1ZSGA

Beta pix-sh3 complexed with an atypical peptide from alpha-pak
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
65
structure length
65
Chain Sequence
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the SH3 Domain of beta-PIX and Its Interaction with alpha-p21 Activated Kinase (PAK)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Rho guanine nucleotide exchange factor 7
total genus 6
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zsgA00
1BBZA 2EYXA 2HBWA 5L23A 1RLQC 2O31A 2OAWA 3VS3A 1SHFA 4CC2A 2BZ8A 2V1QA 2SEMA 1RI9A 1X69A 4AFQC 2KE9A 1W70A 1WIEA 3H41A 1YNZA 2K3BA 1BU1A 2AKKA 4J9BA 2L2PA 2CREA 2F2XA 4JZ3A 2EKHA 1T0HA 1UHCA 2DMOA 3QWYA 4AFUC 1E6HA 1OOTA 4WCIA 3EGUA 2JW4A 1PNJA 1IO6A 4GBQA 2ESWA 2I0NA 2K79A 1ZLMA 2LQNA 2FPDA 2YSQA 1QWFA 3H0FA 3SEMA 1NG2A 2X3WD 4J9EA 4J9HA 3TSWA 1JEGA 2LCSA 2NWMA 1NLPC 2RQVA 2A28A 3JV3A 2CSIA 4CC4B 1LCKA 2DYBA 2DE0X 1ZBJA 1WLPB 1XOVA 2J6KA 4EIKA 1W6XA 1KSWA 2RQUA 2LMJA 2JS2A 2JMCA 2LJ0A 3VRZA 1GBRA 4J9DA 2EPDA 3ZL7C 1PWTA 2DL3A 5IXFA 1VYVA 2YUNA 1WX6A 1ZUYA 1EFNA 2L3SA 1JQQA 1GCPA 4RTYA 5EC7A 2DL8A 3M0UA 1AZGB 4M4ZA 3VS5A 4LUDA 1I0CA 4F16A 4IIMA 1UJYA 2E5KA 2ECZA 1UUEA 2F2VA 1WXBA 3EG1A 2L0AA 2KEAA 5FW9A 1X2KA 4K11A 3R6NA 1JO8A 4OMNA 4HVUA 1T3LA 2CH4A 2DLPA 1UTIA 1JU5C 1X27A 2GBQA 2DF6A 3EHQA 2A36A 2J6OA 1I07A 4GLMA 2EYZA 3I35A 1UG1A 2J05A 2DNUA 1Y57A 2ENMA 2OJ2A 2PTKA 4LE9A 2FG0A 2BZXA 1M30A 1TUDA 1K9AA 1X6GA 2B86A 2V1RA 3PVLA 3EHRA 1UJ0A 4RTXA 2YDLA 2RPNA 1SSHA 4RTUA 4IIOA 2DJQA 2DVJA 2KT1A 4HVVA 2GTJA 4JJCA 2L3PA 1AZEA 2DM1A 3M0PA 1U06A 3EG0A 2CUDA 1Z9QA 2KYMA 2J06A 1WXTA 1WDXA 4DEXA 1ZX6A 2MCNA 2FRWA 2VVKA 5HCKA 3M0RA 2O9VA 5GJWB 1YWOA 4AFSC 1YCSB 2EGCA 1T0JA 2ED0A 1W1FA 1WI7A 2ED1A 4HCKA 3EG2A 3M0SA 2EGAA 2LJ3A 4JZ4A 1UHFA 2ROTA 2KRNA 1AWJA 1UDLA 1FMKA 3H0HA 5IHIA 2JTEA 1UGVA 1X2QA 1K76A 3ULRB 2EQIA 4RUGA 1OPKA 2HDAA 2KRMA 5IHNA 1HJDA 1AEYA 2YUPA 3I5RA 2J6FA 3REBB 2DA9A 1ABQA 1BK2A 3A98A 2CSQA 1ABOA 1YN8A 2EBPA 2RF0A 3UA6A 1PKTA 1GL5A 4E6RA 4F17A 2KT8A 1AWXA 1KJWA 2AK5A 2CT3A 2D0NA 4LN2A 2DBMA 1FYNA 1V1CA 1T3SA 3I9QA 3REAB 2RQWA 4ZNXA 1GCQA 4JJDA 4Z88A 2IIMA 2K9GA 1Y0MA 2LQWA 2DL5A 4HXJA 3UATA 4X1VA 2G6FX 2X3XD 2DL4A 1J3TA 2KXDA 1VYTA 5I22A 3TVTA 4J9IA 1VA7A 2JXBA 2K6DA 2A37A 3UF4A 4RTZA 2CT4A 2EW3A 2DRMA 4J9CA 3M0TA 5IXBA 2LJ1A 2MOXA 1TG0A 1WXUA 3VS0A 2DILA 3RNJA 2O2OA 2DX1A 1MUZA 1UECA 2HSPA 2KRSA 2JM8A 4FSSA 1K0SA 4OMQA 1G2BA 1X43A 3M0QA 4OMOA 1NYGA 2FO0A 1QWEA 4JJBA 2D8JA 4J9GA 2W0ZA 1U3OA 2D1XA 3IQLA 2BZYA 1GRIA 3I5SA 3TSZA 1YWPA 2CDTA 2C0IA 2CUBA 2K2MA 1JXOA 3NMZC 4DEYA 3QWXX 4Z89A 4A63B 1ZUUA 1U5SA 5GJVB 2FRYA 1AWOA 1B07A 4AG1C 2KR3A 1GCQC 2EVRA 2M51A 1GBQA 3RBBB 1CSKA 1CKBA 2O9SA 1NEGA 2ROLA 2AKLA 3VS4A 2KROA 1WYXA 2H8HA 4CC3A 1H3HA 1H8KA 3O5ZA 4CC7A 1M8MA 1QLYA 3VRYA 2K7AA 2EYWA 2YUQA 1PHTA 4RTWA 4RTVA 1GFDA 1SRLA 4HVWA 1VYUA 3PVQA 2OI3A 2NUZA 2SRCA 4R0KA 2M0YA 2KBTA 2PZ1A 1S1NA 2BTTA 2RNAA 2RMOA 2VWFA 1K4US 1SEMA 1K1ZA 3H0IA 2CH4W 2KYBA 4JPBW 1PRMC 2VKNA 2L3QA 2JS0A 1NYFA 2LP5A 2W10A 4LUEA 2A08A 4D8DA 3LH5A 2JM9A 3VS2A 4Y92A 1N5ZA 1QCFA 1M3BA 2ABLA 1MV0B 3SHWA 3CQTA 5I11A 2PNIA 1RUWA 3EG3A 1TUCA 2RQRA 1PKSA 2YUOA 1M3CA 2C0OA 1E7OA 2O88A 1HD3A 3VS6A 1PRLC 1M27C 2DL7A 4KRTA 1SHGA 4AG2C 1RLPC 3NGPA 4Z8AA 2LNHB 2DBKA 1KFZA 2J7IA 5FWCA 2FPFA 3PE0A 2LZ6B 1ZSGA 1ARKA 3VS7A 1JXMA 1WA7A 3GBQA 4QT7A 5IHKA 4F14A 2FEIA 4AFZC 2JMAA 2RQTA 2AZVA 1NEBA 1AWWA 1AVZC 2P4RA 2QDLA 1M3AA 1B3QA 1Z9ZA 5FWBA 2GNCA 1YP5A 4D8KA 1SPKA 4LNPA 1SRMA 2KNBB 1NM7A 1GFCA 5IH2A 1CKAA 2DRKA 2EGEA 1OEBA 2MIOA 4RTTA 2XMFA 4ESRA 2KGTA 2HEQA 1K0XA 2C0TA 1AOJA 2HCKA 2KXCA 1ZUKA 2YT6A 4OMLA 2AZSA 2F2WA 1QKXA 2GGRA 1OV3A 1I1JA 3THKA 2FPEA 1WFWA 2EYYA 1AD5A 1NLOC 5ECAA 3U23A 1KIKA 2GQIA 4ORZA 2JT4A 3C0CA 2D8HA 1H92A 1X6BA 1UE9A 1UFFA 2LX7A 1E6GA 2GTOA 3NPFA 3KFVA 1BB9A 3UA7A 4OMMA 1A0NB 1MV3A 2RN8A 3NHNA 3VS1A 1QKWA 3FJ5A 1G83A 4J9FA 1HSQA 4OMPA 1OPLA
chains in the Genus database with same CATH superfamily
1BBZA 3C12A 2DEUA 3AT1B 1SHFA 4CC2A 2QEXQ 4BI3A 3GNFB 3M9QA 3OBWA 4AFQC 4EMKA 4O6JA 4J9BA 2F2XA 2ZZDA 4JZ3A 3CC4T 1UHCA 4MZMA 2DMOA 2L5QA 3QWYA 1VQLT 2DEQA 3CCLT 1RI0A 4AFUC 3RESA 4C92G 3MKDA 3EGUA 5KYNA 3C95A 1VQ9A 4GBQA 2ESWA 2K79A 4PFZA 3G6EQ 2BE9B 2EQMA 3CCRT 2V8IA 4OGEA 3H0FA 3CPWA 3OMCA 1NG2A 3OYBA 1C0MA 4J9EA 2QA4T 3QKJA 1VIEA 2A28A 3OYHA 1WHJA 4M75E 4DQ2A 4IURA 2DYBA 4HCCA 3PGGA 4HKEA 4EMGA 5FU6B 1WLPB 5GAOr 2J6KA 4RKUE 1W6XA 2YHTA 1M8VA 2DFUA 2DIGA 4JUVA 3QIIA 2DL3A 1G3WA 1JQQA 1D3BB 2RB6A 2GQVA 2NUPB 2RHIA 3CCJQ 5GAOq 4M4ZA 4M7AG 1IGQA 4F16A 2E5KA 2ECZA 2F2VA 2LRQA 4BI4A 1W4SA 5FW9A 2OX7A 4M78G 1D0YA 1JJ2S 2JJ9A 4FYXB 3A8OB 1YJNQ 2CH4A 1VQMA 2GBQA 4GLMA 1WHGA 2EYZA 1SF9A 3MHXA 2E65A 2J05A 2OJ2A 1JRIA 2FG0A 2BZXA 3MEVA 2B86A 4ZN1A 3OA6A 2EQKA 1KQSS 1V29B 2BUDA 2DZCA 4RTXA 1IB8A 2RPNA 4JLGA 2DTIA 1NJIC 2HKQB 2VYTA 4JJCA 2MF2A 3CD6A 2RI2A 2J06A 3CC7T 3OW2P 3KBGA 4CRIA 3JB9D 4LD9K 3H6ZA 2CP7A 3M0RA 3CCRA 2O9VA 1VQ7T 3TU4K 5HKCA 2GF7A 1K73R 4BD3A 3VU3C 4MDXA 2QQ9A 4KH1B 1VQLQ 4HCKA 3EG2A 3OSSC 2LJ3A 1UHFA 1OQKA 2ROTA 2DJZA 3CC4A 2X4XA 5FU7B 3H0HA 5IHIA 3QJYA 1RAIB 3JCMW 4C0GA 4M77F 1OPKA 5IHNA 4HT8A 1VQOT 3HFNA 3DB3A 2DA9A 3CCRQ 3A98A 1ABOA 2QQSA 3CCVA 3OYFA 1VQMQ 3LX7A 4E7LA 1PKTA 4PLIA 1VQ9Q 3OS2A 3BDUA 3RMQA 3RKWA 5LJ3g 1AWXA 2CT3A 1P92A 2D0NA 2DTOA 1FYNA 2AIRB 3FJPA 1V1CA 1VQ8Q 3I9QA 1MHNA 2OAUA 1GCQA 5LJ5f 4Z88A 4BE0A 1Q81C 2QXFA 1TTHB 4M77D 1VQ5Q 1VQ4Q 1B34B 3UATA 1PSFA 2G6FX 1D1AA 4HCZA 5GANd 2JTFA 5I22A 4C5EA 3HPWA 4J9IA 3ZBDA 1TOVA 2CP0A 2MOXA 2EJ9A 2X4WA 2DXCA 5KYUB 2DPPB 5GANf 2YRVA 1RABB 3CCVT 2CKKA 2P0QA 2QGFB 1UECA 1V76A 4FT4A 1TH7A 4C92C 3SWNB 1K0SA 4OMQA 1G2BA 5AT1B 3M0QA 3HSBA 3NFCA 1G5VA 3MEWA 2RJEA 4E7JA 2W0ZA 2RI5A 3QO3A 2COZA 2A0FB 2HQXA 1IRXA 2CDTA 2CUBA 2K2MA 3OBYA 1JXOA 3NMZC 4D6WA 4DEYA 3QWXX 3OYGA 4FCYA 4A63B 1ZUUA 3CCVQ 1WNLA 2YWWA 2DAQA 2AHJB 2M51A 1YI2A 3CC7A 2L3RA 3EGXB 2CZ1B 4NOYA 4LDWA 3JCMh 3JB9G 3SFMA 1WYXA 1N8RR 1M90R 2H8HA 3NTIA 4E2FB 1YJNA 2RHYA 3JB9I 1WJRA 2K7AA 3MO8A 4C5HA 2DXBA 1D3BA 4RTWA 3G4SQ 4RTVA 3J81E 4HVWA 1WJSA 2RI3A 