1M3CA

Solution structure of a circular form of the n-terminal sh3 domain (e132c, e133g, r191g mutant) from oncogene protein c-crk
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
CGAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene C-crk
publication title Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 8
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m3cA00
1VYTA 1NEGA 2M51A 1TUCA 1PKSA 3TSWA 1H92A 2LMJA 1YP5A 1XOVA 2RNAA 2HBWA 2O9VA 2X3WD 2YUOA 1BBZA 1HSQA 1VYUA 1UTIA 3EG0A 4F16A 2F2XA 4HVUA 1K9AA 4RTXA 3PVLA 2C0OA 2K6DA 1ZUKA 4AFUC 1AZEA 4J9FA 4LN2A 2J6OA 3REAB 4FSSA 1N5ZA 2KXCA 4JZ3A 1QWFA 2KNBB 1NM7A 1Y0MA 1GL5A 1JEGA 2JS0A 2LQNA 2D8HA 2I0NA 2ECZA 4DEXA 2FRYA 4HCKA 4D8KA 2O31A 2F2WA 2DMOA 4M4ZA 2EVRA 2KROA 3M0UA 1WI7A 5L23A 3VS4A 2K9GA 1JQQA 1WXBA 5IHIA 3O5ZA 2VKNA 3VS7A 3VS6A 1UHFA 2K3BA 1BU1A 1A0NB 1V1CA 1WDXA 1QKXA 2AKLA 2EKHA 2MCNA 1AWXA 4LNPA 2RQUA 3EG3A 2K79A 2FEIA 2KYBA 4RTZA 4DEYA 5IXFA 3M0SA 1ABOA 4X1VA 3QWXX 2FG0A 1WIEA 3EG1A 2PZ1A 4CC3A 1YCSB 2EGAA 5GJWB 4OMQA 4ORZA 3NGPA 3R6NA 1PKTA 4LUDA 1QWEA 3I9QA 2GQIA 2EW3A 4JJCA 2J7IA 2CH4A 4RTVA 2DX1A 2NWMA 4J9HA 2BZYA 2W0ZA 2H8HA 1WLPB 1K76A 1OV3A 1PRLC 1RUWA 2KE9A 1IO6A 2JTEA 2PTKA 1H8KA 4JPBW 5IXBA 4HXJA 4OMOA 1J3TA 2FPEA 4J9IA 1K1ZA 2XMFA 3UA7A 5GJVB 4LUEA 2JMCA 1Z9ZA 1K4US 2ENMA 1UG1A 1GCPA 1JU5C 1RLQC 2ROTA 2LZ6B 3EG2A 2L3QA 3UATA 3ZL7C 2ABLA 1BB9A 1WXUA 2FRWA 2F2VA 2CREA 2E5KA 2YT6A 3VS2A 2RQWA 3A98A 2DILA 4OMLA 4F14A 2LJ0A 2YUQA 2RQVA 2DVJA 2EQIA 2KRSA 2PNIA 1G2BA 2HEQA 2CUBA 4D8DA 2ROLA 3I5RA 2OJ2A 1AD5A 1GBQA 4J9DA 5I11A 1PHTA 3NMZC 2KEAA 1UJYA 2ED1A 4HVWA 1SEMA 1U06A 3H0FA 4IIOA 2YUNA 1M27C 1UFFA 2CT3A 2LX7A 4K11A 2CDTA 3VRYA 2DYBA 2EBPA 1KJWA 5EC7A 1X2KA 1YNZA 2VWFA 5FW9A 1NYGA 4Y92A 2DL7A 1NEBA 1KIKA 3EGUA 4F17A 1ZX6A 3QWYA 2GNCA 4Z8AA 3M0TA 1M3CA 1UE9A 1I07A 1UECA 1ABQA 2L3SA 5IHKA 2DNUA 4LE9A 1SRMA 3C0CA 2CSQA 4OMPA 2JM9A 2GTJA 1X27A 1TUDA 3GBQA 2L3PA 4KRTA 2W10A 2X3XD 4AFQC 1QKWA 1AWWA 1B07A 3EHQA 1H3HA 4CC4B 2SRCA 1OEBA 1UUEA 2CH4W 2D1XA 2A37A 2RQRA 3KFVA 3M0RA 4R0KA 3VRZA 1EFNA 1M8MA 4AG1C 3NHNA 5FWCA 2AZSA 1SPKA 2EGCA 3H0HA 3UA6A 3TSZA 1PWTA 1ZUUA 2VVKA 3H0IA 2LNHB 1UHCA 1T0HA 2CT4A 1WXTA 2KGTA 3PE0A 1LCKA 4E6RA 2RMOA 1QLYA 2J05A 2EYZA 2KT1A 1M3AA 2DLPA 1NYFA 1RI9A 2ESWA 2EYXA 1SHFA 2DJQA 3I5SA 4A63B 2JXBA 2HDAA 3TVTA 2O88A 1OOTA 1AEYA 2L0AA 1ZUYA 2QDLA 3RNJA 2KRMA 2JM8A 1U5SA 1GRIA 1I1JA 4ESRA 2JW4A 4CC2A 1GBRA 2DBKA 4J9EA 3I35A 2JT4A 2O9SA 1YWPA 2MOXA 1SHGA 1MUZA 1X6BA 1ZSGA 1AVZC 3REBB 4JJBA 2O2OA 1FMKA 1WX6A 1OPKA 1T3SA 1T0JA 1AWJA 4JJDA 4AG2C 2DE0X 4HVVA 1X2QA 1NLPC 2MIOA 4IIMA 3IQLA 1JO8A 2DA9A 4J9CA 2DRKA 4CC7A 1VA7A 1NG2A 2LJ3A 2K2MA 1TG0A 4QT7A 2V1RA 2HCKA 2OI3A 2P4RA 1KSWA 1YWOA 1U3OA 1CKBA 1E7OA 1YN8A 3UF4A 2LCSA 1ARKA 2AK5A 2YSQA 3LH5A 1GFDA 1MV0B 2CSIA 3U23A 5FWBA 2ED0A 3SHWA 2FPFA 5ECAA 2V1QA 2DL5A 4J9GA 1GFCA 1GCQC 2GBQA 1JXOA 2DF6A 1W70A 2EPDA 3M0QA 2GGRA 2B86A 2G6FX 1PNJA 3VS5A 1E6HA 2DBMA 2EYYA 1T3LA 5I22A 2LP5A 2K7AA 3RBBB 2EGEA 2LQWA 3VS0A 2SEMA 2A36A 4GLMA 2JS2A 1G83A 3M0PA 2L2PA 2EYWA 2YDLA 2KT8A 4RTUA 1RLPC 4EIKA 4AFZC 4JZ4A 2FO0A 1UGVA 2FPDA 1BK2A 1JXMA 2KRNA 2LJ1A 1M3BA 2DL3A 4OMMA 2AZVA 2GTOA 1X43A 3PVQA 1CKAA 1ZLMA 2NUZA 1WFWA 2A08A 1HD3A 2CUDA 1I0CA 2C0IA 1W1FA 2BZ8A 1S1NA 5IH2A 1X69A 1OPLA 2KYMA 4OMNA 2OAWA 2RF0A 3NPFA 4RTWA 1QCFA 1MV3A 2DM1A 1AZGB 2DL4A 2HSPA 4Z88A 3ULRB 1E6GA 3FJ5A 2DL8A 2J6FA 2KR3A 1KFZA 1K0SA 1SSHA 3VS3A 2AKKA 1SRLA 1AWOA 4RTYA 2JMAA 1VYVA 1GCQA 1CSKA 4Z89A 2YUPA 1X6GA 4J9BA 1WA7A 2C0TA 1UDLA 2D0NA 1M30A 4GBQA 1PRMC 3THKA 1AOJA 1HJDA 1ZBJA 2BZXA 1K0XA 3EHRA 4AFSC 1NLOC 1FYNA 2KXDA 3CQTA 5HCKA 1Z9QA 2DRMA 1WYXA 2D8JA 3SEMA 2BTTA 2J06A 5IHNA 1UJ0A 2RQTA 4WCIA 4RUGA 2IIMA 2M0YA 2RN8A 2RPNA 4RTTA 4ZNXA 2A28A 1B3QA 2KBTA 2J6KA 1Y57A 3JV3A 3VS1A 1W6XA 3H41A
chains in the Genus database with same CATH superfamily
1TUCA 3HRUA 2QASA 1Y96A 4M7AF 3FEOA 1XOVA 2HAXA 3QO3A 1TTHB 1DJ7B 2CZ0B 3EG0A 1UTIA 1OU8A 4F16A 2F2XA 4HVUA 2R5AA 1I8FA 1ZA2B 2C0OA 4QQGA 2DXTA 3MHXA 4AT1B 4J9FA 5AYFA 3JCMQ 3REAB 3OYIA 4FSSA 3V8JA 3CCUT 3INZA 4JZ3A 1Y0MA 3AT1B 2BIVA 2EIFA 4OB1B 2YLCA 1JEGA 2DIQA 1WQWA 4BE2A 4LXCA 2QGFB 4DEXA 3RR6A 2O31A 3M59A 2F2WA 2QQBA 3OB9A 4R56A 1Q86U 3EGDB 1WXBA 3O5ZA 2DJZA 1LVKA 3MP8A 3CCUQ 2VKNA 3EFSA 3OY9A 1EZZB 2DPPB 3CPWS 3JCMb 2CS7A 1G8XA 1VQ7A 1H641 2KYBA 5D6WA 5LJ3d 5GAMh 3CC2Q 1RAGB 1QP3A 2CP7A 2B8AA 1WIEA 3V7SA 5DLQE 3EG1A 4CC3A 3RKWA 1WHLA 4OMQA 3BY7A 4ORZA 3R6NA 3HKSA 1QWEA 1YHQT 1YJWT 2GQIA 4HCCA 4RTVA 4KGZB 2RJDA 3A8MB 3OBWA 4KBMB 1OV3A 2DYIA 5KYXA 2HKNA 3ER0A 5IXBA 3HP9A 3QHSA 5D7UA 4J9IA 1K1ZA 3SDZA 3JCMg 1Z9ZA 2KAFA 1YHQQ 1K4US 4C5GA 1YJWQ 5GAN3 1UG1A 3M56A 1Q7YC 2E4HA 4JS4A 2ROTA 2E41A 1QQJA 2LZ6B 3UATA 3I55A 1QVPA 2ABLA 4MZTA 1N8RC 3CCLA 5I2SA 1B7TA 4Y91A 1SF9A 4CRIA 3OMGA 4OMLA 3CXCS 3CC7T 1VQ5A 2BE7D 4C8QC 3LGFA 2EQIA 2KRSA 3J7AF 1VQNT 2YHTA 2ROLA 3I5RA 4J9DA 2ED1A 4HVWA 4C92D 3OW2P 4IIOA 4XU1A 2DEUA 3PTAA 2LX7A 5GANe 2HZYA 1WJQA 2CDTA 3VRYA 2DYBA 2BKDN 1YNZA 2VWFA 1NYGA 2DZCA 4Y92A 1NEBA 4AMCA 3EH1A 4C0DC 2FYKA 1VQNQ 4JJNK 3AHUA 4F17A 5IT9E 1BYMA 1Y7XA 3QWYA 4QQ6A 4Z8AA 2Y90A 2RHUA 4PKCC 2DKGA 2QK0A 4LE9A 1K73R 4M7AD 1UEBA 2V8KA 5KE3A 2GQVA 1V76A 1X27A 5GAMg 1MMGA 2L3PA 3QIIA 4QQDA 2W10A 2X3XD 4J7FA 1QKWA 5GAN8 3EHQA 4VUBA 1KC8R 2F69A 3CMAA 5FU7C 4FYVB 4WTOB 1OZ2A 2RQRA 3M0RA 2Z0WA 4B6MA 1QVGS 2EYQA 4FSXA 3JCMJ 3L2RA 4LDVA 4C92A 1HXDA 3MCAB 3GNFB 1EFNA 4AG1C 1SPKA 3H0HA 4FU6A 2COZA 5GAOm 4NOYA 1UHCA 1M8VA 3CCQA 2CT4A 1WXTA 5J3BA 2KGTA 2V8IA 1K8AR 2DLPA 2EQKA 2GFUA 1OULA 4LD6A 2VGMA 1D0XA 3V8LA 4OGEA 2FZKB 2QAZA 1YIJT 2QDLA 2JM8A 5KYUB 4M7AA 2EQUA 1M1GA 2AIRB 1VQ8T 1KD1U 2O9SA 3CCVA 1MMNA 1ZSGA 4KH1B 5CK9A 1Y71A 4PLIA 1KQSS 3CD6A 1AVZC 3REBB 3JB9J 4JJBA 1WX6A 4WF2A 1KG1A 1T0JA 1NJIU 1AWJA 2K57A 5CKBA 1KQ2A 4HVVA 3QDFA 1W2BS 2RI3A 1BCMA 1X2QA 2MIOA 3OYFA 3FRNA 1MNDA 1Q86C 3ASKA 4HA8A 2ZPFB 3OYJA 3OYDA 1VA7A 2NUPA 4M77G 5KYYB 1X6OA 2P4RA 1E7OA 3UF4A 2OTJA 4IKFA 3OYGA 2MMPA 4EPCA 2ED0A 3SHWA 4N0AC 1IB8A 4M77F 1VIEA 3OYKA 2V1QA 5CKEA 