4J9BA

Crystal structure of the abl-sh3 domain h59q-n96t mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
PNLFVALYDFVASGDNTLSITKGEKLRVLGYNQTGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Abl-SH3 domain H59Q-N96T mutant
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ABL1
total genus 11
structure length 58
sequence length 58
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9bA00
1X2QA 2EBPA 2F2VA 3M0QA 3VS6A 1WA7A 4Z8AA 2B86A 2DE0X 4D8KA 2GQIA 1GCQC 1I07A 1UJYA 2L0AA 1QWEA 4WCIA 4J9FA 2OAWA 2OJ2A 3UA7A 2KYMA 2EW3A 3LH5A 4RTTA 1ABQA 5IHNA 1ABOA 4JPBW 4HVWA 3ZL7C 1ARKA 2DYBA 1A0NB 2PTKA 2J6FA 3R6NA 1OPKA 1GRIA 1WX6A 3VS1A 3SHWA 2L3SA 1GFCA 2O31A 3H0FA 1TUDA 1EFNA 2EPDA 1AVZC 2EVRA 1NLOC 1E6HA 1K9AA 1UHCA 5HCKA 2K79A 4F16A 2J6OA 4HVVA 1U5SA 2EGEA 1H92A 2FG0A 3QWYA 2RN8A 2ECZA 3M0RA 1UDLA 2LJ0A 3EHRA 2DX1A 1K1ZA 2QDLA 4GBQA 2AKLA 2DL4A 3NHNA 2A08A 2K9GA 4J9GA 2GTOA 1WXTA 3EG2A 1NEBA 1NYGA 2CUBA 2RQWA 1GCQA 1KFZA 2MIOA 2MOXA 2L3QA 2JS2A 2YUOA 2DBMA 2EYZA 2HDAA 2BZXA 1J3TA 3TVTA 3H0HA 2JXBA 4ORZA 1PKTA 1UE9A 2LZ6B 2K3BA 4J9BA 3PVQA 2EGAA 2GGRA 1I0CA 2KNBB 2FPDA 2EGCA 1VA7A 2J7IA 1PRMC 3I35A 4E6RA 4ESRA 4DEXA 2DL3A 2SEMA 2KRNA 1NM7A 2YUPA 1E7OA 3PVLA 4JJCA 1B3QA 1NEGA 5GJWB 1AWXA 1UG1A 3VS7A 4CC4B 4OMMA 1CKAA 1UGVA 1GFDA 1GL5A 4LUEA 3VRZA 1ZUUA 2BZ8A 2P4RA 1KSWA 2ABLA 2PNIA 1SHGA 2LP5A 2X3XD 4HCKA 5I22A 2O2OA 1RUWA 2YT6A 4DEYA 2CH4A 3A98A 2KT8A 1W70A 1H3HA 2ESWA 1KIKA 4Z88A 1OPLA 1W1FA 2PZ1A 1MV3A 1M27C 2FPEA 4RTYA 2O9VA 1T3SA 3H41A 1UHFA 2X3WD 3O5ZA 3FJ5A 2EYWA 1YN8A 1GBRA 1VYVA 1ZX6A 2RMOA 4IIOA 5GJVB 2G6FX 3RBBB 3I5RA 1NYFA 2KR3A 2MCNA 1Z9QA 2AZSA 3M0UA 2LCSA 2KYBA 1M3CA 4R0KA 2KGTA 2D8JA 1X43A 1M3BA 4OMLA 4RUGA 3UA6A 1WIEA 1N5ZA 2JMCA 2C0TA 2C0IA 2LNHB 4J9EA 4LN2A 1I1JA 2M51A 2BZYA 3KFVA 1SPKA 2H8HA 2CDTA 1UTIA 1QKXA 2GNCA 1K0SA 2DA9A 1AD5A 2A36A 2O9SA 1UFFA 1T0JA 1V1CA 2BTTA 1OV3A 2JTEA 1YP5A 2NUZA 1Y57A 4GLMA 4ZNXA 2DF6A 1JU5C 3REAB 2YUQA 2LQWA 1OOTA 1ZLMA 5IXBA 2LMJA 2EYYA 4X1VA 1X69A 2D1XA 4AFQC 1TUCA 4J9HA 1FYNA 2W10A 2AK5A 2AKKA 3TSWA 4M4ZA 3M0PA 4FSSA 1HJDA 1G2BA 1WLPB 2VWFA 5IXFA 3JV3A 5ECAA 4Z89A 4F14A 4LUDA 1QCFA 1CSKA 2CSIA 1AOJA 2ROTA 4D8DA 2DBKA 4OMPA 4JJDA 2RNAA 2YDLA 4J9DA 1PRLC 1JQQA 1M8MA 1JO8A 4K11A 3VS0A 3PE0A 1AZGB 1BBZA 1SHFA 1VYUA 1Z9ZA 4IIMA 1PWTA 1CKBA 2HEQA 3VS3A 2FRWA 2ROLA 4J9CA 4OMNA 1JXMA 4CC2A 1PKSA 2O88A 1SSHA 2CH4W 4EIKA 4AFZC 2DJQA 2DVJA 2IIMA 2K7AA 3TSZA 2JM8A 3C0CA 1PHTA 1T0HA 2GTJA 1JXOA 4AG2C 1WYXA 1YWOA 2JW4A 3M0SA 2ED0A 2K2MA 1OEBA 1LCKA 2L2PA 2RQVA 4AG1C 3GBQA 1WXUA 2A28A 4J9IA 1QKWA 1W6XA 1AWJA 1ZUKA 1Y0MA 4AFUC 2OI3A 1IO6A 2RQRA 1AEYA 1PNJA 1NG2A 2KBTA 2L3PA 1WI7A 4JJBA 2HCKA 4A63B 1GBQA 1FMKA 3H0IA 3NGPA 1U06A 3VRYA 5L23A 2E5KA 1T3LA 2KT1A 1H8KA 2W0ZA 2DILA 1K76A 1ZBJA 2F2XA 2EKHA 2SRCA 4OMQA 2LJ3A 4QT7A 1XOVA 1E6GA 1U3OA 2DL8A 1UUEA 2J06A 1GCPA 2DNUA 3UF4A 1AWOA 2CUDA 1MV0B 3U23A 1AZEA 2KE9A 5FWBA 2M0YA 1BU1A 2DL5A 3EG3A 2RQTA 3RNJA 1YWPA 2F2WA 4RTUA 4RTVA 1UJ0A 5IHKA 3EG1A 4CC7A 1M3AA 2EYXA 1X6GA 1RLPC 2JM9A 2AZVA 5FWCA 3I5SA 2RPNA 2VVKA 4KRTA 2KEAA 4AFSC 2DLPA 1MUZA 4LE9A 4RTZA 1YCSB 1NLPC 2CT3A 4OMOA 1ZSGA 1UECA 1SEMA 1M30A 1WXBA 4CC3A 2DMOA 2FO0A 2FPFA 3NPFA 1BK2A 1SRLA 2D0NA 1ZUYA 2J05A 4F17A 4JZ4A 2YUNA 2LJ1A 3NMZC 2J6KA 3EG0A 2RQUA 2DM1A 4HXJA 2GBQA 2JT4A 1G83A 2JS0A 2KRMA 1WDXA 2KXDA 2JMAA 3M0TA 1RLQC 1X27A 1K0XA 2LX7A 2FRYA 5IH2A 2DRMA 2EQIA 1TG0A 5FW9A 3REBB 2C0OA 2DRKA 2FEIA 1B07A 4JZ3A 5IHIA 2DL7A 1QWFA 4LNPA 1HD3A 3VS2A 4RTXA 3THKA 1JEGA 2VKNA 1S1NA 2RF0A 1KJWA 1X2KA 4HVUA 2KRSA 3IQLA 1YNZA 2NWMA 3EHQA 1WFWA 1SRMA 2D8HA 2KXCA 1X6BA 3VS4A 5I11A 1VYTA 2HBWA 2I0NA 2KROA 2K6DA 3ULRB 4RTWA 1HSQA 2CREA 3UATA 2LQNA 1AWWA 1K4US 2V1QA 1RI9A 3I9QA 2XMFA 3QWXX 2YSQA 2CSQA 5EC7A 2A37A 3EGUA 2V1RA 1BB9A 1QLYA 2CT4A 4Y92A 3SEMA 2ENMA 3CQTA 2ED1A 2HSPA 3VS5A
chains in the Genus database with same CATH superfamily
3VJPA 2EBPA 3M5AA 3M0QA 1VQ9A 3M53A 1M4ZA 4DBRA 4QQDA 2LVMA 2DE0X 5HKCA 1VQ8A 3CC2A 2QA4T 1I07A 2F5TX 3WVEB 1IGUA 4KULA 2OAWA 2X4XA 2AHJB 2FZKB 2A0FB 2EW3A 4RTTA 2GFUA 3ZL7C 4C5IA 5CQXA 1YITQ 4R55A 1WX6A 3VS1A 3SHWA 2PU9B 2EPDA 5FU6C 2M02A 1NLOC 1E6HA 2DYIA 3CCJQ 5I21A 3GF5A 4PJJA 1QVGP 2QG9B 4C92A 3HFNA 2ECZA 1FX7A 2DD4A 3BW1A 1K1ZA 5LJ5d 1RL2A 2RO0A 4KGVB 4PKCC 4NOYA 4X34A 1M1KC 2A08A 5GAMj 1V29B 3OS2A 4N0AA 2DPPB 3V8LA 4M75B 1NPRA 3H0HA 2GFAA 2P4TA 2M9UA 4ORZA 5GAN2 1UE9A 2LZ6B 5J39A 1D0XA 1YJNT 2EGAA 3HRTA 1VQ7A 1I0CA 2CP0A 3JCMV 3EGXB 4BACA 4B9XA 2QGGA 2EGCA 3CPWP 2DZCA 4E6RA 4BE0A 2X4JA 1LJOA 4DEXA 2M1HA 3OYGA 1YJ9T 2DL3A 2V26A 5A0GA 2KRNA 4QVDA 1NM7A 1PSFA 2NUTB 3L1AA 5GJWB 2XU8A 3QYHB 1AWXA 2NYSA 3VS7A 1CKAA 1NPPA 2P4RA 3GNFB 3SWNA 3JB9D 2F69A 2LT1A 8ATCB 3T9NA 2YT6A 1ZSZB 1D0ZA 2GF7A 3CMET 1Q81R 3MP8A 1BI3A 2X35A 4Z88A 3MPUB 1OPLA 3QPHA 5LJ3f 4OB3B 3CD6T 3V7CA 2O9VA 3JB9I 1VQ7T 2NLUA 4E7ZA 2QEXT 3H41A 3HL8A 3D7SB 2CP6A 2EWNA 4FU6A 4QW2A 1WHHA 1ZX6A 4C5GA 1ZBXA 2JTFA 1YJ9A 2IVWA 3ER0A 4C0FA 2KR3A 3CCUA 5GAN8 2LCSA 1MGQA 2KYBA 4R0KA 2KGTA 5GANf 4BD3A 3GOXA 1N5ZA 2JMCA 5CR2A 5CKEA 2OX7A 1OX9A 2K2VA 1KQSA 3I56T 4XTVA 7AT1B 1I8FA 2CDTA 1UTIA 1K0SA 1FMVA 4DQ2A 1AD5A 4J6YA 1N6AA 1K9MU 2O9SA 3CCLA 4VUBA 3RMQA 4RKUE 3CD6A 2E6NA 1WHKA 2BTTA 4JRPA 2RB6A 1YP5A 2L89A 5LJ3d 2Z0WA 4RG8A 4GLMA 4ZNXA 2QEXA 1AHJB 1BCMA 2CP7A 1TOVA 5IXBA 2LMJA 4LD6A 1TH7A 4X1VA 1X69A 2D1XA 1YHQA 4J9HA 3CCUT 4BE2A 1QQJA 3CPWA 1QVFA 3CCSA 1BYMA 1YFNA 1BKBA 5GAOq 1HJDA 3OYFA 1JJ2P 3VUZA 3URGA 2P84A 1CSKA 3QJ6A 2QA4Q 3OBYA 1RAHB 2ROTA 2DBKA 3QDFA 1YJ9Q 4KUDK 2ZPIB 1K73C 4DOWA 5KE2A 1PRLC 1JO8A 1AZGB 3RKWA 2HNIA 1VYUA 1XNIA 3KXTA 2HEQA 4C8QD 2KK4A 5GMKi 2FYKA 1SSHA 5A0LA 3TSZA 1K73U 1OQKA 2DTOA 2RD1A 1PC0A 2HSEB 3M0SA 2ED0A 1UGSB 4J9IA 4Y28E 3FB9A 2XDDA 1RAAB 3QZ9B 1R77A 1Y0MA 1LPLA 2QAZA 2RA2A 2QTVA 4J7IA 4N0AC 4JJBA 3N5BB 1YIJT 1MNEA 2E1HA 4O5VA 1WHJA 3NGPA 1U06A 3G6EA 1Q86U 2E5KA 1YHQQ 1T3LA 2KT1A 1H8KA 4LDVA 1WNLA 2W0ZA 1ZBJA 5GANg 5GAMg 2LJ3A 1XOVA 1D3BB 2EQKA 5HK3A 1UUEA 4ZGJB 4WF2A 1VQLA 2FVUA 4JS5A 1I5OB 2DIQA 4XTXA 2QQ9A 1Q86C 3OS1A 4BUGA 1BU1A 