2E1HA 4FSXA 1YJNT 4R0KA 2KBTA 4EMHA 1S1NA 2KVQG 1XTDA 5GANh 1UGQB 4E7HA 2VWFA 2RMOA 4ZN3A 1RAFB 2HD0A 3H0IA 3MPUB 1VQ7A 4PJOA 5A0GA 2QASA 1VQMT 1SSFA 1FWZA 2JS0A 3PFSA 3VS2A 4PJOG 4J7IA 4PJOD 4Y92A 1QCFA 5GAMg 2ABLA 1S72T 2HAXA 2VUBA 2E64A 3CQTA 3CCLQ 2X35A 1TUCA 2RQRA 2GCXA 3J80E 1E7OA 4KGZB 2COWA 5KYUA 3X24B 1G3YA 4M7AD 4KRTA 3A8MB 3OSVA 3HFOA 4Z8AA 2YRCA 4RG8A 2LNHB 2DBKA 3QXEB 1KFZA 4F7UE 3CPFA 4BY6B 2LZ6B 3RERA 4M7DF 6AT1B 4OF1A 5HY6A 5GAMf 1KHCA 5IHKA 3EG9B 4F14A 2K5LA 5C6SA 4VUBA 3KUFA 4OGCA 1G3TA 1I8FA 3OYLA 2AZVA 4UC4A 1NEBA 1YHQT 4JRPA 1AVZC 2P4RA 2QDLA 1K9MC 4PJJA 4M7DA 1YP5A 1OYXA 4E7ZA 3VKIA 4D8KA 4LNPA 3UT1A 1PC0A 4TVRA 3O8VA 5IAYA 4M77G 3SWNC 4IKFA 2KGTA 3GF5A 4J5YA 4LDUA 3CCMA 1FMWA 2RH2A 4M7DD 2RJCA 4XTWA 3OMGA 3G6ET 1Q86U 4OMLA 3CCQT 2EJFA 2K4YA 2QDYB 4B9XA 4HT9A 2XIDA 1ZA1B 3CCUA 1I1JA 2HKNA 2DTHA 1LPLA 1WHLA 2EIFA 1TWBA 2XDPA 4C8QC 4FT2A 2D8HA 1H92A 4O5VA 1UE9A 4C92E 2H3EB 5C0MA 2LX7A 1SG5A 2VV5A 5CCAA 1Q7YR 4OMMA 1A0NB 3OYIA 4A4HA 3VS1A 3V8JA 1TSFA 2JZ2A 3FJ5A 1WQWA 3QHSA 2OAWA 3JCMg 3S3MA 3VS3A 5LJ5j 4BDZA 4NL3A 2BZ8A 2OTJQ 5FU6C 5J39A 1U1TA 2SEMA 2CZ7B 2KE9A 3H41A 2D6FA 3CCMT 1BU1A 4EPCA 4FYWB 1TU0B 1MMDA 2EKHA 3D7SB 3G71T 2DD5A 3X20B 2JW4A 3QDFA 4MZPA 3JCMc 5LJ3e 1ZLMA 8ATCB 1YHQA 3VV0A 3SEMA 5KCOA 1KQSA 1NPPA 1QVFA 1OZ3A 2R57A 1JEGA 3JRZA 2NWMA 1N27A 4L59A 5LJ3d 4ZGJB 1KQ2A 1QQJA 2CSIA 4XTXA 2JOYA 3CPWS 1UEBA 5GMKh 4EIKA 2X4YA 2JS2A 2LJ0A 3EAEA 1GBRA 3MEAA 4QQ6A 4J9DA 2EPDA 5CKEA 3ZL7C 1PWTA 4A4FA 1VYVA 4XTVA 1JB0E 2L8DA 1GCPA 1VQ4T 3A5ZB 4A53A 1YJ9A 3OYDA 4HCBA 2RK2A 1AZGB 3UWNA 3VS5A 4LUDA 3L1AA 4KUIA 1UJYA 2MI6A 4R55A 5DY9A 3OY9A 2L0AA 1QP3A 1D0ZA 3M4YA 3V7SA 3R6NA 1YIJA 2RHUA 1T3LA 3VYHB 1KG1A 5GMKe 2DLPA 1D0XA 3EHQA 2J6OA 4DA4A 2QK0A 1N8RC 4ME7A 1Y57A 2DNUA 4FW2A 2LT1A 1VQ9T 2PTKA 5D6YA 1SKUB 1M30A 5GAN2 3CCLA 2V1RA 1M1KC 1QCOA 3EHRA 1UJ0A 1AHJB 3M5AA 2MPXC 1VQ8T 5LJ3h 3PMIA 1PD1A 4C8QF 1AZEA 4C92D 3I55A 2YLCA 2DM1A 2E70A 2QQRA 4PFOA 2CUDA 1WXTA 5CK9A 3E19A 1ZX6A 3QG1A 2FRWA 2VVKA 1YBYA 5CO7A 4FW1A 1YCSB 4M75D 4AFSC 2EGCA 3CD6Q 1IGUA 3QZ9B 2LTOA 3LWHA 4AT1B 2ED1A 3G4SA 3M0SA 4IUTA 3ZFJA 1OU8A 4Y91A 2KRNA 2MAMA 1AWJA 4M77E 4C92F 1RACB 2JTEA 3CMAQ 1OU9A 2EAYA 2GFAA 1HJDA 1AEYA 1RAAB 2YUPA 5D7UA 1BI3A 1R0BG 3SB2A 3HHTB 4PNOA 3REBB 4KGVB 1ZSZA 1H641 4ZGDB 3FC3A 4LN2A 3PIPA 1S72Q 3OW2A 5CAIA 2RQWA 1QVGS 4JJDA 1RAGB 4E7IA 2EKOA 2K9GA 3HRUA 1NPRA 4MMKA 3P8DA 2HSEB 4PL6A 1M90U 1M2OA 4X1VA 3DLLA 1R8OB 2MWPA 1VQNA 5GANj 1VA7A 2JXBA 1IHVA 2K6DA 2A37A 2CT4A 1OX9A 4NS5A 2DRMA 3LW5E 2K57A 4J9CA 2LJ1A 1WXUA 2XK0A 2DILA 5KYYB 1N9SA 4ELZC 4JRKA 2O2OA 4DBHA 5J26A 2R5AA 3HRSA 2HSPA 2PVOB 1QVGA 1KC8C 3R6OA 2KRSA 3PT9A 2JM8A 4FSSA 2G3RA 1VQ6T 1PM3A 2XDDA 2HBPA 5L8RE 3EH1A 3PMTA 4II1A 3OYKA 1QWEA 4BE2A 2WSFE 1Q81R 4X9DA 3WVDB 4J9GA 4C8QB 1M2VA 1LVKA 5DLOA 5FRMA 1GRIA 3CCET 1YWPA 2C0IA 1W2BS 1XJWB 4WTOB 2ZPBB 4KULA 2HZYA 5GJVB 1KK7A 2MWOA 1ZHIA 1GCQC 1FX7A 5A0LA 2EVRA 2D0QB 3RBBB 1IZ6A 1CSKA 3MP1A 1CKBA 4M78D 5KYXA 3PIOA 1NEGA 3JB9F 3CCJA 4XU3A 1ACMB 2AKLA 2ATCB 3OS1A 2LNVA 4CC3A 5GAOn 3LYIA 5FLXE 4N0AA 1N8RU 3OYMA 3LH0A 4PJMA 1Q82U 1SRLA 3PVQA 2OI3A 2M0YA 1VQKT 3VUZA 2IPOB 5GMKl 1NZ9A 3A8HB 5KYWB 5IN1A 1SEMA 1K1ZA 2OTLT 2AT1B 3SD4A 4JPBW 2XD0A 3OYCA 1VIFA 3A8GB 2EQUA 4M77C 2FZKB 3JCMf 3FDRA 3FEOA 4M78E 2JM9A 3OYYA 3KXTA 2GFUA 4XK8E 2E4HA 2KK4A 1RL2A 1M90C 2PNIA 3EG3A 4R56A 1VQKQ 2HNIA 1PKSA 2YUOA 1M3CA 2C0OA 2KSSA 4BE1A 2O88A 2DVEA 3CCJT 5A0DA 5GANe 3G1JA 1SHGA 4AG2C 4C8QA 5A2QE 3GPLA 4C8QG 3CMAA 1O9SA 2FPFA 3PE0A 2NLUA 1ZSGA 1Q95G 1BKBA 1RAHB 2MYSA 1WA7A 2CP5A 3GBQA 4J6YA 2NUPA 1X01A 2MMPA 2HL3A 5CQYA 3EFRA 4X9CA 1O75A 2Y90A 3ME9A 3H9NA 4LDVA 1Z9ZA 5FWBA 1VQ6Q 2GNCA 1SRMA 1EIFA 3E9GA 2P0PA 2OTJT 1GFCA 5IH2A 1CKAA 2DRKA 2EGEA 1OEBA 4RTTA 5GAN6 3OYNA 2K5FA 1BI1A 2HEQA 3BFMA 2C0TA 3EG9A 5GMKm 2KXCA 3JCMV 4ZTJA 2YT6A 2Y4XA 1YI2Q 2F2WA 1QKXA 1Q81U 4QVZA 1KC8R 3THKA 2WSEE 3MP8A 1AD5A 1NLOC 3A1PA 5ECAA 3CC2T 4EMKC 1WZOA 5CKFA 2GQIA 1KIKA 2BIVA 4Y28E 1WHMA 1X6BA 1UFFA 2GTOA 3NPFA 5GAOm 1M1FA 5GAOp 1IXDA 3OB9A 5CQXA 1MV3A 2RN8A 2LQ8A 5CKDA 3Q1JA 1YJWA 1G83A 2CZ0B 4J9FA 1HSQA 1JBMA 1VUBA 3N5BB 2HBWA 4M7AE 1VOMA 1K9MR 4ATOA 3QSUA 5KYYA 3I56T 2DXTA 3M53A 1X69A 2P84A 2E3IA 4PJLA 1TUGB 1WIEA 2D9TA 2K3BA 3JB9H 4PJOF 2AKKA 5GAN7 3CCEQ 2L2PA 4LD6A 3CMEA 3A8LB 4QKUA 1T0HA 3L42A 5GMKj 3OYAA 2ZGWA 1E6HA 3G4ST 1OOTA 1QVGP 4WCIA 1PNJA 2M02A 1IO6A 2LQNA 3S3OA 3CC7Q 2E6ZA 3S3NA 2X3WD 4PLLA 2FYKA 4J9HA 3TSWA 2LCSA 2DO3A 3JV3A 1VQPA 4CC4B 1K8AU 2RJFA 1GXIE 1PCXA 4F04B 1XOVA 2RQUA 1KSWA 3L2RA 2LMJA 2JMCA 2CP3A 4M75G 5CR2A 4XQ3A 4XTZA 4JJNK 5EG2A 5IXFA 1WX6A 2L3SA 5EC7A 5GAN3 1X6OA 2DL8A 3M0UA 1I0CA 3ASKA 3CEYA 4IIMA 3EFOA 5LJ3j 1X2KA 3CCST 4RMOA 4E47A 1D1CA 1JO8A 4HVUA 4OMNA 2QQBA 1PD0A 2K2VA 1UTIA 1KHIA 1M5Q1 5CKBA 3RMSA 2A36A 2CP2A 3I35A 3EFSA 2ENMA 1TS9A 3OS5A 8AT1B 1K9AA 1X6GA 3FLGA 5LJ5e 1XQHA 3PVLA 1WQ7A 4RTUA 1UGSB 4KH0B 4IUPA 3CMEQ 1MGQA 4M7DB 2GTJA 4QQDA 2EQJA 2JNGA 1U06A 3EG0A 2HQHA 4BUGA 2KYMA 2LCCA 1WDXA 5I2MA 4DEXA 2MCNA 1R0CB 4FIBA 3HRTA 5HCKA 4F7UF 1YWOA 4L5GA 3OQ5A 3CXCP 3JCMd 1YIJQ 1T0JA 3RUXA 2ED0A 1W1FA 3V8LA 4EDUA 5GAMe 1WI7A 3GNGA 2KDSA 3G71A 2LX9A 2EWNA 4J6XA 5J3BA 1PSEA 2O01E 1D1BA 3ULRB 1NJIR 4M78C 4LDXA 3CPWP 2HDAA 2KRMA 1JJ2P 3CCQQ 1JJ2A 1K8AC 2J6FA 3CCUQ 1ZA2B 1OX8A 1K9MU 1YN8A 2EBPA 2RF0A 1KD1R 4DBQA 1KJWA 4PJOE 3JB9J 4PFPA 3M54A 4OB0B 2RO0A 1T3SA 3I55Q 2CYZB 2KMTA 2B8AA 3T9NA 4A4KA 3EGDA 1Y0MA 2ZPIB 1YITA 2DL5A 3E1SA 3TREA 2Z0WA 4P5NA 2X3XD 1BCMA 2KXDA 4FU6A 1VYTA 4OP0A 3TVTA 1R77A 4IUVA 3E2UA 1N9RA 4FYYB 3DLMA 3M0TA 5IXBA 3G6EA 1TG0A 4LDYA 3BDLA 1LOJA 2JN0A 2QI2A 3RNJA 2K3YA 4Q5WA 1MUZA 5DLQE 4C8QE 2MK5A 2PVDB 1EZZB 2Y4YA 4N4IA 1Q86R 1X43A 4OMOA 1NYGA 1UGRB 5GAN5 2V8JA 4C0FA 2FZCB 3E9FA 1U3OA 2RHXA 3IQLA 2BZYA 3RDVA 3J7AF 1NE8A 3I5SA 3TSZA 1DJ7B 1OI1A 3EGXA 4XU0A 3QYHB 4M75A 2FRYA 5GAMd 4RG2A 1B07A 3TCJA 3VJPA 4AG1C 1AWOA 1HYOA 3CMAT 3RKYA 2QEXT 3JCMe 2XHCA 2ZAEA 3L2ZA 5LJ5g 1VQ5T 2QA4Q 3WVEB 4ANJA 1GBQA 2ROLA 2RA2A 2O4XA 3VS4A 2KROA 3OYJA 1H3HA 4M75F 3O5ZA 1M8MA 3VRYA 1PHTA 3INZA 1KD1U 