1N9SA

Crystal structure of yeast smf in spacegroup p43212
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
LKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRSNNVLYIRELPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Small nuclear ribonucleoprotein F
publication title Homomeric ring assemblies of eukaryotic Sm proteins have affinity for both RNA and DNA: Crystal structure of an oligomeric complex of yeast SmF
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1n9sA00
3L1AA 2VXFA 3HFOA 3GIBA 4EMKB 4XQ3A 4EMKC 2DVEA 3JCMd 4PJOD 1BIBA 4M78D 4WF2A 4EMGA 4M7DA 3RIRA 2DXUA 4M75A 4JRIA 5GAMh 1KQ2A 5I21A 5LJ3g 3JCMg 4M7DB 5GAOq 2YLBA 3RKXA 4Y91A 4A54A 2EJ9A 2DZ9A 3RESA 5GAN4 3EFSA 5GAN2 4M7AE 1M8VA 4HA8A 4M78G 3JB9F 4F7UA 4J6WA 4M77A 4C92E 3V7CA 3HFNA 2QTXA 4F7UB 5GAOp 3M4GA 4J5YA 4M75F 4M77B 4C8QB 3V8JA 3JCMW 4M7DF 1X01A 3RKYA 5GAOr 4XTZA 2DTHA 3RUXA 4DQ2A 4PJOA 1I5LA 1D3BA 4X9CA 5GMKh 3QO3A 1B34B 3AHUA 3JCMc 2E41A 2JN0A 1D3BB 5LJ3j 3V8KA 5LJ5d 5GAMj 3JCMJ 4F7UF 3BY7A 3RKWA 4M77F 3SB2A 4C8QF 4M7DE 4M7AG 4HT8A 3QUIA 3INZA 5GAN6 5LJ5g 5LJ3f 5LJ3h 3JCMh 4C92G 5GAMf 1HXDA 5LJ3e 4X9DA 1MGQA 4PJOF 5GAMe 5GANd 4XTYA 4M75B 4M7DC 2HNIA 2VC8A 4M75C 5DY9A 4XU0A 4XTWA 4F7UE 4XU3A 4C8QE 1N9RA 1N9SA 2EAYA 1U1TA 4JRKA 3SWNA 4NL2A 5GANg 1WNLA 2FB7A 2Y90A 1WQ7A 1I4K1 2FYKA 2DJZA 1LJOA 5GMKj 2ZGWA 2EJGA 2YLCA 5GAOl 4N0AA 4M7AD 2DXTA 1JBMA 4M77C 4C8QC 3HSBA 2RA2A 3JB9J 4XU2A 3L2ZA 3JB9I 4C92D 3QSUA 4JUVA 4M78A 3JB9H 1H641 5GAN3 1TH7A 3QHSA 4PNOA 5GMKe 5LJ5j 4PJOB 3BFMA 5GMKl 4M78B 4PJOC 1YCYA 4QVCA 4MMKA 3FB9A 4RCBA 1BIAA 1WPYA 3VU3C 2RB6A 4M75E 5GAN8 3JB9D 5LJ5h 5GAOn 2YHTA 5GAN7 5GANj 3JCMf 1LNXA 3JCMe 3JCMP 4M7DD 2VXEA 4M78F 2DTIA 2K57A 5GAOm 4XTUA 4M7AA 5GANh 4M77E 2I2LA 4JLIA 4C92A 3RERA 4OP0A 3V7SA 2CGHA 3JB9G 5GAN5 3SWNB 3JCMV 5GMKm 4PJOE 4C8QD 4EMKA 1M5Q1 4M78E 4M7DG 4V2SA 4M75G 2RM4A 3JCMX 2EJFA 3BW1A 4J6YA 2DKGA 4N0AC 3FIFA 4XTXA 3PGGA 5LJ3d 4RCCA 5GAMd 4HT9A 4M7AF 3V8LA 1I81A 4M78C 4C92F 3BDUA 2EWNA 4EMHA 2E1HA 4F7UG 4M77G 1JRIA 4C8QG 4NOYA 4A53A 3JCMQ 5GAMg 5LJ5f 1LOJA 4MMLA 5LJ5e 2DZCA 1HK9A 1I8FA 4PJOG 1WQWA 4XU1A 2E64A 4M75D 2E10A 1KQ1A 1U1SA 4C8QA 2DEQA 5GANf 3FJPA 3V7RA 2DTOA 5GANe 2RD1A 3JCMb 4NL3A 4M7AB 1B34A 4M7AC 2E65A 1Y96A 4QVDA 5GMKi 3SWNC 4C92B 4M77D 5CAIA 4J6XA 4C92C 4XTVA 3EFRA 1Y96B
chains in the Genus database with same CATH superfamily
1NPPA 3JSCA 3OB9A 2OTLA 3BE3A 1AHJB 4J8OA 4JRIA 2KRSA 2EYQA 1M90R 1RABB 2L2PA 2PUOB 2WACA 3EFSA 1YIJQ 4DEXA 5KYXA 3CCMQ 4J5YA 4M77B 4PL6A 4CC7A 4DQ2A 2KRMA 1BBZA 3VUBA 3QO3A 2JZ2A 5CKBA 2JN0A 1X75C 1QKXA 3D7SB 2ZPGB 2KSSA 1WHKA 2V8JA 3QUIA 3CPFA 4FCYA 4K11A 4BDZA 4M75B 4M7DC 2VC8A 4M75C 4Z89A 3GP8A 1S1NA 1S72T 4RMOA 4PFZA 4A4EA 3EG1A 1YFNA 1Q81R 4R55A 1G2BA 1CSKA 5GAN3 4LN2A 4X34A 4A4FA 1PKTA 1TUCA 1PSEA 2C0TA 2GNCA 1Y7XA 3META 2V1RA 1D1CA 1M27C 4AFQC 3JCMP 4M7AA 5CVIA 4QQDA 3REAB 5KCHA 4HCBA 4PKCC 4J9DA 3TU4K 4EMKA 5IXBA 2RM4A 2LT1A 1VQMQ 4J6YA 4FW2A 3FIFA 2ABLA 3CCUT 2EYYA 5CO7A 3CCJQ 3MO8A 3CC2Q 3OYGA 4N4HA 1OQKA 1UTIA 1NEGA 4PJOG 1KK7A 2MCNA 4OMLA 2RMOA 1AT1B 2CP6A 1K76A 4J7IA 3UPUA 5I22A 2WSEE 2LC4A 2WSCE 3MEUA 3TVTA 1UGSB 2CT3A 5HK0A 4VUBA 2F1LA 3L2WA 3HRSA 3CCEA 2HQEA 3CCLA 1VQ7T 2DMOA 2QQRA 2EJ9A 3RESA 3J80E 5IN1A 1RACB 2JMAA 2RI5A 2X3XD 4M7DF 4M75F 4C8QB 3RKYA 3SDZA 1LPLA 1X2QA 5D6XA 2O9SA 1ABQA 1W4SA 1VQ6A 1IGUA 1IGQA 4HT8A 3MP1A 2L0AA 4LUEA 3CPWA 1HXDA 2LVMA 5A0GA 3CCVQ 3A5ZB 1YJWT 1SPKA 2K6DA 2QA4Q 4A4GA 3CMAT 2OTLT 3I5RA 3CMEA 2DO3A 1QLYA 4RTYA 1D09B 3M55A 1MV0B 3EAEA 1JBMA 2GTOA 2LJ3A 1KD1U 1OEBA 2FPDA 4QVCA 1ZA1B 3FB9A 1O9SA 1YJ9Q 1VQ9Q 4N4GA 2NUPB 1G5VA 1UUEA 1QVFP 5A0LA 4CRIA 4AG1C 2J6FA 1SRMA 1FYNA 2FZKB 4IUUA 4PK4A 2CP5A 2JMCA 4J9IA 4M78C 3Q1JA 1BKBA 2MIOA 1FWZA 3QJ6A 2COYA 2GGRA 1K1ZA 2COZA 3JV3A 3JCMQ 2P0QA 1JB0E 2D8HA 2RHIA 3LWIA 1NJIC 2IG0A 1YIJA 4XU1A 4OB2B 1QQJA 3FC3A 1PHTA 3HL8A 3GNFB 1YI2Q 2ATCB 4F04B 2EVRA 1SRLA 3RNJA 4X1VA 2A36A 2K79A 3M53A 2HL3A 4GLMA 3M0QA 2JM9A 2WSFE 1AWXA 2QQ9A 1VOMA 1P92A 1I1JA 4ZN3A 4JRQA 2RJEA 1Q86C 3A1PA 4LDUA 4M77A 3RMSA 2XI9A 3VS1A 3AT1B 2O4XB 2P0KA 2X3WD 1Q82C 4JJNK 3EFOB 2XMFA 3INZA 5EG2A 2J6KA 4C92G 1ZUUA 3QG1A 4J9BA 5CKHA 2EIFA 1N8RU 1FMKA 4GLKA 2A0FB 2CS7A 1I4K1 1OX9A 2RK1A 1LJOA 3JAME 3CCET 3CCLT 5GAOl 2G6FX 2RA2A 3QYGB 1VQMA 4JUVA 2KT8A 2RI2A 4KUIA 1AD5A 2X51A 5J3BA 4A4HA 3CC2A 1YWOA 3TSWA 3VS6A 2DX1A 5GAOn 5DLOA 1W2BA 2OAUA 2HQHA 4M78F 2EW3A 1SHFA 3PVQA 4XK8E 2H3EB 1OULA 3QXEB 4PJNA 1VQ6T 4LE9A 3PMTA 2MWOA 3QKJA 3PMIA 4B9WA 1QVGP 1QWEA 1SHGA 3JCMV 2PVOB 8ATCB 2ZPIB 1YJNQ 4XTXA 4Z8AA 3CMET 3A8OB 1I81A 2DILA 5GAMg 4E7IA 4MMLA 3MHXA 3NTIA 3MJXA 5D6YA 3NFCA 1WHJA 2KE9A 1M9SA 5CR2A 5GANe 2DTOA 4R56A 3JCMb 1WXUA 3QJYA 1ZBXA 1B34A 2H8HA 2LMJA 1NE8A 3GF5A 4O5VA 3CCUQ 1OI1A 3SWNC 3M0SA 1JXOA 3JRZA 2DBKA 1Y07A 3EHRA 3M5AA 5KYWB 4FT2A 1KC8U 4E2FB 5D7UA 3C4SA 2F2VA 3CCVA 2V26A 1RADB 4MZTA 2QA4A 4E7ZA 4J9GA 1BB9A 1IREB 2IIMA 3HFNA 2MK5A 1NYFA 4MDWA 1RUWA 3HTRA 4RKUE 2VKNA 1YIJT 3PFSA 2A28A 1VQ7Q 3ZFJA 2R5AA 1YJ9A 4M7DE 1VQ9A 2DM1A 4D8KA 1M3BA 2DL8A 4JLGA 4LXCA 5DY9A 4XU0A 4IURA 2RN8A 3NMZC 1HSQA 2FB7A 2FYKA 2KEAA 5LL6S 4OGEA 1PNJA 2EBPA 1F1BB 3FEOA 3HSBA 2SEMA 1TUGB 2GTJA 1MMDA 2ZPBB 1H641 1WGSA 1C6VX 2DL5A 2PU9B 1W1FA 3OYMA 3CMAQ 3PIPA 1OPLA 2J6OA 4ZTFA 3KFVA 1XNIA 1RLQC 2RNAA 4BI3A 1YI2A 2RHZA 2K4YA 1QMCA 1ZX6A 2EFIA 2L3SA 3M56A 3OS5A 1QP3A 4M7DG 4M75G 2DF6A 2RJFA 4OF1A 2FZCB 3OYHA 2HEQA 3M4YA 4KBMB 2EQMA 1JRIA 2D8JA 3I56Q 2NUZA 1VQMT 2VB6A 1RAEB 2MF2A 4ZGDB 2P84A 4FIBA 1U06A 1GFDA 1PKSA 3X26B 3CC2T 4CI0C 4NL3A 4M7AB 4M7AC 5IHKA 2LCSA 1NLPC 2DBMA 4XTVA 2YDLA 2RHYA 4EMKB 2X4WA 3NHNA 4EMKC 3G6EQ 1DJ7B 2QDYB 3CEYA 1TS9A 2RO0A 4KT0E 1GCQC 3RBBB 1KSWA 2XICA 5GAOq 4FU6A 3X24B 3G4SQ 5AT1B 5KH6A 1HYOA 4J6WA 1K4US 3V7CA 2JNGA 1R0CB 3H8ZA 2QTXA 4F7UB 5GAOp 2CH4W 4EPCA 2V8IA 1K73C 4OB3B 4RTUA 4L6V5 5GMKh 3EFOA 2LDMA 3JCMJ 3LGLA 4DBRA 2XU8A 2DXCA 1VQOQ 1MNDA 1K73U 3CC7Q 4NL2A 3ZEHA 2JTEA 4YTLA 3CCVT 1YJNA 1VQ4T 4II1A 2P4TA 3JB9I 1U3OA 2CKKA 2QA4T 3LW5E 3BFMA 1NBEB 2X4YA 1VQKQ 2YRDA 2YRVA 2YHTA 1KG1A 1QVFA 1BYMA 3GBQA 1YJ9T 1PD1A 1VQ9T 3HPWA 3CCUA 4LDXA 4BB7A 3RR6A 1K8AU 1JU5C 4V2SA 3PVLA 4M78E 1WLPB 4IUQA 1NEBA 2CZ7B 4M7AF 1ZSGA 1ZQ1A 2EWNA 4OMPA 1VQ6Q 2O88A 2NYSA 5LJ5f 2EYWA 1NJIR 4LDYA 2EYXA 1KQ1A 1OZ2A 1QWFA 3HP9A 5CIUA 2QG9B 2KNBB 3ZBDA 2DAQA 2QQBA 3CMEQ 1BI2A 2QAZA 5GMKi 1VQ7A 3QDFA 3GIBA 1YI2T 2DVEA 1J3TA 1EIFA 3LH5A 4PJJA 1M2VB 1HD3A 5I21A 5LJ3g 2YLBA 3RKXA 2DERA 2DNUA 3EGXB 3RMQA 1Q86R 3S3MA 1ZUKA 4M78G 4XAXB 4B9XA 1JO8A 3OA6A 2DPPB 2RF0A 1Q82R 3AHUA 4IUPA 2LP5A 2D9TA 2AKLA 3MPUB 1IZ6A 3CMAA 4KUDK 5GAN6 2X9HA 2XHCA 2OI3A 2KDSA 3J7AF 4QT7A 3GLXA 