2EKOA

Solution structure of ruh-073, a pseudo chromo domain from human cdna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
87
structure length
87
Chain Sequence
GSSGSSGGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNRRLDEWVTHERLDLKKIQFPKKEAKTPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase HTATIP
publication title Solution structure of RUH-073, a Pseudo Chromo Domain from Human cDNA
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 7
structure length 87
sequence length 87
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ekoA00
2K3XA 2RJCA 3OYDA 3QJ6A 3SD4A 4BDYA 2LTOA 3OYGA 3PNWC 2R57A 3DB3A 2RJDA 4QW2A 3OYFA 3L2UA 3NTHA 2QQRA 2R58A 4IUTA 4B9XA 4A4FA 3L2VA 3M9QA 4C5GA 2EQJA 5FRNA 2JTFA 3OYJA 5C0MA 3O8VA 2NLUA 3EAEA 2X35A 2XK0A 5D6YA 5KH6A 2X4YA 2EQMA 1OZ3A 4A4HA 5M9OA 2LDMA 3OA6A 2RHUA 2LRQA 3P8DA 2G3RA 2X4WA 3OYEA 2CKKA 2LVMA 4GY5A 2BKDN 3PMIA 1WJQA 4HCZA 3OMGA 2RHXA 2GFAA 4N4HA 4UC4A 4C5EA 4CRIA 2DIGA 1SSFA 3FLGA 4A4EA 4BE1A 2YRVA 4FU6A 4PLIA 4EDUA 4IUQA 2L89A 2HQEA 4II1A 3L2QA 3FC3A 5FRMA 4L59A 2QQSA 4IKFA 3L2WA 3QIIA 4QQ6A 3MEVA 3BDLA 4B9WA 3ZEHA 4A4GA 3MEWA 5IAYA 3OYBA 1N27A 2XDPA 3GOXA 3L2RA 4IUVA 3OYNA 1OI1A 3NTIA 5J26A 3KUFA 4QQGA 3S6WA 3S3NA 3MO8A 2WACA 4ZTJA 1MHNA 3S3OA 3LGFA 4C5HA 5KE3A 4E7LA 3OYHA 2R5MA 3UWNA 4PL6A 4E7IA 3OY9A 1OZ2A 3LYIA 3NTKA 2L3RA 2EKOA 1KHCA 4E7HA 2R5AA 2IG0A 2GF7A 5C6SA 3CEYA 4IUUA 4QVZA 4BE0A 2VYTA 2DAQA 4IURA 3OMCA 2M1HA 3MEAA 5J39A 4E7KA 4QQDA 2EFIA 2RHYA 3E9GA 4C5IA 1RI0A 2RI5A 3OYIA 1H3ZA 2DIQA 3PMTA 1XNIA 3LX7A 3E9FA 3MEUA 3MP1A 3FDRA 5CIUA 3MP6A 3OS2A 2PQWA 2RI2A 3OYAA 3OYKA 3P8HA 3DLMA 1G5VA 4E7JA 5IN1A 2LCCA 5D6WA 1OYXA 3DB4A 3OYMA 3S3MA 2F5KA 1WJRA 2E5QA 2EQUA 3LGLA 3META 3PFSA 3Q1JA 3OYCA 2M16A 2HQXA 2MWPA 2P0KA 4RG2A 2L8DA 3FEOA 3OB9A 2M0OA 3OYLA 4X34A 5FROA 5KE2A 3ME9A 2O4XA 3MP8A 2K3YA 4FL6A 4N4GA 2O4XB 2E6NA 2RI3A 3OS1A 3QBYA 3LH0A 2D9TA 3LLRA 2FHDA 3QKJA 5D6XA 4Z02A 2EQKA 2RO0A 4LD6A 4Q5WA 4IUPA 5KCOA 2B8AA 3UT1A 4NS5A 2GFUA 4BE2A 5KCHA 2BIVA 2RJEA 3H6ZA 3OQ5A 4N4IA 2BUDA 4OVAA 2RHIA 3ASKA 2X4XA 3H8ZA 3L42A 4PLLA 3OS0A 4BDZA 2MWOA 2JZ2A 4ZTFA 2RHZA 3F70A 1WGSA 2RJFA 4BACA 4BD3A 3C4SA 1WJSA
chains in the Genus database with same CATH superfamily
2KROA 2YWWA 1YITA 4E6RA 4C8QA 5HKCA 1KQSA 2DEQA 5KYXB 1T3LA 3JB9I 5CKEA 5DM7R 4ZGEB 1AZGB 2K7AA 1OX9A 3GBQA 2KVQG 3CCQA 3RMQA 4QKUA 3G7ZA 2KK4A 4D8DA 5M9OA 1G3SA 4FW2A 2FPDA 1IGQA 1YNZA 5GAN8 1N8RC 4GY5A 3RESA 1NEBA 4C5EA 2QEXA 1RL2A 2O88A 3JSCA 1N8RR 3CMET 1HK9A 1RAIB 4L5GA 4NL2A 1WXUA 5FRMA 1WLPB 4B9WA 1OULA 2YT6A 4OF1A 1YWOA 2H3EB 5KYYB 5KYNA 1VQKT 4X9CA 4OB0B 3J81E 2DYBA 1WXBA 3WXMB 4DBRA 4DQ2A 1X6OA 3CXCP 2GF7A 2V8IA 2DXBA 3JCMc 1VYVA 1I4K1 5LJ3d 3PMTA 1PSEA 1JBMA 3JCMW 3BFMA 1CKAA 2FVUA 3G71Q 3DLMA 4M75E 2ABLA 3LWIA 3OYMA 2QA4A 2RM4A 3LGLA 3G6EA 2EPDA 1Y57A 3CCRQ 3THKA 1NPRA 2VVKA 1Z9ZA 3EG0A 1EX4A 2D1XA 4EMKB 2BIVA 4OVAA 3EGXA 4HCBA 2Y4XA 3CBPA 1OPLA 2HL3A 2LP5A 4R0KA 3PVQA 2L0AA 4NOYA 3EGDA 1Q7YC 3PNWC 1ZHIA 4F7UE 3TEEA 1Q7YR 5GANd 1QVGA 2CYZB 1YI2A 1Q82C 1AOJA 2PUKB 4PK4A 3EAEA 3CCVQ 2X4YA 1Q82R 4M7DF 2RHUA 4J6WA 4CC4B 3A1PA 4M7DC 3SWNB 2OTJT 2NWMA 1AWJA 1VQ6T 3EHQA 2KGTA 1VQ4Q 3L2QA 1W2BA 3A8GB 4XAXB 1N27A 4JRIA 3QUIA 2JM8A 2NUTB 3TU4K 1D09B 1W4SA 2QQBA 2R5MA 4XU3A 1FXXA 2ESWA 1OZ2A 2L3RA 4X9DA 2FYKA 4E7HA 1S72A 2RQUA 3CEYA 2VYTA 1P92A 2RHYA 4C5IA 2DE0X 3G4SA 2EIFA 3JB9G 1VQ5T 2IVWA 3A8HB 1I5OB 4MMLA 2C0TA 1SHFA 2E5QA 2EQUA 3EG2A 2M16A 2DX1A 4MZMA 1OEBA 2QYZA 3MP8A 3CXCS 4DA4A 2O4XB 5FWBA 2RI3A 3VRYA 2P4TA 1M2OA 2DK3A 2VGNA 3VJPA 3G1JA 4Q5WA 3OS5A 1RADB 2RJEA 2XDBA 4KGZB 1B07A 3VS4A 2QTVA 3RKWA 1Q81U 1X2QA 1LOJA 2K3XA 5KYXA 4ELYC 3CCLT 1K1ZA 2DXTA 2EQIA 1MNEA 2CP0A 3NTHA 4B9XA 2LQ8A 4JJDA 2HZYA 2EQJA 1KC8C 1QCNA 4R55A 1W6XA 2NLUA 4PJOF 4FYXB 1QCOA 5KH6A 3FIFA 1KC8R 1SRMA 2E3IA 3I5SA 4M7DB 4PJOC 2M51A 1K73U 5GAOr 2J05A 1X6BA 4J9DA 1GFDA 3G71A 3CD6Q 3VV0A 4PLIA 3CMAQ 1U06A 5I2MA 1GCPA 2YLBA 4KH1B 4QQ6A 3JCMQ 3X25B 3CCRA 1E7OA 2ATCB 2YRDA 8ATCB 3DKMA 3A8OB 3I55T 5A0GA 4F7UB 1Y96B 5LJ3j 3CC7T 3UWNA 2FRWA 4IIOA 2MK5A 3I35A 3V7CA 2KRNA 3JCMb 5C6SA 5A0DA 1QP3A 3VS6A 4CC3A 2EFIA 1LNXA 2M0YA 1ZSZC 1SSHA 1H641 4LNPA 2CP6A 5CIUA 5HCKA 1PHTA 1C6VX 2OTLT 3PIPA 1RLPC 2LJ0A 1QVGP 3OYCA 2MIOA 3CCVA 3OB9A 3OYLA 3C0CA 2DXUA 1NYFA 1ZLMA 3MCAB 1V76A 3E1SA 2FL7A 4F17A 3M0PA 4Z02A 2RO0A 5GJVB 1XOVA 2DBMA 4EMKA 2D0NA 4AMCA 5FLXE 1KIKA 1M30A 1G3WA 2GFUA 4PJOG 2J06A 3CCET 2XI9A 2JXBA 4A4KA 4RTVA 1QMCA 5GANj 4ZN3A 4RCBA 3A5ZB 2BZXA 5LJ5f 1K4US 2ZAEA 2PUOB 1KQ1A 3CCMQ 1TSFA 4C8QG 2V8KA 4BY6B 4C92D 3M0QA 1VQLQ 1EZZB 4F14A 4J83A 1JQQA 1QQJA 1D3BB 5D6YA 2MI6A 2DL3A 5HK0A 1OZ3A 3HP9A 1VQ8Q 1FMKA 3CCSQ 2CP2A 2E70A 2RHXA 2FPFA 3VS1A 2J6OA 3M58A 2HQEA 4PFZA 2DJZA 4PNOA 3FC3A 4DBHA 1BYMA 2K6DA 3SDZA 3GOXA 1UJYA 1NYGA 1AWXA 2QK0A 2NUTA 1SKUB 3S3OA 3A98A 4Y92A 5HY6A 1X69A 1M5Q1 2W0ZA 1KHCA 1UGQB 2DKGA 4CC2A 2AT1B 1U5SA 3H41A 1ZSZB 3M5AA 4RUGA 3OYIA 1M3BA 2JN0A 2JW4A 2QDLA 4J9BA 5HK3A 2RI2A 1WFWA 1R0CB 3CMEQ 2ZPEB 3S3MA 2P0KA 1O75A 2FRYA 1A0NB 1I8FA 2O4XA 2ZZDA 1SG5A 1YJNT 2L2PA 1X43A 5DY9A 1PM3A 4JJBA 1JRIA 3CD6A 2VKNA 2EQKA 1VQKQ 2DMOA 3CMAA 2J7IA 3HHTB 3H8ZA 5LJ3e 1QVGS 2HSPA 1WGSA 4BD3A 2PVGB 1TUDA 2JTEA 5KYWB 4J9IA 1D1AA 4RMOA 1Q95G 2K2MA 3OYGA 2RK2A 1SF9A 2DEUA 1WNLA 4RTXA 3ER0A 4OMMA 4M78F 3CPWA 4PJJA 2E4HA 1BIAA 4M7DA 4M78C 2DPPB 2X4WA 1NJIC 1GBQA 3SHWA 4OMPA 1MV3A 2E41A 2H3JA 3OBWA 1NJIR 1TUGB 1WDXA 1YN8A 2HKNA 3QPHA 1FYNA 4ORZA 1M8VA 3OYNA 1YJWA 1XJWB 4QQGA 1QKWA 3S6WA 2CT3A 4KGXB 2X3XD 3H0FA 1UG1A 5GANe 3VYHB 4ME7A 2KR3A 4C5HA 3L1AA 3OYHA 2D0QB 3QO3A 4PL6A 3EG3A 4LDWA 3JB9D 3NTKA 2AKLA 4RTWA 1SRLA 2XIDA 3EH1A 3EFSA 3OW2P 2W10A 1I5LA 3E9GA 4C92E 2RI5A 1UGVA 4V2SA 3CCMA 2YHTA 5CAIA 1QLYA 3VS3A 2OTJQ 3E9FA 1Y7XA 3MP6A 1VQ6Q 4VUBA 5D7UA 2VXEA 2LCSA 1VQLA 1VQMQ 2IPOB 4OP0A 3RMSA 3M0TA 4MDWA 5GANh 2QG9B 5EC7A 1VQ8A 2E6NA 4EIKA 1RLQC 4OB3B 2EVRA 4Y91A 2A7YA 1AT1B 5LJ5g 4M78G 5KCOA 2DL5A 1TOVA 5ECAA 2RHIA 2FZKB 1M2VA 3HL8A 1DJ7B 2DNUA 2AKKA 3BDUA 2KT8A 3OYDA 1HXDA 2CSIA 1OV3A 2E64A 4BB7A 1VQ5Q 3TREA 1KK7A 4C0ZA 1WQWA 2VV5A 2NYSA 4M78B 1D3BA 2DZCA 4PJOA 1JJ2A 3OYEA 2CKKA 3RNJA 3PMIA 2VWFA 1WIEA 4UC4A 1IO6A 2DIGA 1K0XA 3LWHA 5LJ3g 3CMEA 1VQOT 1JXMA 4JLIA 1ARKA 3A8LB 4FSSA 3RKYA 4OMLA 4L59A 3QIIA 1B7TA 2IIMA 1H8KA 3X26B 1NZ9A 1VOMA 5IAYA 1KD1U 1YP5A 4OMQA 5EG2A 4AFZC 3HFOA 1ZBJA 1PSFA 4ZTJA 4JPBW 3CCLQ 3LGFA 1VQKA 2K79A 4HT9A 4FYYB 2VUBA 4PFPA 3CCJT 3X28B 1FMVA 1BI2A 3SWNC 2RQVA 2JT4A 2EJGA 1M9SA 4XTUA 1ZSZA 5KYUB 2KE9A 2HAXA 1WHMA 3VS5A 1NLPC 3JCMV 1YHQT 4KUIA 2YUPA 4E2FB 1N5ZA 4RG8A 1XQHA 4ANJA 