1M3CA

Solution structure of a circular form of the n-terminal sh3 domain (e132c, e133g, r191g mutant) from oncogene protein c-crk
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
CGAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Proto-oncogene C-crk
publication title Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain
rcsb
source organism Mus musculus
total genus 8
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m3cA00
4ORZA 1KFZA 2L3PA 1UG1A 2LX7A 1UE9A 2RQWA 2FO0A 3PVQA 4RTWA 2EGAA 2EYXA 1K9AA 4AFUC 5IXFA 1FYNA 1NYFA 4OMPA 1X6BA 3H0FA 3NPFA 4CC4B 4J9GA 1HD3A 4WCIA 3SEMA 1SHGA 1BK2A 4RTTA 3PVLA 2LP5A 2CREA 1WLPB 2LJ3A 1T3LA 1RUWA 1KSWA 2JS0A 2KRSA 1PWTA 2O9SA 2EW3A 2BZXA 4E6RA 2RF0A 2F2WA 1M3BA 1OPLA 1RLQC 2HDAA 4JZ4A 5EC7A 2KE9A 1QCFA 3VS3A 2CSQA 2ECZA 1AZEA 3ZL7C 2F2VA 1NLOC 2P4RA 4K11A 4J9HA 2EYWA 4GLMA 2DRMA 2OI3A 1AEYA 3TSWA 1HJDA 1Y0MA 1NEGA 1VA7A 1I0CA 2HSPA 3QWXX 1PKTA 4Z88A 4AG1C 1YP5A 2VVKA 1RLPC 1E6HA 1VYUA 1H8KA 4IIOA 1SSHA 2J7IA 4ZNXA 1W70A 1GFCA 1WDXA 2J6KA 1U3OA 1W6XA 1GRIA 2JM8A 2LMJA 2HEQA 3I5SA 1PHTA 1PRMC 2KT8A 4X1VA 1AWJA 4J9DA 4OMMA 5ECAA 1SRMA 1U5SA 1M3CA 1M3AA 4JZ3A 2DL5A 2K7AA 2BZYA 1J3TA 4J9CA 2CUDA 4RTUA 5L23A 1AOJA 2CH4W 2LCSA 1XOVA 1GCQA 2K2MA 1AWXA 2GGRA 1GBQA 1FMKA 2EGCA 1M8MA 2L3SA 1JQQA 2V1RA 2RMOA 2DBKA 3CQTA 4J9BA 2C0OA 2PNIA 2O2OA 1X27A 1OV3A 2A37A 2KROA 2DBMA 1ZUYA 2FRWA 2C0TA 2XMFA 3KFVA 1SEMA 1NM7A 1ZX6A 1M30A 2FPFA 4RTYA 2D0NA 1WFWA 1AVZC 2D8HA 2JW4A 1BB9A 1VYTA 2DF6A 2OAWA 3EG1A 1MV0B 4A63B 1ZLMA 4DEYA 2LQWA 4Z89A 4HCKA 2YUOA 3FJ5A 2MIOA 2AKLA 2JT4A 1WXTA 1I07A 1ZBJA 2EYZA 3REBB 5IHKA 2ENMA 2K3BA 4KRTA 1PNJA 2KT1A 2DL3A 2JM9A 1ARKA 1GCQC 1WIEA 1JO8A 1K1ZA 1UECA 2I0NA 3EG3A 3EHQA 2FPEA 2ROTA 2JMCA 2HBWA 2JTEA 3JV3A 2GBQA 2FG0A 1ZUUA 2KGTA 2B86A 2KRNA 1H3HA 1U06A 2BZ8A 2C0IA 2W0ZA 2O31A 3EG0A 1UJYA 1K0SA 1UHFA 1A0NB 2JXBA 2DM1A 3O5ZA 1WXBA 2RQRA 2SRCA 1G83A 3QWYA 3UA7A 4J9IA 3H0HA 3UA6A 2KYMA 1YWOA 2EQIA 1W1FA 2F2XA 2GTOA 2A28A 3M0UA 2NUZA 3VS5A 2LNHB 1UFFA 4LE9A 4F16A 5FW9A 3EHRA 1PRLC 4OMNA 3EGUA 4RTVA 4AFSC 1Z9ZA 5IHNA 1T0HA 2YUPA 1HSQA 1WX6A 5IH2A 2D8JA 1E6GA 2X3WD 1CKBA 4LNPA 1WA7A 2ROLA 1NG2A 2K6DA 1UHCA 2GNCA 2RN8A 3VS1A 1AWWA 1OPKA 1ZUKA 2DRKA 3UF4A 1AWOA 4HVUA 1Y57A 2X3XD 1K0XA 1BU1A 3TVTA 1NEBA 4AFZC 5FWBA 1TUCA 1N5ZA 4QT7A 1YCSB 2ED0A 3LH5A 2W10A 2ABLA 1T0JA 5HCKA 2BTTA 1X43A 2KXDA 4HVWA 4D8DA 1UTIA 1X2KA 3C0CA 1V1CA 2DL7A 4JJDA 1AD5A 1NLPC 2AZVA 2DYBA 2DMOA 3A98A 2DNUA 2CDTA 2LZ6B 1QKXA 3H41A 3RBBB 4F17A 1UGVA 4OMOA 1BBZA 2H8HA 2AKKA 3I35A 3IQLA 2G6FX 3NMZC 2DVJA 4OMQA 3VRYA 1QLYA 1JU5C 2IIMA 4AFQC 1X6GA 1CSKA 1AZGB 2A08A 2M0YA 4LUDA 2HCKA 5IHIA 3M0SA 1QKWA 4D8KA 2FRYA 3H0IA 3M0QA 1UDLA 2YT6A 2KXCA 2FPDA 3GBQA 4OMLA 2ED1A 1NYGA 1ABQA 2LQNA 2JMAA 4GBQA 4RTXA 1CKAA 1PKSA 1UJ0A 3I9QA 1KIKA 1Z9QA 2CH4A 2K9GA 2CT3A 2J6FA 2MCNA 4AG2C 1WYXA 2DL8A 2M51A 4R0KA 2DA9A 2VWFA 5I22A 1M27C 4CC3A 2FEIA 3SHWA 2GTJA 2EPDA 4J9FA 1GL5A 1B3QA 2D1XA 4CC7A 1I1JA 1E7OA 2SEMA 4DEXA 2QDLA 2KR3A 4HXJA 2A36A 2JS2A 1LCKA 1GCPA 5GJVB 1ZSGA 3TSZA 1YNZA 2RQVA 2V1QA 4LN2A 3M0TA 1QWFA 1JXMA 1H92A 2RQUA 5I11A 4LUEA 2VKNA 2MOXA 2CT4A 3THKA 3RNJA 3U23A 1SHFA 1TG0A 1K4US 1B07A 3VS4A 2EGEA 2LJ1A 3R6NA 2PTKA 1RI9A 1OOTA 3VRZA 3VS6A 2ESWA 2KNBB 2OJ2A 3NGPA 5IXBA 2YDLA 4EIKA 2O9VA 2AK5A 2GQIA 2EYYA 3NHNA 1EFNA 1UUEA 2KEAA 2PZ1A 3M0RA 1K76A 4IIMA 1WXUA 1SPKA 4Y92A 1JXOA 4M4ZA 4F14A 1ABOA 3REAB 2CUBA 1GBRA 1GFDA 2KYBA 1YN8A 2EVRA 1SRLA 4RUGA 2YUNA 4RTZA 1TUDA 2EBPA 1OEBA 1T3SA 2CSIA 2YUQA 4JJCA 1KJWA 4J9EA 1X2QA 2E5KA 2DJQA 1X69A 2LJ0A 2L3QA 1G2BA 4HVVA 2KRMA 2J06A 2KBTA 2RPNA 2EKHA 2DE0X 2AZSA 2L2PA 4Z8AA 4JPBW 1YWPA 2DILA 1WI7A 2DX1A 5FWCA 2DL4A 3EG2A 3UATA 2NWMA 2DLPA 5GJWB 3VS7A 1VYVA 2K79A 3VS2A 4CC2A 1IO6A 2YSQA 2L0AA 3VS0A 3M0PA 4JJBA 2J05A 1QWEA 3I5RA 2RNAA 1JEGA 1S1NA 3PE0A 2O88A 3ULRB 1MV3A 2RQTA 4FSSA 4ESRA 2J6OA 1MUZA
chains in the Genus database with same CATH superfamily
2L3PA 1UG1A 3PIOA 3WVDB 3ZEHA 2QGFB 4ANJA 1FMWA 4FT4A 3MO8A 4XTUA 4GLKA 3L42A 4M78A 2GFAA 1OX9A 4JRKA 2EJGA 4M77A 4AFUC 2R58A 5IXFA 1FYNA 2E10A 1U8RA 2QTVA 2QEXQ 1LVKA 2LCCA 9ATCB 7AT1B 3GIBA 4PKCC 1PSEA 4FIBA 1M4ZA 4RTTA 3PVLA 1WLPB 1T3LA 3V8KA 3OQ5A 1RUWA 4F7UF 5KCOA 2KRSA 1RAAB 2PUOB 2L8DA 2MPXC 1Q7YU 1KQ2A 4M78B 4E6RA 1R77A 2E4HA 2F2WA 2RF0A 1M3BA 2EYQA 4M77B 3X28B 4JZ4A 2HDAA 2DTIA 3LYIA 2X35A 4C8QB 5LJ5h 5GAOn 2ECZA 2RI2A 4PLIA 4M78C 2F2VA 2YWWA 4BE2A 3JB9H 4BI3A 3RIRA 5GAOp 1M90U 2RK1A 4M77C 2LT1A 2DYIA 4M78F 3TSWA 1HJDA 2RHIA 1Y0MA 2P84A 2WSCE 3M5AA 3CCET 1QVPA 2QQBA 1RLPC 1E6HA 4XQ3A 2IPOB 4LD9K 2J7IA 5GANh 2FZKB 4C5HA 1W70A 3UPUA 2CKKA 4M7DG 1TU0B 3PTAA 1PCXA 1W6XA 1Q81U 3MKDA 3V7RA 1K73R 3I5SA 4IUTA 1IGQA 2ZPEB 2RHYA 1AWJA 1SRMA 2XDPA 1U5SA 4LDUA 3BDLA 1O9SA 1M3AA 1VQ7Q 1QP3A 3EG9A 1MGQA 2K7AA 1QVFP 1WQWA 1AHJB 4RTUA 1I5OB 4A4EA 1YIJA 1GCQA 2ATCB 4M77D 1G8XA 1SG5A 2V1RA 4C92G 4C8QD 2AIRB 3SWNB 3BE3A 4JJNK 5EG2A 3CQTA 3M4YA 4J9BA 2QK0A 4JLIA 5DY9A 2O2OA 5CKBA 1D0YA 1RADB 1X27A 2A37A 2DBMA 2FRWA 5LJ5g 5LJ3h 2RJDA 3UWNA 1QVFA 3SWNC 2KQWA 3JCMb 2RHZA 1WFWA 3OYFA 2COZA 3EG9B 1N9SA 2DF6A 1WJRA 3EG1A 1MV0B 3FLGA 3P8DA 3CBPA 5KYNA 3REBB 5GANg 4BACA 3CMAT 3LWIA 3A8HB 4HT8A 1RAEB 4XTXA 3OYBA 1GCQC 3JSCA 2K2VA 1JO8A 2E70A 1Q86C 1G5VA 4LDXA 2QA4A 3L2QA 2HBWA 2GBQA 3CCQT 2YRDA 4BDZA 1KC8C 2C0IA 3CMAQ 3SD4A 3V8JA 3CCRT 1UJYA 2LX9A 4HA8A 3HRTA 1VIFA 1MNEA 4OB3B 1IREB 3G7ZA 3O5ZA 3CXCS 3QWYA 4J9IA 3VYHB 5LJ3g 3JCMd 3UA6A 3CCQQ 1XJWB 5HK3A 3JB9J 3M0UA 3VS5A 1N27A 2VXEA 2RI5A 4Q5WA 4RTVA 2OTLA 5GAN3 1ZA2B 5IHNA 3J7AF 2FYKA 3M56A 4EMHA 2YUPA 1MNDA 5CKEA 1WX6A 2XD0A 4PFOA 3RUXA 1WA7A 1NG2A 1Y96B 3CMET 1AWWA 2RK2A 4A53A 3CBOA 2X3XD 4DA4A 1EZZB 1WGSA 2RH2A 4XU3A 1K73U 3JCMQ 4Y91A 5GAN2 1YCSB 1W2BA 2CYZB 4OMFB 1M1GA 2CP5A 5C6SA 1X43A 1G3WA 2FHDA 2KXDA 5IT9E 3CMEQ 3P8HA 3I55T 3CC2Q 3C0CA 1YHQA 3OS5A 3CC2A 3RERA 2OTJA 1NLPC 2DYBA 3JCMJ 2IVWA 2CDTA 3CCMT 3QBYA 4F17A 5CIUA 2X4YA 1BBZA 2FZGB 3JB9D 3NMZC 4FM4B 2DVJA 2NUTA 4LUDA 3M54A 3CCLT 4E7SA 2BIVA 4ZTFA 1VQ9A 2FRYA 4X9CA 2X51A 2JVVA 4P5NA 2MAMA 1UDLA 