4J9BA

Crystal structure of the abl-sh3 domain h59q-n96t mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
PNLFVALYDFVASGDNTLSITKGEKLRVLGYNQTGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the Abl-SH3 domain H59Q-N96T mutant
rcsb
source organism Homo sapiens
total genus 11
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9bA00
4IIOA 2KGTA 2D8HA 2KXCA 1X43A 2FG0A 2A37A 1JU5C 3THKA 2D0NA 1GCPA 2NWMA 1EFNA 2LJ0A 4F17A 2CH4A 2EYXA 1OPLA 2JTEA 3VS5A 1QWFA 1OOTA 2W0ZA 1ABOA 4OMQA 2CT4A 3H41A 3IQLA 1WDXA 3I9QA 1GBRA 4J9DA 2RNAA 2EYZA 1GCQC 2KE9A 4JJBA 2SEMA 4HVVA 2EGCA 2DX1A 2O9VA 2L3SA 1ZUKA 2LQWA 2RQUA 1CKBA 1ZUYA 2AZVA 5EC7A 2AZSA 1WIEA 1IO6A 1BK2A 5IHKA 3NPFA 1QLYA 2JT4A 2J06A 1NYGA 2DVJA 1KIKA 2DL7A 2DL5A 3I5RA 4RTWA 2EYWA 2M0YA 2D1XA 3UA7A 3ZL7C 2KRMA 2LNHB 2EQIA 4OMOA 3M0RA 1UHFA 2A28A 2LQNA 1U5SA 2DJQA 4AG2C 1M3CA 3SEMA 5IHNA 4DEYA 2KRSA 3QWXX 2DA9A 2A36A 5HCKA 2A08A 2CSIA 2G6FX 4OMPA 1Y57A 4J9BA 3M0QA 2DE0X 5IH2A 5GJVB 1WXBA 3O5ZA 1AD5A 2L3PA 2JM9A 2DF6A 2ECZA 2ROLA 1J3TA 4J9FA 1A0NB 3R6NA 3C0CA 1QWEA 2L2PA 2LJ3A 1WLPB 1UDLA 2O9SA 1GRIA 1WA7A 2LCSA 2M51A 4JJDA 4J9GA 2KT8A 3H0IA 4CC4B 2D8JA 1K1ZA 2LZ6B 4OMLA 2LMJA 4OMMA 2YDLA 4X1VA 2F2WA 2X3WD 1YWOA 5IXBA 2RN8A 1FYNA 2AKLA 1K0SA 4CC7A 2J6KA 2PNIA 4WCIA 1I07A 1E7OA 2EPDA 1ZSGA 2FPDA 4K11A 2J6OA 1X6BA 4GBQA 2VWFA 4JPBW 2EW3A 3EGUA 3VS0A 2FRWA 1AEYA 5FW9A 2VVKA 3A98A 4AFZC 2C0IA 4F16A 2EVRA 1VA7A 1SHFA 1OPKA 2DBKA 3VS6A 1UG1A 3VS2A 2FO0A 1W1FA 1SPKA 2CUDA 1T0JA 2QDLA 2BZ8A 2GTJA 3FJ5A 2K2MA 4D8DA 1NEBA 4RTXA 4AFUC 1PWTA 3REBB 2YSQA 2YT6A 1PKSA 4RUGA 1JEGA 2EBPA 4AFSC 1AWOA 2PTKA 2JMAA 2C0OA 3VRZA 4M4ZA 2OI3A 1HJDA 3TSZA 4LNPA 2EGAA 2KRNA 3EG1A 5IHIA 2JS2A 1NEGA 1AZGB 1RLPC 1TUCA 4CC2A 1SRLA 4LE9A 1OV3A 2HEQA 1GFDA 2DYBA 2ED0A 1WXTA 2O2OA 4DEXA 3EG2A 3M0PA 2RPNA 4A63B 2YUNA 1Y0MA 5ECAA 1QKWA 1Z9QA 1VYTA 1ABQA 1M3BA 2GNCA 1M3AA 1YCSB 1H92A 1K0XA 4E6RA 3UATA 1UTIA 3I35A 2KBTA 1QCFA 1I1JA 1WX6A 2J7IA 1X2QA 1OEBA 2V1QA 3U23A 2MIOA 4J9EA 1MV3A 2CREA 2MCNA 2L0AA 4HXJA 2GBQA 4LUDA 2ENMA 2XMFA 1SEMA 2HBWA 1UJ0A 2DNUA 2BTTA 2C0TA 2CT3A 2HCKA 3H0HA 1VYVA 3H0FA 2FPEA 2H8HA 2YUOA 4LN2A 1X2KA 2DL8A 4GLMA 2EKHA 5GJWB 4JZ3A 3SHWA 1NYFA 5L23A 2JS0A 4J9IA 2K3BA 1U3OA 4Y92A 3NGPA 3I5SA 4ESRA 3M0SA 4CC3A 2OJ2A 1AVZC 2K79A 4RTUA 2JM8A 3UA6A 1X27A 2CH4W 1GL5A 2CDTA 1WYXA 1UECA 4AFQC 3VS1A 2AKKA 2ABLA 2V1RA 2JMCA 1CKAA 2HDAA 2HSPA 1H3HA 3NHNA 2LJ1A 1T3SA 1ZLMA 5FWBA 1XOVA 1W6XA 2O31A 3M0UA 1AOJA 2F2VA 4LUEA 2LX7A 2GTOA 4HCKA 1RLQC 2W10A 1FMKA 1Z9ZA 1M30A 1TG0A 2GGRA 1ZX6A 1VYUA 1KSWA 4J9HA 1JXMA 3REAB 2FRYA 2YUQA 1UHCA 1WI7A 2ED1A 2BZYA 1X6GA 2E5KA 1E6GA 1NLOC 5I11A 1NM7A 4EIKA 5I22A 2MOXA 1H8KA 1YNZA 4KRTA 4JZ4A 2DRMA 1SRMA 2JXBA 3VRYA 2EGEA 1U06A 1GFCA 3PVLA 4ORZA 2RQVA 1WFWA 1AWJA 2DM1A 1YN8A 2KT1A 3M0TA 2RMOA 1BU1A 1PRLC 1LCKA 2DL3A 2K9GA 4D8KA 1KFZA 2L3QA 2CUBA 1PNJA 3EG3A 1B3QA 2O88A 1SHGA 1UUEA 1HD3A 1UJYA 1AWXA 1YP5A 1M8MA 2YUPA 3RNJA 1G2BA 4QT7A 2IIMA 1AWWA 2KXDA 1G83A 1JXOA 1UGVA 2ESWA 1PKTA 4RTVA 2FPFA 4RTYA 1HSQA 2B86A 2ROTA 2DL4A 1ARKA 2KNBB 4HVUA 5FWCA 1K9AA 3EHRA 1N5ZA 1PRMC 1KJWA 2LP5A 2DILA 1ZUUA 2DBMA 5IXFA 1MV0B 1CSKA 1GBQA 1BB9A 1PHTA 1E6HA 1W70A 2I0NA 2SRCA 1B07A 2KR3A 3UF4A 2VKNA 2DMOA 3EG0A 2KROA 3KFVA 3PE0A 3NMZC 2KEAA 1K4US 2KYBA 1S1NA 2F2XA 3VS4A 1JO8A 1ZBJA 2FEIA 4Z8AA 3VS7A 4Z88A 2PZ1A 2AK5A 2P4RA 2BZXA 4IIMA 1GCQA 3QWYA 1WXUA 4AG1C 1M27C 3CQTA 1K76A 1MUZA 1T3LA 4HVWA 2DRKA 1RI9A 4JJCA 1I0CA 1NLPC 2RQRA 2J05A 1T0HA 2OAWA 2NUZA 2RQTA 3ULRB 4R0KA 1UFFA 4Z89A 3LH5A 4RTZA 1BBZA 3GBQA 2RQWA 4ZNXA 2J6FA 1QKXA 1TUDA 2DLPA 1X69A 2RF0A 1RUWA 3RBBB 2K7AA 3TVTA 3EHQA 3TSWA 2CSQA 1YWPA 2GQIA 1SSHA 2JW4A 4J9CA 1UE9A 4OMNA 4RTTA 2K6DA 4F14A 2KYMA 1JQQA 3PVQA 4FSSA 1V1CA 2X3XD 3JV3A 1AZEA 3VS3A 2EYYA 1NG2A
chains in the Genus database with same CATH superfamily
1N9SA 3MCAB 1BIAA 3JB9D 1QCNA 3CCJA 3SDZA 2D8HA 2KXCA 3CCQA 3MEUA 3A8GB 5CKEA 2LQ8A 3THKA 2D0NA 3E2UA 1EFNA 3CCVA 2WSCE 1NZ9A 2MWPA 4ZN1A 2JTEA 1OOTA 4ZGJB 1K73U 4OMQA 1WZOA 3OBYA 5LJ5f 2V8IA 3ASKA 4J9DA 1VQNA 2EYZA 1GCQC 4JJBA 4DOVA 4HVVA 2RO0A 4PFPA 4KULA 3QKJA 1ZUKA 1Q7YU 2AZVA 3DLMA 4OB1B 2RB6A 3OS2A 2AZSA 3L2ZA 1IO6A 2VV5A 2QA4A 5CK9A 1YFNA 5IHKA 2COZA 3WVDB 3M53A 1QLYA 5D7UA 4ZTJA 2J06A 5J39A 4RTWA 2EYWA 2M0YA 4X34A 3CCSQ 2D1XA 1G3WA 2KRMA 1WQ7A 2LNHB 2IPOB 2RH2A 3BY7A 5KYYB 2ATCB 1VQ5T 5GAN7 1Q7YR 3CCUT 4FYYB 1U5SA 2OTJT 5KE2A 1WHMA 2CP5A 1FMVA 3VYHB 2R58A 2DIQA 4DEYA 1GXIE 5HCKA 3CCET 1VQ7A 2A0FB 4OMPA 2GFAA 4NL2A 2DE0X 5IH2A 2JM9A 1YITQ 1O9SA 2ECZA 2VXFA 4XTZA 1N9RA 4M75A 4J9FA 3C0CA 1D09B 2XG8D 1SF9A 2L3RA 2YLCA 1WA7A 3CC4T 2AHJB 3LGFA 3ZBDA 3Q1JA 2LCSA 4JJDA 1I4K1 3JCMP 3G4ST 4CI0C 4ZN3A 2BE7D 2D8JA 4OMLA 2YDLA 1MNEA 2X3WD 2QEXQ 1OI1A 5IXBA 2RN8A 1FYNA 4B6MA 1YIJQ 4M7AF 3FB9A 2EPDA 4Y28E 4WTOB 1ZSGA 3OY9A 4K11A 3EGUA 2XIDA 2ZPHB 1RACB 4MMLA 3MEVA 1WHGA 2ZZDA 4F16A 4RMOA 2VYTA 2RA2A 2D9TA 2O4XB 2DKGA 2X4YA 3HP9A 1D0YA 3GNFB 3VS2A 3WVEB 4C92F 1M4ZA 3LWIA 1Q82R 4L6V5 4F7UB 3SWNA 2K2MA 4D8DA 1NEBA 1MGQA 4RTXA 4AFUC 4AFSC 4M77B 1M2VA 2JMAA 4QW2A 3VRZA 2OI3A 4M75C 2E41A 2PVDB 1HJDA 4KT0E 4LNPA 2EGAA 2MI6A 3CBPA 4JS4A 1N27A 2WACA 1AZGB 1TUCA 1QP2A 2OAUA 1D1AA 3CCLT 1W4SA 5GAN4 3OW2P 1QVGP 3NTIA 3QUIA 3M0PA 4IUPA 1TUGB 2RPNA 1YJNT 5I21A 1KQ1A 4B9WA 3S3NA 2QTVA 5KCOA 4E7IA 5CVIA 2L5QA 1WQWA 2FL7A 1M3AA 1YJWQ 1ZSZB 3CPFA 3A1PA 3I35A 2CZ7B 4IUQA 1G3TA 1QCFA 2J7IA 1YI2A 4E7LA 1K9MU 1OEBA 2V1QA 3CCJQ 1RAEB 5L8RE 4R55A 1MV3A 4E7KA 2CREA 3CXCP 2MCNA 4HCCA 4HXJA 3JCMe 2XMFA 4KUIA 2C0TA 4AMCA 3CMAT 2CP7A 3J7AF 3V7CA 1V29B 1VYVA 3JB9J 3CC7A 1IGUA 2FPEA 3H0FA 1LNXA 2H8HA 2ZPIB 4FYXB 2YUOA 2HKNA 3MEAA 2DL8A 4GLMA 1K9MR 3VUBA 4M7AG 3SWNC 5L23A 2JS0A 2K3BA 3QDFA 3CCMA 1U3OA 2EYQA 3L2RA 5GAOn 2QGGA 5LJ3g 3M55A 2K79A 4RTUA 3VKIA 2P0KA 1NJIU 1X27A 2CKKA 2QA4Q 3HFOA 2E3HA 1WYXA 3QZ5B 4AFQC 3OB9A 2ABLA 2FYKA 2HDAA 2HSPA 1NPPA 3S6WA 4A4HA 1W6XA 1U8RA 3VJPA 4J7FA 2F2VA 4C8QD 3NFCA 2P84A 1ZX6A 1VQLA 4EMHA 1KQSA 1NJIR 1KSWA 2YUQA 2CGHA 4M75D 2ED1A 2BZYA 2A3LA 3CCLQ 5I11A 1VQ7Q 1NM7A 1ACMB 2E6NA 