1GFDA 3LLRA 4BACA 3M57A 4BI8B 2NUZA 2SRCA 2KQWA 2QTVA 3M56A 2RNAA 4ELYC 1Q86C 1K4US 3HKSA 1QVPA 3S6WA 1VQ5A 2KYBA 3L2UA 2VKNA 4MDWA 3RR6A 3DB4A 4M77B 2W10A 4D8DA 2A7YA 1QW1A 3LH5A 3JCMX 3CXCS 1QMCA 2XG8D 3CCSA 3I55T 3DKMA 1N5ZA 2HL5C 4M7AA 1B34A 2PVGB 3GLXA 4A4EA 2XKOC 3L2WA 2RHZA 3QZ5B 2DETA 1MNDA 1KD1C 1BI0A 1HD3A 4Z02A 3QYGB 3V8KA 1QVFP 4M7DC 4OMFB 3VS6A 3GIBA 4NL2A 2DXUA 3M55A 5KE3A 1PRLC 1VQOQ 1M27C 1U8RA 2DIQA 1RLPC 2X51A 2M16A 2CGHA 4KT0E 2E12A 5FWCA 2M0OA 4JRQA 1BCOA 3VS7A 5KYXB 4N0AC 1JXMA 2A3LA 4B9WA 4QT7A 4YTLA 5FRNA 1C6VX 4JDSA 2PUOB 3FRNA 1Q82C 4M7AF 1SPKA 4QW2A 1VQ6A 2BKDN 1NM7A 3CBOA 3V7RA 1VQ7Q 3QDRB 1K73U 3G71Q 2E10A 3G7ZA 1OZ2A 1UGPB 4C0DB 3UPUA 2HCKA 4DBFA 1ZUKA 4F7UB 3I56A 2RK1A 2AZSA 2X9HA 1Y71A 2YRDA 4FM4B 3FB9A 4PJNA 4GY5A 1OV3A 2QGGA 1WFWA 2EYYA 1BYMA 1NJIU 4MZTA 2H3JA 1Y07A 4ORZA 2FZGB 2JT4A 3UDCA 2PQWA 2F1LA 2DERA 4LXCA 4XTYA 1E6GA 2M9UA 3CMET 3PNWC 5FROA 2LDMA 4RCCA 3NHNA 4OB2B 4JS4A 2EYXA 5L23A 1RLQC 2O31A 2CZ6B 2L89A 2V1QA 2LQKA 1VQOA 1ZSZC 1FXXA 3URGA 1RI9A 1WPYA 1ZSZB 4XTUA 2NYSA 1W70A 5LL6S 1YNZA 2RJDA 2C06A 3CBMA 1IREB 2CREA 3C4SA 4J6WA 3P8HA 2JUFA 5CKHA 3H8ZA 2DYIA 4F7UA 3OW2S 2I0NA 5DM7R 2EYQA 2FPDA 2YSQA 1G3SA 1QWFA 2PU9B 1U1SA 4DBRA 3CCUT 5GMKi 1Y96A 4DOWA 1RADB 1OULA 2QQAA 3M58A 1NLPC 2RQVA 4BY6C 2QAZA 3CD6T 1NBEB 3M4GA 1FMVA 1LCKA 4C92B 5GAOl 1VQPQ 2DE0X 1ZBJA 2LCLA 2HMAA 3QPHA 1Y96B 4IUQA 3TQ7P 1VQ8A 1MMGA 3VRZA 1W2BP 2V26A 3NTHA 2YUNA 1ZUYA 3EH2A 1EFNA 4BDYA 4RTYA 2F69A 5D6WA 4PK4A 4CI0C 2FL7A 2ZPHB 1N6AA 1UUEA 3EG1A 1WXBA 2KEAA 1YIJT 4PJOB 5D6XA 1C1AA 3PTAA 4K11A 2YXYA 2VXEA 3CC4Q 3BW1A 3AHUA 4ZGEB 1JU5C 1X27A 3V7CA 2LT4A 3WXMB 2E6NA 3JAME 2OTLA 2DF6A 1I07A 1UG1A 1F1BB 3JCMQ 1M2VB 4KBMB 5CVIA 4LE9A 1VQKA 4AMCA 1TUDA 3X25B 1Q82R 4QVDA 2RM4A 2XICA 2YDLA 1SSHA 1BI2A 4IIOA 2E3HA 2QYZA 2DJQA 5CIUA 2HQEA 1LNXA 2DVJA 2VC8A 2VGNA 2KT1A 4HVVA 5I2SA 2L3PA 3RKXA 3M0PA 1H3ZA 1I81A 2VASA 3JCMP 2CS7A 1Z9QA 3JSCA 4FL6A 2FVUA 2QEXA 3HL8A 1YJWT 4J7FA 5GJWB 4J8OA 2EJGA 1BIBA 4N4GA 4M7DE 3CCEA 3P8BB 4GLKA 2EGAA 1VQLA 4JZ4A 4FYVB 2JTMA 1YFNA 1UDLA 3VYGA 5GANg 2LC4A 1FMKA 2XI9A 3X26B 4C8QD 1KC8U 4N4HA 5KYWA 4RCBA 1UGVA 1X2QA 3EGDB 1K76A 1Q7YU 4OVAA 2EQIA 4RUGA 2KI7A 1I5OB 3SDZA 4C92A 1M4ZA 3I5RA 3L2QA 3CCQA 1ABQA 1BK2A 2CSQA 1M1KR 3UA6A 1GL5A 4E6RA 2RD1A 1ZQ1A 4F17A 2KT8A 2AK5A 2QTXA 3HP9A 2DBMA 2OTJA 1PG5B 3REAB 3MP6A 4ZNXA 1VQNT 3OS0A 4WF2A 2VB6A 2IIMA 4M75C 2VXFA 5KCHA 2LQWA 5LJ5h 4HXJA 3L2VA 1YITT 5IT9E 2OTLQ 2XDBA 2DL4A 1J3TA 1UB4A 1QP2A 1K73C 2DD4A 1TXQA 3UF4A 4RTZA 2EW3A 5M9OA 4XU2A 1X75C 2YLBA 2F5KA 3VS0A 2WACA 1QVFS 1WHKA 2NUTA 3QJ6A 3X28B 4F7UG 4X34A 2DX1A 2COYA 4DOVA 2PUKB 4M78B 4QVCA 4C0ZA 2M1HA 9ATCB 1YJ9Q 2VGMA 5HK3A 2FO0A 2QG9B 1WHHA 1Y7XA 4C5IA 4JJBA 3GP8A 2D8JA 2D1XA 3MCAB 4M7AC 2R5MA 3VUBA 2JVVA 1Q7YC 5KH6A 3CCMQ 2K5IA 4M75B 4Z89A 1U5SA 3CCSQ 2KR3A 2R58A 2ZPGB 2K3XA 1YJWQ 4V2SA 3EFOB 2KAFA 4M7AB 2O9SA 3QBYA 3GOXA 2XU8A 4B6MA 1M1KU 1WJQA 3CXCA 5I21A 1H8KA 1D09B 4CC7A 3BY7A 1QLYA 4EMKB 4XAXB 2EYWA 2YUQA 1VYUA 1S72A 4QQGA 2PZ1A 5HK0A 5FU7C 2BTTA 1M9SA 2ZPFB 3FIFA 1YI2T 1KQSP 4KGXB 2CH4W 1PRMC 4ZTFA 4M78F 2DKGA 2L3QA 3QUIA 2EFIA 4JS5A 3RIRA 1NYFA 4BB7A 2LP5A 4LUEA 4KUDK 2A08A 3CC2Q 3SWNA 5GAMj 2ZCFB 1XNIA 2BE7D 4A54A 1M3BA 1MV0B 3SHWA 5I11A 1K8AR 5GAMh 4MMLA 1RUWA 4C5GA 1VQ4A 3BE3A 1YHQQ 1BIAA 3LGLA 1I4K1 2DL7A 2X4JA 2LVMA 4M77A 3NGPA 5LJ3f 3I56Q 4JLIA 4HA8A 2J7IA 4XU1A 4IUUA 2E5QA 1I5LA 1ARKA 1IHWA 4M7DG 3TEEA 1VQPT 2O4XB 5LJ5d 2P4TA 3C94A 1MNEA 3LGFA 2V8KA 7AT1B 2KY9A 2FEIA 4AFZC 1KQ1A 2JMAA 3ER0A 1EX4A 3F70A 1HXDA 1YCYA 2RQTA 4J83A 3ZEHA 1LJOA 3JCMJ 5GAN4 1G8XA 4OB3B 1AWWA 2NUTB 4A4GA 1M3AA 3HTRA 3M59A 1B3QA 5GAN8 2E41A 4PKCC 1YJ9T 4PJOC 4E7SA 5KE2A 4JRIA 2KNBB 2DK3A 1AT1B 2ZPEB 4L6V5 2MIOA 5AYFA 1M1GA 2XMFA 4ESRA 2P0KA 4OB1B 1K0XA 1ZBXA 1VQNQ 1MMNA 1WGSA 1AOJA 2CP6A 3META 4C0DC 1W2BA 2FB7A 1YITQ 3OYEA 2QA4A 2GGRA 3MEUA 2FPEA 1B7TA 3CBPA 3JCMb 3U23A 2IVWA 1QCNA 3C0CA 3NTKA 3MJXA 3LWIA 1RAEB 2FHDA 3KFVA 4E7KA 1BB9A 2F5TX 3UA7A 1MMAA 3CC2A 1HK9A 2DZ9A 2I2LA 1QKWA 4M78A 4OMPA 2IG0A 2WSCE 1OPLA
chains in the Genus database with same CATH topology
1BBZA 2EYXA 2HBWA 5L23A 1RLQC 2O31A 2OAWA 3VS3A 1SHFA 4CC2A 2BZ8A 2V1QA 2SEMA 1RI9A 1X69A 4AFQC 2KE9A 1W70A 1WIEA 3H41A 1YNZA 2K3BA 1BU1A 2AKKA 4J9BA 2L2PA 2CREA 2F2XA 4JZ3A 2EKHA 1T0HA 1UHCA 2DMOA 3QWYA 4AFUC 1E6HA 1OOTA 4WCIA 3EGUA 2JW4A 1PNJA 1IO6A 4GBQA 2ESWA 2I0NA 2K79A 1ZLMA 2LQNA 2FPDA 2YSQA 1QWFA 3H0FA 3SEMA 1NG2A 2X3WD 4J9EA 4J9HA 3TSWA 1JEGA 2LCSA 2NWMA 1NLPC 2RQVA 2A28A 3JV3A 2CSIA 4CC4B 1LCKA 2DYBA 2DE0X 1ZBJA 1WLPB 1XOVA 2J6KA 4EIKA 1W6XA 1KSWA 2RQUA 2LMJA 2JS2A 2JMCA 2LJ0A 3VRZA 1GBRA 4J9DA 2EPDA 3ZL7C 1PWTA 2DL3A 5IXFA 1VYVA 2YUNA 1WX6A 1ZUYA 1EFNA 2L3SA 1JQQA 1GCPA 4RTYA 5EC7A 2DL8A 3M0UA 1AZGB 4M4ZA 3VS5A 4LUDA 1I0CA 4F16A 4IIMA 1UJYA 2E5KA 2ECZA 1UUEA 2F2VA 1WXBA 3EG1A 2L0AA 2KEAA 5FW9A 1X2KA 4K11A 3R6NA 1JO8A 4OMNA 4HVUA 1T3LA 2CH4A 2DLPA 1UTIA 1JU5C 1X27A 2GBQA 2DF6A 3EHQA 2A36A 2J6OA 1I07A 4GLMA 2EYZA 3I35A 1UG1A 2J05A 2DNUA 1Y57A 2ENMA 2OJ2A 2PTKA 4LE9A 2FG0A 2BZXA 1M30A 1TUDA 1K9AA 1X6GA 2B86A 2V1RA 3PVLA 3EHRA 1UJ0A 4RTXA 2YDLA 2RPNA 1SSHA 4RTUA 4IIOA 2DJQA 2DVJA 2KT1A 4HVVA 2GTJA 4JJCA 2L3PA 1AZEA 2DM1A 3M0PA 1U06A 3EG0A 2CUDA 1Z9QA 2KYMA 2J06A 1WXTA 1WDXA 4DEXA 1ZX6A 2MCNA 2FRWA 2VVKA 5HCKA 3M0RA 2O9VA 5GJWB 1YWOA 4AFSC 1YCSB 2EGCA 1T0JA 2ED0A 1W1FA 1WI7A 2ED1A 4HCKA 3EG2A 3M0SA 2EGAA 2LJ3A 4JZ4A 1UHFA 2ROTA 2KRNA 1AWJA 1UDLA 1FMKA 3H0HA 5IHIA 2JTEA 1UGVA 1X2QA 1K76A 3ULRB 2EQIA 4RUGA 1OPKA 2HDAA 2KRMA 5IHNA 1HJDA 1AEYA 2YUPA 3I5RA 2J6FA 3REBB 2DA9A 1ABQA 1BK2A 3A98A 2CSQA 1ABOA 1YN8A 2EBPA 2RF0A 3UA6A 1PKTA 1GL5A 4E6RA 4F17A 2KT8A 1AWXA 1KJWA 2AK5A 2CT3A 2D0NA 4LN2A 2DBMA 1FYNA 1V1CA 1T3SA 3I9QA 3REAB 2RQWA 4ZNXA 1GCQA 4JJDA 4Z88A 2IIMA 2K9GA 1Y0MA 2LQWA 2DL5A 4HXJA 3UATA 4X1VA 2G6FX 2X3XD 2DL4A 1J3TA 2KXDA 1VYTA 5I22A 3TVTA 4J9IA 1VA7A 2JXBA 2K6DA 2A37A 3UF4A 4RTZA 2CT4A 2EW3A 2DRMA 4J9CA 3M0TA 5IXBA 2LJ1A 2MOXA 1TG0A 1WXUA 3VS0A 2DILA 3RNJA 2O2OA 2DX1A 1MUZA 1UECA 2HSPA 2KRSA 2JM8A 4FSSA 1K0SA 4OMQA 