1ZSGA

Beta pix-sh3 complexed with an atypical peptide from alpha-pak
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
65
structure length
65
Chain Sequence
b'MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 7
publication title Structural Analysis of the SH3 Domain of beta-PIX and Its Interaction with alpha-p21 Activated Kinase (PAK)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 6
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zsgA00
1N5ZA 4RTVA 2KROA 2J06A 4JJBA 2O2OA 3VS0A 4CC3A 1YWOA 2D8HA 4F14A 2LJ0A 1YCSB 3EG0A 3O5ZA 2L3PA 2F2XA 4LNPA 2LJ3A 1PKTA 3M0RA 4HCKA 1KFZA 2KRSA 2CSIA 3IQLA 2BTTA 2DJQA 2J6OA 2FG0A 2JW4A 2ENMA 2EYYA 3NGPA 1QCFA 1GBQA 1WDXA 3EHQA 1UG1A 2QDLA 1UFFA 1X69A 2KYBA 4DEYA 2D1XA 3VS3A 1ZUYA 2O9SA 2BZYA 3A98A 1MV0B 3R6NA 2A08A 1EFNA 1PHTA 2DILA 2DL8A 1U3OA 1U5SA 2I0NA 1V1CA 1UE9A 1E6HA 3H0FA 2KEAA 4Y92A 2JT4A 4GLMA 4LE9A 3SEMA 2ROLA 1YNZA 2K3BA 1TUCA 2OAWA 4AFUC 4D8DA 2D8JA 1ZBJA 2JTEA 2NUZA 3M0SA 1G2BA 2P4RA 1FMKA 4Z89A 2KT1A 1M8MA 2EPDA 4J9EA 1GL5A 4OMMA 2DL4A 1X6GA 2AKKA 4AFZC 2GNCA 2CT4A 1QWEA 1WI7A 5IXBA 3PVLA 3FJ5A 1B3QA 4X1VA 4IIMA 1VYTA 2CDTA 2FPEA 4K11A 1AWWA 1T0JA 2DYBA 1WYXA 1JQQA 4OMNA 3M0QA 3REBB 2DM1A 2E5KA 1T3SA 2DNUA 2FO0A 4QT7A 3I35A 1HSQA 2NWMA 4HVUA 3GBQA 1AZEA 1Z9QA 1FYNA 1WXUA 3VRZA 3M0UA 4J9IA 3U23A 4LUEA 2RNAA 2LMJA 1MUZA 2ED1A 2FPFA 3PVQA 1NYGA 2EW3A 4AFQC 5IHNA 2RPNA 2LNHB 4ORZA 1W70A 2DA9A 4J9DA 1B07A 2CH4W 2CUDA 2L2PA 4R0KA 1CKBA 1NEBA 4A63B 2MCNA 1NG2A 2DLPA 4DEXA 1K4US 2L3QA 1GCQA 4RTTA 3VS7A 4WCIA 2AZVA 2X3XD 2DMOA 2RN8A 2YDLA 1I1JA 1OOTA 2KRNA 2HBWA 2J7IA 1RLQC 2KE9A 2KT8A 2GTJA 1AWOA 3VS6A 2EGAA 4JJDA 1KIKA 2V1QA 2W0ZA 5HCKA 1GCPA 2CUBA 1ZUUA 2CREA 1M3AA 4OMLA 2FEIA 1M30A 1WFWA 1RI9A 1YN8A 2EGEA 1WXTA 1VA7A 5GJVB 3VS4A 2HCKA 1TUDA 2RQVA 5IHIA 1X43A 1ZX6A 3H41A 2JMAA 1JO8A 4J9HA 4ZNXA 2AKLA 2JS0A 1M3BA 2EGCA 4JJCA 1X6BA 1SEMA 4OMQA 1J3TA 2EYXA 1W6XA 1ABQA 2KXCA 1OPKA 2V1RA 2A37A 2EVRA 2RF0A 1X27A 1E7OA 1QKWA 4E6RA 2YT6A 3RBBB 2K2MA 1K9AA 4OMPA 1A0NB 2VKNA 1UECA 1PWTA 1QLYA 1JXOA 1H8KA 2FRYA 2D0NA 2O88A 4AG2C 1UDLA 2PNIA 2M0YA 2W10A 3ZL7C 1KJWA 2A36A 2C0OA 2EBPA 1ARKA 1PRMC 1SPKA 2DL3A 5EC7A 2K6DA 1UUEA 2EYZA 1PNJA 5ECAA 2GGRA 2JS2A 1WX6A 4J9CA 3I5SA 2MOXA 3VS5A 2YUNA 1XOVA 3THKA 3EG3A 2A28A 2LQWA 3RNJA 3H0HA 1GBRA 1CKAA 1SRLA 2H8HA 3PE0A 1IO6A 1TG0A 2IIMA 2RQTA 1NYFA 4IIOA 1UJ0A 1UHCA 2L0AA 4OMOA 1CSKA 4M4ZA 5I22A 2LJ1A 2RQWA 2KGTA 2EQIA 4JZ3A 1GFCA 5FW9A 3SHWA 2K9GA 3H0IA 2F2WA 2ECZA 4RUGA 3REAB 1JXMA 2BZXA 1M3CA 1AWXA 2KR3A 1T3LA 2FPDA 2M51A 2JM8A 2O31A 2VVKA 1JU5C 1YWPA 1I07A 1YP5A 2J6KA 1QWFA 3C0CA 3VRYA 2YUQA 1NLPC 1AEYA 1GFDA 3LH5A 4HVWA 2ESWA 2HEQA 4AFSC 1BK2A 1Y0MA 5IXFA 3EG1A 2SRCA 2L3SA 2LQNA 3CQTA 1SHGA 2BZ8A 3I5RA 1SHFA 2C0TA 1LCKA 1VYVA 2DRKA 1K1ZA 2EYWA 1WLPB 5GJWB 3JV3A 2GQIA 3EG2A 2DL5A 2XMFA 1JEGA 4CC2A 1KSWA 2FRWA 3M0PA 1I0CA 2ABLA 2CT3A 1PRLC 2J05A 2VWFA 4J9GA 1S1NA 4F16A 1NM7A 3TSZA 4JPBW 1GRIA 3UF4A 1RLPC 1AD5A 2K7AA 2EKHA 2B86A 2DVJA 1ZLMA 2KYMA 1UHFA 2JM9A 2DL7A 2DRMA 1K76A 1NLOC 1BB9A 4J9FA 4GBQA 1W1FA 2RQUA 2JMCA 1UGVA 1WA7A 2PTKA 2JXBA 1OV3A 1MV3A 4RTUA 1BBZA 2ED0A 4Z88A 2GBQA 1K0XA 1SRMA 3VS2A 1X2QA 2HDAA 1HJDA 2RMOA 2C0IA 1AOJA 2KRMA 3M0TA 2DX1A 3TSWA 2AK5A 2J6FA 1X2KA 2LP5A 4AG1C 4CC4B 2MIOA 2YUOA 1RUWA 1OEBA 5I11A 2HSPA 2F2VA 1H3HA 2O9VA 2SEMA 1K0SA 2YUPA 2PZ1A 3TVTA 4HXJA 3QWXX 1NEGA 2CSQA 3NHNA 1E6GA 4HVVA 1BU1A 4EIKA 1WXBA 3EGUA 1PKSA 5FWBA 1OPLA 3UA6A 1HD3A 1VYUA 2KXDA 4RTZA 4KRTA 1H92A 2KBTA 5L23A 1ABOA 4Z8AA 4FSSA 1ZUKA 3NMZC 2AZSA 1M27C 5IHKA 1ZSGA 3UATA 2LCSA 2ROTA 2X3WD 4J9BA 1G83A 2OJ2A 1Y57A 2DF6A 1SSHA 2GTOA 4JZ4A 4RTWA 2LX7A 1Z9ZA 1U06A 2DE0X 2DBKA 2KNBB 3VS1A 5IH2A 1UTIA 2DBMA 3NPFA 4F17A 3UA7A 4RTYA 4CC7A 3I9QA 2YSQA 3KFVA 3ULRB 4ESRA 3QWYA 2LZ6B 1UJYA 2RQRA 1AVZC 3EHRA 4D8KA 2K79A 5FWCA 1AWJA 2CH4A 4LN2A 1T0HA 4RTXA 1AZGB 4LUDA 1QKXA 1WIEA 2OI3A 1GCQC 2G6FX
chains in the Genus database with same CATH superfamily
1N5ZA 4JJBA 3RERA 4EMGA 3MCAB 4M78D 4CC3A 2D0QB 1LNXA 4JDSA 4M77D 3MEWA 4HT8A 1PKTA 4HCZA 2XDDA 3M4GA 1TUGB 2QDYB 2KRSA 1YIJT 5LJ3h 2ZGWA 3PTAA 3CCJT 5KE2A 2FG0A 2JW4A 2ENMA 2EYYA 3JSCA 5CKDA 1Q95G 5D7UA 4C8QG 1WDXA 3EHQA 4M75F 1UG1A 2QDLA 2RI5A 3LWIA 1QVFP 3OYDA 3M56A 4YTLA 3CMAA 1EFNA 1PHTA 2DTIA 4L6V5 3FJPA 3OYGA 1U3OA 1XJWB 1V1CA 2MWPA 2F1LA 3H0FA 1BCOA 2KEAA 4OB3B 3OW2S 1VQLT 2ROLA 3G7ZA 5GAMg 4B9XA 2K3BA 5D6YA 1TUCA 2OAWA 4RG8A 4NS5A 4C8QB 3JB9I 1G2BA 2I2LA 2EFIA 2OX7A 1G3WA 2QAZA 5C0MA 5GANf 1YITQ 2KT1A 3MPUB 1QP3A 2QXFA 1GL5A 4OMMA 4R55A 3L1AA 2MF2A 4QVDA 1W2BS 4AT1B 1N27A 5M9OA 4OVAA 4BI8B 3QYHB 4C8QC 1TSFA 3PVLA 1PM3A 3SB2A 5GAN2 4E2FB 2WSFE 4X1VA 4KGXB 2CDTA 4K11A 2LQ8A 2DYBA 2DERA 1JQQA 4E7SA 4OB1B 1K8AC 2COZA 4CI0C 2DM1A 2QK0A 3BDLA 2CZ7B 3M4YA 3S3NA 2A0FB 3CMAT 4QT7A 3I35A 2FZGB 1D3BB 2NWMA 3CCRA 1Z9QA 4O6JA 1WXUA 3M0UA 4HA8A 4LUEA 2RNAA 3SFMA 2ED1A 2MK5A 1RL2A 4FW1A 2FPFA 3L2QA 2X35A 5IHNA 2RPNA 1VQ7Q 2RK2A 4M7DB 2DEUA 2XDPA 3OYYA 5GAMe 1WJSA 2L3QA 1WHMA 3SDZA 5J3BA 1GCQA 2HSEB 2R5AA 4NL3A 4PJOD 4BUGA 2E64A 5HK0A 3GIBA 5GMKl 3G71Q 2DMOA 2RN8A 2XI9A 2M16A 2LX9A 4MZTA 4M7DA 1OOTA 3ME9A 1YJNA 1XNIA 2KE9A 4M7DC 4BE1A 2VXEA 3OS1A 1V29B 5D6XA 1BYMA 4FSXA 4M78A 3VS6A 3JCMe 2V1QA 2LNVA 3CCRT 3CBPA 1ZUUA 3OYJA 4IUPA 4BY6B 1KQSP 2FEIA 1YN8A 4XTWA 3PIOA 2EGEA 1IB8A 3CCQQ 4GY5A 3CMEQ 2RQVA 2L8DA 4KH0B 3PT9A 3JCMb 2NUPB 5FRMA 4BY6C 3TU4K 2E70A 1SEMA 3EAEA 1TXQA 1J3TA 2V1RA 2A37A 1G8XA 2EVRA 4JS5A 2RF0A 4HCBA 3CBMA 2P0KA 1G5VA 4VUBA 4E7JA 1YJNT 2PUKB 4NL2A 3FRNA 4C8QE 5GAMh 3DLMA 4OMPA 3OY9A 2NYSA 1PWTA 4A53A 3MO8A 1JXOA 3CMEA 4PNOA 3RR6A 4FU6A 3QUIA 2D0NA 1QVGS 2X4JA 5LJ5d 1KJWA 2K5LA 2A36A 4GLKA 2EBPA 2DL3A 3QDRB 2LQKA 2K6DA 3JCMh 2EYZA 2FYKA 2DETA 4KUIA 4IUUA 1QVPA 2HZYA 2PQWA 3I5SA 5HKCA 3THKA 3HFOA 2PVGB 4B9WA 2WSCE 2P84A 2OTLA 3RNJA 1R8OB 2RQTA 2M9UA 5L8RE 3SWNC 3EFOA 5HK3A 2QTVA 4LDVA 4EMKA 2RQWA 1JRIA 5GAN7 1QCNA 5HY6A 3QHSA 2ECZA 2IPOB 4RUGA 3CMET 2EWNA 1AWXA 2M51A 3QXEB 4PJOA 2VVKA 5A0DA 1Q81U 2QEXQ 3VRYA 1QWFA 1VQ9A 3CCEA 1NLPC 2K3XA 4JLIA 4PJJA 3OMGA 3GF5A 2SRCA 