1N9SA

Crystal structure of yeast smf in spacegroup p43212
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
LKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein F
publication title Homomeric ring assemblies of eukaryotic Sm proteins have affinity for both RNA and DNA: Crystal structure of an oligomeric complex of yeast SmF
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 13
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1n9sA00
4XU3A 5GAN3 2DKGA 4M77B 3RIRA 5GMKe 5GAN2 1I4K1 4M7AB 4M75E 2EAYA 4C8QC 5GANd 4NL3A 3HFOA 4HT9A 4M77F 3RKYA 1X01A 4M7AF 4J6YA 5GAOq 4M78C 3JB9G 2DTIA 2JN0A 4NOYA 1M5Q1 2RD1A 4M77D 4A53A 4F7UB 4HT8A 4WF2A 2EJFA 4M7AD 3L1AA 5LJ5f 1TH7A 4PJOC 3JB9I 4M7DC 4C8QG 1HK9A 2K57A 3BY7A 4F7UF 4M78E 1MGQA 4J6XA 2VXEA 4QVCA 3EFSA 4PJOG 3JCMX 4M7DF 1WQWA 2EWNA 3JCMd 3BFMA 3RESA 4M75B 1JRIA 1D3BB 4M7DG 2YHTA 4EMKC 3JCMW 1BIAA 1H641 2DEQA 1WQ7A 2E64A 1D3BA 4M77C 1LNXA 4M75A 4A54A 4QVDA 1B34B 2YLBA 5LJ5d 1KQ2A 4M7AC 2FB7A 4RCBA 2DTOA 3INZA 1B34A 4XTXA 5GMKm 3JCMh 3JB9J 2VC8A 4N0AA 1N9RA 4XTWA 1HXDA 5GAN6 3SWNC 1M8VA 1N9SA 2E65A 2FYKA 3EFRA 4M77G 3JCMP 4M7AG 3BW1A 4MMKA 5LJ3h 5LJ3g 1U1SA 1WNLA 4C8QE 5GAMh 4XU2A 5GAMg 4OP0A 1I8FA 1Y96B 2YLCA 5GAN8 4C92B 1KQ1A 5GANh 3V7CA 1Y96A 4F7UG 3AHUA 4C92A 4DQ2A 2DZCA 4PNOA 4PJOE 4RCCA 2RB6A 4J5YA 4JUVA 2E1HA 2DZ9A 4MMLA 5GAOr 3HFNA 4M7DE 4C92D 4XQ3A 5GMKl 2RM4A 2EJ9A 3BDUA 1U1TA 4HA8A 3JB9H 5CAIA 4M75F 3QO3A 3HSBA 5GAOn 4Y91A 4M75D 3RKXA 4EMGA 4X9DA 3JCMQ 3JCMg 4M77E 4C8QA 2RA2A 3JB9D 5GAN4 4M78B 4M7AE 4V2SA 5GMKi 2HNIA 4XU1A 3FB9A 4M78A 4NL2A 5LJ5g 5LJ5h 3QUIA 4J6WA 3V7RA 2DTHA 4PJOA 1YCYA 3RUXA 3VU3C 3JCMe 4F7UE 5LJ3j 4M78D 4M7DA 5GANg 3V7SA 5LJ5j 5GAMj 3V8LA 5GMKh 3FIFA 5LJ3e 4C92F 4JLIA 4M75C 5GAMe 1LOJA 3L2ZA 4XTUA 4C92G 5GANj 3V8JA 5GAN5 4XU0A 4EMKB 2E10A 5GANe 4XTVA 3JCMc 4EMHA 1BIBA 3JCMb 4XTZA 4EMKA 1I5LA 2I2LA 2QTXA 4N0AC 3JCMV 3V8KA 4M77A 2ZGWA 4M75G 4XTYA 3JCMf 4M7AA 4JRKA 3QHSA 5I21A 3JB9F 4C8QB 2E41A 5GAOm 3FJPA 3PGGA 5GAOp 2VXFA 5LJ3f 3SWNB 4C8QF 3RKWA 5GAMf 4F7UA 3SWNA 4PJOB 2DXUA 4C92C 4M78F 4C8QD 3GIBA 3QSUA 5GANf 4M7DB 3SB2A 4M78G 3JCMJ 1WPYA 1I81A 2Y90A 2CGHA 1LJOA 2DVEA 3M4GA 4PJOF 4X9CA 3RERA 4JRIA 2DXTA 2DJZA 1JBMA 4C92E 5GAN7 4PJOD 5LJ5e 5DY9A 4M7DD 5LJ3d 2EJGA 5GAOl 5GMKj 5GAMd
chains in the Genus database with same CATH superfamily
1AWXA 2CP0A 4C0GA 3D7SB 5FU7C 5FWBA 4OB3B 4HT9A 3RKYA 5J26A 4J6YA 4QT7A 3TSZA 4TVRA 4M7AD 2O31A 3EH1A 2J06A 4J9IA 3PFSA 3S6WA 1YITT 1X6OA 4QVZA 1D09B 3X25B 4M77C 2F5KA 3TSWA 1BKBA 2FZGB 3INZA 2ZPHB 1D1CA 4XTWA 1F1BB 3OYEA 2JS2A 3I5SA 4OP0A 1FXXA 1I8FA 2EKOA 3I5RA 5ECAA 2PNIA 2RK2A 1UTIA 1NJIU 4BE0A 5GAOr 2DZ9A 3EG9B 5FROA 4C92D 4GLKA 4Y28E 5D6WA 2DD4A 1JJ2S 2X35A 2JNGA 3PVQA 3CCRA 5KCOA 3KXTA 1QP3A 2DL7A 4XU1A 4EDUA 3OW2P 1NYFA 1YCYA 2KMTA 5KYXB 3JCMe 3OYBA 4M78D 5LJ5j 5GAMj 1SHFA 1VUBA 1T0JA 2P84A 4KH0B 1IHWA 4XAXB 2EYYA 2I0NA 1G3YA 3OYGA 1WJSA 3PGGA 3M0UA 1X75C 2JOYA 3M9QA 3DB4A 1IB8A 2COWA 3GNGA 4B9WA 2CGHA 1YI2Q 2KVQG 4JRIA 2Y4YA 1YHQQ 2MYSA 1G5VA 4RTWA 3T9NA 2DLPA 5GAN3 2KRNA 4M7AB 1K9AA 2CH4A 2EYQA 2OI3A 3QYGB 4HVVA 4M7AF 1BBZA 2GQIA 2JS0A 1RABB 2VVKA 1FMWA 3CD6Q 1W70A 3SDZA 1Q81R 3M4YA 2ESWA 3QWXX 1KG1A 1D0YA 1RADB 4Z8AA 1WDXA 2H8HA 3MPUB 2M16A 2B8AA 4M7DG 2F69A 4LE9A 1M3AA 3ZL7C 2FB7A 3CPWP 1CKBA 1CSKA 4ZGJB 2QA4A 1Q7YU 1OX9A 1JU5C 3FEOA 2CT4A 5LJ3g 2EGAA 3PMIA 5GAMh 1WGSA 4C92B 2DFUA 1N8RU 4M7DE 2QQSA 4RUGA 4NS5A 1RI0A 2CP7A 3THKA 3M54A 1UHFA 1AZGB 2RK1A 3EFOA 4OMLA 1Y07A 4M78B 4Z88A 1WHHA 2QG9B 1BB9A 2RF0A 1VQ5Q 4PJOA 1KHIA 1ZQ1A 3EHRA 3MP6A 3FIFA 5LJ3e 4HCZA 2L2PA 3CCLA 4UC4A 3I55A 4OGEA 4IUTA 2DBMA 2HL3A 3V8KA 1XTDA 3JCMf 1YI2T 4FCYA 2J7IA 4P5NA 1YHQT 4PL6A 2YUQA 3CCVT 2AK5A 2CKKA 1LJOA 1P92A 1WXBA 5KYYA 2O88A 2KK4A 3I56Q 2GQVA 4ME7A 1Y57A 1C6VX 1PHTA 2LQKA 5KYWB 1BCOA 2QEXA 1QVGP 1WIEA 2ECZA 2IPOB 3F70A 3L2WA 3CCMQ 1NYGA 4M77D 1YJ9A 3J80E 2MOXA 1E7OA 2X4JA 4FW2A 3SHWA 2P4RA 1R77A 4F14A 1ZUUA 4ZTJA 5CKEA 4QQ6A 2LT1A 3CCST 2KE9A 2YLBA 4J9CA 2D0NA 1Q95G 4OMQA 2JTEA 4HXJA 1K9MR 2D8HA 4RTXA 1RAHB 4M7AG 3NTKA 2DMOA 4E6RA 4JJDA 1YP5A 3M53A 2R57A 4PFPA 1H92A 1Y96A 5KYNA 4DQ2A 2KBTA 4FYYB 2CYZB 2RB6A 2E1HA 3PVLA 2RHYA 2XI9A 3BDUA 1ZSZC 2BZXA 1VQKQ 4PLIA 2CP5A 2LNHB 5I2SA 3VUBA 2LQNA 1VQ5T 2DRKA 2XIDA 3A8MB 4FM4B 4BDYA 4M7AE 3G7ZA 1GL5A 2EFIA 4MZMA 2G6FX 3VYHB 2JMAA 5LL6S 5LJ5g 1PRMC 4J6WA 4PFZA 1SRMA 4C92G 3Q1JA 3V8JA 2DIGA 2O2OA 4PKCC 2ATCB 2O9VA 4EMKB 1VQLQ 2HMAA 3KBGA 1KQSP 2H3EB 5IN1A 1NLPC 4CC4B 5FU7B 5KE3A 3JB9F 5LJ3f 3O5ZA 2F5TX 4GLMA 4M78G 3I56T 2DVEA 1VQ7Q 1I0CA 1PD1A 4C92E 4J9GA 5LJ5e 1ZBJA 4JJCA 3ASKA 3G6EQ 1M90R 2X4WA 5A0GA 4M77B 2QGFB 3M0QA 4M77F 2CDTA 2JM8A 2RN8A 1YN8A 1M5Q1 1TTHB 4CRIA 2LJ1A 3AT1B 4M78E 2DJQA 1WX6A 2KXDA 5GJVB 3WXMB 2MF2A 3QJYA 3EGXA 2K5FA 3OYKA 2MMPA 4B9XA 2OTLQ 2VGMA 1D3BA 1QVFA 5I22A 1D0ZA 2EGCA 1Z9QA 4RCBA 2JT4A 1B34A 2CZ0B 4X34A 2XMFA 2DNUA 1DJ7B 3OS0A 4OGCA 1G8XA 2XDPA 1W4SA 4Q5WA 4PFOA 1KC8R 4J5YA 4N4IA 1SSFA 2LJ0A 3QXEB 2PTKA 3HFNA 3WVDB 2EYWA 4BI4A 5GMKl 3JRZA 2FG0A 1WXTA 2EGEA 4Y92A 1UHCA 1YIJT 2DYIA 4EMGA 3RMQA 1W6XA 2NUTA 4ORZA 2YSQA 2RQWA 4DBQA 3C95A 2VASA 1UE9A 1QWEA 1GFCA 1IGQA 1VQLT 1QCFA 4M7DA 3V7SA 5DLOA 2LCLA 4JLIA 3C94A 3JV3A 3CBMA 1VQ9Q 1I5LA 3UWNA 2ZGWA 3QHSA 2E41A 4ESRA 3EAEA 1VQ7T 3OBYA 3SWNA 2CZ1B 4C92C 3JCMJ 3QZ5B 3G6ET 1TUGB 1KQSS 1WA7A 1IRXA 1WHKA 3GLXA 3WVEB 4RG8A 1B7TA 2WSEE 3EG1A 3VRYA 2RI3A 2EAYA 1K73R 3HFOA 2C06A 4F04B 2O4XB 1OV3A 4M78C 3JB9G 2P0PA 1IO6A 5KCHA 5LJ5f 1NE8A 3CCEQ 1ZUKA 1MHNA 1PC0A 1CKAA 1T0HA 2NUPA 1YJNA 3EFSA 1YI2A 4R0KA 2CZ6B 4J9EA 3S3NA 3EG9A 2RHZA 2E64A 2QDLA 1YHQA 3N5BB 3CCVA 2MCNA 3FC3A 1X2QA 1K4US 3S3OA 5FRMA 5GMKm 3JCMh 1N9RA 1ZHIA 1M9SA 4M77G 1HD3A 2O01E 2LP5A 3H0FA 1KD1U 2QGGA 1JB0E 1KSWA 1H8KA 2KQWA 1Q82R 3UT1A 5KYXA 3AHUA 1D1AA 4PNOA 1S1NA 2L3RA 2V8IA 5I2MA 2HSPA 3CC4T 1K0SA 1M8MA 1YJWQ 1OPLA 4HA8A 5L8RE 3REBB 1K0XA 4FW1A 1TOVA 1XQHA 4M77E 4PJJA 2Y4XA 5GAN4 3FRNA 4QQGA 1JJ2P 2M1HA 3CCSA 2W0ZA 2F2XA 3RNJA 2PUKB 3M5AA 2BZYA 4OVAA 1K76A 5LJ3j 2AHJB 2LCSA 2C0IA 4E7ZA 2P0QA 1VQ9T 1BCMA 4O5VA 3CCUT 4MDWA 2ENMA 3CPFA 2RNAA 3ZFJA 5DLQE 1OU8A 3S3MA 3NFCA 2D1XA 4M7AA 1MNDA 1TU0B 2O9SA 4PJLA 3UF4A 3URGA 2P4TA 2ED0A 1GCQA 2A7YA 5C0MA 2Y90A 4ZGDB 3CC2T 1VQ5A 1RL2A 5CKHA 2DE0X 2FPFA 3VS0A 3LYIA 1Q81C 3OYHA 1IGUA 5GAMd 4J83A 5GMKe 1VQOQ 4R56A 2E3IA 3UA7A 3RR6A 2M9UA 4JPBW 4NOYA 2WSCE 1QCOA 2HD0A 5HK3A 1HK9A 2MWPA 3OS1A 4FYWB 2LZ6B 4KBMB 4QVCA 3PTAA 4M7DF 1YCSB 3CCJA 1KJWA 4QW2A 4EMKC 3EGUA 3VS2A 1LNXA 3G71T 1ZSZB 3I56A 1UB4A 5HY6A 1WHLA 4N0AA 1X6GA 2L8DA 2RJEA 3JCMP 3QG1A 5LJ3h 1QVFS 2K5LA 2YLCA 4C5GA 2DK3A 3GOXA 4GBQA 2OTJQ 1YJWT 2FRWA 1AT1B 