1ZQ1A 1OZ3A 3OYYA 1TOVA 1NYGA 3S6WA 4C92F 3KXTA 1CKAA 1PKSA 1Z9QA 2CH4A 1BI3A 2K9GA 2CT3A 1RAFB 2MCNA 4AG2C 1WYXA 2DL8A 3CCLQ 2A7YA 2FL7A 4R0KA 2K3XA 1M27C 4L6V5 2NUTB 8AT1B 3CC4T 3H9NA 2CP7A 3MJXA 1VQPT 3UT1A 1E7OA 1MMDA 4HXJA 5KE2A 1GCPA 2KI7A 3C12A 5GAOm 1C1AA 5GJVB 6AT1B 1YNZA 1HYOA 1VUBA 2DIGA 5CO7A 3BW1A 2RQUA 3DB4A 3HPWA 2YRVA 3EH2A 3CC4Q 4PFPA 3JCMX 1OU9A 1VQPQ 2GCXA 2XIDA 1K4US 4CI0C 3JCMh 2A3LA 4M78E 3LGFA 1KD1C 5D6WA 2EJFA 4M77E 2YXYA 2ESWA 2EWNA 2X9HA 1KQ1A 2GF7A 4EIKA 2GQIA 2EYYA 4E7ZA 1UUEA 2PZ1A 1K76A 1VQMA 5CVIA 4B6MA 3OS0A 5GMKe 2YHTA 1YN8A 4OVAA 3QDFA 1SRLA 3CCUT 3TU4K 1TUDA 3C94A 3JB9I 4C0GA 2L3QA 3G71T 3TEEA 4Z8AA 3GLXA 3RDVA 2ZPIB 4JPBW 3GNGA 1YWPA 2DILA 5FU7B 3L2UA 1WI7A 2LQ8A 4PJJA 1VQKA 1VQOT 3L2WA 2F5KA 3OB9A 5FU7C 1VQ4Q 3I56Q 1D1CA 3I56A 3JCMg 1S1NA 4IURA 3A1PA 4WF2A 2PVOB 3G71Q 3RMSA 1D0ZA 1IRXA 4LNPA 3OYNA 2PUKB 5I21A 1YJWT 4ORZA 4JUVA 1KFZA 2LX7A 1M8VA 4KGZB 2HL3A 1NJIR 2FO0A 3QO3A 2EGAA 2EYXA 2JTMA 1B7TA 4NL2A 3EFSA 3OS1A 4M75G 1NYFA 4OMPA 5FRMA 1X6BA 3H0FA 1UGRB 3HFOA 2XHCA 2DZ9A 1YJWQ 4J5YA 1BK2A 1S72T 4PJOB 4II1A 2EAYA 1Q7YC 1JJ2P 4M7AA 1PWTA 1JRIA 4OGCA 3OYIA 1H3ZA 4PJOC 5GMKl 3H8ZA 3CD6T 4C8QG 2HL5C 4XTZA 1WHHA 1M90C 2KE9A 5J26A 2HQHA 3OMCA 2EFIA 3VS3A 1M90R 2DPPB 3ZL7C 1VQ6A 1NLOC 4QVZA 3G4ST 4J9HA 4RCCA 1TTHB 2EYWA 3CXCA 3URGA 1BI2A 1VA7A 2OAUA 1I0CA 2Y4YA 3QWXX 1U1TA 4ZN3A 3V8LA 4AG1C 4IKFA 2Y4XA 4NL3A 2DAQA 4ZGEB 1YJNQ 4M7AB 3MEVA 2LC4A 1H8KA 2QAZA 1Q81C 1D3BA 2EQUA 3OSVA 1YI2Q 2M02A 2XK0A 1YI2A 2LMJA 2JM8A 4M7AC 3G4SQ 3CC7Q 2CZ7B 3CPFA 4PJOD 1PRMC 3CC7A 4HT9A 4J9DA 4OMMA 1HXDA 2NLUA 3WVEB 2E12A 4JZ3A 2DL5A 2RJFA 3X24B 4A4FA 1B34B 3A8GB 3CEYA 2CUDA 2K2MA 2ZGWA 3LH0A 3R6OA 4KGXB 1TS9A 1JQQA 1BCOA 4F7UA 1D3BB 2PU9B 4V2SA 3BFMA 2PNIA 1MMAA 2P0PA 4DQ2A 2KROA 1ZUYA 1SEMA 4FYYB 1NM7A 1BCMA 2LCLA 2VASA 1OZ2A 1YITA 2JW4A 1BB9A 4M7AD 3HRSA 1PD0A 4IUVA 1NJIU 2YUOA 1WXTA 1IB8A 1M1KU 1ZBJA 1PNJA 4F7UB 4HKEA 2DL3A 1K8AR 2CZ1B 3JCMV 3OW2P 2JOYA 4KH1B 1WIEA 3S3MA 1K1ZA 1UECA 3VKIA 2FPEA 3QXEB 2ROTA 4LXCA 2JTEA 3JV3A 1RABB 2DD5A 1ZUUA 1KK7A 4PK4A 2VC8A 2R57A 4FW1A 1YBYA 1R8OB 1VQNA 2W0ZA 5LL6S 4BB7A 4BE1A 1OYXA 1K0SA 3NFCA 2JXBA 2RJCA 4MMLA 2WACA 1R0CB 1KQSP 2KYMA 2QGGA 1VQLQ 2R5MA 3OBWA 4KT0E 2EQIA 1W1FA 2GTOA 4QVCA 3CCSQ 1VQLA 4F16A 4ZGDB 5FW9A 3CCSA 3QPHA 3JB9G 5L8RE 4OMNA 3EGUA 1TSFA 1VQ7T 4AFSC 3VUZA 3CPWP 1T0HA 1WHLA 1YIJT 1X01A 2D8JA 5HY6A 1CKBA 1PG5B 3G6EA 1K73C 2K6DA 1UHCA 5A0LA 1OPKA 5J3BA 5HK0A 1AWOA 3DKMA 1K0XA 3TVTA 3PT9A 1WJQA 3M59A 5DLOA 1NEBA 4AFZC 5FWBA 1TUCA 1N5ZA 2NYSA 1UGQB 3EGDA 5KE3A 1YIJQ 1WQ7A 1T0JA 4M78D 2BTTA 5CR2A 4QW2A 1SSFA 3C4SA 1AD5A 4XTYA 1IZ6A 1Q82R 2HMAA 1QW1A 2DFUA 3HP9A 4FCYA 1Y71A 4DOVA 4BDYA 1UGVA 4OMOA 3OMGA 2H8HA 4AMCA 1NPRA 4LDVA 4DBHA 3EGDB 3VRYA 1JU5C 4AFQC 1R0BG 2HKNA 4OB2B 5GMKj 4RMOA 4QQGA 4D8KA 1N6AA 3H0IA 3OY9A 4EMKA 2YT6A 3META 2XKOC 2ED1A 1K8AU 2LQNA 2JMAA 4GBQA 4AT1B 4E2FB 4KBMB 2QA4Q 5LJ5f 5KCHA 1UJ0A 3I9QA 1C0MA 2J6FA 2X4XA 2DA9A 2VWFA 2EPDA 4J9FA 1GL5A 2OTLT 1B3QA 4FT2A 4HCBA 3RKWA 2CP2A 5GANf 2KR3A 3MHXA 1JJ2S 4EMKB 2JS2A 1LCKA 3OYKA 3QSUA 3TSZA 5M9OA 4PJOE 3JCMW 2HNIA 1IHVA 1QWFA 1JXMA 1G3TA 1H92A 2BUDA 2P0QA 4EMKC 2VKNA 2DETA 2OTLQ 3THKA 1SHFA 2BE9B 2M0OA 4M7DA 1MHNA 2DD4A 3V7CA 2DJZA 1YJ9Q 1RI9A 1FMVA 2MI6A 1YJ9A 2Y90A 1QVGP 5IXBA 4N4IA 1YHQT 2O9VA 3CC2T 5GAN4 3NHNA 2OTJT 3HFNA 1IGUA 1EFNA 3JCMP 4IIMA 5IN1A 1PC0A 5FROA 3J80E 2P0KA 3REAB 1FWZA 2DKGA 4M7AE 3QUIA 4C92A 1OU8A 2JZ2A 2E65A 3FEOA 2FZCB 4M7DB 2EBPA 1T3SA 2YUQA 1YHQQ 4ATOA 2D6FA 3VUBA 1VQ9T 2OTJQ 5A0DA 3CCJA 4HVVA 2J06A 2KBTA 2RPNA 4M7DC 3BY7A 3T9NA 1Q82U 3FIFA 5FWCA 4M7DF 4LD6A 4NOYA 2D0QB 3EFRA 2O4XA 2K79A 3PMTA 2CP0A 3VS0A 5A2QE 3M0PA 4X9DA 1QQJA 2H3EB 3E19A 1VQ9Q 1WZOA 4BI8B 1KHIA 4C92B 1VQ5A 1QWEA 3PE0A 2LDMA 1I81A 4UC4A 4C0ZA 2RJEA 4KH0B 3RESA 2J6OA 1MUZA 4C92C 1UE9A 2RQWA 1I4K1 1XNIA 2QQ9A 3PVQA 3QKJA 4RTWA 4BE0A 2KAFA 5KYUA 1WHMA 5GMKi 1K9AA 1M5Q1 2O4XB 1BIAA 2XDBA 1TH7A 3GF5A 3OW2S 3SB2A 4MZMA 2DO3A 4PJOG 3SEMA 2NUPA 3GOXA 4F7UE 1VQ8Q 2LT4A 3M57A 5I2MA 1VQ8A 2LP5A 2CREA 1QCOA 2M16A 4JS4A 2DXBA 2JS0A 4J7IA 2EW3A 1P92A 1RI0A 1VQMT 1BIBA 5KYUB 4YTLA 4C92D 3L1AA 2O01E 1OPLA 4XAXB 5GAMe 4MZTA 5EC7A 1KQSS 3L2VA 3GNFB 2H3JA 2HKQB 2CP6A 1AZEA 2QQSA 2NUPB 4K11A 5KYYA 2KVQG 4GLMA 2DRMA 2E41A 2RHXA 3X20B 3Q1JA 1NEGA 4BUGA 1N8RR 4JRIA 1VQMQ 3HSBA 1YP5A 2VVKA 3CPWS 5FRNA 1JB0E 1LNXA 4IIOA 1SSHA 3EGXA 4ZNXA 5GMKm 1VQKT 2JN0A 3DLMA 2J6KA 1U3OA 3PFSA 2HEQA 3N5BB 2DXTA 2KT8A 3I56T 1VQ4T 1X6OA 5ECAA 3D7SB 2VXFA 2V8KA 2CS7A 1YCYA 2BZYA 2K5LA 2EJ9A 2L3RA 4OP0A 5L23A 1AOJA 2LCSA 1VQKQ 2ZPHB 3A8LB 2GGRA 1GBQA 1FMKA 1M8MA 2L3SA 2JTFA 4DBRA 2RMOA 1IXDA 2DBKA 2EQKA 2OX7A 1OV3A 3KFVA 5J39A 2C0TA 2QG9B 4FYWB 2AHJB 3ZFJA 1ZX6A 2DK3A 1QCNA 2ZPFB 1AVZC 2D8HA 1NJIC 1LOJA 1VYTA 2OAWA 4O5VA 1ZLMA 4DEYA 2KDSA 4Z89A 1M1KR 1U1SA 3CCVA 3X26B 4MZPA 3VYGA 1NPPA 4E7JA 2JT4A 3QG1A 1BI0A 1I07A 5IHKA 2XI9A 4N0AA 2K3BA 4KRTA 3ME9A 2KT1A 3A5ZB 2X4WA 1JBMA 1ARKA 3OYDA 3NTKA 3BDUA 4PFZA 3EG3A 1O75A 2M1HA 1AT1B 3OYAA 1VQ6T 2G3RA 4GY5A 2FG0A 3OA6A 1H3HA 1U06A 2BZ8A 5CCAA 4M78G 2E1HA 4M77G 5GMKh 3E1SA 8ATCB 4J6YA 1IHWA 1YJNT 1UHFA 1UGSB 2V8IA 2DM1A 1VQ6Q 4ELYC 2RQRA 1YI2T 1TXQA 1JJ2A 1WHKA 1K9MR 3CC7T 4N0AC 1UFFA 1X75C 4E7IA 3M55A 2KY9A 2V8JA 1N8RU 1UB4A 1Z9ZA 4RKUE 3OYHA 3S3OA 2ZPBB 5KYWA 1HSQA 4FL6A 3KUFA 4A4KA 1QVGS 3HHTB 1M9SA 2ROLA 2R5AA 2GNCA 2RN8A 3VS1A 1ZUKA 3UF4A 2DERA 4HVUA 1Y57A 5CK9A 2PVGB 2FVUA 4QT7A 4XTWA 2W10A 4ZGJB 1RACB 1YITT 5GAMf 1F1BB 3FC3A 5LJ5e 4HVWA 4RG2A 1PM3A 4D8DA 5KYWB 1M1FA 2V26A 1RAIB 1X2KA 2HQXA 3TCJA 1V1CA 2DL7A 1YFNA 2K5IA 2AZVA 4M7DE 3FB9A 4JRQA 2M9UA 4C0DB 5A0GA 3H41A 3RBBB 1YITQ 5GANe 3HKSA 3IQLA 1DJ7B 2G6FX 5GAN6 3LGLA 3OS2A 2QASA 4C0DC 4R56A 1X6GA 1AZGB 4M75A 2A08A 2M0YA 2HCKA 1QKWA 3AHUA 3OYGA 1VQNT 2DEQA 3M0QA 5GAN5 1K8AC 3JAME 2FPDA 4C92E 2DVEA 4OMLA 2VUBA 1M2OA 4C5IA 2QXFA 1WPYA 1ABQA 4IUQA 2E6ZA 4J6WA 1HK9A 1KG1A 1VQLT 2M51A 2HD0A 3CCST 5I22A 1VQNQ 4C8QA 1LPLA 4CC3A 4L5GA 2AT1B 2GTJA 2QEXA 4M75B 2CGHA 5LJ3e 2D1XA 2RD1A 2HQEA 3OW2A 3OYMA 2SEMA 3VU3C 4DEXA 2A36A 