2Y90A 4OGEA 1SHGA 2BZ8A 5CQXA 5GANd 3M54A 3UT1A 4C8QF 5CCAA 4XQ3A 2DRKA 1K1ZA 3TEEA 3ZFJA 4XTYA 1JEGA 4L59A 2COYA 2X4WA 4M75G 1KSWA 2DXTA 1IZ6A 3A1PA 2FRWA 5A0LA 3M0PA 1I4K1 2ABLA 2RI3A 2J05A 3QIIA 3HRSA 1N9RA 1GRIA 3QJ6A 2K7AA 1AD5A 1Q81R 2DVJA 1ZLMA 2CP6A 5I2SA 3J7AF 1BB9A 1PSFA 1R77A 1TOVA 4UC4A 1W1FA 2RQUA 4PL6A 3OS0A 2EKOA 1UB4A 3NTKA 4M75B 3PMIA 3E19A 1PSEA 1U1TA 2JXBA 1OV3A 1N6AA 2ED0A 2VB6A 3CCET 2GCXA 4A4GA 2DXUA 2HDAA 1I5OB 1AOJA 3M0TA 1RADB 2LP5A 1OEBA 3C95A 5I11A 3M53A 2HSPA 2O9VA 1VQ5Q 4M75C 5KYXA 2PZ1A 1YHQA 4DBQA 3TVTA 3CCMQ 4PJMA 4HXJA 1IGQA 1NEGA 2R58A 3RKWA 3CC7A 2F5TX 5IN1A 3I55A 3EG9A 3HPWA 2E4HA 4XTUA 3UA6A 1HD3A 4R56A 2CYZB 2LT4A 2KXDA 2JN0A 3M9QA 1UEBA 1JB0E 1N8RU 5C6SA 2DJZA 3JCMQ 3NMZC 5DY9A 1ZSGA 1M4ZA 2X3WD 1QVGA 1G83A 4A4KA 1VQ5A 4JZ4A 1SSHA 2GTOA 2DE0X 2KNBB 4FT2A 3QJYA 4JRQA 1NBEB 4CC7A 3I9QA 2YSQA 3KFVA 3CEYA 1QVFS 3HFNA 1AVZC 1M90U 3LGLA 2K79A 5FWCA 2K3YA 2RI2A 2QQAA 1G3SA 1YHQT 4LN2A 2R5MA 1T0HA 4RTXA 4LUDA 3J81E 3CC7T 4E7ZA 1N8RR 3I55T 2KROA 3JCMP 3PIPA 2O2OA 4ATOA 3HL8A 1YFNA 2YRCA 2LJ0A 2GQVA 3EG0A 3O5ZA 4LNPA 5GAOn 1KFZA 1D0XA 2CSIA 1ZSZB 1X01A 2DJQA 3NGPA 4BI4A 3KUFA 4DA4A 1GBQA 1ZHIA 1UFFA 2KYBA 5CK9A 2D9TA 2D1XA 4E47A 1ZSZA 3T9NA 1S72Q 1VQ5T 1M90R 2KQWA 2KMTA 2DL8A 3QDFA 3CCMT 1U5SA 2I0NA 3DKMA 1UE9A 3OS2A 1LPLA 2VGNA 4GLMA 4IURA 5GAOl 2D8JA 4XAXB 1FMVA 3M0SA 3H9NA 1XTDA 4J8OA 1OU9A 4C8QD 2Z0WA 4LD6A 1YI2A 4M75E 1YBYA 1NE8A 2PVOB 1X6GA 2AKKA 2GNCA 5GANg 2RA2A 2HQXA 2CT4A 2RJCA 3LGFA 5LJ5e 3FJ5A 1B3QA 2QQ9A 1K8AU 2P4TA 2IG0A 3REBB 4QQDA 4RMOA 2E10A 2KSSA 4QKUA 2E5KA 1T3SA 1QCOA 2XDBA 4MMLA 2DNUA 2XIDA 2HL3A 2E6NA 4Z02A 3OA6A 1M8VA 2QGGA 3V8LA 2FL7A 3GBQA 1AZEA 3VRZA 1M9SA 4J9IA 3NTHA 2DK3A 2ZPIB 2BE9B 3CCLA 4FYVB 5KH6A 5KYNA 2R57A 1KQSS 1W70A 1HXDA 1MMDA 3EGXB 4E7KA 2X4XA 4J9DA 1B07A 2CH4W 2CUDA 2L2PA 3A8LB 3BFMA 1M90C 4O5VA 1UGPB 1NEBA 1K8AR 2CS7A 1GXIE 1D0YA 2EAYA 3S3OA 4N4HA 3EGXA 1I1JA 4ANJA 3FC3A 2KRNA 4WTOB 2DO3A 1NPPA 1OX9A 3OYKA 3HRUA 2GTJA 2DAQA 2EGAA 5HCKA 5KCOA 5LJ5h 1GCPA 2P0QA 1M3AA 1BI0A 1M30A 5CKHA 1QVFA 3BW1A 1VQMQ 3PFSA 3CCLT 1QP2A 4LDYA 1TUDA 4BDZA 3OSVA 2IVWA 1Y07A 2RM4A 3H41A 4C92G 3V7CA 1YJ9Q 3J80E 1M1KC 4JJCA 1IHWA 2LCLA 2E5QA 2EYXA 1W6XA 3RMSA 3RIRA 4F7UG 1VQOQ 4E7IA 4C8QA 2K2MA 5GMKj 4A54A 2FVUA 2Y4XA 4C92B 2VKNA 2CZ6B 1M2OA 2YRDA 1M2VB 2CZ0B 1H8KA 4BE2A 2NLUA 1UDLA 2CZ1B 2M0YA 4Q5WA 1MHNA 1FWZA 2ZPHB 3FLGA 2VXFA 1ARKA 1PRMC 2QGFB 1M2VA 4C92C 1YITA 4MZMA 2B8AA 4JUVA 3TCJA 1O75A 2QG9B 2JUFA 4XTXA 2YUNA 4XK8E 5GAOr 5CKFA 2A28A 1D3BA 3H0HA 1VQ8Q 1TG0A 2IIMA 1M1GA 1O9SA 4ZTJA 1M5Q1 5DM7R 4IIOA 3X20B 1UJ0A 2L0AA 2JJ9A 1CSKA 2KK4A 2F5KA 2LJ1A 4J7FA 2KGTA 1VQMT 3TREA 4JZ3A 1GFCA 1YJWQ 3SHWA 3H0IA 2DEQA 3REAB 2FPDA 2O31A 1D1CA 1MMNA 2YUQA 1AEYA 1PCXA 2DVEA 1GFDA 1WGSA 4QQ6A 4TVRA 3GNFB 4HVWA 2X9HA 2E3HA 5IXFA 2BE7D 3UDCA 4RKUE 4BI3A 2L3SA 1VQ7A 3L42A 1YITT 3LW5E 1KQSA 5FU7C 3CPFA 3I5RA 1SHFA 2ZPBB 1MMGA 2OAUA 3M58A 1LCKA 1VYVA 5GJWB 3EG2A 1VUBA 2BUDA 2DL5A 1D0ZA 2LC4A 3G71A 2A7YA 1I0CA 1WQWA 2CT3A 4ELZC 1KG1A 2VWFA 1DJ7B 3QKJA 4F16A 1NM7A 4JPBW 2EKHA 2VUBA 2CP3A 2EJGA 2LT1A 2KYMA 2P0PA 4DBHA 2CP7A 2DRMA 3VV0A 2NUPA 1NLOC 4J9FA 3OYBA 3MJXA 1XQHA 3D7SB 2PTKA 4C5HA 3N5BB 3A8MB 1BBZA 4M75D 1SRMA 1ZBXA 3JCMV 2RMOA 2C0IA 3CCQA 2KRMA 2DX1A 2E12A 2WACA 1RAHB 1RUWA 3JCMf 1VQ7T 1KD1C 5LJ3j 2F2VA 1H3HA 1K0SA 3JRZA 3QWXX 4C92E 3NHNA 3SWNB 5I21A 4HVVA 2YRVA 1BU1A 3G71T 2RHIA 3EGUA 1PKSA 1OPLA 2E6ZA 5GAN3 5EG2A 5A0GA 4XU1A 4F7UE 2AHJB 4KRTA 5CO7A 4BB7A 1H92A 5DLOA 3VKIA 1PC0A 2XKOC 2E65A 3SWNA 4RCCA 2M0OA 2JNGA 1UGQB 4FSSA 1ZUKA 4DBRA 2AZSA 5IHKA 1I8FA 3OQ5A 3UATA 4J9BA 1RABB 3L2UA 1Y57A 3EFSA 4RTWA 1OI1A 4J6WA 1VQPQ 3A8OB 4XU3A 3UA7A 3CCQT 3VYHB 2F69A 2CP2A 3QSUA 1AHJB 1UJYA 4JRPA 3BY7A 2RQRA 4D8KA 4HCCA 3JB9H 2YWWA 1QKXA 3OYLA 2OI3A 1RAEB 1PG5B 1YWOA 2LVMA 1WHHA 2L3PA 4J83A 2LJ3A 3V8KA 3M0RA 3IQLA 1IXDA 5CAIA 3E1SA 4A4EA 2DIGA 2RJDA 4C0DC 2QQSA 4OB0B 2KAFA 2QQRA 4JLGA 1VIEA 1VQPA 4PKCC 1QCFA 1Y96B 4M77E 3JCMX 1KQ2A 1X69A 4DEYA 4C92F 3VS3A 2QEXA 3FDRA 2BZYA 4ZTFA 4F04B 2DILA 2MWOA 2O4XB 3DB4A 1SSFA 1Y96A 1MNEA 1Q7YC 1VQ4Q 1E6HA 4FT4A 2LDMA 1VIFA 4F7UF 4X9DA 2JT4A 2RHYA 2QA4Q 2FZCB 4RG2A 1YNZA 3M59A 3M5AA 4AFUC 4D8DA 1ZBJA 3JB9G 2NUZA 2EYQA 3LLRA 2P4RA 3S3MA 4PJNA 1TTHB 4Y91A 1FMKA 4Z89A 1JJ2P 3G6EQ 3ZEHA 2EPDA 1KQ1A 2MYSA 2JZ2A 3MEVA 4M75A 2DL4A 2JVVA 2C06A 3M55A 5KYWB 3X24B 1BIAA 3CPWP 1Y7XA 1HYOA 1QWEA 1M1FA 2HQHA 4IIMA 1OYXA 1VQ4A 1VYTA 1VQPT 1AWWA 3C12A 1G3YA 5FLXE 2JTFA 3M0QA 2QA4A 3OYMA 1WHGA 4NOYA 2H3EB 2QEXT 2YLBA 3OB9A 1X6OA 3CC2Q 3G6EA 3QG1A 1Y71A 4FW2A 1U1SA 1I81A 2FB7A 4N4GA 1FYNA 3U23A 2LMJA 4QQGA 1MUZA 3GP8A 3BE3A 4M78F 2K5FA 4EPCA 3CCMA 1B34B 1QQJA 4M77F 5GAOp 2EW3A 3QZ9B 1LVKA 3ZBDA 2LNHB 1FMWA 2EQUA 2NUTB 3OYFA 5GAMj 4II1A 2MCNA 4A63B 2COWA 3JCMW 1AT1B 4E7HA 4MDXA 3VS7A 2AZVA 3CC2A 3H8ZA 4JRKA 1X75C 1C0MA 5A2QE 3JB9J 2NUTA 5GAN5 4IKFA 2HBWA 2J7IA 1VQ4T 2KT8A 2QA4T 4C0GA 4JJDA 1KIKA 4KBMB 3I56Q 1ZA1B 2AT1B 2CGHA 2XD0A 5KCHA 1BCMA 4LDXA 5FU6B 3G6ET 1F1BB 4OMLA 3UWNA 3R6OA 1YCYA 2RHUA 1WFWA 3JCMd 2DFUA 3V8JA 2BIVA 5GJVB 2LRQA 4PK4A 1D09B 3L2ZA 3CD6Q 1SKUB 1WHLA 1X43A 1ZX6A 2JMAA 4J9HA 3KXTA 4PJLA 5FU6C 1NPRA 1M1KU 1M3BA 2EGCA 1KHIA 1X6BA 1ABQA 1RI0A 3I56A 4LXCA 3CC2T 3META 1P92A 4KH1B 1YIJQ 3RKXA 3FB9A 3CXCA 1Q86U 3P8DA 3CXCP 2YT6A 3RBBB 4M7AG 3LWHA 1S72A 4J6XA 4Y28E 2DXCA 1QLYA 3QYGB 3CD6A 2QYZA 4C92D 5DLQE 5FROA 3GLXA 3V7RA 2PNIA 2W10A 3X28B 4C5GA 6AT1B 1M1KR 1SPKA 2CP0A 1UUEA 1V76A 3G4SQ 1VQLQ 4M7AB 1WX6A 4PJOF 4J9CA 3P8HA 2XU8A 5GAOm 5I2MA 2DD4A 5FRNA 3EG3A 7AT1B 2LQWA 3PGGA 1Q86R 1GBRA 4XU0A 1CKAA 1SRLA 1IO6A 3I56T 4D6WA 3EFRA 1KHCA 1NYFA 2K2VA 3EGDB 4ZGDB 4M7AC 3QZ5B 4AMCA 4QVZA 3ASKA 1VQKQ 4V2SA 2OTJQ 5I22A 5LJ3f 1S72T 4PFOA 1RAFB 2EQIA 5GAN4 1KC8U 3RESA 3CD6T 3G4SA 1R0BG 4N0AC 2GFAA 2BZXA 5LJ5f 2XG8D 2JM8A 2VASA 2CKKA 1YWPA 5GANe 1YP5A 2J6KA 3CMAQ 3LH5A 1D1BA 2ESWA 3BDUA 2HEQA 4FYWB 5J39A 3OYAA 1UGSB 3EG1A 2LQNA 2RHZA 3CQTA 2EQKA 2EYWA 1WLPB 3AT1B 3JV3A 3RDVA 3CCSQ 2GQIA 2DPPB 1VQKA 2OTJA 1B7TA 3HTRA 8AT1B 4X9CA 2XMFA 2G3RA 2HKQB 1KC8R 