3A8OB 4F17A 2PU9B 2KYBA 3OYCA 1NJIR 4KUIA 1M2VB 3TCJA 3JCMg 2RA2A 4LUEA 1BI2A 4RTVA 1VOMA 3QDFA 1OULA 2DL5A 1FWZA 5FU6B 1AWOA 4LDWA 2XHCA 3DLLA 3L2ZA 1RUWA 3O8VA 2RQVA 2PQWA 1C1AA 4JRKA 1WHJA 2GNCA 2JTFA 4Z89A 1BU1A 2KY9A 2E6ZA 2JXBA 2MPXC 3ER0A 1WI7A 2YWWA 4L5GA 2RJCA 3GIBA 1N5ZA 2YDLA 4ELYC 3M0SA 3H9NA 1YIJA 4CC3A 2KT1A 1X27A 4RTZA 2DX1A 1ABOA 1PKTA 2QQBA 2XU8A 1U8RA 1VQLA 1I4K1 1PNJA 4IIOA 2EW3A 2X3XD 2RD1A 5AT1B 4F7UB 3CMAQ 5IXBA 1MV3A 2E6NA 1OQKA 4F7UF 4RTUA 4E7KA 4HCKA 4OB0B 2K5IA 5CIUA 3HRTA 2AKLA 4M75B 1JRIA 1VQ7A 2L3PA 2ZAEA 1ABQA 3E9GA 3CQTA 2HKQB 4E7HA 3A5ZB 1KQ2A 1PG5B 3UDCA 3G6EA 9ATCB 1QP2A 4A4KA 2NWMA 2EIFA 3CMEQ 2CSQA 3R6OA 1RAAB 1Q7YR 2EYXA 1Q86C 2RI2A 4O6JA 5CQYA 1PSFA 3PIOA 4RCCA 3PT9A 2LNVA 2M02A 3UPUA 4MZPA 4RTYA 1N8RR 1LPLA 3OA6A 4Y91A 3JCMQ 3LGLA 5GMKi 3CC7Q 3DLMA 5LJ5h 3QIIA 3OSVA 1IZ6A 3H8ZA 5HK0A 1OOTA 4C92F 1OPKA 1S72Q 3PNWC 4BD3A 5GANe 3JCMc 3L2VA 4M77A 4ZN1A 1V29B 4BI8B 3CC4A 1VYVA 3R6NA 1M90C 2EYZA 1EZZB 4IUPA 2DL4A 4M78F 1M1KC 2OJ2A 3I35A 2JZ2A 1SHGA 1H3HA 2FZCB 2PVGB 1GBRA 1ZX6A 1VQMQ 1SG5A 1AOJA 1G3TA 3G4SQ 3CMAT 4C8QC 3ME9A 1VQ9A 5GAOq 3CCUA 2DAQA 2HZYA 5J3BA 3EGDA 2L0AA 2K57A 4ELZC 1KIKA 4JZ4A 3LW5E 3OYJA 2KSSA 1KK7A 4HVUA 2GFUA 4J7FA 2L3QA 1OEBA 1WJQA 4DA4A 7AT1B 1I1JA 2OAWA 1ZBXA 3CMET 3CC2A 4R55A 3CD6T 3EFRA 2CUDA 3EG2A 5KH6A 2JJ9A 2QQRA 5A0LA 1WNLA 1W2BA 2ABLA 4K11A 3RMSA 2R5AA 3V7CA 4F7UG 4KGXB 2RJFA 2F2VA 1W1FA 2EJ9A 1U1TA 3HHTB 4KRTA 2ZCFB 1VQPQ 2DL3A 4CI0C 3GNFB 4E7LA 3RBBB 3CC7T 3IQLA 3FJ5A 2DYBA 1M1GA 4LNPA 5FLXE 2V26A 3OB9A 4IUQA 2HNIA 3G71A 3FDRA 3QUIA 2DTHA 4F7UE 1S72T 5GJWB 1SEMA 2OAUA 1WHMA 1SF9A 3A8HB 1K8AC 1C0MA 2SEMA 3M0TA 4XTVA 2CREA 2QTXA 4OMPA 3VS1A 1YJWA 1YITA 1TS9A 1UEBA 1NEGA 4BUGA 5GAOp 1NPPA 4A4GA 2AKKA 3HRUA 4IUUA 5GANf 1A0NB 1R0BG 1RAEB 1VQMT 1UGPB 3VYGA 3META 2GGRA 1EFNA 5GMKj 2QASA 2HSEB 3LWHA 2DM1A 4RG2A 2L3SA 2DTIA 5KE2A 1AWJA 5IHIA 3A98A 4JS4A 1TH7A 4FT4A 2X3WD 4GY5A 5FU6C 4LXCA 2DXBA 1BI1A 5AYFA 2XDDA 1MMGA 5CO7A 1Q86U 1X69A 3J81E 2YHTA 4E47A 1H641 1Y71A 1WQ7A 2DEQA 2EBPA 2L5QA 3CCMT 2DTOA 2M0YA 1W2BP 1N9SA 4DOWA 3MP8A 4LN2A 1JXOA 2HQXA 5IAYA 5IHNA 1QVPA 1GRIA 2LDMA 1VQPT 1MMDA 8AT1B 1VIFA 3C0CA 1AVZC 2KYMA 2HDAA 4XQ3A 1PM3A 2GTOA 2GTJA 3EFOB 3EG3A 1VA7A 5GAOn 3LGFA 3M57A 3X24B 2EQMA 3ULRB 2AT1B 4OMNA 1KHCA 1VYTA 3FB9A 1M4ZA 2FZKB 2QYZA 1G2BA 5CKBA 3L2RA 2CSIA 5CQXA 1JQQA 5GMKh 3A1PA 2H3JA 4M75C 2FL7A 4Z02A 1VQKT 2QA4Q 1M1KU 1TUCA 1Z9ZA 2QQAA 3CCQQ 1Y0MA 2QK0A 4EPCA 2LJ3A 4E7SA 2KAFA 1VQ4Q 3RKWA 1NM7A 3P8HA 1JO8A 4QQDA 1UGQB 4C8QD 3GP8A 3SB2A 3OYNA 4LDXA 1I81A 5KYUB 2QI2A 2DJZA 5D7UA 2C0TA 1G3SA 1YWPA 2V8KA 1NZ9A 4J7IA 2A28A 5LJ3d 4XU3A 2QXFA 4JDSA 3RIRA 2AZVA 2RHUA 2Z0WA 2A08A 2K3XA 1ZSZA 3CXCA 1PWTA 1UUEA 2CP6A 4BY6B 1VQ6Q 1UDLA 2XK0A 2K3BA 4FYVB 4HT8A 1YWOA 3BY7A 3LLRA 3CCLQ 5IT9E 3OYDA 2K2MA 2KROA 1FMKA 4X1VA 2XG8D 4AG2C 4A4FA 5GAN2 1LCKA 4BE2A 1SRLA 4BI3A 3OYMA 1M2VA 2VC8A 1HXDA 3TVTA 1RI9A 2XICA 1NJIC 4OMMA 3HTRA 2LT4A 3M0RA 1Y96B 2E3HA 4C5EA 1RAGB 2OTLT 1KD1R 4BB7A 1FYNA 2A36A 4BE1A 1QVFP 1OYXA 3MEVA 1ZSGA 3QZ9B 2QEXQ 2RM4A 1W2BS 4FSSA 4D6WA 4C0DC 4ANJA 4KT0E 3NMZC 3REAB 2D9TA 1M2OA 1K8AU 4AFQC 2E12A 5M9OA 4BDZA 2HKNA 3CMEA 2RH2A 4HVWA 2BE9B 4L59A 3CD6A 3VRZA 3CCQT 4OB2B 5GANj 1RLPC 4XU0A 4JS5A 4FIBA 4CC7A 1VQ4T 3VS3A 3DB3A 2OX7A 2RQUA 4C8QB 2LX7A 4C8QF 2P0KA 3NHNA 4D8DA 4F7UA 4II1A 4WCIA 3CC7A 1G83A 3E1SA 3M4GA 3MKDA 1SSHA 3SEMA 3VKIA 3CEYA 2XKOC 1VQNA 1VQ6T 4IKFA 1QWFA 5FRNA 4FYXB 1SPKA 2GBQA 2VB6A 4A4EA 1QLYA 1S72A 4NL3A 2DILA 4LDUA 3OYAA 2DEUA 1XOVA 2IG0A 2BZ8A 3UATA 2BKDN 3M0PA 3L1AA 2K4YA 2EVRA 1XNIA 1MGQA 2VXEA 3EGXB 3MHXA 1QQJA 1EIFA 1D3BB 3C4SA 3GPLA 3DKMA 2LQ8A 2ZPEB 4A54A 5LJ5d 1B34B 1WYXA 1ZA1B 5IXFA 2D8JA 3E19A 2PUOB 1I07A 2HBPA 4XTXA 4PJNA 2V1RA 3QWYA 3CCET 2F1LA 3U23A 2E65A 4AFSC 1N8RC 2CZ7B 1OZ2A 3BW1A 2EQUA 2X4XA 2MWOA 2LVMA 2ZPGB 1WJRA 3CBPA 1JEGA 1SKUB 1HJDA 1AZEA 3SFMA 5GANh 3MCAB 3OW2A 3QDRB 4C92A 2QTVA 2XDBA 2PVDB 1PD0A 2KXCA 2EQIA 4E7JA 4E7IA 3OYYA 1PRLC 3LX7A 2NUZA 2C0OA 3H41A 2R5MA 4M75D 3JSCA 4YTLA 2IVWA 3TQ7P 4M78A 4ZTFA 2XD0A 2A3LA 3SD4A 3EHQA 3CCMA 1IXDA 2RHIA 2VYTA 4BACA 1VIEA 2YXYA 1MNEA 1U5SA 3HP9A 5GAN5 2AIRB 1LVKA 3L2QA 2FO0A 5DM7R 1BIBA 3JCMb 4ATOA 1VQPA 2X4YA 2COYA 2KGTA 2V1QA 3SWNB 3OSSC 4OF1A 4JJNK 4RTTA 3QSUA 3X28B 2ZZDA 1TG0A 2G3RA 2JM9A 1YBYA 3PE0A 3TEEA 1GCPA 2DKGA 3BE3A 3OBWA 1GXIE 4IIMA 1TWBA 3MEWA 5KYWA 3CPWA 4M4ZA 3PIPA 2JN0A 3OY9A 1VQKA 4PJOC 2EJFA 3JB9I 4C8QG 1TXQA 2LCCA 4WTOB 2RPNA 2VWFA 3HRSA 4C5IA 2NUPB 4JRPA 3CXCS 3UA6A 5FW9A 5HKCA 1BI3A 3LWIA 2KDSA 3RESA 2BIVA 1VQOT 3JCMW 3VV0A 3E9FA 4FT2A 1R8OB 3JB9J 1O9SA 3OYLA 1OX8A 1QKWA 4JLGA 4C8QE 4J8OA 1KQ1A 1K9MC 2J05A 3JAME 3H6ZA 4KH1B 2RO0A 2QDYB 4M75F 3QO3A 3HSBA 3MEUA 4BY6C 1AWWA 1KFZA 1GFDA 2OTJT 1YFNA 1YJNQ 2HQHA 1NLOC 2LC4A 3EG0A 1BYMA 5GANg 3E2UA 1FMVA 2BTTA 2E70A 2DPPB 4MZTA 2ROTA 3G1JA 3CCVQ 1Y7XA 1IHVA 1UG1A 4EMHA 3TU4K 4EMKA 4KGZB 2OTLA 1VQ8Q 1QVGA 2YUNA 3CBOA 4RKUE 1OI1A 4A4HA 3QPHA 4PK4A 1M1FA 2ZPBB 3OYFA 5D6YA 1ARKA 4FU6A 1VYUA 2K3YA 2MIOA 3A8LB 2YUPA 2K79A 4LDVA 1X01A 3CCSQ 2L89A 4VUBA 1Q81U 3CCQA 2ZPIB 1VQ4A 3EH2A 2DF6A 4RMOA 4KGVB 1M3CA 3HL8A 1WXUA 1RAFB 1MUZA 1WQWA 2EWNA 5J39A 4OMOA 3MJXA 5CVIA 2DL8A 1QW1A 4C0DB 2RMOA 3OQ5A 1B07A 3GF5A 1JXMA 1M8VA 2FYKA 1J3TA 1TSFA 2J6FA 1VQ6A 4XU2A 2ZPFB 2DZCA 3L42A 4AFZC 2HL5C 4ZNXA 3NTIA 3JB9H 5CAIA 2AZSA 3OW2S 2B86A 3P8BB 5CCAA 1KC8C 1KQSA 1YJNT 1FX7A 1WFWA 5IHKA 3JB9D 3QJ6A 1NEBA 3KFVA 1M30A 4DBFA 4NL2A 4MDXA 4LD6A 2CP3A 1E6GA 3CCJQ 4LD9K 3M59A 3TREA 4C0ZA 2DBKA 5KYUA 3CCEA 1VQNQ 1M3BA 2FPDA 2RI5A 2E10A 1VQ8T 2DO3A 3JCMV 4M75G 4DEYA 4XTYA 2JUFA 1N6AA 3FJPA 2GFAA 1OZ3A 4QKUA 2K7AA 1D0XA 2DXUA 4J9FA 1IREB 1RLQC 2F2WA 2JTMA 5I11A 2DXTA 1JBMA 4PJOD 1WLPB 5DY9A 2DD5A 5GAOl 1H3ZA 2FRYA 1YNZA 4M75E 2VKNA 3BDLA 2WACA 1AD5A 2O4XA 4A53A 4WF2A 5C6SA 1ZLMA 4M7DC 2VGNA 4J9BA 4D8KA 1K73C 2COZA 2JW4A 2CH4W 2KRSA 4J6XA 2JMCA 3PMTA 3CPWS 2NYSA 1GBQA 3JCMd 2BUDA 4B6MA 3G4ST 1K9MU 3CCRQ 2EQJA 1KD1C 1Q86R 2RQRA 2X9HA 2DETA 3NTHA 5GAN6 1BK2A 3SWNC 3VS7A 3LH5A 1YIJQ 1U1SA 1R0CB 5GAMg 5GAN8 1E6HA 4HKEA 1RAIB 2RHXA 2KR3A 2FVUA 5IH2A 1D1BA 1QMCA 1Q82C 2E5QA 1UJYA 2HCKA 3ZEHA 2CS7A 4L6V5 1HSQA 3RKXA 4X9DA 2FEIA 4C8QA 4HCBA 3CCJT 1VQOA 3HKSA 1VQNT 3VU3C 4AFUC 5CK9A 2KEAA 1UFFA 2DIQA 4N4GA 5GAMe 4XTUA 2CT3A 1AEYA 3OYIA 4OMFB 1BI0A 2A37A 4LUDA 4AG1C 2YUOA 1M1KR 1U3OA 5GAOm 3P8DA 3VS5A 1V1CA 1UGSB 3VS4A 4PJOB 2PVOB 1MMNA 2W10A 1WPYA 1PCXA 4PJOF 4JZ3A 4X9CA 1M90U 1QVGS 2LTOA 3ZBDA 3J7AF 5FWCA 2OTJA 4FSXA 4C5HA 2KT8A 4F16A 3FLGA 3OMGA 5GANd 4PJMA 3EGDB 2HBWA 5D6XA 1V76A 5CKDA 2DVJA 3CCRT 1MV0B 1OU9A 5KYYB 4N4HA 2DXCA 3QKJA 3H0IA 2E4HA 2ED1A 4DBHA 