3G6ET 2HSEB 4M75C 1ZSGA 2RQVA 5D7UA 3S3NA 3M0TA 2BE7D 4J6XA 4M75F 2LTOA 3LW5E 5I11A 4LUEA 1K9MU 4DBQA 4PJMA 2F5TX 2DXCA 1BKBA 1TG0A 1B07A 3VS4A 2EGEA 1VIEA 2LJ1A 2XU8A 2PTKA 3G6EQ 3VRZA 2PVDB 1XTDA 1KQSA 2OJ2A 3NGPA 2F69A 4IUUA 2YDLA 4C8QC 4M77F 2XICA 5CAIA 2KEAA 3KBGA 3M0RA 4C8QF 1ZSZA 1SPKA 4Y92A 2MMPA 2ZPGB 1JXOA 2VGMA 2KMTA 4M4ZA 2MWOA 3SWNA 4ZN1A 3QIIA 3CPWA 1ABOA 3G1JA 3QDRB 1GFDA 1UEBA 2KYBA 4M75D 5KYXA 2EVRA 1I5LA 4RUGA 3A8MB 2YUNA 4RTZA 1OEBA 2ZCFB 3CCEQ 1RAGB 4L59A 5GAMj 4FSXA 4J9EA 1Q82C 4NS5A 3CCEA 2E5KA 1X69A 1WNLA 2LJ0A 2KRMA 1VQ7A 2EKHA 2QYZA 2AZSA 1WHJA 3OBYA 2DX1A 3UATA 2NWMA 1ZSZB 3VS7A 1VYVA 2L0AA 2Z0WA 3QYGB 2QA4T 3PGGA 4JJBA 1ZBXA 4ME7A 2COWA 2J05A 5GAOq 1EX4A 5KYXB 3I5RA 1D1AA 2RNAA 1ZSZC 2D9TA 4B9WA 2O88A 5CKDA 1MV3A 2RQTA 4FSSA 4ESRA 2I2LA 1XQHA 1SKUB 3MEWA 2RO0A 3QZ9B 4Z02A 2YLCA 1QP2A 3MP6A 3M4GA 3TREA 1G3SA 5IAYA 3M9QA 4E7LA 2ZZDA 4F04B 4OB0B 3NPFA 4CC4B 4J9GA 1D09B 1HD3A 4WCIA 2GFUA 1OI1A 4JS5A 1NE8A 1SHGA 3VV0A 5CQXA 1Q86R 2LJ3A 1YJ9T 4DBFA 1KSWA 4RG8A 2O9SA 4FYVB 3O8VA 1KC8R 3CMAA 2BZXA 2PQWA 1Y96A 4EMGA 1RLQC 3HTRA 4DOWA 1QCFA 3L2RA 4KGVB 1PD1A 5FU6B 5HKCA 2CSQA 2KK4A 4A4HA 3EAEA 4OGEA 2P4RA 5CQYA 3J81E 3H6ZA 3CCQA 2KSSA 2OI3A 1AEYA 2K3YA 1NBEB 2HSPA 4PNOA 3CCJT 3CCRQ 2HZYA 5FU6C 4MMKA 4C5EA 1PKTA 4Z88A 3CCRA 2EIFA 4E47A 1W2BP 1VYUA 3INZA 4O6JA 4RCBA 5LJ3f 5KH6A 1C6VX 1FXXA 4A54A 3FJPA 1GFCA 1WDXA 2K5FA 2X4JA 2DTOA 4JDSA 1GRIA 3ER0A 3FRNA 1QVGA 1PHTA 4HCZA 4X1VA 1VQ5T 3JB9F 3CCJQ 5DLQE 4LDYA 4A4GA 3RMQA 1M3CA 1ZHIA 1KHCA 1VOMA 1J3TA 2EQMA 4J9CA 3MEAA 5D6YA 2CH4W 2RM4A 1XOVA 1BI1A 1AWXA 3JCMe 3TQ7P 2EGCA 3CMEA 1V76A 1VQ5Q 2C0OA 5GJWB 2XMFA 3FDRA 2DZCA 1M2VA 4J8OA 5D6XA 3V7SA 2RA2A 4PLLA 1M30A 2FPFA 4RTYA 2D0NA 2RB6A 2MYSA 5GAMd 5I2SA 1VQ8T 1GXIE 2CP3A 3I55Q 4A63B 2LQWA 3I55A 3E2UA 4HCKA 3FJ5A 2YLBA 3MP1A 2MIOA 2AKLA 5CKFA 3RR6A 4BY6B 2EYZA 2JJ9A 2LQKA 2ENMA 4KUIA 4M7DD 3CBMA 3NTIA 3VJPA 3CCMQ 3MPUB 1TWBA 3SDZA 5LJ5j 4N4HA 2JM9A 3CCMA 4FW2A 4BY6C 1WJSA 2C06A 2I0NA 3EHQA 1M2VB 2JMCA 3P8BB 3EFOA 1Q86U 2KGTA 2B86A 5GAN7 2JNGA 2KRNA 4B9XA 5GAN8 4X34A 4J7FA 2CZ0B 3MEUA 3CCLA 3X25B 3RKYA 2XG8D 3QJ6A 3MP8A 5AYFA 4QKUA 5GANj 2XDDA 2O31A 2E3HA 3EG0A 4CRIA 4IUPA 1KC8U 3QYHB 4BD3A 1A0NB 1QMCA 2EQJA 2RI3A 4QQDA 4M75E 2RHUA 3E9GA 4EDUA 1WXBA 2SRCA 1G83A 1H641 1EIFA 3UA7A 2MF2A 3H0HA 4MDXA 1YWOA 1SF9A 2F2XA 1N8RC 1W4SA 2A28A 2NUZA 2LNHB 4LE9A 3EHRA 4M7AG 1PRLC 3EFOB 3CC4A 4KULA 4KUDK 2DTHA 1VQPA 2DXUA 5IH2A 1TUGB 1E6GA 2X3WD 1Q95G 1KD1R 1OULA 4XU1A 4C8QE 1UGPB 5LJ3j 2DRKA 4TVRA 1BU1A 2MWPA 1ACMB 4XU2A 5KYYB 2ED0A 3LH5A 2ABLA 2LNVA 5HCKA 3CCVT 3MCAB 2QQAA 3AT1B 3EGXB 1UTIA 4OB1B 4VUBA 5AT1B 4D6WA 3PMIA 4JJDA 1QVFS 2DMOA 3A98A 2DNUA 4PJLA 3M58A 2LZ6B 1QKXA 3PIPA 3CCUQ 2AKKA 3I35A 3CCUA 1M1KC 2QI2A 2HAXA 2B8AA 3CCVQ 4OMQA 1QLYA 2IIMA 1CSKA 5IHIA 1VQ4A 3M0SA 4XK8E 4F7UG 3UDCA 3M53A 4PJOA 2CZ6B 5FLXE 5GAMh 3G71A 4OF1A 2KXCA 1G3YA 3SFMA 5GAOl 3GBQA 3HL8A 1VQOQ 2VV5A 4ZTJA 2LVMA 4RTXA 1VQOA 3LX7A 2P4TA 2L89A 3LWHA 3JCMf 1KIKA 2COYA 3GPLA 3ZBDA 1NZ9A 1ZA1B 3OYEA 3PNWC 4XTVA 2LRQA 2FEIA 1Y07A 2E6NA 3SHWA 2E3IA 5C0MA 2F1LA 4CC7A 4HCCA 1I1JA 1YJWA 3GP8A 2QDLA 2MK5A 4QQ6A 1FX7A 4QVDA 3CXCP 2K4YA 3NTHA 4FYXB 5LJ5d 4BI4A 1K9MC 1RL2A 1Q7YR 2V1QA 4LN2A 3QZ5B 2DEUA 2EKOA 1PSFA 1MMGA 3OYLA 3OSSC 5DM7R 2MOXA 4PJOF 2CT4A 2QTXA 3DLLA 3OYJA 3RNJA 3U23A 1S72Q 4J83A 5CKHA 4MDWA 1S72A 2QQRA 3R6NA 1OOTA 5GANd 3VS6A 2KNBB 1BYMA 4R55A 1Y7XA 1B34A 5GAMg 1N9RA 2YRCA 2IG0A 1KD1U 4N4GA 2AK5A 2K57A 2VB6A 4WTOB 2WSEE 1W2BS 3CD6Q 3HRUA 3CD6A 4LDWA 1I8FA 1WXUA 4E7KA 3E9FA 1YJNA 4XU0A 1LJOA 4F14A 4ELZC 1Q81R 2GQVA 2CUBA 4EPCA 1GBRA 4Y28E 5GAOr 4PL6A 2JUFA 2CSIA 3G4SA 3ASKA 4C0FA 1D1BA 3JRZA 4JJCA 4M7AF 1KJWA 3JCMc 1RAHB 2QDYB 1X2QA 4JRPA 2DJQA 2FB7A 1G2BA 3OYCA 2HBPA 2DE0X 2L2PA 2WSFE 3QHSA 2VGNA 3A8OB 2DL4A 3EG2A 3QJYA 5LJ3d 2DLPA 2VYTA 1MMNA 3L2ZA 3VS2A 4CC2A 1IO6A 1D0XA 1WHGA 2BKDN 2YSQA 4C5GA 4PJNA 4E7HA 3DB3A 2L5QA 1V29B 3C95A 2DIQA 2ZAEA 1JEGA 3LLRA 3F70A 3RKXA 1OQKA 3WXMB 4FU6A 3ULRB 2QEXT 2A0FB 2E64A 2E5QA 4JLGA 1OX8A 3EH1A
chains in the Genus database with same CATH topology
4ORZA 1KFZA 2L3PA 1UG1A 2LX7A 1UE9A 2RQWA 2FO0A 3PVQA 4RTWA 2EGAA 2EYXA 1K9AA 4AFUC 5IXFA 1FYNA 1NYFA 4OMPA 1X6BA 3H0FA 3NPFA 4CC4B 4J9GA 1HD3A 4WCIA 3SEMA 1SHGA 1BK2A 4RTTA 3PVLA 2LP5A 2CREA 1WLPB 2LJ3A 1T3LA 1RUWA 1KSWA 2JS0A 2KRSA 1PWTA 2O9SA 2EW3A 2BZXA 4E6RA 2RF0A 2F2WA 1M3BA 1OPLA 1RLQC 2HDAA 4JZ4A 5EC7A 2KE9A 1QCFA 3VS3A 2CSQA 2ECZA 1AZEA 3ZL7C 2F2VA 1NLOC 2P4RA 4K11A 4J9HA 2EYWA 4GLMA 2DRMA 2OI3A 1AEYA 3TSWA 1HJDA 1Y0MA 1NEGA 1VA7A 1I0CA 2HSPA 3QWXX 1PKTA 4Z88A 4AG1C 1YP5A 2VVKA 1RLPC 1E6HA 1VYUA 1H8KA 4IIOA 1SSHA 2J7IA 4ZNXA 1W70A 1GFCA 1WDXA 2J6KA 1U3OA 1W6XA 1GRIA 2JM8A 2LMJA 2HEQA 3I5SA 1PHTA 1PRMC 2KT8A 4X1VA 1AWJA 4J9DA 4OMMA 5ECAA 1SRMA 1U5SA 1M3CA 1M3AA 4JZ3A 2DL5A 2K7AA 2BZYA 1J3TA 4J9CA 2CUDA 4RTUA 5L23A 1AOJA 2CH4W 2LCSA 1XOVA 1GCQA 2K2MA 1AWXA 2GGRA 1GBQA 1FMKA 2EGCA 1M8MA 2L3SA 1JQQA 2V1RA 2RMOA 2DBKA 3CQTA 4J9BA 2C0OA 2PNIA 2O2OA 1X27A 1OV3A 2A37A 2KROA 2DBMA 1ZUYA 2FRWA 2C0TA 2XMFA 3KFVA 1SEMA 1NM7A 1ZX6A 1M30A 2FPFA 4RTYA 2D0NA 1WFWA 1AVZC 2D8HA 2JW4A 1BB9A 1VYTA 2DF6A 2OAWA 3EG1A 1MV0B 4A63B 1ZLMA 4DEYA 2LQWA 4Z89A 4HCKA 2YUOA 3FJ5A 2MIOA 2AKLA 2JT4A 1WXTA 1I07A 1ZBJA 2EYZA 3REBB 5IHKA 2ENMA 2K3BA 4KRTA 1PNJA 2KT1A 2DL3A 2JM9A 1ARKA 1GCQC 1WIEA 1JO8A 1K1ZA 1UECA 2I0NA 3EG3A 3EHQA 2FPEA 2ROTA 2JMCA 2HBWA 2JTEA 3JV3A 2GBQA 2FG0A 1ZUUA 2KGTA 2B86A 2KRNA 1H3HA 1U06A 2BZ8A 2C0IA 2W0ZA 2O31A 3EG0A 1UJYA 1K0SA 1UHFA 1A0NB 2JXBA 2DM1A 3O5ZA 1WXBA 2RQRA 2SRCA 1G83A 3QWYA 3UA7A 4J9IA 3H0HA 3UA6A 2KYMA 1YWOA 2EQIA 1W1FA 2F2XA 2GTOA 2A28A 3M0UA 2NUZA 3VS5A 2LNHB 1UFFA 4LE9A 4F16A 5FW9A 3EHRA 1PRLC 4OMNA 3EGUA 4RTVA 4AFSC 1Z9ZA 5IHNA 1T0HA 2YUPA 1HSQA 1WX6A 5IH2A 2D8JA 1E6GA 2X3WD 1CKBA 4LNPA 1WA7A 2ROLA 1NG2A 2K6DA 1UHCA 2GNCA 2RN8A 3VS1A 1AWWA 1OPKA 1ZUKA 2DRKA 3UF4A 1AWOA 4HVUA 1Y57A 2X3XD 1K0XA 1BU1A 3TVTA 1NEBA 4AFZC 5FWBA 1TUCA 1N5ZA 4QT7A 1YCSB 2ED0A 3LH5A 2W10A 2ABLA 1T0JA 5HCKA 2BTTA 1X43A 2KXDA 4HVWA 4D8DA 1UTIA 1X2KA 