4F04B 3FEOA 4M77E 1OQKA 5FROA 4OMNA 4PJOD 2NUPB 2DTHA 4JZ4A 4N4GA 1EFNA 1G8XA 3OW2S 1K8AU 2K57A 4A53A 2D9TA 1OU8A 3QXEB 4M7AD 2HNIA 4KGVB 3E19A 3CCQT 7AT1B 2B8AA 3H9NA 3FJPA 4C8QD 1M90C 5GAN7 3L42A 3QYGB 2O01E 1M1FA 3QHSA 3VS2A 2HKQB 2D8HA 1M90R 4ZTFA 1D1CA 1BI3A 5KYWA 5CKFA 1WJSA 2QGFB 3P8HA 3PGGA 3ZL7C 2K5IA 1YJ9Q 2R57A 1PCXA 1MMDA 2YXYA 2J6FA 3JCMh 1VQ7T 1U3OA 1W70A 5GAN6 3PIOA 4PJMA 2HQHA 2OTJA 2GFAA 4RTZA 1MUZA 3FLGA 4JJNK 4M75F 3CCUA 2XMFA 5I11A 4E47A 2V26A 1VQMA 4KULA 8AT1B 2SRCA 3CCEQ 4M75C 3MEVA 3ZEHA 2K9GA 2L3QA 3OYBA 3A8MB 3L2RA 5IHKA 2CH4W 2A37A 1AWWA 2ECZA 1D0XA 2QA4T 4ZNXA 3G6ET 2DL7A 3IQLA 1KJWA 4AFUC 3VRZA 2FG0A 3LYIA 4WCIA 1VQNT 3TSZA 2CT4A 4E7KA 1H3ZA 1N8RU 4EPCA 4OGEA 4EMGA 1G5VA 1VQ5A 1IREB 5IN1A 4F7UF 2BE7D 5GAMd 2EYZA 2KBTA 1TH7A 3CBOA 4JRPA 1PWTA 3RERA 4FT4A 3QBYA 1UECA 1YI2T 2FEIA 2YUOA 2COZA 4JRQA 1YCSB 2I0NA 2KAFA 3JB9J 4J6YA 1KQSP 2E6ZA 3ASKA 1MMAA 2P84A 2V1RA 2PZ1A 4BDZA 2DA9A 3M53A 1WX6A 1ZA2B 4BDYA 3QJ6A 3TVTA 4LN2A 2LTOA 3CCLA 4KH0B 2KY9A 2RJDA 1M90U 2DRKA 2V8JA 4IUTA 1AHJB 3M9QA 1JXOA 3REAB 4C5GA 1IHWA 2JTFA 2X4JA 3GNGA 1KQ2A 4M78A 4M77B 1C0MA 2CSQA 2K2VA 2EBPA 1RI9A 2QASA 2LDMA 3I56T 4MDXA 1QVFA 4M7DG 1YJNQ 1UJ0A 2BKDN 2C06A 2SEMA 2LZ6B 4CC7A 2YRVA 4C0GA 1S72T 2JNGA 1RAHB 4M75B 2AHJB 3HRTA 4J7IA 3SB2A 5GAOn 2ENMA 4M7AE 5I22A 1YFNA 2DLPA 1I81A 2Y4YA 4A4GA 4BY6C 4OGCA 1HD3A 4C8QE 5L23A 4FYWB 3M0RA 3MO8A 1Q7YU 4F7UG 3OSVA 3L2ZA 3RR6A 4LUEA 1JU5C 5AT1B 3RUXA 1Q82U 1NPPA 4O6JA 4QVZA 1Q86C 2BZYA 2DM1A 4IURA 2J6KA 1PG5B 4XQ3A 2GTOA 4DOWA 1Q86R 3NMZC 1WYXA 1YJ9A 4MMKA 3OYKA 5GAOq 2P0PA 5KYYA 4KRTA 1UB4A 2G6FX 2XICA 3JCMd 1ZA1B 1H3HA 2KXDA 1LJOA 2K4YA 1D1BA 1K9AA 1IRXA 2NUPA 3VUBA 1WA7A 4C0FA 4HCKA 3TCJA 4DEYA 2MAMA 5GAN4 3WVEB 2LJ3A 3EHRA 1G3YA 4J8OA 2CUBA 2JJ9A 2JS2A 1OOTA 5GMKm 1R77A 4PLLA 3OS0A 1BK2A 4JS5A 3EG1A 1KSWA 2A0FB 4OMOA 3OBYA 1QWEA 1RAEB 2DTIA 2MMPA 3META 3PFSA 3BY7A 3LW5E 2DRMA 2O9SA 3AHUA 4LDUA 3M0SA 2DD5A 3ZFJA 2PNIA 4AT1B 1VQ4A 2C0OA 3HPWA 1KQSS 3OA6A 3JRZA 1W2BP 3EGUA 4HVVA 1BCMA 2XKOC 1M1KC 2KEAA 3HRUA 3NGPA 3WVDB 1UHFA 1ZUYA 1ZUKA 3CBMA 1M1KR 2M02A 3L2WA 3RKXA 4DBFA 2K3BA 4JS4A 4J9EA 2GQVA 2O2OA 4FIBA 2CDTA 3PTAA 3CCVT 3SWNA 1KC8U 4PKCC 1IHVA 2RK1A 1VIFA 2M1HA 5GAMj 2EGCA 1IXDA 1UHCA 5LJ3f 1R8OB 2RQWA 1Y0MA 1YBYA 1PC0A 1VQOQ 2OJ2A 2XHCA 1M4ZA 2L8DA 2M0OA 4J9FA 5CK9A 5KE2A 3P8BB 4ZN1A 5CR2A 2WSCE 2FZCB 2FZGB 1ABOA 1MMGA 5GAN2 2DL4A 3LLRA 1GFCA 1IGUA 4RCCA 3U23A 4NS5A 4FCYA 1WQ7A 1BKBA 1UE9A 2EKHA 3M55A 1ACMB 1G83A 3RBBB 2LJ1A 1RAGB 1O9SA 1NE8A 4ELZC 2ED1A 5DLQE 1YIJT 2ZCFB 3GF5A 3L2UA 1LCKA 2CZ1B 5LL6S 2E1HA 4X1VA 3OYJA 3T9NA 4M77A 3I9QA 3SEMA 5GANf 1N9RA 2VXFA 1U1TA 5GMKj 3HSBA 3P8DA 3UATA 2DZ9A 1WJQA 1QWFA 3M0UA 2GNCA 3QWYA 1SSFA 4DEXA 3CCQQ 1OX8A 4EDUA 2ZPHB 4M75A 2GTJA 2V1QA 2MF2A 2HD0A 3JB9H 2XDPA 3FB9A 3PE0A 4XTVA 1M1KU 3S3NA 2CUDA 1W2BS 1WHLA 1MHNA 2RQTA 6AT1B 2D6FA 4E7IA 2DETA 1K0SA 1M3CA 3MHXA 3OY9A 4FSXA 1K9MC 1VQ7Q 1AD5A 2CP5A 1SHGA 3MEAA 5A0LA 1K9MR 3CMAT 5CKHA 3MEUA 3MP1A 3FDRA 3CXCA 2YSQA 2QQ9A 3KXTA 1QKXA 5FU6C 5D6WA 4F7UA 1OYXA 2CH4A 1WJRA 1Y96A 4HCCA 1KFZA 2DD4A 2LMJA 4J9HA 2YUQA 3CC4T 2E12A 3CQTA 2LNHB 3OSSC 1FWZA 3HRSA 2QA4Q 2GQIA 2KSSA 1NG2A 2DVJA 1VQPT 4EMHA 4BE2A 2MYSA 4QT7A 1VQ9T 2X4XA 1VQNQ 1J3TA 4GLMA 3F70A 2AZVA 2AK5A 2KXCA 1Y07A 3SD4A 5IT9E 3J7AF 2LX9A 5GAMe 3DB3A 4M7DD 2YLCA 3CCSA 4KUDK 2OAWA 1TTHB 4FM4B 1YJWT 1Y71A 5FWCA 2ZPBB 2DF6A 5IHNA 2X35A 2XK0A 4Z8AA 3NPFA 3KBGA 2RPNA 1H92A 2KNBB 2LQKA 1VYUA 4N0AC 4C92F 1JEGA 5FW9A 3OMGA 1YI2Q 4C92C 4A4EA 3UF4A 1B34B 2M9UA 1VQOA 2JMCA 4K11A 4II1A 1OU9A 4HVUA 1UUEA 1VIEA 4ZGDB 5GAMh 5GAN3 4IUVA 1OI1A 3URGA 2X3WD 1BU1A 1BIBA 4R56A 2XD0A 2KT1A 4DOVA 4PJLA 3QSUA 2QAZA 4TVRA 2DTOA 3VUZA 3QYHB 2DYIA 1NEGA 4LDVA 1WHKA 1PRMC 4ZGJB 2ZPGB 4RTTA 4Z89A 3I56Q 1ZUUA 1NJIU 5FU6B 4PFOA 3TQ7P 1X01A 2XDDA 1RABB 2KI7A 2F5KA 3PT9A 2RD1A 5L8RE 2VC8A 3GP8A 2HEQA 1T3SA 1UDLA 3HTRA 2JOYA 4JJCA 1WHJA 2HSEB 3JCMP 1RACB 1U1SA 2EJ9A 2AZSA 3CC2T 3MKDA 2RNAA 5CKBA 2XG8D 2MOXA 4XTXA 5KCHA 3H0HA 2CGHA 3H6ZA 2K5FA 1RAFB 3ZBDA 2JUFA 5LJ5d 3REBB 5GMKh 4C92G 2NUZA 2JM9A 2RMOA 5IHIA 1M8MA 4C0DC 3OS1A 5CCAA 1YITT 5CO7A 2COWA 4F16A 4A54A 5GANg 3CPWP 1WPYA 3NHNA 3JCMe 2VB6A 5J3BA 1AVZC 3I55Q 4D6WA 1VQ7A 2ROTA 9ATCB 3CC7Q 4NL3A 2FB7A 3SFMA 2QI2A 2JS0A 2EGAA 1PRLC 4C92B 1WXTA 4CRIA 2QEXT 4BE1A 4BI8B 2EYWA 1FX7A 2OTLQ 2E5KA 2L5QA 5GAMg 4M77F 2HL5C 2CREA 5CQYA 2JMAA 2LNVA 4M77C 1FMWA 2CP7A 2RN8A 1KG1A 1UFFA 2A28A 4HA8A 1YWPA 1VQ6A 1VQNA 2EKOA 1IB8A 4WTOB 4M7DE 1KHIA 1Q81C 2DAQA 1T0JA 4AFQC 3GPLA 1M3AA 1RI0A 2DL8A 2DIQA 3JB9F 1XNIA 1BI0A 1Q81R 3OYAA 1M1GA 1TWBA 3FJ5A 4BUGA 2A36A 2HQXA 3TSWA 1N9SA 2MCNA 3PVLA 3HKSA 4RTUA 1K73C 3QZ5B 1MGQA 3JCMX 2DVEA 2CZ7B 2FHDA 5IXBA 2LT1A 4LD6A 3ULRB 1K73R 3V8KA 5IXFA 5GJWB 4L6V5 2CZ6B 1LPLA 4C0DB 3EFRA 4MZPA 4BACA 1WZOA 3C4SA 2KYMA 5GAOp 2AIRB 3CCUT 4Y28E 2EW3A 3QG1A 1ZSGA 2OI3A 3BW1A 1VQMT 1QVPA 1T0HA 2DJQA 1GCQC 2QQRA 1K76A 1JJ2P 1RUWA 2YRCA 2RB6A 2YDLA 3RDVA 5C0MA 3V8LA 2OX7A 2WSFE 4ESRA 4M77G 3UA6A 3VYGA 1X2KA 3I56A 2B86A 4OB1B 2I2LA 3JCMJ 3D7SB 3M57A 4N4HA 5GMKl 2KRSA 2ZGWA 3CPWS 1B34A 2X9HA 2L89A 1Z9QA 4YTLA 3C12A 3DLLA 4AG1C 3EFOB 4M75G 3V7RA 2F69A 2QGGA 1UTIA 1QW1A 4E7ZA 5A2QE 1GRIA 2VASA 4M4ZA 4JDSA 3JCMg 2E65A 2PVOB 3KUFA 1D0ZA 3HFNA 1QP2A 1YIJQ 4AFSC 1PNJA 1WI7A 3M56A 1NBEB 2Z0WA 4JUVA 4MZTA 4AG2C 2P4RA 1NLOC 4PJOE 1LVKA 4FW1A 4CI0C 4IUUA 1MV0B 4BE0A 1B3QA 3OMCA 2BTTA 1XTDA 1X75C 2X51A 3G4ST 1PD1A 5IH2A 3GIBA 1W1FA 1BBZA 3OS2A 2F1LA 3I55A 3VS0A 2MWPA 3CC7A 1V1CA 2EJFA 4JLGA 4X34A 3ME9A 4FL6A 1U8RA 5KYUA 5LJ5j 3LH0A 2F2VA 2PTKA 3X20B 1UGPB 1QCFA 1JO8A 4PJNA 1D0YA 2OTLA 1CSKA 4M7AF 2RJFA 2EAYA 4FYVB 4M78D 4M7AC 2RJCA 4C8QF 4WF2A 2KMTA 3UA7A 3QDRB 3C94A 3L2VA 4C8QC 4A4FA 2DBKA 3J80E 1HJDA 3UDCA 2GGRA 2BZ8A 4N0AA 1N6AA 3CCEA 1I1JA 3CC4Q 4C92A 3G71T 2L3PA 5GAOl 1IZ6A 3H0IA 4FU6A 1VQPQ 2LC4A 1BI1A 1JJ2S 1VQ9Q 5I21A 3V7SA 2KYBA 3CCRT 1YJ9T 3AT1B 3CPFA 4LD9K 1PKTA 3X24B 2MPXC 3NTIA 3RIRA 4A63B 2CS7A 5FU7C 5KE3A 1TG0A 4XU1A 1MNDA 3EG9B 2R5AA 4JRKA 1YJWQ 1HSQA 2EYQA 5J39A 4RTYA 2F2XA 3C95A 3VS7A 2LQWA 2PQWA 4DBQA 3OW2A 1YCYA 4HT8A 2LCCA 4HXJA 1M2VB 3Q1JA 4M7AG 4RG2A 3V8JA 4JZ3A 1OPKA 1TXQA 5CVIA 2HDAA 1M27C 2RA2A 1X27A 1VQ4T 4PJOB 2KRMA 4N4IA 1PKSA 2PVDB 1S1NA 4M7AB 1Q86U 5AYFA 2HMAA 3QJYA 4GBQA 2ZPIB 3LH5A 3QDFA 5CQXA 1YIJA 4C8QB 1VUBA 4LXCA 3VU3C 2O31A 1AEYA 3OYYA 1YJNA 4OMFB 2R58A 1QVFP 3QZ9B 1F1BB 2P0QA 2RF0A 5FRNA 1X6GA 4QVDA 2FO0A 4XTWA 2D8JA 3O8VA 2LX7A 3FRNA 2QQAA 3CCJQ 2QXFA 2E10A 2H8HA 3VKIA 5GMKi 5GAOm 2G3RA 2LQNA 2VGMA 1I07A 2HCKA 2LCLA 4HCZA 3CC2Q 2QTXA 4P5NA 3QWXX 1YHQQ 4OB2B 