2PVGB 2E5KA 4PJLA 3OSSC 2DJZA 3SFMA 4OB1B 2DXTA 4M77C 3CCST 4LDVA 5DM7R 4ESRA 3A8GB 3NGPA 5LJ5j 5CKEA 2DXBA 3I56A 5LJ5h 3JCMf 2ROLA 4M7DD 1EFNA 2VXEA 1QVGA 2DTIA 3OS0A 3DLLA 5GAN5 4AG2C 4PJOE 4GBQA 3G6EA 2LQWA 1TTHB 2L89A 3V8LA 3ULRB 5A2QE 1IHWA 1XJWB 4EMHA 1YJNT 2GFAA 3A98A 2MMPA 3QZ5B 2YUPA 4E6RA 4PJMA 1QVGS 4RTTA 1Y0MA 3RDVA 3G4SA 1WQWA 3SD4A 2VGMA 3OYKA 1K0SA 2M51A 1B3QA 3I5SA 3H9NA 4QVDA 2KT1A 2XDDA 1Y96B 3M54A 3J81E 4F14A 2DVJA 2VYTA 4ZTJA 4LD6A 3RIRA 1KQ2A 2RH2A 2DRKA 1FMVA 1VQOA 2Y4YA 3T9NA 3CC7A 2QTVA 4F7UA 3HRTA 3OS2A 2HKQB 4BI8B 4A63B 3I35A 1B34B 3X20B 9ATCB 2RJCA 1UGPB 5LJ5d 1VQKA 4M77F 3REBB 4M4ZA 5LJ3f 3JCMh 1MGQA 1I07A 3NTHA 1G3YA 3L42A 3LYIA 4XU3A 4BI4A 5GANg 2F5KA 4Q5WA 5D6WA 1NPRA 3KBGA 2ZGWA 2YLCA 4C8QC 4BACA 2LX9A 2KROA 4PNOA 2COWA 2AKKA 2QK0A 3MCAB 1T3LA 3VU3C 3G7ZA 4KRTA 1KD1C 2K2VA 3OSVA 2LJ0A 4FSXA 1SEMA 2ZAEA 1VQ4Q 3QYHB 4LUDA 3QZ9B 3M0RA 3VYHB 1BI3A 4AT1B 2W10A 3CCRA 3MP8A 1Q7YU 2DKGA 1UGVA 1G83A 2O01E 3VJPA 2ED0A 1GFCA 4KH0B 3EGUA 2YWWA 2JM8A 3F70A 2ZCFB 4KH1B 3SHWA 4QKUA 2E64A 4IUTA 3OYIA 4BD3A 2KXDA 2LQKA 2D0QB 3I56T 4ZGJB 1VUBA 1UFFA 2CREA 4BY6B 3A8LB 1XTDA 4JJCA 2VXFA 4RG2A 3OY9A 1X43A 3JCMd 1M2VA 4M78D 2MWPA 1VQLA 1MHNA 1VA7A 3EGXA 1ZHIA 3DKMA 1YP5A 3VRYA 2PVDB 4Y91A 4A54A 1X6BA 3G6ET 3KXTA 3JB9F 1YITQ 4C92E 4DBHA 4JZ3A 1B7TA 1K73R 2PZ1A 3RUXA 5IH2A 3G4ST 1A0NB 3CC4T 1TXQA 4J9HA 4EIKA 2X4JA 2BZXA 4LD9K 3C94A 4C8QF 1RLPC 4M7AG 3HRUA 1GCPA 5GJVB 2H3JA 2X4XA 1YBYA 2KYBA 2QYZA 4D6WA 1EZZB 1BK2A 3M9QA 1RI9A 2FVUA 2FO0A 1JJ2P 2JOYA 1WQ7A 3DB4A 1VQOT 2EKHA 2ESWA 5M9OA 1N8RC 3QSUA 3CC7T 3QHSA 2RQTA 4JRPA 5GMKl 2F69A 3VS4A 1YCSB 4C0GA 3L2QA 4R0KA 4DOVA 3H0FA 2DA9A 2RQVA 3EH2A 1PM3A 2DL3A 1LNXA 1VQPQ 1VQKT 3CCSQ 2DJQA 5IHIA 3S3NA 1ACMB 2OTJQ 2OAWA 4C0DB 5LJ3d 2CDTA 3H6ZA 2YRCA 2V1QA 5L8RE 1GRIA 4Y28E 3P8BB 2QDLA 4FYXB 2GCXA 2HDAA 2W0ZA 1M90C 1I8FA 3E9FA 2D0NA 2KYMA 2KGTA 3VV0A 5J26A 2YUNA 1Y96A 1PCXA 3WXMB 1W6XA 3L1AA 2HBPA 3HFOA 3H0HA 1M90U 1MMAA 4PJOD 1R77A 2M0YA 4WF2A 3VS5A 2Y4XA 2E12A 1E6GA 2D6FA 3CCRT 4LDWA 2DZ9A 4J9CA 1MNEA 4BDYA 1KC8C 3M0UA 5CKDA 5IT9E 3FLGA 3V8JA 1ZUYA 1BU1A 5CQXA 4IIOA 3JCMc 1MV3A 3UWNA 1SSFA 2XK0A 3LWHA 1MUZA 1TSFA 3I9QA 2LJ1A 2O9VA 1H3ZA 1ZA2B 1Q81U 1VQ4A 1UJ0A 4XTWA 1Z9QA 1FMWA 4JRKA 3UDCA 3OW2P 1VQLT 2LT4A 4WCIA 2RJDA 1RAIB 1AOJA 2QEXT 4FM4B 2DFUA 2CP2A 4M75E 2RHXA 4B6MA 5KYYB 1M4ZA 2K57A 5GAOm 2BKDN 4OGCA 3ER0A 4JPBW 2CP0A 2F5TX 5C0MA 3VYGA 4FYYB 3JCMX 2IVWA 5FU7B 2HD0A 5FU7C 5A0DA 1M1GA 1V1CA 2GBQA 4M77G 4NOYA 2DZCA 4ATOA 2AZSA 2E10A 1YITA 2BZ8A 2CP7A 4ZNXA 4DEYA 1LVKA 4C0FA 3EG0A 2JS2A 3H41A 2KI7A 3HKSA 2RQWA 1D1AA 4EMGA 4HCCA 2J06A 1KHIA 3VS0A 2L3QA 1MMNA 3DB3A 3S6WA 3P8DA 2CP3A 2EKOA 2D1XA 1WJSA 2LCCA 2YSQA 2G3RA 4IIMA 4Y92A 4IUVA 1D3BB 2HL5C 2DRMA 4E47A 5DLQE 2JUFA 4OB0B 5GAMf 3M57A 3LX7A 4IKFA 4E7SA 4XTYA 1VQPA 2BTTA 3CCSA 4C8QE 1OV3A 4AFZC 1Y71A 3CC4Q 2Y90A 2GQIA 5GMKj 4OMNA 3GPLA 2OTJA 4C92D 1YJWA 2J7IA 3L2UA 4CC3A 1OX8A 3LGFA 5GMKe 1MMGA 5FWBA 3M0TA 2YUQA 4LNPA 3CD6Q 1KD1R 2VUBA 4HVVA 5GAN7 2R58A 2AK5A 1AWWA 2RI3A 4PFPA 3JB9G 4WTOB 4OMOA 1TOVA 1M5Q1 1SF9A 1NG2A 2PNIA 3C12A 2DD4A 1UGQB 1WXTA 3PGGA 2MPXC 4RCCA 3VRZA 1M8MA 3UA6A 3N5BB 3BDUA 1VQ8T 4C8QG 4J7FA 1K8AC 4RTWA 2YUOA 4D8DA 2ROTA 2CUBA 2K5IA 1QCFA 1IRXA 3GNGA 4DBQA 3OYEA 3OBWA 2LNVA 1RAAB 1PD0A 4CC2A 1T3SA 2EGAA 3OYNA 2ED1A 5IXFA 2R57A 1R0BG 3EGDB 1X2KA 5FWCA 2NUTA 1UHFA 4Z02A 3E1SA 5GAMh 4OMQA 3G1JA 1KHCA 3H0IA 1XOVA 5FRNA 1WJRA 2A3LA 2E70A 4HA8A 1UHCA 1WYXA 1BI0A 5GAOr 4PJOA 4X9CA 1YITT 1G3TA 3CCRQ 4F7UF 3VKIA 3DLMA 2HSPA 1XQHA 3C0CA 2QGGA 2XDBA 2DYIA 2EQIA 4X9DA 1JJ2A 5FW9A 2OX7A 3OYCA 1OYXA 3SWNA 1U1TA 1UJYA 4FW1A 2MYSA 1QCNA 3BDLA 3QPHA 3OMCA 1N8RR 5KYUB 1RL2A 5FU6B 3EG9A 2DLPA 3QIIA 2CH4A 4FYWB 5KYYA 4JS4A 1VQLQ 1VIEA 1G3SA 1JJ2S 4ELYC 2QEXQ 4PLLA 1H92A 4HVUA 3V7SA 2HQXA 3M59A 3UT1A 2GQVA 1VQPT 2L5QA 1PRLC 2HAXA 2EJFA 1KFZA 2EGEA 5CK9A 5GAMd 3E19A 2DIQA 3TREA 3CCQQ 5FROA 1H3HA 2OTJT 1H8KA 5LJ5e 2QXFA 1GXIE 3CBMA 1NM7A 4M75D 2L3RA 1N6AA 2DIGA 2KAFA 3OS1A 2M0OA 1D0YA 1QW1A 2DD5A 1ZSZA 2ZPHB 4F17A 1AZEA 4RG8A 1C0MA 2KY9A 3TEEA 2GFUA 4HCKA 3R6NA 2HCKA 1WA7A 3VS3A 1WHMA 2JXBA 2CZ0B 2DXUA 4M7DB 3I55Q 3SEMA 3CC4A 1KC8R 4J9EA 1UB4A 4TVRA 1M2OA 1T0HA 3TSZA 1PC0A 3QBYA 1D3BA 3EHQA 1I5LA 2B86A 2PUKB 5CKFA 4BE0A 3V8KA 2FHDA 1M1FA 3EH1A 3CD6A 3M0PA 1KQSP 2XD0A 5I2MA 3OW2A 1ARKA 1QKWA 2QQAA 1IB8A 1N9RA 2JVVA 1M1KC 2K5LA 5KCOA 2EYZA 4RTVA 4AMCA 5HK3A 5IHNA 1I0CA 4ELZC 1GCQA 4FYVB 2RHUA 3WVEB 3X28B 3OYYA 4MMKA 2MAMA 4RCBA 4L59A 1T0JA 1M1KU 1UE9A 3JB9D 1D1BA 1WFWA 3OW2S 2K5FA 1NZ9A 2JT4A 4HVWA 3JCMe 1KIKA 4DOWA 3UA7A 4JLIA 4C92A 3PNWC 2BUDA 5KE2A 1YWPA 4L5GA 4C8QD 4OMFB 2MI6A 2AT1B 1VQ5Q 2E3HA 2KVQG 3MEWA 2BZYA 2XIDA 3OYBA 3MKDA 5HKCA 3CXCA 3OBYA 4KGVB 1Q7YC 4C5HA 2P4RA 1AZGB 3G71Q 3V7RA 3PIOA 4E7JA 2JW4A 2IPOB 1VQ8Q 1YHQT 3EGDA 1WHLA 4XQ3A 4QQ6A 1TU0B 4JZ4A 1D0ZA 3M58A 2DE0X 4C5GA 3CXCS 2E6NA 2M02A 1WDXA 2EQJA 3P8HA 4M7AE 1GL5A 3EG3A 1K9MC 2ZZDA 3QWYA 4AFSC 1SKUB 3PE0A 2BE7D 4XTZA 1VQNQ 1FXXA 4BY6C 5LJ3j 2M9UA 3RKWA 3CPWS 1AEYA 1RAFB 1K9MU 5LJ3h 4HCZA 4RTZA 5LJ3e 3E9GA 2FRYA 2VVKA 4F7UE 1GBQA 4P5NA 1B07A 2QEXA 1I5OB 2EAYA 4J83A 1AWOA 5CCAA 2A37A 2QQSA 1M3AA 5KYUA 4N0AA 1CKAA 1V29B 4XU2A 3JB9H 1Y57A 4M78B 3CCQA 5HY6A 2DEUA 2P0PA 5C6SA 1G8XA 4PLIA 2VWFA 4JS5A 5KYNA 2SRCA 4F16A 5ECAA 4XTUA 5HCKA 2K7AA 4QW2A 3CCMA 1M30A 3CD6T 2FPFA 2CGHA 4N4IA 2FZGB 3QWXX 1EX4A 1HJDA 1IHVA 1NJIU 1AWJA 1Z9ZA 2O2OA 2EQUA 2RQRA 3MEVA 1X27A 3FRNA 1K8AR 3OYLA 4F7UG 2C06A 2A08A 4A53A 4DBFA 5IAYA 2KQWA 3I55A 1SG5A 4C5EA 5GANf 2RD1A 2YXYA 1RAHB 3LH0A 2E65A 1GBRA 2FL7A 4J6XA 3EFRA 8AT1B 1M3CA 1NLOC 3L2RA 4QVZA 4C0DC 5AYFA 1Q86U 3WVDB 1BIBA 2K3YA 4M7DA 4M75A 4RUGA 4A4KA 1QVPA 2A7YA 1M8VA 2M16A 1Q82U 2L3PA 1UGRB 2O31A 3JCMW 1UDLA 1OU9A 1V76A 1X01A 2DTHA 3GOXA 2V8KA 1N5ZA 4FSSA 2HZYA 3CCJA 1OU8A 2E4HA 1PRMC 2VV5A 1X6OA 4FT4A 1W70A 1JXMA 1S72Q 2NUTB 2DL7A 2LZ6B 2R5MA 2ZPEB 4JJDA 4OVAA 2KR3A 2I0NA 2HNIA 2Z0WA 2RQUA 4MZMA 2C0IA 3VUZA 4CC4B 1N9SA 3L2VA 2VASA 4KGZB 3NPFA 2HMAA 1Q81C 2KK4A 3L2ZA 3CBOA 1VQ5A 4JDSA 4PJOB 4PJOC 1QP2A 4OMMA 1YCYA 1WHHA 1W2BS 2RB6A 3C95A 1C1AA 2ZPFB 5GANj 2LQNA 3OYDA 2CYZB 3VS7A 4M77E 3ZL7C 5GANh 3G71A 4OP0A 1KJWA 3SWNB 3URGA 5GMKm 1VQ8A 2EPDA 2F2XA 2DYBA 1K9AA 4PFOA 2ECZA 2CUDA 2XDPA 3FJ5A 2NWMA 1E6HA 3QDRB 3EG9B 1WJQA 1Q95G 5L23A 3CBPA 4ZN1A 4KULA 1RAGB 3A8MB 3CCQT 4C8QA 3LLRA 2CSQA 1OPKA 1D0XA 1VQNA 2GF7A 4J9FA 3OMGA 3NTKA 1TWBA 3MEAA 3CCMT 7AT1B 1OOTA 2VGNA 1R8OB 2DK3A 3VS2A 6AT1B 4ZGEB 5GAN4 2FRWA 5GAN2 3ME9A 1YHQQ 4C0ZA 2CT4A 1BCOA 1CKBA 1TG0A 3CXCP 2JTMA 3R6OA 3FDRA 3EG2A 5KYXB 1UECA 3I55T 4BUGA 1ZSZB 3U23A 1ZSZC 2E41A 1YJWQ 1KQSA 2NUPA 3BY7A 