1M3CA

Solution structure of a circular form of the n-terminal sh3 domain (e132c, e133g, r191g mutant) from oncogene protein c-crk
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
b'CGAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene C-crk
publication title Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 8
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m3cA00
2L2PA 3VS7A 4AFZC 4CC4B 1K76A 2BZYA 1QLYA 2O9VA 3REAB 4LNPA 2YUQA 5GJWB 2CUDA 4RTXA 2A36A 4AG2C 2AKKA 2RQRA 2PTKA 1W6XA 2KXDA 2A08A 2DJQA 2ED1A 1CKBA 2O88A 4HVWA 5IXFA 2CREA 2KR3A 2J6OA 2L0AA 4J9IA 2O9SA 1PNJA 2HCKA 4CC7A 3PE0A 1AZEA 2EYZA 2L3QA 2C0IA 1M3BA 1RI9A 2JS2A 4A63B 1ZUKA 3LH5A 1V1CA 3QWXX 2K3BA 2J06A 2AKLA 1OEBA 1ZBJA 1ZLMA 1NEGA 1AVZC 1U5SA 1YCSB 4D8DA 2DBKA 2VVKA 1HD3A 1T3LA 1VYUA 1KIKA 4OMLA 4K11A 2FPEA 3VS1A 2DL4A 1E6GA 4AFSC 2SEMA 2DILA 3NMZC 1UJ0A 2K6DA 2EPDA 1GBRA 2DRKA 4HVUA 3VRZA 4J9GA 3H41A 2FPDA 2QDLA 1I0CA 2DX1A 4RTZA 1SSHA 4JZ3A 3RBBB 4JJBA 2P4RA 4AFUC 2K2MA 2HDAA 2KE9A 1ZUYA 1JQQA 2M0YA 2OAWA 2EGCA 1M3CA 2CT4A 2DRMA 3SEMA 1GCQA 4RTVA 1SEMA 4JJCA 3NPFA 1K9AA 4LN2A 2MOXA 4RUGA 2J7IA 3VS5A 1UE9A 2RQWA 2D8JA 1SHFA 1WXUA 3ULRB 4J9BA 4DEYA 2O2OA 1WIEA 2DA9A 2EW3A 2JTEA 2KROA 3PVLA 1M3AA 3M0RA 2RQTA 4RTWA 1U3OA 1AWOA 2KT1A 1UFFA 2KRSA 2GTOA 2LX7A 3RNJA 5GJVB 1QWFA 3H0HA 2DL7A 3H0IA 3PVQA 3EG0A 2LQWA 1OOTA 2W10A 2ED0A 2DMOA 4ORZA 5FWCA 1YN8A 1I07A 2YUNA 3M0QA 1IO6A 2EQIA 2V1RA 1WDXA 4HXJA 5IHNA 3VS0A 4KRTA 2NUZA 2BZXA 2F2VA 2DYBA 2LJ1A 2A37A 1WX6A 2W0ZA 1PRLC 1QCFA 4JPBW 2JW4A 2CSQA 4HVVA 4RTUA 1OPLA 2GGRA 1TUCA 1SPKA 1WFWA 1GCPA 2G6FX 1UG1A 2GBQA 2SRCA 4X1VA 1JXOA 1VA7A 3U23A 1AD5A 1G83A 2L3SA 2OI3A 1H8KA 1NG2A 2MIOA 1WLPB 2DL5A 1JO8A 2YUOA 2EKHA 1A0NB 2CUBA 1LCKA 2FRWA 2FEIA 4FSSA 3NGPA 2CDTA 4F16A 2CH4A 2CT3A 2YUPA 4F17A 1N5ZA 2AZSA 1BB9A 2H8HA 5FW9A 1FMKA 1NLOC 3EG2A 2JT4A 2RQUA 3EHQA 5L23A 3I5SA 4Z88A 2GTJA 2E5KA 1YWPA 4LUDA 1Y57A 1QWEA 1KFZA 2LZ6B 2HSPA 2JXBA 4Z8AA 1GRIA 3VS4A 1TG0A 2KYBA 5ECAA 4F14A 1SHGA 2KBTA 4ZNXA 1UECA 3H0FA 1X43A 2EYXA 3I5RA 2DLPA 2I0NA 2J6KA 2RN8A 1X27A 1M27C 2RNAA 3M0UA 3THKA 2X3WD 4QT7A 2DE0X 4J9FA 1ABQA 1GCQC 2FO0A 1GBQA 1M30A 1AOJA 2J6FA 1AWJA 2JS0A 2K7AA 1NM7A 1M8MA 3I35A 2D8HA 2LP5A 2KNBB 1UGVA 1T3SA 4WCIA 1ABOA 1W70A 2F2WA 3VS6A 1J3TA 3GBQA 1SRLA 2F2XA 1VYTA 2KEAA 1ZX6A 4CC2A 1WI7A 1WXBA 1UTIA 1AEYA 2DL8A 4AG1C 1JU5C 2DF6A 3VS2A 3EGUA 2O31A 1Z9QA 2A28A 4OMNA 3O5ZA 1HSQA 4OMMA 1RLPC 2LQNA 3I9QA 1ZUUA 4IIOA 1QKWA 1MV0B 2V1QA 2X3XD 1AWXA 1BK2A 2RQVA 5FWBA 1UHCA 2CH4W 2AK5A 4OMQA 1GFCA 2DBMA 2HEQA 3R6NA 2KRNA 4Z89A 1TUDA 2C0OA 1G2BA 3JV3A 5EC7A 1K1ZA 1QKXA 2B86A 2J05A 1YNZA 4J9CA 3EHRA 2D0NA 3VS3A 2JM8A 2PNIA 3C0CA 3EG3A 1PRMC 1CSKA 2YDLA 1NEBA 2C0TA 1AZGB 3KFVA 2AZVA 1FYNA 4J9DA 4J9HA 4M4ZA 2EYYA 3QWYA 4J9EA 4GBQA 2GNCA 5I11A 1GFDA 1B3QA 3UF4A 2EVRA 2DM1A 1PHTA 4OMPA 1AWWA 5HCKA 3M0SA 1BBZA 1OPKA 1Y0MA 3FJ5A 1NYFA 4IIMA 1Z9ZA 2XMFA 1U06A 1X6BA 2FPFA 5IHKA 5IXBA 2EYWA 2RF0A 5I22A 3IQLA 1VYVA 2D1XA 4Y92A 3TVTA 2KT8A 1E7OA 1MUZA 3EG1A 5IHIA 1T0HA 4R0KA 1EFNA 2LCSA 3ZL7C 2NWMA 3UATA 2RMOA 3M0TA 4JJDA 3TSZA 2YT6A 1KJWA 4DEXA 2ENMA 4LUEA 3REBB 2ESWA 1HJDA 1BU1A 1K0SA 2EBPA 1ZSGA 1UUEA 4RTTA 1CKAA 3TSWA 1W1FA 2DNUA 3UA6A 1PWTA 1PKSA 2YSQA 1UDLA 4D8KA 1ARKA 1OV3A 4AFQC 1XOVA 1JXMA 2KGTA 1T0JA 2FRYA 2KRMA 1K4US 1NLPC 1X2QA 1H3HA 4GLMA 2LMJA 2JMCA 2JMAA 3SHWA 1WYXA 2MCNA 3M0PA 2K79A 2M51A 4RTYA 2CSIA 2GQIA 1RLQC 2BTTA 4EIKA 1GL5A 1S1NA 2VKNA 1X6GA 1H92A 2ROLA 1B07A 1PKTA 2ROTA 2EGEA 2FG0A 2HBWA 2ECZA 1UHFA 2OJ2A 2LJ0A 3A98A 2RPNA 4HCKA 4LE9A 1JEGA 1WA7A 2K9GA 1E6HA 1MV3A 2DL3A 2JM9A 3CQTA 1UJYA 1NYGA 2KXCA 4JZ4A 4E6RA 1SRMA 2ABLA 2KYMA 3VRYA 5IH2A 2LNHB 1KSWA 2L3PA 1X69A 2BZ8A 3UA7A 2EGAA 2PZ1A 1YWOA 2IIMA 3NHNA 4CC3A 2LJ3A 1RUWA 1X2KA 4ESRA 1YP5A 1WXTA 1K0XA 1I1JA 4OMOA 2DVJA 2VWFA
chains in the Genus database with same CATH superfamily
2L2PA 1VQNA 5GAOq 2JTMA 5KYUA 2O9VA 4M78E 1TTHB 3X24B 3CPFA 1TS9A 2YUQA 1N27A 5GAN8 3OYIA 3CCUA 2CUDA 4RTXA 2PTKA 5GAOm 1G8XA 3S3NA 3OYNA 3PIPA 2HBPA 2A08A 2ED1A 2O88A 2WSFE 4OB0B 4OB3B 2J6OA 2RHUA 2L0AA 4DBHA 4EMKB 3V7CA 2NUTA 4BI3A 1NJIR 4BE2A 2PUKB 3OYYA 2EFIA 1AZEA 1JJ2P 2C0IA 2DXCA 2DZ9A 3Q1JA 3LH5A 1V1CA 1IGUA 3CC2T 2ZGWA 2J06A 2AKLA 2ZPEB 1OEBA 1ZLMA 2COZA 1NEGA 4ZGEB 2QTVA 1VQNT 3M54A 4MDWA 3FJPA 1HYOA 3MHXA 4QVCA 5CKDA 2DBKA 3CCUT 1VYUA 4EMKA 3GOXA 3LGLA 4OMLA 4FCYA 2LDMA 1Y07A 5C6SA 1W2BP 2P0KA 3PMIA 1M2OA 2SEMA 3H6ZA 1UJ0A 4N4IA 1D0XA 3CC4A 4EPCA 1GBRA 4EDUA 2OTJQ 4HVUA 3VRZA 1K9MC 5KCOA 4M77E 2LCCA 1WPYA 2QDLA 1I0CA 3M58A 4JZ3A 3FB9A 4UC4A 2CS7A 2K2MA 2F69A 3M59A 3VYGA 4WF2A 2M0YA 1YITA 4C5HA 3BDLA 3P8BB 2YRVA 2DRMA 4XTUA 3AHUA 1SEMA 3NPFA 3L2ZA 1BCOA 3VS5A 3JAME 1KD1R 2RQWA 5GANj 5GAMe 4HCBA 4J9BA 2YWWA 2O2OA 2E3IA 2B8AA 2KROA 2XU8A 1M3AA 2KY9A 3M0RA 4RTWA 4RKUE 4NOYA 3EFOB 2GTOA 2FZKB 2VGNA 4QQGA 1K73C 2FYKA 2QEXQ 1QWFA 2IG0A 2LRQA 3WVDB 3H0IA 3JCMb 1QVGA 1AHJB 1OOTA 1ZA2B 3V8KA 3QKJA 2GQVA 4VUBA 2DMOA 5FWCA 2VGMA 5KCHA 1M5Q1 3VS0A 4E7JA 2NUZA 3CCVQ 2LJ1A 4M75G 4MMKA 3X20B 3QDRB 3QBYA 3LWHA 3EFOA 1C1AA 2DZCA 3GLXA 3I55A 4XU0A 1OPLA 2GGRA 4J6WA 1WFWA 2SRCA 4C5GA 1Q95G 3C12A 3ASKA 2CZ1B 4JRPA 1JXOA 3CBPA 3CCMQ 1YHQT 2DAQA 2H3EB 2OI3A 2MIOA 4BY6C 1WJQA 2RH2A 4FYVB 5GMKj 2EKHA 3OYFA 4KH1B 2CDTA 4M7DG 2XG8D 2YUPA 5CCAA 5J39A 4F17A 1N5ZA 2AZSA 1MNDA 1OU9A 3E9GA 4AMCA 4GLKA 2EQMA 2VB6A 1K9MU 3EHQA 3I5SA 3I55T 1JRIA 2GTJA 1VQ6T 1VQOQ 1KFZA 2LZ6B 2HSPA 2CZ6B 2E1HA 3G71A 1GRIA 2KYBA 3CEYA 4JLGA 3OSSC 4FIBA 2KSSA 2NLUA 2DLPA 1JJ2A 4C8QC 2RN8A 2RO0A 2HL3A 1YJNA 1HK9A 3THKA 3L2UA 1ABQA 2J6FA 5A0DA 1AWJA 1IZ6A 2JS0A 2K7AA 2CP0A 1Q81C 4IKFA 3I35A 1SF9A 2LP5A 3QJYA 4WCIA 1T3SA 4PJLA 1JBMA 2F2WA 3GBQA 1UB4A 4LDXA 4LXCA 1K73U 1PSFA 1W2BA 1OZ3A 3SD4A 2K3XA 1VQ4T 1WXBA 3PMTA 1S72Q 4M75E 4AG1C 2HNIA 5LJ5g 2DTOA 2KQWA 4C92F 4IUTA 1Z9QA 2LC4A 4B6MA 1UGQB 1HSQA 5AYFA 4N4HA 1KQSP 3G4ST 1YJNT 3JSCA 4BACA 1RABB 3CMAA 4KUIA 2KAFA 3JB9H 1BI1A 1WQWA 2O4XB 3LYIA 4Q5WA 1ZUUA 1Y71A 5HK3A 4QQ6A 1MV0B 4FW2A 3FRNA 1X01A 2PVDB 4M7DE 3V8LA 4N4GA 4KH0B 4F7UF 3JCMc 