1WHHA 5LJ5e 3EFOA 2DILA 2QQSA 4IKFA 2JTMA 2EGEA 3BDLA 3NFCA 5FU7B 5J26A 4LE9A 3M4YA 1YITQ 2WACA 4D8KA 1R0BG 4E7LA 1ABQA 4KBMB 4J6XA 1UEBA 1ZX6A 4M78E 3GNFB 2KDSA 2IG0A 5DLOA 2E3HA 1V29B 4QQDA 4XU0A 5LJ5h 1HYOA 1SEMA 4KT0E 2OAUA 3LX7A 2A3LA 1CKBA 2QEXQ 4XTZA 4B6MA 4GLKA 3DB4A 4FT2A 5GAN5 1C1AA 1BB9A 5GAMf 2DXCA 1MMNA 2KQWA 3R6NA 2HBWA 2L3SA 3CC4A 3GLXA 1E6GA 3MPUB 3CD6T 3I5RA 2RQRA 5D6XA 1UGSB 5I2SA 2EWNA 4HKEA 4IUPA 1VQPA 2Y90A 3UT1A 1TS9A 2ZPFB 3JV3A 1EIFA 1VA7A 2A08A 2GCXA 1VQ9A 4J7FA 3EGXB 4J9CA 3M4GA 2RHZA 2O9VA 1KD1C 2JVVA 4M77D 2BE9B 5LJ3h 1GCQA 2F2WA 3EGDB 3KFVA 1SPKA 1KD1R 4QW2A 2FPEA 3E2UA 1GL5A 2F5TX 1JB0E 4ATOA 1WHGA 2ROLA 2LT4A 3G6EQ 3INZA 2K5LA 2WSEE 2EQMA 2CZ0B 4A4HA 4M75D 2LRQA 4O5VA 2LVMA 1RAAB 3R6OA 1G3TA 2XU8A 2PU9B 4IUQA 1TU0B 3BE3A 1QVFS 1ZQ1A 2EYYA 4IIMA 3MEWA 3M59A 3N5BB 4LUDA 1K8AC 2EYXA 3MJXA 3CCUQ 1K8AR 1VYTA 4Z88A 1GXIE 3EH2A 4XU2A 4XK8E 3EG9A 4J5YA 2DO3A 3JAME 4RKUE 4BI3A 2RH2A 1BCOA 2DERA 3CCMT 3O5ZA 1I0CA 2HBPA 4LDYA 4E7JA 1E6HA 1TUCA 2ED0A 1VQLT 1AWOA 3OYFA 4QVCA 4LDXA 3CCJA 3JCMf 2COYA 1VQ8T 2K3YA 1PD0A 2CP3A 4J9GA 3CCST 4BI4A 3UPUA 1AZEA 3CC2A 3QKJA 1GBRA 3M54A 4E7SA 1YHQA 1G2BA 4XTYA 2QDYB 2YUNA 5GMKe 3OQ5A 1UGRB 2BUDA 4EMKC 5CKDA 1NM7A 1K9MU 1S72Q 2C0IA 2MWOA 4M7AA 2GBQA 2JZ2A 1ZBXA 2DFUA 3G4SQ 4HVWA
chains in the Genus database with same CATH topology
5GAOp 1YITA 3BY7A 4RMOA 1KQSA 4C8QA 5HKCA 3CCUT 2DEQA 4Y28E 3OYGA 3LW5E 3QG1A 3BW1A 1VQMT 1QVPA 2QQRA 3JB9I 5CKEA 5DM7R 3AHUA 2RK2A 4ZGEB 4LDUA 2RB6A 1WNLA 3ER0A 5C0MA 3V8LA 2DD5A 2WSFE 3ZFJA 4M78F 2KVQG 3CPWA 3CCQA 4M77G 3RMQA 1VQ4A 1BIAA 3HPWA 1KQSS 3G7ZA 2KK4A 4M7DA 4M78C 3VYGA 2DPPB 5M9OA 3OA6A 3I56A 1G3SA 3JRZA 4OB1B 2I2LA 2X4WA 5GAN8 1N8RC 4GY5A 3RESA 3JCMJ 1NJIC 2E41A 3M57A 4N4HA 2XKOC 4C5EA 5GMKl 2QEXA 2ZGWA 3CPWS 1RL2A 2H3JA 3HRUA 3JSCA 3OBWA 1M1KC 1B34A 3QPHA 3WVDB 3CMET 1HK9A 2L89A 4L5GA 4YTLA 3C12A 3DLLA 3CBMA 4NL2A 5FRMA 4M75G 1M8VA 3V7RA 2F69A 3L2WA 1QW1A 5A2QE 4B9WA 3RKXA 4JDSA 3JCMg 4JS4A 2E65A 2PVOB 4OF1A 3OYNA 1YJWA 3KUFA 2GQVA 4QQGA 3S6WA 3HFNA 1QP2A 4FIBA 3PTAA 5GANe 3VYHB 4ME7A 4X9CA 4C5HA 4OB0B 3L1AA 1VQKT 3J81E 3OYHA 2D0QB 3M56A 3QO3A 3CCVT 3SWNA 4PL6A 4LDWA 4JUVA 3JB9D 4MZTA 3WXMB 3NTKA 1KC8U 4PJOE 4DQ2A 4CI0C 4PKCC 1X6OA 2XIDA 2GF7A 3EFSA 2V8IA 2DXBA 4IUUA 3JCMc 4BE0A 2RK1A 1VIFA 2M1HA 3OMCA 5GAMj 1I5LA 1XTDA 1I4K1 3E9GA 1X75C 2RI5A 5LJ3d 4C92E 3G4ST 4V2SA 3CCMA 2YHTA 5CAIA 3PMTA 1PSEA 1JBMA 3JCMW 3GIBA 3BFMA 3E9FA 5LJ3f 1Y7XA 1R8OB 3MP6A 3OS2A 2FVUA 3DLMA 4VUBA 4M75E 3I55A 3LWIA 1YBYA 3OYMA 2QA4A 2VXEA 2RM4A 1VQLA 3META 3LGLA 3G6EA 2XHCA 2MWPA 3CC7A 1M4ZA 2L8DA 4OP0A 2M0OA 5CK9A 2EJFA 3RMSA 4JLGA 4X34A 4MDWA 5GANh 5KE2A 3ME9A 3P8BB 4ZN1A 4FL6A 5CR2A 1Q82U 1VQ8A 1U8RA 2E6NA 5LJ5j 1NPRA 2WSCE 3LH0A 4OB3B 5GAN2 3LLRA 4Y91A 2A7YA 4RCCA 5LJ5g 4EMKB 4M78G 3X20B 5KCOA 4NS5A 1UGPB 1WQ7A 2BIVA 4OVAA 1BKBA 2RHIA 4HCBA 2Y4XA 3M55A 2OTLA 3CBPA 4M7AF 3HL8A 1DJ7B 2RJFA 1O9SA 1NE8A 3BDUA 4ELZC 2EAYA 4M78D 4M7AC 5DLQE 4NOYA 2RJCA 3OYDA 1YIJT 1Q7YC 4C8QF 2ZCFB 1HXDA 3PNWC 3GF5A 4WF2A 3L2UA 2KMTA 1ZHIA 3QDRB 3C94A 4F7UE 3L2VA 4C8QC 2E64A 3TEEA 4A4FA 4BB7A 5GANd 1QVGA 2CZ1B 5LL6S 2E1HA 2CYZB 3OYJA 1YI2A 3T9NA 3TREA 1Q82C 3J80E 4M77A 2PUKB 4C0ZA 1WQWA 2VV5A 4M78B 3EAEA 1D3BA 2DZCA 5GANf 4PJOA 1N9RA 3UDCA 2VXFA 2X4YA 1U1TA 4N0AA 4M7DF 1N6AA 5GMKj 3CCEA 1JJ2A 3HSBA 2RHUA 3P8DA 4J6WA 3OYEA 2CKKA 4C92A 4M7DC 2DZ9A 3PMIA 3SWNB 1WJQA 2OTJT 4UC4A 3G71T 2DIGA 5GAOl 1VQ6T 3LWHA 1SSFA 1IZ6A 5LJ3g 4FU6A 4EDUA 3CMEA 1VQOT 2ZPHB 4M75A 4JLIA 3L2QA 3A8LB 1W2BA 3RKYA 2LC4A 1BI1A 2MF2A 4L59A 1JJ2S 2HD0A 3QIIA 5I21A 3JB9H 3V7SA 3CCRT 3A8GB 3X26B 1NZ9A 4XAXB 1YJ9T 5IAYA 1N27A 2XDPA 3CPFA 3FB9A 4JRIA 4LD9K 1KD1U 3X24B 3NTIA 4XTVA 3RIRA 3QUIA 2CS7A 5EG2A 1M1KU 3HFOA 3S3NA 1PSFA 5FU7C 4ZTJA 1W2BS 1MHNA 3LGFA 3TU4K 1VQKA 5KE3A 4HT9A 2VUBA 1W4SA 2R5MA 2QQBA 4XU3A 3CCJT 2D6FA 3X28B 4E7IA 1BI2A 1FXXA 4XU1A 3MHXA 3OY9A 1OZ2A 4FSXA 2L3RA 3SWNC 4X9DA 2FYKA 4E7HA 2EJGA 2R5AA 1K9MC 4JRKA 1S72A 1M9SA 4XTUA 3CEYA 2VYTA 2HAXA 2EYQA 5J39A 3MEAA 5A0LA 1P92A 2RHYA 4C5IA 3JCMV 1YHQT 3G4SA 4KUIA 3CMAT 2EIFA 3C95A 5CKHA 4RG8A 3MEUA 3MP1A 3FDRA 3CXCA 3JB9G 1XQHA 2PQWA 3OW2A 2QQ9A 3KXTA 1VQ5T 5FU6C 2IVWA 1YCYA 3A8HB 2LCCA 5D6WA 4F7UA 4HT8A 1OYXA 4MMLA 1WJRA 2E5QA 1Y96A 2EQUA 3Q1JA 4HCCA 4M7AG 2M16A 4RG2A 3FEOA 3V8JA 4MZMA 4M77E 4PJOD 5FROA 2DD4A 3MP8A 2DTHA 4N4GA 3CXCS 4DA4A 2O4XB 3OW2S 3CC4T 2E12A 2RI3A 5CVIA 1K8AU 2K57A 3OSSC 1FWZA 4A53A 2D9TA 2P4TA 3HRSA 2DK3A 3QXEB 4M7AD 2VGNA 2KSSA 2HNIA 2RA2A 3VJPA 4Q5WA 3E19A 3CCQT 1VQ4T 4PJOB 1VQPT 2B8AA 3OS5A 4EMHA 4BE2A 2RJEA 3FJPA 4C8QD 4N4IA 5GAN7 1M90C 2XDBA 1VQ9T 2X4XA 3L42A 3QYGB 2O01E 1M1FA 3QHSA 2PVDB 4M7AB 1Q86U 5AYFA 3RKWA 4ZTFA 3F70A 1Q81U 1BI3A 3QJYA 2ZPIB 5CKFA 1LOJA 1WJSA 3P8HA 1Y07A 2K3XA 5CQXA 3PGGA 3SD4A 5IT9E 4ELYC 3CCLT 2LX9A 4C8QB 1VUBA 2K5IA 2DXTA 2R57A 3DB3A 3OYYA 2YLCA 3VU3C 4OMFB 5GAMe 1YJNA 3CCSA 4M7DD 4KUDK 3NTHA 4B9XA 2R58A 2LQ8A 3QZ9B 2EQJA 5FRNA 2P0QA 1KC8C 4QVDA 4R55A 4XTWA 3JCMh 1VQ7T 4FM4B 1YJWT 3O8VA 1Y71A 2NLUA 4PJOF 2ZPBB 3FRNA 2QQAA 2X35A 2XK0A 5KH6A 3FIFA 2QXFA 2E10A 5GAN6 3KBGA 3VKIA 4M7DB 3PIOA 5GMKi 4PJOC 5GAOm 2G3RA 2LQKA 2VGMA 4N0AC 4C92F 1K73U 2OTJA 2LCLA 5GAOr 4HCZA 3OMGA 2GFAA 3G71A 3VV0A 2QTXA 4P5NA 3FLGA 4A4EA 4C92C 4JJNK 4PLIA 1B34B 2M9UA 4OB2B 5LJ5e 1VQOA 4M75F 4II1A 3CCUA 4E47A 1VQMA 5I2MA 2QQSA 4KULA 4IKFA 2JTMA 2YLBA 4M75C 4QQ6A 3JCMQ 3MEVA 3X25B 3BDLA 3NFCA 3CCRA 1VIEA 3ZEHA 4ZGDB 3OYBA 5GAMh 5GAN3 3A8MB 3L2RA 4IUVA 1OI1A 3URGA 5FU7B 3DKMA 5J26A 3A8OB 3I55T 1BIBA 5A0GA 3M4YA 4R56A 4F7UB 2QA4T 2WACA 4DOVA 2XD0A 3QSUA 3G6ET 4E7LA 1Y96B 5LJ3j 4KBMB 3CC7T 4J6XA 4TVRA 3UWNA 1UEBA 2DTOA 3VUZA 4M78E 3QYHB 3LYIA 3V7CA 1VQNT 3GNFB 2KDSA 4LDVA 2IG0A 3JCMb 5C6SA 5DLOA 5A0DA 4E7KA 4ZGJB 1QP3A 1V29B 2ZPGB 4QQDA 2EFIA 1LNXA 4XU0A 1H3ZA 1H641 5LJ5h 4KT0E 2OAUA 4EPCA 1N8RU 1NJIU 3LX7A 2A3LA 5FU6B 5CIUA 4OGEA 4XTZA 4EMGA 1X01A 1G5VA 1VQ5A 1IREB 2XDDA 2OTLT 5IN1A 4GLKA 3PIPA 4F7UF 3DB4A 4FT2A 5GAMd 2F5KA 3PT9A 3PFSA 3OYCA 1TH7A 3CBOA 3CCVA 5GAN5 2RD1A 3OB9A 5L8RE 4JRPA 5GAMf 2DXCA 3OYLA 2VC8A 3GP8A 4FT4A 3RERA 2DXUA 2KQWA 2JOYA 3MCAB 3CC4A 3GLXA 3E1SA 3QBYA 3JCMP 2FL7A 1U1SA 2EJ9A 3CC2T 1YI2T 3CD6T 5D6XA 4Z02A 1UGSB 2RO0A 5CKBA 5I2SA 1XOVA 2EWNA 2XG8D 4EMKA 4JRQA 5FLXE 4HKEA 4IUPA 2KAFA 1VQPA 2Y90A 3UT1A 1G3WA 3JB9J 2GFUA 4PJOG 4XTXA 2ZPFB 4J6YA 5KCHA 3H6ZA 2CGHA 3CCET 1EIFA 2E6ZA 2GCXA 2K5FA 2JUFA 2XI9A 3ASKA 4J7FA 3ZBDA 4A4KA 5LJ5d 1VQ9A 3M4GA 4BDZA 5GANj 4ZN3A 5GMKh 4RCBA 2RHZA 3A5ZB 4C92G 1KD1C 5LJ5f 3M53A 2JVVA 4M77D 5LJ3h 4C0DC 2PUOB 3OS1A 5CCAA 1KQ1A 4BDYA 