1SKUB 1YNZA 4JZ4A 2DRMA 2HNIA 1IXDA 3VRYA 4O5VA 4F7UG 2EGEA 4EMKB 4XTUA 2RJCA 2HBPA 4ORZA 2A7YA 3EG9A 5A0GA 5KYWA 5C0MA 2GCXA 2P0PA 4BI8B 4WF2A 2K5FA 3P8HA 1MNDA 4M77G 1EIFA 4J6WA 1LCKA 5GANg 3CBMA 3HTRA 2R57A 1KFZA 2L3QA 2CUBA 2LT1A 2X4XA 3CD6A 1C0MA 1N8RC 4M7DE 1B3QA 1PD1A 4PJOB 4LD9K 1HD3A 1UJYA 1YP5A 2HAXA 1YHQT 1G2BA 2KXDA 1KD1R 3GPLA 1JXOA 3G71A 4C8QF 4HT9A 3FLGA 3V8KA 1HSQA 2ROTA 4BE1A 4HVUA 2E1HA 5FWCA 4E7SA 3M4GA 2PVOB 2QASA 3C12A 2LP5A 3JSCA 4E7JA 2XDBA 1PSFA 1M1KR 4J83A 2CZ1B 1MV0B 3PT9A 1BB9A 2OTLT 1M90U 3QO3A 2E64A 1K8AC 3PE0A 1Q81R 3LH0A 5KCHA 2KEAA 2JZ2A 2LQKA 3EFRA 3VS7A 4Z8AA 1VIEA 2AK5A 5A0DA 4IIMA 4NS5A 4X9CA 1K76A 4QQDA 3ME9A 3QHSA 3INZA 2RK2A 4NOYA 3KBGA 1G5VA 5FU7C 1VQPT 2O01E 2J05A 1T0HA 2RQTA 1ZBXA 1KHCA 3JCMX 4RTZA 1NPRA 5LJ5j 1N6AA 2L89A 3A8LB 3CMET 4QKUA 5KYXB 2FHDA 3G6EA 5DLQE 3CCSA 1B34B 5KYYA 1SSHA 2JW4A 2V8KA 4OMNA 3OS1A 4RTTA 2K6DA 4F14A 4FYWB 2KYMA 3FRNA 1JQQA 3DB3A 3PVQA 1V1CA 1QP3A 3E9GA 2RJFA 2HMAA 2QI2A 2XHCA 2R5AA 5FLXE 3DKMA 5I2SA 3M57A 2KI7A 2CH4A 4C0GA 1KD1C 3CCMQ 1QWFA 1VQKA 3OYEA 1Q86U 1WDXA 3MO8A 4KH0B 2JOYA 1GBRA 3RUXA 4PJOG 2QQBA 5J3BA 2P4TA 4BUGA 2EQUA 3E9FA 3RMSA 2LQWA 2IG0A 1WPYA 1CKBA 1FXXA 1ZUYA 5GAMg 2DO3A 3PFSA 3QG1A 1BK2A 2ZPEB 4PLLA 4A4GA 1VOMA 1VQLQ 2JT4A 1PC0A 3PNWC 1KIKA 2E6ZA 4FCYA 1Q81C 4BY6B 2LX9A 2MAMA 3ZL7C 1PG5B 1SG5A 2M16A 5LJ5g 4OMOA 2A28A 2O4XA 2DJQA 3RR6A 5GMKm 2X51A 3SEMA 5IHNA 3TCJA 3PMTA 1XNIA 2KRSA 2A36A 1KC8U 3BDLA 4A53A 2G6FX 2HQXA 4YTLA 5CQYA 4F7UA 2JTMA 3M0QA 3O5ZA 1WXBA 1AD5A 2VC8A 3MPUB 1IHWA 1VQ5A 2DF6A 3S3OA 5AT1B 3CCUA 4JJNK 2ROLA 1TOVA 1J3TA 4XQ3A 2E5QA 2XKOC 4M77A 3OYJA 3P8DA 1A0NB 1QWEA 2V26A 3CEYA 2LJ3A 3M5AA 1WLPB 3CD6Q 2RHZA 5D6YA 4M7DF 1IRXA 1KC8R 2LC4A 4M78B 2K2VA 2KT8A 4M7AC 3H0IA 1M8VA 4RCCA 2LZ6B 2LMJA 2F2WA 4P5NA 1YCYA 2CP6A 2VB6A 3DLLA 3CC4A 1K0SA 2J6KA 1E7OA 2DVEA 2EJFA 4V2SA 1F1BB 1ZSZA 3G4SA 4JPBW 2KMTA 3D7SB 3GOXA 1AEYA 5FW9A 5GMKj 1BCOA 5I2MA 3OSSC 2EIFA 2EVRA 2QQAA 2DETA 2DBKA 2COYA 2OX7A 4XU3A 5GAN2 1JJ2P 2FO0A 1SPKA 2CUDA 3CC2Q 5HKCA 3FJ5A 3J81E 2NLUA 3C4SA 5CKBA 2Y90A 2YSQA 4PJLA 2YT6A 4J5YA 4OGCA 4RUGA 2EBPA 2RI3A 2PTKA 4M77C 3EAEA 3OSVA 4PL6A 3JCMf 2KRNA 1BI1A 3OQ5A 2FZGB 4C0DB 1K73R 2XDPA 4CC2A 1UGQB 3MP1A 4MDWA 4LE9A 3C94A 3G6EQ 2HEQA 2DXCA 4IUTA 4KGVB 2DEUA 2CS7A 4DEXA 3EG2A 3QIIA 1PD0A 2YUNA 5HK3A 5M9OA 3JCMQ 1QKWA 1Z9QA 4FT2A 1ABQA 4LDWA 4C5HA 4E6RA 3CCLA 3JB9F 2KBTA 1RAGB 2C06A 1ZSZC 1I1JA 3X26B 1OZ2A 2D6FA 3U23A 4M7DG 2MIOA 4J9EA 4FW1A 4E7HA 4EMKA 1YJNA 2L0AA 3UWNA 2GBQA 4LUDA 2YRCA 2E70A 5CIUA 5CAIA 1UJ0A 3OYKA 2MPXC 4OGEA 1VQKQ 1AT1B 3H0HA 2E3IA 1DJ7B 4XU1A 4PFOA 3SB2A 3HPWA 4FSXA 4IURA 4HCZA 3LYIA 4JZ3A 4M7AB 4M78G 5A0LA 3AT1B 4Y92A 2AT1B 3NGPA 4ELZC 1PSEA 3M0SA 4PJOA 1AVZC 3OA6A 4BDYA 4KGZB 2CH4W 2EQMA 3CMAA 1UECA 4DBFA 3KXTA 2F5KA 2CP0A 2V1RA 5HY6A 3OS5A 2M9UA 4LDVA 3OYAA 3L2UA 2LT4A 2PUOB 4JUVA 4OMFB 4C8QE 2IVWA 2M1HA 2KSSA 2GTOA 2LX7A 4C92B 2W10A 1Z9ZA 4N0AC 4J8OA 3RKXA 1OU9A 4KBMB 2F5TX 1QVFP 4M75E 1UHCA 5LJ3d 1LOJA 4BI3A 3RKWA 1E6GA 2DJZA 1NLOC 4DOWA 3JCMh 4EIKA 1H8KA 2E12A 4KRTA 4GLKA 2JXBA 5LJ3j 1YBYA 1VQ5Q 3CCUQ 4HA8A 3HSBA 2OTJQ 4EMKC 1AWJA 2MWOA 5GAOl 1VQNT 1YN8A 2NUTB 3CCEQ 2JTFA 1WGSA 1BU1A 3VV0A 4KGXB 2K9GA 1M5Q1 2M02A 2K5IA 1LPLA 1Q7YC 1FWZA 3EG3A 4OVAA 3OBWA 4PFZA 2QTXA 1UUEA 1YJ9T 1AWXA 3CC4Q 3META 4PJOC 4PLIA 5KYXA 2EJGA 1V76A 2DYIA 1PKTA 3HFNA 2FPFA 1B34A 4RTYA 3G4SQ 1BKBA 3A8OB 2KNBB 5IAYA 3MHXA 3HRTA 5GANd 5HK0A 1WJSA 3EHRA 1PRMC 4IKFA 1ZUUA 3MP8A 1YHQA 2DBMA 5IXFA 4BACA 2GF7A 3H9NA 1E6HA 5GANj 1D3BB 2SRCA 3UF4A 3I56T 2VKNA 2DMOA 3EG0A 4PKCC 3KFVA 3NMZC 1WJRA 2PUKB 1S1NA 1RI0A 2RHXA 2P4RA 4LXCA 2AIRB 2BZXA 2K3YA 2OTLA 2LCCA 1M27C 2DFUA 3TEEA 1KQSS 1T3LA 1UGPB 3M4YA 1W2BP 1NLPC 1VQMT 1BI2A 3OYFA 2RQRA 3QZ9B 1VQ8T 2LDMA 2NUZA 1O75A 3CPWP 1I5OB 2E4HA 4C92G 3GBQA 4ZNXA 2RJEA 3JCMJ 3GNGA 4JLGA 1BI0A 3BFMA 2RHYA 1Q82C 4KH1B 2QGFB 3TSWA 1KG1A 4CRIA 1WJQA 2CSQA 2GQIA 1VQPA 2KQWA 1VQ4T 1UE9A 1FMWA 1M9SA 2LTOA 1OULA 2K4YA 1P92A 3CBOA 5FU6B 2JN0A 3CMEA 1AZEA 1ZA1B 3TU4K 1YJNQ 3VS3A 2EYYA 1OU8A 4TVRA 4BB7A 2KDSA 4PJOD 1OX9A 4RG2A 1X43A 2FG0A 2KY9A 2A37A 3ER0A 1XQHA 3OYMA 1GCPA 4ZGDB 1TTHB 1C1AA 2XK0A 2EYXA 4XTYA 1OPLA 3GP8A 1VQ6T 5GMKh 3FEOA 4C8QB 2VGMA 3IQLA 3QYHB 4M78A 3WXMB 3CMAQ 3RMQA 3I9QA 2RNAA 5CCAA 2KE9A 1SSFA 2SEMA 3G7ZA 2EGCA 3ZEHA 2O9VA 2X4WA 3PIOA 2L3SA 2CP3A 3TQ7P 5FRNA 2RQUA 4A4KA 1B7TA 4Z02A 1JJ2A 4LDXA 4OF1A 5EC7A 4Q5WA 2P0QA 3NPFA 3M54A 2L8DA 1NYGA 2DVJA 1YI2T 1UB4A 2DL7A 2DL5A 4M75F 4X9DA 1VQMQ 2EAYA 1H641 3JB9H 1WHKA 3UA7A 5AYFA 4L5GA 4BY6C 1K9MC 3RKYA 1R8OB 1UHFA 2LQNA 3M56A 5D6XA 4AG2C 4ME7A 5GAN6 1M3CA 2FZCB 2DIGA 3CC7T 2JVVA 5GAMd 2NUPB 2DA9A 5CKDA 1BIBA 1Y71A 1VQ4Q 4J9BA 2FVUA 2DPPB 5GJVB 4JRQA 1QMCA 3CC2A 5GAMj 3FJPA 1Y96B 2PVGB 3V8JA 4QQGA 5GMKe 3R6NA 5LJ5d 2EQJA 2L2PA 1M90R 3QXEB 4QVCA 2O9SA 1TSFA 1NJIC 1FX7A 4DBRA 1KHIA 2KK4A 2M51A 4R56A 8AT1B 4D6WA 1XJWB 2EKOA 4M78C 2DTHA 3I55T 2YXYA 4BDZA 4DA4A 4XTXA 1VQ9T 5GAOm 2MYSA 1MHNA 1VQ6Q 3TREA 1TS9A 1YWOA 1EX4A 2AKLA 1I07A 4O6JA 2DK3A 1OQKA 1YHQQ 5CKFA 1VQOT 3GF5A 2VWFA 2EW3A 3M9QA 3VS0A 2FRWA 2VVKA 3A98A 4AFZC 2C0IA 5KYUB 1R0BG 4BE0A 3QDRB 2YRVA 1OPKA 3VS6A 1UG1A 2LRQA 3OMCA 4LDUA 4JDSA 2DEQA 2QDLA 3MEWA 2OTLQ 2GTJA 4C8QG 3BW1A 4M7AA 2H3JA 3CCRT 1KQ2A 2WSEE 1QVFA 4II1A 2BKDN 1PKSA 3PGGA 1JEGA 4M75G 1D0ZA 2CYZB 3LX7A 1NBEB 1TWBA 4M4ZA 1M1KC 2H3EB 1PM3A 2DD4A 5LJ3h 3C95A 5IHIA 2JS2A 1NEGA 1RLPC 3FIFA 4C0DC 1SRLA 3EGDB 1Q86R 4C92A 3X20B 4JRPA 1Y7XA 2DYBA 2ED0A 3OW2S 1VQPQ 1ZHIA 1QVGS 2O2OA 3OYLA 2YHTA 2QAZA 1Y0MA 2F69A 5CQXA 1VYTA 3V7RA 3A8MB 2DTIA 3CMEQ 1M3BA 2FB7A 4MZMA 1G3SA 1UTIA 1WX6A 1M90C 4M78D 1X2QA 4M7DB 2PQWA 3OW2A 1QVGA 2GFUA 1M1GA 2ENMA 1SEMA 2HBWA 2KAFA 1EZZB 2LVMA 2OTJA 2NUTA 2CT3A 2HCKA 3SFMA 4MZPA 2XD0A 3OYBA 4DBQA 2CP2A 3CCEA 1X2KA 2LCLA 2EKHA 2VXEA 3PIPA 1BI3A 5GANh 1S72T 3CXCA 3I5SA 4ESRA 2YRDA 2OJ2A 2JM8A 3ZFJA 4J7IA 3JCMV 1GL5A 4IUUA 2Y4XA 5LJ3e 3VS1A 3QYGB 2AKKA 2MMPA 2JMCA 1CKAA 1X01A 1OYXA 1H3HA 2LJ1A 3M58A 5LL6S 5FWBA 2O31A 3M0UA 1AOJA 2QG9B 4F7UE 3RERA 1RLQC 1M30A 4PJMA 