1ZSGA

Beta pix-sh3 complexed with an atypical peptide from alpha-pak
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
65
structure length
65
Chain Sequence
MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the SH3 Domain of beta-PIX and Its Interaction with alpha-p21 Activated Kinase (PAK)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Rho guanine nucleotide exchange factor 7
total genus 6
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zsgA00
1K0XA 4ORZA 1M27C 1W1FA 1AOJA 1YWPA 2JW4A 2GNCA 2MIOA 5IXFA 2FEIA 2CUDA 2L3PA 3SHWA 1YP5A 2EYWA 2KEAA 1KFZA 1X6GA 3TSZA 2ROTA 1SRMA 2MOXA 5EC7A 3VS7A 2DBMA 2CREA 2EKHA 1GBQA 2EGCA 1PRMC 3M0QA 3ULRB 1NLPC 1YWOA 3QWXX 2K3BA 2CT3A 1Z9QA 1I07A 3ZL7C 1UJYA 2ROLA 1T3LA 1WXTA 2RMOA 1NG2A 1NLOC 4J9CA 2F2XA 2NWMA 3VS3A 3H0FA 2JS2A 3I5RA 1GCPA 1TUDA 3M0UA 1V1CA 2OI3A 1NYFA 2A08A 2K9GA 4M4ZA 3REAB 2LCSA 1ABQA 2B86A 2BTTA 2D0NA 1CKBA 2YSQA 2KXCA 2BZXA 3VS2A 2J06A 3UATA 1CKAA 1VA7A 1KIKA 5ECAA 3VS5A 2EQIA 3EG3A 2CSQA 2IIMA 4HCKA 1BU1A 2JM9A 4J9EA 5I11A 2KT8A 3TSWA 1FYNA 2O88A 1NEBA 1UUEA 1LCKA 5GJWB 1AEYA 2LJ3A 5I22A 1FMKA 2GBQA 2XMFA 3REBB 4Z8AA 2FRWA 1HJDA 2GQIA 2LP5A 3R6NA 2DX1A 2DRMA 2YT6A 2DVJA 1WDXA 1RI9A 4OMLA 1JU5C 1GFDA 4HXJA 4J9DA 4X1VA 2H8HA 2BZYA 1Y57A 4EIKA 4JPBW 1PKSA 4RTYA 4Z88A 1WLPB 4DEYA 2W0ZA 1CSKA 2LZ6B 2VKNA 2HBWA 1WYXA 1B3QA 1M3AA 1SHGA 2OAWA 2DMOA 1M3CA 1UE9A 2L0AA 2L2PA 1U3OA 4ZNXA 1WIEA 1U06A 1AWJA 1E7OA 2DLPA 2SEMA 4RTUA 1E6HA 2SRCA 4OMOA 2K2MA 2YDLA 1UDLA 2M0YA 1T3SA 1GL5A 2KRMA 2CH4W 2EGEA 2ESWA 2KXDA 1OV3A 2LQNA 1JXOA 3VRYA 2KGTA 1I1JA 2LNHB 1M3BA 1G83A 1GBRA 1MV3A 3I35A 1NYGA 4AG1C 1ZLMA 1Y0MA 3PVQA 4OMNA 2FPFA 2DM1A 2ENMA 4JZ4A 2FG0A 1JXMA 1OPKA 3EHQA 4JJCA 2NUZA 3EG0A 3EHRA 3M0SA 4K11A 1U5SA 3M0PA 1UJ0A 4J9FA 1AD5A 5IXBA 1RUWA 2KYMA 1QWFA 3I5SA 5IHKA 2A36A 2LX7A 2DL4A 1SEMA 1SRLA 1MV0B 3U23A 3I9QA 5FWBA 3VRZA 3TVTA 1OEBA 2YUNA 2CDTA 1ZSGA 1GRIA 1QCFA 2KT1A 1K0SA 2FRYA 4RTXA 4LN2A 4F16A 2LMJA 3JV3A 2DRKA 2KE9A 1EFNA 4E6RA 2D8JA 3NHNA 3NMZC 1ABOA 2K7AA 1QKXA 1B07A 1I0CA 4IIMA 1NM7A 4CC4B 2VWFA 2KR3A 1AZGB 4ESRA 1PKTA 3H0HA 4AFZC 1GCQC 1UTIA 1Z9ZA 1SHFA 3C0CA 4HVWA 2A37A 4LUEA 1BB9A 1TG0A 1X69A 2PTKA 1M8MA 1T0HA 2HEQA 5IH2A 4HVVA 4RUGA 1ZUKA 1OOTA 1UG1A 2BZ8A 1N5ZA 2DJQA 4F17A 2AK5A 1WXUA 2LJ0A 1UHCA 1H3HA 4J9IA 1GFCA 1ZUYA 2O9VA 2MCNA 2YUOA 2L3SA 3SEMA 1QWEA 1TUCA 5L23A 1G2BA 1QLYA 1E6GA 4D8KA 1SSHA 4KRTA 1PRLC 1KSWA 2EBPA 1WFWA 2RN8A 2HDAA 2A28A 2DL7A 1WI7A 4LUDA 1T0JA 1JQQA 1NEGA 2VVKA 1GCQA 1WXBA 3LH5A 1UFFA 4Y92A 1AZEA 2ED0A 1AWWA 1UGVA 4CC7A 1X6BA 2F2VA 2LQWA 3KFVA 2C0OA 3UA6A 2FPDA 1K1ZA 4AG2C 2D8HA 5GJVB 2KRNA 1QKWA 2CSIA 4OMMA 4GLMA 3UA7A 4QT7A 1X2QA 2HSPA 1K76A 2YUQA 2JMCA 2EYXA 2F2WA 3H0IA 1W70A 1XOVA 2AZVA 1KJWA 1BBZA 1ZUUA 2EYZA 1VYUA 4AFSC 1M30A 2KNBB 1PWTA 2KBTA 2EGAA 2DNUA 2EW3A 2J6OA 2L3QA 2DE0X 1IO6A 1BK2A 2KROA 5IHIA 2X3WD 3GBQA 4DEXA 2C0TA 2FPEA 2O2OA 2DILA 4WCIA 1ZBJA 4Z89A 1YNZA 3NPFA 1PNJA 3RNJA 2DL5A 5IHNA 2DYBA 2LJ1A 2JMAA 2QDLA 2HCKA 3NGPA 2RQRA 2PNIA 2GTOA 2M51A 2RNAA 2V1QA 2DF6A 4JJDA 1YN8A 3EGUA 1W6XA 2GTJA 2DL3A 3PE0A 2DL8A 5FW9A 2JXBA 3FJ5A 1UECA 4LNPA 4CC3A 1AWOA 3O5ZA 1HD3A 1X27A 1ARKA 1VYVA 4LE9A 2DBKA 1PHTA 1AWXA 1VYTA 2K79A 3EG1A 4R0KA 3CQTA 2JS0A 4OMPA 2E5KA 1K4US 4D8DA 1AVZC 1JO8A 3M0TA 1OPLA 2I0NA 4GBQA 4AFQC 2EYYA 2G6FX 1YCSB 1H8KA 2JM8A 2AKKA 2X3XD 4J9BA 4JZ3A 2YUPA 4RTTA 2RQVA 2GGRA 2W10A 4OMQA 2C0IA 2D1XA 4J9GA 4J9HA 1RLQC 2EVRA 2OJ2A 2AZSA 1WA7A 4JJBA 2O31A 1MUZA 5HCKA 2J05A 3UF4A 3THKA 2RPNA 1J3TA 2RF0A 1UHFA 5FWCA 1JEGA 2J7IA 2ED1A 2RQTA 1ZX6A 3VS0A 1RLPC 3M0RA 1A0NB 2KYBA 4RTVA 4HVUA 2O9SA 2JT4A 2CT4A 2CH4A 2AKLA 1X2KA 3QWYA 4RTWA 2ABLA 3VS1A 3RBBB 2CUBA 2JTEA 3VS4A 2V1RA 2PZ1A 4IIOA 1HSQA 2P4RA 2DA9A 4F14A 2RQWA 1H92A 3VS6A 1WX6A 2KRSA 3IQLA 1X43A 1K9AA 1S1NA 2J6KA 2J6FA 2K6DA 4CC2A 4AFUC 2ECZA 4RTZA 1SPKA 4FSSA 3H41A 4A63B 3PVLA 2FO0A 3A98A 3EG2A 2RQUA 2EPDA
chains in the Genus database with same CATH superfamily
1K0XA 2LQ8A 3RKXA 1NJIC 1M5Q1 3EGXB 2WACA 3S6WA 2P4TA 4FT2A 5IXFA 1TXQA 2FEIA 4PJOG 3JB9H 1KQ2A 3SHWA 3I56T 1QCOA 1VQ7A 1NE8A 2ROTA 5EC7A 5CKBA 1QVFP 1VQPQ 1X01A 4WF2A 3CC4T 2DBMA 2FZCB 2EKHA 5GAMh 4J7IA 1VQ4Q 2EJ9A 2EGCA 3M0QA 1YWOA 2K3BA 3VU3C 2CT3A 3HFNA 1I07A 3ZL7C 4WTOB 1W2BP 1IB8A 2VXEA 3J7AF 4IUUA 1U1TA 3QDFA 4PLLA 2EIFA 2JS2A 1GCPA 1TUDA 2AHJB 5GAMd 2F69A 5LJ3d 2KSSA 1YJ9T 2CGHA 2KAFA 4J6WA 2QQSA 4X9DA 2JTFA 1KQSA 2RHUA 1CKBA 2YSQA 3BW1A 3OYHA 1I5OB 3P8BB 3QKJA 2MI6A 4L6V5 4UC4A 4HCZA 5ECAA 3CC2Q 2EQIA 1C0MA 1ZSZB 2JM9A 3EFSA 3SDZA 3KXTA 3SFMA 3CC4A 1UUEA 3X26B 5FU6C 4HCBA 2ATCB 5GJWB 3G71T 2F5KA 2P0PA 2XMFA 3CCJA 1VQKA 2FRWA 3C94A 2GQIA 2LP5A 1ZSZA 4LD9K 2CP2A 5GANh 1JU5C 1QP2A 4HXJA 4J9DA 5LJ3j 1BCMA 5I2SA 2BZYA 4EIKA 3JB9J 1Q86U 4PFZA 1PKSA 2HQHA 1Q82U 2QEXT 4DEYA 2RHZA 4EMKA 1EZZB 2XHCA 3EFOA 1WJQA 1B3QA 3RUXA 1SHGA 2CP6A 1M3CA 1UE9A 3CCSA 4OF1A 1AWJA 2G3RA 3AT1B 2Z0WA 1NPPA 1PG5B 1T3SA 4QW2A 3V7RA 1G8XA 2KRMA 2CH4W 2EGEA 5LJ3e 1S72Q 2LNHB 1S72T 1FX7A 3MCAB 5KYYB 2LX9A 3I35A 1ZLMA 3PVQA 3EG9A 4EPCA 2ENMA 3G4SA 4EMKC 2FG0A 1JXMA 1KQ1A 3EG0A 1VQOT 5GANj 3TU4K 1U5SA 1QVGA 3M0PA 4PNOA 2XU8A 3P8DA 1VQ4T 1AD5A 3BDUA 1RUWA 3LGFA 4Y91A 4M7DF 4MZPA 1QWFA 2HQEA 2A36A 2GF7A 3NTKA 3DKMA 3OYLA 2LX7A 2DL4A 3TREA 5C6SA 3E19A 1R8OB 3C4SA 1BYMA 4ZGEB 3GLXA 3NTIA 1C1AA 3VRZA 1VQ9A 3TVTA 2LQKA 1Q7YU 1BI0A 2QTVA 2YUNA 2EJFA 4FYYB 3MHXA 3CMEQ 3A8LB 3M9QA 4DBFA 4M75F 1QCFA 1K0SA 3JCMf 1IHVA 4C92E 1D3BA 4HKEA 3NMZC 2EQUA 1FMWA 5CQYA 1I0CA 3CMAT 4RG8A 2NLUA 2B8AA 1VQ6A 1AZGB 4ESRA 4XU1A 4AFZC 2ZCFB 3OYIA 1EIFA 3OS2A 1HK9A 2A37A 2E41A 1BB9A 1RI0A 2M9UA 3GP8A 1X69A 2HEQA 4BE0A 4ZGJB 4YTLA 4RUGA 1ZUKA 4C8QF 4M77C 3CPWS 2BZ8A 1N5ZA 1Q95G 2K3XA 1UHCA 3L1AA 1M1KC 4J6YA 2MCNA 1D1BA 2DXBA 2YUOA 1VQ5A 1BI3A 5L23A 4D8KA 1SSHA 2QEXQ 1KSWA 1NJIU 2RHYA 4LUDA 2DTOA 2VVKA 3LH5A 4JUVA 4AMCA 1PM3A 5KE3A 1PD1A 5GMKl 4M78G 5FLXE 4M78F 3KFVA 1OQKA 2C0OA 1YCYA 1K1ZA 2FPDA 3UA6A 3J80E 4M77A 3LWIA 1KC8C 2DPPB 1LOJA 5CQXA 4OMMA 4C5IA 1G5VA 1VQPT 1K76A 3QO3A 1VQ8A 3CCQQ 4JLGA 2AZVA 2PVOB 2D9TA 1VYUA 3QUIA 