5CO7A 3QJ6A 1YITT 4A54A 5GANg 3CCLA 1WPYA 2LTOA 4QW2A 2KY9A 2RJDA 4C8QG 3JCMe 1M90U 2V8KA 2V8JA 4IUTA 4BY6B 5J3BA 1AHJB 3M9QA 2F5TX 4C5GA 1JB0E 4C92D 2JTFA 2X4JA 4D6WA 4ATOA 3GNGA 1KQ2A 4M78A 2LT4A 4M77B 1VQ7A 3INZA 4J83A 2K2VA 2K5LA 1D3BB 2FB7A 4NL3A 5D6YA 2MI6A 2WSEE 2EQMA 5HK0A 2CZ0B 1OZ3A 3HP9A 4M75D 2LDMA 4A4HA 3I56T 4MDXA 1QVFA 2LRQA 3SFMA 4M7DG 2QI2A 4O5VA 2LVMA 2BKDN 4C92B 3R6OA 2E70A 2C06A 1G3TA 2RHXA 4CRIA 2QEXT 4BE1A 2YRVA 4C0GA 4BI8B 2JNGA 2XU8A 1S72T 2PU9B 4IUQA 3M58A 2HQEA 4M75B 2AHJB 3HRTA 2DJZA 4J7IA 4PNOA 3SB2A 5GAOn 3FC3A 1QVFS 1FX7A 4M7AE 1ZQ1A 1BYMA 1I81A 2Y4YA 4A4GA 3MEWA 2L5QA 3SDZA 4BY6C 5GAMg 4OGCA 4M77F 3M59A 3N5BB 3GOXA 5CQYA 1K8AC 4C8QE 1VQNA 2LNVA 4M77C 3J7AF 3MO8A 1Q7YU 3S3OA 4F7UG 3OSVA 1KG1A 3L2ZA 1GXIE 4XU2A 4XK8E 5HY6A 1M5Q1 1YIJA 4HA8A 1VQ6A 4J5YA 2DO3A 3RUXA 2EKOA 1KHCA 1UGQB 2DKGA 4RKUE 3JAME 1NPPA 4O6JA 4M7DE 4QVZA 2RH2A 1KHIA 4BI3A 1Q81C 2DAQA 4IURA 1Q86C 3M5AA 3GPLA 1RI0A 3OYIA 4XQ3A 2JN0A 3CCMT 2DIQA 4DOWA 3JB9F 1XNIA 1BI0A 1YJ9A 4MMKA 2HBPA 4LDYA 5HK3A 2RI2A 3OYAA 3OYKA 1M1GA 4E7JA 5GAOq 2P0PA 4BUGA 1UB4A 2XICA 2ZPEB 3S3MA 3JCMd 1VQLT 3OYFA 4QVCA 2P0KA 2HQXA 4LDXA 1LJOA 2K4YA 1N9SA 3CCJA 1O75A 3JCMf 1I8FA 3VUBA 2O4XA 2ZZDA 2K3YA 3HKSA 1VQ8T 4C0FA 1YJNT 3CCST 5DY9A 1K73C 3QZ5B 4BI4A 1MGQA 3JCMX 3UPUA 1JRIA 3TCJA 2DVEA 2CZ7B 3CC2A 3CD6A 2FHDA 2MAMA 2LT1A 3QKJA 5GAN4 3M54A 2EQKA 3WVEB 4LD6A 1YHQA 3V8KA 3CMAA 1G3YA 4J8OA 4XTYA 2QDYB 5GMKe 3OQ5A 1UGRB 2BUDA 3HHTB 4L6V5 4EMKC 5CKDA 5GMKm 2CZ6B 3H8ZA 4PLLA 5LJ3e 3OS0A 1K9MU 1QVGS 2MWOA 4JS5A 4M7AA 4C0DB 3OBYA 2JZ2A 1ZBXA 2DTIA 1WGSA 3EFRA 4MZPA 4BACA 4BD3A 2MMPA 2PVGB 3C4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3X A;  2RJC A;  3OYD A;  3QJ6 A;  3SD4 A;  4BDY A;  2LTO A;  3OYG A;  3PNW C;  2R57 A;  3DB3 A;  2RJD A;  4QW2 A;  3OYF A;  3L2U A;  3NTH A;  2QQR A;  2R58 A;  4IUT A;  4B9X A;  4A4F A;  3L2V A;  3M9Q A;  4C5G A;  2EQJ A;  5FRN A;  2JTF A;  3OYJ A;  5C0M A;  3O8V A;  2NLU A;  3EAE A;  2X35 A;  2XK0 A;  5D6Y A;  5KH6 A;  2X4Y A;  2EQM A;  1OZ3 A;  4A4H A;  5M9O A;  2LDM A;  3OA6 A;  2RHU A;  2LRQ A;  3P8D A;  2G3R A;  2X4W A;  3OYE A;  2CKK A;  2LVM A;  4GY5 A;  2BKD N;  3PMI A;  1WJQ A;  4HCZ A;  3OMG A;  2RHX A;  2GFA A;  4N4H A;  4UC4 A;  4C5E A;  4CRI A;  2DIG A;  1SSF A;  3FLG A;  4A4E A;  4BE1 A;  2YRV A;  4FU6 A;  4PLI A;  4EDU A;  4IUQ A;  2L89 A;  2HQE A;  4II1 A;  3L2Q A;  3FC3 A;  5FRM A;  4L59 A;  2QQS A;  4IKF A;  3L2W A;  3QII A;  4QQ6 A;  3MEV A;  3BDL A;  4B9W A;  3ZEH A;  4A4G A;  3MEW A;  5IAY A;  3OYB A;  1N27 A;  2XDP A;  3GOX A;  3L2R A;  4IUV A;  3OYN A;  1OI1 A;  3NTI A;  5J26 A;  3KUF A;  4QQG A;  3S6W A;  3S3N A;  3MO8 A;  2WAC A;  4ZTJ A;  1MHN A;  3S3O A;  3LGF A;  4C5H A;  5KE3 A;  4E7L A;  3OYH A;  2R5M A;  3UWN A;  4PL6 A;  4E7I A;  3OY9 A;  1OZ2 A;  3LYI A;  3NTK A;  2L3R A;  2EKO A;  1KHC A;  4E7H A;  2R5A A;  2IG0 A;  2GF7 A;  5C6S A;  3CEY A;  4IUU A;  4QVZ A;  4BE0 A;  2VYT A;  2DAQ A;  4IUR A;  3OMC A;  2M1H A;  3MEA A;  5J39 A;  4E7K A;  4QQD A;  2EFI A;  2RHY A;  3E9G A;  4C5I A;  1RI0 A;  2RI5 A;  3OYI A;  1H3Z A;  2DIQ A;  3PMT A;  1XNI A;  3LX7 A;  3E9F A;  3MEU A;  3MP1 A;  3FDR A;  5CIU A;  3MP6 A;  3OS2 A;  2PQW A;  2RI2 A;  3OYA A;  3OYK A;  3P8H A;  3DLM A;  1G5V A;  4E7J A;  5IN1 A;  2LCC A;  5D6W A;  1OYX A;  3DB4 A;  3OYM A;  3S3M A;  2F5K A;  1WJR A;  2E5Q A;  2EQU A;  3LGL A;  3MET A;  3PFS A;  3Q1J A;  3OYC A;  2M16 A;  2HQX A;  2MWP A;  2P0K A;  4RG2 A;  2L8D A;  3FEO A;  3OB9 A;  2M0O A;  3OYL A;  4X34 A;  5FRO A;  5KE2 A;  3ME9 A;  2O4X A;  3MP8 A;  2K3Y A;  4FL6 A;  4N4G A;  2O4X B;  2E6N A;  2RI3 A;  3OS1 A;  3QBY A;  3LH0 A;  2D9T A;  3LLR A;  2FHD A;  3QKJ A;  5D6X A;  4Z02 A;  2EQK A;  2RO0 A;  4LD6 A;  4Q5W A;  4IUP A;  5KCO A;  2B8A A;  3UT1 A;  4NS5 A;  2GFU A;  4BE2 A;  5KCH A;  2BIV A;  2RJE A;  3H6Z A;  3OQ5 A;  4N4I A;  2BUD A;  4OVA A;  2RHI A;  3ASK A;  2X4X A;  3H8Z A;  3L42 A;  4PLL A;  3OS0 A;  4BDZ A;  2MWO A;  2JZ2 A;  4ZTF A;  2RHZ A;  3F70 A;  1WGS A;  2RJF A;  4BAC A;  4BD3 A;  3C4S A;  1WJS A; 
#chains in the Genus database with same CATH topology
 2KRO A;  2YWW A;  1YIT A;  4E6R A;  4C8Q A;  5HKC A;  1KQS A;  2DEQ A;  5KYX B;  1T3L A;  3JB9 I;  5CKE A;  5DM7 R;  4ZGE B;  1AZG B;  2K7A A;  1OX9 A;  3GBQ A;  2KVQ G;  3CCQ A;  3RMQ A;  4QKU A;  3G7Z A;  2KK4 A;  4D8D A;  5M9O A;  1G3S A;  4FW2 A;  2FPD A;  1IGQ A;  1YNZ A;  5GAN 8;  1N8R C;  4GY5 A;  3RES A;  1NEB A;  4C5E A;  2QEX A;  1RL2 A;  2O88 A;  3JSC A;  1N8R R;  3CME T;  1HK9 A;  1RAI B;  4L5G A;  4NL2 A;  1WXU A;  5FRM A;  1WLP B;  4B9W A;  1OUL A;  2YT6 A;  4OF1 A;  1YWO A;  2H3E B;  5KYY B;  5KYN A;  1VQK T;  4X9C A;  4OB0 B;  3J81 E;  2DYB A;  1WXB A;  3WXM B;  4DBR A;  4DQ2 A;  1X6O A;  3CXC P;  2GF7 A;  2V8I A;  2DXB A;  3JCM c;  1VYV A;  1I4K 1;  5LJ3 d;  3PMT A;  1PSE A;  1JBM A;  3JCM W;  3BFM A;  1CKA A;  2FVU A;  3G71 Q;  3DLM A;  4M75 E;  2ABL A;  3LWI A;  3OYM A;  2QA4 A;  2RM4 A;  3LGL A;  3G6E A;  2EPD A;  1Y57 A;  3CCR Q;  3THK A;  1NPR A;  2VVK A;  1Z9Z A;  3EG0 A;  1EX4 A;  2D1X A;  4EMK B;  2BIV A;  4OVA A;  3EGX A;  4HCB A;  2Y4X A;  3CBP A;  1OPL A;  2HL3 A;  2LP5 A;  4R0K A;  3PVQ A;  2L0A A;  4NOY A;  3EGD A;  1Q7Y C;  3PNW C;  1ZHI A;  4F7U E;  3TEE A;  1Q7Y R;  5GAN d;  1QVG A;  2CYZ B;  1YI2 A;  1Q82 C;  1AOJ A;  2PUK B;  4PK4 A;  3EAE A;  3CCV Q;  2X4Y A;  1Q82 R;  4M7D F;  2RHU A;  4J6W A;  4CC4 B;  3A1P A;  4M7D C;  3SWN B;  2OTJ T;  2NWM A;  1AWJ A;  1VQ6 T;  3EHQ A;  2KGT A;  1VQ4 Q;  3L2Q A;  1W2B A;  3A8G B;  4XAX B;  1N27 A;  4JRI A;  3QUI A;  2JM8 A;  2NUT B;  3TU4 K;  1D09 B;  1W4S A;  2QQB A;  2R5M A;  4XU3 A;  1FXX A;  2ESW A;  1OZ2 A;  2L3R A;  4X9D A;  2FYK A;  4E7H A;  1S72 A;  2RQU A;  3CEY A;  2VYT A;  1P92 A;  2RHY A;  4C5I A;  2DE0 X;  3G4S A;  2EIF A;  3JB9 G;  1VQ5 T;  2IVW A;  3A8H B;  1I5O B;  4MML A;  2C0T A;  1SHF A;  2E5Q A;  2EQU A;  3EG2 A;  2M16 A;  2DX1 A;  4MZM A;  1OEB A;  2QYZ A;  3MP8 A;  3CXC S;  4DA4 A;  2O4X B;  5FWB A;  2RI3 A;  3VRY A;  2P4T A;  1M2O A;  2DK3 A;  2VGN A;  3VJP A;  3G1J A;  4Q5W A;  3OS5 A;  1RAD B;  2RJE A;  2XDB A;  4KGZ B;  1B07 A;  3VS4 A;  2QTV A;  3RKW A;  1Q81 U;  1X2Q A;  1LOJ A;  2K3X A;  5KYX A;  4ELY C;  3CCL T;  1K1Z A;  2DXT A;  2EQI A;  1MNE A;  2CP0 A;  3NTH A;  4B9X A;  2LQ8 A;  4JJD A;  2HZY A;  2EQJ A;  1KC8 C;  1QCN A;  4R55 A;  1W6X A;  2NLU A;  4PJO F;  4FYX B;  1QCO A;  5KH6 A;  3FIF A;  1KC8 R;  1SRM A;  2E3I A;  3I5S A;  4M7D B;  4PJO C;  2M51 A;  1K73 