2EPDA 6AT1B 2V8JA 4ZN3A 2QQ9A 4M7AC 3OS2A 2MAMA 3CC4Q 1X43A 1UGVA 2E5KA 2D6FA 4IURA 1GCQC 2YT6A 4FL6A 4MMKA 4E2FB 4C0FA 1KC8U 2LX9A 3VS6A 1JJ2A 1I5OB 2GF7A 4J9HA 2K2VA 1XJWB 3I55Q 1NPRA 2BE7D 4MMLA 1AHJB 1PKSA 3C12A 3H0HA 2YRCA 2M0OA 3MO8A 1NBEB 3CCUQ 1PSEA 3QYHB 1UGRB 5HCKA 2MI6A 1WHGA 4DBRA 2SRCA 1K8AR 3RUXA 4HCCA 2DA9A 3CMAA 3V8LA 1LOJA 1EX4A 3CC2Q 4XTZA 2I2LA 3NPFA 4N0AC 1RACB 1X2KA 1YJ9Q 2RJDA 2VXFA 1QCNA 1TUDA 4CC2A 1UECA 5GAMf 2IIMA 2YRDA 3I9QA 5A2QE 2MK5A 2VUBA 3OMCA 3RDVA 2QA4T 2KNBB 2R58A 3RERA 2VV5A 5CKFA 1K73U 3OS5A 4M7DD 2EJGA 3VUZA 2GCXA 1ZUYA 2EKHA 4AT1B 1U06A 5CR2A 2ROLA 2DRMA 4PLLA 4ZGEB 3G71Q 2EQKA 8ATCB 2J6OA 1VQ8A 3MEAA 4AMCA 1HYOA 2J6KA 4DEXA 4PJOG 3JCMX 2NLUA 3BFMA 1K1ZA 2HAXA 1BIAA 4JRQA 1YITQ 1O75A 4M75A 5A0DA 4QVDA 3CXCP 4OB1B 2PZ1A 3NGPA 2YRVA 2QAZA 1B3QA 1Q82U 1G3WA 3CCLT 2K9GA 3I55T 1T3SA 4XK8E 2K6DA 4J9DA 1ZA2B 3A8GB 1N27A 3GBQA 2X51A 5EC7A 4PJOE 3MP1A 4IUVA 2CP2A 4JUVA 1Q7YC 3X26B 1X6BA 5L23A 2FPEA 4A63B 4KUDK 4DOVA 2HQEA 2M51A 1VQMA 2HEQA 2LQWA 4V2SA 3G4SA 2WSFE 4EIKA 2JVVA 3L2UA 3V7RA 3LH0A 3M56A 1NG2A 2QEXT 3X20B 2A0FB 3M55A 1YJ9T 3VJPA 4KULA 2KRMA 1UJ0A 3QBYA 1ACMB 1QKXA 3KUFA 5I21A 2CUBA 1MMAA 2NUTB 2LRQA 5EG2A 1M27C 4JJBA 2DERA 2LMJA 2KI7A 2RQTA 4LDYA 4M7DB 3M58A 2FHDA 1WZOA 1T3LA 5GAN7 3HPWA 2D0QB
chains in the Genus database with same CATH topology
3A8LB 2WSEE 4C0GA 2RI3A 5FU7C 2EAYA 3LWHA 3HFOA 4LDVA 2C06A 4OB3B 4HT9A 3RKYA 1X01A 2O4XB 2L89A 5J26A 4J6YA 4VUBA 4M78C 4RG2A 3JB9G 2DTIA 5KE2A 3CCQA 1Q81U 2P0PA 4TVRA 4JS4A 2ZPIB 5KCHA 4M7AD 5LJ5f 1TH7A 4FT4A 1NE8A 4GY5A 5FU6C 1VQ4A 2DXBA 4RMOA 1MHNA 3PFSA 3S6WA 1BI1A 5AYFA 3HL8A 2XDDA 1X6OA 1YITT 1YJNA 3EFSA 4QVZA 1WQWA 2EWNA 5CO7A 1YI2A 1Q86U 3J81E 5J39A 2YHTA 2CZ6B 3S3NA 4E47A 3X25B 1H641 1Y71A 2RHZA 1WQ7A 2DEQA 2E64A 4M77C 2F5KA 1YHQA 5CVIA 3N5BB 2L5QA 1BKBA 3CCMT 3CCVA 1QW1A 3FC3A 2DTOA 4C0DB 3INZA 3S3OA 5FRMA 2ZPHB 3OQ5A 5GMKm 3GF5A 3JCMh 1N9RA 4XTWA 1ZHIA 1M8VA 1M9SA 1N9SA 2FYKA 4M77G 4DOWA 3MP8A 2O01E 1VQ6A 1KD1U 4XU2A 3OYEA 4OP0A 1FXXA 1JB0E 1I8FA 2EKOA 2HQXA 2KQWA 2ZPFB 5IAYA 3UT1A 1QVPA 3AHUA 2RK2A 2LDMA 1VQPT 2DZCA 3L42A 4PNOA 1NJIU 2L3RA 2V8IA 1VIFA 4BE0A 5I2MA 5GAOr 2DZ9A 3CC4T 5FROA 4C92D 4XQ3A 4GLKA 3NTIA 4HA8A 4Y28E 3JB9H 5D6WA 5CAIA 2DD4A 1JJ2S 2X35A 5L8RE 3OW2S 2JNGA 3P8BB 3CCRA 5CCAA 5KCOA 1KC8C 5GAOn 1KQSA 3LGFA 3M57A 1FX7A 3X24B 1YJNT 1XQHA 2EQMA 4M77E 3QJ6A 3JB9D 2Y4XA 5GAN4 1QP3A 3FRNA 4QQGA 3KXTA 1KHCA 4XU1A 4EDUA 2M1HA 3FB9A 4NL2A 1M4ZA 3CCSA 4MDXA 4LD6A 2PUKB 3M5AA 1YCYA 2KMTA 4OVAA 3JCMe 3OYBA 5CKBA 2AHJB 5LJ3j 4M78D 3L2RA 5CQXA 4LD9K 5LJ5j 3M59A 5GAMj 5GMKh 3TREA 2H3JA 2P0QA 4C0ZA 3CCEA 1VUBA 1VQ9T 4M75C 4O5VA 3CCUT 2FL7A 4Z02A 1VQKT 4MDWA 1M1KU 2RI5A 4XAXB 2E10A 3CPFA 1VQ8T 3ZFJA 5DLQE 2DO3A 2QQAA 3S3MA 3NFCA 3JCMV 1G3YA 4M75G 4XTYA 4M7AA 2JUFA 3OYGA 1WJSA 1N6AA 3FJPA 2GFAA 3PGGA 4EPCA 1OZ3A 3URGA 1X75C 2JOYA 2KAFA 3RKWA 2P4TA 3M9QA 3DB4A 3P8HA 2DXUA 1IREB 1UGQB 4QQDA 4C8QD 3GP8A 3SB2A 2A7YA 3OYNA 4LDXA 5C0MA 1I81A 2Y90A 2CGHA 3GNGA 4B9WA 4ZGDB 2KVQG 3CC2T 4JRIA 2JTMA 1RL2A 1VQ5A 2DXTA 2QI2A 2DJZA 1G3SA 1JBMA 2Y4YA 5CKHA 4PJOD 1G5VA 2V8KA 1NZ9A 5DY9A 3LYIA 3T9NA 4J7IA 5LJ3d 2DD5A 5GAOl 3OYHA 1Q81C 5GAMd 4XU3A 2QXFA 5GAN3 4J83A 4JDSA 1H3ZA 3RIRA 2RHUA 5GMKe 2K3XA 4M7AB 4M75E 4R56A 3CXCA 2EYQA 3BDLA 4BY6B 2M9UA 3QYGB 4M7AF 2WACA 4NOYA 2XK0A 2WSCE 2O4XA 4HT8A 4A53A 4WF2A 5C6SA 2HD0A 5HK3A 4M7DC 1HK9A 2VGNA 1K73C 3BY7A 2MWPA 3OS1A 3SDZA 4J6XA 3LLRA 3M4YA 5IT9E 4KBMB 3PMTA 4QVCA 3CPWS 1KG1A 3PTAA 3OYDA 4M7DF 3JCMd 2M16A 2BUDA 2B8AA 5GMKj 3CCJA 4M7DG 4QW2A 4EMKC 3G4ST 2F69A 1K9MU 2XG8D 4A4FA 5GAN2 1LNXA 3G71T 4BE2A 2EQJA 3I56A 1UB4A 2FB7A 1KD1C 5HY6A 4ZGJB 2QA4A 1Q7YU 4BI3A 3OYMA 2VC8A 3FEOA 3NTHA 2L8DA 4N0AA 1HXDA 5GAN6 3SWNC 2RJEA 3JCMP 2XICA 3QG1A 5LJ3h 5LJ3g 1NJIC 1U1SA 2LT4A 3PMIA 5GAMh 5GAMg 1QVFS 2K5LA 5GAN8 1Y96B 1WGSA 2YLCA 4C5GA 4C92B 4C5EA 2DK3A 4HKEA 3GOXA 2RHXA 1YJWT 2OTLT 1N8RU 2FVUA 4BB7A 3A8OB 2QQSA 4M7DE 4NS5A 4BE1A 1OYXA 3MEVA 1RI0A 3QZ9B 1W2BS 2RM4A 2PU9B 3M54A 4D6WA 1Q82C 4C0DC 3OYCA 4KT0E 2E5QA 3ZEHA 4KUIA 2RK1A 3TCJA 2D9TA 2CS7A 4L6V5 3RKXA 4X9DA 1K8AU 3JCMg 4C8QA 4HCBA 1Y07A 2RA2A 2E12A 4M78B 3HKSA 3CCJT 1VQOA 1BI2A 5M9OA 4BDZA 1VQNT 3CMEA 1FWZA 4PJOA 3VU3C 5FU6B 1KHIA 5CK9A 2RH2A 1ZQ1A 4LDWA 2DIQA 3MP6A 3FIFA 2XHCA 4L59A 4N4GA 5LJ3e 3CD6A 3DLLA 5GAMe 3L2ZA 4XTUA 4HCZA 3CCQT 4OB2B 4OMFB 3OYIA 5GANj 1BI0A 3CCLA 4UC4A 4XU0A 3I55A 3O8VA 4OGEA 4IUTA 4JS5A 4FIBA 1VQ4T 2PQWA 3V8KA 1XTDA 3DB3A 4JRKA 3JCMf 4C8QB 5GAOm 2JTFA 3P8DA 2KY9A 2E6ZA 1YI2T 4C8QF 2P0KA 1UGSB 4F7UA 3ER0A 4II1A 4PJOB 4P5NA 1YHQT 4L5GA 4PL6A 2RJCA 2PVOB 3CC7A 3GIBA 3E1SA 1WPYA 4ELYC 3CCVT 1YIJA 2CKKA 3M4GA 1LJOA 1P92A 4PJOF 4X9CA 1M90U 1QVGS 2LTOA 3ZBDA 3J7AF 3VKIA 2KK4A 3CEYA 2OTJA 4FSXA 2GQVA 2XKOC 4ME7A 4C5HA 1VQNA 1VQ6T 4IKFA 5FRNA 3FLGA 2QQBA 2XU8A 3OMGA 4A4EA 2LQKA 1U8RA 1VQLA 1I4K1 1S72A 2QEXA 5GANd 4NL3A 3F70A 4LDUA 3OYAA 3L2WA 1XOVA 2IG0A 2BKDN 2RD1A 4M77D 4F7UB 1YJ9A 5D6XA 3J80E 3L1AA 2K4YA 2E6NA 4F7UF 1XNIA 2X4JA 1MGQA 4E7KA 2VXEA 5CKDA 4OB0B 2K5IA 5CIUA 3CCRT 3HRTA 4N4HA 2DXCA 3MHXA 3QKJA 1EIFA 4ZTJA 4M75B 1JRIA 1D3BB 1VQ7A 5CKEA 3C4SA 2V8JA 4QQ6A 3E9GA 4ZN3A 3GPLA 3DKMA 2LT1A 4E7HA 2QQ9A 2LQ8A 2ZPEB 3A5ZB 3CCST 4A54A 5LJ5d 1B34B 2YLBA 3UDCA 2MAMA 3OS2A 1KQ2A 4M7AC 3G6EA 1QP2A 3E19A 2PUOB 2HBPA 4XTXA 4A4KA 2D6FA 4IURA 3CCET 2E65A 1N8RC 2CZ7B 2EIFA 1OZ2A 4M7AG 3BW1A 2EQUA 2X4XA 3NTKA 2MWOA 2LVMA 2ZPGB 3R6OA 1WJRA 3CBPA 4FL6A 4C0FA 1KC8U 2LX9A 3M53A 1Q86C 1JJ2A 2R57A 2RI2A 4O6JA 5CQYA 3SFMA 3MCAB 1Y96A 2GF7A 3QDRB 5GANh 3OW2A 2K2VA 1PSFA 4C92A 4DQ2A 2XDBA 3PIOA 2PVDB 4RCCA 2CYZB 2RB6A 1NPRA 2E1HA 3PT9A 4MMLA 4E7JA 1AHJB 2LNVA 3OYYA 4E7IA 3UPUA 2RHYA 2XI9A 3C12A 3BDUA 3LX7A 2M0OA 4MZPA 3MO8A 2R5MA 1PSEA 4PLIA 3QYHB 3OA6A 5I2SA 4Y91A 4M75D 3VUBA 3JSCA 3JCMQ 4YTLA 1UGRB 1VQ5T 2XIDA 3A8MB 4FM4B 4BDYA 4M7AE 3G7ZA 2MI6A 2IVWA 3LGLA 5GMKi 2EFIA 3DLMA 4MZMA 4M78A 3VYHB 4ZTFA 2XD0A 5LL6S 2A3LA 3QIIA 3SD4A 5LJ5g 5LJ5h 3OSVA 4J6WA 3CCMA 1IZ6A 2RHIA 2VYTA 3H8ZA 3RUXA 5HK0A 3CMAA 4BACA 4HCCA 1VIEA 3V8LA 4C92F 1LOJA 3HP9A 4C92G 3Q1JA 3V8JA 5GAN5 2DIGA 4PKCC 4EMKB 3KBGA 3PNWC 3L2QA 4BD3A 5GANe 3JCMc 5DM7R 1BIBA 3JCMb 4ATOA 3L2VA 4XTZA 5IN1A 2I2LA 4N0AC 4M77A 1VQPA 2X4YA 5FU7B 5KE3A 3JB9F 4ZN1A 1V29B 2RJDA 4BI8B 2VXFA 3CC4A 5LJ3f 3SWNB 1M90C 3OSSC 5GAMf 4IUPA 4OF1A 4JJNK 2F5TX 4M78F 3QSUA 3X28B 1M1KC 4M78G 5A2QE 3I56T 2JZ2A 2VUBA 2ZZDA 3OMCA 2DVEA 2G3RA 2QA4T 2PVGB 2R58A 3RERA 2VV5A 1YBYA 5CKFA 4C92E 1K73U 3OS5A 5LJ5e 3TEEA 4M7DD 2EJGA 3ASKA 3VUZA 2GCXA 2DKGA 2X4WA 3OBWA 5A0GA 5CR2A 4M77B 1G3TA 3CMAT 1GXIE 4C8QC 3ME9A 1VQ9A 3MEWA 4PLLA 4M77F 4ZGEB 2EQKA 3CPWA 