9ATCB 1LJOA 2GGRA 3KUFA 4FIBA 4C92C 4GY5A 1MMAA 1VYUA 2VASA 2HKQB 1JXMA 2FRYA 1WI7A 5GMKi 1D3BA 2E5KA 3R6OA 2BE9B 4MDXA 5I22A 5IT9E 1YITT 4F04B 3CPWA 5C6SA 2MK5A 1R77A 4QQ6A 2BUDA 3PVLA 1GFCA 1G3YA 2RQVA 3GLXA 2DM1A 2KT1A 3L42A 3P8BB 2QQ9A 3EH1A 1Q86C 3H8ZA 1Q95G 2DL3A 4EDUA 3J80E 4KUDK 1RAFB 4D8KA 5GANe 2QEXT 2K5LA 1PNJA 4PJJA 3L1AA 4N0AA 2E10A 3LWHA 2O88A 1YIJT 1SHGA 3G1JA 2YUPA 3RNJA 2IIMA 4Y91A 1AWWA 3V8LA 1G83A 1UGVA 2ESWA 2RD1A 2HQEA 4ANJA 3DB4A 3JCMc 2B86A 2X4JA 1RAAB 1S72Q 1I8FA 1RADB 3QPHA 1K9AA 1KJWA 1M2OA 2DXTA 2DILA 4M7AD 1YJ9A 3PTAA 2EWNA 1AHJB 1KC8C 1GBQA 2Z0WA 3RDVA 1W70A 2I0NA 3HL8A 2KR3A 3JCMW 2I2LA 3X28B 2KROA 4ELYC 4E47A 2DXBA 4JS5A 5J26A 1K4US 3MP6A 2F2XA 2GQVA 1JO8A 4C8QA 4C92D 6AT1B 4Z88A 1IGQA 1VUBA 3QWYA 4EPCA 2RI5A 4E2FB 3CQTA 3I56A 1MUZA 1RABB 1RI9A 1I0CA 1BYMA 4LD6A 4RKUE 2MF2A 3HRUA 2E65A 2OAWA 4L59A 3ULRB 1UFFA 4Z89A 3LH5A 4ZGEB 3QJ6A 2DAQA 5GAMh 3V7SA 1QKXA 2DLPA 1X69A 2RF0A 1YJWT 1ZA2B 3EHQA 1D0XA 4C0FA 3OYGA 1VQMA 3A8HB 2X9HA 4M77D 3CCJT 3CCQT 4NL3A 1VQ8A 3EGXB 4FYVB 2RHIA 4HT8A 5LJ5h 3CCVT 3EFOB 5DY9A 1Q82U 2NUPA 2X3XD 3JV3A 3PMIA 5FU6C 2V8JA 1NG2A 4BD3A 4PJOE 4A4EA 4IIOA 1QW1A 2ZPGB 2KGTA 3OS0A 1K73C 4XK8E 4J6YA 1VQ4A 1UGRB 1Y96A 1JU5C 5GAN3 5KYNA 3QSUA 3HHTB 2NWMA 2LJ0A 4F17A 1IZ6A 3VS5A 2QA4T 2W0ZA 1ABOA 2YLBA 2JJ9A 2CT4A 3H41A 3S3MA 4C8QC 5GAN5 3JB9G 3EH2A 2DX1A 1D1BA 2DERA 3NTKA 1N8RU 1OX8A 4F7UF 1VQ6A 1WIEA 5GAMe 2X35A 4OB3B 3I5RA 4M77F 1VQ7T 4FU6A 1NE8A 8ATCB 3OYYA 2EQIA 5KYUA 2RJDA 3M0RA 2JUFA 4JRIA 1N8RR 5LJ5e 4RCBA 5DM7R 2Y4YA 3QWXX 4XU2A 4VUBA 2A08A 2CSIA 1U1SA 1Y57A 3OYNA 3CCQQ 4RG8A 2DXUA 2L3PA 2ZPFB 2M0OA 1K8AU 3H6ZA 3CCVQ 1HK9A 3UPUA 5CR2A 1TH7A 3JB9I 1UDLA 4EMGA 3X25B 1GRIA 4C5EA 3OYCA 1VQNQ 4J9GA 4N4IA 1OZ3A 1X75C 4CC4B 3EGDA 3JCMb 1K1ZA 1K8AR 4OMMA 4X1VA 1JBMA 5FRMA 4AT1B 2VGNA 2DD5A 4FW2A 5GMKl 4CC7A 2PNIA 4WCIA 2VUBA 1YJ9Q 2BIVA 2FPDA 2J6OA 1X6BA 4GBQA 3I55A 1VQ9A 2DZ9A 3FDRA 3JRZA 4M7DA 1I81A 1WNLA 3E19A 2NYSA 1LVKA 1VA7A 1SHFA 3L2VA 1KK7A 4OP0A 1JJ2S 1W1FA 2D0QB 1VQOA 1MMGA 1T0JA 1MMNA 3LLRA 2BZ8A 1HYOA 5KE3A 1MMDA 3I56Q 5GAOr 1PWTA 3REBB 4A54A 1AWOA 4M75B 2RM4A 1KD1U 2K57A 2C0OA 1TXQA 4FM4B 1WHJA 3VYGA 2QXFA 3TSZA 2RHUA 5D6WA 3GIBA 3MKDA 4XTWA 2HD0A 3EG1A 4QVZA 3BDUA 5EG2A 4PK4A 3CCRA 2ZCFB 1OV3A 2FZKB 1M1KU 1GFDA 4HCBA 2HSEB 1WXTA 1VQ8Q 3LGLA 2XI9A 5GAOq 3OMGA 4A63B 5ECAA 2PU9B 3A5ZB 3F70A 2GNCA 1Q81U 1YCSB 1H92A 1K0XA 2JNGA 3UATA 5LJ3f 4M78E 4PJOF 3E1SA 2XICA 3MJXA 5CKHA 4M7DC 1HXDA 4FT4A 3CCMT 2HZYA 2DNUA 2BTTA 2ZGWA 2HQHA 2COWA 4A4FA 3UDCA 4LN2A 3O8VA 3LW5E 4DBHA 5FROA 1RAIB 3NTHA 3SWNB 3URGA 5GJWB 4OB0B 3SHWA 1QQJA 1NYFA 3L2WA 1PCXA 4J9IA 2EFIA 3M59A 2WSFE 3L2QA 4CC3A 1M2VB 4PJNA 3UA6A 1VQLT 4IUVA 3JCMd 5CO7A 2CDTA 2ZAEA 7AT1B 3T9NA 5A2QE 4QVDA 4C5IA 3NHNA 4ZTFA 1T3SA 1ZLMA 1XOVA 3QBYA 4XAXB 4LUEA 4C5GA 4HCKA 1FMKA 1TG0A 1S72A 1VIFA 4LDYA 4C0ZA 5GANf 2B8AA 4J9HA 3REAB 1QVFS 1WHHA 1IB8A 1X6GA 1YI2Q 4JLIA 2ZPBB 4BI4A 2MOXA 4PNOA 5DLOA 1SRMA 2DZCA 4XTVA 3CD6T 1QCOA 1U06A 3JAME 1WFWA 4DQ2A 3VU3C 1G8XA 1UGSB 4N4GA 3CC7Q 3M0TA 2RMOA 5GAOp 1PRLC 1YITA 2QQSA 3G71T 1QVPA 3HKSA 1BCMA 3RESA 5GAN8 2XU8A 4M7DD 1XTDA 3QJYA 4MZTA 1WHLA 1JRIA 1M8MA 3OYHA 3HRSA 4QT7A 3N5BB 3BE3A 3VUZA 4B9XA 4N4HA 2DTOA 4RTVA 4BE2A 3EFSA 3EGXA 2DL4A 3I55Q 1ARKA 2QEXA 1VQ9Q 1N5ZA 4M7AE 2EQKA 4FL6A 1YIJA 3EFOA 1IHVA 1JB0E 3FC3A 3JCMg 1CSKA 3CXCS 1PHTA 3CC2T 1RL2A 2QQRA 1B07A 1C6VX 1VQOQ 4MMKA 1ZQ1A 2R5MA 1U1TA 3AHUA 4ATOA 2K3XA 2KYBA 4C92E 3VS4A 2FEIA 1ZBJA 2PZ1A 1D1CA 3EG9B 5KYWB 1H3ZA 2QK0A 1GCQA 2CZ6B 4HKEA 1WXUA 1M1FA 3X24B 4AG1C 4J6XA 3RIRA 1KQSP 2QDYB 4UC4A 3UT1A 4HVWA 2G3RA 2DRKA 2XDDA 2KVQG 4JJCA 2HL5C 5FU7B 3G6ET 1W2BS 1UEBA 2HL3A 3CCST 2YWWA 3CCRQ 1I5LA 4R0KA 2RK1A 3CPWS 1TU0B 1BBZA 2RQWA 2J6FA 1Y07A 1TUDA 3G71Q 1RUWA 5KH6A 3RBBB 4JRKA 3OYIA 2K7AA 4OB2B 3TVTA 2RI2A 4M77E 1IREB 1R0CB 2QYZA 3SD4A 1YWPA 1W2BA 4E7ZA 4J9CA 4M78F 2CZ0B 4XU0A 1RAHB 2EJ9A 4FSSA 3OYDA 5IN1A 1VQKT 1YJWA 2LNVA 1X6OA 2F1LA 5GAMf
chains in the Genus database with same CATH topology
4IIOA 2KGTA 2D8HA 2KXCA 1X43A 2FG0A 2A37A 1JU5C 3THKA 2D0NA 1GCPA 2NWMA 1EFNA 2LJ0A 4F17A 2CH4A 2EYXA 1OPLA 2JTEA 3VS5A 1QWFA 1OOTA 2W0ZA 1ABOA 4OMQA 2CT4A 3H41A 3IQLA 1WDXA 3I9QA 1GBRA 4J9DA 2RNAA 2EYZA 1GCQC 2KE9A 4JJBA 2SEMA 4HVVA 2EGCA 2DX1A 2O9VA 2L3SA 1ZUKA 2LQWA 2RQUA 1CKBA 1ZUYA 2AZVA 5EC7A 2AZSA 1WIEA 1IO6A 1BK2A 5IHKA 3NPFA 1QLYA 2JT4A 2J06A 1NYGA 2DVJA 1KIKA 2DL7A 2DL5A 3I5RA 4RTWA 2EYWA 2M0YA 2D1XA 3UA7A 3ZL7C 2KRMA 2LNHB 2EQIA 4OMOA 3M0RA 1UHFA 2A28A 2LQNA 1U5SA 2DJQA 4AG2C 1M3CA 3SEMA 5IHNA 4DEYA 2KRSA 3QWXX 2DA9A 2A36A 5HCKA 2A08A 2CSIA 2G6FX 4OMPA 1Y57A 4J9BA 3M0QA 2DE0X 5IH2A 5GJVB 1WXBA 3O5ZA 1AD5A 2L3PA 2JM9A 2DF6A 2ECZA 2ROLA 1J3TA 4J9FA 1A0NB 3R6NA 3C0CA 1QWEA 2L2PA 2LJ3A 1WLPB 1UDLA 2O9SA 1GRIA 1WA7A 2LCSA 2M51A 4JJDA 4J9GA 2KT8A 3H0IA 4CC4B 2D8JA 1K1ZA 2LZ6B 4OMLA 2LMJA 4OMMA 2YDLA 4X1VA 2F2WA 2X3WD 1YWOA 5IXBA 2RN8A 1FYNA 2AKLA 1K0SA 4CC7A 2J6KA 2PNIA 4WCIA 1I07A 1E7OA 2EPDA 1ZSGA 2FPDA 4K11A 2J6OA 1X6BA 4GBQA 2VWFA 4JPBW 2EW3A 3EGUA 3VS0A 2FRWA 1AEYA 5FW9A 2VVKA 3A98A 4AFZC 2C0IA 4F16A 2EVRA 1VA7A 1SHFA 1OPKA 2DBKA 3VS6A 1UG1A 3VS2A 2FO0A 1W1FA 1SPKA 2CUDA 1T0JA 2QDLA 2BZ8A 2GTJA 3FJ5A 2K2MA 4D8DA 1NEBA 4RTXA 4AFUC 1PWTA 3REBB 2YSQA 2YT6A 1PKSA 4RUGA 1JEGA 2EBPA 4AFSC 1AWOA 2PTKA 2JMAA 2C0OA 3VRZA 4M4ZA 2OI3A 1HJDA 3TSZA 4LNPA 2EGAA 2KRNA 3EG1A 5IHIA 2JS2A 1NEGA 1AZGB 1RLPC 1TUCA 4CC2A 1SRLA 4LE9A 1OV3A 2HEQA 1GFDA 2DYBA 2ED0A 1WXTA 2O2OA 4DEXA 3EG2A 3M0PA 2RPNA 4A63B 2YUNA 1Y0MA 5ECAA 1QKWA 1Z9QA 1VYTA 1ABQA 1M3BA 2GNCA 1M3AA 1YCSB 1H92A 1K0XA 4E6RA 3UATA 1UTIA 3I35A 2KBTA 1QCFA 1I1JA 1WX6A 2J7IA 1X2QA 1OEBA 2V1QA 3U23A 2MIOA 4J9EA 1MV3A 2CREA 2MCNA 2L0AA 4HXJA 2GBQA 4LUDA 2ENMA 2XMFA 1SEMA 2HBWA 1UJ0A 2DNUA 2BTTA 2C0TA 2CT3A 2HCKA 3H0HA 1VYVA 3H0FA 2FPEA 2H8HA 2YUOA 4LN2A 1X2KA 2DL8A 4GLMA 2EKHA 5GJWB 4JZ3A 3SHWA 1NYFA 5L23A 2JS0A 4J9IA 2K3BA 1U3OA 4Y92A 3NGPA 3I5SA 4ESRA 3M0SA 4CC3A 2OJ2A 1AVZC 2K79A 4RTUA 2JM8A 3UA6A 1X27A 2CH4W 1GL5A 2CDTA 1WYXA 1UECA 4AFQC 3VS1A 2AKKA 