U;  5GAO r;  2J05 A;  1X6B A;  4J9D A;  1GFD A;  3G71 A;  3CD6 Q;  3VV0 A;  4PLI A;  3CMA Q;  1U06 A;  5I2M A;  1GCP A;  2YLB A;  4KH1 B;  4QQ6 A;  3JCM Q;  3X25 B;  3CCR A;  1E7O A;  2ATC B;  2YRD A;  8ATC B;  3DKM A;  3A8O B;  3I55 T;  5A0G A;  4F7U B;  1Y96 B;  5LJ3 j;  3CC7 T;  3UWN A;  2FRW A;  4IIO A;  2MK5 A;  3I35 A;  3V7C A;  2KRN A;  3JCM b;  5C6S A;  5A0D A;  1QP3 A;  3VS6 A;  4CC3 A;  2EFI A;  1LNX A;  2M0Y A;  1ZSZ C;  1SSH A;  1H64 1;  4LNP A;  2CP6 A;  5CIU A;  5HCK A;  1PHT A;  1C6V X;  2OTL T;  3PIP A;  1RLP C;  2LJ0 A;  1QVG P;  3OYC A;  2MIO A;  3CCV A;  3OB9 A;  3OYL A;  3C0C A;  2DXU A;  1NYF A;  1ZLM A;  3MCA B;  1V76 A;  3E1S A;  2FL7 A;  4F17 A;  3M0P A;  4Z02 A;  2RO0 A;  5GJV B;  1XOV A;  2DBM A;  4EMK A;  2D0N A;  4AMC A;  5FLX E;  1KIK A;  1M30 A;  1G3W A;  2GFU A;  4PJO G;  2J06 A;  3CCE T;  2XI9 A;  2JXB A;  4A4K A;  4RTV A;  1QMC A;  5GAN j;  4ZN3 A;  4RCB A;  3A5Z B;  2BZX A;  5LJ5 f;  1K4U S;  2ZAE A;  2PUO B;  1KQ1 A;  3CCM Q;  1TSF A;  4C8Q G;  2V8K A;  4BY6 B;  4C92 D;  3M0Q A;  1VQL Q;  1EZZ B;  4F14 A;  4J83 A;  1JQQ A;  1QQJ A;  1D3B B;  5D6Y A;  2MI6 A;  2DL3 A;  5HK0 A;  1OZ3 A;  3HP9 A;  1VQ8 Q;  1FMK A;  3CCS Q;  2CP2 A;  2E70 A;  2RHX A;  2FPF A;  3VS1 A;  2J6O A;  3M58 A;  2HQE A;  4PFZ A;  2DJZ A;  4PNO A;  3FC3 A;  4DBH A;  1BYM A;  2K6D A;  3SDZ A;  3GOX A;  1UJY A;  1NYG A;  1AWX A;  2QK0 A;  2NUT A;  1SKU B;  3S3O A;  3A98 A;  4Y92 A;  5HY6 A;  1X69 A;  1M5Q 1;  2W0Z A;  1KHC A;  1UGQ B;  2DKG A;  4CC2 A;  2AT1 B;  1U5S A;  3H41 A;  1ZSZ B;  3M5A A;  4RUG A;  3OYI A;  1M3B A;  2JN0 A;  2JW4 A;  2QDL A;  4J9B A;  5HK3 A;  2RI2 A;  1WFW A;  1R0C B;  3CME Q;  2ZPE B;  3S3M A;  2P0K A;  1O75 A;  2FRY A;  1A0N B;  1I8F A;  2O4X A;  2ZZD A;  1SG5 A;  1YJN T;  2L2P A;  1X43 A;  5DY9 A;  1PM3 A;  4JJB A;  1JRI A;  3CD6 A;  2VKN A;  2EQK A;  1VQK Q;  2DMO A;  3CMA A;  2J7I A;  3HHT B;  3H8Z A;  5LJ3 e;  1QVG S;  2HSP A;  1WGS A;  4BD3 A;  2PVG B;  1TUD A;  2JTE A;  5KYW B;  4J9I A;  1D1A A;  4RMO A;  1Q95 G;  2K2M A;  3OYG A;  2RK2 A;  1SF9 A;  2DEU A;  1WNL A;  4RTX A;  3ER0 A;  4OMM A;  4M78 F;  3CPW A;  4PJJ A;  2E4H A;  1BIA A;  4M7D A;  4M78 C;  2DPP B;  2X4W A;  1NJI C;  1GBQ A;  3SHW A;  4OMP A;  1MV3 A;  2E41 A;  2H3J A;  3OBW A;  1NJI R;  1TUG B;  1WDX A;  1YN8 A;  2HKN A;  3QPH A;  1FYN A;  4ORZ A;  1M8V A;  3OYN A;  1YJW A;  1XJW B;  4QQG A;  1QKW A;  3S6W A;  2CT3 A;  4KGX B;  2X3X D;  3H0F A;  1UG1 A;  5GAN e;  3VYH B;  4ME7 A;  2KR3 A;  4C5H A;  3L1A A;  3OYH A;  2D0Q B;  3QO3 A;  4PL6 A;  3EG3 A;  4LDW A;  3JB9 D;  3NTK A;  2AKL A;  4RTW A;  1SRL A;  2XID A;  3EH1 A;  3EFS A;  3OW2 P;  2W10 A;  1I5L A;  3E9G A;  4C92 E;  2RI5 A;  1UGV A;  4V2S A;  3CCM A;  2YHT A;  5CAI A;  1QLY A;  3VS3 A;  2OTJ Q;  3E9F A;  1Y7X A;  3MP6 A;  1VQ6 Q;  4VUB A;  5D7U A;  2VXE A;  2LCS A;  1VQL A;  1VQM Q;  2IPO B;  4OP0 A;  3RMS A;  3M0T A;  4MDW A;  5GAN h;  2QG9 B;  5EC7 A;  1VQ8 A;  2E6N A;  4EIK A;  1RLQ C;  4OB3 B;  2EVR A;  4Y91 A;  2A7Y A;  1AT1 B;  5LJ5 g;  4M78 G;  5KCO A;  2DL5 A;  1TOV A;  5ECA A;  2RHI A;  2FZK B;  1M2V A;  3HL8 A;  1DJ7 B;  2DNU A;  2AKK A;  3BDU A;  2KT8 A;  3OYD A;  1HXD A;  2CSI A;  1OV3 A;  2E64 A;  4BB7 A;  1VQ5 Q;  3TRE A;  1KK7 A;  4C0Z A;  1WQW A;  2VV5 A;  2NYS A;  4M78 B;  1D3B A;  2DZC A;  4PJO A;  1JJ2 A;  3OYE A;  2CKK A;  3RNJ A;  3PMI A;  2VWF A;  1WIE A;  4UC4 A;  1IO6 A;  2DIG A;  1K0X A;  3LWH A;  5LJ3 g;  3CME A;  1VQO T;  1JXM A;  4JLI A;  1ARK A;  3A8L B;  4FSS A;  3RKY A;  4OML A;  4L59 A;  3QII A;  1B7T A;  2IIM A;  1H8K A;  3X26 B;  1NZ9 A;  1VOM A;  5IAY A;  1KD1 U;  1YP5 A;  4OMQ A;  5EG2 A;  4AFZ C;  3HFO A;  1ZBJ A;  1PSF A;  4ZTJ A;  4JPB W;  3CCL Q;  3LGF A;  1VQK A;  2K79 A;  4HT9 A;  4FYY B;  2VUB A;  4PFP A;  3CCJ T;  3X28 B;  1FMV A;  1BI2 A;  3SWN C;  2RQV A;  2JT4 A;  2EJG A;  1M9S A;  4XTU A;  1ZSZ A;  5KYU B;  2KE9 A;  2HAX A;  1WHM A;  3VS5 A;  1NLP C;  3JCM V;  1YHQ T;  4KUI A;  2YUP A;  4E2F B;  1N5Z A;  4RG8 A;  1XQH A;  4ANJ A;  4F04 B;  3FEO A;  4M77 E;  1OQK A;  5FRO A;  4OMN A;  4PJO D;  2NUP B;  2DTH A;  4JZ4 A;  4N4G A;  1EFN A;  1G8X A;  3OW2 S;  1K8A U;  2K57 A;  4A53 A;  2D9T A;  1OU8 A;  3QXE B;  4M7A D;  2HNI A;  4KGV B;  3E19 A;  3CCQ T;  7AT1 B;  2B8A A;  3H9N A;  3FJP A;  4C8Q D;  1M90 C;  5GAN 7;  3L42 A;  3QYG B;  2O01 E;  1M1F A;  3QHS A;  3VS2 A;  2HKQ B;  2D8H A;  1M90 R;  4ZTF A;  1D1C A;  1BI3 A;  5KYW A;  5CKF A;  1WJS A;  2QGF B;  3P8H A;  3PGG A;  3ZL7 C;  2K5I A;  1YJ9 Q;  2R57 A;  1PCX A;  1MMD A;  2YXY A;  2J6F A;  3JCM h;  1VQ7 T;  1U3O A;  1W70 A;  5GAN 6;  3PIO A;  4PJM A;  2HQH A;  2OTJ A;  2GFA A;  4RTZ A;  1MUZ A;  3FLG A;  4JJN K;  4M75 F;  3CCU A;  2XMF A;  5I11 A;  4E47 A;  2V26 A;  1VQM A;  4KUL A;  8AT1 B;  2SRC A;  3CCE Q;  4M75 C;  3MEV A;  3ZEH A;  2K9G A;  2L3Q A;  3OYB A;  3A8M B;  3L2R A;  5IHK A;  2CH4 W;  2A37 A;  1AWW A;  2ECZ A;  1D0X A;  2QA4 T;  4ZNX A;  3G6E T;  2DL7 A;  3IQL A;  1KJW A;  4AFU C;  3VRZ A;  2FG0 A;  3LYI A;  4WCI A;  1VQN T;  3TSZ A;  2CT4 A;  4E7K A;  1H3Z A;  1N8R U;  4EPC A;  4OGE A;  4EMG A;  1G5V A;  1VQ5 A;  1IRE B;  5IN1 A;  4F7U F;  2BE7 D;  5GAM d;  2EYZ A;  2KBT A;  1TH7 A;  3CBO A;  4JRP A;  1PWT A;  3RER A;  4FT4 A;  3QBY A;  1UEC A;  1YI2 T;  2FEI A;  2YUO A;  2COZ A;  4JRQ A;  1YCS B;  2I0N A;  2KAF A;  3JB9 J;  4J6Y A;  1KQS P;  2E6Z A;  3ASK A;  1MMA A;  2P84 A;  2V1R A;  2PZ1 A;  4BDZ A;  2DA9 A;  3M53 A;  1WX6 A;  1ZA2 B;  4BDY A;  3QJ6 A;  3TVT A;  4LN2 A;  2LTO A;  3CCL A;  4KH0 B;  2KY9 A;  2RJD A;  1M90 U;  2DRK A;  2V8J A;  4IUT A;  1AHJ B;  3M9Q A;  1JXO A;  3REA B;  4C5G A;  1IHW A;  2JTF A;  2X4J A;  3GNG A;  1KQ2 A;  4M78 A;  4M77 B;  1C0M A;  2CSQ A;  2K2V A;  2EBP A;  1RI9 A;  2QAS A;  2LDM A;  3I56 T;  4MDX A;  1QVF A;  4M7D G;  1YJN Q;  1UJ0 A;  2BKD N;  2C06 A;  2SEM A;  2LZ6 B;  4CC7 A;  2YRV A;  4C0G A;  1S72 T;  2JNG A;  1RAH B;  4M75 B;  2AHJ B;  3HRT A;  4J7I A;  3SB2 A;  5GAO n;  2ENM A;  4M7A E;  5I22 A;  1YFN A;  2DLP A;  1I81 A;  2Y4Y A;  4A4G A;  4BY6 C;  4OGC A;  1HD3 A;  4C8Q E;  5L23 A;  4FYW B;  3M0R A;  3MO8 A;  1Q7Y U;  4F7U G;  3OSV A;  3L2Z A;  3RR6 A;  4LUE A;  1JU5 C;  5AT1 B;  3RUX A;  1Q82 U;  1NPP A;  4O6J A;  4QVZ A;  1Q86 C;  2BZY A;  2DM1 A;  4IUR A;  2J6K A;  1PG5 B;  4XQ3 A;  2GTO A;  4DOW A;  1Q86 R;  3NMZ C;  1WYX A;  1YJ9 A;  4MMK A;  3OYK A;  5GAO q;  2P0P A;  5KYY A;  4KRT A;  1UB4 A;  2G6F X;  2XIC A;  3JCM d;  1ZA1 B;  1H3H A;  2KXD A;  1LJO A;  2K4Y