5GAOq 3CCUA 2DAQA 3PIPA 2JN0A 3OY9A 1M5Q1 1VQKA 5J3BA 4PJOC 2EJFA 4CRIA 1VQ8A 3JB9I 4C8QG 2LCCA 2K57A 4ELZC 3HRSA 4M78E 4C5IA 3LW5E 3MEAA 3OYJA 4JRPA 3CXCS 3WXMB 2MF2A 2KSSA 3QJYA 5HKCA 2GFUA 4PJOG 1BI3A 3JCMX 2NLUA 2K5FA 4MMKA 2KDSA 3BFMA 4J7FA 3RESA 3LWIA 2BIVA 3OYKA 2MMPA 1VQOT 3JCMW 2HAXA 1WJQA 4B9XA 3VV0A 1BIAA 4JRQA 4DA4A 1O75A 3E9FA 2VGMA 1D3BA 4M75A 5A0DA 4QVDA 1QVFA 1ZBXA 4FT2A 4OB1B 4RCBA 3CMET 2YRVA 1B34A 3CC2A 4R55A 2CZ0B 1R8OB 3JB9J 4X34A 1Q82U 3CD6T 3EFRA 1G3WA 1O9SA 5KH6A 3OYLA 2QQRA 4JLGA 5A0LA 1WNLA 4C8QE 3CCLT 1W2BA 3I55T 1DJ7B 4XK8E 3OS0A 3RMSA 4J8OA 2R5AA 4OGCA 1KQ1A 1K9MC 3V7CA 4F7UG 3A8GB 2XDPA 1N27A 1W4SA 4Q5WA 4PJOE 2RJFA 3MP1A 4IUVA 3JAME 4J5YA 4JUVA 3H6ZA 4N4IA 1Q7YC 1SSFA 3HFNA 2RO0A 2QDYB 3QXEB 3WVDB 3X26B 4BI4A 5GMKl 2EJ9A 3JRZA 1U1TA 3HHTB 2ZCFB 4KUDK 4CI0C 3GNFB 4M75F 4DOVA 4E7LA 3CC7T 3QO3A 3HSBA 3MEUA 2HQEA 1YIJT 4BY6C 4EMGA 1VQMA 1M1GA 5FLXE 3RMQA 4V2SA 3OB9A 3G4SA 4IUQA 2WSFE 2HNIA 2OTJT 2JVVA 3C95A 3G71A 3FDRA 3QUIA 3L2UA 3V7RA 3LH0A 2DTHA 2LC4A 4F7UE 3M56A 1VQLT 1S72T 4M7DA 5GANg 3V7SA 3X20B 2QEXT 1BYMA 5DLOA 2E70A 2LCLA 4JLIA 2OAUA 2DPPB 3C94A 4MZTA 3M55A 3A8HB 1Y7XA 1YJ9T 1K8AC 3VJPA 3CBMA 4KULA 4XTVA 4EMHA 3TU4K 4EMKA 1I5LA 3QBYA 2QTXA 3UWNA 1YJWA 2OTLA 2ZGWA 1YITA 3KUFA 5I21A 3QHSA 2E41A 1UEBA 5GAOp 4BUGA 1QVGA 2LRQA 3CBOA 5EG2A 3EAEA 4RKUE 1OI1A 1VQ7T 3OBYA 1NPPA 3SWNA 2CZ1B 4A4HA 3QPHA 4A4GA 4C92C 3HRUA 4IUUA 4LDYA 5GANf 3JCMJ 3M58A 1M1FA 2ZPBB 3QZ5B 4M7DB 3OYFA 5D6YA 3G6ET 4FU6A 1VQMT 1KQSS 2FHDA 2K3YA 5GAN7 1UGPB 3VYGA 3GLXA 3WVEB 3HPWA 3META 4RG8A 2D0QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XU3 A;  5GAN 3;  2DKG A;  4M77 B;  3RIR A;  5GMK e;  5GAN 2;  1I4K 1;  4M7A B;  4M75 E;  2EAY A;  4C8Q C;  5GAN d;  4NL3 A;  3HFO A;  4HT9 A;  4M77 F;  3RKY A;  1X01 A;  4M7A F;  4J6Y A;  5GAO q;  4M78 C;  3JB9 G;  2DTI A;  2JN0 A;  4NOY A;  1M5Q 1;  2RD1 A;  4M77 D;  4A53 A;  4F7U B;  4HT8 A;  4WF2 A;  2EJF A;  4M7A D;  3L1A A;  5LJ5 f;  1TH7 A;  4PJO C;  3JB9 I;  4M7D C;  4C8Q G;  1HK9 A;  2K57 A;  3BY7 A;  4F7U F;  4M78 E;  1MGQ A;  4J6X A;  2VXE A;  4QVC A;  3EFS A;  4PJO G;  3JCM X;  4M7D F;  1WQW A;  2EWN A;  3JCM d;  3BFM A;  3RES A;  4M75 B;  1JRI A;  1D3B B;  4M7D G;  2YHT A;  4EMK C;  3JCM W;  1BIA A;  1H64 1;  2DEQ A;  1WQ7 A;  2E64 A;  1D3B A;  4M77 C;  1LNX A;  4M75 A;  4A54 A;  4QVD A;  1B34 B;  2YLB A;  5LJ5 d;  1KQ2 A;  4M7A C;  2FB7 A;  4RCB A;  2DTO A;  3INZ A;  1B34 A;  4XTX A;  5GMK m;  3JCM h;  3JB9 J;  2VC8 A;  4N0A A;  1N9R A;  4XTW A;  1HXD A;  5GAN 6;  3SWN C;  1M8V A;  1N9S A;  2E65 A;  2FYK A;  3EFR A;  4M77 G;  3JCM P;  4M7A G;  3BW1 A;  4MMK A;  5LJ3 h;  5LJ3 g;  1U1S A;  1WNL A;  4C8Q E;  5GAM h;  4XU2 A;  5GAM g;  4OP0 A;  1I8F A;  1Y96 B;  2YLC A;  5GAN 8;  4C92 B;  1KQ1 A;  5GAN h;  3V7C A;  1Y96 A;  4F7U G;  3AHU A;  4C92 A;  4DQ2 A;  2DZC A;  4PNO A;  4PJO E;  4RCC A;  2RB6 A;  4J5Y A;  4JUV A;  2E1H A;  2DZ9 A;  4MML A;  5GAO r;  3HFN A;  4M7D E;  4C92 D;  4XQ3 A;  5GMK l;  2RM4 A;  2EJ9 A;  3BDU A;  1U1T A;  4HA8 A;  3JB9 H;  5CAI A;  4M75 F;  3QO3 A;  3HSB A;  5GAO n;  4Y91 A;  4M75 D;  3RKX A;  4EMG A;  4X9D A;  3JCM Q;  3JCM g;  4M77 E;  4C8Q A;  2RA2 A;  3JB9 D;  5GAN 4;  4M78 B;  4M7A E;  4V2S A;  5GMK i;  2HNI A;  4XU1 A;  3FB9 A;  4M78 A;  4NL2 A;  5LJ5 g;  5LJ5 h;  3QUI A;  4J6W A;  3V7R A;  2DTH A;  4PJO A;  1YCY A;  3RUX A;  3VU3 C;  3JCM e;  4F7U E;  5LJ3 j;  4M78 D;  4M7D A;  5GAN g;  3V7S A;  5LJ5 j;  5GAM j;  3V8L A;  5GMK h;  3FIF A;  5LJ3 e;  4C92 F;  4JLI A;  4M75 C;  5GAM e;  1LOJ A;  3L2Z A;  4XTU A;  4C92 G;  5GAN j;  3V8J A;  5GAN 5;  4XU0 A;  4EMK B;  2E10 A;  5GAN e;  4XTV A;  3JCM c;  4EMH A;  1BIB A;  3JCM b;  4XTZ A;  4EMK A;  1I5L A;  2I2L A;  2QTX A;  4N0A C;  3JCM V;  3V8K A;  4M77 A;  2ZGW A;  4M75 G;  4XTY A;  3JCM f;  4M7A A;  4JRK A;  3QHS A;  5I21 A;  3JB9 F;  4C8Q B;  2E41 A;  5GAO m;  3FJP A;  3PGG A;  5GAO p;  2VXF A;  5LJ3 f;  3SWN B;  4C8Q F;  3RKW A;  5GAM f;  4F7U A;  3SWN A;  4PJO B;  2DXU A;  4C92 C;  4M78 F;  4C8Q D;  3GIB A;  3QSU A;  5GAN f;  4M7D B;  3SB2 A;  4M78 G;  3JCM J;  1WPY A;  1I81 A;  2Y90 A;  2CGH A;  1LJO A;  2DVE A;  3M4G A;  4PJO F;  4X9C A;  3RER A;  4JRI A;  2DXT A;  2DJZ A;  1JBM A;  4C92 E;  5GAN 7;  4PJO D;  5LJ5 e;  5DY9 A;  4M7D D;  5LJ3 d;  2EJG A;  5GAO l;  5GMK j;  5GAM d; 
#chains in the Genus database with same CATH topology
 1AWX A;  2CP0 A;  4C0G A;  3D7S B;  5FU7 C;  5FWB A;  4OB3 B;  4HT9 A;  3RKY A;  5J26 A;  4J6Y A;  4QT7 A;  3TSZ A;  4TVR A;  4M7A D;  2O31 A;  3EH1 A;  2J06 A;  4J9I A;  3PFS A;  3S6W A;  1YIT T;  1X6O A;  4QVZ A;  1D09 B;  3X25 B;  4M77 C;  2F5K A;  3TSW A;  1BKB A;  2FZG B;  3INZ A;  2ZPH B;  1D1C A;  4XTW A;  1F1B B;  3OYE A;  2JS2 A;  3I5S A;  4OP0 A;  1FXX A;  1I8F A;  2EKO A;  3I5R A;  5ECA A;  2PNI A;  2RK2 A;  1UTI A;  1NJI U;  4BE0 A;  5GAO r;  2DZ9 A;  3EG9 B;  5FRO A;  4C92 D;  4GLK A;  4Y28 E;  5D6W A;  2DD4 A;  1JJ2 S;  2X35 A;  2JNG A;  3PVQ A;  3CCR A;  5KCO A;  3KXT A;  1QP3 A;  2DL7 A;  4XU1 A;  4EDU A;  3OW2 P;  1NYF A;  1YCY A;  2KMT A;  5KYX B;  3JCM e;  3OYB A;  4M78 D;  5LJ5 j;  5GAM j;  1SHF A;  1VUB A;  1T0J A;  2P84 A;  4KH0 B;  1IHW A;  4XAX B;  2EYY A;  2I0N A;  1G3Y A;  3OYG A;  1WJS A;  3PGG A;  3M0U A;  1X75 C;  2JOY A;  3M9Q A;  3DB4 A;  1IB8 A;  2COW A;  3GNG A;  4B9W A;  2CGH A;  1YI2 Q;  2KVQ G;  4JRI A;  2Y4Y A;  1YHQ Q;  2MYS A;  1G5V A;  4RTW A;  3T9N A;  2DLP A;  5GAN 3;  2KRN A;  4M7A B;  1K9A A;  2CH4 A;  2EYQ A;  2OI3 A;  3QYG B;  4HVV A;  4M7A F;  1BBZ A;  2GQI A;  2JS0 A;  1RAB B;  2VVK A;  1FMW A;  3CD6 Q;  1W70 A;  3SDZ A;  1Q81 R;  3M4Y A;  2ESW A;  3QWX X;  1KG1 A;  1D0Y A;  1RAD B;  4Z8A A;  1WDX A;  2H8H A;  3MPU B;  2M16 A;  2B8A A;  4M7D G;  2F69 A;  4LE9 A;  1M3A A;  3ZL7 C;  2FB7 A;  3CPW P;  1CKB A;  1CSK A;  4ZGJ B;  2QA4 A;  1Q7Y U;  1OX9 A;  1JU5 C;  3FEO A;  2CT4 A;  5LJ3 g;  2EGA A;  3PMI A;  5GAM h;  1WGS A;  4C92 B;  2DFU A;  1N8R U;  4M7D E;  2QQS A;  4RUG A;  4NS5 A;  1RI0 A;  2CP7 A;  3THK A;  3M54 A;  1UHF A;  1AZG B;  2RK1 A;  3EFO A;  4OML A;  1Y07 A;  4M78 B;  4Z88 A;  1WHH A;  2QG9 B;  1BB9 A;  2RF0 A;  1VQ5 Q;  4PJO A;  1KHI A;  1ZQ1 A;  3EHR A;  3MP6 A;  3FIF A;  5LJ3 e;  4HCZ A;  2L2P A;  3CCL A;  4UC4 A;  3I55 A;  4OGE A;  4IUT A;  2DBM A;  2HL3 A;  3V8K A;  1XTD A;  3JCM f;  1YI2 T;  4FCY A;  2J7I A;  4P5N A;  1YHQ T;  4PL6 A;  2YUQ A;  3CCV T;  2AK5 A;  2CKK A;  1LJO A;  1P92 A;  1WXB A;  5KYY A;  2O88 A;  2KK4 A;  3I56 Q;  2GQV A;  4ME7 A;  1Y57 A;  1C6V X;  1PHT A;  2LQK A;  5KYW B;  1BCO