1G2BA 1X43A 3M0QA 4OMOA 1NYGA 2FO0A 1QWEA 4JJBA 2D8JA 4J9GA 2W0ZA 1U3OA 2D1XA 3IQLA 2BZYA 1GRIA 3I5SA 3TSZA 1YWPA 2CDTA 2C0IA 2CUBA 2K2MA 1JXOA 3NMZC 4DEYA 3QWXX 4Z89A 4A63B 1ZUUA 1U5SA 5GJVB 2FRYA 1AWOA 1B07A 4AG1C 2KR3A 1GCQC 2EVRA 2M51A 1GBQA 3RBBB 1CSKA 1CKBA 2O9SA 1NEGA 2ROLA 2AKLA 3VS4A 2KROA 1WYXA 2H8HA 4CC3A 1H3HA 1H8KA 3O5ZA 4CC7A 1M8MA 1QLYA 3VRYA 2K7AA 2EYWA 2YUQA 1PHTA 4RTWA 4RTVA 1GFDA 1SRLA 4HVWA 1VYUA 3PVQA 2OI3A 2NUZA 2SRCA 4R0KA 2M0YA 2KBTA 2PZ1A 1S1NA 2BTTA 2RNAA 2RMOA 2VWFA 1K4US 1SEMA 1K1ZA 3H0IA 2CH4W 2KYBA 4JPBW 1PRMC 2VKNA 2L3QA 2JS0A 1NYFA 2LP5A 2W10A 4LUEA 2A08A 4D8DA 3LH5A 2JM9A 3VS2A 4Y92A 1N5ZA 1QCFA 1M3BA 2ABLA 1MV0B 3SHWA 3CQTA 5I11A 2PNIA 1RUWA 3EG3A 1TUCA 2RQRA 1PKSA 2YUOA 1M3CA 2C0OA 1E7OA 2O88A 1HD3A 3VS6A 1PRLC 1M27C 2DL7A 4KRTA 1SHGA 4AG2C 1RLPC 3NGPA 4Z8AA 2LNHB 2DBKA 1KFZA 2J7IA 5FWCA 2FPFA 3PE0A 2LZ6B 1ZSGA 1ARKA 3VS7A 1JXMA 1WA7A 3GBQA 4QT7A 5IHKA 4F14A 2FEIA 4AFZC 2JMAA 2RQTA 2AZVA 1NEBA 1AWWA 1AVZC 2P4RA 2QDLA 1M3AA 1B3QA 1Z9ZA 5FWBA 2GNCA 1YP5A 4D8KA 1SPKA 4LNPA 1SRMA 2KNBB 1NM7A 1GFCA 5IH2A 1CKAA 2DRKA 2EGEA 1OEBA 2MIOA 4RTTA 2XMFA 4ESRA 2KGTA 2HEQA 1K0XA 2C0TA 1AOJA 2HCKA 2KXCA 1ZUKA 2YT6A 4OMLA 2AZSA 2F2WA 1QKXA 2GGRA 1OV3A 1I1JA 3THKA 2FPEA 1WFWA 2EYYA 1AD5A 1NLOC 5ECAA 3U23A 1KIKA 2GQIA 4ORZA 2JT4A 3C0CA 2D8HA 1H92A 1X6BA 1UE9A 1UFFA 2LX7A 1E6GA 2GTOA 3NPFA 3KFVA 1BB9A 3UA7A 4OMMA 1A0NB 1MV3A 2RN8A 3NHNA 3VS1A 1QKWA 3FJ5A 1G83A 4J9FA 1HSQA 4OMPA 1OPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBZ A;  2EYX A;  2HBW A;  5L23 A;  1RLQ C;  2O31 A;  2OAW A;  3VS3 A;  1SHF A;  4CC2 A;  2BZ8 A;  2V1Q A;  2SEM A;  1RI9 A;  1X69 A;  4AFQ C;  2KE9 A;  1W70 A;  1WIE A;  3H41 A;  1YNZ A;  2K3B A;  1BU1 A;  2AKK A;  4J9B A;  2L2P A;  2CRE A;  2F2X A;  4JZ3 A;  2EKH A;  1T0H A;  1UHC A;  2DMO A;  3QWY A;  4AFU C;  1E6H A;  1OOT A;  4WCI A;  3EGU A;  2JW4 A;  1PNJ A;  1IO6 A;  4GBQ A;  2ESW A;  2I0N A;  2K79 A;  1ZLM A;  2LQN A;  2FPD A;  2YSQ A;  1QWF A;  3H0F A;  3SEM A;  1NG2 A;  2X3W D;  4J9E A;  4J9H A;  3TSW A;  1JEG A;  2LCS A;  2NWM A;  1NLP C;  2RQV A;  2A28 A;  3JV3 A;  2CSI A;  4CC4 B;  1LCK A;  2DYB A;  2DE0 X;  1ZBJ A;  1WLP B;  1XOV A;  2J6K A;  4EIK A;  1W6X A;  1KSW A;  2RQU A;  2LMJ A;  2JS2 A;  2JMC A;  2LJ0 A;  3VRZ A;  1GBR A;  4J9D A;  2EPD A;  3ZL7 C;  1PWT A;  2DL3 A;  5IXF A;  1VYV A;  2YUN A;  1WX6 A;  1ZUY A;  1EFN A;  2L3S A;  1JQQ A;  1GCP A;  4RTY A;  5EC7 A;  2DL8 A;  3M0U A;  1AZG B;  4M4Z A;  3VS5 A;  4LUD A;  1I0C A;  4F16 A;  4IIM A;  1UJY A;  2E5K A;  2ECZ A;  1UUE A;  2F2V A;  1WXB A;  3EG1 A;  2L0A A;  2KEA A;  5FW9 A;  1X2K A;  4K11 A;  3R6N A;  1JO8 A;  4OMN A;  4HVU A;  1T3L A;  2CH4 A;  2DLP A;  1UTI A;  1JU5 C;  1X27 A;  2GBQ A;  2DF6 A;  3EHQ A;  2A36 A;  2J6O A;  1I07 A;  4GLM A;  2EYZ A;  3I35 A;  1UG1 A;  2J05 A;  2DNU A;  1Y57 A;  2ENM A;  2OJ2 A;  2PTK A;  4LE9 A;  2FG0 A;  2BZX A;  1M30 A;  1TUD A;  1K9A A;  1X6G A;  2B86 A;  2V1R A;  3PVL A;  3EHR A;  1UJ0 A;  4RTX A;  2YDL A;  2RPN A;  1SSH A;  4RTU A;  4IIO A;  2DJQ A;  2DVJ A;  2KT1 A;  4HVV A;  2GTJ A;  4JJC A;  2L3P A;  1AZE A;  2DM1 A;  3M0P A;  1U06 A;  3EG0 A;  2CUD A;  1Z9Q A;  2KYM A;  2J06 A;  1WXT A;  1WDX A;  4DEX A;  1ZX6 A;  2MCN A;  2FRW A;  2VVK A;  5HCK A;  3M0R A;  2O9V A;  5GJW B;  1YWO A;  4AFS C;  1YCS B;  2EGC A;  1T0J A;  2ED0 A;  1W1F A;  1WI7 A;  2ED1 A;  4HCK A;  3EG2 A;  3M0S A;  2EGA A;  2LJ3 A;  4JZ4 A;  1UHF A;  2ROT A;  2KRN A;  1AWJ A;  1UDL A;  1FMK A;  3H0H A;  5IHI A;  2JTE A;  1UGV A;  1X2Q A;  1K76 A;  3ULR B;  2EQI A;  4RUG A;  1OPK A;  2HDA A;  2KRM A;  5IHN A;  1HJD A;  1AEY A;  2YUP A;  3I5R A;  2J6F A;  3REB B;  2DA9 A;  1ABQ A;  1BK2 A;  3A98 A;  2CSQ A;  1ABO A;  1YN8 A;  2EBP A;  2RF0 A;  3UA6 A;  1PKT A;  1GL5 A;  4E6R A;  4F17 A;  2KT8 A;  1AWX A;  1KJW A;  2AK5 A;  2CT3 A;  2D0N A;  4LN2 A;  2DBM A;  1FYN A;  1V1C A;  1T3S A;  3I9Q A;  3REA B;  2RQW A;  4ZNX A;  1GCQ A;  4JJD A;  4Z88 A;  2IIM A;  2K9G A;  1Y0M A;  2LQW A;  2DL5 A;  4HXJ A;  3UAT A;  4X1V A;  2G6F X;  2X3X D;  2DL4 A;  1J3T A;  2KXD A;  1VYT A;  5I22 A;  3TVT A;  4J9I A;  1VA7 A;  2JXB A;  2K6D A;  2A37 A;  3UF4 A;  4RTZ A;  2CT4 A;  2EW3 A;  2DRM A;  4J9C A;  3M0T A;  5IXB A;  2LJ1 A;  2MOX A;  1TG0 A;  1WXU A;  3VS0 A;  2DIL A;  3RNJ A;  2O2O A;  2DX1 A;  1MUZ A;  1UEC A;  2HSP A;  2KRS A;  2JM8 A;  4FSS A;  1K0S A;  4OMQ A;  1G2B A;  1X43 A;  3M0Q A;  4OMO A;  1NYG A;  2FO0 A;  1QWE A;  4JJB A;  2D8J A;  4J9G A;  2W0Z A;  1U3O A;  2D1X A;  3IQL A;  2BZY A;  1GRI A;  3I5S A;  3TSZ A;  1YWP A;  2CDT A;  2C0I A;  2CUB A;  2K2M A;  1JXO A;  3NMZ C;  4DEY A;  3QWX X;  4Z89 A;  4A63 B;  1ZUU A;  1U5S A;  5GJV B;  2FRY A;  1AWO A;  1B07 A;  4AG1 C;  2KR3 A;  1GCQ C;  2EVR A;  2M51 A;  1GBQ A;  3RBB B;  1CSK A;  1CKB A;  2O9S A;  1NEG A;  2ROL A;  2AKL A;  3VS4 A;  2KRO A;  1WYX A;  2H8H A;  4CC3 A;  1H3H A;  1H8K A;  3O5Z A;  4CC7 A;  1M8M A;  1QLY A;  3VRY A;  2K7A A;  2EYW A;  2YUQ A;  1PHT A;  4RTW A;  4RTV A;  1GFD A;  1SRL A;  4HVW A;  1VYU A;  3PVQ A;  2OI3 A;  2NUZ A;  2SRC A;  4R0K A;  2M0Y A;  2KBT A;  2PZ1 A;  1S1N A;  2BTT A;  2RNA A;  2RMO A;  2VWF A;  1K4U S;  1SEM A;  1K1Z A;  3H0I A;  2CH4 W;  2KYB A;  4JPB W;  1PRM C;  2VKN A;  2L3Q A;  2JS0 A;  1NYF A;  2LP5 A;  2W10 A;  4LUE A;  2A08 A;  4D8D A;  3LH5 A;  2JM9 A;  3VS2 A;  4Y92 A;  1N5Z A;  1QCF A;  1M3B A;  2ABL A;  1MV0 B;  3SHW A;  3CQT A;  5I11 A;  2PNI A;  1RUW A;  3EG3 A;  1TUC A;  2RQR A;  1PKS A;  2YUO A;  1M3C A;  2C0O A;  1E7O A;  2O88 A;  1HD3 A;  3VS6 A;  1PRL C;  1M27 C;  2DL7 A;  4KRT A;  1SHG A;  4AG2 C;  1RLP C;  3NGP A;  4Z8A A;  2LNH B;  2DBK A;  1KFZ A;  2J7I A;  5FWC A;  2FPF A;  3PE0 A;  2LZ6 B;  1ZSG A;  1ARK A;  3VS7 A;  1JXM A;  1WA7 A;  3GBQ A;  4QT7 A;  5IHK A;  4F14 A;  2FEI A;  4AFZ C;  2JMA A;  2RQT A;  2AZV A;  1NEB A;  1AWW A;  1AVZ C;  2P4R A;  2QDL A;  1M3A A;  1B3Q A;  1Z9Z A;  5FWB A;  2GNC A;  1YP5 A;  4D8K A;  1SPK A;  4LNP A;  1SRM A;  2KNB B;  1NM7 A;  1GFC A;  5IH2 A;  1CKA A;  2DRK A;  2EGE A;  1OEB A;  2MIO A;  4RTT A;  2XMF A;  4ESR A;  2KGT A;  2HEQ A;  1K0X A;  2C0T A;  1AOJ A;  2HCK A;  2KXC A;  1ZUK A;  2YT6 A;  4OML A;  2AZS A;  2F2W A;  1QKX A;  2GGR A;  1OV3 A;  1I1J A;  3THK A;  2FPE A;  1WFW A;  2EYY A;  1AD5 A;  1NLO C;  5ECA A;  3U23 A;  1KIK A;  2GQI A;  4ORZ A;  2JT4 A;  3C0C A;  2D8H A;  1H92 A;  1X6B A;  1UE9 A;  1UFF A;  2LX7 A;  1E6G A;  2GTO A;  3NPF A;  3KFV A;  1BB9 A;  3UA7 A;  4OMM A;  1A0N B;  1MV3 A;  2RN8 A;  3NHN A;  3VS1 A;  1QKW A;  3FJ5 A;  1G83 A;  4J9F A;  1HSQ A;  4OMP A;  1OPL A; 