A;  1D1B A;  1K9A A;  1IRX A;  2NUP A;  3VUB A;  1WA7 A;  4C0F A;  4HCK A;  3TCJ A;  4DEY A;  2MAM A;  5GAN 4;  3WVE B;  2LJ3 A;  3EHR A;  1G3Y A;  4J8O A;  2CUB A;  2JJ9 A;  2JS2 A;  1OOT A;  5GMK m;  1R77 A;  4PLL A;  3OS0 A;  1BK2 A;  4JS5 A;  3EG1 A;  1KSW A;  2A0F B;  4OMO A;  3OBY A;  1QWE A;  1RAE B;  2DTI A;  2MMP A;  3MET A;  3PFS A;  3BY7 A;  3LW5 E;  2DRM A;  2O9S A;  3AHU A;  4LDU A;  3M0S A;  2DD5 A;  3ZFJ A;  2PNI A;  4AT1 B;  1VQ4 A;  2C0O A;  3HPW A;  1KQS S;  3OA6 A;  3JRZ A;  1W2B P;  3EGU A;  4HVV A;  1BCM A;  2XKO C;  1M1K C;  2KEA A;  3HRU A;  3NGP A;  3WVD B;  1UHF A;  1ZUY A;  1ZUK A;  3CBM A;  1M1K R;  2M02 A;  3L2W A;  3RKX A;  4DBF A;  2K3B A;  4JS4 A;  4J9E A;  2GQV A;  2O2O A;  4FIB A;  2CDT A;  3PTA A;  3CCV T;  3SWN A;  1KC8 U;  4PKC C;  1IHV A;  2RK1 A;  1VIF A;  2M1H A;  5GAM j;  2EGC A;  1IXD A;  1UHC A;  5LJ3 f;  1R8O B;  2RQW A;  1Y0M A;  1YBY A;  1PC0 A;  1VQO Q;  2OJ2 A;  2XHC A;  1M4Z A;  2L8D A;  2M0O A;  4J9F A;  5CK9 A;  5KE2 A;  3P8B B;  4ZN1 A;  5CR2 A;  2WSC E;  2FZC B;  2FZG B;  1ABO A;  1MMG A;  5GAN 2;  2DL4 A;  3LLR A;  1GFC A;  1IGU A;  4RCC A;  3U23 A;  4NS5 A;  4FCY A;  1WQ7 A;  1BKB A;  1UE9 A;  2EKH A;  3M55 A;  1ACM B;  1G83 A;  3RBB B;  2LJ1 A;  1RAG B;  1O9S A;  1NE8 A;  4ELZ C;  2ED1 A;  5DLQ E;  1YIJ T;  2ZCF B;  3GF5 A;  3L2U A;  1LCK A;  2CZ1 B;  5LL6 S;  2E1H A;  4X1V A;  3OYJ A;  3T9N A;  4M77 A;  3I9Q A;  3SEM A;  5GAN f;  1N9R A;  2VXF A;  1U1T A;  5GMK j;  3HSB A;  3P8D A;  3UAT A;  2DZ9 A;  1WJQ A;  1QWF A;  3M0U A;  2GNC A;  3QWY A;  1SSF A;  4DEX A;  3CCQ Q;  1OX8 A;  4EDU A;  2ZPH B;  4M75 A;  2GTJ A;  2V1Q A;  2MF2 A;  2HD0 A;  3JB9 H;  2XDP A;  3FB9 A;  3PE0 A;  4XTV A;  1M1K U;  3S3N A;  2CUD A;  1W2B S;  1WHL A;  1MHN A;  2RQT A;  6AT1 B;  2D6F A;  4E7I A;  2DET A;  1K0S A;  1M3C A;  3MHX A;  3OY9 A;  4FSX A;  1K9M C;  1VQ7 Q;  1AD5 A;  2CP5 A;  1SHG A;  3MEA A;  5A0L A;  1K9M R;  3CMA T;  5CKH A;  3MEU A;  3MP1 A;  3FDR A;  3CXC A;  2YSQ A;  2QQ9 A;  3KXT A;  1QKX A;  5FU6 C;  5D6W A;  4F7U A;  1OYX A;  2CH4 A;  1WJR A;  1Y96 A;  4HCC A;  1KFZ A;  2DD4 A;  2LMJ A;  4J9H A;  2YUQ A;  3CC4 T;  2E12 A;  3CQT A;  2LNH B;  3OSS C;  1FWZ A;  3HRS A;  2QA4 Q;  2GQI A;  2KSS A;  1NG2 A;  2DVJ A;  1VQP T;  4EMH A;  4BE2 A;  2MYS A;  4QT7 A;  1VQ9 T;  2X4X A;  1VQN Q;  1J3T A;  4GLM A;  3F70 A;  2AZV A;  2AK5 A;  2KXC A;  1Y07 A;  3SD4 A;  5IT9 E;  3J7A F;  2LX9 A;  5GAM e;  3DB3 A;  4M7D D;  2YLC A;  3CCS A;  4KUD K;  2OAW A;  1TTH B;  4FM4 B;  1YJW T;  1Y71 A;  5FWC A;  2ZPB B;  2DF6 A;  5IHN A;  2X35 A;  2XK0 A;  4Z8A A;  3NPF A;  3KBG A;  2RPN A;  1H92 A;  2KNB B;  2LQK A;  1VYU A;  4N0A C;  4C92 F;  1JEG A;  5FW9 A;  3OMG A;  1YI2 Q;  4C92 C;  4A4E A;  3UF4 A;  1B34 B;  2M9U A;  1VQO A;  2JMC A;  4K11 A;  4II1 A;  1OU9 A;  4HVU A;  1UUE A;  1VIE A;  4ZGD B;  5GAM h;  5GAN 3;  4IUV A;  1OI1 A;  3URG A;  2X3W D;  1BU1 A;  1BIB A;  4R56 A;  2XD0 A;  2KT1 A;  4DOV A;  4PJL A;  3QSU A;  2QAZ A;  4TVR A;  2DTO A;  3VUZ A;  3QYH B;  2DYI A;  1NEG A;  4LDV A;  1WHK A;  1PRM C;  4ZGJ B;  2ZPG B;  4RTT A;  4Z89 A;  3I56 Q;  1ZUU A;  1NJI U;  5FU6 B;  4PFO A;  3TQ7 P;  1X01 A;  2XDD A;  1RAB B;  2KI7 A;  2F5K A;  3PT9 A;  2RD1 A;  5L8R E;  2VC8 A;  3GP8 A;  2HEQ A;  1T3S A;  1UDL A;  3HTR A;  2JOY A;  4JJC A;  1WHJ A;  2HSE B;  3JCM P;  1RAC B;  1U1S A;  2EJ9 A;  2AZS A;  3CC2 T;  3MKD A;  2RNA A;  5CKB A;  2XG8 D;  2MOX A;  4XTX A;  5KCH A;  3H0H A;  2CGH A;  3H6Z A;  2K5F A;  1RAF B;  3ZBD A;  2JUF A;  5LJ5 d;  3REB B;  5GMK h;  4C92 G;  2NUZ A;  2JM9 A;  2RMO A;  5IHI A;  1M8M A;  4C0D C;  3OS1 A;  5CCA A;  1YIT T;  5CO7 A;  2COW A;  4F16 A;  4A54 A;  5GAN g;  3CPW P;  1WPY A;  3NHN A;  3JCM e;  2VB6 A;  5J3B A;  1AVZ C;  3I55 Q;  4D6W A;  1VQ7 A;  2ROT A;  9ATC B;  3CC7 Q;  4NL3 A;  2FB7 A;  3SFM A;  2QI2 A;  2JS0 A;  2EGA A;  1PRL C;  4C92 B;  1WXT A;  4CRI A;  2QEX T;  4BE1 A;  4BI8 B;  2EYW A;  1FX7 A;  2OTL Q;  2E5K A;  2L5Q A;  5GAM g;  4M77 F;  2HL5 C;  2CRE A;  5CQY A;  2JMA A;  2LNV A;  4M77 C;  1FMW A;  2CP7 A;  2RN8 A;  1KG1 A;  1UFF A;  2A28 A;  4HA8 A;  1YWP A;  1VQ6 A;  1VQN A;  2EKO A;  1IB8 A;  4WTO B;  4M7D E;  1KHI A;  1Q81 C;  2DAQ A;  1T0J A;  4AFQ C;  3GPL A;  1M3A A;  1RI0 A;  2DL8 A;  2DIQ A;  3JB9 F;  1XNI A;  1BI0 A;  1Q81 R;  3OYA A;  1M1G A;  1TWB A;  3FJ5 A;  4BUG A;  2A36 A;  2HQX A;  3TSW A;  1N9S A;  2MCN A;  3PVL A;  3HKS A;  4RTU A;  1K73 C;  3QZ5 B;  1MGQ A;  3JCM X;  2DVE A;  2CZ7 B;  2FHD A;  5IXB A;  2LT1 A;  4LD6 A;  3ULR B;  1K73 R;  3V8K A;  5IXF A;  5GJW B;  4L6V 5;  2CZ6 B;  1LPL A;  4C0D B;  3EFR A;  4MZP A;  4BAC A;  1WZO A;  3C4S A;  2KYM A;  5GAO p;  2AIR B;  3CCU T;  4Y28 E;  2EW3 A;  3QG1 A;  1ZSG A;  2OI3 A;  3BW1 A;  1VQM T;  1QVP A;  1T0H A;  2DJQ A;  1GCQ C;  2QQR A;  1K76 A;  1JJ2 P;  1RUW A;  2YRC A;  2RB6 A;  2YDL A;  3RDV A;  5C0M A;  3V8L A;  2OX7 A;  2WSF E;  4ESR A;  4M77 G;  3UA6 A;  3VYG A;  1X2K A;  3I56 A;  2B86 A;  4OB1 B;  2I2L A;  3JCM J;  3D7S B;  3M57 A;  4N4H A;  5GMK l;  2KRS A;  2ZGW A;  3CPW S;  1B34 A;  2X9H A;  2L89 A;  1Z9Q A;  4YTL A;  3C12 A;  3DLL A;  4AG1 C;  3EFO B;  4M75 G;  3V7R A;  2F69 A;  2QGG A;  1UTI A;  1QW1 A;  4E7Z A;  5A2Q E;  1GRI A;  2VAS A;  4M4Z A;  4JDS A;  3JCM g;  2E65 A;  2PVO B;  3KUF A;  1D0Z A;  3HFN A;  1QP2 A;  1YIJ Q;  4AFS C;  1PNJ A;  1WI7 A;  3M56 A;  1NBE B;  2Z0W A;  4JUV A;  4MZT A;  4AG2 C;  2P4R A;  1NLO C;  4PJO E;  1LVK A;  4FW1 A;  4CI0 C;  4IUU A;  1MV0 B;  4BE0 A;  1B3Q A;  3OMC A;  2BTT A;  1XTD A;  1X75 C;  2X51 A;  3G4S T;  1PD1 A;  5IH2 A;  3GIB A;  1W1F A;  1BBZ A;  3OS2 A;  2F1L A;  3I55 A;  3VS0 A;  2MWP A;  3CC7 A;  1V1C A;  2EJF A;  4JLG A;  4X34 A;  3ME9 A;  4FL6 A;  1U8R A;  5KYU A;  5LJ5 j;  3LH0 A;  2F2V A;  2PTK A;  3X20 B;  1UGP B;  1QCF A;  1JO8 A;  4PJN A;  1D0Y A;  2OTL A;  1CSK A;  4M7A F;  2RJF A;  2EAY A;  4FYV B;  4M78 D;  4M7A C;  2RJC A;  4C8Q F;  4WF2 A;  2KMT A;  3UA7 A;  3QDR B;  3C94 A;  3L2V A;  4C8Q C;  4A4F A;  2DBK A;  3J80 E;  1HJD A;  3UDC A;  2GGR A;  2BZ8 A;  4N0A A;  1N6A A;  3CCE A;  1I1J A;  3CC4 Q;  4C92 A;  3G71 T;  2L3P A;  5GAO l;  1IZ6 A;  3H0I A;  4FU6 A;  1VQP Q;  2LC4 A;  1BI1 A;  1JJ2 S;  1VQ9 Q;  5I21 A;  3V7S A;  2KYB A;  3CCR T;  1YJ9 T;  3AT1 B;  3CPF A;  4LD9 K;  1PKT A;  3X24 B;  2MPX C;  3NTI A;  3RIR A;  4A63 B;  2CS7 A;  5FU7 C;  5KE3 A;  1TG0 A;  4XU1 A;  1MND A;  3EG9 B;  2R5A A;  4JRK A;  1YJW Q;  1HSQ A;  2EYQ A;  5J39 A;  4RTY A;  2F2X A;  3C95 A;  3VS7 