A;  2QEX A;  1QVG P;  1WIE A;  2ECZ A;  2IPO B;  3F70 A;  3L2W A;  3CCM Q;  1NYG A;  4M77 D;  1YJ9 A;  3J80 E;  2MOX A;  1E7O A;  2X4J A;  4FW2 A;  3SHW A;  2P4R A;  1R77 A;  4F14 A;  1ZUU A;  4ZTJ A;  5CKE A;  4QQ6 A;  2LT1 A;  3CCS T;  2KE9 A;  2YLB A;  4J9C A;  2D0N A;  1Q95 G;  4OMQ A;  2JTE A;  4HXJ A;  1K9M R;  2D8H A;  4RTX A;  1RAH B;  4M7A G;  3NTK A;  2DMO A;  4E6R A;  4JJD A;  1YP5 A;  3M53 A;  2R57 A;  4PFP A;  1H92 A;  1Y96 A;  5KYN A;  4DQ2 A;  2KBT A;  4FYY B;  2CYZ B;  2RB6 A;  2E1H A;  3PVL A;  2RHY A;  2XI9 A;  3BDU A;  1ZSZ C;  2BZX A;  1VQK Q;  4PLI A;  2CP5 A;  2LNH B;  5I2S A;  3VUB A;  2LQN A;  1VQ5 T;  2DRK A;  2XID A;  3A8M B;  4FM4 B;  4BDY A;  4M7A E;  3G7Z A;  1GL5 A;  2EFI A;  4MZM A;  2G6F X;  3VYH B;  2JMA A;  5LL6 S;  5LJ5 g;  1PRM C;  4J6W A;  4PFZ A;  1SRM A;  4C92 G;  3Q1J A;  3V8J A;  2DIG A;  2O2O A;  4PKC C;  2ATC B;  2O9V A;  4EMK B;  1VQL Q;  2HMA A;  3KBG A;  1KQS P;  2H3E B;  5IN1 A;  1NLP C;  4CC4 B;  5FU7 B;  5KE3 A;  3JB9 F;  5LJ3 f;  3O5Z A;  2F5T X;  4GLM A;  4M78 G;  3I56 T;  2DVE A;  1VQ7 Q;  1I0C A;  1PD1 A;  4C92 E;  4J9G A;  5LJ5 e;  1ZBJ A;  4JJC A;  3ASK A;  3G6E Q;  1M90 R;  2X4W A;  5A0G A;  4M77 B;  2QGF B;  3M0Q A;  4M77 F;  2CDT A;  2JM8 A;  2RN8 A;  1YN8 A;  1M5Q 1;  1TTH B;  4CRI A;  2LJ1 A;  3AT1 B;  4M78 E;  2DJQ A;  1WX6 A;  2KXD A;  5GJV B;  3WXM B;  2MF2 A;  3QJY A;  3EGX A;  2K5F A;  3OYK A;  2MMP A;  4B9X A;  2OTL Q;  2VGM A;  1D3B A;  1QVF A;  5I22 A;  1D0Z A;  2EGC A;  1Z9Q A;  4RCB A;  2JT4 A;  1B34 A;  2CZ0 B;  4X34 A;  2XMF A;  2DNU A;  1DJ7 B;  3OS0 A;  4OGC A;  1G8X A;  2XDP A;  1W4S A;  4Q5W A;  4PFO A;  1KC8 R;  4J5Y A;  4N4I A;  1SSF A;  2LJ0 A;  3QXE B;  2PTK A;  3HFN A;  3WVD B;  2EYW A;  4BI4 A;  5GMK l;  3JRZ A;  2FG0 A;  1WXT A;  2EGE A;  4Y92 A;  1UHC A;  1YIJ T;  2DYI A;  4EMG A;  3RMQ A;  1W6X A;  2NUT A;  4ORZ A;  2YSQ A;  2RQW A;  4DBQ A;  3C95 A;  2VAS A;  1UE9 A;  1QWE A;  1GFC A;  1IGQ A;  1VQL T;  1QCF A;  4M7D A;  3V7S A;  5DLO A;  2LCL A;  4JLI A;  3C94 A;  3JV3 A;  3CBM A;  1VQ9 Q;  1I5L A;  3UWN A;  2ZGW A;  3QHS A;  2E41 A;  4ESR A;  3EAE A;  1VQ7 T;  3OBY A;  3SWN A;  2CZ1 B;  4C92 C;  3JCM J;  3QZ5 B;  3G6E T;  1TUG B;  1KQS S;  1WA7 A;  1IRX A;  1WHK A;  3GLX A;  3WVE B;  4RG8 A;  1B7T A;  2WSE E;  3EG1 A;  3VRY A;  2RI3 A;  2EAY A;  1K73 R;  3HFO A;  2C06 A;  4F04 B;  2O4X B;  1OV3 A;  4M78 C;  3JB9 G;  2P0P A;  1IO6 A;  5KCH A;  5LJ5 f;  1NE8 A;  3CCE Q;  1ZUK A;  1MHN A;  1PC0 A;  1CKA A;  1T0H A;  2NUP A;  1YJN A;  3EFS A;  1YI2 A;  4R0K A;  2CZ6 B;  4J9E A;  3S3N A;  3EG9 A;  2RHZ A;  2E64 A;  2QDL A;  1YHQ A;  3N5B B;  3CCV A;  2MCN A;  3FC3 A;  1X2Q A;  1K4U S;  3S3O A;  5FRM A;  5GMK m;  3JCM h;  1N9R A;  1ZHI A;  1M9S A;  4M77 G;  1HD3 A;  2O01 E;  2LP5 A;  3H0F A;  1KD1 U;  2QGG A;  1JB0 E;  1KSW A;  1H8K A;  2KQW A;  1Q82 R;  3UT1 A;  5KYX A;  3AHU A;  1D1A A;  4PNO A;  1S1N A;  2L3R A;  2V8I A;  5I2M A;  2HSP A;  3CC4 T;  1K0S A;  1M8M A;  1YJW Q;  1OPL A;  4HA8 A;  5L8R E;  3REB B;  1K0X A;  4FW1 A;  1TOV A;  1XQH A;  4M77 E;  4PJJ A;  2Y4X A;  5GAN 4;  3FRN A;  4QQG A;  1JJ2 P;  2M1H A;  3CCS A;  2W0Z A;  2F2X A;  3RNJ A;  2PUK B;  3M5A A;  2BZY A;  4OVA A;  1K76 A;  5LJ3 j;  2AHJ B;  2LCS A;  2C0I A;  4E7Z A;  2P0Q A;  1VQ9 T;  1BCM A;  4O5V A;  3CCU T;  4MDW A;  2ENM A;  3CPF A;  2RNA A;  3ZFJ A;  5DLQ E;  1OU8 A;  3S3M A;  3NFC A;  2D1X A;  4M7A A;  1MND A;  1TU0 B;  2O9S A;  4PJL A;  3UF4 A;  3URG A;  2P4T A;  2ED0 A;  1GCQ A;  2A7Y A;  5C0M A;  2Y90 A;  4ZGD B;  3CC2 T;  1VQ5 A;  1RL2 A;  5CKH A;  2DE0 X;  2FPF A;  3VS0 A;  3LYI A;  1Q81 C;  3OYH A;  1IGU A;  5GAM d;  4J83 A;  5GMK e;  1VQO Q;  4R56 A;  2E3I A;  3UA7 A;  3RR6 A;  2M9U A;  4JPB W;  4NOY A;  2WSC E;  1QCO A;  2HD0 A;  5HK3 A;  1HK9 A;  2MWP A;  3OS1 A;  4FYW B;  2LZ6 B;  4KBM B;  4QVC A;  3PTA A;  4M7D F;  1YCS B;  3CCJ A;  1KJW A;  4QW2 A;  4EMK C;  3EGU A;  3VS2 A;  1LNX A;  3G71 T;  1ZSZ B;  3I56 A;  1UB4 A;  5HY6 A;  1WHL A;  4N0A A;  1X6G A;  2L8D A;  2RJE A;  3JCM P;  3QG1 A;  5LJ3 h;  1QVF S;  2K5L A;  2YLC A;  4C5G A;  2DK3 A;  3GOX A;  4GBQ A;  2OTJ Q;  1YJW T;  2FRW A;  1AT1 B;  3A8O B;  4F17 A;  2PU9 B;  2KYB A;  3OYC A;  1NJI R;  4KUI A;  1M2V B;  3TCJ A;  3JCM g;  2RA2 A;  4LUE A;  1BI2 A;  4RTV A;  1VOM A;  3QDF A;  1OUL A;  2DL5 A;  1FWZ A;  5FU6 B;  1AWO A;  4LDW A;  2XHC A;  3DLL A;  3L2Z A;  1RUW A;  3O8V A;  2RQV A;  2PQW A;  1C1A A;  4JRK A;  1WHJ A;  2GNC A;  2JTF A;  4Z89 A;  1BU1 A;  2KY9 A;  2E6Z A;  2JXB A;  2MPX C;  3ER0 A;  1WI7 A;  2YWW A;  4L5G A;  2RJC A;  3GIB A;  1N5Z A;  2YDL A;  4ELY C;  3M0S A;  3H9N A;  1YIJ A;  4CC3 A;  2KT1 A;  1X27 A;  4RTZ A;  2DX1 A;  1ABO A;  1PKT A;  2QQB A;  2XU8 A;  1U8R A;  1VQL A;  1I4K 1;  1PNJ A;  4IIO A;  2EW3 A;  2X3X D;  2RD1 A;  5AT1 B;  4F7U B;  3CMA Q;  5IXB A;  1MV3 A;  2E6N A;  1OQK A;  4F7U F;  4RTU A;  4E7K A;  4HCK A;  4OB0 B;  2K5I A;  5CIU A;  3HRT A;  2AKL A;  4M75 B;  1JRI A;  1VQ7 A;  2L3P A;  2ZAE A;  1ABQ A;  3E9G A;  3CQT A;  2HKQ B;  4E7H A;  3A5Z B;  1KQ2 A;  1PG5 B;  3UDC A;  3G6E A;  9ATC B;  1QP2 A;  4A4K A;  2NWM A;  2EIF A;  3CME Q;  2CSQ A;  3R6O A;  1RAA B;  1Q7Y R;  2EYX A;  1Q86 C;  2RI2 A;  4O6J A;  5CQY A;  1PSF A;  3PIO A;  4RCC A;  3PT9 A;  2LNV A;  2M02 A;  3UPU A;  4MZP A;  4RTY A;  1N8R R;  1LPL A;  3OA6 A;  4Y91 A;  3JCM Q;  3LGL A;  5GMK i;  3CC7 Q;  3DLM A;  5LJ5 h;  3QII A;  3OSV A;  1IZ6 A;  3H8Z A;  5HK0 A;  1OOT A;  4C92 F;  1OPK A;  1S72 Q;  3PNW C;  4BD3 A;  5GAN e;  3JCM c;  3L2V A;  4M77 A;  4ZN1 A;  1V29 B;  4BI8 B;  3CC4 A;  1VYV A;  3R6N A;  1M90 C;  2EYZ A;  1EZZ B;  4IUP A;  2DL4 A;  4M78 F;  1M1K C;  2OJ2 A;  3I35 A;  2JZ2 A;  1SHG A;  1H3H A;  2FZC B;  2PVG B;  1GBR A;  1ZX6 A;  1VQM Q;  1SG5 A;  1AOJ A;  1G3T A;  3G4S Q;  3CMA T;  4C8Q C;  3ME9 A;  1VQ9 A;  5GAO q;  3CCU A;  2DAQ A;  2HZY A;  5J3B A;  3EGD A;  2L0A A;  2K57 A;  4ELZ C;  1KIK A;  4JZ4 A;  3LW5 E;  3OYJ A;  2KSS A;  1KK7 A;  4HVU A;  2GFU A;  4J7F A;  2L3Q A;  1OEB A;  1WJQ A;  4DA4 A;  7AT1 B;  1I1J A;  2OAW A;  1ZBX A;  3CME T;  3CC2 A;  4R55 A;  3CD6 T;  3EFR A;  2CUD A;  3EG2 A;  5KH6 A;  2JJ9 A;  2QQR A;  5A0L A;  1WNL A;  1W2B A;  2ABL A;  4K11 A;  3RMS A;  2R5A A;  3V7C A;  4F7U G;  4KGX B;  2RJF A;  2F2V A;  1W1F A;  2EJ9 A;  1U1T A;  3HHT B;  4KRT A;  2ZCF B;  1VQP Q;  2DL3 A;  4CI0 C;  3GNF B;  4E7L A;  3RBB B;  3CC7 T;  3IQL A;  3FJ5 A;  2DYB A;  1M1G A;  4LNP A;  5FLX E;  2V26 A;  3OB9 A;  4IUQ A;  2HNI A;  3G71 A;  3FDR A;  3QUI A;  2DTH A;  4F7U E;  1S72 T;  5GJW