2EKOA

Solution structure of ruh-073, a pseudo chromo domain from human cdna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
87
structure length
87
Chain Sequence
GSSGSSGGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNRRLDEWVTHERLDLKKIQFPKKEAKTPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone acetyltransferase HTATIP
publication title Solution structure of RUH-073, a Pseudo Chromo Domain from Human cDNA
rcsb
source organism Homo sapiens
total genus 7
structure length 87
sequence length 87
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ekoA00
2RHYA 3S6WA 3O8VA 2LDMA 2QQSA 3L2VA 3OYAA 2MWOA 3LLRA 1SSFA 2PQWA 2K3YA 2R57A 2HQEA 3MO8A 5J26A 2O4XA 4IUQA 3OS1A 2HQXA 4N4GA 2VYTA 4ZTJA 2X4XA 4B9WA 2RHZA 3H6ZA 4N4HA 3DLMA 5J39A 1KHCA 4QVZA 3LYIA 3OYJA 1G5VA 2M1HA 2EKOA 5KCHA 4X34A 3OS2A 4OVAA 4A4HA 2NLUA 5IN1A 4PLIA 3MEAA 4C5IA 3MP6A 2MWPA 3OYCA 3E9GA 2BUDA 2LVMA 5C6SA 3S3OA 2G3RA 4BE1A 3QBYA 2M0OA 4RG2A 5KCOA 2M16A 3OYKA 3OYBA 4E7HA 3Q1JA 4II1A 3QJ6A 2XK0A 4IKFA 4BACA 2DIQA 2L3RA 3OYIA 3OYFA 3NTHA 2WACA 3ME9A 4BD3A 1WJRA 1WJQA 2RI3A 3NTKA 4CRIA 4IURA 4EDUA 3OS0A 3LH0A 5KH6A 4E7LA 3L42A 4C5GA 3F70A 4Q5WA 5FROA 3M9QA 4IUUA 3OYDA 4BDZA 3NTIA 4HCZA 3CEYA 4C5EA 3L2QA 2DIGA 3LGFA 3OMCA 3P8DA 1N27A 3ASKA 3META 3PNWC 4B9XA 4A4EA 4PLLA 2JZ2A 2L89A 2GF7A 4ZTFA 3OMGA 5D6YA 2CKKA 2K3XA 2X35A 2EFIA 3BDLA 3UT1A 4FL6A 3UWNA 4BDYA 1OI1A 4BE2A 2EQKA 2RJCA 5C0MA 2RJEA 4GY5A 4Z02A 5M9OA 2O4XB 3H8ZA 2L8DA 3C4SA 4QQGA 4N4IA 3FLGA 2BIVA 5KE3A 4QQDA 2R58A 2RHIA 3FC3A 1MHNA 2YRVA 3GOXA 3MP1A 2R5MA 3KUFA 2F5KA 3PFSA 1RI0A 2E6NA 2GFAA 2X4WA 3MEVA 4C5HA 3OA6A 4BE0A 3FEOA 3EAEA 5FRMA 2RO0A 3OYNA 4IUVA 2P0KA 1WGSA 4A4GA 5IAYA 5D6XA 3DB3A 5D6WA 3OYMA 1H3ZA 3L2WA 1XNIA 2EQJA 3OYLA 3QIIA 3L2UA 2R5AA 2RJDA 3PMTA 4A4FA 2D9TA 1OZ2A 4FU6A 1WJSA 2X4YA 3MEWA 2LRQA 5CIUA 4L59A 4NS5A 4IUPA 3OB9A 5KE2A 2LCCA 3FDRA 2RHXA 4PL6A 2LTOA 1OYXA 3LGLA 2JTFA 3OYEA 3OYGA 2DAQA 3MEUA 4LD6A 2RI5A 2RHUA 3OQ5A 2IG0A 2EQUA 3PMIA 4UC4A 3MP8A 2B8AA 4E7JA 3L2RA 3S3MA 4QW2A 2XDPA 2FHDA 1OZ3A 3P8HA 3ZEHA 2EQMA 3E9FA 2RJFA 4IUTA 2QQRA 2RI2A 2BKDN 3QKJA 2E5QA 3LX7A 4E7IA 3S3NA 3SD4A 3OYHA 2GFUA 3OY9A 4QQ6A 5FRNA 4E7KA 3DB4A
chains in the Genus database with same CATH superfamily
4JRPA 4M78A 4ZNXA 5FLXE 1RAFB 1GFCA 2ATCB 3EGDA 2D8HA 4J9EA 2YUQA 3OS1A 4AG2C 4J5YA 4KRTA 2RHZA 5FWCA 1ZSZA 2K57A 1BIAA 5GJVB 1Q7YU 3I55Q 1V1CA 3CCQA 1VQ4T 1K73R 1K9MC 2MIOA 1YNZA 1Y96A 3QBYA 2FEIA 2DL4A 4AFQC 1CKAA 4J7IA 2RA2A 1YJ9T 3TEEA 5LJ3h 3JB9I 2XMFA 4LDWA 1Y7XA 1VIEA 4M77E 5CQYA 4B9XA 2NUTB 3CCRT 2QK0A 1NYGA 2QI2A 2ZGWA 3OMGA 4C92A 4EMGA 1QVGS 1KIKA 2BE7D 4ELZC 2RJEA 4GY5A 5M9OA 4R55A 1IREB 5FU6C 4GLMA 1JB0E 4Z89A 2J7IA 5KE3A 2NUZA 3PFSA 1M1KC 3MEVA 4HCKA 3CCEA 4JRQA 1K8AU 2LNHB 1WYXA 4L6V5 4QKUA 2CP5A 3BE3A 5FU6B 3JCMP 1ZUUA 1CKBA 2FRYA 2LNVA 1QVPA 2MAMA 2F5TX 1WHKA 3OYGA 3MEUA 3CMAT 1OX8A 2IG0A 3OW2S 3MP8A 1M9SA 1RACB 5GAN7 3ZEHA 1AD5A 4RTXA 4FYWB 1RAHB 3MHXA 2SRCA 4E7SA 3JB9D 2J6OA 2LQWA 2FVUA 4MMLA 1C6VX 4JJNK 5IH2A 3BY7A 5J26A 2JM9A 5I22A 3PT9A 2I0NA 4XU2A 1PWTA 2CZ0B 1QWEA 3OYJA 2KXDA 1Q82U 4PNOA 1GCQC 4LN2A 5IN1A 3CCQQ 1X2KA 4F14A 2WSEE 1EFNA 2YWWA 4MDWA 2M16A 3OYBA 1NE8A 2RD1A 1RAAB 3EH2A 3JCMX 2WACA 3ME9A 3CC7A 2GQVA 3LH0A 4WF2A 3L42A 3OBYA 5FU7C 3QHSA 3CXCA 2H8HA 2M02A 3BDUA 4M77F 4BDZA 4J9IA 1RL2A 4FT4A 2BTTA 2HQHA 3HFOA 3META 1SRLA 2VGMA 5KYNA 5FU7B 4JJDA 4M7AA 3FLGA 2M0YA 1UG1A 2DF6A 2RHIA 1BCOA 1YFNA 5FRMA 1Z9QA 1JJ2P 3G4SA 3CCEQ 2D8JA 3X28B 5KYWB 3VS0A 3A8GB 3QIIA 4FSSA 3OB9A 3FDRA 2E70A 1KC8C 3EG3A 1VQ6A 4KGZB 2FPFA 2ROLA 1FX7A 4EMKA 1YN8A 1JRIA 2CZ7B 4OMQA 4UC4A 3V8JA 2VGNA 1XQHA 3P8HA 1OOTA 2JVVA 2JXBA 2BKDN 1MMGA 1QW1A 1YJNA 2FG0A 5HK0A 4RTUA 4FT2A 1KHIA 2CSQA 2DTOA 1H8KA 2KT1A 4HCCA 1WZOA 3QDFA 4RTWA 4LDYA 1YJWA 2F2XA 2HAXA 3ZBDA 7AT1B 1BYMA 4KBMB 3KBGA 5GAMg 1AWOA 4MZMA 2EBPA 4LDXA 1PM3A 3I9QA 4RCBA 4X9CA 2JJ9A 5GAMh 3CC7Q 2W0ZA 3P8BB 2DD4A 1HYOA 4HT8A 2PTKA 3CBPA 1QKWA 2EIFA 2DD5A 3I56T 1VQ5A 2KNBB 3LH5A 2QGFB 4YTLA 1HK9A 3C4SA 5GMKj 2MI6A 4QQGA 3FIFA 4QVDA 2OI3A 2K2VA 2E1HA 2F5KA 4FSXA 2X4WA 3M4YA 1D3BB 1RUWA 2HDAA 4IUVA 1W6XA 1JXMA 2PNIA 5D6WA 3G4SQ 1G3TA 2CT3A 4LUEA 2X4YA 1VQKT 3VS6A 1ZBXA 2QG9B 2LCCA 3LGLA 2V1QA 1SF9A 2KVQG 3CQTA 1IGUA 1VQ6Q 3V7SA 2YHTA 3M59A 2KRMA 1VQ6T 3PMIA 2B8AA 1H92A 2EQMA 2RJFA 2QQRA 4F7UB 1VQ7A 1YJNQ 3TSZA 4QVCA 3QZ5B 1GL5A 4X9DA 2RHYA 1N6AA 2XKOC 2QQSA 4F17A 1AVZC 2MWOA 3GPLA 4AMCA 2PQWA 1K76A 5GMKh 3CCJA 4GBQA 5GMKm 4P5NA 4LD9K 4ZTJA 4B9WA 3MJXA 2KGTA 2AKKA 1NLOC 4FYXB 1YJWQ 2V26A 2NLUA 4C0DC 4PLIA 2O9VA 4DBRA 2LQKA 2BUDA 1K0SA 4OMNA 5GANf 3M58A 4M77G 1Z9ZA 3OYIA 1Y07A 2CH4A 2LMJA 4C0ZA 2A36A 4ANJA 1ARKA 4M75D 3VS1A 3EGXB 4C0DB 2LQNA 2AK5A 2RN8A 2GTJA 4HT9A 5LJ5f 2K6DA 3EH1A 3ZL7C 4HCBA 2I2LA 2PUOB 3CBOA 3UATA 4A4EA 1UHFA 1QVFA 4PJOE 3OBWA 5D6YA 2CKKA 2RH2A 1VQ5Q 4BE2A 3CCMA 1WNLA 1Q7YC 1K73C 3BFMA 1BU1A 2ROTA 1GXIE 1QVGP 3HKSA 2QQAA 3T9NA 2CUBA 3V8LA 5IAYA 1UTIA 1X75C 4D8DA 3R6OA 1WQWA 2FB7A 1LVKA 2JUFA 2LJ0A 5GANe 2D9TA 5LJ3f 2DMOA 1UEBA 4IUPA 1JJ2S 2LTOA 1OYXA 2K7AA 4KUIA 1VQ9A 1T0JA 3OQ5A 3M54A 2H3EB 2DKGA 1QWFA 5LJ5e 4PKCC 5CKFA 2DJQA 1TS9A 1OULA 1MNEA 2YLBA 5IXFA 2NUTA 1VQ7Q 3OW2P 2XI9A 3S6WA 6AT1B 1VYUA 3H0HA 2K5LA 1WXTA 2KT8A 2JNGA 2F2VA 3CCJQ 3H6ZA 3DLMA 4M77B 1G3WA 1I8FA 5HK3A 4MZTA 4XU1A 1VQ8T 1SHFA 2EKOA 3OS2A 2DRKA 4NOYA 1U1SA 4C8QC 2O01E 2GGRA 4M75A 5GAOn 2AKLA 5I2MA 2LVMA 2PVGB 5KCOA 5LJ3e 2LP5A 1R0CB 3NPFA 1VQNA 1OX9A 2EYWA 2DIQA 2XICA 5KH6A 4C5GA 2YUNA 3F70A 3V7CA 2MK5A 3LWIA 4J8OA 5J3BA 1M5Q1 3OYDA 2LCLA 1TUDA 5GAOl 3OMCA 1W2BA 1JO8A 2BE9B 2XDDA 4JJCA 4JZ4A 1H641 2DXBA 3EFOB 1KQ2A 3HSBA 2HBWA 2F69A 4J9FA 1Q82C 3E19A 3G1JA 3CCMQ 2ZCFB 5GAN4 4IIOA 4E47A 1F1BB 2BIVA 4LE9A 1MHNA 2YRVA 4J9CA 3A8LB 1U3OA 4ESRA 2KRNA 2C0IA 3VS7A 2DPPB 3G7ZA 4RTTA 3CCRA 4BI4A 1UDLA 2W10A 2EQJA 2QGGA 3QWXX 2BZXA 3QG1A 4D8KA 3GP8A 2DXUA 1W4SA 1ZBJA 4L59A 5KE2A 3ULRB 1I81A 1WA7A 2EKHA 1MMAA 1VQ9Q 5KYXB 1GCQA 5EC7A 1FMWA 1I1JA 3CC2T 3WVDB 2LCSA 2K5IA 1W1FA 1D09B 1X43A 2RF0A 5LL6S 3A8HB 2ZPHB 3SD4A 2ZPEB 1K1ZA 3O8VA 2DE0X 1ZQ1A 2G6FX 2KDSA 2R57A 3CMAA 4M7AE 3O5ZA 5GANd 4M4ZA 4N4HA 4XTZA 1X2QA 4ME7A 1GRIA 4M7DE 2PVDB 2FPDA 3QWYA 2EAYA 4OVAA 3LW5E 4ZN1A 1U1TA 1YHQT 3M0QA 2O31A 3Q1JA 2FRWA 2K3BA 5L8RE 5LJ5d 1X01A 1VQNT 3NTKA 4CRIA 2KK4A 3VYGA 4Q5WA 1NJIU 5GAOp 5LJ5g 2A28A 5GJWB 1NJIR 1N8RU 1VQ4Q 2DLPA 2RM4A 1Q7YR 1M3AA 4MMKA 1N8RR 2VASA 4F7UF 2K3XA 1Y71A 5IT9E 1KK7A 2K5FA 2KAFA 4BUGA 5C0MA 1G3YA 4N4IA 4KGXB 1OV3A 2JOYA 1YJ9Q 2HKQB 2ZAEA 1E6GA 2YDLA 2DXCA 2R5MA 3H9NA 5LJ3d 1JEGA 4JRIA 2ZPGB 3RIRA 2YXYA 2VUBA 3EAEA 4L5GA 3QZ9B 2RK1A 1FWZA 3CCRQ 2YUPA 1KD1U 4ELYC 3QYHB 4J6YA 1KG1A 4KH1B 3QXEB 2FYKA 3MEWA 2MYSA 4PFPA 5KYUB 2EYXA 2LRQA 3UF4A 3QDRB 1NM7A 2EYZA 3VS5A 1Q81U 1LNXA 3FB9A 1D0YA 2DAQA 1Q81R 1N5ZA 5CAIA 5CR2A 1NEGA 2E12A 2PVOB 2QAZA 3L2RA 3GF5A 4QW2A 2XDPA 3VV0A 1M2OA 3JCMV 2FL7A 1VQPT 4C8QE 2Y4XA 1K8AR 3PE0A 2HMAA 4EPCA 2AZSA 4GLKA 2GCXA 2XU8A 3CMAQ 4M7DF 3X24B 2X4XA 3SDZA 2M51A 4EMHA 1K0XA 1D3BA 4DOWA 2E3HA 4Y92A 3CPWA 2NUPB 5C6SA 1M4ZA 3QO3A 2MCNA 2DL7A 4IKFA 3PIOA 3EG1A 2EGEA 3MKDA 2RI3A 4PJOG 1IZ6A 4X1VA 4ORZA 2DTHA 4IUUA 1WQ7A 4E7ZA 1D1AA 4DEXA 4C5EA 2X9HA 3GNGA 3IQLA 1Q82R 4Y28E 2GF7A 2JS0A 2FZKB 1OEBA 3HTRA 1PRLC 4KULA 4BI8B 1B34B 3SHWA 3HRTA 4BE0A 1UFFA 1RLPC 1RADB 3I56A 4XAXB 3UA6A 5DM7R 1X6BA 4DA4A 4M77D 4NS5A 2YUOA 2DJZA 1TG0A 1M27C 2COZA 3RERA 4JPBW 1NLPC 1VOMA 2EQUA 1KQSA 4BB7A 4C8QF 1Q86U 1O9SA 2KE9A 3X20B 2QA4A 5AYFA 2VWFA 1LOJA 1NG2A 3QPHA 5GMKe 1VQKA 3HFNA 4PJOC 3RDVA 3V7RA 1YWOA 5GAMj 3DLLA 2HQEA 3E1SA 2P4TA 4FW1A 2VC8A 2CP2A 2VYTA 3THKA 4LNPA 4JLGA 1VQLT 1E6HA 4PJOB 4F16A 2QQBA 4B6MA 1ZSZC 2IVWA 4PK4A 1M8VA 1UECA 2HSEB 2HL3A 4Z88A 2DX1A 3J80E 3VS4A 1D0ZA 2JW4A 4RG2A 2K79A 2JMCA 3A8MB 4FM4B 2JMAA 4IURA 1RAIB 1H3HA 2OTLT 1ZSZB 1M30A 3CC4A 2YRDA 4F7UG 3G6ET 3VS2A 2L0AA 2FZCB 2L5QA 1FMVA 1T0HA 2BZ8A 2D6FA 1GCPA 1ABQA 1TOVA 3RMQA 2VVKA 1YIJT 1KFZA 3RUXA 3S3OA 2KROA 4FL6A 2IPOB 1U5SA 3H8ZA 3PVLA 5A0DA 3OS5A 1G3SA 1JXOA 1AHJB 3RMSA 5GMKl 3QYGB 2RO0A 2P0KA 4M77A 3H0IA 5D6XA 1IHVA 4EIKA 2GQIA 3OYLA 2RQUA 3I56Q 2RJDA 1G83A 4JJBA 5GAN2 3RR6A 4M75E 1WJSA 1WHHA 3VUZA 5IHIA 3M5AA 1PCXA 3AHUA 1ZLMA 3LWHA 2RHXA 1MMNA 1OU9A 4AT1B 3JCMb 4FCYA 2RI5A 1PRMC 1GFDA 1QVFS 4M7AG 2FHDA 1OZ3A 1C0MA 2RMOA 3ER0A 1UHCA 2RI2A 4ZGEB 2DEQA 3JB9J 2QA4T 3OYHA 3U23A 5KYYB 4A4KA 3HRUA 2P0PA 5FRNA 4M7DG 1VQKQ 3CCUA 3JSCA 3EHQA 1XOVA 1KJWA 3EFOA 5I21A 2K3YA 4QT7A 3QJYA 4HKEA 5CK9A 1CSKA 5GMKi 3NMZC 4OB2B 1WIEA 3INZA 3JCMf 3MP6A 4RG8A 2OTJA 2CUDA 1SEMA 2DRMA 2DYIA 3OYKA 1UJYA 2DL3A 2DTIA 1FMKA 2LJ3A 2XK0A 2RB6A 2P4RA 3NTHA 1VA7A 2K9GA 3OS0A 3OSVA 2ED0A 2F1LA 1M2VB 1PKTA 1VQ8A 1ZA1B 2D0NA 2CGHA 2NWMA 2GTOA 3CC4T 1ZX6A 2CP7A 4XTWA 1QMCA 3A8OB 3TU4K 3P8DA 2E41A 5IHNA 3MCAB 4DEYA 2PZ1A 4XTVA 2CSIA 4D6WA 3N5BB 2O4XB 2CT4A 2EGCA 1KSWA 1IB8A 4M7AC 3VRYA 1RI0A 3JV3A 4C5HA 2DA9A 1YI2A 1ACMB 3SFMA 4OMFB 4M7DC 1KQ1A 3JCMe 1WHGA 4HVWA 2V1RA 4J83A 3CD6A 3VRZA 1PKSA 4M7AB 1NJIC 2HL5C 1PSEA 2F2WA 3M0PA 4C8QG 3A98A 4OB3B 4M78E 1LJOA 2JTFA 4ZN3A 3M55A 2XG8D 3OYEA 1N8RC 4M7DB 2DYBA 1W2BS 4AFSC 1JQQA 2XIDA 3SWNC 2LT1A 5CKBA 3LX7A 3L1AA 4DBFA 1N9SA 2JTEA 2OAWA 1VQOT 3L2VA 3C12A 1B07A 3CCUT 4FW2A 4RTYA 1PD0A 3CC2A 3SWNB 3EHRA 1EZZB 1KD1C 1G5VA 1KC8U 1S72A 5GAN3 4J7FA 2X3XD 1AT1B 3I5SA 4AG1C 5CQXA 1Q81C 2WSCE 1GBQA 3E9GA 4IIMA 3I35A 1M90U 2E6ZA 8AT1B 2OTJT 4C92E 5KYUA 4DBQA 3EGUA 4AFZC 1K8AC 5ECAA 4NL2A 3X25B 5CKDA 3UPUA 4J9DA 4R56A 4XU3A 1VQ8Q 3L2QA 4KT0E 2DIGA 1QCFA 2VB6A 2QTXA 3RKXA 1YHQA 2COWA 1PD1A 2JM8A 3G71T 4XQ3A 3GNFB 5AT1B 3TQ7P 2EFIA 3BDLA 3UWNA 4BDYA 3CMET 2QQ9A 2CH4W 2FO0A 2BZYA 4A63B 2KYMA 3VJPA 1W70A 3KUFA 3C94A 3REBB 4C8QB 4J9HA 1YCSB 3FEOA 1K9AA 2XHCA 3NFCA 2C0TA 1YI2Q 2DEUA 4CC2A 4PJOF 1BI2A 1I4K1 1YI2T 2E65A 1WXBA 2DBMA 4PFOA 3D7SB 2LT4A 2NUPA 2VV5A 3CD6T 1SG5A 4A54A 1TSFA 4PJOD 1U06A 1NYFA 1WLPB 1AEYA 2JN0A 1NPPA 3I55A 3PTAA 2D1XA 2XD0A 2VKNA 2CREA 1UGRB 2DM1A 3QKJA 2YLCA 2L3QA 2K4YA 3VUBA 3JCMJ 1TXQA 1WX6A 2EYYA 1BI0A 3MO8A 3JCMd 1V76A 1M3BA 4N4GA 2YT6A 1JJ2A 1UB4A 3CC2Q 2PUKB 1R0BG 1RABB 4QVZA 1B34A 1QCOA 2E5KA 1YITT 1EX4A 2EVRA 1VQPA 2O9SA 1S72Q 3JCMg 1S72T 3JCMQ 5LJ5j 2DILA 2DXTA 4C92F 8ATCB 3CCSA 3C95A 2M0OA 2X3WD 1TWBA 1XTDA 1PNJA 3QUIA 2QEXT 2L3RA 2GBQA 3RNJA 2KSSA 4JS5A 1Q86C 1WJQA 2M9UA 3EFRA 2L2PA 4E7LA 4RTVA 1PSFA 3M9QA 3PIPA 4RKUE 2EJFA 1ZSGA 1ZUKA 3NTIA 1U8RA 1IXDA 2DO3A 1YHQQ 2L89A 2X51A 5KYWA 5GANg 1LCKA 1NPRA 3EG0A 1OI1A 2RJCA 5A0LA 2KBTA 1Y57A 1VQNQ 4CC4B 1MV0B 5GANh 2B86A 2DNUA 1UGPB 1HSQA 3URGA 2RQTA 3CPWS 1TUCA 2KY9A 3TREA 4PJOA 1H3ZA 1TTHB 2R5AA 1OZ2A 5LJ5h 1QKXA 2MOXA 2LX7A 2AT1B 9ATCB 1YWPA 1V29B 1K73U 3I55T 1C1AA 1I5OB 1UE9A 4IUTA 3S3NA 2SEMA 3OY9A 2KYBA 1RAEB 2A08A 2GNCA 4OP0A 5GAMf 5LJ3g 1KD1R 2D0QB 2KMTA 1QVFP 1X69A 2DK3A 3FJ5A 3CXCS 5GAN5 2HQXA 2J6KA 2VXFA 1OPLA 2ESWA 3I5RA 3R6NA 1SSHA 3BW1A 4A4HA 1VQPQ 1WHLA 4OMPA 5DLQE 4RUGA 3CCVA 4K11A 4M75C 3CCSQ 4M7AF 3CCST 1NZ9A 2OX7A 5HY6A 2KQWA 1KQSS 3NHNA 1QP2A 2DBKA 1SPKA 1YBYA 4MDXA 1VQLA 2DFUA 5CO7A 4M7AD 1OQKA 2VXEA 4M75B 1IRXA 2A0FB 1G8XA 5CKEA 1N27A 2QASA 1T3LA 1GBRA 1BIBA 4M7DD 5GAMe 1X27A 5FWBA 5DLOA 5KYYA 3UA7A 2HKNA 1VIFA 4Z02A 1JBMA 2A3LA 2OTLA 2RPNA 1O75A 1WPYA 4DQ2A 1MUZA 1VYTA 3RESA 1B3QA 1WDXA 2A7YA 3G6EA 3REAB 2E6NA 1BI3A 3JB9F 1FYNA 2COYA 4M78G 3EG9B 1WGSA 4A4GA 4RCCA 2CZ6B 1K4US 1YIJA 1M1GA 3PMTA 4J9BA 4F7UA 3HRSA 2AIRB 3JAME 2EYQA 3TCJA 4PL6A 2HNIA 3J7AF 1IGQA 2CS7A 3VS3A 5I11A 2RHUA 1M2VA 1BKBA 4E7JA 2HCKA 3S3MA 1G2BA 3CCQT 1OU8A 2DL5A 1UGVA 4E7KA 1W2BP 2IIMA 4Y91A 2LDMA 3OYAA 1UGQB 4WCIA 3LLRA 1TUGB 4O5VA 4PJLA 1QVGA 2O4XA 5L23A 4IUQA 3PVQA 2QDYB 4BI3A 4XTYA 2A37A 1EIFA 1KHCA 3TSWA 4C92G 3GIBA 4AFUC 2M1HA 3EGXA 5HKCA 4XU0A 3GLXA 2OJ2A 2MMPA 1UGSB 2ZPIB 1Q86R 2MWPA 4PJJA 1M3CA 2FZGB 4N0AC 2XDBA 1ABOA 3FJPA 3CCVQ 2H3JA 4PJNA 4C8QD 2YRCA 4BACA 2JS2A 3CCVT 3VYHB 4FYYB 4M78C 4M7DA 1NEBA 1VQLQ 2EW3A 3CEYA 4HCZA 1M1FA 3CCET 3WVEB 3PNWC 1X6OA 3OW2A 2DERA 2ZZDA 3CCLA 1AOJA 4M78B 3RKWA 2MF2A 3TVTA 1WHMA 2EQKA 3EG2A 3EGDB 2OAUA 2CYZB 3M0TA 2OTLQ 4QQDA 1BBZA 4LXCA 3C0CA 3SWNA 3G6EQ 2E4HA 1M90C 3JB9H 2KEAA 1VQMA 2EGAA 4HVVA 1M8MA 3NGPA 1SKUB 1PHTA 3L2WA 1Y96B 2FPEA 1YIJQ 2HZYA 2DZ9A 4A4FA 2HD0A 1BK2A 4PJMA 4R0KA 2O2OA 2Y90A 1DJ7B 1Y0MA 1AZGB 5EG2A 4C92C 1K9MU 5FW9A 4ZGDB 2MPXC 3HL8A 5GAMd 3RKYA 1K9MR 5GAOq 2NYSA 4MZPA 3E9FA 4XK8E 5GAN8 4C92B 2P0QA 1P92A 1ZA2B 1IHWA 1PG5B 2QTVA 2EJGA 3EFSA 4ZGJB 5I2SA 2CP0A 3CC7T 2Y4YA 5CCAA 1X6GA 2Z0WA 1D1BA 4C8QA 1SRMA 4X34A 1VUBA 1UUEA 2C0OA 4JRKA 3M0RA 4LUDA 3X26B 2QA4Q 1MMDA 1M1KU 3OYCA 2E64A 1VQOA 1HJDA 3WXMB 1UJ0A 1M1KR 2ABLA 4E7HA 2KR3A 3FRNA 2AZVA 1NBEB 4EDUA 2V8KA 2HBPA 2AHJB 2L3PA 5FROA 4ATOA 1QP3A 3M57A 4NL3A 2ENMA 3A5ZB 3G4ST 4PLLA 2EJ9A 5DY9A 2JT4A 2RQVA 1TU0B 3CCLQ 4ZTFA 2X35A 2HSPA 1QLYA 3CCLT 2QDLA 3JB9G 1ZHIA 3AT1B 2J06A 2PU9B 4OMLA 1HD3A 2R58A 2EPDA 3OSSC 1B7TA 2QXFA 3CC4Q 5KYXA 2KRSA 3DB3A 1QCNA 3H0FA 2EWNA 2DZCA 1VQMQ 3G71A 1WXUA 1VQMT 4PFZA 2LJ1A 4F04B 2RQWA 2ZPFB 3OYYA 3CMEA 1J3TA 1AWJA 1YJNT 4OGEA 5IXBA 1AWXA 3CPWP 4RTZA 4LDVA 1MNDA 5GAN6 1ZUYA 4KUDK 4LD6A 1I0CA 2J6FA 5HCKA 1Q95G 1YJWT 2LZ6B 4M75F 5CKHA 4QQ6A 1SHGA 3HP9A 4CI0C 4XTUA 2LC4A 3M4GA 3M0SA 1N9RA 1BCMA 5IHKA 4C0GA 4HVUA 4KH0B 