2HEQA 4FT2A 2KRNA 4Z89A 5EC7A 4J9CA 3EHRA 3E9FA 3VS3A 3P8DA 2O4XA 1BIAA 1K9MR 1WQ7A 1AZGB 3KFVA 1LPLA 2QQSA 3CMAT 1FYNA 1VQLQ 4J9HA 4BY6B 2RA2A 4M7AC 1TH7A 2QQBA 4OMPA 1PHTA 2VC8A 1BBZA 3FJ5A 3BW1A 1YIJQ 3G6EQ 2JVVA 1R0CB 1YCYA 1HXDA 4J6YA 3NTHA 1X6BA 2ZPGB 3INZA 4BI8B 3A1PA 3CCLQ 5FLXE 3I56Q 3IQLA 5GAN3 5CKBA 1PCXA 2KT8A 1E7OA 1MUZA 3EG1A 4C0FA 1YFNA 1Q81U 1EFNA 2K2VA 3FIFA 2RMOA 3M0TA 4M77D 1I4K1 5D6XA 3ZEHA 3CD6Q 2QGFB 4JJDA 4KGVB 3TSZA 2MI6A 4C8QB 1D3BA 1RADB 3RKYA 1K73R 3REBB 1K0SA 4PFPA 5KE2A 1UUEA 1CKAA 1W4SA 2NUPB 3LGFA 2QI2A 1W1FA 2YSQA 2E65A 2KRMA 5LJ3j 1NLPC 1X2QA 4QKUA 1H3HA 1M9SA 4XU3A 4XAXB 1VQPT 1G3WA 4YTLA 2DJZA 2CSIA 3A8MB 4C8QA 1TUGB 1RLQC 3CC7A 2DKGA 1X6GA 2NUPA 8AT1B 4E7HA 3EAEA 1H92A 1PKTA 1WHKA 5J26A 3A98A 4LE9A 4JJNK 2X4XA 2K9GA 1E6HA 3QZ9B 3X25B 2QASA 1UJYA 2KXCA 4JZ4A 2M16A 3GIBA 1WHHA 2KYMA 4XTXA 3VRYA 4OF1A 2X9HA 2EGAA 2RHYA 3JRZA 2QG9B 3TEEA 5GAOn 4M7AF 1YI2T 3CC7T 5CKHA 2VWFA 5GMKi 1KQSA 4HT8A 5GMKl 4AFZC 1RAFB 2JN0A 1RI0A 3H9NA 2BZYA 3VUZA 3CCQQ 1PC0A 5GAMf 1VIFA 4M7AB 1I5LA 4GY5A 2RQRA 4PFOA 2P0PA 1RAEB 4B9WA 3JCMQ 5LJ5e 4Y91A 1Q81R 5IXFA 2D6FA 2CREA 1D1CA 3UPUA 1K8AC 4PLLA 1X75C 2RD1A 1OI1A 2AHJB 4PJOF 2EYZA 3HSBA 3JCMg 3OBYA 2BIVA 1ZUKA 1KK7A 5CKFA 3QWXX 2LT4A 2P4TA 2K3BA 2PUOB 1IRXA 1ZBJA 2ZZDA 1YCSB 1C0MA 4BI4A 1MGQA 2VVKA 1HD3A 4K11A 2RB6A 1U1SA 2DL4A 5GAMd 4AFSC 4FL6A 3DLLA 5CK9A 5GAOl 1FMWA 2DILA 4E47A 2K6DA 2DRKA 3RERA 2DPPB 2R5AA 3RKXA 4OB2B 3OQ5A 3CCUQ 2FPDA 4RTZA 4C0DC 1SSHA 3QG1A 1UGRB 3E1SA 3JB9D 4M75D 4AFUC 1ZBXA 2DD4A 2KE9A 1BI0A 3OYLA 1D1AA 2QXFA 1M3CA 2K3YA 2XI9A 5KH6A 3HPWA 3SEMA 4RTVA 4JJCA 4E7SA 2OX7A 2M9UA 2CZ7B 3R6OA 2J7IA 3RIRA 1SHFA 1WXUA 5J3BA 3CBOA 2R57A 3D7SB 4ZN3A 3MCAB 4M7DD 2KDSA 3OA6A 1VQ8A 2AT1B 1OYXA 2KRSA 5DY9A 4PL6A 4HCZA 4MDXA 2COYA 1N8RC 2XICA 2EJGA 1UGPB 3MKDA 3EH2A 3EG0A 3CCJT 3NTIA 2D0QB 3QIIA 3QXEB 2DD5A 1O75A 2XDBA 5FROA 2EQIA 2RK2A 1WDXA 4HXJA 5IHNA 1D1BA 4L6V5 5GAN6 2BZXA 2X35A 1K8AU 2HSEB 1M2VB 1WX6A 2W0ZA 4PNOA 5A2QE 1VQ9A 2JW4A 3T9NA 4FU6A 2CSQA 2XKOC 4RTUA 2EQUA 2X4YA 3M57A 3CCEA 4LDUA 2GBQA 1VQKA 1UG1A 2F1LA 3G7ZA 3CCSA 4ZTFA 1G83A 2L3SA 4Y28E 3OYJA 1OULA 1N9SA 2HKNA 4C8QG 1WLPB 2DL5A 3MEUA 2CUBA 2PVGB 1LCKA 2FRWA 1VQ7T 3QSUA 1M2VA 1TOVA 3HL8A 2HQHA 3DB4A 5FW9A 2VV5A 3EG2A 2XD0A 2JT4A 1YHQQ 5L23A 4A54A 1ZSZC 3OMCA 1Y57A 3CCET 3M5AA 4XTZA 3CXCS 3EFSA 4Z8AA 1VQKT 5FU6C 3QYGB 3EGDB 3CCST 1SHGA 4ZNXA 4E7KA 3MEAA 1X43A 2A7YA 2ATCB 2DIQA 2QTXA 4O6JA 2H3JA 2I0NA 3A5ZB 4C0DB 1WHLA 2YLBA 3OS5A 1VQ6Q 5GAOr 4JRKA 2DE0X 1GCQC 2VXFA 4OB1B 3C94A 4C5EA 2KNBB 1UGVA 1TXQA 3CCRA 2P84A 2M02A 3EGDA 3OYDA 1W70A 3OB9A 1J3TA 4DBFA 1VYTA 4C0ZA 1N8RU 3JCMe 2DFUA 3RKWA 5GAN2 2F5TX 3L42A 2DL8A 1QCNA 1JU5C 4M78C 3CC4T 4MMLA 1QVFS 1EIFA 2A28A 1TU0B 4OMNA 1U1TA 1K8AR 3O5ZA 2VASA 2RHIA 4FYYB 2FVUA 2LQNA 1XTDA 1N6AA 1VQ4Q 1YITT 1IREB 4IURA 3SDZA 4ME7A 4AT1B 4C8QE 1QKWA 4L5GA 1LJOA 4C92C 4MZTA 2RHXA 2RJDA 2X3XD 1AWXA 4F04B 1UHCA 5L8RE 3G4SQ 2QGGA 2AK5A 3JB9G 1YJNQ 2DBMA 3ZBDA 2B86A 3EGXB 5LJ3g 5IT9E 2D0NA 2PNIA 3C4SA 3EG3A 4D6WA 1PRMC 4KGZB 2E6ZA 2YDLA 5D7UA 2OTJA 5GMKe 2AZVA 4BDZA 1MMGA 2F5KA 3OS0A 2GNCA 1M4ZA 1GFDA 2QA4A 2EVRA 4JS4A 3HKSA 4M77C 1ZQ1A 1R8OB 1NYFA 4IIMA 1YJWA 1Z9ZA 3EGXA 3PTAA 4BD3A 4PLIA 3CMAQ 5IXBA 2EYWA 1ZSZB 2LVMA 4QW2A 1WHMA 1VYVA 1XJWB 2HMAA 1X6OA 2D1XA 2RI5A 5FU6B 3TVTA 3SWNC 1T0HA 4R0KA 2OTJT 3UATA 3LW5E 2K5FA 2ESWA 1N8RR 1BU1A 4A4FA 2QA4T 7AT1B 1ZSGA 2QEXA 2X4JA 3TSWA 2ZPFB 3BE3A 5LJ5f 4A4HA 2DNUA 1YJWT 1FMVA 4M78F 3ZFJA 3BFMA 4AFQC 5HK0A 4HKEA 3QPHA 2QDYB 1T0JA 2QQRA 3E2UA 4B9XA 4GLMA 3NTKA 5GAMh 3CCVA 5HKCA 2K79A 3OYAA 3G71T 2GQIA 2JUFA 3DKMA 1VQMA 1QQJA 4M78B 4XK8E 4EIKA 3M4GA 1S1NA 3JB9J 2ROLA 2IPOB 4ZN1A 1B07A 2EGEA 2FG0A 1VQPQ 1Y7XA 3CCMA 2ECZA 1M1KC 1D09B 4HCKA 1VIEA 4XTYA 3OYMA 1NE8A 2DL3A 2JJ9A 3CMEA 1NPRA 4C92B 3P8HA 5LJ5d 2LNHB 2L3PA 2FHDA 4M78A 2BZ8A 5KE3A 3UA7A 2PZ1A 1G5VA 1M1GA 5C0MA 1VQMT 4DBRA 4RMOA 4CC3A 5D6YA 2LJ3A 4LDYA 1VQOA 1RUWA 3HFNA 2DERA 1X2KA 4M77F 1YP5A 2RK1A 1I1JA 4OMOA 4BUGA 2DVJA 2L5QA 3VS7A 5CAIA 5KYXB 5GMKh 3CCMT 2VUBA 4CC4B 4F7UB 1K76A 1QLYA 3TCJA 5AT1B 3REAB 5IAYA 4LNPA 4C92A 5GJWB 2RHZA 3ME9A 4AG2C 2AKKA 1IXDA 3QO3A 1YI2Q 3OS1A 3CMET 3CC7Q 4FYXB 1W6XA 2YRDA 4M77B 1WHJA 2DJQA 1CKBA 1Y96B 1OU8A 4P5NA 3OBWA 3TQ7P 2HCKA 3A8OB 1RAHB 3PE0A 2L3QA 2JTFA 5KYXA 1RI9A 4F7UA 2JS2A 4A63B 1KQ2A 2YRCA 4IUQA 1R0BG 2EAYA 4FW1A 3SWNB 2BUDA 2YXYA 1IGQA 3MO8A 2IVWA 1I5OB 1Y96A 1WZOA 4ZGJB 4PJOC 3M53A 1T3LA 2K57A 2Y90A 4QVDA 5CO7A 1KIKA 3OYGA 2Y4XA 2EWNA 5IN1A 4KULA 2V8IA 3VS1A 2WSCE 5A0GA 1E6GA 3OYBA 5LJ3e 3HRUA 3GNGA 3GPLA 4XU1A 4E7LA 4OGCA 2EPDA 2LT1A 2QK0A 4A4GA 2DXBA 3JCMP 4J9GA 4NS5A 3SWNA 3OW2S 2DX1A 3CPWS 1M1KU 2P4RA 5FU7C 2HDAA 2LTOA 2ZPIB 1YBYA 1ZUYA 2KI7A 3MPUB 3HHTB 4J7FA 2LCLA 4PJJA 4DA4A 1TWBA 3S3MA 2CT4A 1M1FA 1IB8A 2HQXA 1K9AA 4LN2A 4MZPA 1UE9A 2FZGB 4KUDK 4DEYA 4C8QD 1WIEA 2DA9A 2EW3A 5I2SA 1VUBA 1AT1B 1PD0A 2G3RA 4J6XA 3OYHA 3OW2A 1AWOA 2KT1A 3G6EA 3RNJA 2E10A 5GJVB 3H0HA 2COWA 3MEVA 4PJNA 2MWOA 3QHSA 3CCLA 3VKIA 1MMNA 2W10A 5KYNA 2ED0A 1Q86C 1BCMA 3JB9I 3M0QA 2L89A 1P92A 3FEOA 3M4YA 1JB0E 1I8FA 2PVOB 2QYZA 3CD6A 2F2VA 2DYBA 3JCMf 2OAUA 1PRLC 4HVVA 3CCJQ 1TUCA 1FWZA 1GCPA 2G6FX 2DO3A 1VA7A 3U23A 5GANg 4M75F 4RG2A 1H8KA 1NG2A 3J81E 2RM4A 3V7RA 1RACB 3A8GB 1JO8A 2XK0A 3M9QA 1D0YA 4FSSA 3NGPA 3GNFB 3WVEB 2CT3A 4M7AA 1OX8A 3RMQA 2HAXA 1H641 1BB9A 2H8HA 5CIUA 1FMKA 3FDRA 4Z88A 4PJOB 1M1KR 5GANd 2E5KA 1YWPA 3CXCP 4RCCA 1VQ7Q 4M7DF 5LJ3h 2JXBA 2DETA 3JCMd 3VS4A 5ECAA 4F14A 3CC2Q 2KBTA 1VQNQ 4M78G 4XU2A 4OGEA 1GXIE 2BE9B 2EYXA 3I5RA 4ZTJA 5GAN5 2R58A 3LX7A 1NBEB 3RDVA 3URGA 2DEQA 1WHGA 1M27C 3M0UA 5FU7B 4PJOA 4J9FA 2FO0A 4LD6A 1M30A 1VQKQ 3MP1A 3CCSQ 1M8MA 2D8HA 2YLCA 1UGSB 4O5VA 1VQ5A 4C92G 1ABOA 3VS6A 1SRLA 3MP6A 2F2XA 1FX7A 2OTLA 1ZX6A 4CC2A 4PKCC 1UTIA 2HD0A 3O8VA 1AEYA 1SSFA 4J8OA 1QVFP 4RCBA 1Q86U 1PSEA 3VU3C 4JUVA 4OMMA 1RLPC 4F7UG 1MHNA 4LDWA 3I9QA 3BY7A 4ANJA 2MMPA 2E4HA 3CC4Q 4IIOA 1VQ5T 3V8JA 2V8KA 3M55A 2OTLT 4EMGA 2RQVA 5FWBA 4IUVA 1GFCA 3VJPA 1KHIA 1RAAB 1YJ9A 1TUDA 3F70A 3JV3A 