4C8QF

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qF00
4M75F 2Y90A 2FYKA 4EMKC 2E64A 4A53A 4C92B 1B34A 3SWNB 2YLBA 1D3BB 1BIAA 3SB2A 2RD1A 4C92A 5GAOr 4XU1A 3SWNA 2DTOA 5GAMd 5LJ3h 5GAN3 1H641 3JCMW 3QSUA 4M78G 4F7UB 4QVDA 4XU0A 4M7DA 4X9DA 4PJOD 2FB7A 2VC8A 1M5Q1 5LJ5e 4OP0A 2DXTA 4F7UA 5LJ5g 5GANf 4XU3A 3BDUA 3JCMf 4M7AG 3GIBA 2RB6A 3JCMV 4M7DE 4M75D 4M7DC 5GANh 3V8LA 4C8QB 5GAN2 3JCMh 5GAN7 4M77A 5GAOm 5I21A 2DXUA 4M78B 2EAYA 5LJ3j 4PJOG 5GAN8 2DEQA 3JCMQ 3JB9H 2ZGWA 4M78A 4PNOA 5LJ3f 5GMKe 2YHTA 3V7SA 4XTYA 3EFSA 2E65A 4JLIA 4M7AB 4M77E 4DQ2A 1U1TA 4M77C 4M7DF 3M4GA 1D3BA 4NL2A 1I81A 5GANd 4RCCA 4C8QG 3JCMd 4WF2A 4NOYA 4XTUA 4M7AA 3FJPA 4XQ3A 4J5YA 5GAN4 2E10A 5GANj 4MMLA 2DKGA 4PJOB 3V8KA 4C92E 4C92C 1LNXA 2EJGA 3SWNC 5CAIA 1I8FA 5GAN5 4M77F 3JB9F 4JRKA 4XTXA 5DY9A 2QTXA 4M75B 5LJ3d 4J6YA 4JRIA 3FB9A 2RA2A 3JCMb 1WQ7A 4F7UE 3BW1A 3RESA 3HFNA 3RKWA 4C8QA 5GAMe 3INZA 3V7RA 4C92F 5GAOp 3HFOA 1YCYA 4XTZA 3RUXA 5LJ5h 5GAMg 5GAOq 4M7DD 5GAOn 4HT9A 1HXDA 4MMKA 2YLCA 2K57A 4HT8A 5GMKl 5GMKi 4EMKB 1KQ2A 1N9RA 1LJOA 1TH7A 4HA8A 4M75G 2CGHA 1LOJA 1JBMA 1HK9A 1KQ1A 4C8QE 4C8QC 4PJOE 2EJ9A 3L2ZA 2DJZA 3L1AA 4F7UF 4M78E 4EMKA 4PJOC 4M78C 3BY7A 1X01A 5LJ3e 3RKYA 4M77D 2DZ9A 2VXEA 3JB9D 4M7DG 4J6WA 5LJ3g 1MGQA 4XU2A 2E41A 4Y91A 1WPYA 1M8VA 1N9SA 4PJOA 1B34B 5GMKh 3JB9J 4M7AE 4RCBA 3BFMA 4M78D 4A54A 4M7AC 2DTIA 3QUIA 5LJ5j 1Y96B 5GAN6 4X9CA 4C8QF 4JUVA 4J6XA 1U1SA 4C92D 4M78F 5LJ5f 3QO3A 3V7CA 2JN0A 3FIFA 4M75A 3RKXA 4EMHA 3JCMP 1Y96A 4M77G 3RIRA 3PGGA 4XTVA 3JB9G 5GANe 2DZCA 4EMGA 4M7AD 2RM4A 4M7DB 1I5LA 3JCMe 3AHUA 2I2LA 5GANg 2DVEA 3JCMg 4N0AA 4M7AF 3RERA 2HNIA 3JCMJ 3HSBA 1JRIA 5GAMj 3V8JA 4M75E 4M75C 3EFRA 4XTWA 2EWNA 4C92G 5GMKj 1BIBA 5GAMf 3JCMc 2EJFA 4V2SA 5GAOl 5GMKm 1WQWA 4PJOF 4NL3A 4M77B 3JCMX 2VXFA 4QVCA 4N0AC 3QHSA 5LJ5d 2DTHA 5GAMh 3JB9I 1WNLA 1I4K1 4C8QD 4F7UG 2E1HA 3VU3C
chains in the Genus database with same CATH superfamily