2DL5A 3EG3A 1Q86R 2HQXA 1QCOA 4RTVA 3P8HA 5GAN4 1MHNA 1TU0B 4N4IA 3A5ZB 3CMAA 4MMLA 5GAOn 4RCCA 3I5SA 3OYEA 4M77C 3INZA 4M78F 3OB9A 5GANe 2VUBA 2H3JA 3SWNB 3CD6Q 5AT1B 1MUZA 1NLPC 1VQ6T 1YJNQ 2CT3A 4M77F 2MF2A 2O01E 2R5MA 3CCMT 3WXMB 1N8RR 1SG5A 4CC3A 3PMIA 3NPFA 1AT1B 1BK2A 2D0NA 1ZUYA 1KHIA 3BFMA 1NJIC 2J05A 1U1SA 1VQOT 2LJ1A 4A4HA 2RM4A 5KCOA 2DEQA 1VQ4T 2DM1A 3HP9A 4HXJA 1RAFB 2KVQG 5KYWA 2LT4A 3HKSA 1WJQA 4M7AA 4M75G 1X27A 2LX7A 2EJFA 1TG0A 2C0OA 2DRKA 2EFIA 1B07A 2RI5A 2JOYA 5IHIA 2DL7A 4R56A 2HAXA 1HD3A 1LNXA 1QW1A 3VV0A 4FW2A 3G7ZA 4RTXA 2QQAA 4A4EA 3LGLA 1S1NA 3VKIA 1KJWA 1X2KA 4X9DA 3EHQA 4GLKA 3CCMA 1WFWA 3CCEQ 1VQ7Q 5I11A 3ZEHA 3CCQA 1ZHIA 4M77G 1Y71A 2B8AA 4HCBA 5GMKm 4M7DA 1IZ6A 2A3LA 2O4XA 3OS5A 5KYXA 1RI0A 2DAQA 3CCVT 2V1QA 1RI9A 1K9MC 4CI0C 2XMFA 1GXIE 2V1RA 1BB9A 1QLYA 4IUQA 4JRIA 4UC4A 3SEMA 2ENMA 3EFOA 4RMOA 3CQTA 3VS5A 1X2QA 4RCBA 3JCMP 3VS6A 1SKUB 1B7TA 4M7DE 4OF1A 4Z8AA 1MMAA 2GQIA 1GCQC 4B9WA 3GIBA 3X24B 2QI2A 2DXCA 2RJCA 2A7YA 4M75E 3CPWS 1IREB 1H3ZA 1QVFS 3ASKA 3UA7A 2K3XA 3C95A 3JCMc 5IHNA 4HVWA 3JCMJ 3RKXA 3NTKA 3QXEB 1GRIA 1OI1A 2L3SA 1GFCA 2O31A 3ME9A 2COYA 4FSXA 1I4K1 1K9AA 5HCKA 3CCMQ 3LH0A 4C8QA 3UT1A 5CAIA 5LJ3h 1K8AR 3QWYA 2EAYA 2XDPA 1XJWB 4OGCA 3CCQT 2QQRA 4Y91A 1C1AA 1LOJA 4C8QF 3MEVA 3SWNC 1PD0A 4J9GA 4BY6B 3G6ET 1NEBA 1BIAA 2CUBA 3MO8A 2MIOA 1WJSA 2DXBA 2JS2A 2YUOA 2R58A 1KC8C 2EYZA 2HDAA 2JXBA 4Q5WA 2CS7A 5DM7R 1TTHB 2GGRA 4C92F 2ZGWA 4N4GA 3JCMX 5GAN5 2YRDA 3E19A 4ZTJA 2J7IA 4XTUA 1VQMQ 1LVKA 4MZMA 3G71Q 2CP2A 1KC8U 5GMKh 1YJWT 2SEMA 1ACMB 1NE8A 4KGXB 3PVLA 3LWHA 3C94A 2RHIA 4JJCA 2YWWA 4OVAA 4M7AB 4CC4B 1GL5A 1ZUUA 2RK1A 2BZ8A 2VXFA 1KSWA 1YI2T 2PNIA 4MDXA 1SHGA 5KYNA 4HCKA 4LXCA 1NZ9A 1RUWA 2EQUA 2VXEA 1VQNT 1UGQB 2DTHA 1W1FA 5A0DA 3TU4K 1MV3A 3FLGA 3DLLA 2FPEA 2VV5A 4M7AD 4E2FB 3HHTB 1T3SA 1OX8A 2FL7A 3O5ZA 3FJ5A 1ZQ1A 1V76A 2CZ6B 3JCMW 3I55A 2RMOA 4IIOA 1JBMA 3FRNA 2G6FX 3MEUA 1PSEA 3RBBB 1Q82U 5FU6B 5CKFA 4FT2A 1M3CA 4XTWA 1D0YA 1X43A 3CC4A 1TUGB 4RUGA 3UA6A 3PMTA 4FYWB 3CC7T 1B34A 3META 1I1JA 3OYDA 3H6ZA 3QIIA 2BZYA 3EFOB 3KFVA 1HXDA 1SPKA 4M7AF 2RK2A 3Q1JA 3OQ5A 4WTOB 2AIRB 1UFFA 4C92D 3A8OB 3CCRA 1OV3A 1QP2A 1HK9A 1W4SA 4QQGA 1JJ2A 1TWBA 2NUPB 1JU5C 2YUQA 1Y7XA 4C8QG 1ZLMA 5LJ5h 1TUCA 3H9NA 2XD0A 1EX4A 2DERA 2ZPBB 1NJIR 3HSBA 3RERA 2DZ9A 4E7KA 1RAEB 3OYYA 3I55T 1WJRA 3QO3A 3JCMe 2X9HA 5ECAA 1RABB 2Y4YA 4F14A 5LJ3g 6AT1B 3VU3C 1UB4A 3OYNA 2XKOC 1AOJA 4ELYC 3G4ST 4M77A 4BI8B 1PG5B 3JCMb 2YDLA 2MWPA 1M8MA 5FRMA 3V8JA 5FU7C 1SHFA 4XK8E 5GAMf 3VS3A 1PKSA 3P8DA 2DVEA 1VQLQ 3HRUA 2CH4W 3V7RA 2YLBA 1OZ2A 4DBHA 3C0CA 4JLIA 2XIDA 4EMHA 4A53A 1JXOA 1D1AA 1WYXA 1F1BB 4FYVB 3BDUA 4PLIA 4OP0A 2A28A 4C8QE 1KG1A 3FC3A 3CCRQ 2RQRA 2QK0A 1AEYA 1PNJA 3EH2A 2K4YA 3C4SA 4A4FA 3EGXA 4ATOA 2BE7D 4J5YA 2QGFB 4A63B 1YI2A 3H0IA 3L2RA 4P5NA 2EKHA 4JRKA 4J7FA 4LD9K 4QT7A 3JCMf 2QASA 3C12A 4JUVA 1D1CA 1XQHA 3S3MA 2CGHA 2R57A 2CP3A 4EDUA 2CUDA 3AT1B 5HY6A 3CCET 4AMCA 2COWA 2M0YA 3OYJA 1YWPA 2HMAA 2D9TA 4RTUA 3OYIA 3EG9B 4M75F 1TS9A 5CVIA 1M90U 2EYXA 4M7DC 4L59A 1RLPC 1R8OB 2JM9A 2ZPFB 1QCNA 4XU2A 2L5QA 1QVGA 1KK7A 3OBWA 5GANj 3SB2A 4OB2B 3M58A 4M75C 3CCJA 3OY9A 1WPYA 1TXQA 4F7UE 2YXYA 4BY6C 2QTXA 3A8LB 2GCXA 3OMGA 5L8RE 3OW2S 3X28B 4LDYA 1WXBA 1P92A 1Q7YC 4A4KA 2FO0A 2P0PA 3QUIA 2ZPGB 4M77D 4DOVA 4PJLA 2KY9A 3NMZC 2QEXQ 3EG0A 1YJWQ 2GBQA 2PVOB 2JT4A 3HFOA 4IURA 1G83A 2JS0A 1VQ8Q 2KRMA 4MDWA 5IAYA 1KC8R 1Q7YU 4C5EA 2FRYA 4OGEA 2DRMA 4M75A 2FEIA 1QWFA 4XAXB 1SSFA 5AYFA 2RJFA 1VQNQ 2VKNA 2JVVA 4M78B 4ZN3A 2KRSA 3IQLA 1YNZA 3M54A 2KXCA 1X01A 4PNOA 1I5LA 2PUOB 2HBWA 1VQOA 5CIUA 3ULRB 2HL5C 4BI3A 2LDMA 3GNGA 1OULA 1Q95G 1UGPB 2CREA 4C0GA 1M5Q1 5DY9A 1K4US 4L6V5 3QWXX 3I55Q 2VGMA 4Y92A 1VQPQ 3A8HB 2EJ9A 3MP1A 2ED1A 3VS0A 2HSPA 4B6MA 3V7SA 4JS4A 1VQ6Q 4PFZA 4C8QB 1WA7A 4M7DB 2K57A 4XU0A 3EG9A 4J6WA 5I2SA 4M78C 2RH2A 3F70A 1UJYA 2FB7A 4A54A 4WCIA 4J9FA 4FYXB 1VQ4Q 2E5QA 2KYMA 3FEOA 2KQWA 3LH5A 1ABQA 1ABOA 4JPBW 2E3IA 1N9RA 2K5IA 2AT1B 4PJOD 1ARKA 4PJOA 2XDBA 1A0NB 1G8XA 5J3BA 5GAN6 1K73R 3TQ7P 3H0FA 2DD5A 1S72Q 2K79A 3CCEA 2E3HA 2EQJA 2J6OA 1H92A 2FG0A 2RN8A 2LNVA 2E10A 3DKMA 3M57A 3OSVA 1VQ6A 1UDLA 1RAIB 5M9OA 2QXFA 4ANJA 2LJ0A 3EHRA 3QSUA 2WSCE 3DLMA 8AT1B 1M1KR 2OTJA 4E47A 3NHNA 3CPFA 1WGSA 2EYQA 2JZ2A 4MZTA 2K9GA 3KBGA 4DBQA 2GTOA 1WXTA 1YIJQ 2RQWA 1R0BG 2HKNA 1KFZA 2MOXA 4KH1B 2L3QA 1UGRB 5D6YA 5CKDA 2DBMA 2BZXA 4XU1A 3G1JA 3TVTA 4LDWA 2F1LA 2JTMA 3QHSA 4OB0B 5A2QE 2K3BA 4FW1A 5GAOr 4EMKA 2V8IA 4M7AG 5FU7B 3OA6A 2FPDA 3CBMA 1VA7A 1PRMC 4ESRA 1Y07A 5GANd 2I2LA 1YJNA 4M78A 3EGDA 2VGNA 2YUPA 3CCRT 1VQMA 4IUUA 4XU3A 2BIVA 3RIRA 3L42A 4ZN1A 2BE9B 3J7AF 1UG1A 2VASA 4OMMA 1GFDA 4LUEA 4XQ3A 3CEYA 3VRZA 2ABLA 2LP5A 2X3XD 2O2OA 4FYYB 4DEYA 2CH4A 2LCCA 1W70A 1YJWA 1H3HA 1Q82C 2VYTA 2ESWA 1N8RU 2QQSA 2EJGA 2PZ1A 1VQ9Q 1M27C 1IRXA 2DKGA 1I81A 4F04B 4RG2A 2BUDA 2MWOA 2QQBA 2EYWA 3EGDB 4J83A 1VYVA 1W2BP 4MZPA 5CKHA 3HPWA 2HZYA 3EFRA 1G3YA 2K5LA 2MCNA 1Z9QA 4FCYA 3M0UA 5KYYB 3VUBA 4NS5A 5GAN7 3SFMA 3G6EQ 4F7UF 3DB3A 3OW2P 2E4HA 2OTJT 1VIEA 1IXDA 2C0IA 2JUFA 4QQ6A 4MMKA 4J9EA 1NJIU 4E7SA 1RACB 3QJYA 1PM3A 2H8HA 2MK5A 4PJOC 3O8VA 1QKXA 2LTOA 4PJOG 4PFOA 2A36A 1MNDA 3E9GA 4V2SA 3A8GB 1V1CA 5GAMd 1UEBA 2NUZA 3NFCA 1Y57A 4QVCA 2DF6A 3CCST 3JB9F 2CZ7B 2XICA 3CC7A 5DLOA 4X9CA 2E12A 3L2QA 2EYYA 4NL3A 3MEAA 1M1FA 1FYNA 3RMSA 5J26A 1YI2Q 3TSWA 2Y4XA 2RI3A 4HT9A 4FSSA 4C92E 1WLPB 3S6WA 2E64A 5IXFA 2JJ9A 3SDZA 1BIBA 2JNGA 4M78G 2LQKA 1DJ7B 3QDRB 2V8JA 2CSIA 3L2WA 1VQOQ 2ZZDA 3CCQQ 2YRCA 1G3TA 4J9DA 3OYHA 1JQQA 3PGGA 4K11A 3J81E 3PE0A 1BBZA 4OB1B 1FWZA 1Z9ZA 3JRZA 4IIMA 3S3NA 4NL2A 1YITT 2K3YA 5I2MA 4CC2A 4OMNA 1JXMA 3MP6A 3CMEQ 1BCOA 4AFZC 2DVJA 2YLCA 2LC4A 2DEUA 1M1KU 4LDXA 2RHYA 4J8OA 1PHTA 1WQ7A 1T0HA 2GTJA 4AG2C 4C92C 1YWOA 2JW4A 3X25B 2K2MA 1OEBA 1M9SA 3QG1A 1WXUA 3CCLQ 4HCCA 1W6XA 1VIFA 2KAFA 1AWJA 1JRIA 1ZUKA 5C6SA 3KUFA 1KD1U 4AFUC 2OI3A 1IO6A 1ZA1B 2EKOA 1NG2A 1ZA2B 1VQ8T 2LQ8A 5DLQE 3GLXA 4D6WA 2OAUA 1GBQA 5LJ3e 1WQWA 3P8BB 1FMKA 3X20B 3VRYA 2DILA 4M7DF 2F2XA 4OMQA 1M90R 1E6GA 4EMKC 2X4WA 1M90C 