#chains in the Genus database with same CATH topology
 1BBZ A;  3C12 A;  2DEU A;  3AT1 B;  1SHF A;  4CC2 A;  2QEX Q;  4BI3 A;  3GNF B;  3M9Q A;  3OBW A;  4AFQ C;  4EMK A;  4O6J A;  4J9B A;  2F2X A;  2ZZD A;  4JZ3 A;  3CC4 T;  1UHC A;  4MZM A;  2DMO A;  2L5Q A;  3QWY A;  1VQL T;  2DEQ A;  3CCL T;  1RI0 A;  4AFU C;  3RES A;  4C92 G;  3MKD A;  3EGU A;  5KYN A;  3C95 A;  1VQ9 A;  4GBQ A;  2ESW A;  2K79 A;  4PFZ A;  3G6E Q;  2BE9 B;  2EQM A;  3CCR T;  2V8I A;  4OGE A;  3H0F A;  3CPW A;  3OMC A;  1NG2 A;  3OYB A;  1C0M A;  4J9E A;  2QA4 T;  3QKJ A;  1VIE A;  2A28 A;  3OYH A;  1WHJ A;  4M75 E;  4DQ2 A;  4IUR A;  2DYB A;  4HCC A;  3PGG A;  4HKE A;  4EMG A;  5FU6 B;  1WLP B;  5GAO r;  2J6K A;  4RKU E;  1W6X A;  2YHT A;  1M8V A;  2DFU A;  2DIG A;  4JUV A;  3QII A;  2DL3 A;  1G3W A;  1JQQ A;  1D3B B;  2RB6 A;  2GQV A;  2NUP B;  2RHI A;  3CCJ Q;  5GAO q;  4M4Z A;  4M7A G;  1IGQ A;  4F16 A;  2E5K A;  2ECZ A;  2F2V A;  2LRQ A;  4BI4 A;  1W4S A;  5FW9 A;  2OX7 A;  4M78 G;  1D0Y A;  1JJ2 S;  2JJ9 A;  4FYX B;  3A8O B;  1YJN Q;  2CH4 A;  1VQM A;  2GBQ A;  4GLM A;  1WHG A;  2EYZ A;  1SF9 A;  3MHX A;  2E65 A;  2J05 A;  2OJ2 A;  1JRI A;  2FG0 A;  2BZX A;  3MEV A;  2B86 A;  4ZN1 A;  3OA6 A;  2EQK A;  1KQS S;  1V29 B;  2BUD A;  2DZC A;  4RTX A;  1IB8 A;  2RPN A;  4JLG A;  2DTI A;  1NJI C;  2HKQ B;  2VYT A;  4JJC A;  2MF2 A;  3CD6 A;  2RI2 A;  2J06 A;  3CC7 T;  3OW2 P;  3KBG A;  4CRI A;  3JB9 D;  4LD9 K;  3H6Z A;  2CP7 A;  3M0R A;  3CCR A;  2O9V A;  1VQ7 T;  3TU4 K;  5HKC A;  2GF7 A;  1K73 R;  4BD3 A;  3VU3 C;  4MDX A;  2QQ9 A;  4KH1 B;  1VQL Q;  4HCK A;  3EG2 A;  3OSS C;  2LJ3 A;  1UHF A;  1OQK A;  2ROT A;  2DJZ A;  3CC4 A;  2X4X A;  5FU7 B;  3H0H A;  5IHI A;  3QJY A;  1RAI B;  3JCM W;  4C0G A;  4M77 F;  1OPK A;  5IHN A;  4HT8 A;  1VQO T;  3HFN A;  3DB3 A;  2DA9 A;  3CCR Q;  3A98 A;  1ABO A;  2QQS A;  3CCV A;  3OYF A;  1VQM Q;  3LX7 A;  4E7L A;  1PKT A;  4PLI A;  1VQ9 Q;  3OS2 A;  3BDU A;  3RMQ A;  3RKW A;  5LJ3 g;  1AWX A;  2CT3 A;  1P92 A;  2D0N A;  2DTO A;  1FYN A;  2AIR B;  3FJP A;  1V1C A;  1VQ8 Q;  3I9Q A;  1MHN A;  2OAU A;  1GCQ A;  5LJ5 f;  4Z88 A;  4BE0 A;  1Q81 C;  2QXF A;  1TTH B;  4M77 D;  1VQ5 Q;  1VQ4 Q;  1B34 B;  3UAT A;  1PSF A;  2G6F X;  1D1A A;  4HCZ A;  5GAN d;  2JTF A;  5I22 A;  4C5E A;  3HPW A;  4J9I A;  3ZBD A;  1TOV A;  2CP0 A;  2MOX A;  2EJ9 A;  2X4W A;  2DXC A;  5KYU B;  2DPP B;  5GAN f;  2YRV A;  1RAB B;  3CCV T;  2CKK A;  2P0Q A;  2QGF B;  1UEC A;  1V76 A;  4FT4 A;  1TH7 A;  4C92 C;  3SWN B;  1K0S A;  4OMQ A;  1G2B A;  5AT1 B;  3M0Q A;  3HSB A;  3NFC A;  1G5V A;  3MEW A;  2RJE A;  4E7J A;  2W0Z A;  2RI5 A;  3QO3 A;  2COZ A;  2A0F B;  2HQX A;  1IRX A;  2CDT A;  2CUB A;  2K2M A;  3OBY A;  1JXO A;  3NMZ C;  4D6W A;  4DEY A;  3QWX X;  3OYG A;  4FCY A;  4A63 B;  1ZUU A;  3CCV Q;  1WNL A;  2YWW A;  2DAQ A;  2AHJ B;  2M51 A;  1YI2 A;  3CC7 A;  2L3R A;  3EGX B;  2CZ1 B;  4NOY A;  4LDW A;  3JCM h;  3JB9 G;  3SFM A;  1WYX A;  1N8R R;  1M90 R;  2H8H A;  3NTI A;  4E2F B;  1YJN A;  2RHY A;  3JB9 I;  1WJR A;  2K7A A;  3MO8 A;  4C5H A;  2DXB A;  1D3B A;  4RTW A;  3G4S Q;  4RTV A;  3J81 E;  4HVW A;  1WJS A;  2RI3 A;  2E1H A;  4FSX A;  1YJN T;  4R0K A;  2KBT A;  4EMH A;  1S1N A;  2KVQ G;  1XTD A;  5GAN h;  1UGQ B;  4E7H A;  2VWF A;  2RMO A;  4ZN3 A;  1RAF B;  2HD0 A;  3H0I A;  3MPU B;  1VQ7 A;  4PJO A;  5A0G A;  2QAS A;  1VQM T;  1SSF A;  1FWZ A;  2JS0 A;  3PFS A;  3VS2 A;  4PJO G;  4J7I A;  4PJO D;  4Y92 A;  1QCF A;  5GAM g;  2ABL A;  1S72 T;  2HAX A;  2VUB A;  2E64 A;  3CQT A;  3CCL Q;  2X35 A;  1TUC A;  2RQR A;  2GCX A;  3J80 E;  1E7O A;  4KGZ B;  2COW A;  5KYU A;  3X24 B;  1G3Y A;  4M7A D;  4KRT A;  3A8M B;  3OSV A;  3HFO A;  4Z8A A;  2YRC A;  4RG8 A;  2LNH B;  2DBK A;  3QXE B;  1KFZ A;  4F7U E;  3CPF A;  4BY6 B;  2LZ6 B;  3RER A;  4M7D F;  6AT1 B;  4OF1 A;  5HY6 A;  5GAM f;  1KHC A;  5IHK A;  3EG9 B;  4F14 A;  2K5L A;  5C6S A;  4VUB A;  3KUF A;  4OGC A;  1G3T A;  1I8F A;  3OYL A;  2AZV A;  4UC4 A;  1NEB A;  1YHQ T;  4JRP A;  1AVZ C;  2P4R A;  2QDL A;  1K9M C;  4PJJ A;  4M7D A;  1YP5 A;  1OYX A;  4E7Z A;  3VKI A;  4D8K A;  4LNP A;  3UT1 A;  1PC0 A;  4TVR A;  3O8V A;  5IAY A;  4M77 G;  3SWN C;  4IKF A;  2KGT A;  3GF5 A;  4J5Y A;  4LDU A;  3CCM A;  1FMW A;  2RH2 A;  4M7D D;  2RJC A;  4XTW A;  3OMG A;  3G6E T;  1Q86 U;  4OML A;  3CCQ T;  2EJF A;  2K4Y A;  2QDY B;  4B9X A;  4HT9 A;  2XID A;  1ZA1 B;  3CCU A;  1I1J A;  2HKN A;  2DTH A;  1LPL A;  1WHL A;  2EIF A;  1TWB A;  2XDP A;  4C8Q C;  4FT2 A;  2D8H A;  1H92 A;  4O5V A;  1UE9 A;  4C92 E;  2H3E B;  5C0M A;  2LX7 A;  1SG5 A;  2VV5 A;  5CCA A;  1Q7Y R;  4OMM A;  1A0N B;  3OYI A;  4A4H A;  3VS1 A;  3V8J A;  1TSF A;  2JZ2 A;  3FJ5 A;  1WQW A;  3QHS A;  2OAW A;  3JCM g;  3S3M A;  3VS3 A;  5LJ5 j;  4BDZ A;  4NL3 A;  2BZ8 A;  2OTJ Q;  5FU6 C;  5J39 A;  1U1T A;  2SEM A;  2CZ7 B;  2KE9 A;  3H41 A;  2D6F A;  3CCM T;  1BU1 A;  4EPC A;  4FYW B;  1TU0 B;  1MMD A;  2EKH A;  3D7S B;  3G71 T;  2DD5 A;  3X20 B;  2JW4 A;  3QDF A;  4MZP A;  3JCM c;  5LJ3 e;  1ZLM A;  8ATC B;  1YHQ A;  3VV0 A;  3SEM A;  5KCO A;  1KQS A;  1NPP A;  1QVF A;  1OZ3 A;  2R57 A;  1JEG A;  3JRZ A;  2NWM A;  1N27 A;  4L59 A;  5LJ3 d;  4ZGJ B;  1KQ2 A;  1QQJ A;  2CSI A;  4XTX A;  2JOY A;  3CPW S;  1UEB A;  5GMK h;  4EIK A;  2X4Y A;  2JS2 A;  2LJ0 A;  3EAE A;  1GBR A;  3MEA A;  4QQ6 A;  4J9D A;  2EPD A;  5CKE A;  3ZL7 C;  1PWT A;  