3OYIA 2DTOA 3UF4A 1OZ2A 2WSEE 1RLPC 1RAAB 4DQ2A 3RUXA 1UHFA 4RCBA 3JB9F 2JM9A 4ZGJB 1Q82C 2DL7A 4E7LA 1D1AA 3X26B 2VYTA 4FCYA 3G4ST 1K9MC 1H641 1SF9A 2PU9B 4MZPA 1UGVA 1WA7A 2DD5A 5AYFA 4MMKA 1Q86C 1OX8A 3CCSA 4RTUA 1VQMA 2GBQA 1K0XA 3E9GA 1HJDA 3CCRQ 1NZ9A 3TSWA 2AK5A 2J6FA 4AG1C 2YUOA 4KGZB 1KD1U 5GAOq 4F7UB 1YJ9A 2SEMA 2DXBA 2YUPA 2DKGA 4C92A 3VUBA 3CBOA 1VQKT 2OTJT 3JCMg 4OP0A 5GANh 4LDUA 1E6GA 3ER0A 5CVIA 3HP9A 1RACB 1VQOA 2KVQG 1IHVA 4OGCA 5KYYB 5FWBA 4F7UA 3GOXA 3CC4Q 4RTZA 1PD1A 2KBTA 1ABOA 4M7DG 3L2WA 1R0CB 2VV5A 1K73U 5KYYA 1YJNQ 4M7AE 3JCMc 1M27C 4M78G 4BDYA 2LCSA 3WXMB 2ROTA 1FX7A 4M77G 1KD1R 2RJEA 3CCST 1Z9ZA 3FEOA 4JRIA 1KC8C 2MPXC 5FU7B 4PFPA 3S6WA 4ESRA 3TQ7P 3CCVQ 3QWYA 2LZ6B 1YJ9T 1BI1A 3EHRA 3CC4A 4FYYB 1ACMB 1AWJA 4M78B 1VQ8A 2E3IA 1WIEA 2ZCFB 1GCQC 4M77B 3SD4A 2G6FX 4RTVA 2J06A 3M57A 3VS0A 1VQOT 1MMAA 2D8HA 1RAGB 4F14A 1K73R 1YCSB 2M1HA 2F2XA 4HCKA 1ZA2B 2YXYA 2BTTA 4ELYC 1I5LA 1JJ2S 2J6OA 3HSBA 3FIFA 4M77A 2RJFA 4JJNK 1YJWA 2QQBA 4M78C 3UPUA 1TU0B 4M77C 5IAYA 1G3TA 3CCVA 3CPWS 1VQ6Q 2PUOB 2M02A 1ZUYA 2O9SA 3DLLA 3A98A 3O8VA 2YHTA 1MV0B 3R6NA 2A08A 5GMKm 1QW1A 1RAIB 5GAMf 1Q7YU 4Y92A 4LE9A 2PVDB 3SEMA 3EH1A 2JTEA 2Y4YA 3CC4T 4M7AF 3LH0A 1VQ8T 4HKEA 3QBYA 1M8MA 1WJRA 4J9EA 3MKDA 1SG5A 2X51A 2L3RA 3E9FA 4AFZC 1VQ6A 3MP8A 3MEUA 1WI7A 3H6ZA 2OTLQ 5IXBA 5KYUB 5LJ5j 3OYHA 4LD9K 3VU3C 2HQEA 5LJ3d 4XU2A 1YJWT 1NJIU 2FPEA 1T0JA 1Q7YR 1WYXA 2KI7A 4OMNA 4BACA 3CCVT 3OW2A 3OW2P 3JB9D 4A4HA 5KYUA 1EZZB 2FO0A 3QO3A 2X4YA 1TH7A 2E41A 1HSQA 4PJOG 1KK7A 5GAN8 4JS4A 4J7IA 3DB3A 4HVUA 4PFZA 1K73C 4FIBA 1C1AA 3MHXA 3EFOB 2RHXA 1VQ9Q 3CCEQ 3L2RA 1W2BA 1W2BP 3PVQA 4EMKB 1NYGA 1MGQA 1OQKA 4IUTA 2QTXA 3F70A 4AFQC 2KY9A 4ORZA 4XTZA 2FHDA 1WHJA 2DA9A 2O01E 4R0KA 1CKBA 1NJIR 2HNIA 4PJOB 3MP1A 1NG2A 2DLPA 4FM4B 4OF1A 4C0DB 4DEXA 1VQ6T 1K4US 3OMCA 4RTTA 2HKNA 4J5YA 9ATCB 3A8HB 3HRTA 4WCIA 2MMPA 2DIQA 4EMKC 4N4IA 2X3XD 2EJ9A 2RH2A 2YDLA 4L5GA 2VGMA 1N9SA 4M7DE 1RLQC 1AWOA 5GANj 2GFUA 4PJOC 4C5IA 2ZAEA 3EH2A 2YLCA 1VQNQ 2HL5C 4M78E 1OULA 4CRIA 2W0ZA 1TWBA 2CUBA 4ZN3A 4BE0A 1IREB 3CCUQ 2CREA 5CIUA 4QW2A 3CXCS 4X34A 1RI9A 2L89A 1WPYA 2K57A 1WXTA 1VA7A 3VS4A 1FXXA 2HCKA 5GMKi 2OTLT 4PLIA 3OYCA 5IHIA 1JO8A 4ZNXA 2AKLA 1WQ7A 2JS0A 1ZQ1A 2DZ9A 1YHQQ 4OMQA 2O4XA 3OSSC 4LDWA 2KXCA 1OPKA 1JJ2A 3CC7Q 1VQNA 3INZA 2LTOA 3I55Q 2EQJA 3NTIA 2A3LA 2E1HA 2K5IA 2JOYA 1IGUA 1X27A 1TS9A 3CCUA 1E7OA 1QKWA 3HKSA 5D6WA 3CPWA 2HAXA 4ZGEB 4E6RA 4DBFA 5KE3A 1K9AA 5GMKe 5KYXB 1OZ3A 1A0NB 1VQ9T 3V7SA 3AHUA 1UECA 2XHCA 3JAME 1NJIC 2FRYA 2RB6A 5GAN6 3EG9B 5KYWA 2O88A 4AG2C 3ZL7C 2DYIA 3KBGA 2C0OA 5IT9E 5CR2A 5EC7A 4M7DF 1PNJA 1WZOA 4KGVB 4C0ZA 3VJPA 5ECAA 2MAMA 2GGRA 3OYNA 2JS2A 3VUZA 2EQMA 3PMTA 2MOXA 2RO0A 3VS5A 4M7AD 1XOVA 4QVCA 5CKBA 3LYIA 1BIBA 3QPHA 4KT0E 1PD0A 2V8KA 3GPLA 3RMQA 2H8HA 2K4YA 3PE0A 2VC8A 4ME7A 1VQNT 4KULA 3X25B 4FYXB 1EIFA 4B6MA 3L2VA 4DOVA 1UHCA 3CCUT 4FL6A 2L5QA 5LL6S 1MNDA 4MDWA 1B34A 1QVGP 4OMOA 4M4ZA 1LJOA 5FW9A 2K9GA 2F2WA 5GAMd 2LCCA 1JXMA 2AIRB 1M3CA 1WJQA 2KR3A 1H3ZA 1T3LA 2QASA 2V26A 5LJ3g 1JU5C 1W4SA 1Q81C 3PNWC 4PJOE 1I07A 3C0CA 2V8JA 4PLLA 4WF2A 4AFSC 1BK2A 5LJ5g 3WVDB 1Y0MA 3MEAA 5GMKh 4J6YA 3NFCA 2HBPA 3LX7A 3P8BB 4DOWA 2C0TA 3RKYA 2RK1A 4CC2A 4KUDK 2XK0A 2EIFA 3C4SA 2D6FA 2HMAA 4C5EA 1OU8A 1PRLC 1YI2Q 4HT9A 1BKBA 3OBWA 4J9GA 1U8RA 1JBMA 1S1NA 3TSZA 2MI6A 2B86A 3URGA 1EX4A 1ZSZC 1Q82U 3OS5A 5CKEA 1K76A 8ATCB 4C0FA 4EDUA 3JCMJ 4GBQA 4EMHA 1K9MU 4OB2B 1QMCA 3A5ZB 2JMCA 2XICA 2DZCA 1MV3A 3CCJQ 5J26A 5AT1B 4Z88A 2FZKB 2ATCB 2QI2A 3VS2A 1X2QA 5CQYA 2CP5A 1X2KA 3Q1JA 1WHKA 2DTHA 4CC4B 2MIOA 2V8IA 3GNGA 1BI2A 2ZPEB 5LJ3e 4A4FA 3E2UA 3CCLQ 3HHTB 2CSQA 3A8GB 2KDSA 4EIKA 4XTVA 1Q82R 1WXBA 2ZPGB 1VYUA 2HD0A 4P5NA 1YIJA 1WNLA 1K9MR 4ZN1A 2ZPFB 5L23A 1UGRB 3CCJA 3MP6A 4Z8AA 2EJFA 1N8RC 4M7AA 1IRXA 1C6VX 2BKDN 2GF7A 3OYEA 3OBYA 3WVEB 1VOMA 3G1JA 4IUVA 2RD1A 2OJ2A 2DF6A 4OMFB 2LX7A 1U06A 2DBKA 4N0AA 3VS1A 5IH2A 1UTIA 2DBMA 3NPFA 4F17A 3EGDA 1LOJA 4RTYA 1VQLA 3ULRB 2H3JA 4BD3A 1YI2T 1HK9A 2ZZDA 1BI3A 4IUQA 4M7DD 2JTMA 2CH4A 3VYGA 1AZGB 3C94A
chains in the Genus database with same CATH topology
1N5ZA 4RTVA 2KROA 2J06A 4JJBA 2O2OA 3VS0A 4CC3A 1YWOA 2D8HA 4F14A 2LJ0A 1YCSB 3EG0A 3O5ZA 2L3PA 2F2XA 4LNPA 2LJ3A 1PKTA 3M0RA 4HCKA 1KFZA 2KRSA 2CSIA 3IQLA 2BTTA 2DJQA 2J6OA 2FG0A 2JW4A 2ENMA 2EYYA 3NGPA 1QCFA 1GBQA 1WDXA 3EHQA 1UG1A 2QDLA 1UFFA 1X69A 2KYBA 4DEYA 2D1XA 3VS3A 1ZUYA 2O9SA 2BZYA 3A98A 1MV0B 3R6NA 2A08A 1EFNA 1PHTA 2DILA 2DL8A 1U3OA 1U5SA 2I0NA 1V1CA 1UE9A 1E6HA 3H0FA 2KEAA 4Y92A 2JT4A 4GLMA 4LE9A 3SEMA 2ROLA 1YNZA 2K3BA 1TUCA 2OAWA 4AFUC 4D8DA 2D8JA 1ZBJA 2JTEA 2NUZA 3M0SA 1G2BA 2P4RA 1FMKA 4Z89A 2KT1A 1M8MA 2EPDA 4J9EA 1GL5A 4OMMA 2DL4A 1X6GA 2AKKA 4AFZC 2GNCA 2CT4A 1QWEA 1WI7A 5IXBA 3PVLA 3FJ5A 1B3QA 4X1VA 4IIMA 1VYTA 2CDTA 2FPEA 4K11A 1AWWA 1T0JA 2DYBA 1WYXA 1JQQA 4OMNA 3M0QA 3REBB 2DM1A 2E5KA 1T3SA 2DNUA 2FO0A 4QT7A 3I35A 1HSQA 2NWMA 4HVUA 3GBQA 1AZEA 1Z9QA 1FYNA 1WXUA 3VRZA 3M0UA 4J9IA 3U23A 4LUEA 2RNAA 2LMJA 1MUZA 2ED1A 2FPFA 3PVQA 1NYGA 2EW3A 4AFQC 5IHNA 2RPNA 2LNHB 4ORZA 1W70A 2DA9A 4J9DA 1B07A 2CH4W 2CUDA 2L2PA 4R0KA 1CKBA 1NEBA 4A63B 2MCNA 1NG2A 2DLPA 4DEXA 1K4US 2L3QA 1GCQA 4RTTA 3VS7A 4WCIA 2AZVA 2X3XD 2DMOA 2RN8A 2YDLA 1I1JA 1OOTA 2KRNA 2HBWA 2J7IA 1RLQC 2KE9A 2KT8A 2GTJA 1AWOA 3VS6A 2EGAA 4JJDA 1KIKA 2V1QA 2W0ZA 5HCKA 1GCPA 2CUBA 1ZUUA 2CREA 1M3AA 4OMLA 2FEIA 1M30A 1WFWA 1RI9A 1YN8A 2EGEA 1WXTA 1VA7A 5GJVB 3VS4A 2HCKA 1TUDA 2RQVA 5IHIA 1X43A 1ZX6A 3H41A 2JMAA 1JO8A 4J9HA 4ZNXA 2AKLA 2JS0A 1M3BA 2EGCA 4JJCA 1X6BA 1SEMA 4OMQA 1J3TA 2EYXA 1W6XA 1ABQA 2KXCA 1OPKA 2V1RA 2A37A 2EVRA 2RF0A 1X27A 1E7OA 1QKWA 4E6RA 2YT6A 3RBBB 2K2MA 1K9AA 4OMPA 1A0NB 2VKNA 1UECA 1PWTA 1QLYA 1JXOA 1H8KA 2FRYA 2D0NA 2O88A 4AG2C 1UDLA 2PNIA 2M0YA 2W10A 3ZL7C 1KJWA 2A36A 2C0OA 2EBPA 1ARKA 1PRMC 1SPKA 2DL3A 5EC7A 2K6DA 1UUEA 2EYZA 1PNJA 5ECAA 2GGRA 2JS2A 1WX6A 4J9CA 3I5SA 2MOXA 3VS5A 2YUNA 1XOVA 3THKA 3EG3A 2A28A 2LQWA 3RNJA 3H0HA 1GBRA 1CKAA 1SRLA 2H8HA 3PE0A 1IO6A 1TG0A 2IIMA 2RQTA 1NYFA 4IIOA 1UJ0A 1UHCA 2L0AA 4OMOA 1CSKA 4M4ZA 