2K2MA 3SB2A 3HHTB 1UEBA 2OTLQ 2CZ1B 5LJ5g 2MOXA 4PJOF 2BE9B 2HKNA 5GANd 5GJWB 3CPWP 4ME7A 1BI1A 1M1KR 4JJBA 1TUDA 2PQWA 2KMTA 2LNHB 4UC4A 1WIEA 2EJGA 4M7AD 1O75A 3JB9J 1X6GA 4M78A 3X25B 1TH7A 3A8HB 3S3OA 3O5ZA 1KQSS 1E7OA 1VYVA 1BIAA 1WPYA 3UATA 4GY5A 2B8AA 2RK2A 2QI2A 2AHJB 3CCJT 2K3BA 2I2LA 1OZ3A 2K3XA 4HKEA 3O8VA 3RERA 4E7HA 2LQ8A 3KUFA 2CSIA 2YT6A 3OYJA 2J05A 1ZLMA 2EQKA 4QQGA 5J39A 3BW1A 2OJ2A 4HT9A 2FPEA 2XKOC 1RI0A 2RPNA 2CZ6B 2PTKA 2X35A 2EGCA 1Q7YR 1VQ5T 1HK9A 2LTOA 2F2WA 3UF4A 1YN8A 2KBTA 3IQLA 2KRNA 2XG8D 2O4XA 2DETA 3TCJA 4C92B 4C92C 1N27A 4FL6A 2L8DA 5I11A 1UG1A 1WHGA 3G71T 4DA4A 1S72A 1X69A 2KXCA 1VYTA 3JCMg 2HBWA 1AVZC 4O6JA 1U5SA 4ANJA 3OYAA 4Z88A 1K9MR 1IO6A 1FX7A 4EDUA 3M4GA 1LCKA 4ORZA 1ABOA 4NS5A 2AIRB 5CQYA 2E3IA 2K9GA 5GAMj 2DL4A 2LX7A 3TQ7P 1IXDA 3THKA 1WZOA 4RTXA 1VQNT 4HXJA 2ENMA 2E5QA 3CCEQ 5GAMe 3CCLQ 2BIVA 3OYFA 4MZPA 1VYUA 2FG0A 1WNLA 5FLXE 2QASA 1ZBJA 4C5IA 4BE1A 1SSHA 1G3WA 5EC7A 2JS0A 1QVFS 1WX6A 5GAN8 2AZVA 2JJ9A 2FEIA 5KE3A 1QCOA 1W2BP 1YNZA 2HSEB 2NLUA 3PT9A 4E7LA 4AFUC 3CQTA 3E2UA 1BCMA 3ASKA 2JTFA 5I2SA 1WI7A 3MP6A 5KYWA 4N0AC 4BE2A 4C92F 1WXBA 5FU6C 1K0XA 1PWTA 1VIFA 2E1HA 1PG5B 1LOJA 2LCLA 4KGXB 1JEGA 1YHQA 2QGFB 1U1SA 2M1HA 2DEQA 1JQQA 2LRQA 3FJPA 5FRMA 1NYGA 4E7KA 4MDXA 1PSFA 2E6ZA 4M77D 5CAIA 1U8RA 3PTAA 3OQ5A 2C0OA
chains in the Genus database with same CATH topology
3L1AA 2HBPA 3HFOA 2RHYA 4EMKB 2X4WA 4XQ3A 4EMKC 1M90U 4PJOD 1NPPA 1DJ7B 2QDYB 3JSCA 4QQ6A 3OB9A 4WF2A 3CEYA 2OTLA 2RO0A 2Y4XA 4KT0E 1AHJB 4J8OA 2E12A 4JRIA 3M58A 2D6FA 2XICA 5GAOq 3CCRT 4LDWA 4FU6A 4C5GA 2E6NA 3CXCS 2EYQA 2DZ9A 3X24B 2EQJA 2PUOB 2WACA 3EFSA 3P8HA 4M7AE 5KH6A 4BDYA 4J6WA 1KC8C 3V7CA 1K9MC 2JNGA 5CKDA 3FLGA 3H8ZA 2ZZDA 2QTXA 4F7UB 5GAOp 4J5YA 4M77B 4PL6A 4EPCA 3V8JA 2V8IA 4XTZA 4DQ2A 1K73C 4OB3B 5CQXA 3CCET 4L6V5 3VUBA 3QO3A 5GMKh 2JZ2A 5CKBA 1FXXA 4BY6C 3JCMc 2JN0A 1X75C 2LDMA 5LJ3j 3UWNA 3JCMJ 1SSFA 2KSSA 2M9UA 2XK0A 2ZPGB 3RKWA 3LWHA 3CPWS 2V8JA 3QUIA 3LGLA 1K9MU 5LJ3h 2XU8A 2DXCA 4HCZA 5LJ3e 3CPFA 1H3ZA 3E9GA 1VQ6T 4BDZA 1Q81U 4M75B 4M7DC 2VC8A 4M75C 1VQ4A 1K73U 4F7UE 4P5NA 4XTWA 3GP8A 2QEXA 2EAYA 4JRKA 4J83A 4NL2A 3UDCA 1VQLT 2LT4A 3ZEHA 5CCAA 1S72T 4RMOA 4A4EA 4YTLA 2QQSA 2RJDA 3CCVT 1YJNA 4N0AA 4R55A 1V29B 4XU2A 4II1A 2P4TA 3JB9I 2QEXT 1VQ4T 4FM4B 3JB9H 2CKKA 5GAN3 2QA4T 3LW5E 3BFMA 4M78B 3CCQA 4X34A 2X4YA 4A4FA 1PSEA 4M75E 1Y7XA 3META 2RHXA 2P0PA 5HY6A 2YRVA 5C6SA 2YHTA 1KG1A 1QVFA 1BYMA 4PLIA 4JS5A 3JCMP 1M4ZA 2K57A 5GAOm 4XTUA 4M7AA 5CVIA 1YJ9T 2BKDN 4OGCA 4QQDA 4QW2A 3HPWA 5KCHA 3CCMA 1VQ9T 3CD6T 3CCUA 2CGHA 3ER0A 4PKCC 4N4IA 4BB7A 4HCBA 4LDXA 3TU4K 2F5TX 5C0MA 3VYGA 1K8AU 4EMKA 4V2SA 4M78E 4IUQA 2RM4A 2LT1A 3JCMX 2IVWA 1NJIU 4J6YA 2EQUA 5FU7B 2CZ7B 3FIFA 2HD0A 3MEVA 5FU7C 4M7AF 5A0DA 1M1GA 3CCUT 5CO7A 1ZQ1A 3FRNA 2EWNA 3OYLA 3MO8A 4F7UG 2C06A 4M77G 4NOYA 4A53A 5IAYA 3OYGA 2KQWA 5LJ5f 4N4HA 4LDYA 2DZCA 4ATOA 3I55A 4PJOG 2E10A 1YITA 1KQ1A 1OZ2A 4C5EA 5GANf 3HP9A 5CIUA 2RD1A 3ZBDA 2DAQA 3LH0A 2QQBA 2E65A 4J7IA 1BI2A 5GMKi 4C0FA 3UPUA 2FL7A 4J6XA 2WSEE 2WSCE 2LC4A 3EFRA 3MEUA 1VQ7A 3L2RA 4QVZA 3GIBA 1UGSB 5HK0A 1YI2T 4C0DC 2DVEA 5AYFA 1Q86U 3WVDB 1BIBA 3HKSA 4VUBA 2K3YA 3L2WA 4EMGA 4HCCA 4M7DA 1EIFA 3HRSA 4M75A 3CCEA 1KHIA 2HQEA 5I21A 5LJ3g 3CCLA 1VQ7T 2YLBA 4A4KA 3RKXA 2QQRA 1QVPA 2A7YA 2EJ9A 3RMQA 3DB3A 3RESA 3J80E 3S6WA 2M16A 3P8DA 5IN1A 5IT9E 3S3MA 4M78G 1Q82U 1M8VA 2EKOA 4XAXB 4B9XA 1WJSA 2LCCA 1UGRB 2RI5A 4M7DF 4M75F 4C8QB 3OA6A 3JCMW 1X01A 3RKYA 2G3RA 3SDZA 2DTHA 2DPPB 3GOXA 5D6XA 2V8KA 3AHUA 4IUPA 4IUVA 1D3BB 1W4SA 2D9TA 3CCJA 4E47A 2VV5A 1VQ6A 1IZ6A 1X6OA 4FT4A 3CMAA 4HT8A 5DLQE 4KUDK 3MP1A 5GAN6 2JUFA 3CPWA 4OB0B 2R5MA 2ZPEB 1HXDA 2LVMA 3M57A 2XHCA 3LX7A 4OVAA 5GAMf 3A5ZB 5A0GA 4IKFA 2KDSA 4XTYA 1VQPA 1YJWT 3J7AF 2HNIA 3CCSA 4MZMA 3VUZA 4C8QE 3GLXA 1N9SA 2PVGB 4A4GA 3L2VA 3CMAT 1Y71A 2OTLT 3CMEA 2DO3A 2Y90A 3OSSC 2DJZA 5GMKj 3M55A 3SFMA 3GPLA 3EAEA 4OB1B 2OTJA 2DXTA 1JBMA 4M77C 1KD1U 3CCST 2KK4A 3L2ZA 4LDVA 5DM7R 4C92D 1Q81C 3L2UA 3A8GB 3CBOA 3LGFA 1VQ5A 4JDSA 5GMKe 5LJ5j 5CKEA 4PJOB 4PJOC 1QP2A 2DXBA 1YCYA 4QVCA 3FB9A 1O9SA 1W2BS 3I56A 2RB6A 4N4GA 3C95A 2VUBA 5LJ5h 1G5VA 5GAN7 2ZPFB 5GANj 2R58A 3JCMf 4M7DD 2VXEA 1QVGA 2DTIA 3OYDA 2CYZB 5A0LA 4M77E 4CRIA 5GANh 3G71A 3OS0A 2RI3A 4OP0A 3DLLA 3JB9G 5GAN5 3SWNB 3URGA 5GMKm 1VQ8A 4PJOE 4IUUA 1M5Q1 3C12A 2DD4A 1UGQB 3G6EA 3PGGA 4RCCA 2XDPA 2L89A 3V8LA 4M78C 5A2QE 3N5BB 3BDUA 4EMHA 1VQ8T 3Q1JA 1YJNT 2GFAA 1BKBA 4C8QG 4J7FA 1FWZA 2MMPA 3QJ6A 3QZ5B 3JCMQ 1K8AC 3QDRB 2P0QA 1JB0E 1WJQA 1QVGS 3CBPA 2RHIA 4ZN1A 3LWIA 4KULA 1NJIC 3G4SA 2IG0A 3A8MB 1YIJA 1WQWA 4XU1A 2K5IA 3SD4A 2VGMA 4OB2B 3CCQT 4C8QA 3GNGA 3FC3A 3HL8A 3OYEA 3OBWA 2LNVA 3GNFB 3OYKA 3LLRA 3OYNA 1VQNA 4QVDA 2GF7A 3OMGA 3NTKA 3MEAA 2XDDA 1Y96B 3M54A 2R57A 3J81E 3M53A 3CCMT 4Z02A 2VYTA 2WSFE 2VGNA 4ZTJA 4LD6A 2QQ9A 3RIRA 1R8OB 3E1SA 2RH2A 2DK3A 5GAMh 1KQ2A 1KHCA 1VQOA 1P92A 2Y4YA 1XOVA 4ZN3A 4JRQA 4ZGEB 3T9NA 5GAN4 5FRNA 1WJRA 5GAN2 2A3LA 2E70A 2RJEA 3ME9A 4HA8A 3CC7A 4LDUA 4C0ZA 4F7UA 1Q86C 4M77A 3RMSA 2XI9A 3HRTA 3OS2A 2JTMA 3R6OA 3FDRA 4BI8B 1BI0A 5GAOr 4PJOA 4X9CA 3I55T 2O4XB 4BUGA 3X20B 1B34B 1YITT 1G3TA 2E41A 2P0KA 1UGPB 2RJCA 1Q82C 5LJ5d 4JJNK 1KQSA 4F7UF 3BY7A 1VQKA 4M77F 3SB2A 3VKIA 3DLMA 3HHTB 1UEBA 1XQHA 3INZA 2CZ1B 5EG2A 2XDBA 5LJ5g 5LJ3f 3JCMh 4C92G 4X9DA 1MGQA 4PJOF 5GANd 3NTHA 3QG1A 5CKHA 2EIFA 1N8RU 1JJ2A 1G3YA 3L42A 3LYIA 4ME7A 3OYCA 1BI1A 1OYXA 4XU3A 4BI4A 3SWNA 1U1TA 5GANg 2F5KA 4Q5WA 2PQWA 4GLKA 5D6WA 2KMTA 2CS7A 1I4K1 4UC4A 2RK1A 1LJOA 3BDLA 1NPRA 3JAME 3KBGA 2ZGWA 3QPHA 2EJGA 2YLCA 3OMCA 5GAOl 1O75A 3CCLT 4M7AD 4C8QC 4BACA 2LX9A 2RA2A 3JB9J 3QYGB 1VQMA 4JUVA 4M78A 1RL2A 2RI2A 3X25B 1TH7A 3A8HB 4KUIA 3S3OA 4PNOA 1KQSS 5J3BA 4A4HA 5FU6B 1BIAA 3CC2A 1WPYA 3MCAB 3QIIA 3G7ZA 3VU3C 4GY5A 4JS4A 5GAOn 5DLOA 2B8AA 1VIEA 1W2BA 1KD1C 2RK2A 1G3SA 2OAUA 1JJ2S 2K2VA 2QI2A 2AHJB 3OSVA 4M78F 4FSXA 3CCJT 4ELYC 4XK8E 4PLLA 2I2LA 3QXEB 1OZ3A 2K3XA 3QYHB 3PMTA 3O8VA 2MWOA 3QKJA 3PMIA 3QZ9B 4HKEA 4B9WA 4E7HA 3V7SA 3RERA 2LQ8A 2HQXA 3VYHB 3JCMV 2PVOB 1BI3A 3M59A 3UT1A 2ZPIB 3KUFA 2GQVA 1VQPT 2L5QA 3OYJA 3CCRA 2HAXA 2EJFA 2EQKA 3MP8A 4QQGA 5J39A 3BW1A 5CK9A 2DKGA 1Q7YU 4XTXA 4HT9A 5GAMd 2O01E 3E19A 2DIQA 2XKOC 3CMET 3A8OB 1I81A 1RI0A 3TREA 2CZ6B 3VJPA 5FROA 2OTJT 5GAMg 4E7IA 2X35A 4MMLA 3MHXA 2QXFA 3NTIA 3CBMA 2ZCFB 3F70A 5LJ5e 1GXIE 1VQ5T 1HK9A 2LTOA 5D6YA 2E64A 2L3RA 1N6AA 4IUTA 4M75D 3OYIA 2DIGA 3NFCA 4BD3A 2KAFA 2LQKA 3OS1A 2M0OA 2D0QB 1M9SA 5CR2A 5GANe 2DTOA 4ZGJB 3JCMb 4R56A 2XG8D 3I56T 1QW1A 2O4XA 1VUBA 1ZBXA 1B34A 2DD5A 2ZPHB 3GF5A 1NE8A 3QJYA 4O5VA 4RG8A 3TCJA 1OI1A 3SWNC 4C92B 2KY9A 3TEEA 4BY6B 3A8LB 