1M3CA

Solution structure of a circular form of the n-terminal sh3 domain (e132c, e133g, r191g mutant) from oncogene protein c-crk
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
CGAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain
rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Proto-oncogene C-crk
total genus 8
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m3cA00
2HBWA 2KE9A 4HVUA 3EG0A 3PVLA 1I07A 1ABQA 1GBQA 2DBKA 3LH5A 2BZYA 3I5RA 2GGRA 1PNJA 1UUEA 3PVQA 2EQIA 2YT6A 2DL5A 1OPLA 2I0NA 2KGTA 4GLMA 3ZL7C 2OI3A 2F2XA 4LE9A 1GCQA 1QKXA 4LN2A 4ORZA 3VS0A 1NYGA 1Y57A 1B3QA 1SPKA 4OMPA 2SEMA 3UA7A 2KRSA 2SRCA 1SRLA 2FRYA 4Z88A 2IIMA 1PRMC 2EW3A 2EKHA 3SEMA 2RN8A 1RUWA 1E6GA 2JMAA 1U3OA 1FMKA 2PTKA 1W70A 2J6OA 2CREA 2DRKA 2LNHB 3A98A 4CC7A 2DNUA 1UG1A 2EGCA 4JJBA 2DJQA 2X3WD 2YUNA 1UDLA 2ED1A 1X27A 1M27C 5FWCA 5EC7A 2L0AA 2JMCA 2HDAA 4JPBW 3NMZC 3RNJA 2K9GA 2RQTA 1WXUA 4RTWA 4AFQC 1SHGA 3KFVA 2OJ2A 2AZVA 1GFCA 3VS4A 1ZX6A 1KSWA 2ENMA 2KRMA 3UF4A 2L3SA 3M0TA 1JQQA 1T3LA 1GRIA 1EFNA 1NEGA 1SHFA 1AVZC 4F14A 4E6RA 1JXMA 3REBB 3U23A 1ZUYA 1ZUKA 2KT1A 1AWOA 1BBZA 2JM8A 4AG1C 4J9IA 2EBPA 2K79A 3M0RA 2LZ6B 1X6BA 2M51A 5I11A 2EPDA 1TUCA 1VYVA 4DEYA 2F2VA 2PZ1A 2GTOA 1JO8A 2A28A 3M0SA 1W6XA 2VKNA 5FW9A 1AWXA 2DA9A 4M4ZA 4A63B 2F2WA 4HXJA 3TSWA 2KEAA 2CSQA 2CSIA 2GQIA 2DL3A 2DLPA 5L23A 4D8KA 2RNAA 2ROLA 1NLOC 2V1RA 1M3CA 2LCSA 1QWFA 1XOVA 2CT3A 4J9GA 4OMMA 1A0NB 3H0FA 2O9SA 3ULRB 2CUDA 2EYZA 1M8MA 1AEYA 1WYXA 4OMQA 1PKSA 2A36A 3NGPA 2BZ8A 4J9CA 1ZSGA 4OMOA 2LJ0A 3M0QA 3NPFA 3C0CA 2MCNA 4HCKA 2O31A 1AWWA 2FPEA 3PE0A 2FPDA 4RTVA 2D8HA 2G6FX 1RLQC 1WXBA 2AZSA 1AWJA 5ECAA 5I22A 2K6DA 1WX6A 2C0TA 2RPNA 1K9AA 2J6KA 1M3BA 1V1CA 2ABLA 1GCPA 2DX1A 4RTTA 2J6FA 1K0SA 1GCQC 2EVRA 1K76A 3H0HA 4JZ3A 1VYUA 1QLYA 2YDLA 1QWEA 2J06A 1LCKA 4GBQA 2A37A 1U5SA 4RUGA 4D8DA 3H41A 1WA7A 2DBMA 4ZNXA 2HEQA 2BZXA 5GJWB 1SSHA 3QWXX 1RI9A 1T0HA 1WFWA 1RLPC 2JW4A 1AD5A 4K11A 3I5SA 2EGAA 2GNCA 1GFDA 3REAB 4J9DA 1U06A 2X3XD 2DE0X 1ABOA 5IHNA 1UTIA 3VS5A 1KJWA 3VRYA 3VS6A 2JT4A 1AZGB 1OOTA 3VS3A 3SHWA 1N5ZA 1YWOA 5IXBA 1H3HA 1ZLMA 1J3TA 1PKTA 2J05A 2RMOA 1MV0B 3UA6A 2W10A 1WIEA 1BB9A 1T3SA 4CC3A 2LJ1A 1YN8A 2CUBA 3EHQA 2DYBA 2DRMA 2KBTA 4R0KA 3GBQA 2KRNA 1PWTA 1M3AA 1NG2A 3JV3A 2FG0A 3IQLA 2RQVA 3EG3A 2RF0A 1UECA 4OMNA 3RBBB 5GJVB 5IHIA 2FRWA 4CC4B 5IHKA 1PHTA 2YUQA 1VYTA 2CT4A 2EYWA 2LX7A 3TVTA 1K0XA 3R6NA 2AKLA 2D8JA 1X2QA 2DILA 1UE9A 3EG1A 1TUDA 1UHCA 2W0ZA 2CH4A 4Y92A 2OAWA 2MOXA 1JXOA 2NUZA 4J9HA 1BK2A 1YP5A 4EIKA 2YUOA 2C0IA 5HCKA 3M0PA 5FWBA 1Z9QA 2RQWA 2LQWA 3H0IA 4KRTA 2GBQA 3O5ZA 5IH2A 3THKA 1AOJA 4FSSA 2EGEA 2K7AA 2YSQA 2VVKA 1BU1A 4IIMA 3EGUA 1QCFA 2CDTA 2RQRA 4Z89A 1S1NA 1PRLC 1H8KA 2KXCA 1K4US 2DMOA 1KFZA 2L3QA 2D1XA 2XMFA 2KYBA 1YCSB 2BTTA 1CSKA 3EHRA 2DL7A 2KXDA 2H8HA 4LUDA 1W1FA 3VRZA 4DEXA 4AFSC 1UJ0A 2K3BA 3UATA 2B86A 1G83A 2KROA 1H92A 1MV3A 3VS7A 1HD3A 2HSPA 1UGVA 1OPKA 2O2OA 3I35A 1CKAA 1UFFA 2QDLA 1OEBA 2L3PA 4J9EA 1WXTA 1X2KA 1UHFA 1NLPC 1ARKA 2JTEA 2P4RA 3EG2A 4JJDA 1WDXA 3VS2A 2LJ3A 1WI7A 2DL8A 3CQTA 2K2MA 2JXBA 2VWFA 3NHNA 2A08A 1SRMA 2LQNA 4RTUA 4F16A 1NM7A 4Z8AA 4JZ4A 2LMJA 4WCIA 1WLPB 3VS1A 2HCKA 2L2PA 2E5KA 2M0YA 2J7IA 4J9BA 1TG0A 1NEBA 4J9FA 1YNZA 1I0CA 2DVJA 1AZEA 1YWPA 4HVVA 4JJCA 1GL5A 4RTYA 1X69A 1M30A 2C0OA 1K1ZA 1X43A 2D0NA 1CKBA 2O88A 1IO6A 1I1JA 2DF6A 3TSZA 4CC2A 4LUEA 1OV3A 1UJYA 2DL4A 2YUPA 3FJ5A 2JS0A 1MUZA 2RQUA 2KR3A 1E7OA 4ESRA 2FEIA 4QT7A 2O9VA 1FYNA 3I9QA 1G2BA 4AFZC 2EYYA 2ROTA 4RTZA 4OMLA 2ED0A 2ECZA 1ZBJA 4X1VA 1VA7A 2FPFA 2KT8A 5IXFA 2PNIA 4AG2C 1ZUUA 2MIOA 2KYMA 1Y0MA 2NWMA 2V1QA 1E6HA 2FO0A 4HVWA 1JEGA 3QWYA 4AFUC 1Z9ZA 4LNPA 2ESWA 1GBRA 2LP5A 2EYXA 4RTXA 1HJDA 2JM9A 1B07A 2AKKA 1KIKA 1T0JA 2DM1A 3M0UA 1NYFA 2KNBB 1QKWA 1X6GA 4F17A 1HSQA 2AK5A 1SEMA 2GTJA 2CH4W 1JU5C 4IIOA 2JS2A
chains in the Genus database with same CATH superfamily
4RKUE 1VQPQ 3CCEA 3MKDA 1VQLQ 2DBKA 3CC4Q 2LRQA 2BZYA 2E65A 4F7UE 3BDUA 3QUIA 4BE1A 2YT6A 2DZCA 3SWNA 2FL7A 3CCRQ 2XU8A 1M2VA 1IHWA 1VQ7A 5DLOA 4FYXB 1QKXA 3CMET 4LN2A 4ORZA 3CCUT 2XG8D 1TWBA 2HAXA 2SEMA 3LLRA 3UA7A 2LC4A 4X9DA 3MP1A 5GAOq 4IUVA 1FMVA 1PRMC 2EW3A 4M77F 3RIRA 1RL2A 3SEMA 2O4XB 3NFCA 5HKCA 3JCMJ 2E64A 3JCMW 5KYWB 3CEYA 3V8LA 2PTKA 2QGFB 1NJIR 3HKSA 3UWNA 4FU6A 1UG1A 2EGCA 3LW5E 3RR6A 3KUFA 4C92D 1WZOA 3CCMA 1VQ8T 2ZZDA 1D1CA 5EC7A 2HDAA 2HSEB 3NMZC 1Q95G 2K9GA 4LXCA 1WXUA 4AFQC 1SHGA 3KFVA 1FX7A 1GFCA 1ZX6A 1KSWA 3CXCS 2L3SA 1JQQA 3CXCA 1GRIA 4LD6A 1FMWA 1VIFA 3CCJA 4M7AE 1M9SA 5GAN3 3JB9J 1YFNA 1WQWA 4M78G 2DERA 2KVQG 1ZUKA 1Y96A 4QQDA 1JB0E 2KSSA 2DPPB 1K8AC 1VQLT 4M7DC 3QHSA 3M0RA 1X6BA 2M51A 4E7JA 2CP0A 1TOVA 2VGMA 4KH0B 3A8MB 3MPUB 4C92B 5LJ3j 2NLUA 4RG8A 3DLMA 1H3ZA 2EQKA 1Q86U 5GAOn 2VKNA 2Z0WA 2QQBA 5FW9A 2F2WA 2CZ1B 4HXJA 4M75C 4C8QD 3N5BB 5KCHA 2GQIA 2DL3A 3LYIA 1Q82U 4D8KA 1VQPA 2ROLA 2MWOA 4OGCA 1M3CA 1VQLA 5FU6B 3CMAT 1M1KC 4HKEA 1XOVA 1BI3A 3CC4A 3H0FA 4B9WA 2F69A 4NL2A 1I8FA 5CQXA 2JTFA 4C5GA 1PKSA 4DBHA 2BZ8A 2P0KA 1ZSGA 4OMOA 4B9XA 3SFMA 5GAN5 3MEUA 4OB1B 4Y91A 2FPEA 2HQEA 1YJNA 1MMAA 4Y28E 3CMEA 3EGXA 1WXBA 3GLXA 1RACB 3MHXA 4DBQA 2MPXC 1WX6A 1RAHB 3EGDA 3EH1A 1WHMA 1KQ1A 2J6FA 3OS5A 1GCQC 5LJ5f 3QDFA 1VYUA 1ZA1B 2YDLA 4A4FA 2A37A 4FT4A 4D8DA 3H41A 2QEXA 4ZNXA 5KYUA 3QWXX 5GAMe 3OA6A 2E12A 5CR2A 1RI9A 4TVRA 3QJYA 4A4KA 2GQVA 2VV5A 3A8GB 3I5SA 3M59A 5GAOl 1X75C 3RMQA 1VQOT 4FYYB 3REAB 4J9DA 1U06A 2LTOA 3P8BB 1ABOA 2DIGA 2R5MA 4ZN1A 1UTIA 3OSVA 1D0XA 1W2BP 4E7IA 4QQGA 4O6JA 1OOTA 3I56Q 3M9QA 2OAUA 4RG2A 2PQWA 2E3HA 2F5TX 2A3LA 5M9OA 1PKTA 1WPYA 3AT1B 3EFSA 3V7SA 3JB9I 1WIEA 2M16A 1T3SA 3CC4T 5LJ5d 2KQWA 4VUBA 4KT0E 2DRMA 5D6XA 2KRNA 4YTLA 1NG2A 4LDVA 2RF0A 1YITA 1UECA 2XD0A 3OYFA 2FRWA 4CC4B 3G6EA 1VQ9A 4IURA 2RB6A 4BE2A 1PD0A 2MYSA 2LX7A 5IT9E 1HYOA 1K0XA 1PCXA 3G6ET 2DILA 3S3MA 3MP6A 4ME7A 1TUDA 2E4HA 1WQ7A 2IPOB 5I2MA 1D0YA 1IRXA 3TQ7P 2MOXA 2NUZA 1M1FA 4DA4A 2CYZB 4EIKA 2QXFA 5GMKl 2A7YA 2HNIA 1BI1A 3PGGA 3H0IA 4KRTA 2ZPFB 4PFOA 5IH2A 5LJ3f 3CCJQ 4A4GA 1RADB 4MMLA 2K7AA 2YSQA 3S3OA 2ZPEB 4V2SA 1MMGA 