3C0CA 1V1CA 2DL7A 4JJDA 1AD5A 1NLPC 2AZVA 2DYBA 2DMOA 3A98A 2DNUA 2CDTA 2LZ6B 1QKXA 3H41A 3RBBB 4F17A 1UGVA 4OMOA 1BBZA 2H8HA 2AKKA 3I35A 3IQLA 2G6FX 3NMZC 2DVJA 4OMQA 3VRYA 1QLYA 1JU5C 2IIMA 4AFQC 1X6GA 1CSKA 1AZGB 2A08A 2M0YA 4LUDA 2HCKA 5IHIA 3M0SA 1QKWA 4D8KA 2FRYA 3H0IA 3M0QA 1UDLA 2YT6A 2KXCA 2FPDA 3GBQA 4OMLA 2ED1A 1NYGA 1ABQA 2LQNA 2JMAA 4GBQA 4RTXA 1CKAA 1PKSA 1UJ0A 3I9QA 1KIKA 1Z9QA 2CH4A 2K9GA 2CT3A 2J6FA 2MCNA 4AG2C 1WYXA 2DL8A 2M51A 4R0KA 2DA9A 2VWFA 5I22A 1M27C 4CC3A 2FEIA 3SHWA 2GTJA 2EPDA 4J9FA 1GL5A 1B3QA 2D1XA 4CC7A 1I1JA 1E7OA 2SEMA 4DEXA 2QDLA 2KR3A 4HXJA 2A36A 2JS2A 1LCKA 1GCPA 5GJVB 1ZSGA 3TSZA 1YNZA 2RQVA 2V1QA 4LN2A 3M0TA 1QWFA 1JXMA 1H92A 2RQUA 5I11A 4LUEA 2VKNA 2MOXA 2CT4A 3THKA 3RNJA 3U23A 1SHFA 1TG0A 1K4US 1B07A 3VS4A 2EGEA 2LJ1A 3R6NA 2PTKA 1RI9A 1OOTA 3VRZA 3VS6A 2ESWA 2KNBB 2OJ2A 3NGPA 5IXBA 2YDLA 4EIKA 2O9VA 2AK5A 2GQIA 2EYYA 3NHNA 1EFNA 1UUEA 2KEAA 2PZ1A 3M0RA 1K76A 4IIMA 1WXUA 1SPKA 4Y92A 1JXOA 4M4ZA 4F14A 1ABOA 3REAB 2CUBA 1GBRA 1GFDA 2KYBA 1YN8A 2EVRA 1SRLA 4RUGA 2YUNA 4RTZA 1TUDA 2EBPA 1OEBA 1T3SA 2CSIA 2YUQA 4JJCA 1KJWA 4J9EA 1X2QA 2E5KA 2DJQA 1X69A 2LJ0A 2L3QA 1G2BA 4HVVA 2KRMA 2J06A 2KBTA 2RPNA 2EKHA 2DE0X 2AZSA 2L2PA 4Z8AA 4JPBW 1YWPA 2DILA 1WI7A 2DX1A 5FWCA 2DL4A 3EG2A 3UATA 2NWMA 2DLPA 5GJWB 3VS7A 1VYVA 2K79A 3VS2A 4CC2A 1IO6A 2YSQA 2L0AA 3VS0A 3M0PA 4JJBA 2J05A 1QWEA 3I5RA 2RNAA 1JEGA 1S1NA 3PE0A 2O88A 3ULRB 1MV3A 2RQTA 4FSSA 4ESRA 2J6OA 1MUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORZ A;  1KFZ A;  2L3P A;  1UG1 A;  2LX7 A;  1UE9 A;  2RQW A;  2FO0 A;  3PVQ A;  4RTW A;  2EGA A;  2EYX A;  1K9A A;  4AFU C;  5IXF A;  1FYN A;  1NYF A;  4OMP A;  1X6B A;  3H0F A;  3NPF A;  4CC4 B;  4J9G A;  1HD3 A;  4WCI A;  3SEM A;  1SHG A;  1BK2 A;  4RTT A;  3PVL A;  2LP5 A;  2CRE A;  1WLP B;  2LJ3 A;  1T3L A;  1RUW A;  1KSW A;  2JS0 A;  2KRS A;  1PWT A;  2O9S A;  2EW3 A;  2BZX A;  4E6R A;  2RF0 A;  2F2W A;  1M3B A;  1OPL A;  1RLQ C;  2HDA A;  4JZ4 A;  5EC7 A;  2KE9 A;  1QCF A;  3VS3 A;  2CSQ A;  2ECZ A;  1AZE A;  3ZL7 C;  2F2V A;  1NLO C;  2P4R A;  4K11 A;  4J9H A;  2EYW A;  4GLM A;  2DRM A;  2OI3 A;  1AEY A;  3TSW A;  1HJD A;  1Y0M A;  1NEG A;  1VA7 A;  1I0C A;  2HSP A;  3QWX X;  1PKT A;  4Z88 A;  4AG1 C;  1YP5 A;  2VVK A;  1RLP C;  1E6H A;  1VYU A;  1H8K A;  4IIO A;  1SSH A;  2J7I A;  4ZNX A;  1W70 A;  1GFC A;  1WDX A;  2J6K A;  1U3O A;  1W6X A;  1GRI A;  2JM8 A;  2LMJ A;  2HEQ A;  3I5S A;  1PHT A;  1PRM C;  2KT8 A;  4X1V A;  1AWJ A;  4J9D A;  4OMM A;  5ECA A;  1SRM A;  1U5S A;  1M3C A;  1M3A A;  4JZ3 A;  2DL5 A;  2K7A A;  2BZY A;  1J3T A;  4J9C A;  2CUD A;  4RTU A;  5L23 A;  1AOJ A;  2CH4 W;  2LCS A;  1XOV A;  1GCQ A;  2K2M A;  1AWX A;  2GGR A;  1GBQ A;  1FMK A;  2EGC A;  1M8M A;  2L3S A;  1JQQ A;  2V1R A;  2RMO A;  2DBK A;  3CQT A;  4J9B A;  2C0O A;  2PNI A;  2O2O A;  1X27 A;  1OV3 A;  2A37 A;  2KRO A;  2DBM A;  1ZUY A;  2FRW A;  2C0T A;  2XMF A;  3KFV A;  1SEM A;  1NM7 A;  1ZX6 A;  1M30 A;  2FPF A;  4RTY A;  2D0N A;  1WFW A;  1AVZ C;  2D8H A;  2JW4 A;  1BB9 A;  1VYT A;  2DF6 A;  2OAW A;  3EG1 A;  1MV0 B;  4A63 B;  1ZLM A;  4DEY A;  2LQW A;  4Z89 A;  4HCK A;  2YUO A;  3FJ5 A;  2MIO A;  2AKL A;  2JT4 A;  1WXT A;  1I07 A;  1ZBJ A;  2EYZ A;  3REB B;  5IHK A;  2ENM A;  2K3B A;  4KRT A;  1PNJ A;  2KT1 A;  2DL3 A;  2JM9 A;  1ARK A;  1GCQ C;  1WIE A;  1JO8 A;  1K1Z A;  1UEC A;  2I0N A;  3EG3 A;  3EHQ A;  2FPE A;  2ROT A;  2JMC A;  2HBW A;  2JTE A;  3JV3 A;  2GBQ A;  2FG0 A;  1ZUU A;  2KGT A;  2B86 A;  2KRN A;  1H3H A;  1U06 A;  2BZ8 A;  2C0I A;  2W0Z A;  2O31 A;  3EG0 A;  1UJY A;  1K0S A;  1UHF A;  1A0N B;  2JXB A;  2DM1 A;  3O5Z A;  1WXB A;  2RQR A;  2SRC A;  1G83 A;  3QWY A;  3UA7 A;  4J9I A;  3H0H A;  3UA6 A;  2KYM A;  1YWO A;  2EQI A;  1W1F A;  2F2X A;  2GTO A;  2A28 A;  3M0U A;  2NUZ A;  3VS5 A;  2LNH B;  1UFF A;  4LE9 A;  4F16 A;  5FW9 A;  3EHR A;  1PRL C;  4OMN A;  3EGU A;  4RTV A;  4AFS C;  1Z9Z A;  5IHN A;  1T0H A;  2YUP A;  1HSQ A;  1WX6 A;  5IH2 A;  2D8J A;  1E6G A;  2X3W D;  1CKB A;  4LNP A;  1WA7 A;  2ROL A;  1NG2 A;  2K6D A;  1UHC A;  2GNC A;  2RN8 A;  3VS1 A;  1AWW A;  1OPK A;  1ZUK A;  2DRK A;  3UF4 A;  1AWO A;  4HVU A;  1Y57 A;  2X3X D;  1K0X A;  1BU1 A;  3TVT A;  1NEB A;  4AFZ C;  5FWB A;  1TUC A;  1N5Z A;  4QT7 A;  1YCS B;  2ED0 A;  3LH5 A;  2W10 A;  2ABL A;  1T0J A;  5HCK A;  2BTT A;  1X43 A;  2KXD A;  4HVW A;  4D8D A;  1UTI A;  1X2K A;  3C0C A;  1V1C A;  2DL7 A;  4JJD A;  1AD5 A;  1NLP C;  2AZV A;  2DYB A;  2DMO A;  3A98 A;  2DNU A;  2CDT A;  2LZ6 B;  1QKX A;  3H41 A;  3RBB B;  4F17 A;  1UGV A;  4OMO A;  1BBZ A;  2H8H A;  2AKK A;  3I35 A;  3IQL A;  2G6F X;  3NMZ C;  2DVJ A;  4OMQ A;  3VRY A;  1QLY A;  1JU5 C;  2IIM A;  4AFQ C;  1X6G A;  1CSK A;  1AZG B;  2A08 A;  2M0Y A;  4LUD A;  2HCK A;  5IHI A;  3M0S A;  1QKW A;  4D8K A;  2FRY A;  3H0I A;  3M0Q A;  1UDL A;  2YT6 A;  2KXC A;  2FPD A;  3GBQ A;  4OML A;  2ED1 A;  1NYG A;  1ABQ A;  2LQN A;  2JMA A;  4GBQ A;  4RTX A;  1CKA A;  1PKS A;  1UJ0 A;  3I9Q A;  1KIK A;  1Z9Q A;  2CH4 A;  2K9G A;  2CT3 A;  2J6F A;  2MCN A;  4AG2 C;  1WYX A;  2DL8 A;  2M51 A;  4R0K A;  2DA9 A;  2VWF A;  5I22 A;  1M27 C;  4CC3 A;  2FEI A;  3SHW A;  2GTJ A;  2EPD A;  4J9F A;  1GL5 A;  1B3Q A;  2D1X A;  4CC7 A;  1I1J A;  1E7O A;  2SEM A;  4DEX A;  2QDL A;  2KR3 A;  4HXJ A;  2A36 A;  2JS2 A;  1LCK A;  1GCP A;  5GJV B;  1ZSG A;  3TSZ A;  1YNZ A;  2RQV A;  2V1Q A;  4LN2 A;  3M0T A;  1QWF A;  1JXM A;  1H92 A;  2RQU A;  5I11 A;  4LUE A;  2VKN A;  2MOX A;  2CT4 A;  3THK A;  3RNJ A;  3U23 A;  1SHF A;  1TG0 A;  1K4U S;  1B07 A;  3VS4 A;  2EGE A;  2LJ1 A;  3R6N A;  2PTK A;  1RI9 A;  1OOT A;  3VRZ A;  3VS6 A;  2ESW A;  2KNB B;  2OJ2 A;  3NGP A;  5IXB A;  2YDL A;  4EIK A;  2O9V A;  2AK5 A;  2GQI A;  2EYY A;  3NHN A;  1EFN A;  1UUE A;  2KEA A;  2PZ1 A;  3M0R A;  1K76 A;  4IIM A;  1WXU A;  1SPK A;  4Y92 A;  1JXO A;  4M4Z A;  4F14 A;  1ABO A;  3REA B;  2CUB A;  1GBR A;  1GFD A;  2KYB A;  1YN8 A;  2EVR A;  1SRL A;  4RUG A;  2YUN A;  4RTZ A;  1TUD A;  2EBP A;  1OEB A;  1T3S A;  2CSI A;  2YUQ A;  4JJC A;  1KJW A;  4J9E A;  1X2Q A;  2E5K A;  2DJQ A;  1X69 A;  2LJ0 A;  2L3Q A;  1G2B A;  4HVV A;  2KRM A;  2J06 A;  2KBT A;  2RPN A;  2EKH A;  2DE0 X;  2AZS A;  2L2P A;  4Z8A A;  4JPB W;  1YWP A;  2DIL A;  1WI7 A;  2DX1 A;  5FWC A;  2DL4 A;  3EG2 A;  3UAT A;  2NWM A;  2DLP A;  5GJW B;  3VS7 A;  1VYV A;  2K79 A;  3VS2 A;  4CC2 A;  1IO6 A;  2YSQ A;  2L0A A;  3VS0 A;  3M0P A;  4JJB A;  2J05 A;  1QWE A;  3I5R A;  2RNA A;  1JEG A;  1S1N A;  3PE0 A;  2O88 A;  3ULR B;  1MV3 A;  2RQT A;  4FSS A;  4ESR A;  2J6O A;  1MUZ A; 
