1ZSGA

Beta pix-sh3 complexed with an atypical peptide from alpha-pak
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
65
structure length
65
Chain Sequence
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Rho guanine nucleotide exchange factor 7
publication title Structural Analysis of the SH3 Domain of beta-PIX and Its Interaction with alpha-p21 Activated Kinase (PAK)
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zsgA00
1HSQA 1OV3A 2DM1A 4LUDA 2FPDA 2CREA 5GJVB 5EC7A 1GCQA 1WFWA 1SEMA 2EYXA 2DX1A 1JQQA 1T0HA 2VWFA 3TSZA 1VA7A 1AOJA 2J7IA 1WDXA 2L0AA 4ESRA 2JS0A 1EFNA 3H0FA 2YT6A 1ZLMA 4LN2A 1H8KA 3VS0A 4IIMA 2KYBA 1BB9A 2KRNA 1X27A 2FRWA 1NLPC 2ROTA 2I0NA 3NGPA 2K6DA 4HVWA 2DL5A 2ED0A 3H41A 3M0PA 2FO0A 1AWOA 1X6GA 2DBMA 1YCSB 1UTIA 2K2MA 3EG3A 1NEBA 2ESWA 2QDLA 4JZ3A 2DA9A 4RTXA 1AZEA 2RMOA 2KNBB 1K0SA 1RLQC 4DEXA 1NYGA 1U06A 2JS2A 1WA7A 2O9VA 2KROA 2CH4W 4K11A 5IHKA 4FSSA 2DILA 3CQTA 2DBKA 1H92A 1QKXA 3PVLA 1NLOC 1OPLA 2YSQA 1QWEA 4KRTA 4J9IA 1JEGA 3REBB 3SEMA 1W1FA 1UJYA 2YDLA 1AWXA 2FEIA 2RQRA 2DJQA 1UUEA 4QT7A 1SPKA 2OAWA 4RTUA 2G6FX 3EGUA 5FWCA 4AG2C 1E6GA 2EGAA 2LQNA 2X3XD 4JJCA 2F2XA 3M0UA 1K1ZA 2YUQA 1WXUA 2RPNA 4CC2A 2C0IA 2EVRA 1MUZA 3VS4A 2BTTA 1BK2A 4HCKA 5L23A 4AFZC 1SHFA 1ARKA 3ULRB 1GL5A 1UFFA 1I07A 2D8HA 3FJ5A 3EG2A 1X2KA 1X69A 2LMJA 1UGVA 1VYUA 1ABOA 2AKKA 4HVUA 3JV3A 2DL3A 2DRMA 1WXTA 4D8DA 1AVZC 1I1JA 2EGCA 1Y0MA 4Z8AA 3UA6A 1X6BA 2KT8A 1QCFA 4GBQA 2KYMA 1QKWA 1M3BA 3VRZA 4HVVA 1W6XA 1UJ0A 4RTTA 1RI9A 3VS1A 1UECA 1NG2A 1MV0B 1CKBA 1UE9A 4LUEA 2ECZA 4LNPA 2NUZA 2MCNA 1X2QA 2EYWA 1MV3A 1ZBJA 2DNUA 2W10A 1JU5C 2OI3A 1UHFA 2J6OA 2AZSA 2EYYA 1KJWA 4M4ZA 2H8HA 3THKA 1T3SA 2CT3A 2CH4A 3C0CA 2EGEA 2DL7A 4ZNXA 2KXDA 1T3LA 3R6NA 4CC4B 2DL4A 2F2VA 4Z88A 3H0HA 3LH5A 1B3QA 2FPEA 4WCIA 2W0ZA 3H0IA 3SHWA 5GJWB 1M8MA 1ZUKA 3I5SA 2F2WA 1T0JA 1YP5A 3VS3A 4J9BA 4ORZA 4JZ4A 1KSWA 3NPFA 4JJDA 2MIOA 3UF4A 2XMFA 4CC7A 1GBRA 3TSWA 1VYTA 1I0CA 2SEMA 5ECAA 1HJDA 5FW9A 2RN8A 5IXBA 4A63B 4J9DA 1K4US 1PRMC 2CT4A 2K7AA 2AK5A 5I22A 2CSIA 2KR3A 3GBQA 5IHIA 3VS7A 2M51A 1GRIA 2KBTA 2JW4A 3NMZC 4J9FA 4OMNA 2JMCA 1SRLA 4DEYA 1TUDA 1H3HA 3VRYA 1OPKA 1Z9QA 1AD5A 3EG0A 3REAB 1VYVA 2JTEA 2KGTA 2MOXA 4IIOA 4OMPA 2D1XA 2DVJA 2O88A 2L3QA 4AFSC 2J06A 2CSQA 1GFCA 3VS5A 1KIKA 2CDTA 3UATA 3I35A 3M0TA 2EPDA 1Z9ZA 1YN8A 1ZX6A 2DE0X 5HCKA 1W70A 2JXBA 4J9CA 1GFDA 2O2OA 2GBQA 1B07A 2L3PA 4E6RA 2K79A 1K9AA 4AFQC 1SHGA 1ABQA 1UHCA 2X3WD 1YWOA 3EHRA 4LE9A 2LJ3A 4J9GA 4F17A 1WXBA 2RQVA 2DYBA 5IXFA 3UA7A 1PWTA 1SSHA 2O31A 1PRLC 2DL8A 2KT1A 3ZL7C 4J9HA 3VS2A 2B86A 1Y57A 2PZ1A 4RTYA 1AWWA 4GLMA 2A08A 1CKAA 4OMOA 1IO6A 2LJ0A 1E7OA 2C0TA 1RUWA 1WX6A 2HCKA 2RNAA 1S1NA 1NEGA 1AZGB 2LZ6B 4RTWA 2RQWA 1QWFA 2ED1A 2JM8A 2GNCA 2KE9A 3TVTA 1YWPA 2JM9A 2K9GA 1G83A 2M0YA 2O9SA 2EQIA 2AKLA 2EYZA 1E6HA 2GTOA 3PVQA 2D8JA 1M3CA 1BU1A 2ENMA 2JT4A 1OOTA 1J3TA 1X43A 1ZSGA 2GQIA 1U5SA 2JMAA 1ZUUA 2P4RA 2SRCA 3M0QA 4Z89A 1G2BA 2BZXA 3NHNA 2YUOA 3IQLA 2V1RA 3M0SA 4J9EA 2HDAA 4HXJA 4R0KA 1A0NB 1HD3A 1WLPB 2A36A 1JXMA 2D0NA 2J6FA 2PTKA 1QLYA 1TUCA 2BZYA 2YUPA 2V1QA 1NYFA 1PKTA 2HBWA 2KEAA 2K3BA 4RTVA 3O5ZA 1LCKA 3EHQA 4OMMA 3RNJA 2ROLA 1WI7A 1FYNA 1M3AA 4JJBA 2BZ8A 2DMOA 4RTZA 1SRMA 3RBBB 1M30A 3PE0A 4CC3A 4RUGA 1GCQC 4X1VA 3QWXX 2OJ2A 1PKSA 1YNZA 2NWMA 2J6KA 2LX7A 1K76A 2CUBA 1JO8A 2DLPA 2E5KA 1WYXA 1M27C 5I11A 2FG0A 2KRMA 1PNJA 2PNIA 1PHTA 2IIMA 2HEQA 2LJ1A 4JPBW 2FPFA 2DF6A 4D8KA 1UG1A 2J05A 2KXCA 1K0XA 1KFZA 2EKHA 3QWYA 3U23A 2L2PA 2FRYA 2RQUA 2GGRA 1BBZA 1AWJA 3VS6A 2GTJA 3I5RA 2LNHB 4AFUC 4F14A 1V1CA 5IH2A 3A98A 2RF0A 2L3SA 4EIKA 3KFVA 2EBPA 1N5ZA 2KRSA 1GCPA 1UDLA 2ABLA 2AZVA 1RLPC 4OMLA 1FMKA 1WIEA 1NM7A 1TG0A 2DRKA 1JXOA 1XOVA 1OEBA 3EG1A 2LQWA 4Y92A 3I9QA 4AG1C 2VVKA 1U3OA 2A28A 2C0OA 2EW3A 1CSKA 2LCSA 5IHNA 4OMQA 2A37A 1AEYA 2CUDA 2RQTA 2VKNA 2YUNA 2HSPA 2LP5A 4F16A 5FWBA 1ZUYA 3M0RA 1GBQA
chains in the Genus database with same CATH superfamily
2NUTA 3CCRA 3VV0A 4LUDA 2FHDA 4M7AE 4NS5A 1M9SA 1XNIA 2DTHA 3OYDA 4M75B 4LDVA 2EYXA 5GAOl 1JQQA 4ZN1A 1QVGA 1YJ9Q 2J7IA 2QTXA 3PT9A 3AT1B 1K73C 5HK0A 1QVGS 4IIMA 1BB9A 2KRNA 2FRWA 3OS5A 3QYHB 1N8RU 5A2QE 1ZA2B 4BB7A 2NLUA 3NGPA 5FROA 1I8FA 2KDSA 2JJ9A 4QVZA 2EAYA 1X6GA 3X25B 3CC7Q 2DBMA 1YCSB 1LVKA 2DA9A 2RJCA 2DZCA 1TXQA 2LVMA 4J6XA 4F04B 5D6XA 4XTUA 1U06A 4OB3B 4QVCA 4M78F 3JB9J 3ER0A 1RAIB 2YHTA 3LWHA 2GFUA 2IVWA 1ZSZB 2Y4YA 1GXIE 1JJ2A 2QAZA 3OYYA 3TREA 1D1CA 3PVLA 1NLOC 2YSQA 1JEGA 1QWEA 3CCVA 2V26A 2K2VA 3G4SQ 2YDLA 2FEIA 1JJ2S 1R77A 4QT7A 1VQ9Q 4RTUA 4AG2C 3M56A 3JAME 5GAMd 1K9MR 3CCRQ 2LRQA 2F2XA 4LXCA 2RPNA 2C0IA 2K5FA 1S72A 4XAXB 1BK2A 5GAOn 1V76A 1OYXA 3MKDA 3FJ5A 4RG2A 2LMJA 3NTHA 4PJOE 2D0QB 3ZBDA 1UGVA 2NYSA 1VYUA 3OMGA 1VQ8A 3JB9I 2DL3A 1WXTA 3DB4A 4D8DA 2EGCA 3J7AF 2EJFA 1X6BA 4KBMB 2KT8A 3TEEA 3LYIA 1QKWA 4PJOB 1LPLA 1M3BA 5GANg 5GANd 3VRZA 2D6FA 4BI3A 2QG9B 5AYFA 3VS1A 1UECA 2QI2A 5FRMA 4BDZA 1UE9A 4LUEA 3ZFJA 5CCAA 3FIFA 5KYUB 3M59A 4LNPA 3L2UA 2KVQG 2MCNA 4OMFB 3S3MA 4GY5A 3OYEA 5J3BA 3HP9A 2QEXQ 1RAHB 2J6OA 1PG5B 3E9FA 3HRSA 2EYYA 1MNDA 4M4ZA 2H8HA 3V7RA 4JRIA 2CT3A 3A1PA 3URGA 1T3LA 3Q1JA 1ACMB 1IZ6A 1IREB 1IB8A 2F2VA 1Q81C 1R0CB 1M1KC 4M7DF 1PM3A 3LH5A 5GMKj 3QJ6A 1JB0E 2RI5A 4M78C 4WTOB 2BKDN 4N0AC 1U8RA 1VQ7A 2VC8A 1N8RR 4ORZA 4JZ4A 3PMTA 3NPFA 3BY7A 3OS1A 2MIOA 1K8AU 4CC7A 2QTVA 4ZGJB 1I0CA 5ECAA 5CKHA 2QGGA 3CCJQ 2E3HA 2RN8A 5CVIA 1N9RA 6AT1B 1NJIC 3G6ET 1KQSP 2DO3A 4BDYA 2QQSA 5FU7C 1YITA 2KR3A 3H6ZA 1QQJA 2KBTA 1N9SA 1EX4A 3OYIA 3EG9B 5CKBA 1MGQA 4C0DC 3X24B 4F7UG 1AD5A 4OB1B 3VUZA 3EG0A 1M1GA 2IPOB 1PD1A 2DEUA 3CBMA 3PGGA 3OYAA 2LTOA 4PFZA 4FU6A 2H3JA 3MJXA 1YJNT 2E64A 3E19A 4KULA 4EMKB 1RAFB 3CC2Q 1GFCA 4BUGA 2NUTB 3VS5A 3M0TA 1ZX6A 5GMKe 3JCMe 2HQEA 4J9CA 2JXBA 4FIBA 3HTRA 2L3PA 1BI2A 2PU9B 1ABQA 3QKJA 4FYWB 1YWOA 4FYXB 1VQ4Q 4J6WA 3EHRA 3C95A 1HK9A 3OW2P 1M8VA 1IHWA 5CK9A 4M78A 4C0GA 2CP5A 1VQMT 5IXFA 1FMVA 4N0AA 4BE0A 4JLIA 4O6JA 3GNGA 2P84A 2PZ1A 1Y57A 4M7DC 2CGHA 3JCMf 2HNIA 1YJNQ 2VXFA 2DEQA 3OSSC 4OF1A 3FJPA 1CKAA 1IO6A 3CC4Q 2CP2A 2C0TA 2HCKA 4IUVA 1B7TA 