2CDTA 3OBWA 4Z89A 3ZEHA 1R0CB 5GAMj 1KFZA 1WJSA 5GAOp 4JLIA 2D1XA 3C95A 2XMFA 2KYBA 4ZGDB 1YCSB 2COZA 1OZ3A 2IVWA 2KXDA 3QYHB 3DKMA 1MMNA 2K3BA 3UATA 1G83A 3CCMT 4DOVA 2CZ0B 4F7UF 3QO3A 1G8XA 4OB0B 1AHJB 2RHYA 4M7AB 1WHKA 2O2OA 5CCAA 3I35A 4OVAA 2OTLT 2JN0A 4XK8E 4FCYA 4N0AA 1WXTA 1Q7YR 5AYFA 1QP2A 1D1AA 1WDXA 1HK9A 1VQOA 1UGRB 2K5LA 2CP2A 2LJ3A 3CQTA 2K2MA 1KD1C 2JXBA 3A8LB 1OQKA 1Y96B 5CKEA 1K8AR 2K3XA 3OYLA 1IREB 2LMJA 1WLPB 2VUBA 4PJOC 3JSCA 4M77E 3JB9G 3RDVA 3DB3A 4PJOD 4XTYA 1NEBA 4J9FA 1W2BS 1OULA 4M77A 4F7UG 3JCMX 2COWA 1BIBA 2QGGA 3M5AA 4JS5A 1RI0A 1M90U 1G5VA 1O9SA 2DF6A 4PJJA 3TSZA 4CC2A 2QEXQ 2E70A 3M58A 3R6OA 1QVFP 4GLKA 5LL6S 1H641 1YIJT 1MUZA 3HRSA 5GAOm 4BD3A 2FEIA 1QVFA 2O9VA 3QXEB 1QP3A 4AFZC 4J8OA 4ANJA 3E9FA 4RTZA 5LJ5h 4OMLA 2PU9B 3EH2A 4JUVA 2HKNA 2DEQA 1NPPA 4J7FA 4HVWA 4AFUC 4QVCA 1Z9ZA 2XDBA 1XQHA 2EYXA 1KQ2A 1HJDA 3M0UA 3P8DA 4OGEA 1QKWA 2BE9B 2V26A 5GANd 3TREA 2JS2A 3ER0A 1FWZA 1P92A 4HVUA 3PVLA 4R55A 3LGFA 2JJ9A 1YITQ 1GBQA 2O01E 3CCVA 3PTAA 2OTJA 3I5RA 1B34A 3CBPA 2DL5A 4C0GA 4F7UA 3CCJT 3OY9A 1C1AA 3ZL7C 3LGLA 4KUDK 5CKHA 5GAMh 1Y57A 4FT2A 1B3QA 1SPKA 3CPFA 2KRSA 2O4XA 2SRCA 1Y07A 3M56A 4RCCA 4CI0C 3QPHA 2DTOA 1E6GA 1G3YA 2JMAA 4M7DF 2V8KA 3CCLT 5KYXA 3EG9B 5CIUA 4DBFA 3L2QA 3L2VA 2DNUA 2LDMA 3JAME 3PIOA 2YRDA 1I5OB 2YUNA 1Q86R 1UDLA 2ED1A 5KE2A 2K2VA 3T9NA 4ZTJA 5J39A 4JPBW 3OMGA 3BE3A 4LDYA 1KQSA 2YRCA 1X01A 5A2QE 1GXIE 5GAN4 3VS4A 1KQSP 2ENMA 3UF4A 4ZGEB 3M0TA 1T3LA 1VQKQ 1NEGA 1SHFA 4C0FA 4Z02A 4C5IA 4MZMA 4F14A 2RJEA 3L2ZA 3SDZA 4E6RA 5AT1B 1JXMA 3REBB 3DLLA 1ZUYA 2KT1A 1AWOA 2AIRB 1BBZA 2JM8A 2JZ2A 3FIFA 4J9IA 3CMAA 1YI2A 2RHIA 1OYXA 4XU0A 2PUOB 4OB2B 4BE0A 2L5QA 2DXTA 2F2VA 3H8ZA 3M0SA 3FC3A 1W6XA 1WNLA 1M1KU 3G6EQ 2DA9A 4A63B 1VQ7T 1VQ9Q 2WSCE 2CSIA 4FSXA 1YI2Q 1VQMT 3E19A 2DLPA 1ZHIA 2Y4YA 3OSSC 4C8QC 3AHUA 2HL5C 2RNAA 3JCMg 1LJOA 1R0BG 3UDCA 1QWFA 2XHCA 2K57A 3OYIA 2GFAA 3BY7A 3OYYA 4IKFA 2X4WA 3ULRB 5LJ3h 1R77A 3CC7A 3FB9A 1AEYA 1M8MA 3M53A 1Y71A 3NGPA 8ATCB 2P4TA 2ZPHB 4J9CA 2HBPA 1LOJA 1V29B 3M0QA 2DO3A 1YBYA 1K73R 1Y7XA 5EG2A 4M75D 1BKBA 2O31A 2RJCA 3QYGB 2JUFA 3PE0A 2LT1A 1M90C 2FPDA 3DB4A 5ECAA 2DK3A 3P8HA 2J6KA 4D6WA 1V1CA 2ABLA 1QVGP 4RTTA 2HZYA 4C8QB 2EVRA 4JZ3A 1VQ8Q 5A0LA 1QCNA 2XIDA 4ELZC 3OYHA 5A0GA 4PJMA 3MCAB 1VQKT 1WA7A 2DBMA 2VXFA 1JJ2P 2OTLA 2EJGA 3KXTA 3HSBA 3FEOA 2F1LA 3E9GA 1M4ZA 1AD5A 4N4GA 1D3BB 1Q81R 2DFUA 3HP9A 1GFDA 2KI7A 3FJPA 2X3XD 3L2RA 2YXYA 1NZ9A 1MNDA 4EMKA 1KJWA 4Q5WA 5I21A 3OS2A 1VQKA 3JCMV 3EFRA 3VS3A 5CVIA 1VQ9T 1VQ7Q 3JB9D 2CP7A 1H3HA 5HY6A 1JBMA 2RMOA 1MNEA 1MV0B 5FU7B 3J7AF 3EGDB 3UA6A 2EJFA 3RMSA 2NUTA 2D6FA 2QASA 1PWTA 1M3AA 3JV3A 5GAN8 1N27A 1B7TA 3EG3A 3G71T 4ZTFA 3CC2Q 2LQ8A 2GF7A 5FU7C 1ACMB 1YIJQ 4C0DC 3OW2S 3PMIA 5GANg 2RH2A 2CZ7B 3R6NA 2AKLA 2VASA 5D7UA 1UE9A 3RKYA 4XU1A 1UHCA 2QI2A 2W0ZA 2JNGA 3A8OB 3CBOA 2CH4A 3PNWC 2X4YA 2AHJB 3QJ6A 1JXOA 1UGSB 1BK2A 4M75A 2VXEA 3JB9F 4AMCA 2YUOA 5HCKA 1LVKA 1TXQA 4M7DA 1IZ6A 3CCSA 5FRNA 1Q7YU 5LJ3g 3O5ZA 4KGXB 3THKA 1AOJA 4M7DE 5KYWA 3PMTA 4E7HA 3EG9A 3JCMh 3CXCP 1TTHB 3CCST 2VC8A 1QCFA 1S1NA 4IUUA 1H8KA 4HCBA 3CBMA 2DEUA 1VIEA 3G7ZA 4XU3A 4PLLA 5HK0A 3SB2A 3EFOA 3A8HB 1CSKA 3V8JA 3VJPA 1KC8U 1VUBA 2RI3A 4LUDA 5C6SA 4AFSC 4BY6C 1BI0A 2B86A 3C94A 4HT8A 2EAYA 3VS7A 2QA4Q 2HSPA 1UGVA 3VKIA 4M77G 2JVVA 4C0DB 1CKAA 2DXCA 1PSEA 2L3PA 3PFSA 3VUBA 4ZN3A 2NYSA 2RHXA 1NLPC 4JJDA 2ZAEA 1ZSZA 2EFIA 1BCOA 2WSFE 3CC7Q 5FU6C 2QA4A 4L59A 1SRMA 2LQNA 3OYCA 5LJ5j 4PNOA 2QA4T 4WCIA 1KHIA 2HCKA 4MZTA 3VS1A 1YJNQ 2E5KA 2DD5A 5LJ5e 3VUZA 2V8IA 1VOMA 2J7IA 4FYVB 1M90R 1EIFA 1I4K1 4PKCC 1K73U 1YNZA 2Y4XA 1AZEA 3UT1A 3C4SA 2CP6A 1GL5A 4C8QF 2K4YA 4RTYA 1M30A 2C0OA 1ZBXA 2D0NA 1CKBA 2O88A 1I1JA 1BCMA 2R5AA 4LUEA 2XDPA 3RKXA 2YUPA 2NUPA 4IUPA 1YJ9T 1OX8A 2RQUA 2KR3A 1B34B 1E7OA 4QT7A 2RI5A 3VV0A 3M4GA 2ROTA 1KQSS 2CP3A 1YJ9A 2L89A 1DJ7B 1JJ2S 1ZBJA 4EMKB 1VA7A 3D7SB 2X9HA 4AG2C 2MIOA 4IUTA 2K5FA 1D09B 1KD1U 2LCCA 4KH1B 1GBRA 5GMKi 2LP5A 1YJ9Q 2JM9A 4OB3B 1KIKA 2AKKA 1T0JA 3L2WA 2KNBB 1NPRA 4XTVA 1X6GA 4F17A 2X4XA 2AK5A 2DVEA 4A4HA 3OYKA 2E41A 3EG0A 7AT1B 2ZGWA 1I07A 2LNVA 3OYEA 1VQ4Q 1YIJA 2L3RA 4PFPA 2GGRA 2QQRA 4N4IA 3PVQA 4M7AA 5CKBA 4QQ6A 1G3WA 4BB7A 3Q1JA 1OPLA 1Q81U 2I0NA 2KGTA 3FLGA 2F2XA 1GCQA 1KHCA 2RD1A 3VS0A 3CPWP 4HA8A 1KK7A 1SRLA 2FRYA 4Z88A 2JOYA 4RCBA 3OW2A 2IIMA 4XQ3A 4C92A 5KYXB 2EKHA 2DKGA 2A0FB 2RN8A 4C8QE 4C92E 1U3OA 3GOXA 4M75E 5GMKh 2J6OA 2CREA 2LNHB 2WACA 2YRVA 3A98A 4PJOE 3E2UA 2XI9A 1W4SA 5IAYA 4JRQA 2X3WD 5GANf 1YJWT 3QZ5B 3PT9A 4J6YA 3MEAA 2K3YA 3CCQA 1ZQ1A 1HXDA 1K9MR 4RTWA 2C06A 2DYIA 2G3RA 5C0MA 3F70A 3CMEQ 2M9UA 2DZ9A 2FHDA 1PSFA 1M2VB 3WXMB 2P0QA 1EFNA 5LJ3e 3MEVA 2MF2A 3CCQQ 3JCMd 1XNIA 5HK3A 2DIQA 2M1HA 3LWIA 5KE3A 5J3BA 3I55A 2CKKA 1BIAA 3X26B 4AG1C 2LX9A 1EZZB 2EBPA 3O8VA 2CGHA 2LZ6B 3CCVT 2RK2A 1TUCA 1VYVA 1C0MA 3G4SQ 1SSFA 2EQMA 3HFOA 2DETA 2PZ1A 1N6AA 1JO8A 2A28A 2RM4A 2JTMA 4PLIA 3TEEA 3V7RA 3J80E 2R58A 1AWXA 2CSQA 1UEBA 1VQ6T 3NTKA 2QDYB 1N8RR 5LJ3d 5L23A 1NE8A 2X51A 4QVZA 2D0QB 1YITT 2RJDA 2LCSA 3META 2CT3A 2BKDN 4OMMA 4PL6A 1A0NB 2O9SA 3OBYA 2MMPA 4P5NA 1N8RU 1TS9A 1QVPA 4BUGA 1WYXA 3QG1A 2LCLA 4OMQA 5GAOr 4M78A 3JCMf 2A36A 3CCSQ 5GANj 1IGUA 4XTZA 3JRZA 3C0CA 2MCNA 1YJWA 1AWWA 1RAGB 2AZSA 1AWJA 5I22A 2K6DA 2C0TA 3HPWA 1M3BA 1GCPA 2QTXA 3GNGA 1M8VA 1QLYA 1QWEA 2J06A 4GBQA 1U5SA 3INZA 3E1SA 4A54A 5FRMA 1U1TA 5GAN6 1IGQA 1SKUB 1T0HA 1WFWA 1Q7YC 2JW4A 4BY6B 2K5IA 4K11A 3CC7T 1KD1R 4C92F 2QAZA 1WHHA 2PVDB 2DE0X 2OTJQ 5IHNA 2YLCA 2QK0A 2AT1B 3VS5A 3VRYA 3VS6A 1AZGB 1YI2T 1YJNT 4E7LA 4X34A 4KGVB 2XK0A 4PJOF 1V76A 2QYZA 5IXBA 3OMCA 1D1BA 2E6NA 4CC3A 3I55T 1YN8A 2ATCB 4LDUA 2DYBA 3M54A 1UGPB 2KBTA 1PC0A 2B8AA 3S6WA 3L2UA 1QMCA 1WHJA 2RQVA 2EWNA 5IHIA 5GJVB 5IHKA 1PHTA 3RUXA 2YUQA 2D9TA 5GAMf 4FM4B 1VYTA 3TVTA 2PVOB 4A4EA 3OYGA 4C5EA 2FZGB 5LJ5g 2BE7D 4E7SA 2KMTA 1U1SA 4Y92A 4M7AG 4RMOA 1YP5A 4OMFB 2C0IA 3M0PA 2OTLQ 1Q82C 2M0OA 2EQJA 4GY5A 5DLQE 4M7DD 4FSSA 3ME9A 1BU1A 1UB4A 4N0AC 3MP8A 5CKDA 3X28B 3EGUA 1VQ5Q 5CQYA 1PRLC 4M77B 5CKFA 1C6VX 4X9CA 3CCMQ 1MGQA 