#chains in the Genus database with same CATH topology
 2L3P A;  1UG1 A;  3PIO A;  3WVD B;  3ZEH A;  2QGF B;  4ANJ A;  1FMW A;  4FT4 A;  3MO8 A;  4XTU A;  4GLK A;  3L42 A;  4M78 A;  2GFA A;  1OX9 A;  4JRK A;  2EJG A;  4M77 A;  4AFU C;  2R58 A;  5IXF A;  1FYN A;  2E10 A;  1U8R A;  2QTV A;  2QEX Q;  1LVK A;  2LCC A;  9ATC B;  7AT1 B;  3GIB A;  4PKC C;  1PSE A;  4FIB A;  1M4Z A;  4RTT A;  3PVL A;  1WLP B;  1T3L A;  3V8K A;  3OQ5 A;  1RUW A;  4F7U F;  5KCO A;  2KRS A;  1RAA B;  2PUO B;  2L8D A;  2MPX C;  1Q7Y U;  1KQ2 A;  4M78 B;  4E6R A;  1R77 A;  2E4H A;  2F2W A;  2RF0 A;  1M3B A;  2EYQ A;  4M77 B;  3X28 B;  4JZ4 A;  2HDA A;  2DTI A;  3LYI A;  2X35 A;  4C8Q B;  5LJ5 h;  5GAO n;  2ECZ A;  2RI2 A;  4PLI A;  4M78 C;  2F2V A;  2YWW A;  4BE2 A;  3JB9 H;  4BI3 A;  3RIR A;  5GAO p;  1M90 U;  2RK1 A;  4M77 C;  2LT1 A;  2DYI A;  4M78 F;  3TSW A;  1HJD A;  2RHI A;  1Y0M A;  2P84 A;  2WSC E;  3M5A A;  3CCE T;  1QVP A;  2QQB A;  1RLP C;  1E6H A;  4XQ3 A;  2IPO B;  4LD9 K;  2J7I A;  5GAN h;  2FZK B;  4C5H A;  1W70 A;  3UPU A;  2CKK A;  4M7D G;  1TU0 B;  3PTA A;  1PCX A;  1W6X A;  1Q81 U;  3MKD A;  3V7R A;  1K73 R;  3I5S A;  4IUT A;  1IGQ A;  2ZPE B;  2RHY A;  1AWJ A;  1SRM A;  2XDP A;  1U5S A;  4LDU A;  3BDL A;  1O9S A;  1M3A A;  1VQ7 Q;  1QP3 A;  3EG9 A;  1MGQ A;  2K7A A;  1QVF P;  1WQW A;  1AHJ B;  4RTU A;  1I5O B;  4A4E A;  1YIJ A;  1GCQ A;  2ATC B;  4M77 D;  1G8X A;  1SG5 A;  2V1R A;  4C92 G;  4C8Q D;  2AIR B;  3SWN B;  3BE3 A;  4JJN K;  5EG2 A;  3CQT A;  3M4Y A;  4J9B A;  2QK0 A;  4JLI A;  5DY9 A;  2O2O A;  5CKB A;  1D0Y A;  1RAD B;  1X27 A;  2A37 A;  2DBM A;  2FRW A;  5LJ5 g;  5LJ3 h;  2RJD A;  3UWN A;  1QVF A;  3SWN C;  2KQW A;  3JCM b;  2RHZ A;  1WFW A;  3OYF A;  2COZ A;  3EG9 B;  1N9S A;  2DF6 A;  1WJR A;  3EG1 A;  1MV0 B;  3FLG A;  3P8D A;  3CBP A;  5KYN A;  3REB B;  5GAN g;  4BAC A;  3CMA T;  3LWI A;  3A8H B;  4HT8 A;  1RAE B;  4XTX A;  3OYB A;  1GCQ C;  3JSC A;  2K2V A;  1JO8 A;  2E70 A;  1Q86 C;  1G5V A;  4LDX A;  2QA4 A;  3L2Q A;  2HBW A;  2GBQ A;  3CCQ T;  2YRD A;  4BDZ A;  1KC8 C;  2C0I A;  3CMA Q;  3SD4 A;  3V8J A;  3CCR T;  1UJY A;  2LX9 A;  4HA8 A;  3HRT A;  1VIF A;  1MNE A;  4OB3 B;  1IRE B;  3G7Z A;  3O5Z A;  3CXC S;  3QWY A;  4J9I A;  3VYH B;  5LJ3 g;  3JCM d;  3UA6 A;  3CCQ Q;  1XJW B;  5HK3 A;  3JB9 J;  3M0U A;  3VS5 A;  1N27 A;  2VXE A;  2RI5 A;  4Q5W A;  4RTV A;  2OTL A;  5GAN 3;  1ZA2 B;  5IHN A;  3J7A F;  2FYK A;  3M56 A;  4EMH A;  2YUP A;  1MND A;  5CKE A;  1WX6 A;  2XD0 A;  4PFO A;  3RUX A;  1WA7 A;  1NG2 A;  1Y96 B;  3CME T;  1AWW A;  2RK2 A;  4A53 A;  3CBO A;  2X3X D;  4DA4 A;  1EZZ B;  1WGS A;  2RH2 A;  4XU3 A;  1K73 U;  3JCM Q;  4Y91 A;  5GAN 2;  1YCS B;  1W2B A;  2CYZ B;  4OMF B;  1M1G A;  2CP5 A;  5C6S A;  1X43 A;  1G3W A;  2FHD A;  2KXD A;  5IT9 E;  3CME Q;  3P8H A;  3I55 T;  3CC2 Q;  3C0C A;  1YHQ A;  3OS5 A;  3CC2 A;  3RER A;  2OTJ A;  1NLP C;  2DYB A;  3JCM J;  2IVW A;  2CDT A;  3CCM T;  3QBY A;  4F17 A;  5CIU A;  2X4Y A;  1BBZ A;  2FZG B;  3JB9 D;  3NMZ C;  4FM4 B;  2DVJ A;  2NUT A;  4LUD A;  3M54 A;  3CCL T;  4E7S A;  2BIV A;  4ZTF A;  1VQ9 A;  2FRY A;  4X9C A;  2X51 A;  2JVV A;  4P5N A;  2MAM A;  1UDL A;  1ZQ1 A;  1OZ3 A;  3OYY A;  1TOV A;  1NYG A;  3S6W A;  4C92 F;  3KXT A;  1CKA A;  1PKS A;  1Z9Q A;  2CH4 A;  1BI3 A;  2K9G A;  2CT3 A;  1RAF B;  2MCN A;  4AG2 C;  1WYX A;  2DL8 A;  3CCL Q;  2A7Y A;  2FL7 A;  4R0K A;  2K3X A;  1M27 C;  4L6V 5;  2NUT B;  8AT1 B;  3CC4 T;  3H9N A;  2CP7 A;  3MJX A;  1VQP T;  3UT1 A;  1E7O A;  1MMD A;  4HXJ A;  5KE2 A;  1GCP A;  2KI7 A;  3C12 A;  5GAO m;  1C1A A;  5GJV B;  6AT1 B;  1YNZ A;  1HYO A;  1VUB A;  2DIG A;  5CO7 A;  3BW1 A;  2RQU A;  3DB4 A;  3HPW A;  2YRV A;  3EH2 A;  3CC4 Q;  4PFP A;  3JCM X;  1OU9 A;  1VQP Q;  2GCX A;  2XID A;  1K4U S;  4CI0 C;  3JCM h;  2A3L A;  4M78 E;  3LGF A;  1KD1 C;  5D6W A;  2EJF A;  4M77 E;  2YXY A;  2ESW A;  2EWN A;  2X9H A;  1KQ1 A;  2GF7 A;  4EIK A;  2GQI A;  2EYY A;  4E7Z A;  1UUE A;  2PZ1 A;  1K76 A;  1VQM A;  5CVI A;  4B6M A;  3OS0 A;  5GMK e;  2YHT A;  1YN8 A;  4OVA A;  3QDF A;  1SRL A;  3CCU T;  3TU4 K;  1TUD A;  3C94 A;  3JB9 I;  4C0G A;  2L3Q A;  3G71 T;  3TEE A;  4Z8A A;  3GLX A;  3RDV A;  2ZPI B;  4JPB W;  3GNG A;  1YWP A;  2DIL A;  5FU7 B;  3L2U A;  1WI7 A;  2LQ8 A;  4PJJ A;  1VQK A;  1VQO T;  3L2W A;  2F5K A;  3OB9 A;  5FU7 C;  1VQ4 Q;  3I56 Q;  1D1C A;  3I56 A;  3JCM g;  1S1N A;  4IUR A;  3A1P A;  4WF2 A;  2PVO B;  3G71 Q;  3RMS A;  1D0Z A;  1IRX A;  4LNP A;  3OYN A;  2PUK B;  5I21 A;  1YJW T;  4ORZ A;  4JUV A;  1KFZ A;  2LX7 A;  1M8V A;  4KGZ B;  2HL3 A;  1NJI R;  2FO0 A;  3QO3 A;  2EGA A;  2EYX A;  2JTM A;  1B7T A;  4NL2 A;  3EFS A;  3OS1 A;  4M75 G;  1NYF A;  4OMP A;  5FRM A;  1X6B A;  3H0F A;  1UGR B;  3HFO A;  2XHC A;  2DZ9 A;  1YJW Q;  4J5Y A;  1BK2 A;  1S72 T;  4PJO B;  4II1 A;  2EAY A;  1Q7Y C;  1JJ2 P;  4M7A A;  1PWT A;  1JRI A;  4OGC A;  3OYI A;  1H3Z A;  4PJO C;  5GMK l;  3H8Z A;  3CD6 T;  4C8Q G;  2HL5 C;  4XTZ A;  1WHH A;  1M90 C;  2KE9 A;  5J26 A;  2HQH A;  3OMC A;  2EFI A;  3VS3 A;  1M90 R;  2DPP B;  3ZL7 C;  1VQ6 A;  1NLO C;  4QVZ A;  3G4S T;  4J9H A;  4RCC A;  1TTH B;  2EYW A;  3CXC A;  3URG A;  1BI2 A;  1VA7 A;  2OAU A;  1I0C A;  2Y4Y A;  3QWX X;  1U1T A;  4ZN3 A;  3V8L A;  4AG1 C;  4IKF A;  2Y4X A;  4NL3 A;  2DAQ A;  4ZGE B;  1YJN Q;  4M7A B;  3MEV A;  2LC4 A;  1H8K A;  2QAZ A;  1Q81 C;  1D3B A;  2EQU A;  