5I22A 2LJ1A 2RQWA 2KGTA 2EQIA 4JZ3A 1GFCA 5FW9A 3SHWA 2K9GA 3H0IA 2F2WA 2ECZA 4RUGA 3REAB 1JXMA 2BZXA 1M3CA 1AWXA 2KR3A 1T3LA 2FPDA 2M51A 2JM8A 2O31A 2VVKA 1JU5C 1YWPA 1I07A 1YP5A 2J6KA 1QWFA 3C0CA 3VRYA 2YUQA 1NLPC 1AEYA 1GFDA 3LH5A 4HVWA 2ESWA 2HEQA 4AFSC 1BK2A 1Y0MA 5IXFA 3EG1A 2SRCA 2L3SA 2LQNA 3CQTA 1SHGA 2BZ8A 3I5RA 1SHFA 2C0TA 1LCKA 1VYVA 2DRKA 1K1ZA 2EYWA 1WLPB 5GJWB 3JV3A 2GQIA 3EG2A 2DL5A 2XMFA 1JEGA 4CC2A 1KSWA 2FRWA 3M0PA 1I0CA 2ABLA 2CT3A 1PRLC 2J05A 2VWFA 4J9GA 1S1NA 4F16A 1NM7A 3TSZA 4JPBW 1GRIA 3UF4A 1RLPC 1AD5A 2K7AA 2EKHA 2B86A 2DVJA 1ZLMA 2KYMA 1UHFA 2JM9A 2DL7A 2DRMA 1K76A 1NLOC 1BB9A 4J9FA 4GBQA 1W1FA 2RQUA 2JMCA 1UGVA 1WA7A 2PTKA 2JXBA 1OV3A 1MV3A 4RTUA 1BBZA 2ED0A 4Z88A 2GBQA 1K0XA 1SRMA 3VS2A 1X2QA 2HDAA 1HJDA 2RMOA 2C0IA 1AOJA 2KRMA 3M0TA 2DX1A 3TSWA 2AK5A 2J6FA 1X2KA 2LP5A 4AG1C 4CC4B 2MIOA 2YUOA 1RUWA 1OEBA 5I11A 2HSPA 2F2VA 1H3HA 2O9VA 2SEMA 1K0SA 2YUPA 2PZ1A 3TVTA 4HXJA 3QWXX 1NEGA 2CSQA 3NHNA 1E6GA 4HVVA 1BU1A 4EIKA 1WXBA 3EGUA 1PKSA 5FWBA 1OPLA 3UA6A 1HD3A 1VYUA 2KXDA 4RTZA 4KRTA 1H92A 2KBTA 5L23A 1ABOA 4Z8AA 4FSSA 1ZUKA 3NMZC 2AZSA 1M27C 5IHKA 1ZSGA 3UATA 2LCSA 2ROTA 2X3WD 4J9BA 1G83A 2OJ2A 1Y57A 2DF6A 1SSHA 2GTOA 4JZ4A 4RTWA 2LX7A 1Z9ZA 1U06A 2DE0X 2DBKA 2KNBB 3VS1A 5IH2A 1UTIA 2DBMA 3NPFA 4F17A 3UA7A 4RTYA 4CC7A 3I9QA 2YSQA 3KFVA 3ULRB 4ESRA 3QWYA 2LZ6B 1UJYA 2RQRA 1AVZC 3EHRA 4D8KA 2K79A 5FWCA 1AWJA 2CH4A 4LN2A 1T0HA 4RTXA 1AZGB 4LUDA 1QKXA 1WIEA 2OI3A 1GCQC 2G6FX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5Z A;  4RTV A;  2KRO A;  2J06 A;  4JJB A;  2O2O A;  3VS0 A;  4CC3 A;  1YWO A;  2D8H A;  4F14 A;  2LJ0 A;  1YCS B;  3EG0 A;  3O5Z A;  2L3P A;  2F2X A;  4LNP A;  2LJ3 A;  1PKT A;  3M0R A;  4HCK A;  1KFZ A;  2KRS A;  2CSI A;  3IQL A;  2BTT A;  2DJQ A;  2J6O A;  2FG0 A;  2JW4 A;  2ENM A;  2EYY A;  3NGP A;  1QCF A;  1GBQ A;  1WDX A;  3EHQ A;  1UG1 A;  2QDL A;  1UFF A;  1X69 A;  2KYB A;  4DEY A;  2D1X A;  3VS3 A;  1ZUY A;  2O9S A;  2BZY A;  3A98 A;  1MV0 B;  3R6N A;  2A08 A;  1EFN A;  1PHT A;  2DIL A;  2DL8 A;  1U3O A;  1U5S A;  2I0N A;  1V1C A;  1UE9 A;  1E6H A;  3H0F A;  2KEA A;  4Y92 A;  2JT4 A;  4GLM A;  4LE9 A;  3SEM A;  2ROL A;  1YNZ A;  2K3B A;  1TUC A;  2OAW A;  4AFU C;  4D8D A;  2D8J A;  1ZBJ A;  2JTE A;  2NUZ A;  3M0S A;  1G2B A;  2P4R A;  1FMK A;  4Z89 A;  2KT1 A;  1M8M A;  2EPD A;  4J9E A;  1GL5 A;  4OMM A;  2DL4 A;  1X6G A;  2AKK A;  4AFZ C;  2GNC A;  2CT4 A;  1QWE A;  1WI7 A;  5IXB A;  3PVL A;  3FJ5 A;  1B3Q A;  4X1V A;  4IIM A;  1VYT A;  2CDT A;  2FPE A;  4K11 A;  1AWW A;  1T0J A;  2DYB A;  1WYX A;  1JQQ A;  4OMN A;  3M0Q A;  3REB B;  2DM1 A;  2E5K A;  1T3S A;  2DNU A;  2FO0 A;  4QT7 A;  3I35 A;  1HSQ A;  2NWM A;  4HVU A;  3GBQ A;  1AZE A;  1Z9Q A;  1FYN A;  1WXU A;  3VRZ A;  3M0U A;  4J9I A;  3U23 A;  4LUE A;  2RNA A;  2LMJ A;  1MUZ A;  2ED1 A;  2FPF A;  3PVQ A;  1NYG A;  2EW3 A;  4AFQ C;  5IHN A;  2RPN A;  2LNH B;  4ORZ A;  1W70 A;  2DA9 A;  4J9D A;  1B07 A;  2CH4 W;  2CUD A;  2L2P A;  4R0K A;  1CKB A;  1NEB A;  4A63 B;  2MCN A;  1NG2 A;  2DLP A;  4DEX A;  1K4U S;  2L3Q A;  1GCQ A;  4RTT A;  3VS7 A;  4WCI A;  2AZV A;  2X3X D;  2DMO A;  2RN8 A;  2YDL A;  1I1J A;  1OOT A;  2KRN A;  2HBW A;  2J7I A;  1RLQ C;  2KE9 A;  2KT8 A;  2GTJ A;  1AWO A;  3VS6 A;  2EGA A;  4JJD A;  1KIK A;  2V1Q A;  2W0Z A;  5HCK A;  1GCP A;  2CUB A;  1ZUU A;  2CRE A;  1M3A A;  4OML A;  2FEI A;  1M30 A;  1WFW A;  1RI9 A;  1YN8 A;  2EGE A;  1WXT A;  1VA7 A;  5GJV B;  3VS4 A;  2HCK A;  1TUD A;  2RQV A;  5IHI A;  1X43 A;  1ZX6 A;  3H41 A;  2JMA A;  1JO8 A;  4J9H A;  4ZNX A;  2AKL A;  2JS0 A;  1M3B A;  2EGC A;  4JJC A;  1X6B A;  1SEM A;  4OMQ A;  1J3T A;  2EYX A;  1W6X A;  1ABQ A;  2KXC A;  1OPK A;  2V1R A;  2A37 A;  2EVR A;  2RF0 A;  1X27 A;  1E7O A;  1QKW A;  4E6R A;  2YT6 A;  3RBB B;  2K2M A;  1K9A A;  4OMP A;  1A0N B;  2VKN A;  1UEC A;  1PWT A;  1QLY A;  1JXO A;  1H8K A;  2FRY A;  2D0N A;  2O88 A;  4AG2 C;  1UDL A;  2PNI A;  2M0Y A;  2W10 A;  3ZL7 C;  1KJW A;  2A36 A;  2C0O A;  2EBP A;  1ARK A;  1PRM C;  1SPK A;  2DL3 A;  5EC7 A;  2K6D A;  1UUE A;  2EYZ A;  1PNJ A;  5ECA A;  2GGR A;  2JS2 A;  1WX6 A;  4J9C A;  3I5S A;  2MOX A;  3VS5 A;  2YUN A;  1XOV A;  3THK A;  3EG3 A;  2A28 A;  2LQW A;  3RNJ A;  3H0H A;  1GBR A;  1CKA A;  1SRL A;  2H8H A;  3PE0 A;  1IO6 A;  1TG0 A;  2IIM A;  2RQT A;  1NYF A;  4IIO A;  1UJ0 A;  1UHC A;  2L0A A;  4OMO A;  1CSK A;  4M4Z A;  5I22 A;  2LJ1 A;  2RQW A;  2KGT A;  2EQI A;  4JZ3 A;  1GFC A;  5FW9 A;  3SHW A;  2K9G A;  3H0I A;  2F2W A;  2ECZ A;  4RUG A;  3REA B;  1JXM A;  2BZX A;  1M3C A;  1AWX A;  2KR3 A;  1T3L A;  2FPD A;  2M51 A;  2JM8 A;  2O31 A;  2VVK A;  1JU5 C;  1YWP A;  1I07 A;  1YP5 A;  2J6K A;  1QWF A;  3C0C A;  3VRY A;  2YUQ A;  1NLP C;  1AEY A;  1GFD A;  3LH5 A;  4HVW A;  2ESW A;  2HEQ A;  4AFS C;  1BK2 A;  1Y0M A;  5IXF A;  3EG1 A;  2SRC A;  2L3S A;  2LQN A;  3CQT A;  1SHG A;  2BZ8 A;  3I5R A;  1SHF A;  2C0T A;  1LCK A;  1VYV A;  2DRK A;  1K1Z A;  2EYW A;  1WLP B;  5GJW B;  3JV3 A;  2GQI A;  3EG2 A;  2DL5 A;  2XMF A;  1JEG A;  4CC2 A;  1KSW A;  2FRW A;  3M0P A;  1I0C A;  2ABL A;  2CT3 A;  1PRL C;  2J05 A;  2VWF A;  4J9G A;  1S1N A;  4F16 A;  1NM7 A;  3TSZ A;  4JPB W;  1GRI A;  3UF4 A;  1RLP C;  1AD5 A;  2K7A A;  2EKH A;  2B86 A;  2DVJ A;  1ZLM A;  2KYM A;  1UHF A;  2JM9 A;  2DL7 A;  2DRM A;  1K76 A;  1NLO C;  1BB9 A;  4J9F A;  4GBQ A;  1W1F A;  2RQU A;  2JMC A;  1UGV A;  1WA7 A;  2PTK A;  2JXB A;  1OV3 A;  1MV3 A;  4RTU A;  1BBZ A;  2ED0 A;  4Z88 A;  2GBQ A;  1K0X A;  1SRM A;  3VS2 A;  1X2Q A;  2HDA A;  1HJD A;  2RMO A;  2C0I A;  1AOJ A;  2KRM A;  3M0T A;  2DX1 A;  3TSW A;  2AK5 A;  2J6F A;  1X2K A;  2LP5 A;  4AG1 C;  4CC4 B;  2MIO A;  2YUO A;  1RUW A;  1OEB A;  5I11 A;  2HSP A;  2F2V A;  1H3H A;  2O9V A;  2SEM A;  1K0S A;  2YUP A;  2PZ1 A;  3TVT A;  4HXJ A;  3QWX X;  1NEG A;  2CSQ A;  3NHN A;  1E6G A;  4HVV A;  1BU1 A;  4EIK A;  1WXB A;  3EGU A;  1PKS A;  5FWB A;  1OPL A;  3UA6 A;  1HD3 A;  1VYU A;  2KXD A;  4RTZ A;  4KRT A;  1H92 A;  2KBT A;  5L23 A;  1ABO A;  4Z8A A;  4FSS A;  1ZUK A;  3NMZ C;  2AZS A;  1M27 C;  5IHK A;  1ZSG A;  3UAT A;  2LCS A;  2ROT A;  2X3W D;  4J9B A;  1G83 A;  2OJ2 A;  1Y57 A;  2DF6 A;  1SSH A;  2GTO A;  4JZ4 A;  4RTW A;  2LX7 A;  1Z9Z A;  1U06 A;  2DE0 X;  2DBK A;  2KNB B;  3VS1 A;  5IH2 A;  1UTI A;  2DBM A;  3NPF A;  4F17 A;  3UA7 A;  4RTY A;  4CC7 A;  3I9Q A;  2YSQ A;  3KFV A;  3ULR B;  4ESR A;  3QWY A;  2LZ6 B;  1UJY A;  2RQR A;  1AVZ C;  3EHR A;  4D8K A;  2K79 A;  5FWC A;  1AWJ A;  2CH4 A;  4LN2 A;  1T0H A;  4RTX A;  1AZG B;  4LUD A;  1QKX A;  1WIE A;  2OI3 A;  1GCQ C;  2G6F X; 