1M30A 2KNBB 1PWTA 2KBTA 2EGAA 4C0GA 2EW3A 4BE2A 2J6OA 2DE0X 2KROA 5CKDA 3CCMQ 3CC7T 3F70A 4HCCA 2O2OA 2DTIA 3ZFJA 1ZBJA 3G4ST 1YNZA 5IHNA 4JJNK 2LJ1A 4OGEA 2HCKA 1NBEB 5GAOq 2M51A 4II1A 2V1QA 3UPUA 1W6XA 2F1LA 1RADB 2DL3A 2DO3A 2LT4A 4TVRA 4A4HA 5FW9A 1AT1B 2IVWA 5HK0A 2NYSA 1X27A 5LJ3f 2OTJT 1YHQQ 2DIGA 4ZN1A 1XJWB 3OYCA 2Y4YA 2JS0A 3SB2A 1M1KR 4HT9A 2RJFA 2RA2A 1RABB 2QAZA 4HT8A 1OPLA 3MKDA 2I0NA 3WVDB 4AFQC 2RI3A 2EFIA 1YCSB 3CCEA 2X3XD 4JZ3A 4PJOE 2YUPA 1Q82R 2HSEB 1B7TA 4OMQA 3M4GA 1VQ8T 4F04B 1QVGS 1RLQC 3E9GA 1K73R 2O31A 4Q5WA 5J26A 3THKA 2WSCE 2J7IA 2X4JA 2ED1A 2L89A 3VS0A 3PNWC 3M0RA 1A0NB 2O9SA 4QQ6A 2YHTA 2PQWA 1KK7A 1YI2Q 2AKLA 3QWYA 4RTWA 3RKWA 3RBBB 3QDRB 4ANJA 1W4SA 2PZ1A 5FROA 4M7AD 4F14A 1WHLA 1WX6A 3IQLA 2FL7A 2KRSA 2ZAEA 1XNIA 2RI5A 2A3LA 2DETA 3A8OB 1UEBA 3X24B 1YJ9A 5GAN5 3M56A 2K6DA 2QK0A 2OTLT 1Q81U 4AFUC 3JCMc 1RAEB 7AT1B 4RTZA 3H41A 3VYGA 3LLRA 1LJOA 1Y96A 5A0GA 4LDWA 2XI9A 1QW1A 1WHKA 5I21A 2EPDA 2RJEA 2KDSA 4ORZA 2COWA 1YWPA 4E7LA 2MIOA 2CP5A 3FDRA 1M1GA 2L3PA 3L2VA 1YP5A 5L8RE 2E12A 1X6GA 3TSZA 3KUFA 1U1SA 3VS7A 5GAN7 4BI3A 2E5QA 4C92A 1LNXA 2E6NA 3LX7A 3CD6Q 2EJGA 2IG0A 4FYXB 2K5FA 5A2QE 1G3TA 1Q86C 3FB9A 1UJYA 3G6EA 4OB2B 2OAUA 2ROLA 1H3ZA 5GAMj 5GANd 2RMOA 2D6FA 1NLOC 4J9CA 3M57A 5GMKm 3PT9A 1I8FA 4KGXB 2K5IA 3FC3A 4ME7A 3PTAA 2OI3A 1TU0B 4M4ZA 3REAB 2K5LA 4C92C 1RACB 1VQLA 5D6YA 3UATA 1S72A 1VA7A 3CCQA 3RIRA 4HCKA 2X51A 5I11A 2KT8A 3QZ9B 3TSWA 5KYNA 2HMAA 2QA4Q 4N0AC 5FU7B 3JB9D 4PK4A 3OYKA 4PFOA 5I22A 1FMKA 1TTHB 2NUTB 4M77B 4Z8AA 4A54A 2MPXC 3GNGA 2DRMA 1WDXA 4OMLA 2H3EB 1M2VB 5KYUB 3JCMh 2Y90A 1Y57A 3OYGA 2JTMA 4FU6A 4Z88A 3VKIA 4M7AC 1WLPB 1CSKA 3HKSA 2RK1A 5J39A 2HBWA 2HAXA 2DMOA 5CKEA 4ZNXA 5GMKi 1KD1U 1U06A 1TS9A 4MMLA 2SEMA 3OW2A 2SRCA 2DZCA 1VIFA 1GL5A 1HYOA 1VQ6T 3QIIA 3CMAA 5CVIA 1OV3A 2YLBA 4BACA 4BY6B 3VRYA 1EX4A 2ZGWA 5C0MA 2GFAA 2HQXA 1M3BA 2XICA 4FT4A 2KY9A 2RO0A 4B6MA 4F7UF 2COZA 1KD1C 4E7JA 4M7AA 2FPFA 1VQNA 4JZ4A 1NPRA 2DXUA 5GAMe 3EHQA 3M0SA 3MP8A 1XTDA 2I2LA 3O8VA 1UJ0A 2HL5C 4KH0B 2OX7A 1YHQT 4XU0A 1BKBA 2XG8D 2EQJA 1VQ9Q 2DZ9A 2E64A 2K2VA 5HY6A 1Q81C 4O5VA 1WJRA 2RM4A 3LH0A 2VASA 3I9QA 4B9WA 4C5GA 1KG1A 3MP1A 1G3SA 4JS5A 4M75A 5GMKh 2P0KA 2QTXA 4LDXA 3M58A 3BE3A 4GLKA 4M7AF 1OEBA 1WJSA 2RB6A 2KQWA 1ZSGA 4ZTFA 4OB3B 3WXMB 2KT1A 1VQOA 3EGDB 1WPYA 4LDUA 3CXCS 4DOWA 2KE9A 1WQ7A 2D8JA 4BI4A 3CPWP 3HP9A 3R6OA 1UGRB 2EWNA 5EG2A 2KR3A 1YJ9Q 5HK3A 1PKTA 3RERA 2HD0A 3H0HA 1UTIA 1QQJA 4LD6A 4HVWA 1M90C 1PD0A 1I5LA 4M77G 2PTKA 3X25B 1T0HA 5IH2A 3V8LA 3L2WA 4HVVA 4FL6A 4E47A 5GANe 1D09B 1M8VA 3CBPA 4R55A 1MGQA 3RMSA 4M7AB 1F1BB 3G7ZA 2L3SA 3I56Q 1TUCA 1G2BA 1QLYA 3A1PA 4KRTA 1PRLC 4A4KA 2EBPA 3CCQT 4P5NA 5CCAA 1MMGA 2QXFA 1WXBA 1UFFA 1KQSP 1DJ7B 2RHIA 3CCJT 3OW2S 1UGVA 4XTZA 1X6BA 4IUQA 1M9SA 2F2VA 2LTOA 5GJVB 5GAN2 1TSFA 2XDDA 3H8ZA 2LCCA 1QKWA 2CSIA 4EMHA 3X20B 2HSPA 5LJ5d 4M7DE 4A53A 2XK0A 4FYVB 1OU9A 2F2WA 4DBQA 4J83A 1D1CA 4JLIA 2BIVA 1BBZA 1ZUUA 4AFSC 3CEYA 2DNUA 2GCXA 3ASKA 3SWNB 3CCLQ 1YITA 5IHIA 1N9SA 2M16A 3A8MB 2X3WD 3C12A 4V2SA 1YBYA 2C0TA 4OB0B 3OYNA 2DEUA 3JSCA 4Z89A 2DIQA 3RNJA 4ZTJA 3SWNA 3NGPA 1TOVA 4EMGA 2GTOA 2RNAA 4JJDA 1YN8A 3EGUA 4FM4B 2E70A 1C6VX 2BKDN 4DBHA 3CC4Q 2KMTA 2DL8A 3L2UA 4CC3A 1AWOA 1HD3A 1ARKA 1VYVA 1VQKQ 2DBKA 1PHTA 3CC7Q 4C8QB 1AWXA 2OTJA 2FZKB 1P92A 3EG1A 4R0KA 3CQTA 1TH7A 2E5KA 3A5ZB 1AVZC 1K8AU 5D6WA 4F7UE 2E65A 1Y7XA 4GBQA 4NL3A 1MHNA 1ZSZC 4DA4A 4Y28E 2JM8A 2RQVA 4NS5A 4MMKA 4PJOF 2W10A 1MMAA 1O9SA 5DLOA 4C5HA 1SF9A 2X4XA 2AZSA 1WA7A 4JJBA 1YIJA 5HCKA 2J05A 3UF4A 1KC8U 3VUBA 3CC2T 4C0DC 2WSFE 1JEGA 4KBMB 2QGGA 2DFUA 3GF5A 5A0LA 2RH2A 4C0DB 1OX9A 3QYHB 1M90R 4HVUA 3J81E 2CT4A 3T9NA 1K8AR 2CH4A 2JN0A 1JRIA 2ABLA 4KUIA 2LDMA 1RAAB 1W2BS 3OS5A 1VQOQ 4IIOA 2DJZA 2RQWA 4BY6C 2QDYB 1X43A 1K9AA 1S1NA 4PL6A 4ZGDB 1WHMA 2J6KA 5GAMg 4FYWB 2J6FA 1HXDA 2ECZA 3UT1A 4FSSA 1MNDA 2DEQA 2DVEA 4M7DD 2YLCA 3PVLA 2FO0A 3EH2A 4C8QA 2DTHA 5GAN4 3CMEA 4QQDA 1R0CB 1M27C 1W1FA 1AOJA 4E7HA 3TEEA 1PCXA 3QZ5B 3OSVA 5LJ5f 2KVQG 2EYWA 2KEAA 1RAGB 1KFZA 3QJ6A 1V29B 4XK8E 2HKNA 3CC7A 1GBQA 1YJNT 3TCJA 4B9XA 3INZA 3G1JA 1NLPC 2JNGA 3QWXX 4JS4A 2MYSA 4IUTA 2ZPBB 2QGFB 4C8QC 4M75E 1YIJQ 3PMTA 1NG2A 1BCOA 3VYHB 2F2XA 5AT1B 3VS3A 3PIOA 2K4YA 3M0UA 4M78B 4FCYA 4BDYA 5GANg 1NYFA 3QPHA 2K9GA 1OZ2A 2DERA 4M75G 2LCSA 3CCLA 1ABQA 2BTTA 1OX8A 2FZGB 2PVDB 4E7ZA 2V8KA 4NOYA 1CKAA 4M77E 3VS5A 3CMAQ 2OTLQ 3EG3A 2X35A 2CZ7B 3S3OA 3D7SB 4J9EA 1MMNA 1WHGA 2O88A 3EFOB 3BFMA 1NEBA 1QVFS 1LCKA 4M7DG 3MEUA 1AEYA 3JCMX 3FRNA 3REBB 1K9MU 4MDWA 5KCHA 3DLLA 1HJDA 3H6ZA 1V76A 2YT6A 2DVJA 1RI9A 1SG5A 1Q82C 4X1VA 1JJ2S 2CZ0B 3H9NA 5GAN6 2V26A 1YITQ 2CP0A 1OU8A 2VKNA 2YRCA 1M3AA 2CKKA 2OAWA 2RK2A 3HTRA 4OP0A 2L0AA 2L2PA 3HPWA 1WIEA 4PJOC 2DLPA 4XTWA 4C92D 4RTUA 3LW5E 2QEXA 3JCMP 3OBYA 4OMOA 2E10A 1D3BB 2QA4A 1H641 5GANf 3AHUA 1UDLA 2M0YA 2ESWA 2KXDA 2LQNA 2XD0A 2VGMA 2MAMA 4JRIA 2KGTA 2L8DA 2DKGA 3PIPA 1GBRA 1M90U 1I4K1 1MV3A 1NYGA 2NUPB 1OPKA 4JJCA 5GMKj 3RESA 2MWPA 3JCMJ 4J9FA 4PJOA 4C92F 1VQ6Q 1M4ZA 5IXBA 1VQ4A 5FRMA 3CXCP 3QJYA 2EYQA 3V8KA 4M75D 2VV5A 4HA8A 5GAOp 1VQ7Q 5IN1A 4IUPA 4C8QD 1SEMA 1SRLA 4XU2A 1MV0B 5GAOr 1MMDA 3GIBA 5KCOA 4X9CA 5FWBA 3DB3A 4RMOA 2KK4A 1N8RC 4BD3A 3JB9G 2CDTA 1GRIA 3MEWA 4F7UA 1R0BG 4LN2A 3EH1A 3HRSA 4PLIA 2LMJA 3EGXA 3JV3A 4XTYA 4F16A 1EFNA 2XDPA 4E6RA 3NHNA 1UGSB 1ABOA 2K7AA 1SSFA 2FVUA 3UDCA 1QKXA 2M0OA 3QG1A 4XTUA 1BIBA 2E6ZA 4MZMA 4CC4B 4IURA 4XU3A 2HBPA 5FU6B 5KYXB 1GCQC 3CCUQ 3OY9A 4FIBA 4KT0E 1Z9ZA 3BY7A 4Z02A 1D1AA 4LUEA 2MK5A 5LJ5h 2DYIA 1M8MA 1M1FA 2CS7A 1D0ZA 1PC0A 3DLMA 5IAYA 4FW2A 1UG1A 4N4GA 3JCMW 3NFCA 4F17A 2AK5A 2C06A 2LJ0A 3L2ZA 1ACMB 1UGQB 4J9IA 3CCEQ 1WNLA 3JCMd 4LXCA 1GFCA 3EG9B 4AT1B 2XDBA 1FMVA 2DD5A 2BE7D 4E2FB 1X6OA 4E7IA 2HKQB 4E7KA 3SEMA 1QWEA 3MEVA 3CCVA 1MNEA 2RN8A 2RD1A 2DL7A 2YRVA 2P0QA 1WI7A 4ATOA 1YI2T 1GCQA 2DAQA 2AIRB 1YHQA 4Y92A 2ZPFB 4M7DB 1IHWA 2ED0A 4CC7A 1OI1A 3OYAA 2LQWA 2E3HA 4N4HA 4CRIA 5CKFA 4AG2C 2COYA 3LWHA 1TWBA 5CO7A 3CBOA 1IXDA 1KHCA 1VOMA 2LNVA 4QT7A 1X2QA 5D7UA 1BI1A 1M2OA 4J5YA 4F7UG 2JMCA 2EYXA 