1K1ZA 1QKXA 1YITQ 2J05A 5I2MA 3NFCA 2CP7A 2XHCA 5LJ5h 1YNZA 1VQ8T 1BI3A 2JM8A 3C0CA 3RR6A 2CYZB 1NEBA 2C0TA 1DJ7B 2LNVA 1U8RA 4J9DA 3QDFA 4M4ZA 2DVEA 3QWYA 3L2WA 2MYSA 3N5BB 3RMSA 3HTRA 5KYWB 3UF4A 2DM1A 5CQYA 1AWWA 1R77A 3FC3A 1G3YA 1Y0MA 3WXMB 1N9RA 5D6WA 5GAOp 1V29B 2XMFA 1YJ9T 1VQ9T 4C92E 4C5IA 1QMCA 5I22A 2AIRB 4V2SA 2JOYA 4BB7A 1LOJA 3FLGA 3SB2A 4QQDA 1TSFA 5KYWA 4L59A 2V8JA 6AT1B 2NWMA 4J7IA 2HZYA 2ZPHB 1KJWA 3E19A 2ENMA 1F1BB 4ATOA 3LH0A 2WACA 3I55Q 3JCMW 1C6VX 1WGSA 4F7UE 3SFMA 1PKSA 1UDLA 1Q86R 1ARKA 1OV3A 4FSXA 1XOVA 2KGTA 2FRYA 2LMJA 5GANe 2JMCA 4EMHA 2E64A 3CXCA 2EQKA 1WYXA 2QA4Q 3M0PA 2M51A 1YJWQ 1QVGS 3L2QA 4OMFB 2MPXC 1GL5A 2VKNA 2L3RA 2RJFA 3A8LB 5CVIA 4BDYA 4X34A 1OQKA 2LJ0A 4DOVA 2RPNA 1MNEA 1JEGA 1WA7A 3HP9A 5DLQE 3H8ZA 1MV3A 4Z02A 5LJ3f 2JM9A 3CQTA 3G71Q 4M7AG 1NYGA 5GAMj 3RUXA 2P0QA 3G1JA 3CCRT 2YHTA 2DTIA 4BE0A 2E5QA 3UWNA 2NYSA 4RG8A 3MJXA 2HL5C 1X69A 1KG1A 4ELZC 1KQ1A 1YHQA 2BKDN 4FYWB 2IIMA 2K5IA 1B7TA 3NHNA 1QVFA 2DTHA 5GAN7 5A0LA 2C06A 1BKBA 2KK4A 5HY6A 4PJOG 1I81A 5GAN4 2A36A 2V26A 1VQMQ 1VQ6A 1BIBA 2KXDA 1FXXA 4JRQA 4HVWA 2KR3A 5LJ3d 2MK5A 2GFUA 3DB3A 4ZGDB 1LNXA 3L2VA 1WNLA 2E12A 3QZ5B 4J9IA 2O9SA 1PNJA 4CC7A 3LWIA 5I21A 2EIFA 1M3BA 4LD9K 5EG2A 1JJ2S 3HRTA 3CMEQ 3KUFA 2MF2A 3VUBA 1AVZC 8ATCB 1U5SA 2RJCA 4D8DA 3META 2ZPBB 2FPEA 1QP3A 1M90C 1VQ4A 1W2BS 1ZSZA 2CP2A 2K5LA 4KBMB 1PD1A 3NMZC 4M7AE 1V76A 3OS2A 5GANh 4OP0A 3OW2P 1BYMA 3H41A 3CPWP 3QYHB 3GP8A 3JCMh 3G4SA 2E41A 3RBBB 4JJBA 1PG5B 1JQQA 2OAWA 2EGCA 1GCQA 4XTVA 4QVZA 5DM7R 2MOXA 2FB7A 4RUGA 2QEXT 3V7SA 2D8JA 3MEWA 3ULRB 3EH1A 4J5YA 2JTEA 4PJOE 3PVLA 2CP5A 2DEUA 2RQTA 2R5MA 2FZCB 1U3OA 1UFFA 2VXEA 3CCVT 2LX7A 4JDSA 3PNWC 1G3TA 2DL7A 3EFRA 3PVQA 3OYEA 2LQWA 5DLOA 1WJRA 4BE1A 1NZ9A 1QW1A 3VYHB 4ORZA 1UEBA 1YN8A 1I07A 2YUNA 1IO6A 2QQAA 2V1RA 1Q7YC 3TU4K 4M78D 2RJEA 4KRTA 4WTOB 1Q82C 2DYIA 2RI3A 2A37A 3JCMJ 4DBQA 1QCFA 4JPBW 3OYCA 2Z0WA 1SPKA 3ER0A 4CI0C 4X1VA 4N0AC 1MMAA 2GCXA 3QUIA 1SKUB 1AD5A 2RI2A 1M8VA 2XIDA 2LX9A 3HRSA 4C92D 2DXTA 2YUOA 2EKOA 2XDDA 1A0NB 1VQOT 2FEIA 3MP8A 1M90U 4F16A 2CH4A 1S72A 4FT4A 5CKEA 4KGXB 1D3BB 1NLOC 4M77A 1KC8C 3S6WA 4M75C 1H3ZA 2RQUA 2EJFA 4C8QF 4LDVA 1VQPA 4LUDA 3PFSA 4E7ZA 1QWEA 2ZCFB 1TG0A 4XTWA 3JCMX 2ZAEA 3PT9A 5CQXA 2DIGA 1UECA 3H0FA 2PQWA 1D0ZA 3OY9A 1EX4A 3CBMA 4II1A 2CGHA 2J6KA 4KT0E 1X27A 2MAMA 2RNAA 1S72T 3JCMV 2X3WD 3AT1B 4QT7A 4M7DC 2A3LA 4A4EA 1GBQA 1AOJA 5FRMA 1NM7A 4E7IA 2M0OA 4J83A 2X51A 1QVPA 5KYYB 1NJIC 2GF7A 2M1HA 1KHCA 2KEAA 4PFZA 4CRIA 3OYKA 1RL2A 1WI7A 1VQLA 2A0FB 1YI2A 3X28B 2DF6A 2L8DA 5CR2A 3BDUA 3VS2A 4C0GA 4A53A 3EGUA 2O31A 1YIJA 3CPWA 1Q7YU 1NPPA 1KQSS 4JRIA 1Q82U 3KXTA 1VOMA 4PK4A 5KYYA 1ZHIA 9ATCB 4X9DA 3I56A 2BE7D 3M56A 4HA8A 2WSEE 2EYQA 5GANf 2V1QA 4XQ3A 1XNIA 2EJ9A 1OZ2A 3VV0A 1BK2A 2CH4W 1VQLT 4OMQA 3R6NA 2I2LA 4A4KA 4R56A 2C0OA 1G2BA 3UDCA 1XQHA 2CP3A 2QQ9A 1M90R 4E2FB 1YIJT 3G6ET 1VQ5Q 1CSKA 2XDPA 3JB9F 2OTLQ 1KC8U 2QAZA 3EG9B 1KD1C 2EYYA 4J9EA 3CCLT 1ACMB 1QCOA 4GBQA 5I11A 3I56T 1B3QA 2E70A 4OVAA 5HCKA 2EQJA 2E6NA 3M0SA 3A8HB 1OPKA 1VQ8Q 4EMKC 5LJ5j 3CD6T 1U06A 4DQ2A 1QP2A 4M75B 2FPFA 5IHKA 2RF0A 4N0AA 2KMTA 5GAMg 1RAGB 1MMDA 2HQEA 3EG9A 3L2RA 4JLIA 4Y92A 3S3OA 4M7AD 1OX9A 5M9OA 5IHIA 2DXUA 1IHVA 2LCSA 2Y4YA 3ZL7C 2E3HA 3X26B 3KBGA 3GF5A 1NJIU 2MWPA 2YT6A 4DEXA 2KVQG 4LUEA 1YJ9Q 1VQ9Q 1HJDA 3DLMA 2EBPA 2FL7A 2HKQB 1O9SA 4M75A 4RTTA 3L1AA 4M7DB 2PU9B 3CCEQ 3UA6A 1PWTA 2LQKA 1WJSA 4D8KA 1JXMA 1EZZB 5FRNA 3OSVA 1K4US 2CKKA 2GFAA 2LQ8A 1Q7YR 4IUUA 2CZ0B 2JMAA 3RESA 3SHWA 1Q82R 1IHWA 3CCQA 2MCNA 3OMGA 3UT1A 4RTYA 2CP6A 4PJOD 1QVGP 3PGGA 4TVRA 1PM3A 2JZ2A 3CCJA 1G3SA 2BTTA 4M7DA 1ZA1B 5GMKm 4NL3A 2K4YA 1BI2A 2O01E 2ROTA 4HCCA 3J80E 2HBWA 1B34B 1UHFA 4HT9A 4DOWA 2OJ2A 1RAIB 2DK3A 4MZMA 4JS5A 3QJ6A 3LLRA 4E6RA 4PJMA 5KYUB 1SRMA 2ABLA 2X4WA 3PIOA 4M77G 2JNGA 3J7AF 4NL2A 5IH2A 1KSWA 1KC8R 4X9CA 3TREA 3CCQT 4IUPA 2VYTA 1YWOA 4ELYC 1KD1U 1LVKA 3HFOA 4FM4B 4R55A 1B34A 1VQ7A 2NUTB 2D9TA 4ESRA 1WXTA 1K0XA 3CCRQ 3CC2A 5LL6S 1SG5A 3C95A
chains in the Genus database with same CATH topology
2L2PA 3VS7A 4AFZC 4CC4B 1K76A 2BZYA 1QLYA 2O9VA 3REAB 4LNPA 2YUQA 5GJWB 2CUDA 4RTXA 2A36A 4AG2C 2AKKA 2RQRA 2PTKA 1W6XA 2KXDA 2A08A 2DJQA 2ED1A 1CKBA 2O88A 4HVWA 5IXFA 2CREA 2KR3A 2J6OA 2L0AA 4J9IA 2O9SA 1PNJA 2HCKA 4CC7A 3PE0A 1AZEA 2EYZA 2L3QA 2C0IA 1M3BA 1RI9A 2JS2A 4A63B 1ZUKA 3LH5A 1V1CA 3QWXX 2K3BA 2J06A 2AKLA 1OEBA 1ZBJA 1ZLMA 1NEGA 1AVZC 1U5SA 1YCSB 4D8DA 2DBKA 2VVKA 1HD3A 1T3LA 1VYUA 1KIKA 4OMLA 4K11A 2FPEA 3VS1A 2DL4A 1E6GA 4AFSC 2SEMA 2DILA 3NMZC 1UJ0A 2K6DA 2EPDA 1GBRA 2DRKA 4HVUA 3VRZA 4J9GA 3H41A 2FPDA 2QDLA 1I0CA 2DX1A 4RTZA 1SSHA 4JZ3A 3RBBB 4JJBA 2P4RA 4AFUC 2K2MA 2HDAA 2KE9A 1ZUYA 1JQQA 2M0YA 2OAWA 2EGCA 1M3CA 2CT4A 2DRMA 3SEMA 1GCQA 4RTVA 1SEMA 4JJCA 3NPFA 1K9AA 4LN2A 2MOXA 4RUGA 2J7IA 3VS5A 1UE9A 2RQWA 2D8JA 1SHFA 1WXUA 3ULRB 4J9BA 4DEYA 2O2OA 1WIEA 2DA9A 2EW3A 2JTEA 2KROA 3PVLA 1M3AA 3M0RA 2RQTA 4RTWA 1U3OA 1AWOA 2KT1A 1UFFA 2KRSA 2GTOA 2LX7A 3RNJA 5GJVB 1QWFA 3H0HA 2DL7A 3H0IA 3PVQA 3EG0A 2LQWA 1OOTA 2W10A 2ED0A 2DMOA 4ORZA 5FWCA 1YN8A 1I07A 2YUNA 3M0QA 1IO6A 2EQIA 2V1RA 1WDXA 4HXJA 5IHNA 3VS0A 4KRTA 2NUZA 2BZXA 2F2VA 2DYBA 2LJ1A 2A37A 1WX6A 2W0ZA 1PRLC 1QCFA 4JPBW 2JW4A 2CSQA 4HVVA 4RTUA 1OPLA 2GGRA 1TUCA 1SPKA 1WFWA 1GCPA 2G6FX 1UG1A 2GBQA 2SRCA 4X1VA 1JXOA 1VA7A 3U23A 1AD5A 1G83A 2L3SA 2OI3A 1H8KA 1NG2A 2MIOA 1WLPB 2DL5A 1JO8A 2YUOA 2EKHA 1A0NB 2CUBA 1LCKA 2FRWA 2FEIA 4FSSA 3NGPA 2CDTA 4F16A 2CH4A 2CT3A 2YUPA 4F17A 1N5ZA 2AZSA 1BB9A 2H8HA 5FW9A 1FMKA 1NLOC 3EG2A 2JT4A 2RQUA 3EHQA 5L23A 3I5SA 4Z88A 2GTJA 2E5KA 1YWPA 4LUDA 1Y57A 1QWEA 1KFZA 2LZ6B 2HSPA 2JXBA 4Z8AA 1GRIA 3VS4A 1TG0A 2KYBA 5ECAA 4F14A 1SHGA 2KBTA 4ZNXA 1UECA 3H0FA 1X43A 2EYXA 3I5RA 2DLPA 2I0NA 2J6KA 2RN8A 1X27A 1M27C 2RNAA 3M0UA 3THKA 2X3WD 4QT7A 2DE0X 4J9FA 1ABQA 1GCQC 2FO0A 1GBQA 1M30A 1AOJA 2J6FA 1AWJA 2JS0A 2K7AA 1NM7A 1M8MA 3I35A 2D8HA 2LP5A 2KNBB 1UGVA 1T3SA 4WCIA 1ABOA 1W70A 2F2WA 3VS6A 1J3TA 3GBQA 1SRLA 2F2XA 1VYTA 2KEAA 1ZX6A 4CC2A 1WI7A 1WXBA 1UTIA 1AEYA 2DL8A 4AG1C 1JU5C 2DF6A 