2COWA 1S1NA 4RTWA 1BIBA 4C92A 2GNCA 1X75C 3A8OB 4JLGA 5IT9E 2RA2A 5CKDA 1E6HA 1K73U 1VQ5T 1M3CA 2RJDA 1BI0A 4B9XA 4F7UE 1U5SA 1Q82U 2JMAA 1H3ZA 2SRCA 1Y96B 5LJ3h 3HFNA 2BZXA 5FLXE 3L2QA 3OYLA 2X4XA 2F5TX 2YUOA 2BIVA 3RESA 3C94A 1K8AR 2DPPB 4KH0B 1WLPB 2A36A 4F7UB 1VQOT 2PTKA 2OTJT 2BZYA 2DZ9A 1NYFA 1PKTA 2KEAA 1FXXA 4OMMA 3M9QA 1M3AA 1YHQA 2HL5C 1M30A 4RUGA 1YI2A 1IHVA 5GANj 3J81E 1VQNT 2NUPA 4RKUE 2E5KA 2AHJB 2E3IA 2AIRB 3CCMA 1M90C 3CMAT 5I11A 1XTDA 1OQKA 1Q86C 1PNJA 2DYIA 2PNIA 2IIMA 1VUBA 2R58A 1QVPA 2EKOA 4CRIA 1B34A 3RKWA 5A0LA 5KYWA 2MF2A 2EKHA 3EGXA 3U23A 2L2PA 4E7LA 2RQUA 2CP0A 1BBZA 2CS7A 3HSBA 4ZTJA 4FT4A 2LNHB 5GAMe 3WVDB 2M0OA 1JBMA 4FW1A 1KQ2A 2L3SA 5HKCA 3KFVA 5KYYB 4RMOA 4R56A 2M16A 1N5ZA 3I56A 5LJ5h 2XICA 3I55Q 1HYOA 1XOVA 5CO7A 2LQWA 1SSFA 2HMAA 1YJWA 2BUDA 2C0OA 2EW3A 3MEVA 1C1AA 2R5AA 2FVUA 5IHNA 4OMQA 3PFSA 3CCEQ 3MP6A 3HPWA 3NTKA 4J83A 2YUNA 2K4YA 3FC3A 4F16A 5GANe 3DB3A 1XJWB 1HSQA 1OV3A 2DM1A 4IURA 4OGCA 1TH7A 4XTVA 4IUTA 1JRIA 1YHQQ 2A0FB 2CP7A 4MDXA 2XU8A 1WPYA 2V8KA 3CCUQ 4AT1B 4LDWA 1WHLA 2DX1A 2B8AA 1K73R 4KT0E 1VA7A 1AOJA 4L59A 2KK4A 2L0AA 2Z0WA 1PD0A 4A4EA 5D6YA 2DD5A 4XTZA 3QG1A 2XG8D 1MMAA 1Q82R 3HKSA 4E7IA 2WACA 1X27A 1RAAB 3JB9G 2FZCB 4A4GA 2QASA 4M75G 2ROTA 4XTWA 2I0NA 5CQYA 2DL5A 4M77A 3H41A 3M0PA 1YIJQ 2DXCA 1AWOA 2X51A 5DM7R 5GMKm 1I4K1 4DQ2A 1DJ7B 2K2MA 1NEBA 2ESWA 2QDLA 4JZ3A 1WJRA 1G3TA 4MMLA 2RMOA 1RLQC 4J8OA 1NYGA 2DTIA 4HT8A 1SG5A 4NL2A 2E12A 4M78B 3E1SA 2CYZB 4ELYC 2XI9A 3EFOB 1YJWQ 2YRDA 4KUIA 1UJYA 3INZA 4JS4A 4ZGDB 3CCST 1K9MU 3OYMA 1UUEA 1SPKA 2OAWA 3OQ5A 3M5AA 5FWCA 3LH0A 3VKIA 4C8QF 1TTHB 1LNXA 3JCMW 1D0ZA 1W2BP 5FU7B 1VQKA 2YUQA 3NFCA 5DY9A 3SB2A 1SHFA 4AFZC 1YJ9T 2QA4Q 3EG2A 1X2KA 4C0DB 4EPCA 1X69A 2MK5A 4XU3A 3ASKA 1ABOA 1I1JA 1Y0MA 1W4SA 3JB9D 3F70A 4Z8AA 4GBQA 4M75D 4OB0B 2KYMA 2EIFA 2HL3A 1W6XA 4OB2B 4XQ3A 1G8XA 1NG2A 3CC7T 1M1FA 4EMGA 1X2QA 4EMHA 3A8MB 2JN0A 2DNUA 3QIIA 4FYYB 1RADB 2MWPA 4PJOG 4M7DE 1QVFP 1QCOA 1KJWA 2R5MA 3MP8A 3A8HB 2KXDA 3R6NA 4CC4B 5GAN7 5I2MA 2RM4A 2DTOA 2XHCA 3LX7A 3G4ST 2KQWA 1O75A 5J26A 4E47A 5GAOq 4M7DB 4Z88A 3H0HA 4FT2A 1VQ9T 1EZZB 5GJWB 1M8MA 5GMKi 2Y4XA 3I5SA 5KYXB 3CCRT 3CPWA 2DIGA 1YP5A 1B34B 2HZYA 3EGXB 3V8KA 1RL2A 3G71Q 3CCLA 2SEMA 3CPWS 1G3WA 2G3RA 5D6WA 1OU9A 2RO0A 4J9DA 1K4US 3WXMB 4C8QC 7AT1B 2AK5A 2L3RA 3RKYA 1WHHA 5I21A 5CKFA 1PCXA 2QQ9A 3VS7A 5CIUA 1KD1C 1SF9A 1BYMA 2LDMA 2JW4A 1OULA 3CBOA 3NMZC 2JMCA 4DEYA 3JCMV 2K5LA 3QPHA 1F1BB 1OPKA 5LJ3d 1QVGP 1V29B 3AHUA 1VYVA 5GAMg 1X6OA 2MOXA 2E10A 3N5BB 3CD6A 4C92F 2O88A 2L3QA 2J06A 2CSQA 4X9CA 2QEXT 4PJOD 2CDTA 3OYHA 4IUUA 2RK2A 3BFMA 2CP3A 3PTAA 5HCKA 4JDSA 3OMCA 3L1AA 1B07A 1VQPA 1WGSA 3CCVT 4O5VA 1UHCA 2X3WD 2YRVA 1OZ2A 5DLOA 4PJMA 2HKQB 1D0YA 4A54A 2LJ3A 4J9GA 4F17A 4FCYA 1WXBA 2RHZA 2JVVA 2QQAA 1Y7XA 1SSHA 3H8ZA 4PK4A 3RKXA 1PRLC 3T9NA 1VQ6A 1QCNA 4J9HA 1S72T 2B86A 4RTYA 3CCLQ 1UGPB 2A08A 3CCJT 4JRPA 3L2RA 5AT1B 1D3BA 4PL6A 3QYGB 3FB9A 4C8QA 1WX6A 3ME9A 3PIOA 2RNAA 1NEGA 3C4SA 3JRZA 2RQWA 3RERA 3SFMA 2OAUA 2VUBA 2K9GA 3M4GA 3CCVQ 1KC8U 2O9SA 5LJ5d 2AKLA 2EYZA 2D8JA 4OVAA 2FZKB 2JT4A 3GIBA 4M7AF 2DFUA 3CD6Q 2LT1A 3G6EA 3CC2T 2OTLA 1S72Q 2PVGB 4Z89A 1G2BA 3LLRA 4C0ZA 4R0KA 3M0SA 4HXJA 4FW2A 3EH1A 2FZGB 1I81A 1VQPQ 1VQ8Q 1TUCA 4HKEA 1VQ4T 4C92C 2HBWA 3TQ7P 1LCKA 2HD0A 1Q7YC 1WI7A 3ZEHA 4A4KA 4DBFA 4JJBA 2BZ8A 1TUGB 3PE0A 3QWXX 1VQ6Q 3OYKA 3L2ZA 4JRQA 4CI0C 3MCAB 3GF5A 2J6KA 3RMQA 5GAN8 2CUBA 4FL6A 3CXCA 1JO8A 1P92A 2VGNA 1M5Q1 1VQLA 4N4IA 1M27C 3CC4T 3EFRA 2JZ2A 1VOMA 2F69A 2FG0A 2DD4A 3JCMX 3MP1A 2HEQA 1YITT 1KQ1A 4J6YA 1WNLA 2DF6A 3CXCS 2CZ0B 3OY9A 1K0XA 3V8LA 1VQMA 2D9TA 2GTJA 1AHJB 1NPRA 4BD3A 1BI3A 1Q95G 4AFUC 4IUPA 2RF0A 2EBPA 2ABLA 1OX8A 1MMGA 1RLPC 1VQ7Q 4OMLA 1IGUA 5GAOp 2ZPHB 2X4JA 1TG0A 4M77F 2OTLQ 1JXOA 3JCMQ 1OEBA 3LGFA 3V8JA 3EG1A 3JCMc 1MNEA 4Y92A 4J7IA 2RH2A 4AG1C 1U3OA 2P4TA 2EJGA 4KGZB 2A37A 5EG2A 1YITQ 2CUDA 1ZQ1A 3MEUA 4M7AC 1VQ5A 2HBPA 5IAYA 3PMIA 5HK3A 1KHIA 1ZUYA 4QQGA 2FB7A 2FPDA 3CMEA 1KC8R 2VYTA 5EC7A 2MMPA 1T0HA 3TSZA 3QUIA 1WDXA 2JS0A 4BACA 3QHSA 3L2WA 5GAMj 1VQLQ 4C5IA 2ZZDA 1H8KA 2X9HA 4B6MA 4GLKA 2F5KA 3OYJA 2ZPFB 3QXEB 3TU4K 1NLPC 2K6DA 2E70A 4PFPA 3CCQA 3OB9A 5KE2A 4V2SA 3SD4A 1N8RC 1VQNA 2MWOA 1FMWA 1WHGA 4RTXA 4ZN3A 3X26B 3EGDA 1AZEA 5L8RE 5KCOA 2KNBB 1K0SA 3FDRA 1FWZA 1M2VA 1NZ9A 2JS2A 4LD9K 3CMAA 2KROA 3I55T 1I5LA 3JB9H 4K11A 1MMNA 4FSSA 2XDDA 2DBKA 1H92A 1QKXA 1PC0A 4C8QE 4J9IA 4KH1B 1TOVA 3CCET 2DJQA 4M78G 4EDUA 2G6FX 4HCZA 4M77C 1E6GA 4M7AA 2EGAA 2LQNA 4RCBA 4C8QB 3OYFA 3HRTA 3OSVA 3PIPA 5LJ3e 1K1ZA 1YHQT 4BI4A 4CC2A 1NBEB 3CMEQ 3OBWA 1MUZA 3CCUT 3H9NA 1ARKA 3M54A 3ULRB 4C5GA 1I07A 1RACB 3UDCA 4VUBA 2CZ1B 4MZTA 4XU0A 2AKKA 2BE9B 4HVUA 3JV3A 1C0MA 2DRMA 1AVZC 2L5QA 3UA6A 2X35A 2V8JA 4PJJA 3RDVA 3UPUA 4HVVA 1UJ0A 5GAMf 1YIJT 4RTTA 1RI9A 4XU1A 5KH6A 3CCQQ 1MV0B 2ECZA 2NUZA 2EYWA 1MV3A 1ZBJA 2K3YA 2W10A 2RJEA 1WQ7A 1JU5C 1UHFA 1YI2Q 2AZSA 1Q81U 1M1KU 1RI0A 2E4HA 2HQHA 2RJFA 3THKA 2CH4A 1YJWT 2DL7A 3WVEB 2DL4A 3CCMQ 3QBYA 4MMKA 4ANJA 2FPEA 4JUVA 5GANf 4WCIA 4M78D 3JCMJ 2X4WA 4Y91A 1UB4A 4PNOA 5LJ5e 4B9WA 4MZMA 2F2WA 1T0JA 2XIDA 3TCJA 3VS3A 2PUOB 4M78E 1NJIU 1W2BA 3CPFA 1QW1A 1GBRA 1Y07A 1AT1B 4M7DG 1OZ3A 3R6OA 2QA4T 3I56Q 5FW9A 4F7UF 1W2BS 1UGQB 1PRMC 2CT4A 2K7AA 1K8AC 5I22A 2CSIA 5GAOm 3CCSA 3GBQA 5IHIA 1Y71A 3X20B 1GRIA 1SRLA 3VYHB 4C92E 3A5ZB 3VRYA 2BE7D 3D7SB 4R55A 2YWWA 4IIOA 4BE2A 2D1XA 3P8BB 2DVJA 4FM4B 4C92B 3JCMd 5CR2A 2CKKA 3UATA 3I35A 2LNVA 2QK0A 3FLGA 1Z9ZA 1YN8A 3M53A 1LOJA 2A7YA 2PQWA 2YRCA 2HKNA 1GFDA 3QZ5B 2O2OA 2K79A 1K9AA 1SHGA 2XDPA 1PSFA 4II1A 1XQHA 1MMDA 2EQKA 3PNWC 4ATOA 4MZPA 1C6VX 4LE9A 4LDXA 3S6WA 2RQVA 3VJPA 2DYBA 5KYNA 3UA7A 2A3LA 1PWTA 4E7KA 2O31A 2HSEB 3ZL7C 4XTXA 3VS2A 3G71T 4DOVA 4M7DD 4GLMA 4E2FB 4DA4A 4BY6C 4HCBA 4E7ZA 4OMOA 2LJ0A 1E7OA 3G4SA 1M2VB 3LGLA 3GOXA 3QSUA 5GMKl 1AZGB 4M77G 2JNGA 1Q81R 1M1KR 2KE9A 1RAGB 2COYA 5GAN5 2DK3A 2NUPB 3JSCA 2K3XA 2EWNA 4PKCC 1BU1A 2DIQA 4LD6A 1OOTA 1X43A 1ZSGA 2GQIA 2VV5A 4M7AB 3QZ9B 2LCCA 2P4RA 3UWNA 5KYWB 1VQKQ 3P8HA 5A0DA 4C5HA 3NHNA 1NJIR 1TWBA 