A;  2LQW A;  2PQW A;  4DBQ A;  3OW2 A;  1YCY A;  4HT8 A;  2LCC A;  4HXJ A;  1M2V B;  3Q1J A;  4M7A G;  4RG2 A;  3V8J A;  4JZ3 A;  1OPK A;  1TXQ A;  5CVI A;  2HDA A;  1M27 C;  2RA2 A;  1X27 A;  1VQ4 T;  4PJO B;  2KRM A;  4N4I A;  1PKS A;  2PVD B;  1S1N A;  4M7A B;  1Q86 U;  5AYF A;  2HMA A;  3QJY A;  4GBQ A;  2ZPI B;  3LH5 A;  3QDF A;  5CQX A;  1YIJ A;  4C8Q B;  1VUB A;  4LXC A;  3VU3 C;  2O31 A;  1AEY A;  3OYY A;  1YJN A;  4OMF B;  2R58 A;  1QVF P;  3QZ9 B;  1F1B B;  2P0Q A;  2RF0 A;  5FRN A;  1X6G A;  4QVD A;  2FO0 A;  4XTW A;  2D8J A;  3O8V A;  2LX7 A;  3FRN A;  2QQA A;  3CCJ Q;  2QXF A;  2E10 A;  2H8H A;  3VKI A;  5GMK i;  5GAO m;  2G3R A;  2LQN A;  2VGM A;  1I07 A;  2HCK A;  2LCL A;  4HCZ A;  3CC2 Q;  2QTX A;  4P5N A;  3QWX X;  1YHQ Q;  4OB2 B;  1WHH A;  5LJ5 e;  3EFO A;  2DIL A;  2QQS A;  4IKF A;  2JTM A;  2EGE A;  3BDL A;  3NFC A;  5FU7 B;  5J26 A;  4LE9 A;  3M4Y A;  1YIT Q;  2WAC A;  4D8K A;  1R0B G;  4E7L A;  1ABQ A;  4KBM B;  4J6X A;  1UEB A;  1ZX6 A;  4M78 E;  3GNF B;  2KDS A;  2IG0 A;  5DLO A;  2E3H A;  1V29 B;  4QQD A;  4XU0 A;  5LJ5 h;  1HYO A;  1SEM A;  4KT0 E;  2OAU A;  3LX7 A;  2A3L A;  1CKB A;  2QEX Q;  4XTZ A;  4B6M A;  4GLK A;  3DB4 A;  4FT2 A;  5GAN 5;  1C1A A;  1BB9 A;  5GAM f;  2DXC A;  1MMN A;  2KQW A;  3R6N A;  2HBW A;  2L3S A;  3CC4 A;  3GLX A;  1E6G A;  3MPU B;  3CD6 T;  3I5R A;  2RQR A;  5D6X A;  1UGS B;  5I2S A;  2EWN A;  4HKE A;  4IUP A;  1VQP A;  2Y90 A;  3UT1 A;  1TS9 A;  2ZPF B;  3JV3 A;  1EIF A;  1VA7 A;  2A08 A;  2GCX A;  1VQ9 A;  4J7F A;  3EGX B;  4J9C A;  3M4G A;  2RHZ A;  2O9V A;  1KD1 C;  2JVV A;  4M77 D;  2BE9 B;  5LJ3 h;  1GCQ A;  2F2W A;  3EGD B;  3KFV A;  1SPK A;  1KD1 R;  4QW2 A;  2FPE A;  3E2U A;  1GL5 A;  2F5T X;  1JB0 E;  4ATO A;  1WHG A;  2ROL A;  2LT4 A;  3G6E Q;  3INZ A;  2K5L A;  2WSE E;  2EQM A;  2CZ0 B;  4A4H A;  4M75 D;  2LRQ A;  4O5V A;  2LVM A;  1RAA B;  3R6O A;  1G3T A;  2XU8 A;  2PU9 B;  4IUQ A;  1TU0 B;  3BE3 A;  1QVF S;  1ZQ1 A;  2EYY A;  4IIM A;  3MEW A;  3M59 A;  3N5B B;  4LUD A;  1K8A C;  2EYX A;  3MJX A;  3CCU Q;  1K8A R;  1VYT A;  4Z88 A;  1GXI E;  3EH2 A;  4XU2 A;  4XK8 E;  3EG9 A;  4J5Y A;  2DO3 A;  3JAM E;  4RKU E;  4BI3 A;  2RH2 A;  1BCO A;  2DER A;  3CCM T;  3O5Z A;  1I0C A;  2HBP A;  4LDY A;  4E7J A;  1E6H A;  1TUC A;  2ED0 A;  1VQL T;  1AWO A;  3OYF A;  4QVC A;  4LDX A;  3CCJ A;  3JCM f;  2COY A;  1VQ8 T;  2K3Y A;  1PD0 A;  2CP3 A;  4J9G A;  3CCS T;  4BI4 A;  3UPU A;  1AZE A;  3CC2 A;  3QKJ A;  1GBR A;  3M54 A;  4E7S A;  1YHQ A;  1G2B A;  4XTY A;  2QDY B;  2YUN A;  5GMK e;  3OQ5 A;  1UGR B;  2BUD A;  4EMK C;  5CKD A;  1NM7 A;  1K9M U;  1S72 Q;  2C0I A;  2MWO A;  4M7A A;  2GBQ A;  2JZ2 A;  1ZBX A;  2DFU A;  3G4S Q;  4HVW A; 
#chains in the Genus database with same CATH homology
 5GAO p;  1YIT A;  3BY7 A;  4RMO A;  1KQS A;  4C8Q A;  5HKC A;  3CCU T;  2DEQ A;  4Y28 E;  3OYG A;  3LW5 E;  3QG1 A;  3BW1 A;  1VQM T;  1QVP A;  2QQR A;  3JB9 I;  5CKE A;  5DM7 R;  3AHU A;  2RK2 A;  4ZGE B;  4LDU A;  2RB6 A;  1WNL A;  3ER0 A;  5C0M A;  3V8L A;  2DD5 A;  2WSF E;  3ZFJ A;  4M78 F;  2KVQ G;  3CPW A;  3CCQ A;  4M77 G;  3RMQ A;  1VQ4 A;  1BIA A;  3HPW A;  1KQS S;  3G7Z A;  2KK4 A;  4M7D A;  4M78 C;  3VYG A;  2DPP B;  5M9O A;  3OA6 A;  3I56 A;  1G3S A;  3JRZ A;  4OB1 B;  2I2L A;  2X4W A;  5GAN 8;  1N8R C;  4GY5 A;  3RES A;  3JCM J;  1NJI C;  2E41 A;  3M57 A;  4N4H A;  2XKO C;  4C5E A;  5GMK l;  2QEX A;  2ZGW A;  3CPW S;  1RL2 A;  2H3J A;  3HRU A;  3JSC A;  3OBW A;  1M1K C;  1B34 A;  3QPH A;  3WVD B;  3CME T;  1HK9 A;  2L89 A;  4L5G A;  4YTL A;  3C12 A;  3DLL A;  3CBM A;  4NL2 A;  5FRM A;  4M75 G;  1M8V A;  3V7R A;  2F69 A;  3L2W A;  1QW1 A;  5A2Q E;  4B9W A;  3RKX A;  4JDS A;  3JCM g;  4JS4 A;  2E65 A;  2PVO B;  4OF1 A;  3OYN A;  1YJW A;  3KUF A;  2GQV A;  4QQG A;  3S6W A;  3HFN A;  1QP2 A;  4FIB A;  3PTA A;  5GAN e;  3VYH B;  4ME7 A;  4X9C A;  4C5H A;  4OB0 B;  3L1A A;  1VQK T;  3J81 E;  3OYH A;  2D0Q B;  3M56 A;  3QO3 A;  3CCV T;  3SWN A;  4PL6 A;  4LDW A;  4JUV A;  3JB9 D;  4MZT A;  3WXM B;  3NTK A;  1KC8 U;  4PJO E;  4DQ2 A;  4CI0 C;  4PKC C;  1X6O A;  2XID A;  2GF7 A;  3EFS A;  2V8I A;  2DXB A;  4IUU A;  3JCM c;  4BE0 A;  2RK1 A;  1VIF A;  2M1H A;  3OMC A;  5GAM j;  1I5L A;  1XTD A;  1I4K 1;  3E9G A;  1X75 C;  2RI5 A;  5LJ3 d;  4C92 E;  3G4S T;  4V2S A;  3CCM A;  2YHT A;  5CAI A;  3PMT A;  1PSE A;  1JBM A;  3JCM W;  3GIB A;  3BFM A;  3E9F A;  5LJ3 f;  1Y7X A;  1R8O B;  3MP6 A;  3OS2 A;  2FVU A;  3DLM A;  4VUB A;  4M75 E;  3I55 A;  3LWI A;  1YBY A;  3OYM A;  2QA4 A;  2VXE A;  2RM4 A;  1VQL A;  3MET A;  3LGL A;  3G6E A;  2XHC A;  2MWP A;  3CC7 A;  1M4Z A;  2L8D A;  4OP0 A;  2M0O A;  5CK9 A;  2EJF A;  3RMS A;  4JLG A;  4X34 A;  4MDW A;  5GAN h;  5KE2 A;  3ME9 A;  3P8B B;  4ZN1 A;  4FL6 A;  5CR2 A;  1Q82 U;  1VQ8 A;  1U8R A;  2E6N A;  5LJ5 j;  1NPR A;  2WSC E;  3LH0 A;  4OB3 B;  5GAN 2;  3LLR A;  4Y91 A;  2A7Y A;  4RCC A;  5LJ5 g;  4EMK B;  4M78 G;  3X20 B;  5KCO A;  4NS5 A;  1UGP B;  1WQ7 A;  2BIV A;  4OVA A;  1BKB A;  2RHI A;  4HCB A;  2Y4X A;  3M55 A;  2OTL A;  3CBP A;  4M7A F;  3HL8 A;  1DJ7 B;  2RJF A;  1O9S A;  1NE8 A;  3BDU A;  4ELZ C;  2EAY A;  4M78 D;  4M7A C;  5DLQ E;  4NOY A;  2RJC A;  3OYD A;  1YIJ T;  1Q7Y C;  4C8Q F;  2ZCF B;  1HXD A;  3PNW C;  3GF5 A;  4WF2 A;  3L2U A;  2KMT A;  1ZHI A;  3QDR B;  3C94 A;  4F7U E;  3L2V A;  4C8Q C;  2E64 A;  3TEE A;  4A4F A;  4BB7 A;  5GAN d;  1QVG A;  2CZ1 B;  5LL6 S;  2E1H A;  2CYZ B;  3OYJ A;  1YI2 A;  3T9N A;  3TRE A;  1Q82 C;  3J80 E;  4M77 A;  2PUK B;  4C0Z A;  1WQW A;  2VV5 A;  4M78 B;  3EAE A;  1D3B A;  2DZC A;  5GAN f;  4PJO A;  1N9R A;  3UDC A;  2VXF A;  2X4Y A;  1U1T A;  4N0A A;  4M7D F;  1N6A A;  5GMK j;  3CCE A;  1JJ2 A;  3HSB A;  2RHU A;  3P8D A;  4J6W A;  3OYE A;  2CKK A;  4C92 A;  4M7D C;  2DZ9 A;  3PMI A;  3SWN B;  1WJQ A;  2OTJ T;  4UC4 A;  3G71 T;  2DIG A;  5GAO l;  1VQ6 T;  3LWH A;  1SSF A;  1IZ6 A;  5LJ3 g;  4FU6 A;  4EDU A;  3CME A;  1VQO T;  2ZPH B;  4M75 A;  4JLI A;  3L2Q A;  3A8L B;  1W2B A;  3RKY A;  2LC4 A;  1BI1 A;  2MF2 A;  4L59 A;  1JJ2 S;  2HD0 A;  3QII A;  5I21 A;  3JB9 H;  3V7S A;  3CCR T;  3A8G B;  3X26 B;  1NZ9 A;  4XAX B;  1YJ9 T;  5IAY A;  1N27 A;  2XDP A;  3CPF A;  3FB9 A;  4JRI A;  4LD9 K;  1KD1 U;  3X24 B;  3NTI A;  4XTV A;  3RIR A;  3QUI A;  2CS7 A;  5EG2 A;  1M1K U;  3HFO A;  3S3N A;  1PSF A;  5FU7 C;  4ZTJ A;  1W2B S;  1MHN A;  3LGF A;  3TU4 K;  1VQK A;  5KE3 A;  4HT9 A;  2VUB A;  1W4S A;  2R5M A;  2QQB A;  4XU3 A;  3CCJ T;  2D6F A;  3X28 B;  4E7I