1XTDA 1N27A 4FL6A 4C92C 2GFUA 3JRZA 2L8DA 1Y07A 2VXFA 4RG2A 3G71T 3OY9A 4DA4A 3JCMd 4M78D 2MWPA 1VQLA 2CZ0B 3M5AA 1S72A 1MHNA 4FT2A 1KC8U 2DXUA 3C4SA 3CCVA 3JCMg 1ZHIA 3DKMA 4M7DB 2PVDB 4Y91A 4A54A 4MZTA 3G6ET 2QA4A 4O6JA 3KXTA 3OYAA 3CC4A 3JB9F 1IREB 1UB4A 4C92E 4TVRA 3HFNA 1FX7A 4EDUA 3M4GA 4MDWA 3RUXA 3QBYA 4RKUE 1D3BA 3G4ST 1I5LA 1YIJT 2PUKB 4NS5A 5CKFA 5CQYA 3CC4T 3PFSA 4BE0A 3ZFJA 3V8KA 2R5AA 5GAMj 2FHDA 2X4JA 4LD9K 1YJ9A 3C94A 4C8QF 4M7DE 1VQ9A 1M1FA 4M7AG 3CD6A 1VQNT 3HRUA 2E5QA 2H3JA 2X4XA 5GAMe 1YBYA 4JLGA 2XD0A 5I2MA 4D6WA 3OW2A 2QQAA 2BIVA 5DY9A 3OYFA 4XU0A 4IURA 3M9QA 2JVVA 1N9RA 4MZPA 1WNLA 2FB7A 2FVUA 2K5LA 5KCOA 5FLXE 1M1KC 2JOYA 1WQ7A 2FYKA 5LL6S 4OGEA 3DB4A 5HK3A 1VQOT 3FEOA 3HSBA 5M9OA 1N8RC 2ZPBB 3QSUA 1H641 4C5IA 4ELZC 3QHSA 4BE1A 3CC7T 1WGSA 4JRPA 2PU9B 5GMKl 2RHUA 3WVEB 3X28B 2F69A 1G3WA 3OYYA 4MMKA 2MAMA 4RCBA 4L59A 4C0GA 3L2QA 4DOVA 3OYMA 1QVFS 1M1KU 5GAN8 3JB9D 3PIPA 4ZTFA 3OW2S 2K5FA 1XNIA 1NZ9A 1LNXA 3JCMe 5KE3A 1VQKT 4BI3A 4DOWA 1YI2A 2NLUA 2RHZA 3PT9A 4E7LA 4JLIA 4C92A 2K4YA 2EFIA 3S3NA 3PNWC 2BUDA 3M56A 5KE2A 4L5GA 3OS5A 4C8QD 1QP3A 3ASKA 4OMFB 4M7DG 4M75G 2RJFA 4OF1A 2JTFA 3OYHA 5I2SA 2MI6A 4C0DB 3MP6A 4N0AC 5LJ3d 3M4YA 3H6ZA 4KBMB 4BE2A 2KVQG 4C92F 2EQMA 5FU6C 3MEWA 1VIFA 2E1HA 5L8RE 1JRIA 4Y28E 3P8BB 2XIDA 1LOJA 2LCLA 1VQMT 3OYBA 2GCXA 2MF2A 4ZGDB 4FIBA 5HKCA 3CXCA 1I8FA 3OBYA 1Q7YC 3E9FA 1YHQA 1M90C 1U1SA 2M1HA 2DEQA 4C5HA 2LRQA 3X26B 3CC2T 3FJPA 3VV0A 5FRMA 3V7RA 4CI0C 4NL3A 3PIOA 4E7KA 4MDXA 4M7AB 1PSFA 4E7JA 5J26A 4M7AC 2E6ZA 1Y96A 4M77D 5CAIA 1U8RA 1YHQT 4XTVA 3WXMB 3PTAA 3OQ5A 1YJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L1A A;  2VXF A;  3HFO A;  3GIB A;  4EMK B;  4XQ3 A;  4EMK C;  2DVE A;  3JCM d;  4PJO D;  1BIB A;  4M78 D;  4WF2 A;  4EMG A;  4M7D A;  3RIR A;  2DXU A;  4M75 A;  4JRI A;  5GAM h;  1KQ2 A;  5I21 A;  5LJ3 g;  3JCM g;  4M7D B;  5GAO q;  2YLB A;  3RKX A;  4Y91 A;  4A54 A;  2EJ9 A;  2DZ9 A;  3RES A;  5GAN 4;  3EFS A;  5GAN 2;  4M7A E;  1M8V A;  4HA8 A;  4M78 G;  3JB9 F;  4F7U A;  4J6W A;  4M77 A;  4C92 E;  3V7C A;  3HFN A;  2QTX A;  4F7U B;  5GAO p;  3M4G A;  4J5Y A;  4M75 F;  4M77 B;  4C8Q B;  3V8J A;  3JCM W;  4M7D F;  1X01 A;  3RKY A;  5GAO r;  4XTZ A;  2DTH A;  3RUX A;  4DQ2 A;  4PJO A;  1I5L A;  1D3B A;  4X9C A;  5GMK h;  3QO3 A;  1B34 B;  3AHU A;  3JCM c;  2E41 A;  2JN0 A;  1D3B B;  5LJ3 j;  3V8K A;  5LJ5 d;  5GAM j;  3JCM J;  4F7U F;  3BY7 A;  3RKW A;  4M77 F;  3SB2 A;  4C8Q F;  4M7D E;  4M7A G;  4HT8 A;  3QUI A;  3INZ A;  5GAN 6;  5LJ5 g;  5LJ3 f;  5LJ3 h;  3JCM h;  4C92 G;  5GAM f;  1HXD A;  5LJ3 e;  4X9D A;  1MGQ A;  4PJO F;  5GAM e;  5GAN d;  4XTY A;  4M75 B;  4M7D C;  2HNI A;  2VC8 A;  4M75 C;  5DY9 A;  4XU0 A;  4XTW A;  4F7U E;  4XU3 A;  4C8Q E;  1N9R A;  1N9S A;  2EAY A;  1U1T A;  4JRK A;  3SWN A;  4NL2 A;  5GAN g;  1WNL A;  2FB7 A;  2Y90 A;  1WQ7 A;  1I4K 1;  2FYK A;  2DJZ A;  1LJO A;  5GMK j;  2ZGW A;  2EJG A;  2YLC A;  5GAO l;  4N0A A;  4M7A D;  2DXT A;  1JBM A;  4M77 C;  4C8Q C;  3HSB A;  2RA2 A;  3JB9 J;  4XU2 A;  3L2Z A;  3JB9 I;  4C92 D;  3QSU A;  4JUV A;  4M78 A;  3JB9 H;  1H64 1;  5GAN 3;  1TH7 A;  3QHS A;  4PNO A;  5GMK e;  5LJ5 j;  4PJO B;  3BFM A;  5GMK l;  4M78 B;  4PJO C;  1YCY A;  4QVC A;  4MMK A;  3FB9 A;  4RCB A;  1BIA A;  1WPY A;  3VU3 C;  2RB6 A;  4M75 E;  5GAN 8;  3JB9 D;  5LJ5 h;  5GAO n;  2YHT A;  5GAN 7;  5GAN j;  3JCM f;  1LNX A;  3JCM e;  3JCM P;  4M7D D;  2VXE A;  4M78 F;  2DTI A;  2K57 A;  5GAO m;  4XTU A;  4M7A A;  5GAN h;  4M77 E;  2I2L A;  4JLI A;  4C92 A;  3RER A;  4OP0 A;  3V7S A;  2CGH A;  3JB9 G;  5GAN 5;  3SWN B;  3JCM V;  5GMK m;  4PJO E;  4C8Q D;  4EMK A;  1M5Q 1;  4M78 E;  4M7D G;  4V2S A;  4M75 G;  2RM4 A;  3JCM X;  2EJF A;  3BW1 A;  4J6Y A;  2DKG A;  4N0A C;  3FIF A;  4XTX A;  3PGG A;  5LJ3 d;  4RCC A;  5GAM d;  4HT9 A;  4M7A F;  3V8L A;  1I81 A;  4M78 C;  4C92 F;  3BDU A;  2EWN A;  4EMH A;  2E1H A;  4F7U G;  4M77 G;  1JRI A;  4C8Q G;  4NOY A;  4A53 A;  3JCM Q;  5GAM g;  5LJ5 f;  1LOJ A;  4MML A;  5LJ5 e;  2DZC A;  1HK9 A;  1I8F A;  4PJO G;  1WQW A;  4XU1 A;  2E64 A;  4M75 D;  2E10 A;  1KQ1 A;  1U1S A;  4C8Q A;  2DEQ A;  5GAN f;  3FJP A;  3V7R A;  2DTO A;  5GAN e;  2RD1 A;  3JCM b;  4NL3 A;  4M7A B;  1B34 A;  4M7A C;  2E65 A;  1Y96 A;  4QVD A;  5GMK i;  3SWN C;  4C92 B;  4M77 D;  5CAI A;  4J6X A;  4C92 C;  4XTV A;  3EFR A;  1Y96 B; 
#chains in the Genus database with same CATH topology
 1NPP A;  3JSC A;  3OB9 A;  2OTL A;  3BE3 A;  1AHJ B;  4J8O A;  4JRI A;  2KRS A;  2EYQ A;  1M90 R;  1RAB B;  2L2P A;  2PUO B;  2WAC A;  3EFS A;  1YIJ Q;  4DEX A;  5KYX A;  3CCM Q;  4J5Y A;  4M77 B;  4PL6 A;  4CC7 A;  4DQ2 A;  2KRM A;  1BBZ A;  3VUB A;  3QO3 A;  2JZ2 A;  5CKB A;  2JN0 A;  1X75 C;  1QKX A;  3D7S B;  2ZPG B;  2KSS A;  1WHK A;  2V8J A;  3QUI A;  3CPF A;  4FCY A;  4K11 A;  4BDZ A;  4M75 B;  4M7D C;  2VC8 A;  4M75 C;  4Z89 A;  3GP8 A;  1S1N A;  1S72 T;  4RMO A;  4PFZ A;  4A4E A;  3EG1 A;  1YFN A;  1Q81 R;  4R55 A;  1G2B A;  1CSK A;  5GAN 3;  4LN2 A;  4X34 A;  4A4F A;  1PKT A;  1TUC A;  1PSE A;  2C0T A;  2GNC A;  1Y7X A;  3MET A;  2V1R A;  1D1C A;  1M27 C;  4AFQ C;  3JCM P;  4M7A A;  5CVI A;  4QQD A;  3REA B;  5KCH A;  4HCB A;  4PKC C;  4J9D A;  3TU4 K;  4EMK A;  5IXB A;  2RM4 A;  2LT1 A;  1VQM Q;  4J6Y A;  4FW2 A;  3FIF A;  2ABL A;  3CCU T;  2EYY A;  5CO7 A;  3CCJ Q;  3MO8 A;  3CC2 Q;  3OYG A;  4N4H A;  1OQK A;  1UTI A;  1NEG A;  4PJO G;  1KK7 A;  2MCN A;  4OML A;  2RMO A;  1AT1 B;  2CP6 A;  1K76 A;  4J7I A;  3UPU A;  5I22 A;  2WSE E;  2LC4 A;  2WSC E;  3MEU A;  3TVT A;  1UGS B;  2CT3 A;  5HK0 A;  4VUB A;  2F1L A;  3L2W A;  3HRS A;  3CCE A;  2HQE A;  3CCL A;  1VQ7 T;  2DMO A;  2QQR A;  2EJ9 A;  3RES A;  3J80 E;  5IN1 A;  1RAC B;  2JMA A;  2RI5 A;  2X3X D;  4M7D F;  4M75 F;  4C8Q B;  3RKY A;  3SDZ A;  1LPL A;  1X2Q A;  5D6X A;  2O9S A;  1ABQ A;  1W4S A;  1VQ6 A;  1IGU A;  1IGQ A;  4HT8 A;  3MP1 A;  2L0A A;  4LUE A;  3CPW A;  1HXD A;  2LVM A;  5A0G A;  3CCV Q;  3A5Z B;  1YJW T;  1SPK A;  2K6D A;  2QA4 Q;  4A4G A;  3CMA T;  2OTL T;  3I5R A;  3CME A;  2DO3 A;  1QLY A;  4RTY A;  1D09 B;  3M55 A;  1MV0 B;  3EAE A;  1JBM A;  2GTO A;  2LJ3 A;  1KD1 U;  1OEB A;  2FPD A;  4QVC A;  1ZA1 B;  3FB9 A;  1O9S A;  1YJ9 Q;  1VQ9 Q;  4N4G A;  2NUP B;  1G5V A;  1UUE A;  1QVF P;  5A0L A;  4CRI A;  4AG1 C;  2J6F A;  1SRM A;  1FYN A;  2FZK B;  4IUU A;  4PK4 A;  2CP5 A;  2JMC A;  4J9I A;  4M78 C;  3Q1J A;  1BKB A;  2MIO A;  1FWZ A;  3QJ6 A;  2COY A;  2GGR A;  1K1Z A;  2COZ A;  3JV3 A;  3JCM Q;  2P0Q A;  1JB0 E;  2D8H A;  2RHI A;  3LWI A;  1NJI C;  2IG0 A;  1YIJ A;  4XU1 A;  4OB2 B;  1QQJ A;  3FC3 A;  1PHT A;  3HL8 A;  3GNF B;  1YI2 Q;  2ATC B;  4F04 B;  2EVR A;  1SRL A;  3RNJ A;  4X1V A;  2A36 A;  2K79 A;  3M53 A;  2HL3 A;  4GLM A;  3M0Q A;  2JM9 A;  2WSF E;  1AWX A;  2QQ9 A;  1VOM A;  1P92 A;  1I1J A;  4ZN3 A;  4JRQ A;  2RJE A;  1Q86 C;  3A1P A;  4LDU A;  4M77 A;  3RMS A;  2XI9 A;  3VS1 A;  3AT1 B;  2O4X B;  2P0K A;  2X3W D;  1Q82 C;  4JJN K;  3EFO B;  2XMF A;  3INZ A;  5EG2 A;  2J6K A;  4C92 G;  1ZUU A;  3QG1 A;  4J9B A;  5CKH A;  2EIF A;  1N8R U;  1FMK A;  4GLK A;  2A0F B;  2CS7 A;  1I4K 1;  1OX9 A;  2RK1 A;  1LJO A;  3JAM E;  3CCE T;  3CCL T;  5GAO l;  2G6F X;  2RA2 A;  3QYG B;  1VQM A;  4JUV A;  2KT8 A;  2RI2 A;  4KUI A;  1AD5 A;  2X51 A;  5J3B A;  4A4H A;  3CC2 A;  1YWO A;  3TSW A;  3VS6 A;  2DX1 A;  5GAO n;  5DLO A;  1W2B A;  2OAU A;  2HQH A;  4M78 F;  2EW3 A;  1SHF A;  3PVQ A;  4XK8 E;  2H3E B;  1OUL A;  3QXE B;  4PJN A;  1VQ6 T;  4LE9 A;  3PMT A;  2MWO A;  3QKJ A;  3PMI A;  4B9W A;  1QVG P;  1QWE A;  1SHG A;  3JCM V;  2PVO B;  8ATC B;  2ZPI B;  1YJN Q;  4XTX A;  4Z8A A;  3CME T;  3A8O B;  1I81 A;  2DIL A;  5GAM g;  4E7I A;  4MML A;  3MHX A;  3NTI A;  3MJX A;  5D6Y A;  3NFC A;  1WHJ A;  2KE9 A;  1M9S A;  5CR2 A;  5GAN e;  2DTO A;  4R56 A;  3JCM b;  1WXU A;  3QJY A;  1ZBX A;  1B34 A;  2H8H A;  2LMJ A;  1NE8 A;  3GF5 A;  4O5V A;  3CCU Q;  1OI1 A;  3SWN C;  3M0S A;  1JXO A;  3JRZ A;  2DBK A;  1Y07 A;  3EHR A;  3M5A A;  5KYW B;  4FT2 A;  1KC8 U;  4E2F B;  5D7U A;  3C4S A;  2F2V A;  3CCV A;  2V26 A;  1RAD B;  4MZT A;  2QA4 A;  4E7Z A;  4J9G A;  1BB9 A;  1IRE B;  2IIM A;  3HFN A;  2MK5 A;  1NYF A;  4MDW A;  1RUW A;  3HTR A;  4RKU E;  2VKN A;  1YIJ T;  3PFS A;  2A28 A;  1VQ7 Q;  3ZFJ A;  2R5A A;  1YJ9 A;  4M7D E;  1VQ9 A;  2DM1 A;  4D8K A;  1M3B A;  2DL8 A;  4JLG A;  4LXC A;  5DY9 A;  4XU0 A;  4IUR A;  2RN8 A;  3NMZ C;  1HSQ A;  2FB7 A;  2FYK A;  2KEA A;  5LL6 S;  4OGE A;  1PNJ A;  2EBP A;  1F1B B;  3FEO A;  3HSB A;  2SEM A;  1TUG B;  2GTJ A;  1MMD A;  2ZPB B;  1H64 1;  1WGS A;  1C6V X;  2DL5 A;  2PU9 B;  1W1F A;  3OYM A;  3CMA Q;  3PIP A;  1OPL A;  2J6O A;  4ZTF A;  3KFV A;  1XNI A;  1RLQ C;  2RNA A;  4BI3 A;  1YI2 A;  2RHZ A;  2K4Y A;  1QMC A;  1ZX6 A;  2EFI A;  2L3S A;  3M56 A;  3OS5 A;  1QP3 A;  4M7D G;  4M75 G;  2DF6 A;  2RJF A;  4OF1 A;  2FZC B;  3OYH A;  2HEQ A;  3M4Y A;  4KBM B;  2EQM A;  1JRI A;  2D8J A;  3I56 Q;  2NUZ A;  1VQM T;  2VB6 A;  1RAE B;  2MF2 A;  4ZGD B;  2P84 A;  4FIB A;  1U06 A;  1GFD A;  1PKS A;  3X26 B;  3CC2 T;  4CI0 C;  4NL3 A;  4M7A B;  4M7A C;  5IHK A;  2LCS A;  1NLP C;  2DBM A;  4XTV A;  2YDL A;  2RHY A;  4EMK B;  2X4W A;  3NHN A;  4EMK C;  3G6E Q;  1DJ7 B;  2QDY B;  3CEY A;  1TS9 A;  2RO0 A;  4KT0 E;  1GCQ C;  3RBB B;  1KSW A;  2XIC A;  5GAO q;  4FU6 A;  3X24 B;  3G4S Q;  5AT1 B;  5KH6 A;  1HYO A;  4J6W A;  1K4U S;  3V7C A;  2JNG A;  1R0C B;  3H8Z A;  2QTX A;  4F7U B;  5GAO p;  2CH4 W;  4EPC A;  2V8I A;  1K73 C;  4OB3 B;  4RTU A;  4L6V 5;  5GMK h;  3EFO A;  2LDM A;  3JCM J;  3LGL A;  4DBR A;  2XU8 A;  2DXC A;  1VQO Q;  1MND A;  1K73 U;  3CC7 Q;  4NL2 A;  3ZEH A;  2JTE A;  4YTL A;  3CCV T;  1YJN A;  1VQ4 T;  4II1 A;  2P4T A;  3JB9 I;  1U3O A;  2CKK A;  2QA4 T;  3LW5 E;  3BFM A;  1NBE B;  2X4Y A;  1VQK Q;  2YRD A;  2YRV A;  2YHT A;  1KG1 A;  1QVF A;  1BYM A;  3GBQ A;  1YJ9 T;  1PD1 A;  1VQ9 T;  3HPW A;  3CCU A;  4LDX A;  4BB7 A;  3RR6 A;  1K8A U;  1JU5 C;  4V2S A;  3PVL A;  4M78 E;  1WLP B;  4IUQ A;  1NEB A;  2CZ7 B;  4M7A F;  1ZSG A;  1ZQ1 A;  2EWN A;  4OMP A;  1VQ6 Q;  2O88 A;  2NYS A;  5LJ5 f;  2EYW A;  1NJI R;  4LDY A;  2EYX A;  1KQ1 A;  1OZ2 A;  1QWF A;  3HP9 A;  5CIU A;  2QG9 B;  2KNB B;  3ZBD A;  2DAQ A;  2QQB A;  3CME Q;  1BI2 A;  2QAZ A;  5GMK i;  1VQ7 A;  3QDF A;  3GIB A;  1YI2 T;  2DVE A;  1J3T A;  1EIF A;  3LH5 A;  4PJJ A;  1M2V B;  1HD3 A;  5I21 A;  5LJ3 g;  2YLB A;  3RKX A;  2DER A;  2DNU A;  3EGX B;  3RMQ A;  1Q86 R;  3S3M A;  1ZUK A;  4M78 G;  4XAX B;  4B9X A;  1JO8 A;  3OA6 A;  2DPP B;  2RF0 A;  1Q82 R;  3AHU A;  4IUP A;  2LP5 A;  2D9T A;  2AKL A;  3MPU B;  1IZ6 A;  3CMA A;  4KUD K;  5GAN 6;  2X9H A;  2XHC A;  2OI3 A;  2KDS A;  3J7A F;  4QT7 A;  3GLX A;  2PVG B;  2E5K A;  4PJL A;  3OSS C;  2DJZ A;  3SFM A;  4OB1 B;  2DXT A;  4M77 C;  3CCS T;  4LDV A;  5DM7 R;  4ESR A;  3A8G B;  3NGP A;  5LJ5 j;  5CKE A;  2DXB A;  3I56 A;  5LJ5 h;  3JCM f;  2ROL A;  4M7D D;  1EFN A;  2VXE A;  1QVG A;  2DTI A;  3OS0 A;  3DLL A;  5GAN 5;  4AG2 C;  4PJO E;  4GBQ A;  3G6E A;  2LQW A;  1TTH B;  2L89 A;  3V8L A;  3ULR B;  5A2Q E;  1IHW A;  1XJW B;  4EMH A;  1YJN T;  2GFA A;  3A98 A;  2MMP A;  3QZ5 B;  2YUP A;  4E6R A;  4PJM A;  1QVG S;  4RTT A;  1Y0M A;  3RDV A;  3G4S A;  1WQW A;  3SD4 A;  2VGM A;  3OYK A;  1K0S A;  2M51 A;  1B3Q A;  3I5S A;  3H9N A;  4QVD A;  2KT1 A;  2XDD A;  1Y96 B;  3M54 A;  3J81 E;  4F14 A;  2DVJ A;  2VYT A;  4ZTJ A;  4LD6 A;  3RIR A;  1KQ2 A;  2RH2 A;  2DRK A;  1FMV A;  1VQO A;  2Y4Y A;  3T9N A;  3CC7 A;  2QTV A;  4F7U A;  3HRT A;  3OS2 A;  2HKQ B;  4BI8 B;  4A63 B;  3I35 A;  1B34 B;  3X20 B;  9ATC B;  2RJC A;  1UGP B;  5LJ5 d;  1VQK A;  4M77 F;  3REB B;  4M4Z A;  5LJ3 f;  3JCM h;  1MGQ A;  1I07 A;  3NTH A;  1G3Y A;  3L42 A;  3LYI A;  4XU3 A;  4BI4 A;  5GAN g;  2F5K A;  4Q5W A;  5D6W A;  1NPR A;  3KBG A;  2ZGW A;  2YLC A;  4C8Q C;  4BAC A;  2LX9 A;  2KRO A;  4PNO A;  2COW A;  2AKK A;  2QK0 A;  3MCA B;  1T3L A;  3VU3 C;  3G7Z A;  4KRT A;  1KD1 C;  2K2V A;  3OSV A;  2LJ0 A;  4FSX A;  1SEM A;  2ZAE A;  1VQ4 Q;  3QYH B;  4LUD A;  3QZ9 B;  3M0R A;  3VYH B;  1BI3 A;  4AT1 B;  2W10 A;  3CCR A;  3MP8 A;  1Q7Y U;  2DKG A;  1UGV A;  1G83 A;  2O01 E;  3VJP A;  2ED0 A;  1GFC A;  4KH0 B;  3EGU A;  2YWW A;  2JM8 A;  3F70 A;  2ZCF B;  4KH1 B;  3SHW A;  4QKU A;  2E64 A;  4IUT A;  3OYI A;  4BD3 A;  2KXD A;  2LQK A;  2D0Q B;  3I56 T;  4ZGJ B;  1VUB A;  1UFF A;  2CRE A;  4BY6 B;  3A8L B;  1XTD A;  4JJC A;  2VXF A;  4RG2 A;  3OY9 A;  1X43 A;  3JCM d;  1M2V A;  4M78 D;  2MWP A;  1VQL A;  1MHN A;  1VA7 A;  3EGX A;  1ZHI A;  3DKM A;  1YP5 A;  3VRY A;  2PVD B;  4Y91 A;  4A54 A;  1X6B A;  3G6E T;  3KXT A;  3JB9 F;  1YIT Q;  4C92 E;  4DBH A;  4JZ3 A;  1B7T A;  1K73 R;  2PZ1 A;  3RUX A;  5IH2 A;  3G4S T;  1A0N B;  3CC4 T;  1TXQ A;  4J9H A;  4EIK A;  2X4J A;  2BZX A;  4LD9 K;  3C94 A;  4C8Q F;  1RLP C;  4M7A G;  3HRU A;  1GCP A;  5GJV B;  2H3J A;  2X4X A;  1YBY A;  2KYB A;  2QYZ A;  4D6W A;  1EZZ B;  1BK2 A;  3M9Q A;  1RI9 A;  2FVU A;  2FO0 A;  1JJ2 P;  2JOY A;  1WQ7 A;  3DB4 A;  1VQO T;  2EKH A;  2ESW A;  5M9O A;  1N8R C;  3QSU A;  3CC7 T;  3QHS A;  2RQT A;  4JRP A;  5GMK l;  2F69 A;  