2ABLA 2V1RA 2JMCA 1CKAA 2HDAA 2HSPA 1H3HA 3NHNA 2LJ1A 1T3SA 1ZLMA 5FWBA 1XOVA 1W6XA 2O31A 3M0UA 1AOJA 2F2VA 4LUEA 2LX7A 2GTOA 4HCKA 1RLQC 2W10A 1FMKA 1Z9ZA 1M30A 1TG0A 2GGRA 1ZX6A 1VYUA 1KSWA 4J9HA 1JXMA 3REAB 2FRYA 2YUQA 1UHCA 1WI7A 2ED1A 2BZYA 1X6GA 2E5KA 1E6GA 1NLOC 5I11A 1NM7A 4EIKA 5I22A 2MOXA 1H8KA 1YNZA 4KRTA 4JZ4A 2DRMA 1SRMA 2JXBA 3VRYA 2EGEA 1U06A 1GFCA 3PVLA 4ORZA 2RQVA 1WFWA 1AWJA 2DM1A 1YN8A 2KT1A 3M0TA 2RMOA 1BU1A 1PRLC 1LCKA 2DL3A 2K9GA 4D8KA 1KFZA 2L3QA 2CUBA 1PNJA 3EG3A 1B3QA 2O88A 1SHGA 1UUEA 1HD3A 1UJYA 1AWXA 1YP5A 1M8MA 2YUPA 3RNJA 1G2BA 4QT7A 2IIMA 1AWWA 2KXDA 1G83A 1JXOA 1UGVA 2ESWA 1PKTA 4RTVA 2FPFA 4RTYA 1HSQA 2B86A 2ROTA 2DL4A 1ARKA 2KNBB 4HVUA 5FWCA 1K9AA 3EHRA 1N5ZA 1PRMC 1KJWA 2LP5A 2DILA 1ZUUA 2DBMA 5IXFA 1MV0B 1CSKA 1GBQA 1BB9A 1PHTA 1E6HA 1W70A 2I0NA 2SRCA 1B07A 2KR3A 3UF4A 2VKNA 2DMOA 3EG0A 2KROA 3KFVA 3PE0A 3NMZC 2KEAA 1K4US 2KYBA 1S1NA 2F2XA 3VS4A 1JO8A 1ZBJA 2FEIA 4Z8AA 3VS7A 4Z88A 2PZ1A 2AK5A 2P4RA 2BZXA 4IIMA 1GCQA 3QWYA 1WXUA 4AG1C 1M27C 3CQTA 1K76A 1MUZA 1T3LA 4HVWA 2DRKA 1RI9A 4JJCA 1I0CA 1NLPC 2RQRA 2J05A 1T0HA 2OAWA 2NUZA 2RQTA 3ULRB 4R0KA 1UFFA 4Z89A 3LH5A 4RTZA 1BBZA 3GBQA 2RQWA 4ZNXA 2J6FA 1QKXA 1TUDA 2DLPA 1X69A 2RF0A 1RUWA 3RBBB 2K7AA 3TVTA 3EHQA 3TSWA 2CSQA 1YWPA 2GQIA 1SSHA 2JW4A 4J9CA 1UE9A 4OMNA 4RTTA 2K6DA 4F14A 2KYMA 1JQQA 3PVQA 4FSSA 1V1CA 2X3XD 3JV3A 1AZEA 3VS3A 2EYYA 1NG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIO A;  2KGT A;  2D8H A;  2KXC A;  1X43 A;  2FG0 A;  2A37 A;  1JU5 C;  3THK A;  2D0N A;  1GCP A;  2NWM A;  1EFN A;  2LJ0 A;  4F17 A;  2CH4 A;  2EYX A;  1OPL A;  2JTE A;  3VS5 A;  1QWF A;  1OOT A;  2W0Z A;  1ABO A;  4OMQ A;  2CT4 A;  3H41 A;  3IQL A;  1WDX A;  3I9Q A;  1GBR A;  4J9D A;  2RNA A;  2EYZ A;  1GCQ C;  2KE9 A;  4JJB A;  2SEM A;  4HVV A;  2EGC A;  2DX1 A;  2O9V A;  2L3S A;  1ZUK A;  2LQW A;  2RQU A;  1CKB A;  1ZUY A;  2AZV A;  5EC7 A;  2AZS A;  1WIE A;  1IO6 A;  1BK2 A;  5IHK A;  3NPF A;  1QLY A;  2JT4 A;  2J06 A;  1NYG A;  2DVJ A;  1KIK A;  2DL7 A;  2DL5 A;  3I5R A;  4RTW A;  2EYW A;  2M0Y A;  2D1X A;  3UA7 A;  3ZL7 C;  2KRM A;  2LNH B;  2EQI A;  4OMO A;  3M0R A;  1UHF A;  2A28 A;  2LQN A;  1U5S A;  2DJQ A;  4AG2 C;  1M3C A;  3SEM A;  5IHN A;  4DEY A;  2KRS A;  3QWX X;  2DA9 A;  2A36 A;  5HCK A;  2A08 A;  2CSI A;  2G6F X;  4OMP A;  1Y57 A;  4J9B A;  3M0Q A;  2DE0 X;  5IH2 A;  5GJV B;  1WXB A;  3O5Z A;  1AD5 A;  2L3P A;  2JM9 A;  2DF6 A;  2ECZ A;  2ROL A;  1J3T A;  4J9F A;  1A0N B;  3R6N A;  3C0C A;  1QWE A;  2L2P A;  2LJ3 A;  1WLP B;  1UDL A;  2O9S A;  1GRI A;  1WA7 A;  2LCS A;  2M51 A;  4JJD A;  4J9G A;  2KT8 A;  3H0I A;  4CC4 B;  2D8J A;  1K1Z A;  2LZ6 B;  4OML A;  2LMJ A;  4OMM A;  2YDL A;  4X1V A;  2F2W A;  2X3W D;  1YWO A;  5IXB A;  2RN8 A;  1FYN A;  2AKL A;  1K0S A;  4CC7 A;  2J6K A;  2PNI A;  4WCI A;  1I07 A;  1E7O A;  2EPD A;  1ZSG A;  2FPD A;  4K11 A;  2J6O A;  1X6B A;  4GBQ A;  2VWF A;  4JPB W;  2EW3 A;  3EGU A;  3VS0 A;  2FRW A;  1AEY A;  5FW9 A;  2VVK A;  3A98 A;  4AFZ C;  2C0I A;  4F16 A;  2EVR A;  1VA7 A;  1SHF A;  1OPK A;  2DBK A;  3VS6 A;  1UG1 A;  3VS2 A;  2FO0 A;  1W1F A;  1SPK A;  2CUD A;  1T0J A;  2QDL A;  2BZ8 A;  2GTJ A;  3FJ5 A;  2K2M A;  4D8D A;  1NEB A;  4RTX A;  4AFU C;  1PWT A;  3REB B;  2YSQ A;  2YT6 A;  1PKS A;  4RUG A;  1JEG A;  2EBP A;  4AFS C;  1AWO A;  2PTK A;  2JMA A;  2C0O A;  3VRZ A;  4M4Z A;  2OI3 A;  1HJD A;  3TSZ A;  4LNP A;  2EGA A;  2KRN A;  3EG1 A;  5IHI A;  2JS2 A;  1NEG A;  1AZG B;  1RLP C;  1TUC A;  4CC2 A;  1SRL A;  4LE9 A;  1OV3 A;  2HEQ A;  1GFD A;  2DYB A;  2ED0 A;  1WXT A;  2O2O A;  4DEX A;  3EG2 A;  3M0P A;  2RPN A;  4A63 B;  2YUN A;  1Y0M A;  5ECA A;  1QKW A;  1Z9Q A;  1VYT A;  1ABQ A;  1M3B A;  2GNC A;  1M3A A;  1YCS B;  1H92 A;  1K0X A;  4E6R A;  3UAT A;  1UTI A;  3I35 A;  2KBT A;  1QCF A;  1I1J A;  1WX6 A;  2J7I A;  1X2Q A;  1OEB A;  2V1Q A;  3U23 A;  2MIO A;  4J9E A;  1MV3 A;  2CRE A;  2MCN A;  2L0A A;  4HXJ A;  2GBQ A;  4LUD A;  2ENM A;  2XMF A;  1SEM A;  2HBW A;  1UJ0 A;  2DNU A;  2BTT A;  2C0T A;  2CT3 A;  2HCK A;  3H0H A;  1VYV A;  3H0F A;  2FPE A;  2H8H A;  2YUO A;  4LN2 A;  1X2K A;  2DL8 A;  4GLM A;  2EKH A;  5GJW B;  4JZ3 A;  3SHW A;  1NYF A;  5L23 A;  2JS0 A;  4J9I A;  2K3B A;  1U3O A;  4Y92 A;  3NGP A;  3I5S A;  4ESR A;  3M0S A;  4CC3 A;  2OJ2 A;  1AVZ C;  2K79 A;  4RTU A;  2JM8 A;  3UA6 A;  1X27 A;  2CH4 W;  1GL5 A;  2CDT A;  1WYX A;  1UEC A;  4AFQ C;  3VS1 A;  2AKK A;  2ABL A;  2V1R A;  2JMC A;  1CKA A;  2HDA A;  2HSP A;  1H3H A;  3NHN A;  2LJ1 A;  1T3S A;  1ZLM A;  5FWB A;  1XOV A;  1W6X A;  2O31 A;  3M0U A;  1AOJ A;  2F2V A;  4LUE A;  2LX7 A;  2GTO A;  4HCK A;  1RLQ C;  2W10 A;  1FMK A;  1Z9Z A;  1M30 A;  1TG0 A;  2GGR A;  1ZX6 A;  1VYU A;  1KSW A;  4J9H A;  1JXM A;  3REA B;  2FRY A;  2YUQ A;  1UHC A;  1WI7 A;  2ED1 A;  2BZY A;  1X6G A;  2E5K A;  1E6G A;  1NLO C;  5I11 A;  1NM7 A;  4EIK A;  5I22 A;  2MOX A;  1H8K A;  1YNZ A;  4KRT A;  4JZ4 A;  2DRM A;  1SRM A;  2JXB A;  3VRY A;  2EGE A;  1U06 A;  1GFC A;  3PVL A;  4ORZ A;  2RQV A;  1WFW A;  1AWJ A;  2DM1 A;  1YN8 A;  2KT1 A;  3M0T A;  2RMO A;  1BU1 A;  1PRL C;  1LCK A;  2DL3 A;  2K9G A;  4D8K A;  1KFZ A;  2L3Q A;  2CUB A;  1PNJ A;  3EG3 A;  1B3Q A;  2O88 A;  1SHG A;  1UUE A;  1HD3 A;  1UJY A;  1AWX A;  1YP5 A;  1M8M A;  2YUP A;  3RNJ A;  1G2B A;  4QT7 A;  2IIM A;  1AWW A;  2KXD A;  1G83 A;  1JXO A;  1UGV A;  2ESW A;  1PKT A;  4RTV A;  2FPF A;  4RTY A;  1HSQ A;  2B86 A;  2ROT A;  2DL4 A;  1ARK A;  2KNB B;  4HVU A;  5FWC A;  1K9A A;  3EHR A;  1N5Z A;  1PRM C;  1KJW A;  2LP5 A;  2DIL A;  1ZUU A;  2DBM A;  5IXF A;  1MV0 B;  1CSK A;  1GBQ A;  1BB9 A;  1PHT A;  1E6H A;  1W70 A;  2I0N A;  2SRC A;  1B07 A;  2KR3 A;  3UF4 A;  2VKN A;  2DMO A;  3EG0 A;  2KRO A;  3KFV A;  3PE0 A;  3NMZ C;  2KEA A;  1K4U S;  2KYB A;  1S1N A;  2F2X A;  3VS4 A;  1JO8 A;  1ZBJ A;  2FEI A;  4Z8A A;  3VS7 A;  4Z88 A;  2PZ1 A;  2AK5 A;  2P4R A;  2BZX A;  4IIM A;  1GCQ A;  3QWY A;  1WXU A;  4AG1 C;  1M27 C;  3CQT A;  1K76 A;  1MUZ A;  1T3L A;  4HVW A;  2DRK A;  1RI9 A;  4JJC A;  1I0C A;  1NLP C;  2RQR A;  2J05 A;  1T0H A;  2OAW A;  2NUZ A;  2RQT A;  3ULR B;  4R0K A;  1UFF A;  4Z89 A;  3LH5 A;  4RTZ A;  1BBZ A;  3GBQ A;  2RQW A;  4ZNX A;  2J6F A;  1QKX A;  1TUD A;  2DLP A;  1X69 A;  2RF0 A;  1RUW A;  3RBB B;  2K7A A;  3TVT A;  3EHQ A;  3TSW A;  2CSQ A;  1YWP A;  2GQI A;  1SSH A;  2JW4 A;  4J9C A;  1UE9 A;  4OMN A;  4RTT A;  2K6D A;  4F14 A;  2KYM A;  1JQQ A;  3PVQ A;  4FSS A;  1V1C A;  2X3X D;  3JV3 A;  1AZE A;  3VS3 A;  2EYY A;  1NG2 A; 