1YP5A 1WI7A 5J39A 4O6JA 3CXCP 1AZEA 3VU3C 4EMKC 2V8JA 2E3IA 5D7UA 3HHTB 1R77A 4E2FB 2G3RA 4BY6C 3KXTA 4BE1A 1VQOQ 2X4JA 3ZFJA 1VQ5T 4V2SA 2V8IA 3PGGA 3OYFA 3CCUQ 4BD3A 1S1NA 1AWWA 4EMKB 2RK2A 1TH7A 3L2ZA 1YITA 1D1CA 3DKMA 2CP3A 2ED1A 4BY6B 1KQSP 3LGFA 1KC8R 4JLIA 1A0NB 2HEQA 1D0XA 4TVRA 2QEXA 3UT1A 3M53A 3V8KA 2OTJQ 3QSUA 2DETA 1PC0A 1FXXA 2RQRA 4KGVB 2L8DA 1M90R 1BI1A 1XJWB 4JZ3A 3FC3A 3GOXA 3MP1A 4OB1B 3OYNA 3SB2A 2CDTA 4WTOB 1HXDA 3OYMA 4M77C 1XNIA 1RLQC 3G71Q 2JTMA 3L2UA 4Z8AA 4FU6A 1VQ7T 3CMEQ 2QYZA 2C06A 1OPKA 1JU5C 3JCMc 1MGQA 2DVJA 4FIBA 3GBQA 2EQIA 3CCJT 2CZ1B 1WHJA 1RI9A 2DVEA 4RMOA 4E7IA 2E5QA 1I07A 2KXCA 4OMOA 3DB4A 2LQ8A 1I5LA 2YSQA 4M78F 3CD6Q 4FYVB 2L3SA 1SSFA 3E2UA 4HXJA 3LYIA 4M78D 5GAOr 1VQ4A 2LX9A 5KCHA 3SEMA 1WFWA 3EG9A 4OGCA 3CBMA 1BB9A 3MEAA 4C5IA 5A0GA 4DBHA 4II1A 3QJ6A 4F7UE 5A2QE 1YJ9A 3H41A 1WJRA 3CCMT 5GANj 3HPWA 3KFVA 4HA8A 1E7OA 3RBBB 1YITQ 1YCYA 3A1PA 4OF1A 4VUBA 3JCMW 2KI7A 3ASKA 2E10A 2JZ2A 2ZPBB 4OB0B 2WSFE 1LPLA 4JS4A 5CVIA 3J81E 2QEXQ 3JCMh 3M0UA 4A53A 4J6XA 4C0FA 4DOVA 1VYVA 1VQ9T 4C92D 3OA6A 2GFAA 1T3SA 2ECZA 3VKIA 3JRZA 2P84A 2CP6A 4OMMA 1RAGB 3M56A 3MPUB 4CC3A 5CIUA 2J05A 1MV3A 2K2MA 4J6WA 5LJ3j 4XTXA 4LDUA 3UDCA 4M75G 4J9GA 3CPFA 4JDSA 5GAOm 2DL8A 2RNAA 4JUVA 4CC7A 1R8OB 4N0AA 4E6RA 1IO6A 1QQJA 2O88A 2GFUA
chains in the Genus database with same CATH topology
2XI9A 3S6WA 4JRPA 4M78A 2LDMA 3JSCA 3CCUA 3OYAA 1XOVA 1UGQB 5FLXE 5I21A 3LLRA 4O5VA 2K3YA 2K5LA 1QVGA 2O4XA 4IUQA 3OS1A 4J5YA 2JNGA 2QDYB 3QJYA 4BI3A 4XTYA 2RHZA 3H6ZA 4HKEA 3DLMA 1EIFA 1KHCA 4M77B 1G3WA 5CK9A 1I8FA 4C92G 5HK3A 2K57A 4MZTA 1BIAA 2M1HA 4XU1A 4BE1A 1Q7YU 2EKOA 1VQ8T 3GIBA 5HKCA 4XU0A 3GLXA 3CCQA 2MMPA 3OS2A 5GMKi 4NOYA 1U1SA 4OB2B 1VQ4T 4C8QC 1UGSB 2O01E 2ZPIB 3INZA 3JCMf 3MP6A 2MWPA 4M75A 4RG8A 5GAOn 1K9MC 2OTJA 5I2MA 2LVMA 2PVGB 1Y96A 4N0AC 3QBYA 5KCOA 5LJ3e 3OYKA 2XDBA 2DTIA 1VQNA 3FJPA 2H3JA 2XK0A 2RB6A 4C8QD 4BACA 2DIQA 4J7IA 3CCVT 2RA2A 2XICA 3NTHA 3VYHB 4M78C 3OS0A 5KH6A 3OSVA 1YJ9T 3TEEA 4C5GA 3F70A 5LJ3h 3V7CA 4M7DA 3LWIA 1VQ8A 3JB9I 4J8OA 5J3BA 2CGHA 4LDWA 1M5Q1 3OYDA 2LCLA 4HCZA 3CEYA 1Y7XA 3CC4T 1M1FA 5GAOl 3CCET 3OMCA 4XTWA 3A8OB 3WVEB 3TU4K 1VIEA 3P8DA 4M77E 2E41A 5CQYA 3PNWC 1X6OA 4B9XA 2XDDA 2QI2A 2ZZDA 3CCRT 3OW2A 3MCAB 3CCLA 2ZGWA 4M78B 3RKWA 1H641 2MF2A 4XTVA 3OMGA 2DXBA 4C92A 4EMGA 1QVGS 4D6WA 3N5BB 1KQ2A 3HSBA 4ELZC 2EQKA 2F69A 2RJEA 4GY5A 5M9OA 2O4XB 1Q82C 3E19A 1IREB 4R55A 2OAUA 2CYZB 2ZCFB 5FU6C 5GAN4 4E47A 1JB0E 2BIVA 5KE3A 4QQDA 4M7AC 1MHNA 2YRVA 3PFSA 1M1KC 1RI0A 3A8LB 3MEVA 4C5HA 3SWNA 3CCEA 4JRQA 1K8AU 1M90C 1YI2A 3JB9H 2DPPB 3SFMA 3G7ZA 4OMFB 1KQ1A 1VQMA 4M7DC 3CCRA 4L6V5 4BI4A 3JCMe 3L2WA 1Y96B 2EQJA 5FU6B 4J83A 2DZ9A 3JCMP 4A4FA 2HD0A 3CD6A 4M7AB 3GP8A 3QG1A 2DXUA 1W4SA 1NJIC 2LNVA 1PSEA 1QVPA 2Y90A 1DJ7B 4L59A 4C8QG 5KE2A 4OB3B 4M78E 2MAMA 5EG2A 4C92C 1K9MU 1LJOA 2F5TX 2JTFA 3M55A 2XG8D 1I81A 4ZN3A 3OYEA 4ZGDB 3OYGA 3HL8A 1N8RC 4M7DB 5GAMd 3RKYA 3MEUA 3CMAT 2IG0A 3CC2T 1W2BS 3WVDB 3OW2S 2K5IA 3MP8A 1M9SA 5GAN7 5GAOq 4MZPA 2XIDA 5LL6S 3ZEHA 3E9FA 3SWNC 2LT1A 5CKBA 3A8HB 2ZPHB 3LX7A 4XK8E 3SD4A 5GAN8 2ZPEB 4C92B 2P0QA 3L1AA 3MHXA 1N9SA 1P92A 3JB9D 3O8VA 1VQOT 2FVUA 3L2VA 4MMLA 2EJGA 3EFSA 4ZGJB 1ZQ1A 4JJNK 5I2SA 3C12A 3BY7A 2KDSA 2R57A 5J26A 3CMAA 3CCUT 4M7AE 3PT9A 3CC7T 3CC2A 3SWNB 2Y4YA 4XU2A 1KD1C 5CCAA 5GANd 4N4HA 2CZ0B 4XTZA 4ME7A 3OYJA 1G5VA 1KC8U 1Q82U 4M7DE 4C8QA 2PVDB 4PNOA 5GAN3 4J7FA 1S72A 4X34A 5FRNA 2EAYA 1VUBA 4OVAA 3LW5E 5IN1A 4JRKA 4ZN1A 3X26B 5CQXA 1Q81C 1U1TA 3OYCA 2E64A 2WSCE 3E9GA 1M1KU 1VQOA 2WSEE 3WXMB 1YHQT 1M90U 2E6ZA 4MDWA 2M16A 3OYBA 1NE8A 2RD1A 4E7HA 3Q1JA 5L8RE 5LJ5d 2OTJT 4C92E 3JCMX 2WACA 3FRNA 1X01A 3ME9A 4EDUA 3NTKA 2V8KA 3CC7A 4CRIA 1K8AC 2HBPA 1VQNT 2AHJB 2GQVA 3LH0A 2KK4A 4WF2A 4NL2A 3L42A 3OBYA 3VYGA 5FU7C 3QHSA 4Q5WA 3CXCA 3X25B 5CKDA 5FROA 3UPUA 1NJIU 4ATOA 3BDUA 4R56A 1QP3A 5GAOp 4XU3A 4M77F 5LJ5g 4BDZA 3M57A 4NL3A 3L2QA 4KT0E 1N8RU 1RL2A 2DIGA 3A5ZB 4FT4A 3HFOA 2QTXA 3G4ST 2RM4A 3META 3RKXA 1YHQA 4MMKA 4PLLA 3G71T 2EJ9A 5DY9A 4F7UF 4ZTFA 2VGMA 4XQ3A 3GNFB 2K3XA 1Y71A 2EFIA 2X35A 3BDLA 3UWNA 5FU7B 4BDYA 2K5FA 3CMET 2KAFA 2QQ9A 4BUGA 5C0MA 3CCLT 3JB9G 1ZHIA 4M7AA 1G3YA 2PU9B 4N4IA 3FLGA 2JOYA 2R58A 2RHIA 3VJPA 2DXCA 2R5MA 3KUFA 5LJ3d 3C94A 4JRIA 2ZPGB 4C8QB 3OSSC 3RIRA 2VUBA 3FEOA 3EAEA 5FRMA 2QXFA 2XHCA 3NFCA 4L5GA 3G4SA 3DB3A 2EWNA 2DZCA 3X28B 3QZ9B 2RK1A 3G71A 4PJOF 1BI2A 1FWZA 1I4K1 1VQMT 2E65A 1YI2T 1KD1U 3A8GB 3QIIA 2ZPFB 3OYYA 4ELYC 3QYHB 3CMEA 4J6YA 1KG1A 1YJNT 4OGEA 3QXEB 2FYKA 2LT4A 3MEWA 2VV5A 2LRQA 3QDRB 3CD6T 4LDVA 3OB9A 3FDRA 2E70A 4A54A 1Q81U 1KC8C 1LNXA 3FB9A 4PJOD 1VQ6A 5GAN6 4KUDK 2DAQA 4LD6A 2JN0A 1FX7A 1NPPA 3I55A 3PTAA 4EMKA 1W2BA 1JRIA 2CZ7B 4UC4A 5CAIA 5CR2A 2E12A 2PVOB 3V8JA 2XD0A 3L2RA 2VGNA 1XQHA 3GF5A 2XDPA 4QW2A 3VV0A 1YJWT 3P8HA 2JVVA 3JCMV 2FL7A 1UGRB 1VQPT 2BKDN 2Y4XA 1QW1A 3QKJA 4M75F 5CKHA 4C8QE 1YJNA 2YLCA 4QQ6A 2K4YA 5HK0A 3HP9A 4CI0C 3VUBA 4EPCA 3JCMJ 4XTUA 4FT2A 4GLKA 1KHIA 2GCXA 2LC4A 2XU8A 3M4GA 1BI0A 3MO8A 3JCMd 1N9RA 2DTOA 4C0GA 4M7DF 3X24B 4N4GA 2X4XA 1JJ2A 4HCCA 1UB4A 2PUKB 5J39A 4QVZA 3SDZA 1B34A 4LDYA 1YJWA 2HAXA 1YITT 4O6JA 4EMHA 1VQPA 3VU3C 4EMKC 1D3BA 5IT9E 2V8JA 3JCMg 4DOWA 3HHTB 3ZBDA 1S72T 3JCMQ 5LJ5j 3CPWA 1BYMA 5C6SA 2DXTA 4KBMB 3KBGA 4C92F 5GAMg 2G3RA 3C95A 1M4ZA 2M0OA 3QO3A 4BY6C 3KXTA 4MZMA 2X4JA 3CCSA 1XTDA 3ZFJA 1VQ5T 4LDXA 3QUIA 4V2SA 2QEXT 4IKFA 3PIOA 2L3RA 2V8IA 3PGGA 3OYFA 4JS5A 2KSSA 4RCBA 4X9CA 1WJQA 2M9UA 2RI3A 3EFRA 4BD3A 1Q86C 5GAMh 4PJOG 4E7LA 1IZ6A 4EMKB 2RK2A 3P8BB 1PSFA 1TH7A 3L2ZA 3M9QA 1YITA 2DD4A 3DKMA 4RKUE 2DTHA 3PIPA 2EJFA 4IUUA 1WQ7A 1U8RA 3NTIA 4BY6B 4C5EA 3GNGA 3LGFA 4HT8A 3CBPA 4JLIA 4Y28E 2DO3A 2EIFA 2L89A 2GF7A 2DD5A 3I56T 1VQ5A 4TVRA 2QEXA 5GANg 3UT1A 3M53A 3V8KA 1NPRA 3QSUA 1OI1A 2RJCA 5A0LA 1FXXA 4YTLA 1HK9A 2L8DA 3C4SA 2MI6A 4QQGA 5GMKj 3FIFA 1BI1A 4KULA 4QVDA 2K2VA 4BI8B 2E1HA 5GANh 3FC3A 3GOXA 3MP1A 1B34B 4OB1B 2F5KA 4FSXA 3HRTA 2X4WA 3M4YA 1UGPB 4BE0A 3URGA 1D3BB 3OYNA 4IUVA 3CPWS 3SB2A 2KY9A 1HXDA 5D6WA 3OYMA 1G3TA 3TREA 4M77C 4PJOA 1XNIA 3I56A 1H3ZA 4XAXB 2JTMA 3L2UA 2R5AA 5DM7R 4FU6A 1OZ2A 5LJ5h 2X4YA 1VQ7T 1VQKT 4DA4A 4M77D 1ZBXA 4NS5A 2C06A 3JCMc 1MGQA 2LCCA 2DJZA 3LGLA 4FIBA 1V29B 2KVQG 3RERA 3V7SA 2YHTA 3M59A 3CCJT 1VQ6T 2EQUA 2CZ1B 1KQSA 3PMIA 1K73U 4BB7A 4C8QF 2B8AA 1Q86U 3I55T 1O9SA 3X20B 2QA4A 2EQMA 4IUTA 2RJFA 2DVEA 5AYFA 2QQRA 4RMOA 4E7IA 1LOJA 2E5QA 4F7UB 3S3NA 3QPHA 5GMKe 1VQ7A 3OY9A 1VQKA 4QVCA 3QZ5B 3HFNA 3DB4A 2LQ8A 4OP0A 4X9DA 2RHYA 5GAMf 5LJ3g 1I5LA 4PJOC 1N6AA 2XKOC 4M78F 2QQSA 2D0QB 2KMTA 3V7RA 3GPLA 2MWOA 