2RB6A 1TOVA 4FL6A 5D6XA 4EDUA 1JXOA 4ELZC 2EPDA 3OW2A 2MPXC 2QTXA 2YRCA 3CBPA 1ZSZB 1C0MA 2F1LA 3HL8A 4OB0B 5CQYA 3DB4A 2PVGB 3PFSA 4BDZA 3JCMc 3M0PA 4PJOG 2L2PA 4M75C 2EYWA 4J8OA 4RTUA 4EIKA 4C92E 4JZ4A 1UGVA 2FPDA 1BK2A 3C95A 2D0QB 2JNGA 5IN1A 1K9MU 2P4TA 1SG5A 2M0OA 3C94A 4PJOF 1CKAA 2XHCA 1Q82R 1ZLMA 1YJNA 3OBYA 1WFWA 3HHTB 4EMKA 4QW2A 1MMAA 1BI2A 1YCYA 4C5IA 4DBFA 2GCXA 1VQ9Q 1X69A 1OPLA 2EQJA 2H3EB 2KYMA 2XK0A 4XTWA 1MV3A 2DM1A 4C0FA 4C5EA 1XTDA 2HSPA 2ZAEA 3BDUA 3R6OA 3ULRB 1KQ1A 1WNLA 4RMOA 4M7AE 1KFZA 1K73U 2DK3A 1SKUB 2KVQG 3NFCA 1OQKA 3VKIA 4PFZA 2E12A 2AKKA 1G3SA 2OTLT 4RTYA 4M7DC 4C8QB 4LDUA 2YUPA 2RJFA 1N9SA 4BI8B 2CZ1B 2FVUA 4J9BA 3S6WA 3MEWA 2C0TA 8ATCB 3CCMT 4GBQA 2E3IA 1AOJA 7AT1B 4DA4A 4FYWB 4UC4A 3HFOA 5GAOq 1TH7A 3RMSA 3EHRA 3EFOB 3CCSQ 1VQPT 1WHKA 1Z9QA 2XICA 3PGGA 2OTLQ 1WYXA 4EMHA 3UWNA 2ZPBB 3J81E 3JB9I 2J06A 5IHNA 2M9UA 3OS1A 2LNVA 1K8AU 4C0DB 2YWWA 3CC4A 2KBTA 1B3QA 3M5AA 1QCNA 3WVDB 3LWIA 2XKOC 3CCMQ 5GAN6 1NEGA 2M51A 1LJOA 2CP0A 2M02A 1PKSA 3TSWA 3FIFA 1YP5A 2WSEE 2RNAA 1VQPQ 1ZSZA 1BI3A 1S72A 5KE2A 3DLLA 1BBZA 1HSQA 1VYUA 3VYHB 5KH6A 3QJ6A 1WHGA 4XAXB 3M54A 1B34B 1PD1A 5CAIA 1FWZA 1ZUKA 2PVDB 1M9SA 1N5ZA 1WHMA 3QJYA 3S3NA 1VQ4Q 2KNBB 2I2LA 2JS0A 4E7ZA 1X75C 2D8HA 2OAUA 5CCAA 2ECZA 3MP6A 4HT8A 1VQ9A 3HFNA 3CCRT 3DB3A 1JJ2A 2BE9B 3RMQA 3L2VA 1NE8A 2VB6A 2COWA 3UT1A 4M77D 1M2VA 2ZPEB 2DXCA 2LCLA 3G4ST 2VYTA 3VS7A 1R8OB 1BU1A 3ZFJA 1A0NB 2EKHA 1QKXA 1AWXA 3QZ5B 5LJ3g 2ZZDA 3M53A 4J6YA 2CKKA 4DEYA 5IXFA 1ABOA 3CCRQ 2MF2A 1YJ9T 2FG0A 4O6JA 1UGSB 2EGAA 4ATOA 3NGPA 1PKTA 4LUDA 3G4SQ 2NUTB 3M9QA 3I9QA 2X9HA 1PSFA 2ZGWA 3X24B 1QW1A 1I81A 2DX1A 4FCYA 2W0ZA 2H8HA 4RCBA 1K76A 3QDRB 3A8GB 1M90R 2KE9A 4E2FB 1VQLA 2RO0A 2JTEA 4A54A 1YJ9Q 1H8KA 3M55A 4PJOD 1PSEA 3MKDA 3E19A 4F7UG 2QYZA 3UA7A 4M77A 5GJVB 3JCMP 1R0BG 4C0GA 2KY9A 1GCPA 1JU5C 1Q82U 4L59A 3EG2A 4QVDA 3ZL7C 2XI9A 2FRWA 2GF7A 4F7UF 3QSUA 2CREA 4OVAA 3CPWP 3HRSA 1IHWA 4LDYA 3DLMA 3A8LB 1VUBA 4BACA 2LJ0A 2YUQA 4IUUA 4FYYB 3OYEA 2PNIA 2XU8A 2CUBA 1B34A 2R57A 4HT9A 5I11A 1PHTA 3JCMX 1I4K1 2M16A 2O01E 3H0FA 5GMKj 4L5GA 2YUNA 3SWNC 3M58A 1UFFA 4M75B 4PJOA 3CCEQ 1KJWA 2P0KA 1UB4A 5FLXE 1IZ6A 4BY6C 4FW2A 3RKXA 2V26A 2DL7A 4OF1A 2GNCA 3V7CA 3OS2A 1UE9A 1I07A 1UECA 1K73C 2LRQA 1ABQA 2L3SA 1WHJA 3OYYA 1IGQA 3OS0A 1SRMA 2KMTA 3V7RA 2CSQA 3ZBDA 2BUDA 2JM9A 1KC8C 1RADB 2AHJB 1TUDA 2DD4A 1QP2A 3EG9A 2E3HA 1KD1R 1D1AA 1B07A 1VOMA 1C1AA 2JVVA 3CXCP 4HCBA 4ZGDB 4KH0B 2VGNA 1X01A 2HBPA 2NUTA 1NJIR 4ME7A 3KFVA 3LW5E 4R0KA 4KGVB 3HRTA 4ZGJB 4M78E 3L2ZA 3VRZA 4FM4B 3NHNA 5KYNA 1I5LA 2AZSA 3BFMA 3UA6A 5GMKh 1K8AC 1PWTA 3VUBA 5KYWB 2V8JA 4E7HA 2VVKA 3H0IA 3OYCA 1D1CA 5C6SA 1R0CB 2RMOA 2Y4YA 1NYFA 1RI9A 2ESWA 5FRMA 3A5ZB 4PNOA 3FB9A 4F7UB 2EKOA 4M77E 2HDAA 3M4GA 8AT1B 1ZUYA 2DO3A 3PT9A 1VQOT 1NZ9A 3GNGA 2JW4A 3MJXA 1YWPA 2RD1A 2IPOB 5A0LA 2K4YA 3QPHA 1FMKA 1OPKA 1T3SA 4LDWA 1KHCA 1VQOQ 1WJSA 1WHHA 1NLPC 2PUOB 1QVGP 3IQLA 2VXEA 2E1HA 1WQ7A 1NG2A 3URGA 2LJ3A 4B9XA 2QTVA 4BUGA 4BE0A 1RI0A 4QT7A 2K3XA 2HCKA 1KSWA 3CPWA 2WSFE 1M90U 1K9MR 5GANf 4PJOE 2JTMA 4LDXA 4M78C 3CCJT 2YSQA 3HPWA 5HK3A 1GFDA 1PD0A 2CSIA 3EAEA 3V8KA 5D6YA 3CC7Q 3CCUA 4N4HA 5FU6C 1EIFA 4XQ3A 5ECAA 3J80E 1Q81U 1GFCA 3EGDA 2VUBA 1GCQC 1JRIA 3CC2A 2GBQA 1W70A 2B86A 3CMET 2AT1B 1RAIB 1NBEB 4D6WA 2EYYA 4JDSA 1U8RA 1KQSP 2LP5A 2K7AA 3RBBB 1OYXA 1MMDA 4XU3A 2A36A 2JS2A 1W2BP 1Q95G 4JRPA 2PVOB 1D3BB 3PIOA 1Y07A 3CMEQ 4AFZC 1M4ZA 3I56T 1IHVA 2KRNA 1Q82C 3LGLA 4PLLA 2AZVA 4JS5A 5CQXA 2EJFA 2X4YA 1YHQA 1YJWA 4IUQA 2CUDA 4F7UA 5IH2A 1W1FA 3CXCA 2QA4T 3TCJA 2M1HA 2OAWA 4RTWA 1QCFA 4E7JA 2E5QA 4OB3B 2DL4A 3D7SB 3FJ5A 5LJ3e 3OYAA 1EX4A 4FYXB 5A0GA 5GANj 1ZQ1A 4PFOA 1VQKT 1JB0E 1SRLA 3WVEB 3TREA 3RESA 2QA4Q 1F1BB 3G6ET 4A4FA 4C8QG 5I21A 4JRQA 3TU4K 2QG9B 1UDLA 3JRZA 2NLUA 1WGSA 1YIJQ 2CP6A 4J6XA 1ZBJA 3CC7A 5LJ5e 3SWNB 4AFSC 1NLOC 1VQKQ 1FYNA 1D1BA 4C8QF 1VQ8Q 3RDVA 1VQNA 2DRMA 3EFRA 2ATCB 3G6EQ 3LYIA 4BY6B 1UJ0A 2M0YA 2VXFA 2RPNA 4RTTA 1JBMA 4N4IA 2A28A 3T9NA 1TSFA 1VYTA 4XTVA 2EFIA 4PJLA 3LH0A 5GMKi 2HBWA 2O9VA 2X3WD 1WJRA 1IREB 4V2SA 3KBGA 5GANh 2CZ7B 1P92A 1VQMT 1QMCA 2ZPIB 4RTXA 4A4HA 1NPPA 2K6DA 2DTOA 4AFUC 1AZEA 4LN2A 3RUXA 2J6OA 4OMFB 5HK0A 3UPUA 2HL3A 1QWFA 1N9RA 5C0MA 1D3BA 2XD0A 5A0DA 1G5VA 2I0NA 4DOWA 4ZTJA 4D8KA 4NS5A 1VQMQ 3OQ5A 3META 4KUIA 3M0UA 3VS4A 2GFAA 4A53A 1QVFS 1JQQA 1VQ6T 5IHIA 2QEXT 1UHFA 2K3BA 2FHDA 1LOJA 1V1CA 3G71T 4BDYA 1YITT 4LNPA 2RQUA 3EG3A 5EG2A 1W2BA 5LJ5j 1OX8A 1IXDA 2FZCB 4X9DA 4RTZA 1W4SA 3P8HA 2COYA 3QWXX 2LVMA 5KYUA 2PZ1A 2QXFA 1I5OB 3QKJA 1VQ6Q 4NL2A 2CGHA 1BIAA 3G71Q 2J7IA 1YITQ 1M90C 2BZYA 1WLPB 2MWPA 1PRLC 2IG0A 2X4XA 1IO6A 1XNIA 4JPBW 2CYZB 2A7YA 2DD5A 4OMOA 2DFUA 1J3TA 2XMFA 4YTLA 2FB7A 2HL5C 2P0QA 4L6V5 4LUEA 4MZPA 5LL6S 5KYYA 1JJ2S 2ENMA 3QZ9B 1RLQC 1BB9A 2F2VA 3H8ZA 3PNWC 3JCMf 1HK9A 1YI2T 3JCMe 4C92C 2K2VA 2RQWA 4N4GA 3A98A 1RAHB 2DILA 4F14A 3GLXA 4KULA 2DVJA 4IUVA 4D8DA 1ZHIA 2OJ2A 4MDWA 1AD5A 2K3YA 5GAOr 3OSVA 4Y28E 2E10A 2KEAA 1UJYA 1U06A 1YI2Q 5FU7B 2D6FA 2QGGA 4ZN1A 4M75G 5EC7A 4C8QD 2QQSA 4A4EA 3QUIA 1X2KA 4M7AC 4TVRA 2YRVA 5CO7A 3EGUA 3N5BB 2KDSA 2ZCFB 2DXBA 1ZX6A 2VV5A 4JLIA 1M3CA 3RIRA 1Y96B 4M75F 2O4XB 1TWBA 2RI5A 5IHKA 2DNUA 4QVCA 1Q7YU 5DM7R 3A8HB 3C0CA 1V29B 1BI1A 1KD1C 4OMPA 2GTJA 1N8RU 1M1FA 1MNEA 4KRTA 4BI3A 1H3HA 4CC4B 1NJIC 2SRCA 3DKMA 1UUEA 3MEVA 2D1XA 3JB9G 3M4YA 4OP0A 2MWOA 5GAMe 4LD9K 4A4KA 5HY6A 4EMGA 5FWCA 2EGCA 4M7DG 1C6VX 3L2WA 2E6NA 5GMKl 4C0ZA 3TSZA 5IAYA 4C8QA 1VQ7T 1ZUUA 1G3WA 3JB9F 1BI0A 3NTKA 1G3YA 5GAN2 1T0HA 3CCSA 2RHIA 1LCKA 4E6RA 2OTLA 2HMAA 3L2UA 3VJPA 1GXIE 3GF5A 2LX9A 3E9GA 1IGUA 4FW1A 2EYXA 1SHFA 2EWNA 4M7DF 4A63B 3TVTA 1AEYA 3EFOA 5CKFA 4C5HA 3RNJA 1O75A 2KRMA 3CCMA 2E6ZA 1Q81R 1VQ7Q 2RHYA 4XU2A 4C92G 4ESRA 2HQHA 4CC2A 1GBRA 4J9EA 3I35A 3SB2A 2JT4A 1VQPA 2MOXA 3BW1A 1X6BA 1MUZA 5M9OA 3P8DA 2DE0X 1AT1B 4E47A 4IIMA 3FJPA 1VQ4A 2DETA 4EMKC 2LDMA 2DA9A 2R58A 2YRDA 3JCMh 4J9CA 4CC7A 5GANd 3FLGA 2E65A 3I55T 3MPUB 1ZA1B 1K9MC 1TG0A 3CCLT 1YWOA 1CKBA 4BB7A 1ARKA 3QYHB 1RABB 2PQWA 2K5IA 1LNXA 1VQ5T 1MV0B 3U23A 2RK1A 