1VQKA 2DL8A 2OTLA 2J06A 1X75C 3PFSA 2DNUA 2O4XB 3UF4A 2RI2A 5KH6A 5GMKj 4J6XA 3CMAQ 1AWOA 3U23A 3JCMQ 2KE9A 4AT1B 1OU8A 2F2WA 1UJ0A 1VQMT 4O6JA 4KH0B 1M3AA 2FZCB 1X6GA 2AZVA 5KYWB 3BDLA 4EPCA 3M59A 1OU9A 2VVKA 3CC7Q 2KI7A 4BI4A 4KRTA 3H8ZA 4ZTFA 1IHVA 1YCYA 4OMFB 3M4YA 4DBFA 3AHUA 2GQVA 2DLPA 4LE9A 4RTZA 1YCSB 3UWNA 4OMOA 3JSCA 2PUKB 2XHCA 4TVRA 1B34B 2RJEA 1SRLA 3CXCS 1VQ4A 4JDSA 3G71A 1VQKT 1ZSZA 3RR6A 5KYUB 2RQUA 1Y96A 2KDSA 1D1BA 4M78D 2EIFA 2KXDA 2JMAA 5FROA 3QKJA 3BE3A 3M55A 5GAOm 1VOMA 1WHGA 2DETA 2QDYB 5IH2A 3QBYA 5FRNA 2NUTA 3REBB 5FW9A 4M77E 4JZ3A 1MMGA 5GAN3 1JEGA 3LGFA 2KMTA 2HBPA 4IUVA 4HVUA 2NWMA 1JB0E 2L8DA 4C0ZA 1WHLA 1PCXA 1U8RA 1X6BA 3VS4A 2M16A 2E6ZA 2BKDN 2MI6A 2YHTA 1VYTA 2CKKA 1QVFP 1O75A 2MMPA 2MPXC 4F7UA 1M2VB 3UPUA 4EMKB 3CC2T 1YITA 1HSQA 2WSFE 3CCUQ 3M4GA 1YIJA 1BI2A 3TCJA 3I9QA 2CYZB 4IKFA 3OYCA 1D09B 2CT4A 2ATCB 1Q82R 2QYZA 3JB9H 3I56Q 2RHXA 3OYBA 5D7UA 1KQSS 3OSSC 2F2VA 5EG2A 4PJNA 4GY5A 3EH1A 1C0MA 5IN1A 2B86A 4D8KA 1BI1A 3RKYA 1WZOA 5CK9A 1S72A 2R5AA 3PT9A 2L0AA 1QWEA 1N27A 4E7IA 2OJ2A 3WVDB 3E2UA 1JJ2S 1K8AU 1X6OA 1W2BS 2EQMA 2ZAEA 4HKEA 4JJNK 2DYBA 2PTKA 2J6FA 3R6NA 1OPKA 1W2BA 4CRIA 9ATCB 1TUDA 1EFNA 2COZA 3CXCP 1AVZC 4ZGEB 2EVRA 2PVGB 1C6VX 1UHCA 3S3OA 3CC4Q 2FZGB 3EAEA 2HD0A 4F16A 3OYKA 1QP3A 4HVVA 1K8AC 1U5SA 2EGEA 1R0CB 1G3SA 3R6OA 2E65A 3M0RA 2DTIA 4PJOE 2OTLT 4JRQA 4M77B 3FIFA 2DX1A 1Q81C 2QDLA 4GBQA 3MCAB 2M0OA 3BY7A 4E7JA 5FLXE 2AKLA 2DL4A 3ZBDA 5D6XA 4PJMA 3EG2A 1NYGA 5KE3A 1GCQA 2WACA 1ZSZC 1BI0A 5KYXB 2PVDB 3JCMh 5GAOl 1J3TA 1PKTA 1PD1A 5LJ5f 3OMCA 4J9BA 1Q81U 3PVQA 3EFSA 1KHCA 4BE1A 1KQ2A 3MEWA 2KNBB 2RHUA 1M1GA 3I35A 3NTHA 2VB6A 3X26B 2NUPA 1VQNA 2YRVA 4IUTA 3G4SQ 2HQHA 4ME7A 3OYMA 3OW2A 1E7OA 1B3QA 3JCMg 3TEEA 1NEGA 1VUBA 2F5KA 3HTRA 1UGVA 2G3RA 3DB4A 3OYLA 3L2VA 1IGQA 1M2VA 4FM4B 5I22A 1VQLT 3A98A 2KT8A 3A8MB 3I56A 4FIBA 1KIKA 5GAMh 4II1A 4ELZC 3CCVA 4RTYA 2DJZA 1EZZB 1N9SA 2H3EB 2IPOB 4C5HA 1UHFA 2X3WD 1YN8A 1GBRA 1FXXA 2X4YA 4EMGA 5GJVB 1U1TA 3I5RA 2WSEE 1KQSP 1NYFA 2DXUA 2C06A 2AZSA 2VC8A 2CZ0B 2IG0A 2D8JA 1M3BA 4OMLA 4N4HA 3A1PA 1WIEA 3JAME 3LLRA 3OS0A 2C0TA 2V8KA 2LNHB 1IHWA 4LN2A 1G3WA 2M51A 1KD1R 5CKBA 2D6FA 4C92G 3QYGB 1XTDA 2X51A 3GPLA 3CC4T 4FT4A 1QMCA 2GNCA 5CQYA 4YTLA 2DA9A 3CCLT 1OYXA 2CZ1B 2XI9A 3LYIA 4C0DC 1RADB 2PQWA 1T0JA 2LCLA 2JTEA 3RUXA 3CC2Q 3REAB 5CO7A 3CMEA 2LQWA 1OOTA 1YHQT 3JB9G 4AFQC 2DFUA 2W10A 3TREA 2AK5A 3M9QA 5GAOp 2MAMA 2AKKA 4DA4A 3PNWC 1K9MR 4M4ZA 2P0KA 4C92B 3M0PA 1G2BA 1S72T 2VWFA 1VQ5Q 3MJXA 5C0MA 3CBOA 3JV3A 3CCJT 4Z89A 4LUDA 4PJOB 1QCFA 3V8KA 1D3BA 1VQ9T 2CP5A 4D8DA 1MMNA 1OZ3A 4OMPA 2L3RA 4JJDA 3SD4A 2RNAA 3RDVA 2LRQA 4F7UG 2E70A 4F7UB 5GANh 2QA4A 4E7HA 5GMKl 1PWTA 1CKBA 5LL6S 2RJDA 2FRWA 2ROLA 4J9CA 1KD1C 2O88A 4EIKA 2XG8D 2DJQA 3L2UA 2IIMA 2K7AA 4PL6A 2JM8A 3RESA 4JLGA 3VYGA 3CXCA 2E41A 5KYYA 4M7DG 5LJ5e 1LCKA 4E7LA 2L2PA 2RQVA 3M56A 4AG1C 3JB9J 3GBQA 5CCAA 2OTLQ 1Q7YR 1QKWA 4QVZA 1VQKQ 3FJPA 4IUPA 5LJ3j 2KBTA 4HT8A 3CCSQ 2L3PA 1WI7A 2HCKA 1EIFA 4QKUA 4PJOF 5D6WA 1M8VA 3MKDA 5L23A 4PFPA 3E9FA 1K76A 4BDYA 2SRCA 1MMDA 1RAGB 1VQPT 1U3OA 3PTAA 2HL3A 3FDRA 5GMKe 4PLLA 2KSSA 1GCPA 1FMWA 1MV0B 1AZEA 5FWBA 4BB7A 3RNJA 2RQTA 2XK0A 3UDCA 2ZCFB 2DO3A 5IHKA 2FHDA 3MHXA 3EG1A 4CC7A 4HCZA 1Y96B 3ZFJA 2DK3A 4C8QC 3L2ZA 5FWCA 3GP8A 3CCVQ 2RPNA 2P0QA 3PIPA 2KEAA 4AFSC 1NBEB 2HKQB 1KQ1A 1VQ5T 4KGZB 2D0QB 1O9SA 5IT9E 1QVPA 3CBPA 3OYAA 1YBYA 1ZSGA 1UECA 1SEMA 1M30A 4KBMB 1SF9A 2DMOA 4KT0E 2FPFA 4LDUA 4F17A 4JZ4A 2Y90A 2YUNA 2RHZA 4C0DB 3G4SA 3G71T 2HQEA 2J6KA 5LJ5j 1N8RC 1WDXA 3JCMd 4L5GA 3M0TA 1RLQC 1HYOA 1K0XA 1WHMA 4M7AE 3LX7A 2EQIA 4ZGDB 2OTJQ 4HA8A 1VQPA 3E1SA 4LNPA 2JN0A 4BDZA 2MYSA 3VS2A 5KYUA 3THKA 5KCHA 1M2OA 2LX9A 2RF0A 5LJ5g 4M78E 3LW5E 5GAMe 3CMAT 1SRMA 2D8HA 4FL6A 1QVGS 1IB8A 4KUIA 4XTZA 2I0NA 2KROA 3HRSA 4Z02A 2K6DA 4RTWA 2DXTA 1TSFA 4M7DD 4XTYA 3UATA 2LQNA 1AWWA 2ZPHB 2DIGA 3QZ5B 4A4GA 2K5FA 1G5VA 5HK0A 1VQ5A 3J80E 2YSQA 2CSQA 5EC7A 2A37A 3EGUA 3VYHB 3PIOA 4M75D 1H641 3NTIA 4PK4A 4M7AC 2ZPEB 3LWIA
chains in the Genus database with same CATH topology
1X2QA 2EBPA 2F2VA 3M0QA 3VS6A 1WA7A 4Z8AA 2B86A 2DE0X 4D8KA 2GQIA 1GCQC 1I07A 1UJYA 2L0AA 1QWEA 4WCIA 4J9FA 2OAWA 2OJ2A 3UA7A 2KYMA 2EW3A 3LH5A 4RTTA 1ABQA 5IHNA 1ABOA 4JPBW 4HVWA 3ZL7C 1ARKA 2DYBA 1A0NB 2PTKA 2J6FA 3R6NA 1OPKA 1GRIA 1WX6A 3VS1A 3SHWA 2L3SA 1GFCA 2O31A 3H0FA 1TUDA 1EFNA 2EPDA 1AVZC 2EVRA 1NLOC 1E6HA 1K9AA 1UHCA 5HCKA 2K79A 4F16A 2J6OA 4HVVA 1U5SA 2EGEA 1H92A 2FG0A 3QWYA 2RN8A 2ECZA 3M0RA 1UDLA 2LJ0A 3EHRA 2DX1A 1K1ZA 2QDLA 4GBQA 2AKLA 2DL4A 3NHNA 2A08A 2K9GA 4J9GA 2GTOA 1WXTA 3EG2A 1NEBA 1NYGA 2CUBA 2RQWA 1GCQA 1KFZA 2MIOA 2MOXA 2L3QA 2JS2A 2YUOA 2DBMA 2EYZA 2HDAA 2BZXA 1J3TA 3TVTA 3H0HA 2JXBA 4ORZA 1PKTA 1UE9A 2LZ6B 2K3BA 4J9BA 3PVQA 2EGAA 2GGRA 1I0CA 2KNBB 2FPDA 2EGCA 1VA7A 2J7IA 1PRMC 3I35A 4E6RA 4ESRA 4DEXA 2DL3A 2SEMA 2KRNA 1NM7A 2YUPA 1E7OA 3PVLA 4JJCA 1B3QA 1NEGA 5GJWB 1AWXA 1UG1A 3VS7A 4CC4B 4OMMA 1CKAA 1UGVA 1GFDA 1GL5A 4LUEA 3VRZA 1ZUUA 2BZ8A 2P4RA 1KSWA 2ABLA 2PNIA 1SHGA 2LP5A 2X3XD 4HCKA 5I22A 2O2OA 1RUWA 2YT6A 4DEYA 2CH4A 3A98A 2KT8A 1W70A 1H3HA 2ESWA 1KIKA 4Z88A 1OPLA 1W1FA 2PZ1A 1MV3A 1M27C 2FPEA 4RTYA 2O9VA 1T3SA 3H41A 1UHFA 2X3WD 3O5ZA 3FJ5A 2EYWA 1YN8A 1GBRA 1VYVA 1ZX6A 2RMOA 4IIOA 5GJVB 2G6FX 3RBBB 3I5RA 1NYFA 2KR3A 2MCNA 1Z9QA 2AZSA 3M0UA 2LCSA 2KYBA 1M3CA 4R0KA 2KGTA 2D8JA 1X43A 1M3BA 4OMLA 4RUGA 3UA6A 1WIEA 1N5ZA 2JMCA 2C0TA 2C0IA 2LNHB 4J9EA 4LN2A 1I1JA 2M51A 2BZYA 3KFVA 1SPKA 2H8HA 2CDTA 1UTIA 1QKXA 2GNCA 1K0SA 2DA9A 1AD5A 2A36A 2O9SA 1UFFA 1T0JA 1V1CA 2BTTA 1OV3A 2JTEA 1YP5A 2NUZA 1Y57A 4GLMA 4ZNXA 2DF6A 1JU5C 3REAB 2YUQA 2LQWA 1OOTA 1ZLMA 5IXBA 2LMJA 2EYYA 4X1VA 1X69A 2D1XA 4AFQC 1TUCA 4J9HA 1FYNA 2W10A 2AK5A 2AKKA 3TSWA 4M4ZA 3M0PA 4FSSA 1HJDA 1G2BA 1WLPB 2VWFA 5IXFA 3JV3A 5ECAA 4Z89A 4F14A 4LUDA 1QCFA 1CSKA 2CSIA 1AOJA 2ROTA 4D8DA 2DBKA 4OMPA 4JJDA 2RNAA 2YDLA 4J9DA 1PRLC 1JQQA 1M8MA 1JO8A 4K11A 3VS0A 3PE0A 1AZGB 1BBZA 1SHFA 1VYUA 1Z9ZA 4IIMA 1PWTA 1CKBA 2HEQA 3VS3A 2FRWA 2ROLA 4J9CA 4OMNA 1JXMA 4CC2A 1PKSA 2O88A 1SSHA 