2V1RA 2HDAA 1BCOA 2YXYA 1HD3A 1BIAA 1EIFA 2ZPBB 1JXMA 1Q82C 1KHCA 8ATCB 4BE1A 2D0NA 3G7ZA 2J6FA 2YUPA 1Q7YR 5CQXA 3BDUA 2K3BA 2EQUA 4RTVA 3O5ZA 4JRKA 1WJSA 5C6SA 2DMOA 4RTZA 4J5YA 1SRMA 4CC3A 5LJ3g 3L42A 3RR6A 1GCQC 5LL6S 3UT1A 2QEXA 4X1VA 3S3NA 1M90U 2OJ2A 5GAN4 3SWNC 1Q86U 2DERA 3CCLT 1PKSA 2LX7A 2XK0A 1K76A 2E65A 2QGFB 4UC4A 2DLPA 2PVDB 3OBYA 2RHUA 2LJ1A 4DBHA 2FPFA 2CZ7B 1M2OA 4Q5WA 4D8KA 2DETA 3CPWP 4M77D 1UG1A 2J05A 2KXCA 2RI3A 3QWYA 5FU6C 1Y96A 4LDUA 2FRYA 1VIEA 4QQ6A 1G3SA 2XKOC 4NOYA 4M77E 4PLLA 2JUFA 4F7UA 4F14A 5GAN2 4EIKA 4ZTFA 3V7SA 3CCJA 4A4FA 2KRSA 4E7SA 1GCPA 1WHJA 2E1HA 1FMKA 1WHMA 3V7CA 3CD6T 1NM7A 1JJ2P 4KGVB 4M77B 2DRKA 4JJNK 4QW2A 5HY6A 3KXTA 1SKUB 3I9QA 2K5IA 2A28A 1CSKA 4OGEA 2PUKB 4XU2A 1VQPT 1VQ8T 2VKNA 4KGXB 2HSPA 1KQSA 1FX7A 2LP5A 4X34A 2O01E 3OYGA 5LJ5g 1G3YA 1D09B 4IKFA 2PVOB 2CREA 3CC2A 1KQSS 3VUBA 3M4YA 3JB9F 2ZPIB 5GJVB 1VQ6T 4M75F 2DAQA 4AMCA 1GCQA 1WFWA 1SEMA 2M1HA 2VWFA 1IXDA 3SWNA 2GCXA 2P0QA 4ESRA 2C06A 1EFNA 4ME7A 5KE3A 3H0FA 2YT6A 1ZLMA 4LN2A 3OYCA 3VS0A 1VQ4A 5KYYA 2RB6A 3BDLA 2KYBA 1RAEB 1U1TA 2JOYA 1D1BA 5GMKh 4HVWA 1VIFA 2EJ9A 3JCMh 3M57A 4XTYA 2ED0A 2E41A 2FO0A 4N4GA 4BI8B 3EH2A 1H641 2XD0A 1UTIA 3MO8A 3SDZA 3EG3A 4LDYA 2RHIA 2EFIA 1YJNA 2E6NA 2QQRA 3EAEA 3OW2A 4DEXA 1VQ7T 1WA7A 1LJOA 2O9VA 3CC4A 2CH4W 1MHNA 1UGRB 3EFSA 4D6WA 2OTLT 5IHKA 2YLBA 2VB6A 3MEAA 2DILA 2GF7A 3CQTA 3OW2S 1M90R 1D1AA 5GAN3 1Q86R 4HA8A 1OPLA 3O8VA 4KRTA 4PFOA 3M55A 3REBB 3SEMA 1W1FA 4C5EA 2MPXC 1BCMA 1UEBA 1AWXA 2RQRA 4QVDA 3EGUA 3HL8A 2X3XD 5GAN6 3META 3JCMP 4JJCA 3M0UA 5GAOr 4RCCA 3OS2A 1K9MC 3QDFA 1WXUA 2K57A 2EVRA 4RG8A 3VS4A 2BTTA 2LX9A 4HCKA 1TU0B 2I2LA 5L23A 5J39A 4X9DA 1UFFA 1GL5A 2KSSA 2D8HA 2JTFA 1VQLT 2O4XA 1OU8A 3BW1A 4C8QG 3G6EQ 2KY9A 4KUDK 4JS5A 1R8OB 3A8LB 4IUQA 4HT9A 2M02A 4C0FA 1QCFA 4M75C 1WJQA 1U1SA 4PJOF 2ZAEA 3QO3A 2LC4A 1WZOA 4J7FA 2MAMA 3EFOA 2RI2A 1CKBA 2E6ZA 4QQDA 1M4ZA 3CXCP 4DBQA 2GFAA 2QXFA 4PJLA 2EYQA 3RIRA 4DOWA 2AT1B 4NL3A 2OI3A 4HCCA 2JTMA 3HFOA 3M58A 1NE8A 2V8IA 5LJ3j 1T3SA 3C0CA 2EGEA 2L89A 4ZNXA 1OI1A 1VQOA 3J80E 1YFNA 2DXTA 3C12A 2MYSA 4MDWA 2OTJA 2QDYB 2IG0A 1B3QA 5I2SA 3KUFA 2W0ZA 5IN1A 2Y90A 4BY6B 3H0IA 3OYBA 3DLLA 3SHWA 4ZGEB 1ZUKA 1N27A 4N4HA 1ZSZC 3OS0A 1UGSB 1VQMQ 4J9BA 3I55A 1KSWA 1O9SA 3CMET 4JJDA 3G1JA 9ATCB 3UF4A 2XMFA 3TSWA 2VASA 1VYTA 2RHXA 5C0MA 1RABB 5GAMh 1KD1U 2RK1A 4E7JA 2LQ8A 1HJDA 5IXBA 4A63B 4C8QD 3CCEA 3BE3A 3VU3C 5A0GA 2ZGWA 2LT4A 2M51A 4Z02A 3RMSA 1ZBXA 1IRXA 4J9FA 4OMNA 1I5OB 4M75A 1TUDA 4A4HA 2DXBA 1H3HA 3CCQT 1Z9QA 3CCUA 2HAXA 1D3BB 1VQ5Q 3REAB 4P5NA 3MEWA 1ZA1B 2JTEA 2KGTA 4OMPA 4M7DA 5GANh 3L2VA 1D0XA 4AFSC 2DJZA 2F1LA 3MPUB 1YI2T 1KIKA 2VXEA 4PJOC 5LJ5j 4YTLA 2EPDA 3GP8A 2DE0X 2FL7A 5KYXA 1QP2A 3VYGA 4L5GA 1W70A 2QQBA 3QJYA 4DBRA 1VQOQ 2GBQA 4E6RA 4AFQC 3SWNB 2P0KA 3CCMT 1YIJA 2OTJQ 2ZPEB 3CBPA 4C92G 1X01A 3OA6A 3E2UA 5LJ3f 2LQKA 2VGMA 2DKGA 2COZA 1ZSZA 3X28B 2KAFA 2DL8A 2KT1A 2P0PA 1AWWA 3A8GB 4TVRA 5FU6B 2L8DA 1VQNQ 4ELZC 2ATCB 4PJNA 3I56T 3FEOA 3HRUA 3KBGA 4E7HA 3CMAQ 1RUWA 3NTIA 1ZHIA 2H3EB 2DXUA 4Y28E 2LZ6B 5M9OA 1QWFA 2KI7A 2ED1A 2JM8A 1WHKA 3TVTA 1YWPA 2JM9A 1G83A 1R0BG 2M0YA 3FRNA 3GLXA 2EQIA 5CAIA 1YCYA 2WSFE 2GTOA 3PVQA 1TSFA 5KCHA 2ENMA 2WSEE 3GNFB 2QA4A 1KC8C 1J3TA 2RD1A 2HQXA 1ZUUA 3M0QA 1KK7A 3GPLA 8AT1B 2R57A 3CEYA 4PJOA 3IQLA 4J9EA 1A0NB 4QKUA 1QP3A 3QDRB 1Q7YU 3LW5E 3S3OA 1KD1R 5KYUA 1QMCA 1WQWA 3OYNA 1QLYA 4FYVB 2CP6A 2V1QA 2YLCA 4C92D 4M7AG 2OX7A 4PLIA 4EMKC 4L6V5 3E9GA 5LJ5f 2O4XB 2EQJA 4A53A 3EHQA 3RNJA 2ROLA 2RHYA 1FYNA 5DLQE 4WF2A 3RBBB 2WSCE 2EQMA 1YNZA 2NWMA 1YJ9A 2CZ6B 2X4YA 1G5VA 2MI6A 2GQVA 3JCMg 1IGQA 1WYXA 2ZCFB 1OX9A 1KG1A 2KRMA 1PHTA 4JPBW 3DKMA 5D7UA 1QVFA 1NPPA 1KFZA 3DLMA 2QYZA 4FSXA 1PSEA 2GGRA 1AWJA 3VS6A 4XK8E 3CC7A 3HHTB 4OP0A 3I5RA 3P8DA 1QVFS 3JCMb 3G71A 1TS9A 2DVEA 1V1CA 5IH2A 3A98A 2AZVA 1UDLA 2E5QA 3MHXA 1WIEA 1VQKT 1BKBA 3RUXA 2KMTA 5FRNA 2XDBA 1BI1A 2VVKA 3EG9A 2LCLA 2LCSA 1HXDA 1YBYA 3EGDB 1N6AA 2FYKA 5CKEA 3LWIA 2M9UA 1AEYA 2ZPGB 2RQTA 3CCSQ 1VQ9A 4M7AD 4M75E 4EMKA 5FWBA 3M0RA 1GBQA
chains in the Genus database with same CATH topology
1HSQA 1OV3A 2DM1A 4LUDA 2FPDA 2CREA 5GJVB 5EC7A 1GCQA 1WFWA 1SEMA 2EYXA 2DX1A 1JQQA 1T0HA 2VWFA 3TSZA 1VA7A 1AOJA 2J7IA 1WDXA 2L0AA 4ESRA 2JS0A 1EFNA 3H0FA 2YT6A 1ZLMA 4LN2A 1H8KA 3VS0A 4IIMA 2KYBA 1BB9A 2KRNA 1X27A 2FRWA 1NLPC 2ROTA 2I0NA 3NGPA 2K6DA 4HVWA 2DL5A 2ED0A 3H41A 3M0PA 2FO0A 1AWOA 1X6GA 2DBMA 1YCSB 1UTIA 2K2MA 3EG3A 1NEBA 2ESWA 2QDLA 4JZ3A 2DA9A 4RTXA 1AZEA 2RMOA 2KNBB 1K0SA 1RLQC 4DEXA 1NYGA 1U06A 2JS2A 1WA7A 2O9VA 2KROA 2CH4W 4K11A 5IHKA 4FSSA 2DILA 3CQTA 2DBKA 1H92A 1QKXA 3PVLA 1NLOC 1OPLA 2YSQA 1QWEA 4KRTA 4J9IA 1JEGA 3REBB 3SEMA 1W1FA 1UJYA 2YDLA 1AWXA 2FEIA 2RQRA 2DJQA 1UUEA 4QT7A 1SPKA 2OAWA 4RTUA 2G6FX 3EGUA 5FWCA 4AG2C 1E6GA 2EGAA 2LQNA 2X3XD 4JJCA 2F2XA 3M0UA 1K1ZA 2YUQA 1WXUA 2RPNA 4CC2A 2C0IA 2EVRA 1MUZA 3VS4A 2BTTA 1BK2A 4HCKA 5L23A 4AFZC 1SHFA 1ARKA 3ULRB 1GL5A 1UFFA 1I07A 2D8HA 3FJ5A 3EG2A 1X2KA 1X69A 2LMJA 1UGVA 1VYUA 1ABOA 2AKKA 4HVUA 3JV3A 2DL3A 2DRMA 1WXTA 4D8DA 1AVZC 1I1JA 2EGCA 1Y0MA 4Z8AA 3UA6A 1X6BA 2KT8A 1QCFA 4GBQA 2KYMA 1QKWA 1M3BA 3VRZA 4HVVA 1W6XA 1UJ0A 4RTTA 1RI9A 3VS1A 1UECA 1NG2A 1MV0B 1CKBA 1UE9A 4LUEA 2ECZA 4LNPA 2NUZA 2MCNA 1X2QA 2EYWA 1MV3A 1ZBJA 2DNUA 2W10A 1JU5C 2OI3A 1UHFA 2J6OA 2AZSA 2EYYA 1KJWA 4M4ZA 2H8HA 3THKA 1T3SA 2CT3A 2CH4A 3C0CA 2EGEA 2DL7A 4ZNXA 2KXDA 1T3LA 3R6NA 4CC4B 2DL4A 2F2VA 4Z88A 3H0HA 3LH5A 1B3QA 2FPEA 4WCIA 2W0ZA 3H0IA 3SHWA 5GJWB 1M8MA 1ZUKA 3I5SA 2F2WA 1T0JA 1YP5A 3VS3A 4J9BA 4ORZA 4JZ4A 1KSWA 3NPFA 4JJDA 2MIOA 3UF4A 2XMFA 4CC7A 1GBRA 3TSWA 1VYTA 1I0CA 2SEMA 5ECAA 1HJDA 5FW9A 2RN8A 5IXBA 4A63B 4J9DA 1K4US 1PRMC 2CT4A 2K7AA 2AK5A 5I22A 2CSIA 2KR3A 3GBQA 5IHIA 3VS7A 2M51A 1GRIA 2KBTA 2JW4A 3NMZC 4J9FA 4OMNA 2JMCA 1SRLA 4DEYA 1TUDA 1H3HA 3VRYA 1OPKA 1Z9QA 1AD5A 3EG0A 3REAB 1VYVA 2JTEA 2KGTA 2MOXA 4IIOA 4OMPA 2D1XA 2DVJA 2O88A 2L3QA 4AFSC 2J06A 2CSQA 1GFCA 3VS5A 1KIKA 2CDTA 3UATA 3I35A 3M0TA 2EPDA 1Z9ZA 1YN8A 1ZX6A 2DE0X 5HCKA 1W70A 2JXBA 4J9CA 1GFDA 2O2OA 2GBQA 1B07A 2L3PA 