3VS4 A;  1YCS B;  4C0G A;  3L2Q A;  4R0K A;  4DOV A;  3H0F A;  2DA9 A;  2RQV A;  3EH2 A;  1PM3 A;  2DL3 A;  1LNX A;  1VQP Q;  1VQK T;  3CCS Q;  2DJQ A;  5IHI A;  3S3N A;  1ACM B;  2OTJ Q;  2OAW A;  4C0D B;  5LJ3 d;  2CDT A;  3H6Z A;  2YRC A;  2V1Q A;  5L8R E;  1GRI A;  4Y28 E;  3P8B B;  2QDL A;  4FYX B;  2GCX A;  2HDA A;  2W0Z A;  1M90 C;  1I8F A;  3E9F A;  2D0N A;  2KYM A;  2KGT A;  3VV0 A;  5J26 A;  2YUN A;  1Y96 A;  1PCX A;  3WXM B;  1W6X A;  3L1A A;  2HBP A;  3HFO A;  3H0H A;  1M90 U;  1MMA A;  4PJO D;  1R77 A;  2M0Y A;  4WF2 A;  3VS5 A;  2Y4X A;  2E12 A;  1E6G A;  2D6F A;  3CCR T;  4LDW A;  2DZ9 A;  4J9C A;  1MNE A;  4BDY A;  1KC8 C;  3M0U A;  5CKD A;  5IT9 E;  3FLG A;  3V8J A;  1ZUY A;  1BU1 A;  5CQX A;  4IIO A;  3JCM c;  1MV3 A;  3UWN A;  1SSF A;  2XK0 A;  3LWH A;  1MUZ A;  1TSF A;  3I9Q A;  2LJ1 A;  2O9V A;  1H3Z A;  1ZA2 B;  1Q81 U;  1VQ4 A;  1UJ0 A;  4XTW A;  1Z9Q A;  1FMW A;  4JRK A;  3UDC A;  3OW2 P;  1VQL T;  2LT4 A;  4WCI A;  2RJD A;  1RAI B;  1AOJ A;  2QEX T;  4FM4 B;  2DFU A;  2CP2 A;  4M75 E;  2RHX A;  4B6M A;  5KYY B;  1M4Z A;  2K57 A;  5GAO m;  2BKD N;  4OGC A;  3ER0 A;  4JPB W;  2CP0 A;  2F5T X;  5C0M A;  3VYG A;  4FYY B;  3JCM X;  2IVW A;  5FU7 B;  2HD0 A;  5FU7 C;  5A0D A;  1M1G A;  1V1C A;  2GBQ A;  4M77 G;  4NOY A;  2DZC A;  4ATO A;  2AZS A;  2E10 A;  1YIT A;  2BZ8 A;  2CP7 A;  4ZNX A;  4DEY A;  1LVK A;  4C0F A;  3EG0 A;  2JS2 A;  3H41 A;  2KI7 A;  3HKS A;  2RQW A;  1D1A A;  4EMG A;  4HCC A;  2J06 A;  1KHI A;  3VS0 A;  2L3Q A;  1MMN A;  3DB3 A;  3S6W A;  3P8D A;  2CP3 A;  2EKO A;  2D1X A;  1WJS A;  2LCC A;  2YSQ A;  2G3R A;  4IIM A;  4Y92 A;  4IUV A;  1D3B B;  2HL5 C;  2DRM A;  4E47 A;  5DLQ E;  2JUF A;  4OB0 B;  5GAM f;  3M57 A;  3LX7 A;  4IKF A;  4E7S A;  4XTY A;  1VQP A;  2BTT A;  3CCS A;  4C8Q E;  1OV3 A;  4AFZ C;  1Y71 A;  3CC4 Q;  2Y90 A;  2GQI A;  5GMK j;  4OMN A;  3GPL A;  2OTJ A;  4C92 D;  1YJW A;  2J7I A;  3L2U A;  4CC3 A;  1OX8 A;  3LGF A;  5GMK e;  1MMG A;  5FWB A;  3M0T A;  2YUQ A;  4LNP A;  3CD6 Q;  1KD1 R;  2VUB A;  4HVV A;  5GAN 7;  2R58 A;  2AK5 A;  1AWW A;  2RI3 A;  4PFP A;  3JB9 G;  4WTO B;  4OMO A;  1TOV A;  1M5Q 1;  1SF9 A;  1NG2 A;  2PNI A;  3C12 A;  2DD4 A;  1UGQ B;  1WXT A;  3PGG A;  2MPX C;  4RCC A;  3VRZ A;  1M8M A;  3UA6 A;  3N5B B;  3BDU A;  1VQ8 T;  4C8Q G;  4J7F A;  1K8A C;  4RTW A;  2YUO A;  4D8D A;  2ROT A;  2CUB A;  2K5I A;  1QCF A;  1IRX A;  3GNG A;  4DBQ A;  3OYE A;  3OBW A;  2LNV A;  1RAA B;  1PD0 A;  4CC2 A;  1T3S A;  2EGA A;  3OYN A;  2ED1 A;  5IXF A;  2R57 A;  1R0B G;  3EGD B;  1X2K A;  5FWC A;  2NUT A;  1UHF A;  4Z02 A;  3E1S A;  5GAM h;  4OMQ A;  3G1J A;  1KHC A;  3H0I A;  1XOV A;  5FRN A;  1WJR A;  2A3L A;  2E70 A;  4HA8 A;  1UHC A;  1WYX A;  1BI0 A;  5GAO r;  4PJO A;  4X9C A;  1YIT T;  1G3T A;  3CCR Q;  4F7U F;  3VKI A;  3DLM A;  2HSP A;  1XQH A;  3C0C A;  2QGG A;  2XDB A;  2DYI A;  2EQI A;  4X9D A;  1JJ2 A;  5FW9 A;  2OX7 A;  3OYC A;  1OYX A;  3SWN A;  1U1T A;  1UJY A;  4FW1 A;  2MYS A;  1QCN A;  3BDL A;  3QPH A;  3OMC A;  1N8R R;  5KYU B;  1RL2 A;  5FU6 B;  3EG9 A;  2DLP A;  3QII A;  2CH4 A;  4FYW B;  5KYY A;  4JS4 A;  1VQL Q;  1VIE A;  1G3S A;  1JJ2 S;  4ELY C;  2QEX Q;  4PLL A;  1H92 A;  4HVU A;  3V7S A;  2HQX A;  3M59 A;  3UT1 A;  2GQV A;  1VQP T;  2L5Q A;  1PRL C;  2HAX A;  2EJF A;  1KFZ A;  2EGE A;  5CK9 A;  5GAM d;  3E19 A;  2DIQ A;  3TRE A;  3CCQ Q;  5FRO A;  1H3H A;  2OTJ T;  1H8K A;  5LJ5 e;  2QXF A;  1GXI E;  3CBM A;  1NM7 A;  4M75 D;  2L3R A;  1N6A A;  2DIG A;  2KAF A;  3OS1 A;  2M0O A;  1D0Y A;  1QW1 A;  2DD5 A;  1ZSZ A;  2ZPH B;  4F17 A;  1AZE A;  4RG8 A;  1C0M A;  2KY9 A;  3TEE A;  2GFU A;  4HCK A;  3R6N A;  2HCK A;  1WA7 A;  3VS3 A;  1WHM A;  2JXB A;  2CZ0 B;  2DXU A;  4M7D B;  3I55 Q;  3SEM A;  3CC4 A;  1KC8 R;  4J9E A;  1UB4 A;  4TVR A;  1M2O A;  1T0H A;  3TSZ A;  1PC0 A;  3QBY A;  1D3B A;  3EHQ A;  1I5L A;  2B86 A;  2PUK B;  5CKF A;  4BE0 A;  3V8K A;  2FHD A;  1M1F A;  3EH1 A;  3CD6 A;  3M0P A;  1KQS P;  2XD0 A;  5I2M A;  3OW2 A;  1ARK A;  1QKW A;  2QQA A;  1IB8 A;  1N9R A;  2JVV A;  1M1K C;  2K5L A;  5KCO A;  2EYZ A;  4RTV A;  4AMC A;  5HK3 A;  5IHN A;  1I0C A;  4ELZ C;  1GCQ A;  4FYV B;  2RHU A;  3WVE B;  3X28 B;  3OYY A;  4MMK A;  2MAM A;  4RCB A;  4L59 A;  1T0J A;  1M1K U;  1UE9 A;  3JB9 D;  1D1B A;  1WFW A;  3OW2 S;  2K5F A;  1NZ9 A;  2JT4 A;  4HVW A;  3JCM e;  1KIK A;  4DOW A;  3UA7 A;  4JLI A;  4C92 A;  3PNW C;  2BUD A;  5KE2 A;  1YWP A;  4L5G A;  4C8Q D;  4OMF B;  2MI6 A;  2AT1 B;  1VQ5 Q;  2E3H A;  2KVQ G;  3MEW A;  2BZY A;  2XID A;  3OYB A;  3MKD A;  5HKC A;  3CXC A;  3OBY A;  4KGV B;  1Q7Y C;  4C5H A;  2P4R A;  1AZG B;  3G71 Q;  3V7R A;  3PIO A;  4E7J A;  2JW4 A;  2IPO B;  1VQ8 Q;  1YHQ T;  3EGD A;  1WHL A;  4XQ3 A;  4QQ6 A;  1TU0 B;  4JZ4 A;  1D0Z A;  3M58 A;  2DE0 X;  4C5G A;  3CXC S;  2E6N A;  2M02 A;  1WDX A;  2EQJ A;  3P8H A;  4M7A E;  1GL5 A;  3EG3 A;  1K9M C;  2ZZD A;  3QWY A;  4AFS C;  1SKU B;  3PE0 A;  2BE7 D;  4XTZ A;  1VQN Q;  1FXX A;  4BY6 C;  5LJ3 j;  2M9U A;  3RKW A;  3CPW S;  1AEY A;  1RAF B;  1K9M U;  5LJ3 h;  4HCZ A;  4RTZ A;  5LJ3 e;  3E9G A;  2FRY A;  2VVK A;  4F7U E;  1GBQ A;  4P5N A;  1B07 A;  2QEX A;  1I5O B;  2EAY A;  4J83 A;  1AWO A;  5CCA A;  2A37 A;  2QQS A;  1M3A A;  5KYU A;  4N0A A;  1CKA A;  1V29 B;  4XU2 A;  3JB9 H;  1Y57 A;  4M78 B;  3CCQ A;  5HY6 A;  2DEU A;  2P0P A;  5C6S A;  1G8X A;  4PLI A;  2VWF A;  4JS5 A;  5KYN A;  2SRC A;  4F16 A;  5ECA A;  4XTU A;  5HCK A;  2K7A A;  4QW2 A;  3CCM A;  1M30 A;  3CD6 T;  2FPF A;  2CGH A;  4N4I A;  2FZG B;  3QWX X;  1EX4 A;  1HJD A;  1IHV A;  1NJI U;  1AWJ A;  1Z9Z A;  2O2O A;  2EQU A;  2RQR A;  3MEV A;  1X27 A;  3FRN A;  1K8A R;  3OYL A;  4F7U G;  2C06 A;  2A08 A;  4A53 A;  4DBF A;  5IAY A;  2KQW A;  3I55 A;  1SG5 A;  4C5E A;  5GAN f;  2RD1 A;  2YXY A;  1RAH B;  3LH0 A;  2E65 A;  1GBR A;  2FL7 A;  4J6X A;  3EFR A;  8AT1 B;  1M3C A;  1NLO C;  3L2R A;  4QVZ A;  4C0D C;  5AYF A;  1Q86 U;  3WVD B;  1BIB A;  2K3Y A;  4M7D A;  4M75 A;  4RUG A;  4A4K A;  1QVP A;  2A7Y A;  1M8V A;  2M16 A;  1Q82 U;  2L3P A;  1UGR B;  2O31 A;  3JCM W;  1UDL A;  1OU9 A;  1V76 A;  1X01 A;  2DTH A;  3GOX A;  2V8K A;  1N5Z A;  4FSS A;  2HZY A;  3CCJ A;  1OU8 A;  2E4H A;  1PRM C;  2VV5 A;  1X6O A;  4FT4 A;  1W70 A;  1JXM A;  1S72 Q;  2NUT B;  2DL7 A;  2LZ6 B;  2R5M A;  2ZPE B;  4JJD A;  4OVA A;  2KR3 A;  2I0N A;  2HNI A;  2Z0W A;  2RQU A;  4MZM A;  2C0I A;  3VUZ A;  4CC4 B;  1N9S A;  3L2V A;  2VAS A;  4KGZ B;  3NPF A;  2HMA A;  1Q81 C;  2KK4 A;  3L2Z A;  3CBO A;  1VQ5 A;  4JDS A;  4PJO B;  4PJO C;  1QP2 A;  