2CH4W 4EIKA 4AFZC 2DJQA 2DVJA 2IIMA 2K7AA 3TSZA 2JM8A 3C0CA 1PHTA 1T0HA 2GTJA 1JXOA 4AG2C 1WYXA 1YWOA 2JW4A 3M0SA 2ED0A 2K2MA 1OEBA 1LCKA 2L2PA 2RQVA 4AG1C 3GBQA 1WXUA 2A28A 4J9IA 1QKWA 1W6XA 1AWJA 1ZUKA 1Y0MA 4AFUC 2OI3A 1IO6A 2RQRA 1AEYA 1PNJA 1NG2A 2KBTA 2L3PA 1WI7A 4JJBA 2HCKA 4A63B 1GBQA 1FMKA 3H0IA 3NGPA 1U06A 3VRYA 5L23A 2E5KA 1T3LA 2KT1A 1H8KA 2W0ZA 2DILA 1K76A 1ZBJA 2F2XA 2EKHA 2SRCA 4OMQA 2LJ3A 4QT7A 1XOVA 1E6GA 1U3OA 2DL8A 1UUEA 2J06A 1GCPA 2DNUA 3UF4A 1AWOA 2CUDA 1MV0B 3U23A 1AZEA 2KE9A 5FWBA 2M0YA 1BU1A 2DL5A 3EG3A 2RQTA 3RNJA 1YWPA 2F2WA 4RTUA 4RTVA 1UJ0A 5IHKA 3EG1A 4CC7A 1M3AA 2EYXA 1X6GA 1RLPC 2JM9A 2AZVA 5FWCA 3I5SA 2RPNA 2VVKA 4KRTA 2KEAA 4AFSC 2DLPA 1MUZA 4LE9A 4RTZA 1YCSB 1NLPC 2CT3A 4OMOA 1ZSGA 1UECA 1SEMA 1M30A 1WXBA 4CC3A 2DMOA 2FO0A 2FPFA 3NPFA 1BK2A 1SRLA 2D0NA 1ZUYA 2J05A 4F17A 4JZ4A 2YUNA 2LJ1A 3NMZC 2J6KA 3EG0A 2RQUA 2DM1A 4HXJA 2GBQA 2JT4A 1G83A 2JS0A 2KRMA 1WDXA 2KXDA 2JMAA 3M0TA 1RLQC 1X27A 1K0XA 2LX7A 2FRYA 5IH2A 2DRMA 2EQIA 1TG0A 5FW9A 3REBB 2C0OA 2DRKA 2FEIA 1B07A 4JZ3A 5IHIA 2DL7A 1QWFA 4LNPA 1HD3A 3VS2A 4RTXA 3THKA 1JEGA 2VKNA 1S1NA 2RF0A 1KJWA 1X2KA 4HVUA 2KRSA 3IQLA 1YNZA 2NWMA 3EHQA 1WFWA 1SRMA 2D8HA 2KXCA 1X6BA 3VS4A 5I11A 1VYTA 2HBWA 2I0NA 2KROA 2K6DA 3ULRB 4RTWA 1HSQA 2CREA 3UATA 2LQNA 1AWWA 1K4US 2V1QA 1RI9A 3I9QA 2XMFA 3QWXX 2YSQA 2CSQA 5EC7A 2A37A 3EGUA 2V1RA 1BB9A 1QLYA 2CT4A 4Y92A 3SEMA 2ENMA 3CQTA 2ED1A 2HSPA 3VS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2Q A;  2EBP A;  2F2V A;  3M0Q A;  3VS6 A;  1WA7 A;  4Z8A A;  2B86 A;  2DE0 X;  4D8K A;  2GQI A;  1GCQ C;  1I07 A;  1UJY A;  2L0A A;  1QWE A;  4WCI A;  4J9F A;  2OAW A;  2OJ2 A;  3UA7 A;  2KYM A;  2EW3 A;  3LH5 A;  4RTT A;  1ABQ A;  5IHN A;  1ABO A;  4JPB W;  4HVW A;  3ZL7 C;  1ARK A;  2DYB A;  1A0N B;  2PTK A;  2J6F A;  3R6N A;  1OPK A;  1GRI A;  1WX6 A;  3VS1 A;  3SHW A;  2L3S A;  1GFC A;  2O31 A;  3H0F A;  1TUD A;  1EFN A;  2EPD A;  1AVZ C;  2EVR A;  1NLO C;  1E6H A;  1K9A A;  1UHC A;  5HCK A;  2K79 A;  4F16 A;  2J6O A;  4HVV A;  1U5S A;  2EGE A;  1H92 A;  2FG0 A;  3QWY A;  2RN8 A;  2ECZ A;  3M0R A;  1UDL A;  2LJ0 A;  3EHR A;  2DX1 A;  1K1Z A;  2QDL A;  4GBQ A;  2AKL A;  2DL4 A;  3NHN A;  2A08 A;  2K9G A;  4J9G A;  2GTO A;  1WXT A;  3EG2 A;  1NEB A;  1NYG A;  2CUB A;  2RQW A;  1GCQ A;  1KFZ A;  2MIO A;  2MOX A;  2L3Q A;  2JS2 A;  2YUO A;  2DBM A;  2EYZ A;  2HDA A;  2BZX A;  1J3T A;  3TVT A;  3H0H A;  2JXB A;  4ORZ A;  1PKT A;  1UE9 A;  2LZ6 B;  2K3B A;  4J9B A;  3PVQ A;  2EGA A;  2GGR A;  1I0C A;  2KNB B;  2FPD A;  2EGC A;  1VA7 A;  2J7I A;  1PRM C;  3I35 A;  4E6R A;  4ESR A;  4DEX A;  2DL3 A;  2SEM A;  2KRN A;  1NM7 A;  2YUP A;  1E7O A;  3PVL A;  4JJC A;  1B3Q A;  1NEG A;  5GJW B;  1AWX A;  1UG1 A;  3VS7 A;  4CC4 B;  4OMM A;  1CKA A;  1UGV A;  1GFD A;  1GL5 A;  4LUE A;  3VRZ A;  1ZUU A;  2BZ8 A;  2P4R A;  1KSW A;  2ABL A;  2PNI A;  1SHG A;  2LP5 A;  2X3X D;  4HCK A;  5I22 A;  2O2O A;  1RUW A;  2YT6 A;  4DEY A;  2CH4 A;  3A98 A;  2KT8 A;  1W70 A;  1H3H A;  2ESW A;  1KIK A;  4Z88 A;  1OPL A;  1W1F A;  2PZ1 A;  1MV3 A;  1M27 C;  2FPE A;  4RTY A;  2O9V A;  1T3S A;  3H41 A;  1UHF A;  2X3W D;  3O5Z A;  3FJ5 A;  2EYW A;  1YN8 A;  1GBR A;  1VYV A;  1ZX6 A;  2RMO A;  4IIO A;  5GJV B;  2G6F X;  3RBB B;  3I5R A;  1NYF A;  2KR3 A;  2MCN A;  1Z9Q A;  2AZS A;  3M0U A;  2LCS A;  2KYB A;  1M3C A;  4R0K A;  2KGT A;  2D8J A;  1X43 A;  1M3B A;  4OML A;  4RUG A;  3UA6 A;  1WIE A;  1N5Z A;  2JMC A;  2C0T A;  2C0I A;  2LNH B;  4J9E A;  4LN2 A;  1I1J A;  2M51 A;  2BZY A;  3KFV A;  1SPK A;  2H8H A;  2CDT A;  1UTI A;  1QKX A;  2GNC A;  1K0S A;  2DA9 A;  1AD5 A;  2A36 A;  2O9S A;  1UFF A;  1T0J A;  1V1C A;  2BTT A;  1OV3 A;  2JTE A;  1YP5 A;  2NUZ A;  1Y57 A;  4GLM A;  4ZNX A;  2DF6 A;  1JU5 C;  3REA B;  2YUQ A;  2LQW A;  1OOT A;  1ZLM A;  5IXB A;  2LMJ A;  2EYY A;  4X1V A;  1X69 A;  2D1X A;  4AFQ C;  1TUC A;  4J9H A;  1FYN A;  2W10 A;  2AK5 A;  2AKK A;  3TSW A;  4M4Z A;  3M0P A;  4FSS A;  1HJD A;  1G2B A;  1WLP B;  2VWF A;  5IXF A;  3JV3 A;  5ECA A;  4Z89 A;  4F14 A;  4LUD A;  1QCF A;  1CSK A;  2CSI A;  1AOJ A;  2ROT A;  4D8D A;  2DBK A;  4OMP A;  4JJD A;  2RNA A;  2YDL A;  4J9D A;  1PRL C;  1JQQ A;  1M8M A;  1JO8 A;  4K11 A;  3VS0 A;  3PE0 A;  1AZG B;  1BBZ A;  1SHF A;  1VYU A;  1Z9Z A;  4IIM A;  1PWT A;  1CKB A;  2HEQ A;  3VS3 A;  2FRW A;  2ROL A;  4J9C A;  4OMN A;  1JXM A;  4CC2 A;  1PKS A;  2O88 A;  1SSH A;  2CH4 W;  4EIK A;  4AFZ C;  2DJQ A;  2DVJ A;  2IIM A;  2K7A A;  3TSZ A;  2JM8 A;  3C0C A;  1PHT A;  1T0H A;  2GTJ A;  1JXO A;  4AG2 C;  1WYX A;  1YWO A;  2JW4 A;  3M0S A;  2ED0 A;  2K2M A;  1OEB A;  1LCK A;  2L2P A;  2RQV A;  4AG1 C;  3GBQ A;  1WXU A;  2A28 A;  4J9I A;  1QKW A;  1W6X A;  1AWJ A;  1ZUK A;  1Y0M A;  4AFU C;  2OI3 A;  1IO6 A;  2RQR A;  1AEY A;  1PNJ A;  1NG2 A;  2KBT A;  2L3P A;  1WI7 A;  4JJB A;  2HCK A;  4A63 B;  1GBQ A;  1FMK A;  3H0I A;  3NGP A;  1U06 A;  3VRY A;  5L23 A;  2E5K A;  1T3L A;  2KT1 A;  1H8K A;  2W0Z A;  2DIL A;  1K76 A;  1ZBJ A;  2F2X A;  2EKH A;  2SRC A;  4OMQ A;  2LJ3 A;  4QT7 A;  1XOV A;  1E6G A;  1U3O A;  2DL8 A;  1UUE A;  2J06 A;  1GCP A;  2DNU A;  3UF4 A;  1AWO A;  2CUD A;  1MV0 B;  3U23 A;  1AZE A;  2KE9 A;  5FWB A;  2M0Y A;  1BU1 A;  2DL5 A;  3EG3 A;  2RQT A;  3RNJ A;  1YWP A;  2F2W A;  4RTU A;  4RTV A;  1UJ0 A;  5IHK A;  3EG1 A;  4CC7 A;  1M3A A;  2EYX A;  1X6G A;  1RLP C;  2JM9 A;  2AZV A;  5FWC A;  3I5S A;  2RPN A;  2VVK A;  4KRT A;  2KEA A;  4AFS C;  2DLP A;  1MUZ A;  4LE9 A;  4RTZ A;  1YCS B;  1NLP C;  2CT3 A;  4OMO A;  1ZSG A;  1UEC A;  1SEM A;  1M30 A;  1WXB A;  4CC3 A;  2DMO A;  2FO0 A;  2FPF A;  3NPF A;  1BK2 A;  1SRL A;  2D0N A;  1ZUY A;  2J05 A;  4F17 A;  4JZ4 A;  2YUN A;  2LJ1 A;  3NMZ C;  2J6K A;  3EG0 A;  2RQU A;  2DM1 A;  4HXJ A;  2GBQ A;  2JT4 A;  1G83 A;  2JS0 A;  2KRM A;  1WDX A;  2KXD A;  2JMA A;  3M0T A;  1RLQ C;  1X27 A;  1K0X A;  2LX7 A;  2FRY A;  5IH2 A;  2DRM A;  2EQI A;  1TG0 A;  5FW9 A;  3REB B;  2C0O A;  2DRK A;  2FEI A;  1B07 A;  4JZ3 A;  5IHI A;  2DL7 A;  1QWF A;  4LNP A;  1HD3 A;  3VS2 A;  4RTX A;  3THK A;  1JEG A;  2VKN A;  1S1N A;  2RF0 A;  1KJW A;  1X2K A;  4HVU A;  2KRS A;  3IQL A;  1YNZ A;  2NWM A;  3EHQ A;  1WFW A;  1SRM A;  2D8H A;  2KXC A;  1X6B A;  3VS4 A;  5I11 A;  1VYT A;  2HBW A;  2I0N A;  2KRO A;  2K6D A;  3ULR B;  4RTW A;  1HSQ A;  2CRE A;  3UAT A;  2LQN A;  1AWW A;  1K4U S;  2V1Q A;  1RI9 A;  3I9Q A;  2XMF A;  3QWX X;  2YSQ A;  2CSQ A;  5EC7 A;  2A37 A;  3EGU A;  2V1R A;  1BB9 A;  1QLY A;  2CT4 A;  4Y92 A;  3SEM A;  2ENM A;  3CQT A;  2ED1 A;  2HSP A;  3VS5 A; 