4A4F A;  1VYV A;  4XTV A;  1JB0 E;  2L8D A;  1GCP A;  1VQ4 T;  3A5Z B;  4A53 A;  1YJ9 A;  3OYD A;  4HCB A;  2RK2 A;  1AZG B;  3UWN A;  3VS5 A;  4LUD A;  3L1A A;  4KUI A;  1UJY A;  2MI6 A;  4R55 A;  5DY9 A;  3OY9 A;  2L0A A;  1QP3 A;  1D0Z A;  3M4Y A;  3V7S A;  3R6N A;  1YIJ A;  2RHU A;  1T3L A;  3VYH B;  1KG1 A;  5GMK e;  2DLP A;  1D0X A;  3EHQ A;  2J6O A;  4DA4 A;  2QK0 A;  1N8R C;  4ME7 A;  1Y57 A;  2DNU A;  4FW2 A;  2LT1 A;  1VQ9 T;  2PTK A;  5D6Y A;  1SKU B;  1M30 A;  5GAN 2;  3CCL A;  2V1R A;  1M1K C;  1QCO A;  3EHR A;  1UJ0 A;  1AHJ B;  3M5A A;  2MPX C;  1VQ8 T;  5LJ3 h;  3PMI A;  1PD1 A;  4C8Q F;  1AZE A;  4C92 D;  3I55 A;  2YLC A;  2DM1 A;  2E70 A;  2QQR A;  4PFO A;  2CUD A;  1WXT A;  5CK9 A;  3E19 A;  1ZX6 A;  3QG1 A;  2FRW A;  2VVK A;  1YBY A;  5CO7 A;  4FW1 A;  1YCS B;  4M75 D;  4AFS C;  2EGC A;  3CD6 Q;  1IGU A;  3QZ9 B;  2LTO A;  3LWH A;  4AT1 B;  2ED1 A;  3G4S A;  3M0S A;  4IUT A;  3ZFJ A;  1OU8 A;  4Y91 A;  2KRN A;  2MAM A;  1AWJ A;  4M77 E;  4C92 F;  1RAC B;  2JTE A;  3CMA Q;  1OU9 A;  2EAY A;  2GFA A;  1HJD A;  1AEY A;  1RAA B;  2YUP A;  5D7U A;  1BI3 A;  1R0B G;  3SB2 A;  3HHT B;  4PNO A;  3REB B;  4KGV B;  1ZSZ A;  1H64 1;  4ZGD B;  3FC3 A;  4LN2 A;  3PIP A;  1S72 Q;  3OW2 A;  5CAI A;  2RQW A;  1QVG S;  4JJD A;  1RAG B;  4E7I A;  2EKO A;  2K9G A;  3HRU A;  1NPR A;  4MMK A;  3P8D A;  2HSE B;  4PL6 A;  1M90 U;  1M2O A;  4X1V A;  3DLL A;  1R8O B;  2MWP A;  1VQN A;  5GAN j;  1VA7 A;  2JXB A;  1IHV A;  2K6D A;  2A37 A;  2CT4 A;  1OX9 A;  4NS5 A;  2DRM A;  3LW5 E;  2K57 A;  4J9C A;  2LJ1 A;  1WXU A;  2XK0 A;  2DIL A;  5KYY B;  1N9S A;  4ELZ C;  4JRK A;  2O2O A;  4DBH A;  5J26 A;  2R5A A;  3HRS A;  2HSP A;  2PVO B;  1QVG A;  1KC8 C;  3R6O A;  2KRS A;  3PT9 A;  2JM8 A;  4FSS A;  2G3R A;  1VQ6 T;  1PM3 A;  2XDD A;  2HBP A;  5L8R E;  3EH1 A;  3PMT A;  4II1 A;  3OYK A;  1QWE A;  4BE2 A;  2WSF E;  1Q81 R;  4X9D A;  3WVD B;  4J9G A;  4C8Q B;  1M2V A;  1LVK A;  5DLO A;  5FRM A;  1GRI A;  3CCE T;  1YWP A;  2C0I A;  1W2B S;  1XJW B;  4WTO B;  2ZPB B;  4KUL A;  2HZY A;  5GJV B;  1KK7 A;  2MWO A;  1ZHI A;  1GCQ C;  1FX7 A;  5A0L A;  2EVR A;  2D0Q B;  3RBB B;  1IZ6 A;  1CSK A;  3MP1 A;  1CKB A;  4M78 D;  5KYX A;  3PIO A;  1NEG A;  3JB9 F;  3CCJ A;  4XU3 A;  1ACM B;  2AKL A;  2ATC B;  3OS1 A;  2LNV A;  4CC3 A;  5GAO n;  3LYI A;  5FLX E;  4N0A A;  1N8R U;  3OYM A;  3LH0 A;  4PJM A;  1Q82 U;  1SRL A;  3PVQ A;  2OI3 A;  2M0Y A;  1VQK T;  3VUZ A;  2IPO B;  5GMK l;  1NZ9 A;  3A8H B;  5KYW B;  5IN1 A;  1SEM A;  1K1Z A;  2OTL T;  2AT1 B;  3SD4 A;  4JPB W;  2XD0 A;  3OYC A;  1VIF A;  3A8G B;  2EQU A;  4M77 C;  2FZK B;  3JCM f;  3FDR A;  3FEO A;  4M78 E;  2JM9 A;  3OYY A;  3KXT A;  2GFU A;  4XK8 E;  2E4H A;  2KK4 A;  1RL2 A;  1M90 C;  2PNI A;  3EG3 A;  4R56 A;  1VQK Q;  2HNI A;  1PKS A;  2YUO A;  1M3C A;  2C0O A;  2KSS A;  4BE1 A;  2O88 A;  2DVE A;  3CCJ T;  5A0D A;  5GAN e;  3G1J A;  1SHG A;  4AG2 C;  4C8Q A;  5A2Q E;  3GPL A;  4C8Q G;  3CMA A;  1O9S A;  2FPF A;  3PE0 A;  2NLU A;  1ZSG A;  1Q95 G;  1BKB A;  1RAH B;  2MYS A;  1WA7 A;  2CP5 A;  3GBQ A;  4J6Y A;  2NUP A;  1X01 A;  2MMP A;  2HL3 A;  5CQY A;  3EFR A;  4X9C A;  1O75 A;  2Y90 A;  3ME9 A;  3H9N A;  4LDV A;  1Z9Z A;  5FWB A;  1VQ6 Q;  2GNC A;  1SRM A;  1EIF A;  3E9G A;  2P0P A;  2OTJ T;  1GFC A;  5IH2 A;  1CKA A;  2DRK A;  2EGE A;  1OEB A;  4RTT A;  5GAN 6;  3OYN A;  2K5F A;  1BI1 A;  2HEQ A;  3BFM A;  2C0T A;  3EG9 A;  5GMK m;  2KXC A;  3JCM V;  4ZTJ A;  2YT6 A;  2Y4X A;  1YI2 Q;  2F2W A;  1QKX A;  1Q81 U;  4QVZ A;  1KC8 R;  3THK A;  2WSE E;  3MP8 A;  1AD5 A;  1NLO C;  3A1P A;  5ECA A;  3CC2 T;  4EMK C;  1WZO A;  5CKF A;  2GQI A;  1KIK A;  2BIV A;  4Y28 E;  1WHM A;  1X6B A;  1UFF A;  2GTO A;  3NPF A;  5GAO m;  1M1F A;  5GAO p;  1IXD A;  3OB9 A;  5CQX A;  1MV3 A;  2RN8 A;  2LQ8 A;  5CKD A;  3Q1J A;  1YJW A;  1G83 A;  2CZ0 B;  4J9F A;  1HSQ A;  1JBM A;  1VUB A;  3N5B B;  2HBW A;  4M7A E;  1VOM A;  1K9M R;  4ATO A;  3QSU A;  5KYY A;  3I56 T;  2DXT A;  3M53 A;  1X69 A;  2P84 A;  2E3I A;  4PJL A;  1TUG B;  1WIE A;  2D9T A;  2K3B A;  3JB9 H;  4PJO F;  2AKK A;  5GAN 7;  3CCE Q;  2L2P A;  4LD6 A;  3CME A;  3A8L B;  4QKU A;  1T0H A;  3L42 A;  5GMK j;  3OYA A;  2ZGW A;  1E6H A;  3G4S T;  1OOT A;  1QVG P;  4WCI A;  1PNJ A;  2M02 A;  1IO6 A;  2LQN A;  3S3O A;  3CC7 Q;  2E6Z A;  3S3N A;  2X3W D;  4PLL A;  2FYK A;  4J9H A;  3TSW A;  2LCS A;  2DO3 A;  3JV3 A;  1VQP A;  4CC4 B;  1K8A U;  2RJF A;  1GXI E;  1PCX A;  4F04 B;  1XOV A;  2RQU A;  1KSW A;  3L2R A;  2LMJ A;  2JMC A;  2CP3 A;  4M75 G;  5CR2 A;  4XQ3 A;  4XTZ A;  4JJN K;  5EG2 A;  5IXF A;  1WX6 A;  2L3S A;  5EC7 A;  5GAN 3;  1X6O A;  2DL8 A;  3M0U A;  1I0C A;  3ASK A;  3CEY A;  4IIM A;  3EFO A;  5LJ3 j;  1X2K A;  3CCS T;  4RMO A;  4E47 A;  1D1C A;  1JO8 A;  4HVU A;  4OMN A;  2QQB A;  1PD0 A;  2K2V A;  1UTI A;  1KHI A;  1M5Q 1;  5CKB A;  3RMS A;  2A36 A;  2CP2 A;  3I35 A;  3EFS A;  2ENM A;  1TS9 A;  3OS5 A;  8AT1 B;  1K9A A;  1X6G A;  3FLG A;  5LJ5 e;  1XQH A;  3PVL A;  1WQ7 A;  4RTU A;  1UGS B;  4KH0 B;  4IUP A;  3CME Q;  1MGQ A;  4M7D B;  2GTJ A;  4QQD A;  2EQJ A;  2JNG A;  1U06 A;  3EG0 A;  2HQH A;  4BUG A;  2KYM A;  2LCC A;  1WDX A;  5I2M A;  4DEX A;  2MCN A;  1R0C B;  4FIB A;  3HRT A;  5HCK A;  4F7U F;  1YWO A;  4L5G A;  3OQ5 A;  3CXC P;  3JCM d;  1YIJ Q;  1T0J A;  3RUX A;  2ED0 A;  1W1F A;  3V8L A;  4EDU A;  5GAM e;  1WI7 A;  3GNG A;  2KDS A;  3G71 A;  2LX9 A;  2EWN A;  4J6X A;  5J3B A;  1PSE A;  2O01 E;  1D1B A;  3ULR B;  1NJI R;  4M78 C;  4LDX A;  3CPW P;  2HDA A;  2KRM A;  1JJ2 P;  3CCQ Q;  1JJ2 A;  1K8A C;  2J6F A;  3CCU Q;  1ZA2 B;  1OX8 A;  1K9M U;  1YN8 A;  2EBP A;  2RF0 A;  1KD1 R;  4DBQ A;  1KJW A;  4PJO E;  3JB9 J;  4PFP A;  3M54 A;  4OB0 B;  2RO0 A;  1T3S A;  3I55 Q;  2CYZ B;  2KMT A;  2B8A A;  3T9N A;  4A4K A;  3EGD A;  1Y0M A;  2ZPI B;  1YIT A;  2DL5 A;  3E1S A;  3TRE A;  2Z0W A;  4P5N A;  2X3X D;  1BCM A;  2KXD A;  4FU6 A;  1VYT A;  4OP0 A;  3TVT A;  1R77 A;  4IUV A;  3E2U A;  1N9R A;  4FYY