B;  1SEM A;  2OAU A;  1WHM A;  1SF9 A;  3A8H B;  1K8A C;  1C0M A;  2SEM A;  3M0T A;  4XTV A;  2CRE A;  2QTX A;  4OMP A;  3VS1 A;  1YJW A;  1YIT A;  1TS9 A;  1UEB A;  1NEG A;  4BUG A;  5GAO p;  1NPP A;  4A4G A;  2AKK A;  3HRU A;  4IUU A;  5GAN f;  1A0N B;  1R0B G;  1RAE B;  1VQM T;  1UGP B;  3VYG A;  3MET A;  2GGR A;  1EFN A;  5GMK j;  2QAS A;  2HSE B;  3LWH A;  2DM1 A;  4RG2 A;  2L3S A;  2DTI A;  5KE2 A;  1AWJ A;  5IHI A;  3A98 A;  4JS4 A;  1TH7 A;  4FT4 A;  2X3W D;  4GY5 A;  5FU6 C;  4LXC A;  2DXB A;  1BI1 A;  5AYF A;  2XDD A;  1MMG A;  5CO7 A;  1Q86 U;  1X69 A;  3J81 E;  2YHT A;  4E47 A;  1H64 1;  1Y71 A;  1WQ7 A;  2DEQ A;  2EBP A;  2L5Q A;  3CCM T;  2DTO A;  2M0Y A;  1W2B P;  1N9S A;  4DOW A;  3MP8 A;  4LN2 A;  1JXO A;  2HQX A;  5IAY A;  5IHN A;  1QVP A;  1GRI A;  2LDM A;  1VQP T;  1MMD A;  8AT1 B;  1VIF A;  3C0C A;  1AVZ C;  2KYM A;  2HDA A;  4XQ3 A;  1PM3 A;  2GTO A;  2GTJ A;  3EFO B;  3EG3 A;  1VA7 A;  5GAO n;  3LGF A;  3M57 A;  3X24 B;  2EQM A;  3ULR B;  2AT1 B;  4OMN A;  1KHC A;  1VYT A;  3FB9 A;  1M4Z A;  2FZK B;  2QYZ A;  1G2B A;  5CKB A;  3L2R A;  2CSI A;  5CQX A;  1JQQ A;  5GMK h;  3A1P A;  2H3J A;  4M75 C;  2FL7 A;  4Z02 A;  1VQK T;  2QA4 Q;  1M1K U;  1TUC A;  1Z9Z A;  2QQA A;  3CCQ Q;  1Y0M A;  2QK0 A;  4EPC A;  2LJ3 A;  4E7S A;  2KAF A;  1VQ4 Q;  3RKW A;  1NM7 A;  3P8H A;  1JO8 A;  4QQD A;  1UGQ B;  4C8Q D;  3GP8 A;  3SB2 A;  3OYN A;  4LDX A;  1I81 A;  5KYU B;  2QI2 A;  2DJZ A;  5D7U A;  2C0T A;  1G3S A;  1YWP A;  2V8K A;  1NZ9 A;  4J7I A;  2A28 A;  5LJ3 d;  4XU3 A;  2QXF A;  4JDS A;  3RIR A;  2AZV A;  2RHU A;  2Z0W A;  2A08 A;  2K3X A;  1ZSZ A;  3CXC A;  1PWT A;  1UUE A;  2CP6 A;  4BY6 B;  1VQ6 Q;  1UDL A;  2XK0 A;  2K3B A;  4FYV B;  4HT8 A;  1YWO A;  3BY7 A;  3LLR A;  3CCL Q;  5IT9 E;  3OYD A;  2K2M A;  2KRO A;  1FMK A;  4X1V A;  2XG8 D;  4AG2 C;  4A4F A;  5GAN 2;  1LCK A;  4BE2 A;  1SRL A;  4BI3 A;  3OYM A;  1M2V A;  2VC8 A;  1HXD A;  3TVT A;  1RI9 A;  2XIC A;  1NJI C;  4OMM A;  3HTR A;  2LT4 A;  3M0R A;  1Y96 B;  2E3H A;  4C5E A;  1RAG B;  2OTL T;  1KD1 R;  4BB7 A;  1FYN A;  2A36 A;  4BE1 A;  1QVF P;  1OYX A;  3MEV A;  1ZSG A;  3QZ9 B;  2QEX Q;  2RM4 A;  1W2B S;  4FSS A;  4D6W A;  4C0D C;  4ANJ A;  4KT0 E;  3NMZ C;  3REA B;  2D9T A;  1M2O A;  1K8A U;  4AFQ C;  2E12 A;  5M9O A;  4BDZ A;  2HKN A;  3CME A;  2RH2 A;  4HVW A;  2BE9 B;  4L59 A;  3CD6 A;  3VRZ A;  3CCQ T;  4OB2 B;  5GAN j;  1RLP C;  4XU0 A;  4JS5 A;  4FIB A;  4CC7 A;  1VQ4 T;  3VS3 A;  3DB3 A;  2OX7 A;  2RQU A;  4C8Q B;  2LX7 A;  4C8Q F;  2P0K A;  3NHN A;  4D8D A;  4F7U A;  4II1 A;  4WCI A;  3CC7 A;  1G83 A;  3E1S A;  3M4G A;  3MKD A;  1SSH A;  3SEM A;  3VKI A;  3CEY A;  2XKO C;  1VQN A;  1VQ6 T;  4IKF A;  1QWF A;  5FRN A;  4FYX B;  1SPK A;  2GBQ A;  2VB6 A;  4A4E A;  1QLY A;  1S72 A;  4NL3 A;  2DIL A;  4LDU A;  3OYA A;  2DEU A;  1XOV A;  2IG0 A;  2BZ8 A;  3UAT A;  2BKD N;  3M0P A;  3L1A A;  2K4Y A;  2EVR A;  1XNI A;  1MGQ A;  2VXE A;  3EGX B;  3MHX A;  1QQJ A;  1EIF A;  1D3B B;  3C4S A;  3GPL A;  3DKM A;  2LQ8 A;  2ZPE B;  4A54 A;  5LJ5 d;  1B34 B;  1WYX A;  1ZA1 B;  5IXF A;  2D8J A;  3E19 A;  2PUO B;  1I07 A;  2HBP A;  4XTX A;  4PJN A;  2V1R A;  3QWY A;  3CCE T;  2F1L A;  3U23 A;  2E65 A;  4AFS C;  1N8R C;  2CZ7 B;  1OZ2 A;  3BW1 A;  2EQU A;  2X4X A;  2MWO A;  2LVM A;  2ZPG B;  1WJR A;  3CBP A;  1JEG A;  1SKU B;  1HJD A;  1AZE A;  3SFM A;  5GAN h;  3MCA B;  3OW2 A;  3QDR B;  4C92 A;  2QTV A;  2XDB A;  2PVD B;  1PD0 A;  2KXC A;  2EQI A;  4E7J A;  4E7I A;  3OYY A;  1PRL C;  3LX7 A;  2NUZ A;  2C0O A;  3H41 A;  2R5M A;  4M75 D;  3JSC A;  4YTL A;  2IVW A;  3TQ7 P;  4M78 A;  4ZTF A;  2XD0 A;  2A3L A;  3SD4 A;  3EHQ A;  3CCM A;  1IXD A;  2RHI A;  2VYT A;  4BAC A;  1VIE A;  2YXY A;  1MNE A;  1U5S A;  3HP9 A;  5GAN 5;  2AIR B;  1LVK A;  3L2Q A;  2FO0 A;  5DM7 R;  1BIB A;  3JCM b;  4ATO A;  1VQP A;  2X4Y A;  2COY A;  2KGT A;  2V1Q A;  3SWN B;  3OSS C;  4OF1 A;  4JJN K;  4RTT A;  3QSU A;  3X28 B;  2ZZD A;  1TG0 A;  2G3R A;  2JM9 A;  1YBY A;  3PE0 A;  3TEE A;  1GCP A;  2DKG A;  3BE3 A;  3OBW A;  1GXI E;  4IIM A;  1TWB A;  3MEW A;  5KYW A;  3CPW A;  4M4Z A;  3PIP A;  2JN0 A;  3OY9 A;  1VQK A;  4PJO C;  2EJF A;  3JB9 I;  4C8Q G;  1TXQ A;  2LCC A;  4WTO B;  2RPN A;  2VWF A;  3HRS A;  4C5I A;  2NUP B;  4JRP A;  3CXC S;  3UA6 A;  5FW9 A;  5HKC A;  1BI3 A;  3LWI A;  2KDS A;  3RES A;  2BIV A;  1VQO T;  3JCM W;  3VV0 A;  3E9F A;  4FT2 A;  1R8O B;  3JB9 J;  1O9S A;  3OYL A;  1OX8 A;  1QKW A;  4JLG A;  4C8Q E;  4J8O A;  1KQ1 A;  1K9M C;  2J05 A;  3JAM E;  3H6Z A;  4KH1 B;  2RO0 A;  2QDY B;  4M75 F;  3QO3 A;  3HSB A;  3MEU A;  4BY6 C;  1AWW A;  1KFZ A;  1GFD A;  2OTJ T;  1YFN A;  1YJN Q;  2HQH A;  1NLO C;  2LC4 A;  3EG0 A;  1BYM A;  5GAN g;  3E2U A;  1FMV A;  2BTT A;  2E70 A;  2DPP B;  4MZT A;  2ROT A;  3G1J A;  3CCV Q;  1Y7X A;  1IHV A;  1UG1 A;  4EMH A;  3TU4 K;  4EMK A;  4KGZ B;  2OTL A;  1VQ8 Q;  1QVG A;  2YUN A;  3CBO A;  4RKU E;  1OI1 A;  4A4H A;  3QPH A;  4PK4 A;  1M1F A;  2ZPB B;  3OYF A;  5D6Y A;  1ARK A;  4FU6 A;  1VYU A;  2K3Y A;  2MIO A;  3A8L B;  2YUP A;  2K79 A;  4LDV A;  1X01 A;  3CCS Q;  2L89 A;  4VUB A;  1Q81 U;  3CCQ A;  2ZPI B;  1VQ4 A;  3EH2 A;  2DF6 A;  4RMO A;  4KGV B;  1M3C A;  3HL8 A;  1WXU A;  1RAF B;  1MUZ A;  1WQW A;  2EWN A;  5J39 A;  4OMO A;  3MJX A;  5CVI A;  2DL8 A;  1QW1 A;  4C0D B;  2RMO A;  3OQ5 A;  1B07 A;  3GF5 A;  1JXM A;  1M8V A;  2FYK A;  1J3T A;  1TSF A;  2J6F A;  1VQ6 A;  4XU2 A;  2ZPF B;  2DZC A;  3L42 A;  4AFZ C;  2HL5 C;  4ZNX A;  3NTI A;  3JB9 H;  5CAI A;  2AZS A;  3OW2 S;  2B86 A;  3P8B B;  5CCA A;  1KC8 C;  1KQS A;  1YJN T;  1FX7 A;  1WFW A;  5IHK A;  3JB9 D;  3QJ6 A;  1NEB A;  3KFV A;  1M30 A;  4DBF A;  4NL2 A;  4MDX A;  4LD6 A;  2CP3 A;  1E6G A;  3CCJ Q;  4LD9 K;  3M59 A;  3TRE A;  4C0Z A;  2DBK A;  5KYU A;  3CCE A;  1VQN Q;  1M3B A;  2FPD A;  2RI5 A;  2E10 A;  1VQ8 T;  2DO3 A;  3JCM V;  4M75 G;  4DEY A;  4XTY A;  2JUF A;  1N6A A;  3FJP A;  2GFA A;  1OZ3 A;  4QKU A;  2K7A A;  1D0X A;  2DXU A;  4J9F A;  1IRE B;  1RLQ C;  2F2W A;  2JTM A;  5I11 A;  2DXT A;  1JBM A;  4PJO D;  1WLP B;  5DY9 A;  2DD5 A;  5GAO l;  1H3Z A;  2FRY A;  1YNZ A;  4M75 E;  2VKN A;  3BDL A;  2WAC A;  1AD5 A;  2O4X A;  4A53 A;  4WF2 A;  5C6S A;  1ZLM A;  4M7D C;  2VGN A;  4J9B A;  4D8K A;  1K73 C;  2COZ A;  2JW4 A;  2CH4 W;  2KRS A;  4J6X A;  2JMC A;  3PMT A;  3CPW S;  2NYS A;  1GBQ A;  3JCM d;  2BUD A;  4B6M A;  3G4S T;  1K9M U;  3CCR Q;  2EQJ A;  1KD1 C;  1Q86 R;  2RQR A;  2X9H A;  2DET A;  3NTH A;  5GAN 6;  1BK2 A;  3SWN C;  3VS7 A;  3LH5 A;  1YIJ Q;  1U1S A;  