5GAMj 5FWBA 4CI0C 2QQRA 3LLRA 2O4XA 2DL5A 1PG5B 3I55Q 4XTUA 3CCLQ 2DVEA 2DF6A 3CCRA 3M0QA 4B9WA 2G6FX 1E6HA 2DBMA 2VASA 2JJ9A 1VQ5Q 1T3LA 3HTRA 3OYBA 3G4SA 5I2MA 2SEMA 4GLMA 4PK4A 3RKYA 3RERA 1M5Q1 2LQKA 2FL7A 3CC2T 1BIBA 4GY5A 2KT8A 2X51A 3F70A 1YJ9A 2FO0A 1XJWB 3A8OB 2LJ1A 2DEQA 4PJMA 4XTYA 5GAOp 4M7DB 2JUFA 4ANJA 2GTOA 4C8QE 3MO8A 2G3RA 1X43A 2NUZA 3CMAT 4M75D 3OYLA 2DAQA 2L8DA 1ZSZC 2BZ8A 3GOXA 4HKEA 2L89A 4XK8E 2RF0A 9ATCB 2HKQB 2X35A 4Z88A 3SFMA 5GAN5 2LCCA 2KR3A 1M1KR 1D0ZA 4RKUE 2QQAA 4C92B 4ZGEB 4N0AA 3CCQT 2DERA 3CMAQ 3UDCA 1AWOA 2JMAA 1CSKA 5LJ5d 5KCOA 4Z89A 3EH2A 4FIBA 2DIGA 2EJ9A 1ACMB 5AT1B 1WA7A 2C06A 3JB9D 2D0NA 3CCEA 1HJDA 2BZXA 2XDDA 2VC8A 2QI2A 3CCQQ 4J7IA 3QYGB 3CCVT 1FMVA 4M7DD 4M7AB 2JZ2A 4M75A 3CD6T 3E1SA 2D8JA 1HYOA 2RQTA 4ZNXA 2YLBA 5CKHA 4IUPA 3L2QA 2OX7A 1W6XA 1N27A 1RACB 4RCCA 1NPRA 4JLGA 4PFPA 1H3ZA 1H92A 2LMJA 2ZPHB 1UGQB 3CCVQ 1U1SA 2YUOA 3C12A 4IUTA 3CD6Q 2OTJT 5FRNA 2RK2A 1K9AA 3PVLA 1FX7A 2IVWA 2NUPB 5CR2A 3CCJQ 4M77C 1QCOA 1R77A 1WZOA 2KXCA 4KGXB 4OGCA 1NM7A 1GL5A 3OA6A 2LQNA 5GAN4 4Z02A 2FRYA 2KQWA 4HCKA 3OS5A 4M7DA 2DMOA 4M4ZA 2EVRA 2OTJQ 4PL6A 2KROA 1WI7A 5L23A 2K9GA 5KYWA 2EQMA 3FDRA 2KSSA 1WPYA 3Q1JA 3QXEB 3NTIA 3VS6A 2F5KA 1WDXA 2AKLA 2MCNA 3JSCA 2XDPA 2K79A 2FEIA 2QDYB 4E7KA 3OYNA 3M0SA 3BE3A 1VIFA 4X1VA 3P8BB 3CBMA 3M57A 2KK4A 4KT0E 2CP2A 3CEYA 1YCSB 5GJWB 2RHZA 5LJ3f 3I56Q 4PJOC 1U1TA 1YJNT 3X25B 5CVIA 1VQOA 2EW3A 4JJCA 2CH4A 2NWMA 4JUVA 3OW2S 4J9HA 3TEEA 3FC3A 3JCMW 3A1PA 1RUWA 1ZBXA 2HQEA 2PTKA 5KCHA 4EMKB 4HXJA 2XDBA 5DLOA 3E9FA 2FPEA 3G7ZA 2K5FA 3NTHA 2JMCA 1YJNQ 5LJ5f 3JCMd 2PUKB 2LT4A 1MHNA 1QVFP 1OI1A 3VV0A 4M75E 4M78G 1TXQA 2X4WA 3OSSC 2L3QA 3LWHA 2HD0A 2LC4A 1WXUA 4O5VA 2E5KA 3SD4A 1Q7YR 2K5LA 3L42A 2YT6A 2A3LA 4X34A 3VS2A 2EAYA 2HQXA 4Q5WA 2R5MA 1N8RR 3OYMA 3CCJA 4FT4A 4M78F 2RQVA 1QVGA 1G2BA 2HEQA 1M1KU 4MMKA 4GLKA 1GBQA 1KHIA 1MGQA 3NMZC 2CP5A 3KUFA 1SEMA 1KK7A 2PU9B 4ELYC 3CC4T 1M27C 1BCOA 2CT3A 3CMEA 4K11A 2CZ6B 2F5TX 2XG8D 4NL3A 3X28B 2EBPA 1OX9A 3VYGA 5GAOn 3S3MA 1PCXA 1YFNA 5GAOl 5FW9A 4KUDK 4XU0A 4FT2A 3C4SA 3BDLA 5LJ3j 4MDXA 1KIKA 1S72T 2L5QA 4M7DE 1UGRB 3GP8A 2P84A 3M0TA 1JJ2P 1PC0A 4A4GA 2A0FB 3CC4Q 3LX7A 2DXUA 2D9TA 2X4JA 3MP1A 3G1JA 5HKCA 3I56A 2RJCA 4DQ2A 2YXYA 1KQSA 1SSFA 3GBQA 2KI7A 3VUZA 4AFQC 1AWWA 5GAMd 2DTHA 4JRIA 4F7UE 2LQ8A 4MZMA 1S72Q 1VQ9T 1OEBA 2CH4W 2A37A 2QA4A 3GIBA 4P5NA 4BE1A 1M8MA 3TQ7P 4MMLA 4BD3A 2QEXQ 1YIJA 1IRXA 1M2OA 3S3OA 1M2VB 2E64A 4F04B 2LNHB 5GAN7 1VQKA 4OB2B 1N6AA 2MYSA 3PE0A 1UGPB 1YBYA 3EGXB 1VQ8A 1QLYA 2J05A 2RH2A 2ZPGB 2EYZA 2KT1A 5LJ3h 3ZEHA 3G6EA 1M3AA 2H3JA 2MK5A 2DJQA 3I5SA 1FXXA 3SWNA 2JXBA 1Q81C 2O88A 1OOTA 2L0AA 2RI2A 1U5SA 1GRIA 1LPLA 2QQ9A 1I1JA 2RHXA 1D09B 1RAEB 3CCST 1BKBA 2DBKA 4M78B 2LT1A 1KC8U 2RA2A 3MEUA 1VQLT 1SHGA 3JB9H 3E2UA 2MI6A 1RAAB 5J26A 2E70A 5FU6B 2O2OA 5LJ5h 2FZGB 4JJDA 4AG2C 2HSEB 2WACA 3PIPA 2WSCE 3WXMB 5GANg 5GMKm 1JO8A 1QVFA 2HNIA 2DRKA 1OU9A 1G3TA 4M77B 2K2MA 4ZN3A 1VQLQ 2V1RA 2MAMA 1Q86R 3MEAA 2OI3A 1U3OA 3CBOA 1YN8A 1VQMA 2LCSA 4E7IA 4J5YA 4XTXA 3GPLA 2RM4A 2AK5A 2DZ9A 3LH5A 4IURA 4X9CA 1VQ4T 3JCMV 2FPFA 1AHJB 1RL2A 4J9GA 2NYSA 1PM3A 1OZ3A 4PJNA 2GGRA 4M78D 1PNJA 3VS5A 2XIDA 3OMCA 3H6ZA 5CIUA 5I22A 1VQ6A 6AT1B 2EGEA 2LQWA 2QEXA 3L1AA 3VS0A 5FROA 3G71A 5J39A 4PJOB 4DBQA 1G83A 1YITA 2YDLA 2JTFA 1D0YA 1RLPC 2L3RA 5L8RE 5GAMf 1TS9A 1JXMA 4J83A 4JRKA 4R55A 3PMIA 1M3BA 2DL3A 4OMMA 2JN0A 3EGXA 3PVQA 4RG2A 4RG8A 2A08A 4E7LA 1HD3A 1I0CA 2DTIA 2C0IA 1S1NA 5GMKe 4DOVA 4OMNA 3EG9B 3QG1A 3NPFA 4DBHA 1AZGB 1TU0B 2LTOA 1M1KC 1E6GA 3CPFA 4QKUA 4ZTFA 4M78A 4J6WA 2DL8A 2J6FA 3OYHA 4DBRA 1K0SA 1RAFB 1SSHA 2CP3A 3VU3C 3VS3A 3PMTA 5LJ5g 1VYVA 1GCQA 3O8VA 4XTZA 2RJEA 1X6GA 4II1A 4E7SA 1O9SA 5A2QE 1YI2A 5KYXB 2Y4XA 1M30A 4BI4A 4C92F 1PRMC 3THKA 5DY9A 3KXTA 1K0XA 3X26B 5CKDA 2KXDA 3CQTA 5HCKA 4PJJA 3X20B 3HSBA 4M7AG 3SEMA 1TUGB 2BTTA 4HCZA 3ME9A 4WCIA 1XQHA 2IIMA 4RUGA 2RN8A 3QBYA 2JOYA 4QVZA 3CCET 2EJGA 2J6KA 1Y57A 3JV3A 3JAME 1FMWA 3VS1A 3H41A 2P0PA 3H9NA
chains in the Genus database with same CATH topology
1VYTA 1NEGA 2M51A 1TUCA 1PKSA 3TSWA 1H92A 2LMJA 1YP5A 1XOVA 2RNAA 2HBWA 2O9VA 2X3WD 2YUOA 1BBZA 1HSQA 1VYUA 1UTIA 3EG0A 4F16A 2F2XA 4HVUA 1K9AA 4RTXA 3PVLA 2C0OA 2K6DA 1ZUKA 4AFUC 1AZEA 4J9FA 4LN2A 2J6OA 3REAB 4FSSA 1N5ZA 2KXCA 4JZ3A 1QWFA 2KNBB 1NM7A 1Y0MA 1GL5A 1JEGA 2JS0A 2LQNA 2D8HA 2I0NA 2ECZA 4DEXA 2FRYA 4HCKA 4D8KA 2O31A 2F2WA 2DMOA 4M4ZA 2EVRA 2KROA 3M0UA 1WI7A 5L23A 3VS4A 2K9GA 1JQQA 1WXBA 5IHIA 3O5ZA 2VKNA 3VS7A 3VS6A 1UHFA 2K3BA 1BU1A 1A0NB 1V1CA 1WDXA 1QKXA 2AKLA 2EKHA 2MCNA 1AWXA 4LNPA 2RQUA 3EG3A 2K79A 2FEIA 2KYBA 4RTZA 4DEYA 5IXFA 3M0SA 1ABOA 4X1VA 3QWXX 2FG0A 1WIEA 3EG1A 2PZ1A 4CC3A 1YCSB 2EGAA 5GJWB 4OMQA 4ORZA 3NGPA 3R6NA 1PKTA 4LUDA 1QWEA 3I9QA 2GQIA 2EW3A 4JJCA 2J7IA 2CH4A 4RTVA 2DX1A 2NWMA 4J9HA 2BZYA 2W0ZA 2H8HA 1WLPB 1K76A 1OV3A 1PRLC 1RUWA 2KE9A 1IO6A 2JTEA 2PTKA 1H8KA 4JPBW 5IXBA 4HXJA 4OMOA 1J3TA 2FPEA 4J9IA 1K1ZA 2XMFA 3UA7A 5GJVB 4LUEA 2JMCA 1Z9ZA 1K4US 2ENMA 1UG1A 1GCPA 1JU5C 1RLQC 2ROTA 2LZ6B 3EG2A 2L3QA 3UATA 3ZL7C 2ABLA 1BB9A 1WXUA 2FRWA 2F2VA 2CREA 2E5KA 2YT6A 3VS2A 2RQWA 3A98A 2DILA 4OMLA 4F14A 2LJ0A 2YUQA 2RQVA 2DVJA 2EQIA 2KRSA 2PNIA 1G2BA 2HEQA 2CUBA 4D8DA 2ROLA 3I5RA 2OJ2A 1AD5A 1GBQA 4J9DA 5I11A 1PHTA 3NMZC 2KEAA 1UJYA 2ED1A 4HVWA 1SEMA 1U06A 3H0FA 4IIOA 2YUNA 1M27C 1UFFA 2CT3A 2LX7A 4K11A 2CDTA 3VRYA 2DYBA 2EBPA 1KJWA 5EC7A 1X2KA 1YNZA 2VWFA 5FW9A 1NYGA 4Y92A 2DL7A 1NEBA 1KIKA 3EGUA 4F17A 1ZX6A 3QWYA 2GNCA 4Z8AA 3M0TA 1M3CA 1UE9A 1I07A 1UECA 1ABQA 2L3SA 5IHKA 2DNUA 4LE9A 1SRMA 3C0CA 2CSQA 4OMPA 2JM9A 2GTJA 1X27A 1TUDA 3GBQA 2L3PA 4KRTA 2W10A 2X3XD 4AFQC 1QKWA 1AWWA 1B07A 3EHQA 1H3HA 4CC4B 2SRCA 1OEBA 1UUEA 2CH4W 2D1XA 2A37A 2RQRA 3KFVA 3M0RA 4R0KA 3VRZA 1EFNA 1M8MA 4AG1C 3NHNA 5FWCA 2AZSA 1SPKA 2EGCA 3H0HA 3UA6A 3TSZA 1PWTA 1ZUUA 2VVKA 3H0IA 2LNHB 1UHCA 1T0HA 2CT4A 1WXTA 2KGTA 3PE0A 1LCKA 4E6RA 2RMOA 1QLYA 2J05A 2EYZA 2KT1A 1M3AA 2DLPA 1NYFA 1RI9A 2ESWA 2EYXA 1SHFA 2DJQA 3I5SA 4A63B 2JXBA 2HDAA 3TVTA 2O88A 1OOTA 1AEYA 2L0AA 1ZUYA 2QDLA 