#chains in the Genus database with same CATH topology
 1N5Z A;  4JJB A;  3RER A;  4EMG A;  3MCA B;  4M78 D;  4CC3 A;  2D0Q B;  1LNX A;  4JDS A;  4M77 D;  3MEW A;  4HT8 A;  1PKT A;  4HCZ A;  2XDD A;  3M4G A;  1TUG B;  2QDY B;  2KRS A;  1YIJ T;  5LJ3 h;  2ZGW A;  3PTA A;  3CCJ T;  5KE2 A;  2FG0 A;  2JW4 A;  2ENM A;  2EYY A;  3JSC A;  5CKD A;  1Q95 G;  5D7U A;  4C8Q G;  1WDX A;  3EHQ A;  4M75 F;  1UG1 A;  2QDL A;  2RI5 A;  3LWI A;  1QVF P;  3OYD A;  3M56 A;  4YTL A;  3CMA A;  1EFN A;  1PHT A;  2DTI A;  4L6V 5;  3FJP A;  3OYG A;  1U3O A;  1XJW B;  1V1C A;  2MWP A;  2F1L A;  3H0F A;  1BCO A;  2KEA A;  4OB3 B;  3OW2 S;  1VQL T;  2ROL A;  3G7Z A;  5GAM g;  4B9X A;  2K3B A;  5D6Y A;  1TUC A;  2OAW A;  4RG8 A;  4NS5 A;  4C8Q B;  3JB9 I;  1G2B A;  2I2L A;  2EFI A;  2OX7 A;  1G3W A;  2QAZ A;  5C0M A;  5GAN f;  1YIT Q;  2KT1 A;  3MPU B;  1QP3 A;  2QXF A;  1GL5 A;  4OMM A;  4R55 A;  3L1A A;  2MF2 A;  4QVD A;  1W2B S;  4AT1 B;  1N27 A;  5M9O A;  4OVA A;  4BI8 B;  3QYH B;  4C8Q C;  1TSF A;  3PVL A;  1PM3 A;  3SB2 A;  5GAN 2;  4E2F B;  2WSF E;  4X1V A;  4KGX B;  2CDT A;  4K11 A;  2LQ8 A;  2DYB A;  2DER A;  1JQQ A;  4E7S A;  4OB1 B;  1K8A C;  2COZ A;  4CI0 C;  2DM1 A;  2QK0 A;  3BDL A;  2CZ7 B;  3M4Y A;  3S3N A;  2A0F B;  3CMA T;  4QT7 A;  3I35 A;  2FZG B;  1D3B B;  2NWM A;  3CCR A;  1Z9Q A;  4O6J A;  1WXU A;  3M0U A;  4HA8 A;  4LUE A;  2RNA A;  3SFM A;  2ED1 A;  2MK5 A;  1RL2 A;  4FW1 A;  2FPF A;  3L2Q A;  2X35 A;  5IHN A;  2RPN A;  1VQ7 Q;  2RK2 A;  4M7D B;  2DEU A;  2XDP A;  3OYY A;  5GAM e;  1WJS A;  2L3Q A;  1WHM A;  3SDZ A;  5J3B A;  1GCQ A;  2HSE B;  2R5A A;  4NL3 A;  4PJO D;  4BUG A;  2E64 A;  5HK0 A;  3GIB A;  5GMK l;  3G71 Q;  2DMO A;  2RN8 A;  2XI9 A;  2M16 A;  2LX9 A;  4MZT A;  4M7D A;  1OOT A;  3ME9 A;  1YJN A;  1XNI A;  2KE9 A;  4M7D C;  4BE1 A;  2VXE A;  3OS1 A;  1V29 B;  5D6X A;  1BYM A;  4FSX A;  4M78 A;  3VS6 A;  3JCM e;  2V1Q A;  2LNV A;  3CCR T;  3CBP A;  1ZUU A;  3OYJ A;  4IUP A;  4BY6 B;  1KQS P;  2FEI A;  1YN8 A;  4XTW A;  3PIO A;  2EGE A;  1IB8 A;  3CCQ Q;  4GY5 A;  3CME Q;  2RQV A;  2L8D A;  4KH0 B;  3PT9 A;  3JCM b;  2NUP B;  5FRM A;  4BY6 C;  3TU4 K;  2E70 A;  1SEM A;  3EAE A;  1TXQ A;  1J3T A;  2V1R A;  2A37 A;  1G8X A;  2EVR A;  4JS5 A;  2RF0 A;  4HCB A;  3CBM A;  2P0K A;  1G5V A;  4VUB A;  4E7J A;  1YJN T;  2PUK B;  4NL2 A;  3FRN A;  4C8Q E;  5GAM h;  3DLM A;  4OMP A;  3OY9 A;  2NYS A;  1PWT A;  4A53 A;  3MO8 A;  1JXO A;  3CME A;  4PNO A;  3RR6 A;  4FU6 A;  3QUI A;  2D0N A;  1QVG S;  2X4J A;  5LJ5 d;  1KJW A;  2K5L A;  2A36 A;  4GLK A;  2EBP A;  2DL3 A;  3QDR B;  2LQK A;  2K6D A;  3JCM h;  2EYZ A;  2FYK A;  2DET A;  4KUI A;  4IUU A;  1QVP A;  2HZY A;  2PQW A;  3I5S A;  5HKC A;  3THK A;  3HFO A;  2PVG B;  4B9W A;  2WSC E;  2P84 A;  2OTL A;  3RNJ A;  1R8O B;  2RQT A;  2M9U A;  5L8R E;  3SWN C;  3EFO A;  5HK3 A;  2QTV A;  4LDV A;  4EMK A;  2RQW A;  1JRI A;  5GAN 7;  1QCN A;  5HY6 A;  3QHS A;  2ECZ A;  2IPO B;  4RUG A;  3CME T;  2EWN A;  1AWX A;  2M51 A;  3QXE B;  4PJO A;  2VVK A;  5A0D A;  1Q81 U;  2QEX Q;  3VRY A;  1QWF A;  1VQ9 A;  3CCE A;  1NLP C;  2K3X A;  4JLI A;  4PJJ A;  3OMG A;  3GF5 A;  2SRC A;  2Y90 A;  4OGE A;  1SHG A;  2BZ8 A;  5CQX A;  5GAN d;  3M54 A;  3UT1 A;  4C8Q F;  5CCA A;  4XQ3 A;  2DRK A;  1K1Z A;  3TEE A;  3ZFJ A;  4XTY A;  1JEG A;  4L59 A;  2COY A;  2X4W A;  4M75 G;  1KSW A;  2DXT A;  1IZ6 A;  3A1P A;  2FRW A;  5A0L A;  3M0P A;  1I4K 1;  2ABL A;  2RI3 A;  2J05 A;  3QII A;  3HRS A;  1N9R A;  1GRI A;  3QJ6 A;  2K7A A;  1AD5 A;  1Q81 R;  2DVJ A;  1ZLM A;  2CP6 A;  5I2S A;  3J7A F;  1BB9 A;  1PSF A;  1R77 A;  1TOV A;  4UC4 A;  1W1F A;  2RQU A;  4PL6 A;  3OS0 A;  2EKO A;  1UB4 A;  3NTK A;  4M75 B;  3PMI A;  3E19 A;  1PSE A;  1U1T A;  2JXB A;  1OV3 A;  1N6A A;  2ED0 A;  2VB6 A;  3CCE T;  2GCX A;  4A4G A;  2DXU A;  2HDA A;  1I5O B;  1AOJ A;  3M0T A;  1RAD B;  2LP5 A;  1OEB A;  3C95 A;  5I11 A;  3M53 A;  2HSP A;  2O9V A;  1VQ5 Q;  4M75 C;  5KYX A;  2PZ1 A;  1YHQ A;  4DBQ A;  3TVT A;  3CCM Q;  4PJM A;  4HXJ A;  1IGQ A;  1NEG A;  2R58 A;  3RKW A;  3CC7 A;  2F5T X;  5IN1 A;  3I55 A;  3EG9 A;  3HPW A;  2E4H A;  4XTU A;  3UA6 A;  1HD3 A;  4R56 A;  2CYZ B;  2LT4 A;  2KXD A;  2JN0 A;  3M9Q A;  1UEB A;  1JB0 E;  1N8R U;  5C6S A;  2DJZ A;  3JCM Q;  3NMZ C;  5DY9 A;  1ZSG A;  1M4Z A;  2X3W D;  1QVG A;  1G83 A;  4A4K A;  1VQ5 A;  4JZ4 A;  1SSH A;  2GTO A;  2DE0 X;  2KNB B;  4FT2 A;  3QJY A;  4JRQ A;  1NBE B;  4CC7 A;  3I9Q A;  2YSQ A;  3KFV A;  3CEY A;  1QVF S;  3HFN A;  1AVZ C;  1M90 U;  3LGL A;  2K79 A;  5FWC A;  2K3Y A;  2RI2 A;  2QQA A;  1G3S A;  1YHQ T;  4LN2 A;  2R5M A;  1T0H A;  4RTX A;  4LUD A;  3J81 E;  3CC7 T;  4E7Z A;  1N8R R;  3I55 T;  2KRO A;  3JCM P;  3PIP A;  2O2O A;  4ATO A;  3HL8 A;  1YFN A;  2YRC A;  2LJ0 A;  2GQV A;  3EG0 A;  3O5Z A;  4LNP A;  5GAO n;  1KFZ A;  1D0X A;  2CSI A;  1ZSZ B;  1X01 A;  2DJQ A;  3NGP A;  4BI4 A;  3KUF A;  4DA4 A;  1GBQ A;  1ZHI A;  1UFF A;  2KYB A;  5CK9 A;  2D9T A;  2D1X A;  4E47 A;  1ZSZ A;  3T9N A;  1S72 Q;  1VQ5 T;  1M90 R;  2KQW A;  2KMT A;  2DL8 A;  3QDF A;  3CCM T;  1U5S A;  2I0N A;  3DKM A;  1UE9 A;  3OS2 A;  1LPL A;  2VGN A;  4GLM A;  4IUR A;  5GAO l;  2D8J A;  4XAX B;  1FMV A;  3M0S A;  3H9N A;  1XTD A;  4J8O A;  1OU9 A;  4C8Q D;  2Z0W A;  4LD6 A;  1YI2 A;  4M75 E;  1YBY A;  1NE8 A;  2PVO B;  1X6G A;  2AKK A;  2GNC A;  5GAN g;  2RA2 A;  2HQX A;  2CT4 A;  2RJC