A;  1BI2 A;  1FXX A;  4XU1 A;  3MHX A;  3OY9 A;  1OZ2 A;  4FSX A;  2L3R A;  3SWN C;  4X9D A;  2FYK A;  4E7H A;  2EJG A;  2R5A A;  1K9M C;  4JRK A;  1S72 A;  1M9S A;  4XTU A;  3CEY A;  2VYT A;  2HAX A;  2EYQ A;  5J39 A;  3MEA A;  5A0L A;  1P92 A;  2RHY A;  4C5I A;  3JCM V;  1YHQ T;  3G4S A;  4KUI A;  3CMA T;  2EIF A;  3C95 A;  5CKH A;  4RG8 A;  3MEU A;  3MP1 A;  3FDR A;  3CXC A;  3JB9 G;  1XQH A;  2PQW A;  3OW2 A;  2QQ9 A;  3KXT A;  1VQ5 T;  5FU6 C;  2IVW A;  1YCY A;  3A8H B;  2LCC A;  5D6W A;  4F7U A;  4HT8 A;  1OYX A;  4MML A;  1WJR A;  2E5Q A;  1Y96 A;  2EQU A;  3Q1J A;  4HCC A;  4M7A G;  2M16 A;  4RG2 A;  3FEO A;  3V8J A;  4MZM A;  4M77 E;  4PJO D;  5FRO A;  2DD4 A;  3MP8 A;  2DTH A;  4N4G A;  3CXC S;  4DA4 A;  2O4X B;  3OW2 S;  3CC4 T;  2E12 A;  2RI3 A;  5CVI A;  1K8A U;  2K57 A;  3OSS C;  1FWZ A;  4A53 A;  2D9T A;  2P4T A;  3HRS A;  2DK3 A;  3QXE B;  4M7A D;  2VGN A;  2KSS A;  2HNI A;  2RA2 A;  3VJP A;  4Q5W A;  3E19 A;  3CCQ T;  1VQ4 T;  4PJO B;  1VQP T;  2B8A A;  3OS5 A;  4EMH A;  4BE2 A;  2RJE A;  3FJP A;  4C8Q D;  4N4I A;  5GAN 7;  1M90 C;  2XDB A;  1VQ9 T;  2X4X A;  3L42 A;  3QYG B;  2O01 E;  1M1F A;  3QHS A;  2PVD B;  4M7A B;  1Q86 U;  5AYF A;  3RKW A;  4ZTF A;  3F70 A;  1Q81 U;  1BI3 A;  3QJY A;  2ZPI B;  5CKF A;  1LOJ A;  1WJS A;  3P8H A;  1Y07 A;  2K3X A;  5CQX A;  3PGG A;  3SD4 A;  5IT9 E;  4ELY C;  3CCL T;  2LX9 A;  4C8Q B;  1VUB A;  2K5I A;  2DXT A;  2R57 A;  3DB3 A;  3OYY A;  2YLC A;  3VU3 C;  4OMF B;  5GAM e;  1YJN A;  3CCS A;  4M7D D;  4KUD K;  3NTH A;  4B9X A;  2R58 A;  2LQ8 A;  3QZ9 B;  2EQJ A;  5FRN A;  2P0Q A;  1KC8 C;  4QVD A;  4R55 A;  4XTW A;  3JCM h;  1VQ7 T;  4FM4 B;  1YJW T;  3O8V A;  1Y71 A;  2NLU A;  4PJO F;  2ZPB B;  3FRN A;  2QQA A;  2X35 A;  2XK0 A;  5KH6 A;  3FIF A;  2QXF A;  2E10 A;  5GAN 6;  3KBG A;  3VKI A;  4M7D B;  3PIO A;  5GMK i;  4PJO C;  5GAO m;  2G3R A;  2LQK A;  2VGM A;  4N0A C;  4C92 F;  1K73 U;  2OTJ A;  2LCL A;  5GAO r;  4HCZ A;  3OMG A;  2GFA A;  3G71 A;  3VV0 A;  2QTX A;  4P5N A;  3FLG A;  4A4E A;  4C92 C;  4JJN K;  4PLI A;  1B34 B;  2M9U A;  4OB2 B;  5LJ5 e;  1VQO A;  4M75 F;  4II1 A;  3CCU A;  4E47 A;  1VQM A;  5I2M A;  2QQS A;  4KUL A;  4IKF A;  2JTM A;  2YLB A;  4M75 C;  4QQ6 A;  3JCM Q;  3MEV A;  3X25 B;  3BDL A;  3NFC A;  3CCR A;  1VIE A;  3ZEH A;  4ZGD B;  3OYB A;  5GAM h;  5GAN 3;  3A8M B;  3L2R A;  4IUV A;  1OI1 A;  3URG A;  5FU7 B;  3DKM A;  5J26 A;  3A8O B;  3I55 T;  1BIB A;  5A0G A;  3M4Y A;  4R56 A;  4F7U B;  2QA4 T;  2WAC A;  4DOV A;  2XD0 A;  3QSU A;  3G6E T;  4E7L A;  1Y96 B;  5LJ3 j;  4KBM B;  3CC7 T;  4J6X A;  4TVR A;  3UWN A;  1UEB A;  2DTO A;  3VUZ A;  4M78 E;  3QYH B;  3LYI A;  3V7C A;  1VQN T;  3GNF B;  2KDS A;  4LDV A;  2IG0 A;  3JCM b;  5C6S A;  5DLO A;  5A0D A;  4E7K A;  4ZGJ B;  1QP3 A;  1V29 B;  2ZPG B;  4QQD A;  2EFI A;  1LNX A;  4XU0 A;  1H3Z A;  1H64 1;  5LJ5 h;  4KT0 E;  2OAU A;  4EPC A;  1N8R U;  1NJI U;  3LX7 A;  2A3L A;  5FU6 B;  5CIU A;  4OGE A;  4XTZ A;  4EMG A;  1X01 A;  1G5V A;  1VQ5 A;  1IRE B;  2XDD A;  2OTL T;  5IN1 A;  4GLK A;  3PIP A;  4F7U F;  3DB4 A;  4FT2 A;  5GAM d;  2F5K A;  3PT9 A;  3PFS A;  3OYC A;  1TH7 A;  3CBO A;  3CCV A;  5GAN 5;  2RD1 A;  3OB9 A;  5L8R E;  4JRP A;  5GAM f;  2DXC A;  3OYL A;  2VC8 A;  3GP8 A;  4FT4 A;  3RER A;  2DXU A;  2KQW A;  2JOY A;  3MCA B;  3CC4 A;  3GLX A;  3E1S A;  3QBY A;  3JCM P;  2FL7 A;  1U1S A;  2EJ9 A;  3CC2 T;  1YI2 T;  3CD6 T;  5D6X A;  4Z02 A;  1UGS B;  2RO0 A;  5CKB A;  5I2S A;  1XOV A;  2EWN A;  2XG8 D;  4EMK A;  4JRQ A;  5FLX E;  4HKE A;  4IUP A;  2KAF A;  1VQP A;  2Y90 A;  3UT1 A;  1G3W A;  3JB9 J;  2GFU A;  4PJO G;  4XTX A;  2ZPF B;  4J6Y A;  5KCH A;  3H6Z A;  2CGH A;  3CCE T;  1EIF A;  2E6Z A;  2GCX A;  2K5F A;  2JUF A;  2XI9 A;  3ASK A;  4J7F A;  3ZBD A;  4A4K A;  5LJ5 d;  1VQ9 A;  3M4G A;  4BDZ A;  5GAN j;  4ZN3 A;  5GMK h;  4RCB A;  2RHZ A;  3A5Z B;  4C92 G;  1KD1 C;  5LJ5 f;  3M53 A;  2JVV A;  4M77 D;  5LJ3 h;  4C0D C;  2PUO B;  3OS1 A;  5CCA A;  1KQ1 A;  4BDY A;  5CO7 A;  3QJ6 A;  1YIT T;  4A54 A;  5GAN g;  3CCL A;  1WPY A;  2LTO A;  4QW2 A;  2KY9 A;  2RJD A;  4C8Q G;  3JCM e;  1M90 U;  2V8K A;  2V8J A;  4IUT A;  4BY6 B;  5J3B A;  1AHJ B;  3M9Q A;  2F5T X;  4C5G A;  1JB0 E;  4C92 D;  2JTF A;  2X4J A;  4D6W A;  4ATO A;  3GNG A;  1KQ2 A;  4M78 A;  2LT4 A;  4M77 B;  1VQ7 A;  3INZ A;  4J83 A;  2K2V A;  2K5L A;  1D3B B;  2FB7 A;  4NL3 A;  5D6Y A;  2MI6 A;  2WSE E;  2EQM A;  5HK0 A;  2CZ0 B;  1OZ3 A;  3HP9 A;  4M75 D;  2LDM A;  4A4H A;  3I56 T;  4MDX A;  1QVF A;  2LRQ A;  3SFM A;  4M7D G;  2QI2 A;  4O5V A;  2LVM A;  2BKD N;  4C92 B;  3R6O A;  2E70 A;  2C06 A;  1G3T A;  2RHX A;  4CRI A;  2QEX T;  4BE1 A;  2YRV A;  4C0G A;  4BI8 B;  2JNG A;  2XU8 A;  1S72 T;  2PU9 B;  4IUQ A;  3M58 A;  2HQE A;  4M75 B;  2AHJ B;  3HRT A;  2DJZ A;  4J7I A;  4PNO A;  3SB2 A;  5GAO n;  3FC3 A;  1QVF S;  1FX7 A;  4M7A E;  1ZQ1 A;  1BYM A;  1I81 A;  2Y4Y A;  4A4G A;  3MEW A;  2L5Q A;  3SDZ A;  4BY6 C;  5GAM g;  4OGC A;  4M77 F;  3M59 A;  3N5B B;  3GOX A;  5CQY A;  1K8A C;  4C8Q E;  1VQN A;  2LNV A;  4M77 C;  3J7A F;  3MO8 A;  1Q7Y U;  3S3O A;  4F7U G;  3OSV A;  1KG1 A;  3L2Z A;  1GXI E;  4XU2 A;  4XK8 E;  5HY6 A;  1M5Q 1;  1YIJ A;  4HA8 A;  1VQ6 A;  4J5Y A;  2DO3 A;  3RUX A;  2EKO A;  1KHC A;  1UGQ B;  2DKG A;  4RKU E;  3JAM E;  1NPP A;  4O6J A;  4M7D E;  4QVZ A;  2RH2 A;  1KHI A;  4BI3 A;  1Q81 C;  2DAQ A;  4IUR A;  1Q86 C;  3M5A A;  3GPL A;  1RI0 A;  3OYI A;  4XQ3 A;  2JN0 A;  3CCM T;  2DIQ A;  4DOW A;  3JB9 F;  1XNI A;  1BI0 A;  1YJ9 A;  4MMK A;  2HBP A;  4LDY A;  5HK3 A;  2RI2 A;  3OYA A;  3OYK A;  1M1G A;  4E7J A;  5GAO q;  2P0P A;  4BUG A;  1UB4 A;  2XIC A;  2ZPE B;  3S3M A;  3JCM d;  1VQL T;  3OYF A;  4QVC A;  2P0K A;  2HQX A;  4LDX A;  1LJO A;  2K4Y A;  1N9S A;  3CCJ A;  1O75 A;  3JCM f;  1I8F A;  3VUB A;  2O4X A;  2ZZD A;  2K3Y A;  3HKS A;  1VQ8 T;  4C0F A;  1YJN T;  3CCS T;  5DY9 A;  1K73 C;  3QZ5 B;  4BI4 A;  1MGQ A;  3JCM X;  3UPU A;  1JRI A;  3TCJ A;  2DVE A;  2CZ7 B;  3CC2 A;  3CD6 A;  2FHD A;  2MAM A;  2LT1 A;  3QKJ A;  5GAN 4;  3M54 A;  2EQK A;  3WVE B;  4LD6 A;  1YHQ A;  3V8K A;  3CMA A;  1G3Y A;  4J8O A;  4XTY A;  2QDY B;  5GMK e;  3OQ5 A;  1UGR B;  2BUD A;  3HHT B;  4L6V 5;  4EMK C;  5CKD A;  5GMK m;  2CZ6 B;  3H8Z A;  4PLL A;  5LJ3 e;  3OS0 A;  1K9M U;  1QVG S;  2MWO A;  4JS5 A;  4M7A A;  4C0D B;  3OBY A;  2JZ2 A;  1ZBX A;  2DTI A;  1WGS A;  3EFR A;  4MZP A;  4BAC A;  4BD3 A;  2MMP A;  2PVG B;  3C4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...