4J9BA

Crystal structure of the abl-sh3 domain h59q-n96t mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
PNLFVALYDFVASGDNTLSITKGEKLRVLGYNQTGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Abl-SH3 domain H59Q-N96T mutant
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ABL1
total genus 11
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9bA00
2EYXA 2DL4A 1WA7A 1G2BA 1QCFA 4OMOA 3RBBB 2CT4A 2H8HA 2CT3A 2HSPA 1JQQA 2MOXA 2L3SA 2LZ6B 2F2WA 1ABOA 5L23A 2A37A 1ARKA 4OMMA 4RTYA 3I35A 2JS0A 4ORZA 2RQTA 1E7OA 1J3TA 1KJWA 1ZBJA 1AWWA 3TVTA 2JXBA 2RQVA 2FG0A 3VS1A 2VKNA 3VS2A 1ZUYA 1W1FA 3QWYA 4D8DA 2A28A 3C0CA 2YUQA 5FW9A 4JJCA 2MCNA 1ZSGA 3VS0A 2DL3A 1I0CA 2CSIA 3VS6A 4F14A 2B86A 2EPDA 3LH5A 4Z89A 3EHRA 2F2VA 4OMQA 2HCKA 2ED1A 2DNUA 1QLYA 1RLPC 3H0HA 4Y92A 5FWBA 3ZL7C 1I1JA 4LUDA 1MUZA 2KR3A 4M4ZA 4KRTA 1QWEA 2A36A 1YWOA 1TUDA 2XMFA 2YSQA 5IHKA 4A63B 5IXFA 2CREA 1RUWA 2SEMA 1JXOA 1M30A 1U5SA 1HSQA 1JO8A 3UA6A 3REBB 1OV3A 2NWMA 3FJ5A 4AFZC 2LNHB 2FRWA 1ABQA 4JZ3A 3M0RA 3UF4A 1AZGB 2KGTA 4LUEA 1UJYA 3TSZA 2RPNA 1PRLC 2V1QA 3R6NA 1UTIA 2W10A 4AFUC 1H3HA 3ULRB 2FPDA 1KFZA 3NHNA 2GGRA 2L3PA 3REAB 4WCIA 1KSWA 2DF6A 2SRCA 2F2XA 1B07A 2ROTA 2LJ1A 4J9BA 2EVRA 2KBTA 1Z9QA 1M8MA 4LN2A 4F17A 1Y57A 4Z88A 2AZVA 2KEAA 1RI9A 1YN8A 2C0OA 4OMPA 1BK2A 2PNIA 3RNJA 2BTTA 3UATA 2X3XD 4GBQA 1K0XA 2DM1A 2K3BA 1M3AA 1BU1A 1M3CA 1LCKA 1AOJA 2VWFA 4CC7A 2J06A 1OEBA 3H0FA 3PVLA 2V1RA 1QKXA 4FSSA 4CC4B 1NLOC 1UGVA 1X27A 3EG3A 1E6HA 3GBQA 2P4RA 1WXTA 2KYMA 2LJ0A 2RMOA 1UE9A 3NMZC 1T3SA 4HCKA 4AFQC 3VRZA 5IHNA 1SSHA 1ZUUA 1JEGA 2RQWA 1K9AA 2RNAA 1YNZA 5IH2A 2CDTA 1SHFA 1NEGA 1PRMC 1BBZA 1W6XA 1EFNA 5I22A 1E6GA 1PNJA 1VYUA 1SHGA 2CUDA 3M0QA 2VVKA 2JTEA 2OI3A 2K79A 1X2QA 2LQNA 1UFFA 1SEMA 2DBMA 4X1VA 2YUOA 2J05A 4JPBW 4IIOA 2L0AA 2ED0A 2J6KA 1WXUA 1NYFA 4D8KA 5FWCA 3QWXX 4RTXA 1FYNA 3KFVA 1MV0B 4QT7A 1GCQA 2LX7A 3TSWA 2FEIA 4RTVA 3M0UA 2BZYA 1HD3A 2RQRA 1K76A 2CUBA 3EHQA 2HDAA 5EC7A 2DJQA 2EYYA 1PWTA 1WX6A 1WXBA 2L2PA 2D8HA 2OJ2A 3UA7A 1AWJA 2O31A 1PHTA 4AG2C 2J6OA 2FRYA 2M0YA 3H41A 1CKBA 2W0ZA 1OOTA 3NPFA 2EQIA 1SPKA 1ZUKA 4RUGA 2EYZA 5GJVB 3THKA 1WI7A 1U3OA 2M51A 1KIKA 1WLPB 1NEBA 1X2KA 1B3QA 2EW3A 2J6FA 3M0PA 2NUZA 1YWPA 1GFCA 2BZ8A 1UUEA 2DA9A 2EGCA 1QWFA 4K11A 3SHWA 2LCSA 4Z8AA 2DX1A 4J9FA 2K9GA 1GL5A 2MIOA 1IO6A 2DE0X 2DVJA 4J9CA 1JXMA 1V1CA 1NLPC 2KRMA 1GBRA 2YUNA 2C0TA 3I5SA 4CC3A 1ZLMA 4JZ4A 2E5KA 2DILA 1VYVA 3I5RA 2KXDA 1GBQA 2K7AA 2YT6A 2KT1A 1G83A 1K1ZA 2D0NA 2JS2A 1TUCA 2J7IA 3VS4A 1BB9A 3VS7A 2O9VA 4OMNA 2JT4A 3CQTA 1M27C 4J9IA 4EIKA 3VS5A 4HXJA 2GTOA 4J9DA 2DL7A 2AKLA 2DRKA 2ESWA 3EG1A 1NG2A 1VYTA 1S1NA 2JMCA 1CSKA 3VS3A 2FPFA 2DYBA 1AZEA 4RTZA 2RF0A 2KE9A 2DBKA 4E6RA 2L3QA 2JM8A 2ROLA 2KT8A 2KRSA 5I11A 3JV3A 4DEXA 4GLMA 2QDLA 2O88A 3M0SA 2O9SA 2CH4W 3NGPA 2CH4A 1GFDA 4OMLA 2ABLA 1AD5A 2EYWA 1WDXA 1T3LA 2IIMA 5IXBA 2DLPA 1NYGA 1Y0MA 1UJ0A 1WYXA 2O2OA 1I07A 5IHIA 2EBPA 2YDLA 1T0HA 2GTJA 1AEYA 2D1XA 1Z9ZA 2DL5A 4J9HA 4CC2A 4AFSC 1U06A 2D8JA 3EGUA 3PE0A 2DRMA 2JW4A 3IQLA 2GQIA 2G6FX 2KRNA 4RTUA 2X3WD 2EKHA 2FPEA 1X6GA 4JJDA 4IIMA 2JM9A 1H92A 4LE9A 3A98A 4R0KA 1SRMA 2DL8A 3O5ZA 3H0IA 1CKAA 4F16A 1UG1A 1AWXA 5HCKA 1M3BA 2KXCA 2ECZA 3EG0A 2OAWA 3M0TA 2PZ1A 1QKWA 1UHFA 1TG0A 1YCSB 1K4US 1JU5C 2PTKA 2A08A 2HBWA 1UDLA 1X43A 2KROA 2ENMA 2BZXA 2KNBB 1RLQC 1NM7A 1XOVA 1N5ZA 4HVVA 1K0SA 2CSQA 1SRLA 1YP5A 4RTWA 1WIEA 3EG2A 2EGEA 2FO0A 1UECA 2AKKA 1GRIA 1AVZC 4DEYA 1VA7A 4RTTA 1T0JA 1MV3A 3PVQA 2AZSA 2GNCA 1GCQC 2EGAA 2KYBA 1AWOA 2JMAA 2LMJA 2YUPA 5ECAA 2LJ3A 4J9EA 1X69A 4ESRA 2LQWA 2LP5A 3I9QA 2K6DA 2DMOA 2GBQA 2K2MA 3SEMA 1X6BA 4AG1C 4ZNXA 3VRYA 2RQUA 1ZX6A 1PKSA 1W70A 1A0NB 1GCPA 4LNPA 3U23A 1H8KA 2I0NA 5GJWB 2AK5A 1WFWA 1FMKA 1HJDA 4HVUA 2RN8A 4J9GA 1OPKA 1OPLA 2C0IA 1PKTA 1UHCA 4JJBA 2HEQA 4HVWA
chains in the Genus database with same CATH superfamily
3M59A 2M1HA 2K5FA 1OYXA 4M75F 3UT1A 1WA7A 1QCFA 4XAXB 1Y07A 2YXYA 2CT3A 2NUPA 1U1SA 1MGQA 2QQ9A 2X4YA 2EQMA 4DOVA 1OZ3A 1NZ9A 1ABOA 2EWNA 4JLGA 5L23A 4J5YA 1ARKA 4RTYA 2JS0A 3FJPA 1J3TA 5CCAA 1AWWA 2FG0A 2VKNA 3O8VA 2EAYA 5GAMg 2RO0A 2Y4YA 3UPUA 2CSIA 3FEOA 4BE0A 1N6AA 1M1KR 3V8LA 3JB9H 4OMQA 2RHZA 2ED1A 1YITT 3CCJT 3DLLA 3FLGA 2DXCA 3ZL7C 1VQKA 1VQKT 1EZZB 3CC4Q 1MUZA 3M54A 4JRQA 4KRTA 1N8RC 1QWEA 2A36A 1TUDA 4N0AC 2XMFA 3T9NA 3S3MA 4C5GA 5IXFA 2CREA 4MMLA 2JOYA 5KYUB 2HNIA 1U5SA 3QHSA 3RMQA 2NWMA 3FJ5A 2E4HA 2CGHA 4IUTA 1RI0A 2JUFA 2OAUA 2LNHB 4JRPA 1AZGB 1OU8A 2RPNA 3R6NA 2W10A 1OI1A 2DK3A 1H3HA 1VQ6A 1KFZA 2KI7A 1YJ9Q 4WCIA 3G71A 3CPWA 2F2XA 3JCMc 2DXTA 4J9BA 2LVMA 2KBTA 1JJ2P 2EIFA 1VQNA 5D6XA 4LDVA 1G3SA 2RI2A 4V2SA 4XK8E 5AYFA 1QVGP 4OMPA 4BE1A 3RNJA 3UATA 5J39A 4GBQA 5D6WA 1D3BB 4LDUA 1XJWB 2DM1A 3DKMA 4FW2A 1BU1A 5KYXB 2XIDA 5GAN8 1M3CA 2VWFA 2XKOC 3M57A 1IRXA 3RKYA 4ZN1A 3PVLA 3CC4A 3RDVA 1M90C 2VC8A 3CEYA 1M1KC 1SKUB 2CP3A 1RL2A 1VQ5T 2KYMA 4HCCA 4EPCA 5GMKh 2RQWA 2RNAA 1YJWQ 1IGUA 5IH2A 3I55Q 1IZ6A 3D7SB 3L2UA 3OYGA 1EFNA 4M75C 4E47A 1KD1R 1E6GA 1ACMB 2HSEB 3EGDB 1RAIB 4NS5A 3M0QA 4M75A 3CCMA 2OI3A 1NPPA 1VQLT 1X2QA 3PMIA 2FYKA 2DBMA 5LJ3j 2YUOA 4A4KA 2J05A 3M53A 4IUQA 1YHQA 1NJIC 3RERA 1SG5A 2ZCFB 4M77G 1MMNA 2ED0A 1WGSA 1TOVA 3QWXX 4FM4B 1KQSA 3KFVA 4RG2A 2NUPB 3MP1A 2AIRB 5GMKe 2FEIA 2BZYA 4QQDA 3EGXA 1R0BG 3E9FA 1K76A 4F04B 2QTXA 2K2VA 3EHQA 2HDAA 2XDDA 2EYYA 2F5TX 3L1AA 1WXBA 3HP9A 2L2PA 1H641 1VQ7A 2X51A 2OJ2A 2QI2A 2MMPA 2J6OA 4ZN3A 2QEXA 4BI3A 1MMDA 4C5EA 3CCLQ 3NPFA 2LQKA 1SPKA 2OTLT 4RUGA 2EYZA 5GJVB 2X4WA 4E7IA 3QUIA 1WI7A 5IT9E 3OYCA 1BKBA 1X2KA 3M0PA 2GCXA 2NUZA 5CKDA 4J83A 1VQPQ 3SHWA 3HKSA 3JCMb 2CP7A 2DTOA 1QVGS 5D6YA 5EG2A 5J26A 2E6ZA 1BI3A 1IO6A 2DPPB 5DM7R 1K9MR 1JXMA 3NFCA 2KRMA 1Q7YC 1GBRA 2YUNA 5LL6S 5KYWB 4E7JA 4PJOG 1ZLMA 4JZ4A 3V7SA 3I5RA 3CCUA 1YIJQ 2KXDA 2DTHA 2I2LA 4JS5A 2RI3A 1GBQA 2K7AA 1DJ7B 2KT1A 2DVEA 2AHJB 4C92A 4PJOE 3VYGA 2J7IA 2JT4A 1WHLA 3CQTA 2RM4A 4CI0C 4FIBA 2JN0A 4LDYA 5FRNA 2DRKA 4C92F 4R56A 2JMCA 2HQXA 4PJJA 1S72T 4HA8A 2CP5A 4B9XA 2RF0A 3CCJQ 2L3QA 1YBYA 2QEXT 1VIEA 1LVKA 2ROLA 4LD9K 3JV3A 4DEXA 5A0LA 