4OMM A;  1YCY A;  1WHH A;  1W2B S;  2RB6 A;  3C95 A;  1C1A A;  2ZPF B;  5GAN j;  2LQN A;  3OYD A;  2CYZ B;  3VS7 A;  4M77 E;  3ZL7 C;  5GAN h;  3G71 A;  4OP0 A;  1KJW A;  3SWN B;  3URG A;  5GMK m;  1VQ8 A;  2EPD A;  2F2X A;  2DYB A;  1K9A A;  4PFO A;  2ECZ A;  2CUD A;  2XDP A;  3FJ5 A;  2NWM A;  1E6H A;  3QDR B;  3EG9 B;  1WJQ A;  1Q95 G;  5L23 A;  3CBP A;  4ZN1 A;  4KUL A;  1RAG B;  3A8M B;  3CCQ T;  4C8Q A;  3LLR A;  2CSQ A;  1OPK A;  1D0X A;  1VQN A;  2GF7 A;  4J9F A;  3OMG A;  3NTK A;  1TWB A;  3MEA A;  3CCM T;  7AT1 B;  1OOT A;  2VGN A;  1R8O B;  2DK3 A;  3VS2 A;  6AT1 B;  4ZGE B;  5GAN 4;  2FRW A;  5GAN 2;  3ME9 A;  1YHQ Q;  4C0Z A;  2CT4 A;  1BCO A;  1CKB A;  1TG0 A;  3CXC P;  2JTM A;  3R6O A;  3FDR A;  3EG2 A;  5KYX B;  1UEC A;  3I55 T;  4BUG A;  1ZSZ B;  3U23 A;  1ZSZ C;  2E41 A;  1YJW Q;  1KQS A;  2NUP A;  3BY7 A;  2K2M A;  3SB2 A;  3HHT B;  1UEB A;  2OTL Q;  2CZ1 B;  5LJ5 g;  2MOX A;  4PJO F;  2BE9 B;  2HKN A;  5GAN d;  5GJW B;  3CPW P;  4ME7 A;  1BI1 A;  1M1K R;  4JJB A;  1TUD A;  2PQW A;  2KMT A;  2LNH B;  4UC4 A;  1WIE A;  2EJG A;  4M7A D;  1O75 A;  3JB9 J;  1X6G A;  4M78 A;  3X25 B;  1TH7 A;  3A8H B;  3S3O A;  3O5Z A;  1KQS S;  1E7O A;  1VYV A;  1BIA A;  1WPY A;  3UAT A;  4GY5 A;  2B8A A;  2RK2 A;  2QI2 A;  2AHJ B;  3CCJ T;  2K3B A;  2I2L A;  1OZ3 A;  2K3X A;  4HKE A;  3O8V A;  3RER A;  4E7H A;  2LQ8 A;  3KUF A;  2CSI A;  2YT6 A;  3OYJ A;  2J05 A;  1ZLM A;  2EQK A;  4QQG A;  5J39 A;  3BW1 A;  2OJ2 A;  4HT9 A;  2FPE A;  2XKO C;  1RI0 A;  2RPN A;  2CZ6 B;  2PTK A;  2X35 A;  2EGC A;  1Q7Y R;  1VQ5 T;  1HK9 A;  2LTO A;  2F2W A;  3UF4 A;  1YN8 A;  2KBT A;  3IQL A;  2KRN A;  2XG8 D;  2O4X A;  2DET A;  3TCJ A;  4C92 B;  4C92 C;  1N27 A;  4FL6 A;  2L8D A;  5I11 A;  1UG1 A;  1WHG A;  3G71 T;  4DA4 A;  1S72 A;  1X69 A;  2KXC A;  1VYT A;  3JCM g;  2HBW A;  1AVZ C;  4O6J A;  1U5S A;  4ANJ A;  3OYA A;  4Z88 A;  1K9M R;  1IO6 A;  1FX7 A;  4EDU A;  3M4G A;  1LCK A;  4ORZ A;  1ABO A;  4NS5 A;  2AIR B;  5CQY A;  2E3I A;  2K9G A;  5GAM j;  2DL4 A;  2LX7 A;  3TQ7 P;  1IXD A;  3THK A;  1WZO A;  4RTX A;  1VQN T;  4HXJ A;  2ENM A;  2E5Q A;  3CCE Q;  5GAM e;  3CCL Q;  2BIV A;  3OYF A;  4MZP A;  1VYU A;  2FG0 A;  1WNL A;  5FLX E;  2QAS A;  1ZBJ A;  4C5I A;  4BE1 A;  1SSH A;  1G3W A;  5EC7 A;  2JS0 A;  1QVF S;  1WX6 A;  5GAN 8;  2AZV A;  2JJ9 A;  2FEI A;  5KE3 A;  1QCO A;  1W2B P;  1YNZ A;  2HSE B;  2NLU A;  3PT9 A;  4E7L A;  4AFU C;  3CQT A;  3E2U A;  1BCM A;  3ASK A;  2JTF A;  5I2S A;  1WI7 A;  3MP6 A;  5KYW A;  4N0A C;  4BE2 A;  4C92 F;  1WXB A;  5FU6 C;  1K0X A;  1PWT A;  1VIF A;  2E1H A;  1PG5 B;  1LOJ A;  2LCL A;  4KGX B;  1JEG A;  1YHQ A;  2QGF B;  1U1S A;  2M1H A;  2DEQ A;  1JQQ A;  2LRQ A;  3FJP A;  5FRM A;  1NYG A;  4E7K A;  4MDX A;  1PSF A;  2E6Z A;  4M77 D;  5CAI A;  1U8R A;  3PTA A;  3OQ5 A;  2C0O A; 
#chains in the Genus database with same CATH homology
 3L1A A;  2HBP A;  3HFO A;  2RHY A;  4EMK B;  2X4W A;  4XQ3 A;  4EMK C;  1M90 U;  4PJO D;  1NPP A;  1DJ7 B;  2QDY B;  3JSC A;  4QQ6 A;  3OB9 A;  4WF2 A;  3CEY A;  2OTL A;  2RO0 A;  2Y4X A;  4KT0 E;  1AHJ B;  4J8O A;  2E12 A;  4JRI A;  3M58 A;  2D6F A;  2XIC A;  5GAO q;  3CCR T;  4LDW A;  4FU6 A;  4C5G A;  2E6N A;  3CXC S;  2EYQ A;  2DZ9 A;  3X24 B;  2EQJ A;  2PUO B;  2WAC A;  3EFS A;  3P8H A;  4M7A E;  5KH6 A;  4BDY A;  4J6W A;  1KC8 C;  3V7C A;  1K9M C;  2JNG A;  5CKD A;  3FLG A;  3H8Z A;  2ZZD A;  2QTX A;  4F7U B;  5GAO p;  4J5Y A;  4M77 B;  4PL6 A;  4EPC A;  3V8J A;  2V8I A;  4XTZ A;  4DQ2 A;  1K73 C;  4OB3 B;  5CQX A;  3CCE T;  4L6V 5;  3VUB A;  3QO3 A;  5GMK h;  2JZ2 A;  5CKB A;  1FXX A;  4BY6 C;  3JCM c;  2JN0 A;  1X75 C;  2LDM A;  5LJ3 j;  3UWN A;  3JCM J;  1SSF A;  2KSS A;  2M9U A;  2XK0 A;  2ZPG B;  3RKW A;  3LWH A;  3CPW S;  2V8J A;  3QUI A;  3LGL A;  1K9M U;  5LJ3 h;  2XU8 A;  2DXC A;  4HCZ A;  5LJ3 e;  3CPF A;  1H3Z A;  3E9G A;  1VQ6 T;  4BDZ A;  1Q81 U;  4M75 B;  4M7D C;  2VC8 A;  4M75 C;  1VQ4 A;  1K73 U;  4F7U E;  4P5N A;  4XTW A;  3GP8 A;  2QEX A;  2EAY A;  4JRK A;  4J83 A;  4NL2 A;  3UDC A;  1VQL T;  2LT4 A;  3ZEH A;  5CCA A;  1S72 T;  4RMO A;  4A4E A;  4YTL A;  2QQS A;  2RJD A;  3CCV T;  1YJN A;  4N0A A;  4R55 A;  1V29 B;  4XU2 A;  4II1 A;  2P4T A;  3JB9 I;  2QEX T;  1VQ4 T;  4FM4 B;  3JB9 H;  2CKK A;  5GAN 3;  2QA4 T;  3LW5 E;  3BFM A;  4M78 B;  3CCQ A;  4X34 A;  2X4Y A;  4A4F A;  1PSE A;  4M75 E;  1Y7X A;  3MET A;  2RHX A;  2P0P A;  5HY6 A;  2YRV A;  5C6S A;  2YHT A;  1KG1 A;  1QVF A;  1BYM A;  4PLI A;  4JS5 A;  3JCM P;  1M4Z A;  2K57 A;  5GAO m;  4XTU A;  4M7A A;  5CVI A;  1YJ9 T;  2BKD N;  4OGC A;  4QQD A;  4QW2 A;  3HPW A;  5KCH A;  3CCM A;  1VQ9 T;  3CD6 T;  3CCU A;  2CGH A;  3ER0 A;  4PKC C;  4N4I A;  4BB7 A;  4HCB A;  4LDX A;  3TU4 K;  2F5T X;  5C0M A;  3VYG A;  1K8A U;  4EMK A;  4V2S A;  4M78 E;  4IUQ A;  2RM4 A;  2LT1 A;  3JCM X;  2IVW A;  1NJI U;  4J6Y A;  2EQU A;  5FU7 B;  2CZ7 B;  3FIF A;  2HD0 A;  3MEV A;  5FU7 C;  4M7A F;  5A0D A;  1M1G A;  3CCU T;  5CO7 A;  1ZQ1 A;  3FRN A;  2EWN A;  3OYL A;  3MO8 A;  4F7U G;  2C06 A;  4M77 G;  4NOY A;  4A53 A;  5IAY A;  3OYG A;  2KQW A;  5LJ5 f;  4N4H A;  4LDY A;  2DZC A;  4ATO A;  3I55 A;  4PJO G;  2E10 A;  1YIT A;  1KQ1 A;  1OZ2 A;  4C5E A;  5GAN f;  3HP9 A;  5CIU A;  2RD1 A;  3ZBD A;  2DAQ A;  3LH0 A;  2QQB A;  2E65 A;  4J7I A;  1BI2 A;  5GMK i;  4C0F A;  3UPU A;  2FL7 A;  4J6X A;  2WSE E;  2WSC E;  2LC4 A;  3EFR A;  3MEU A;  1VQ7 A;  3L2R A;  4QVZ A;  3GIB A;  1UGS B;  5HK0 A;  1YI2 T;  4C0D C;  2DVE A;  5AYF A;  1Q86 U;  3WVD B;  1BIB A;  3HKS A;  4VUB A;  2K3Y A;  3L2W A;  4EMG A;  4HCC A;  4M7D A;  1EIF A;  3HRS A;  4M75 A;  3CCE A;  1KHI A;  2HQE A;  5I21 A;  5LJ3 g;  3CCL A;  1VQ7 T;  2YLB A;  4A4K A;  3RKX A;  2QQR A;  1QVP A;  2A7Y A;  2EJ9 A;  3RMQ A;  3DB3 A;  3RES A;  3J80 E;  3S6W A;  2M16 A;  3P8D A;  5IN1 A;  5IT9 E;  3S3M A;  4M78 G;  1Q82 U;  1M8V A;  2EKO A;  4XAX B;  4B9X A;  1WJS A;  2LCC A;  1UGR B;  2RI5 A;  4M7D F;  4M75 F;  4C8Q B;  3OA6 A;  3JCM W;  1X01 A;  3RKY A;  2G3R A;  3SDZ A;  2DTH A;  2DPP B;  3GOX A;  5D6X A;  2V8K A;  3AHU A;  4IUP A;  4IUV A;  1D3B B;  1W4S A;  2D9T A;  3CCJ A;  4E47 A;  2VV5 A;  1VQ6 A;  1IZ6 A;  1X6O A;  4FT4 A;  3CMA A;  4HT8 A;  5DLQ E;  4KUD K;  3MP1 A;  5GAN 6;  2JUF A;  3CPW A;  4OB0 B;  2R5M A;  2ZPE B;  1HXD A;  2LVM A;  3M57 A;  2XHC A;  3LX7 A;  4OVA A;  5GAM f;  3A5Z B;  5A0G A;  4IKF A;  2KDS A;  4XTY A;  1VQP A;  1YJW T;  3J7A F;  2HNI A;  3CCS A;  4MZM A;  3VUZ A;  4C8Q E;  3GLX A;  1N9S A;  2PVG B;  4A4G A;  3L2V A;  3CMA T;  1Y71 A;  2OTL T;  3CME A;  2DO3 