1W70A 1Q81R 2HNIA 2EYZA 3M5AA 3FIFA 3MO8A 1FWZA 4A4FA 2CZ1B 2QYZA 3HRTA 1LVKA 4QVZA 1YIJT 3E1SA 2NUTA 4EDUA 4QVDA 3SD4A 1BI2A 3GBQA 2FPEA 3QBYA 2DILA 3CC2A 1RAHB 1KD1R 1KHIA 4PJOB 3NPFA 1PNJA 2DL5A 2E4HA 3QHSA 4A4EA 1RAFB 4RKUE 4C8QG 1ZHIA 1JB0E 2RQRA 2DF6A 3DB4A 3G6EQ 2JXBA 2L3RA 4LNPA 1RAIB 4R56A 3RR6A 4LE9A 4ELZC 1IRXA 1YJWA 2MMPA 4D6WA 2K79A 2O4XA 4N0AA 3V7SA 2HL3A 2EKOA 4D8DA 3VUZA 3MEAA 3M0TA 4JRPA 2GFUA 4BE1A 4RTTA 2GGRA 1QMCA 3JB9I 3ER0A 1IGQA 3G71A 4J9GA 2FYKA 2R57A 5DY9A 2OJ2A 2VC8A 1K73U 1VQKT 1MUZA 1AHJB 3OBWA 2RPNA 3OYYA 2DD4A 1IZ6A 2QQRA 1OULA 2RQTA 3C95A 3FLGA 3HSBA 1RLPC 2KYBA 2QG9B 4XTVA 2EQKA 2O01E 4OVAA 1X2KA 1M1KU 2JTEA 3VS4A 2V1RA 1JBMA 3OYEA 2V8JA 1HSQA 2DA9A 1H92A 3JCMe 3OMGA 3VS6A 3NTHA 2VB6A 3TQ7P 5KYWB 2CP3A 2NUPA 3CPWA 3FEOA 4IKFA 3E9FA 3EGDA 2P84A 5KE2A 4CC2A 2QQ9A 2XIDA 3RDVA 3CCRA 5CK9A 2ZPHB 3GOXA 4ZN3A 2EAYA 4E7SA 4C92B 2PVGB 2K57A 4MZTA 3G71Q 2RJCA 3EG2A 3PFSA 3BDLA 5KH6A 3META 2JW4A 4DOVA 2BUDA 2GNCA 3E2UA 5LJ3h 2CUDA 1YJNA 1TUGB 5A0DA 4M75C 4M78D 3HFOA 2QA4T 2JUFA 3HRUA 3CCRQ 4M77D 4C0ZA 1SRMA 1WQWA 2MOXA 3CBMA 2VUBA 4M75B 2LVMA 3JCMV 2MF2A 2QQAA 2CREA 2Y4XA 2YWWA 1N8RU 3OB9A 3ULRB 1PRMC 1K73C 4OB1B 1D0YA 2A7YA 1Z9QA 2QQBA 3UWNA 1VQ9T 3CMET 1T3LA 5LJ3g 1WXTA 4N4IA 4J6XA 5DM7R 3OA6A 2NWMA 2IPOB 3H0FA 1ZA1B 3I5RA 3JCMQ 5FU7C 1QVPA 1V1CA 4QVCA 4PJMA 4PJLA 2A08A 3JCMg 2K3YA 1RL2A 2D0QB 3CCMA 3M54A 2ZPIB 4O6JA 2B86A 1VQLT 4QQGA 2D0NA 2KXCA 2BZXA 3EFRA 3VS2A 2J06A 3I55Q 4OMFB 1R77A 1K8AC 1M2VA 2LT1A 5KYUA 1KIKA 3CCET 2X9HA 9ATCB 1D0XA 4J8OA 5I2MA 1JJ2P 3URGA 2CSQA 2IIMA 2V8IA 1BU1A 4C5EA 5LJ5g 2R5AA 1FYNA 2QASA 1QVFA 2YRDA 3QXEB 5CR2A 1N6AA 2LJ3A 2GBQA 2R5MA 4VUBA 4KGVB 2FHDA 3R6NA 2M02A 2DX1A 3M4YA 5DLQE 1VQ5T 3L2RA 4BI8B 1GFDA 4PJNA 2H8HA 2JOYA 1Q7YC 4JPBW 4LDYA 4M7AG 2X4WA 4RTYA 1Q7YR 1WZOA 1YFNA 4JRQA 2W0ZA 3RKYA 2LZ6B 4RCBA 1WYXA 5GAMf 1IREB 1U3OA 4C8QE 3MPUB 1E7OA 2QI2A 1G3WA 3GPLA 1VQ8Q 1VQLQ 1E6HA 2R58A 2K2MA 2YDLA 3PGGA 1UB4A 3I56A 3LGLA 4PJJA 1Y71A 2OTLA 2JVVA 4GY5A 3SWNC 3X28B 4RG2A 1VQMQ 1JXOA 2DXTA 1I1JA 2E3IA 4LDVA 3M59A 4M77F 1G83A 3MJXA 1B34A 1ZBXA 4EMKB 3KBGA 4AG1C 1Y0MA 1G3YA 4OMNA 2DM1A 2ZZDA 4KH1B 1QP3A 8AT1B 2NUZA 3EHRA 3GNFB 3RMQA 1VQ5Q 4K11A 2RI2A 2FB7A 5CIUA 1ZQ1A 2HZYA 3FJPA 3V8JA 2KYMA 1XQHA 3I5SA 1NJIR 5IHKA 5CKHA 1K9MR 3OYDA 1K9MC 4BUGA 1VUBA 3OMCA 1YJNQ 3U23A 5LJ5j 1WHJA 4PKCC 3A8HB 1SKUB 5GAOn 1PSEA 4NL2A 1KQSS 3OW2P 4M7AE 5IT9E 2FRYA 4RTXA 4PFPA 3S3NA 4M7DC 3ME9A 1VQMT 2F5TX 4ELYC 1KC8R 2DRKA 2PUOB 3QYGB 4KULA 2L5QA 3L42A 1FXXA 1B07A 3CCUA 3OS0A 2ZPGB 4IIMA 1NM7A 3L2QA 2VWFA 3JCMb 4M78C 1WGSA 3P8HA 3OYMA 4L59A 8ATCB 2A0FB 3C0CA 1SHFA 4A4GA 4X34A 1TG0A 1UGPB 2VGNA 4JDSA 1IGUA 4IUVA 1OOTA 2DJQA 2H3JA 2OTJQ 1WXUA 1H3HA 5LL6S 1VQMA 4M7DA 3A8GB 1ZUYA 2O9VA 2DXCA 3JB9F 1U8RA 1ZA2B 4MDXA 3OS1A 1PSFA 3HHTB 1E6GA 1BIAA 1WFWA 2M1HA 3CCUT 2HDAA 2A28A 4M78A 3HL8A 2VYTA 1T0JA 1JQQA 1NEGA 4XAXB 4DBRA 3CCMT 2CP7A 2YXYA 3QSUA 1N27A 1AZEA 1AWWA 4M78E 2VXFA 4PJOD 6AT1B 2D8HA 3G4SQ 2KRNA 1JJ2A 3S3MA 4GLMA 3UA7A 5HKCA 1N8RR 2YUQA 4CI0C 5FRNA 1LPLA 3H0IA 1XOVA 3CCSQ 1YJWQ 1KJWA 5J3BA 1B34B 4J7FA 2O4XB 2L3QA 1IO6A 1BK2A 2PUKB 3G6ET 4FSXA 4F7UB 4DEXA 4C0FA 4WCIA 2MWOA 4XTXA 3CCVT 3JRZA 3I55A 2JJ9A 1Y07A 2DYBA 2XKOC 2JMAA 2QDLA 3VV0A 3OQ5A 2PNIA 3OYBA 2KI7A 2BE9B 2GTJA 5GMKe 3PE0A 1Q86R 3WVEB 3V7CA 5GAOm 5GAN3 3FJ5A 4KGZB 1UECA 2AT1B 5D6XA 2RHXA 3O5ZA 4C92G 3JAME 1QCNA 3M55A 2LCLA 3EAEA 3CCJQ 3OYFA 1OYXA 3I55T 1X75C 2DK3A 1VYTA 4DQ2A 3CCRT 2ZPEB 3OYJA 3M53A 4OMPA 3LYIA 3ZBDA 1K4US 5GAN8 5KYXA 3MP6A 1JO8A 2WSEE 1YITT 3N5BB 2EYYA 2G6FX 3CD6A 1H8KA 3VJPA 2AKKA 4J9BA 5KYWA 5LJ5e 2LRQA 3Q1JA 2EQMA 2C0IA 2D1XA 5GAOl 4J9HA 2EVRA 3CCLT 4L5GA 3CCVQ 2CZ6B 2LC4A 1J3TA 2RF0A 1UHFA 5FWCA 1VIEA 1ZX6A 2RJDA 2JZ2A 3CPFA 4BB7A 4RTVA 2JT4A 1VQPA 3ZEHA 5M9OA 1O75A 1I81A 4BDZA 2X4YA 3VS1A 1QVGP 4QKUA 2CUBA 3PMIA 1W2BA 2PU9B 2P4RA 1OZ3A 3CXCA 4OGCA 2GQVA 1GXIE 5AYFA 2CYZB 4FW1A 1Y96B 2E1HA 1WHHA 5KYYA 1SPKA 4JRKA 4RCCA 1VQ7T 1NZ9A 1VQNT 4A63B 1VQNQ 1YI2A 3A98A 3CD6T 5CAIA 4XQ3A 3OSSC 2RQUA 1N9RA 3CCST 4KUDK 1YJWT
chains in the Genus database with same CATH topology
1K0XA 4ORZA 1M27C 1W1FA 1AOJA 1YWPA 2JW4A 2GNCA 2MIOA 5IXFA 2FEIA 2CUDA 2L3PA 3SHWA 1YP5A 2EYWA 2KEAA 1KFZA 1X6GA 3TSZA 2ROTA 1SRMA 2MOXA 5EC7A 3VS7A 2DBMA 2CREA 2EKHA 1GBQA 2EGCA 1PRMC 3M0QA 3ULRB 1NLPC 1YWOA 3QWXX 2K3BA 2CT3A 1Z9QA 1I07A 3ZL7C 1UJYA 2ROLA 1T3LA 1WXTA 2RMOA 1NG2A 1NLOC 4J9CA 2F2XA 2NWMA 3VS3A 3H0FA 2JS2A 3I5RA 1GCPA 1TUDA 3M0UA 1V1CA 2OI3A 1NYFA 2A08A 2K9GA 4M4ZA 3REAB 2LCSA 1ABQA 2B86A 2BTTA 2D0NA 1CKBA 2YSQA 2KXCA 2BZXA 3VS2A 2J06A 3UATA 1CKAA 1VA7A 1KIKA 5ECAA 3VS5A 2EQIA 3EG3A 2CSQA 2IIMA 4HCKA 1BU1A 2JM9A 4J9EA 5I11A 2KT8A 3TSWA 1FYNA 2O88A 1NEBA 1UUEA 1LCKA 5GJWB 1AEYA 2LJ3A 5I22A 1FMKA 2GBQA 2XMFA 3REBB 4Z8AA 2FRWA 1HJDA 2GQIA 2LP5A 3R6NA 2DX1A 2DRMA 2YT6A 2DVJA 1WDXA 1RI9A 4OMLA 1JU5C 1GFDA 4HXJA 4J9DA 4X1VA 2H8HA 2BZYA 1Y57A 4EIKA 4JPBW 1PKSA 4RTYA 4Z88A 1WLPB 4DEYA 2W0ZA 1CSKA 2LZ6B 2VKNA 2HBWA 1WYXA 1B3QA 1M3AA 1SHGA 2OAWA 2DMOA 1M3CA 1UE9A 2L0AA 2L2PA 1U3OA 4ZNXA 1WIEA 1U06A 1AWJA 1E7OA 2DLPA 2SEMA 4RTUA 1E6HA 2SRCA 4OMOA 2K2MA 2YDLA 1UDLA 2M0YA 1T3SA 1GL5A 2KRMA 2CH4W 2EGEA 2ESWA 2KXDA 1OV3A 2LQNA 1JXOA 3VRYA 2KGTA 1I1JA 2LNHB 1M3BA 1G83A 1GBRA 1MV3A 3I35A 1NYGA 4AG1C 1ZLMA 1Y0MA 3PVQA 4OMNA 2FPFA 2DM1A 2ENMA 4JZ4A 2FG0A 1JXMA 1OPKA 3EHQA 4JJCA 2NUZA 3EG0A 3EHRA 3M0SA 4K11A 1U5SA 3M0PA 1UJ0A 4J9FA 1AD5A 5IXBA 1RUWA 2KYMA 1QWFA 3I5SA 5IHKA 2A36A 2LX7A 2DL4A 1SEMA 1SRLA 1MV0B 3U23A 3I9QA 5FWBA 3VRZA 3TVTA 1OEBA 2YUNA 2CDTA 1ZSGA 1GRIA 1QCFA 2KT1A 1K0SA 2FRYA 4RTXA 4LN2A 4F16A 2LMJA 3JV3A 2DRKA 2KE9A 1EFNA 4E6RA 2D8JA 3NHNA 3NMZC 1ABOA 2K7AA 1QKXA 1B07A 1I0CA 4IIMA 1NM7A 4CC4B 2VWFA 2KR3A 1AZGB 4ESRA 1PKTA 3H0HA 4AFZC 1GCQC 1UTIA 1Z9ZA 1SHFA 3C0CA 4HVWA 2A37A 4LUEA 1BB9A 1TG0A 1X69A 2PTKA 1M8MA 1T0HA 2HEQA 5IH2A 4HVVA 4RUGA 1ZUKA 1OOTA 1UG1A 2BZ8A 1N5ZA 2DJQA 4F17A 2AK5A 1WXUA 2LJ0A 1UHCA 1H3HA 4J9IA 1GFCA 1ZUYA 2O9VA 2MCNA 2YUOA 2L3SA 3SEMA 1QWEA 1TUCA 5L23A 1G2BA 1QLYA 1E6GA 4D8KA 1SSHA 4KRTA 1PRLC 