2GFUA 3WVEB 3I56A 2BTTA 5CAIA 2MWPA 3G4SA 5KCOA 5GAMd 1W1FA 4DEXA 1UJ0A 2E1HA 1PM3A 1VQ5A 2QQAA 1N9SA 2KROA 1XJWB 1MV3A 1M2OA 2DXBA 2FB7A 4ATOA 3RKWA 3CCQT 1K9MU 2QDLA 1MHNA 1OEBA 4JDSA 2E3IA 3HHTB 1X2KA 2VB6A 4QVDA 4JRPA 2JTEA 2P4RA 4M7DB 1WI7A 2DL8A 2HKQB 5GMKe 2A08A 3CCUQ 2DD4A 2BUDA 5D6YA 4F16A 4Z8AA 3M55A 1Q82R 1VQ6Q 4M78F 5GANh 3H6ZA 4JLGA 4IUQA 2FVUA 4HT9A 2L2PA 5GAN7 1EX4A 2M0YA 1VQNA 1RAEB 4J9BA 1F1BB 3EFOB 1TG0A 1KC8R 4NL3A 3FDRA 1OX9A 4L6V5 1Q81C 2MAMA 3OYDA 3NTIA 1SF9A 3UPUA 1VQNT 4WF2A 4MDWA 2KAFA 1K1ZA 1RAAB 1IO6A 1ZSZC 4DOWA 1VQMA 3J81E 1OV3A 4L5GA 1UJYA 4UC4A 3FJ5A 2JS0A 2YWWA 3FRNA 4ESRA 3JCMQ 1M1GA 4OF1A 1JJ2A 4R56A 2EYYA 1I81A 1ZSZB 3BDLA 4EMGA 4MDXA 4X1VA 4AT1B 3I55Q 1RAIB 2FPFA 2KT8A 5IXFA 1IHVA 2ZCFB 3CPWS 2PNIA 4EMHA 1ZUUA 2M02A 2KYMA 3CD6A 1Y0MA 2FO0A 2H3EB 1YCYA 4LNPA 2ESWA 1W2BA 1O75A 1TU0B 4RTXA 1QQJA 1B07A 5GAMg 2DTIA 2EKOA 1YHQA 1HSQA 3WVDB 1SEMA 5IN1A 3CCRA 1JU5C 4PK4A 4FIBA 1VQ4T 4IIOA 2HBWA 5GAN2 2KE9A 2HQHA 2EQUA 1SG5A 1FXXA 1ABQA 4LD9K 3OYNA 4M78E 4BDYA 3LH5A 1PNJA 1UUEA 2EQIA 1BI2A 2E6ZA 3CPWA 4OP0A 2E5QA 3GNFB 4GLMA 2OI3A 2NUTB 4LE9A 3OW2P 3RERA 3CCLQ 1NYGA 1VQ4A 4OMPA 4JRIA 4CRIA 1D3BA 4E2FB 3LH0A 4KUIA 5J26A 4QKUA 4WTOB 3HRTA 1RUWA 4C5HA 4JS4A 1FMKA 1W70A 1R8OB 3LX7A 2DRKA 4CC7A 3JB9H 1XTDA 4J7IA 4O5VA 4PJNA 4JJBA 2DJQA 1S72Q 1G3TA 1QW1A 5FROA 1X27A 3GIBA 1M27C 2DXUA 5FWCA 4DQ2A 2L0AA 2JMCA 1LPLA 3RNJA 3HL8A 4F04B 2RQTA 2DTHA 2P0PA 2ZPGB 3CCET 1NBEB 2OJ2A 2AZVA 2XICA 3JCMP 2NUPB 2X4JA 5GMKj 4HCZA 2KRMA 3C12A 4M78C 1K8AU 1AVZC 2HQXA 5KYNA 5FLXE 1VQ8A 2LVMA 3U23A 3OQ5A 4J83A 3S3NA 2RJFA 3CCVQ 2CZ6B 3JCMe 1G3SA 4A53A 4FW2A 2YHTA 2K79A 3CD6Q 4M77C 3PIPA 2WSEE 5I11A 2EPDA 4DEYA 5KYUB 2GTOA 4EPCA 4JJNK 1OU8A 1TSFA 4M7AF 3V7CA 4M4ZA 1YHQQ 3TSWA 2KEAA 3BFMA 1QCOA 2XDDA 3I56T 4N4HA 1OZ2A 3X20B 9ATCB 3QBYA 1QVGS 1NLOC 2V1RA 5I2SA 3GPLA 4XAXB 4J5YA 4J9GA 3JCMc 3ZBDA 1VQPT 1VQOQ 3SWNB 1VQMQ 2CUDA 2EYZA 3NTHA 2VYTA 5KYYA 2LJ0A 2HD0A 3NPFA 3OYBA 4HCKA 3VYGA 3CCLA 2OX7A 3CC2A 1D0ZA 3HRUA 3TCJA 2LT4A 4RTVA 4KGZB 2BIVA 2D8HA 2G6FX 1RLQC 2ZPBB 4BI4A 2RPNA 4C8QA 2EIFA 1TUGB 1JRIA 1K9AA 4E7ZA 3G71A 2DX1A 4LDXA 3KBGA 1K0SA 2R57A 1NJIC 3H0HA 1K76A 1WGSA 1YJWQ 1LCKA 4PJLA 4RUGA 3QSUA 1RAFB 2HEQA 2BZXA 5GJWB 1SSHA 3OYAA 4M75G 4FYWB 3LWHA 3HTRA 3SWNC 3MEWA 1X6OA 1RLPC 3RESA 3G71Q 3MJXA 2EGAA 4KULA 2GNCA 3X24B 4BDZA 1WHGA 2L8DA 4M75B 2JT4A 2VGNA 1BYMA 2QTVA 4E47A 3SHWA 1VQ6A 1N5ZA 1YWOA 4C8QG 3EGXB 1ZLMA 3QZ9B 1J3TA 2J05A 3MO8A 2YLBA 3HFNA 4C92C 2W10A 1TH7A 3JCMb 1BB9A 1VQNQ 5A0DA 2LJ1A 2X35A 1KC8C 4PFZA 4EMKC 2CUBA 3EHQA 4R0KA 4M77D 3CCEQ 3GBQA 2FG0A 3IQLA 3RBBB 4OMNA 4BACA 2RI2A 2V8JA 3QKJA 3EAEA 2RHZA 5KH6A 2CT4A 2EYWA 2CS7A 4KBMB 2D8JA 1X2QA 3H9NA 3BW1A 4MZPA 6AT1B 1WJQA 3A5ZB 3EG1A 1N8RC 2XKOC 2OAWA 1WHLA 4B6MA 4J9HA 3G1JA 2E10A 2F5KA 5CK9A 2H3JA 1UGQB 5FWBA 1Z9QA 2RQWA 4ZGJB 2LQWA 4J6WA 4C0ZA 2GBQA 1VQ5T 2EJ9A 3A1PA 2EGEA 3ZFJA 1M5Q1 2HL3A 2CP5A 3L42A 2VVKA 3VU3C 4IIMA 4LDWA 2RQRA 2PVGB 2LQKA 2KXCA 3CC2T 1K4US 3OB9A 4EDUA 2DMOA 3G4ST 2FZKB 2L3QA 3M57A 3X25B 2QQSA 3ASKA 2FYKA 4XU2A 5D6WA 4PJOG 3EHRA 2DL7A 2H8HA 3TU4K 3OYJA 4M75F 2KK4A 3VRZA 2MK5A 2MI6A 2RA2A 1LNXA 1H92A 2P84A 1HD3A 3QDRB 2QEXT 1OPKA 4XTXA 1WJRA 1UFFA 4FW1A 1MMDA 1IXDA 4J9EA 1M1KR 1UHFA 2OTJT 3URGA 1ARKA 1ZA2B 3EG2A 4M78D 4MMKA 3VS2A 1AT1B 3CMAQ 2I2LA 2VWFA 3NHNA 3QIIA 2IG0A 2RHUA 2RK1A 5KYYB 4RTUA 2EYQA 5DY9A 1NM7A 1I5LA 4JZ4A 1S72T 1PD1A 2DJZA 2QG9B 4ELYC 1Q86C 4XTUA 2KY9A 2QQ9A 4PJOA 2RO0A 3L1AA 4XTWA 8AT1B 1S72A 4BI8B 4M7DG 3VYHB 1K9MC 5GMKm 1OI1A 1I0CA 2DVJA 3SD4A 1YWPA 4HVVA 4JJCA 2KDSA 1IB8A 1U8RA 3V8KA 3GP8A 1X69A 3GF5A 4NOYA 1X43A 4M7AD 4F7UB 4BI3A 4M7AC 4FL6A 1N9RA 2PUKB 2GCXA 3OS1A 3M4YA 2DL4A 4QW2A 5DM7R 1K73C 4M78B 1FYNA 2FZCB 3I9QA 4C92G 1G2BA 1QVFS 2Y90A 2COYA 4II1A 4DBRA 4NS5A 2ED0A 1QVGA 2ECZA 3CD6T 4JRKA 4HCCA 3OYMA 2HMAA 2NWMA 2V1QA 4E7KA 1E6HA 1JEGA 3QWYA 1YHQT 4PJOB 2ZPIB 5GANe 3CCRT 2DAQA 5L8RE 2DM1A 1NYFA 1OU9A 1KG1A 4J6XA 1PG5B 2GTJA 2CH4W 1NJIU 5CO7A 1RABB 3OS0A 3CCUA
chains in the Genus database with same CATH topology
2HBWA 2KE9A 4HVUA 3EG0A 3PVLA 1I07A 1ABQA 1GBQA 2DBKA 3LH5A 2BZYA 3I5RA 2GGRA 1PNJA 1UUEA 3PVQA 2EQIA 2YT6A 2DL5A 1OPLA 2I0NA 2KGTA 4GLMA 3ZL7C 2OI3A 2F2XA 4LE9A 1GCQA 1QKXA 4LN2A 4ORZA 3VS0A 1NYGA 1Y57A 1B3QA 1SPKA 4OMPA 2SEMA 3UA7A 2KRSA 2SRCA 1SRLA 2FRYA 4Z88A 2IIMA 1PRMC 2EW3A 2EKHA 3SEMA 2RN8A 1RUWA 1E6GA 2JMAA 1U3OA 1FMKA 2PTKA 1W70A 2J6OA 2CREA 2DRKA 2LNHB 3A98A 4CC7A 2DNUA 1UG1A 2EGCA 4JJBA 2DJQA 2X3WD 2YUNA 1UDLA 2ED1A 1X27A 1M27C 5FWCA 5EC7A 2L0AA 2JMCA 2HDAA 4JPBW 3NMZC 3RNJA 2K9GA 2RQTA 1WXUA 4RTWA 4AFQC 1SHGA 3KFVA 2OJ2A 2AZVA 1GFCA 3VS4A 1ZX6A 1KSWA 2ENMA 2KRMA 3UF4A 2L3SA 3M0TA 1JQQA 1T3LA 1GRIA 1EFNA 1NEGA 1SHFA 1AVZC 4F14A 4E6RA 1JXMA 3REBB 3U23A 1ZUYA 1ZUKA 2KT1A 1AWOA 1BBZA 2JM8A 4AG1C 4J9IA 2EBPA 2K79A 3M0RA 2LZ6B 1X6BA 2M51A 5I11A 2EPDA 1TUCA 1VYVA 4DEYA 2F2VA 2PZ1A 2GTOA 1JO8A 2A28A 3M0SA 1W6XA 2VKNA 5FW9A 1AWXA 2DA9A 4M4ZA 4A63B 2F2WA 4HXJA 3TSWA 2KEAA 2CSQA 2CSIA 2GQIA 2DL3A 2DLPA 5L23A 4D8KA 2RNAA 2ROLA 1NLOC 2V1RA 1M3CA 2LCSA 1QWFA 1XOVA 2CT3A 4J9GA 4OMMA 1A0NB 3H0FA 2O9SA 3ULRB 2CUDA 2EYZA 1M8MA 1AEYA 1WYXA 4OMQA 1PKSA 2A36A 3NGPA 2BZ8A 4J9CA 1ZSGA 4OMOA 2LJ0A 3M0QA 3NPFA 3C0CA 2MCNA 4HCKA 2O31A 1AWWA 2FPEA 3PE0A 2FPDA 4RTVA 2D8HA 2G6FX 1RLQC 1WXBA 2AZSA 1AWJA 5ECAA 5I22A 2K6DA 1WX6A 2C0TA 2RPNA 1K9AA 2J6KA 1M3BA 1V1CA 2ABLA 1GCPA 2DX1A 4RTTA 2J6FA 1K0SA 1GCQC 2EVRA 1K76A 3H0HA 4JZ3A 1VYUA 1QLYA 2YDLA 1QWEA 2J06A 1LCKA 4GBQA 2A37A 1U5SA 4RUGA 4D8DA 3H41A 1WA7A 2DBMA 4ZNXA 2HEQA 2BZXA 5GJWB 1SSHA 3QWXX 1RI9A 1T0HA 1WFWA 1RLPC 2JW4A 1AD5A 4K11A 3I5SA 2EGAA 2GNCA 1GFDA 3REAB 4J9DA 1U06A 2X3XD 2DE0X 1ABOA 5IHNA 1UTIA 3VS5A 1KJWA 3VRYA 3VS6A 2JT4A 1AZGB 1OOTA 3VS3A 3SHWA 1N5ZA 1YWOA 5IXBA 1H3HA 1ZLMA 1J3TA 1PKTA 2J05A 2RMOA 1MV0B 3UA6A 2W10A 1WIEA 1BB9A 1T3SA 4CC3A 2LJ1A 1YN8A 2CUBA 3EHQA 2DYBA 2DRMA 2KBTA 4R0KA 3GBQA 2KRNA 1PWTA 1M3AA 1NG2A 3JV3A 2FG0A 3IQLA 2RQVA 3EG3A 2RF0A 1UECA 4OMNA 3RBBB 5GJVB 5IHIA 2FRWA 4CC4B 5IHKA 1PHTA 2YUQA 1VYTA 2CT4A 