2DK3A 1SSFA 2PQWA 3CXCS 5GAN5 5GAMj 3DLLA 2HQEA 3E1SA 5GMKh 2P4TA 2VC8A 3CCJA 2HQXA 5GMKm 4P5NA 4LD9K 2VYTA 4ZTJA 4B9WA 2VXFA 3LYIA 4M78D 4JLGA 5GAOr 1VQLT 1VQ4A 2LX9A 5KCHA 4PJOB 2QQBA 3BW1A 2IVWA 1M8VA 4A4HA 2NLUA 4C0DC 4OGCA 4PLIA 3CBMA 3MEAA 4C5IA 2LQKA 5DLQE 5A0GA 2BUDA 3J80E 3CCVA 4RG2A 4M75C 5GANf 4II1A 3QJ6A 4F7UE 4M7AF 5A2QE 3CCST 3M58A 1NZ9A 4M77G 3OYIA 1Y07A 3A8MB 4FM4B 5HY6A 1YJ9A 1WJRA 2KQWA 4C0ZA 3CCMT 1KQSS 4IURA 5GANj 1QP2A 3HPWA 2OTLT 4M75D 1YBYA 4MDXA 4C0DB 1VQLA 3CC4A 4HA8A 4F7UG 5CO7A 3G6ET 1YCYA 4M7AD 4OF1A 4VUBA 4HT9A 2VXEA 5LJ5f 2L5QA 4M75B 3JCMW 4HCBA 2I2LA 2PUOB 3CBOA 5CKEA 1N27A 3ASKA 2D6FA 4A4EA 2E10A 1BIBA 4M7DD 2JZ2A 2ZPBB 4OB0B 5GAMe 1QVFA 3RMQA 4PJOE 2WSFE 3OBWA 5D6YA 5DLOA 2CKKA 3RUXA 3S3OA 1YIJT 4JS4A 2RH2A 5CVIA 4FL6A 4BE2A 3J81E 3CCMA 1VIFA 4Z02A 1JBMA 1WNLA 3JCMh 2A3LA 3H8ZA 5A0DA 1Q7YC 2OTLA 4A53A 1K73C 3BFMA 3OS5A 1O75A 4J6XA 1WPYA 1G3SA 4DQ2A 4C0FA 1GXIE 1AHJB 4DOVA 3RESA 2A7YA 3G6EA 1VQ9T 4C92D 3HKSA 3OA6A 2E6NA 1BI3A 2GFAA 3JB9F 3RMSA 2QQAA 3T9NA 5GMKl 3QYGB 2RO0A 4M78G 2P0KA 4M77A 1WGSA 3V8LA 4A4GA 5IAYA 5D6XA 1X75C 3R6OA 4RCCA 3VKIA 1WQWA 2CZ6B 2FB7A 1YIJA 3OYLA 1M1GA 3JRZA 2JUFA 2RJDA 3PMTA 5GAN2 5GANe 2D9TA 4M75E 4F7UA 1WJSA 3M56A 3HRSA 5LJ3f 3VUZA 5CIUA 3JAME 3M5AA 1UEBA 2EYQA 3TCJA 4IUPA 3AHUA 3LWHA 2RHXA 4PL6A 2HNIA 2LTOA 1OYXA 1JJ2S 4KUIA 4J6WA 3J7AF 5LJ3j 2CS7A 4XTXA 4LDUA 1VQ9A 3UDCA 3JCMb 4M75G 2RI5A 2RHUA 3OQ5A 3M54A 3CPFA 2DKGA 4JDSA 5GAOm 1BKBA 4E7JA 5LJ5e 3S3MA 4PKCC 5CKFA 2FHDA 1QVFS 4M7AG 1OZ3A 4JUVA 1R8OB 4N0AA 3ER0A 2RI2A 4ZGEB 3CCQT 2DEQA 3JB9J 2QA4T 3OYHA 2GFUA 4A4KA 3HRUA 2P0PA 2YLBA 4E7KA 4M7DG 4Y91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHY A;  3S6W A;  3O8V A;  2LDM A;  2QQS A;  3L2V A;  3OYA A;  2MWO A;  3LLR A;  1SSF A;  2PQW A;  2K3Y A;  2R57 A;  2HQE A;  3MO8 A;  5J26 A;  2O4X A;  4IUQ A;  3OS1 A;  2HQX A;  4N4G A;  2VYT A;  4ZTJ A;  2X4X A;  4B9W A;  2RHZ A;  3H6Z A;  4N4H A;  3DLM A;  5J39 A;  1KHC A;  4QVZ A;  3LYI A;  3OYJ A;  1G5V A;  2M1H A;  2EKO A;  5KCH A;  4X34 A;  3OS2 A;  4OVA A;  4A4H A;  2NLU A;  5IN1 A;  4PLI A;  3MEA A;  4C5I A;  3MP6 A;  2MWP A;  3OYC A;  3E9G A;  2BUD A;  2LVM A;  5C6S A;  3S3O A;  2G3R A;  4BE1 A;  3QBY A;  2M0O A;  4RG2 A;  5KCO A;  2M16 A;  3OYK A;  3OYB A;  4E7H A;  3Q1J A;  4II1 A;  3QJ6 A;  2XK0 A;  4IKF A;  4BAC A;  2DIQ A;  2L3R A;  3OYI A;  3OYF A;  3NTH A;  2WAC A;  3ME9 A;  4BD3 A;  1WJR A;  1WJQ A;  2RI3 A;  3NTK A;  4CRI A;  4IUR A;  4EDU A;  3OS0 A;  3LH0 A;  5KH6 A;  4E7L A;  3L42 A;  4C5G A;  3F70 A;  4Q5W A;  5FRO A;  3M9Q A;  4IUU A;  3OYD A;  4BDZ A;  3NTI A;  4HCZ A;  3CEY A;  4C5E A;  3L2Q A;  2DIG A;  3LGF A;  3OMC A;  3P8D A;  1N27 A;  3ASK A;  3MET A;  3PNW C;  4B9X A;  4A4E A;  4PLL A;  2JZ2 A;  2L89 A;  2GF7 A;  4ZTF A;  3OMG A;  5D6Y A;  2CKK A;  2K3X A;  2X35 A;  2EFI A;  3BDL A;  3UT1 A;  4FL6 A;  3UWN A;  4BDY A;  1OI1 A;  4BE2 A;  2EQK A;  2RJC A;  5C0M A;  2RJE A;  4GY5 A;  4Z02 A;  5M9O A;  2O4X B;  3H8Z A;  2L8D A;  3C4S A;  4QQG A;  4N4I A;  3FLG A;  2BIV A;  5KE3 A;  4QQD A;  2R58 A;  2RHI A;  3FC3 A;  1MHN A;  2YRV A;  3GOX A;  3MP1 A;  2R5M A;  3KUF A;  2F5K A;  3PFS A;  1RI0 A;  2E6N A;  2GFA A;  2X4W A;  3MEV A;  4C5H A;  3OA6 A;  4BE0 A;  3FEO A;  3EAE A;  5FRM A;  2RO0 A;  3OYN A;  4IUV A;  2P0K A;  1WGS A;  4A4G A;  5IAY A;  5D6X A;  3DB3 A;  5D6W A;  3OYM A;  1H3Z A;  3L2W A;  1XNI A;  2EQJ A;  3OYL A;  3QII A;  3L2U A;  2R5A A;  2RJD A;  3PMT A;  4A4F A;  2D9T A;  1OZ2 A;  4FU6 A;  1WJS A;  2X4Y A;  3MEW A;  2LRQ A;  5CIU A;  4L59 A;  4NS5 A;  4IUP A;  3OB9 A;  5KE2 A;  2LCC A;  3FDR A;  2RHX A;  4PL6 A;  2LTO A;  1OYX A;  3LGL A;  2JTF A;  3OYE A;  3OYG A;  2DAQ A;  3MEU A;  4LD6 A;  2RI5 A;  2RHU A;  3OQ5 A;  2IG0 A;  2EQU A;  3PMI A;  4UC4 A;  3MP8 A;  2B8A A;  4E7J A;  3L2R A;  3S3M A;  4QW2 A;  2XDP A;  2FHD A;  1OZ3 A;  3P8H A;  3ZEH A;  2EQM A;  3E9F A;  2RJF A;  4IUT A;  2QQR A;  2RI2 A;  2BKD N;  3QKJ A;  2E5Q A;  3LX7 A;  4E7I A;  3S3N A;  3SD4 A;  3OYH A;  2GFU A;  3OY9 A;  4QQ6 A;  5FRN A;  4E7K A;  3DB4 A; 
#chains in the Genus database with same CATH topology
 4JRP A;  4M78 A;  4ZNX A;  5FLX E;  1RAF B;  1GFC A;  2ATC B;  3EGD A;  2D8H A;  4J9E A;  2YUQ A;  3OS1 A;  4AG2 C;  4J5Y A;  4KRT A;  2RHZ A;  5FWC A;  1ZSZ A;  2K57 A;  1BIA A;  5GJV B;  1Q7Y U;  3I55 Q;  1V1C A;  3CCQ A;  1VQ4 T;  1K73 R;  1K9M C;  2MIO A;  1YNZ A;  1Y96 A;  3QBY A;  2FEI A;  2DL4 A;  4AFQ C;  1CKA A;  4J7I A;  2RA2 A;  1YJ9 T;  3TEE A;  5LJ3 h;  3JB9 I;  2XMF A;  4LDW A;  1Y7X A;  1VIE A;  4M77 E;  5CQY A;  4B9X A;  2NUT B;  3CCR T;  2QK0 A;  1NYG A;  2QI2 A;  2ZGW A;  3OMG A;  4C92 A;  4EMG A;  1QVG S;  1KIK A;  2BE7 D;  4ELZ C;  2RJE A;  4GY5 A;  5M9O A;  4R55 A;  1IRE B;  5FU6 C;  4GLM A;  1JB0 E;  4Z89 A;  2J7I A;  5KE3 A;  2NUZ A;  3PFS A;  1M1K C;  3MEV A;  4HCK A;  3CCE A;  4JRQ A;  1K8A U;  2LNH B;  1WYX A;  4L6V 5;  4QKU A;  2CP5 A;  3BE3 A;  5FU6 B;  3JCM P;  1ZUU A;  1CKB A;  2FRY A;  2LNV A;  1QVP A;  2MAM A;  2F5T X;  1WHK A;  3OYG A;  3MEU A;  3CMA T;  1OX8 A;  2IG0 A;  3OW2 S;  3MP8 A;  1M9S A;  1RAC B;  5GAN 7;  3ZEH A;  1AD5 A;  4RTX A;  4FYW B;  1RAH B;  3MHX A;  2SRC A;  4E7S A;  3JB9 D;  2J6O A;  2LQW A;  2FVU A;  4MML A;  1C6V X;  4JJN K;  5IH2 A;  3BY7 A;  5J26 A;  2JM9 A;  5I22 A;  3PT9 A;  2I0N A;  4XU2 A;  1PWT A;  2CZ0 B;  1QWE A;  3OYJ A;  2KXD A;  1Q82 U;  4PNO A;  1GCQ C;  4LN2 A;  5IN1 A;  3CCQ Q;  1X2K A;  4F14 A;  2WSE E;  1EFN A;  2YWW A;  4MDW A;  2M16 A;  3OYB A;  1NE8 A;  2RD1 A;  1RAA B;  3EH2 A;  3JCM X;  2WAC A;  3ME9 A;  3CC7 A;  2GQV A;  3LH0 A;  4WF2 A;  3L42 A;  3OBY A;  5FU7 C;  3QHS A;  3CXC A;  2H8H A;  2M02 A;  3BDU A;  4M77 F;  4BDZ A;  4J9I A;  1RL2 A;  4FT4 A;  2BTT A;  2HQH A;  3HFO A;  3MET A;  1SRL A;  2VGM A;  5KYN A;  5FU7 B;  4JJD A;  4M7A A;  3FLG A;  2M0Y A;  1UG1 A;  2DF6 A;  2RHI A;  1BCO A;  1YFN A;  5FRM A;  1Z9Q A;  1JJ2 P;  3G4S A;  3CCE Q;  2D8J A;  3X28 B;  5KYW B;  3VS0 A;  3A8G B;  3QII A;  4FSS A;  3OB9 A;  3FDR A;  2E70 A;  1KC8 C;  3EG3 A;  1VQ6 A;  4KGZ B;  2FPF A;  2ROL A;  1FX7 A;  4EMK A;  1YN8 A;  1JRI A;  2CZ7 B;  4OMQ A;  4UC4 A;  3V8J A;  2VGN A;  1XQH A;  3P8H A;  1OOT A;  2JVV A;  2JXB A;  2BKD N;  1MMG A;  1QW1 A;  1YJN A;  2FG0 A;  5HK0 A;  4RTU A;  4FT2 A;  1KHI A;  2CSQ A;  2DTO A;  1H8K A;  2KT1 A;  4HCC A;  1WZO A;  3QDF A;  4RTW A;  4LDY A;  1YJW A;  2F2X A;  2HAX A;  3ZBD A;  7AT1 B;  1BYM A;  4KBM B;  3KBG A;  5GAM g;  1AWO A;  4MZM A;  2EBP A;  4LDX A;  