3OSV A;  1YI2 Q;  2M02 A;  2XK0 A;  1YI2 A;  2LMJ A;  2JM8 A;  4M7A C;  3G4S Q;  3CC7 Q;  2CZ7 B;  3CPF A;  4PJO D;  1PRM C;  3CC7 A;  4HT9 A;  4J9D A;  4OMM A;  1HXD A;  2NLU A;  3WVE B;  2E12 A;  4JZ3 A;  2DL5 A;  2RJF A;  3X24 B;  4A4F A;  1B34 B;  3A8G B;  3CEY A;  2CUD A;  2K2M A;  2ZGW A;  3LH0 A;  3R6O A;  4KGX B;  1TS9 A;  1JQQ A;  1BCO A;  4F7U A;  1D3B B;  2PU9 B;  4V2S A;  3BFM A;  2PNI A;  1MMA A;  2P0P A;  4DQ2 A;  2KRO A;  1ZUY A;  1SEM A;  4FYY B;  1NM7 A;  1BCM A;  2LCL A;  2VAS A;  1OZ2 A;  1YIT A;  2JW4 A;  1BB9 A;  4M7A D;  3HRS A;  1PD0 A;  4IUV A;  1NJI U;  2YUO A;  1WXT A;  1IB8 A;  1M1K U;  1ZBJ A;  1PNJ A;  4F7U B;  4HKE A;  2DL3 A;  1K8A R;  2CZ1 B;  3JCM V;  3OW2 P;  2JOY A;  4KH1 B;  1WIE A;  3S3M A;  1K1Z A;  1UEC A;  3VKI A;  2FPE A;  3QXE B;  2ROT A;  4LXC A;  2JTE A;  3JV3 A;  1RAB B;  2DD5 A;  1ZUU A;  1KK7 A;  4PK4 A;  2VC8 A;  2R57 A;  4FW1 A;  1YBY A;  1R8O B;  1VQN A;  2W0Z A;  5LL6 S;  4BB7 A;  4BE1 A;  1OYX A;  1K0S A;  3NFC A;  2JXB A;  2RJC A;  4MML A;  2WAC A;  1R0C B;  1KQS P;  2KYM A;  2QGG A;  1VQL Q;  2R5M A;  3OBW A;  4KT0 E;  2EQI A;  1W1F A;  2GTO A;  4QVC A;  3CCS Q;  1VQL A;  4F16 A;  4ZGD B;  5FW9 A;  3CCS A;  3QPH A;  3JB9 G;  5L8R E;  4OMN A;  3EGU A;  1TSF A;  1VQ7 T;  4AFS C;  3VUZ A;  3CPW P;  1T0H A;  1WHL A;  1YIJ T;  1X01 A;  2D8J A;  5HY6 A;  1CKB A;  1PG5 B;  3G6E A;  1K73 C;  2K6D A;  1UHC A;  5A0L A;  1OPK A;  5J3B A;  5HK0 A;  1AWO A;  3DKM A;  1K0X A;  3TVT A;  3PT9 A;  1WJQ A;  3M59 A;  5DLO A;  1NEB A;  4AFZ C;  5FWB A;  1TUC A;  1N5Z A;  2NYS A;  1UGQ B;  3EGD A;  5KE3 A;  1YIJ Q;  1WQ7 A;  1T0J A;  4M78 D;  2BTT A;  5CR2 A;  4QW2 A;  1SSF A;  3C4S A;  1AD5 A;  4XTY A;  1IZ6 A;  1Q82 R;  2HMA A;  1QW1 A;  2DFU A;  3HP9 A;  4FCY A;  1Y71 A;  4DOV A;  4BDY A;  1UGV A;  4OMO A;  3OMG A;  2H8H A;  4AMC A;  1NPR A;  4LDV A;  4DBH A;  3EGD B;  3VRY A;  1JU5 C;  4AFQ C;  1R0B G;  2HKN A;  4OB2 B;  5GMK j;  4RMO A;  4QQG A;  4D8K A;  1N6A A;  3H0I A;  3OY9 A;  4EMK A;  2YT6 A;  3MET A;  2XKO C;  2ED1 A;  1K8A U;  2LQN A;  2JMA A;  4GBQ A;  4AT1 B;  4E2F B;  4KBM B;  2QA4 Q;  5LJ5 f;  5KCH A;  1UJ0 A;  3I9Q A;  1C0M A;  2J6F A;  2X4X A;  2DA9 A;  2VWF A;  2EPD A;  4J9F A;  1GL5 A;  2OTL T;  1B3Q A;  4FT2 A;  4HCB A;  3RKW A;  2CP2 A;  5GAN f;  2KR3 A;  3MHX A;  1JJ2 S;  4EMK B;  2JS2 A;  1LCK A;  3OYK A;  3QSU A;  3TSZ A;  5M9O A;  4PJO E;  3JCM W;  2HNI A;  1IHV A;  1QWF A;  1JXM A;  1G3T A;  1H92 A;  2BUD A;  2P0Q A;  4EMK C;  2VKN A;  2DET A;  2OTL Q;  3THK A;  1SHF A;  2BE9 B;  2M0O A;  4M7D A;  1MHN A;  2DD4 A;  3V7C A;  2DJZ A;  1YJ9 Q;  1RI9 A;  1FMV A;  2MI6 A;  1YJ9 A;  2Y90 A;  1QVG P;  5IXB A;  4N4I A;  1YHQ T;  2O9V A;  3CC2 T;  5GAN 4;  3NHN A;  2OTJ T;  3HFN A;  1IGU A;  1EFN A;  3JCM P;  4IIM A;  5IN1 A;  1PC0 A;  5FRO A;  3J80 E;  2P0K A;  3REA B;  1FWZ A;  2DKG A;  4M7A E;  3QUI A;  4C92 A;  1OU8 A;  2JZ2 A;  2E65 A;  3FEO A;  2FZC B;  4M7D B;  2EBP A;  1T3S A;  2YUQ A;  1YHQ Q;  4ATO A;  2D6F A;  3VUB A;  1VQ9 T;  2OTJ Q;  5A0D A;  3CCJ A;  4HVV A;  2J06 A;  2KBT A;  2RPN A;  4M7D C;  3BY7 A;  3T9N A;  1Q82 U;  3FIF A;  5FWC A;  4M7D F;  4LD6 A;  4NOY A;  2D0Q B;  3EFR A;  2O4X A;  2K79 A;  3PMT A;  2CP0 A;  3VS0 A;  5A2Q E;  3M0P A;  4X9D A;  1QQJ A;  2H3E B;  3E19 A;  1VQ9 Q;  1WZO A;  4BI8 B;  1KHI A;  4C92 B;  1VQ5 A;  1QWE A;  3PE0 A;  2LDM A;  1I81 A;  4UC4 A;  4C0Z A;  2RJE A;  4KH0 B;  3RES A;  2J6O A;  1MUZ A;  4C92 C;  1UE9 A;  2RQW A;  1I4K 1;  1XNI A;  2QQ9 A;  3PVQ A;  3QKJ A;  4RTW A;  4BE0 A;  2KAF A;  5KYU A;  1WHM A;  5GMK i;  1K9A A;  1M5Q 1;  2O4X B;  1BIA A;  2XDB A;  1TH7 A;  3GF5 A;  3OW2 S;  3SB2 A;  4MZM A;  2DO3 A;  4PJO G;  3SEM A;  2NUP A;  3GOX A;  4F7U E;  1VQ8 Q;  2LT4 A;  3M57 A;  5I2M A;  1VQ8 A;  2LP5 A;  2CRE A;  1QCO A;  2M16 A;  4JS4 A;  2DXB A;  2JS0 A;  4J7I A;  2EW3 A;  1P92 A;  1RI0 A;  1VQM T;  1BIB A;  5KYU B;  4YTL A;  4C92 D;  3L1A A;  2O01 E;  1OPL A;  4XAX B;  5GAM e;  4MZT A;  5EC7 A;  1KQS S;  3L2V A;  3GNF B;  2H3J A;  2HKQ B;  2CP6 A;  1AZE A;  2QQS A;  2NUP B;  4K11 A;  5KYY A;  2KVQ G;  4GLM A;  2DRM A;  2E41 A;  2RHX A;  3X20 B;  3Q1J A;  1NEG A;  4BUG A;  1N8R R;  4JRI A;  1VQM Q;  3HSB A;  1YP5 A;  2VVK A;  3CPW S;  5FRN A;  1JB0 E;  1LNX A;  4IIO A;  1SSH A;  3EGX A;  4ZNX A;  5GMK m;  1VQK T;  2JN0 A;  3DLM A;  2J6K A;  1U3O A;  3PFS A;  2HEQ A;  3N5B B;  2DXT A;  2KT8 A;  3I56 T;  1VQ4 T;  1X6O A;  5ECA A;  3D7S B;  2VXF A;  2V8K A;  2CS7 A;  1YCY A;  2BZY A;  2K5L A;  2EJ9 A;  2L3R A;  4OP0 A;  5L23 A;  1AOJ A;  2LCS A;  1VQK Q;  2ZPH B;  3A8L B;  2GGR A;  1GBQ A;  1FMK A;  1M8M A;  2L3S A;  2JTF A;  4DBR A;  2RMO A;  1IXD A;  2DBK A;  2EQK A;  2OX7 A;  1OV3 A;  3KFV A;  5J39 A;  2C0T A;  2QG9 B;  4FYW B;  2AHJ B;  3ZFJ A;  1ZX6 A;  2DK3 A;  1QCN A;  2ZPF B;  1AVZ C;  2D8H A;  1NJI C;  1LOJ A;  1VYT A;  2OAW A;  4O5V A;  1ZLM A;  4DEY A;  2KDS A;  4Z89 A;  1M1K R;  1U1S A;  3CCV A;  3X26 B;  4MZP A;  3VYG A;  1NPP A;  4E7J A;  2JT4 A;  3QG1 A;  1BI0 A;  1I07 A;  5IHK A;  2XI9 A;  4N0A A;  2K3B A;  4KRT A;  3ME9 A;  2KT1 A;  3A5Z B;  2X4W A;  1JBM A;  1ARK A;  3OYD A;  3NTK A;  3BDU A;  4PFZ A;  3EG3 A;  1O75 A;  2M1H A;  1AT1 B;  3OYA A;  1VQ6 T;  2G3R A;  4GY5 A;  2FG0 A;  3OA6 A;  1H3H A;  1U06 A;  2BZ8 A;  5CCA A;  4M78 G;  2E1H A;  4M77 G;  5GMK h;  3E1S A;  8ATC B;  4J6Y A;  1IHW A;  1YJN T;  1UHF A;  1UGS B;  2V8I A;  2DM1 A;  1VQ6 Q;  4ELY C;  2RQR A;  1YI2 T;  1TXQ A;  1JJ2 A;  1WHK A;  1K9M R;  3CC7 T;  4N0A C;  1UFF A;  1X75 C;  4E7I A;  3M55 A;  2KY9 A;  2V8J A;  1N8R U;  1UB4 A;  1Z9Z A;  4RKU E;  3OYH A;  3S3O A;  2ZPB B;  5KYW A;  1HSQ A;  4FL6 A;  3KUF A;  4A4K A;  1QVG S;  3HHT B;  1M9S A;  2ROL A;  2R5A A;  2GNC A;  2RN8 A;  3VS1 A;  1ZUK A;  3UF4 A;  2DER A;  4HVU A;  1Y57 A;  5CK9 A;  2PVG B;  2FVU A;  4QT7 A;  4XTW A;  2W10 A;  4ZGJ B;  1RAC B;  1YIT T;  5GAM f;  1F1B B;  3FC3 A;  5LJ5 e;  4HVW A;  4RG2 A;  1PM3 A;  4D8D A;  5KYW B;  1M1F A;  2V26 