3RNJA 2KRMA 2JM8A 1U5SA 1GRIA 1I1JA 4ESRA 2JW4A 4CC2A 1GBRA 2DBKA 4J9EA 3I35A 2JT4A 2O9SA 1YWPA 2MOXA 1SHGA 1MUZA 1X6BA 1ZSGA 1AVZC 3REBB 4JJBA 2O2OA 1FMKA 1WX6A 1OPKA 1T3SA 1T0JA 1AWJA 4JJDA 4AG2C 2DE0X 4HVVA 1X2QA 1NLPC 2MIOA 4IIMA 3IQLA 1JO8A 2DA9A 4J9CA 2DRKA 4CC7A 1VA7A 1NG2A 2LJ3A 2K2MA 1TG0A 4QT7A 2V1RA 2HCKA 2OI3A 2P4RA 1KSWA 1YWOA 1U3OA 1CKBA 1E7OA 1YN8A 3UF4A 2LCSA 1ARKA 2AK5A 2YSQA 3LH5A 1GFDA 1MV0B 2CSIA 3U23A 5FWBA 2ED0A 3SHWA 2FPFA 5ECAA 2V1QA 2DL5A 4J9GA 1GFCA 1GCQC 2GBQA 1JXOA 2DF6A 1W70A 2EPDA 3M0QA 2GGRA 2B86A 2G6FX 1PNJA 3VS5A 1E6HA 2DBMA 2EYYA 1T3LA 5I22A 2LP5A 2K7AA 3RBBB 2EGEA 2LQWA 3VS0A 2SEMA 2A36A 4GLMA 2JS2A 1G83A 3M0PA 2L2PA 2EYWA 2YDLA 2KT8A 4RTUA 1RLPC 4EIKA 4AFZC 4JZ4A 2FO0A 1UGVA 2FPDA 1BK2A 1JXMA 2KRNA 2LJ1A 1M3BA 2DL3A 4OMMA 2AZVA 2GTOA 1X43A 3PVQA 1CKAA 1ZLMA 2NUZA 1WFWA 2A08A 1HD3A 2CUDA 1I0CA 2C0IA 1W1FA 2BZ8A 1S1NA 5IH2A 1X69A 1OPLA 2KYMA 4OMNA 2OAWA 2RF0A 3NPFA 4RTWA 1QCFA 1MV3A 2DM1A 1AZGB 2DL4A 2HSPA 4Z88A 3ULRB 1E6GA 3FJ5A 2DL8A 2J6FA 2KR3A 1KFZA 1K0SA 1SSHA 3VS3A 2AKKA 1SRLA 1AWOA 4RTYA 2JMAA 1VYVA 1GCQA 1CSKA 4Z89A 2YUPA 1X6GA 4J9BA 1WA7A 2C0TA 1UDLA 2D0NA 1M30A 4GBQA 1PRMC 3THKA 1AOJA 1HJDA 1ZBJA 2BZXA 1K0XA 3EHRA 4AFSC 1NLOC 1FYNA 2KXDA 3CQTA 5HCKA 1Z9QA 2DRMA 1WYXA 2D8JA 3SEMA 2BTTA 2J06A 5IHNA 1UJ0A 2RQTA 4WCIA 4RUGA 2IIMA 2M0YA 2RN8A 2RPNA 4RTTA 4ZNXA 2A28A 1B3QA 2KBTA 2J6KA 1Y57A 3JV3A 3VS1A 1W6XA 3H41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYT A;  1NEG A;  2M51 A;  1TUC A;  1PKS A;  3TSW A;  1H92 A;  2LMJ A;  1YP5 A;  1XOV A;  2RNA A;  2HBW A;  2O9V A;  2X3W D;  2YUO A;  1BBZ A;  1HSQ A;  1VYU A;  1UTI A;  3EG0 A;  4F16 A;  2F2X A;  4HVU A;  1K9A A;  4RTX A;  3PVL A;  2C0O A;  2K6D A;  1ZUK A;  4AFU C;  1AZE A;  4J9F A;  4LN2 A;  2J6O A;  3REA B;  4FSS A;  1N5Z A;  2KXC A;  4JZ3 A;  1QWF A;  2KNB B;  1NM7 A;  1Y0M A;  1GL5 A;  1JEG A;  2JS0 A;  2LQN A;  2D8H A;  2I0N A;  2ECZ A;  4DEX A;  2FRY A;  4HCK A;  4D8K A;  2O31 A;  2F2W A;  2DMO A;  4M4Z A;  2EVR A;  2KRO A;  3M0U A;  1WI7 A;  5L23 A;  3VS4 A;  2K9G A;  1JQQ A;  1WXB A;  5IHI A;  3O5Z A;  2VKN A;  3VS7 A;  3VS6 A;  1UHF A;  2K3B A;  1BU1 A;  1A0N B;  1V1C A;  1WDX A;  1QKX A;  2AKL A;  2EKH A;  2MCN A;  1AWX A;  4LNP A;  2RQU A;  3EG3 A;  2K79 A;  2FEI A;  2KYB A;  4RTZ A;  4DEY A;  5IXF A;  3M0S A;  1ABO A;  4X1V A;  3QWX X;  2FG0 A;  1WIE A;  3EG1 A;  2PZ1 A;  4CC3 A;  1YCS B;  2EGA A;  5GJW B;  4OMQ A;  4ORZ A;  3NGP A;  3R6N A;  1PKT A;  4LUD A;  1QWE A;  3I9Q A;  2GQI A;  2EW3 A;  4JJC A;  2J7I A;  2CH4 A;  4RTV A;  2DX1 A;  2NWM A;  4J9H A;  2BZY A;  2W0Z A;  2H8H A;  1WLP B;  1K76 A;  1OV3 A;  1PRL C;  1RUW A;  2KE9 A;  1IO6 A;  2JTE A;  2PTK A;  1H8K A;  4JPB W;  5IXB A;  4HXJ A;  4OMO A;  1J3T A;  2FPE A;  4J9I A;  1K1Z A;  2XMF A;  3UA7 A;  5GJV B;  4LUE A;  2JMC A;  1Z9Z A;  1K4U S;  2ENM A;  1UG1 A;  1GCP A;  1JU5 C;  1RLQ C;  2ROT A;  2LZ6 B;  3EG2 A;  2L3Q A;  3UAT A;  3ZL7 C;  2ABL A;  1BB9 A;  1WXU A;  2FRW A;  2F2V A;  2CRE A;  2E5K A;  2YT6 A;  3VS2 A;  2RQW A;  3A98 A;  2DIL A;  4OML A;  4F14 A;  2LJ0 A;  2YUQ A;  2RQV A;  2DVJ A;  2EQI A;  2KRS A;  2PNI A;  1G2B A;  2HEQ A;  2CUB A;  4D8D A;  2ROL A;  3I5R A;  2OJ2 A;  1AD5 A;  1GBQ A;  4J9D A;  5I11 A;  1PHT A;  3NMZ C;  2KEA A;  1UJY A;  2ED1 A;  4HVW A;  1SEM A;  1U06 A;  3H0F A;  4IIO A;  2YUN A;  1M27 C;  1UFF A;  2CT3 A;  2LX7 A;  4K11 A;  2CDT A;  3VRY A;  2DYB A;  2EBP A;  1KJW A;  5EC7 A;  1X2K A;  1YNZ A;  2VWF A;  5FW9 A;  1NYG A;  4Y92 A;  2DL7 A;  1NEB A;  1KIK A;  3EGU A;  4F17 A;  1ZX6 A;  3QWY A;  2GNC A;  4Z8A A;  3M0T A;  1M3C A;  1UE9 A;  1I07 A;  1UEC A;  1ABQ A;  2L3S A;  5IHK A;  2DNU A;  4LE9 A;  1SRM A;  3C0C A;  2CSQ A;  4OMP A;  2JM9 A;  2GTJ A;  1X27 A;  1TUD A;  3GBQ A;  2L3P A;  4KRT A;  2W10 A;  2X3X D;  4AFQ C;  1QKW A;  1AWW A;  1B07 A;  3EHQ A;  1H3H A;  4CC4 B;  2SRC A;  1OEB A;  1UUE A;  2CH4 W;  2D1X A;  2A37 A;  2RQR A;  3KFV A;  3M0R A;  4R0K A;  3VRZ A;  1EFN A;  1M8M A;  4AG1 C;  3NHN A;  5FWC A;  2AZS A;  1SPK A;  2EGC A;  3H0H A;  3UA6 A;  3TSZ A;  1PWT A;  1ZUU A;  2VVK A;  3H0I A;  2LNH B;  1UHC A;  1T0H A;  2CT4 A;  1WXT A;  2KGT A;  3PE0 A;  1LCK A;  4E6R A;  2RMO A;  1QLY A;  2J05 A;  2EYZ A;  2KT1 A;  1M3A A;  2DLP A;  1NYF A;  1RI9 A;  2ESW A;  2EYX A;  1SHF A;  2DJQ A;  3I5S A;  4A63 B;  2JXB A;  2HDA A;  3TVT A;  2O88 A;  1OOT A;  1AEY A;  2L0A A;  1ZUY A;  2QDL A;  3RNJ A;  2KRM A;  2JM8 A;  1U5S A;  1GRI A;  1I1J A;  4ESR A;  2JW4 A;  4CC2 A;  1GBR A;  2DBK A;  4J9E A;  3I35 A;  2JT4 A;  2O9S A;  1YWP A;  2MOX A;  1SHG A;  1MUZ A;  1X6B A;  1ZSG A;  1AVZ C;  3REB B;  4JJB A;  2O2O A;  1FMK A;  1WX6 A;  1OPK A;  1T3S A;  1T0J A;  1AWJ A;  4JJD A;  4AG2 C;  2DE0 X;  4HVV A;  1X2Q A;  1NLP C;  2MIO A;  4IIM A;  3IQL A;  1JO8 A;  2DA9 A;  4J9C A;  2DRK A;  4CC7 A;  1VA7 A;  1NG2 A;  2LJ3 A;  2K2M A;  1TG0 A;  4QT7 A;  2V1R A;  2HCK A;  2OI3 A;  2P4R A;  1KSW A;  1YWO A;  1U3O A;  1CKB A;  1E7O A;  1YN8 A;  3UF4 A;  2LCS A;  1ARK A;  2AK5 A;  2YSQ A;  3LH5 A;  1GFD A;  1MV0 B;  2CSI A;  3U23 A;  5FWB A;  2ED0 A;  3SHW A;  2FPF A;  5ECA A;  2V1Q A;  2DL5 A;  4J9G A;  1GFC A;  1GCQ C;  2GBQ A;  1JXO A;  2DF6 A;  1W70 A;  2EPD A;  3M0Q A;  2GGR A;  2B86 A;  2G6F X;  1PNJ A;  3VS5 A;  1E6H A;  2DBM A;  2EYY A;  1T3L A;  5I22 A;  2LP5 A;  2K7A A;  3RBB B;  2EGE A;  2LQW A;  3VS0 A;  2SEM A;  2A36 A;  4GLM A;  2JS2 A;  1G83 A;  3M0P A;  2L2P A;  2EYW A;  2YDL A;  2KT8 A;  4RTU A;  1RLP C;  4EIK A;  4AFZ C;  4JZ4 A;  2FO0 A;  1UGV A;  2FPD A;  1BK2 A;  1JXM A;  2KRN A;  2LJ1 A;  1M3B A;  2DL3 A;  4OMM A;  2AZV A;  2GTO A;  1X43 A;  3PVQ A;  1CKA A;  1ZLM A;  2NUZ A;  1WFW A;  2A08 A;  1HD3 A;  2CUD A;  1I0C A;  2C0I A;  1W1F A;  2BZ8 A;  1S1N A;  5IH2 A;  1X69 A;  1OPL A;  2KYM A;  4OMN A;  2OAW A;  2RF0 A;  3NPF A;  4RTW A;  1QCF A;  1MV3 A;  2DM1 A;  1AZG B;  2DL4 A;  2HSP A;  4Z88 A;  3ULR B;  1E6G A;  3FJ5 A;  2DL8 A;  2J6F A;  2KR3 A;  1KFZ A;  1K0S A;  1SSH A;  3VS3 A;  2AKK A;  1SRL A;  1AWO A;  4RTY A;  2JMA A;  1VYV A;  1GCQ A;  1CSK A;  4Z89 A;  2YUP A;  1X6G A;  4J9B A;  1WA7 A;  2C0T A;  1UDL A;  2D0N A;  1M30 A;  4GBQ A;  1PRM C;  3THK A;  1AOJ A;  1HJD A;  1ZBJ A;  2BZX A;  1K0X A;  3EHR A;  4AFS C;  1NLO C;  1FYN A;  2KXD A;  3CQT A;  5HCK A;  1Z9Q A;  2DRM A;  1WYX A;  2D8J A;  3SEM A;  2BTT A;  2J06 A;  5IHN A;  1UJ0 A;  2RQT A;  4WCI A;  4RUG A;  2IIM A;  2M0Y A;  2RN8 A;  2RPN A;  4RTT A;  4ZNX A;  2A28 A;  1B3Q A;  2KBT A;  2J6K A;  1Y57 A;  3JV3 A;  3VS1 A;  1W6X A;  3H41 A; 