1KSWA 2EBPA 1WFWA 2RN8A 2HDAA 2A28A 2DL7A 1WI7A 4LUDA 1T0JA 1JQQA 1NEGA 2VVKA 1GCQA 1WXBA 3LH5A 1UFFA 4Y92A 1AZEA 2ED0A 1AWWA 1UGVA 4CC7A 1X6BA 2F2VA 2LQWA 3KFVA 2C0OA 3UA6A 2FPDA 1K1ZA 4AG2C 2D8HA 5GJVB 2KRNA 1QKWA 2CSIA 4OMMA 4GLMA 3UA7A 4QT7A 1X2QA 2HSPA 1K76A 2YUQA 2JMCA 2EYXA 2F2WA 3H0IA 1W70A 1XOVA 2AZVA 1KJWA 1BBZA 1ZUUA 2EYZA 1VYUA 4AFSC 1M30A 2KNBB 1PWTA 2KBTA 2EGAA 2DNUA 2EW3A 2J6OA 2L3QA 2DE0X 1IO6A 1BK2A 2KROA 5IHIA 2X3WD 3GBQA 4DEXA 2C0TA 2FPEA 2O2OA 2DILA 4WCIA 1ZBJA 4Z89A 1YNZA 3NPFA 1PNJA 3RNJA 2DL5A 5IHNA 2DYBA 2LJ1A 2JMAA 2QDLA 2HCKA 3NGPA 2RQRA 2PNIA 2GTOA 2M51A 2RNAA 2V1QA 2DF6A 4JJDA 1YN8A 3EGUA 1W6XA 2GTJA 2DL3A 3PE0A 2DL8A 5FW9A 2JXBA 3FJ5A 1UECA 4LNPA 4CC3A 1AWOA 3O5ZA 1HD3A 1X27A 1ARKA 1VYVA 4LE9A 2DBKA 1PHTA 1AWXA 1VYTA 2K79A 3EG1A 4R0KA 3CQTA 2JS0A 4OMPA 2E5KA 1K4US 4D8DA 1AVZC 1JO8A 3M0TA 1OPLA 2I0NA 4GBQA 4AFQC 2EYYA 2G6FX 1YCSB 1H8KA 2JM8A 2AKKA 2X3XD 4J9BA 4JZ3A 2YUPA 4RTTA 2RQVA 2GGRA 2W10A 4OMQA 2C0IA 2D1XA 4J9GA 4J9HA 1RLQC 2EVRA 2OJ2A 2AZSA 1WA7A 4JJBA 2O31A 1MUZA 5HCKA 2J05A 3UF4A 3THKA 2RPNA 1J3TA 2RF0A 1UHFA 5FWCA 1JEGA 2J7IA 2ED1A 2RQTA 1ZX6A 3VS0A 1RLPC 3M0RA 1A0NB 2KYBA 4RTVA 4HVUA 2O9SA 2JT4A 2CT4A 2CH4A 2AKLA 1X2KA 3QWYA 4RTWA 2ABLA 3VS1A 3RBBB 2CUBA 2JTEA 3VS4A 2V1RA 2PZ1A 4IIOA 1HSQA 2P4RA 2DA9A 4F14A 2RQWA 1H92A 3VS6A 1WX6A 2KRSA 3IQLA 1X43A 1K9AA 1S1NA 2J6KA 2J6FA 2K6DA 4CC2A 4AFUC 2ECZA 4RTZA 1SPKA 4FSSA 3H41A 4A63B 3PVLA 2FO0A 3A98A 3EG2A 2RQUA 2EPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0X A;  4ORZ A;  1M27 C;  1W1F A;  1AOJ A;  1YWP A;  2JW4 A;  2GNC A;  2MIO A;  5IXF A;  2FEI A;  2CUD A;  2L3P A;  3SHW A;  1YP5 A;  2EYW A;  2KEA A;  1KFZ A;  1X6G A;  3TSZ A;  2ROT A;  1SRM A;  2MOX A;  5EC7 A;  3VS7 A;  2DBM A;  2CRE A;  2EKH A;  1GBQ A;  2EGC A;  1PRM C;  3M0Q A;  3ULR B;  1NLP C;  1YWO A;  3QWX X;  2K3B A;  2CT3 A;  1Z9Q A;  1I07 A;  3ZL7 C;  1UJY A;  2ROL A;  1T3L A;  1WXT A;  2RMO A;  1NG2 A;  1NLO C;  4J9C A;  2F2X A;  2NWM A;  3VS3 A;  3H0F A;  2JS2 A;  3I5R A;  1GCP A;  1TUD A;  3M0U A;  1V1C A;  2OI3 A;  1NYF A;  2A08 A;  2K9G A;  4M4Z A;  3REA B;  2LCS A;  1ABQ A;  2B86 A;  2BTT A;  2D0N A;  1CKB A;  2YSQ A;  2KXC A;  2BZX A;  3VS2 A;  2J06 A;  3UAT A;  1CKA A;  1VA7 A;  1KIK A;  5ECA A;  3VS5 A;  2EQI A;  3EG3 A;  2CSQ A;  2IIM A;  4HCK A;  1BU1 A;  2JM9 A;  4J9E A;  5I11 A;  2KT8 A;  3TSW A;  1FYN A;  2O88 A;  1NEB A;  1UUE A;  1LCK A;  5GJW B;  1AEY A;  2LJ3 A;  5I22 A;  1FMK A;  2GBQ A;  2XMF A;  3REB B;  4Z8A A;  2FRW A;  1HJD A;  2GQI A;  2LP5 A;  3R6N A;  2DX1 A;  2DRM A;  2YT6 A;  2DVJ A;  1WDX A;  1RI9 A;  4OML A;  1JU5 C;  1GFD A;  4HXJ A;  4J9D A;  4X1V A;  2H8H A;  2BZY A;  1Y57 A;  4EIK A;  4JPB W;  1PKS A;  4RTY A;  4Z88 A;  1WLP B;  4DEY A;  2W0Z A;  1CSK A;  2LZ6 B;  2VKN A;  2HBW A;  1WYX A;  1B3Q A;  1M3A A;  1SHG A;  2OAW A;  2DMO A;  1M3C A;  1UE9 A;  2L0A A;  2L2P A;  1U3O A;  4ZNX A;  1WIE A;  1U06 A;  1AWJ A;  1E7O A;  2DLP A;  2SEM A;  4RTU A;  1E6H A;  2SRC A;  4OMO A;  2K2M A;  2YDL A;  1UDL A;  2M0Y A;  1T3S A;  1GL5 A;  2KRM A;  2CH4 W;  2EGE A;  2ESW A;  2KXD A;  1OV3 A;  2LQN A;  1JXO A;  3VRY A;  2KGT A;  1I1J A;  2LNH B;  1M3B A;  1G83 A;  1GBR A;  1MV3 A;  3I35 A;  1NYG A;  4AG1 C;  1ZLM A;  1Y0M A;  3PVQ A;  4OMN A;  2FPF A;  2DM1 A;  2ENM A;  4JZ4 A;  2FG0 A;  1JXM A;  1OPK A;  3EHQ A;  4JJC A;  2NUZ A;  3EG0 A;  3EHR A;  3M0S A;  4K11 A;  1U5S A;  3M0P A;  1UJ0 A;  4J9F A;  1AD5 A;  5IXB A;  1RUW A;  2KYM A;  1QWF A;  3I5S A;  5IHK A;  2A36 A;  2LX7 A;  2DL4 A;  1SEM A;  1SRL A;  1MV0 B;  3U23 A;  3I9Q A;  5FWB A;  3VRZ A;  3TVT A;  1OEB A;  2YUN A;  2CDT A;  1ZSG A;  1GRI A;  1QCF A;  2KT1 A;  1K0S A;  2FRY A;  4RTX A;  4LN2 A;  4F16 A;  2LMJ A;  3JV3 A;  2DRK A;  2KE9 A;  1EFN A;  4E6R A;  2D8J A;  3NHN A;  3NMZ C;  1ABO A;  2K7A A;  1QKX A;  1B07 A;  1I0C A;  4IIM A;  1NM7 A;  4CC4 B;  2VWF A;  2KR3 A;  1AZG B;  4ESR A;  1PKT A;  3H0H A;  4AFZ C;  1GCQ C;  1UTI A;  1Z9Z A;  1SHF A;  3C0C A;  4HVW A;  2A37 A;  4LUE A;  1BB9 A;  1TG0 A;  1X69 A;  2PTK A;  1M8M A;  1T0H A;  2HEQ A;  5IH2 A;  4HVV A;  4RUG A;  1ZUK A;  1OOT A;  1UG1 A;  2BZ8 A;  1N5Z A;  2DJQ A;  4F17 A;  2AK5 A;  1WXU A;  2LJ0 A;  1UHC A;  1H3H A;  4J9I A;  1GFC A;  1ZUY A;  2O9V A;  2MCN A;  2YUO A;  2L3S A;  3SEM A;  1QWE A;  1TUC A;  5L23 A;  1G2B A;  1QLY A;  1E6G A;  4D8K A;  1SSH A;  4KRT A;  1PRL C;  1KSW A;  2EBP A;  1WFW A;  2RN8 A;  2HDA A;  2A28 A;  2DL7 A;  1WI7 A;  4LUD A;  1T0J A;  1JQQ A;  1NEG A;  2VVK A;  1GCQ A;  1WXB A;  3LH5 A;  1UFF A;  4Y92 A;  1AZE A;  2ED0 A;  1AWW A;  1UGV A;  4CC7 A;  1X6B A;  2F2V A;  2LQW A;  3KFV A;  2C0O A;  3UA6 A;  2FPD A;  1K1Z A;  4AG2 C;  2D8H A;  5GJV B;  2KRN A;  1QKW A;  2CSI A;  4OMM A;  4GLM A;  3UA7 A;  4QT7 A;  1X2Q A;  2HSP A;  1K76 A;  2YUQ A;  2JMC A;  2EYX A;  2F2W A;  3H0I A;  1W70 A;  1XOV A;  2AZV A;  1KJW A;  1BBZ A;  1ZUU A;  2EYZ A;  1VYU A;  4AFS C;  1M30 A;  2KNB B;  1PWT A;  2KBT A;  2EGA A;  2DNU A;  2EW3 A;  2J6O A;  2L3Q A;  2DE0 X;  1IO6 A;  1BK2 A;  2KRO A;  5IHI A;  2X3W D;  3GBQ A;  4DEX A;  2C0T A;  2FPE A;  2O2O A;  2DIL A;  4WCI A;  1ZBJ A;  4Z89 A;  1YNZ A;  3NPF A;  1PNJ A;  3RNJ A;  2DL5 A;  5IHN A;  2DYB A;  2LJ1 A;  2JMA A;  2QDL A;  2HCK A;  3NGP A;  2RQR A;  2PNI A;  2GTO A;  2M51 A;  2RNA A;  2V1Q A;  2DF6 A;  4JJD A;  1YN8 A;  3EGU A;  1W6X A;  2GTJ A;  2DL3 A;  3PE0 A;  2DL8 A;  5FW9 A;  2JXB A;  3FJ5 A;  1UEC A;  4LNP A;  4CC3 A;  1AWO A;  3O5Z A;  1HD3 A;  1X27 A;  1ARK A;  1VYV A;  4LE9 A;  2DBK A;  1PHT A;  1AWX A;  1VYT A;  2K79 A;  3EG1 A;  4R0K A;  3CQT A;  2JS0 A;  4OMP A;  2E5K A;  1K4U S;  4D8D A;  1AVZ C;  1JO8 A;  3M0T A;  1OPL A;  2I0N A;  4GBQ A;  4AFQ C;  2EYY A;  2G6F X;  1YCS B;  1H8K A;  2JM8 A;  2AKK A;  2X3X D;  4J9B A;  4JZ3 A;  2YUP A;  4RTT A;  2RQV A;  2GGR A;  2W10 A;  4OMQ A;  2C0I A;  2D1X A;  4J9G A;  4J9H A;  1RLQ C;  2EVR A;  2OJ2 A;  2AZS A;  1WA7 A;  4JJB A;  2O31 A;  1MUZ A;  5HCK A;  2J05 A;  3UF4 A;  3THK A;  2RPN A;  1J3T A;  2RF0 A;  1UHF A;  5FWC A;  1JEG A;  2J7I A;  2ED1 A;  2RQT A;  1ZX6 A;  3VS0 A;  1RLP C;  3M0R A;  1A0N B;  2KYB A;  4RTV A;  4HVU A;  2O9S A;  2JT4 A;  2CT4 A;  2CH4 A;  2AKL A;  1X2K A;  3QWY A;  4RTW A;  2ABL A;  3VS1 A;  3RBB B;  2CUB A;  2JTE A;  3VS4 A;  2V1R A;  2PZ1 A;  4IIO A;  1HSQ A;  2P4R A;  2DA9 A;  4F14 A;  2RQW A;  1H92 A;  3VS6 A;  1WX6 A;  2KRS A;  3IQL A;  1X43 A;  1K9A A;  1S1N A;  2J6K A;  2J6F A;  2K6D A;  4CC2 A;  4AFU C;  2ECZ A;  4RTZ A;  1SPK A;  4FSS A;  3H41 A;  4A63 B;  3PVL A;  2FO0 A;  3A98 A;  3EG2 A;  2RQU A;  2EPD A; 