#chains in the Genus database with same CATH topology
 1N9S A;  3MCA B;  1BIA A;  3JB9 D;  1QCN A;  3CCJ A;  3SDZ A;  2D8H A;  2KXC A;  3CCQ A;  3MEU A;  3A8G B;  5CKE A;  2LQ8 A;  3THK A;  2D0N A;  3E2U A;  1EFN A;  3CCV A;  2WSC E;  1NZ9 A;  2MWP A;  4ZN1 A;  2JTE A;  1OOT A;  4ZGJ B;  1K73 U;  4OMQ A;  1WZO A;  3OBY A;  5LJ5 f;  2V8I A;  3ASK A;  4J9D A;  1VQN A;  2EYZ A;  1GCQ C;  4JJB A;  4DOV A;  4HVV A;  2RO0 A;  4PFP A;  4KUL A;  3QKJ A;  1ZUK A;  1Q7Y U;  2AZV A;  3DLM A;  4OB1 B;  2RB6 A;  3OS2 A;  2AZS A;  3L2Z A;  1IO6 A;  2VV5 A;  2QA4 A;  5CK9 A;  1YFN A;  5IHK A;  2COZ A;  3WVD B;  3M53 A;  1QLY A;  5D7U A;  4ZTJ A;  2J06 A;  5J39 A;  4RTW A;  2EYW A;  2M0Y A;  4X34 A;  3CCS Q;  2D1X A;  1G3W A;  2KRM A;  1WQ7 A;  2LNH B;  2IPO B;  2RH2 A;  3BY7 A;  5KYY B;  2ATC B;  1VQ5 T;  5GAN 7;  1Q7Y R;  3CCU T;  4FYY B;  1U5S A;  2OTJ T;  5KE2 A;  1WHM A;  2CP5 A;  1FMV A;  3VYH B;  2R58 A;  2DIQ A;  4DEY A;  1GXI E;  5HCK A;  3CCE T;  1VQ7 A;  2A0F B;  4OMP A;  2GFA A;  4NL2 A;  2DE0 X;  5IH2 A;  2JM9 A;  1YIT Q;  1O9S A;  2ECZ A;  2VXF A;  4XTZ A;  1N9R A;  4M75 A;  4J9F A;  3C0C A;  1D09 B;  2XG8 D;  1SF9 A;  2L3R A;  2YLC A;  1WA7 A;  3CC4 T;  2AHJ B;  3LGF A;  3ZBD A;  3Q1J A;  2LCS A;  4JJD A;  1I4K 1;  3JCM P;  3G4S T;  4CI0 C;  4ZN3 A;  2BE7 D;  2D8J A;  4OML A;  2YDL A;  1MNE A;  2X3W D;  2QEX Q;  1OI1 A;  5IXB A;  2RN8 A;  1FYN A;  4B6M A;  1YIJ Q;  4M7A F;  3FB9 A;  2EPD A;  4Y28 E;  4WTO B;  1ZSG A;  3OY9 A;  4K11 A;  3EGU A;  2XID A;  2ZPH B;  1RAC B;  4MML A;  3MEV A;  1WHG A;  2ZZD A;  4F16 A;  4RMO A;  2VYT A;  2RA2 A;  2D9T A;  2O4X B;  2DKG A;  2X4Y A;  3HP9 A;  1D0Y A;  3GNF B;  3VS2 A;  3WVE B;  4C92 F;  1M4Z A;  3LWI A;  1Q82 R;  4L6V 5;  4F7U B;  3SWN A;  2K2M A;  4D8D A;  1NEB A;  1MGQ A;  4RTX A;  4AFU C;  4AFS C;  4M77 B;  1M2V A;  2JMA A;  4QW2 A;  3VRZ A;  2OI3 A;  4M75 C;  2E41 A;  2PVD B;  1HJD A;  4KT0 E;  4LNP A;  2EGA A;  2MI6 A;  3CBP A;  4JS4 A;  1N27 A;  2WAC A;  1AZG B;  1TUC A;  1QP2 A;  2OAU A;  1D1A A;  3CCL T;  1W4S A;  5GAN 4;  3OW2 P;  1QVG P;  3NTI A;  3QUI A;  3M0P A;  4IUP A;  1TUG B;  2RPN A;  1YJN T;  5I21 A;  1KQ1 A;  4B9W A;  3S3N A;  2QTV A;  5KCO A;  4E7I A;  5CVI A;  2L5Q A;  1WQW A;  2FL7 A;  1M3A A;  1YJW Q;  1ZSZ B;  3CPF A;  3A1P A;  3I35 A;  2CZ7 B;  4IUQ A;  1G3T A;  1QCF A;  2J7I A;  1YI2 A;  4E7L A;  1K9M U;  1OEB A;  2V1Q A;  3CCJ Q;  1RAE B;  5L8R E;  4R55 A;  1MV3 A;  4E7K A;  2CRE A;  3CXC P;  2MCN A;  4HCC A;  4HXJ A;  3JCM e;  2XMF A;  4KUI A;  2C0T A;  4AMC A;  3CMA T;  2CP7 A;  3J7A F;  3V7C A;  1V29 B;  1VYV A;  3JB9 J;  3CC7 A;  1IGU A;  2FPE A;  3H0F A;  1LNX A;  2H8H A;  2ZPI B;  4FYX B;  2YUO A;  2HKN A;  3MEA A;  2DL8 A;  4GLM A;  1K9M R;  3VUB A;  4M7A G;  3SWN C;  5L23 A;  2JS0 A;  2K3B A;  3QDF A;  3CCM A;  1U3O A;  2EYQ A;  3L2R A;  5GAO n;  2QGG A;  5LJ3 g;  3M55 A;  2K79 A;  4RTU A;  3VKI A;  2P0K A;  1NJI U;  1X27 A;  2CKK A;  2QA4 Q;  3HFO A;  2E3H A;  1WYX A;  3QZ5 B;  4AFQ C;  3OB9 A;  2ABL A;  2FYK A;  2HDA A;  2HSP A;  1NPP A;  3S6W A;  4A4H A;  1W6X A;  1U8R A;  3VJP A;  4J7F A;  2F2V A;  4C8Q D;  3NFC A;  2P84 A;  1ZX6 A;  1VQL A;  4EMH A;  1KQS A;  1NJI R;  1KSW A;  2YUQ A;  2CGH A;  4M75 D;  2ED1 A;  2BZY A;  2A3L A;  3CCL Q;  5I11 A;  1VQ7 Q;  1NM7 A;  1ACM B;  2E6N A;  1SKU B;  1YNZ A;  4JZ4 A;  2DRM A;  2HNI A;  1IXD A;  3VRY A;  4O5V A;  4F7U G;  2EGE A;  4EMK B;  4XTU A;  2RJC A;  2HBP A;  4ORZ A;  2A7Y A;  3EG9 A;  5A0G A;  5KYW A;  5C0M A;  2GCX A;  2P0P A;  4BI8 B;  4WF2 A;  2K5F A;  3P8H A;  1MND A;  4M77 G;  1EIF A;  4J6W A;  1LCK A;  5GAN g;  3CBM A;  3HTR A;  2R57 A;  1KFZ A;  2L3Q A;  2CUB A;  2LT1 A;  2X4X A;  3CD6 A;  1C0M A;  1N8R C;  4M7D E;  1B3Q A;  1PD1 A;  4PJO B;  4LD9 K;  1HD3 A;  1UJY A;  1YP5 A;  2HAX A;  1YHQ T;  1G2B A;  2KXD A;  1KD1 R;  3GPL A;  1JXO A;  3G71 A;  4C8Q F;  4HT9 A;  3FLG A;  3V8K A;  1HSQ A;  2ROT A;  4BE1 A;  4HVU A;  2E1H A;  5FWC A;  4E7S A;  3M4G A;  2PVO B;  2QAS A;  3C12 A;  2LP5 A;  3JSC A;  4E7J A;  2XDB A;  1PSF A;  1M1K R;  4J83 A;  2CZ1 B;  1MV0 B;  3PT9 A;  1BB9 A;  2OTL T;  1M90 U;  3QO3 A;  2E64 A;  1K8A C;  3PE0 A;  1Q81 R;  3LH0 A;  5KCH A;  2KEA A;  2JZ2 A;  2LQK A;  3EFR A;  3VS7 A;  4Z8A A;  1VIE A;  2AK5 A;  5A0D A;  4IIM A;  4NS5 A;  4X9C A;  1K76 A;  4QQD A;  3ME9 A;  3QHS A;  3INZ A;  2RK2 A;  4NOY A;  3KBG A;  1G5V A;  5FU7 C;  1VQP T;  2O01 E;  2J05 A;  1T0H A;  2RQT A;  1ZBX A;  1KHC A;  3JCM X;  4RTZ A;  1NPR A;  5LJ5 j;  1N6A A;  2L89 A;  3A8L B;  3CME T;  4QKU A;  5KYX B;  2FHD A;  3G6E A;  5DLQ E;  3CCS A;  1B34 B;  5KYY A;  1SSH A;  2JW4 A;  2V8K A;  4OMN A;  3OS1 A;  4RTT A;  2K6D A;  4F14 A;  4FYW B;  2KYM A;  3FRN A;  1JQQ A;  3DB3 A;  3PVQ A;  1V1C A;  1QP3 A;  3E9G A;  2RJF A;  2HMA A;  2QI2 A;  2XHC A;  2R5A A;  5FLX E;  3DKM A;  5I2S A;  3M57 A;  2KI7 A;  2CH4 A;  4C0G A;  1KD1 C;  3CCM Q;  1QWF A;  1VQK A;  3OYE A;  1Q86 U;  1WDX A;  3MO8 A;  4KH0 B;  2JOY A;  1GBR A;  3RUX A;  4PJO G;  2QQB A;  5J3B A;  2P4T A;  4BUG A;  2EQU A;  3E9F A;  3RMS A;  2LQW A;  2IG0 A;  1WPY A;  1CKB A;  1FXX A;  1ZUY A;  5GAM g;  2DO3 A;  3PFS A;  3QG1 A;  1BK2 A;  2ZPE B;  4PLL A;  4A4G A;  1VOM A;  1VQL Q;  2JT4 A;  1PC0 A;  3PNW C;  1KIK A;  2E6Z A;  4FCY A;  1Q81 C;  4BY6 B;  2LX9 A;  2MAM A;  3ZL7 C;  1PG5 B;  1SG5 A;  2M16 A;  5LJ5 g;  4OMO A;  2A28 A;  2O4X A;  2DJQ A;  3RR6 A;  5GMK m;  2X51 A;  3SEM A;  5IHN