#chains in the Genus database with same CATH topology
 1TUC A;  3HRU A;  2QAS A;  1Y96 A;  4M7A F;  3FEO A;  1XOV A;  2HAX A;  3QO3 A;  1TTH B;  1DJ7 B;  2CZ0 B;  3EG0 A;  1UTI A;  1OU8 A;  4F16 A;  2F2X A;  4HVU A;  2R5A A;  1I8F A;  1ZA2 B;  2C0O A;  4QQG A;  2DXT A;  3MHX A;  4AT1 B;  4J9F A;  5AYF A;  3JCM Q;  3REA B;  3OYI A;  4FSS A;  3V8J A;  3CCU T;  3INZ A;  4JZ3 A;  1Y0M A;  3AT1 B;  2BIV A;  2EIF A;  4OB1 B;  2YLC A;  1JEG A;  2DIQ A;  1WQW A;  4BE2 A;  4LXC A;  2QGF B;  4DEX A;  3RR6 A;  2O31 A;  3M59 A;  2F2W A;  2QQB A;  3OB9 A;  4R56 A;  1Q86 U;  3EGD B;  1WXB A;  3O5Z A;  2DJZ A;  1LVK A;  3MP8 A;  3CCU Q;  2VKN A;  3EFS A;  3OY9 A;  1EZZ B;  2DPP B;  3CPW S;  3JCM b;  2CS7 A;  1G8X A;  1VQ7 A;  1H64 1;  2KYB A;  5D6W A;  5LJ3 d;  5GAM h;  3CC2 Q;  1RAG B;  1QP3 A;  2CP7 A;  2B8A A;  1WIE A;  3V7S A;  5DLQ E;  3EG1 A;  4CC3 A;  3RKW A;  1WHL A;  4OMQ A;  3BY7 A;  4ORZ A;  3R6N A;  3HKS A;  1QWE A;  1YHQ T;  1YJW T;  2GQI A;  4HCC A;  4RTV A;  4KGZ B;  2RJD A;  3A8M B;  3OBW A;  4KBM B;  1OV3 A;  2DYI A;  5KYX A;  2HKN A;  3ER0 A;  5IXB A;  3HP9 A;  3QHS A;  5D7U A;  4J9I A;  1K1Z A;  3SDZ A;  3JCM g;  1Z9Z A;  2KAF A;  1YHQ Q;  1K4U S;  4C5G A;  1YJW Q;  5GAN 3;  1UG1 A;  3M56 A;  1Q7Y C;  2E4H A;  4JS4 A;  2ROT A;  2E41 A;  1QQJ A;  2LZ6 B;  3UAT A;  3I55 A;  1QVP A;  2ABL A;  4MZT A;  1N8R C;  3CCL A;  5I2S A;  1B7T A;  4Y91 A;  1SF9 A;  4CRI A;  3OMG A;  4OML A;  3CXC S;  3CC7 T;  1VQ5 A;  2BE7 D;  4C8Q C;  3LGF A;  2EQI A;  2KRS A;  3J7A F;  1VQN T;  2YHT A;  2ROL A;  3I5R A;  4J9D A;  2ED1 A;  4HVW A;  4C92 D;  3OW2 P;  4IIO A;  4XU1 A;  2DEU A;  3PTA A;  2LX7 A;  5GAN e;  2HZY A;  1WJQ A;  2CDT A;  3VRY A;  2DYB A;  2BKD N;  1YNZ A;  2VWF A;  1NYG A;  2DZC A;  4Y92 A;  1NEB A;  4AMC A;  3EH1 A;  4C0D C;  2FYK A;  1VQN Q;  4JJN K;  3AHU A;  4F17 A;  5IT9 E;  1BYM A;  1Y7X A;  3QWY A;  4QQ6 A;  4Z8A A;  2Y90 A;  2RHU A;  4PKC C;  2DKG A;  2QK0 A;  4LE9 A;  1K73 R;  4M7A D;  1UEB A;  2V8K A;  5KE3 A;  2GQV A;  1V76 A;  1X27 A;  5GAM g;  1MMG A;  2L3P A;  3QII A;  4QQD A;  2W10 A;  2X3X D;  4J7F A;  1QKW A;  5GAN 8;  3EHQ A;  4VUB A;  1KC8 R;  2F69 A;  3CMA A;  5FU7 C;  4FYV B;  4WTO B;  1OZ2 A;  2RQR A;  3M0R A;  2Z0W A;  4B6M A;  1QVG S;  2EYQ A;  4FSX A;  3JCM J;  3L2R A;  4LDV A;  4C92 A;  1HXD A;  3MCA B;  3GNF B;  1EFN A;  4AG1 C;  1SPK A;  3H0H A;  4FU6 A;  2COZ A;  5GAO m;  4NOY A;  1UHC A;  1M8V A;  3CCQ A;  2CT4 A;  1WXT A;  5J3B A;  2KGT A;  2V8I A;  1K8A R;  2DLP A;  2EQK A;  2GFU A;  1OUL A;  4LD6 A;  2VGM A;  1D0X A;  3V8L A;  4OGE A;  2FZK B;  2QAZ A;  1YIJ T;  2QDL A;  2JM8 A;  5KYU B;  4M7A A;  2EQU A;  1M1G A;  2AIR B;  1VQ8 T;  1KD1 U;  2O9S A;  3CCV A;  1MMN A;  1ZSG A;  4KH1 B;  5CK9 A;  1Y71 A;  4PLI A;  1KQS S;  3CD6 A;  1AVZ C;  3REB B;  3JB9 J;  4JJB A;  1WX6 A;  4WF2 A;  1KG1 A;  1T0J A;  1NJI U;  1AWJ A;  2K57 A;  5CKB A;  1KQ2 A;  4HVV A;  3QDF A;  1W2B S;  2RI3 A;  1BCM A;  1X2Q A;  2MIO A;  3OYF A;  3FRN A;  1MND A;  1Q86 C;  3ASK A;  4HA8 A;  2ZPF B;  3OYJ A;  3OYD A;  1VA7 A;  2NUP A;  4M77 G;  5KYY B;  1X6O A;  2P4R A;  1E7O A;  3UF4 A;  2OTJ A;  4IKF A;  3OYG A;  2MMP A;  4EPC A;  2ED0 A;  3SHW A;  4N0A C;  1IB8 A;  4M77 F;  1VIE A;  3OYK A;  2V1Q A;  5CKE A;  2RB6 A;  1TOV A;  4FL6 A;  5D6X A;  4EDU A;  1JXO A;  4ELZ C;  2EPD A;  3OW2 A;  2MPX C;  2QTX A;  2YRC A;  3CBP A;  1ZSZ B;  1C0M A;  2F1L A;  3HL8 A;  4OB0 B;  5CQY A;  3DB4 A;  2PVG B;  3PFS A;  4BDZ A;  3JCM c;  3M0P A;  4PJO G;  2L2P A;  4M75 C;  2EYW A;  4J8O A;  4RTU A;  4EIK A;  4C92 E;  4JZ4 A;  1UGV A;  2FPD A;  1BK2 A;  3C95 A;  2D0Q B;  2JNG A;  5IN1 A;  1K9M U;  2P4T A;  1SG5 A;  2M0O A;  3C94 A;  4PJO F;  1CKA A;  2XHC A;  1Q82 R;  1ZLM A;  1YJN A;  3OBY A;  1WFW A;  3HHT B;  4EMK A;  4QW2 A;  1MMA A;  1BI2 A;  1YCY A;  4C5I A;  4DBF A;  2GCX A;  1VQ9 Q;  1X69 A;  1OPL A;  2EQJ A;  2H3E B;  2KYM A;  2XK0 A;  4XTW A;  1MV3 A;  2DM1 A;  4C0F A;  4C5E A;  1XTD A;  2HSP A;  2ZAE A;  3BDU A;  3R6O A;  3ULR B;  1KQ1 A;  1WNL A;  4RMO A;  4M7A E;  1KFZ A;  1K73 U;  2DK3 A;  1SKU B;  2KVQ G;  3NFC A;  1OQK A;  3VKI A;  4PFZ A;  2E12 A;  2AKK A;  1G3S A;  2OTL T;  4RTY A;  4M7D C;  4C8Q B;  4LDU A;  2YUP A;  2RJF A;  1N9S A;  4BI8 B;  2CZ1 B;  2FVU A;  4J9B A;  3S6W A;  3MEW A;  2C0T A;  8ATC B;  3CCM T;  4GBQ A;  2E3I A;  1AOJ A;  7AT1 B;  4DA4 A;  4FYW B;  4UC4 A;  3HFO A;  5GAO q;  1TH7 A;  3RMS A;  3EHR A;  3EFO B;  3CCS Q;  1VQP T;  1WHK A;  1Z9Q A;  2XIC A;  3PGG A;  2OTL Q;  1WYX A;  4EMH A;  3UWN A;  2ZPB B;  3J81 E;  3JB9 I;  2J06 A;  5IHN A;  2M9U A;  3OS1 A;  2LNV A;  1K8A U;  4C0D B;  2YWW A;  3CC4 A;  2KBT A;  1B3Q A;  3M5A A;  1QCN A;  3WVD B;  3LWI A;  2XKO C;  3CCM Q;  5GAN 6;  1NEG A;  2M51 A;  1LJO A;  2CP0 A;  2M02 A;  1PKS A;  3TSW A;  3FIF A;  1YP5 A;  2WSE E;  2RNA A;  1VQP Q;  1ZSZ A;  1BI3 A;  1S72 A;  5KE2 A;  3DLL A;  1BBZ A;  1HSQ A;  1VYU A;  3VYH B;  5KH6 A;  3QJ6 A;  1WHG A;  4XAX B;  3M54 A;  1B34 B;  1PD1 A;  5CAI A;  1FWZ A;  1ZUK A;  2PVD B;  1M9S A;  1N5Z A;  1WHM A;  3QJY A;  3S3N A;  1VQ4 Q;  2KNB B;  2I2L A;  2JS0 A;  4E7Z A;  1X75 C;  2D8H A;  2OAU A;  5CCA A;  2ECZ A;  3MP6 A;  4HT8 A;  1VQ9 A;  3HFN A;  3CCR T;  3DB3 A;  1JJ2 A;  2BE9 B;  3RMQ A;  3L2V A;  1NE8 A;  2VB6 A;  2COW A;  3UT1 A;  4M77 D;  1M2V A;  2ZPE B;  2DXC A;  2LCL A;  3G4S T;  2VYT A;  3VS7 A;  1R8O B;  1BU1 A;  3ZFJ A;  1A0N B;  2EKH