#chains in the Genus database with same CATH topology
 1K0X A;  2LQ8 A;  3RKX A;  1NJI C;  1M5Q 1;  3EGX B;  2WAC A;  3S6W A;  2P4T A;  4FT2 A;  5IXF A;  1TXQ A;  2FEI A;  4PJO G;  3JB9 H;  1KQ2 A;  3SHW A;  3I56 T;  1QCO A;  1VQ7 A;  1NE8 A;  2ROT A;  5EC7 A;  5CKB A;  1QVF P;  1VQP Q;  1X01 A;  4WF2 A;  3CC4 T;  2DBM A;  2FZC B;  2EKH A;  5GAM h;  4J7I A;  1VQ4 Q;  2EJ9 A;  2EGC A;  3M0Q A;  1YWO A;  2K3B A;  3VU3 C;  2CT3 A;  3HFN A;  1I07 A;  3ZL7 C;  4WTO B;  1W2B P;  1IB8 A;  2VXE A;  3J7A F;  4IUU A;  1U1T A;  3QDF A;  4PLL A;  2EIF A;  2JS2 A;  1GCP A;  1TUD A;  2AHJ B;  5GAM d;  2F69 A;  5LJ3 d;  2KSS A;  1YJ9 T;  2CGH A;  2KAF A;  4J6W A;  2QQS A;  4X9D A;  2JTF A;  1KQS A;  2RHU A;  1CKB A;  2YSQ A;  3BW1 A;  3OYH A;  1I5O B;  3P8B B;  3QKJ A;  2MI6 A;  4L6V 5;  4UC4 A;  4HCZ A;  5ECA A;  3CC2 Q;  2EQI A;  1C0M A;  1ZSZ B;  2JM9 A;  3EFS A;  3SDZ A;  3KXT A;  3SFM A;  3CC4 A;  1UUE A;  3X26 B;  5FU6 C;  4HCB A;  2ATC B;  5GJW B;  3G71 T;  2F5K A;  2P0P A;  2XMF A;  3CCJ A;  1VQK A;  2FRW A;  3C94 A;  2GQI A;  2LP5 A;  1ZSZ A;  4LD9 K;  2CP2 A;  5GAN h;  1JU5 C;  1QP2 A;  4HXJ A;  4J9D A;  5LJ3 j;  1BCM A;  5I2S A;  2BZY A;  4EIK A;  3JB9 J;  1Q86 U;  4PFZ A;  1PKS A;  2HQH A;  1Q82 U;  2QEX T;  4DEY A;  2RHZ A;  4EMK A;  1EZZ B;  2XHC A;  3EFO A;  1WJQ A;  1B3Q A;  3RUX A;  1SHG A;  2CP6 A;  1M3C A;  1UE9 A;  3CCS A;  4OF1 A;  1AWJ A;  2G3R A;  3AT1 B;  2Z0W A;  1NPP A;  1PG5 B;  1T3S A;  4QW2 A;  3V7R A;  1G8X A;  2KRM A;  2CH4 W;  2EGE A;  5LJ3 e;  1S72 Q;  2LNH B;  1S72 T;  1FX7 A;  3MCA B;  5KYY B;  2LX9 A;  3I35 A;  1ZLM A;  3PVQ A;  3EG9 A;  4EPC A;  2ENM A;  3G4S A;  4EMK C;  2FG0 A;  1JXM A;  1KQ1 A;  3EG0 A;  1VQO T;  5GAN j;  3TU4 K;  1U5S A;  1QVG A;  3M0P A;  4PNO A;  2XU8 A;  3P8D A;  1VQ4 T;  1AD5 A;  3BDU A;  1RUW A;  3LGF A;  4Y91 A;  4M7D F;  4MZP A;  1QWF A;  2HQE A;  2A36 A;  2GF7 A;  3NTK A;  3DKM A;  3OYL A;  2LX7 A;  2DL4 A;  3TRE A;  5C6S A;  3E19 A;  1R8O B;  3C4S A;  1BYM A;  4ZGE B;  3GLX A;  3NTI A;  1C1A A;  3VRZ A;  1VQ9 A;  3TVT A;  2LQK A;  1Q7Y U;  1BI0 A;  2QTV A;  2YUN A;  2EJF A;  4FYY B;  3MHX A;  3CME Q;  3A8L B;  3M9Q A;  4DBF A;  4M75 F;  1QCF A;  1K0S A;  3JCM f;  1IHV A;  4C92 E;  1D3B A;  4HKE A;  3NMZ C;  2EQU A;  1FMW A;  5CQY A;  1I0C A;  3CMA T;  4RG8 A;  2NLU A;  2B8A A;  1VQ6 A;  1AZG B;  4ESR A;  4XU1 A;  4AFZ C;  2ZCF B;  3OYI A;  1EIF A;  3OS2 A;  1HK9 A;  2A37 A;  2E41 A;  1BB9 A;  1RI0 A;  2M9U A;  3GP8 A;  1X69 A;  2HEQ A;  4BE0 A;  4ZGJ B;  4YTL A;  4RUG A;  1ZUK A;  4C8Q F;  4M77 C;  3CPW S;  2BZ8 A;  1N5Z A;  1Q95 G;  2K3X A;  1UHC A;  3L1A A;  1M1K C;  4J6Y A;  2MCN A;  1D1B A;  2DXB A;  2YUO A;  1VQ5 A;  1BI3 A;  5L23 A;  4D8K A;  1SSH A;  2QEX Q;  1KSW A;  1NJI U;  2RHY A;  4LUD A;  2DTO A;  2VVK A;  3LH5 A;  4JUV A;  4AMC A;  1PM3 A;  5KE3 A;  1PD1 A;  5GMK l;  4M78 G;  5FLX E;  4M78 F;  3KFV A;  1OQK A;  2C0O A;  1YCY A;  1K1Z A;  2FPD A;  3UA6 A;  3J80 E;  4M77 A;  3LWI A;  1KC8 C;  2DPP B;  1LOJ A;  5CQX A;  4OMM A;  4C5I A;  1G5V A;  1VQP T;  1K76 A;  3QO3 A;  1VQ8 A;  3CCQ Q;  4JLG A;  2AZV A;  2PVO B;  2D9T A;  1VYU A;  3QUI A;  1M30 A;  2KNB B;  1PWT A;  2KBT A;  2EGA A;  4C0G A;  2EW3 A;  4BE2 A;  2J6O A;  2DE0 X;  2KRO A;  5CKD A;  3CCM Q;  3CC7 T;  3F70 A;  4HCC A;  2O2O A;  2DTI A;  3ZFJ A;  1ZBJ A;  3G4S T;  1YNZ A;  5IHN A;  4JJN K;  2LJ1 A;  4OGE A;  2HCK A;  1NBE B;  5GAO q;  2M51 A;  4II1 A;  2V1Q A;  3UPU A;  1W6X A;  2F1L A;  1RAD B;  2DL3 A;  2DO3 A;  2LT4 A;  4TVR A;  4A4H A;  5FW9 A;  1AT1 B;  2IVW A;  5HK0 A;  2NYS A;  1X27 A;  5LJ3 f;  2OTJ T;  1YHQ Q;  2DIG A;  4ZN1 A;  1XJW B;  3OYC A;  2Y4Y A;  2JS0 A;  3SB2 A;  1M1K R;  4HT9 A;  2RJF A;  2RA2 A;  1RAB B;  2QAZ A;  4HT8 A;  1OPL A;  3MKD A;  2I0N A;  3WVD B;  4AFQ C;  2RI3 A;  2EFI A;  1YCS B;  3CCE A;  2X3X D;  4JZ3 A;  4PJO E;  2YUP A;  1Q82 R;  2HSE B;  1B7T A;  4OMQ A;  3M4G A;  1VQ8 T;  4F04 B;  1QVG S;  1RLQ C;  3E9G A;  1K73 R;  2O31 A;  4Q5W A;  5J26 A;  3THK A;  2WSC E;  2J7I A;  2X4J A;  2ED1 A;  2L89 A;  3VS0 A;  3PNW C;  3M0R A;  1A0N B;  2O9S A;  4QQ6 A;  2YHT A;  2PQW A;  1KK7 A;  1YI2 Q;  2AKL A;  3QWY A;  4RTW A;  3RKW A;  3RBB B;  3QDR B;  4ANJ A;  1W4S A;  2PZ1 A;  5FRO A;  4M7A D;  4F14 A;  1WHL A;  1WX6 A;  3IQL A;  2FL7 A;  2KRS A;  2ZAE A;  1XNI A;  2RI5 A;  2A3L A;  2DET A;  3A8O B;  1UEB A;  3X24 B;  1YJ9 A;  5GAN 5;  3M56 A;  2K6D A;  2QK0 A;  2OTL T;  1Q81 U;  4AFU C;  3JCM c;  1RAE B;  7AT1 B;  4RTZ A;  3H41 A;  3VYG A;  3LLR A;  1LJO A;  1Y96 A;  5A0G A;  4LDW A;  2XI9 A;  1QW1 A;  1WHK A;  5I21 A;  2EPD A;  2RJE A;  2KDS A;  4ORZ A;  2COW A;  1YWP A;  4E7L A;  2MIO A;  2CP5 A;  3FDR A;  1M1G A;  2L3P A;  3L2V A;  1YP5 A;  5L8R E;  2E12 A;  1X6G A;  3TSZ A;  3KUF A;  1U1S A;  3VS7 A;  5GAN 7;  4BI3 A;  2E5Q A;  4C92 A;  1LNX A;  2E6N A;  3LX7 A;  3CD6 Q;  2EJG A;  2IG0 A;  4FYX B;  2K5F A;  5A2Q E;  1G3T A;  1Q86 C;  3FB9 A;  1UJY A;  3G6E A;  4OB2 B;  2OAU A;  2ROL A;  1H3Z A;  5GAM j;  5GAN d;  2RMO A;  2D6F A;  1NLO C;  4J9C A;  3M57 A;  5GMK m;  3PT9 A;  1I8F A;  4KGX B;  2K5I A;  3FC3 A;  4ME7 A;  3PTA A;  2OI3 A;  1TU0 B;  4M4Z A;  3REA B;  2K5L A;  4C92 C;  1RAC B;  1VQL A;  5D6Y A;  3UAT A;  1S72 A;  1VA7 A;  3CCQ A;  3RIR A;  4HCK A;  2X51 A;  5I11 A;  2KT8 A;  3QZ9 B;  3TSW A;  5KYN A;  2HMA A;  2QA4 Q;  4N0A C;  5FU7 B;  3JB9 D;  4PK4 A;  