#chains in the Genus database with same CATH topology
 3VJP A;  2EBP A;  3M5A A;  3M0Q A;  1VQ9 A;  3M53 A;  1M4Z A;  4DBR A;  4QQD A;  2LVM A;  2DE0 X;  5HKC A;  1VQ8 A;  3CC2 A;  2QA4 T;  1I07 A;  2F5T X;  3WVE B;  1IGU A;  4KUL A;  2OAW A;  2X4X A;  2AHJ B;  2FZK B;  2A0F B;  2EW3 A;  4RTT A;  2GFU A;  3ZL7 C;  4C5I A;  5CQX A;  1YIT Q;  4R55 A;  1WX6 A;  3VS1 A;  3SHW A;  2PU9 B;  2EPD A;  5FU6 C;  2M02 A;  1NLO C;  1E6H A;  2DYI A;  3CCJ Q;  5I21 A;  3GF5 A;  4PJJ A;  1QVG P;  2QG9 B;  4C92 A;  3HFN A;  2ECZ A;  1FX7 A;  2DD4 A;  3BW1 A;  1K1Z A;  5LJ5 d;  1RL2 A;  2RO0 A;  4KGV B;  4PKC C;  4NOY A;  4X34 A;  1M1K C;  2A08 A;  5GAM j;  1V29 B;  3OS2 A;  4N0A A;  2DPP B;  3V8L A;  4M75 B;  1NPR A;  3H0H A;  2GFA A;  2P4T A;  2M9U A;  4ORZ A;  5GAN 2;  1UE9 A;  2LZ6 B;  5J39 A;  1D0X A;  1YJN T;  2EGA A;  3HRT A;  1VQ7 A;  1I0C A;  2CP0 A;  3JCM V;  3EGX B;  4BAC A;  4B9X A;  2QGG A;  2EGC A;  3CPW P;  2DZC A;  4E6R A;  4BE0 A;  2X4J A;  1LJO A;  4DEX A;  2M1H A;  3OYG A;  1YJ9 T;  2DL3 A;  2V26 A;  5A0G A;  2KRN A;  4QVD A;  1NM7 A;  1PSF A;  2NUT B;  3L1A A;  5GJW B;  2XU8 A;  3QYH B;  1AWX A;  2NYS A;  3VS7 A;  1CKA A;  1NPP A;  2P4R A;  3GNF B;  3SWN A;  3JB9 D;  2F69 A;  2LT1 A;  8ATC B;  3T9N A;  2YT6 A;  1ZSZ B;  1D0Z A;  2GF7 A;  3CME T;  1Q81 R;  3MP8 A;  1BI3 A;  2X35 A;  4Z88 A;  3MPU B;  1OPL A;  3QPH A;  5LJ3 f;  4OB3 B;  3CD6 T;  3V7C A;  2O9V A;  3JB9 I;  1VQ7 T;  2NLU A;  4E7Z A;  2QEX T;  3H41 A;  3HL8 A;  3D7S B;  2CP6 A;  2EWN A;  4FU6 A;  4QW2 A;  1WHH A;  1ZX6 A;  4C5G A;  1ZBX A;  2JTF A;  1YJ9 A;  2IVW A;  3ER0 A;  4C0F A;  2KR3 A;  3CCU A;  5GAN 8;  2LCS A;  1MGQ A;  2KYB A;  4R0K A;  2KGT A;  5GAN f;  4BD3 A;  3GOX A;  1N5Z A;  2JMC A;  5CR2 A;  5CKE A;  2OX7 A;  1OX9 A;  2K2V A;  1KQS A;  3I56 T;  4XTV A;  7AT1 B;  1I8F A;  2CDT A;  1UTI A;  1K0S A;  1FMV A;  4DQ2 A;  1AD5 A;  4J6Y A;  1N6A A;  1K9M U;  2O9S A;  3CCL A;  4VUB A;  3RMQ A;  4RKU E;  3CD6 A;  2E6N A;  1WHK A;  2BTT A;  4JRP A;  2RB6 A;  1YP5 A;  2L89 A;  5LJ3 d;  2Z0W A;  4RG8 A;  4GLM A;  4ZNX A;  2QEX A;  1AHJ B;  1BCM A;  2CP7 A;  1TOV A;  5IXB A;  2LMJ A;  4LD6 A;  1TH7 A;  4X1V A;  1X69 A;  2D1X A;  1YHQ A;  4J9H A;  3CCU T;  4BE2 A;  1QQJ A;  3CPW A;  1QVF A;  3CCS A;  1BYM A;  1YFN A;  1BKB A;  5GAO q;  1HJD A;  3OYF A;  1JJ2 P;  3VUZ A;  3URG A;  2P84 A;  1CSK A;  3QJ6 A;  2QA4 Q;  3OBY A;  1RAH B;  2ROT A;  2DBK A;  3QDF A;  1YJ9 Q;  4KUD K;  2ZPI B;  1K73 C;  4DOW A;  5KE2 A;  1PRL C;  1JO8 A;  1AZG B;  3RKW A;  2HNI A;  1VYU A;  1XNI A;  3KXT A;  2HEQ A;  4C8Q D;  2KK4 A;  5GMK i;  2FYK A;  1SSH A;  5A0L A;  3TSZ A;  1K73 U;  1OQK A;  2DTO A;  2RD1 A;  1PC0 A;  2HSE B;  3M0S A;  2ED0 A;  1UGS B;  4J9I A;  4Y28 E;  3FB9 A;  2XDD A;  1RAA B;  3QZ9 B;  1R77 A;  1Y0M A;  1LPL A;  2QAZ A;  2RA2 A;  2QTV A;  4J7I A;  4N0A C;  4JJB A;  3N5B B;  1YIJ T;  1MNE A;  2E1H A;  4O5V A;  1WHJ A;  3NGP A;  1U06 A;  3G6E A;  1Q86 U;  2E5K A;  1YHQ Q;  1T3L A;  2KT1 A;  1H8K A;  4LDV A;  1WNL A;  2W0Z A;  1ZBJ A;  5GAN g;  5GAM g;  2LJ3 A;  1XOV A;  1D3B B;  2EQK A;  5HK3 A;  1UUE A;  4ZGJ B;  4WF2 A;  1VQL A;  2FVU A;  4JS5 A;  1I5O B;  2DIQ A;  4XTX A;  2QQ9 A;  1Q86 C;  3OS1 A;  4BUG A;  1BU1 A;  2DL5 A;  3EG3 A;  1Q86 R;  2HQX A;  1QCO A;  4RTV A;  3P8H A;  5GAN 4;  1MHN A;  1TU0 B;  4N4I A;  3A5Z B;  3CMA A;  4MML A;  5GAO n;  4RCC A;  3I5S A;  3OYE A;  4M77 C;  3INZ A;  4M78 F;  3OB9 A;  5GAN e;  2VUB A;  2H3J A;  3SWN B;  3CD6 Q;  5AT1 B;  1MUZ A;  1NLP C;  1VQ6 T;  1YJN Q;  2CT3 A;  4M77 F;  2MF2 A;  2O01 E;  2R5M A;  3CCM T;  3WXM B;  1N8R R;  1SG5 A;  4CC3 A;  3PMI A;  3NPF A;  1AT1 B;  1BK2 A;  2D0N A;  1ZUY A;  1KHI A;  3BFM A;  1NJI C;  2J05 A;  1U1S A;  1VQO T;  2LJ1 A;  4A4H A;  2RM4 A;  5KCO A;  2DEQ A;  1VQ4 T;  2DM1 A;  3HP9 A;  4HXJ A;  1RAF B;  2KVQ G;  5KYW A;  2LT4 A;  3HKS A;  1WJQ A;  4M7A A;  4M75 G;  1X27 A;  2LX7 A;  2EJF A;  1TG0 A;  2C0O A;  2DRK A;  2EFI A;  1B07 A;  2RI5 A;  2JOY A;  5IHI A;  2DL7 A;  4R56 A;  2HAX A;  1HD3 A;  1LNX A;  1QW1 A;  3VV0 A;  4FW2 A;  3G7Z A;  4RTX A;  2QQA A;  4A4E A;  3LGL A;  1S1N A;  3VKI A;  1KJW A;  1X2K A;  4X9D A;  3EHQ A;  4GLK A;  3CCM A;  1WFW A;  3CCE Q;  1VQ7 Q;  5I11 A;  3ZEH A;  3CCQ A;  1ZHI A;  4M77 G;  1Y71 A;  2B8A A;  4HCB A;  5GMK m;  4M7D A;  1IZ6 A;  2A3L A;  2O4X A;  3OS5 A;  5KYX A;  1RI0 A;  2DAQ A;  3CCV T;  2V1Q A;  1RI9 A;  1K9M C;  4CI0 C;  2XMF A;  1GXI E;  2V1R A;  1BB9 A;  1QLY A;  4IUQ A;  4JRI A;  4UC4 A;  3SEM A;  2ENM A;  3EFO A;  4RMO A;  3CQT A;  3VS5 A;  1X2Q A;  4RCB A;  3JCM P;  3VS6 A;  1SKU B;  1B7T A;  4M7D E;  4OF1 A;  4Z8A A;  1MMA A;  2GQI A;  1GCQ C;  4B9W A;  3GIB A;  3X24 B;  2QI2 A;  2DXC A;  2RJC A;  2A7Y A;  4M75 E;  3CPW S;  1IRE B;  1H3Z A;  1QVF S;  3ASK A;  3UA7 A;  2K3X A;  3C95 A;  3JCM c;  5IHN A;  4HVW A;  3JCM J;  3RKX A;  3NTK A;  3QXE B;  1GRI A;  1OI1 A;  2L3S A;  1GFC A;  2O31 A;  3ME9 A;  2COY A;  4FSX A;  1I4K 1;  1K9A A;  5HCK A;  3CCM Q;  3LH0 A;  4C8Q A;  3UT1 A;  5CAI A;  5LJ3 h;  1K8A R;  3QWY A;  2EAY A;  2XDP A;  1XJW B;  4OGC A;  3CCQ T;  2QQR A;  4Y91 A;  1C1A A;  1LOJ A;  4C8Q F;  3MEV A;  3SWN C;  1PD0 A;  4J9G A;  4BY6 B;  3G6E T;  1NEB A;  1BIA A;  2CUB A;  3MO8 A;  2MIO A;  1WJS A;  2DXB A;  2JS2 A;  2YUO A;  2R58 A;  1KC8 C;  2EYZ A;  2HDA A;  2JXB A;  4Q5W A;  2CS7 A;  5DM7 R;  1TTH B;  2GGR A;  4C92 F;  2ZGW A;  4N4G A;  