A;  1RAI B;  1X2K A;  2HQX A;  3TCJ A;  1V1C A;  2DL7 A;  1YFN A;  2K5I A;  2AZV A;  4M7D E;  3FB9 A;  4JRQ A;  2M9U A;  4C0D B;  5A0G A;  3H41 A;  3RBB B;  1YIT Q;  5GAN e;  3HKS A;  3IQL A;  1DJ7 B;  2G6F X;  5GAN 6;  3LGL A;  3OS2 A;  2QAS A;  4C0D C;  4R56 A;  1X6G A;  1AZG B;  4M75 A;  2A08 A;  2M0Y A;  2HCK A;  1QKW A;  3AHU A;  3OYG A;  1VQN T;  2DEQ A;  3M0Q A;  5GAN 5;  1K8A C;  3JAM E;  2FPD A;  4C92 E;  2DVE A;  4OML A;  2VUB A;  1M2O A;  4C5I A;  2QXF A;  1WPY A;  1ABQ A;  4IUQ A;  2E6Z A;  4J6W A;  1HK9 A;  1KG1 A;  1VQL T;  2M51 A;  2HD0 A;  3CCS T;  5I22 A;  1VQN Q;  4C8Q A;  1LPL A;  4CC3 A;  4L5G A;  2AT1 B;  2GTJ A;  2QEX A;  4M75 B;  2CGH A;  5LJ3 e;  2D1X A;  2RD1 A;  2HQE A;  3OW2 A;  3OYM A;  2SEM A;  3VU3 C;  4DEX A;  2A36 A;  3G6E T;  2HSE B;  4M75 C;  1ZSG A;  2RQV A;  5D7U A;  3S3N A;  3M0T A;  2BE7 D;  4J6X A;  4M75 F;  2LTO A;  3LW5 E;  5I11 A;  4LUE A;  1K9M U;  4DBQ A;  4PJM A;  2F5T X;  2DXC A;  1BKB A;  1TG0 A;  1B07 A;  3VS4 A;  2EGE A;  1VIE A;  2LJ1 A;  2XU8 A;  2PTK A;  3G6E Q;  3VRZ A;  2PVD B;  1XTD A;  1KQS A;  2OJ2 A;  3NGP A;  2F69 A;  4IUU A;  2YDL A;  4C8Q C;  4M77 F;  2XIC A;  5CAI A;  2KEA A;  3KBG A;  3M0R A;  4C8Q F;  1ZSZ A;  1SPK A;  4Y92 A;  2MMP A;  2ZPG B;  1JXO A;  2VGM A;  2KMT A;  4M4Z A;  2MWO A;  3SWN A;  4ZN1 A;  3QII A;  3CPW A;  1ABO A;  3G1J A;  3QDR B;  1GFD A;  1UEB A;  2KYB A;  4M75 D;  5KYX A;  2EVR A;  1I5L A;  4RUG A;  3A8M B;  2YUN A;  4RTZ A;  1OEB A;  2ZCF B;  3CCE Q;  1RAG B;  4L59 A;  5GAM j;  4FSX A;  4J9E A;  1Q82 C;  4NS5 A;  3CCE A;  2E5K A;  1X69 A;  1WNL A;  2LJ0 A;  2KRM A;  1VQ7 A;  2EKH A;  2QYZ A;  2AZS A;  1WHJ A;  3OBY A;  2DX1 A;  3UAT A;  2NWM A;  1ZSZ B;  3VS7 A;  1VYV A;  2L0A A;  2Z0W A;  3QYG B;  2QA4 T;  3PGG A;  4JJB A;  1ZBX A;  4ME7 A;  2COW A;  2J05 A;  5GAO q;  1EX4 A;  5KYX B;  3I5R A;  1D1A A;  2RNA A;  1ZSZ C;  2D9T A;  4B9W A;  2O88 A;  5CKD A;  1MV3 A;  2RQT A;  4FSS A;  4ESR A;  2I2L A;  1XQH A;  1SKU B;  3MEW A;  2RO0 A;  3QZ9 B;  4Z02 A;  2YLC A;  1QP2 A;  3MP6 A;  3M4G A;  3TRE A;  1G3S A;  5IAY A;  3M9Q A;  4E7L A;  2ZZD A;  4F04 B;  4OB0 B;  3NPF A;  4CC4 B;  4J9G A;  1D09 B;  1HD3 A;  4WCI A;  2GFU A;  1OI1 A;  4JS5 A;  1NE8 A;  1SHG A;  3VV0 A;  5CQX A;  1Q86 R;  2LJ3 A;  1YJ9 T;  4DBF A;  1KSW A;  4RG8 A;  2O9S A;  4FYV B;  3O8V A;  1KC8 R;  3CMA A;  2BZX A;  2PQW A;  1Y96 A;  4EMG A;  1RLQ C;  3HTR A;  4DOW A;  1QCF A;  3L2R A;  4KGV B;  1PD1 A;  5FU6 B;  5HKC A;  2CSQ A;  2KK4 A;  4A4H A;  3EAE A;  4OGE A;  2P4R A;  5CQY A;  3J81 E;  3H6Z A;  3CCQ A;  2KSS A;  2OI3 A;  1AEY A;  2K3Y A;  1NBE B;  2HSP A;  4PNO A;  3CCJ T;  3CCR Q;  2HZY A;  5FU6 C;  4MMK A;  4C5E A;  1PKT A;  4Z88 A;  3CCR A;  2EIF A;  4E47 A;  1W2B P;  1VYU A;  3INZ A;  4O6J A;  4RCB A;  5LJ3 f;  5KH6 A;  1C6V X;  1FXX A;  4A54 A;  3FJP A;  1GFC A;  1WDX A;  2K5F A;  2X4J A;  2DTO A;  4JDS A;  1GRI A;  3ER0 A;  3FRN A;  1QVG A;  1PHT A;  4HCZ A;  4X1V A;  1VQ5 T;  3JB9 F;  3CCJ Q;  5DLQ E;  4LDY A;  4A4G A;  3RMQ A;  1M3C A;  1ZHI A;  1KHC A;  1VOM A;  1J3T A;  2EQM A;  4J9C A;  3MEA A;  5D6Y A;  2CH4 W;  2RM4 A;  1XOV A;  1BI1 A;  1AWX A;  3JCM e;  3TQ7 P;  2EGC A;  3CME A;  1V76 A;  1VQ5 Q;  2C0O A;  5GJW B;  2XMF A;  3FDR A;  2DZC A;  1M2V A;  4J8O A;  5D6X A;  3V7S A;  2RA2 A;  4PLL A;  1M30 A;  2FPF A;  4RTY A;  2D0N A;  2RB6 A;  2MYS A;  5GAM d;  5I2S A;  1VQ8 T;  1GXI E;  2CP3 A;  3I55 Q;  4A63 B;  2LQW A;  3I55 A;  3E2U A;  4HCK A;  3FJ5 A;  2YLB A;  3MP1 A;  2MIO A;  2AKL A;  5CKF A;  3RR6 A;  4BY6 B;  2EYZ A;  2JJ9 A;  2LQK A;  2ENM A;  4KUI A;  4M7D D;  3CBM A;  3NTI A;  3VJP A;  3CCM Q;  3MPU B;  1TWB A;  3SDZ A;  5LJ5 j;  4N4H A;  2JM9 A;  3CCM A;  4FW2 A;  4BY6 C;  1WJS A;  2C06 A;  2I0N A;  3EHQ A;  1M2V B;  2JMC A;  3P8B B;  3EFO A;  1Q86 U;  2KGT A;  2B86 A;  5GAN 7;  2JNG A;  2KRN A;  4B9X A;  5GAN 8;  4X34 A;  4J7F A;  2CZ0 B;  3MEU A;  3CCL A;  3X25 B;  3RKY A;  2XG8 D;  3QJ6 A;  3MP8 A;  5AYF A;  4QKU A;  5GAN j;  2XDD A;  2O31 A;  2E3H A;  3EG0 A;  4CRI A;  4IUP A;  1KC8 U;  3QYH B;  4BD3 A;  1A0N B;  1QMC A;  2EQJ A;  2RI3 A;  4QQD A;  4M75 E;  2RHU A;  3E9G A;  4EDU A;  1WXB A;  2SRC A;  1G83 A;  1H64 1;  1EIF A;  3UA7 A;  2MF2 A;  3H0H A;  4MDX A;  1YWO A;  1SF9 A;  2F2X A;  1N8R C;  1W4S A;  2A28 A;  2NUZ A;  2LNH B;  4LE9 A;  3EHR A;  4M7A G;  1PRL C;  3EFO B;  3CC4 A;  4KUL A;  4KUD K;  2DTH A;  1VQP A;  2DXU A;  5IH2 A;  1TUG B;  1E6G A;  2X3W D;  1Q95 G;  1KD1 R;  1OUL A;  4XU1 A;  4C8Q E;  1UGP B;  5LJ3 j;  2DRK A;  4TVR A;  1BU1 A;  2MWP A;  1ACM B;  4XU2 A;  5KYY B;  2ED0 A;  3LH5 A;  2ABL A;  2LNV A;  5HCK A;  3CCV T;  3MCA B;  2QQA A;  3AT1 B;  3EGX B;  1UTI A;  4OB1 B;  4VUB A;  5AT1 B;  4D6W A;  3PMI A;  4JJD A;  1QVF S;  2DMO A;  3A98 A;  2DNU A;  4PJL A;  3M58 A;  2LZ6 B;  1QKX A;  3PIP A;  3CCU Q;  2AKK A;  3I35 A;  3CCU A;  1M1K C;  2QI2 A;  2HAX A;  2B8A A;  3CCV Q;  4OMQ A;  1QLY A;  2IIM A;  1CSK A;  5IHI A;  1VQ4 A;  3M0S A;  4XK8 E;  4F7U G;  3UDC A;  3M53 A;  4PJO A;  2CZ6 B;  5FLX E;  5GAM h;  3G71 A;  4OF1 A;  2KXC A;  1G3Y A;  3SFM A;  5GAO l;  3GBQ A;  3HL8 A;  1VQO Q;  2VV5 A;  4ZTJ A;  2LVM A;  4RTX A;  1VQO A;  3LX7 A;  2P4T A;  2L89 A;  3LWH A;  3JCM f;  1KIK A;  2COY A;  3GPL A;  3ZBD A;  1NZ9 A;  1ZA1 B;  3OYE A;  3PNW C;  4XTV A;  2LRQ A;  2FEI A;  1Y07 A;  2E6N A;  3SHW A;  2E3I A;  5C0M A;  2F1L A;  4CC7 A;  4HCC A;  1I1J A;  1YJW A;  3GP8 A;  2QDL A;  2MK5 A;  4QQ6 A;  1FX7 A;  4QVD A;  3CXC P;  2K4Y A;  3NTH A;  4FYX B;  5LJ5 d;  4BI4 A;  1K9M C;  1RL2 A;  1Q7Y R;  2V1Q A;  4LN2 A;  3QZ5 B;  2DEU A;  2EKO A;  1PSF A;  1MMG A;  3OYL A;  3OSS C;  5DM7 R;  2MOX A;  4PJO F;  2CT4 A;  2QTX A;  3DLL A;  3OYJ A;  3RNJ A;  3U23 A;  1S72 Q;  4J83 A;  5CKH A;  4MDW A;  1S72 A;  2QQR A;  3R6N A;  1OOT A;  5GAN d;  3VS6 A;  2KNB B;  1BYM A;  4R55 A;  1Y7X A;  1B34 A;  5GAM g;  1N9R A;  2YRC A;  2IG0 A;  1KD1 U;  4N4G A;  2AK5 A;  2K57 A;  2VB6 A;  4WTO B;  2WSE E;  1W2B S;  3CD6 Q;  3HRU A;  3CD6 A;  4LDW A;  1I8F A;  1WXU A;  4E7K A;  3E9F A;  1YJN A;  4XU0 A;  1LJO A;  4F14 A;  4ELZ C;  1Q81 R;  2GQV A;  2CUB A;  4EPC A;  1GBR A;  4Y28 E;  5GAO r;  4PL6 A;  2JUF A;  2CSI A;  3G4S A;  3ASK A;  4C0F A;  1D1B A;  3JRZ A;  4JJC A;  4M7A F;  1KJW A;  3JCM c;  1RAH B;  2QDY B;  1X2Q A;  4JRP A;  2DJQ A;  2FB7 A;  1G2B A;  3OYC A;  2HBP A;  2DE0 X;  2L2P A;  2WSF E;  3QHS A;  2VGN A;  3A8O B;  2DL4 A;  3EG2 A;  3QJY A;  5LJ3 d;  2DLP A;  2VYT A;  1MMN A;  3L2Z A;  3VS2 A;  4CC2 A;  1IO6 A;  1D0X A;  1WHG A;  2BKD N;  2YSQ A;  4C5G A;  4PJN A;  4E7H A;  3DB3 A;  2L5Q A;  1V29 B;  3C95 A;  2DIQ A;  2ZAE A;  1JEG A;  3LLR A;  3F70 A;  3RKX A;  1OQK A;  3WXM B;  4FU6 A;  3ULR B;  2QEX T;  2A0F B;  2E64 A;  2E5Q A;  4JLG A;  1OX8 A;  3EH1 A; 