1R0C B;  5GAM g;  5GAN 8;  1E6H A;  4HKE A;  1RAI B;  2RHX A;  2KR3 A;  2FVU A;  5IH2 A;  1D1B A;  1QMC A;  1Q82 C;  2E5Q A;  1UJY A;  2HCK A;  3ZEH A;  2CS7 A;  4L6V 5;  1HSQ A;  3RKX A;  4X9D A;  2FEI A;  4C8Q A;  4HCB A;  3CCJ T;  1VQO A;  3HKS A;  1VQN T;  3VU3 C;  4AFU C;  5CK9 A;  2KEA A;  1UFF A;  2DIQ A;  4N4G A;  5GAM e;  4XTU A;  2CT3 A;  1AEY A;  3OYI A;  4OMF B;  1BI0 A;  2A37 A;  4LUD A;  4AG1 C;  2YUO A;  1M1K R;  1U3O A;  5GAO m;  3P8D A;  3VS5 A;  1V1C A;  1UGS B;  3VS4 A;  4PJO B;  2PVO B;  1MMN A;  2W10 A;  1WPY A;  1PCX A;  4PJO F;  4JZ3 A;  4X9C A;  1M90 U;  1QVG S;  2LTO A;  3ZBD A;  3J7A F;  5FWC A;  2OTJ A;  4FSX A;  4C5H A;  2KT8 A;  4F16 A;  3FLG A;  3OMG A;  5GAN d;  4PJM A;  3EGD B;  2HBW A;  5D6X A;  1V76 A;  5CKD A;  2DVJ A;  3CCR T;  1MV0 B;  1OU9 A;  5KYY B;  4N4H A;  2DXC A;  3QKJ A;  3H0I A;  2E4H A;  2ED1 A;  4DBH A;  2EPD A;  6AT1 B;  2V8J A;  4ZN3 A;  2QQ9 A;  4M7A C;  3OS2 A;  2MAM A;  3CC4 Q;  1X43 A;  1UGV A;  2E5K A;  2D6F A;  4IUR A;  1GCQ C;  2YT6 A;  4FL6 A;  4MMK A;  4E2F B;  4C0F A;  1KC8 U;  2LX9 A;  3VS6 A;  1JJ2 A;  1I5O B;  2GF7 A;  4J9H A;  2K2V A;  1XJW B;  3I55 Q;  1NPR A;  2BE7 D;  4MML A;  1AHJ B;  1PKS A;  3C12 A;  3H0H A;  2YRC A;  2M0O A;  3MO8 A;  1NBE B;  3CCU Q;  1PSE A;  3QYH B;  1UGR B;  5HCK A;  2MI6 A;  1WHG A;  4DBR A;  2SRC A;  1K8A R;  3RUX A;  4HCC A;  2DA9 A;  3CMA A;  3V8L A;  1LOJ A;  1EX4 A;  3CC2 Q;  4XTZ A;  2I2L A;  3NPF A;  4N0A C;  1RAC B;  1X2K A;  1YJ9 Q;  2RJD A;  2VXF A;  1QCN A;  1TUD A;  4CC2 A;  1UEC A;  5GAM f;  2IIM A;  2YRD A;  3I9Q A;  5A2Q E;  2MK5 A;  2VUB A;  3OMC A;  3RDV A;  2QA4 T;  2KNB B;  2R58 A;  3RER A;  2VV5 A;  5CKF A;  1K73 U;  3OS5 A;  4M7D D;  2EJG A;  3VUZ A;  2GCX A;  1ZUY A;  2EKH A;  4AT1 B;  1U06 A;  5CR2 A;  2ROL A;  2DRM A;  4PLL A;  4ZGE B;  3G71 Q;  2EQK A;  8ATC B;  2J6O A;  1VQ8 A;  3MEA A;  4AMC A;  1HYO A;  2J6K A;  4DEX A;  4PJO G;  3JCM X;  2NLU A;  3BFM A;  1K1Z A;  2HAX A;  1BIA A;  4JRQ A;  1YIT Q;  1O75 A;  4M75 A;  5A0D A;  4QVD A;  3CXC P;  4OB1 B;  2PZ1 A;  3NGP A;  2YRV A;  2QAZ A;  1B3Q A;  1Q82 U;  1G3W A;  3CCL T;  2K9G A;  3I55 T;  1T3S A;  4XK8 E;  2K6D A;  4J9D A;  1ZA2 B;  3A8G B;  1N27 A;  3GBQ A;  2X51 A;  5EC7 A;  4PJO E;  3MP1 A;  4IUV A;  2CP2 A;  4JUV A;  1Q7Y C;  3X26 B;  1X6B A;  5L23 A;  2FPE A;  4A63 B;  4KUD K;  4DOV A;  2HQE A;  2M51 A;  1VQM A;  2HEQ A;  2LQW A;  4V2S A;  3G4S A;  2WSF E;  4EIK A;  2JVV A;  3L2U A;  3V7R A;  3LH0 A;  3M56 A;  1NG2 A;  2QEX T;  3X20 B;  2A0F B;  3M55 A;  1YJ9 T;  3VJP A;  4KUL A;  2KRM A;  1UJ0 A;  3QBY A;  1ACM B;  1QKX A;  3KUF A;  5I21 A;  2CUB A;  1MMA A;  2NUT B;  2LRQ A;  5EG2 A;  1M27 C;  4JJB A;  2DER A;  2LMJ A;  2KI7 A;  2RQT A;  4LDY A;  4M7D B;  3M58 A;  2FHD A;  1WZO A;  1T3L A;  5GAN 7;  3HPW A;  2D0Q B; 
#chains in the Genus database with same CATH homology
 3A8L B;  2WSE E;  4C0G A;  2RI3 A;  5FU7 C;  2EAY A;  3LWH A;  3HFO A;  4LDV A;  2C06 A;  4OB3 B;  4HT9 A;  3RKY A;  1X01 A;  2O4X B;  2L89 A;  5J26 A;  4J6Y A;  4VUB A;  4M78 C;  4RG2 A;  3JB9 G;  2DTI A;  5KE2 A;  3CCQ A;  1Q81 U;  2P0P A;  4TVR A;  4JS4 A;  2ZPI B;  5KCH A;  4M7A D;  5LJ5 f;  1TH7 A;  4FT4 A;  1NE8 A;  4GY5 A;  5FU6 C;  1VQ4 A;  2DXB A;  4RMO A;  1MHN A;  3PFS A;  3S6W A;  1BI1 A;  5AYF A;  3HL8 A;  2XDD A;  1X6O A;  1YIT T;  1YJN A;  3EFS A;  4QVZ A;  1WQW A;  2EWN A;  5CO7 A;  1YI2 A;  1Q86 U;  3J81 E;  5J39 A;  2YHT A;  2CZ6 B;  3S3N A;  4E47 A;  3X25 B;  1H64 1;  1Y71 A;  2RHZ A;  1WQ7 A;  2DEQ A;  2E64 A;  4M77 C;  2F5K A;  1YHQ A;  5CVI A;  3N5B B;  2L5Q A;  1BKB A;  3CCM T;  3CCV A;  1QW1 A;  3FC3 A;  2DTO A;  4C0D B;  3INZ A;  3S3O A;  5FRM A;  2ZPH B;  3OQ5 A;  5GMK m;  3GF5 A;  3JCM h;  1N9R A;  4XTW A;  1ZHI A;  1M8V A;  1M9S A;  1N9S A;  2FYK A;  4M77 G;  4DOW A;  3MP8 A;  2O01 E;  1VQ6 A;  1KD1 U;  4XU2 A;  3OYE A;  4OP0 A;  1FXX A;  1JB0 E;  1I8F A;  2EKO A;  2HQX A;  2KQW A;  2ZPF B;  5IAY A;  3UT1 A;  1QVP A;  3AHU A;  2RK2 A;  2LDM A;  1VQP T;  2DZC A;  3L42 A;  4PNO A;  1NJI U;  2L3R A;  2V8I A;  1VIF A;  4BE0 A;  5I2M A;  5GAO r;  2DZ9 A;  3CC4 T;  5FRO A;  4C92 D;  4XQ3 A;  4GLK A;  3NTI A;  4HA8 A;  4Y28 E;  3JB9 H;  5D6W A;  5CAI A;  2DD4 A;  1JJ2 S;  2X35 A;  5L8R E;  3OW2 S;  2JNG A;  3P8B B;  3CCR A;  5CCA A;  5KCO A;  1KC8 C;  5GAO n;  1KQS A;  3LGF A;  3M57 A;  1FX7 A;  3X24 B;  1YJN T;  1XQH A;  2EQM A;  4M77 E;  3QJ6 A;  3JB9 D;  2Y4X A;  5GAN 4;  1QP3 A;  3FRN A;  4QQG A;  3KXT A;  1KHC A;  4XU1 A;  4EDU A;  2M1H A;  3FB9 A;  4NL2 A;  1M4Z A;  3CCS A;  4MDX A;  4LD6 A;  2PUK B;  3M5A A;  1YCY A;  2KMT A;  4OVA A;  3JCM e;  3OYB A;  5CKB A;  2AHJ B;  5LJ3 j;  4M78 D;  3L2R A;  5CQX A;  4LD9 K;  5LJ5 j;  3M59 A;  5GAM j;  5GMK h;  3TRE A;  2H3J A;  2P0Q A;  4C0Z A;  3CCE A;  1VUB A;  1VQ9 T;  4M75 C;  4O5V A;  3CCU T;  2FL7 A;  4Z02 A;  1VQK T;  4MDW A;  1M1K U;  2RI5 A;  4XAX B;  2E10 A;  3CPF A;  1VQ8 T;  3ZFJ A;  5DLQ E;  2DO3 A;  2QQA A;  3S3M A;  3NFC A;  3JCM V;  1G3Y A;  4M75 G;  4XTY A;  4M7A A;  2JUF A;  3OYG A;  1WJS A;  1N6A A;  3FJP A;  2GFA A;  3PGG A;  4EPC A;  1OZ3 A;  3URG A;  1X75 C;  2JOY A;  2KAF A;  3RKW A;  2P4T A;  3M9Q A;  3DB4 A;  3P8H A;  2DXU A;  1IRE B;  1UGQ B;  4QQD A;  4C8Q D;  3GP8 A;  3SB2 A;  2A7Y A;  3OYN A;  4LDX A;  5C0M A;  1I81 A;  2Y90 A;  2CGH A;  3GNG A;  4B9W A;  4ZGD B;  2KVQ G;  3CC2 T;  4JRI A;  2JTM A;  1RL2 A;  1VQ5 A;  2DXT A;  2QI2 A;  2DJZ A;  1G3S A;  1JBM A;  2Y4Y A;  5CKH A;  4PJO D;  1G5V A;  2V8K A;  1NZ9 A;  5DY9 A;  3LYI A;  3T9N A;  4J7I A;  5LJ3 d;  2DD5 A;  5GAO l;  3OYH A;  1Q81 C;  5GAM d;  4XU3 A;  2QXF A;  5GAN 3;  4J83 A;  4JDS A;  1H3Z A;  3RIR A;  2RHU A;  5GMK e;  2K3X A;  4M7A B;  4M75 E;  4R56 A;  3CXC A;  2EYQ A;  3BDL A;  4BY6 B;  2M9U A;  3QYG B;  4M7A F;  2WAC A;  4NOY A;  2XK0 A;  2WSC E;  2O4X A;  4HT8 A;  4A53 A;  4WF2 A;  5C6S A;  2HD0 A;  5HK3 A;  4M7D C;  1HK9 A;  2VGN A;  1K73 C;  3BY7 A;  2MWP A;  3OS1 A;  3SDZ A;  4J6X A;  3LLR A;  3M4Y A;  5IT9 E;  4KBM B;  3PMT A;  4QVC A;  3CPW S;  1KG1 A;  3PTA A;  3OYD A;  4M7D F;  3JCM d;  2M16 A;  2BUD A;  2B8A A;  5GMK j;  3CCJ A;  4M7D G;  4QW2 A;  4EMK C;  3G4S T;  2F69 A;  1K9M U;  2XG8 D;  4A4F A;  5GAN 2;  1LNX A;  3G71 T;  4BE2 A;  2EQJ A;  3I56 A;  1UB4 A;  2FB7 A;  1KD1 C;  5HY6 A;  4ZGJ B;  2QA4 A;  1Q7Y U;  4BI3 A;  3OYM A;  2VC8 A;  3FEO A;  3NTH A;  2L8D A;  4N0A A;  1HXD A;  5GAN 6;  3SWN C;  2RJE A;  3JCM P;  2XIC A;  3QG1 A;  5LJ3 h;  5LJ3 g;  1NJI C;  1U1S A;  2LT4 A;  3PMI A;  5GAM h;  5GAM g;  1QVF S;  2K5L