4GLMA 2O88A 3C94A 3CCVA 4M7AG 1GFDA 4CRIA 2ABLA 1AD5A 2EYWA 2OTJT 1T3LA 5IXBA 1VUBA 1Y0MA 1C0MA 1WYXA 1I07A 2RD1A 3AT1B 3VU3C 4XTYA 3WVEB 2DERA 1Z9ZA 4ZTJA 3RR6A 2DIQA 3I56Q 2XI9A 2YRVA 4Y91A 4AFSC 2DRMA 3IQLA 4E7ZA 3OSSC 4PJOD 2KQWA 1VQ6T 4AMCA 2HKNA 2Y90A 4IIMA 4M7DD 4R0KA 3A98A 1SRMA 1I8FA 1M1KU 3OW2P 4J8OA 4DBFA 1ZHIA 1M3BA 3CMAA 1MMAA 3M4GA 2KXCA 2KMTA 3EG0A 3KBGA 1EIFA 5FLXE 2OAWA 2PUKB 5I21A 2PZ1A 4IURA 1JU5C 3CCMT 3S3OA 2PTKA 2A08A 3OQ5A 3QBYA 3G71T 5CR2A 2E70A 1HXDA 2A3LA 1K0SA 2CSQA 1SRLA 4A4HA 1WIEA 1NE8A 1UECA 2NUTB 4F7UA 1GRIA 3H6ZA 1SSFA 4M77B 1ZSZA 1T0JA 3OYKA 5FROA 2E41A 1D0XA 4QW2A 1GCQC 2KYBA 2DFUA 4RG8A 2NLUA 3JB9I 2JMAA 4ATOA 4FYXB 5A0DA 1QVFA 1X69A 2ZZDA 4FSXA 3L2ZA 4C5IA 4Y28E 5KYYB 5GAOp 1X6BA 2EJGA 2RQUA 1ZX6A 3CXCA 1A0NB 4OF1A 4LNPA 2I0NA 4KGVB 2DZ9A 2G3RA 2QA4A 3DLMA 4OB0B 5GAOm 1YJNA 4KGXB 1D0ZA 2DL4A 1VQ9Q 2GQVA 1JBMA 2D9TA 4M77D 1YHQT 2RJCA 1TS9A 2H8HA 1YFNA 2C06A 5LJ5d 3HHTB 1VQOA 4B6MA 3QJYA 3OS5A 2L3SA 4C8QG 3CCRA 2F2WA 5GAN3 4GLKA 2VGNA 1BIAA 1SF9A 3G6EA 1VQ9T 3I35A 1LPLA 3QJ6A 4ORZA 2RQTA 1E7OA 2PQWA 1KJWA 3CCQT 1ZBJA 4XTWA 3CC7Q 2JXBA 4PLLA 4IKFA 5A0GA 1ZUYA 2A28A 5GAOl 2MCNA 2HBPA 3VS0A 3JCMX 3CCLT 2QA4Q 4C8QC 3CCQQ 4F14A 2B86A 1WZOA 1QQJA 2O4XA 1Y96B 2F2VA 2CS7A 5HY6A 1BCMA 1ZSZC 1KG1A 1QLYA 1GXIE 2RHYA 1RLPC 5FWBA 2K3YA 3MKDA 1X75C 4ME7A 4C92D 4XTXA 1WJQA 1VQ8A 1YWOA 6AT1B 3L42A 5GANe 4M77E 1I81A 2YSQA 2RB6A 1IHVA 2JNGA 2QQAA 4M7AE 5GAOq 3V8KA 2FVUA 2P84A 3VV0A 1M30A 1HSQA 1TWBA 1KQ1A 1JO8A 3UA6A 1OV3A 2K57A 2WACA 3J7AF 4PL6A 1YI2Q 1M90R 4F7UB 3CBOA 2F69A 2FRWA 3G1JA 3X24B 1VQ6Q 4KGZB 2LNVA 3M0RA 1P92A 1UJYA 1ZA1B 4M78F 3N5BB 5I2SA 4KULA 5GANh 4AFUC 2HD0A 2L5QA 3NHNA 2LCLA 1R8OB 4EMKB 2FL7A 2ROTA 3CC2A 2QQBA 3HL8A 5KCHA 2FHDA 5FRMA 2FZCB 1D09B 2EVRA 3KUFA 4RCCA 1M8MA 4LN2A 5FU6B 3HFOA 4F17A 1VIFA 1Y57A 3MHXA 1N8RR 2KK4A 4XTVA 1WQWA 2DKGA 1MHNA 3I56A 3CMEQ 1RI9A 1YN8A 1M2VB 3PTAA 2OTJQ 2LT1A 2BTTA 1YJNQ 4E7HA 1ZSZB 4JJNK 5DLQE 4A4GA 3ZFJA 2GFUA 3CCET 1B34A 1M5Q1 4FSSA 3UWNA 1X27A 1Q95G 3GBQA 2M16A 1QP2A 1VQPT 1T3SA 3SWNB 1SSHA 3CC2Q 1ZUUA 1JEGA 1Q86R 3JCMQ 3LYIA 1WHGA 4PFZA 1WHJA 3L2RA 1LOJA 2RJDA 1VYUA 2K79A 2PVGB 1UFFA 2LC4A 1SEMA 2DYIA 4XQ3A 4X1VA 4IIOA 4BI8B 1VQMT 1VQMA 1BCOA 1WNLA 1NYFA 4AT1B 3ZBDA 4D8KA 1XTDA 3FB9A 1MV0B 4JLIA 2F5KA 1GCQA 1BI1A 1IHWA 5GMKm 4OB3B 3M0UA 1HD3A 3BDLA 1M2OA 3NTHA 2XDBA 3CCVT 5FU7C 2D8HA 1QCOA 1K9MC 3UA7A 1AWJA 2DZCA 4C8QF 4PK4A 4D6WA 2OTLA 2FRYA 2M0YA 3H41A 1JB0E 2HKQB 2EQIA 2Z0WA 3P8HA 3CCSQ 2RI5A 4FT4A 3EGXB 1KIKA 1NEBA 2ZAEA 1K8AC 2EW3A 2J6FA 4MDXA 1GFCA 4C0DC 2DA9A 2EGCA 5KCOA 1WHKA 3OYYA 4K11A 3PIPA 1V76A 1QVFS 4M7AC 4BDZA 2QGFB 4Z8AA 1UEBA 4OB2B 4FYWB 3OB9A 4J9CA 5KH6A 1U8RA 1NLPC 2C0TA 3R6OA 4M77C 2H3EB 4BI4A 1XNIA 2CYZB 2YT6A 3OYMA 1KC8U 3PT9A 1G83A 4M78A 2D0NA 2JS2A 1S72Q 3SD4A 3CCMQ 1TUCA 1NJIR 3VS7A 1M27C 1M9SA 3VS5A 4GY5A 4B9WA 1D1AA 4IUPA 4J9DA 2AKLA 3EG1A 4PJNA 5GANd 1S1NA 3VS3A 2YWWA 3EFRA 2H3JA 4J7IA 2FZGB 5GAN5 4RTZA 2DD5A 4M7DB 4E7KA 2DBKA 3VKIA 4LXCA 1FMWA 3URGA 2KRSA 3X25B 2E1HA 1KQ2A 2QDLA 4Z02A 4QVDA 3TEEA 3JSCA 2CH4W 4C92C 1WDXA 3RKXA 3TQ7P 2FZKB 3JB9J 2JTMA 1NYGA 4BY6B 2O2OA 1OQKA 2EBPA 5LJ5g 3OYNA 4Q5WA 4C92B 4TVRA 1VOMA 4DBQA 5DY9A 4QKUA 5GANf 2D8JA 3EGUA 4PFPA 2JW4A 2GQIA 2V26A 1QVPA 4F7UE 4FYVB 1I5OB 2YHTA 4OGEA 1VQ5Q 8AT1B 2DEQA 5GAMh 2FPEA 3A1PA 4C92G 1WHMA 3A8LB 1H92A 2BE9B 2QASA 4J6WA 4M7AB 2DL8A 3H0IA 2MI6A 4EMKA 5HCKA 1IB8A 3CXCP 4C0DB 1VQ4Q 4HT8A 2E10A 3JB9F 4OGCA 1QKWA 1K4US 1OZ2A 2HBWA 3OW2S 2WSCE 4C0FA 3CMAQ 3LLRA 3CD6A 2XHCA 1OX8A 5KYWA 1XOVA 3OS2A 1N5ZA 4PJOF 1V29B 3WVDB 2Y4XA 3HFNA 4RTWA 2M9UA 3TREA 3OS1A 1VA7A 3RIRA 3PFSA 5KE2A 5KYNA 4O5VA 4BE2A 4ZGDB 2HL3A 3CCEQ 4RMOA 4VUBA 4C0GA 3VUZA 3GPLA 3RESA 2LP5A 2L3RA 2R57A 4C5HA 4WTOB 1TTHB 1G3TA 4AG1C 1WHHA 2VV5A 5GMKj 1PKSA 1W70A 1H8KA 3OYEA 5GJWB 3CMEA 2XDPA 3LGLA 3EFSA 2LX9A 2CP0A 4HVUA 3JB9D 1M1GA 3SFMA 4ANJA 4PJMA 1D1CA 3LGFA 4JJBA 5GAMd 4HVWA 1OULA 2EYXA 3A8HB 1VQOQ 2ZPIB 1G2BA 4OMOA 3QYHB 1Q81U 1VQ9A 2DXUA 2BKDN 5HK0A 3V7CA 3J80E 4FCYA 3L2WA 3TVTA 2RQVA 3FDRA 3L2VA 2ZPHB 1YI2A 3QWYA 4D8DA 3C0CA 1VQ8T 2E65A 5FW9A 3GP8A 3M4YA 2DL3A 3OBWA 1RABB 2COZA 4F7UF 3VS6A 4N4GA 4MMKA 4FW1A 2QAZA 4J7FA 4KH0B 3C4SA 1AHJB 1I4K1 4Z89A 3EHRA 3SWNC 2HCKA 1VQ8Q 3H0HA 2YRCA 2BIVA 5CVIA 2QEXQ 2QA4T 2KR3A 4M7DG 4M4ZA 4JUVA 2QXFA 4L6V5 3QO3A 4M78B 2V8KA 1EX4A 4NOYA 4M75E 3SDZA 3X20B 3JCMg 3QSUA 4P5NA 2SEMA 1JXOA 4M78C 4AFZC 3V8JA 3A8OB 1VQOT 2IG0A 2COYA 3M58A 2V8JA 1NJIU 1ABQA 1MNEA 1ZA2B 4HCZA 7AT1B 3UF4A 5GAN6 5D7UA 3GNGA 2FPDA 2EQUA 2L3PA 1KQSS 1KSWA 3TCJA 2SRCA 4PJLA 2MK5A 2QQSA 3CPFA 1B07A 2VUBA 2LJ1A 2MWOA 1YJNT 4ELYC 4PJOA 2AZVA 5A2QE 3CXCS 3A5ZB 5I2MA 1BIBA 2L8DA 4PKCC 2PNIA 2HMAA 4M75D 4JDSA 5KYYA 1KQSP 4M7DA 1K0XA 3P8BB 1TH7A 2OTJA 2CP2A 5CO7A 3OYJA 4L59A 3AHUA 2M0OA 1LCKA 1UGRB 3G4SA 4CC7A 2J06A 5LJ5f 1QKXA 4CC4B 1NLOC 1UGVA 2DJZA 3JAME 1I5LA 1VQNQ 1WXTA 1Y96A 2RMOA 5DLOA 1N8RU 5IHNA 3QYGB 1K9AA 4C8QB 1SHFA 1PRMC 1W6XA 2EFIA 1YIJA 3MP8A 3G6ET 1F1BB 3EFOB 4FU6A 3OSVA 2ZGWA 2VVKA 2JTEA 4OMFB 2LQNA 3G71Q 4E7SA 4M75B 1WJRA 4QQ6A 1YJ9T 3Q1JA 2XICA 2JJ9A 1C6VX 4RTXA 2E3HA 1FYNA 1Q82U 3TSWA 4BD3A 5CQYA 4M75G 2QYZA 2RQRA 2KVQG 5EC7A 2DJQA 1AT1B 1WX6A 1IREB 3E2UA 3MEUA 3OMCA 3S6WA 3OYBA 2E6NA 2RJEA 3LX7A 1PHTA 4AG2C 3NTIA 4PNOA 1D0YA 3INZA 2RK2A 1CKBA 3BDUA 2W0ZA 1OOTA 2MPXC 2COWA 1Y71A 1RACB 3OMGA 3BE3A 1VQ7Q 4DA4A 3G4ST 2HAXA 1U3OA 2M51A 4PJOC 1WLPB 1UB4A 1M2VA 3JCMJ 3MEAA 1VQKQ 1YWPA 4MZPA 1BI0A 4A4EA 1UUEA 2K3XA 2P0PA 4F7UG 5IAYA 3QDFA 4X9DA 5HKCA 2LCSA 4DBHA 1VQ7T 2DD4A 1K73U 4J9FA 1OX9A 2K9GA 1GL5A 2MIOA 2DE0X 1V1CA 3BY7A 2QK0A 3I5SA 1S72A 3GLXA 2DILA 2CKKA 1VYVA 4E2FB 4JS4A 4MZMA 1W2BA 2E5QA 2NYSA 4BY6C 1YCYA 1K1ZA 3RUXA 1Q7YR 3CCUQ 1JJ2A 2ZPBB 3VS4A 1BB9A 4M7DE 2O9VA 4J9IA 2KY9A 3QIIA 5KYXA 4HXJA 4MZTA 1FMVA 1VQ5A 2ZPGB 4XTZA 1PSFA 2ESWA 1VYTA 2QTVA 4IUVA 1CSKA 2E64A 4EMGA 1VQLA 1YITQ 1QCNA 2XG8D 1AZEA 3PGGA 4N4HA 2IVWA 1VQPA 2BUDA 4HKEA 2EJ9A 4HCBA 2X9HA 4C8QA 4KH1B 2KT8A 5CKFA 4IUUA 3G4SQ 5LJ3h 4XU2A 3HTRA 3NGPA 4OMLA 2GFAA 3OW2A 3E9GA 