4E6RA 2K79A 1K9AA 4AFQC 1SHGA 1ABQA 1UHCA 2X3WD 1YWOA 3EHRA 4LE9A 2LJ3A 4J9GA 4F17A 1WXBA 2RQVA 2DYBA 5IXFA 3UA7A 1PWTA 1SSHA 2O31A 1PRLC 2DL8A 2KT1A 3ZL7C 4J9HA 3VS2A 2B86A 1Y57A 2PZ1A 4RTYA 1AWWA 4GLMA 2A08A 1CKAA 4OMOA 1IO6A 2LJ0A 1E7OA 2C0TA 1RUWA 1WX6A 2HCKA 2RNAA 1S1NA 1NEGA 1AZGB 2LZ6B 4RTWA 2RQWA 1QWFA 2ED1A 2JM8A 2GNCA 2KE9A 3TVTA 1YWPA 2JM9A 2K9GA 1G83A 2M0YA 2O9SA 2EQIA 2AKLA 2EYZA 1E6HA 2GTOA 3PVQA 2D8JA 1M3CA 1BU1A 2ENMA 2JT4A 1OOTA 1J3TA 1X43A 1ZSGA 2GQIA 1U5SA 2JMAA 1ZUUA 2P4RA 2SRCA 3M0QA 4Z89A 1G2BA 2BZXA 3NHNA 2YUOA 3IQLA 2V1RA 3M0SA 4J9EA 2HDAA 4HXJA 4R0KA 1A0NB 1HD3A 1WLPB 2A36A 1JXMA 2D0NA 2J6FA 2PTKA 1QLYA 1TUCA 2BZYA 2YUPA 2V1QA 1NYFA 1PKTA 2HBWA 2KEAA 2K3BA 4RTVA 3O5ZA 1LCKA 3EHQA 4OMMA 3RNJA 2ROLA 1WI7A 1FYNA 1M3AA 4JJBA 2BZ8A 2DMOA 4RTZA 1SRMA 3RBBB 1M30A 3PE0A 4CC3A 4RUGA 1GCQC 4X1VA 3QWXX 2OJ2A 1PKSA 1YNZA 2NWMA 2J6KA 2LX7A 1K76A 2CUBA 1JO8A 2DLPA 2E5KA 1WYXA 1M27C 5I11A 2FG0A 2KRMA 1PNJA 2PNIA 1PHTA 2IIMA 2HEQA 2LJ1A 4JPBW 2FPFA 2DF6A 4D8KA 1UG1A 2J05A 2KXCA 1K0XA 1KFZA 2EKHA 3QWYA 3U23A 2L2PA 2FRYA 2RQUA 2GGRA 1BBZA 1AWJA 3VS6A 2GTJA 3I5RA 2LNHB 4AFUC 4F14A 1V1CA 5IH2A 3A98A 2RF0A 2L3SA 4EIKA 3KFVA 2EBPA 1N5ZA 2KRSA 1GCPA 1UDLA 2ABLA 2AZVA 1RLPC 4OMLA 1FMKA 1WIEA 1NM7A 1TG0A 2DRKA 1JXOA 1XOVA 1OEBA 3EG1A 2LQWA 4Y92A 3I9QA 4AG1C 2VVKA 1U3OA 2A28A 2C0OA 2EW3A 1CSKA 2LCSA 5IHNA 4OMQA 2A37A 1AEYA 2CUDA 2RQTA 2VKNA 2YUNA 2HSPA 2LP5A 4F16A 5FWBA 1ZUYA 3M0RA 1GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HSQ A;  1OV3 A;  2DM1 A;  4LUD A;  2FPD A;  2CRE A;  5GJV B;  5EC7 A;  1GCQ A;  1WFW A;  1SEM A;  2EYX A;  2DX1 A;  1JQQ A;  1T0H A;  2VWF A;  3TSZ A;  1VA7 A;  1AOJ A;  2J7I A;  1WDX A;  2L0A A;  4ESR A;  2JS0 A;  1EFN A;  3H0F A;  2YT6 A;  1ZLM A;  4LN2 A;  1H8K A;  3VS0 A;  4IIM A;  2KYB A;  1BB9 A;  2KRN A;  1X27 A;  2FRW A;  1NLP C;  2ROT A;  2I0N A;  3NGP A;  2K6D A;  4HVW A;  2DL5 A;  2ED0 A;  3H41 A;  3M0P A;  2FO0 A;  1AWO A;  1X6G A;  2DBM A;  1YCS B;  1UTI A;  2K2M A;  3EG3 A;  1NEB A;  2ESW A;  2QDL A;  4JZ3 A;  2DA9 A;  4RTX A;  1AZE A;  2RMO A;  2KNB B;  1K0S A;  1RLQ C;  4DEX A;  1NYG A;  1U06 A;  2JS2 A;  1WA7 A;  2O9V A;  2KRO A;  2CH4 W;  4K11 A;  5IHK A;  4FSS A;  2DIL A;  3CQT A;  2DBK A;  1H92 A;  1QKX A;  3PVL A;  1NLO C;  1OPL A;  2YSQ A;  1QWE A;  4KRT A;  4J9I A;  1JEG A;  3REB B;  3SEM A;  1W1F A;  1UJY A;  2YDL A;  1AWX A;  2FEI A;  2RQR A;  2DJQ A;  1UUE A;  4QT7 A;  1SPK A;  2OAW A;  4RTU A;  2G6F X;  3EGU A;  5FWC A;  4AG2 C;  1E6G A;  2EGA A;  2LQN A;  2X3X D;  4JJC A;  2F2X A;  3M0U A;  1K1Z A;  2YUQ A;  1WXU A;  2RPN A;  4CC2 A;  2C0I A;  2EVR A;  1MUZ A;  3VS4 A;  2BTT A;  1BK2 A;  4HCK A;  5L23 A;  4AFZ C;  1SHF A;  1ARK A;  3ULR B;  1GL5 A;  1UFF A;  1I07 A;  2D8H A;  3FJ5 A;  3EG2 A;  1X2K A;  1X69 A;  2LMJ A;  1UGV A;  1VYU A;  1ABO A;  2AKK A;  4HVU A;  3JV3 A;  2DL3 A;  2DRM A;  1WXT A;  4D8D A;  1AVZ C;  1I1J A;  2EGC A;  1Y0M A;  4Z8A A;  3UA6 A;  1X6B A;  2KT8 A;  1QCF A;  4GBQ A;  2KYM A;  1QKW A;  1M3B A;  3VRZ A;  4HVV A;  1W6X A;  1UJ0 A;  4RTT A;  1RI9 A;  3VS1 A;  1UEC A;  1NG2 A;  1MV0 B;  1CKB A;  1UE9 A;  4LUE A;  2ECZ A;  4LNP A;  2NUZ A;  2MCN A;  1X2Q A;  2EYW A;  1MV3 A;  1ZBJ A;  2DNU A;  2W10 A;  1JU5 C;  2OI3 A;  1UHF A;  2J6O A;  2AZS A;  2EYY A;  1KJW A;  4M4Z A;  2H8H A;  3THK A;  1T3S A;  2CT3 A;  2CH4 A;  3C0C A;  2EGE A;  2DL7 A;  4ZNX A;  2KXD A;  1T3L A;  3R6N A;  4CC4 B;  2DL4 A;  2F2V A;  4Z88 A;  3H0H A;  3LH5 A;  1B3Q A;  2FPE A;  4WCI A;  2W0Z A;  3H0I A;  3SHW A;  5GJW B;  1M8M A;  1ZUK A;  3I5S A;  2F2W A;  1T0J A;  1YP5 A;  3VS3 A;  4J9B A;  4ORZ A;  4JZ4 A;  1KSW A;  3NPF A;  4JJD A;  2MIO A;  3UF4 A;  2XMF A;  4CC7 A;  1GBR A;  3TSW A;  1VYT A;  1I0C A;  2SEM A;  5ECA A;  1HJD A;  5FW9 A;  2RN8 A;  5IXB A;  4A63 B;  4J9D A;  1K4U S;  1PRM C;  2CT4 A;  2K7A A;  2AK5 A;  5I22 A;  2CSI A;  2KR3 A;  3GBQ A;  5IHI A;  3VS7 A;  2M51 A;  1GRI A;  2KBT A;  2JW4 A;  3NMZ C;  4J9F A;  4OMN A;  2JMC A;  1SRL A;  4DEY A;  1TUD A;  1H3H A;  3VRY A;  1OPK A;  1Z9Q A;  1AD5 A;  3EG0 A;  3REA B;  1VYV A;  2JTE A;  2KGT A;  2MOX A;  4IIO A;  4OMP A;  2D1X A;  2DVJ A;  2O88 A;  2L3Q A;  4AFS C;  2J06 A;  2CSQ A;  1GFC A;  3VS5 A;  1KIK A;  2CDT A;  3UAT A;  3I35 A;  3M0T A;  2EPD A;  1Z9Z A;  1YN8 A;  1ZX6 A;  2DE0 X;  5HCK A;  1W70 A;  2JXB A;  4J9C A;  1GFD A;  2O2O A;  2GBQ A;  1B07 A;  2L3P A;  4E6R A;  2K79 A;  1K9A A;  4AFQ C;  1SHG A;  1ABQ A;  1UHC A;  2X3W D;  1YWO A;  3EHR A;  4LE9 A;  2LJ3 A;  4J9G A;  4F17 A;  1WXB A;  2RQV A;  2DYB A;  5IXF A;  3UA7 A;  1PWT A;  1SSH A;  2O31 A;  1PRL C;  2DL8 A;  2KT1 A;  3ZL7 C;  4J9H A;  3VS2 A;  2B86 A;  1Y57 A;  2PZ1 A;  4RTY A;  1AWW A;  4GLM A;  2A08 A;  1CKA A;  4OMO A;  1IO6 A;  2LJ0 A;  1E7O A;  2C0T A;  1RUW A;  1WX6 A;  2HCK A;  2RNA A;  1S1N A;  1NEG A;  1AZG B;  2LZ6 B;  4RTW A;  2RQW A;  1QWF A;  2ED1 A;  2JM8 A;  2GNC A;  2KE9 A;  3TVT A;  1YWP A;  2JM9 A;  2K9G A;  1G83 A;  2M0Y A;  2O9S A;  2EQI A;  2AKL A;  2EYZ A;  1E6H A;  2GTO A;  3PVQ A;  2D8J A;  1M3C A;  1BU1 A;  2ENM A;  2JT4 A;  1OOT A;  1J3T A;  1X43 A;  1ZSG A;  2GQI A;  1U5S A;  2JMA A;  1ZUU A;  2P4R A;  2SRC A;  3M0Q A;  4Z89 A;  1G2B A;  2BZX A;  3NHN A;  2YUO A;  3IQL A;  2V1R A;  3M0S A;  4J9E A;  2HDA A;  4HXJ A;  4R0K A;  1A0N B;  1HD3 A;  1WLP B;  2A36 A;  1JXM A;  2D0N A;  2J6F A;  2PTK A;  1QLY A;  1TUC A;  2BZY A;  2YUP A;  2V1Q A;  1NYF A;  1PKT A;  2HBW A;  2KEA A;  2K3B A;  4RTV A;  3O5Z A;  1LCK A;  3EHQ A;  4OMM A;  3RNJ A;  2ROL A;  1WI7 A;  1FYN A;  1M3A A;  4JJB A;  2BZ8 A;  2DMO A;  4RTZ A;  1SRM A;  3RBB B;  1M30 A;  3PE0 A;  4CC3 A;  4RUG A;  1GCQ C;  4X1V A;  3QWX X;  2OJ2 A;  1PKS A;  1YNZ A;  2NWM A;  2J6K A;  2LX7 A;  1K76 A;  2CUB A;  1JO8 A;  2DLP A;  2E5K A;  1WYX A;  1M27 C;  5I11 A;  2FG0 A;  2KRM A;  1PNJ A;  2PNI A;  1PHT A;  2IIM A;  2HEQ A;  2LJ1 A;  4JPB W;  2FPF A;  2DF6 A;  4D8K A;  1UG1 A;  2J05 A;  2KXC A;  1K0X A;  1KFZ A;  2EKH A;  3QWY A;  3U23 A;  2L2P A;  2FRY A;  2RQU A;  2GGR A;  1BBZ A;  1AWJ A;  3VS6 A;  2GTJ A;  3I5R A;  2LNH B;  4AFU C;  4F14 A;  1V1C A;  5IH2 A;  3A98 A;  2RF0 A;  2L3S A;  4EIK A;  3KFV A;  2EBP A;  1N5Z A;  2KRS A;  1GCP A;  1UDL A;  2ABL A;  2AZV A;  1RLP C;  4OML A;  1FMK A;  1WIE A;  1NM7 A;  1TG0 A;  2DRK A;  1JXO A;  1XOV A;  1OEB A;  3EG1 A;  2LQW A;  4Y92 A;  3I9Q A;  4AG1 C;  2VVK A;  1U3O A;  2A28 A;  2C0O A;  2EW3 A;  1CSK A;  2LCS A;  5IHN A;  4OMQ A;  2A37 A;  1AEY A;  2CUD A;  2RQT A;  2VKN A;  2YUN A;  2HSP A;  2LP5 A;  4F16 A;  5FWB A;  1ZUY A;  3M0R A;  1GBQ A; 