2EYWA 2LX7A 3TVTA 1K0XA 3R6NA 2AKLA 2D8JA 1X2QA 2DILA 1UE9A 3EG1A 1TUDA 1UHCA 2W0ZA 2CH4A 4Y92A 2OAWA 2MOXA 1JXOA 2NUZA 4J9HA 1BK2A 1YP5A 4EIKA 2YUOA 2C0IA 5HCKA 3M0PA 5FWBA 1Z9QA 2RQWA 2LQWA 3H0IA 4KRTA 2GBQA 3O5ZA 5IH2A 3THKA 1AOJA 4FSSA 2EGEA 2K7AA 2YSQA 2VVKA 1BU1A 4IIMA 3EGUA 1QCFA 2CDTA 2RQRA 4Z89A 1S1NA 1PRLC 1H8KA 2KXCA 1K4US 2DMOA 1KFZA 2L3QA 2D1XA 2XMFA 2KYBA 1YCSB 2BTTA 1CSKA 3EHRA 2DL7A 2KXDA 2H8HA 4LUDA 1W1FA 3VRZA 4DEXA 4AFSC 1UJ0A 2K3BA 3UATA 2B86A 1G83A 2KROA 1H92A 1MV3A 3VS7A 1HD3A 2HSPA 1UGVA 1OPKA 2O2OA 3I35A 1CKAA 1UFFA 2QDLA 1OEBA 2L3PA 4J9EA 1WXTA 1X2KA 1UHFA 1NLPC 1ARKA 2JTEA 2P4RA 3EG2A 4JJDA 1WDXA 3VS2A 2LJ3A 1WI7A 2DL8A 3CQTA 2K2MA 2JXBA 2VWFA 3NHNA 2A08A 1SRMA 2LQNA 4RTUA 4F16A 1NM7A 4Z8AA 4JZ4A 2LMJA 4WCIA 1WLPB 3VS1A 2HCKA 2L2PA 2E5KA 2M0YA 2J7IA 4J9BA 1TG0A 1NEBA 4J9FA 1YNZA 1I0CA 2DVJA 1AZEA 1YWPA 4HVVA 4JJCA 1GL5A 4RTYA 1X69A 1M30A 2C0OA 1K1ZA 1X43A 2D0NA 1CKBA 2O88A 1IO6A 1I1JA 2DF6A 3TSZA 4CC2A 4LUEA 1OV3A 1UJYA 2DL4A 2YUPA 3FJ5A 2JS0A 1MUZA 2RQUA 2KR3A 1E7OA 4ESRA 2FEIA 4QT7A 2O9VA 1FYNA 3I9QA 1G2BA 4AFZC 2EYYA 2ROTA 4RTZA 4OMLA 2ED0A 2ECZA 1ZBJA 4X1VA 1VA7A 2FPFA 2KT8A 5IXFA 2PNIA 4AG2C 1ZUUA 2MIOA 2KYMA 1Y0MA 2NWMA 2V1QA 1E6HA 2FO0A 4HVWA 1JEGA 3QWYA 4AFUC 1Z9ZA 4LNPA 2ESWA 1GBRA 2LP5A 2EYXA 4RTXA 1HJDA 2JM9A 1B07A 2AKKA 1KIKA 1T0JA 2DM1A 3M0UA 1NYFA 2KNBB 1QKWA 1X6GA 4F17A 1HSQA 2AK5A 1SEMA 2GTJA 2CH4W 1JU5C 4IIOA 2JS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBW A;  2KE9 A;  4HVU A;  3EG0 A;  3PVL A;  1I07 A;  1ABQ A;  1GBQ A;  2DBK A;  3LH5 A;  2BZY A;  3I5R A;  2GGR A;  1PNJ A;  1UUE A;  3PVQ A;  2EQI A;  2YT6 A;  2DL5 A;  1OPL A;  2I0N A;  2KGT A;  4GLM A;  3ZL7 C;  2OI3 A;  2F2X A;  4LE9 A;  1GCQ A;  1QKX A;  4LN2 A;  4ORZ A;  3VS0 A;  1NYG A;  1Y57 A;  1B3Q A;  1SPK A;  4OMP A;  2SEM A;  3UA7 A;  2KRS A;  2SRC A;  1SRL A;  2FRY A;  4Z88 A;  2IIM A;  1PRM C;  2EW3 A;  2EKH A;  3SEM A;  2RN8 A;  1RUW A;  1E6G A;  2JMA A;  1U3O A;  1FMK A;  2PTK A;  1W70 A;  2J6O A;  2CRE A;  2DRK A;  2LNH B;  3A98 A;  4CC7 A;  2DNU A;  1UG1 A;  2EGC A;  4JJB A;  2DJQ A;  2X3W D;  2YUN A;  1UDL A;  2ED1 A;  1X27 A;  1M27 C;  5FWC A;  5EC7 A;  2L0A A;  2JMC A;  2HDA A;  4JPB W;  3NMZ C;  3RNJ A;  2K9G A;  2RQT A;  1WXU A;  4RTW A;  4AFQ C;  1SHG A;  3KFV A;  2OJ2 A;  2AZV A;  1GFC A;  3VS4 A;  1ZX6 A;  1KSW A;  2ENM A;  2KRM A;  3UF4 A;  2L3S A;  3M0T A;  1JQQ A;  1T3L A;  1GRI A;  1EFN A;  1NEG A;  1SHF A;  1AVZ C;  4F14 A;  4E6R A;  1JXM A;  3REB B;  3U23 A;  1ZUY A;  1ZUK A;  2KT1 A;  1AWO A;  1BBZ A;  2JM8 A;  4AG1 C;  4J9I A;  2EBP A;  2K79 A;  3M0R A;  2LZ6 B;  1X6B A;  2M51 A;  5I11 A;  2EPD A;  1TUC A;  1VYV A;  4DEY A;  2F2V A;  2PZ1 A;  2GTO A;  1JO8 A;  2A28 A;  3M0S A;  1W6X A;  2VKN A;  5FW9 A;  1AWX A;  2DA9 A;  4M4Z A;  4A63 B;  2F2W A;  4HXJ A;  3TSW A;  2KEA A;  2CSQ A;  2CSI A;  2GQI A;  2DL3 A;  2DLP A;  5L23 A;  4D8K A;  2RNA A;  2ROL A;  1NLO C;  2V1R A;  1M3C A;  2LCS A;  1QWF A;  1XOV A;  2CT3 A;  4J9G A;  4OMM A;  1A0N B;  3H0F A;  2O9S A;  3ULR B;  2CUD A;  2EYZ A;  1M8M A;  1AEY A;  1WYX A;  4OMQ A;  1PKS A;  2A36 A;  3NGP A;  2BZ8 A;  4J9C A;  1ZSG A;  4OMO A;  2LJ0 A;  3M0Q A;  3NPF A;  3C0C A;  2MCN A;  4HCK A;  2O31 A;  1AWW A;  2FPE A;  3PE0 A;  2FPD A;  4RTV A;  2D8H A;  2G6F X;  1RLQ C;  1WXB A;  2AZS A;  1AWJ A;  5ECA A;  5I22 A;  2K6D A;  1WX6 A;  2C0T A;  2RPN A;  1K9A A;  2J6K A;  1M3B A;  1V1C A;  2ABL A;  1GCP A;  2DX1 A;  4RTT A;  2J6F A;  1K0S A;  1GCQ C;  2EVR A;  1K76 A;  3H0H A;  4JZ3 A;  1VYU A;  1QLY A;  2YDL A;  1QWE A;  2J06 A;  1LCK A;  4GBQ A;  2A37 A;  1U5S A;  4RUG A;  4D8D A;  3H41 A;  1WA7 A;  2DBM A;  4ZNX A;  2HEQ A;  2BZX A;  5GJW B;  1SSH A;  3QWX X;  1RI9 A;  1T0H A;  1WFW A;  1RLP C;  2JW4 A;  1AD5 A;  4K11 A;  3I5S A;  2EGA A;  2GNC A;  1GFD A;  3REA B;  4J9D A;  1U06 A;  2X3X D;  2DE0 X;  1ABO A;  5IHN A;  1UTI A;  3VS5 A;  1KJW A;  3VRY A;  3VS6 A;  2JT4 A;  1AZG B;  1OOT A;  3VS3 A;  3SHW A;  1N5Z A;  1YWO A;  5IXB A;  1H3H A;  1ZLM A;  1J3T A;  1PKT A;  2J05 A;  2RMO A;  1MV0 B;  3UA6 A;  2W10 A;  1WIE A;  1BB9 A;  1T3S A;  4CC3 A;  2LJ1 A;  1YN8 A;  2CUB A;  3EHQ A;  2DYB A;  2DRM A;  2KBT A;  4R0K A;  3GBQ A;  2KRN A;  1PWT A;  1M3A A;  1NG2 A;  3JV3 A;  2FG0 A;  3IQL A;  2RQV A;  3EG3 A;  2RF0 A;  1UEC A;  4OMN A;  3RBB B;  5GJV B;  5IHI A;  2FRW A;  4CC4 B;  5IHK A;  1PHT A;  2YUQ A;  1VYT A;  2CT4 A;  2EYW A;  2LX7 A;  3TVT A;  1K0X A;  3R6N A;  2AKL A;  2D8J A;  1X2Q A;  2DIL A;  1UE9 A;  3EG1 A;  1TUD A;  1UHC A;  2W0Z A;  2CH4 A;  4Y92 A;  2OAW A;  2MOX A;  1JXO A;  2NUZ A;  4J9H A;  1BK2 A;  1YP5 A;  4EIK A;  2YUO A;  2C0I A;  5HCK A;  3M0P A;  5FWB A;  1Z9Q A;  2RQW A;  2LQW A;  3H0I A;  4KRT A;  2GBQ A;  3O5Z A;  5IH2 A;  3THK A;  1AOJ A;  4FSS A;  2EGE A;  2K7A A;  2YSQ A;  2VVK A;  1BU1 A;  4IIM A;  3EGU A;  1QCF A;  2CDT A;  2RQR A;  4Z89 A;  1S1N A;  1PRL C;  1H8K A;  2KXC A;  1K4U S;  2DMO A;  1KFZ A;  2L3Q A;  2D1X A;  2XMF A;  2KYB A;  1YCS B;  2BTT A;  1CSK A;  3EHR A;  2DL7 A;  2KXD A;  2H8H A;  4LUD A;  1W1F A;  3VRZ A;  4DEX A;  4AFS C;  1UJ0 A;  2K3B A;  3UAT A;  2B86 A;  1G83 A;  2KRO A;  1H92 A;  1MV3 A;  3VS7 A;  1HD3 A;  2HSP A;  1UGV A;  1OPK A;  2O2O A;  3I35 A;  1CKA A;  1UFF A;  2QDL A;  1OEB A;  2L3P A;  4J9E A;  1WXT A;  1X2K A;  1UHF A;  1NLP C;  1ARK A;  2JTE A;  2P4R A;  3EG2 A;  4JJD A;  1WDX A;  3VS2 A;  2LJ3 A;  1WI7 A;  2DL8 A;  3CQT A;  2K2M A;  2JXB A;  2VWF A;  3NHN A;  2A08 A;  1SRM A;  2LQN A;  4RTU A;  4F16 A;  1NM7 A;  4Z8A A;  4JZ4 A;  2LMJ A;  4WCI A;  1WLP B;  3VS1 A;  2HCK A;  2L2P A;  2E5K A;  2M0Y A;  2J7I A;  4J9B A;  1TG0 A;  1NEB A;  4J9F A;  1YNZ A;  1I0C A;  2DVJ A;  1AZE A;  1YWP A;  4HVV A;  4JJC A;  1GL5 A;  4RTY A;  1X69 A;  1M30 A;  2C0O A;  1K1Z A;  1X43 A;  2D0N A;  1CKB A;  2O88 A;  1IO6 A;  1I1J A;  2DF6 A;  3TSZ A;  4CC2 A;  4LUE A;  1OV3 A;  1UJY A;  2DL4 A;  2YUP A;  3FJ5 A;  2JS0 A;  1MUZ A;  2RQU A;  2KR3 A;  1E7O A;  4ESR A;  2FEI A;  4QT7 A;  2O9V A;  1FYN A;  3I9Q A;  1G2B A;  4AFZ C;  2EYY A;  2ROT A;  4RTZ A;  4OML A;  2ED0 A;  2ECZ A;  1ZBJ A;  4X1V A;  1VA7 A;  2FPF A;  2KT8 A;  5IXF A;  2PNI A;  4AG2 C;  1ZUU A;  2MIO A;  2KYM A;  1Y0M A;  2NWM A;  2V1Q A;  1E6H A;  2FO0 A;  4HVW A;  1JEG A;  3QWY A;  4AFU C;  1Z9Z A;  4LNP A;  2ESW A;  1GBR A;  2LP5 A;  2EYX A;  4RTX A;  1HJD A;  2JM9 A;  1B07 A;  2AKK A;  1KIK A;  1T0J A;  2DM1 A;  3M0U A;  1NYF A;  2KNB B;  1QKW A;  1X6G A;  4F17 A;  1HSQ A;  2AK5 A;  1SEM A;  2GTJ A;  2CH4 W;  1JU5 C;  4IIO A;  2JS2 A; 