2IIMA 3H8ZA 3P8DA 3C12A 5CKBA 2YDLA 2DXBA 4YTLA 1T0HA 3OYHA 1YITA 1AEYA 3JCMW 2DL5A 4J9HA 1YJ9A 4CC2A 3EG9B 1U06A 5GANg 3PE0A 3META 1VQ4T 1VQNT 2LRQA 2LCCA 3DB4A 1ZBXA 4RTUA 2EKHA 3JCMe 3G7ZA 2LDMA 2JM9A 5LJ3e 4LE9A 1RAGB 2XU8A 1KD1U 2HZYA 3O5ZA 3I56T 1YIJT 3CBPA 1M90U 1AWXA 3HPWA 4E7LA 5LJ5j 5CAIA 2ECZA 3PNWC 3M0TA 1O9SA 2P0KA 2R58A 5CQXA 1LJOA 1UHFA 2K4YA 2XD0A 2EQJA 1UDLA 1X43A 1JJ2S 2KROA 2BZXA 3HRUA 3VUBA 2KNBB 1RLQC 1BI2A 3J81E 3I55A 1PCXA 1YJWA 4HVVA 5C6SA 3OY9A 2IPOB 4ELZC 5GAMe 1YP5A 2FO0A 5FU7B 2A0FB 1TSFA 4OB1B 4RTTA 3V7RA 2RA2A 2EQKA 1MV3A 2AZSA 1Q82C 2DEUA 3CCVQ 1PG5B 2E3IA 2GNCA 2EGAA 4FYYB 2MYSA 2LMJA 1R0CB 2YUPA 2K5IA 5ECAA 1TU0B 4J9EA 2HQEA 2EJFA 2LQWA 5CKEA 5GMKi 3VJPA 2KDSA 3SEMA 3CCEA 4OP0A 4ZNXA 4ZTFA 1UGSB 2AT1B 2MF2A 4FT2A 5LJ5e 5GAMf 2WSEE 1WFWA 2RJFA 4J9GA 1N27A 1OPKA 1OPLA 1K73R 3CD6Q 2VGMA 1PKTA 1UHCA 5KYUA 4C92E 5CK9A 1RAEB 1WJSA 2CZ7B 2HEQA 3WXMB 3CCRT 1QVFP 1KK7A 1VQLQ 1TUGB 3RBBB 2CZ0B 2CT4A 2DTIA 2HSPA 2PVOB 3CC7T 1IXDA 1JQQA 1VQMQ 2MOXA 2LZ6B 5LJ5h 2ATCB 2E12A 2VASA 2A37A 4C8QE 4OMMA 3E19A 4XTUA 5LJ3d 2VYTA 2HQHA 4PFOA 4M7AA 2YLBA 5CKHA 1N9SA 5J3BA 2KAFA 3MCAB 3VS1A 4EMHA 1FXXA 3VS2A 1W1FA 3ZEHA 4C0ZA 2YUQA 4JJCA 1ZSGA 9ATCB 2MAMA 4XU0A 1FWZA 3QKJA 1I0CA 1LNXA 1JRIA 8ATCB 2LT4A 3QPHA 4PLIA 2EPDA 3JCMV 4M7DF 3LH5A 3TU4K 2DIGA 1KD1C 2R5MA 3BFMA 2PVDB 2DNUA 4Y92A 2M02A 1I1JA 4LUDA 3UDCA 3ME9A 5GAN4 1W2BP 2DETA 1YI2T 2PUOB 3EGDA 2VXEA 1R77A 5IHKA 4RKUE 1PSEA 4A63B 4A54A 1RUWA 4JRKA 1Q86U 3CCJA 4DOWA 3CD6T 1RAAB 3REBB 2CZ6B 1N9RA 4C8QD 1YJWT 3MJXA 3I55T 3LH0A 2XK0A 3G6EQ 3OYFA 4JZ3A 1D1BA 2KGTA 4LUEA 3TSZA 1PRLC 2V1QA 1UTIA 3FIFA 4QVCA 1RAHB 5AT1B 1UGPB 3HRSA 3ULRB 3X28B 4UC4A 2BE7D 2GGRA 3MEVA 2LQ8A 3REAB 4ZGJB 1VQ4A 3CMET 5CIUA 2DF6A 1KHIA 1Q81C 2K5LA 2V8IA 3EH1A 1HYOA 1K9MU 2L89A 3SB2A 1Z9QA 2MWPA 3CMAT 3QZ9B 4Z88A 2RHIA 2KEAA 5GAN2 3CBMA 3CPWP 1Q81R 2C0OA 4M7DC 1RADB 1BK2A 4XU3A 3OYAA 3CCSA 4HT9A 3ER0A 4M77F 2X3XD 2YLCA 1NPRA 4M7AD 1FX7A 1QW1A 2K3BA 1M3AA 2OTLQ 3QXEB 4OVAA 2FB7A 2DO3A 2P0QA 1AOJA 4M78G 1G3WA 3H0FA 1OEBA 3PMTA 2V1RA 4A4FA 3CCLA 4DQ2A 2PU9B 1B34B 3EG3A 1X6OA 1E6HA 3CPWS 2P4RA 4QVZA 2LJ0A 1UE9A 3NMZC 4M78E 4HCKA 4AFQC 3VRZA 4J6YA 5GAOn 4L5GA 3M56A 2KSSA 3SWNA 1D3BA 3MP6A 3GNFB 1YNZA 2CDTA 1HK9A 2X4JA 1NEGA 1BBZA 2RK1A 2X35A 1Y7XA 3MO8A 5I22A 4PJOB 5LJ3f 4LD6A 3EAEA 1PNJA 2D6FA 1SHGA 1PD0A 2CUDA 3JB9G 4NL3A 2WSFE 1MMGA 3CC7A 2O4XB 3BW1A 3ASKA 4BUGA 4JPBW 2L0AA 2J6KA 1WXUA 2D0QB 3FRNA 3CCUT 1G5VA 4FL6A 5FWCA 4QT7A 2ZPFB 2LX7A 2QQRA 4M7AF 4RTVA 3NTKA 3M5AA 4XU1A 2CUBA 5GAMj 1KHCA 1PWTA 3M9QA 4X9CA 1UGQB 2LTOA 2RHUA 2O31A 4KT0E 1O75A 3MPUB 5KE3A 3RKWA 1PD1A 2YRDA 3OYIA 4M78D 1ZUKA 3THKA 1X01A 2RHXA 5GAN7 5GAOr 1B3QA 3X26B 1W4SA 2BZ8A 3JCMd 4RCBA 1QWFA 4N4IA 3KXTA 1Q86C 5M9OA 4BB7A 2DX1A 3M55A 3H9NA 2VB6A 2EYQA 2JTFA 2DVJA 3A8MB 5HK3A 1B7TA 3DB3A 3LWIA 3LW5E 1OU9A 4CC3A 2E5KA 2F1LA 3EH2A 3HSBA 1QVGA 1QMCA 1KC8C 2QGGA 4M77A 4II1A 4OMNA 3EFOA 4EIKA 2VXFA 2GTOA 2DL7A 1U1TA 5FU6C 4N0AA 1K73C 1NG2A 1XQHA 2JVVA 3OYLA 1RAFB 2FPFA 3MEWA 1M4ZA 2DYBA 3QG1A 3L2QA 4EMKC 2KE9A 3OA6A 5C0MA 4R55A 4LDWA 5GMKl 3RMSA 4E6RA 2B8AA 2ZPEB 2JM8A 5I11A 1IGQA 1G8XA 3E1SA 2RH2A 1BYMA 5IN1A 3CCST 3M0SA 2O9SA 3PIOA 1Q7YU 2CH4A 2CZ1B 4NL2A 2DLPA 4MDWA 3QZ5B 4J6XA 1UJ0A 1Q82R 5IHIA 3OYDA 2GTJA 2D1XA 3F70A 1KC8R 3GIBA 1TXQA 2G6FX 1NBEB 2KRNA 2X3WD 1K8AR 2P4TA 1C1AA 1G3YA 1X6GA 4JJDA 2CP6A 1M1FA 3VYHB 5GANj 4BDYA 3CC2T 3CCRQ 1WQ7A 3GF5A 1M8VA 1QP3A 1YHQQ 4ZGEB 5LJ3g 1CKAA 4BACA 4F16A 2JZ2A 3LWHA 1UG1A 2NUTA 3JRZA 1W2BS 1PM3A 1TG0A 1YCSB 2R5AA 2QG9B 3EG9A 2ENMA 4A53A 1H3ZA 1NM7A 2A7YA 2O01E 2GF7A 1K8AU 3GOXA 4LDXA 3JCMP 3A8GB 2EKOA 3HRTA 3JCMh 1MNDA 2DAQA 4EDUA 4WF2A 3EG2A 4KUDK 2EGEA 3OS0A 2AKKA 2OX7A 1AVZC 4DEYA 4X34A 4QQGA 3PVQA 1AWOA 3OBYA 4JRIA 2LJ3A 2X4XA 4ESRA 3I9QA 4DBRA 2K6DA 5L8RE 2DMOA 2GBQA 3C95A 2K2MA 3JCMf 3CC4T 3S3NA 3FC3A 3VRYA 1GCPA 3U23A 4O6JA 2AK5A 3QDRB 1FMKA 1HJDA 3CCQA 1WPYA 2HL5C 2RN8A 1ZQ1A 2C0IA 4KBMB 1PC0A 2QDYB 4KUIA
chains in the Genus database with same CATH topology
2EYXA 2DL4A 1WA7A 1G2BA 1QCFA 4OMOA 3RBBB 2CT4A 2H8HA 2CT3A 2HSPA 1JQQA 2MOXA 2L3SA 2LZ6B 2F2WA 1ABOA 5L23A 2A37A 1ARKA 4OMMA 4RTYA 3I35A 2JS0A 4ORZA 2RQTA 1E7OA 1J3TA 1KJWA 1ZBJA 1AWWA 3TVTA 2JXBA 2RQVA 2FG0A 3VS1A 2VKNA 3VS2A 1ZUYA 1W1FA 3QWYA 4D8DA 2A28A 3C0CA 2YUQA 5FW9A 4JJCA 2MCNA 1ZSGA 3VS0A 2DL3A 1I0CA 2CSIA 3VS6A 4F14A 2B86A 2EPDA 3LH5A 4Z89A 3EHRA 2F2VA 4OMQA 2HCKA 2ED1A 2DNUA 1QLYA 1RLPC 3H0HA 4Y92A 5FWBA 3ZL7C 1I1JA 4LUDA 1MUZA 2KR3A 4M4ZA 4KRTA 1QWEA 2A36A 1YWOA 1TUDA 2XMFA 2YSQA 5IHKA 4A63B 5IXFA 2CREA 1RUWA 2SEMA 1JXOA 1M30A 1U5SA 1HSQA 1JO8A 3UA6A 3REBB 1OV3A 2NWMA 3FJ5A 4AFZC 2LNHB 2FRWA 1ABQA 4JZ3A 3M0RA 3UF4A 1AZGB 2KGTA 4LUEA 1UJYA 3TSZA 2RPNA 1PRLC 2V1QA 3R6NA 1UTIA 2W10A 4AFUC 1H3HA 3ULRB 2FPDA 1KFZA 3NHNA 2GGRA 2L3PA 3REAB 4WCIA 1KSWA 2DF6A 2SRCA 2F2XA 1B07A 2ROTA 2LJ1A 4J9BA 2EVRA 2KBTA 1Z9QA 1M8MA 4LN2A 4F17A 1Y57A 4Z88A 2AZVA 2KEAA 1RI9A 1YN8A 2C0OA 4OMPA 1BK2A 2PNIA 3RNJA 2BTTA 3UATA 2X3XD 4GBQA 1K0XA 2DM1A 2K3BA 1M3AA 1BU1A 1M3CA 1LCKA 1AOJA 2VWFA 4CC7A 2J06A 1OEBA 3H0FA 3PVLA 2V1RA 1QKXA 4FSSA 4CC4B 1NLOC 1UGVA 1X27A 3EG3A 1E6HA 3GBQA 2P4RA 1WXTA 2KYMA 2LJ0A 2RMOA 1UE9A 3NMZC 1T3SA 4HCKA 4AFQC 3VRZA 5IHNA 1SSHA 1ZUUA 1JEGA 2RQWA 1K9AA 2RNAA 1YNZA 5IH2A 2CDTA 1SHFA 1NEGA 1PRMC 1BBZA 1W6XA 1EFNA 5I22A 1E6GA 1PNJA 1VYUA 1SHGA 2CUDA 3M0QA 2VVKA 2JTEA 2OI3A 2K79A 1X2QA 2LQNA 1UFFA 1SEMA 2DBMA 4X1VA 2YUOA 2J05A 4JPBW 4IIOA 2L0AA 2ED0A 2J6KA 1WXUA 1NYFA 4D8KA 5FWCA 3QWXX 4RTXA 1FYNA 3KFVA 1MV0B 4QT7A 1GCQA 2LX7A 3TSWA 2FEIA 4RTVA 3M0UA 2BZYA 1HD3A 2RQRA 1K76A 2CUBA 3EHQA 2HDAA 5EC7A 2DJQA 2EYYA 1PWTA 1WX6A 1WXBA 2L2PA 2D8HA 2OJ2A 3UA7A 1AWJA 2O31A 1PHTA 4AG2C 2J6OA 2FRYA 2M0YA 3H41A 1CKBA 2W0ZA 1OOTA 3NPFA 2EQIA 1SPKA 1ZUKA 4RUGA 2EYZA 5GJVB 3THKA 1WI7A 1U3OA 2M51A 1KIKA 1WLPB 1NEBA 1X2KA 1B3QA 2EW3A 2J6FA 3M0PA 2NUZA 1YWPA 1GFCA 2BZ8A 1UUEA 2DA9A 2EGCA 1QWFA 4K11A 3SHWA 2LCSA 4Z8AA 2DX1A 4J9FA 2K9GA 1GL5A 2MIOA 1IO6A 2DE0X 2DVJA 4J9CA 1JXMA 1V1CA 1NLPC 2KRMA 1GBRA 