A;  3LGF A;  5LJ5 e;  3FJ5 A;  1B3Q A;  2QQ9 A;  1K8A U;  2P4T A;  2IG0 A;  3REB B;  4QQD A;  4RMO A;  2E10 A;  2KSS A;  4QKU A;  2E5K A;  1T3S A;  1QCO A;  2XDB A;  4MML A;  2DNU A;  2XID A;  2HL3 A;  2E6N A;  4Z02 A;  3OA6 A;  1M8V A;  2QGG A;  3V8L A;  2FL7 A;  3GBQ A;  1AZE A;  3VRZ A;  1M9S A;  4J9I A;  3NTH A;  2DK3 A;  2ZPI B;  2BE9 B;  3CCL A;  4FYV B;  5KH6 A;  5KYN A;  2R57 A;  1KQS S;  1W70 A;  1HXD A;  1MMD A;  3EGX B;  4E7K A;  2X4X A;  4J9D A;  1B07 A;  2CH4 W;  2CUD A;  2L2P A;  3A8L B;  3BFM A;  1M90 C;  4O5V A;  1UGP B;  1NEB A;  1K8A R;  2CS7 A;  1GXI E;  1D0Y A;  2EAY A;  3S3O A;  4N4H A;  3EGX A;  1I1J A;  4ANJ A;  3FC3 A;  2KRN A;  4WTO B;  2DO3 A;  1NPP A;  1OX9 A;  3OYK A;  3HRU A;  2GTJ A;  2DAQ A;  2EGA A;  5HCK A;  5KCO A;  5LJ5 h;  1GCP A;  2P0Q A;  1M3A A;  1BI0 A;  1M30 A;  5CKH A;  1QVF A;  3BW1 A;  1VQM Q;  3PFS A;  3CCL T;  1QP2 A;  4LDY A;  1TUD A;  4BDZ A;  3OSV A;  2IVW A;  1Y07 A;  2RM4 A;  3H41 A;  4C92 G;  3V7C A;  1YJ9 Q;  3J80 E;  1M1K C;  4JJC A;  1IHW A;  2LCL A;  2E5Q A;  2EYX A;  1W6X A;  3RMS A;  3RIR A;  4F7U G;  1VQO Q;  4E7I A;  4C8Q A;  2K2M A;  5GMK j;  4A54 A;  2FVU A;  2Y4X A;  4C92 B;  2VKN A;  2CZ6 B;  1M2O A;  2YRD A;  1M2V B;  2CZ0 B;  1H8K A;  4BE2 A;  2NLU A;  1UDL A;  2CZ1 B;  2M0Y A;  4Q5W A;  1MHN A;  1FWZ A;  2ZPH B;  3FLG A;  2VXF A;  1ARK A;  1PRM C;  2QGF B;  1M2V A;  4C92 C;  1YIT A;  4MZM A;  2B8A A;  4JUV A;  3TCJ A;  1O75 A;  2QG9 B;  2JUF A;  4XTX A;  2YUN A;  4XK8 E;  5GAO r;  5CKF A;  2A28 A;  1D3B A;  3H0H A;  1VQ8 Q;  1TG0 A;  2IIM A;  1M1G A;  1O9S A;  4ZTJ A;  1M5Q 1;  5DM7 R;  4IIO A;  3X20 B;  1UJ0 A;  2L0A A;  2JJ9 A;  1CSK A;  2KK4 A;  2F5K A;  2LJ1 A;  4J7F A;  2KGT A;  1VQM T;  3TRE A;  4JZ3 A;  1GFC A;  1YJW Q;  3SHW A;  3H0I A;  2DEQ A;  3REA B;  2FPD A;  2O31 A;  1D1C A;  1MMN A;  2YUQ A;  1AEY A;  1PCX A;  2DVE A;  1GFD A;  1WGS A;  4QQ6 A;  4TVR A;  3GNF B;  4HVW A;  2X9H A;  2E3H A;  5IXF A;  2BE7 D;  3UDC A;  4RKU E;  4BI3 A;  2L3S A;  1VQ7 A;  3L42 A;  1YIT T;  3LW5 E;  1KQS A;  5FU7 C;  3CPF A;  3I5R A;  1SHF A;  2ZPB B;  1MMG A;  2OAU A;  3M58 A;  1LCK A;  1VYV A;  5GJW B;  3EG2 A;  1VUB A;  2BUD A;  2DL5 A;  1D0Z A;  2LC4 A;  3G71 A;  2A7Y A;  1I0C A;  1WQW A;  2CT3 A;  4ELZ C;  1KG1 A;  2VWF A;  1DJ7 B;  3QKJ A;  4F16 A;  1NM7 A;  4JPB W;  2EKH A;  2VUB A;  2CP3 A;  2EJG A;  2LT1 A;  2KYM A;  2P0P A;  4DBH A;  2CP7 A;  2DRM A;  3VV0 A;  2NUP A;  1NLO C;  4J9F A;  3OYB A;  3MJX A;  1XQH A;  3D7S B;  2PTK A;  4C5H A;  3N5B B;  3A8M B;  1BBZ A;  4M75 D;  1SRM A;  1ZBX A;  3JCM V;  2RMO A;  2C0I A;  3CCQ A;  2KRM A;  2DX1 A;  2E12 A;  2WAC A;  1RAH B;  1RUW A;  3JCM f;  1VQ7 T;  1KD1 C;  5LJ3 j;  2F2V A;  1H3H A;  1K0S A;  3JRZ A;  3QWX X;  4C92 E;  3NHN A;  3SWN B;  5I21 A;  4HVV A;  2YRV A;  1BU1 A;  3G71 T;  2RHI A;  3EGU A;  1PKS A;  1OPL A;  2E6Z A;  5GAN 3;  5EG2 A;  5A0G A;  4XU1 A;  4F7U E;  2AHJ B;  4KRT A;  5CO7 A;  4BB7 A;  1H92 A;  5DLO A;  3VKI A;  1PC0 A;  2XKO C;  2E65 A;  3SWN A;  4RCC A;  2M0O A;  2JNG A;  1UGQ B;  4FSS A;  1ZUK A;  4DBR A;  2AZS A;  5IHK A;  1I8F A;  3OQ5 A;  3UAT A;  4J9B A;  1RAB B;  3L2U A;  1Y57 A;  3EFS A;  4RTW A;  1OI1 A;  4J6W A;  1VQP Q;  3A8O B;  4XU3 A;  3UA7 A;  3CCQ T;  3VYH B;  2F69 A;  2CP2 A;  3QSU A;  1AHJ B;  1UJY A;  4JRP A;  3BY7 A;  2RQR A;  4D8K A;  4HCC A;  3JB9 H;  2YWW A;  1QKX A;  3OYL A;  2OI3 A;  1RAE B;  1PG5 B;  1YWO A;  2LVM A;  1WHH A;  2L3P A;  4J83 A;  2LJ3 A;  3V8K A;  3M0R A;  3IQL A;  1IXD A;  5CAI A;  3E1S A;  4A4E A;  2DIG A;  2RJD A;  4C0D C;  2QQS A;  4OB0 B;  2KAF A;  2QQR A;  4JLG A;  1VIE A;  1VQP A;  4PKC C;  1QCF A;  1Y96 B;  4M77 E;  3JCM X;  1KQ2 A;  1X69 A;  4DEY A;  4C92 F;  3VS3 A;  2QEX A;  3FDR A;  2BZY A;  4ZTF A;  4F04 B;  2DIL A;  2MWO A;  2O4X B;  3DB4 A;  1SSF A;  1Y96 A;  1MNE A;  1Q7Y C;  1VQ4 Q;  1E6H A;  4FT4 A;  2LDM A;  1VIF A;  4F7U F;  4X9D A;  2JT4 A;  2RHY A;  2QA4 Q;  2FZC B;  4RG2 A;  1YNZ A;  3M59 A;  3M5A A;  4AFU C;  4D8D A;  1ZBJ A;  3JB9 G;  2NUZ A;  2EYQ A;  3LLR A;  2P4R A;  3S3M A;  4PJN A;  1TTH B;  4Y91 A;  1FMK A;  4Z89 A;  1JJ2 P;  3G6E Q;  3ZEH A;  2EPD A;  1KQ1 A;  2MYS A;  2JZ2 A;  3MEV A;  4M75 A;  2DL4 A;  2JVV A;  2C06 A;  3M55 A;  5KYW B;  3X24 B;  1BIA A;  3CPW P;  1Y7X A;  1HYO A;  1QWE A;  1M1F A;  2HQH A;  4IIM A;  1OYX A;  1VQ4 A;  1VYT A;  1VQP T;  1AWW A;  3C12 A;  1G3Y A;  5FLX E;  2JTF A;  3M0Q A;  2QA4 A;  3OYM A;  1WHG A;  4NOY A;  2H3E B;  2QEX T;  2YLB A;  3OB9 A;  1X6O A;  3CC2 Q;  3G6E A;  3QG1 A;  1Y71 A;  4FW2 A;  1U1S A;  1I81 A;  2FB7 A;  4N4G A;  1FYN A;  3U23 A;  2LMJ A;  4QQG A;  1MUZ A;  3GP8 A;  3BE3 A;  4M78 F;  2K5F A;  4EPC A;  3CCM A;  1B34 B;  1QQJ A;  4M77 F;  5GAO p;  2EW3 A;  3QZ9 B;  1LVK A;  3ZBD A;  2LNH B;  1FMW A;  2EQU A;  2NUT B;  3OYF A;  5GAM j;  4II1 A;  2MCN A;  4A63 B;  2COW A;  3JCM W;  1AT1 B;  4E7H A;  4MDX A;  3VS7 A;  2AZV A;  3CC2 A;  3H8Z A;  4JRK A;  1X75 C;  1C0M A;  5A2Q E;  3JB9 J;  2NUT A;  5GAN 5;  4IKF A;  2HBW A;  2J7I A;  1VQ4 T;  2KT8 A;  2QA4 T;  4C0G A;  4JJD A;  1KIK A;  4KBM B;  3I56 Q;  1ZA1 B;  2AT1 B;  2CGH A;  2XD0 A;  5KCH A;  1BCM A;  4LDX A;  5FU6 B;  3G6E T;  1F1B B;  4OML A;  3UWN A;  3R6O A;  1YCY A;  2RHU A;  1WFW A;  3JCM d;  2DFU A;  3V8J A;  2BIV A;  5GJV B;  2LRQ A;  4PK4 A;  1D09 B;  3L2Z A;  3CD6 Q;  1SKU B;  1WHL A;  1X43 A;  1ZX6 A;  2JMA A;  4J9H A;  3KXT A;  4PJL A;  5FU6 C;  1NPR A;  1M1K U;  1M3B A;  2EGC A;  1KHI A;  1X6B A;  1ABQ A;  1RI0 A;  3I56 A;  4LXC A;  3CC2 T;  3MET A;  1P92 A;  4KH1 B;  1YIJ Q;  3RKX A;  3FB9 A;  3CXC A;  1Q86 U;  3P8D A;  3CXC P;  2YT6 A;  3RBB B;  4M7A G;  3LWH A;  1S72 A;  4J6X A;  4Y28 E;  2DXC A;  1QLY A;  3QYG B;  3CD6 A;  2QYZ A;  4C92 D;  5DLQ E;  5FRO A;  3GLX A;  3V7R A;  2PNI A;  2W10 A;  3X28 B;  4C5G A;  6AT1 B;  1M1K R;  1SPK A;  2CP0 A;  1UUE A;  1V76 A;  3G4S Q;  1VQL Q;  4M7A B;  1WX6 A;  4PJO F;  4J9C A;  3P8H A;  2XU8 A;  5GAO m;  5I2M A;  2DD4 A;  5FRN A;  