A;  2Y90 A;  3OSS C;  2DJZ A;  5GMK j;  3M55 A;  3SFM A;  3GPL A;  3EAE A;  4OB1 B;  2OTJ A;  2DXT A;  1JBM A;  4M77 C;  1KD1 U;  3CCS T;  2KK4 A;  3L2Z A;  4LDV A;  5DM7 R;  4C92 D;  1Q81 C;  3L2U A;  3A8G B;  3CBO A;  3LGF A;  1VQ5 A;  4JDS A;  5GMK e;  5LJ5 j;  5CKE A;  4PJO B;  4PJO C;  1QP2 A;  2DXB A;  1YCY A;  4QVC A;  3FB9 A;  1O9S A;  1W2B S;  3I56 A;  2RB6 A;  4N4G A;  3C95 A;  2VUB A;  5LJ5 h;  1G5V A;  5GAN 7;  2ZPF B;  5GAN j;  2R58 A;  3JCM f;  4M7D D;  2VXE A;  1QVG A;  2DTI A;  3OYD A;  2CYZ B;  5A0L A;  4M77 E;  4CRI A;  5GAN h;  3G71 A;  3OS0 A;  2RI3 A;  4OP0 A;  3DLL A;  3JB9 G;  5GAN 5;  3SWN B;  3URG A;  5GMK m;  1VQ8 A;  4PJO E;  4IUU A;  1M5Q 1;  3C12 A;  2DD4 A;  1UGQ B;  3G6E A;  3PGG A;  4RCC A;  2XDP A;  2L89 A;  3V8L A;  4M78 C;  5A2Q E;  3N5B B;  3BDU A;  4EMH A;  1VQ8 T;  3Q1J A;  1YJN T;  2GFA A;  1BKB A;  4C8Q G;  4J7F A;  1FWZ A;  2MMP A;  3QJ6 A;  3QZ5 B;  3JCM Q;  1K8A C;  3QDR B;  2P0Q A;  1JB0 E;  1WJQ A;  1QVG S;  3CBP A;  2RHI A;  4ZN1 A;  3LWI A;  4KUL A;  1NJI C;  3G4S A;  2IG0 A;  3A8M B;  1YIJ A;  1WQW A;  4XU1 A;  2K5I A;  3SD4 A;  2VGM A;  4OB2 B;  3CCQ T;  4C8Q A;  3GNG A;  3FC3 A;  3HL8 A;  3OYE A;  3OBW A;  2LNV A;  3GNF B;  3OYK A;  3LLR A;  3OYN A;  1VQN A;  4QVD A;  2GF7 A;  3OMG A;  3NTK A;  3MEA A;  2XDD A;  1Y96 B;  3M54 A;  2R57 A;  3J81 E;  3M53 A;  3CCM T;  4Z02 A;  2VYT A;  2WSF E;  2VGN A;  4ZTJ A;  4LD6 A;  2QQ9 A;  3RIR A;  1R8O B;  3E1S A;  2RH2 A;  2DK3 A;  5GAM h;  1KQ2 A;  1KHC A;  1VQO A;  1P92 A;  2Y4Y A;  1XOV A;  4ZN3 A;  4JRQ A;  4ZGE B;  3T9N A;  5GAN 4;  5FRN A;  1WJR A;  5GAN 2;  2A3L A;  2E70 A;  2RJE A;  3ME9 A;  4HA8 A;  3CC7 A;  4LDU A;  4C0Z A;  4F7U A;  1Q86 C;  4M77 A;  3RMS A;  2XI9 A;  3HRT A;  3OS2 A;  2JTM A;  3R6O A;  3FDR A;  4BI8 B;  1BI0 A;  5GAO r;  4PJO A;  4X9C A;  3I55 T;  2O4X B;  4BUG A;  3X20 B;  1B34 B;  1YIT T;  1G3T A;  2E41 A;  2P0K A;  1UGP B;  2RJC A;  1Q82 C;  5LJ5 d;  4JJN K;  1KQS A;  4F7U F;  3BY7 A;  1VQK A;  4M77 F;  3SB2 A;  3VKI A;  3DLM A;  3HHT B;  1UEB A;  1XQH A;  3INZ A;  2CZ1 B;  5EG2 A;  2XDB A;  5LJ5 g;  5LJ3 f;  3JCM h;  4C92 G;  4X9D A;  1MGQ A;  4PJO F;  5GAN d;  3NTH A;  3QG1 A;  5CKH A;  2EIF A;  1N8R U;  1JJ2 A;  1G3Y A;  3L42 A;  3LYI A;  4ME7 A;  3OYC A;  1BI1 A;  1OYX A;  4XU3 A;  4BI4 A;  3SWN A;  1U1T A;  5GAN g;  2F5K A;  4Q5W A;  2PQW A;  4GLK A;  5D6W A;  2KMT A;  2CS7 A;  1I4K 1;  4UC4 A;  2RK1 A;  1LJO A;  3BDL A;  1NPR A;  3JAM E;  3KBG A;  2ZGW A;  3QPH A;  2EJG A;  2YLC A;  3OMC A;  5GAO l;  1O75 A;  3CCL T;  4M7A D;  4C8Q C;  4BAC A;  2LX9 A;  2RA2 A;  3JB9 J;  3QYG B;  1VQM A;  4JUV A;  4M78 A;  1RL2 A;  2RI2 A;  3X25 B;  1TH7 A;  3A8H B;  4KUI A;  3S3O A;  4PNO A;  1KQS S;  5J3B A;  4A4H A;  5FU6 B;  1BIA A;  3CC2 A;  1WPY A;  3MCA B;  3QII A;  3G7Z A;  3VU3 C;  4GY5 A;  4JS4 A;  5GAO n;  5DLO A;  2B8A A;  1VIE A;  1W2B A;  1KD1 C;  2RK2 A;  1G3S A;  2OAU A;  1JJ2 S;  2K2V A;  2QI2 A;  2AHJ B;  3OSV A;  4M78 F;  4FSX A;  3CCJ T;  4ELY C;  4XK8 E;  4PLL A;  2I2L A;  3QXE B;  1OZ3 A;  2K3X A;  3QYH B;  3PMT A;  3O8V A;  2MWO A;  3QKJ A;  3PMI A;  3QZ9 B;  4HKE A;  4B9W A;  4E7H A;  3V7S A;  3RER A;  2LQ8 A;  2HQX A;  3VYH B;  3JCM V;  2PVO B;  1BI3 A;  3M59 A;  3UT1 A;  2ZPI B;  3KUF A;  2GQV A;  1VQP T;  2L5Q A;  3OYJ A;  3CCR A;  2HAX A;  2EJF A;  2EQK A;  3MP8 A;  4QQG A;  5J39 A;  3BW1 A;  5CK9 A;  2DKG A;  1Q7Y U;  4XTX A;  4HT9 A;  5GAM d;  2O01 E;  3E19 A;  2DIQ A;  2XKO C;  3CME T;  3A8O B;  1I81 A;  1RI0 A;  3TRE A;  2CZ6 B;  3VJP A;  5FRO A;  2OTJ T;  5GAM g;  4E7I A;  2X35 A;  4MML A;  3MHX A;  2QXF A;  3NTI A;  3CBM A;  2ZCF B;  3F70 A;  5LJ5 e;  1GXI E;  1VQ5 T;  1HK9 A;  2LTO A;  5D6Y A;  2E64 A;  2L3R A;  1N6A A;  4IUT A;  4M75 D;  3OYI A;  2DIG A;  3NFC A;  4BD3 A;  2KAF A;  2LQK A;  3OS1 A;  2M0O A;  2D0Q B;  1M9S A;  5CR2 A;  5GAN e;  2DTO A;  4ZGJ B;  3JCM b;  4R56 A;  2XG8 D;  3I56 T;  1QW1 A;  2O4X A;  1VUB A;  1ZBX A;  1B34 A;  2DD5 A;  2ZPH B;  3GF5 A;  1NE8 A;  3QJY A;  4O5V A;  4RG8 A;  3TCJ A;  1OI1 A;  3SWN C;  4C92 B;  2KY9 A;  3TEE A;  4BY6 B;  3A8L B;  1XTD A;  1N27 A;  4FL6 A;  4C92 C;  2GFU A;  3JRZ A;  2L8D A;  1Y07 A;  2VXF A;  4RG2 A;  3G71 T;  3OY9 A;  4DA4 A;  3JCM d;  4M78 D;  2MWP A;  1VQL A;  2CZ0 B;  3M5A A;  1S72 A;  1MHN A;  4FT2 A;  1KC8 U;  2DXU A;  3C4S A;  3CCV A;  3JCM g;  1ZHI A;  3DKM A;  4M7D B;  2PVD B;  4Y91 A;  4A54 A;  4MZT A;  3G6E T;  2QA4 A;  4O6J A;  3KXT A;  3OYA A;  3CC4 A;  3JB9 F;  1IRE B;  1UB4 A;  4C92 E;  4TVR A;  3HFN A;  1FX7 A;  4EDU A;  3M4G A;  4MDW A;  3RUX A;  3QBY A;  4RKU E;  1D3B A;  3G4S T;  1I5L A;  1YIJ T;  2PUK B;  4NS5 A;  5CKF A;  5CQY A;  3CC4 T;  3PFS A;  4BE0 A;  3ZFJ A;  3V8K A;  2R5A A;  5GAM j;  2FHD A;  2X4J A;  4LD9 K;  1YJ9 A;  3C94 A;  4C8Q F;  4M7D E;  1VQ9 A;  1M1F A;  4M7A G;  3CD6 A;  1VQN T;  3HRU A;  2E5Q A;  2H3J A;  2X4X A;  5GAM e;  1YBY A;  4JLG A;  2XD0 A;  5I2M A;  4D6W A;  3OW2 A;  2QQA A;  2BIV A;  5DY9 A;  3OYF A;  4XU0 A;  4IUR A;  3M9Q A;  2JVV A;  1N9R A;  4MZP A;  1WNL A;  2FB7 A;  2FVU A;  2K5L A;  5KCO A;  5FLX E;  1M1K C;  2JOY A;  1WQ7 A;  2FYK A;  5LL6 S;  4OGE A;  3DB4 A;  5HK3 A;  1VQO T;  3FEO A;  3HSB A;  5M9O A;  1N8R C;  2ZPB B;  3QSU A;  1H64 1;  4C5I A;  4ELZ C;  3QHS A;  4BE1 A;  3CC7 T;  1WGS A;  4JRP A;  2PU9 B;  5GMK l;  2RHU A;  3WVE B;  3X28 B;  2F69 A;  1G3W A;  3OYY A;  4MMK A;  2MAM A;  4RCB A;  4L59 A;  4C0G A;  3L2Q A;  4DOV A;  3OYM A;  1QVF S;  1M1K U;  5GAN 8;  3JB9 D;  3PIP A;  4ZTF A;  3OW2 S;  2K5F A;  1XNI A;  1NZ9 A;  1LNX A;  3JCM e;  5KE3 A;  1VQK T;  4BI3 A;  4DOW A;  1YI2 A;  2NLU A;  2RHZ A;  3PT9 A;  4E7L A;  4JLI A;  4C92 A;  2K4Y A;  2EFI A;  3S3N A;  3PNW C;  2BUD A;  3M56 A;  5KE2 A;  4L5G A;  3OS5 A;  4C8Q D;  1QP3 A;  3ASK A;  4OMF B;  4M7D G;  4M75 G;  2RJF A;  4OF1 A;  2JTF A;  3OYH A;  5I2S A;  2MI6 A;  4C0D B;  3MP6 A;  4N0A C;  5LJ3 d;  3M4Y A;  3H6Z A;  4KBM B;  4BE2 A;  2KVQ G;  4C92 F;  2EQM A;  5FU6 C;  3MEW A;  1VIF A;  2E1H A;  5L8R E;  1JRI A;  4Y28 E;  3P8B B;  2XID A;  1LOJ A;  2LCL A;  1VQM T;  3OYB A;  2GCX A;  2MF2 A;  4ZGD B;  4FIB A;  5HKC A;  3CXC A;  1I8F A;  3OBY A;  1Q7Y C;  3E9F A;  1YHQ A;  1M90 C;  1U1S A;  2M1H A;  2DEQ A;  4C5H A;  2LRQ A;  3X26 B;  3CC2 T;  3FJP A;  3VV0 A;  5FRM A;  3V7R A;  4CI0 C;  4NL3 A;  3PIO A;  4E7K A;  4MDX A;  4M7A B;  1PSF A;  4E7J A;  5J26 A;  4M7A C;  2E6Z A;  1Y96 A;  4M77 D;  5CAI A;  1U8R A;  1YHQ T;  4XTV A;  3WXM B;  3PTA A;  3OQ5 A;  1YJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...