3VS2A 3EGUA 2O31A 1Z9QA 2A28A 4OMNA 3O5ZA 1HSQA 4OMMA 1RLPC 2LQNA 3I9QA 1ZUUA 4IIOA 1QKWA 1MV0B 2V1QA 2X3XD 1AWXA 1BK2A 2RQVA 5FWBA 1UHCA 2CH4W 2AK5A 4OMQA 1GFCA 2DBMA 2HEQA 3R6NA 2KRNA 4Z89A 1TUDA 2C0OA 1G2BA 3JV3A 5EC7A 1K1ZA 1QKXA 2B86A 2J05A 1YNZA 4J9CA 3EHRA 2D0NA 3VS3A 2JM8A 2PNIA 3C0CA 3EG3A 1PRMC 1CSKA 2YDLA 1NEBA 2C0TA 1AZGB 3KFVA 2AZVA 1FYNA 4J9DA 4J9HA 4M4ZA 2EYYA 3QWYA 4J9EA 4GBQA 2GNCA 5I11A 1GFDA 1B3QA 3UF4A 2EVRA 2DM1A 1PHTA 4OMPA 1AWWA 5HCKA 3M0SA 1BBZA 1OPKA 1Y0MA 3FJ5A 1NYFA 4IIMA 1Z9ZA 2XMFA 1U06A 1X6BA 2FPFA 5IHKA 5IXBA 2EYWA 2RF0A 5I22A 3IQLA 1VYVA 2D1XA 4Y92A 3TVTA 2KT8A 1E7OA 1MUZA 3EG1A 5IHIA 1T0HA 4R0KA 1EFNA 2LCSA 3ZL7C 2NWMA 3UATA 2RMOA 3M0TA 4JJDA 3TSZA 2YT6A 1KJWA 4DEXA 2ENMA 4LUEA 3REBB 2ESWA 1HJDA 1BU1A 1K0SA 2EBPA 1ZSGA 1UUEA 4RTTA 1CKAA 3TSWA 1W1FA 2DNUA 3UA6A 1PWTA 1PKSA 2YSQA 1UDLA 4D8KA 1ARKA 1OV3A 4AFQC 1XOVA 1JXMA 2KGTA 1T0JA 2FRYA 2KRMA 1K4US 1NLPC 1X2QA 1H3HA 4GLMA 2LMJA 2JMCA 2JMAA 3SHWA 1WYXA 2MCNA 3M0PA 2K79A 2M51A 4RTYA 2CSIA 2GQIA 1RLQC 2BTTA 4EIKA 1GL5A 1S1NA 2VKNA 1X6GA 1H92A 2ROLA 1B07A 1PKTA 2ROTA 2EGEA 2FG0A 2HBWA 2ECZA 1UHFA 2OJ2A 2LJ0A 3A98A 2RPNA 4HCKA 4LE9A 1JEGA 1WA7A 2K9GA 1E6HA 1MV3A 2DL3A 2JM9A 3CQTA 1UJYA 1NYGA 2KXCA 4JZ4A 4E6RA 1SRMA 2ABLA 2KYMA 3VRYA 5IH2A 2LNHB 1KSWA 2L3PA 1X69A 2BZ8A 3UA7A 2EGAA 2PZ1A 1YWOA 2IIMA 3NHNA 4CC3A 2LJ3A 1RUWA 1X2KA 4ESRA 1YP5A 1WXTA 1K0XA 1I1JA 4OMOA 2DVJA 2VWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2P A;  3VS7 A;  4AFZ C;  4CC4 B;  1K76 A;  2BZY A;  1QLY A;  2O9V A;  3REA B;  4LNP A;  2YUQ A;  5GJW B;  2CUD A;  4RTX A;  2A36 A;  4AG2 C;  2AKK A;  2RQR A;  2PTK A;  1W6X A;  2KXD A;  2A08 A;  2DJQ A;  2ED1 A;  1CKB A;  2O88 A;  4HVW A;  5IXF A;  2CRE A;  2KR3 A;  2J6O A;  2L0A A;  4J9I A;  2O9S A;  1PNJ A;  2HCK A;  4CC7 A;  3PE0 A;  1AZE A;  2EYZ A;  2L3Q A;  2C0I A;  1M3B A;  1RI9 A;  2JS2 A;  4A63 B;  1ZUK A;  3LH5 A;  1V1C A;  3QWX X;  2K3B A;  2J06 A;  2AKL A;  1OEB A;  1ZBJ A;  1ZLM A;  1NEG A;  1AVZ C;  1U5S A;  1YCS B;  4D8D A;  2DBK A;  2VVK A;  1HD3 A;  1T3L A;  1VYU A;  1KIK A;  4OML A;  4K11 A;  2FPE A;  3VS1 A;  2DL4 A;  1E6G A;  4AFS C;  2SEM A;  2DIL A;  3NMZ C;  1UJ0 A;  2K6D A;  2EPD A;  1GBR A;  2DRK A;  4HVU A;  3VRZ A;  4J9G A;  3H41 A;  2FPD A;  2QDL A;  1I0C A;  2DX1 A;  4RTZ A;  1SSH A;  4JZ3 A;  3RBB B;  4JJB A;  2P4R A;  4AFU C;  2K2M A;  2HDA A;  2KE9 A;  1ZUY A;  1JQQ A;  2M0Y A;  2OAW A;  2EGC A;  1M3C A;  2CT4 A;  2DRM A;  3SEM A;  1GCQ A;  4RTV A;  1SEM A;  4JJC A;  3NPF A;  1K9A A;  4LN2 A;  2MOX A;  4RUG A;  2J7I A;  3VS5 A;  1UE9 A;  2RQW A;  2D8J A;  1SHF A;  1WXU A;  3ULR B;  4J9B A;  4DEY A;  2O2O A;  1WIE A;  2DA9 A;  2EW3 A;  2JTE A;  2KRO A;  3PVL A;  1M3A A;  3M0R A;  2RQT A;  4RTW A;  1U3O A;  1AWO A;  2KT1 A;  1UFF A;  2KRS A;  2GTO A;  2LX7 A;  3RNJ A;  5GJV B;  1QWF A;  3H0H A;  2DL7 A;  3H0I A;  3PVQ A;  3EG0 A;  2LQW A;  1OOT A;  2W10 A;  2ED0 A;  2DMO A;  4ORZ A;  5FWC A;  1YN8 A;  1I07 A;  2YUN A;  3M0Q A;  1IO6 A;  2EQI A;  2V1R A;  1WDX A;  4HXJ A;  5IHN A;  3VS0 A;  4KRT A;  2NUZ A;  2BZX A;  2F2V A;  2DYB A;  2LJ1 A;  2A37 A;  1WX6 A;  2W0Z A;  1PRL C;  1QCF A;  4JPB W;  2JW4 A;  2CSQ A;  4HVV A;  4RTU A;  1OPL A;  2GGR A;  1TUC A;  1SPK A;  1WFW A;  1GCP A;  2G6F X;  1UG1 A;  2GBQ A;  2SRC A;  4X1V A;  1JXO A;  1VA7 A;  3U23 A;  1AD5 A;  1G83 A;  2L3S A;  2OI3 A;  1H8K A;  1NG2 A;  2MIO A;  1WLP B;  2DL5 A;  1JO8 A;  2YUO A;  2EKH A;  1A0N B;  2CUB A;  1LCK A;  2FRW A;  2FEI A;  4FSS A;  3NGP A;  2CDT A;  4F16 A;  2CH4 A;  2CT3 A;  2YUP A;  4F17 A;  1N5Z A;  2AZS A;  1BB9 A;  2H8H A;  5FW9 A;  1FMK A;  1NLO C;  3EG2 A;  2JT4 A;  2RQU A;  3EHQ A;  5L23 A;  3I5S A;  4Z88 A;  2GTJ A;  2E5K A;  1YWP A;  4LUD A;  1Y57 A;  1QWE A;  1KFZ A;  2LZ6 B;  2HSP A;  2JXB A;  4Z8A A;  1GRI A;  3VS4 A;  1TG0 A;  2KYB A;  5ECA A;  4F14 A;  1SHG A;  2KBT A;  4ZNX A;  1UEC A;  3H0F A;  1X43 A;  2EYX A;  3I5R A;  2DLP A;  2I0N A;  2J6K A;  2RN8 A;  1X27 A;  1M27 C;  2RNA A;  3M0U A;  3THK A;  2X3W D;  4QT7 A;  2DE0 X;  4J9F A;  1ABQ A;  1GCQ C;  2FO0 A;  1GBQ A;  1M30 A;  1AOJ A;  2J6F A;  1AWJ A;  2JS0 A;  2K7A A;  1NM7 A;  1M8M A;  3I35 A;  2D8H A;  2LP5 A;  2KNB B;  1UGV A;  1T3S A;  4WCI A;  1ABO A;  1W70 A;  2F2W A;  3VS6 A;  1J3T A;  3GBQ A;  1SRL A;  2F2X A;  1VYT A;  2KEA A;  1ZX6 A;  4CC2 A;  1WI7 A;  1WXB A;  1UTI A;  1AEY A;  2DL8 A;  4AG1 C;  1JU5 C;  2DF6 A;  3VS2 A;  3EGU A;  2O31 A;  1Z9Q A;  2A28 A;  4OMN A;  3O5Z A;  1HSQ A;  4OMM A;  1RLP C;  2LQN A;  3I9Q A;  1ZUU A;  4IIO A;  1QKW A;  1MV0 B;  2V1Q A;  2X3X D;  1AWX A;  1BK2 A;  2RQV A;  5FWB A;  1UHC A;  2CH4 W;  2AK5 A;  4OMQ A;  1GFC A;  2DBM A;  2HEQ A;  3R6N A;  2KRN A;  4Z89 A;  1TUD A;  2C0O A;  1G2B A;  3JV3 A;  5EC7 A;  1K1Z A;  1QKX A;  2B86 A;  2J05 A;  1YNZ A;  4J9C A;  3EHR A;  2D0N A;  3VS3 A;  2JM8 A;  2PNI A;  3C0C A;  3EG3 A;  1PRM C;  1CSK A;  2YDL A;  1NEB A;  2C0T A;  1AZG B;  3KFV A;  2AZV A;  1FYN A;  4J9D A;  4J9H A;  4M4Z A;  2EYY A;  3QWY A;  4J9E A;  4GBQ A;  2GNC A;  5I11 A;  1GFD A;  1B3Q A;  3UF4 A;  2EVR A;  2DM1 A;  1PHT A;  4OMP A;  1AWW A;  5HCK A;  3M0S A;  1BBZ A;  1OPK A;  1Y0M A;  3FJ5 A;  1NYF A;  4IIM A;  1Z9Z A;  2XMF A;  1U06 A;  1X6B A;  2FPF A;  5IHK A;  5IXB A;  2EYW A;  2RF0 A;  5I22 A;  3IQL A;  1VYV A;  2D1X A;  4Y92 A;  3TVT A;  2KT8 A;  1E7O A;  1MUZ A;  3EG1 A;  5IHI A;  1T0H A;  4R0K A;  1EFN A;  2LCS A;  3ZL7 C;  2NWM A;  3UAT A;  2RMO A;  3M0T A;  4JJD A;  3TSZ A;  2YT6 A;  1KJW A;  4DEX A;  2ENM A;  4LUE A;  3REB B;  2ESW A;  1HJD A;  1BU1 A;  1K0S A;  2EBP A;  1ZSG A;  1UUE A;  4RTT A;  1CKA A;  3TSW A;  1W1F A;  2DNU A;  3UA6 A;  1PWT A;  1PKS A;  2YSQ A;  1UDL A;  4D8K A;  1ARK A;  1OV3 A;  4AFQ C;  1XOV A;  1JXM A;  2KGT A;  1T0J A;  2FRY A;  2KRM A;  1K4U S;  1NLP C;  1X2Q A;  1H3H A;  4GLM A;  2LMJ A;  2JMC A;  2JMA A;  3SHW A;  1WYX A;  2MCN A;  3M0P A;  2K79 A;  2M51 A;  4RTY A;  2CSI A;  2GQI A;  1RLQ C;  2BTT A;  4EIK A;  1GL5 A;  1S1N A;  2VKN A;  1X6G A;  1H92 A;  2ROL A;  1B07 A;  1PKT A;  2ROT A;  2EGE A;  2FG0 A;  2HBW A;  2ECZ A;  1UHF A;  2OJ2 A;  2LJ0 A;  3A98 A;  2RPN A;  4HCK A;  4LE9 A;  1JEG A;  1WA7 A;  2K9G A;  1E6H A;  1MV3 A;  2DL3 A;  2JM9 A;  3CQT A;  1UJY A;  1NYG A;  2KXC A;  4JZ4 A;  4E6R A;  1SRM A;  2ABL A;  2KYM A;  3VRY A;  5IH2 A;  2LNH B;  1KSW A;  2L3P A;  1X69 A;  2BZ8 A;  3UA7 A;  2EGA A;  2PZ1 A;  1YWO A;  2IIM A;  3NHN A;  4CC3 A;  2LJ3 A;  1RUW A;  1X2K A;  4ESR A;  1YP5 A;  1WXT A;  1K0X A;  1I1J A;  4OMO A;  2DVJ A;  2VWF A; 