#chains in the Genus database with same CATH homology
 4ORZ A;  1KFZ A;  2L3P A;  1UG1 A;  2LX7 A;  1UE9 A;  2RQW A;  2FO0 A;  3PVQ A;  4RTW A;  2EGA A;  2EYX A;  1K9A A;  4AFU C;  5IXF A;  1FYN A;  1NYF A;  4OMP A;  1X6B A;  3H0F A;  3NPF A;  4CC4 B;  4J9G A;  1HD3 A;  4WCI A;  3SEM A;  1SHG A;  1BK2 A;  4RTT A;  3PVL A;  2LP5 A;  2CRE A;  1WLP B;  2LJ3 A;  1T3L A;  1RUW A;  1KSW A;  2JS0 A;  2KRS A;  1PWT A;  2O9S A;  2EW3 A;  2BZX A;  4E6R A;  2RF0 A;  2F2W A;  1M3B A;  1OPL A;  1RLQ C;  2HDA A;  4JZ4 A;  5EC7 A;  2KE9 A;  1QCF A;  3VS3 A;  2CSQ A;  2ECZ A;  1AZE A;  3ZL7 C;  2F2V A;  1NLO C;  2P4R A;  4K11 A;  4J9H A;  2EYW A;  4GLM A;  2DRM A;  2OI3 A;  1AEY A;  3TSW A;  1HJD A;  1Y0M A;  1NEG A;  1VA7 A;  1I0C A;  2HSP A;  3QWX X;  1PKT A;  4Z88 A;  4AG1 C;  1YP5 A;  2VVK A;  1RLP C;  1E6H A;  1VYU A;  1H8K A;  4IIO A;  1SSH A;  2J7I A;  4ZNX A;  1W70 A;  1GFC A;  1WDX A;  2J6K A;  1U3O A;  1W6X A;  1GRI A;  2JM8 A;  2LMJ A;  2HEQ A;  3I5S A;  1PHT A;  1PRM C;  2KT8 A;  4X1V A;  1AWJ A;  4J9D A;  4OMM A;  5ECA A;  1SRM A;  1U5S A;  1M3C A;  1M3A A;  4JZ3 A;  2DL5 A;  2K7A A;  2BZY A;  1J3T A;  4J9C A;  2CUD A;  4RTU A;  5L23 A;  1AOJ A;  2CH4 W;  2LCS A;  1XOV A;  1GCQ A;  2K2M A;  1AWX A;  2GGR A;  1GBQ A;  1FMK A;  2EGC A;  1M8M A;  2L3S A;  1JQQ A;  2V1R A;  2RMO A;  2DBK A;  3CQT A;  4J9B A;  2C0O A;  2PNI A;  2O2O A;  1X27 A;  1OV3 A;  2A37 A;  2KRO A;  2DBM A;  1ZUY A;  2FRW A;  2C0T A;  2XMF A;  3KFV A;  1SEM A;  1NM7 A;  1ZX6 A;  1M30 A;  2FPF A;  4RTY A;  2D0N A;  1WFW A;  1AVZ C;  2D8H A;  2JW4 A;  1BB9 A;  1VYT A;  2DF6 A;  2OAW A;  3EG1 A;  1MV0 B;  4A63 B;  1ZLM A;  4DEY A;  2LQW A;  4Z89 A;  4HCK A;  2YUO A;  3FJ5 A;  2MIO A;  2AKL A;  2JT4 A;  1WXT A;  1I07 A;  1ZBJ A;  2EYZ A;  3REB B;  5IHK A;  2ENM A;  2K3B A;  4KRT A;  1PNJ A;  2KT1 A;  2DL3 A;  2JM9 A;  1ARK A;  1GCQ C;  1WIE A;  1JO8 A;  1K1Z A;  1UEC A;  2I0N A;  3EG3 A;  3EHQ A;  2FPE A;  2ROT A;  2JMC A;  2HBW A;  2JTE A;  3JV3 A;  2GBQ A;  2FG0 A;  1ZUU A;  2KGT A;  2B86 A;  2KRN A;  1H3H A;  1U06 A;  2BZ8 A;  2C0I A;  2W0Z A;  2O31 A;  3EG0 A;  1UJY A;  1K0S A;  1UHF A;  1A0N B;  2JXB A;  2DM1 A;  3O5Z A;  1WXB A;  2RQR A;  2SRC A;  1G83 A;  3QWY A;  3UA7 A;  4J9I A;  3H0H A;  3UA6 A;  2KYM A;  1YWO A;  2EQI A;  1W1F A;  2F2X A;  2GTO A;  2A28 A;  3M0U A;  2NUZ A;  3VS5 A;  2LNH B;  1UFF A;  4LE9 A;  4F16 A;  5FW9 A;  3EHR A;  1PRL C;  4OMN A;  3EGU A;  4RTV A;  4AFS C;  1Z9Z A;  5IHN A;  1T0H A;  2YUP A;  1HSQ A;  1WX6 A;  5IH2 A;  2D8J A;  1E6G A;  2X3W D;  1CKB A;  4LNP A;  1WA7 A;  2ROL A;  1NG2 A;  2K6D A;  1UHC A;  2GNC A;  2RN8 A;  3VS1 A;  1AWW A;  1OPK A;  1ZUK A;  2DRK A;  3UF4 A;  1AWO A;  4HVU A;  1Y57 A;  2X3X D;  1K0X A;  1BU1 A;  3TVT A;  1NEB A;  4AFZ C;  5FWB A;  1TUC A;  1N5Z A;  4QT7 A;  1YCS B;  2ED0 A;  3LH5 A;  2W10 A;  2ABL A;  1T0J A;  5HCK A;  2BTT A;  1X43 A;  2KXD A;  4HVW A;  4D8D A;  1UTI A;  1X2K A;  3C0C A;  1V1C A;  2DL7 A;  4JJD A;  1AD5 A;  1NLP C;  2AZV A;  2DYB A;  2DMO A;  3A98 A;  2DNU A;  2CDT A;  2LZ6 B;  1QKX A;  3H41 A;  3RBB B;  4F17 A;  1UGV A;  4OMO A;  1BBZ A;  2H8H A;  2AKK A;  3I35 A;  3IQL A;  2G6F X;  3NMZ C;  2DVJ A;  4OMQ A;  3VRY A;  1QLY A;  1JU5 C;  2IIM A;  4AFQ C;  1X6G A;  1CSK A;  1AZG B;  2A08 A;  2M0Y A;  4LUD A;  2HCK A;  5IHI A;  3M0S A;  1QKW A;  4D8K A;  2FRY A;  3H0I A;  3M0Q A;  1UDL A;  2YT6 A;  2KXC A;  2FPD A;  3GBQ A;  4OML A;  2ED1 A;  1NYG A;  1ABQ A;  2LQN A;  2JMA A;  4GBQ A;  4RTX A;  1CKA A;  1PKS A;  1UJ0 A;  3I9Q A;  1KIK A;  1Z9Q A;  2CH4 A;  2K9G A;  2CT3 A;  2J6F A;  2MCN A;  4AG2 C;  1WYX A;  2DL8 A;  2M51 A;  4R0K A;  2DA9 A;  2VWF A;  5I22 A;  1M27 C;  4CC3 A;  2FEI A;  3SHW A;  2GTJ A;  2EPD A;  4J9F A;  1GL5 A;  1B3Q A;  2D1X A;  4CC7 A;  1I1J A;  1E7O A;  2SEM A;  4DEX A;  2QDL A;  2KR3 A;  4HXJ A;  2A36 A;  2JS2 A;  1LCK A;  1GCP A;  5GJV B;  1ZSG A;  3TSZ A;  1YNZ A;  2RQV A;  2V1Q A;  4LN2 A;  3M0T A;  1QWF A;  1JXM A;  1H92 A;  2RQU A;  5I11 A;  4LUE A;  2VKN A;  2MOX A;  2CT4 A;  3THK A;  3RNJ A;  3U23 A;  1SHF A;  1TG0 A;  1K4U S;  1B07 A;  3VS4 A;  2EGE A;  2LJ1 A;  3R6N A;  2PTK A;  1RI9 A;  1OOT A;  3VRZ A;  3VS6 A;  2ESW A;  2KNB B;  2OJ2 A;  3NGP A;  5IXB A;  2YDL A;  4EIK A;  2O9V A;  2AK5 A;  2GQI A;  2EYY A;  3NHN A;  1EFN A;  1UUE A;  2KEA A;  2PZ1 A;  3M0R A;  1K76 A;  4IIM A;  1WXU A;  1SPK A;  4Y92 A;  1JXO A;  4M4Z A;  4F14 A;  1ABO A;  3REA B;  2CUB A;  1GBR A;  1GFD A;  2KYB A;  1YN8 A;  2EVR A;  1SRL A;  4RUG A;  2YUN A;  4RTZ A;  1TUD A;  2EBP A;  1OEB A;  1T3S A;  2CSI A;  2YUQ A;  4JJC A;  1KJW A;  4J9E A;  1X2Q A;  2E5K A;  2DJQ A;  1X69 A;  2LJ0 A;  2L3Q A;  1G2B A;  4HVV A;  2KRM A;  2J06 A;  2KBT A;  2RPN A;  2EKH A;  2DE0 X;  2AZS A;  2L2P A;  4Z8A A;  4JPB W;  1YWP A;  2DIL A;  1WI7 A;  2DX1 A;  5FWC A;  2DL4 A;  3EG2 A;  3UAT A;  2NWM A;  2DLP A;  5GJW B;  3VS7 A;  1VYV A;  2K79 A;  3VS2 A;  4CC2 A;  1IO6 A;  2YSQ A;  2L0A A;  3VS0 A;  3M0P A;  4JJB A;  2J05 A;  1QWE A;  3I5R A;  2RNA A;  1JEG A;  1S1N A;  3PE0 A;  2O88 A;  3ULR B;  1MV3 A;  2RQT A;  4FSS A;  4ESR A;  2J6O A;  1MUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...