3JCM X;  5GAN 5;  2YRD A;  3E19 A;  4ZTJ A;  2J7I A;  4XTU A;  1VQM Q;  1LVK A;  4MZM A;  3G71 Q;  2CP2 A;  1KC8 U;  5GMK h;  1YJW T;  2SEM A;  1ACM B;  1NE8 A;  4KGX B;  3PVL A;  3LWH A;  3C94 A;  2RHI A;  4JJC A;  2YWW A;  4OVA A;  4M7A B;  4CC4 B;  1GL5 A;  1ZUU A;  2RK1 A;  2BZ8 A;  2VXF A;  1KSW A;  1YI2 T;  2PNI A;  4MDX A;  1SHG A;  5KYN A;  4HCK A;  4LXC A;  1NZ9 A;  1RUW A;  2EQU A;  2VXE A;  1VQN T;  1UGQ B;  2DTH A;  1W1F A;  5A0D A;  3TU4 K;  1MV3 A;  3FLG A;  3DLL A;  2FPE A;  2VV5 A;  4M7A D;  4E2F B;  3HHT B;  1T3S A;  1OX8 A;  2FL7 A;  3O5Z A;  3FJ5 A;  1ZQ1 A;  1V76 A;  2CZ6 B;  3JCM W;  3I55 A;  2RMO A;  4IIO A;  1JBM A;  3FRN A;  2G6F X;  3MEU A;  1PSE A;  3RBB B;  1Q82 U;  5FU6 B;  5CKF A;  4FT2 A;  1M3C A;  4XTW A;  1D0Y A;  1X43 A;  3CC4 A;  1TUG B;  4RUG A;  3UA6 A;  3PMT A;  4FYW B;  3CC7 T;  1B34 A;  3MET A;  1I1J A;  3OYD A;  3H6Z A;  3QII A;  2BZY A;  3EFO B;  3KFV A;  1HXD A;  1SPK A;  4M7A F;  2RK2 A;  3Q1J A;  3OQ5 A;  4WTO B;  2AIR B;  1UFF A;  4C92 D;  3A8O B;  3CCR A;  1OV3 A;  1QP2 A;  1HK9 A;  1W4S A;  4QQG A;  1JJ2 A;  1TWB A;  2NUP B;  1JU5 C;  2YUQ A;  1Y7X A;  4C8Q G;  1ZLM A;  5LJ5 h;  1TUC A;  3H9N A;  2XD0 A;  1EX4 A;  2DER A;  2ZPB B;  1NJI R;  3HSB A;  3RER A;  2DZ9 A;  4E7K A;  1RAE B;  3OYY A;  3I55 T;  1WJR A;  3QO3 A;  3JCM e;  2X9H A;  5ECA A;  1RAB B;  2Y4Y A;  4F14 A;  5LJ3 g;  6AT1 B;  3VU3 C;  1UB4 A;  3OYN A;  2XKO C;  1AOJ A;  4ELY C;  3G4S T;  4M77 A;  4BI8 B;  1PG5 B;  3JCM b;  2YDL A;  2MWP A;  1M8M A;  5FRM A;  3V8J A;  5FU7 C;  1SHF A;  4XK8 E;  5GAM f;  3VS3 A;  1PKS A;  3P8D A;  2DVE A;  1VQL Q;  3HRU A;  2CH4 W;  3V7R A;  2YLB A;  1OZ2 A;  4DBH A;  3C0C A;  4JLI A;  2XID A;  4EMH A;  4A53 A;  1JXO A;  1D1A A;  1WYX A;  1F1B B;  4FYV B;  3BDU A;  4PLI A;  4OP0 A;  2A28 A;  4C8Q E;  1KG1 A;  3FC3 A;  3CCR Q;  2RQR A;  2QK0 A;  1AEY A;  1PNJ A;  3EH2 A;  2K4Y A;  3C4S A;  4A4F A;  3EGX A;  4ATO A;  2BE7 D;  4J5Y A;  2QGF B;  4A63 B;  1YI2 A;  3H0I A;  3L2R A;  4P5N A;  2EKH A;  4JRK A;  4J7F A;  4LD9 K;  4QT7 A;  3JCM f;  2QAS A;  3C12 A;  4JUV A;  1D1C A;  1XQH A;  3S3M A;  2CGH A;  2R57 A;  2CP3 A;  4EDU A;  2CUD A;  3AT1 B;  5HY6 A;  3CCE T;  4AMC A;  2COW A;  2M0Y A;  3OYJ A;  1YWP A;  2HMA A;  2D9T A;  4RTU A;  3OYI A;  3EG9 B;  4M75 F;  1TS9 A;  5CVI A;  1M90 U;  2EYX A;  4M7D C;  4L59 A;  1RLP C;  1R8O B;  2JM9 A;  2ZPF B;  1QCN A;  4XU2 A;  2L5Q A;  1QVG A;  1KK7 A;  3OBW A;  5GAN j;  3SB2 A;  4OB2 B;  3M58 A;  4M75 C;  3CCJ A;  3OY9 A;  1WPY A;  1TXQ A;  4F7U E;  2YXY A;  4BY6 C;  2QTX A;  3A8L B;  2GCX A;  3OMG A;  5L8R E;  3OW2 S;  3X28 B;  4LDY A;  1WXB A;  1P92 A;  1Q7Y C;  4A4K A;  2FO0 A;  2P0P A;  3QUI A;  2ZPG B;  4M77 D;  4DOV A;  4PJL A;  2KY9 A;  3NMZ C;  2QEX Q;  3EG0 A;  1YJW Q;  2GBQ A;  2PVO B;  2JT4 A;  3HFO A;  4IUR A;  1G83 A;  2JS0 A;  1VQ8 Q;  2KRM A;  4MDW A;  5IAY A;  1KC8 R;  1Q7Y U;  4C5E A;  2FRY A;  4OGE A;  2DRM A;  4M75 A;  2FEI A;  1QWF A;  4XAX B;  1SSF A;  5AYF A;  2RJF A;  1VQN Q;  2VKN A;  2JVV A;  4M78 B;  4ZN3 A;  2KRS A;  3IQL A;  1YNZ A;  3M54 A;  2KXC A;  1X01 A;  4PNO A;  1I5L A;  2PUO B;  2HBW A;  1VQO A;  5CIU A;  3ULR B;  2HL5 C;  4BI3 A;  2LDM A;  3GNG A;  1OUL A;  1Q95 G;  1UGP B;  2CRE A;  4C0G A;  1M5Q 1;  5DY9 A;  1K4U S;  4L6V 5;  3QWX X;  3I55 Q;  2VGM A;  4Y92 A;  1VQP Q;  3A8H B;  2EJ9 A;  3MP1 A;  2ED1 A;  3VS0 A;  2HSP A;  4B6M A;  3V7S A;  4JS4 A;  1VQ6 Q;  4PFZ A;  4C8Q B;  1WA7 A;  4M7D B;  2K57 A;  4XU0 A;  3EG9 A;  4J6W A;  5I2S A;  4M78 C;  2RH2 A;  3F70 A;  1UJY A;  2FB7 A;  4A54 A;  4WCI A;  4J9F A;  4FYX B;  1VQ4 Q;  2E5Q A;  2KYM A;  3FEO A;  2KQW A;  3LH5 A;  1ABQ A;  1ABO A;  4JPB W;  2E3I A;  1N9R A;  2K5I A;  2AT1 B;  4PJO D;  1ARK A;  4PJO A;  2XDB A;  1A0N B;  1G8X A;  5J3B A;  5GAN 6;  1K73 R;  3TQ7 P;  3H0F A;  2DD5 A;  1S72 Q;  2K79 A;  3CCE A;  2E3H A;  2EQJ A;  2J6O A;  1H92 A;  2FG0 A;  2RN8 A;  2LNV A;  2E10 A;  3DKM A;  3M57 A;  3OSV A;  1VQ6 A;  1UDL A;  1RAI B;  5M9O A;  2QXF A;  4ANJ A;  2LJ0 A;  3EHR A;  3QSU A;  2WSC E;  3DLM A;  8AT1 B;  1M1K R;  2OTJ A;  4E47 A;  3NHN A;  3CPF A;  1WGS A;  2EYQ A;  2JZ2 A;  4MZT A;  2K9G A;  3KBG A;  4DBQ A;  2GTO A;  1WXT A;  1YIJ Q;  2RQW A;  1R0B G;  2HKN A;  1KFZ A;  2MOX A;  4KH1 B;  2L3Q A;  1UGR B;  5D6Y A;  5CKD A;  2DBM A;  2BZX A;  4XU1 A;  3G1J A;  3TVT A;  4LDW A;  2F1L A;  2JTM A;  3QHS A;  4OB0 B;  5A2Q E;  2K3B A;  4FW1 A;  5GAO r;  4EMK A;  2V8I A;  4M7A G;  5FU7 B;  3OA6 A;  2FPD A;  3CBM A;  1VA7 A;  1PRM C;  4ESR A;  1Y07 A;  5GAN d;  2I2L A;  1YJN A;  4M78 A;  3EGD A;  2VGN A;  2YUP A;  3CCR T;  1VQM A;  4IUU A;  4XU3 A;  2BIV A;  3RIR A;  3L42 A;  4ZN1 A;  2BE9 B;  3J7A F;  1UG1 A;  2VAS A;  4OMM A;  1GFD A;  4LUE A;  4XQ3 A;  3CEY A;  3VRZ A;  2ABL A;  2LP5 A;  2X3X D;  2O2O A;  4FYY B;  4DEY A;  2CH4 A;  2LCC A;  1W70 A;  1YJW A;  1H3H A;  1Q82 C;  2VYT A;  2ESW A;  1N8R U;  2QQS A;  2EJG A;  2PZ1 A;  1VQ9 Q;  1M27 C;  1IRX A;  2DKG A;  1I81 A;  4F04 B;  4RG2 A;  2BUD A;  2MWO A;  2QQB A;  2EYW A;  3EGD B;  4J83 A;  1VYV A;  1W2B P;  4MZP A;  5CKH A;  3HPW A;  2HZY A;  3EFR A;  1G3Y A;  2K5L A;  2MCN A;  1Z9Q A;  4FCY A;  3M0U A;  5KYY B;  3VUB A;  4NS5 A;  5GAN 7;  3SFM A;  3G6E Q;  4F7U F;  3DB3 A;  3OW2 P;  2E4H A;  2OTJ T;  1VIE A;  1IXD A;  2C0I A;  2JUF A;  4QQ6 A;  4MMK A;  4J9E A;  1NJI U;  4E7S A;  1RAC B;  3QJY A;  1PM3 A;  2H8H A;  2MK5 A;  4PJO C;  3O8V A;  1QKX A;  2LTO A;  4PJO G;  4PFO A;  2A36 A;  1MND A;  3E9G A;  4V2S A;  3A8G B;  1V1C A;  5GAM d;  1UEB A;  2NUZ A;  3NFC A;  1Y57 A;  4QVC A;  2DF6 A;  3CCS T;  3JB9 F;  2CZ7 B;  2XIC A;  3CC7 A;  5DLO A;  4X9C A;  2E12 A;  3L2Q A;  2EYY A;  4NL3 A;  3MEA A;  1M1F A;  1FYN A;  3RMS A;  5J26 A;  1YI2 Q;  3TSW A;  2Y4X A;  2RI3 A;  4HT9 A;  4FSS A;  4C92 E;  1WLP B;  3S6W A;  2E64 A;  5IXF A;  2JJ9 A;  3SDZ A;  1BIB A;  2JNG A;  4M78 G;  2LQK A;  1DJ7 B;  3QDR B;  2V8J A;  2CSI A;  3L2W A;  1VQO Q;  2ZZD A;  3CCQ Q;  2YRC