#chains in the Genus database with same CATH topology
 2NUT A;  3CCR A;  3VV0 A;  4LUD A;  2FHD A;  4M7A E;  4NS5 A;  1M9S A;  1XNI A;  2DTH A;  3OYD A;  4M75 B;  4LDV A;  2EYX A;  5GAO l;  1JQQ A;  4ZN1 A;  1QVG A;  1YJ9 Q;  2J7I A;  2QTX A;  3PT9 A;  3AT1 B;  1K73 C;  5HK0 A;  1QVG S;  4IIM A;  1BB9 A;  2KRN A;  2FRW A;  3OS5 A;  3QYH B;  1N8R U;  5A2Q E;  1ZA2 B;  4BB7 A;  2NLU A;  3NGP A;  5FRO A;  1I8F A;  2KDS A;  2JJ9 A;  4QVZ A;  2EAY A;  1X6G A;  3X25 B;  3CC7 Q;  2DBM A;  1YCS B;  1LVK A;  2DA9 A;  2RJC A;  2DZC A;  1TXQ A;  2LVM A;  4J6X A;  4F04 B;  5D6X A;  4XTU A;  1U06 A;  4OB3 B;  4QVC A;  4M78 F;  3JB9 J;  3ER0 A;  1RAI B;  2YHT A;  3LWH A;  2GFU A;  2IVW A;  1ZSZ B;  2Y4Y A;  1GXI E;  1JJ2 A;  2QAZ A;  3OYY A;  3TRE A;  1D1C A;  3PVL A;  1NLO C;  2YSQ A;  1JEG A;  1QWE A;  3CCV A;  2V26 A;  2K2V A;  3G4S Q;  2YDL A;  2FEI A;  1JJ2 S;  1R77 A;  4QT7 A;  1VQ9 Q;  4RTU A;  4AG2 C;  3M56 A;  3JAM E;  5GAM d;  1K9M R;  3CCR Q;  2LRQ A;  2F2X A;  4LXC A;  2RPN A;  2C0I A;  2K5F A;  1S72 A;  4XAX B;  1BK2 A;  5GAO n;  1V76 A;  1OYX A;  3MKD A;  3FJ5 A;  4RG2 A;  2LMJ A;  3NTH A;  4PJO E;  2D0Q B;  3ZBD A;  1UGV A;  2NYS A;  1VYU A;  3OMG A;  1VQ8 A;  3JB9 I;  2DL3 A;  1WXT A;  3DB4 A;  4D8D A;  2EGC A;  3J7A F;  2EJF A;  1X6B A;  4KBM B;  2KT8 A;  3TEE A;  3LYI A;  1QKW A;  4PJO B;  1LPL A;  1M3B A;  5GAN g;  5GAN d;  3VRZ A;  2D6F A;  4BI3 A;  2QG9 B;  5AYF A;  3VS1 A;  1UEC A;  2QI2 A;  5FRM A;  4BDZ A;  1UE9 A;  4LUE A;  3ZFJ A;  5CCA A;  3FIF A;  5KYU B;  3M59 A;  4LNP A;  3L2U A;  2KVQ G;  2MCN A;  4OMF B;  3S3M A;  4GY5 A;  3OYE A;  5J3B A;  3HP9 A;  2QEX Q;  1RAH B;  2J6O A;  1PG5 B;  3E9F A;  3HRS A;  2EYY A;  1MND A;  4M4Z A;  2H8H A;  3V7R A;  4JRI A;  2CT3 A;  3A1P A;  3URG A;  1T3L A;  3Q1J A;  1ACM B;  1IZ6 A;  1IRE B;  1IB8 A;  2F2V A;  1Q81 C;  1R0C B;  1M1K C;  4M7D F;  1PM3 A;  3LH5 A;  5GMK j;  3QJ6 A;  1JB0 E;  2RI5 A;  4M78 C;  4WTO B;  2BKD N;  4N0A C;  1U8R A;  1VQ7 A;  2VC8 A;  1N8R R;  4ORZ A;  4JZ4 A;  3PMT A;  3NPF A;  3BY7 A;  3OS1 A;  2MIO A;  1K8A U;  4CC7 A;  2QTV A;  4ZGJ B;  1I0C A;  5ECA A;  5CKH A;  2QGG A;  3CCJ Q;  2E3H A;  2RN8 A;  5CVI A;  1N9R A;  6AT1 B;  1NJI C;  3G6E T;  1KQS P;  2DO3 A;  4BDY A;  2QQS A;  5FU7 C;  1YIT A;  2KR3 A;  3H6Z A;  1QQJ A;  2KBT A;  1N9S A;  1EX4 A;  3OYI A;  3EG9 B;  5CKB A;  1MGQ A;  4C0D C;  3X24 B;  4F7U G;  1AD5 A;  4OB1 B;  3VUZ A;  3EG0 A;  1M1G A;  2IPO B;  1PD1 A;  2DEU A;  3CBM A;  3PGG A;  3OYA A;  2LTO A;  4PFZ A;  4FU6 A;  2H3J A;  3MJX A;  1YJN T;  2E64 A;  3E19 A;  4KUL A;  4EMK B;  1RAF B;  3CC2 Q;  1GFC A;  4BUG A;  2NUT B;  3VS5 A;  3M0T A;  1ZX6 A;  5GMK e;  3JCM e;  2HQE A;  4J9C A;  2JXB A;  4FIB A;  3HTR A;  2L3P A;  1BI2 A;  2PU9 B;  1ABQ A;  3QKJ A;  4FYW B;  1YWO A;  4FYX B;  1VQ4 Q;  4J6W A;  3EHR A;  3C95 A;  1HK9 A;  3OW2 P;  1M8V A;  1IHW A;  5CK9 A;  4M78 A;  4C0G A;  2CP5 A;  1VQM T;  5IXF A;  1FMV A;  4N0A A;  4BE0 A;  4JLI A;  4O6J A;  3GNG A;  2P84 A;  2PZ1 A;  1Y57 A;  4M7D C;  2CGH A;  3JCM f;  2HNI A;  1YJN Q;  2VXF A;  2DEQ A;  3OSS C;  4OF1 A;  3FJP A;  1CKA A;  1IO6 A;  3CC4 Q;  2CP2 A;  2C0T A;  2HCK A;  4IUV A;  1B7T A;  2COW A;  1S1N A;  4RTW A;  1BIB A;  4C92 A;  2GNC A;  1X75 C;  3A8O B;  4JLG A;  5IT9 E;  2RA2 A;  5CKD A;  1E6H A;  1K73 U;  1VQ5 T;  1M3C A;  2RJD A;  1BI0 A;  4B9X A;  4F7U E;  1U5S A;  1Q82 U;  2JMA A;  1H3Z A;  2SRC A;  1Y96 B;  5LJ3 h;  3HFN A;  2BZX A;  5FLX E;  3L2Q A;  3OYL A;  2X4X A;  2F5T X;  2YUO A;  2BIV A;  3RES A;  3C94 A;  1K8A R;  2DPP B;  4KH0 B;  1WLP B;  2A36 A;  4F7U B;  1VQO T;  2PTK A;  2OTJ T;  2BZY A;  2DZ9 A;  1NYF A;  1PKT A;  2KEA A;  1FXX A;  4OMM A;  3M9Q A;  1M3A A;  1YHQ A;  2HL5 C;  1M30 A;  4RUG A;  1YI2 A;  1IHV A;  5GAN j;  3J81 E;  1VQN T;  2NUP A;  4RKU E;  2E5K A;  2AHJ B;  2E3I A;  2AIR B;  3CCM A;  1M90 C;  3CMA T;  5I11 A;  1XTD A;  1OQK A;  1Q86 C;  1PNJ A;  2DYI A;  2PNI A;  2IIM A;  1VUB A;  2R58 A;  1QVP A;  2EKO A;  4CRI A;  1B34 A;  3RKW A;  5A0L A;  5KYW A;  2MF2 A;  2EKH A;  3EGX A;  3U23 A;  2L2P A;  4E7L A;  2RQU A;  2CP0 A;  1BBZ A;  2CS7 A;  3HSB A;  4ZTJ A;  4FT4 A;  2LNH B;  5GAM e;  3WVD B;  2M0O A;  1JBM A;  4FW1 A;  1KQ2 A;  2L3S A;  5HKC A;  3KFV A;  5KYY B;  4RMO A;  4R56 A;  2M16 A;  1N5Z A;  3I56 A;  5LJ5 h;  2XIC A;  3I55 Q;  1HYO A;  1XOV A;  5CO7 A;  2LQW A;  1SSF A;  2HMA A;  1YJW A;  2BUD A;  2C0O A;  2EW3 A;  3MEV A;  1C1A A;  2R5A A;  2FVU A;  5IHN A;  4OMQ A;  3PFS A;  3CCE Q;  3MP6 A;  3HPW A;  3NTK A;  4J83 A;  2YUN A;  2K4Y A;  3FC3 A;  4F16 A;  5GAN e;  3DB3 A;  1XJW B;  1HSQ A;  1OV3 A;  2DM1 A;  4IUR A;  4OGC A;  1TH7 A;  4XTV A;  4IUT A;  1JRI A;  1YHQ Q;  2A0F B;  2CP7 A;  4MDX A;  2XU8 A;  1WPY A;  2V8K A;  3CCU Q;  4AT1 B;  4LDW A;  1WHL A;  2DX1 A;  2B8A A;  1K73 R;  4KT0 E;  1VA7 A;  1AOJ A;  4L59 A;  2KK4 A;  2L0A A;  2Z0W A;  1PD0 A;  4A4E A;  5D6Y A;  2DD5 A;  4XTZ A;  3QG1 A;  2XG8 D;  1MMA A;  1Q82 R;  3HKS A;  4E7I A;  2WAC A;  1X27 A;  1RAA B;  3JB9 G;  2FZC B;  4A4G A;  2QAS A;  4M75 G;  2ROT A;  4XTW A;  2I0N A;  5CQY A;  2DL5 A;  4M77 A;  3H41 A;  3M0P A;  1YIJ Q;  2DXC A;  1AWO A;  2X51 A;  5DM7 R;  5GMK m;  1I4K 1;  4DQ2 A;  1DJ7 B;  2K2M A;  1NEB A;  2ESW A;  2QDL A;  4JZ3 A;  1WJR A;  1G3T A;  4MML A;  2RMO A;  1RLQ C;  4J8O A;  1NYG A;  2DTI A;  4HT8 A;  1SG5 A;  4NL2 A;  2E12 A;  4M78 B;  3E1S A;  