A;  1QKX A;  1AWX A;  3QZ5 B;  5LJ3 g;  2ZZD A;  3M53 A;  4J6Y A;  2CKK A;  4DEY A;  5IXF A;  1ABO A;  3CCR Q;  2MF2 A;  1YJ9 T;  2FG0 A;  4O6J A;  1UGS B;  2EGA A;  4ATO A;  3NGP A;  1PKT A;  4LUD A;  3G4S Q;  2NUT B;  3M9Q A;  3I9Q A;  2X9H A;  1PSF A;  2ZGW A;  3X24 B;  1QW1 A;  1I81 A;  2DX1 A;  4FCY A;  2W0Z A;  2H8H A;  4RCB A;  1K76 A;  3QDR B;  3A8G B;  1M90 R;  2KE9 A;  4E2F B;  1VQL A;  2RO0 A;  2JTE A;  4A54 A;  1YJ9 Q;  1H8K A;  3M55 A;  4PJO D;  1PSE A;  3MKD A;  3E19 A;  4F7U G;  2QYZ A;  3UA7 A;  4M77 A;  5GJV B;  3JCM P;  1R0B G;  4C0G A;  2KY9 A;  1GCP A;  1JU5 C;  1Q82 U;  4L59 A;  3EG2 A;  4QVD A;  3ZL7 C;  2XI9 A;  2FRW A;  2GF7 A;  4F7U F;  3QSU A;  2CRE A;  4OVA A;  3CPW P;  3HRS A;  1IHW A;  4LDY A;  3DLM A;  3A8L B;  1VUB A;  4BAC A;  2LJ0 A;  2YUQ A;  4IUU A;  4FYY B;  3OYE A;  2PNI A;  2XU8 A;  2CUB A;  1B34 A;  2R57 A;  4HT9 A;  5I11 A;  1PHT A;  3JCM X;  1I4K 1;  2M16 A;  2O01 E;  3H0F A;  5GMK j;  4L5G A;  2YUN A;  3SWN C;  3M58 A;  1UFF A;  4M75 B;  4PJO A;  3CCE Q;  1KJW A;  2P0K A;  1UB4 A;  5FLX E;  1IZ6 A;  4BY6 C;  4FW2 A;  3RKX A;  2V26 A;  2DL7 A;  4OF1 A;  2GNC A;  3V7C A;  3OS2 A;  1UE9 A;  1I07 A;  1UEC A;  1K73 C;  2LRQ A;  1ABQ A;  2L3S A;  1WHJ A;  3OYY A;  1IGQ A;  3OS0 A;  1SRM A;  2KMT A;  3V7R A;  2CSQ A;  3ZBD A;  2BUD A;  2JM9 A;  1KC8 C;  1RAD B;  2AHJ B;  1TUD A;  2DD4 A;  1QP2 A;  3EG9 A;  2E3H A;  1KD1 R;  1D1A A;  1B07 A;  1VOM A;  1C1A A;  2JVV A;  3CXC P;  4HCB A;  4ZGD B;  4KH0 B;  2VGN A;  1X01 A;  2HBP A;  2NUT A;  1NJI R;  4ME7 A;  3KFV A;  3LW5 E;  4R0K A;  4KGV B;  3HRT A;  4ZGJ B;  4M78 E;  3L2Z A;  3VRZ A;  4FM4 B;  3NHN A;  5KYN A;  1I5L A;  2AZS A;  3BFM A;  3UA6 A;  5GMK h;  1K8A C;  1PWT A;  3VUB A;  5KYW B;  2V8J A;  4E7H A;  2VVK A;  3H0I A;  3OYC A;  1D1C A;  5C6S A;  1R0C B;  2RMO A;  2Y4Y A;  1NYF A;  1RI9 A;  2ESW A;  5FRM A;  3A5Z B;  4PNO A;  3FB9 A;  4F7U B;  2EKO A;  4M77 E;  2HDA A;  3M4G A;  8AT1 B;  1ZUY A;  2DO3 A;  3PT9 A;  1VQO T;  1NZ9 A;  3GNG A;  2JW4 A;  3MJX A;  1YWP A;  2RD1 A;  2IPO B;  5A0L A;  2K4Y A;  3QPH A;  1FMK A;  1OPK A;  1T3S A;  4LDW A;  1KHC A;  1VQO Q;  1WJS A;  1WHH A;  1NLP C;  2PUO B;  1QVG P;  3IQL A;  2VXE A;  2E1H A;  1WQ7 A;  1NG2 A;  3URG A;  2LJ3 A;  4B9X A;  2QTV A;  4BUG A;  4BE0 A;  1RI0 A;  4QT7 A;  2K3X A;  2HCK A;  1KSW A;  3CPW A;  2WSF E;  1M90 U;  1K9M R;  5GAN f;  4PJO E;  2JTM A;  4LDX A;  4M78 C;  3CCJ T;  2YSQ A;  3HPW A;  5HK3 A;  1GFD A;  1PD0 A;  2CSI A;  3EAE A;  3V8K A;  5D6Y A;  3CC7 Q;  3CCU A;  4N4H A;  5FU6 C;  1EIF A;  4XQ3 A;  5ECA A;  3J80 E;  1Q81 U;  1GFC A;  3EGD A;  2VUB A;  1GCQ C;  1JRI A;  3CC2 A;  2GBQ A;  1W70 A;  2B86 A;  3CME T;  2AT1 B;  1RAI B;  1NBE B;  4D6W A;  2EYY A;  4JDS A;  1U8R A;  1KQS P;  2LP5 A;  2K7A A;  3RBB B;  1OYX A;  1MMD A;  4XU3 A;  2A36 A;  2JS2 A;  1W2B P;  1Q95 G;  4JRP A;  2PVO B;  1D3B B;  3PIO A;  1Y07 A;  3CME Q;  4AFZ C;  1M4Z A;  3I56 T;  1IHV A;  2KRN A;  1Q82 C;  3LGL A;  4PLL A;  2AZV A;  4JS5 A;  5CQX A;  2EJF A;  2X4Y A;  1YHQ A;  1YJW A;  4IUQ A;  2CUD A;  4F7U A;  5IH2 A;  1W1F A;  3CXC A;  2QA4 T;  3TCJ A;  2M1H A;  2OAW A;  4RTW A;  1QCF A;  4E7J A;  2E5Q A;  4OB3 B;  2DL4 A;  3D7S B;  3FJ5 A;  5LJ3 e;  3OYA A;  1EX4 A;  4FYX B;  5A0G A;  5GAN j;  1ZQ1 A;  4PFO A;  1VQK T;  1JB0 E;  1SRL A;  3WVE B;  3TRE A;  3RES A;  2QA4 Q;  1F1B B;  3G6E T;  4A4F A;  4C8Q G;  5I21 A;  4JRQ A;  3TU4 K;  2QG9 B;  1UDL A;  3JRZ A;  2NLU A;  1WGS A;  1YIJ Q;  2CP6 A;  4J6X A;  1ZBJ A;  3CC7 A;  5LJ5 e;  3SWN B;  4AFS C;  1NLO C;  1VQK Q;  1FYN A;  1D1B A;  4C8Q F;  1VQ8 Q;  3RDV A;  1VQN A;  2DRM A;  3EFR A;  2ATC B;  3G6E Q;  3LYI A;  4BY6 B;  1UJ0 A;  2M0Y A;  2VXF A;  2RPN A;  4RTT A;  1JBM A;  4N4I A;  2A28 A;  3T9N A;  1TSF A;  1VYT A;  4XTV A;  2EFI A;  4PJL A;  3LH0 A;  5GMK i;  2HBW A;  2O9V A;  2X3W D;  1WJR A;  1IRE B;  4V2S A;  3KBG A;  5GAN h;  2CZ7 B;  1P92 A;  1VQM T;  1QMC A;  2ZPI B;  4RTX A;  4A4H A;  1NPP A;  2K6D A;  2DTO A;  4AFU C;  1AZE A;  4LN2 A;  3RUX A;  2J6O A;  4OMF B;  5HK0 A;  3UPU A;  2HL3 A;  1QWF A;  1N9R A;  5C0M A;  1D3B A;  2XD0 A;  5A0D A;  1G5V A;  2I0N A;  4DOW A;  4ZTJ A;  4D8K A;  4NS5 A;  1VQM Q;  3OQ5 A;  3MET A;  4KUI A;  3M0U A;  3VS4 A;  2GFA A;  4A53 A;  1QVF S;  1JQQ A;  1VQ6 T;  5IHI A;  2QEX T;  1UHF A;  2K3B A;  2FHD A;  1LOJ A;  1V1C A;  3G71 T;  4BDY A;  1YIT T;  4LNP A;  2RQU A;  3EG3 A;  5EG2 A;  1W2B A;  5LJ5 j;  1OX8 A;  1IXD A;  2FZC B;  4X9D A;  4RTZ A;  1W4S A;  3P8H A;  2COY A;  3QWX X;  2LVM A;  5KYU A;  2PZ1 A;  2QXF A;  1I5O B;  3QKJ A;  1VQ6 Q;  4NL2 A;  2CGH A;  1BIA A;  3G71 Q;  2J7I A;  1YIT Q;  1M90 C;  2BZY A;  1WLP B;  2MWP A;  1PRL C;  2IG0 A;  2X4X A;  1IO6 A;  1XNI A;  4JPB W;  2CYZ B;  2A7Y A;  2DD5 A;  4OMO A;  2DFU A;  1J3T A;  2XMF A;  4YTL A;  2FB7 A;  2HL5 C;  2P0Q A;  4L6V 5;  4LUE A;  4MZP A;  5LL6 S;  5KYY A;  1JJ2 S;  2ENM A;  3QZ9 B;  1RLQ C;  1BB9 A;  2F2V A;  3H8Z A;  3PNW C;  3JCM f;  1HK9 A;  1YI2 T;  3JCM e;  4C92 C;  2K2V A;  2RQW A;  4N4G A;  3A98 A;  1RAH B;  2DIL A;  4F14 A;  3GLX A;  4KUL A;  2DVJ A;  4IUV A;  4D8D A;  1ZHI A;  2OJ2 A;  4MDW A;  1AD5 A;  2K3Y A;  5GAO r;  3OSV A;  4Y28 E;  2E10 A;  2KEA A;  1UJY A;  1U06 A;  1YI2 Q;  5FU7 B;  2D6F A;  2QGG A;  4ZN1 A;  4M75 G;  5EC7 A;  4C8Q D;  2QQS A;  4A4E A;  3QUI A;  1X2K A;  4M7A C;  4TVR A;  2YRV A;  5CO7 A;  3EGU A;  3N5B B;  2KDS A;  2ZCF B;  2DXB A;  1ZX6 A;  2VV5 A;  4JLI A;  1M3C A;  3RIR A;  1Y96 B;  4M75 F;  2O4X B;  1TWB A;  2RI5 A;  5IHK A;  2DNU A;  4QVC A;  1Q7Y U;  5DM7 R;  3A8H B;  3C0C A;  1V29 B;  1BI1 A;  1KD1 C;  4OMP A;  2GTJ A;  1N8R U;  1M1F A;  1MNE A;  4KRT A;  4BI3 A;  1H3H A;  4CC4 B;  1NJI C;  2SRC A;  3DKM A;  1UUE A;  3MEV A;  2D1X A;  3JB9 G;  3M4Y A;  4OP0 A;  2MWO A;  5GAM e;  4LD9 K;  4A4K A;  5HY6 A;  4EMG A;  5FWC A;  2EGC A;  4M7D G;  1C6V X;  3L2W A;  2E6N A;  5GMK l;  4C0Z A;  3TSZ A;  5IAY A;  4C8Q A;  1VQ7 T;  1ZUU A;  1G3W A;  3JB9 F;  