A;  5GAN 8;  1Y96 B;  1WGS A;  2YLC A;  4C5G A;  4C92 B;  4C5E A;  2DK3 A;  4HKE A;  3GOX A;  2RHX A;  1YJW T;  2OTL T;  1N8R U;  2FVU A;  4BB7 A;  3A8O B;  2QQS A;  4M7D E;  4NS5 A;  4BE1 A;  1OYX A;  3MEV A;  1RI0 A;  3QZ9 B;  1W2B S;  2RM4 A;  2PU9 B;  3M54 A;  4D6W A;  1Q82 C;  4C0D C;  3OYC A;  4KT0 E;  2E5Q A;  3ZEH A;  4KUI A;  2RK1 A;  3TCJ A;  2D9T A;  2CS7 A;  4L6V 5;  3RKX A;  4X9D A;  1K8A U;  3JCM g;  4C8Q A;  4HCB A;  1Y07 A;  2RA2 A;  2E12 A;  4M78 B;  3HKS A;  3CCJ T;  1VQO A;  1BI2 A;  5M9O A;  4BDZ A;  1VQN T;  3CME A;  1FWZ A;  4PJO A;  3VU3 C;  5FU6 B;  1KHI A;  5CK9 A;  2RH2 A;  1ZQ1 A;  4LDW A;  2DIQ A;  3MP6 A;  3FIF A;  2XHC A;  4L59 A;  4N4G A;  5LJ3 e;  3CD6 A;  3DLL A;  5GAM e;  3L2Z A;  4XTU A;  4HCZ A;  3CCQ T;  4OB2 B;  4OMF B;  3OYI A;  5GAN j;  1BI0 A;  3CCL A;  4UC4 A;  4XU0 A;  3I55 A;  3O8V A;  4OGE A;  4IUT A;  4JS5 A;  4FIB A;  1VQ4 T;  2PQW A;  3V8K A;  1XTD A;  3DB3 A;  4JRK A;  3JCM f;  4C8Q B;  5GAO m;  2JTF A;  3P8D A;  2KY9 A;  2E6Z A;  1YI2 T;  4C8Q F;  2P0K A;  1UGS B;  4F7U A;  3ER0 A;  4II1 A;  4PJO B;  4P5N A;  1YHQ T;  4L5G A;  4PL6 A;  2RJC A;  2PVO B;  3CC7 A;  3GIB A;  3E1S A;  1WPY A;  4ELY C;  3CCV T;  1YIJ A;  2CKK A;  3M4G A;  1LJO A;  1P92 A;  4PJO F;  4X9C A;  1M90 U;  1QVG S;  2LTO A;  3ZBD A;  3J7A F;  3VKI A;  2KK4 A;  3CEY A;  2OTJ A;  4FSX A;  2GQV A;  2XKO C;  4ME7 A;  4C5H A;  1VQN A;  1VQ6 T;  4IKF A;  5FRN A;  3FLG A;  2QQB A;  2XU8 A;  3OMG A;  4A4E A;  2LQK A;  1U8R A;  1VQL A;  1I4K 1;  1S72 A;  2QEX A;  5GAN d;  4NL3 A;  3F70 A;  4LDU A;  3OYA A;  3L2W A;  1XOV A;  2IG0 A;  2BKD N;  2RD1 A;  4M77 D;  4F7U B;  1YJ9 A;  5D6X A;  3J80 E;  3L1A A;  2K4Y A;  2E6N A;  4F7U F;  1XNI A;  2X4J A;  1MGQ A;  4E7K A;  2VXE A;  5CKD A;  4OB0 B;  2K5I A;  5CIU A;  3CCR T;  3HRT A;  4N4H A;  2DXC A;  3MHX A;  3QKJ A;  1EIF A;  4ZTJ A;  4M75 B;  1JRI A;  1D3B B;  1VQ7 A;  5CKE A;  3C4S A;  2V8J A;  4QQ6 A;  3E9G A;  4ZN3 A;  3GPL A;  3DKM A;  2LT1 A;  4E7H A;  2QQ9 A;  2LQ8 A;  2ZPE B;  3A5Z B;  3CCS T;  4A54 A;  5LJ5 d;  1B34 B;  2YLB A;  3UDC A;  2MAM A;  3OS2 A;  1KQ2 A;  4M7A C;  3G6E A;  1QP2 A;  3E19 A;  2PUO B;  2HBP A;  4XTX A;  4A4K A;  2D6F A;  4IUR A;  3CCE T;  2E65 A;  1N8R C;  2CZ7 B;  2EIF A;  1OZ2 A;  4M7A G;  3BW1 A;  2EQU A;  2X4X A;  3NTK A;  2MWO A;  2LVM A;  2ZPG B;  3R6O A;  1WJR A;  3CBP A;  4FL6 A;  4C0F A;  1KC8 U;  2LX9 A;  3M53 A;  1Q86 C;  1JJ2 A;  2R57 A;  2RI2 A;  4O6J A;  5CQY A;  3SFM A;  3MCA B;  1Y96 A;  2GF7 A;  3QDR B;  5GAN h;  3OW2 A;  2K2V A;  1PSF A;  4C92 A;  4DQ2 A;  2XDB A;  3PIO A;  2PVD B;  4RCC A;  2CYZ B;  2RB6 A;  1NPR A;  2E1H A;  3PT9 A;  4MML A;  4E7J A;  1AHJ B;  2LNV A;  3OYY A;  4E7I A;  3UPU A;  2RHY A;  2XI9 A;  3C12 A;  3BDU A;  3LX7 A;  2M0O A;  4MZP A;  3MO8 A;  2R5M A;  1PSE A;  4PLI A;  3QYH B;  3OA6 A;  5I2S A;  4Y91 A;  4M75 D;  3VUB A;  3JSC A;  3JCM Q;  4YTL A;  1UGR B;  1VQ5 T;  2XID A;  3A8M B;  4FM4 B;  4BDY A;  4M7A E;  3G7Z A;  2MI6 A;  2IVW A;  3LGL A;  5GMK i;  2EFI A;  3DLM A;  4MZM A;  4M78 A;  3VYH B;  4ZTF A;  2XD0 A;  5LL6 S;  2A3L A;  3QII A;  3SD4 A;  5LJ5 g;  5LJ5 h;  3OSV A;  4J6W A;  3CCM A;  1IZ6 A;  2RHI A;  2VYT A;  3H8Z A;  3RUX A;  5HK0 A;  3CMA A;  4BAC A;  4HCC A;  1VIE A;  3V8L A;  4C92 F;  1LOJ A;  3HP9 A;  4C92 G;  3Q1J A;  3V8J A;  5GAN 5;  2DIG A;  4PKC C;  4EMK B;  3KBG A;  3PNW C;  3L2Q A;  4BD3 A;  5GAN e;  3JCM c;  5DM7 R;  1BIB A;  3JCM b;  4ATO A;  3L2V A;  4XTZ A;  5IN1 A;  2I2L A;  4N0A C;  4M77 A;  1VQP A;  2X4Y A;  5FU7 B;  5KE3 A;  3JB9 F;  4ZN1 A;  1V29 B;  2RJD A;  4BI8 B;  2VXF A;  3CC4 A;  5LJ3 f;  3SWN B;  1M90 C;  3OSS C;  5GAM f;  4IUP A;  4OF1 A;  4JJN K;  2F5T X;  4M78 F;  3QSU A;  3X28 B;  1M1K C;  4M78 G;  5A2Q E;  3I56 T;  2JZ2 A;  2VUB A;  2ZZD A;  3OMC A;  2DVE A;  2G3R A;  2QA4 T;  2PVG B;  2R58 A;  3RER A;  2VV5 A;  1YBY A;  5CKF A;  4C92 E;  1K73 U;  3OS5 A;  5LJ5 e;  3TEE A;  4M7D D;  2EJG A;  3ASK A;  3VUZ A;  2GCX A;  2DKG A;  2X4W A;  3OBW A;  5A0G A;  5CR2 A;  4M77 B;  1G3T A;  3CMA T;  1GXI E;  4C8Q C;  3ME9 A;  1VQ9 A;  3MEW A;  4PLL A;  4M77 F;  4ZGE B;  2EQK A;  3CPW A;  5GAO q;  3CCU A;  2DAQ A;  3PIP A;  2JN0 A;  3OY9 A;  1M5Q 1;  1VQK A;  5J3B A;  4PJO C;  2EJF A;  4CRI A;  1VQ8 A;  3JB9 I;  4C8Q G;  2LCC A;  2K57 A;  4ELZ C;  3HRS A;  4M78 E;  4C5I A;  3LW5 E;  3MEA A;  3OYJ A;  4JRP A;  3CXC S;  3WXM B;  2MF2 A;  2KSS A;  3QJY A;  5HKC A;  2GFU A;  4PJO G;  1BI3 A;  3JCM X;  2NLU A;  2K5F A;  4MMK A;  2KDS A;  3BFM A;  4J7F A;  3RES A;  3LWI A;  2BIV A;  3OYK A;  2MMP A;  1VQO T;  3JCM W;  2HAX A;  1WJQ A;  4B9X A;  3VV0 A;  1BIA A;  4JRQ A;  4DA4 A;  1O75 A;  3E9F A;  2VGM A;  1D3B A;  4M75 A;  5A0D A;  4QVD A;  1QVF A;  1ZBX A;  4FT2 A;  4OB1 B;  4RCB A;  3CME T;  2YRV A;  1B34 A;  3CC2 A;  4R55 A;  2CZ0 B;  1R8O B;  3JB9 J;  4X34 A;  1Q82 U;  3CD6 T;  3EFR A;  1G3W A;  1O9S A;  5KH6 A;  3OYL A;  2QQR A;  4JLG A;  5A0L A;  1WNL A;  4C8Q E;  3CCL T;  1W2B A;  3I55 T;  1DJ7 B;  4XK8 E;  3OS0 A;  3RMS A;  4J8O A;  2R5A A;  4OGC A;  1KQ1 A;  1K9M C;  3V7C A;  4F7U G;  3A8G B;  2XDP A;  1N27 A;  1W4S A;  4Q5W A;  4PJO E;  2RJF A;  3MP1 A;  4IUV A;  3JAM E;  4J5Y A;  4JUV A;  3H6Z A;  4N4I A;  1Q7Y C;  1SSF A;  3HFN A;  2RO0 A;  2QDY B;  3QXE B;  3WVD B;  3X26 B;  4BI4 A;  5GMK l;  2EJ9 A;  3JRZ A;  1U1T A;  3HHT B;  2ZCF B;  4KUD K;  4CI0 C;  3GNF B;  4M75 F;  4DOV A;  4E7L A;  3CC7 T;  3QO3 A;  3HSB A;  3MEU A;  2HQE A;  1YIJ T;  4BY6 C;  4EMG A;  1VQM A;  1M1G A;  5FLX E;  3RMQ A;  4V2S A;  3OB9 A;  3G4S A;  4IUQ A;  2WSF E;  2HNI A;  2OTJ T;  2JVV A;  3C95 A;  3G71 A;  3FDR A;  3QUI A;  3L2U A;  3V7R A;  3LH0 A;  2DTH A;  2LC4 A;  4F7U E;  3M56 A;  1VQL T;  1S72 T;  4M7D A;  5GAN g;  3V7S A;  3X20 B;  2QEX T;  1BYM A;  5DLO A;  2E70 A;  2LCL A;  4JLI A;  2OAU A;  2DPP B;  3C94 A;  4MZT A;  3M55 A;  3A8H B;  1Y7X A;  1YJ9 T;  1K8A C;  3VJP A;  3CBM A;  4KUL A;  4XTV A;  4EMH A;  3TU4 K;  4EMK A;  1I5L A;  3QBY A;  2QTX A;  3UWN A;  1YJW A;  2OTL A;  2ZGW A;  1YIT A;  3KUF A;  5I21 A;  3QHS A;  2E41 A;  1UEB A;  5GAO p;  4BUG A;  1QVG A;  2LRQ A;  3CBO A;  5EG2 A;  3EAE A;  4RKU E;  1OI1 A;  1VQ7 T;  3OBY A;  1NPP A;  3SWN A;  2CZ1 B;  4A4H A;  3QPH A;  4A4G A;  4C92 C;  3HRU A;  4IUU A;  4LDY A;  5GAN f;  3JCM J;  3M58 A;  1M1F A;  2ZPB B;  3QZ5 B;  4M7D B;  3OYF A;  5D6Y A;  3G6E T;  4FU6 A;  1VQM T;  1KQS S;  2FHD A;  2K3Y A;  5GAN 7;  1UGP B;  3VYG A;  3GLX A;  3WVE B;  3HPW A;  3MET A;  4RG8 A;  2D0Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...