2CYZ B;  4ELY C;  2XI9 A;  3EFO B;  1YJW Q;  2YRD A;  4KUI A;  1UJY A;  3INZ A;  4JS4 A;  4ZGD B;  3CCS T;  1K9M U;  3OYM A;  1UUE A;  1SPK A;  2OAW A;  3OQ5 A;  3M5A A;  5FWC A;  3LH0 A;  3VKI A;  4C8Q F;  1TTH B;  1LNX A;  3JCM W;  1D0Z A;  1W2B P;  5FU7 B;  1VQK A;  2YUQ A;  3NFC A;  5DY9 A;  3SB2 A;  1SHF A;  4AFZ C;  1YJ9 T;  2QA4 Q;  3EG2 A;  1X2K A;  4C0D B;  4EPC A;  1X69 A;  2MK5 A;  4XU3 A;  3ASK A;  1ABO A;  1I1J A;  1Y0M A;  1W4S A;  3JB9 D;  3F70 A;  4Z8A A;  4GBQ A;  4M75 D;  4OB0 B;  2KYM A;  2EIF A;  2HL3 A;  1W6X A;  4OB2 B;  4XQ3 A;  1G8X A;  1NG2 A;  3CC7 T;  1M1F A;  4EMG A;  1X2Q A;  4EMH A;  3A8M B;  2JN0 A;  2DNU A;  3QII A;  4FYY B;  1RAD B;  2MWP A;  4PJO G;  4M7D E;  1QVF P;  1QCO A;  1KJW A;  2R5M A;  3MP8 A;  3A8H B;  2KXD A;  3R6N A;  4CC4 B;  5GAN 7;  5I2M A;  2RM4 A;  2DTO A;  2XHC A;  3LX7 A;  3G4S T;  2KQW A;  1O75 A;  5J26 A;  4E47 A;  5GAO q;  4M7D B;  4Z88 A;  3H0H A;  4FT2 A;  1VQ9 T;  1EZZ B;  5GJW B;  1M8M A;  5GMK i;  2Y4X A;  3I5S A;  5KYX B;  3CCR T;  3CPW A;  2DIG A;  1YP5 A;  1B34 B;  2HZY A;  3EGX B;  3V8K A;  1RL2 A;  3G71 Q;  3CCL A;  2SEM A;  3CPW S;  1G3W A;  2G3R A;  5D6W A;  1OU9 A;  2RO0 A;  4J9D A;  1K4U S;  3WXM B;  4C8Q C;  7AT1 B;  2AK5 A;  2L3R A;  3RKY A;  1WHH A;  5I21 A;  5CKF A;  1PCX A;  2QQ9 A;  3VS7 A;  5CIU A;  1KD1 C;  1SF9 A;  1BYM A;  2LDM A;  2JW4 A;  1OUL A;  3CBO A;  3NMZ C;  2JMC A;  4DEY A;  3JCM V;  2K5L A;  3QPH A;  1F1B B;  1OPK A;  5LJ3 d;  1QVG P;  1V29 B;  3AHU A;  1VYV A;  5GAM g;  1X6O A;  2MOX A;  2E10 A;  3N5B B;  3CD6 A;  4C92 F;  2O88 A;  2L3Q A;  2J06 A;  2CSQ A;  4X9C A;  2QEX T;  4PJO D;  2CDT A;  3OYH A;  4IUU A;  2RK2 A;  3BFM A;  2CP3 A;  3PTA A;  5HCK A;  4JDS A;  3OMC A;  3L1A A;  1B07 A;  1VQP A;  1WGS A;  3CCV T;  4O5V A;  1UHC A;  2X3W D;  2YRV A;  1OZ2 A;  5DLO A;  4PJM A;  2HKQ B;  1D0Y A;  4A54 A;  2LJ3 A;  4J9G A;  4F17 A;  4FCY A;  1WXB A;  2RHZ A;  2JVV A;  2QQA A;  1Y7X A;  1SSH A;  3H8Z A;  4PK4 A;  3RKX A;  1PRL C;  3T9N A;  1VQ6 A;  1QCN A;  4J9H A;  1S72 T;  2B86 A;  4RTY A;  3CCL Q;  1UGP B;  2A08 A;  3CCJ T;  4JRP A;  3L2R A;  5AT1 B;  1D3B A;  4PL6 A;  3QYG B;  3FB9 A;  4C8Q A;  1WX6 A;  3ME9 A;  3PIO A;  2RNA A;  1NEG A;  3C4S A;  3JRZ A;  2RQW A;  3RER A;  3SFM A;  2OAU A;  2VUB A;  2K9G A;  3M4G A;  3CCV Q;  1KC8 U;  2O9S A;  5LJ5 d;  2AKL A;  2EYZ A;  2D8J A;  4OVA A;  2FZK B;  2JT4 A;  3GIB A;  4M7A F;  2DFU A;  3CD6 Q;  2LT1 A;  3G6E A;  3CC2 T;  2OTL A;  1S72 Q;  2PVG B;  4Z89 A;  1G2B A;  3LLR A;  4C0Z A;  4R0K A;  3M0S A;  4HXJ A;  4FW2 A;  3EH1 A;  2FZG B;  1I81 A;  1VQP Q;  1VQ8 Q;  1TUC A;  4HKE A;  1VQ4 T;  4C92 C;  2HBW A;  3TQ7 P;  1LCK A;  2HD0 A;  1Q7Y C;  1WI7 A;  3ZEH A;  4A4K A;  4DBF A;  4JJB A;  2BZ8 A;  1TUG B;  3PE0 A;  3QWX X;  1VQ6 Q;  3OYK A;  3L2Z A;  4JRQ A;  4CI0 C;  3MCA B;  3GF5 A;  2J6K A;  3RMQ A;  5GAN 8;  2CUB A;  4FL6 A;  3CXC A;  1JO8 A;  1P92 A;  2VGN A;  1M5Q 1;  1VQL A;  4N4I A;  1M27 C;  3CC4 T;  3EFR A;  2JZ2 A;  1VOM A;  2F69 A;  2FG0 A;  2DD4 A;  3JCM X;  3MP1 A;  2HEQ A;  1YIT T;  1KQ1 A;  4J6Y A;  1WNL A;  2DF6 A;  3CXC S;  2CZ0 B;  3OY9 A;  1K0X A;  3V8L A;  1VQM A;  2D9T A;  2GTJ A;  1AHJ B;  1NPR A;  4BD3 A;  1BI3 A;  1Q95 G;  4AFU C;  4IUP A;  2RF0 A;  2EBP A;  2ABL A;  1OX8 A;  1MMG A;  1RLP C;  1VQ7 Q;  4OML A;  1IGU A;  5GAO p;  2ZPH B;  2X4J A;  1TG0 A;  4M77 F;  2OTL Q;  1JXO A;  3JCM Q;  1OEB A;  3LGF A;  3V8J A;  3EG1 A;  3JCM c;  1MNE A;  4Y92 A;  4J7I A;  2RH2 A;  4AG1 C;  1U3O A;  2P4T A;  2EJG A;  4KGZ B;  2A37 A;  5EG2 A;  1YIT Q;  2CUD A;  1ZQ1 A;  3MEU A;  4M7A C;  1VQ5 A;  2HBP A;  5IAY A;  3PMI A;  5HK3 A;  1KHI A;  1ZUY A;  4QQG A;  2FB7 A;  2FPD A;  3CME A;  1KC8 R;  2VYT A;  5EC7 A;  2MMP A;  1T0H A;  3TSZ A;  3QUI A;  1WDX A;  2JS0 A;  4BAC A;  3QHS A;  3L2W A;  5GAM j;  1VQL Q;  4C5I A;  2ZZD A;  1H8K A;  2X9H A;  4B6M A;  4GLK A;  2F5K A;  3OYJ A;  2ZPF B;  3QXE B;  3TU4 K;  1NLP C;  2K6D A;  2E70 A;  4PFP A;  3CCQ A;  3OB9 A;  5KE2 A;  4V2S A;  3SD4 A;  1N8R C;  1VQN A;  2MWO A;  1FMW A;  1WHG A;  4RTX A;  4ZN3 A;  3X26 B;  3EGD A;  1AZE A;  5L8R E;  5KCO A;  2KNB B;  1K0S A;  3FDR A;  1FWZ A;  1M2V A;  1NZ9 A;  2JS2 A;  4LD9 K;  3CMA A;  2KRO A;  3I55 T;  1I5L A;  3JB9 H;  4K11 A;  1MMN A;  4FSS A;  2XDD A;  2DBK A;  1H92 A;  1QKX A;  1PC0 A;  4C8Q E;  4J9I A;  4KH1 B;  1TOV A;  3CCE T;  2DJQ A;  4M78 G;  4EDU A;  2G6F X;  4HCZ A;  4M77 C;  1E6G A;  4M7A A;  2EGA A;  2LQN A;  4RCB A;  4C8Q B;  3OYF A;  3HRT A;  3OSV A;  3PIP A;  5LJ3 e;  1K1Z A;  1YHQ T;  4BI4 A;  4CC2 A;  1NBE B;  3CME Q;  3OBW A;  1MUZ A;  3CCU T;  3H9N A;  1ARK A;  3M54 A;  3ULR B;  4C5G A;  1I07 A;  1RAC B;  3UDC A;  4VUB A;  2CZ1 B;  4MZT A;  4XU0 A;  2AKK A;  2BE9 B;  4HVU A;  3JV3 A;  1C0M A;  2DRM A;  1AVZ C;  2L5Q A;  3UA6 A;  2X35 A;  2V8J A;  4PJJ A;  3RDV A;  3UPU A;  4HVV A;  1UJ0 A;  5GAM f;  1YIJ T;  4RTT A;  1RI9 A;  4XU1 A;  5KH6 A;  3CCQ Q;  1MV0 B;  2ECZ A;  2NUZ A;  2EYW A;  1MV3 A;  1ZBJ A;  2K3Y A;  2W10 A;  2RJE A;  1WQ7 A;  1JU5 C;  1UHF A;  1YI2 Q;  2AZS A;  1Q81 U;  1M1K U;  1RI0 A;  2E4H A;  2HQH A;  2RJF A;  3THK A;  2CH4 A;  1YJW T;  2DL7 A;  3WVE B;  2DL4 A;  3CCM Q;  3QBY A;  4MMK A;  4ANJ A;  2FPE A;  4JUV A;  5GAN f;  4WCI A;  4M78 D;  3JCM J;  2X4W A;  4Y91 A;  1UB4 A;  4PNO A;  5LJ5 e;  4B9W A;  4MZM A;  2F2W A;  1T0J A;  2XID A;  3TCJ A;  3VS3 A;  2PUO B;  4M78 E;  1NJI U;  1W2B A;  3CPF A;  1QW1 A;  1GBR A;  1Y07 A;  1AT1 B;  4M7D G;  1OZ3 A;  3R6O A;  2QA4 T;  3I56 Q;  5FW9 A;  4F7U F;  1W2B S;  1UGQ B;  1PRM C;  2CT4 A;  2K7A A;  1K8A C;  5I22 A;  2CSI A;  5GAO m;  3CCS A;  3GBQ A;  5IHI A;  1Y71 A;  3X20 B;  1GRI A;  1SRL A;  3VYH B;  4C92 E;  3A5Z B;  3VRY A;  2BE7 D;  3D7S B;  4R55 A;  2YWW A;  4IIO A;  4BE2 A;  2D1X A;  3P8B B;  2DVJ A;  4FM4 B;  4C92 B;  3JCM d;  5CR2 A;  2CKK A;  3UAT A;  3I35 A;  2LNV A;  2QK0 A;  3FLG A;  1Z9Z A;  1YN8 A;  3M53 A;  1LOJ A;  2A7Y A;  2PQW A;  2YRC A;  2HKN A;  1GFD A;  3QZ5 