1BI0 A;  3NTK A;  1G3Y A;  5GAN 2;  1T0H A;  3CCS A;  2RHI A;  1LCK A;  4E6R A;  2OTL A;  2HMA A;  3L2U A;  3VJP A;  1GXI E;  3GF5 A;  2LX9 A;  3E9G A;  1IGU A;  4FW1 A;  2EYX A;  1SHF A;  2EWN A;  4M7D F;  4A63 B;  3TVT A;  1AEY A;  3EFO A;  5CKF A;  4C5H A;  3RNJ A;  1O75 A;  2KRM A;  3CCM A;  2E6Z A;  1Q81 R;  1VQ7 Q;  2RHY A;  4XU2 A;  4C92 G;  4ESR A;  2HQH A;  4CC2 A;  1GBR A;  4J9E A;  3I35 A;  3SB2 A;  2JT4 A;  1VQP A;  2MOX A;  3BW1 A;  1X6B A;  1MUZ A;  5M9O A;  3P8D A;  2DE0 X;  1AT1 B;  4E47 A;  4IIM A;  3FJP A;  1VQ4 A;  2DET A;  4EMK C;  2LDM A;  2DA9 A;  2R58 A;  2YRD A;  3JCM h;  4J9C A;  4CC7 A;  5GAN d;  3FLG A;  2E65 A;  3I55 T;  3MPU B;  1ZA1 B;  1K9M C;  1TG0 A;  3CCL T;  1YWO A;  1CKB A;  4BB7 A;  1ARK A;  3QYH B;  1RAB B;  2PQW A;  2K5I A;  1LNX A;  1VQ5 T;  1MV0 B;  3U23 A;  2RK1 A;  5GAM j;  5FWB A;  4CI0 C;  2QQR A;  3LLR A;  2O4X A;  2DL5 A;  1PG5 B;  3I55 Q;  4XTU A;  3CCL Q;  2DVE A;  2DF6 A;  3CCR A;  3M0Q A;  4B9W A;  2G6F X;  1E6H A;  2DBM A;  2VAS A;  2JJ9 A;  1VQ5 Q;  1T3L A;  3HTR A;  3OYB A;  3G4S A;  5I2M A;  2SEM A;  4GLM A;  4PK4 A;  3RKY A;  3RER A;  1M5Q 1;  2LQK A;  2FL7 A;  3CC2 T;  1BIB A;  4GY5 A;  2KT8 A;  2X51 A;  3F70 A;  1YJ9 A;  2FO0 A;  1XJW B;  3A8O B;  2LJ1 A;  2DEQ A;  4PJM A;  4XTY A;  5GAO p;  4M7D B;  2JUF A;  4ANJ A;  2GTO A;  4C8Q E;  3MO8 A;  2G3R A;  1X43 A;  2NUZ A;  3CMA T;  4M75 D;  3OYL A;  2DAQ A;  2L8D A;  1ZSZ C;  2BZ8 A;  3GOX A;  4HKE A;  2L89 A;  4XK8 E;  2RF0 A;  9ATC B;  2HKQ B;  2X35 A;  4Z88 A;  3SFM A;  5GAN 5;  2LCC A;  2KR3 A;  1M1K R;  1D0Z A;  4RKU E;  2QQA A;  4C92 B;  4ZGE B;  4N0A A;  3CCQ T;  2DER A;  3CMA Q;  3UDC A;  1AWO A;  2JMA A;  1CSK A;  5LJ5 d;  5KCO A;  4Z89 A;  3EH2 A;  4FIB A;  2DIG A;  2EJ9 A;  1ACM B;  5AT1 B;  1WA7 A;  2C06 A;  3JB9 D;  2D0N A;  3CCE A;  1HJD A;  2BZX A;  2XDD A;  2VC8 A;  2QI2 A;  3CCQ Q;  4J7I A;  3QYG B;  3CCV T;  1FMV A;  4M7D D;  4M7A B;  2JZ2 A;  4M75 A;  3CD6 T;  3E1S A;  2D8J A;  1HYO A;  2RQT A;  4ZNX A;  2YLB A;  5CKH A;  4IUP A;  3L2Q A;  2OX7 A;  1W6X A;  1N27 A;  1RAC B;  4RCC A;  1NPR A;  4JLG A;  4PFP A;  1H3Z A;  1H92 A;  2LMJ A;  2ZPH B;  1UGQ B;  3CCV Q;  1U1S A;  2YUO A;  3C12 A;  4IUT A;  3CD6 Q;  2OTJ T;  5FRN A;  2RK2 A;  1K9A A;  3PVL A;  1FX7 A;  2IVW A;  2NUP B;  5CR2 A;  3CCJ Q;  4M77 C;  1QCO A;  1R77 A;  1WZO A;  2KXC A;  4KGX B;  4OGC A;  1NM7 A;  1GL5 A;  3OA6 A;  2LQN A;  5GAN 4;  4Z02 A;  2FRY A;  2KQW A;  4HCK A;  3OS5 A;  4M7D A;  2DMO A;  4M4Z A;  2EVR A;  2OTJ Q;  4PL6 A;  2KRO A;  1WI7 A;  5L23 A;  2K9G A;  5KYW A;  2EQM A;  3FDR A;  2KSS A;  1WPY A;  3Q1J A;  3QXE B;  3NTI A;  3VS6 A;  2F5K A;  1WDX A;  2AKL A;  2MCN A;  3JSC A;  2XDP A;  2K79 A;  2FEI A;  2QDY B;  4E7K A;  3OYN A;  3M0S A;  3BE3 A;  1VIF A;  4X1V A;  3P8B B;  3CBM A;  3M57 A;  2KK4 A;  4KT0 E;  2CP2 A;  3CEY A;  1YCS B;  5GJW B;  2RHZ A;  5LJ3 f;  3I56 Q;  4PJO C;  1U1T A;  1YJN T;  3X25 B;  5CVI A;  1VQO A;  2EW3 A;  4JJC A;  2CH4 A;  2NWM A;  4JUV A;  3OW2 S;  4J9H A;  3TEE A;  3FC3 A;  3JCM W;  3A1P A;  1RUW A;  1ZBX A;  2HQE A;  2PTK A;  5KCH A;  4EMK B;  4HXJ A;  2XDB A;  5DLO A;  3E9F A;  2FPE A;  3G7Z A;  2K5F A;  3NTH A;  2JMC A;  1YJN Q;  5LJ5 f;  3JCM d;  2PUK B;  2LT4 A;  1MHN A;  1QVF P;  1OI1 A;  3VV0 A;  4M75 E;  4M78 G;  1TXQ A;  2X4W A;  3OSS C;  2L3Q A;  3LWH A;  2HD0 A;  2LC4 A;  1WXU A;  4O5V A;  2E5K A;  3SD4 A;  1Q7Y R;  2K5L A;  3L42 A;  2YT6 A;  2A3L A;  4X34 A;  3VS2 A;  2EAY A;  2HQX A;  4Q5W A;  2R5M A;  1N8R R;  3OYM A;  3CCJ A;  4FT4 A;  4M78 F;  2RQV A;  1QVG A;  1G2B A;  2HEQ A;  1M1K U;  4MMK A;  4GLK A;  1GBQ A;  1KHI A;  1MGQ A;  3NMZ C;  2CP5 A;  3KUF A;  1SEM A;  1KK7 A;  2PU9 B;  4ELY C;  3CC4 T;  1M27 C;  1BCO A;  2CT3 A;  3CME A;  4K11 A;  2CZ6 B;  2F5T X;  2XG8 D;  4NL3 A;  3X28 B;  2EBP A;  1OX9 A;  3VYG A;  5GAO n;  3S3M A;  1PCX A;  1YFN A;  5GAO l;  5FW9 A;  4KUD K;  4XU0 A;  4FT2 A;  3C4S A;  3BDL A;  5LJ3 j;  4MDX A;  1KIK A;  1S72 T;  2L5Q A;  4M7D E;  1UGR B;  3GP8 A;  2P84 A;  3M0T A;  1JJ2 P;  1PC0 A;  4A4G A;  2A0F B;  3CC4 Q;  3LX7 A;  2DXU A;  2D9T A;  2X4J A;  3MP1 A;  3G1J A;  5HKC A;  3I56 A;  2RJC A;  4DQ2 A;  2YXY A;  1KQS A;  1SSF A;  3GBQ A;  2KI7 A;  3VUZ A;  4AFQ C;  1AWW A;  5GAM d;  2DTH A;  4JRI A;  4F7U E;  2LQ8 A;  4MZM A;  1S72 Q;  1VQ9 T;  1OEB A;  2CH4 W;  2A37 A;  2QA4 A;  3GIB A;  4P5N A;  4BE1 A;  1M8M A;  3TQ7 P;  4MML A;  4BD3 A;  2QEX Q;  1YIJ A;  1IRX A;  1M2O A;  3S3O A;  1M2V B;  2E64 A;  4F04 B;  2LNH B;  5GAN 7;  1VQK A;  4OB2 B;  1N6A A;  2MYS A;  3PE0 A;  1UGP B;  1YBY A;  3EGX B;  1VQ8 A;  1QLY A;  2J05 A;  2RH2 A;  2ZPG B;  2EYZ A;  2KT1 A;  5LJ3 h;  3ZEH A;  3G6E A;  1M3A A;  2H3J A;  2MK5 A;  2DJQ A;  3I5S A;  1FXX A;  3SWN A;  2JXB A;  1Q81 C;  2O88 A;  1OOT A;  2L0A A;  2RI2 A;  1U5S A;  1GRI A;  1LPL A;  2QQ9 A;  1I1J A;  2RHX A;  1D09 B;  1RAE B;  3CCS T;  1BKB A;  2DBK A;  4M78 B;  2LT1 A;  1KC8 U;  2RA2 A;  3MEU A;  1VQL T;  1SHG A;  3JB9 H;  3E2U A;  2MI6 A;  1RAA B;  5J26 A;  2E70 A;  5FU6 B;  2O2O A;  5LJ5 h;  2FZG B;  4JJD A;  4AG2 C;  2HSE B;  2WAC A;  3PIP A;  2WSC E;  3WXM B;  5GAN g;  5GMK m;  1JO8 A;  1QVF A;  2HNI A;  2DRK A;  1OU9 A;  1G3T A;  4M77 B;  2K2M A;  4ZN3 A;  1VQL Q;  2V1R A;  2MAM A;  1Q86 R;  3MEA A;  2OI3 A;  1U3O A;  3CBO A;  1YN8 A;  1VQM A;  2LCS A;  4E7I A;  4J5Y A;  4XTX A;  3GPL A;  2RM4 A;  2AK5 A;  2DZ9 A;  3LH5 A;  4IUR A;  4X9C A;  1VQ4 T;  3JCM V;  2FPF A;  1AHJ B;  1RL2 A;  4J9G A;  2NYS A;  1PM3 A;  1OZ3 A;  4PJN A;  2GGR A;  4M78 D;  1PNJ A;  3VS5 A;  2XID A;  3OMC A;  3H6Z A;  5CIU A;  5I22 A;  1VQ6 A;  6AT1 B;  2EGE A;  2LQW A;  2QEX A;  3L1A A;  3VS0 A;  5FRO A;  3G71 A;  5J39 A;  4PJO B;  4DBQ A;  1G83 A;  1YIT A;  2YDL A;  2JTF A;  1D0Y A;  1RLP C;  2L3R A;  5L8R E;  5GAM f;  1TS9 A;  1JXM A;  4J83 A;  4JRK A;  4R55 A;  3PMI A;  1M3B A;  2DL3 A;  4OMM A;  2JN0 A;  3EGX A;  3PVQ A;  4RG2 A;  4RG8 A;  2A08 A;  4E7L A;  1HD3 A;  1I0C A;  2DTI A;  2C0I A;  1S1N A;  5GMK e;  4DOV A;  4OMN A;  3EG9 B;  3QG1 A;  3NPF A;  4DBH A;  1AZG B;  1TU0 B;  2LTO A;  1M1K C;  1E6G A;  3CPF A;  4QKU A;  4ZTF A;  4M78 A;  4J6W A;  2DL8 A;  2J6F A;  3OYH A;  4DBR A;  1K0S A;  1RAF B;  1SSH A;  2CP3 A;  3VU3 C;  3VS3 A;  3PMT A;  5LJ5 g;  1VYV A;  1GCQ A;  3O8V A;  4XTZ A;  2RJE A;  1X6G A;  4II1 A;  4E7S A;  1O9S A;  5A2Q E;  1YI2 A;  5KYX B;  2Y4X A;  1M30 A;  4BI4 A;  4C92 F;  1PRM C;  3THK A;  5DY9 A;  3KXT A;  1K0X A;  3X26 B;  5CKD A;  2KXD A;  3CQT A;  5HCK A;  4PJJ A;  3X20 B;  3HSB A;  4M7A G;  3SEM A;  1TUG B;  2BTT A;  4HCZ A;  3ME9 A;  4WCI A;  1XQH A;  2IIM A;  4RUG A;  2RN8 A;  3QBY A;  2JOY A;  4QVZ A;  3CCE T;  2EJG A;  2J6K A;  1Y57 A;  3JV3 A;  3JAM E;  1FMW A;  3VS1 A;  3H41 A;  2P0P A;  3H9N A; 