A;  1G3T A;  4J9D A;  3OYH A;  1JQQ A;  3PGG A;  4K11 A;  3J81 E;  3PE0 A;  1BBZ A;  4OB1 B;  1FWZ A;  1Z9Z A;  3JRZ A;  4IIM A;  3S3N A;  4NL2 A;  1YIT T;  2K3Y A;  5I2M A;  4CC2 A;  4OMN A;  1JXM A;  3MP6 A;  3CME Q;  1BCO A;  4AFZ C;  2DVJ A;  2YLC A;  2LC4 A;  2DEU A;  1M1K U;  4LDX A;  2RHY A;  4J8O A;  1PHT A;  1WQ7 A;  1T0H A;  2GTJ A;  4AG2 C;  4C92 C;  1YWO A;  2JW4 A;  3X25 B;  2K2M A;  1OEB A;  1M9S A;  3QG1 A;  1WXU A;  3CCL Q;  4HCC A;  1W6X A;  1VIF A;  2KAF A;  1AWJ A;  1JRI A;  1ZUK A;  5C6S A;  3KUF A;  1KD1 U;  4AFU C;  2OI3 A;  1IO6 A;  1ZA1 B;  2EKO A;  1NG2 A;  1ZA2 B;  1VQ8 T;  2LQ8 A;  5DLQ E;  3GLX A;  4D6W A;  2OAU A;  1GBQ A;  5LJ3 e;  1WQW A;  3P8B B;  1FMK A;  3X20 B;  3VRY A;  2DIL A;  4M7D F;  2F2X A;  4OMQ A;  1M90 R;  1E6G A;  4EMK C;  2X4W A;  1M90 C;  1VQK A;  2DL8 A;  2OTL A;  2J06 A;  1X75 C;  3PFS A;  2DNU A;  2O4X B;  3UF4 A;  2RI2 A;  5KH6 A;  5GMK j;  4J6X A;  3CMA Q;  1AWO A;  3U23 A;  3JCM Q;  2KE9 A;  4AT1 B;  1OU8 A;  2F2W A;  1UJ0 A;  1VQM T;  4O6J A;  4KH0 B;  1M3A A;  2FZC B;  1X6G A;  2AZV A;  5KYW B;  3BDL A;  4EPC A;  3M59 A;  1OU9 A;  2VVK A;  3CC7 Q;  2KI7 A;  4BI4 A;  4KRT A;  3H8Z A;  4ZTF A;  1IHV A;  1YCY A;  4OMF B;  3M4Y A;  4DBF A;  3AHU A;  2GQV A;  2DLP A;  4LE9 A;  4RTZ A;  1YCS B;  3UWN A;  4OMO A;  3JSC A;  2PUK B;  2XHC A;  4TVR A;  1B34 B;  2RJE A;  1SRL A;  3CXC S;  1VQ4 A;  4JDS A;  3G71 A;  1VQK T;  1ZSZ A;  3RR6 A;  5KYU B;  2RQU A;  1Y96 A;  2KDS A;  1D1B A;  4M78 D;  2EIF A;  2KXD A;  2JMA A;  5FRO A;  3QKJ A;  3BE3 A;  3M55 A;  5GAO m;  1VOM A;  1WHG A;  2DET A;  2QDY B;  5IH2 A;  3QBY A;  5FRN A;  2NUT A;  3REB B;  5FW9 A;  4M77 E;  4JZ3 A;  1MMG A;  5GAN 3;  1JEG A;  3LGF A;  2KMT A;  2HBP A;  4IUV A;  4HVU A;  2NWM A;  1JB0 E;  2L8D A;  4C0Z A;  1WHL A;  1PCX A;  1U8R A;  1X6B A;  3VS4 A;  2M16 A;  2E6Z A;  2BKD N;  2MI6 A;  2YHT A;  1VYT A;  2CKK A;  1QVF P;  1O75 A;  2MMP A;  2MPX C;  4F7U A;  1M2V B;  3UPU A;  4EMK B;  3CC2 T;  1YIT A;  1HSQ A;  2WSF E;  3CCU Q;  3M4G A;  1YIJ A;  1BI2 A;  3TCJ A;  3I9Q A;  2CYZ B;  4IKF A;  3OYC A;  1D09 B;  2CT4 A;  2ATC B;  1Q82 R;  2QYZ A;  3JB9 H;  3I56 Q;  2RHX A;  3OYB A;  5D7U A;  1KQS S;  3OSS C;  2F2V A;  5EG2 A;  4PJN A;  4GY5 A;  3EH1 A;  1C0M A;  5IN1 A;  2B86 A;  4D8K A;  1BI1 A;  3RKY A;  1WZO A;  5CK9 A;  1S72 A;  2R5A A;  3PT9 A;  2L0A A;  1QWE A;  1N27 A;  4E7I A;  2OJ2 A;  3WVD B;  3E2U A;  1JJ2 S;  1K8A U;  1X6O A;  1W2B S;  2EQM A;  2ZAE A;  4HKE A;  4JJN K;  2DYB A;  2PTK A;  2J6F A;  3R6N A;  1OPK A;  1W2B A;  4CRI A;  9ATC B;  1TUD A;  1EFN A;  2COZ A;  3CXC P;  1AVZ C;  4ZGE B;  2EVR A;  2PVG B;  1C6V X;  1UHC A;  3S3O A;  3CC4 Q;  2FZG B;  3EAE A;  2HD0 A;  4F16 A;  3OYK A;  1QP3 A;  4HVV A;  1K8A C;  1U5S A;  2EGE A;  1R0C B;  1G3S A;  3R6O A;  2E65 A;  3M0R A;  2DTI A;  4PJO E;  2OTL T;  4JRQ A;  4M77 B;  3FIF A;  2DX1 A;  1Q81 C;  2QDL A;  4GBQ A;  3MCA B;  2M0O A;  3BY7 A;  4E7J A;  5FLX E;  2AKL A;  2DL4 A;  3ZBD A;  5D6X A;  4PJM A;  3EG2 A;  1NYG A;  5KE3 A;  1GCQ A;  2WAC A;  1ZSZ C;  1BI0 A;  5KYX B;  2PVD B;  3JCM h;  5GAO l;  1J3T A;  1PKT A;  1PD1 A;  5LJ5 f;  3OMC A;  4J9B A;  1Q81 U;  3PVQ A;  3EFS A;  1KHC A;  4BE1 A;  1KQ2 A;  3MEW A;  2KNB B;  2RHU A;  1M1G A;  3I35 A;  3NTH A;  2VB6 A;  3X26 B;  2NUP A;  1VQN A;  2YRV A;  4IUT A;  3G4S Q;  2HQH A;  4ME7 A;  3OYM A;  3OW2 A;  1E7O A;  1B3Q A;  3JCM g;  3TEE A;  1NEG A;  1VUB A;  2F5K A;  3HTR A;  1UGV A;  2G3R A;  3DB4 A;  3OYL A;  3L2V A;  1IGQ A;  1M2V A;  4FM4 B;  5I22 A;  1VQL T;  3A98 A;  2KT8 A;  3A8M B;  3I56 A;  4FIB A;  1KIK A;  5GAM h;  4II1 A;  4ELZ C;  3CCV A;  4RTY A;  2DJZ A;  1EZZ B;  1N9S A;  2H3E B;  2IPO B;  4C5H A;  1UHF A;  2X3W D;  1YN8 A;  1GBR A;  1FXX A;  2X4Y A;  4EMG A;  5GJV B;  1U1T A;  3I5R A;  2WSE E;  1KQS P;  1NYF A;  2DXU A;  2C06 A;  2AZS A;  2VC8 A;  2CZ0 B;  2IG0 A;  2D8J A;  1M3B A;  4OML A;  4N4H A;  3A1P A;  1WIE A;  3JAM E;  3LLR A;  3OS0 A;  2C0T A;  2V8K A;  2LNH B;  1IHW A;  4LN2 A;  1G3W A;  2M51 A;  1KD1 R;  5CKB A;  2D6F A;  4C92 G;  3QYG B;  1XTD A;  2X51 A;  3GPL A;  3CC4 T;  4FT4 A;  1QMC A;  2GNC A;  5CQY A;  4YTL A;  2DA9 A;  3CCL T;  1OYX A;  2CZ1 B;  2XI9 A;  3LYI A;  4C0D C;  1RAD B;  2PQW A;  1T0J A;  2LCL A;  2JTE A;  3RUX A;  3CC2 Q;  3REA B;  5CO7 A;  3CME A;  2LQW A;  1OOT A;  1YHQ T;  3JB9 G;  4AFQ C;  2DFU A;  2W10 A;  3TRE A;  2AK5 A;  3M9Q A;  5GAO p;  2MAM A;  2AKK A;  4DA4 A;  3PNW C;  1K9M R;  4M4Z A;  2P0K A;  4C92 B;  3M0P A;  1G2B A;  1S72 T;  2VWF A;  1VQ5 Q;  3MJX A;  5C0M A;  3CBO A;  3JV3 A;  3CCJ T;  4Z89 A;  4LUD A;  4PJO B;  1QCF A;  3V8K A;  1D3B A;  1VQ9 T;  2CP5 A;  4D8D A;  1MMN A;  1OZ3 A;  4OMP A;  2L3R A;  4JJD A;  3SD4 A;  2RNA A;  3RDV A;  2LRQ A;  4F7U G;  2E70 A;  4F7U B;  5GAN h;  2QA4 A;  4E7H A;  5GMK l;  1PWT A;  1CKB A;  5LL6 S;  2RJD A;  2FRW A;  2ROL A;  4J9C A;  1KD1 C;  2O88 A;  4EIK A;  2XG8 D;  2DJQ A;  3L2U A;  2IIM A;  2K7A A;  4PL6 A;  2JM8 A;  3RES A;  4JLG A;  3VYG A;  3CXC A;  2E41 A;  5KYY A;  4M7D G;  5LJ5 e;  1LCK A;  4E7L A;  2L2P A;  2RQV A;  3M56 A;  4AG1 C;  3JB9 J;  3GBQ A;  5CCA A;  2OTL Q;  1Q7Y R;  1QKW A;  4QVZ A;  1VQK Q;  3FJP A;  4IUP A;  5LJ3 j;  2KBT A;  4HT8 A;  3CCS Q;  2L3P A;  1WI7 A;  2HCK A;  1EIF A;  4QKU A;  4PJO F;  5D6W A;  1M8V A;  3MKD A;  5L23 A;  4PFP A;  3E9F A;  1K76 A;  4BDY A;  2SRC A;  1MMD A;  1RAG B;  1VQP T;  1U3O A;  3PTA A;  2HL3 A;  3FDR A;  5GMK e;  4PLL A;  2KSS A;  1GCP A;  1FMW A;  1MV0 B;  1AZE A;  5FWB A;  4BB7 A;  3RNJ A;  2RQT A;  2XK0 A;  3UDC A;  2ZCF B;  2DO3 A;  5IHK A;  2FHD A;  3MHX A;  3EG1 A;  4CC7 A;  4HCZ A;  1Y96 B;  3ZFJ A;  2DK3 A;  4C8Q C;  3L2Z A;  5FWC A;  3GP8 A;  3CCV Q;  2RPN A;  2P0Q A;  3PIP A;  2KEA A;  4AFS C;  1NBE B;  2HKQ B;  1KQ1 A;  1VQ5 T;  4KGZ B;  2D0Q B;  1O9S A;  5IT9 E;  1QVP A;  3CBP A;  3OYA A;  1YBY A;  1ZSG A;  1UEC A;  1SEM A;  1M30 A;  4KBM B;  1SF9 A;  2DMO A;  4KT0 E;  2FPF A;  4LDU A;  4F17 A;  4JZ4 A;  2Y90 A;  2YUN A;  2RHZ A;  4C0D B;  3G4S A;  3G71 T;  2HQE A;  2J6K A;  5LJ5 j;  1N8R C;  1WDX A;  3JCM d;  4L5G A;  3M0T A;  1RLQ C;  1HYO A;  1K0X A;  1WHM A;  4M7A E;  3LX7 A;  2EQI A;  4ZGD B;  2OTJ Q;  4HA8 A;  1VQP A;  3E1S A;  4LNP A;  2JN0 A;  4BDZ A;  2MYS A;  3VS2 A;  5KYU A;  3THK A;  5KCH A;  1M2O A;  2LX9 A;  2RF0 A;  5LJ5 g;  4M78 E;  3LW5 E;  5GAM e;  3CMA T;  1SRM A;  2D8H A;  4FL6 A;  1QVG S;  1IB8 A;  4KUI A;  4XTZ A;  2I0N A;  2KRO A;  3HRS A;  4Z02 A;  2K6D A;  4RTW A;  2DXT A;  1TSF A;  4M7D D;  4XTY A;  3UAT A;  2LQN A;  1AWW A;  2ZPH B;  2DIG A;  3QZ5 B;  4A4G A;  2K5F A;  1G5V A;  5HK0 A;  1VQ5 A;  3J80 E;  2YSQ A;  2CSQ A;  5EC7 A;  2A37 A;  3EGU A;  3VYH B;  3PIO A;  4M75 D;  1H64 1;  3NTI A;  4PK4 A;  4M7A C;  2ZPE B;  3LWI A; 