B;  2O2O A;  2K79 A;  1K9A A;  1SHG A;  2XDP A;  1PSF A;  4II1 A;  1XQH A;  1MMD A;  2EQK A;  3PNW C;  4ATO A;  4MZP A;  1C6V X;  4LE9 A;  4LDX A;  3S6W A;  2RQV A;  3VJP A;  2DYB A;  5KYN A;  3UA7 A;  2A3L A;  1PWT A;  4E7K A;  2O31 A;  2HSE B;  3ZL7 C;  4XTX A;  3VS2 A;  3G71 T;  4DOV A;  4M7D D;  4GLM A;  4E2F B;  4DA4 A;  4BY6 C;  4HCB A;  4E7Z A;  4OMO A;  2LJ0 A;  1E7O A;  3G4S A;  1M2V B;  3LGL A;  3GOX A;  3QSU A;  5GMK l;  1AZG B;  4M77 G;  2JNG A;  1Q81 R;  1M1K R;  2KE9 A;  1RAG B;  2COY A;  5GAN 5;  2DK3 A;  2NUP B;  3JSC A;  2K3X A;  2EWN A;  4PKC C;  1BU1 A;  2DIQ A;  4LD6 A;  1OOT A;  1X43 A;  1ZSG A;  2GQI A;  2VV5 A;  4M7A B;  3QZ9 B;  2LCC A;  2P4R A;  3UWN A;  5KYW B;  1VQK Q;  3P8H A;  5A0D A;  4C5H A;  3NHN A;  1NJI R;  1TWB A;  2V1R A;  2HDA A;  1BCO A;  2YXY A;  1HD3 A;  1BIA A;  1EIF A;  2ZPB B;  1JXM A;  1Q82 C;  1KHC A;  8ATC B;  4BE1 A;  2D0N A;  3G7Z A;  2J6F A;  2YUP A;  1Q7Y R;  5CQX A;  3BDU A;  2K3B A;  2EQU A;  4RTV A;  3O5Z A;  4JRK A;  1WJS A;  5C6S A;  2DMO A;  4RTZ A;  4J5Y A;  1SRM A;  4CC3 A;  5LJ3 g;  3L42 A;  3RR6 A;  1GCQ C;  5LL6 S;  3UT1 A;  2QEX A;  4X1V A;  3S3N A;  1M90 U;  2OJ2 A;  5GAN 4;  3SWN C;  1Q86 U;  2DER A;  3CCL T;  1PKS A;  2LX7 A;  2XK0 A;  1K76 A;  2E65 A;  2QGF B;  4UC4 A;  2DLP A;  2PVD B;  3OBY A;  2RHU A;  2LJ1 A;  4DBH A;  2FPF A;  2CZ7 B;  1M2O A;  4Q5W A;  4D8K A;  2DET A;  3CPW P;  4M77 D;  1UG1 A;  2J05 A;  2KXC A;  2RI3 A;  3QWY A;  5FU6 C;  1Y96 A;  4LDU A;  2FRY A;  1VIE A;  4QQ6 A;  1G3S A;  2XKO C;  4NOY A;  4M77 E;  4PLL A;  2JUF A;  4F7U A;  4F14 A;  5GAN 2;  4EIK A;  4ZTF A;  3V7S A;  3CCJ A;  4A4F A;  2KRS A;  4E7S A;  1GCP A;  1WHJ A;  2E1H A;  1FMK A;  1WHM A;  3V7C A;  3CD6 T;  1NM7 A;  1JJ2 P;  4KGV B;  4M77 B;  2DRK A;  4JJN K;  4QW2 A;  5HY6 A;  3KXT A;  1SKU B;  3I9Q A;  2K5I A;  2A28 A;  1CSK A;  4OGE A;  2PUK B;  4XU2 A;  1VQP T;  1VQ8 T;  2VKN A;  4KGX B;  2HSP A;  1KQS A;  1FX7 A;  2LP5 A;  4X34 A;  2O01 E;  3OYG A;  5LJ5 g;  1G3Y A;  1D09 B;  4IKF A;  2PVO B;  2CRE A;  3CC2 A;  1KQS S;  3VUB A;  3M4Y A;  3JB9 F;  2ZPI B;  5GJV B;  1VQ6 T;  4M75 F;  2DAQ A;  4AMC A;  1GCQ A;  1WFW A;  1SEM A;  2M1H A;  2VWF A;  1IXD A;  3SWN A;  2GCX A;  2P0Q A;  4ESR A;  2C06 A;  1EFN A;  4ME7 A;  5KE3 A;  3H0F A;  2YT6 A;  1ZLM A;  4LN2 A;  3OYC A;  3VS0 A;  1VQ4 A;  5KYY A;  2RB6 A;  3BDL A;  2KYB A;  1RAE B;  1U1T A;  2JOY A;  1D1B A;  5GMK h;  4HVW A;  1VIF A;  2EJ9 A;  3JCM h;  3M57 A;  4XTY A;  2ED0 A;  2E41 A;  2FO0 A;  4N4G A;  4BI8 B;  3EH2 A;  1H64 1;  2XD0 A;  1UTI A;  3MO8 A;  3SDZ A;  3EG3 A;  4LDY A;  2RHI A;  2EFI A;  1YJN A;  2E6N A;  2QQR A;  3EAE A;  3OW2 A;  4DEX A;  1VQ7 T;  1WA7 A;  1LJO A;  2O9V A;  3CC4 A;  2CH4 W;  1MHN A;  1UGR B;  3EFS A;  4D6W A;  2OTL T;  5IHK A;  2YLB A;  2VB6 A;  3MEA A;  2DIL A;  2GF7 A;  3CQT A;  3OW2 S;  1M90 R;  1D1A A;  5GAN 3;  1Q86 R;  4HA8 A;  1OPL A;  3O8V A;  4KRT A;  4PFO A;  3M55 A;  3REB B;  3SEM A;  1W1F A;  4C5E A;  2MPX C;  1BCM A;  1UEB A;  1AWX A;  2RQR A;  4QVD A;  3EGU A;  3HL8 A;  2X3X D;  5GAN 6;  3MET A;  3JCM P;  4JJC A;  3M0U A;  5GAO r;  4RCC A;  3OS2 A;  1K9M C;  3QDF A;  1WXU A;  2K57 A;  2EVR A;  4RG8 A;  3VS4 A;  2BTT A;  2LX9 A;  4HCK A;  1TU0 B;  2I2L A;  5L23 A;  5J39 A;  4X9D A;  1UFF A;  1GL5 A;  2KSS A;  2D8H A;  2JTF A;  1VQL T;  2O4X A;  1OU8 A;  3BW1 A;  4C8Q G;  3G6E Q;  2KY9 A;  4KUD K;  4JS5 A;  1R8O B;  3A8L B;  4IUQ A;  4HT9 A;  2M02 A;  4C0F A;  1QCF A;  4M75 C;  1WJQ A;  1U1S A;  4PJO F;  2ZAE A;  3QO3 A;  2LC4 A;  1WZO A;  4J7F A;  2MAM A;  3EFO A;  2RI2 A;  1CKB A;  2E6Z A;  4QQD A;  1M4Z A;  3CXC P;  4DBQ A;  2GFA A;  2QXF A;  4PJL A;  2EYQ A;  3RIR A;  4DOW A;  2AT1 B;  4NL3 A;  2OI3 A;  4HCC A;  2JTM A;  3HFO A;  3M58 A;  1NE8 A;  2V8I A;  5LJ3 j;  1T3S A;  3C0C A;  2EGE A;  2L89 A;  4ZNX A;  1OI1 A;  1VQO A;  3J80 E;  1YFN A;  2DXT A;  3C12 A;  2MYS A;  4MDW A;  2OTJ A;  2QDY B;  2IG0 A;  1B3Q A;  5I2S A;  3KUF A;  2W0Z A;  5IN1 A;  2Y90 A;  4BY6 B;  3H0I A;  3OYB A;  3DLL A;  3SHW A;  4ZGE B;  1ZUK A;  1N27 A;  4N4H A;  1ZSZ C;  3OS0 A;  1UGS B;  1VQM Q;  4J9B A;  3I55 A;  1KSW A;  1O9S A;  3CME T;  4JJD A;  3G1J A;  9ATC B;  3UF4 A;  2XMF A;  3TSW A;  2VAS A;  1VYT A;  2RHX A;  5C0M A;  1RAB B;  5GAM h;  1KD1 U;  2RK1 A;  4E7J A;  2LQ8 A;  1HJD A;  5IXB A;  4A63 B;  4C8Q D;  3CCE A;  3BE3 A;  3VU3 C;  5A0G A;  2ZGW A;  2LT4 A;  2M51 A;  4Z02 A;  3RMS A;  1ZBX A;  1IRX A;  4J9F A;  4OMN A;  1I5O B;  4M75 A;  1TUD A;  4A4H A;  2DXB A;  1H3H A;  3CCQ T;  1Z9Q A;  3CCU A;  2HAX A;  1D3B B;  1VQ5 Q;  3REA B;  4P5N A;  3MEW A;  1ZA1 B;  2JTE A;  2KGT A;  4OMP A;  4M7D A;  5GAN h;  3L2V A;  1D0X A;  4AFS C;  2DJZ A;  2F1L A;  3MPU B;  1YI2 T;  1KIK A;  2VXE A;  4PJO C;  5LJ5 j;  4YTL A;  2EPD A;  3GP8 A;  2DE0 X;  2FL7 A;  5KYX A;  1QP2 A;  3VYG A;  4L5G A;  1W70 A;  2QQB A;  3QJY A;  4DBR A;  1VQO Q;  2GBQ A;  4E6R A;  4AFQ C;  3SWN B;  2P0K A;  3CCM T;  1YIJ A;  2OTJ Q;  2ZPE B;  3CBP A;  4C92 G;  1X01 A;  3OA6 A;  3E2U A;  5LJ3 f;  2LQK A;  2VGM A;  2DKG A;  2COZ A;  1ZSZ A;  3X28 B;  2KAF A;  2DL8 A;  2KT1 A;  2P0P A;  1AWW A;  3A8G B;  4TVR A;  5FU6 B;  2L8D A;  1VQN Q;  4ELZ C;  2ATC B;  4PJN A;  3I56 T;  3FEO A;  3HRU A;  3KBG A;  4E7H A;  3CMA Q;  1RUW A;  3NTI A;  1ZHI A;  2H3E B;  2DXU A;  4Y28 E;  2LZ6 B;  5M9O A;  1QWF A;  2KI7 A;  2ED1 A;  2JM8 A;  1WHK A;  3TVT A;  1YWP A;  2JM9 A;  1G83 A;  1R0B G;  2M0Y A;  3FRN A;  3GLX A;  2EQI A;  5CAI A;  1YCY A;  2WSF E;  2GTO A;  3PVQ A;  1TSF A;  5KCH A;  2ENM A;  2WSE E;  3GNF B;  2QA4 A;  1KC8 C;  1J3T A;  2RD1 A;  2HQX A;  1ZUU A;  3M0Q A;  1KK7 A;  3GPL A;  8AT1 B;  2R57 A;  3CEY A;  4PJO A;  3IQL A;  4J9E A;  1A0N B;  4QKU A;  1QP3 A;  3QDR B;  1Q7Y U;  3LW5 E;  3S3O A;  1KD1 R;  5KYU A;  1QMC A;  1WQW A;  3OYN A;  1QLY A;  4FYV B;  2CP6 A;  2V1Q A;  2YLC A;  4C92 D;  4M7A G;  2OX7 A;  4PLI A;  4EMK C;  4L6V 5;  3E9G A;  5LJ5 f;  2O4X B;  2EQJ A;  4A53 A;  3EHQ A;  3RNJ A;  2ROL A;  2RHY A;  1FYN A;  5DLQ E;  4WF2 A;  3RBB B;  2WSC E;  2EQM A;  1YNZ A;  2NWM A;  1YJ9 A;  2CZ6 B;  2X4Y A;  1G5V A;  2MI6 A;  2GQV A;  3JCM g;  1IGQ A;  1WYX A;  2ZCF B;  1OX9 A;  1KG1 A;  2KRM A;  1PHT A;  4JPB W;  3DKM A;  5D7U A;  1QVF A;  1NPP A;  1KFZ A;  3DLM A;  2QYZ A;  4FSX A;  1PSE A;  2GGR A;  1AWJ A;  3VS6 A;  4XK8 E;  3CC7 A;  3HHT B;  4OP0 A;  3I5R A;  3P8D A;  1QVF S;  3JCM b;  3G71 A;  1TS9 A;  2DVE A;  1V1C A;  5IH2 A;  3A98 A;  2AZV A;  1UDL A;  2E5Q A;  3MHX A;  1WIE A;  1VQK T;  1BKB A;  3RUX A;  2KMT A;  5FRN A;  2XDB A;  1BI1 A;  2VVK A;  3EG9 A;  2LCL A;  2LCS A;  1HXD A;  1YBY A;  3EGD B;  1N6A A;  2FYK A;  5CKE A;  3LWI A;  2M9U A;  1AEY A;  2ZPG B;  2RQT A;  3CCS Q;  1VQ9 A;  4M7A D;  4M75 E;  4EMK A;  5FWB A;  3M0R A;  1GBQ A; 