B;  3DLM A;  3M0T A;  5IXB A;  3G6E A;  1TG0 A;  4LDY A;  3BDL A;  1LOJ A;  2JN0 A;  2QI2 A;  3RNJ A;  2K3Y A;  4Q5W A;  1MUZ A;  5DLQ E;  4C8Q E;  2MK5 A;  2PVD B;  1EZZ B;  2Y4Y A;  4N4I A;  1Q86 R;  1X43 A;  4OMO A;  1NYG A;  1UGR B;  5GAN 5;  2V8J A;  4C0F A;  2FZC B;  3E9F A;  1U3O A;  2RHX A;  3IQL A;  2BZY A;  3RDV A;  3J7A F;  1NE8 A;  3I5S A;  3TSZ A;  1DJ7 B;  1OI1 A;  3EGX A;  4XU0 A;  3QYH B;  4M75 A;  2FRY A;  5GAM d;  4RG2 A;  1B07 A;  3TCJ A;  3VJP A;  4AG1 C;  1AWO A;  1HYO A;  3CMA T;  3RKY A;  2QEX T;  3JCM e;  2XHC A;  2ZAE A;  3L2Z A;  5LJ5 g;  1VQ5 T;  2QA4 Q;  3WVE B;  4ANJ A;  1GBQ A;  2ROL A;  2RA2 A;  2O4X A;  3VS4 A;  2KRO A;  3OYJ A;  1H3H A;  4M75 F;  3O5Z A;  1M8M A;  3VRY A;  1PHT A;  3INZ A;  1KD1 U;  1GFD A;  3LLR A;  4BAC A;  3M57 A;  4BI8 B;  2NUZ A;  2SRC A;  2KQW A;  2QTV A;  3M56 A;  2RNA A;  4ELY C;  1Q86 C;  1K4U S;  3HKS A;  1QVP A;  3S6W A;  1VQ5 A;  2KYB A;  3L2U A;  2VKN A;  4MDW A;  3RR6 A;  3DB4 A;  4M77 B;  2W10 A;  4D8D A;  2A7Y A;  1QW1 A;  3LH5 A;  3JCM X;  3CXC S;  1QMC A;  2XG8 D;  3CCS A;  3I55 T;  3DKM A;  1N5Z A;  2HL5 C;  4M7A A;  1B34 A;  2PVG B;  3GLX A;  4A4E A;  2XKO C;  3L2W A;  2RHZ A;  3QZ5 B;  2DET A;  1MND A;  1KD1 C;  1BI0 A;  1HD3 A;  4Z02 A;  3QYG B;  3V8K A;  1QVF P;  4M7D C;  4OMF B;  3VS6 A;  3GIB A;  4NL2 A;  2DXU A;  3M55 A;  5KE3 A;  1PRL C;  1VQO Q;  1M27 C;  1U8R A;  2DIQ A;  1RLP C;  2X51 A;  2M16 A;  2CGH A;  4KT0 E;  2E12 A;  5FWC A;  2M0O A;  4JRQ A;  1BCO A;  3VS7 A;  5KYX B;  4N0A C;  1JXM A;  2A3L A;  4B9W A;  4QT7 A;  4YTL A;  5FRN A;  1C6V X;  4JDS A;  2PUO B;  3FRN A;  1Q82 C;  4M7A F;  1SPK A;  4QW2 A;  1VQ6 A;  2BKD N;  1NM7 A;  3CBO A;  3V7R A;  1VQ7 Q;  3QDR B;  1K73 U;  3G71 Q;  2E10 A;  3G7Z A;  1OZ2 A;  1UGP B;  4C0D B;  3UPU A;  2HCK A;  4DBF A;  1ZUK A;  4F7U B;  3I56 A;  2RK1 A;  2AZS A;  2X9H A;  1Y71 A;  2YRD A;  4FM4 B;  3FB9 A;  4PJN A;  4GY5 A;  1OV3 A;  2QGG A;  1WFW A;  2EYY A;  1BYM A;  1NJI U;  4MZT A;  2H3J A;  1Y07 A;  4ORZ A;  2FZG B;  2JT4 A;  3UDC A;  2PQW A;  2F1L A;  2DER A;  4LXC A;  4XTY A;  1E6G A;  2M9U A;  3CME T;  3PNW C;  5FRO A;  2LDM A;  4RCC A;  3NHN A;  4OB2 B;  4JS4 A;  2EYX A;  5L23 A;  1RLQ C;  2O31 A;  2CZ6 B;  2L89 A;  2V1Q A;  2LQK A;  1VQO A;  1ZSZ C;  1FXX A;  3URG A;  1RI9 A;  1WPY A;  1ZSZ B;  4XTU A;  2NYS A;  1W70 A;  5LL6 S;  1YNZ A;  2RJD A;  2C06 A;  3CBM A;  1IRE B;  2CRE A;  3C4S A;  4J6W A;  3P8H A;  2JUF A;  5CKH A;  3H8Z A;  2DYI A;  4F7U A;  3OW2 S;  2I0N A;  5DM7 R;  2EYQ A;  2FPD A;  2YSQ A;  1G3S A;  1QWF A;  2PU9 B;  1U1S A;  4DBR A;  3CCU T;  5GMK i;  1Y96 A;  4DOW A;  1RAD B;  1OUL A;  2QQA A;  3M58 A;  1NLP C;  2RQV A;  4BY6 C;  2QAZ A;  3CD6 T;  1NBE B;  3M4G A;  1FMV A;  1LCK A;  4C92 B;  5GAO l;  1VQP Q;  2DE0 X;  1ZBJ A;  2LCL A;  2HMA A;  3QPH A;  1Y96 B;  4IUQ A;  3TQ7 P;  1VQ8 A;  1MMG A;  3VRZ A;  1W2B P;  2V26 A;  3NTH A;  2YUN A;  1ZUY A;  3EH2 A;  1EFN A;  4BDY A;  4RTY A;  2F69 A;  5D6W A;  4PK4 A;  4CI0 C;  2FL7 A;  2ZPH B;  1N6A A;  1UUE A;  3EG1 A;  1WXB A;  2KEA A;  1YIJ T;  4PJO B;  5D6X A;  1C1A A;  3PTA A;  4K11 A;  2YXY A;  2VXE A;  3CC4 Q;  3BW1 A;  3AHU A;  4ZGE B;  1JU5 C;  1X27 A;  3V7C A;  2LT4 A;  3WXM B;  2E6N A;  3JAM E;  2OTL A;  2DF6 A;  1I07 A;  1UG1 A;  1F1B B;  3JCM Q;  1M2V B;  4KBM B;  5CVI A;  4LE9 A;  1VQK A;  4AMC A;  1TUD A;  3X25 B;  1Q82 R;  4QVD A;  2RM4 A;  2XIC A;  2YDL A;  1SSH A;  1BI2 A;  4IIO A;  2E3H A;  2QYZ A;  2DJQ A;  5CIU A;  2HQE A;  1LNX A;  2DVJ A;  2VC8 A;  2VGN A;  2KT1 A;  4HVV A;  5I2S A;  2L3P A;  3RKX A;  3M0P A;  1H3Z A;  1I81 A;  2VAS A;  3JCM P;  2CS7 A;  1Z9Q A;  3JSC A;  4FL6 A;  2FVU A;  2QEX A;  3HL8 A;  1YJW T;  4J7F A;  5GJW B;  4J8O A;  2EJG A;  1BIB A;  4N4G A;  4M7D E;  3CCE A;  3P8B B;  4GLK A;  2EGA A;  1VQL A;  4JZ4 A;  4FYV B;  2JTM A;  1YFN A;  1UDL A;  3VYG A;  5GAN g;  2LC4 A;  1FMK A;  2XI9 A;  3X26 B;  4C8Q D;  1KC8 U;  4N4H A;  5KYW A;  4RCB A;  1UGV A;  1X2Q A;  3EGD B;  1K76 A;  1Q7Y U;  4OVA A;  2EQI A;  4RUG A;  2KI7 A;  1I5O B;  3SDZ A;  4C92 A;  1M4Z A;  3I5R A;  3L2Q A;  3CCQ A;  1ABQ A;  1BK2 A;  2CSQ A;  1M1K R;  3UA6 A;  1GL5 A;  4E6R A;  2RD1 A;  1ZQ1 A;  4F17 A;  2KT8 A;  2AK5 A;  2QTX A;  3HP9 A;  2DBM A;  2OTJ A;  1PG5 B;  3REA B;  3MP6 A;  4ZNX A;  1VQN T;  3OS0 A;  4WF2 A;  2VB6 A;  2IIM A;  4M75 C;  2VXF A;  5KCH A;  2LQW A;  5LJ5 h;  4HXJ A;  3L2V A;  1YIT T;  5IT9 E;  2OTL Q;  2XDB A;  2DL4 A;  1J3T A;  1UB4 A;  1QP2 A;  1K73 C;  2DD4 A;  1TXQ A;  3UF4 A;  4RTZ A;  2EW3 A;  5M9O A;  4XU2 A;  1X75 C;  2YLB A;  2F5K A;  3VS0 A;  2WAC A;  1QVF S;  1WHK A;  2NUT A;  3QJ6 A;  3X28 B;  4F7U G;  4X34 A;  2DX1 A;  2COY A;  4DOV A;  2PUK B;  4M78 B;  4QVC A;  4C0Z A;  2M1H A;  9ATC B;  1YJ9 Q;  2VGM A;  5HK3 A;  2FO0 A;  2QG9 B;  1WHH A;  1Y7X A;  4C5I A;  4JJB A;  3GP8 A;  2D8J A;  2D1X A;  3MCA B;  4M7A C;  2R5M A;  3VUB A;  2JVV A;  1Q7Y C;  5KH6 A;  3CCM Q;  2K5I A;  4M75 B;  4Z89 A;  1U5S A;  3CCS Q;  2KR3 A;  2R58 A;  2ZPG B;  2K3X A;  1YJW Q;  4V2S A;  3EFO B;  2KAF A;  4M7A B;  2O9S A;  3QBY A;  3GOX A;  2XU8 A;  4B6M A;  1M1K U;  1WJQ A;  3CXC A;  5I21 A;  1H8K A;  1D09 B;  4CC7 A;  3BY7 A;  1QLY A;  4EMK B;  4XAX B;  2EYW A;  2YUQ A;  1VYU A;  1S72 A;  4QQG A;  2PZ1 A;  5HK0 A;  5FU7 C;  2BTT A;  1M9S A;  2ZPF B;  3FIF A;  1YI2 T;  1KQS P;  4KGX B;  2CH4 W;  1PRM C;  4ZTF A;  4M78 F;  2DKG A;  2L3Q A;  3QUI A;  2EFI A;  4JS5 A;  3RIR A;  1NYF A;  4BB7 A;  2LP5 A;  4LUE A;  4KUD K;  2A08 A;  3CC2 Q;  3SWN A;  5GAM j;  2ZCF B;  1XNI A;  2BE7 D;  4A54 A;  1M3B A;  1MV0 B;  3SHW A;  5I11 A;  1K8A R;  5GAM h;  4MML A;  1RUW A;  4C5G A;  1VQ4 A;  3BE3 A;  1YHQ Q;  1BIA A;  3LGL A;  1I4K 1;  2DL7 A;  2X4J A;  2LVM A;  4M77 A;  3NGP A;  5LJ3 f;  3I56 Q;  4JLI A;  4HA8 A;  2J7I A;  4XU1 A;  4IUU A;  2E5Q A;  1I5L A;  1ARK A;  1IHW A;  4M7D G;  3TEE A;  1VQP T;  2O4X B;  5LJ5 d;  2P4T A;  3C94 A;  1MNE A;  3LGF A;  2V8K A;  7AT1 B;  2KY9 A;  2FEI A;  4AFZ C;  1KQ1 A;  2JMA A;  3ER0 A;  1EX4 A;  3F70 A;  1HXD A;  1YCY A;  2RQT A;  4J83 A;  3ZEH A;  1LJO A;  3JCM J;  5GAN 4;  1G8X A;  4OB3 B;  1AWW A;  2NUT B;  4A4G A;  1M3A A;  3HTR A;  3M59 A;  1B3Q A;  5GAN 8;  2E41 A;  4PKC C;  1YJ9 T;  4PJO C;  4E7S A;  5KE2 A;  4JRI A;  2KNB B;  2DK3 A;  1AT1 B;  2ZPE B;  4L6V 5;  2MIO A;  5AYF A;  1M1G A;  2XMF A;  4ESR A;  2P0K A;  4OB1 B;  1K0X A;  1ZBX A;  1VQN Q;  1MMN A;  1WGS A;  1AOJ A;  2CP6 A;  3MET A;  4C0D C;  1W2B A;  2FB7 A;  1YIT Q;  3OYE A;  2QA4 A;  2GGR A;  3MEU A;  2FPE A;  1B7T A;  3CBP A;  3JCM b;  3U23 A;  2IVW A;  1QCN A;  3C0C A;  3NTK A;  3MJX A;  3LWI A;  1RAE B;  2FHD A;  3KFV A;  4E7K A;  1BB9 A;  2F5T X;  3UA7 A;  1MMA A;  3CC2 A;  1HK9 A;  2DZ9 A;  2I2L A;  1QKW A;  4M78 A;  4OMP A;  2IG0 A;  2WSC E;  1OPL A; 