#chains in the Genus database with same CATH topology
 4RKU E;  1VQP Q;  3CCE A;  3MKD A;  1VQL Q;  2DBK A;  3CC4 Q;  2LRQ A;  2BZY A;  2E65 A;  4F7U E;  3BDU A;  3QUI A;  4BE1 A;  2YT6 A;  2DZC A;  3SWN A;  2FL7 A;  3CCR Q;  2XU8 A;  1M2V A;  1IHW A;  1VQ7 A;  5DLO A;  4FYX B;  1QKX A;  3CME T;  4LN2 A;  4ORZ A;  3CCU T;  2XG8 D;  1TWB A;  2HAX A;  2SEM A;  3LLR A;  3UA7 A;  2LC4 A;  4X9D A;  3MP1 A;  5GAO q;  4IUV A;  1FMV A;  1PRM C;  2EW3 A;  4M77 F;  3RIR A;  1RL2 A;  3SEM A;  2O4X B;  3NFC A;  5HKC A;  3JCM J;  2E64 A;  3JCM W;  5KYW B;  3CEY A;  3V8L A;  2PTK A;  2QGF B;  1NJI R;  3HKS A;  3UWN A;  4FU6 A;  1UG1 A;  2EGC A;  3LW5 E;  3RR6 A;  3KUF A;  4C92 D;  1WZO A;  3CCM A;  1VQ8 T;  2ZZD A;  1D1C A;  5EC7 A;  2HDA A;  2HSE B;  3NMZ C;  1Q95 G;  2K9G A;  4LXC A;  1WXU A;  4AFQ C;  1SHG A;  3KFV A;  1FX7 A;  1GFC A;  1ZX6 A;  1KSW A;  3CXC S;  2L3S A;  1JQQ A;  3CXC A;  1GRI A;  4LD6 A;  1FMW A;  1VIF A;  3CCJ A;  4M7A E;  1M9S A;  5GAN 3;  3JB9 J;  1YFN A;  1WQW A;  4M78 G;  2DER A;  2KVQ G;  1ZUK A;  1Y96 A;  4QQD A;  1JB0 E;  2KSS A;  2DPP B;  1K8A C;  1VQL T;  4M7D C;  3QHS A;  3M0R A;  1X6B A;  2M51 A;  4E7J A;  2CP0 A;  1TOV A;  2VGM A;  4KH0 B;  3A8M B;  3MPU B;  4C92 B;  5LJ3 j;  2NLU A;  4RG8 A;  3DLM A;  1H3Z A;  2EQK A;  1Q86 U;  5GAO n;  2VKN A;  2Z0W A;  2QQB A;  5FW9 A;  2F2W A;  2CZ1 B;  4HXJ A;  4M75 C;  4C8Q D;  3N5B B;  5KCH A;  2GQI A;  2DL3 A;  3LYI A;  1Q82 U;  4D8K A;  1VQP A;  2ROL A;  2MWO A;  4OGC A;  1M3C A;  1VQL A;  5FU6 B;  3CMA T;  1M1K C;  4HKE A;  1XOV A;  1BI3 A;  3CC4 A;  3H0F A;  4B9W A;  2F69 A;  4NL2 A;  1I8F A;  5CQX A;  2JTF A;  4C5G A;  1PKS A;  4DBH A;  2BZ8 A;  2P0K A;  1ZSG A;  4OMO A;  4B9X A;  3SFM A;  5GAN 5;  3MEU A;  4OB1 B;  4Y91 A;  2FPE A;  2HQE A;  1YJN A;  1MMA A;  4Y28 E;  3CME A;  3EGX A;  1WXB A;  3GLX A;  1RAC B;  3MHX A;  4DBQ A;  2MPX C;  1WX6 A;  1RAH B;  3EGD A;  3EH1 A;  1WHM A;  1KQ1 A;  2J6F A;  3OS5 A;  1GCQ C;  5LJ5 f;  3QDF A;  1VYU A;  1ZA1 B;  2YDL A;  4A4F A;  2A37 A;  4FT4 A;  4D8D A;  3H41 A;  2QEX A;  4ZNX A;  5KYU A;  3QWX X;  5GAM e;  3OA6 A;  2E12 A;  5CR2 A;  1RI9 A;  4TVR A;  3QJY A;  4A4K A;  2GQV A;  2VV5 A;  3A8G B;  3I5S A;  3M59 A;  5GAO l;  1X75 C;  3RMQ A;  1VQO T;  4FYY B;  3REA B;  4J9D A;  1U06 A;  2LTO A;  3P8B B;  1ABO A;  2DIG A;  2R5M A;  4ZN1 A;  1UTI A;  3OSV A;  1D0X A;  1W2B P;  4E7I A;  4QQG A;  4O6J A;  1OOT A;  3I56 Q;  3M9Q A;  2OAU A;  4RG2 A;  2PQW A;  2E3H A;  2F5T X;  2A3L A;  5M9O A;  1PKT A;  1WPY A;  3AT1 B;  3EFS A;  3V7S A;  3JB9 I;  1WIE A;  2M16 A;  1T3S A;  3CC4 T;  5LJ5 d;  2KQW A;  4VUB A;  4KT0 E;  2DRM A;  5D6X A;  2KRN A;  4YTL A;  1NG2 A;  4LDV A;  2RF0 A;  1YIT A;  1UEC A;  2XD0 A;  3OYF A;  2FRW A;  4CC4 B;  3G6E A;  1VQ9 A;  4IUR A;  2RB6 A;  4BE2 A;  1PD0 A;  2MYS A;  2LX7 A;  5IT9 E;  1HYO A;  1K0X A;  1PCX A;  3G6E T;  2DIL A;  3S3M A;  3MP6 A;  4ME7 A;  1TUD A;  2E4H A;  1WQ7 A;  2IPO B;  5I2M A;  1D0Y A;  1IRX A;  3TQ7 P;  2MOX A;  2NUZ A;  1M1F A;  4DA4 A;  2CYZ B;  4EIK A;  2QXF A;  5GMK l;  2A7Y A;  2HNI A;  1BI1 A;  3PGG A;  3H0I A;  4KRT A;  2ZPF B;  4PFO A;  5IH2 A;  5LJ3 f;  3CCJ Q;  4A4G A;  1RAD B;  4MML A;  2K7A A;  2YSQ A;  3S3O A;  2ZPE B;  4V2S A;  1MMG A;  2CDT A;  3OBW A;  4Z89 A;  3ZEH A;  1R0C B;  5GAM j;  1KFZ A;  1WJS A;  5GAO p;  4JLI A;  2D1X A;  3C95 A;  2XMF A;  2KYB A;  4ZGD B;  1YCS B;  2COZ A;  1OZ3 A;  2IVW A;  2KXD A;  3QYH B;  3DKM A;  1MMN A;  2K3B A;  3UAT A;  1G83 A;  3CCM T;  4DOV A;  2CZ0 B;  4F7U F;  3QO3 A;  1G8X A;  4OB0 B;  1AHJ B;  2RHY A;  4M7A B;  1WHK A;  2O2O A;  5CCA A;  3I35 A;  4OVA A;  2OTL T;  2JN0 A;  4XK8 E;  4FCY A;  4N0A A;  1WXT A;  1Q7Y R;  5AYF A;  1QP2 A;  1D1A A;  1WDX A;  1HK9 A;  1VQO A;  1UGR B;  2K5L A;  2CP2 A;  2LJ3 A;  3CQT A;  2K2M A;  1KD1 C;  2JXB A;  3A8L B;  1OQK A;  1Y96 B;  5CKE A;  1K8A R;  2K3X A;  3OYL A;  1IRE B;  2LMJ A;  1WLP B;  2VUB A;  4PJO C;  3JSC A;  4M77 E;  3JB9 G;  3RDV A;  3DB3 A;  4PJO D;  4XTY A;  1NEB A;  4J9F A;  1W2B S;  1OUL A;  4M77 A;  4F7U G;  3JCM X;  2COW A;  1BIB A;  2QGG A;  3M5A A;  4JS5 A;  1RI0 A;  1M90 U;  1G5V A;  1O9S A;  2DF6 A;  4PJJ A;  3TSZ A;  4CC2 A;  2QEX Q;  2E70 A;  3M58 A;  3R6O A;  1QVF P;  4GLK A;  5LL6 S;  1H64 1;  1YIJ T;  1MUZ A;  3HRS A;  5GAO m;  4BD3 A;  2FEI A;  1QVF A;  2O9V A;  3QXE B;  1QP3 A;  4AFZ C;  4J8O A;  4ANJ A;  3E9F A;  4RTZ A;  5LJ5 h;  4OML A;  2PU9 B;  3EH2 A;  4JUV A;  2HKN A;  2DEQ A;  1NPP A;  4J7F A;  4HVW A;  4AFU C;  4QVC A;  1Z9Z A;  2XDB A;  1XQH A;  2EYX A;  1KQ2 A;  1HJD A;  3M0U A;  3P8D A;  4OGE A;  1QKW A;  2BE9 B;  2V26 A;  5GAN d;  3TRE A;  2JS2 A;  3ER0 A;  1FWZ A;  1P92 A;  4HVU A;  3PVL A;  4R55 A;  3LGF A;  2JJ9 A;  1YIT Q;  1GBQ A;  2O01 E;  3CCV A;  3PTA A;  2OTJ A;  3I5R A;  1B34 A;  3CBP A;  2DL5 A;  4C0G A;  4F7U A;  3CCJ T;  3OY9 A;  1C1A A;  3ZL7 C;  3LGL A;  4KUD K;  5CKH A;  5GAM h;  1Y57 A;  4FT2 A;  1B3Q A;  1SPK A;  3CPF A;  2KRS A;  2O4X A;  2SRC A;  1Y07 A;  3M56 A;  4RCC A;  4CI0 C;  3QPH A;  2DTO A;  1E6G A;  1G3Y A;  2JMA A;  4M7D F;  2V8K A;  3CCL T;  5KYX A;  3EG9 B;  5CIU A;  4DBF A;  3L2Q A;  3L2V A;  2DNU A;  2LDM A;  3JAM E;  3PIO A;  2YRD A;  1I5O B;  2YUN A;  1Q86 R;  1UDL A;  2ED1 A;  5KE2 A;  2K2V A;  3T9N A;  4ZTJ A;  5J39 A;  4JPB W;  3OMG A;  3BE3 A;  4LDY A;  1KQS A;  2YRC A;  1X01 A;  5A2Q E;  1GXI E;  5GAN 4;  3VS4 A;  1KQS P;  2ENM