#chains in the Genus database with same CATH topology
 2L2P A;  1VQN A;  5GAO q;  2JTM A;  5KYU A;  2O9V A;  4M78 E;  1TTH B;  3X24 B;  3CPF A;  1TS9 A;  2YUQ A;  1N27 A;  5GAN 8;  3OYI A;  3CCU A;  2CUD A;  4RTX A;  2PTK A;  5GAO m;  1G8X A;  3S3N A;  3OYN A;  3PIP A;  2HBP A;  2A08 A;  2ED1 A;  2O88 A;  2WSF E;  4OB0 B;  4OB3 B;  2J6O A;  2RHU A;  2L0A A;  4DBH A;  4EMK B;  3V7C A;  2NUT A;  4BI3 A;  1NJI R;  4BE2 A;  2PUK B;  3OYY A;  2EFI A;  1AZE A;  1JJ2 P;  2C0I A;  2DXC A;  2DZ9 A;  3Q1J A;  3LH5 A;  1V1C A;  1IGU A;  3CC2 T;  2ZGW A;  2J06 A;  2AKL A;  2ZPE B;  1OEB A;  1ZLM A;  2COZ A;  1NEG A;  4ZGE B;  2QTV A;  1VQN T;  3M54 A;  4MDW A;  3FJP A;  1HYO A;  3MHX A;  4QVC A;  5CKD A;  2DBK A;  3CCU T;  1VYU A;  4EMK A;  3GOX A;  3LGL A;  4OML A;  4FCY A;  2LDM A;  1Y07 A;  5C6S A;  1W2B P;  2P0K A;  3PMI A;  1M2O A;  2SEM A;  3H6Z A;  1UJ0 A;  4N4I A;  1D0X A;  3CC4 A;  4EPC A;  1GBR A;  4EDU A;  2OTJ Q;  4HVU A;  3VRZ A;  1K9M C;  5KCO A;  4M77 E;  2LCC A;  1WPY A;  2QDL A;  1I0C A;  3M58 A;  4JZ3 A;  3FB9 A;  4UC4 A;  2CS7 A;  2K2M A;  2F69 A;  3M59 A;  3VYG A;  4WF2 A;  2M0Y A;  1YIT A;  4C5H A;  3BDL A;  3P8B B;  2YRV A;  2DRM A;  4XTU A;  3AHU A;  1SEM A;  3NPF A;  3L2Z A;  1BCO A;  3VS5 A;  3JAM E;  1KD1 R;  2RQW A;  5GAN j;  5GAM e;  4HCB A;  4J9B A;  2YWW A;  2O2O A;  2E3I A;  2B8A A;  2KRO A;  2XU8 A;  1M3A A;  2KY9 A;  3M0R A;  4RTW A;  4RKU E;  4NOY A;  3EFO B;  2GTO A;  2FZK B;  2VGN A;  4QQG A;  1K73 C;  2FYK A;  2QEX Q;  1QWF A;  2IG0 A;  2LRQ A;  3WVD B;  3H0I A;  3JCM b;  1QVG A;  1AHJ B;  1OOT A;  1ZA2 B;  3V8K A;  3QKJ A;  2GQV A;  4VUB A;  2DMO A;  5FWC A;  2VGM A;  5KCH A;  1M5Q 1;  3VS0 A;  4E7J A;  2NUZ A;  3CCV Q;  2LJ1 A;  4M75 G;  4MMK A;  3X20 B;  3QDR B;  3QBY A;  3LWH A;  3EFO A;  1C1A A;  2DZC A;  3GLX A;  3I55 A;  4XU0 A;  1OPL A;  2GGR A;  4J6W A;  1WFW A;  2SRC A;  4C5G A;  1Q95 G;  3C12 A;  3ASK A;  2CZ1 B;  4JRP A;  1JXO A;  3CBP A;  3CCM Q;  1YHQ T;  2DAQ A;  2H3E B;  2OI3 A;  2MIO A;  4BY6 C;  1WJQ A;  2RH2 A;  4FYV B;  5GMK j;  2EKH A;  3OYF A;  4KH1 B;  2CDT A;  4M7D G;  2XG8 D;  2YUP A;  5CCA A;  5J39 A;  4F17 A;  1N5Z A;  2AZS A;  1MND A;  1OU9 A;  3E9G A;  4AMC A;  4GLK A;  2EQM A;  2VB6 A;  1K9M U;  3EHQ A;  3I5S A;  3I55 T;  1JRI A;  2GTJ A;  1VQ6 T;  1VQO Q;  1KFZ A;  2LZ6 B;  2HSP A;  2CZ6 B;  2E1H A;  3G71 A;  1GRI A;  2KYB A;  3CEY A;  4JLG A;  3OSS C;  4FIB A;  2KSS A;  2NLU A;  2DLP A;  1JJ2 A;  4C8Q C;  2RN8 A;  2RO0 A;  2HL3 A;  1YJN A;  1HK9 A;  3THK A;  3L2U A;  1ABQ A;  2J6F A;  5A0D A;  1AWJ A;  1IZ6 A;  2JS0 A;  2K7A A;  2CP0 A;  1Q81 C;  4IKF A;  3I35 A;  1SF9 A;  2LP5 A;  3QJY A;  4WCI A;  1T3S A;  4PJL A;  1JBM A;  2F2W A;  3GBQ A;  1UB4 A;  4LDX A;  4LXC A;  1K73 U;  1PSF A;  1W2B A;  1OZ3 A;  3SD4 A;  2K3X A;  1VQ4 T;  1WXB A;  3PMT A;  1S72 Q;  4M75 E;  4AG1 C;  2HNI A;  5LJ5 g;  2DTO A;  2KQW A;  4C92 F;  4IUT A;  1Z9Q A;  2LC4 A;  4B6M A;  1UGQ B;  1HSQ A;  5AYF A;  4N4H A;  1KQS P;  3G4S T;  1YJN T;  3JSC A;  4BAC A;  1RAB B;  3CMA A;  4KUI A;  2KAF A;  3JB9 H;  1BI1 A;  1WQW A;  2O4X B;  3LYI A;  4Q5W A;  1ZUU A;  1Y71 A;  5HK3 A;  4QQ6 A;  1MV0 B;  4FW2 A;  3FRN A;  1X01 A;  2PVD B;  4M7D E;  3V8L A;  4N4G A;  4KH0 B;  4F7U F;  3JCM c;  2HEQ A;  4FT2 A;  2KRN A;  4Z89 A;  5EC7 A;  4J9C A;  3EHR A;  3E9F A;  3VS3 A;  3P8D A;  2O4X A;  1BIA A;  1K9M R;  1WQ7 A;  1AZG B;  3KFV A;  1LPL A;  2QQS A;  3CMA T;  1FYN A;  1VQL Q;  4J9H A;  4BY6 B;  2RA2 A;  4M7A C;  1TH7 A;  2QQB A;  4OMP A;  1PHT A;  2VC8 A;  1BBZ A;  3FJ5 A;  3BW1 A;  1YIJ Q;  3G6E Q;  2JVV A;  1R0C B;  1YCY A;  1HXD A;  4J6Y A;  3NTH A;  1X6B A;  2ZPG B;  3INZ A;  4BI8 B;  3A1P A;  3CCL Q;  5FLX E;  3I56 Q;  3IQL A;  5GAN 3;  5CKB A;  1PCX A;  2KT8 A;  1E7O A;  1MUZ A;  3EG1 A;  4C0F A;  1YFN A;  1Q81 U;  1EFN A;  2K2V A;  3FIF A;  2RMO A;  3M0T A;  4M77 D;  1I4K 1;  5D6X A;  3ZEH A;  3CD6 Q;  2QGF B;  4JJD A;  4KGV B;  3TSZ A;  2MI6 A;  4C8Q B;  1D3B A;  1RAD B;  3RKY A;  1K73 R;  3REB B;  1K0S A;  4PFP A;  5KE2 A;  1UUE A;  1CKA A;  1W4S A;  2NUP B;  3LGF A;  2QI2 A;  1W1F A;  2YSQ A;  2E65 A;  2KRM A;  5LJ3 j;  1NLP C;  1X2Q A;  4QKU A;  1H3H A;  1M9S A;  4XU3 A;  4XAX B;  1VQP T;  1G3W A;  4YTL A;  2DJZ A;  2CSI A;  3A8M B;  4C8Q A;  1TUG B;  1RLQ C;  3CC7 A;  2DKG A;  1X6G A;  2NUP A;  8AT1 B;  4E7H A;  3EAE A;  1H92 A;  1PKT A;  1WHK A;  5J26 A;  3A98 A;  4LE9 A;  4JJN K;  2X4X A;  2K9G A;  1E6H A;  3QZ9 B;  3X25 B;  2QAS A;  1UJY A;  2KXC A;  4JZ4 A;  2M16 A;  3GIB A;  1WHH A;  2KYM A;  4XTX A;  3VRY A;  4OF1 A;  2X9H A;  2EGA A;  2RHY A;  3JRZ A;  2QG9 B;  3TEE A;  5GAO n;  4M7A F;  1YI2 T;  3CC7 T;  5CKH A;  2VWF A;  5GMK i;  1KQS A;  4HT8 A;  5GMK l;  4AFZ C;  1RAF B;  2JN0 A;  1RI0 A;  3H9N A;  2BZY A;  3VUZ A;  3CCQ Q;  1PC0 A;  5GAM f;  1VIF A;  4M7A B;  1I5L A;  4GY5 A;  2RQR A;  4PFO A;  2P0P A;  1RAE B;  4B9W A;  3JCM Q;  5LJ5 e;  4Y91 A;  1Q81 R;  5IXF A;  2D6F A;  2CRE A;  1D1C A;  3UPU A;  1K8A C;  4PLL A;  1X75 C;  2RD1 A;  1OI1 A;  2AHJ B;  4PJO F;  2EYZ A;  3HSB A;  3JCM g;  3OBY A;  2BIV A;  1ZUK A;  1KK7 A;  5CKF A;  3QWX X;  2LT4 A;  2P4T A;  2K3B A;  2PUO B;  1IRX A;  1ZBJ A;  2ZZD A;  1YCS B;  1C0M A;  4BI4 A;  1MGQ A;  2VVK A;  1HD3 A;  4K11 A;  2RB6 A;  1U1S A;  2DL4 A;  5GAM d;  4AFS C;  4FL6 A;  3DLL A;  5CK9 A;  5GAO l;  1FMW A;  2DIL A;  4E47 A;  2K6D A;  2DRK A;  3RER A;  2DPP B;  2R5A