3OYK A;  4PFO A;  5I22 A;  1FMK A;  1TTH B;  2NUT B;  4M77 B;  4Z8A A;  4A54 A;  2MPX C;  3GNG A;  2DRM A;  1WDX A;  4OML A;  2H3E B;  1M2V B;  5KYU B;  3JCM h;  2Y90 A;  1Y57 A;  3OYG A;  2JTM A;  4FU6 A;  4Z88 A;  3VKI A;  4M7A C;  1WLP B;  1CSK A;  3HKS A;  2RK1 A;  5J39 A;  2HBW A;  2HAX A;  2DMO A;  5CKE A;  4ZNX A;  5GMK i;  1KD1 U;  1U06 A;  1TS9 A;  4MML A;  2SEM A;  3OW2 A;  2SRC A;  2DZC A;  1VIF A;  1GL5 A;  1HYO A;  1VQ6 T;  3QII A;  3CMA A;  5CVI A;  1OV3 A;  2YLB A;  4BAC A;  4BY6 B;  3VRY A;  1EX4 A;  2ZGW A;  5C0M A;  2GFA A;  2HQX A;  1M3B A;  2XIC A;  4FT4 A;  2KY9 A;  2RO0 A;  4B6M A;  4F7U F;  2COZ A;  1KD1 C;  4E7J A;  4M7A A;  2FPF A;  1VQN A;  4JZ4 A;  1NPR A;  2DXU A;  5GAM e;  3EHQ A;  3M0S A;  3MP8 A;  1XTD A;  2I2L A;  3O8V A;  1UJ0 A;  2HL5 C;  4KH0 B;  2OX7 A;  1YHQ T;  4XU0 A;  1BKB A;  2XG8 D;  2EQJ A;  1VQ9 Q;  2DZ9 A;  2E64 A;  2K2V A;  5HY6 A;  1Q81 C;  4O5V A;  1WJR A;  2RM4 A;  3LH0 A;  2VAS A;  3I9Q A;  4B9W A;  4C5G A;  1KG1 A;  3MP1 A;  1G3S A;  4JS5 A;  4M75 A;  5GMK h;  2P0K A;  2QTX A;  4LDX A;  3M58 A;  3BE3 A;  4GLK A;  4M7A F;  1OEB A;  1WJS A;  2RB6 A;  2KQW A;  1ZSG A;  4ZTF A;  4OB3 B;  3WXM B;  2KT1 A;  1VQO A;  3EGD B;  1WPY A;  4LDU A;  3CXC S;  4DOW A;  2KE9 A;  1WQ7 A;  2D8J A;  4BI4 A;  3CPW P;  3HP9 A;  3R6O A;  1UGR B;  2EWN A;  5EG2 A;  2KR3 A;  1YJ9 Q;  5HK3 A;  1PKT A;  3RER A;  2HD0 A;  3H0H A;  1UTI A;  1QQJ A;  4LD6 A;  4HVW A;  1M90 C;  1PD0 A;  1I5L A;  4M77 G;  2PTK A;  3X25 B;  1T0H A;  5IH2 A;  3V8L A;  3L2W A;  4HVV A;  4FL6 A;  4E47 A;  5GAN e;  1D09 B;  1M8V A;  3CBP A;  4R55 A;  1MGQ A;  3RMS A;  4M7A B;  1F1B B;  3G7Z A;  2L3S A;  3I56 Q;  1TUC A;  1G2B A;  1QLY A;  3A1P A;  4KRT A;  1PRL C;  4A4K A;  2EBP A;  3CCQ T;  4P5N A;  5CCA A;  1MMG A;  2QXF A;  1WXB A;  1UFF A;  1KQS P;  1DJ7 B;  2RHI A;  3CCJ T;  3OW2 S;  1UGV A;  4XTZ A;  1X6B A;  4IUQ A;  1M9S A;  2F2V A;  2LTO A;  5GJV B;  5GAN 2;  1TSF A;  2XDD A;  3H8Z A;  2LCC A;  1QKW A;  2CSI A;  4EMH A;  3X20 B;  2HSP A;  5LJ5 d;  4M7D E;  4A53 A;  2XK0 A;  4FYV B;  1OU9 A;  2F2W A;  4DBQ A;  4J83 A;  1D1C A;  4JLI A;  2BIV A;  1BBZ A;  1ZUU A;  4AFS C;  3CEY A;  2DNU A;  2GCX A;  3ASK A;  3SWN B;  3CCL Q;  1YIT A;  5IHI A;  1N9S A;  2M16 A;  3A8M B;  2X3W D;  3C12 A;  4V2S A;  1YBY A;  2C0T A;  4OB0 B;  3OYN A;  2DEU A;  3JSC A;  4Z89 A;  2DIQ A;  3RNJ A;  4ZTJ A;  3SWN A;  3NGP A;  1TOV A;  4EMG A;  2GTO A;  2RNA A;  4JJD A;  1YN8 A;  3EGU A;  4FM4 B;  2E70 A;  1C6V X;  2BKD N;  4DBH A;  3CC4 Q;  2KMT A;  2DL8 A;  3L2U A;  4CC3 A;  1AWO A;  1HD3 A;  1ARK A;  1VYV A;  1VQK Q;  2DBK A;  1PHT A;  3CC7 Q;  4C8Q B;  1AWX A;  2OTJ A;  2FZK B;  1P92 A;  3EG1 A;  4R0K A;  3CQT A;  1TH7 A;  2E5K A;  3A5Z B;  1AVZ C;  1K8A U;  5D6W A;  4F7U E;  2E65 A;  1Y7X A;  4GBQ A;  4NL3 A;  1MHN A;  1ZSZ C;  4DA4 A;  4Y28 E;  2JM8 A;  2RQV A;  4NS5 A;  4MMK A;  4PJO F;  2W10 A;  1MMA A;  1O9S A;  5DLO A;  4C5H A;  1SF9 A;  2X4X A;  2AZS A;  1WA7 A;  4JJB A;  1YIJ A;  5HCK A;  2J05 A;  3UF4 A;  1KC8 U;  3VUB A;  3CC2 T;  4C0D C;  2WSF E;  1JEG A;  4KBM B;  2QGG A;  2DFU A;  3GF5 A;  5A0L A;  2RH2 A;  4C0D B;  1OX9 A;  3QYH B;  1M90 R;  4HVU A;  3J81 E;  2CT4 A;  3T9N A;  1K8A R;  2CH4 A;  2JN0 A;  1JRI A;  2ABL A;  4KUI A;  2LDM A;  1RAA B;  1W2B S;  3OS5 A;  1VQO Q;  4IIO A;  2DJZ A;  2RQW A;  4BY6 C;  2QDY B;  1X43 A;  1K9A A;  1S1N A;  4PL6 A;  4ZGD B;  1WHM A;  2J6K A;  5GAM g;  4FYW B;  2J6F A;  1HXD A;  2ECZ A;  3UT1 A;  4FSS A;  1MND A;  2DEQ A;  2DVE A;  4M7D D;  2YLC A;  3PVL A;  2FO0 A;  3EH2 A;  4C8Q A;  2DTH A;  5GAN 4;  3CME A;  4QQD A;  1R0C B;  1M27 C;  1W1F A;  1AOJ A;  4E7H A;  3TEE A;  1PCX A;  3QZ5 B;  3OSV A;  5LJ5 f;  2KVQ G;  2EYW A;  2KEA A;  1RAG B;  1KFZ A;  3QJ6 A;  1V29 B;  4XK8 E;  2HKN A;  3CC7 A;  1GBQ A;  1YJN T;  3TCJ A;  4B9X A;  3INZ A;  3G1J A;  1NLP C;  2JNG A;  3QWX X;  4JS4 A;  2MYS A;  4IUT A;  2ZPB B;  2QGF B;  4C8Q C;  4M75 E;  1YIJ Q;  3PMT A;  1NG2 A;  1BCO A;  3VYH B;  2F2X A;  5AT1 B;  3VS3 A;  3PIO A;  2K4Y A;  3M0U A;  4M78 B;  4FCY A;  4BDY A;  5GAN g;  1NYF A;  3QPH A;  2K9G A;  1OZ2 A;  2DER A;  4M75 G;  2LCS A;  3CCL A;  1ABQ A;  2BTT A;  1OX8 A;  2FZG B;  2PVD B;  4E7Z A;  2V8K A;  4NOY A;  1CKA A;  4M77 E;  3VS5 A;  3CMA Q;  2OTL Q;  3EG3 A;  2X35 A;  2CZ7 B;  3S3O A;  3D7S B;  4J9E A;  1MMN A;  1WHG A;  2O88 A;  3EFO B;  3BFM A;  1NEB A;  1QVF S;  1LCK A;  4M7D G;  3MEU A;  1AEY A;  3JCM X;  3FRN A;  3REB B;  1K9M U;  4MDW A;  5KCH A;  3DLL A;  1HJD A;  3H6Z A;  1V76 A;  2YT6 A;  2DVJ A;  1RI9 A;  1SG5 A;  1Q82 C;  4X1V A;  1JJ2 S;  2CZ0 B;  3H9N A;  5GAN 6;  2V26 A;  1YIT Q;  2CP0 A;  1OU8 A;  2VKN A;  2YRC A;  1M3A A;  2CKK A;  2OAW A;  2RK2 A;  3HTR A;  4OP0 A;  2L0A A;  2L2P A;  3HPW A;  1WIE A;  4PJO C;  2DLP A;  4XTW A;  4C92 D;  4RTU A;  3LW5 E;  2QEX A;  3JCM P;  3OBY A;  4OMO A;  2E10 A;  1D3B B;  2QA4 A;  1H64 1;  5GAN f;  3AHU A;  1UDL A;  2M0Y A;  2ESW A;  2KXD A;  2LQN A;  2XD0 A;  2VGM A;  2MAM A;  4JRI A;  2KGT A;  2L8D A;  2DKG A;  3PIP A;  1GBR A;  1M90 U;  1I4K 1;  1MV3 A;  1NYG A;  2NUP B;  1OPK A;  4JJC A;  5GMK j;  3RES A;  2MWP A;  3JCM J;  4J9F A;  4PJO A;  4C92 F;  1VQ6 Q;  1M4Z A;  5IXB A;  1VQ4 A;  5FRM A;  3CXC P;  3QJY A;  2EYQ A;  3V8K A;  4M75 D;  2VV5 A;  4HA8 A;  5GAO p;  1VQ7 Q;  5IN1 A;  4IUP A;  4C8Q D;  1SEM A;  1SRL A;  4XU2 A;  1MV0 B;  5GAO r;  1MMD A;  3GIB A;  5KCO A;  4X9C A;  5FWB A;  3DB3 A;  4RMO A;  2KK4 A;  1N8R C;  4BD3 A;  3JB9 G;  2CDT A;  1GRI A;  3MEW A;  4F7U A;  1R0B G;  4LN2 A;  3EH1 A;  3HRS A;  4PLI A;  2LMJ A;  3EGX A;  3JV3 A;  4XTY A;  4F16 A;  1EFN A;  2XDP A;  4E6R A;  3NHN A;  1UGS B;  1ABO A;  2K7A A;  1SSF A;  2FVU A;  3UDC A;  1QKX A;  2M0O A;  3QG1 A;  4XTU A;  1BIB A;  2E6Z A;  4MZM A;  4CC4 B;  4IUR A;  4XU3 A;  2HBP A;  5FU6 B;  5KYX B;  1GCQ C;  3CCU Q;  3OY9 A;  4FIB A;  4KT0 E;  1Z9Z A;  3BY7 A;  4Z02 A;  1D1A A;  4LUE A;  2MK5 A;  5LJ5 h;  2DYI A;  1M8M A;  1M1F A;  2CS7 