A;  3UF4 A;  4ZGE B;  3M0T A;  1T3L A;  1VQK Q;  1NEG A;  1SHF A;  4C0F A;  4Z02 A;  4C5I A;  4MZM A;  4F14 A;  2RJE A;  3L2Z A;  3SDZ A;  4E6R A;  5AT1 B;  1JXM A;  3REB B;  3DLL A;  1ZUY A;  2KT1 A;  1AWO A;  2AIR B;  1BBZ A;  2JM8 A;  2JZ2 A;  3FIF A;  4J9I A;  3CMA A;  1YI2 A;  2RHI A;  1OYX A;  4XU0 A;  2PUO B;  4OB2 B;  4BE0 A;  2L5Q A;  2DXT A;  2F2V A;  3H8Z A;  3M0S A;  3FC3 A;  1W6X A;  1WNL A;  1M1K U;  3G6E Q;  2DA9 A;  4A63 B;  1VQ7 T;  1VQ9 Q;  2WSC E;  2CSI A;  4FSX A;  1YI2 Q;  1VQM T;  3E19 A;  2DLP A;  1ZHI A;  2Y4Y A;  3OSS C;  4C8Q C;  3AHU A;  2HL5 C;  2RNA A;  3JCM g;  1LJO A;  1R0B G;  3UDC A;  1QWF A;  2XHC A;  2K57 A;  3OYI A;  2GFA A;  3BY7 A;  3OYY A;  4IKF A;  2X4W A;  3ULR B;  5LJ3 h;  1R77 A;  3CC7 A;  3FB9 A;  1AEY A;  1M8M A;  3M53 A;  1Y71 A;  3NGP A;  8ATC B;  2P4T A;  2ZPH B;  4J9C A;  2HBP A;  1LOJ A;  1V29 B;  3M0Q A;  2DO3 A;  1YBY A;  1K73 R;  1Y7X A;  5EG2 A;  4M75 D;  1BKB A;  2O31 A;  2RJC A;  3QYG B;  2JUF A;  3PE0 A;  2LT1 A;  1M90 C;  2FPD A;  3DB4 A;  5ECA A;  2DK3 A;  3P8H A;  2J6K A;  4D6W A;  1V1C A;  2ABL A;  1QVG P;  4RTT A;  2HZY A;  4C8Q B;  2EVR A;  4JZ3 A;  1VQ8 Q;  5A0L A;  1QCN A;  2XID A;  4ELZ C;  3OYH A;  5A0G A;  4PJM A;  3MCA B;  1VQK T;  1WA7 A;  2DBM A;  2VXF A;  1JJ2 P;  2OTL A;  2EJG A;  3KXT A;  3HSB A;  3FEO A;  2F1L A;  3E9G A;  1M4Z A;  1AD5 A;  4N4G A;  1D3B B;  1Q81 R;  2DFU A;  3HP9 A;  1GFD A;  2KI7 A;  3FJP A;  2X3X D;  3L2R A;  2YXY A;  1NZ9 A;  1MND A;  4EMK A;  1KJW A;  4Q5W A;  5I21 A;  3OS2 A;  1VQK A;  3JCM V;  3EFR A;  3VS3 A;  5CVI A;  1VQ9 T;  1VQ7 Q;  3JB9 D;  2CP7 A;  1H3H A;  5HY6 A;  1JBM A;  2RMO A;  1MNE A;  1MV0 B;  5FU7 B;  3J7A F;  3EGD B;  3UA6 A;  2EJF A;  3RMS A;  2NUT A;  2D6F A;  2QAS A;  1PWT A;  1M3A A;  3JV3 A;  5GAN 8;  1N27 A;  1B7T A;  3EG3 A;  3G71 T;  4ZTF A;  3CC2 Q;  2LQ8 A;  2GF7 A;  5FU7 C;  1ACM B;  1YIJ Q;  4C0D C;  3OW2 S;  3PMI A;  5GAN g;  2RH2 A;  2CZ7 B;  3R6N A;  2AKL A;  2VAS A;  5D7U A;  1UE9 A;  3RKY A;  4XU1 A;  1UHC A;  2QI2 A;  2W0Z A;  2JNG A;  3A8O B;  3CBO A;  2CH4 A;  3PNW C;  2X4Y A;  2AHJ B;  3QJ6 A;  1JXO A;  1UGS B;  1BK2 A;  4M75 A;  2VXE A;  3JB9 F;  4AMC A;  2YUO A;  5HCK A;  1LVK A;  1TXQ A;  4M7D A;  1IZ6 A;  3CCS A;  5FRN A;  1Q7Y U;  5LJ3 g;  3O5Z A;  4KGX B;  3THK A;  1AOJ A;  4M7D E;  5KYW A;  3PMT A;  4E7H A;  3EG9 A;  3JCM h;  3CXC P;  1TTH B;  3CCS T;  2VC8 A;  1QCF A;  1S1N A;  4IUU A;  1H8K A;  4HCB A;  3CBM A;  2DEU A;  1VIE A;  3G7Z A;  4XU3 A;  4PLL A;  5HK0 A;  3SB2 A;  3EFO A;  3A8H B;  1CSK A;  3V8J A;  3VJP A;  1KC8 U;  1VUB A;  2RI3 A;  4LUD A;  5C6S A;  4AFS C;  4BY6 C;  1BI0 A;  2B86 A;  3C94 A;  4HT8 A;  2EAY A;  3VS7 A;  2QA4 Q;  2HSP A;  1UGV A;  3VKI A;  4M77 G;  2JVV A;  4C0D B;  1CKA A;  2DXC A;  1PSE A;  2L3P A;  3PFS A;  3VUB A;  4ZN3 A;  2NYS A;  2RHX A;  1NLP C;  4JJD A;  2ZAE A;  1ZSZ A;  2EFI A;  1BCO A;  2WSF E;  3CC7 Q;  5FU6 C;  2QA4 A;  4L59 A;  1SRM A;  2LQN A;  3OYC A;  5LJ5 j;  4PNO A;  2QA4 T;  4WCI A;  1KHI A;  2HCK A;  4MZT A;  3VS1 A;  1YJN Q;  2E5K A;  2DD5 A;  5LJ5 e;  3VUZ A;  2V8I A;  1VOM A;  2J7I A;  4FYV B;  1M90 R;  1EIF A;  1I4K 1;  4PKC C;  1K73 U;  1YNZ A;  2Y4X A;  1AZE A;  3UT1 A;  3C4S A;  2CP6 A;  1GL5 A;  4C8Q F;  2K4Y A;  4RTY A;  1M30 A;  2C0O A;  1ZBX A;  2D0N A;  1CKB A;  2O88 A;  1I1J A;  1BCM A;  2R5A A;  4LUE A;  2XDP A;  3RKX A;  2YUP A;  2NUP A;  4IUP A;  1YJ9 T;  1OX8 A;  2RQU A;  2KR3 A;  1B34 B;  1E7O A;  4QT7 A;  2RI5 A;  3VV0 A;  3M4G A;  2ROT A;  1KQS S;  2CP3 A;  1YJ9 A;  2L89 A;  1DJ7 B;  1JJ2 S;  1ZBJ A;  4EMK B;  1VA7 A;  3D7S B;  2X9H A;  4AG2 C;  2MIO A;  4IUT A;  2K5F A;  1D09 B;  1KD1 U;  2LCC A;  4KH1 B;  1GBR A;  5GMK i;  2LP5 A;  1YJ9 Q;  2JM9 A;  4OB3 B;  1KIK A;  2AKK A;  1T0J A;  3L2W A;  2KNB B;  1NPR A;  4XTV A;  1X6G A;  4F17 A;  2X4X A;  2AK5 A;  2DVE A;  4A4H A;  3OYK A;  2E41 A;  3EG0 A;  7AT1 B;  2ZGW A;  1I07 A;  2LNV A;  3OYE A;  1VQ4 Q;  1YIJ A;  2L3R A;  4PFP A;  2GGR A;  2QQR A;  4N4I A;  3PVQ A;  4M7A A;  5CKB A;  4QQ6 A;  1G3W A;  4BB7 A;  3Q1J A;  1OPL A;  1Q81 U;  2I0N A;  2KGT A;  3FLG A;  2F2X A;  1GCQ A;  1KHC A;  2RD1 A;  3VS0 A;  3CPW P;  4HA8 A;  1KK7 A;  1SRL A;  2FRY A;  4Z88 A;  2JOY A;  4RCB A;  3OW2 A;  2IIM A;  4XQ3 A;  4C92 A;  5KYX B;  2EKH A;  2DKG A;  2A0F B;  2RN8 A;  4C8Q E;  4C92 E;  1U3O A;  3GOX A;  4M75 E;  5GMK h;  2J6O A;  2CRE A;  2LNH B;  2WAC A;  2YRV A;  3A98 A;  4PJO E;  3E2U A;  2XI9 A;  1W4S A;  5IAY A;  4JRQ A;  2X3W D;  5GAN f;  1YJW T;  3QZ5 B;  3PT9 A;  4J6Y A;  3MEA A;  2K3Y A;  3CCQ A;  1ZQ1 A;  1HXD A;  1K9M R;  4RTW A;  2C06 A;  2DYI A;  2G3R A;  5C0M A;  3F70 A;  3CME Q;  2M9U A;  2DZ9 A;  2FHD A;  1PSF A;  1M2V B;  3WXM B;  2P0Q A;  1EFN A;  5LJ3 e;  3MEV A;  2MF2 A;  3CCQ Q;  3JCM d;  1XNI A;  5HK3 A;  2DIQ A;  2M1H A;  3LWI A;  5KE3 A;  5J3B A;  3I55 A;  2CKK A;  1BIA A;  3X26 B;  4AG1 C;  2LX9 A;  1EZZ B;  2EBP A;  3O8V A;  2CGH A;  2LZ6 B;  3CCV T;  2RK2 A;  1TUC A;  1VYV A;  1C0M A;  3G4S Q;  1SSF A;  2EQM A;  3HFO A;  2DET A;  2PZ1 A;  1N6A A;  1JO8 A;  2A28 A;  2RM4 A;  2JTM A;  4PLI A;  3TEE A;  3V7R A;  3J80 E;  2R58 A;  1AWX A;  2CSQ A;  1UEB A;  1VQ6 T;  3NTK A;  2QDY B;  1N8R R;  5LJ3 d;  5L23 A;  1NE8 A;  2X51 A;  4QVZ A;  2D0Q B;  1YIT T;  2RJD A;  2LCS A;  3MET A;  2CT3 A;  2BKD N;  4OMM A;  4PL6 A;  1A0N B;  2O9S A;  3OBY A;  2MMP A;  4P5N A;  1N8R U;  1TS9 A;  1QVP A;  4BUG A;  1WYX A;  3QG1 A;  2LCL A;  4OMQ A;  5GAO r;  4M78 A;  3JCM f;  2A36 A;  3CCS Q;  5GAN j;  1IGU A;  4XTZ A;  3JRZ A;  3C0C A;  2MCN A;  1YJW A;  1AWW A;  1RAG B;  2AZS A;  1AWJ A;  5I22 A;  2K6D A;  2C0T A;  3HPW A;  1M3B A;  1GCP A;  2QTX A;  3GNG A;  1M8V A;  1QLY A;  1QWE A;  2J06 A;  4GBQ A;  1U5S A;  3INZ A;  3E1S A;  4A54 A;  5FRM A;  1U1T A;  5GAN 6;  1IGQ A;  1SKU B;  1T0H A;  1WFW A;  1Q7Y C;  2JW4 A;  4BY6 B;  2K5I A;  4K11 A;  3CC7 T;  1KD1 R;  4C92 F;  2QAZ A;  1WHH A;  2PVD B;  2DE0 X;  2OTJ Q;  5IHN A;  2YLC