A;  3RKX A;  4OB2 B;  3OQ5 A;  3CCU Q;  2FPD A;  4RTZ A;  4C0D C;  1SSH A;  3QG1 A;  1UGR B;  3E1S A;  3JB9 D;  4M75 D;  4AFU C;  1ZBX A;  2DD4 A;  2KE9 A;  1BI0 A;  3OYL A;  1D1A A;  2QXF A;  1M3C A;  2K3Y A;  2XI9 A;  5KH6 A;  3HPW A;  3SEM A;  4RTV A;  4JJC A;  4E7S A;  2OX7 A;  2M9U A;  2CZ7 B;  3R6O A;  2J7I A;  3RIR A;  1SHF A;  1WXU A;  5J3B A;  3CBO A;  2R57 A;  3D7S B;  4ZN3 A;  3MCA B;  4M7D D;  2KDS A;  3OA6 A;  1VQ8 A;  2AT1 B;  1OYX A;  2KRS A;  5DY9 A;  4PL6 A;  4HCZ A;  4MDX A;  2COY A;  1N8R C;  2XIC A;  2EJG A;  1UGP B;  3MKD A;  3EH2 A;  3EG0 A;  3CCJ T;  3NTI A;  2D0Q B;  3QII A;  3QXE B;  2DD5 A;  1O75 A;  2XDB A;  5FRO A;  2EQI A;  2RK2 A;  1WDX A;  4HXJ A;  5IHN A;  1D1B A;  4L6V 5;  5GAN 6;  2BZX A;  2X35 A;  1K8A U;  2HSE B;  1M2V B;  1WX6 A;  2W0Z A;  4PNO A;  5A2Q E;  1VQ9 A;  2JW4 A;  3T9N A;  4FU6 A;  2CSQ A;  2XKO C;  4RTU A;  2EQU A;  2X4Y A;  3M57 A;  3CCE A;  4LDU A;  2GBQ A;  1VQK A;  1UG1 A;  2F1L A;  3G7Z A;  3CCS A;  4ZTF A;  1G83 A;  2L3S A;  4Y28 E;  3OYJ A;  1OUL A;  1N9S A;  2HKN A;  4C8Q G;  1WLP B;  2DL5 A;  3MEU A;  2CUB A;  2PVG B;  1LCK A;  2FRW A;  1VQ7 T;  3QSU A;  1M2V A;  1TOV A;  3HL8 A;  2HQH A;  3DB4 A;  5FW9 A;  2VV5 A;  3EG2 A;  2XD0 A;  2JT4 A;  1YHQ Q;  5L23 A;  4A54 A;  1ZSZ C;  3OMC A;  1Y57 A;  3CCE T;  3M5A A;  4XTZ A;  3CXC S;  3EFS A;  4Z8A A;  1VQK T;  5FU6 C;  3QYG B;  3EGD B;  3CCS T;  1SHG A;  4ZNX A;  4E7K A;  3MEA A;  1X43 A;  2A7Y A;  2ATC B;  2DIQ A;  2QTX A;  4O6J A;  2H3J A;  2I0N A;  3A5Z B;  4C0D B;  1WHL A;  2YLB A;  3OS5 A;  1VQ6 Q;  5GAO r;  4JRK A;  2DE0 X;  1GCQ C;  2VXF A;  4OB1 B;  3C94 A;  4C5E A;  2KNB B;  1UGV A;  1TXQ A;  3CCR A;  2P84 A;  2M02 A;  3EGD A;  3OYD A;  1W70 A;  3OB9 A;  1J3T A;  4DBF A;  1VYT A;  4C0Z A;  1N8R U;  3JCM e;  2DFU A;  3RKW A;  5GAN 2;  2F5T X;  3L42 A;  2DL8 A;  1QCN A;  1JU5 C;  4M78 C;  3CC4 T;  4MML A;  1QVF S;  1EIF A;  2A28 A;  1TU0 B;  4OMN A;  1U1T A;  1K8A R;  3O5Z A;  2VAS A;  2RHI A;  4FYY B;  2FVU A;  2LQN A;  1XTD A;  1N6A A;  1VQ4 Q;  1YIT T;  1IRE B;  4IUR A;  3SDZ A;  4ME7 A;  4AT1 B;  4C8Q E;  1QKW A;  4L5G A;  1LJO A;  4C92 C;  4MZT A;  2RHX A;  2RJD A;  2X3X D;  1AWX A;  4F04 B;  1UHC A;  5L8R E;  3G4S Q;  2QGG A;  2AK5 A;  3JB9 G;  1YJN Q;  2DBM A;  3ZBD A;  2B86 A;  3EGX B;  5LJ3 g;  5IT9 E;  2D0N A;  2PNI A;  3C4S A;  3EG3 A;  4D6W A;  1PRM C;  4KGZ B;  2E6Z A;  2YDL A;  5D7U A;  2OTJ A;  5GMK e;  2AZV A;  4BDZ A;  1MMG A;  2F5K A;  3OS0 A;  2GNC A;  1M4Z A;  1GFD A;  2QA4 A;  2EVR A;  4JS4 A;  3HKS A;  4M77 C;  1ZQ1 A;  1R8O B;  1NYF A;  4IIM A;  1YJW A;  1Z9Z A;  3EGX A;  3PTA A;  4BD3 A;  4PLI A;  3CMA Q;  5IXB A;  2EYW A;  1ZSZ B;  2LVM A;  4QW2 A;  1WHM A;  1VYV A;  1XJW B;  2HMA A;  1X6O A;  2D1X A;  2RI5 A;  5FU6 B;  3TVT A;  3SWN C;  1T0H A;  4R0K A;  2OTJ T;  3UAT A;  3LW5 E;  2K5F A;  2ESW A;  1N8R R;  1BU1 A;  4A4F A;  2QA4 T;  7AT1 B;  1ZSG A;  2QEX A;  2X4J A;  3TSW A;  2ZPF B;  3BE3 A;  5LJ5 f;  4A4H A;  2DNU A;  1YJW T;  1FMV A;  4M78 F;  3ZFJ A;  3BFM A;  4AFQ C;  5HK0 A;  4HKE A;  3QPH A;  2QDY B;  1T0J A;  2QQR A;  3E2U A;  4B9X A;  4GLM A;  3NTK A;  5GAM h;  3CCV A;  5HKC A;  2K79 A;  3OYA A;  3G71 T;  2GQI A;  2JUF A;  3DKM A;  1VQM A;  1QQJ A;  4M78 B;  4XK8 E;  4EIK A;  3M4G A;  1S1N A;  3JB9 J;  2ROL A;  2IPO B;  4ZN1 A;  1B07 A;  2EGE A;  2FG0 A;  1VQP Q;  1Y7X A;  3CCM A;  2ECZ A;  1M1K C;  1D09 B;  4HCK A;  1VIE A;  4XTY A;  3OYM A;  1NE8 A;  2DL3 A;  2JJ9 A;  3CME A;  1NPR A;  4C92 B;  3P8H A;  5LJ5 d;  2LNH B;  2L3P A;  2FHD A;  4M78 A;  2BZ8 A;  5KE3 A;  3UA7 A;  2PZ1 A;  1G5V A;  1M1G A;  5C0M A;  1VQM T;  4DBR A;  4RMO A;  4CC3 A;  5D6Y A;  2LJ3 A;  4LDY A;  1VQO A;  1RUW A;  3HFN A;  2DER A;  1X2K A;  4M77 F;  1YP5 A;  2RK1 A;  1I1J A;  4OMO A;  4BUG A;  2DVJ A;  2L5Q A;  3VS7 A;  5CAI A;  5KYX B;  5GMK h;  3CCM T;  2VUB A;  4CC4 B;  4F7U B;  1K76 A;  1QLY A;  3TCJ A;  5AT1 B;  3REA B;  5IAY A;  4LNP A;  4C92 A;  5GJW B;  2RHZ A;  3ME9 A;  4AG2 C;  2AKK A;  1IXD A;  3QO3 A;  1YI2 Q;  3OS1 A;  3CME T;  3CC7 Q;  4FYX B;  1W6X A;  2YRD A;  4M77 B;  1WHJ A;  2DJQ A;  1CKB A;  1Y96 B;  1OU8 A;  4P5N A;  3OBW A;  3TQ7 P;  2HCK A;  3A8O B;  1RAH B;  3PE0 A;  2L3Q A;  2JTF A;  5KYX A;  1RI9 A;  4F7U A;  2JS2 A;  4A63 B;  1KQ2 A;  2YRC A;  4IUQ A;  1R0B G;  2EAY A;  4FW1 A;  3SWN B;  2BUD A;  2YXY A;  1IGQ A;  3MO8 A;  2IVW A;  1I5O B;  1Y96 A;  1WZO A;  4ZGJ B;  4PJO C;  3M53 A;  1T3L A;  2K57 A;  2Y90 A;  4QVD A;  5CO7 A;  1KIK A;  3OYG A;  2Y4X A;  2EWN A;  5IN1 A;  4KUL A;  2V8I A;  3VS1 A;  2WSC E;  5A0G A;  1E6G A;  3OYB A;  5LJ3 e;  3HRU A;  3GNG A;  3GPL A;  4XU1 A;  4E7L A;  4OGC A;  2EPD A;  2LT1 A;  2QK0 A;  4A4G A;  2DXB A;  3JCM P;  4J9G A;  4NS5 A;  3SWN A;  3OW2 S;  2DX1 A;  3CPW S;  1M1K U;  2P4R A;  5FU7 C;  2HDA A;  2LTO A;  2ZPI B;  1YBY A;  1ZUY A;  2KI7 A;  3MPU B;  3HHT B;  4J7F A;  2LCL A;  4PJJ A;  4DA4 A;  1TWB A;  3S3M A;  2CT4 A;  1M1F A;  1IB8 A;  2HQX A;  1K9A A;  4LN2 A;  4MZP A;  1UE9 A;  2FZG B;  4KUD K;  4DEY A;  4C8Q D;  1WIE A;  2DA9 A;  2EW3 A;  5I2S A;  1VUB A;  1AT1 B;  1PD0 A;  2G3R A;  4J6X A;  3OYH A;  3OW2 A;  1AWO A;  2KT1 A;  3G6E A;  3RNJ A;  2E10 A;  5GJV B;  3H0H A;  2COW A;  3MEV A;  4PJN A;  2MWO A;  3QHS A;  3CCL A;  3VKI A;  1MMN A;  2W10 A;  5KYN A;  2ED0 A;  1Q86 C;  1BCM A;  3JB9 I;  3M0Q A;  2L89 A;  1P92 A;  3FEO A;  3M4Y A;  1JB0 E;  1I8F A;  2PVO B;  2QYZ A;  3CD6 A;  2F2V A;  2DYB A;  3JCM f;  2OAU A;  1PRL C;  4HVV A;  3CCJ Q;  1TUC A;  1FWZ A;  1GCP A;  2G6F X;  2DO3 A;  1VA7 A;  3U23 A;  5GAN g;  4M75 F;  4RG2 A;  1H8K A;  1NG2 A;  3J81 E;  2RM4 A;  3V7R A;  1RAC B;  3A8G B;  1JO8 A;  2XK0 A;  3M9Q A;  1D0Y A;  4FSS A;  3NGP A;  3GNF B;  3WVE B;  2CT3 A;  4M7A A;  1OX8 A;  3RMQ A;  2HAX A;  1H64 1;  1BB9 A;  2H8H A;  5CIU A;  1FMK A;  3FDR A;  4Z88 A;  4PJO B;  1M1K R;  5GAN d;  2E5K A;  1YWP A;  3CXC P;  4RCC A;  1VQ7 Q;  4M7D F;  5LJ3 h;  2JXB A;  2DET A;  3JCM d;  3VS4 A;  