A;  1D0Z A;  1PC0 A;  3DLM A;  5IAY A;  4FW2 A;  1UG1 A;  4N4G A;  3JCM W;  3NFC A;  4F17 A;  2AK5 A;  2C06 A;  2LJ0 A;  3L2Z A;  1ACM B;  1UGQ B;  4J9I A;  3CCE Q;  1WNL A;  3JCM d;  4LXC A;  1GFC A;  3EG9 B;  4AT1 B;  2XDB A;  1FMV A;  2DD5 A;  2BE7 D;  4E2F B;  1X6O A;  4E7I A;  2HKQ B;  4E7K A;  3SEM A;  1QWE A;  3MEV A;  3CCV A;  1MNE A;  2RN8 A;  2RD1 A;  2DL7 A;  2YRV A;  2P0Q A;  1WI7 A;  4ATO A;  1YI2 T;  1GCQ A;  2DAQ A;  2AIR B;  1YHQ A;  4Y92 A;  2ZPF B;  4M7D B;  1IHW A;  2ED0 A;  4CC7 A;  1OI1 A;  3OYA A;  2LQW A;  2E3H A;  4N4H A;  4CRI A;  5CKF A;  4AG2 C;  2COY A;  3LWH A;  1TWB A;  5CO7 A;  3CBO A;  1IXD A;  1KHC A;  1VOM A;  2LNV A;  4QT7 A;  1X2Q A;  5D7U A;  1BI1 A;  1M2O A;  4J5Y A;  4F7U G;  2JMC A;  2EYX A;  1W70 A;  1Q81 R;  2HNI A;  2EYZ A;  3M5A A;  3FIF A;  3MO8 A;  1FWZ A;  4A4F A;  2CZ1 B;  2QYZ A;  3HRT A;  1LVK A;  4QVZ A;  1YIJ T;  3E1S A;  2NUT A;  4EDU A;  4QVD A;  3SD4 A;  1BI2 A;  3GBQ A;  2FPE A;  3QBY A;  2DIL A;  3CC2 A;  1RAH B;  1KD1 R;  1KHI A;  4PJO B;  3NPF A;  1PNJ A;  2DL5 A;  2E4H A;  3QHS A;  4A4E A;  1RAF B;  4RKU E;  4C8Q G;  1ZHI A;  1JB0 E;  2RQR A;  2DF6 A;  3DB4 A;  3G6E Q;  2JXB A;  2L3R A;  4LNP A;  1RAI B;  4R56 A;  3RR6 A;  4LE9 A;  4ELZ C;  1IRX A;  1YJW A;  2MMP A;  4D6W A;  2K79 A;  2O4X A;  4N0A A;  3V7S A;  2HL3 A;  2EKO A;  4D8D A;  3VUZ A;  3MEA A;  3M0T A;  4JRP A;  2GFU A;  4BE1 A;  4RTT A;  2GGR A;  1QMC A;  3JB9 I;  3ER0 A;  1IGQ A;  3G71 A;  4J9G A;  2FYK A;  2R57 A;  5DY9 A;  2OJ2 A;  2VC8 A;  1K73 U;  1VQK T;  1MUZ A;  1AHJ B;  3OBW A;  2RPN A;  3OYY A;  2DD4 A;  1IZ6 A;  2QQR A;  1OUL A;  2RQT A;  3C95 A;  3FLG A;  3HSB A;  1RLP C;  2KYB A;  2QG9 B;  4XTV A;  2EQK A;  2O01 E;  4OVA A;  1X2K A;  1M1K U;  2JTE A;  3VS4 A;  2V1R A;  1JBM A;  3OYE A;  2V8J A;  1HSQ A;  2DA9 A;  1H92 A;  3JCM e;  3OMG A;  3VS6 A;  3NTH A;  2VB6 A;  3TQ7 P;  5KYW B;  2CP3 A;  2NUP A;  3CPW A;  3FEO A;  4IKF A;  3E9F A;  3EGD A;  2P84 A;  5KE2 A;  4CC2 A;  2QQ9 A;  2XID A;  3RDV A;  3CCR A;  5CK9 A;  2ZPH B;  3GOX A;  4ZN3 A;  2EAY A;  4E7S A;  4C92 B;  2PVG B;  2K57 A;  4MZT A;  3G71 Q;  2RJC A;  3EG2 A;  3PFS A;  3BDL A;  5KH6 A;  3MET A;  2JW4 A;  4DOV A;  2BUD A;  2GNC A;  3E2U A;  5LJ3 h;  2CUD A;  1YJN A;  1TUG B;  5A0D A;  4M75 C;  4M78 D;  3HFO A;  2QA4 T;  2JUF A;  3HRU A;  3CCR Q;  4M77 D;  4C0Z A;  1SRM A;  1WQW A;  2MOX A;  3CBM A;  2VUB A;  4M75 B;  2LVM A;  3JCM V;  2MF2 A;  2QQA A;  2CRE A;  2Y4X A;  2YWW A;  1N8R U;  3OB9 A;  3ULR B;  1PRM C;  1K73 C;  4OB1 B;  1D0Y A;  2A7Y A;  1Z9Q A;  2QQB A;  3UWN A;  1VQ9 T;  3CME T;  1T3L A;  5LJ3 g;  1WXT A;  4N4I A;  4J6X A;  5DM7 R;  3OA6 A;  2NWM A;  2IPO B;  3H0F A;  1ZA1 B;  3I5R A;  3JCM Q;  5FU7 C;  1QVP A;  1V1C A;  4QVC A;  4PJM A;  4PJL A;  2A08 A;  3JCM g;  2K3Y A;  1RL2 A;  2D0Q B;  3CCM A;  3M54 A;  2ZPI B;  4O6J A;  2B86 A;  1VQL T;  4QQG A;  2D0N A;  2KXC A;  2BZX A;  3EFR A;  3VS2 A;  2J06 A;  3I55 Q;  4OMF B;  1R77 A;  1K8A C;  1M2V A;  2LT1 A;  5KYU A;  1KIK A;  3CCE T;  2X9H A;  9ATC B;  1D0X A;  4J8O A;  5I2M A;  1JJ2 P;  3URG A;  2CSQ A;  2IIM A;  2V8I A;  1BU1 A;  4C5E A;  5LJ5 g;  2R5A A;  1FYN A;  2QAS A;  1QVF A;  2YRD A;  3QXE B;  5CR2 A;  1N6A A;  2LJ3 A;  2GBQ A;  2R5M A;  4VUB A;  4KGV B;  2FHD A;  3R6N A;  2M02 A;  2DX1 A;  3M4Y A;  5DLQ E;  1VQ5 T;  3L2R A;  4BI8 B;  1GFD A;  4PJN A;  2H8H A;  2JOY A;  1Q7Y C;  4JPB W;  4LDY A;  4M7A G;  2X4W A;  4RTY A;  1Q7Y R;  1WZO A;  1YFN A;  4JRQ A;  2W0Z A;  3RKY A;  2LZ6 B;  4RCB A;  1WYX A;  5GAM f;  1IRE B;  1U3O A;  4C8Q E;  3MPU B;  1E7O A;  2QI2 A;  1G3W A;  3GPL A;  1VQ8 Q;  1VQL Q;  1E6H A;  2R58 A;  2K2M A;  2YDL A;  3PGG A;  1UB4 A;  3I56 A;  3LGL A;  4PJJ A;  1Y71 A;  2OTL A;  2JVV A;  4GY5 A;  3SWN C;  3X28 B;  4RG2 A;  1VQM Q;  1JXO A;  2DXT A;  1I1J A;  2E3I A;  4LDV A;  3M59 A;  4M77 F;  1G83 A;  3MJX A;  1B34 A;  1ZBX A;  4EMK B;  3KBG A;  4AG1 C;  1Y0M A;  1G3Y A;  4OMN A;  2DM1 A;  2ZZD A;  4KH1 B;  1QP3 A;  8AT1 B;  2NUZ A;  3EHR A;  3GNF B;  3RMQ A;  1VQ5 Q;  4K11 A;  2RI2 A;  2FB7 A;  5CIU A;  1ZQ1 A;  2HZY A;  3FJP A;  3V8J A;  2KYM A;  1XQH A;  3I5S A;  1NJI R;  5IHK A;  5CKH A;  1K9M R;  3OYD A;  1K9M C;  4BUG A;  1VUB A;  3OMC A;  1YJN Q;  3U23 A;  5LJ5 j;  1WHJ A;  4PKC C;  3A8H B;  1SKU B;  5GAO n;  1PSE A;  4NL2 A;  1KQS S;  3OW2 P;  4M7A E;  5IT9 E;  2FRY A;  4RTX A;  4PFP A;  3S3N A;  4M7D C;  3ME9 A;  1VQM T;  2F5T X;  4ELY C;  1KC8 R;  2DRK A;  2PUO B;  3QYG B;  4KUL A;  2L5Q A;  3L42 A;  1FXX A;  1B07 A;  3CCU A;  3OS0 A;  2ZPG B;  4IIM A;  1NM7 A;  3L2Q A;  2VWF A;  3JCM b;  4M78 C;  1WGS A;  3P8H A;  3OYM A;  4L59 A;  8ATC B;  2A0F B;  3C0C A;  1SHF A;  4A4G A;  4X34 A;  1TG0 A;  1UGP B;  2VGN A;  4JDS A;  1IGU A;  4IUV A;  1OOT A;  2DJQ A;  2H3J A;  2OTJ Q;  1WXU A;  1H3H A;  5LL6 S;  1VQM A;  4M7D A;  3A8G B;  1ZUY A;  2O9V A;  2DXC A;  3JB9 F;  1U8R A;  1ZA2 B;  4MDX A;  3OS1 A;  1PSF A;  3HHT B;  1E6G A;  1BIA A;  1WFW A;  2M1H A;  3CCU T;  2HDA A;  2A28 A;  4M78 A;  3HL8 A;  2VYT A;  1T0J A;  1JQQ A;  1NEG A;  4XAX B;  4DBR A;  3CCM T;  2CP7 A;  2YXY A;  3QSU A;  1N27 A;  1AZE A;  1AWW A;  4M78 E;  2VXF A;  4PJO D;  6AT1 B;  2D8H A;  3G4S Q;  2KRN A;  1JJ2 A;  3S3M A;  4GLM A;  3UA7 A;  5HKC A;  1N8R R;  2YUQ A;  4CI0 C;  5FRN A;  1LPL A;  3H0I A;  1XOV A;  3CCS Q;  1YJW Q;  1KJW A;  5J3B A;  1B34 B;  4J7F A;  2O4X B;  2L3Q A;  1IO6 A;  1BK2 A;  2PUK B;  3G6E T;  4FSX A;  4F7U B;  4DEX A;  4C0F A;  4WCI A;  2MWO A;  4XTX A;  3CCV T;  3JRZ A;  3I55 A;  2JJ9 A;  1Y07 A;  2DYB A;  2XKO C;  2JMA A;  2QDL A;  3VV0 A;  3OQ5 A;  2PNI A;  3OYB A;  2KI7 A;  2BE9 B;  2GTJ A;  5GMK e;  3PE0 A;  1Q86 R;  3WVE B;  3V7C A;  5GAO m;  5GAN 3;  3FJ5 A;  4KGZ B;  1UEC A;  2AT1 B;  5D6X A;  2RHX A;  3O5Z A;  4C92 G;  3JAM E;  1QCN A;  3M55 A;  2LCL A;  3EAE A;  3CCJ Q;  3OYF A;  1OYX A;  3I55 T;  1X75 C;  2DK3 A;  1VYT A;  4DQ2 A;  3CCR T;  2ZPE B;  3OYJ A;  3M53 A;  4OMP A;  3LYI A;  3ZBD A;  1K4U S;  5GAN 8;  5KYX A;  3MP6 A;  1JO8 A;  2WSE E;  1YIT T;  3N5B B;  2EYY A;  2G6F X;  3CD6 A;  1H8K A;  3VJP A;  2AKK A;  4J9B A;  5KYW A;  5LJ5 e;  2LRQ A;  3Q1J A;  2EQM A;  2C0I A;  2D1X A;  5GAO l;  4J9H A;  2EVR A;  3CCL T;  4L5G A;  3CCV Q;  2CZ6 B;  2LC4 A;  1J3T A;  2RF0 A;  1UHF A;  5FWC A;  1VIE A;  1ZX6 A;  2RJD A;  2JZ2 A;  3CPF A;  4BB7 A;  4RTV A;  2JT4 A;  1VQP A;  3ZEH A;  5M9O A;  1O75 A;  1I81 A;  4BDZ A;  2X4Y A;  3VS1 A;  1QVG P;  4QKU A;  2CUB A;  3PMI A;  1W2B A;  2PU9 B;  2P4R A;  1OZ3 A;  3CXC A;  4OGC A;  2GQV A;  1GXI E;  5AYF A;  2CYZ B;  4FW1 A;  1Y96 B;  2E1H A;  1WHH A;  5KYY A;  1SPK A;  4JRK A;  4RCC A;  1VQ7 T;  1NZ9 A;  1VQN T;  4A63 B;  1VQN Q;  1YI2 A;  3A98 A;  3CD6 T;  5CAI A;  4XQ3 A;  3OSS C;  2RQU A;  1N9R A;  3CCS T;  4KUD K;  1YJW T; 