A;  2QK0 A;  2AT1 B;  3VS5 A;  3VRY A;  3VS6 A;  1AZG B;  1YI2 T;  1YJN T;  4E7L A;  4X34 A;  4KGV B;  2XK0 A;  4PJO F;  1V76 A;  2QYZ A;  5IXB A;  3OMC A;  1D1B A;  2E6N A;  4CC3 A;  3I55 T;  1YN8 A;  2ATC B;  4LDU A;  2DYB A;  3M54 A;  1UGP B;  2KBT A;  1PC0 A;  2B8A A;  3S6W A;  3L2U A;  1QMC A;  1WHJ A;  2RQV A;  2EWN A;  5IHI A;  5GJV B;  5IHK A;  1PHT A;  3RUX A;  2YUQ A;  2D9T A;  5GAM f;  4FM4 B;  1VYT A;  3TVT A;  2PVO B;  4A4E A;  3OYG A;  4C5E A;  2FZG B;  5LJ5 g;  2BE7 D;  4E7S A;  2KMT A;  1U1S A;  4Y92 A;  4M7A G;  4RMO A;  1YP5 A;  4OMF B;  2C0I A;  3M0P A;  2OTL Q;  1Q82 C;  2M0O A;  2EQJ A;  4GY5 A;  5DLQ E;  4M7D D;  4FSS A;  3ME9 A;  1BU1 A;  1UB4 A;  4N0A C;  3MP8 A;  5CKD A;  3X28 B;  3EGU A;  1VQ5 Q;  5CQY A;  1PRL C;  4M77 B;  5CKF A;  1C6V X;  4X9C A;  3CCM Q;  1MGQ A;  2GFU A;  3WVE B;  3I56 A;  2BTT A;  5CAI A;  2MWP A;  3G4S A;  5KCO A;  5GAM d;  1W1F A;  4DEX A;  1UJ0 A;  2E1H A;  1PM3 A;  1VQ5 A;  2QQA A;  1N9S A;  2KRO A;  1XJW B;  1MV3 A;  1M2O A;  2DXB A;  2FB7 A;  4ATO A;  3RKW A;  3CCQ T;  1K9M U;  2QDL A;  1MHN A;  1OEB A;  4JDS A;  2E3I A;  3HHT B;  1X2K A;  2VB6 A;  4QVD A;  4JRP A;  2JTE A;  2P4R A;  4M7D B;  1WI7 A;  2DL8 A;  2HKQ B;  5GMK e;  2A08 A;  3CCU Q;  2DD4 A;  2BUD A;  5D6Y A;  4F16 A;  4Z8A A;  3M55 A;  1Q82 R;  1VQ6 Q;  4M78 F;  5GAN h;  3H6Z A;  4JLG A;  4IUQ A;  2FVU A;  4HT9 A;  2L2P A;  5GAN 7;  1EX4 A;  2M0Y A;  1VQN A;  1RAE B;  4J9B A;  1F1B B;  3EFO B;  1TG0 A;  1KC8 R;  4NL3 A;  3FDR A;  1OX9 A;  4L6V 5;  1Q81 C;  2MAM A;  3OYD A;  3NTI A;  1SF9 A;  3UPU A;  1VQN T;  4WF2 A;  4MDW A;  2KAF A;  1K1Z A;  1RAA B;  1IO6 A;  1ZSZ C;  4DOW A;  1VQM A;  3J81 E;  1OV3 A;  4L5G A;  1UJY A;  4UC4 A;  3FJ5 A;  2JS0 A;  2YWW A;  3FRN A;  4ESR A;  3JCM Q;  1M1G A;  4OF1 A;  1JJ2 A;  4R56 A;  2EYY A;  1I81 A;  1ZSZ B;  3BDL A;  4EMG A;  4MDX A;  4X1V A;  4AT1 B;  3I55 Q;  1RAI B;  2FPF A;  2KT8 A;  5IXF A;  1IHV A;  2ZCF B;  3CPW S;  2PNI A;  4EMH A;  1ZUU A;  2M02 A;  2KYM A;  3CD6 A;  1Y0M A;  2FO0 A;  2H3E B;  1YCY A;  4LNP A;  2ESW A;  1W2B A;  1O75 A;  1TU0 B;  4RTX A;  1QQJ A;  1B07 A;  5GAM g;  2DTI A;  2EKO A;  1YHQ A;  1HSQ A;  3WVD B;  1SEM A;  5IN1 A;  3CCR A;  1JU5 C;  4PK4 A;  4FIB A;  1VQ4 T;  4IIO A;  2HBW A;  5GAN 2;  2KE9 A;  2HQH A;  2EQU A;  1SG5 A;  1FXX A;  1ABQ A;  4LD9 K;  3OYN A;  4M78 E;  4BDY A;  3LH5 A;  1PNJ A;  1UUE A;  2EQI A;  1BI2 A;  2E6Z A;  3CPW A;  4OP0 A;  2E5Q A;  3GNF B;  4GLM A;  2OI3 A;  2NUT B;  4LE9 A;  3OW2 P;  3RER A;  3CCL Q;  1NYG A;  1VQ4 A;  4OMP A;  4JRI A;  4CRI A;  1D3B A;  4E2F B;  3LH0 A;  4KUI A;  5J26 A;  4QKU A;  4WTO B;  3HRT A;  1RUW A;  4C5H A;  4JS4 A;  1FMK A;  1W70 A;  1R8O B;  3LX7 A;  2DRK A;  4CC7 A;  3JB9 H;  1XTD A;  4J7I A;  4O5V A;  4PJN A;  4JJB A;  2DJQ A;  1S72 Q;  1G3T A;  1QW1 A;  5FRO A;  1X27 A;  3GIB A;  1M27 C;  2DXU A;  5FWC A;  4DQ2 A;  2L0A A;  2JMC A;  1LPL A;  3RNJ A;  3HL8 A;  4F04 B;  2RQT A;  2DTH A;  2P0P A;  2ZPG B;  3CCE T;  1NBE B;  2OJ2 A;  2AZV A;  2XIC A;  3JCM P;  2NUP B;  2X4J A;  5GMK j;  4HCZ A;  2KRM A;  3C12 A;  4M78 C;  1K8A U;  1AVZ C;  2HQX A;  5KYN A;  5FLX E;  1VQ8 A;  2LVM A;  3U23 A;  3OQ5 A;  4J83 A;  3S3N A;  2RJF A;  3CCV Q;  2CZ6 B;  3JCM e;  1G3S A;  4A53 A;  4FW2 A;  2YHT A;  2K79 A;  3CD6 Q;  4M77 C;  3PIP A;  2WSE E;  5I11 A;  2EPD A;  4DEY A;  5KYU B;  2GTO A;  4EPC A;  4JJN K;  1OU8 A;  1TSF A;  4M7A F;  3V7C A;  4M4Z A;  1YHQ Q;  3TSW A;  2KEA A;  3BFM A;  1QCO A;  2XDD A;  3I56 T;  4N4H A;  1OZ2 A;  3X20 B;  9ATC B;  3QBY A;  1QVG S;  1NLO C;  2V1R A;  5I2S A;  3GPL A;  4XAX B;  4J5Y A;  4J9G A;  3JCM c;  3ZBD A;  1VQP T;  1VQO Q;  3SWN B;  1VQM Q;  2CUD A;  2EYZ A;  3NTH A;  2VYT A;  5KYY A;  2LJ0 A;  2HD0 A;  3NPF A;  3OYB A;  4HCK A;  3VYG A;  3CCL A;  2OX7 A;  3CC2 A;  1D0Z A;  3HRU A;  3TCJ A;  2LT4 A;  4RTV A;  4KGZ B;  2BIV A;  2D8H A;  2G6F X;  1RLQ C;  2ZPB B;  4BI4 A;  2RPN A;  4C8Q A;  2EIF A;  1TUG B;  1JRI A;  1K9A A;  4E7Z A;  3G71 A;  2DX1 A;  4LDX A;  3KBG A;  1K0S A;  2R57 A;  1NJI C;  3H0H A;  1K76 A;  1WGS A;  1YJW Q;  1LCK A;  4PJL A;  4RUG A;  3QSU A;  1RAF B;  2HEQ A;  2BZX A;  5GJW B;  1SSH A;  3OYA A;  4M75 G;  4FYW B;  3LWH A;  3HTR A;  3SWN C;  3MEW A;  1X6O A;  1RLP C;  3RES A;  3G71 Q;  3MJX A;  2EGA A;  4KUL A;  2GNC A;  3X24 B;  4BDZ A;  1WHG A;  2L8D A;  4M75 B;  2JT4 A;  2VGN A;  1BYM A;  2QTV A;  4E47 A;  3SHW A;  1VQ6 A;  1N5Z A;  1YWO A;  4C8Q G;  3EGX B;  1ZLM A;  3QZ9 B;  1J3T A;  2J05 A;  3MO8 A;  2YLB A;  3HFN A;  4C92 C;  2W10 A;  1TH7 A;  3JCM b;  1BB9 A;  1VQN Q;  5A0D A;  2LJ1 A;  2X35 A;  1KC8 C;  4PFZ A;  4EMK C;  2CUB A;  3EHQ A;  4R0K A;  4M77 D;  3CCE Q;  3GBQ A;  2FG0 A;  3IQL A;  3RBB B;  4OMN A;  4BAC A;  2RI2 A;  2V8J A;  3QKJ A;  3EAE A;  2RHZ A;  5KH6 A;  2CT4 A;  2EYW A;  2CS7 A;  4KBM B;  2D8J A;  1X2Q A;  3H9N A;  3BW1 A;  4MZP A;  6AT1 B;  1WJQ A;  3A5Z B;  3EG1 A;  1N8R C;  2XKO C;  2OAW A;  1WHL A;  4B6M A;  4J9H A;  3G1J A;  2E10 A;  2F5K A;  5CK9 A;  2H3J A;  1UGQ B;  5FWB A;  1Z9Q A;  2RQW A;  4ZGJ B;  2LQW A;  4J6W A;  4C0Z A;  2GBQ A;  1VQ5 T;  2EJ9 A;  3A1P A;  2EGE A;  3ZFJ A;  1M5Q 1;  2HL3 A;  2CP5 A;  3L42 A;  2VVK A;  3VU3 C;  4IIM A;  4LDW A;  2RQR A;  2PVG B;  2LQK A;  2KXC A;  3CC2 T;  1K4U S;  3OB9 A;  4EDU A;  2DMO A;  3G4S T;  2FZK B;  2L3Q A;  3M57 A;  3X25 B;  2QQS A;  3ASK A;  2FYK A;  4XU2 A;  5D6W A;  4PJO G;  3EHR A;  2DL7 A;  2H8H A;  3TU4 K;  3OYJ A;  4M75 F;  2KK4 A;  3VRZ A;  2MK5 A;  2MI6 A;  2RA2 A;  1LNX A;  1H92 A;  2P84 A;  1HD3 A;  3QDR B;  2QEX T;  1OPK A;  4XTX A;  1WJR A;  1UFF A;  4FW1 A;  1MMD A;  1IXD A;  4J9E A;  1M1K R;  1UHF A;  2OTJ T;  3URG A;  1ARK A;  1ZA2 B;  3EG2 A;  4M78 D;  4MMK A;  3VS2 A;  1AT1 B;  3CMA Q;  2I2L A;  2VWF A;  3NHN A;  3QII A;  2IG0 A;  2RHU A;  2RK1 A;  5KYY B;  4RTU A;  2EYQ A;  5DY9 A;  1NM7 A;  1I5L A;  4JZ4 A;  1S72 T;  1PD1 A;  2DJZ A;  2QG9 B;  4ELY C;  1Q86 C;  4XTU A;  2KY9 A;  2QQ9 A;  4PJO A;  2RO0 A;  3L1A A;  4XTW A;  8AT1 B;  1S72 A;  4BI8 B;  4M7D G;  3VYH B;  1K9M C;  5GMK m;  1OI1 A;  1I0C A;  2DVJ A;  3SD4 A;  1YWP A;  4HVV A;  4JJC A;  2KDS A;  1IB8 A;  1U8R A;  3V8K A;  3GP8 A;  1X69 A;  3GF5 A;  4NOY A;  1X43 A;  4M7A D;  4F7U B;  4BI3 A;  4M7A C;  4FL6 A;  1N9R A;  2PUK B;  2GCX A;  3OS1 A;  3M4Y A;  2DL4 A;  4QW2 A;  5DM7 R;  1K73 C;  4M78 B;  1FYN A;  2FZC B;  3I9Q A;  4C92 G;  1G2B A;  1QVF S;  2Y90 A;  2COY A;  4II1 A;  4DBR A;  4NS5 A;  2ED0 A;  1QVG A;  2ECZ A;  3CD6 T;  4JRK A;  4HCC A;  3OYM A;  2HMA A;  2NWM A;  2V1Q A;  4E7K A;  1E6H A;  1JEG A;  3QWY A;  1YHQ T;  4PJO B;  2ZPI B;  5GAN e;  3CCR T;  2DAQ A;  5L8R E;  2DM1 A;  1NYF A;  1OU9 A;  1KG1 A;  4J6X A;  1PG5 B;  2GTJ A;  2CH4 W;  1NJI U;  5CO7 A;  1RAB B;  3OS0 A;  3CCU A; 