#chains in the Genus database with same CATH homology
 1HSQ A;  1OV3 A;  2DM1 A;  4LUD A;  2FPD A;  2CRE A;  5GJV B;  5EC7 A;  1GCQ A;  1WFW A;  1SEM A;  2EYX A;  2DX1 A;  1JQQ A;  1T0H A;  2VWF A;  3TSZ A;  1VA7 A;  1AOJ A;  2J7I A;  1WDX A;  2L0A A;  4ESR A;  2JS0 A;  1EFN A;  3H0F A;  2YT6 A;  1ZLM A;  4LN2 A;  1H8K A;  3VS0 A;  4IIM A;  2KYB A;  1BB9 A;  2KRN A;  1X27 A;  2FRW A;  1NLP C;  2ROT A;  2I0N A;  3NGP A;  2K6D A;  4HVW A;  2DL5 A;  2ED0 A;  3H41 A;  3M0P A;  2FO0 A;  1AWO A;  1X6G A;  2DBM A;  1YCS B;  1UTI A;  2K2M A;  3EG3 A;  1NEB A;  2ESW A;  2QDL A;  4JZ3 A;  2DA9 A;  4RTX A;  1AZE A;  2RMO A;  2KNB B;  1K0S A;  1RLQ C;  4DEX A;  1NYG A;  1U06 A;  2JS2 A;  1WA7 A;  2O9V A;  2KRO A;  2CH4 W;  4K11 A;  5IHK A;  4FSS A;  2DIL A;  3CQT A;  2DBK A;  1H92 A;  1QKX A;  3PVL A;  1NLO C;  1OPL A;  2YSQ A;  1QWE A;  4KRT A;  4J9I A;  1JEG A;  3REB B;  3SEM A;  1W1F A;  1UJY A;  2YDL A;  1AWX A;  2FEI A;  2RQR A;  2DJQ A;  1UUE A;  4QT7 A;  1SPK A;  2OAW A;  4RTU A;  2G6F X;  3EGU A;  5FWC A;  4AG2 C;  1E6G A;  2EGA A;  2LQN A;  2X3X D;  4JJC A;  2F2X A;  3M0U A;  1K1Z A;  2YUQ A;  1WXU A;  2RPN A;  4CC2 A;  2C0I A;  2EVR A;  1MUZ A;  3VS4 A;  2BTT A;  1BK2 A;  4HCK A;  5L23 A;  4AFZ C;  1SHF A;  1ARK A;  3ULR B;  1GL5 A;  1UFF A;  1I07 A;  2D8H A;  3FJ5 A;  3EG2 A;  1X2K A;  1X69 A;  2LMJ A;  1UGV A;  1VYU A;  1ABO A;  2AKK A;  4HVU A;  3JV3 A;  2DL3 A;  2DRM A;  1WXT A;  4D8D A;  1AVZ C;  1I1J A;  2EGC A;  1Y0M A;  4Z8A A;  3UA6 A;  1X6B A;  2KT8 A;  1QCF A;  4GBQ A;  2KYM A;  1QKW A;  1M3B A;  3VRZ A;  4HVV A;  1W6X A;  1UJ0 A;  4RTT A;  1RI9 A;  3VS1 A;  1UEC A;  1NG2 A;  1MV0 B;  1CKB A;  1UE9 A;  4LUE A;  2ECZ A;  4LNP A;  2NUZ A;  2MCN A;  1X2Q A;  2EYW A;  1MV3 A;  1ZBJ A;  2DNU A;  2W10 A;  1JU5 C;  2OI3 A;  1UHF A;  2J6O A;  2AZS A;  2EYY A;  1KJW A;  4M4Z A;  2H8H A;  3THK A;  1T3S A;  2CT3 A;  2CH4 A;  3C0C A;  2EGE A;  2DL7 A;  4ZNX A;  2KXD A;  1T3L A;  3R6N A;  4CC4 B;  2DL4 A;  2F2V A;  4Z88 A;  3H0H A;  3LH5 A;  1B3Q A;  2FPE A;  4WCI A;  2W0Z A;  3H0I A;  3SHW A;  5GJW B;  1M8M A;  1ZUK A;  3I5S A;  2F2W A;  1T0J A;  1YP5 A;  3VS3 A;  4J9B A;  4ORZ A;  4JZ4 A;  1KSW A;  3NPF A;  4JJD A;  2MIO A;  3UF4 A;  2XMF A;  4CC7 A;  1GBR A;  3TSW A;  1VYT A;  1I0C A;  2SEM A;  5ECA A;  1HJD A;  5FW9 A;  2RN8 A;  5IXB A;  4A63 B;  4J9D A;  1K4U S;  1PRM C;  2CT4 A;  2K7A A;  2AK5 A;  5I22 A;  2CSI A;  2KR3 A;  3GBQ A;  5IHI A;  3VS7 A;  2M51 A;  1GRI A;  2KBT A;  2JW4 A;  3NMZ C;  4J9F A;  4OMN A;  2JMC A;  1SRL A;  4DEY A;  1TUD A;  1H3H A;  3VRY A;  1OPK A;  1Z9Q A;  1AD5 A;  3EG0 A;  3REA B;  1VYV A;  2JTE A;  2KGT A;  2MOX A;  4IIO A;  4OMP A;  2D1X A;  2DVJ A;  2O88 A;  2L3Q A;  4AFS C;  2J06 A;  2CSQ A;  1GFC A;  3VS5 A;  1KIK A;  2CDT A;  3UAT A;  3I35 A;  3M0T A;  2EPD A;  1Z9Z A;  1YN8 A;  1ZX6 A;  2DE0 X;  5HCK A;  1W70 A;  2JXB A;  4J9C A;  1GFD A;  2O2O A;  2GBQ A;  1B07 A;  2L3P A;  4E6R A;  2K79 A;  1K9A A;  4AFQ C;  1SHG A;  1ABQ A;  1UHC A;  2X3W D;  1YWO A;  3EHR A;  4LE9 A;  2LJ3 A;  4J9G A;  4F17 A;  1WXB A;  2RQV A;  2DYB A;  5IXF A;  3UA7 A;  1PWT A;  1SSH A;  2O31 A;  1PRL C;  2DL8 A;  2KT1 A;  3ZL7 C;  4J9H A;  3VS2 A;  2B86 A;  1Y57 A;  2PZ1 A;  4RTY A;  1AWW A;  4GLM A;  2A08 A;  1CKA A;  4OMO A;  1IO6 A;  2LJ0 A;  1E7O A;  2C0T A;  1RUW A;  1WX6 A;  2HCK A;  2RNA A;  1S1N A;  1NEG A;  1AZG B;  2LZ6 B;  4RTW A;  2RQW A;  1QWF A;  2ED1 A;  2JM8 A;  2GNC A;  2KE9 A;  3TVT A;  1YWP A;  2JM9 A;  2K9G A;  1G83 A;  2M0Y A;  2O9S A;  2EQI A;  2AKL A;  2EYZ A;  1E6H A;  2GTO A;  3PVQ A;  2D8J A;  1M3C A;  1BU1 A;  2ENM A;  2JT4 A;  1OOT A;  1J3T A;  1X43 A;  1ZSG A;  2GQI A;  1U5S A;  2JMA A;  1ZUU A;  2P4R A;  2SRC A;  3M0Q A;  4Z89 A;  1G2B A;  2BZX A;  3NHN A;  2YUO A;  3IQL A;  2V1R A;  3M0S A;  4J9E A;  2HDA A;  4HXJ A;  4R0K A;  1A0N B;  1HD3 A;  1WLP B;  2A36 A;  1JXM A;  2D0N A;  2J6F A;  2PTK A;  1QLY A;  1TUC A;  2BZY A;  2YUP A;  2V1Q A;  1NYF A;  1PKT A;  2HBW A;  2KEA A;  2K3B A;  4RTV A;  3O5Z A;  1LCK A;  3EHQ A;  4OMM A;  3RNJ A;  2ROL A;  1WI7 A;  1FYN A;  1M3A A;  4JJB A;  2BZ8 A;  2DMO A;  4RTZ A;  1SRM A;  3RBB B;  1M30 A;  3PE0 A;  4CC3 A;  4RUG A;  1GCQ C;  4X1V A;  3QWX X;  2OJ2 A;  1PKS A;  1YNZ A;  2NWM A;  2J6K A;  2LX7 A;  1K76 A;  2CUB A;  1JO8 A;  2DLP A;  2E5K A;  1WYX A;  1M27 C;  5I11 A;  2FG0 A;  2KRM A;  1PNJ A;  2PNI A;  1PHT A;  2IIM A;  2HEQ A;  2LJ1 A;  4JPB W;  2FPF A;  2DF6 A;  4D8K A;  1UG1 A;  2J05 A;  2KXC A;  1K0X A;  1KFZ A;  2EKH A;  3QWY A;  3U23 A;  2L2P A;  2FRY A;  2RQU A;  2GGR A;  1BBZ A;  1AWJ A;  3VS6 A;  2GTJ A;  3I5R A;  2LNH B;  4AFU C;  4F14 A;  1V1C A;  5IH2 A;  3A98 A;  2RF0 A;  2L3S A;  4EIK A;  3KFV A;  2EBP A;  1N5Z A;  2KRS A;  1GCP A;  1UDL A;  2ABL A;  2AZV A;  1RLP C;  4OML A;  1FMK A;  1WIE A;  1NM7 A;  1TG0 A;  2DRK A;  1JXO A;  1XOV A;  1OEB A;  3EG1 A;  2LQW A;  4Y92 A;  3I9Q A;  4AG1 C;  2VVK A;  1U3O A;  2A28 A;  2C0O A;  2EW3 A;  1CSK A;  2LCS A;  5IHN A;  4OMQ A;  2A37 A;  1AEY A;  2CUD A;  2RQT A;  2VKN A;  2YUN A;  2HSP A;  2LP5 A;  4F16 A;  5FWB A;  1ZUY A;  3M0R A;  1GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...