#chains in the Genus database with same CATH homology
 1BBZ A;  2EYX A;  2HBW A;  5L23 A;  1RLQ C;  2O31 A;  2OAW A;  3VS3 A;  1SHF A;  4CC2 A;  2BZ8 A;  2V1Q A;  2SEM A;  1RI9 A;  1X69 A;  4AFQ C;  2KE9 A;  1W70 A;  1WIE A;  3H41 A;  1YNZ A;  2K3B A;  1BU1 A;  2AKK A;  4J9B A;  2L2P A;  2CRE A;  2F2X A;  4JZ3 A;  2EKH A;  1T0H A;  1UHC A;  2DMO A;  3QWY A;  4AFU C;  1E6H A;  1OOT A;  4WCI A;  3EGU A;  2JW4 A;  1PNJ A;  1IO6 A;  4GBQ A;  2ESW A;  2I0N A;  2K79 A;  1ZLM A;  2LQN A;  2FPD A;  2YSQ A;  1QWF A;  3H0F A;  3SEM A;  1NG2 A;  2X3W D;  4J9E A;  4J9H A;  3TSW A;  1JEG A;  2LCS A;  2NWM A;  1NLP C;  2RQV A;  2A28 A;  3JV3 A;  2CSI A;  4CC4 B;  1LCK A;  2DYB A;  2DE0 X;  1ZBJ A;  1WLP B;  1XOV A;  2J6K A;  4EIK A;  1W6X A;  1KSW A;  2RQU A;  2LMJ A;  2JS2 A;  2JMC A;  2LJ0 A;  3VRZ A;  1GBR A;  4J9D A;  2EPD A;  3ZL7 C;  1PWT A;  2DL3 A;  5IXF A;  1VYV A;  2YUN A;  1WX6 A;  1ZUY A;  1EFN A;  2L3S A;  1JQQ A;  1GCP A;  4RTY A;  5EC7 A;  2DL8 A;  3M0U A;  1AZG B;  4M4Z A;  3VS5 A;  4LUD A;  1I0C A;  4F16 A;  4IIM A;  1UJY A;  2E5K A;  2ECZ A;  1UUE A;  2F2V A;  1WXB A;  3EG1 A;  2L0A A;  2KEA A;  5FW9 A;  1X2K A;  4K11 A;  3R6N A;  1JO8 A;  4OMN A;  4HVU A;  1T3L A;  2CH4 A;  2DLP A;  1UTI A;  1JU5 C;  1X27 A;  2GBQ A;  2DF6 A;  3EHQ A;  2A36 A;  2J6O A;  1I07 A;  4GLM A;  2EYZ A;  3I35 A;  1UG1 A;  2J05 A;  2DNU A;  1Y57 A;  2ENM A;  2OJ2 A;  2PTK A;  4LE9 A;  2FG0 A;  2BZX A;  1M30 A;  1TUD A;  1K9A A;  1X6G A;  2B86 A;  2V1R A;  3PVL A;  3EHR A;  1UJ0 A;  4RTX A;  2YDL A;  2RPN A;  1SSH A;  4RTU A;  4IIO A;  2DJQ A;  2DVJ A;  2KT1 A;  4HVV A;  2GTJ A;  4JJC A;  2L3P A;  1AZE A;  2DM1 A;  3M0P A;  1U06 A;  3EG0 A;  2CUD A;  1Z9Q A;  2KYM A;  2J06 A;  1WXT A;  1WDX A;  4DEX A;  1ZX6 A;  2MCN A;  2FRW A;  2VVK A;  5HCK A;  3M0R A;  2O9V A;  5GJW B;  1YWO A;  4AFS C;  1YCS B;  2EGC A;  1T0J A;  2ED0 A;  1W1F A;  1WI7 A;  2ED1 A;  4HCK A;  3EG2 A;  3M0S A;  2EGA A;  2LJ3 A;  4JZ4 A;  1UHF A;  2ROT A;  2KRN A;  1AWJ A;  1UDL A;  1FMK A;  3H0H A;  5IHI A;  2JTE A;  1UGV A;  1X2Q A;  1K76 A;  3ULR B;  2EQI A;  4RUG A;  1OPK A;  2HDA A;  2KRM A;  5IHN A;  1HJD A;  1AEY A;  2YUP A;  3I5R A;  2J6F A;  3REB B;  2DA9 A;  1ABQ A;  1BK2 A;  3A98 A;  2CSQ A;  1ABO A;  1YN8 A;  2EBP A;  2RF0 A;  3UA6 A;  1PKT A;  1GL5 A;  4E6R A;  4F17 A;  2KT8 A;  1AWX A;  1KJW A;  2AK5 A;  2CT3 A;  2D0N A;  4LN2 A;  2DBM A;  1FYN A;  1V1C A;  1T3S A;  3I9Q A;  3REA B;  2RQW A;  4ZNX A;  1GCQ A;  4JJD A;  4Z88 A;  2IIM A;  2K9G A;  1Y0M A;  2LQW A;  2DL5 A;  4HXJ A;  3UAT A;  4X1V A;  2G6F X;  2X3X D;  2DL4 A;  1J3T A;  2KXD A;  1VYT A;  5I22 A;  3TVT A;  4J9I A;  1VA7 A;  2JXB A;  2K6D A;  2A37 A;  3UF4 A;  4RTZ A;  2CT4 A;  2EW3 A;  2DRM A;  4J9C A;  3M0T A;  5IXB A;  2LJ1 A;  2MOX A;  1TG0 A;  1WXU A;  3VS0 A;  2DIL A;  3RNJ A;  2O2O A;  2DX1 A;  1MUZ A;  1UEC A;  2HSP A;  2KRS A;  2JM8 A;  4FSS A;  1K0S A;  4OMQ A;  1G2B A;  1X43 A;  3M0Q A;  4OMO A;  1NYG A;  2FO0 A;  1QWE A;  4JJB A;  2D8J A;  4J9G A;  2W0Z A;  1U3O A;  2D1X A;  3IQL A;  2BZY A;  1GRI A;  3I5S A;  3TSZ A;  1YWP A;  2CDT A;  2C0I A;  2CUB A;  2K2M A;  1JXO A;  3NMZ C;  4DEY A;  3QWX X;  4Z89 A;  4A63 B;  1ZUU A;  1U5S A;  5GJV B;  2FRY A;  1AWO A;  1B07 A;  4AG1 C;  2KR3 A;  1GCQ C;  2EVR A;  2M51 A;  1GBQ A;  3RBB B;  1CSK A;  1CKB A;  2O9S A;  1NEG A;  2ROL A;  2AKL A;  3VS4 A;  2KRO A;  1WYX A;  2H8H A;  4CC3 A;  1H3H A;  1H8K A;  3O5Z A;  4CC7 A;  1M8M A;  1QLY A;  3VRY A;  2K7A A;  2EYW A;  2YUQ A;  1PHT A;  4RTW A;  4RTV A;  1GFD A;  1SRL A;  4HVW A;  1VYU A;  3PVQ A;  2OI3 A;  2NUZ A;  2SRC A;  4R0K A;  2M0Y A;  2KBT A;  2PZ1 A;  1S1N A;  2BTT A;  2RNA A;  2RMO A;  2VWF A;  1K4U S;  1SEM A;  1K1Z A;  3H0I A;  2CH4 W;  2KYB A;  4JPB W;  1PRM C;  2VKN A;  2L3Q A;  2JS0 A;  1NYF A;  2LP5 A;  2W10 A;  4LUE A;  2A08 A;  4D8D A;  3LH5 A;  2JM9 A;  3VS2 A;  4Y92 A;  1N5Z A;  1QCF A;  1M3B A;  2ABL A;  1MV0 B;  3SHW A;  3CQT A;  5I11 A;  2PNI A;  1RUW A;  3EG3 A;  1TUC A;  2RQR A;  1PKS A;  2YUO A;  1M3C A;  2C0O A;  1E7O A;  2O88 A;  1HD3 A;  3VS6 A;  1PRL C;  1M27 C;  2DL7 A;  4KRT A;  1SHG A;  4AG2 C;  1RLP C;  3NGP A;  4Z8A A;  2LNH B;  2DBK A;  1KFZ A;  2J7I A;  5FWC A;  2FPF A;  3PE0 A;  2LZ6 B;  1ZSG A;  1ARK A;  3VS7 A;  1JXM A;  1WA7 A;  3GBQ A;  4QT7 A;  5IHK A;  4F14 A;  2FEI A;  4AFZ C;  2JMA A;  2RQT A;  2AZV A;  1NEB A;  1AWW A;  1AVZ C;  2P4R A;  2QDL A;  1M3A A;  1B3Q A;  1Z9Z A;  5FWB A;  2GNC A;  1YP5 A;  4D8K A;  1SPK A;  4LNP A;  1SRM A;  2KNB B;  1NM7 A;  1GFC A;  5IH2 A;  1CKA A;  2DRK A;  2EGE A;  1OEB A;  2MIO A;  4RTT A;  2XMF A;  4ESR A;  2KGT A;  2HEQ A;  1K0X A;  2C0T A;  1AOJ A;  2HCK A;  2KXC A;  1ZUK A;  2YT6 A;  4OML A;  2AZS A;  2F2W A;  1QKX A;  2GGR A;  1OV3 A;  1I1J A;  3THK A;  2FPE A;  1WFW A;  2EYY A;  1AD5 A;  1NLO C;  5ECA A;  3U23 A;  1KIK A;  2GQI A;  4ORZ A;  2JT4 A;  3C0C A;  2D8H A;  1H92 A;  1X6B A;  1UE9 A;  1UFF A;  2LX7 A;  1E6G A;  2GTO A;  3NPF A;  3KFV A;  1BB9 A;  3UA7 A;  4OMM A;  1A0N B;  1MV3 A;  2RN8 A;  3NHN A;  3VS1 A;  1QKW A;  3FJ5 A;  1G83 A;  4J9F A;  1HSQ A;  4OMP A;  1OPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...