2YUNA 2C0TA 3I5SA 4CC3A 1ZLMA 4JZ4A 2E5KA 2DILA 1VYVA 3I5RA 2KXDA 1GBQA 2K7AA 2YT6A 2KT1A 1G83A 1K1ZA 2D0NA 2JS2A 1TUCA 2J7IA 3VS4A 1BB9A 3VS7A 2O9VA 4OMNA 2JT4A 3CQTA 1M27C 4J9IA 4EIKA 3VS5A 4HXJA 2GTOA 4J9DA 2DL7A 2AKLA 2DRKA 2ESWA 3EG1A 1NG2A 1VYTA 1S1NA 2JMCA 1CSKA 3VS3A 2FPFA 2DYBA 1AZEA 4RTZA 2RF0A 2KE9A 2DBKA 4E6RA 2L3QA 2JM8A 2ROLA 2KT8A 2KRSA 5I11A 3JV3A 4DEXA 4GLMA 2QDLA 2O88A 3M0SA 2O9SA 2CH4W 3NGPA 2CH4A 1GFDA 4OMLA 2ABLA 1AD5A 2EYWA 1WDXA 1T3LA 2IIMA 5IXBA 2DLPA 1NYGA 1Y0MA 1UJ0A 1WYXA 2O2OA 1I07A 5IHIA 2EBPA 2YDLA 1T0HA 2GTJA 1AEYA 2D1XA 1Z9ZA 2DL5A 4J9HA 4CC2A 4AFSC 1U06A 2D8JA 3EGUA 3PE0A 2DRMA 2JW4A 3IQLA 2GQIA 2G6FX 2KRNA 4RTUA 2X3WD 2EKHA 2FPEA 1X6GA 4JJDA 4IIMA 2JM9A 1H92A 4LE9A 3A98A 4R0KA 1SRMA 2DL8A 3O5ZA 3H0IA 1CKAA 4F16A 1UG1A 1AWXA 5HCKA 1M3BA 2KXCA 2ECZA 3EG0A 2OAWA 3M0TA 2PZ1A 1QKWA 1UHFA 1TG0A 1YCSB 1K4US 1JU5C 2PTKA 2A08A 2HBWA 1UDLA 1X43A 2KROA 2ENMA 2BZXA 2KNBB 1RLQC 1NM7A 1XOVA 1N5ZA 4HVVA 1K0SA 2CSQA 1SRLA 1YP5A 4RTWA 1WIEA 3EG2A 2EGEA 2FO0A 1UECA 2AKKA 1GRIA 1AVZC 4DEYA 1VA7A 4RTTA 1T0JA 1MV3A 3PVQA 2AZSA 2GNCA 1GCQC 2EGAA 2KYBA 1AWOA 2JMAA 2LMJA 2YUPA 5ECAA 2LJ3A 4J9EA 1X69A 4ESRA 2LQWA 2LP5A 3I9QA 2K6DA 2DMOA 2GBQA 2K2MA 3SEMA 1X6BA 4AG1C 4ZNXA 3VRYA 2RQUA 1ZX6A 1PKSA 1W70A 1A0NB 1GCPA 4LNPA 3U23A 1H8KA 2I0NA 5GJWB 2AK5A 1WFWA 1FMKA 1HJDA 4HVUA 2RN8A 4J9GA 1OPKA 1OPLA 2C0IA 1PKTA 1UHCA 4JJBA 2HEQA 4HVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYX A;  2DL4 A;  1WA7 A;  1G2B A;  1QCF A;  4OMO A;  3RBB B;  2CT4 A;  2H8H A;  2CT3 A;  2HSP A;  1JQQ A;  2MOX A;  2L3S A;  2LZ6 B;  2F2W A;  1ABO A;  5L23 A;  2A37 A;  1ARK A;  4OMM A;  4RTY A;  3I35 A;  2JS0 A;  4ORZ A;  2RQT A;  1E7O A;  1J3T A;  1KJW A;  1ZBJ A;  1AWW A;  3TVT A;  2JXB A;  2RQV A;  2FG0 A;  3VS1 A;  2VKN A;  3VS2 A;  1ZUY A;  1W1F A;  3QWY A;  4D8D A;  2A28 A;  3C0C A;  2YUQ A;  5FW9 A;  4JJC A;  2MCN A;  1ZSG A;  3VS0 A;  2DL3 A;  1I0C A;  2CSI A;  3VS6 A;  4F14 A;  2B86 A;  2EPD A;  3LH5 A;  4Z89 A;  3EHR A;  2F2V A;  4OMQ A;  2HCK A;  2ED1 A;  2DNU A;  1QLY A;  1RLP C;  3H0H A;  4Y92 A;  5FWB A;  3ZL7 C;  1I1J A;  4LUD A;  1MUZ A;  2KR3 A;  4M4Z A;  4KRT A;  1QWE A;  2A36 A;  1YWO A;  1TUD A;  2XMF A;  2YSQ A;  5IHK A;  4A63 B;  5IXF A;  2CRE A;  1RUW A;  2SEM A;  1JXO A;  1M30 A;  1U5S A;  1HSQ A;  1JO8 A;  3UA6 A;  3REB B;  1OV3 A;  2NWM A;  3FJ5 A;  4AFZ C;  2LNH B;  2FRW A;  1ABQ A;  4JZ3 A;  3M0R A;  3UF4 A;  1AZG B;  2KGT A;  4LUE A;  1UJY A;  3TSZ A;  2RPN A;  1PRL C;  2V1Q A;  3R6N A;  1UTI A;  2W10 A;  4AFU C;  1H3H A;  3ULR B;  2FPD A;  1KFZ A;  3NHN A;  2GGR A;  2L3P A;  3REA B;  4WCI A;  1KSW A;  2DF6 A;  2SRC A;  2F2X A;  1B07 A;  2ROT A;  2LJ1 A;  4J9B A;  2EVR A;  2KBT A;  1Z9Q A;  1M8M A;  4LN2 A;  4F17 A;  1Y57 A;  4Z88 A;  2AZV A;  2KEA A;  1RI9 A;  1YN8 A;  2C0O A;  4OMP A;  1BK2 A;  2PNI A;  3RNJ A;  2BTT A;  3UAT A;  2X3X D;  4GBQ A;  1K0X A;  2DM1 A;  2K3B A;  1M3A A;  1BU1 A;  1M3C A;  1LCK A;  1AOJ A;  2VWF A;  4CC7 A;  2J06 A;  1OEB A;  3H0F A;  3PVL A;  2V1R A;  1QKX A;  4FSS A;  4CC4 B;  1NLO C;  1UGV A;  1X27 A;  3EG3 A;  1E6H A;  3GBQ A;  2P4R A;  1WXT A;  2KYM A;  2LJ0 A;  2RMO A;  1UE9 A;  3NMZ C;  1T3S A;  4HCK A;  4AFQ C;  3VRZ A;  5IHN A;  1SSH A;  1ZUU A;  1JEG A;  2RQW A;  1K9A A;  2RNA A;  1YNZ A;  5IH2 A;  2CDT A;  1SHF A;  1NEG A;  1PRM C;  1BBZ A;  1W6X A;  1EFN A;  5I22 A;  1E6G A;  1PNJ A;  1VYU A;  1SHG A;  2CUD A;  3M0Q A;  2VVK A;  2JTE A;  2OI3 A;  2K79 A;  1X2Q A;  2LQN A;  1UFF A;  1SEM A;  2DBM A;  4X1V A;  2YUO A;  2J05 A;  4JPB W;  4IIO A;  2L0A A;  2ED0 A;  2J6K A;  1WXU A;  1NYF A;  4D8K A;  5FWC A;  3QWX X;  4RTX A;  1FYN A;  3KFV A;  1MV0 B;  4QT7 A;  1GCQ A;  2LX7 A;  3TSW A;  2FEI A;  4RTV A;  3M0U A;  2BZY A;  1HD3 A;  2RQR A;  1K76 A;  2CUB A;  3EHQ A;  2HDA A;  5EC7 A;  2DJQ A;  2EYY A;  1PWT A;  1WX6 A;  1WXB A;  2L2P A;  2D8H A;  2OJ2 A;  3UA7 A;  1AWJ A;  2O31 A;  1PHT A;  4AG2 C;  2J6O A;  2FRY A;  2M0Y A;  3H41 A;  1CKB A;  2W0Z A;  1OOT A;  3NPF A;  2EQI A;  1SPK A;  1ZUK A;  4RUG A;  2EYZ A;  5GJV B;  3THK A;  1WI7 A;  1U3O A;  2M51 A;  1KIK A;  1WLP B;  1NEB A;  1X2K A;  1B3Q A;  2EW3 A;  2J6F A;  3M0P A;  2NUZ A;  1YWP A;  1GFC A;  2BZ8 A;  1UUE A;  2DA9 A;  2EGC A;  1QWF A;  4K11 A;  3SHW A;  2LCS A;  4Z8A A;  2DX1 A;  4J9F A;  2K9G A;  1GL5 A;  2MIO A;  1IO6 A;  2DE0 X;  2DVJ A;  4J9C A;  1JXM A;  1V1C A;  1NLP C;  2KRM A;  1GBR A;  2YUN A;  2C0T A;  3I5S A;  4CC3 A;  1ZLM A;  4JZ4 A;  2E5K A;  2DIL A;  1VYV A;  3I5R A;  2KXD A;  1GBQ A;  2K7A A;  2YT6 A;  2KT1 A;  1G83 A;  1K1Z A;  2D0N A;  2JS2 A;  1TUC A;  2J7I A;  3VS4 A;  1BB9 A;  3VS7 A;  2O9V A;  4OMN A;  2JT4 A;  3CQT A;  1M27 C;  4J9I A;  4EIK A;  3VS5 A;  4HXJ A;  2GTO A;  4J9D A;  2DL7 A;  2AKL A;  2DRK A;  2ESW A;  3EG1 A;  1NG2 A;  1VYT A;  1S1N A;  2JMC A;  1CSK A;  3VS3 A;  2FPF A;  2DYB A;  1AZE A;  4RTZ A;  2RF0 A;  2KE9 A;  2DBK A;  4E6R A;  2L3Q A;  2JM8 A;  2ROL A;  2KT8 A;  2KRS A;  5I11 A;  3JV3 A;  4DEX A;  4GLM A;  2QDL A;  2O88 A;  3M0S A;  2O9S A;  2CH4 W;  3NGP A;  2CH4 A;  1GFD A;  4OML A;  2ABL A;  1AD5 A;  2EYW A;  1WDX A;  1T3L A;  2IIM A;  5IXB A;  2DLP A;  1NYG A;  1Y0M A;  1UJ0 A;  1WYX A;  2O2O A;  1I07 A;  5IHI A;  2EBP A;  2YDL A;  1T0H A;  2GTJ A;  1AEY A;  2D1X A;  1Z9Z A;  2DL5 A;  4J9H A;  4CC2 A;  4AFS C;  1U06 A;  2D8J A;  3EGU A;  3PE0 A;  2DRM A;  2JW4 A;  3IQL A;  2GQI A;  2G6F X;  2KRN A;  4RTU A;  2X3W D;  2EKH A;  2FPE A;  1X6G A;  4JJD A;  4IIM A;  2JM9 A;  1H92 A;  4LE9 A;  3A98 A;  4R0K A;  1SRM A;  2DL8 A;  3O5Z A;  3H0I A;  1CKA A;  4F16 A;  1UG1 A;  1AWX A;  5HCK A;  1M3B A;  2KXC A;  2ECZ A;  3EG0 A;  2OAW A;  3M0T A;  2PZ1 A;  1QKW A;  1UHF A;  1TG0 A;  1YCS B;  1K4U S;  1JU5 C;  2PTK A;  2A08 A;  2HBW A;  1UDL A;  1X43 A;  2KRO A;  2ENM A;  2BZX A;  2KNB B;  1RLQ C;  1NM7 A;  1XOV A;  1N5Z A;  4HVV A;  1K0S A;  2CSQ A;  1SRL A;  1YP5 A;  4RTW A;  1WIE A;  3EG2 A;  2EGE A;  2FO0 A;  1UEC A;  2AKK A;  1GRI A;  1AVZ C;  4DEY A;  1VA7 A;  4RTT A;  1T0J A;  1MV3 A;  3PVQ A;  2AZS A;  2GNC A;  1GCQ C;  2EGA A;  2KYB A;  1AWO A;  2JMA A;  2LMJ A;  2YUP A;  5ECA A;  2LJ3 A;  4J9E A;  1X69 A;  4ESR A;  2LQW A;  2LP5 A;  3I9Q A;  2K6D A;  2DMO A;  2GBQ A;  2K2M A;  3SEM A;  1X6B A;  4AG1 C;  4ZNX A;  3VRY A;  2RQU A;  1ZX6 A;  1PKS A;  1W70 A;  1A0N B;  1GCP A;  4LNP A;  3U23 A;  1H8K A;  2I0N A;  5GJW B;  2AK5 A;  1WFW A;  1FMK A;  1HJD A;  4HVU A;  2RN8 A;  4J9G A;  1OPK A;  1OPL A;  2C0I A;  1PKT A;  1UHC A;  4JJB A;  2HEQ A;  4HVW A; 