5ECA A;  4F14 A;  3CC2 Q;  2KBT A;  1VQN Q;  4M78 G;  4XU2 A;  4OGE A;  1GXI E;  2BE9 B;  2EYX A;  3I5R A;  4ZTJ A;  5GAN 5;  2R58 A;  3LX7 A;  1NBE B;  3RDV A;  3URG A;  2DEQ A;  1WHG A;  1M27 C;  3M0U A;  5FU7 B;  4PJO A;  4J9F A;  2FO0 A;  4LD6 A;  1M30 A;  1VQK Q;  3MP1 A;  3CCS Q;  1M8M A;  2D8H A;  2YLC A;  1UGS B;  4O5V A;  1VQ5 A;  4C92 G;  1ABO A;  3VS6 A;  1SRL A;  3MP6 A;  2F2X A;  1FX7 A;  2OTL A;  1ZX6 A;  4CC2 A;  4PKC C;  1UTI A;  2HD0 A;  3O8V A;  1AEY A;  1SSF A;  4J8O A;  1QVF P;  4RCB A;  1Q86 U;  1PSE A;  3VU3 C;  4JUV A;  4OMM A;  1RLP C;  4F7U G;  1MHN A;  4LDW A;  3I9Q A;  3BY7 A;  4ANJ A;  2MMP A;  2E4H A;  3CC4 Q;  4IIO A;  1VQ5 T;  3V8J A;  2V8K A;  3M55 A;  2OTL T;  4EMG A;  2RQV A;  5FWB A;  4IUV A;  1GFC A;  3VJP A;  1KHI A;  1RAA B;  1YJ9 A;  1TUD A;  3F70 A;  3JV3 A;  1K1Z A;  1QKX A;  1YIT Q;  2J05 A;  5I2M A;  3NFC A;  2CP7 A;  2XHC A;  5LJ5 h;  1YNZ A;  1VQ8 T;  1BI3 A;  2JM8 A;  3C0C A;  3RR6 A;  2CYZ B;  1NEB A;  2C0T A;  1DJ7 B;  2LNV A;  1U8R A;  4J9D A;  3QDF A;  4M4Z A;  2DVE A;  3QWY A;  3L2W A;  2MYS A;  3N5B B;  3RMS A;  3HTR A;  5KYW B;  3UF4 A;  2DM1 A;  5CQY A;  1AWW A;  1R77 A;  3FC3 A;  1G3Y A;  1Y0M A;  3WXM B;  1N9R A;  5D6W A;  5GAO p;  1V29 B;  2XMF A;  1YJ9 T;  1VQ9 T;  4C92 E;  4C5I A;  1QMC A;  5I22 A;  2AIR B;  4V2S A;  2JOY A;  4BB7 A;  1LOJ A;  3FLG A;  3SB2 A;  4QQD A;  1TSF A;  5KYW A;  4L59 A;  2V8J A;  6AT1 B;  2NWM A;  4J7I A;  2HZY A;  2ZPH B;  1KJW A;  3E19 A;  2ENM A;  1F1B B;  4ATO A;  3LH0 A;  2WAC A;  3I55 Q;  3JCM W;  1C6V X;  1WGS A;  4F7U E;  3SFM A;  1PKS A;  1UDL A;  1Q86 R;  1ARK A;  1OV3 A;  4FSX A;  1XOV A;  2KGT A;  2FRY A;  2LMJ A;  5GAN e;  2JMC A;  4EMH A;  2E64 A;  3CXC A;  2EQK A;  1WYX A;  2QA4 Q;  3M0P A;  2M51 A;  1YJW Q;  1QVG S;  3L2Q A;  4OMF B;  2MPX C;  1GL5 A;  2VKN A;  2L3R A;  2RJF A;  3A8L B;  5CVI A;  4BDY A;  4X34 A;  1OQK A;  2LJ0 A;  4DOV A;  2RPN A;  1MNE A;  1JEG A;  1WA7 A;  3HP9 A;  5DLQ E;  3H8Z A;  1MV3 A;  4Z02 A;  5LJ3 f;  2JM9 A;  3CQT A;  3G71 Q;  4M7A G;  1NYG A;  5GAM j;  3RUX A;  2P0Q A;  3G1J A;  3CCR T;  2YHT A;  2DTI A;  4BE0 A;  2E5Q A;  3UWN A;  2NYS A;  4RG8 A;  3MJX A;  2HL5 C;  1X69 A;  1KG1 A;  4ELZ C;  1KQ1 A;  1YHQ A;  2BKD N;  4FYW B;  2IIM A;  2K5I A;  1B7T A;  3NHN A;  1QVF A;  2DTH A;  5GAN 7;  5A0L A;  2C06 A;  1BKB A;  2KK4 A;  5HY6 A;  4PJO G;  1I81 A;  5GAN 4;  2A36 A;  2V26 A;  1VQM Q;  1VQ6 A;  1BIB A;  2KXD A;  1FXX A;  4JRQ A;  4HVW A;  2KR3 A;  5LJ3 d;  2MK5 A;  2GFU A;  3DB3 A;  4ZGD B;  1LNX A;  3L2V A;  1WNL A;  2E12 A;  3QZ5 B;  4J9I A;  2O9S A;  1PNJ A;  4CC7 A;  3LWI A;  5I21 A;  2EIF A;  1M3B A;  4LD9 K;  5EG2 A;  1JJ2 S;  3HRT A;  3CME Q;  3KUF A;  2MF2 A;  3VUB A;  1AVZ C;  8ATC B;  1U5S A;  2RJC A;  4D8D A;  3MET A;  2ZPB B;  2FPE A;  1QP3 A;  1M90 C;  1VQ4 A;  1W2B S;  1ZSZ A;  2CP2 A;  2K5L A;  4KBM B;  1PD1 A;  3NMZ C;  4M7A E;  1V76 A;  3OS2 A;  5GAN h;  4OP0 A;  3OW2 P;  1BYM A;  3H41 A;  3CPW P;  3QYH B;  3GP8 A;  3JCM h;  3G4S A;  2E41 A;  3RBB B;  4JJB A;  1PG5 B;  1JQQ A;  2OAW A;  2EGC A;  1GCQ A;  4XTV A;  4QVZ A;  5DM7 R;  2MOX A;  2FB7 A;  4RUG A;  2QEX T;  3V7S A;  2D8J A;  3MEW A;  3ULR B;  3EH1 A;  4J5Y A;  2JTE A;  4PJO E;  3PVL A;  2CP5 A;  2DEU A;  2RQT A;  2R5M A;  2FZC B;  1U3O A;  1UFF A;  2VXE A;  3CCV T;  2LX7 A;  4JDS A;  3PNW C;  1G3T A;  2DL7 A;  3EFR A;  3PVQ A;  3OYE A;  2LQW A;  5DLO A;  1WJR A;  4BE1 A;  1NZ9 A;  1QW1 A;  3VYH B;  4ORZ A;  1UEB A;  1YN8 A;  1I07 A;  2YUN A;  1IO6 A;  2QQA A;  2V1R A;  1Q7Y C;  3TU4 K;  4M78 D;  2RJE A;  4KRT A;  4WTO B;  1Q82 C;  2DYI A;  2RI3 A;  2A37 A;  3JCM J;  4DBQ A;  1QCF A;  4JPB W;  3OYC A;  2Z0W A;  1SPK A;  3ER0 A;  4CI0 C;  4X1V A;  4N0A C;  1MMA A;  2GCX A;  3QUI A;  1SKU B;  1AD5 A;  2RI2 A;  1M8V A;  2XID A;  2LX9 A;  3HRS A;  4C92 D;  2DXT A;  2YUO A;  2EKO A;  2XDD A;  1A0N B;  1VQO T;  2FEI A;  3MP8 A;  1M90 U;  4F16 A;  2CH4 A;  1S72 A;  4FT4 A;  5CKE A;  4KGX B;  1D3B B;  1NLO C;  4M77 A;  1KC8 C;  3S6W A;  4M75 C;  1H3Z A;  2RQU A;  2EJF A;  4C8Q F;  4LDV A;  1VQP A;  4LUD A;  3PFS A;  4E7Z A;  1QWE A;  2ZCF B;  1TG0 A;  4XTW A;  3JCM X;  2ZAE A;  3PT9 A;  5CQX A;  2DIG A;  1UEC A;  3H0F A;  2PQW A;  1D0Z A;  3OY9 A;  1EX4 A;  3CBM A;  4II1 A;  2CGH A;  2J6K A;  4KT0 E;  1X27 A;  2MAM A;  2RNA A;  1S72 T;  3JCM V;  2X3W D;  3AT1 B;  4QT7 A;  4M7D C;  2A3L A;  4A4E A;  1GBQ A;  1AOJ A;  5FRM A;  1NM7 A;  4E7I A;  2M0O A;  4J83 A;  2X51 A;  1QVP A;  5KYY B;  1NJI C;  2GF7 A;  2M1H A;  1KHC A;  2KEA A;  4PFZ A;  4CRI A;  3OYK A;  1RL2 A;  1WI7 A;  1VQL A;  2A0F B;  1YI2 A;  3X28 B;  2DF6 A;  2L8D A;  5CR2 A;  3BDU A;  3VS2 A;  4C0G A;  4A53 A;  3EGU A;  2O31 A;  1YIJ A;  3CPW A;  1Q7Y U;  1NPP A;  1KQS S;  4JRI A;  1Q82 U;  3KXT A;  1VOM A;  4PK4 A;  5KYY A;  1ZHI A;  9ATC B;  4X9D A;  3I56 A;  2BE7 D;  3M56 A;  4HA8 A;  2WSE E;  2EYQ A;  5GAN f;  2V1Q A;  4XQ3 A;  1XNI A;  2EJ9 A;  1OZ2 A;  3VV0 A;  1BK2 A;  2CH4 W;  1VQL T;  4OMQ A;  3R6N A;  2I2L A;  4A4K A;  4R56 A;  2C0O A;  1G2B A;  3UDC A;  1XQH A;  2CP3 A;  2QQ9 A;  1M90 R;  4E2F B;  1YIJ T;  3G6E T;  1VQ5 Q;  1CSK A;  2XDP A;  3JB9 F;  2OTL Q;  1KC8 U;  2QAZ A;  3EG9 B;  1KD1 C;  2EYY A;  4J9E A;  3CCL T;  1ACM B;  1QCO A;  4GBQ A;  5I11 A;  3I56 T;  1B3Q A;  2E70 A;  4OVA A;  5HCK A;  2EQJ A;  2E6N A;  3M0S A;  3A8H B;  1OPK A;  1VQ8 Q;  4EMK C;  5LJ5 j;  3CD6 T;  1U06 A;  4DQ2 A;  1QP2 A;  4M75 B;  2FPF A;  5IHK A;  2RF0 A;  4N0A A;  2KMT A;  5GAM g;  1RAG B;  1MMD A;  2HQE A;  3EG9 A;  3L2R A;  4JLI A;  4Y92 A;  3S3O A;  4M7A D;  1OX9 A;  5M9O A;  5IHI A;  2DXU A;  1IHV A;  2LCS A;  2Y4Y A;  3ZL7 C;  2E3H A;  3X26 B;  3KBG A;  3GF5 A;  1NJI U;  2MWP A;  2YT6 A;  4DEX A;  2KVQ G;  4LUE A;  1YJ9 Q;  1VQ9 Q;  1HJD A;  3DLM A;  2EBP A;  2FL7 A;  2HKQ B;  1O9S A;  4M75 A;  4RTT A;  3L1A A;  4M7D B;  2PU9 B;  3CCE Q;  3UA6 A;  1PWT A;  2LQK A;  1WJS A;  4D8K A;  1JXM A;  1EZZ B;  5FRN A;  3OSV A;  1K4U S;  2CKK A;  2GFA A;  2LQ8 A;  1Q7Y R;  4IUU A;  2CZ0 B;  2JMA A;  3RES A;  3SHW A;  1Q82 R;  1IHW A;  3CCQ A;  2MCN A;  3OMG A;  3UT1 A;  4RTY A;  2CP6 A;  4PJO D;  1QVG P;  3PGG A;  4TVR A;  1PM3 A;  2JZ2 A;  3CCJ A;  1G3S A;  2BTT A;  4M7D A;  1ZA1 B;  5GMK m;  4NL3 A;  2K4Y A;  1BI2 A;  2O01 E;  2ROT A;  4HCC A;  3J80 E;  2HBW A;  1B34 B;  1UHF A;  4HT9 A;  4DOW A;  2OJ2 A;  1RAI B;  2DK3 A;  4MZM A;  4JS5 A;  3QJ6 A;  3LLR A;  4E6R A;  4PJM A;  5KYU B;  1SRM A;  2ABL A;  2X4W A;  3PIO A;  4M77 G;  2JNG A;  3J7A F;  4NL2 A;  5IH2 A;  1KSW A;  1KC8 R;  4X9C A;  3TRE A;  3CCQ T;  4IUP A;  2VYT A;  1YWO A;  4ELY C;  1KD1 U;  1LVK A;  3HFO A;  4FM4 B;  4R55 A;  1B34 A;  1VQ7 A;  2NUT B;  2D9T A;  4ESR A;  1WXT A;  1K0X A;  3CCR Q;  3CC2 A;  5LL6 S;  1SG5 A;  3C95 A; 