A;  3TCJ A;  3PMT A;  1XNI A;  2KRS A;  2A36 A;  1KC8 U;  3BDL A;  4A53 A;  2G6F X;  2HQX A;  4YTL A;  5CQY A;  4F7U A;  2JTM A;  3M0Q A;  3O5Z A;  1WXB A;  1AD5 A;  2VC8 A;  3MPU B;  1IHW A;  1VQ5 A;  2DF6 A;  3S3O A;  5AT1 B;  3CCU A;  4JJN K;  2ROL A;  1TOV A;  1J3T A;  4XQ3 A;  2E5Q A;  2XKO C;  4M77 A;  3OYJ A;  3P8D A;  1A0N B;  1QWE A;  2V26 A;  3CEY A;  2LJ3 A;  3M5A A;  1WLP B;  3CD6 Q;  2RHZ A;  5D6Y A;  4M7D F;  1IRX A;  1KC8 R;  2LC4 A;  4M78 B;  2K2V A;  2KT8 A;  4M7A C;  3H0I A;  1M8V A;  4RCC A;  2LZ6 B;  2LMJ A;  2F2W A;  4P5N A;  1YCY A;  2CP6 A;  2VB6 A;  3DLL A;  3CC4 A;  1K0S A;  2J6K A;  1E7O A;  2DVE A;  2EJF A;  4V2S A;  1F1B B;  1ZSZ A;  3G4S A;  4JPB W;  2KMT A;  3D7S B;  3GOX A;  1AEY A;  5FW9 A;  5GMK j;  1BCO A;  5I2M A;  3OSS C;  2EIF A;  2EVR A;  2QQA A;  2DET A;  2DBK A;  2COY A;  2OX7 A;  4XU3 A;  5GAN 2;  1JJ2 P;  2FO0 A;  1SPK A;  2CUD A;  3CC2 Q;  5HKC A;  3FJ5 A;  3J81 E;  2NLU A;  3C4S A;  5CKB A;  2Y90 A;  2YSQ A;  4PJL A;  2YT6 A;  4J5Y A;  4OGC A;  4RUG A;  2EBP A;  2RI3 A;  2PTK A;  4M77 C;  3EAE A;  3OSV A;  4PL6 A;  3JCM f;  2KRN A;  1BI1 A;  3OQ5 A;  2FZG B;  4C0D B;  1K73 R;  2XDP A;  4CC2 A;  1UGQ B;  3MP1 A;  4MDW A;  4LE9 A;  3C94 A;  3G6E Q;  2HEQ A;  2DXC A;  4IUT A;  4KGV B;  2DEU A;  2CS7 A;  4DEX A;  3EG2 A;  3QII A;  1PD0 A;  2YUN A;  5HK3 A;  5M9O A;  3JCM Q;  1QKW A;  1Z9Q A;  4FT2 A;  1ABQ A;  4LDW A;  4C5H A;  4E6R A;  3CCL A;  3JB9 F;  2KBT A;  1RAG B;  2C06 A;  1ZSZ C;  1I1J A;  3X26 B;  1OZ2 A;  2D6F A;  3U23 A;  4M7D G;  2MIO A;  4J9E A;  4FW1 A;  4E7H A;  4EMK A;  1YJN A;  2L0A A;  3UWN A;  2GBQ A;  4LUD A;  2YRC A;  2E70 A;  5CIU A;  5CAI A;  1UJ0 A;  3OYK A;  2MPX C;  4OGE A;  1VQK Q;  1AT1 B;  3H0H A;  2E3I A;  1DJ7 B;  4XU1 A;  4PFO A;  3SB2 A;  3HPW A;  4FSX A;  4IUR A;  4HCZ A;  3LYI A;  4JZ3 A;  4M7A B;  4M78 G;  5A0L A;  3AT1 B;  4Y92 A;  2AT1 B;  3NGP A;  4ELZ C;  1PSE A;  3M0S A;  4PJO A;  1AVZ C;  3OA6 A;  4BDY A;  4KGZ B;  2CH4 W;  2EQM A;  3CMA A;  1UEC A;  4DBF A;  3KXT A;  2F5K A;  2CP0 A;  2V1R A;  5HY6 A;  3OS5 A;  2M9U A;  4LDV A;  3OYA A;  3L2U A;  2LT4 A;  2PUO B;  4JUV A;  4OMF B;  4C8Q E;  2IVW A;  2M1H A;  2KSS A;  2GTO A;  2LX7 A;  4C92 B;  2W10 A;  1Z9Z A;  4N0A C;  4J8O A;  3RKX A;  1OU9 A;  4KBM B;  2F5T X;  1QVF P;  4M75 E;  1UHC A;  5LJ3 d;  1LOJ A;  4BI3 A;  3RKW A;  1E6G A;  2DJZ A;  1NLO C;  4DOW A;  3JCM h;  4EIK A;  1H8K A;  2E12 A;  4KRT A;  4GLK A;  2JXB A;  5LJ3 j;  1YBY A;  1VQ5 Q;  3CCU Q;  4HA8 A;  3HSB A;  2OTJ Q;  4EMK C;  1AWJ A;  2MWO A;  5GAO l;  1VQN T;  1YN8 A;  2NUT B;  3CCE Q;  2JTF A;  1WGS A;  1BU1 A;  3VV0 A;  4KGX B;  2K9G A;  1M5Q 1;  2M02 A;  2K5I A;  1LPL A;  1Q7Y C;  1FWZ A;  3EG3 A;  4OVA A;  3OBW A;  4PFZ A;  2QTX A;  1UUE A;  1YJ9 T;  1AWX A;  3CC4 Q;  3MET A;  4PJO C;  4PLI A;  5KYX A;  2EJG A;  1V76 A;  2DYI A;  1PKT A;  3HFN A;  2FPF A;  1B34 A;  4RTY A;  3G4S Q;  1BKB A;  3A8O B;  2KNB B;  5IAY A;  3MHX A;  3HRT A;  5GAN d;  5HK0 A;  1WJS A;  3EHR A;  1PRM C;  4IKF A;  1ZUU A;  3MP8 A;  1YHQ A;  2DBM A;  5IXF A;  4BAC A;  2GF7 A;  3H9N A;  1E6H A;  5GAN j;  1D3B B;  2SRC A;  3UF4 A;  3I56 T;  2VKN A;  2DMO A;  3EG0 A;  4PKC C;  3KFV A;  3NMZ C;  1WJR A;  2PUK B;  1S1N A;  1RI0 A;  2RHX A;  2P4R A;  4LXC A;  2AIR B;  2BZX A;  2K3Y A;  2OTL A;  2LCC A;  1M27 C;  2DFU A;  3TEE A;  1KQS S;  1T3L A;  1UGP B;  3M4Y A;  1W2B P;  1NLP C;  1VQM T;  1BI2 A;  3OYF A;  2RQR A;  3QZ9 B;  1VQ8 T;  2LDM A;  2NUZ A;  1O75 A;  3CPW P;  1I5O B;  2E4H A;  4C92 G;  3GBQ A;  4ZNX A;  2RJE A;  3JCM J;  3GNG A;  4JLG A;  1BI0 A;  3BFM A;  2RHY A;  1Q82 C;  4KH1 B;  2QGF B;  3TSW A;  1KG1 A;  4CRI A;  1WJQ A;  2CSQ A;  2GQI A;  1VQP A;  2KQW A;  1VQ4 T;  1UE9 A;  1FMW A;  1M9S A;  2LTO A;  1OUL A;  2K4Y A;  1P92 A;  3CBO A;  5FU6 B;  2JN0 A;  3CME A;  1AZE A;  1ZA1 B;  3TU4 K;  1YJN Q;  3VS3 A;  2EYY A;  1OU8 A;  4TVR A;  4BB7 A;  2KDS A;  4PJO D;  1OX9 A;  4RG2 A;  1X43 A;  2FG0 A;  2KY9 A;  2A37 A;  3ER0 A;  1XQH A;  3OYM A;  1GCP A;  4ZGD B;  1TTH B;  1C1A A;  2XK0 A;  2EYX A;  4XTY A;  1OPL A;  3GP8 A;  1VQ6 T;  5GMK h;  3FEO A;  4C8Q B;  2VGM A;  3IQL A;  3QYH B;  4M78 A;  3WXM B;  3CMA Q;  3RMQ A;  3I9Q A;  2RNA A;  5CCA A;  2KE9 A;  1SSF A;  2SEM A;  3G7Z A;  2EGC A;  3ZEH A;  2O9V A;  2X4W A;  3PIO A;  2L3S A;  2CP3 A;  3TQ7 P;  5FRN A;  2RQU A;  4A4K A;  1B7T A;  4Z02 A;  1JJ2 A;  4LDX A;  4OF1 A;  5EC7 A;  4Q5W A;  2P0Q A;  3NPF A;  3M54 A;  2L8D A;  1NYG A;  2DVJ A;  1YI2 T;  1UB4 A;  2DL7 A;  2DL5 A;  4M75 F;  4X9D A;  1VQM Q;  2EAY A;  1H64 1;  3JB9 H;  1WHK A;  3UA7 A;  5AYF A;  4L5G A;  4BY6 C;  1K9M C;  3RKY A;  1R8O B;  1UHF A;  2LQN A;  3M56 A;  5D6X A;  4AG2 C;  4ME7 A;  5GAN 6;  1M3C A;  2FZC B;  2DIG A;  3CC7 T;  2JVV A;  5GAM d;  2NUP B;  2DA9 A;  5CKD A;  1BIB A;  1Y71 A;  1VQ4 Q;  4J9B A;  2FVU A;  2DPP B;  5GJV B;  4JRQ A;  1QMC A;  3CC2 A;  5GAM j;  3FJP A;  1Y96 B;  2PVG B;  3V8J A;  4QQG A;  5GMK e;  3R6N A;  5LJ5 d;  2EQJ A;  2L2P A;  1M90 R;  3QXE B;  4QVC A;  2O9S A;  1TSF A;  1NJI C;  1FX7 A;  4DBR A;  1KHI A;  2KK4 A;  2M51 A;  4R56 A;  8AT1 B;  4D6W A;  1XJW B;  2EKO A;  4M78 C;  2DTH A;  3I55 T;  2YXY A;  4BDZ A;  4DA4 A;  4XTX A;  1VQ9 T;  5GAO m;  2MYS A;  1MHN A;  1VQ6 Q;  3TRE A;  1TS9 A;  1YWO A;  1EX4 A;  2AKL A;  1I07 A;  4O6J A;  2DK3 A;  1OQK A;  1YHQ Q;  5CKF A;  1VQO T;  3GF5 A;  2VWF A;  2EW3 A;  3M9Q A;  3VS0 A;  2FRW A;  2VVK A;  3A98 A;  4AFZ C;  2C0I A;  5KYU B;  1R0B G;  4BE0 A;  3QDR B;  2YRV A;  1OPK A;  3VS6 A;  1UG1 A;  2LRQ A;  3OMC A;  4LDU A;  4JDS A;  2DEQ A;  2QDL A;  3MEW A;  2OTL Q;  2GTJ A;  4C8Q G;  3BW1 A;  4M7A A;  2H3J A;  3CCR T;  1KQ2 A;  2WSE E;  1QVF A;  4II1 A;  2BKD N;  1PKS A;  3PGG A;  1JEG A;  4M75 G;  1D0Z A;  2CYZ B;  3LX7 A;  1NBE B;  1TWB A;  4M4Z A;  1M1K C;  2H3E B;  1PM3 A;  2DD4 A;  5LJ3 h;  3C95 A;  5IHI A;  2JS2 A;  1NEG A;  1RLP C;  3FIF A;  4C0D C;  1SRL A;  3EGD B;  1Q86 R;  4C92 A;  3X20 B;  