#chains in the Genus database with same CATH topology
 3M59 A;  2M1H A;  2K5F A;  1OYX A;  4M75 F;  3UT1 A;  1WA7 A;  1QCF A;  4XAX B;  1Y07 A;  2YXY A;  2CT3 A;  2NUP A;  1U1S A;  1MGQ A;  2QQ9 A;  2X4Y A;  2EQM A;  4DOV A;  1OZ3 A;  1NZ9 A;  1ABO A;  2EWN A;  4JLG A;  5L23 A;  4J5Y A;  1ARK A;  4RTY A;  2JS0 A;  3FJP A;  1J3T A;  5CCA A;  1AWW A;  2FG0 A;  2VKN A;  3O8V A;  2EAY A;  5GAM g;  2RO0 A;  2Y4Y A;  3UPU A;  2CSI A;  3FEO A;  4BE0 A;  1N6A A;  1M1K R;  3V8L A;  3JB9 H;  4OMQ A;  2RHZ A;  2ED1 A;  1YIT T;  3CCJ T;  3DLL A;  3FLG A;  2DXC A;  3ZL7 C;  1VQK A;  1VQK T;  1EZZ B;  3CC4 Q;  1MUZ A;  3M54 A;  4JRQ A;  4KRT A;  1N8R C;  1QWE A;  2A36 A;  1TUD A;  4N0A C;  2XMF A;  3T9N A;  3S3M A;  4C5G A;  5IXF A;  2CRE A;  4MML A;  2JOY A;  5KYU B;  2HNI A;  1U5S A;  3QHS A;  3RMQ A;  2NWM A;  3FJ5 A;  2E4H A;  2CGH A;  4IUT A;  1RI0 A;  2JUF A;  2OAU A;  2LNH B;  4JRP A;  1AZG B;  1OU8 A;  2RPN A;  3R6N A;  2W10 A;  1OI1 A;  2DK3 A;  1H3H A;  1VQ6 A;  1KFZ A;  2KI7 A;  1YJ9 Q;  4WCI A;  3G71 A;  3CPW A;  2F2X A;  3JCM c;  2DXT A;  4J9B A;  2LVM A;  2KBT A;  1JJ2 P;  2EIF A;  1VQN A;  5D6X A;  4LDV A;  1G3S A;  2RI2 A;  4V2S A;  4XK8 E;  5AYF A;  1QVG P;  4OMP A;  4BE1 A;  3RNJ A;  3UAT A;  5J39 A;  4GBQ A;  5D6W A;  1D3B B;  4LDU A;  1XJW B;  2DM1 A;  3DKM A;  4FW2 A;  1BU1 A;  5KYX B;  2XID A;  5GAN 8;  1M3C A;  2VWF A;  2XKO C;  3M57 A;  1IRX A;  3RKY A;  4ZN1 A;  3PVL A;  3CC4 A;  3RDV A;  1M90 C;  2VC8 A;  3CEY A;  1M1K C;  1SKU B;  2CP3 A;  1RL2 A;  1VQ5 T;  2KYM A;  4HCC A;  4EPC A;  5GMK h;  2RQW A;  2RNA A;  1YJW Q;  1IGU A;  5IH2 A;  3I55 Q;  1IZ6 A;  3D7S B;  3L2U A;  3OYG A;  1EFN A;  4M75 C;  4E47 A;  1KD1 R;  1E6G A;  1ACM B;  2HSE B;  3EGD B;  1RAI B;  4NS5 A;  3M0Q A;  4M75 A;  3CCM A;  2OI3 A;  1NPP A;  1VQL T;  1X2Q A;  3PMI A;  2FYK A;  2DBM A;  5LJ3 j;  2YUO A;  4A4K A;  2J05 A;  3M53 A;  4IUQ A;  1YHQ A;  1NJI C;  3RER A;  1SG5 A;  2ZCF B;  4M77 G;  1MMN A;  2ED0 A;  1WGS A;  1TOV A;  3QWX X;  4FM4 B;  1KQS A;  3KFV A;  4RG2 A;  2NUP B;  3MP1 A;  2AIR B;  5GMK e;  2FEI A;  2BZY A;  4QQD A;  3EGX A;  1R0B G;  3E9F A;  1K76 A;  4F04 B;  2QTX A;  2K2V A;  3EHQ A;  2HDA A;  2XDD A;  2EYY A;  2F5T X;  3L1A A;  1WXB A;  3HP9 A;  2L2P A;  1H64 1;  1VQ7 A;  2X51 A;  2OJ2 A;  2QI2 A;  2MMP A;  2J6O A;  4ZN3 A;  2QEX A;  4BI3 A;  1MMD A;  4C5E A;  3CCL Q;  3NPF A;  2LQK A;  1SPK A;  2OTL T;  4RUG A;  2EYZ A;  5GJV B;  2X4W A;  4E7I A;  3QUI A;  1WI7 A;  5IT9 E;  3OYC A;  1BKB A;  1X2K A;  3M0P A;  2GCX A;  2NUZ A;  5CKD A;  4J83 A;  1VQP Q;  3SHW A;  3HKS A;  3JCM b;  2CP7 A;  2DTO A;  1QVG S;  5D6Y A;  5EG2 A;  5J26 A;  2E6Z A;  1BI3 A;  1IO6 A;  2DPP B;  5DM7 R;  1K9M R;  1JXM A;  3NFC A;  2KRM A;  1Q7Y C;  1GBR A;  2YUN A;  5LL6 S;  5KYW B;  4E7J A;  4PJO G;  1ZLM A;  4JZ4 A;  3V7S A;  3I5R A;  3CCU A;  1YIJ Q;  2KXD A;  2DTH A;  2I2L A;  4JS5 A;  2RI3 A;  1GBQ A;  2K7A A;  1DJ7 B;  2KT1 A;  2DVE A;  2AHJ B;  4C92 A;  4PJO E;  3VYG A;  2J7I A;  2JT4 A;  1WHL A;  3CQT A;  2RM4 A;  4CI0 C;  4FIB A;  2JN0 A;  4LDY A;  5FRN A;  2DRK A;  4C92 F;  4R56 A;  2JMC A;  2HQX A;  4PJJ A;  1S72 T;  4HA8 A;  2CP5 A;  4B9X A;  2RF0 A;  3CCJ Q;  2L3Q A;  1YBY A;  2QEX T;  1VIE A;  1LVK A;  2ROL A;  4LD9 K;  3JV3 A;  4DEX A;  5A0L A;  4GLM A;  2O88 A;  3C94 A;  3CCV A;  4M7A G;  1GFD A;  4CRI A;  2ABL A;  1AD5 A;  2EYW A;  2OTJ T;  1T3L A;  5IXB A;  1VUB A;  1Y0M A;  1C0M A;  1WYX A;  1I07 A;  2RD1 A;  3AT1 B;  3VU3 C;  4XTY A;  3WVE B;  2DER A;  1Z9Z A;  4ZTJ A;  3RR6 A;  2DIQ A;  3I56 Q;  2XI9 A;  2YRV A;  4Y91 A;  4AFS C;  2DRM A;  3IQL A;  4E7Z A;  3OSS C;  4PJO D;  2KQW A;  1VQ6 T;  4AMC A;  2HKN A;  2Y90 A;  4IIM A;  4M7D D;  4R0K A;  3A98 A;  1SRM A;  1I8F A;  1M1K U;  3OW2 P;  4J8O A;  4DBF A;  1ZHI A;  1M3B A;  3CMA A;  1MMA A;  3M4G A;  2KXC A;  2KMT A;  3EG0 A;  3KBG A;  1EIF A;  5FLX E;  2OAW A;  2PUK B;  5I21 A;  2PZ1 A;  4IUR A;  1JU5 C;  3CCM T;  3S3O A;  2PTK A;  2A08 A;  3OQ5 A;  3QBY A;  3G71 T;  5CR2 A;  2E70 A;  1HXD A;  2A3L A;  1K0S A;  2CSQ A;  1SRL A;  4A4H A;  1WIE A;  1NE8 A;  1UEC A;  2NUT B;  4F7U A;  1GRI A;  3H6Z A;  1SSF A;  4M77 B;  1ZSZ A;  1T0J A;  3OYK A;  5FRO A;  2E41 A;  1D0X A;  4QW2 A;  1GCQ C;  2KYB A;  2DFU A;  4RG8 A;  2NLU A;  3JB9 I;  2JMA A;  4ATO A;  4FYX B;  5A0D A;  1QVF A;  1X69 A;  2ZZD A;  4FSX A;  3L2Z A;  4C5I A;  4Y28 E;  5KYY B;  5GAO p;  1X6B A;  2EJG A;  2RQU A;  1ZX6 A;  3CXC A;  1A0N B;  4OF1 A;  4LNP A;  2I0N A;  4KGV B;  2DZ9 A;  2G3R A;  2QA4 A;  3DLM A;  4OB0 B;  5GAO m;  1YJN A;  4KGX B;  1D0Z A;  2DL4 A;  1VQ9 Q;  2GQV A;  1JBM A;  2D9T A;  4M77 D;  1YHQ T;  2RJC A;  1TS9 A;  2H8H A;  1YFN A;  2C06 A;  5LJ5 d;  3HHT B;  1VQO A;  4B6M A;  3QJY A;  3OS5 A;  2L3S A;  4C8Q G;  3CCR A;  2F2W A;  5GAN 3;  4GLK A;  2VGN A;  1BIA A;  1SF9 A;  3G6E A;  1VQ9 T;  3I35 A;  1LPL A;  3QJ6 A;  4ORZ A;  2RQT A;  1E7O A;  2PQW A;  1KJW A;  3CCQ T;  1ZBJ A;  4XTW A;  3CC7 Q;  2JXB A;  4PLL A;  4IKF A;  5A0G A;  1ZUY A;  2A28 A;  5GAO l;  2MCN A;  2HBP A;  3VS0 A;  3JCM X;  3CCL T;  2QA4 Q;  4C8Q C;  3CCQ Q;  4F14 A;  2B86 A;  1WZO A;  1QQJ A;  2O4X A;  1Y96 B;  2F2V A;  2CS7 A;  5HY6 A;  1BCM A;  1ZSZ C;  1KG1 A;  1QLY A;  1GXI E;  2RHY A;  1RLP C;  5FWB A;  2K3Y A;  3MKD A;  1X75 C;  4ME7 A;  4C92 D;  4XTX A;  1WJQ A;  1VQ8 A;  1YWO A;  6AT1 B;  3L42 A;  5GAN e;  4M77 E;  1I81 A;  2YSQ A;  2RB6 A;  1IHV A;  2JNG