#chains in the Genus database with same CATH homology
 1X2Q A;  2EBP A;  2F2V A;  3M0Q A;  3VS6 A;  1WA7 A;  4Z8A A;  2B86 A;  2DE0 X;  4D8K A;  2GQI A;  1GCQ C;  1I07 A;  1UJY A;  2L0A A;  1QWE A;  4WCI A;  4J9F A;  2OAW A;  2OJ2 A;  3UA7 A;  2KYM A;  2EW3 A;  3LH5 A;  4RTT A;  1ABQ A;  5IHN A;  1ABO A;  4JPB W;  4HVW A;  3ZL7 C;  1ARK A;  2DYB A;  1A0N B;  2PTK A;  2J6F A;  3R6N A;  1OPK A;  1GRI A;  1WX6 A;  3VS1 A;  3SHW A;  2L3S A;  1GFC A;  2O31 A;  3H0F A;  1TUD A;  1EFN A;  2EPD A;  1AVZ C;  2EVR A;  1NLO C;  1E6H A;  1K9A A;  1UHC A;  5HCK A;  2K79 A;  4F16 A;  2J6O A;  4HVV A;  1U5S A;  2EGE A;  1H92 A;  2FG0 A;  3QWY A;  2RN8 A;  2ECZ A;  3M0R A;  1UDL A;  2LJ0 A;  3EHR A;  2DX1 A;  1K1Z A;  2QDL A;  4GBQ A;  2AKL A;  2DL4 A;  3NHN A;  2A08 A;  2K9G A;  4J9G A;  2GTO A;  1WXT A;  3EG2 A;  1NEB A;  1NYG A;  2CUB A;  2RQW A;  1GCQ A;  1KFZ A;  2MIO A;  2MOX A;  2L3Q A;  2JS2 A;  2YUO A;  2DBM A;  2EYZ A;  2HDA A;  2BZX A;  1J3T A;  3TVT A;  3H0H A;  2JXB A;  4ORZ A;  1PKT A;  1UE9 A;  2LZ6 B;  2K3B A;  4J9B A;  3PVQ A;  2EGA A;  2GGR A;  1I0C A;  2KNB B;  2FPD A;  2EGC A;  1VA7 A;  2J7I A;  1PRM C;  3I35 A;  4E6R A;  4ESR A;  4DEX A;  2DL3 A;  2SEM A;  2KRN A;  1NM7 A;  2YUP A;  1E7O A;  3PVL A;  4JJC A;  1B3Q A;  1NEG A;  5GJW B;  1AWX A;  1UG1 A;  3VS7 A;  4CC4 B;  4OMM A;  1CKA A;  1UGV A;  1GFD A;  1GL5 A;  4LUE A;  3VRZ A;  1ZUU A;  2BZ8 A;  2P4R A;  1KSW A;  2ABL A;  2PNI A;  1SHG A;  2LP5 A;  2X3X D;  4HCK A;  5I22 A;  2O2O A;  1RUW A;  2YT6 A;  4DEY A;  2CH4 A;  3A98 A;  2KT8 A;  1W70 A;  1H3H A;  2ESW A;  1KIK A;  4Z88 A;  1OPL A;  1W1F A;  2PZ1 A;  1MV3 A;  1M27 C;  2FPE A;  4RTY A;  2O9V A;  1T3S A;  3H41 A;  1UHF A;  2X3W D;  3O5Z A;  3FJ5 A;  2EYW A;  1YN8 A;  1GBR A;  1VYV A;  1ZX6 A;  2RMO A;  4IIO A;  5GJV B;  2G6F X;  3RBB B;  3I5R A;  1NYF A;  2KR3 A;  2MCN A;  1Z9Q A;  2AZS A;  3M0U A;  2LCS A;  2KYB A;  1M3C A;  4R0K A;  2KGT A;  2D8J A;  1X43 A;  1M3B A;  4OML A;  4RUG A;  3UA6 A;  1WIE A;  1N5Z A;  2JMC A;  2C0T A;  2C0I A;  2LNH B;  4J9E A;  4LN2 A;  1I1J A;  2M51 A;  2BZY A;  3KFV A;  1SPK A;  2H8H A;  2CDT A;  1UTI A;  1QKX A;  2GNC A;  1K0S A;  2DA9 A;  1AD5 A;  2A36 A;  2O9S A;  1UFF A;  1T0J A;  1V1C A;  2BTT A;  1OV3 A;  2JTE A;  1YP5 A;  2NUZ A;  1Y57 A;  4GLM A;  4ZNX A;  2DF6 A;  1JU5 C;  3REA B;  2YUQ A;  2LQW A;  1OOT A;  1ZLM A;  5IXB A;  2LMJ A;  2EYY A;  4X1V A;  1X69 A;  2D1X A;  4AFQ C;  1TUC A;  4J9H A;  1FYN A;  2W10 A;  2AK5 A;  2AKK A;  3TSW A;  4M4Z A;  3M0P A;  4FSS A;  1HJD A;  1G2B A;  1WLP B;  2VWF A;  5IXF A;  3JV3 A;  5ECA A;  4Z89 A;  4F14 A;  4LUD A;  1QCF A;  1CSK A;  2CSI A;  1AOJ A;  2ROT A;  4D8D A;  2DBK A;  4OMP A;  4JJD A;  2RNA A;  2YDL A;  4J9D A;  1PRL C;  1JQQ A;  1M8M A;  1JO8 A;  4K11 A;  3VS0 A;  3PE0 A;  1AZG B;  1BBZ A;  1SHF A;  1VYU A;  1Z9Z A;  4IIM A;  1PWT A;  1CKB A;  2HEQ A;  3VS3 A;  2FRW A;  2ROL A;  4J9C A;  4OMN A;  1JXM A;  4CC2 A;  1PKS A;  2O88 A;  1SSH A;  2CH4 W;  4EIK A;  4AFZ C;  2DJQ A;  2DVJ A;  2IIM A;  2K7A A;  3TSZ A;  2JM8 A;  3C0C A;  1PHT A;  1T0H A;  2GTJ A;  1JXO A;  4AG2 C;  1WYX A;  1YWO A;  2JW4 A;  3M0S A;  2ED0 A;  2K2M A;  1OEB A;  1LCK A;  2L2P A;  2RQV A;  4AG1 C;  3GBQ A;  1WXU A;  2A28 A;  4J9I A;  1QKW A;  1W6X A;  1AWJ A;  1ZUK A;  1Y0M A;  4AFU C;  2OI3 A;  1IO6 A;  2RQR A;  1AEY A;  1PNJ A;  1NG2 A;  2KBT A;  2L3P A;  1WI7 A;  4JJB A;  2HCK A;  4A63 B;  1GBQ A;  1FMK A;  3H0I A;  3NGP A;  1U06 A;  3VRY A;  5L23 A;  2E5K A;  1T3L A;  2KT1 A;  1H8K A;  2W0Z A;  2DIL A;  1K76 A;  1ZBJ A;  2F2X A;  2EKH A;  2SRC A;  4OMQ A;  2LJ3 A;  4QT7 A;  1XOV A;  1E6G A;  1U3O A;  2DL8 A;  1UUE A;  2J06 A;  1GCP A;  2DNU A;  3UF4 A;  1AWO A;  2CUD A;  1MV0 B;  3U23 A;  1AZE A;  2KE9 A;  5FWB A;  2M0Y A;  1BU1 A;  2DL5 A;  3EG3 A;  2RQT A;  3RNJ A;  1YWP A;  2F2W A;  4RTU A;  4RTV A;  1UJ0 A;  5IHK A;  3EG1 A;  4CC7 A;  1M3A A;  2EYX A;  1X6G A;  1RLP C;  2JM9 A;  2AZV A;  5FWC A;  3I5S A;  2RPN A;  2VVK A;  4KRT A;  2KEA A;  4AFS C;  2DLP A;  1MUZ A;  4LE9 A;  4RTZ A;  1YCS B;  1NLP C;  2CT3 A;  4OMO A;  1ZSG A;  1UEC A;  1SEM A;  1M30 A;  1WXB A;  4CC3 A;  2DMO A;  2FO0 A;  2FPF A;  3NPF A;  1BK2 A;  1SRL A;  2D0N A;  1ZUY A;  2J05 A;  4F17 A;  4JZ4 A;  2YUN A;  2LJ1 A;  3NMZ C;  2J6K A;  3EG0 A;  2RQU A;  2DM1 A;  4HXJ A;  2GBQ A;  2JT4 A;  1G83 A;  2JS0 A;  2KRM A;  1WDX A;  2KXD A;  2JMA A;  3M0T A;  1RLQ C;  1X27 A;  1K0X A;  2LX7 A;  2FRY A;  5IH2 A;  2DRM A;  2EQI A;  1TG0 A;  5FW9 A;  3REB B;  2C0O A;  2DRK A;  2FEI A;  1B07 A;  4JZ3 A;  5IHI A;  2DL7 A;  1QWF A;  4LNP A;  1HD3 A;  3VS2 A;  4RTX A;  3THK A;  1JEG A;  2VKN A;  1S1N A;  2RF0 A;  1KJW A;  1X2K A;  4HVU A;  2KRS A;  3IQL A;  1YNZ A;  2NWM A;  3EHQ A;  1WFW A;  1SRM A;  2D8H A;  2KXC A;  1X6B A;  3VS4 A;  5I11 A;  1VYT A;  2HBW A;  2I0N A;  2KRO A;  2K6D A;  3ULR B;  4RTW A;  1HSQ A;  2CRE A;  3UAT A;  2LQN A;  1AWW A;  1K4U S;  2V1Q A;  1RI9 A;  3I9Q A;  2XMF A;  3QWX X;  2YSQ A;  2CSQ A;  5EC7 A;  2A37 A;  3EGU A;  2V1R A;  1BB9 A;  1QLY A;  2CT4 A;  4Y92 A;  3SEM A;  2ENM A;  3CQT A;  2ED1 A;  2HSP A;  3VS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...