1PM3 A;  3I9Q A;  4RCB A;  4X9C A;  2JJ9 A;  5GAM h;  3CC7 Q;  2W0Z A;  3P8B B;  2DD4 A;  1HYO A;  4HT8 A;  2PTK A;  3CBP A;  1QKW A;  2EIF A;  2DD5 A;  3I56 T;  1VQ5 A;  2KNB B;  3LH5 A;  2QGF B;  4YTL A;  1HK9 A;  3C4S A;  5GMK j;  2MI6 A;  4QQG A;  3FIF A;  4QVD A;  2OI3 A;  2K2V A;  2E1H A;  2F5K A;  4FSX A;  2X4W A;  3M4Y A;  1D3B B;  1RUW A;  2HDA A;  4IUV A;  1W6X A;  1JXM A;  2PNI A;  5D6W A;  3G4S Q;  1G3T A;  2CT3 A;  4LUE A;  2X4Y A;  1VQK T;  3VS6 A;  1ZBX A;  2QG9 B;  2LCC A;  3LGL A;  2V1Q A;  1SF9 A;  2KVQ G;  3CQT A;  1IGU A;  1VQ6 Q;  3V7S A;  2YHT A;  3M59 A;  2KRM A;  1VQ6 T;  3PMI A;  2B8A A;  1H92 A;  2EQM A;  2RJF A;  2QQR A;  4F7U B;  1VQ7 A;  1YJN Q;  3TSZ A;  4QVC A;  3QZ5 B;  1GL5 A;  4X9D A;  2RHY A;  1N6A A;  2XKO C;  2QQS A;  4F17 A;  1AVZ C;  2MWO A;  3GPL A;  4AMC A;  2PQW A;  1K76 A;  5GMK h;  3CCJ A;  4GBQ A;  5GMK m;  4P5N A;  4LD9 K;  4ZTJ A;  4B9W A;  3MJX A;  2KGT A;  2AKK A;  1NLO C;  4FYX B;  1YJW Q;  2V26 A;  2NLU A;  4C0D C;  4PLI A;  2O9V A;  4DBR A;  2LQK A;  2BUD A;  1K0S A;  4OMN A;  5GAN f;  3M58 A;  4M77 G;  1Z9Z A;  3OYI A;  1Y07 A;  2CH4 A;  2LMJ A;  4C0Z A;  2A36 A;  4ANJ A;  1ARK A;  4M75 D;  3VS1 A;  3EGX B;  4C0D B;  2LQN A;  2AK5 A;  2RN8 A;  2GTJ A;  4HT9 A;  5LJ5 f;  2K6D A;  3EH1 A;  3ZL7 C;  4HCB A;  2I2L A;  2PUO B;  3CBO A;  3UAT A;  4A4E A;  1UHF A;  1QVF A;  4PJO E;  3OBW A;  5D6Y A;  2CKK A;  2RH2 A;  1VQ5 Q;  4BE2 A;  3CCM A;  1WNL A;  1Q7Y C;  1K73 C;  3BFM A;  1BU1 A;  2ROT A;  1GXI E;  1QVG P;  3HKS A;  2QQA A;  3T9N A;  2CUB A;  3V8L A;  5IAY A;  1UTI A;  1X75 C;  4D8D A;  3R6O A;  1WQW A;  2FB7 A;  1LVK A;  2JUF A;  2LJ0 A;  5GAN e;  2D9T A;  5LJ3 f;  2DMO A;  1UEB A;  4IUP A;  1JJ2 S;  2LTO A;  1OYX A;  2K7A A;  4KUI A;  1VQ9 A;  1T0J A;  3OQ5 A;  3M54 A;  2H3E B;  2DKG A;  1QWF A;  5LJ5 e;  4PKC C;  5CKF A;  2DJQ A;  1TS9 A;  1OUL A;  1MNE A;  2YLB A;  5IXF A;  2NUT A;  1VQ7 Q;  3OW2 P;  2XI9 A;  3S6W A;  6AT1 B;  1VYU A;  3H0H A;  2K5L A;  1WXT A;  2KT8 A;  2JNG A;  2F2V A;  3CCJ Q;  3H6Z A;  3DLM A;  4M77 B;  1G3W A;  1I8F A;  5HK3 A;  4MZT A;  4XU1 A;  1VQ8 T;  1SHF A;  2EKO A;  3OS2 A;  2DRK A;  4NOY A;  1U1S A;  4C8Q C;  2O01 E;  2GGR A;  4M75 A;  5GAO n;  2AKL A;  5I2M A;  2LVM A;  2PVG B;  5KCO A;  5LJ3 e;  2LP5 A;  1R0C B;  3NPF A;  1VQN A;  1OX9 A;  2EYW A;  2DIQ A;  2XIC A;  5KH6 A;  4C5G A;  2YUN A;  3F70 A;  3V7C A;  2MK5 A;  3LWI A;  4J8O A;  5J3B A;  1M5Q 1;  3OYD A;  2LCL A;  1TUD A;  5GAO l;  3OMC A;  1W2B A;  1JO8 A;  2BE9 B;  2XDD A;  4JJC A;  4JZ4 A;  1H64 1;  2DXB A;  3EFO B;  1KQ2 A;  3HSB A;  2HBW A;  2F69 A;  4J9F A;  1Q82 C;  3E19 A;  3G1J A;  3CCM Q;  2ZCF B;  5GAN 4;  4IIO A;  4E47 A;  1F1B B;  2BIV A;  4LE9 A;  1MHN A;  2YRV A;  4J9C A;  3A8L B;  1U3O A;  4ESR A;  2KRN A;  2C0I A;  3VS7 A;  2DPP B;  3G7Z A;  4RTT A;  3CCR A;  4BI4 A;  1UDL A;  2W10 A;  2EQJ A;  2QGG A;  3QWX X;  2BZX A;  3QG1 A;  4D8K A;  3GP8 A;  2DXU A;  1W4S A;  1ZBJ A;  4L59 A;  5KE2 A;  3ULR B;  1I81 A;  1WA7 A;  2EKH A;  1MMA A;  1VQ9 Q;  5KYX B;  1GCQ A;  5EC7 A;  1FMW A;  1I1J A;  3CC2 T;  3WVD B;  2LCS A;  2K5I A;  1W1F A;  1D09 B;  1X43 A;  2RF0 A;  5LL6 S;  3A8H B;  2ZPH B;  3SD4 A;  2ZPE B;  1K1Z A;  3O8V A;  2DE0 X;  1ZQ1 A;  2G6F X;  2KDS A;  2R57 A;  3CMA A;  4M7A E;  3O5Z A;  5GAN d;  4M4Z A;  4N4H A;  4XTZ A;  1X2Q A;  4ME7 A;  1GRI A;  4M7D E;  2PVD B;  2FPD A;  3QWY A;  2EAY A;  4OVA A;  3LW5 E;  4ZN1 A;  1U1T A;  1YHQ T;  3M0Q A;  2O31 A;  3Q1J A;  2FRW A;  2K3B A;  5L8R E;  5LJ5 d;  1X01 A;  1VQN T;  3NTK A;  4CRI A;  2KK4 A;  3VYG A;  4Q5W A;  1NJI U;  5GAO p;  5LJ5 g;  2A28 A;  5GJW B;  1NJI R;  1N8R U;  1VQ4 Q;  2DLP A;  2RM4 A;  1Q7Y R;  1M3A A;  4MMK A;  1N8R R;  2VAS A;  4F7U F;  2K3X A;  1Y71 A;  5IT9 E;  1KK7 A;  2K5F A;  2KAF A;  4BUG A;  5C0M A;  1G3Y A;  4N4I A;  4KGX B;  1OV3 A;  2JOY A;  1YJ9 Q;  2HKQ B;  2ZAE A;  1E6G A;  2YDL A;  2DXC A;  2R5M A;  3H9N A;  5LJ3 d;  1JEG A;  4JRI A;  2ZPG B;  3RIR A;  2YXY A;  2VUB A;  3EAE A;  4L5G A;  3QZ9 B;  2RK1 A;  1FWZ A;  3CCR Q;  2YUP A;  1KD1 U;  4ELY C;  3QYH B;  4J6Y A;  1KG1 A;  4KH1 B;  3QXE B;  2FYK A;  3MEW A;  2MYS A;  4PFP A;  5KYU B;  2EYX A;  2LRQ A;  3UF4 A;  3QDR B;  1NM7 A;  2EYZ A;  3VS5 A;  1Q81 U;  1LNX A;  3FB9 A;  1D0Y A;  2DAQ A;  1Q81 R;  1N5Z A;  5CAI A;  5CR2 A;  1NEG A;  2E12 A;  2PVO B;  2QAZ A;  3L2R A;  3GF5 A;  4QW2 A;  2XDP A;  3VV0 A;  1M2O A;  3JCM V;  2FL7 A;  1VQP T;  4C8Q E;  2Y4X A;  1K8A R;  3PE0 A;  2HMA A;  4EPC A;  2AZS A;  4GLK A;  2GCX A;  2XU8 A;  3CMA Q;  4M7D F;  3X24 B;  2X4X A;  3SDZ A;  2M51 A;  4EMH A;  1K0X A;  1D3B A;  4DOW A;  2E3H A;  4Y92 A;  3CPW A;  2NUP B;  5C6S A;  1M4Z A;  3QO3 A;  2MCN A;  2DL7 A;  4IKF A;  3PIO A;  3EG1 A;  2EGE A;  3MKD A;  2RI3 A;  4PJO G;  1IZ6 A;  4X1V A;  4ORZ A;  2DTH A;  4IUU A;  1WQ7 A;  4E7Z A;  1D1A A;  4DEX A;  4C5E A;  2X9H A;  3GNG A;  3IQL A;  1Q82 R;  4Y28 E;  2GF7 A;  2JS0 A;  2FZK B;  1OEB A;  3HTR A;  1PRL C;  4KUL A;  4BI8 B;  1B34 B;  3SHW A;  3HRT A;  4BE0 A;  1UFF A;  1RLP C;  1RAD B;  3I56 A;  4XAX B;  3UA6 A;  5DM7 R;  1X6B A;  4DA4 A;  4M77 D;  4NS5 A;  2YUO A;  2DJZ A;  1TG0 A;  1M27 C;  2COZ A;  3RER A;  4JPB W;  1NLP C;  1VOM A;  2EQU A;  1KQS A;  4BB7 A;  4C8Q F;  1Q86 U;  1O9S A;  2KE9 A;  3X20 B;  2QA4 A;  5AYF A;  2VWF A;  1LOJ A;  1NG2 A;  3QPH A;  5GMK e;  1VQK A;  3HFN A;  4PJO C;  3RDV A;  3V7R A;  1YWO A;  5GAM j;  3DLL A;  2HQE A;  3E1S A;  2P4T A;  4FW1 A;  2VC8 A;  2CP2 A;  2VYT A;  3THK A;  4LNP A;  4JLG A;  1VQL T;  1E6H A;  4PJO B;  4F16 A;  2QQB A;  4B6M A;  1ZSZ C;  2IVW A;  4PK4 A;  1M8V A;  1UEC A;  2HSE B;  2HL3 A;  4Z88 A;  2DX1 A;  3J80 E;  3VS4 A;  1D0Z A;  2JW4 A;  4RG2 A;  2K79 A;  2JMC A;  3A8M B;  4FM4 B;  2JMA A;  4IUR A;  1RAI B;  1H3H A;  2OTL T;  1ZSZ B;  1M30 A;  3CC4 A;  2YRD A;  4F7U G;  3G6E T;  3VS2 A;  2L0A A;  2FZC B;  2L5Q A;  1FMV A;  1T0H A;  2BZ8 A;  2D6F A;  1GCP A;  1ABQ A;  1TOV A;  3RMQ A;  2VVK A;  1YIJ T;  1KFZ A;  3RUX A;  3S3O A;  2KRO A;  4FL6 A;  2IPO B;  1U5S A;  3H8Z A;  3PVL A;  5A0D A;  3OS5 A;  1G3S A;  1JXO A;  1AHJ B;  3RMS A;  5GMK l;  3QYG B;  2RO0 A;  2P0K A;  4M77 A;  3H0I A;  5D6X A;  1IHV A;  4EIK A;  2GQI A;  3OYL A;  2RQU A;  3I56 Q;  2RJD A;  1G83 A;  4JJB A;  5GAN 2;  3RR6 A;  4M75 E;  1WJS A;  1WHH A;  3VUZ A;  5IHI A;  3M5A A;  1PCX A;  3AHU A;  1ZLM A;  3LWH A;  2RHX A;  1MMN A;  1OU9 A;  4AT1 B;  3JCM b;  4FCY A;  2RI5 A;  1PRM C;  1GFD A;  1QVF S;  4M7A G;  2FHD A;  1OZ3 A;  1C0M