A;  2QQA A;  4M7A E;  5GAO q;  3V8K A;  2FVU A;  2P84 A;  3VV0 A;  1M30 A;  1HSQ A;  1TWB A;  1KQ1 A;  1JO8 A;  3UA6 A;  1OV3 A;  2K57 A;  2WAC A;  3J7A F;  4PL6 A;  1YI2 Q;  1M90 R;  4F7U B;  3CBO A;  2F69 A;  2FRW A;  3G1J A;  3X24 B;  1VQ6 Q;  4KGZ B;  2LNV A;  3M0R A;  1P92 A;  1UJY A;  1ZA1 B;  4M78 F;  3N5B B;  5I2S A;  4KUL A;  5GAN h;  4AFU C;  2HD0 A;  2L5Q A;  3NHN A;  2LCL A;  1R8O B;  4EMK B;  2FL7 A;  2ROT A;  3CC2 A;  2QQB A;  3HL8 A;  5KCH A;  2FHD A;  5FRM A;  2FZC B;  1D09 B;  2EVR A;  3KUF A;  4RCC A;  1M8M A;  4LN2 A;  5FU6 B;  3HFO A;  4F17 A;  1VIF A;  1Y57 A;  3MHX A;  1N8R R;  2KK4 A;  4XTV A;  1WQW A;  2DKG A;  1MHN A;  3I56 A;  3CME Q;  1RI9 A;  1YN8 A;  1M2V B;  3PTA A;  2OTJ Q;  2LT1 A;  2BTT A;  1YJN Q;  4E7H A;  1ZSZ B;  4JJN K;  5DLQ E;  4A4G A;  3ZFJ A;  2GFU A;  3CCE T;  1B34 A;  1M5Q 1;  4FSS A;  3UWN A;  1X27 A;  1Q95 G;  3GBQ A;  2M16 A;  1QP2 A;  1VQP T;  1T3S A;  3SWN B;  1SSH A;  3CC2 Q;  1ZUU A;  1JEG A;  1Q86 R;  3JCM Q;  3LYI A;  1WHG A;  4PFZ A;  1WHJ A;  3L2R A;  1LOJ A;  2RJD A;  1VYU A;  2K79 A;  2PVG B;  1UFF A;  2LC4 A;  1SEM A;  2DYI A;  4XQ3 A;  4X1V A;  4IIO A;  4BI8 B;  1VQM T;  1VQM A;  1BCO A;  1WNL A;  1NYF A;  4AT1 B;  3ZBD A;  4D8K A;  1XTD A;  3FB9 A;  1MV0 B;  4JLI A;  2F5K A;  1GCQ A;  1BI1 A;  1IHW A;  5GMK m;  4OB3 B;  3M0U A;  1HD3 A;  3BDL A;  1M2O A;  3NTH A;  2XDB A;  3CCV T;  5FU7 C;  2D8H A;  1QCO A;  1K9M C;  3UA7 A;  1AWJ A;  2DZC A;  4C8Q F;  4PK4 A;  4D6W A;  2OTL A;  2FRY A;  2M0Y A;  3H41 A;  1JB0 E;  2HKQ B;  2EQI A;  2Z0W A;  3P8H A;  3CCS Q;  2RI5 A;  4FT4 A;  3EGX B;  1KIK A;  1NEB A;  2ZAE A;  1K8A C;  2EW3 A;  2J6F A;  4MDX A;  1GFC A;  4C0D C;  2DA9 A;  2EGC A;  5KCO A;  1WHK A;  3OYY A;  4K11 A;  3PIP A;  1V76 A;  1QVF S;  4M7A C;  4BDZ A;  2QGF B;  4Z8A A;  1UEB A;  4OB2 B;  4FYW B;  3OB9 A;  4J9C A;  5KH6 A;  1U8R A;  1NLP C;  2C0T A;  3R6O A;  4M77 C;  2H3E B;  4BI4 A;  1XNI A;  2CYZ B;  2YT6 A;  3OYM A;  1KC8 U;  3PT9 A;  1G83 A;  4M78 A;  2D0N A;  2JS2 A;  1S72 Q;  3SD4 A;  3CCM Q;  1TUC A;  1NJI R;  3VS7 A;  1M27 C;  1M9S A;  3VS5 A;  4GY5 A;  4B9W A;  1D1A A;  4IUP A;  4J9D A;  2AKL A;  3EG1 A;  4PJN A;  5GAN d;  1S1N A;  3VS3 A;  2YWW A;  3EFR A;  2H3J A;  4J7I A;  2FZG B;  5GAN 5;  4RTZ A;  2DD5 A;  4M7D B;  4E7K A;  2DBK A;  3VKI A;  4LXC A;  1FMW A;  3URG A;  2KRS A;  3X25 B;  2E1H A;  1KQ2 A;  2QDL A;  4Z02 A;  4QVD A;  3TEE A;  3JSC A;  2CH4 W;  4C92 C;  1WDX A;  3RKX A;  3TQ7 P;  2FZK B;  3JB9 J;  2JTM A;  1NYG A;  4BY6 B;  2O2O A;  1OQK A;  2EBP A;  5LJ5 g;  3OYN A;  4Q5W A;  4C92 B;  4TVR A;  1VOM A;  4DBQ A;  5DY9 A;  4QKU A;  5GAN f;  2D8J A;  3EGU A;  4PFP A;  2JW4 A;  2GQI A;  2V26 A;  1QVP A;  4F7U E;  4FYV B;  1I5O B;  2YHT A;  4OGE A;  1VQ5 Q;  8AT1 B;  2DEQ A;  5GAM h;  2FPE A;  3A1P A;  4C92 G;  1WHM A;  3A8L B;  1H92 A;  2BE9 B;  2QAS A;  4J6W A;  4M7A B;  2DL8 A;  3H0I A;  2MI6 A;  4EMK A;  5HCK A;  1IB8 A;  3CXC P;  4C0D B;  1VQ4 Q;  4HT8 A;  2E10 A;  3JB9 F;  4OGC A;  1QKW A;  1K4U S;  1OZ2 A;  2HBW A;  3OW2 S;  2WSC E;  4C0F A;  3CMA Q;  3LLR A;  3CD6 A;  2XHC A;  1OX8 A;  5KYW A;  1XOV A;  3OS2 A;  1N5Z A;  4PJO F;  1V29 B;  3WVD B;  2Y4X A;  3HFN A;  4RTW A;  2M9U A;  3TRE A;  3OS1 A;  1VA7 A;  3RIR A;  3PFS A;  5KE2 A;  5KYN A;  4O5V A;  4BE2 A;  4ZGD B;  2HL3 A;  3CCE Q;  4RMO A;  4VUB A;  4C0G A;  3VUZ A;  3GPL A;  3RES A;  2LP5 A;  2L3R A;  2R57 A;  4C5H A;  4WTO B;  1TTH B;  1G3T A;  4AG1 C;  1WHH A;  2VV5 A;  5GMK j;  1PKS A;  1W70 A;  1H8K A;  3OYE A;  5GJW B;  3CME A;  2XDP A;  3LGL A;  3EFS A;  2LX9 A;  2CP0 A;  4HVU A;  3JB9 D;  1M1G A;  3SFM A;  4ANJ A;  4PJM A;  1D1C A;  3LGF A;  4JJB A;  5GAM d;  4HVW A;  1OUL A;  2EYX A;  3A8H B;  1VQO Q;  2ZPI B;  1G2B A;  4OMO A;  3QYH B;  1Q81 U;  1VQ9 A;  2DXU A;  2BKD N;  5HK0 A;  3V7C A;  3J80 E;  4FCY A;  3L2W A;  3TVT A;  2RQV A;  3FDR A;  3L2V A;  2ZPH B;  1YI2 A;  3QWY A;  4D8D A;  3C0C A;  1VQ8 T;  2E65 A;  5FW9 A;  3GP8 A;  3M4Y A;  2DL3 A;  3OBW A;  1RAB B;  2COZ A;  4F7U F;  3VS6 A;  4N4G A;  4MMK A;  4FW1 A;  2QAZ A;  4J7F A;  4KH0 B;  3C4S A;  1AHJ B;  1I4K 1;  4Z89 A;  3EHR A;  3SWN C;  2HCK A;  1VQ8 Q;  3H0H A;  2YRC A;  2BIV A;  5CVI A;  2QEX Q;  2QA4 T;  2KR3 A;  4M7D G;  4M4Z A;  4JUV A;  2QXF A;  4L6V 5;  3QO3 A;  4M78 B;  2V8K A;  1EX4 A;  4NOY A;  4M75 E;  3SDZ A;  3X20 B;  3JCM g;  3QSU A;  4P5N A;  2SEM A;  1JXO A;  4M78 C;  4AFZ C;  3V8J A;  3A8O B;  1VQO T;  2IG0 A;  2COY A;  3M58 A;  2V8J A;  1NJI U;  1ABQ A;  1MNE A;  1ZA2 B;  4HCZ A;  7AT1 B;  3UF4 A;  5GAN 6;  5D7U A;  3GNG A;  2FPD A;  2EQU A;  2L3P A;  1KQS S;  1KSW A;  3TCJ A;  2SRC A;  4PJL A;  2MK5 A;  2QQS A;  3CPF A;  1B07 A;  2VUB A;  2LJ1 A;  2MWO A;  1YJN T;  4ELY C;  4PJO A;  2AZV A;  5A2Q E;  3CXC S;  3A5Z B;  5I2M A;  1BIB A;  2L8D A;  4PKC C;  2PNI A;  2HMA A;  4M75 D;  4JDS A;  5KYY A;  1KQS P;  4M7D A;  1K0X A;  3P8B B;  1TH7 A;  2OTJ A;  2CP2 A;  5CO7 A;  3OYJ A;  4L59 A;  3AHU A;  2M0O A;  1LCK A;  1UGR B;  3G4S A;  4CC7 A;  2J06 A;  5LJ5 f;  1QKX A;  4CC4 B;  1NLO C;  1UGV A;  2DJZ A;  3JAM E;  1I5L A;  1VQN Q;  1WXT A;  1Y96 A;  2RMO A;  5DLO A;  1N8R U;  5IHN A;  3QYG B;  1K9A A;  4C8Q B;  1SHF A;  1PRM C;  1W6X A;  2EFI A;  1YIJ A;  3MP8 A;  3G6E T;  1F1B B;  3EFO B;  4FU6 A;  3OSV A;  2ZGW A;  2VVK A;  2JTE A;  4OMF B;  2LQN A;  3G71 Q;  4E7S A;  4M75 B;  1WJR A;  4QQ6 A;  1YJ9 T;  3Q1J A;  2XIC A;  2JJ9 A;  1C6V X;  4RTX A;  2E3H A;  1FYN A;  1Q82 U;  3TSW A;  4BD3 A;  5CQY A;  4M75 G;  2QYZ A;  2RQR A;  2KVQ G;  5EC7 A;  2DJQ A;  1AT1 B;  1WX6 A;  1IRE B;  3E2U A;  3MEU A;  3OMC A;  3S6W A;  3OYB A;  2E6N A;  2RJE A;  3LX7 A;  1PHT A;  4AG2 C;  3NTI A;  4PNO A;  1D0Y A;  3INZ A;  2RK2 A;  1CKB A;  3BDU A;  2W0Z A;  1OOT A;  2MPX C;  2COW A;  1Y71 A;  1RAC B;  3OMG A;  3BE3 A;  1VQ7 Q;  4DA4 A;  3G4S T;  2HAX A;  1U3O A;  2M51 A;  4PJO C;  1WLP B;  1UB4 A;  1M2V A;  3JCM J;  3MEA A;  1VQK Q;  1YWP A;  4MZP A;  1BI0 A;  4A4E