#chains in the Genus database with same CATH homology
 2HBW A;  2KE9 A;  4HVU A;  3EG0 A;  3PVL A;  1I07 A;  1ABQ A;  1GBQ A;  2DBK A;  3LH5 A;  2BZY A;  3I5R A;  2GGR A;  1PNJ A;  1UUE A;  3PVQ A;  2EQI A;  2YT6 A;  2DL5 A;  1OPL A;  2I0N A;  2KGT A;  4GLM A;  3ZL7 C;  2OI3 A;  2F2X A;  4LE9 A;  1GCQ A;  1QKX A;  4LN2 A;  4ORZ A;  3VS0 A;  1NYG A;  1Y57 A;  1B3Q A;  1SPK A;  4OMP A;  2SEM A;  3UA7 A;  2KRS A;  2SRC A;  1SRL A;  2FRY A;  4Z88 A;  2IIM A;  1PRM C;  2EW3 A;  2EKH A;  3SEM A;  2RN8 A;  1RUW A;  1E6G A;  2JMA A;  1U3O A;  1FMK A;  2PTK A;  1W70 A;  2J6O A;  2CRE A;  2DRK A;  2LNH B;  3A98 A;  4CC7 A;  2DNU A;  1UG1 A;  2EGC A;  4JJB A;  2DJQ A;  2X3W D;  2YUN A;  1UDL A;  2ED1 A;  1X27 A;  1M27 C;  5FWC A;  5EC7 A;  2L0A A;  2JMC A;  2HDA A;  4JPB W;  3NMZ C;  3RNJ A;  2K9G A;  2RQT A;  1WXU A;  4RTW A;  4AFQ C;  1SHG A;  3KFV A;  2OJ2 A;  2AZV A;  1GFC A;  3VS4 A;  1ZX6 A;  1KSW A;  2ENM A;  2KRM A;  3UF4 A;  2L3S A;  3M0T A;  1JQQ A;  1T3L A;  1GRI A;  1EFN A;  1NEG A;  1SHF A;  1AVZ C;  4F14 A;  4E6R A;  1JXM A;  3REB B;  3U23 A;  1ZUY A;  1ZUK A;  2KT1 A;  1AWO A;  1BBZ A;  2JM8 A;  4AG1 C;  4J9I A;  2EBP A;  2K79 A;  3M0R A;  2LZ6 B;  1X6B A;  2M51 A;  5I11 A;  2EPD A;  1TUC A;  1VYV A;  4DEY A;  2F2V A;  2PZ1 A;  2GTO A;  1JO8 A;  2A28 A;  3M0S A;  1W6X A;  2VKN A;  5FW9 A;  1AWX A;  2DA9 A;  4M4Z A;  4A63 B;  2F2W A;  4HXJ A;  3TSW A;  2KEA A;  2CSQ A;  2CSI A;  2GQI A;  2DL3 A;  2DLP A;  5L23 A;  4D8K A;  2RNA A;  2ROL A;  1NLO C;  2V1R A;  1M3C A;  2LCS A;  1QWF A;  1XOV A;  2CT3 A;  4J9G A;  4OMM A;  1A0N B;  3H0F A;  2O9S A;  3ULR B;  2CUD A;  2EYZ A;  1M8M A;  1AEY A;  1WYX A;  4OMQ A;  1PKS A;  2A36 A;  3NGP A;  2BZ8 A;  4J9C A;  1ZSG A;  4OMO A;  2LJ0 A;  3M0Q A;  3NPF A;  3C0C A;  2MCN A;  4HCK A;  2O31 A;  1AWW A;  2FPE A;  3PE0 A;  2FPD A;  4RTV A;  2D8H A;  2G6F X;  1RLQ C;  1WXB A;  2AZS A;  1AWJ A;  5ECA A;  5I22 A;  2K6D A;  1WX6 A;  2C0T A;  2RPN A;  1K9A A;  2J6K A;  1M3B A;  1V1C A;  2ABL A;  1GCP A;  2DX1 A;  4RTT A;  2J6F A;  1K0S A;  1GCQ C;  2EVR A;  1K76 A;  3H0H A;  4JZ3 A;  1VYU A;  1QLY A;  2YDL A;  1QWE A;  2J06 A;  1LCK A;  4GBQ A;  2A37 A;  1U5S A;  4RUG A;  4D8D A;  3H41 A;  1WA7 A;  2DBM A;  4ZNX A;  2HEQ A;  2BZX A;  5GJW B;  1SSH A;  3QWX X;  1RI9 A;  1T0H A;  1WFW A;  1RLP C;  2JW4 A;  1AD5 A;  4K11 A;  3I5S A;  2EGA A;  2GNC A;  1GFD A;  3REA B;  4J9D A;  1U06 A;  2X3X D;  2DE0 X;  1ABO A;  5IHN A;  1UTI A;  3VS5 A;  1KJW A;  3VRY A;  3VS6 A;  2JT4 A;  1AZG B;  1OOT A;  3VS3 A;  3SHW A;  1N5Z A;  1YWO A;  5IXB A;  1H3H A;  1ZLM A;  1J3T A;  1PKT A;  2J05 A;  2RMO A;  1MV0 B;  3UA6 A;  2W10 A;  1WIE A;  1BB9 A;  1T3S A;  4CC3 A;  2LJ1 A;  1YN8 A;  2CUB A;  3EHQ A;  2DYB A;  2DRM A;  2KBT A;  4R0K A;  3GBQ A;  2KRN A;  1PWT A;  1M3A A;  1NG2 A;  3JV3 A;  2FG0 A;  3IQL A;  2RQV A;  3EG3 A;  2RF0 A;  1UEC A;  4OMN A;  3RBB B;  5GJV B;  5IHI A;  2FRW A;  4CC4 B;  5IHK A;  1PHT A;  2YUQ A;  1VYT A;  2CT4 A;  2EYW A;  2LX7 A;  3TVT A;  1K0X A;  3R6N A;  2AKL A;  2D8J A;  1X2Q A;  2DIL A;  1UE9 A;  3EG1 A;  1TUD A;  1UHC A;  2W0Z A;  2CH4 A;  4Y92 A;  2OAW A;  2MOX A;  1JXO A;  2NUZ A;  4J9H A;  1BK2 A;  1YP5 A;  4EIK A;  2YUO A;  2C0I A;  5HCK A;  3M0P A;  5FWB A;  1Z9Q A;  2RQW A;  2LQW A;  3H0I A;  4KRT A;  2GBQ A;  3O5Z A;  5IH2 A;  3THK A;  1AOJ A;  4FSS A;  2EGE A;  2K7A A;  2YSQ A;  2VVK A;  1BU1 A;  4IIM A;  3EGU A;  1QCF A;  2CDT A;  2RQR A;  4Z89 A;  1S1N A;  1PRL C;  1H8K A;  2KXC A;  1K4U S;  2DMO A;  1KFZ A;  2L3Q A;  2D1X A;  2XMF A;  2KYB A;  1YCS B;  2BTT A;  1CSK A;  3EHR A;  2DL7 A;  2KXD A;  2H8H A;  4LUD A;  1W1F A;  3VRZ A;  4DEX A;  4AFS C;  1UJ0 A;  2K3B A;  3UAT A;  2B86 A;  1G83 A;  2KRO A;  1H92 A;  1MV3 A;  3VS7 A;  1HD3 A;  2HSP A;  1UGV A;  1OPK A;  2O2O A;  3I35 A;  1CKA A;  1UFF A;  2QDL A;  1OEB A;  2L3P A;  4J9E A;  1WXT A;  1X2K A;  1UHF A;  1NLP C;  1ARK A;  2JTE A;  2P4R A;  3EG2 A;  4JJD A;  1WDX A;  3VS2 A;  2LJ3 A;  1WI7 A;  2DL8 A;  3CQT A;  2K2M A;  2JXB A;  2VWF A;  3NHN A;  2A08 A;  1SRM A;  2LQN A;  4RTU A;  4F16 A;  1NM7 A;  4Z8A A;  4JZ4 A;  2LMJ A;  4WCI A;  1WLP B;  3VS1 A;  2HCK A;  2L2P A;  2E5K A;  2M0Y A;  2J7I A;  4J9B A;  1TG0 A;  1NEB A;  4J9F A;  1YNZ A;  1I0C A;  2DVJ A;  1AZE A;  1YWP A;  4HVV A;  4JJC A;  1GL5 A;  4RTY A;  1X69 A;  1M30 A;  2C0O A;  1K1Z A;  1X43 A;  2D0N A;  1CKB A;  2O88 A;  1IO6 A;  1I1J A;  2DF6 A;  3TSZ A;  4CC2 A;  4LUE A;  1OV3 A;  1UJY A;  2DL4 A;  2YUP A;  3FJ5 A;  2JS0 A;  1MUZ A;  2RQU A;  2KR3 A;  1E7O A;  4ESR A;  2FEI A;  4QT7 A;  2O9V A;  1FYN A;  3I9Q A;  1G2B A;  4AFZ C;  2EYY A;  2ROT A;  4RTZ A;  4OML A;  2ED0 A;  2ECZ A;  1ZBJ A;  4X1V A;  1VA7 A;  2FPF A;  2KT8 A;  5IXF A;  2PNI A;  4AG2 C;  1ZUU A;  2MIO A;  2KYM A;  1Y0M A;  2NWM A;  2V1Q A;  1E6H A;  2FO0 A;  4HVW A;  1JEG A;  3QWY A;  4AFU C;  1Z9Z A;  4LNP A;  2ESW A;  1GBR A;  2LP5 A;  2EYX A;  4RTX A;  1HJD A;  2JM9 A;  1B07 A;  2AKK A;  1KIK A;  1T0J A;  2DM1 A;  3M0U A;  1NYF A;  2KNB B;  1QKW A;  1X6G A;  4F17 A;  1HSQ A;  2AK5 A;  1SEM A;  2GTJ A;  2CH4 W;  1JU5 C;  4IIO A;  2JS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...