A;  2RMO A;  3ER0 A;  1UHC A;  2RI2 A;  4ZGE B;  2DEQ A;  3JB9 J;  2QA4 T;  3OYH A;  3U23 A;  5KYY B;  4A4K A;  3HRU A;  2P0P A;  5FRN A;  4M7D G;  1VQK Q;  3CCU A;  3JSC A;  3EHQ A;  1XOV A;  1KJW A;  3EFO A;  5I21 A;  2K3Y A;  4QT7 A;  3QJY A;  4HKE A;  5CK9 A;  1CSK A;  5GMK i;  3NMZ C;  4OB2 B;  1WIE A;  3INZ A;  3JCM f;  3MP6 A;  4RG8 A;  2OTJ A;  2CUD A;  1SEM A;  2DRM A;  2DYI A;  3OYK A;  1UJY A;  2DL3 A;  2DTI A;  1FMK A;  2LJ3 A;  2XK0 A;  2RB6 A;  2P4R A;  3NTH A;  1VA7 A;  2K9G A;  3OS0 A;  3OSV A;  2ED0 A;  2F1L A;  1M2V B;  1PKT A;  1VQ8 A;  1ZA1 B;  2D0N A;  2CGH A;  2NWM A;  2GTO A;  3CC4 T;  1ZX6 A;  2CP7 A;  4XTW A;  1QMC A;  3A8O B;  3TU4 K;  3P8D A;  2E41 A;  5IHN A;  3MCA B;  4DEY A;  2PZ1 A;  4XTV A;  2CSI A;  4D6W A;  3N5B B;  2O4X B;  2CT4 A;  2EGC A;  1KSW A;  1IB8 A;  4M7A C;  3VRY A;  1RI0 A;  3JV3 A;  4C5H A;  2DA9 A;  1YI2 A;  1ACM B;  3SFM A;  4OMF B;  4M7D C;  1KQ1 A;  3JCM e;  1WHG A;  4HVW A;  2V1R A;  4J83 A;  3CD6 A;  3VRZ A;  1PKS A;  4M7A B;  1NJI C;  2HL5 C;  1PSE A;  2F2W A;  3M0P A;  4C8Q G;  3A98 A;  4OB3 B;  4M78 E;  1LJO A;  2JTF A;  4ZN3 A;  3M55 A;  2XG8 D;  3OYE A;  1N8R C;  4M7D B;  2DYB A;  1W2B S;  4AFS C;  1JQQ A;  2XID A;  3SWN C;  2LT1 A;  5CKB A;  3LX7 A;  3L1A A;  4DBF A;  1N9S A;  2JTE A;  2OAW A;  1VQO T;  3L2V A;  3C12 A;  1B07 A;  3CCU T;  4FW2 A;  4RTY A;  1PD0 A;  3CC2 A;  3SWN B;  3EHR A;  1EZZ B;  1KD1 C;  1G5V A;  1KC8 U;  1S72 A;  5GAN 3;  4J7F A;  2X3X D;  1AT1 B;  3I5S A;  4AG1 C;  5CQX A;  1Q81 C;  2WSC E;  1GBQ A;  3E9G A;  4IIM A;  3I35 A;  1M90 U;  2E6Z A;  8AT1 B;  2OTJ T;  4C92 E;  5KYU A;  4DBQ A;  3EGU A;  4AFZ C;  1K8A C;  5ECA A;  4NL2 A;  3X25 B;  5CKD A;  3UPU A;  4J9D A;  4R56 A;  4XU3 A;  1VQ8 Q;  3L2Q A;  4KT0 E;  2DIG A;  1QCF A;  2VB6 A;  2QTX A;  3RKX A;  1YHQ A;  2COW A;  1PD1 A;  2JM8 A;  3G71 T;  4XQ3 A;  3GNF B;  5AT1 B;  3TQ7 P;  2EFI A;  3BDL A;  3UWN A;  4BDY A;  3CME T;  2QQ9 A;  2CH4 W;  2FO0 A;  2BZY A;  4A63 B;  2KYM A;  3VJP A;  1W70 A;  3KUF A;  3C94 A;  3REB B;  4C8Q B;  4J9H A;  1YCS B;  3FEO A;  1K9A A;  2XHC A;  3NFC A;  2C0T A;  1YI2 Q;  2DEU A;  4CC2 A;  4PJO F;  1BI2 A;  1I4K 1;  1YI2 T;  2E65 A;  1WXB A;  2DBM A;  4PFO A;  3D7S B;  2LT4 A;  2NUP A;  2VV5 A;  3CD6 T;  1SG5 A;  4A54 A;  1TSF A;  4PJO D;  1U06 A;  1NYF A;  1WLP B;  1AEY A;  2JN0 A;  1NPP A;  3I55 A;  3PTA A;  2D1X A;  2XD0 A;  2VKN A;  2CRE A;  1UGR B;  2DM1 A;  3QKJ A;  2YLC A;  2L3Q A;  2K4Y A;  3VUB A;  3JCM J;  1TXQ A;  1WX6 A;  2EYY A;  1BI0 A;  3MO8 A;  3JCM d;  1V76 A;  1M3B A;  4N4G A;  2YT6 A;  1JJ2 A;  1UB4 A;  3CC2 Q;  2PUK B;  1R0B G;  1RAB B;  4QVZ A;  1B34 A;  1QCO A;  2E5K A;  1YIT T;  1EX4 A;  2EVR A;  1VQP A;  2O9S A;  1S72 Q;  3JCM g;  1S72 T;  3JCM Q;  5LJ5 j;  2DIL A;  2DXT A;  4C92 F;  8ATC B;  3CCS A;  3C95 A;  2M0O A;  2X3W D;  1TWB A;  1XTD A;  1PNJ A;  3QUI A;  2QEX T;  2L3R A;  2GBQ A;  3RNJ A;  2KSS A;  4JS5 A;  1Q86 C;  1WJQ A;  2M9U A;  3EFR A;  2L2P A;  4E7L A;  4RTV A;  1PSF A;  3M9Q A;  3PIP A;  4RKU E;  2EJF A;  1ZSG A;  1ZUK A;  3NTI A;  1U8R A;  1IXD A;  2DO3 A;  1YHQ Q;  2L89 A;  2X51 A;  5KYW A;  5GAN g;  1LCK A;  1NPR A;  3EG0 A;  1OI1 A;  2RJC A;  5A0L A;  2KBT A;  1Y57 A;  1VQN Q;  4CC4 B;  1MV0 B;  5GAN h;  2B86 A;  2DNU A;  1UGP B;  1HSQ A;  3URG A;  2RQT A;  3CPW S;  1TUC A;  2KY9 A;  3TRE A;  4PJO A;  1H3Z A;  1TTH B;  2R5A A;  1OZ2 A;  5LJ5 h;  1QKX A;  2MOX A;  2LX7 A;  2AT1 B;  9ATC B;  1YWP A;  1V29 B;  1K73 U;  3I55 T;  1C1A A;  1I5O B;  1UE9 A;  4IUT A;  3S3N A;  2SEM A;  3OY9 A;  2KYB A;  1RAE B;  2A08 A;  2GNC A;  4OP0 A;  5GAM f;  5LJ3 g;  1KD1 R;  2D0Q B;  2KMT A;  1QVF P;  1X69 A;  2DK3 A;  3FJ5 A;  3CXC S;  5GAN 5;  2HQX A;  2J6K A;  2VXF A;  1OPL A;  2ESW A;  3I5R A;  3R6N A;  1SSH A;  3BW1 A;  4A4H A;  1VQP Q;  1WHL A;  4OMP A;  5DLQ E;  4RUG A;  3CCV A;  4K11 A;  4M75 C;  3CCS Q;  4M7A F;  3CCS T;  1NZ9 A;  2OX7 A;  5HY6 A;  2KQW A;  1KQS S;  3NHN A;  1QP2 A;  2DBK A;  1SPK A;  1YBY A;  4MDX A;  1VQL A;  2DFU A;  5CO7 A;  4M7A D;  1OQK A;  2VXE A;  4M75 B;  1IRX A;  2A0F B;  1G8X A;  5CKE A;  1N27 A;  2QAS A;  1T3L A;  1GBR A;  1BIB A;  4M7D D;  5GAM e;  1X27 A;  5FWB A;  5DLO A;  5KYY A;  3UA7 A;  2HKN A;  1VIF A;  4Z02 A;  1JBM A;  2A3L A;  2OTL A;  2RPN A;  1O75 A;  1WPY A;  4DQ2 A;  1MUZ A;  1VYT A;  3RES A;  1B3Q A;  1WDX A;  2A7Y A;  3G6E A;  3REA B;  2E6N A;  1BI3 A;  3JB9 F;  1FYN A;  2COY A;  4M78 G;  3EG9 B;  1WGS A;  4A4G A;  4RCC A;  2CZ6 B;  1K4U S;  1YIJ A;  1M1G A;  3PMT A;  4J9B A;  4F7U A;  3HRS A;  2AIR B;  3JAM E;  2EYQ A;  3TCJ A;  4PL6 A;  2HNI A;  3J7A F;  1IGQ A;  2CS7 A;  3VS3 A;  5I11 A;  2RHU A;  1M2V A;  1BKB A;  4E7J A;  2HCK A;  3S3M A;  1G2B A;  3CCQ T;  1OU8 A;  2DL5 A;  1UGV A;  4E7K A;  1W2B P;  2IIM A;  4Y91 A;  2LDM A;  3OYA A;  1UGQ B;  4WCI A;  3LLR A;  1TUG B;  4O5V A;  4PJL A;  1QVG A;  2O4X A;  5L23 A;  4IUQ A;  3PVQ A;  2QDY B;  4BI3 A;  4XTY A;  2A37 A;  1EIF A;  1KHC A;  3TSW A;  4C92 G;  3GIB A;  4AFU C;  2M1H A;  3EGX A;  5HKC A;  4XU0 A;  3GLX A;  2OJ2 A;  2MMP A;  1UGS B;  2ZPI B;  1Q86 R;  2MWP A;  4PJJ A;  1M3C A;  2FZG B;  4N0A C;  2XDB A;  1ABO A;  3FJP A;  3CCV Q;  2H3J A;  4PJN A;  4C8Q D;  2YRC A;  4BAC A;  2JS2 A;  3CCV T;  3VYH B;  4FYY B;  4M78 C;  4M7D A;  1NEB A;  1VQL Q;  2EW3 A;  3CEY A;  4HCZ A;  1M1F A;  3CCE T;  3WVE B;  3PNW C;  1X6O A;  3OW2 A;  2DER A;  2ZZD A;  3CCL A;  1AOJ A;  4M78 B;  3RKW A;  2MF2 A;  3TVT A;  1WHM A;  2EQK A;  3EG2 A;  3EGD B;  2OAU A;  2CYZ B;  3M0T A;  2OTL Q;  4QQD A;  1BBZ A;  4LXC A;  3C0C A;  3SWN A;  3G6E Q;  2E4H A;  1M90 C;  3JB9 H;  2KEA A;  1VQM A;  2EGA A;  4HVV A;  1M8M A;  3NGP A;  1SKU B;  1PHT A;  3L2W A;  1Y96 B;  2FPE A;  1YIJ Q;  2HZY A;  2DZ9 A;  4A4F A;  2HD0 A;  1BK2 A;  4PJM A;  4R0K A;  2O2O A;  2Y90 A;  1DJ7 B;  1Y0M A;  1AZG B;  5EG2 A;  4C92 C;  1K9M U;  5FW9 A;  4ZGD B;  2MPX C;  3HL8 A;  5GAM d;  3RKY A;  1K9M R;  5GAO q;  2NYS A;  4MZP A;  3E9F A;  4XK8 E;  5GAN 8;  4C92 B;  2P0Q A;  1P92 A;  1ZA2 B;  1IHW A;  1PG5 B;  2QTV A;  2EJG A;  3EFS A;  4ZGJ B;  5I2S A;  2CP0 A;  3CC7 T;  2Y4Y A;  5CCA A;  1X6G A;  2Z0W A;  1D1B A;  4C8Q A;  1SRM A;  4X34 A;  1VUB A;  1UUE A;  2C0O A;  4JRK A;  3M0R A;  4LUD A;  3X26 B;  2QA4 Q;  1MMD A;  1M1K U;  3OYC A;  2E64 A;  1VQO A;  1HJD A;  3WXM B;  1UJ0 A;  1M1K R;  2ABL A;  4E7H A;  2KR3 A;  3FRN A;  2AZV A;  1NBE B;  4EDU A;  2V8K A;  2HBP A;  2AHJ B;  2L3P A;  5FRO A;  4ATO A;  1QP3 A;  3M57 A;  4NL3 A;  2ENM