3EG3 A;  7AT1 B;  2LQW A;  3PGG A;  1Q86 R;  1GBR A;  4XU0 A;  1CKA A;  1SRL A;  1IO6 A;  3I56 T;  4D6W A;  3EFR A;  1KHC A;  1NYF A;  2K2V A;  3EGD B;  4ZGD B;  4M7A C;  3QZ5 B;  4AMC A;  4QVZ A;  3ASK A;  1VQK Q;  4V2S A;  2OTJ Q;  5I22 A;  5LJ3 f;  1S72 T;  4PFO A;  1RAF B;  2EQI A;  5GAN 4;  1KC8 U;  3RES A;  3CD6 T;  3G4S A;  1R0B G;  4N0A C;  2GFA A;  2BZX A;  5LJ5 f;  2XG8 D;  2JM8 A;  2VAS A;  2CKK A;  1YWP A;  5GAN e;  1YP5 A;  2J6K A;  3CMA Q;  3LH5 A;  1D1B A;  2ESW A;  3BDU A;  2HEQ A;  4FYW B;  5J39 A;  3OYA A;  1UGS B;  3EG1 A;  2LQN A;  2RHZ A;  3CQT A;  2EQK A;  2EYW A;  1WLP B;  3AT1 B;  3JV3 A;  3RDV A;  3CCS Q;  2GQI A;  2DPP B;  1VQK A;  2OTJ A;  1B7T A;  3HTR A;  8AT1 B;  4X9C A;  2XMF A;  2G3R A;  2HKQ B;  1KC8 R;  3OYI A;  2DTO A;  3UF4 A;  1OZ2 A;  2WSE E;  1RLP C;  1RAA B;  4DQ2 A;  3RUX A;  1UHF A;  4RCB A;  3JB9 F;  2JM9 A;  4ZGJ B;  1Q82 C;  2DL7 A;  4E7L A;  1D1A A;  3X26 B;  2VYT A;  4FCY A;  3G4S T;  1K9M C;  1H64 1;  1SF9 A;  2PU9 B;  4MZP A;  1UGV A;  1WA7 A;  2DD5 A;  5AYF A;  4MMK A;  1Q86 C;  1OX8 A;  3CCS A;  4RTU A;  1VQM A;  2GBQ A;  1K0X A;  3E9G A;  1HJD A;  3CCR Q;  1NZ9 A;  3TSW A;  2AK5 A;  2J6F A;  4AG1 C;  2YUO A;  4KGZ B;  1KD1 U;  5GAO q;  4F7U B;  1YJ9 A;  2SEM A;  2DXB A;  2YUP A;  2DKG A;  4C92 A;  3VUB A;  3CBO A;  1VQK T;  2OTJ T;  3JCM g;  4OP0 A;  5GAN h;  4LDU A;  1E6G A;  3ER0 A;  5CVI A;  3HP9 A;  1RAC B;  1VQO A;  2KVQ G;  1IHV A;  4OGC A;  5KYY B;  5FWB A;  4F7U A;  3GOX A;  3CC4 Q;  4RTZ A;  1PD1 A;  2KBT A;  1ABO A;  4M7D G;  3L2W A;  1R0C B;  2VV5 A;  1K73 U;  5KYY A;  1YJN Q;  4M7A E;  3JCM c;  1M27 C;  4M78 G;  4BDY A;  2LCS A;  3WXM B;  2ROT A;  1FX7 A;  4M77 G;  1KD1 R;  2RJE A;  3CCS T;  1Z9Z A;  3FEO A;  4JRI A;  1KC8 C;  2MPX C;  5FU7 B;  4PFP A;  3S6W A;  4ESR A;  3TQ7 P;  3CCV Q;  3QWY A;  2LZ6 B;  1YJ9 T;  1BI1 A;  3EHR A;  3CC4 A;  4FYY B;  1ACM B;  1AWJ A;  4M78 B;  1VQ8 A;  2E3I A;  1WIE A;  2ZCF B;  1GCQ C;  4M77 B;  3SD4 A;  2G6F X;  4RTV A;  2J06 A;  3M57 A;  3VS0 A;  1VQO T;  1MMA A;  2D8H A;  1RAG B;  4F14 A;  1K73 R;  1YCS B;  2M1H A;  2F2X A;  4HCK A;  1ZA2 B;  2YXY A;  2BTT A;  4ELY C;  1I5L A;  1JJ2 S;  2J6O A;  3HSB A;  3FIF A;  4M77 A;  2RJF A;  4JJN K;  1YJW A;  2QQB A;  4M78 C;  3UPU A;  1TU0 B;  4M77 C;  5IAY A;  1G3T A;  3CCV A;  3CPW S;  1VQ6 Q;  2PUO B;  2M02 A;  1ZUY A;  2O9S A;  3DLL A;  3A98 A;  3O8V A;  2YHT A;  1MV0 B;  3R6N A;  2A08 A;  5GMK m;  1QW1 A;  1RAI B;  5GAM f;  1Q7Y U;  4Y92 A;  4LE9 A;  2PVD B;  3SEM A;  3EH1 A;  2JTE A;  2Y4Y A;  3CC4 T;  4M7A F;  3LH0 A;  1VQ8 T;  4HKE A;  3QBY A;  1M8M A;  1WJR A;  4J9E A;  3MKD A;  1SG5 A;  2X51 A;  2L3R A;  3E9F A;  4AFZ C;  1VQ6 A;  3MP8 A;  3MEU A;  1WI7 A;  3H6Z A;  2OTL Q;  5IXB A;  5KYU B;  5LJ5 j;  3OYH A;  4LD9 K;  3VU3 C;  2HQE A;  5LJ3 d;  4XU2 A;  1YJW T;  1NJI U;  2FPE A;  1T0J A;  1Q7Y R;  1WYX A;  2KI7 A;  4OMN A;  4BAC A;  3CCV T;  3OW2 A;  3OW2 P;  3JB9 D;  4A4H A;  5KYU A;  1EZZ B;  2FO0 A;  3QO3 A;  2X4Y A;  1TH7 A;  2E41 A;  1HSQ A;  4PJO G;  1KK7 A;  5GAN 8;  4JS4 A;  4J7I A;  3DB3 A;  4HVU A;  4PFZ A;  1K73 C;  4FIB A;  1C1A A;  3MHX A;  3EFO B;  2RHX A;  1VQ9 Q;  3CCE Q;  3L2R A;  1W2B A;  1W2B P;  3PVQ A;  4EMK B;  1NYG A;  1MGQ A;  1OQK A;  4IUT A;  2QTX A;  3F70 A;  4AFQ C;  2KY9 A;  4ORZ A;  4XTZ A;  2FHD A;  1WHJ A;  2DA9 A;  2O01 E;  4R0K A;  1CKB A;  1NJI R;  2HNI A;  4PJO B;  3MP1 A;  1NG2 A;  2DLP A;  4FM4 B;  4OF1 A;  4C0D B;  4DEX A;  1VQ6 T;  1K4U S;  3OMC A;  4RTT A;  2HKN A;  4J5Y A;  9ATC B;  3A8H B;  3HRT A;  4WCI A;  2MMP A;  2DIQ A;  4EMK C;  4N4I A;  2X3X D;  2EJ9 A;  2RH2 A;  2YDL A;  4L5G A;  2VGM A;  1N9S A;  4M7D E;  1RLQ C;  1AWO A;  5GAN j;  2GFU A;  4PJO C;  4C5I A;  2ZAE A;  3EH2 A;  2YLC A;  1VQN Q;  2HL5 C;  4M78 E;  1OUL A;  4CRI A;  2W0Z A;  1TWB A;  2CUB A;  4ZN3 A;  4BE0 A;  1IRE B;  3CCU Q;  2CRE A;  5CIU A;  4QW2 A;  3CXC S;  4X34 A;  1RI9 A;  2L89 A;  1WPY A;  2K57 A;  1WXT A;  1VA7 A;  3VS4 A;  1FXX A;  2HCK A;  5GMK i;  2OTL T;  4PLI A;  3OYC A;  5IHI A;  1JO8 A;  4ZNX A;  2AKL A;  1WQ7 A;  2JS0 A;  1ZQ1 A;  2DZ9 A;  1YHQ Q;  4OMQ A;  2O4X A;  3OSS C;  4LDW A;  2KXC A;  1OPK A;  1JJ2 A;  3CC7 Q;  1VQN A;  3INZ A;  2LTO A;  3I55 Q;  2EQJ A;  3NTI A;  2A3L A;  2E1H A;  2K5I A;  2JOY A;  1IGU A;  1X27 A;  1TS9 A;  3CCU A;  1E7O A;  1QKW A;  3HKS A;  5D6W A;  3CPW A;  2HAX A;  4ZGE B;  4E6R A;  4DBF A;  5KE3 A;  1K9A A;  5GMK e;  5KYX B;  1OZ3 A;  1A0N B;  1VQ9 T;  3V7S A;  3AHU A;  1UEC A;  2XHC A;  3JAM E;  1NJI C;  2FRY A;  2RB6 A;  5GAN 6;  3EG9 B;  5KYW A;  2O88 A;  4AG2 C;  3ZL7 C;  2DYI A;  3KBG A;  2C0O A;  5IT9 E;  5CR2 A;  5EC7 A;  4M7D F;  1PNJ A;  1WZO A;  4KGV B;  4C0Z A;  3VJP A;  5ECA A;  2MAM A;  2GGR A;  3OYN A;  2JS2 A;  3VUZ A;  2EQM A;  3PMT A;  2MOX A;  2RO0 A;  3VS5 A;  4M7A D;  1XOV A;  4QVC A;  5CKB A;  3LYI A;  1BIB A;  3QPH A;  4KT0 E;  1PD0 A;  2V8K A;  3GPL A;  3RMQ A;  2H8H A;  2K4Y A;  3PE0 A;  2VC8 A;  4ME7 A;  1VQN T;  4KUL A;  3X25 B;  4FYX B;  1EIF A;  4B6M A;  3L2V A;  4DOV A;  1UHC A;  3CCU T;  4FL6 A;  2L5Q A;  5LL6 S;  1MND A;  4MDW A;  1B34 A;  1QVG P;  4OMO A;  4M4Z A;  1LJO A;  5FW9 A;  2K9G A;  2F2W A;  5GAM d;  2LCC A;  1JXM A;  2AIR B;  1M3C A;  1WJQ A;  2KR3 A;  1H3Z A;  1T3L A;  2QAS A;  2V26 A;  5LJ3 g;  1JU5 C;  1W4S A;  1Q81 C;  3PNW C;  4PJO E;  1I07 A;  3C0C A;  2V8J A;  4PLL A;  4WF2 A;  4AFS C;  1BK2 A;  5LJ5 g;  3WVD B;  1Y0M A;  3MEA A;  5GMK h;  4J6Y A;  3NFC A;  2HBP A;  3LX7 A;  3P8B B;  4DOW A;  2C0T A;  3RKY A;  2RK1 A;  4CC2 A;  4KUD K;  2XK0 A;  2EIF A;  3C4S A;  2D6F A;  2HMA A;  4C5E A;  1OU8 A;  1PRL C;  1YI2 Q;  4HT9 A;  1BKB A;  3OBW A;  4J9G A;  1U8R A;  1JBM A;  1S1N A;  3TSZ A;  2MI6 A;  2B86 A;  3URG A;  1EX4 A;  1ZSZ C;  1Q82 U;  3OS5 A;  5CKE A;  1K76 A;  8ATC B;  4C0F A;  4EDU A;  3JCM J;  4GBQ A;  4EMH A;  1K9M U;  4OB2 B;  1QMC A;  3A5Z B;  2JMC A;  2XIC A;  2DZC A;  1MV3 A;  3CCJ Q;  5J26 A;  5AT1 B;  4Z88 A;  2FZK B;  2ATC B;  2QI2 A;  3VS2 A;  1X2Q A;  5CQY A;  2CP5 A;  1X2K A;  3Q1J A;  1WHK A;  2DTH A;  4CC4 B;  2MIO A;  2V8I A;  3GNG A;  1BI2 A;  2ZPE B;  5LJ3 e;  4A4F A;  3E2U A;  3CCL Q;  3HHT B;  2CSQ A;  3A8G B;  2KDS A;  4EIK A;  4XTV A;  1Q82 R;  1WXB A;  2ZPG B;  1VYU A;  2HD0 A;  4P5N A;  1YIJ A;  1WNL A;  1K9M R;  4ZN1 A;  2ZPF B;  5L23 A;  1UGR B;  3CCJ A;  3MP6 A;  4Z8A A;  2EJF A;  1N8R C;  4M7A A;  1IRX A;  1C6V X;  2BKD N;  2GF7 A;  3OYE A;  3OBY A;  3WVE B;  1VOM A;  3G1J A;  4IUV A;  2RD1 A;  2OJ2 A;  2DF6 A;  4OMF B;  2LX7 A;  1U06 A;  2DBK A;  4N0A A;  3VS1 A;  5IH2 A;  1UTI A;  2DBM A;  3NPF A;  4F17 A;  3EGD A;  1LOJ A;  4RTY A;  1VQL A;  3ULR B;  2H3J A;  4BD3 A;  1YI2 T;  1HK9 A;  2ZZD A;  1BI3 A;  4IUQ A;  4M7D D;  2JTM A;  2CH4 A;  3VYG A;  1AZG B;  3C94 A; 