#chains in the Genus database with same CATH homology
 1VYT A;  1NEG A;  2M51 A;  1TUC A;  1PKS A;  3TSW A;  1H92 A;  2LMJ A;  1YP5 A;  1XOV A;  2RNA A;  2HBW A;  2O9V A;  2X3W D;  2YUO A;  1BBZ A;  1HSQ A;  1VYU A;  1UTI A;  3EG0 A;  4F16 A;  2F2X A;  4HVU A;  1K9A A;  4RTX A;  3PVL A;  2C0O A;  2K6D A;  1ZUK A;  4AFU C;  1AZE A;  4J9F A;  4LN2 A;  2J6O A;  3REA B;  4FSS A;  1N5Z A;  2KXC A;  4JZ3 A;  1QWF A;  2KNB B;  1NM7 A;  1Y0M A;  1GL5 A;  1JEG A;  2JS0 A;  2LQN A;  2D8H A;  2I0N A;  2ECZ A;  4DEX A;  2FRY A;  4HCK A;  4D8K A;  2O31 A;  2F2W A;  2DMO A;  4M4Z A;  2EVR A;  2KRO A;  3M0U A;  1WI7 A;  5L23 A;  3VS4 A;  2K9G A;  1JQQ A;  1WXB A;  5IHI A;  3O5Z A;  2VKN A;  3VS7 A;  3VS6 A;  1UHF A;  2K3B A;  1BU1 A;  1A0N B;  1V1C A;  1WDX A;  1QKX A;  2AKL A;  2EKH A;  2MCN A;  1AWX A;  4LNP A;  2RQU A;  3EG3 A;  2K79 A;  2FEI A;  2KYB A;  4RTZ A;  4DEY A;  5IXF A;  3M0S A;  1ABO A;  4X1V A;  3QWX X;  2FG0 A;  1WIE A;  3EG1 A;  2PZ1 A;  4CC3 A;  1YCS B;  2EGA A;  5GJW B;  4OMQ A;  4ORZ A;  3NGP A;  3R6N A;  1PKT A;  4LUD A;  1QWE A;  3I9Q A;  2GQI A;  2EW3 A;  4JJC A;  2J7I A;  2CH4 A;  4RTV A;  2DX1 A;  2NWM A;  4J9H A;  2BZY A;  2W0Z A;  2H8H A;  1WLP B;  1K76 A;  1OV3 A;  1PRL C;  1RUW A;  2KE9 A;  1IO6 A;  2JTE A;  2PTK A;  1H8K A;  4JPB W;  5IXB A;  4HXJ A;  4OMO A;  1J3T A;  2FPE A;  4J9I A;  1K1Z A;  2XMF A;  3UA7 A;  5GJV B;  4LUE A;  2JMC A;  1Z9Z A;  1K4U S;  2ENM A;  1UG1 A;  1GCP A;  1JU5 C;  1RLQ C;  2ROT A;  2LZ6 B;  3EG2 A;  2L3Q A;  3UAT A;  3ZL7 C;  2ABL A;  1BB9 A;  1WXU A;  2FRW A;  2F2V A;  2CRE A;  2E5K A;  2YT6 A;  3VS2 A;  2RQW A;  3A98 A;  2DIL A;  4OML A;  4F14 A;  2LJ0 A;  2YUQ A;  2RQV A;  2DVJ A;  2EQI A;  2KRS A;  2PNI A;  1G2B A;  2HEQ A;  2CUB A;  4D8D A;  2ROL A;  3I5R A;  2OJ2 A;  1AD5 A;  1GBQ A;  4J9D A;  5I11 A;  1PHT A;  3NMZ C;  2KEA A;  1UJY A;  2ED1 A;  4HVW A;  1SEM A;  1U06 A;  3H0F A;  4IIO A;  2YUN A;  1M27 C;  1UFF A;  2CT3 A;  2LX7 A;  4K11 A;  2CDT A;  3VRY A;  2DYB A;  2EBP A;  1KJW A;  5EC7 A;  1X2K A;  1YNZ A;  2VWF A;  5FW9 A;  1NYG A;  4Y92 A;  2DL7 A;  1NEB A;  1KIK A;  3EGU A;  4F17 A;  1ZX6 A;  3QWY A;  2GNC A;  4Z8A A;  3M0T A;  1M3C A;  1UE9 A;  1I07 A;  1UEC A;  1ABQ A;  2L3S A;  5IHK A;  2DNU A;  4LE9 A;  1SRM A;  3C0C A;  2CSQ A;  4OMP A;  2JM9 A;  2GTJ A;  1X27 A;  1TUD A;  3GBQ A;  2L3P A;  4KRT A;  2W10 A;  2X3X D;  4AFQ C;  1QKW A;  1AWW A;  1B07 A;  3EHQ A;  1H3H A;  4CC4 B;  2SRC A;  1OEB A;  1UUE A;  2CH4 W;  2D1X A;  2A37 A;  2RQR A;  3KFV A;  3M0R A;  4R0K A;  3VRZ A;  1EFN A;  1M8M A;  4AG1 C;  3NHN A;  5FWC A;  2AZS A;  1SPK A;  2EGC A;  3H0H A;  3UA6 A;  3TSZ A;  1PWT A;  1ZUU A;  2VVK A;  3H0I A;  2LNH B;  1UHC A;  1T0H A;  2CT4 A;  1WXT A;  2KGT A;  3PE0 A;  1LCK A;  4E6R A;  2RMO A;  1QLY A;  2J05 A;  2EYZ A;  2KT1 A;  1M3A A;  2DLP A;  1NYF A;  1RI9 A;  2ESW A;  2EYX A;  1SHF A;  2DJQ A;  3I5S A;  4A63 B;  2JXB A;  2HDA A;  3TVT A;  2O88 A;  1OOT A;  1AEY A;  2L0A A;  1ZUY A;  2QDL A;  3RNJ A;  2KRM A;  2JM8 A;  1U5S A;  1GRI A;  1I1J A;  4ESR A;  2JW4 A;  4CC2 A;  1GBR A;  2DBK A;  4J9E A;  3I35 A;  2JT4 A;  2O9S A;  1YWP A;  2MOX A;  1SHG A;  1MUZ A;  1X6B A;  1ZSG A;  1AVZ C;  3REB B;  4JJB A;  2O2O A;  1FMK A;  1WX6 A;  1OPK A;  1T3S A;  1T0J A;  1AWJ A;  4JJD A;  4AG2 C;  2DE0 X;  4HVV A;  1X2Q A;  1NLP C;  2MIO A;  4IIM A;  3IQL A;  1JO8 A;  2DA9 A;  4J9C A;  2DRK A;  4CC7 A;  1VA7 A;  1NG2 A;  2LJ3 A;  2K2M A;  1TG0 A;  4QT7 A;  2V1R A;  2HCK A;  2OI3 A;  2P4R A;  1KSW A;  1YWO A;  1U3O A;  1CKB A;  1E7O A;  1YN8 A;  3UF4 A;  2LCS A;  1ARK A;  2AK5 A;  2YSQ A;  3LH5 A;  1GFD A;  1MV0 B;  2CSI A;  3U23 A;  5FWB A;  2ED0 A;  3SHW A;  2FPF A;  5ECA A;  2V1Q A;  2DL5 A;  4J9G A;  1GFC A;  1GCQ C;  2GBQ A;  1JXO A;  2DF6 A;  1W70 A;  2EPD A;  3M0Q A;  2GGR A;  2B86 A;  2G6F X;  1PNJ A;  3VS5 A;  1E6H A;  2DBM A;  2EYY A;  1T3L A;  5I22 A;  2LP5 A;  2K7A A;  3RBB B;  2EGE A;  2LQW A;  3VS0 A;  2SEM A;  2A36 A;  4GLM A;  2JS2 A;  1G83 A;  3M0P A;  2L2P A;  2EYW A;  2YDL A;  2KT8 A;  4RTU A;  1RLP C;  4EIK A;  4AFZ C;  4JZ4 A;  2FO0 A;  1UGV A;  2FPD A;  1BK2 A;  1JXM A;  2KRN A;  2LJ1 A;  1M3B A;  2DL3 A;  4OMM A;  2AZV A;  2GTO A;  1X43 A;  3PVQ A;  1CKA A;  1ZLM A;  2NUZ A;  1WFW A;  2A08 A;  1HD3 A;  2CUD A;  1I0C A;  2C0I A;  1W1F A;  2BZ8 A;  1S1N A;  5IH2 A;  1X69 A;  1OPL A;  2KYM A;  4OMN A;  2OAW A;  2RF0 A;  3NPF A;  4RTW A;  1QCF A;  1MV3 A;  2DM1 A;  1AZG B;  2DL4 A;  2HSP A;  4Z88 A;  3ULR B;  1E6G A;  3FJ5 A;  2DL8 A;  2J6F A;  2KR3 A;  1KFZ A;  1K0S A;  1SSH A;  3VS3 A;  2AKK A;  1SRL A;  1AWO A;  4RTY A;  2JMA A;  1VYV A;  1GCQ A;  1CSK A;  4Z89 A;  2YUP A;  1X6G A;  4J9B A;  1WA7 A;  2C0T A;  1UDL A;  2D0N A;  1M30 A;  4GBQ A;  1PRM C;  3THK A;  1AOJ A;  1HJD A;  1ZBJ A;  2BZX A;  1K0X A;  3EHR A;  4AFS C;  1NLO C;  1FYN A;  2KXD A;  3CQT A;  5HCK A;  1Z9Q A;  2DRM A;  1WYX A;  2D8J A;  3SEM A;  2BTT A;  2J06 A;  5IHN A;  1UJ0 A;  2RQT A;  4WCI A;  4RUG A;  2IIM A;  2M0Y A;  2RN8 A;  2RPN A;  4RTT A;  4ZNX A;  2A28 A;  1B3Q A;  2KBT A;  2J6K A;  1Y57 A;  3JV3 A;  3VS1 A;  1W6X A;  3H41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...