#chains in the Genus database with same CATH homology
 1K0X A;  4ORZ A;  1M27 C;  1W1F A;  1AOJ A;  1YWP A;  2JW4 A;  2GNC A;  2MIO A;  5IXF A;  2FEI A;  2CUD A;  2L3P A;  3SHW A;  1YP5 A;  2EYW A;  2KEA A;  1KFZ A;  1X6G A;  3TSZ A;  2ROT A;  1SRM A;  2MOX A;  5EC7 A;  3VS7 A;  2DBM A;  2CRE A;  2EKH A;  1GBQ A;  2EGC A;  1PRM C;  3M0Q A;  3ULR B;  1NLP C;  1YWO A;  3QWX X;  2K3B A;  2CT3 A;  1Z9Q A;  1I07 A;  3ZL7 C;  1UJY A;  2ROL A;  1T3L A;  1WXT A;  2RMO A;  1NG2 A;  1NLO C;  4J9C A;  2F2X A;  2NWM A;  3VS3 A;  3H0F A;  2JS2 A;  3I5R A;  1GCP A;  1TUD A;  3M0U A;  1V1C A;  2OI3 A;  1NYF A;  2A08 A;  2K9G A;  4M4Z A;  3REA B;  2LCS A;  1ABQ A;  2B86 A;  2BTT A;  2D0N A;  1CKB A;  2YSQ A;  2KXC A;  2BZX A;  3VS2 A;  2J06 A;  3UAT A;  1CKA A;  1VA7 A;  1KIK A;  5ECA A;  3VS5 A;  2EQI A;  3EG3 A;  2CSQ A;  2IIM A;  4HCK A;  1BU1 A;  2JM9 A;  4J9E A;  5I11 A;  2KT8 A;  3TSW A;  1FYN A;  2O88 A;  1NEB A;  1UUE A;  1LCK A;  5GJW B;  1AEY A;  2LJ3 A;  5I22 A;  1FMK A;  2GBQ A;  2XMF A;  3REB B;  4Z8A A;  2FRW A;  1HJD A;  2GQI A;  2LP5 A;  3R6N A;  2DX1 A;  2DRM A;  2YT6 A;  2DVJ A;  1WDX A;  1RI9 A;  4OML A;  1JU5 C;  1GFD A;  4HXJ A;  4J9D A;  4X1V A;  2H8H A;  2BZY A;  1Y57 A;  4EIK A;  4JPB W;  1PKS A;  4RTY A;  4Z88 A;  1WLP B;  4DEY A;  2W0Z A;  1CSK A;  2LZ6 B;  2VKN A;  2HBW A;  1WYX A;  1B3Q A;  1M3A A;  1SHG A;  2OAW A;  2DMO A;  1M3C A;  1UE9 A;  2L0A A;  2L2P A;  1U3O A;  4ZNX A;  1WIE A;  1U06 A;  1AWJ A;  1E7O A;  2DLP A;  2SEM A;  4RTU A;  1E6H A;  2SRC A;  4OMO A;  2K2M A;  2YDL A;  1UDL A;  2M0Y A;  1T3S A;  1GL5 A;  2KRM A;  2CH4 W;  2EGE A;  2ESW A;  2KXD A;  1OV3 A;  2LQN A;  1JXO A;  3VRY A;  2KGT A;  1I1J A;  2LNH B;  1M3B A;  1G83 A;  1GBR A;  1MV3 A;  3I35 A;  1NYG A;  4AG1 C;  1ZLM A;  1Y0M A;  3PVQ A;  4OMN A;  2FPF A;  2DM1 A;  2ENM A;  4JZ4 A;  2FG0 A;  1JXM A;  1OPK A;  3EHQ A;  4JJC A;  2NUZ A;  3EG0 A;  3EHR A;  3M0S A;  4K11 A;  1U5S A;  3M0P A;  1UJ0 A;  4J9F A;  1AD5 A;  5IXB A;  1RUW A;  2KYM A;  1QWF A;  3I5S A;  5IHK A;  2A36 A;  2LX7 A;  2DL4 A;  1SEM A;  1SRL A;  1MV0 B;  3U23 A;  3I9Q A;  5FWB A;  3VRZ A;  3TVT A;  1OEB A;  2YUN A;  2CDT A;  1ZSG A;  1GRI A;  1QCF A;  2KT1 A;  1K0S A;  2FRY A;  4RTX A;  4LN2 A;  4F16 A;  2LMJ A;  3JV3 A;  2DRK A;  2KE9 A;  1EFN A;  4E6R A;  2D8J A;  3NHN A;  3NMZ C;  1ABO A;  2K7A A;  1QKX A;  1B07 A;  1I0C A;  4IIM A;  1NM7 A;  4CC4 B;  2VWF A;  2KR3 A;  1AZG B;  4ESR A;  1PKT A;  3H0H A;  4AFZ C;  1GCQ C;  1UTI A;  1Z9Z A;  1SHF A;  3C0C A;  4HVW A;  2A37 A;  4LUE A;  1BB9 A;  1TG0 A;  1X69 A;  2PTK A;  1M8M A;  1T0H A;  2HEQ A;  5IH2 A;  4HVV A;  4RUG A;  1ZUK A;  1OOT A;  1UG1 A;  2BZ8 A;  1N5Z A;  2DJQ A;  4F17 A;  2AK5 A;  1WXU A;  2LJ0 A;  1UHC A;  1H3H A;  4J9I A;  1GFC A;  1ZUY A;  2O9V A;  2MCN A;  2YUO A;  2L3S A;  3SEM A;  1QWE A;  1TUC A;  5L23 A;  1G2B A;  1QLY A;  1E6G A;  4D8K A;  1SSH A;  4KRT A;  1PRL C;  1KSW A;  2EBP A;  1WFW A;  2RN8 A;  2HDA A;  2A28 A;  2DL7 A;  1WI7 A;  4LUD A;  1T0J A;  1JQQ A;  1NEG A;  2VVK A;  1GCQ A;  1WXB A;  3LH5 A;  1UFF A;  4Y92 A;  1AZE A;  2ED0 A;  1AWW A;  1UGV A;  4CC7 A;  1X6B A;  2F2V A;  2LQW A;  3KFV A;  2C0O A;  3UA6 A;  2FPD A;  1K1Z A;  4AG2 C;  2D8H A;  5GJV B;  2KRN A;  1QKW A;  2CSI A;  4OMM A;  4GLM A;  3UA7 A;  4QT7 A;  1X2Q A;  2HSP A;  1K76 A;  2YUQ A;  2JMC A;  2EYX A;  2F2W A;  3H0I A;  1W70 A;  1XOV A;  2AZV A;  1KJW A;  1BBZ A;  1ZUU A;  2EYZ A;  1VYU A;  4AFS C;  1M30 A;  2KNB B;  1PWT A;  2KBT A;  2EGA A;  2DNU A;  2EW3 A;  2J6O A;  2L3Q A;  2DE0 X;  1IO6 A;  1BK2 A;  2KRO A;  5IHI A;  2X3W D;  3GBQ A;  4DEX A;  2C0T A;  2FPE A;  2O2O A;  2DIL A;  4WCI A;  1ZBJ A;  4Z89 A;  1YNZ A;  3NPF A;  1PNJ A;  3RNJ A;  2DL5 A;  5IHN A;  2DYB A;  2LJ1 A;  2JMA A;  2QDL A;  2HCK A;  3NGP A;  2RQR A;  2PNI A;  2GTO A;  2M51 A;  2RNA A;  2V1Q A;  2DF6 A;  4JJD A;  1YN8 A;  3EGU A;  1W6X A;  2GTJ A;  2DL3 A;  3PE0 A;  2DL8 A;  5FW9 A;  2JXB A;  3FJ5 A;  1UEC A;  4LNP A;  4CC3 A;  1AWO A;  3O5Z A;  1HD3 A;  1X27 A;  1ARK A;  1VYV A;  4LE9 A;  2DBK A;  1PHT A;  1AWX A;  1VYT A;  2K79 A;  3EG1 A;  4R0K A;  3CQT A;  2JS0 A;  4OMP A;  2E5K A;  1K4U S;  4D8D A;  1AVZ C;  1JO8 A;  3M0T A;  1OPL A;  2I0N A;  4GBQ A;  4AFQ C;  2EYY A;  2G6F X;  1YCS B;  1H8K A;  2JM8 A;  2AKK A;  2X3X D;  4J9B A;  4JZ3 A;  2YUP A;  4RTT A;  2RQV A;  2GGR A;  2W10 A;  4OMQ A;  2C0I A;  2D1X A;  4J9G A;  4J9H A;  1RLQ C;  2EVR A;  2OJ2 A;  2AZS A;  1WA7 A;  4JJB A;  2O31 A;  1MUZ A;  5HCK A;  2J05 A;  3UF4 A;  3THK A;  2RPN A;  1J3T A;  2RF0 A;  1UHF A;  5FWC A;  1JEG A;  2J7I A;  2ED1 A;  2RQT A;  1ZX6 A;  3VS0 A;  1RLP C;  3M0R A;  1A0N B;  2KYB A;  4RTV A;  4HVU A;  2O9S A;  2JT4 A;  2CT4 A;  2CH4 A;  2AKL A;  1X2K A;  3QWY A;  4RTW A;  2ABL A;  3VS1 A;  3RBB B;  2CUB A;  2JTE A;  3VS4 A;  2V1R A;  2PZ1 A;  4IIO A;  1HSQ A;  2P4R A;  2DA9 A;  4F14 A;  2RQW A;  1H92 A;  3VS6 A;  1WX6 A;  2KRS A;  3IQL A;  1X43 A;  1K9A A;  1S1N A;  2J6K A;  2J6F A;  2K6D A;  4CC2 A;  4AFU C;  2ECZ A;  4RTZ A;  1SPK A;  4FSS A;  3H41 A;  4A63 B;  3PVL A;  2FO0 A;  3A98 A;  3EG2 A;  2RQU A;  2EPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...