#chains in the Genus database with same CATH homology
 1N5Z A;  4RTV A;  2KRO A;  2J06 A;  4JJB A;  2O2O A;  3VS0 A;  4CC3 A;  1YWO A;  2D8H A;  4F14 A;  2LJ0 A;  1YCS B;  3EG0 A;  3O5Z A;  2L3P A;  2F2X A;  4LNP A;  2LJ3 A;  1PKT A;  3M0R A;  4HCK A;  1KFZ A;  2KRS A;  2CSI A;  3IQL A;  2BTT A;  2DJQ A;  2J6O A;  2FG0 A;  2JW4 A;  2ENM A;  2EYY A;  3NGP A;  1QCF A;  1GBQ A;  1WDX A;  3EHQ A;  1UG1 A;  2QDL A;  1UFF A;  1X69 A;  2KYB A;  4DEY A;  2D1X A;  3VS3 A;  1ZUY A;  2O9S A;  2BZY A;  3A98 A;  1MV0 B;  3R6N A;  2A08 A;  1EFN A;  1PHT A;  2DIL A;  2DL8 A;  1U3O A;  1U5S A;  2I0N A;  1V1C A;  1UE9 A;  1E6H A;  3H0F A;  2KEA A;  4Y92 A;  2JT4 A;  4GLM A;  4LE9 A;  3SEM A;  2ROL A;  1YNZ A;  2K3B A;  1TUC A;  2OAW A;  4AFU C;  4D8D A;  2D8J A;  1ZBJ A;  2JTE A;  2NUZ A;  3M0S A;  1G2B A;  2P4R A;  1FMK A;  4Z89 A;  2KT1 A;  1M8M A;  2EPD A;  4J9E A;  1GL5 A;  4OMM A;  2DL4 A;  1X6G A;  2AKK A;  4AFZ C;  2GNC A;  2CT4 A;  1QWE A;  1WI7 A;  5IXB A;  3PVL A;  3FJ5 A;  1B3Q A;  4X1V A;  4IIM A;  1VYT A;  2CDT A;  2FPE A;  4K11 A;  1AWW A;  1T0J A;  2DYB A;  1WYX A;  1JQQ A;  4OMN A;  3M0Q A;  3REB B;  2DM1 A;  2E5K A;  1T3S A;  2DNU A;  2FO0 A;  4QT7 A;  3I35 A;  1HSQ A;  2NWM A;  4HVU A;  3GBQ A;  1AZE A;  1Z9Q A;  1FYN A;  1WXU A;  3VRZ A;  3M0U A;  4J9I A;  3U23 A;  4LUE A;  2RNA A;  2LMJ A;  1MUZ A;  2ED1 A;  2FPF A;  3PVQ A;  1NYG A;  2EW3 A;  4AFQ C;  5IHN A;  2RPN A;  2LNH B;  4ORZ A;  1W70 A;  2DA9 A;  4J9D A;  1B07 A;  2CH4 W;  2CUD A;  2L2P A;  4R0K A;  1CKB A;  1NEB A;  4A63 B;  2MCN A;  1NG2 A;  2DLP A;  4DEX A;  1K4U S;  2L3Q A;  1GCQ A;  4RTT A;  3VS7 A;  4WCI A;  2AZV A;  2X3X D;  2DMO A;  2RN8 A;  2YDL A;  1I1J A;  1OOT A;  2KRN A;  2HBW A;  2J7I A;  1RLQ C;  2KE9 A;  2KT8 A;  2GTJ A;  1AWO A;  3VS6 A;  2EGA A;  4JJD A;  1KIK A;  2V1Q A;  2W0Z A;  5HCK A;  1GCP A;  2CUB A;  1ZUU A;  2CRE A;  1M3A A;  4OML A;  2FEI A;  1M30 A;  1WFW A;  1RI9 A;  1YN8 A;  2EGE A;  1WXT A;  1VA7 A;  5GJV B;  3VS4 A;  2HCK A;  1TUD A;  2RQV A;  5IHI A;  1X43 A;  1ZX6 A;  3H41 A;  2JMA A;  1JO8 A;  4J9H A;  4ZNX A;  2AKL A;  2JS0 A;  1M3B A;  2EGC A;  4JJC A;  1X6B A;  1SEM A;  4OMQ A;  1J3T A;  2EYX A;  1W6X A;  1ABQ A;  2KXC A;  1OPK A;  2V1R A;  2A37 A;  2EVR A;  2RF0 A;  1X27 A;  1E7O A;  1QKW A;  4E6R A;  2YT6 A;  3RBB B;  2K2M A;  1K9A A;  4OMP A;  1A0N B;  2VKN A;  1UEC A;  1PWT A;  1QLY A;  1JXO A;  1H8K A;  2FRY A;  2D0N A;  2O88 A;  4AG2 C;  1UDL A;  2PNI A;  2M0Y A;  2W10 A;  3ZL7 C;  1KJW A;  2A36 A;  2C0O A;  2EBP A;  1ARK A;  1PRM C;  1SPK A;  2DL3 A;  5EC7 A;  2K6D A;  1UUE A;  2EYZ A;  1PNJ A;  5ECA A;  2GGR A;  2JS2 A;  1WX6 A;  4J9C A;  3I5S A;  2MOX A;  3VS5 A;  2YUN A;  1XOV A;  3THK A;  3EG3 A;  2A28 A;  2LQW A;  3RNJ A;  3H0H A;  1GBR A;  1CKA A;  1SRL A;  2H8H A;  3PE0 A;  1IO6 A;  1TG0 A;  2IIM A;  2RQT A;  1NYF A;  4IIO A;  1UJ0 A;  1UHC A;  2L0A A;  4OMO A;  1CSK A;  4M4Z A;  5I22 A;  2LJ1 A;  2RQW A;  2KGT A;  2EQI A;  4JZ3 A;  1GFC A;  5FW9 A;  3SHW A;  2K9G A;  3H0I A;  2F2W A;  2ECZ A;  4RUG A;  3REA B;  1JXM A;  2BZX A;  1M3C A;  1AWX A;  2KR3 A;  1T3L A;  2FPD A;  2M51 A;  2JM8 A;  2O31 A;  2VVK A;  1JU5 C;  1YWP A;  1I07 A;  1YP5 A;  2J6K A;  1QWF A;  3C0C A;  3VRY A;  2YUQ A;  1NLP C;  1AEY A;  1GFD A;  3LH5 A;  4HVW A;  2ESW A;  2HEQ A;  4AFS C;  1BK2 A;  1Y0M A;  5IXF A;  3EG1 A;  2SRC A;  2L3S A;  2LQN A;  3CQT A;  1SHG A;  2BZ8 A;  3I5R A;  1SHF A;  2C0T A;  1LCK A;  1VYV A;  2DRK A;  1K1Z A;  2EYW A;  1WLP B;  5GJW B;  3JV3 A;  2GQI A;  3EG2 A;  2DL5 A;  2XMF A;  1JEG A;  4CC2 A;  1KSW A;  2FRW A;  3M0P A;  1I0C A;  2ABL A;  2CT3 A;  1PRL C;  2J05 A;  2VWF A;  4J9G A;  1S1N A;  4F16 A;  1NM7 A;  3TSZ A;  4JPB W;  1GRI A;  3UF4 A;  1RLP C;  1AD5 A;  2K7A A;  2EKH A;  2B86 A;  2DVJ A;  1ZLM A;  2KYM A;  1UHF A;  2JM9 A;  2DL7 A;  2DRM A;  1K76 A;  1NLO C;  1BB9 A;  4J9F A;  4GBQ A;  1W1F A;  2RQU A;  2JMC A;  1UGV A;  1WA7 A;  2PTK A;  2JXB A;  1OV3 A;  1MV3 A;  4RTU A;  1BBZ A;  2ED0 A;  4Z88 A;  2GBQ A;  1K0X A;  1SRM A;  3VS2 A;  1X2Q A;  2HDA A;  1HJD A;  2RMO A;  2C0I A;  1AOJ A;  2KRM A;  3M0T A;  2DX1 A;  3TSW A;  2AK5 A;  2J6F A;  1X2K A;  2LP5 A;  4AG1 C;  4CC4 B;  2MIO A;  2YUO A;  1RUW A;  1OEB A;  5I11 A;  2HSP A;  2F2V A;  1H3H A;  2O9V A;  2SEM A;  1K0S A;  2YUP A;  2PZ1 A;  3TVT A;  4HXJ A;  3QWX X;  1NEG A;  2CSQ A;  3NHN A;  1E6G A;  4HVV A;  1BU1 A;  4EIK A;  1WXB A;  3EGU A;  1PKS A;  5FWB A;  1OPL A;  3UA6 A;  1HD3 A;  1VYU A;  2KXD A;  4RTZ A;  4KRT A;  1H92 A;  2KBT A;  5L23 A;  1ABO A;  4Z8A A;  4FSS A;  1ZUK A;  3NMZ C;  2AZS A;  1M27 C;  5IHK A;  1ZSG A;  3UAT A;  2LCS A;  2ROT A;  2X3W D;  4J9B A;  1G83 A;  2OJ2 A;  1Y57 A;  2DF6 A;  1SSH A;  2GTO A;  4JZ4 A;  4RTW A;  2LX7 A;  1Z9Z A;  1U06 A;  2DE0 X;  2DBK A;  2KNB B;  3VS1 A;  5IH2 A;  1UTI A;  2DBM A;  3NPF A;  4F17 A;  3UA7 A;  4RTY A;  4CC7 A;  3I9Q A;  2YSQ A;  3KFV A;  3ULR B;  4ESR A;  3QWY A;  2LZ6 B;  1UJY A;  2RQR A;  1AVZ C;  3EHR A;  4D8K A;  2K79 A;  5FWC A;  1AWJ A;  2CH4 A;  4LN2 A;  1T0H A;  4RTX A;  1AZG B;  4LUD A;  1QKX A;  1WIE A;  2OI3 A;  1GCQ C;  2G6F X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...