U A;  2L3P A;  2G6F X;  1M3C A;  1SHF A;  1NEG A;  1AWO A;  1X6G A;  2BTT A;  2YSQ A;  4R0K A;  2CH4 A;  2J06 A;  2J7I A;  5L23 A;  2RN8 A;  2SEM A;  4Z8A A;  2P4R A;  4AFZ C;  2K3B A;  2DE0 X;  1MUZ A;  3I35 A;  2E5K A;  2RMO A;  3EG0 A;  1UGV A;  3VS4 A;  1UE9 A;  1AZE A;  4M4Z A;  1SRL A;  1T3S A;  1H3H A;  2D8H A;  1YP5 A;  4HCK A;  4RTX A;  3VS0 A;  4J9H A;  2ENM A;  2J05 A;  1QWE A;  2FG0 A;  1UHF A;  5IXB A;  1VYU A;  4LUE A;  3EHR A;  4JJB A;  2W0Z A;  4J9I A;  5FW9 A;  2M0Y A;  2RF0 A;  5IHK A;  4AG1 C;  1U3O A;  1QKX A;  2NUZ A;  1M8M A;  4F16 A;  1W1F A;  3VRZ A;  4LN2 A;  1SEM A;  2JM9 A;  1ABQ A;  1WLP B;  2MCN A;  4DEX A;  4Z89 A;  1JXM A;  1M3A A;  4KRT A;  1GFD A;  1ZUU A;  2LJ0 A;  4X1V A;  2EQI A;  2DL7 A;  3SEM A;  1RI9 A;  3TSZ A;  2K7A A;  2RQT A;  1RLP C;  4OMO A;  2JXB A;  1GRI A;  1FYN A;  2EYX A;  3M0P A;  1UDL A;  1YNZ A;  1ZUK A;  4LNP A;  5FWC A;  2EPD A;  2NWM A;  1B3Q A;  1ZLM A;  1WDX A;  1B07 A;  2DYB A;  1WXB A;  2EKH A;  1CSK A;  1QLY A;  2FRW A;  2O2O A;  3VS7 A;  2ABL A;  2DBK A;  2GBQ A;  1JQQ A;  1K1Z A;  1TUD A;  1X69 A;  2HCK A;  1GCP A;  3UA7 A;  1X2Q A;  2EYW A;  4FSS A;  4J9F A;  1AWJ A;  2DX1 A;  2K79 A;  2K6D A;  2FPD A;  1GCQ C;  2RQW A;  2M51 A;  3PVQ A;  3I9Q A;  1Y57 A;  2DRK A;  3EHQ A;  3JV3 A;  2K2M A;  2VKN A;  1NEB A;  1M30 A;  2KRO A;  1ZSG A;  2FEI A;  5EC7 A;  4ZNX A;  1WI7 A;  3VS6 A;  2YUP A;  3REB B;  4OMN A;  1UEC A;  1OV3 A;  4HVV A;  2GTO A;  2HSP A;  1K0S A;  1AWX A;  1G2B A;  2VVK A;  2CDT A;  1NYF A;  2B86 A;  1YN8 A;  5GJV B;  2YUQ A;  2PNI A;  5IHI A;  3EG2 A;  3VS1 A;  4HXJ A;  2AZS A;  2C0I A;  4F17 A;  1KJW A;  3O5Z A;  1KFZ A;  2ESW A;  4GLM A;  1UFF A;  2KR3 A;  2JM8 A;  2FRY A;  2YDL A;  3UF4 A;  2DL4 A;  1QCF A;  1QKW A;  2DA9 A;  2EVR A;  2O31 A;  2EW3 A;  2V1Q A;  2KRN A;  3H0F A;  4QT7 A;  4AFQ C;  1ZBJ A;  2O9S A;  3SHW A;  2BZ8 A;  1AWW A;  4OMP A;  1UUE A;  2DL5 A;  1I1J A;  3FJ5 A;  4F14 A;  1J3T A;  3M0Q A;  2C0T A;  2ROL A;  1EFN A;  1HSQ A;  3UA6 A;  2ECZ A;  3H0I A;  1T0H A;  3QWY A;  4RTT A;  1KIK A;  2L3S A;  4J9C A;  4AFS C;  2J6O A;  1IO6 A;  1UHC A;  3A98 A;  1WX6 A;  2DL3 A;  3QWX X;  1OPK A;  1YWP A;  1JO8 A;  2DMO A;  2LQN A;  3NGP A;  4JZ4 A;  2KE9 A;  3GBQ A;  4RTY A;  1LCK A;  1PKS A;  2GTJ A;  4LE9 A;  1M27 C;  4CC3 A;  1S1N A;  2LP5 A;  1HJD A;  2AKL A;  1UJ0 A;  1VA7 A;  2X3W D;  2LX7 A;  5IHN A;  2I0N A;  2SRC A;  3M0R A;  1RLQ C;  5IXF A;  3R6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...