A;  3A5Z B;  3G4S T;  4PLL A;  2EJ9 A;  5DY9 A;  2JT4 A;  2RQV A;  1TU0 B;  3CCL Q;  4ZTF A;  2X35 A;  2HSP A;  1QLY A;  3CCL T;  2QDL A;  3JB9 G;  1ZHI A;  3AT1 B;  2J06 A;  2PU9 B;  4OML A;  1HD3 A;  2R58 A;  2EPD A;  3OSS C;  1B7T A;  2QXF A;  3CC4 Q;  5KYX A;  2KRS A;  3DB3 A;  1QCN A;  3H0F A;  2EWN A;  2DZC A;  1VQM Q;  3G71 A;  1WXU A;  1VQM T;  4PFZ A;  2LJ1 A;  4F04 B;  2RQW A;  2ZPF B;  3OYY A;  3CME A;  1J3T A;  1AWJ A;  1YJN T;  4OGE A;  5IXB A;  1AWX A;  3CPW P;  4RTZ A;  4LDV A;  1MND A;  5GAN 6;  1ZUY A;  4KUD K;  4LD6 A;  1I0C A;  2J6F A;  5HCK A;  1Q95 G;  1YJW T;  2LZ6 B;  4M75 F;  5CKH A;  4QQ6 A;  1SHG A;  3HP9 A;  4CI0 C;  4XTU A;  2LC4 A;  3M4G A;  3M0S A;  1N9R A;  1BCM A;  5IHK A;  4C0G A;  4HVU A;  4KH0 B;  1YP5 A;  1WI7 A;  5J39 A;  4O6J A;  3CXC P;  1AZE A;  3VU3 C;  4EMK C;  2V8J A;  2E3I A;  5D7U A;  3HHT B;  1R77 A;  4E2F B;  2G3R A;  4BY6 C;  3KXT A;  4BE1 A;  1VQO Q;  2X4J A;  3ZFJ A;  1VQ5 T;  4V2S A;  2V8I A;  3PGG A;  3OYF A;  3CCU Q;  4BD3 A;  1S1N A;  1AWW A;  4EMK B;  2RK2 A;  1TH7 A;  3L2Z A;  1YIT A;  1D1C A;  3DKM A;  2CP3 A;  2ED1 A;  4BY6 B;  1KQS P;  3LGF A;  1KC8 R;  4JLI A;  1A0N B;  2HEQ A;  1D0X A;  4TVR A;  2QEX A;  3UT1 A;  3M53 A;  3V8K A;  2OTJ Q;  3QSU A;  2DET A;  1PC0 A;  1FXX A;  2RQR A;  4KGV B;  2L8D A;  1M90 R;  1BI1 A;  1XJW B;  4JZ3 A;  3FC3 A;  3GOX A;  3MP1 A;  4OB1 B;  3OYN A;  3SB2 A;  2CDT A;  4WTO B;  1HXD A;  3OYM A;  4M77 C;  1XNI A;  1RLQ C;  3G71 Q;  2JTM A;  3L2U A;  4Z8A A;  4FU6 A;  1VQ7 T;  3CME Q;  2QYZ A;  2C06 A;  1OPK A;  1JU5 C;  3JCM c;  1MGQ A;  2DVJ A;  4FIB A;  3GBQ A;  2EQI A;  3CCJ T;  2CZ1 B;  1WHJ A;  1RI9 A;  2DVE A;  4RMO A;  4E7I A;  2E5Q A;  1I07 A;  2KXC A;  4OMO A;  3DB4 A;  2LQ8 A;  1I5L A;  2YSQ A;  4M78 F;  3CD6 Q;  4FYV B;  2L3S A;  1SSF A;  3E2U A;  4HXJ A;  3LYI A;  4M78 D;  5GAO r;  1VQ4 A;  2LX9 A;  5KCH A;  3SEM A;  1WFW A;  3EG9 A;  4OGC A;  3CBM A;  1BB9 A;  3MEA A;  4C5I A;  5A0G A;  4DBH A;  4II1 A;  3QJ6 A;  4F7U E;  5A2Q E;  1YJ9 A;  3H41 A;  1WJR A;  3CCM T;  5GAN j;  3HPW A;  3KFV A;  4HA8 A;  1E7O A;  3RBB B;  1YIT Q;  1YCY A;  3A1P A;  4OF1 A;  4VUB A;  3JCM W;  2KI7 A;  3ASK A;  2E10 A;  2JZ2 A;  2ZPB B;  4OB0 B;  2WSF E;  1LPL A;  4JS4 A;  5CVI A;  3J81 E;  2QEX Q;  3JCM h;  3M0U A;  4A53 A;  4J6X A;  4C0F A;  4DOV A;  1VYV A;  1VQ9 T;  4C92 D;  3OA6 A;  2GFA A;  1T3S A;  2ECZ A;  3VKI A;  3JRZ A;  2P84 A;  2CP6 A;  4OMM A;  1RAG B;  3M56 A;  3MPU B;  4CC3 A;  5CIU A;  2J05 A;  1MV3 A;  2K2M A;  4J6W A;  5LJ3 j;  4XTX A;  4LDU A;  3UDC A;  4M75 G;  4J9G A;  3CPF A;  4JDS A;  5GAO m;  2DL8 A;  2RNA A;  4JUV A;  4CC7 A;  1R8O B;  4N0A A;  4E6R A;  1IO6 A;  1QQJ A;  2O88 A;  2GFU A; 
#chains in the Genus database with same CATH homology
 2XI9 A;  3S6W A;  4JRP A;  4M78 A;  2LDM A;  3JSC A;  3CCU A;  3OYA A;  1XOV A;  1UGQ B;  5FLX E;  5I21 A;  3LLR A;  4O5V A;  2K3Y A;  2K5L A;  1QVG A;  2O4X A;  4IUQ A;  3OS1 A;  4J5Y A;  2JNG A;  2QDY B;  3QJY A;  4BI3 A;  4XTY A;  2RHZ A;  3H6Z A;  4HKE A;  3DLM A;  1EIF A;  1KHC A;  4M77 B;  1G3W A;  5CK9 A;  1I8F A;  4C92 G;  5HK3 A;  2K57 A;  4MZT A;  1BIA A;  2M1H A;  4XU1 A;  4BE1 A;  1Q7Y U;  2EKO A;  1VQ8 T;  3GIB A;  5HKC A;  4XU0 A;  3GLX A;  3CCQ A;  2MMP A;  3OS2 A;  5GMK i;  4NOY A;  1U1S A;  4OB2 B;  1VQ4 T;  4C8Q C;  1UGS B;  2O01 E;  2ZPI B;  3INZ A;  3JCM f;  3MP6 A;  2MWP A;  4M75 A;  4RG8 A;  5GAO n;  1K9M C;  2OTJ A;  5I2M A;  2LVM A;  2PVG B;  1Y96 A;  4N0A C;  3QBY A;  5KCO A;  5LJ3 e;  3OYK A;  2XDB A;  2DTI A;  1VQN A;  3FJP A;  2H3J A;  2XK0 A;  2RB6 A;  4C8Q D;  4BAC A;  2DIQ A;  4J7I A;  3CCV T;  2RA2 A;  2XIC A;  3NTH A;  3VYH B;  4M78 C;  3OS0 A;  5KH6 A;  3OSV A;  1YJ9 T;  3TEE A;  4C5G A;  3F70 A;  5LJ3 h;  3V7C A;  4M7D A;  3LWI A;  1VQ8 A;  3JB9 I;  4J8O A;  5J3B A;  2CGH A;  4LDW A;  1M5Q 1;  3OYD A;  2LCL A;  4HCZ A;  3CEY A;  1Y7X A;  3CC4 T;  1M1F A;  5GAO l;  3CCE T;  3OMC A;  4XTW A;  3A8O B;  3WVE B;  3TU4 K;  1VIE A;  3P8D A;  4M77 E;  2E41 A;  5CQY A;  3PNW C;  1X6O A;  4B9X A;  2XDD A;  2QI2 A;  2ZZD A;  3CCR T;  3OW2 A;  3MCA B;  3CCL A;  2ZGW A;  4M78 B;  3RKW A;  1H64 1;  2MF2 A;  4XTV A;  3OMG A;  2DXB A;  4C92 A;  4EMG A;  1QVG S;  4D6W A;  3N5B B;  1KQ2 A;  3HSB A;  4ELZ C;  2EQK A;  2F69 A;  2RJE A;  4GY5 A;  5M9O A;  2O4X B;  1Q82 C;  3E19 A;  1IRE B;  4R55 A;  2OAU A;  2CYZ B;  2ZCF B;  5FU6 C;  5GAN 4;  4E47 A;  1JB0 E;  2BIV A;  5KE3 A;  4QQD A;  4M7A C;  1MHN A;  2YRV A;  3PFS A;  1M1K C;  1RI0 A;  3A8L B;  3MEV A;  4C5H A;  3SWN A;  3CCE A;  4JRQ A;  1K8A U;  1M90 C;  1YI2 A;  3JB9 H;  2DPP B;  3SFM A;  3G7Z A;  4OMF B;  1KQ1 A;  1VQM A;  4M7D C;  3CCR A;  4L6V 5;  4BI4 A;  3JCM e;  3L2W A;  1Y96 B;  2EQJ A;  5FU6 B;  4J83 A;  2DZ9 A;  3JCM P;  4A4F A;  2HD0 A;  3CD6 A;  4M7A B;  3GP8 A;  3QG1 A;  2DXU A;  1W4S A;  1NJI C;  2LNV A;  1PSE A;  1QVP A;  2Y90 A;  1DJ7 B;  4L59 A;  4C8Q G;  5KE2 A;  4OB3 B;  4M78 E;  2MAM A;  5EG2 A;  4C92 C;  1K9M U;  1LJO A;  2F5T X;  2JTF A;  3M55 A;  2XG8 D;  1I81 A;  4ZN3 A;  3OYE A;  4ZGD B;  3OYG A;  3HL8 A;  1N8R C;  4M7D B;  5GAM d;  3RKY A;  3MEU A;  3CMA T;  2IG0 A;  3CC2 T;  1W2B S;  3WVD B;  3OW2 S;  2K5I A;  3MP8 A;  1M9S A;  5GAN 7;  5GAO q;  4MZP A;  2XID A;  5LL6 S;  3ZEH A;  3E9F A;  3SWN C;  2LT1 A;  5CKB A;  3A8H B;  2ZPH B;  3LX7 A;  4XK8 E;  3SD4 A;  5GAN 8;  2ZPE B;  4C92 B;  2P0Q A;  3L1A A;  3MHX A;  1N9S A;  1P92 A;  3JB9 D;  3O8V A;  1VQO T;  2FVU A;  3L2V A;  4MML A;  2EJG A;  3EFS A;  4ZGJ B;  1ZQ1 A;  4JJN K;  5I2S A;  3C12 A;  3BY7 A;  2KDS A;  2R57 A;  5J26 A;  3CMA A;  3CCU T;  4M7A E;  3PT9 A;  3CC7 T;  3CC2 A;  3SWN B;  2Y4Y A;  4XU2 A;  1KD1 C;  5CCA A;  5GAN d;  4N4H A;  2CZ0 B;  4XTZ A;  4ME7 A;  3OYJ A;  1G5V A;  1KC8 U;  1Q82 U;  4M7D E;  4C8Q A;  2PVD B;  4PNO A;  5GAN 3;  4J7F A;  1S72 A;  4X34 A;  5FRN A;  2EAY A;  1VUB A;  4OVA A;  3LW5 E;  5IN1 A;  4JRK A;  4ZN1 A;  3X26 B;  5CQX A;  1Q81 C;  1U1T A;  3OYC A;  2E64 A;  2WSC E;  3E9G A;  1M1K U;  1VQO A;  2WSE E;  3WXM B;  1YHQ T;  1M90 U;  2E6Z A;  4MDW A;  2M16 A;  3OYB A;  1NE8 A;  2RD1 A;  4E7H A;  3Q1J A;  5L8R E;  5LJ5 d;  2OTJ T;  4C92 E;  3JCM X;  2WAC A;  3FRN A;  1X01 A;  3ME9 A;  4EDU A;  3NTK A;  2V8K A;  3CC7 A;  4CRI A;  1K8A C;  2HBP A;  1VQN T;  2AHJ B;  2GQV A;  3LH0 A;  2KK4 A;  4WF2 A;  4NL2 A;  3L42 A;  3OBY A;  3VYG A;  5FU7 C;  3QHS A;  4Q5W A;  3CXC A;  3X25 B;  5CKD A;  5FRO A;  3UPU A;  1NJI U;  4ATO A;  3BDU A;  4R56 A;  1QP3 A;  5GAO p;  4XU3 