4JRP A;  1Y7X A;  2DYB A;  2ED0 A;  3OW2 S;  1VQP Q;  1ZHI A;  1QVG S;  2O2O A;  3OYL A;  2YHT A;  2QAZ A;  1Y0M A;  2F69 A;  5CQX A;  1VYT A;  3V7R A;  3A8M B;  2DTI A;  3CME Q;  1M3B A;  2FB7 A;  4MZM A;  1G3S A;  1UTI A;  1WX6 A;  1M90 C;  4M78 D;  1X2Q A;  4M7D B;  2PQW A;  3OW2 A;  1QVG A;  2GFU A;  1M1G A;  2ENM A;  1SEM A;  2HBW A;  2KAF A;  1EZZ B;  2LVM A;  2OTJ A;  2NUT A;  2CT3 A;  2HCK A;  3SFM A;  4MZP A;  2XD0 A;  3OYB A;  4DBQ A;  2CP2 A;  3CCE A;  1X2K A;  2LCL A;  2EKH A;  2VXE A;  3PIP A;  1BI3 A;  5GAN h;  1S72 T;  3CXC A;  3I5S A;  4ESR A;  2YRD A;  2OJ2 A;  2JM8 A;  3ZFJ A;  4J7I A;  3JCM V;  1GL5 A;  4IUU A;  2Y4X A;  5LJ3 e;  3VS1 A;  3QYG B;  2AKK A;  2MMP A;  2JMC A;  1CKA A;  1X01 A;  1OYX A;  1H3H A;  2LJ1 A;  3M58 A;  5LL6 S;  5FWB A;  2O31 A;  3M0U A;  1AOJ A;  2QG9 B;  4F7U E;  3RER A;  1RLQ C;  1M30 A;  4PJM A;  9ATC B;  1LJO A;  2GGR A;  3KUF A;  4FIB A;  4C92 C;  4GY5 A;  1MMA A;  1VYU A;  2VAS A;  2HKQ B;  1JXM A;  2FRY A;  1WI7 A;  5GMK i;  1D3B A;  2E5K A;  3R6O A;  2BE9 B;  4MDX A;  5I22 A;  5IT9 E;  1YIT T;  4F04 B;  3CPW A;  5C6S A;  2MK5 A;  1R77 A;  4QQ6 A;  2BUD A;  3PVL A;  1GFC A;  1G3Y A;  2RQV A;  3GLX A;  2DM1 A;  2KT1 A;  3L42 A;  3P8B B;  2QQ9 A;  3EH1 A;  1Q86 C;  3H8Z A;  1Q95 G;  2DL3 A;  4EDU A;  3J80 E;  4KUD K;  1RAF B;  4D8K A;  5GAN e;  2QEX T;  2K5L A;  1PNJ A;  4PJJ A;  3L1A A;  4N0A A;  2E10 A;  3LWH A;  2O88 A;  1YIJ T;  1SHG A;  3G1J A;  2YUP A;  3RNJ A;  2IIM A;  4Y91 A;  1AWW A;  3V8L A;  1G83 A;  1UGV A;  2ESW A;  2RD1 A;  2HQE A;  4ANJ A;  3DB4 A;  3JCM c;  2B86 A;  2X4J A;  1RAA B;  1S72 Q;  1I8F A;  1RAD B;  3QPH A;  1K9A A;  1KJW A;  1M2O A;  2DXT A;  2DIL A;  4M7A D;  1YJ9 A;  3PTA A;  2EWN A;  1AHJ B;  1KC8 C;  1GBQ A;  2Z0W A;  3RDV A;  1W70 A;  2I0N A;  3HL8 A;  2KR3 A;  3JCM W;  2I2L A;  3X28 B;  2KRO A;  4ELY C;  4E47 A;  2DXB A;  4JS5 A;  5J26 A;  1K4U S;  3MP6 A;  2F2X A;  2GQV A;  1JO8 A;  4C8Q A;  4C92 D;  6AT1 B;  4Z88 A;  1IGQ A;  1VUB A;  3QWY A;  4EPC A;  2RI5 A;  4E2F B;  3CQT A;  3I56 A;  1MUZ A;  1RAB B;  1RI9 A;  1I0C A;  1BYM A;  4LD6 A;  4RKU E;  2MF2 A;  3HRU A;  2E65 A;  2OAW A;  4L59 A;  3ULR B;  1UFF A;  4Z89 A;  3LH5 A;  4ZGE B;  3QJ6 A;  2DAQ A;  5GAM h;  3V7S A;  1QKX A;  2DLP A;  1X69 A;  2RF0 A;  1YJW T;  1ZA2 B;  3EHQ A;  1D0X A;  4C0F A;  3OYG A;  1VQM A;  3A8H B;  2X9H A;  4M77 D;  3CCJ T;  3CCQ T;  4NL3 A;  1VQ8 A;  3EGX B;  4FYV B;  2RHI A;  4HT8 A;  5LJ5 h;  3CCV T;  3EFO B;  5DY9 A;  1Q82 U;  2NUP A;  2X3X D;  3JV3 A;  3PMI A;  5FU6 C;  2V8J A;  1NG2 A;  4BD3 A;  4PJO E;  4A4E A;  4IIO A;  1QW1 A;  2ZPG B;  2KGT A;  3OS0 A;  1K73 C;  4XK8 E;  4J6Y A;  1VQ4 A;  1UGR B;  1Y96 A;  1JU5 C;  5GAN 3;  5KYN A;  3QSU A;  3HHT B;  2NWM A;  2LJ0 A;  4F17 A;  1IZ6 A;  3VS5 A;  2QA4 T;  2W0Z A;  1ABO A;  2YLB A;  2JJ9 A;  2CT4 A;  3H41 A;  3S3M A;  4C8Q C;  5GAN 5;  3JB9 G;  3EH2 A;  2DX1 A;  1D1B A;  2DER A;  3NTK A;  1N8R U;  1OX8 A;  4F7U F;  1VQ6 A;  1WIE A;  5GAM e;  2X35 A;  4OB3 B;  3I5R A;  4M77 F;  1VQ7 T;  4FU6 A;  1NE8 A;  8ATC B;  3OYY A;  2EQI A;  5KYU A;  2RJD A;  3M0R A;  2JUF A;  4JRI A;  1N8R R;  5LJ5 e;  4RCB A;  5DM7 R;  2Y4Y A;  3QWX X;  4XU2 A;  4VUB A;  2A08 A;  2CSI A;  1U1S A;  1Y57 A;  3OYN A;  3CCQ Q;  4RG8 A;  2DXU A;  2L3P A;  2ZPF B;  2M0O A;  1K8A U;  3H6Z A;  3CCV Q;  1HK9 A;  3UPU A;  5CR2 A;  1TH7 A;  3JB9 I;  1UDL A;  4EMG A;  3X25 B;  1GRI A;  4C5E A;  3OYC A;  1VQN Q;  4J9G A;  4N4I A;  1OZ3 A;  1X75 C;  4CC4 B;  3EGD A;  3JCM b;  1K1Z A;  1K8A R;  4OMM A;  4X1V A;  1JBM A;  5FRM A;  4AT1 B;  2VGN A;  2DD5 A;  4FW2 A;  5GMK l;  4CC7 A;  2PNI A;  4WCI A;  2VUB A;  1YJ9 Q;  2BIV A;  2FPD A;  2J6O A;  1X6B A;  4GBQ A;  3I55 A;  1VQ9 A;  2DZ9 A;  3FDR A;  3JRZ A;  4M7D A;  1I81 A;  1WNL A;  3E19 A;  2NYS A;  1LVK A;  1VA7 A;  1SHF A;  3L2V A;  1KK7 A;  4OP0 A;  1JJ2 S;  1W1F A;  2D0Q B;  1VQO A;  1MMG A;  1T0J A;  1MMN A;  3LLR A;  2BZ8 A;  1HYO A;  5KE3 A;  1MMD A;  3I56 Q;  5GAO r;  1PWT A;  3REB B;  4A54 A;  1AWO A;  4M75 B;  2RM4 A;  1KD1 U;  2K57 A;  2C0O A;  1TXQ A;  4FM4 B;  1WHJ A;  3VYG A;  2QXF A;  3TSZ A;  2RHU A;  5D6W A;  3GIB A;  3MKD A;  4XTW A;  2HD0 A;  3EG1 A;  4QVZ A;  3BDU A;  5EG2 A;  4PK4 A;  3CCR A;  2ZCF B;  1OV3 A;  2FZK B;  1M1K U;  1GFD A;  4HCB A;  2HSE B;  1WXT A;  1VQ8 Q;  3LGL A;  2XI9 A;  5GAO q;  3OMG A;  4A63 B;  5ECA A;  2PU9 B;  3A5Z B;  3F70 A;  2GNC A;  1Q81 U;  1YCS B;  1H92 A;  1K0X A;  2JNG A;  3UAT A;  5LJ3 f;  4M78 E;  4PJO F;  3E1S A;  2XIC A;  3MJX A;  5CKH A;  4M7D C;  1HXD A;  4FT4 A;  3CCM T;  2HZY A;  2DNU A;  2BTT A;  2ZGW A;  2HQH A;  2COW A;  4A4F A;  3UDC A;  4LN2 A;  3O8V A;  3LW5 E;  4DBH A;  5FRO A;  1RAI B;  3NTH A;  3SWN B;  3URG A;  5GJW B;  4OB0 B;  3SHW A;  1QQJ A;  1NYF A;  3L2W A;  1PCX A;  4J9I A;  2EFI A;  3M59 A;  2WSF E;  3L2Q A;  4CC3 A;  1M2V B;  4PJN A;  3UA6 A;  1VQL T;  4IUV A;  3JCM d;  5CO7 A;  2CDT A;  2ZAE A;  7AT1 B;  3T9N A;  5A2Q E;  4QVD A;  4C5I A;  3NHN A;  4ZTF A;  1T3S A;  1ZLM A;  1XOV A;  3QBY A;  4XAX B;  4LUE A;  4C5G A;  4HCK A;  1FMK A;  1TG0 A;  1S72 A;  1VIF A;  4LDY A;  4C0Z A;  5GAN f;  2B8A A;  4J9H A;  3REA B;  1QVF S;  1WHH A;  1IB8 A;  1X6G A;  1YI2 Q;  4JLI A;  2ZPB B;  4BI4 A;  2MOX A;  4PNO A;  5DLO A;  1SRM A;  2DZC A;  4XTV A;  3CD6 T;  1QCO A;  1U06 A;  3JAM E;  1WFW A;  4DQ2 A;  3VU3 C;  1G8X A;  1UGS B;  4N4G A;  3CC7 Q;  3M0T A;  2RMO A;  5GAO p;  1PRL C;  1YIT A;  2QQS A;  3G71 T;  1QVP A;  3HKS A;  1BCM A;  3RES A;  5GAN 8;  2XU8 A;  4M7D D;  1XTD A;  3QJY A;  4MZT A;  1WHL A;  1JRI A;  1M8M A;  3OYH A;  3HRS A;  4QT7 A;  3N5B B;  3BE3 A;  3VUZ A;  4B9X A;  4N4H A;  2DTO A;  4RTV A;  4BE2 A;  3EFS A;  3EGX A;  2DL4 A;  3I55 Q;  1ARK A;  2QEX A;  1VQ9 Q;  1N5Z A;  4M7A E;  2EQK A;  4FL6 A;  1YIJ A;  3EFO A;  1IHV A;  1JB0 E;  3FC3 A;  3JCM g;  1CSK A;  3CXC S;  1PHT A;  3CC2 T;  1RL2 A;  2QQR A;  1B07 A;  1C6V X;  1VQO Q;  4MMK A;  1ZQ1 A;  2R5M A;  1U1T A;  3AHU A;  4ATO A;  2K3X A;  2KYB A;  4C92 E;  3VS4 A;  2FEI A;  1ZBJ A;  2PZ1 A;  1D1C A;  3EG9 B;  5KYW B;  1H3Z A;  2QK0 A;  1GCQ A;  2CZ6 B;  4HKE A;  1WXU A;  1M1F A;  3X24 B;  4AG1 C;  4J6X A;  3RIR A;  1KQS P;  2QDY B;  4UC4 A;  3UT1 A;  4HVW A;  2G3R A;  2DRK A;  2XDD A;  2KVQ G;  4JJC A;  2HL5 C;  5FU7 B;  3G6E T;  1W2B S;  1UEB A;  2HL3 A;  3CCS T;  2YWW A;  3CCR Q;  1I5L A;  4R0K A;  2RK1 A;  3CPW S;  1TU0 B;  1BBZ A;  2RQW A;  2J6F A;  1Y07 A;  1TUD A;  3G71 Q;  1RUW A;  5KH6 A;  3RBB B;  4JRK A;  3OYI A;  2K7A A;  4OB2 B;  3TVT A;  2RI2 A;  4M77 E;  1IRE B;  1R0C B;  2QYZ A;  3SD4 A;  1YWP A;  1W2B A;  4E7Z A;  4J9C A;  4M78 F;  2CZ0 B;  4XU0 A;  1RAH B;  2EJ9 A;  4FSS A;  3OYD A;  5IN1 A;  1VQK T;  1YJW A;  2LNV A;  1X6O A;  2F1L A;  5GAM f; 