#chains in the Genus database with same CATH homology
 2L2P A;  3VS7 A;  4AFZ C;  4CC4 B;  1K76 A;  2BZY A;  1QLY A;  2O9V A;  3REA B;  4LNP A;  2YUQ A;  5GJW B;  2CUD A;  4RTX A;  2A36 A;  4AG2 C;  2AKK A;  2RQR A;  2PTK A;  1W6X A;  2KXD A;  2A08 A;  2DJQ A;  2ED1 A;  1CKB A;  2O88 A;  4HVW A;  5IXF A;  2CRE A;  2KR3 A;  2J6O A;  2L0A A;  4J9I A;  2O9S A;  1PNJ A;  2HCK A;  4CC7 A;  3PE0 A;  1AZE A;  2EYZ A;  2L3Q A;  2C0I A;  1M3B A;  1RI9 A;  2JS2 A;  4A63 B;  1ZUK A;  3LH5 A;  1V1C A;  3QWX X;  2K3B A;  2J06 A;  2AKL A;  1OEB A;  1ZBJ A;  1ZLM A;  1NEG A;  1AVZ C;  1U5S A;  1YCS B;  4D8D A;  2DBK A;  2VVK A;  1HD3 A;  1T3L A;  1VYU A;  1KIK A;  4OML A;  4K11 A;  2FPE A;  3VS1 A;  2DL4 A;  1E6G A;  4AFS C;  2SEM A;  2DIL A;  3NMZ C;  1UJ0 A;  2K6D A;  2EPD A;  1GBR A;  2DRK A;  4HVU A;  3VRZ A;  4J9G A;  3H41 A;  2FPD A;  2QDL A;  1I0C A;  2DX1 A;  4RTZ A;  1SSH A;  4JZ3 A;  3RBB B;  4JJB A;  2P4R A;  4AFU C;  2K2M A;  2HDA A;  2KE9 A;  1ZUY A;  1JQQ A;  2M0Y A;  2OAW A;  2EGC A;  1M3C A;  2CT4 A;  2DRM A;  3SEM A;  1GCQ A;  4RTV A;  1SEM A;  4JJC A;  3NPF A;  1K9A A;  4LN2 A;  2MOX A;  4RUG A;  2J7I A;  3VS5 A;  1UE9 A;  2RQW A;  2D8J A;  1SHF A;  1WXU A;  3ULR B;  4J9B A;  4DEY A;  2O2O A;  1WIE A;  2DA9 A;  2EW3 A;  2JTE A;  2KRO A;  3PVL A;  1M3A A;  3M0R A;  2RQT A;  4RTW A;  1U3O A;  1AWO A;  2KT1 A;  1UFF A;  2KRS A;  2GTO A;  2LX7 A;  3RNJ A;  5GJV B;  1QWF A;  3H0H A;  2DL7 A;  3H0I A;  3PVQ A;  3EG0 A;  2LQW A;  1OOT A;  2W10 A;  2ED0 A;  2DMO A;  4ORZ A;  5FWC A;  1YN8 A;  1I07 A;  2YUN A;  3M0Q A;  1IO6 A;  2EQI A;  2V1R A;  1WDX A;  4HXJ A;  5IHN A;  3VS0 A;  4KRT A;  2NUZ A;  2BZX A;  2F2V A;  2DYB A;  2LJ1 A;  2A37 A;  1WX6 A;  2W0Z A;  1PRL C;  1QCF A;  4JPB W;  2JW4 A;  2CSQ A;  4HVV A;  4RTU A;  1OPL A;  2GGR A;  1TUC A;  1SPK A;  1WFW A;  1GCP A;  2G6F X;  1UG1 A;  2GBQ A;  2SRC A;  4X1V A;  1JXO A;  1VA7 A;  3U23 A;  1AD5 A;  1G83 A;  2L3S A;  2OI3 A;  1H8K A;  1NG2 A;  2MIO A;  1WLP B;  2DL5 A;  1JO8 A;  2YUO A;  2EKH A;  1A0N B;  2CUB A;  1LCK A;  2FRW A;  2FEI A;  4FSS A;  3NGP A;  2CDT A;  4F16 A;  2CH4 A;  2CT3 A;  2YUP A;  4F17 A;  1N5Z A;  2AZS A;  1BB9 A;  2H8H A;  5FW9 A;  1FMK A;  1NLO C;  3EG2 A;  2JT4 A;  2RQU A;  3EHQ A;  5L23 A;  3I5S A;  4Z88 A;  2GTJ A;  2E5K A;  1YWP A;  4LUD A;  1Y57 A;  1QWE A;  1KFZ A;  2LZ6 B;  2HSP A;  2JXB A;  4Z8A A;  1GRI A;  3VS4 A;  1TG0 A;  2KYB A;  5ECA A;  4F14 A;  1SHG A;  2KBT A;  4ZNX A;  1UEC A;  3H0F A;  1X43 A;  2EYX A;  3I5R A;  2DLP A;  2I0N A;  2J6K A;  2RN8 A;  1X27 A;  1M27 C;  2RNA A;  3M0U A;  3THK A;  2X3W D;  4QT7 A;  2DE0 X;  4J9F A;  1ABQ A;  1GCQ C;  2FO0 A;  1GBQ A;  1M30 A;  1AOJ A;  2J6F A;  1AWJ A;  2JS0 A;  2K7A A;  1NM7 A;  1M8M A;  3I35 A;  2D8H A;  2LP5 A;  2KNB B;  1UGV A;  1T3S A;  4WCI A;  1ABO A;  1W70 A;  2F2W A;  3VS6 A;  1J3T A;  3GBQ A;  1SRL A;  2F2X A;  1VYT A;  2KEA A;  1ZX6 A;  4CC2 A;  1WI7 A;  1WXB A;  1UTI A;  1AEY A;  2DL8 A;  4AG1 C;  1JU5 C;  2DF6 A;  3VS2 A;  3EGU A;  2O31 A;  1Z9Q A;  2A28 A;  4OMN A;  3O5Z A;  1HSQ A;  4OMM A;  1RLP C;  2LQN A;  3I9Q A;  1ZUU A;  4IIO A;  1QKW A;  1MV0 B;  2V1Q A;  2X3X D;  1AWX A;  1BK2 A;  2RQV A;  5FWB A;  1UHC A;  2CH4 W;  2AK5 A;  4OMQ A;  1GFC A;  2DBM A;  2HEQ A;  3R6N A;  2KRN A;  4Z89 A;  1TUD A;  2C0O A;  1G2B A;  3JV3 A;  5EC7 A;  1K1Z A;  1QKX A;  2B86 A;  2J05 A;  1YNZ A;  4J9C A;  3EHR A;  2D0N A;  3VS3 A;  2JM8 A;  2PNI A;  3C0C A;  3EG3 A;  1PRM C;  1CSK A;  2YDL A;  1NEB A;  2C0T A;  1AZG B;  3KFV A;  2AZV A;  1FYN A;  4J9D A;  4J9H A;  4M4Z A;  2EYY A;  3QWY A;  4J9E A;  4GBQ A;  2GNC A;  5I11 A;  1GFD A;  1B3Q A;  3UF4 A;  2EVR A;  2DM1 A;  1PHT A;  4OMP A;  1AWW A;  5HCK A;  3M0S A;  1BBZ A;  1OPK A;  1Y0M A;  3FJ5 A;  1NYF A;  4IIM A;  1Z9Z A;  2XMF A;  1U06 A;  1X6B A;  2FPF A;  5IHK A;  5IXB A;  2EYW A;  2RF0 A;  5I22 A;  3IQL A;  1VYV A;  2D1X A;  4Y92 A;  3TVT A;  2KT8 A;  1E7O A;  1MUZ A;  3EG1 A;  5IHI A;  1T0H A;  4R0K A;  1EFN A;  2LCS A;  3ZL7 C;  2NWM A;  3UAT A;  2RMO A;  3M0T A;  4JJD A;  3TSZ A;  2YT6 A;  1KJW A;  4DEX A;  2ENM A;  4LUE A;  3REB B;  2ESW A;  1HJD A;  1BU1 A;  1K0S A;  2EBP A;  1ZSG A;  1UUE A;  4RTT A;  1CKA A;  3TSW A;  1W1F A;  2DNU A;  3UA6 A;  1PWT A;  1PKS A;  2YSQ A;  1UDL A;  4D8K A;  1ARK A;  1OV3 A;  4AFQ C;  1XOV A;  1JXM A;  2KGT A;  1T0J A;  2FRY A;  2KRM A;  1K4U S;  1NLP C;  1X2Q A;  1H3H A;  4GLM A;  2LMJ A;  2JMC A;  2JMA A;  3SHW A;  1WYX A;  2MCN A;  3M0P A;  2K79 A;  2M51 A;  4RTY A;  2CSI A;  2GQI A;  1RLQ C;  2BTT A;  4EIK A;  1GL5 A;  1S1N A;  2VKN A;  1X6G A;  1H92 A;  2ROL A;  1B07 A;  1PKT A;  2ROT A;  2EGE A;  2FG0 A;  2HBW A;  2ECZ A;  1UHF A;  2OJ2 A;  2LJ0 A;  3A98 A;  2RPN A;  4HCK A;  4LE9 A;  1JEG A;  1WA7 A;  2K9G A;  1E6H A;  1MV3 A;  2DL3 A;  2JM9 A;  3CQT A;  1UJY A;  1NYG A;  2KXC A;  4JZ4 A;  4E6R A;  1SRM A;  2ABL A;  2KYM A;  3VRY A;  5IH2 A;  2LNH B;  1KSW A;  2L3P A;  1X69 A;  2BZ8 A;  3UA7 A;  2EGA A;  2PZ1 A;  1YWO A;  2IIM A;  3NHN A;  4CC3 A;  2LJ3 A;  1RUW A;  1X2K A;  4ESR A;  1YP5 A;  1WXT A;  1K0X A;  1I1J A;  4OMO A;  2DVJ A;  2VWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...