A;  1UUE A;  2K3X A;  2P0P A;  4F7U G;  5IAY A;  3QDF A;  4X9D A;  5HKC A;  2LCS A;  4DBH A;  1VQ7 T;  2DD4 A;  1K73 U;  4J9F A;  1OX9 A;  2K9G A;  1GL5 A;  2MIO A;  2DE0 X;  1V1C A;  3BY7 A;  2QK0 A;  3I5S A;  1S72 A;  3GLX A;  2DIL A;  2CKK A;  1VYV A;  4E2F B;  4JS4 A;  4MZM A;  1W2B A;  2E5Q A;  2NYS A;  4BY6 C;  1YCY A;  1K1Z A;  3RUX A;  1Q7Y R;  3CCU Q;  1JJ2 A;  2ZPB B;  3VS4 A;  1BB9 A;  4M7D E;  2O9V A;  4J9I A;  2KY9 A;  3QII A;  5KYX A;  4HXJ A;  4MZT A;  1FMV A;  1VQ5 A;  2ZPG B;  4XTZ A;  1PSF A;  2ESW A;  1VYT A;  2QTV A;  4IUV A;  1CSK A;  2E64 A;  4EMG A;  1VQL A;  1YIT Q;  1QCN A;  2XG8 D;  1AZE A;  3PGG A;  4N4H A;  2IVW A;  1VQP A;  2BUD A;  4HKE A;  2EJ9 A;  4HCB A;  2X9H A;  4C8Q A;  4KH1 B;  2KT8 A;  5CKF A;  4IUU A;  3G4S Q;  5LJ3 h;  4XU2 A;  3HTR A;  3NGP A;  4OML A;  2GFA A;  3OW2 A;  3E9G A;  2IIM A;  3H8Z A;  3P8D A;  3C12 A;  5CKB A;  2YDL A;  2DXB A;  4YTL A;  1T0H A;  3OYH A;  1YIT A;  1AEY A;  3JCM W;  2DL5 A;  4J9H A;  1YJ9 A;  4CC2 A;  3EG9 B;  1U06 A;  5GAN g;  3PE0 A;  3MET A;  1VQ4 T;  1VQN T;  2LRQ A;  2LCC A;  3DB4 A;  1ZBX A;  4RTU A;  2EKH A;  3JCM e;  3G7Z A;  2LDM A;  2JM9 A;  5LJ3 e;  4LE9 A;  1RAG B;  2XU8 A;  1KD1 U;  2HZY A;  3O5Z A;  3I56 T;  1YIJ T;  3CBP A;  1M90 U;  1AWX A;  3HPW A;  4E7L A;  5LJ5 j;  5CAI A;  2ECZ A;  3PNW C;  3M0T A;  1O9S A;  2P0K A;  2R58 A;  5CQX A;  1LJO A;  1UHF A;  2K4Y A;  2XD0 A;  2EQJ A;  1UDL A;  1X43 A;  1JJ2 S;  2KRO A;  2BZX A;  3HRU A;  3VUB A;  2KNB B;  1RLQ C;  1BI2 A;  3J81 E;  3I55 A;  1PCX A;  1YJW A;  4HVV A;  5C6S A;  3OY9 A;  2IPO B;  4ELZ C;  5GAM e;  1YP5 A;  2FO0 A;  5FU7 B;  2A0F B;  1TSF A;  4OB1 B;  4RTT A;  3V7R A;  2RA2 A;  2EQK A;  1MV3 A;  2AZS A;  1Q82 C;  2DEU A;  3CCV Q;  1PG5 B;  2E3I A;  2GNC A;  2EGA A;  4FYY B;  2MYS A;  2LMJ A;  1R0C B;  2YUP A;  2K5I A;  5ECA A;  1TU0 B;  4J9E A;  2HQE A;  2EJF A;  2LQW A;  5CKE A;  5GMK i;  3VJP A;  2KDS A;  3SEM A;  3CCE A;  4OP0 A;  4ZNX A;  4ZTF A;  1UGS B;  2AT1 B;  2MF2 A;  4FT2 A;  5LJ5 e;  5GAM f;  2WSE E;  1WFW A;  2RJF A;  4J9G A;  1N27 A;  1OPK A;  1OPL A;  1K73 R;  3CD6 Q;  2VGM A;  1PKT A;  1UHC A;  5KYU A;  4C92 E;  5CK9 A;  1RAE B;  1WJS A;  2CZ7 B;  2HEQ A;  3WXM B;  3CCR T;  1QVF P;  1KK7 A;  1VQL Q;  1TUG B;  3RBB B;  2CZ0 B;  2CT4 A;  2DTI A;  2HSP A;  2PVO B;  3CC7 T;  1IXD A;  1JQQ A;  1VQM Q;  2MOX A;  2LZ6 B;  5LJ5 h;  2ATC B;  2E12 A;  2VAS A;  2A37 A;  4C8Q E;  4OMM A;  3E19 A;  4XTU A;  5LJ3 d;  2VYT A;  2HQH A;  4PFO A;  4M7A A;  2YLB A;  5CKH A;  1N9S A;  5J3B A;  2KAF A;  3MCA B;  3VS1 A;  4EMH A;  1FXX A;  3VS2 A;  1W1F A;  3ZEH A;  4C0Z A;  2YUQ A;  4JJC A;  1ZSG A;  9ATC B;  2MAM A;  4XU0 A;  1FWZ A;  3QKJ A;  1I0C A;  1LNX A;  1JRI A;  8ATC B;  2LT4 A;  3QPH A;  4PLI A;  2EPD A;  3JCM V;  4M7D F;  3LH5 A;  3TU4 K;  2DIG A;  1KD1 C;  2R5M A;  3BFM A;  2PVD B;  2DNU A;  4Y92 A;  2M02 A;  1I1J A;  4LUD A;  3UDC A;  3ME9 A;  5GAN 4;  1W2B P;  2DET A;  1YI2 T;  2PUO B;  3EGD A;  2VXE A;  1R77 A;  5IHK A;  4RKU E;  1PSE A;  4A63 B;  4A54 A;  1RUW A;  4JRK A;  1Q86 U;  3CCJ A;  4DOW A;  3CD6 T;  1RAA B;  3REB B;  2CZ6 B;  1N9R A;  4C8Q D;  1YJW T;  3MJX A;  3I55 T;  3LH0 A;  2XK0 A;  3G6E Q;  3OYF A;  4JZ3 A;  1D1B A;  2KGT A;  4LUE A;  3TSZ A;  1PRL C;  2V1Q A;  1UTI A;  3FIF A;  4QVC A;  1RAH B;  5AT1 B;  1UGP B;  3HRS A;  3ULR B;  3X28 B;  4UC4 A;  2BE7 D;  2GGR A;  3MEV A;  2LQ8 A;  3REA B;  4ZGJ B;  1VQ4 A;  3CME T;  5CIU A;  2DF6 A;  1KHI A;  1Q81 C;  2K5L A;  2V8I A;  3EH1 A;  1HYO A;  1K9M U;  2L89 A;  3SB2 A;  1Z9Q A;  2MWP A;  3CMA T;  3QZ9 B;  4Z88 A;  2RHI A;  2KEA A;  5GAN 2;  3CBM A;  3CPW P;  1Q81 R;  2C0O A;  4M7D C;  1RAD B;  1BK2 A;  4XU3 A;  3OYA A;  3CCS A;  4HT9 A;  3ER0 A;  4M77 F;  2X3X D;  2YLC A;  1NPR A;  4M7A D;  1FX7 A;  1QW1 A;  2K3B A;  1M3A A;  2OTL Q;  3QXE B;  4OVA A;  2FB7 A;  2DO3 A;  2P0Q A;  1AOJ A;  4M78 G;  1G3W A;  3H0F A;  1OEB A;  3PMT A;  2V1R A;  4A4F A;  3CCL A;  4DQ2 A;  2PU9 B;  1B34 B;  3EG3 A;  1X6O A;  1E6H A;  3CPW S;  2P4R A;  4QVZ A;  2LJ0 A;  1UE9 A;  3NMZ C;  4M78 E;  4HCK A;  4AFQ C;  3VRZ A;  4J6Y A;  5GAO n;  4L5G A;  3M56 A;  2KSS A;  3SWN A;  1D3B A;  3MP6 A;  3GNF B;  1YNZ A;  2CDT A;  1HK9 A;  2X4J A;  1NEG A;  1BBZ A;  2RK1 A;  2X35 A;  1Y7X A;  3MO8 A;  5I22 A;  4PJO B;  5LJ3 f;  4LD6 A;  3EAE A;  1PNJ A;  2D6F A;  1SHG A;  1PD0 A;  2CUD A;  3JB9 G;  4NL3 A;  2WSF E;  1MMG A;  3CC7 A;  2O4X B;  3BW1 A;  3ASK A;  4BUG A;  4JPB W;  2L0A A;  2J6K A;  1WXU A;  2D0Q B;  3FRN A;  3CCU T;  1G5V A;  4FL6 A;  5FWC A;  4QT7 A;  2ZPF B;  2LX7 A;  2QQR A;  4M7A F;  4RTV A;  3NTK A;  3M5A A;  4XU1 A;  2CUB A;  5GAM j;  1KHC A;  1PWT A;  3M9Q A;  4X9C A;  1UGQ B;  2LTO A;  2RHU A;  2O31 A;  4KT0 E;  1O75 A;  3MPU B;  5KE3 A;  3RKW A;  1PD1 A;  2YRD A;  3OYI A;  4M78 D;  1ZUK A;  3THK A;  1X01 A;  2RHX A;  5GAN 7;  5GAO r;  1B3Q A;  3X26 B;  1W4S A;  2BZ8 A;  3JCM d;  4RCB A;  1QWF A;  4N4I A;  3KXT A;  1Q86 C;  5M9O A;  4BB7 A;  2DX1 A;  3M55 A;  3H9N A;  2VB6 A;  2EYQ A;  2JTF A;  2DVJ A;  3A8M B;  5HK3 A;  1B7T A;  3DB3 A;  3LWI A;  3LW5 E;  1OU9 A;  4CC3 A;  2E5K A;  2F1L A;  3EH2 A;  3HSB A;  1QVG A;  1QMC A;  1KC8 C;  2QGG A;  4M77 A;  4II1 A;  4OMN A;  3EFO A;  4EIK A;  2VXF A;  2GTO A;  2DL7 A;  1U1T A;  5FU6 C;  4N0A A;  1K73 C;  1NG2 A;  1XQH A;  2JVV A;  3OYL A;  1RAF B;  2FPF A;  3MEW A;  1M4Z A;  2DYB A;  3QG1 A;  3L2Q A;  4EMK C;  2KE9 A;  3OA6 A;  5C0M A;  4R55 A;  4LDW A;  5GMK l;  3RMS A;  4E6R A;  2B8A A;  2ZPE B;  2JM8 A;  5I11 A;  1IGQ A;  1G8X A;  3E1S A;  2RH2 A;  1BYM A;  5IN1 A;  3CCS T;  3M0S A;  2O9S A;  3PIO A;  1Q7Y U;  2CH4 A;  2CZ1 B;  4NL2 A;  2DLP A;  4MDW A;  3QZ5 B;  4J6X A;  1UJ0 A;  1Q82 R;  5IHI A;  3OYD A;  2GTJ A;  2D1X A;  3F70 A;  1KC8 R;  3GIB A;  1TXQ A;  2G6F X;  1NBE B;  2KRN A;  2X3W D;  1K8A R;  2P4T A;  1C1A A;  1G3Y A;  1X6G A;  4JJD A;  2CP6 A;  1M1F A;  3VYH B;  5GAN j;  4BDY A;  3CC2 T;  3CCR Q;  1WQ7 A;  3GF5 A;  1M8V A;  1QP3 A;  1YHQ Q;  4ZGE B;  5LJ3 g;  1CKA A;  4BAC A;  4F16 A;  2JZ2 A;  3LWH A;  1UG1 A;  2NUT A;  3JRZ A;  1W2B S;  1PM3 A;  1TG0 A;  1YCS B;  2R5A A;  2QG9 B;  3EG9 A;  2ENM A;  4A53 A;  1H3Z A;  1NM7 A;  2A7Y A;  2O01 E;  2GF7 A;  1K8A U;  3GOX A;  4LDX A;  3JCM P;  3A8G B;  2EKO A;  3HRT A;  3JCM h;  1MND A;  2DAQ A;  4EDU A;  4WF2 A;  3EG2 A;  4KUD K;  2EGE A;  3OS0 A;  2AKK A;  2OX7 A;  1AVZ C;  4DEY A;  4X34 A;  4QQG A;  3PVQ A;  1AWO A;  3OBY A;  4JRI A;  2LJ3 A;  2X4X A;  4ESR A;  3I9Q A;  4DBR A;  2K6D A;  5L8R E;  2DMO A;  2GBQ A;  3C95 A;  2K2M A;  3JCM f;  3CC4 T;  3S3N A;  3FC3 A;  3VRY A;  1GCP A;  3U23 A;  4O6J A;  2AK5 A;  3QDR B;  1FMK A;  1HJD A;  3CCQ A;  1WPY A;  2HL5 C;  2RN8 A;  1ZQ1 A;  2C0I A;  4KBM B;  1PC0 A;  2QDY B;  4KUI A; 