A;  4M77 F;  5LJ5 g;  4BDZ A;  3M57 A;  4NL3 A;  3L2Q A;  4KT0 E;  1N8R U;  1RL2 A;  2DIG A;  3A5Z B;  4FT4 A;  3HFO A;  2QTX A;  3G4S T;  2RM4 A;  3MET A;  3RKX A;  1YHQ A;  4MMK A;  4PLL A;  3G71 T;  2EJ9 A;  5DY9 A;  4F7U F;  4ZTF A;  2VGM A;  4XQ3 A;  3GNF B;  2K3X A;  1Y71 A;  2EFI A;  2X35 A;  3BDL A;  3UWN A;  5FU7 B;  4BDY A;  2K5F A;  3CME T;  2KAF A;  2QQ9 A;  4BUG A;  5C0M A;  3CCL T;  3JB9 G;  1ZHI A;  4M7A A;  1G3Y A;  2PU9 B;  4N4I A;  3FLG A;  2JOY A;  2R58 A;  2RHI A;  3VJP A;  2DXC A;  2R5M A;  3KUF A;  5LJ3 d;  3C94 A;  4JRI A;  2ZPG B;  4C8Q B;  3OSS C;  3RIR A;  2VUB A;  3FEO A;  3EAE A;  5FRM A;  2QXF A;  2XHC A;  3NFC A;  4L5G A;  3G4S A;  3DB3 A;  2EWN A;  2DZC A;  3X28 B;  3QZ9 B;  2RK1 A;  3G71 A;  4PJO F;  1BI2 A;  1FWZ A;  1I4K 1;  1VQM T;  2E65 A;  1YI2 T;  1KD1 U;  3A8G B;  3QII A;  2ZPF B;  3OYY A;  4ELY C;  3QYH B;  3CME A;  4J6Y A;  1KG1 A;  1YJN T;  4OGE A;  3QXE B;  2FYK A;  2LT4 A;  3MEW A;  2VV5 A;  2LRQ A;  3QDR B;  3CD6 T;  4LDV A;  3OB9 A;  3FDR A;  2E70 A;  4A54 A;  1Q81 U;  1KC8 C;  1LNX A;  3FB9 A;  4PJO D;  1VQ6 A;  5GAN 6;  4KUD K;  2DAQ A;  4LD6 A;  2JN0 A;  1FX7 A;  1NPP A;  3I55 A;  3PTA A;  4EMK A;  1W2B A;  1JRI A;  2CZ7 B;  4UC4 A;  5CAI A;  5CR2 A;  2E12 A;  2PVO B;  3V8J A;  2XD0 A;  3L2R A;  2VGN A;  1XQH A;  3GF5 A;  2XDP A;  4QW2 A;  3VV0 A;  1YJW T;  3P8H A;  2JVV A;  3JCM V;  2FL7 A;  1UGR B;  1VQP T;  2BKD N;  2Y4X A;  1QW1 A;  3QKJ A;  4M75 F;  5CKH A;  4C8Q E;  1YJN A;  2YLC A;  4QQ6 A;  2K4Y A;  5HK0 A;  3HP9 A;  4CI0 C;  3VUB A;  4EPC A;  3JCM J;  4XTU A;  4FT2 A;  4GLK A;  1KHI A;  2GCX A;  2LC4 A;  2XU8 A;  3M4G A;  1BI0 A;  3MO8 A;  3JCM d;  1N9R A;  2DTO A;  4C0G A;  4M7D F;  3X24 B;  4N4G A;  2X4X A;  1JJ2 A;  4HCC A;  1UB4 A;  2PUK B;  5J39 A;  4QVZ A;  3SDZ A;  1B34 A;  4LDY A;  1YJW A;  2HAX A;  1YIT T;  4O6J A;  4EMH A;  1VQP A;  3VU3 C;  4EMK C;  1D3B A;  5IT9 E;  2V8J A;  3JCM g;  4DOW A;  3HHT B;  3ZBD A;  1S72 T;  3JCM Q;  5LJ5 j;  3CPW A;  1BYM A;  5C6S A;  2DXT A;  4KBM B;  3KBG A;  4C92 F;  5GAM g;  2G3R A;  3C95 A;  1M4Z A;  2M0O A;  3QO3 A;  4BY6 C;  3KXT A;  4MZM A;  2X4J A;  3CCS A;  1XTD A;  3ZFJ A;  1VQ5 T;  4LDX A;  3QUI A;  4V2S A;  2QEX T;  4IKF A;  3PIO A;  2L3R A;  2V8I A;  3PGG A;  3OYF A;  4JS5 A;  2KSS A;  4RCB A;  4X9C A;  1WJQ A;  2M9U A;  2RI3 A;  3EFR A;  4BD3 A;  1Q86 C;  5GAM h;  4PJO G;  4E7L A;  1IZ6 A;  4EMK B;  2RK2 A;  3P8B B;  1PSF A;  1TH7 A;  3L2Z A;  3M9Q A;  1YIT A;  2DD4 A;  3DKM A;  4RKU E;  2DTH A;  3PIP A;  2EJF A;  4IUU A;  1WQ7 A;  1U8R A;  3NTI A;  4BY6 B;  4C5E A;  3GNG A;  3LGF A;  4HT8 A;  3CBP A;  4JLI A;  4Y28 E;  2DO3 A;  2EIF A;  2L89 A;  2GF7 A;  2DD5 A;  3I56 T;  1VQ5 A;  4TVR A;  2QEX A;  5GAN g;  3UT1 A;  3M53 A;  3V8K A;  1NPR A;  3QSU A;  1OI1 A;  2RJC A;  5A0L A;  1FXX A;  4YTL A;  1HK9 A;  2L8D A;  3C4S A;  2MI6 A;  4QQG A;  5GMK j;  3FIF A;  1BI1 A;  4KUL A;  4QVD A;  2K2V A;  4BI8 B;  2E1H A;  5GAN h;  3FC3 A;  3GOX A;  3MP1 A;  1B34 B;  4OB1 B;  2F5K A;  4FSX A;  3HRT A;  2X4W A;  3M4Y A;  1UGP B;  4BE0 A;  3URG A;  1D3B B;  3OYN A;  4IUV A;  3CPW S;  3SB2 A;  2KY9 A;  1HXD A;  5D6W A;  3OYM A;  1G3T A;  3TRE A;  4M77 C;  4PJO A;  1XNI A;  3I56 A;  1H3Z A;  4XAX B;  2JTM A;  3L2U A;  2R5A A;  5DM7 R;  4FU6 A;  1OZ2 A;  5LJ5 h;  2X4Y A;  1VQ7 T;  1VQK T;  4DA4 A;  4M77 D;  1ZBX A;  4NS5 A;  2C06 A;  3JCM c;  1MGQ A;  2LCC A;  2DJZ A;  3LGL A;  4FIB A;  1V29 B;  2KVQ G;  3RER A;  3V7S A;  2YHT A;  3M59 A;  3CCJ T;  1VQ6 T;  2EQU A;  2CZ1 B;  1KQS A;  3PMI A;  1K73 U;  4BB7 A;  4C8Q F;  2B8A A;  1Q86 U;  3I55 T;  1O9S A;  3X20 B;  2QA4 A;  2EQM A;  4IUT A;  2RJF A;  2DVE A;  5AYF A;  2QQR A;  4RMO A;  4E7I A;  1LOJ A;  2E5Q A;  4F7U B;  3S3N A;  3QPH A;  5GMK e;  1VQ7 A;  3OY9 A;  1VQK A;  4QVC A;  3QZ5 B;  3HFN A;  3DB4 A;  2LQ8 A;  4OP0 A;  4X9D A;  2RHY A;  5GAM f;  5LJ3 g;  1I5L A;  4PJO C;  1N6A A;  2XKO C;  4M78 F;  2QQS A;  2D0Q B;  2KMT A;  3V7R A;  3GPL A;  2MWO A;  2DK3 A;  1SSF A;  2PQW A;  3CXC S;  5GAN 5;  5GAM j;  3DLL A;  2HQE A;  3E1S A;  5GMK h;  2P4T A;  2VC8 A;  3CCJ A;  2HQX A;  5GMK m;  4P5N A;  4LD9 K;  2VYT A;  4ZTJ A;  4B9W A;  2VXF A;  3LYI A;  4M78 D;  4JLG A;  5GAO r;  1VQL T;  1VQ4 A;  2LX9 A;  5KCH A;  4PJO B;  2QQB A;  3BW1 A;  2IVW A;  1M8V A;  4A4H A;  2NLU A;  4C0D C;  4OGC A;  4PLI A;  3CBM A;  3MEA A;  4C5I A;  2LQK A;  5DLQ E;  5A0G A;  2BUD A;  3J80 E;  3CCV A;  4RG2 A;  4M75 C;  5GAN f;  4II1 A;  3QJ6 A;  4F7U E;  4M7A F;  5A2Q E;  3CCS T;  3M58 A;  1NZ9 A;  4M77 G;  3OYI A;  1Y07 A;  3A8M B;  4FM4 B;  5HY6 A;  1YJ9 A;  1WJR A;  2KQW A;  4C0Z A;  3CCM T;  1KQS S;  4IUR A;  5GAN j;  1QP2 A;  3HPW A;  2OTL T;  4M75 D;  1YBY A;  4MDX A;  4C0D B;  1VQL A;  3CC4 A;  4HA8 A;  4F7U G;  5CO7 A;  3G6E T;  1YCY A;  4M7A D;  4OF1 A;  4VUB A;  4HT9 A;  2VXE A;  5LJ5 f;  2L5Q A;  4M75 B;  3JCM W;  4HCB A;  2I2L A;  2PUO B;  3CBO A;  5CKE A;  1N27 A;  3ASK A;  2D6F A;  4A4E A;  2E10 A;  1BIB A;  4M7D D;  2JZ2 A;  2ZPB B;  4OB0 B;  5GAM e;  1QVF A;  3RMQ A;  4PJO E;  2WSF E;  3OBW A;  5D6Y A;  5DLO A;  2CKK A;  3RUX A;  3S3O A;  1YIJ T;  4JS4 A;  2RH2 A;  5CVI A;  4FL6 A;  4BE2 A;  3J81 E;  3CCM A;  1VIF A;  4Z02 A;  1JBM A;  1WNL A;  3JCM h;  2A3L A;  3H8Z A;  5A0D A;  1Q7Y C;  2OTL A;  4A53 A;  1K73 C;  3BFM A;  3OS5 A;  1O75 A;  4J6X A;  1WPY A;  1G3S A;  4DQ2 A;  4C0F A;  1GXI E;  1AHJ B;  4DOV A;  3RES A;  2A7Y A;  3G6E A;  1VQ9 T;  4C92 D;  3HKS A;  3OA6 A;  2E6N A;  1BI3 A;  2GFA A;  3JB9 F;  3RMS A;  2QQA A;  3T9N A;  5GMK l;  3QYG B;  2RO0 A;  4M78 G;  2P0K A;  4M77 A;  1WGS A;  3V8L A;  4A4G A;  5IAY A;  5D6X A;  1X75 C;  3R6O A;  4RCC A;  3VKI A;  1WQW A;  2CZ6 B;  2FB7 A;  1YIJ A;  3OYL A;  1M1G A;  3JRZ A;  2JUF A;  2RJD A;  3PMT A;  5GAN 2;  5GAN e;  2D9T A;  4M75 E;  4F7U A;  1WJS A;  3M56 A;  3HRS A;  5LJ3 f;  3VUZ A;  5CIU A;  3JAM E;  3M5A A;  1UEB A;  2EYQ A;  3TCJ A;  4IUP A;  3AHU A;  3LWH A;  2RHX A;  4PL6 A;  2HNI A;  2LTO A;  1OYX A;  1JJ2 S;  4KUI A;  4J6W A;  3J7A F;  5LJ3 j;  2CS7 A;  4XTX A;  4LDU A;  1VQ9 A;  3UDC A;  3JCM b;  4M75 G;  2RI5 A;  2RHU A;  3OQ5 A;  3M54 A;  3CPF A;  2DKG A;  4JDS A;  5GAO m;  1BKB A;  4E7J A;  5LJ5 e;  3S3M A;  4PKC C;  5CKF A;  2FHD A;  1QVF S;  4M7A G;  1OZ3 A;  4JUV A;  1R8O B;  4N0A A;  3ER0 A;  2RI2 A;  4ZGE B;  3CCQ T;  2DEQ A;  3JB9 J;  2QA4 T;  3OYH A;  2GFU A;  4A4K A;  3HRU A;  2P0P A;  2YLB A;  4E7K A;  4M7D G;  4Y91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...