#chains in the Genus database with same CATH homology
 4IIO A;  2KGT A;  2D8H A;  2KXC A;  1X43 A;  2FG0 A;  2A37 A;  1JU5 C;  3THK A;  2D0N A;  1GCP A;  2NWM A;  1EFN A;  2LJ0 A;  4F17 A;  2CH4 A;  2EYX A;  1OPL A;  2JTE A;  3VS5 A;  1QWF A;  1OOT A;  2W0Z A;  1ABO A;  4OMQ A;  2CT4 A;  3H41 A;  3IQL A;  1WDX A;  3I9Q A;  1GBR A;  4J9D A;  2RNA A;  2EYZ A;  1GCQ C;  2KE9 A;  4JJB A;  2SEM A;  4HVV A;  2EGC A;  2DX1 A;  2O9V A;  2L3S A;  1ZUK A;  2LQW A;  2RQU A;  1CKB A;  1ZUY A;  2AZV A;  5EC7 A;  2AZS A;  1WIE A;  1IO6 A;  1BK2 A;  5IHK A;  3NPF A;  1QLY A;  2JT4 A;  2J06 A;  1NYG A;  2DVJ A;  1KIK A;  2DL7 A;  2DL5 A;  3I5R A;  4RTW A;  2EYW A;  2M0Y A;  2D1X A;  3UA7 A;  3ZL7 C;  2KRM A;  2LNH B;  2EQI A;  4OMO A;  3M0R A;  1UHF A;  2A28 A;  2LQN A;  1U5S A;  2DJQ A;  4AG2 C;  1M3C A;  3SEM A;  5IHN A;  4DEY A;  2KRS A;  3QWX X;  2DA9 A;  2A36 A;  5HCK A;  2A08 A;  2CSI A;  2G6F X;  4OMP A;  1Y57 A;  4J9B A;  3M0Q A;  2DE0 X;  5IH2 A;  5GJV B;  1WXB A;  3O5Z A;  1AD5 A;  2L3P A;  2JM9 A;  2DF6 A;  2ECZ A;  2ROL A;  1J3T A;  4J9F A;  1A0N B;  3R6N A;  3C0C A;  1QWE A;  2L2P A;  2LJ3 A;  1WLP B;  1UDL A;  2O9S A;  1GRI A;  1WA7 A;  2LCS A;  2M51 A;  4JJD A;  4J9G A;  2KT8 A;  3H0I A;  4CC4 B;  2D8J A;  1K1Z A;  2LZ6 B;  4OML A;  2LMJ A;  4OMM A;  2YDL A;  4X1V A;  2F2W A;  2X3W D;  1YWO A;  5IXB A;  2RN8 A;  1FYN A;  2AKL A;  1K0S A;  4CC7 A;  2J6K A;  2PNI A;  4WCI A;  1I07 A;  1E7O A;  2EPD A;  1ZSG A;  2FPD A;  4K11 A;  2J6O A;  1X6B A;  4GBQ A;  2VWF A;  4JPB W;  2EW3 A;  3EGU A;  3VS0 A;  2FRW A;  1AEY A;  5FW9 A;  2VVK A;  3A98 A;  4AFZ C;  2C0I A;  4F16 A;  2EVR A;  1VA7 A;  1SHF A;  1OPK A;  2DBK A;  3VS6 A;  1UG1 A;  3VS2 A;  2FO0 A;  1W1F A;  1SPK A;  2CUD A;  1T0J A;  2QDL A;  2BZ8 A;  2GTJ A;  3FJ5 A;  2K2M A;  4D8D A;  1NEB A;  4RTX A;  4AFU C;  1PWT A;  3REB B;  2YSQ A;  2YT6 A;  1PKS A;  4RUG A;  1JEG A;  2EBP A;  4AFS C;  1AWO A;  2PTK A;  2JMA A;  2C0O A;  3VRZ A;  4M4Z A;  2OI3 A;  1HJD A;  3TSZ A;  4LNP A;  2EGA A;  2KRN A;  3EG1 A;  5IHI A;  2JS2 A;  1NEG A;  1AZG B;  1RLP C;  1TUC A;  4CC2 A;  1SRL A;  4LE9 A;  1OV3 A;  2HEQ A;  1GFD A;  2DYB A;  2ED0 A;  1WXT A;  2O2O A;  4DEX A;  3EG2 A;  3M0P A;  2RPN A;  4A63 B;  2YUN A;  1Y0M A;  5ECA A;  1QKW A;  1Z9Q A;  1VYT A;  1ABQ A;  1M3B A;  2GNC A;  1M3A A;  1YCS B;  1H92 A;  1K0X A;  4E6R A;  3UAT A;  1UTI A;  3I35 A;  2KBT A;  1QCF A;  1I1J A;  1WX6 A;  2J7I A;  1X2Q A;  1OEB A;  2V1Q A;  3U23 A;  2MIO A;  4J9E A;  1MV3 A;  2CRE A;  2MCN A;  2L0A A;  4HXJ A;  2GBQ A;  4LUD A;  2ENM A;  2XMF A;  1SEM A;  2HBW A;  1UJ0 A;  2DNU A;  2BTT A;  2C0T A;  2CT3 A;  2HCK A;  3H0H A;  1VYV A;  3H0F A;  2FPE A;  2H8H A;  2YUO A;  4LN2 A;  1X2K A;  2DL8 A;  4GLM A;  2EKH A;  5GJW B;  4JZ3 A;  3SHW A;  1NYF A;  5L23 A;  2JS0 A;  4J9I A;  2K3B A;  1U3O A;  4Y92 A;  3NGP A;  3I5S A;  4ESR A;  3M0S A;  4CC3 A;  2OJ2 A;  1AVZ C;  2K79 A;  4RTU A;  2JM8 A;  3UA6 A;  1X27 A;  2CH4 W;  1GL5 A;  2CDT A;  1WYX A;  1UEC A;  4AFQ C;  3VS1 A;  2AKK A;  2ABL A;  2V1R A;  2JMC A;  1CKA A;  2HDA A;  2HSP A;  1H3H A;  3NHN A;  2LJ1 A;  1T3S A;  1ZLM A;  5FWB A;  1XOV A;  1W6X A;  2O31 A;  3M0U A;  1AOJ A;  2F2V A;  4LUE A;  2LX7 A;  2GTO A;  4HCK A;  1RLQ C;  2W10 A;  1FMK A;  1Z9Z A;  1M30 A;  1TG0 A;  2GGR A;  1ZX6 A;  1VYU A;  1KSW A;  4J9H A;  1JXM A;  3REA B;  2FRY A;  2YUQ A;  1UHC A;  1WI7 A;  2ED1 A;  2BZY A;  1X6G A;  2E5K A;  1E6G A;  1NLO C;  5I11 A;  1NM7 A;  4EIK A;  5I22 A;  2MOX A;  1H8K A;  1YNZ A;  4KRT A;  4JZ4 A;  2DRM A;  1SRM A;  2JXB A;  3VRY A;  2EGE A;  1U06 A;  1GFC A;  3PVL A;  4ORZ A;  2RQV A;  1WFW A;  1AWJ A;  2DM1 A;  1YN8 A;  2KT1 A;  3M0T A;  2RMO A;  1BU1 A;  1PRL C;  1LCK A;  2DL3 A;  2K9G A;  4D8K A;  1KFZ A;  2L3Q A;  2CUB A;  1PNJ A;  3EG3 A;  1B3Q A;  2O88 A;  1SHG A;  1UUE A;  1HD3 A;  1UJY A;  1AWX A;  1YP5 A;  1M8M A;  2YUP A;  3RNJ A;  1G2B A;  4QT7 A;  2IIM A;  1AWW A;  2KXD A;  1G83 A;  1JXO A;  1UGV A;  2ESW A;  1PKT A;  4RTV A;  2FPF A;  4RTY A;  1HSQ A;  2B86 A;  2ROT A;  2DL4 A;  1ARK A;  2KNB B;  4HVU A;  5FWC A;  1K9A A;  3EHR A;  1N5Z A;  1PRM C;  1KJW A;  2LP5 A;  2DIL A;  1ZUU A;  2DBM A;  5IXF A;  1MV0 B;  1CSK A;  1GBQ A;  1BB9 A;  1PHT A;  1E6H A;  1W70 A;  2I0N A;  2SRC A;  1B07 A;  2KR3 A;  3UF4 A;  2VKN A;  2DMO A;  3EG0 A;  2KRO A;  3KFV A;  3PE0 A;  3NMZ C;  2KEA A;  1K4U S;  2KYB A;  1S1N A;  2F2X A;  3VS4 A;  1JO8 A;  1ZBJ A;  2FEI A;  4Z8A A;  3VS7 A;  4Z88 A;  2PZ1 A;  2AK5 A;  2P4R A;  2BZX A;  4IIM A;  1GCQ A;  3QWY A;  1WXU A;  4AG1 C;  1M27 C;  3CQT A;  1K76 A;  1MUZ A;  1T3L A;  4HVW A;  2DRK A;  1RI9 A;  4JJC A;  1I0C A;  1NLP C;  2RQR A;  2J05 A;  1T0H A;  2OAW A;  2NUZ A;  2RQT A;  3ULR B;  4R0K A;  1UFF A;  4Z89 A;  3LH5 A;  4RTZ A;  1BBZ A;  3GBQ A;  2RQW A;  4ZNX A;  2J6F A;  1QKX A;  1TUD A;  2DLP A;  1X69 A;  2RF0 A;  1RUW A;  3RBB B;  2K7A A;  3TVT A;  3EHQ A;  3TSW A;  2CSQ A;  1YWP A;  2GQI A;  1SSH A;  2JW4 A;  4J9C A;  1UE9 A;  4OMN A;  4RTT A;  2K6D A;  4F14 A;  2KYM A;  1JQQ A;  3PVQ A;  4FSS A;  1V1C A;  2X3X D;  3JV3 A;  1AZE A;  3VS3 A;  2EYY A;  1NG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...