#chains in the Genus database with same CATH homology
 2EYX A;  2DL4 A;  1WA7 A;  1G2B A;  1QCF A;  4OMO A;  3RBB B;  2CT4 A;  2H8H A;  2CT3 A;  2HSP A;  1JQQ A;  2MOX A;  2L3S A;  2LZ6 B;  2F2W A;  1ABO A;  5L23 A;  2A37 A;  1ARK A;  4OMM A;  4RTY A;  3I35 A;  2JS0 A;  4ORZ A;  2RQT A;  1E7O A;  1J3T A;  1KJW A;  1ZBJ A;  1AWW A;  3TVT A;  2JXB A;  2RQV A;  2FG0 A;  3VS1 A;  2VKN A;  3VS2 A;  1ZUY A;  1W1F A;  3QWY A;  4D8D A;  2A28 A;  3C0C A;  2YUQ A;  5FW9 A;  4JJC A;  2MCN A;  1ZSG A;  3VS0 A;  2DL3 A;  1I0C A;  2CSI A;  3VS6 A;  4F14 A;  2B86 A;  2EPD A;  3LH5 A;  4Z89 A;  3EHR A;  2F2V A;  4OMQ A;  2HCK A;  2ED1 A;  2DNU A;  1QLY A;  1RLP C;  3H0H A;  4Y92 A;  5FWB A;  3ZL7 C;  1I1J A;  4LUD A;  1MUZ A;  2KR3 A;  4M4Z A;  4KRT A;  1QWE A;  2A36 A;  1YWO A;  1TUD A;  2XMF A;  2YSQ A;  5IHK A;  4A63 B;  5IXF A;  2CRE A;  1RUW A;  2SEM A;  1JXO A;  1M30 A;  1U5S A;  1HSQ A;  1JO8 A;  3UA6 A;  3REB B;  1OV3 A;  2NWM A;  3FJ5 A;  4AFZ C;  2LNH B;  2FRW A;  1ABQ A;  4JZ3 A;  3M0R A;  3UF4 A;  1AZG B;  2KGT A;  4LUE A;  1UJY A;  3TSZ A;  2RPN A;  1PRL C;  2V1Q A;  3R6N A;  1UTI A;  2W10 A;  4AFU C;  1H3H A;  3ULR B;  2FPD A;  1KFZ A;  3NHN A;  2GGR A;  2L3P A;  3REA B;  4WCI A;  1KSW A;  2DF6 A;  2SRC A;  2F2X A;  1B07 A;  2ROT A;  2LJ1 A;  4J9B A;  2EVR A;  2KBT A;  1Z9Q A;  1M8M A;  4LN2 A;  4F17 A;  1Y57 A;  4Z88 A;  2AZV A;  2KEA A;  1RI9 A;  1YN8 A;  2C0O A;  4OMP A;  1BK2 A;  2PNI A;  3RNJ A;  2BTT A;  3UAT A;  2X3X D;  4GBQ A;  1K0X A;  2DM1 A;  2K3B A;  1M3A A;  1BU1 A;  1M3C A;  1LCK A;  1AOJ A;  2VWF A;  4CC7 A;  2J06 A;  1OEB A;  3H0F A;  3PVL A;  2V1R A;  1QKX A;  4FSS A;  4CC4 B;  1NLO C;  1UGV A;  1X27 A;  3EG3 A;  1E6H A;  3GBQ A;  2P4R A;  1WXT A;  2KYM A;  2LJ0 A;  2RMO A;  1UE9 A;  3NMZ C;  1T3S A;  4HCK A;  4AFQ C;  3VRZ A;  5IHN A;  1SSH A;  1ZUU A;  1JEG A;  2RQW A;  1K9A A;  2RNA A;  1YNZ A;  5IH2 A;  2CDT A;  1SHF A;  1NEG A;  1PRM C;  1BBZ A;  1W6X A;  1EFN A;  5I22 A;  1E6G A;  1PNJ A;  1VYU A;  1SHG A;  2CUD A;  3M0Q A;  2VVK A;  2JTE A;  2OI3 A;  2K79 A;  1X2Q A;  2LQN A;  1UFF A;  1SEM A;  2DBM A;  4X1V A;  2YUO A;  2J05 A;  4JPB W;  4IIO A;  2L0A A;  2ED0 A;  2J6K A;  1WXU A;  1NYF A;  4D8K A;  5FWC A;  3QWX X;  4RTX A;  1FYN A;  3KFV A;  1MV0 B;  4QT7 A;  1GCQ A;  2LX7 A;  3TSW A;  2FEI A;  4RTV A;  3M0U A;  2BZY A;  1HD3 A;  2RQR A;  1K76 A;  2CUB A;  3EHQ A;  2HDA A;  5EC7 A;  2DJQ A;  2EYY A;  1PWT A;  1WX6 A;  1WXB A;  2L2P A;  2D8H A;  2OJ2 A;  3UA7 A;  1AWJ A;  2O31 A;  1PHT A;  4AG2 C;  2J6O A;  2FRY A;  2M0Y A;  3H41 A;  1CKB A;  2W0Z A;  1OOT A;  3NPF A;  2EQI A;  1SPK A;  1ZUK A;  4RUG A;  2EYZ A;  5GJV B;  3THK A;  1WI7 A;  1U3O A;  2M51 A;  1KIK A;  1WLP B;  1NEB A;  1X2K A;  1B3Q A;  2EW3 A;  2J6F A;  3M0P A;  2NUZ A;  1YWP A;  1GFC A;  2BZ8 A;  1UUE A;  2DA9 A;  2EGC A;  1QWF A;  4K11 A;  3SHW A;  2LCS A;  4Z8A A;  2DX1 A;  4J9F A;  2K9G A;  1GL5 A;  2MIO A;  1IO6 A;  2DE0 X;  2DVJ A;  4J9C A;  1JXM A;  1V1C A;  1NLP C;  2KRM A;  1GBR A;  2YUN A;  2C0T A;  3I5S A;  4CC3 A;  1ZLM A;  4JZ4 A;  2E5K A;  2DIL A;  1VYV A;  3I5R A;  2KXD A;  1GBQ A;  2K7A A;  2YT6 A;  2KT1 A;  1G83 A;  1K1Z A;  2D0N A;  2JS2 A;  1TUC A;  2J7I A;  3VS4 A;  1BB9 A;  3VS7 A;  2O9V A;  4OMN A;  2JT4 A;  3CQT A;  1M27 C;  4J9I A;  4EIK A;  3VS5 A;  4HXJ A;  2GTO A;  4J9D A;  2DL7 A;  2AKL A;  2DRK A;  2ESW A;  3EG1 A;  1NG2 A;  1VYT A;  1S1N A;  2JMC A;  1CSK A;  3VS3 A;  2FPF A;  2DYB A;  1AZE A;  4RTZ A;  2RF0 A;  2KE9 A;  2DBK A;  4E6R A;  2L3Q A;  2JM8 A;  2ROL A;  2KT8 A;  2KRS A;  5I11 A;  3JV3 A;  4DEX A;  4GLM A;  2QDL A;  2O88 A;  3M0S A;  2O9S A;  2CH4 W;  3NGP A;  2CH4 A;  1GFD A;  4OML A;  2ABL A;  1AD5 A;  2EYW A;  1WDX A;  1T3L A;  2IIM A;  5IXB A;  2DLP A;  1NYG A;  1Y0M A;  1UJ0 A;  1WYX A;  2O2O A;  1I07 A;  5IHI A;  2EBP A;  2YDL A;  1T0H A;  2GTJ A;  1AEY A;  2D1X A;  1Z9Z A;  2DL5 A;  4J9H A;  4CC2 A;  4AFS C;  1U06 A;  2D8J A;  3EGU A;  3PE0 A;  2DRM A;  2JW4 A;  3IQL A;  2GQI A;  2G6F X;  2KRN A;  4RTU A;  2X3W D;  2EKH A;  2FPE A;  1X6G A;  4JJD A;  4IIM A;  2JM9 A;  1H92 A;  4LE9 A;  3A98 A;  4R0K A;  1SRM A;  2DL8 A;  3O5Z A;  3H0I A;  1CKA A;  4F16 A;  1UG1 A;  1AWX A;  5HCK A;  1M3B A;  2KXC A;  2ECZ A;  3EG0 A;  2OAW A;  3M0T A;  2PZ1 A;  1QKW A;  1UHF A;  1TG0 A;  1YCS B;  1K4U S;  1JU5 C;  2PTK A;  2A08 A;  2HBW A;  1UDL A;  1X43 A;  2KRO A;  2ENM A;  2BZX A;  2KNB B;  1RLQ C;  1NM7 A;  1XOV A;  1N5Z A;  4HVV A;  1K0S A;  2CSQ A;  1SRL A;  1YP5 A;  4RTW A;  1WIE A;  3EG2 A;  2EGE A;  2FO0 A;  1UEC A;  2AKK A;  1GRI A;  1AVZ C;  4DEY A;  1VA7 A;  4RTT A;  1T0J A;  1MV3 A;  3PVQ A;  2AZS A;  2GNC A;  1GCQ C;  2EGA A;  2KYB A;  1AWO A;  2JMA A;  2LMJ A;  2YUP A;  5ECA A;  2LJ3 A;  4J9E A;  1X69 A;  4ESR A;  2LQW A;  2LP5 A;  3I9Q A;  2K6D A;  2DMO A;  2GBQ A;  2K2M A;  3SEM A;  1X6B A;  4AG1 C;  4ZNX A;  3VRY A;  2RQU A;  1ZX6 A;  1PKS A;  1W70 A;  1A0N B;  1GCP A;  4LNP A;  3U23 A;  1H8K A;  2I0N A;  5GJW B;  2AK5 A;  1WFW A;  1FMK A;  1HJD A;  4HVU A;  2RN8 A;  4J9G A;  1OPK A;  1OPL A;  2C0I A;  1PKT A;  1UHC A;  4JJB A;  2HEQ A;  4HVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...