1WXTA 2RK2A 2EQUA 1JJ2A 3R6NA 3MEAA 4JRQA 4E7HA 1TXQA 3LGFA 2QDLA 4FW1A 1UECA 4MZTA 5IXFA 3G7ZA 4J9GA 5KYXB 1EFNA 2FG0A 2HKNA 1XNIA 2YUQA 1ZA2B 1SHGA 2HQXA 3BDUA 3GIBA 2YDLA 4KRTA 2YXYA 1QVFP 4BY6C 3C12A 3G4SQ 3H0FA 1VQ9A 5FRNA 6AT1B 2ROLA 2RN8A 4Z02A 1G83A 4PJOB 2HMAA 1K9MC 1ZBJA 1I8FA 3ZBDA 2QTXA 3X26B 4ZTJA 1K9MR 2QI2A 2RH2A 3M55A 3CCLT 3CMEQ 5GAMe 2AK5A 1FXXA 4XTZA 1PC0A 1HXDA 1WJRA 2X9HA 1YI2T 3NHNA 2CZ6B 3KXTA 3I35A 2LX9A 2DD4A 1MGQA 4WTOB 1H3HA 1WPYA 1ZSZC 5IAYA 1M1FA 3FRNA 4AMCA 1PCXA 4KH0B 1NLPC 3RBBB 3CCJQ 2KY9A 3OYFA 2XMFA 1RAFB 4OGEA 1MNDA 1WYXA 2JN0A 2DERA 1ABQA 3QWYA 4Z88A 4M7AD 3A98A 4KGVB 2RM4A 1VQ4A 1SEMA 3E2UA 4N0AA 1J3TA 2M02A 4M75E 1ZUUA 4XTWA 3L2QA 2XU8A 1O9SA 4OMQA 2NWMA 3OYAA 5FROA 2CDTA 3QHSA 1DJ7B 1YCSB 1ZHIA 4C5HA 1I4K1 2MPXC 2ZAEA 3OSVA 3VS4A 2RQWA 3TVTA 3CPWA 2CUDA 2QA4Q 2E12A 3EG9A 1AD5A 1YIJQ 1YP5A 2CH4A 1Q86C 3SB2A 5FRMA 2D8HA 3RR6A 2LQ8A 1Q86R 3HHTB 4M78G 4HVWA 5CR2A 2KRNA 2P84A 1VQLQ 2VC8A 3PMTA 4Y92A 1NPPA 5A0GA 2BKDN 1FMKA 3DLMA 1FWZA 1TOVA 1BYMA 2RB6A 1OU8A 2DA9A 1SSFA 5GANh 3A8GB 3NTIA 3I56T 2P0QA 1XQHA 3CC2Q 3H8ZA 2OTJA 1EX4A 1ABOA 3NPFA 4E7KA 1WXBA 1ZLMA 2KXDA 3V7SA 4XTYA 1S72T 3OS2A 1ZSZA 4JJCA 3JCMd 4WF2A 1QP2A 4MMLA 1JXMA 1OQKA 1W2BA 1WDXA 4C0ZA 3L2VA 1UHCA 3GP8A 2KROA 3GPLA 4LD6A 2FZKB 2ZPFB 2LCCA 3REAB 5HKCA 5C0MA 4ORZA 1EZZB 5GAOp 4QT7A 2J6KA 1N9RA 1LOJA 1X27A 1KQ1A 1UUEA 1X01A 3GNGA 2K2VA 1M4ZA 4KH1B 4BE1A 1X69A 1RAEB 2GBQA 4RCBA 2VGMA 4J9EA 1QMCA 3AT1B 2E6NA 3OYBA 3FIFA 1WHHA 1TWBA 4RTZA 3RERA 1WA7A 2LQNA 4YTLA 4OB1B 1SRMA 3TSWA 2JTMA 4WCIA 5DM7R 5GAMf 1VQNA 2EJFA 4O6JA 1N8RU 2BIVA 2DTHA 2M9UA 2E64A 2A37A 4BE2A 1AEYA 3LYIA 2CKKA 3MP6A 3M4YA 5GAN3 1H641 3JCMW 1VOMA 2HL3A 1UGRB 3WVDB 4DEYA 1MMAA 4AG2C 1WX6A 2DXBA 5LJ5e 5EG2A 1GL5A 4EDUA 1B07A 1Z9QA 3NTKA 3CCLQ 1YJWA 2DIGA 2NUZA 1AHJB 4J83A 4LDYA 5LL6S 4C5GA 2G6FX 2I0NA 3MO8A 4PNOA 2LC4A 4PKCC 1CSKA 2JM8A 1VQOT 2EW3A 4LE9A 3EGXA 2FO0A 3OBYA 5KYUB 3G71Q 1YHQT 1KQSA 2YRDA 3EG0A 2NUTB 2DXCA 4M77F 4A4GA 1C0MA 4KGXB 3MEWA 3I55T 2GNCA 1IXDA 2BUDA 1BBZA 1OPLA 2QK0A 3MP1A 4ANJA 4K11A 5GAOq 3VS0A 1T0HA 3CXCS 2RHYA 1OV3A 1B7TA 2CGHA 2CP5A 2JNGA 2DAQA 1YJ9T 3TCJA 2O4XB 2ESWA 1V1CA 2CT3A 4M7DG 1IREB 2J7IA 4XU2A 4C0GA 1NE8A 4A54A 3CD6T 8AT1B 3EHQA 1RUWA 2FEIA 4HKEA 2RQUA 2YUNA 1G3WA 2DO3A 3EFRA 4C92G 2DYIA 4X34A 3OYLA 3QJ6A 3JCMc 2QQRA 4M77B 3QDRB 4QVCA 4AFSC 4J9HA 1JU5C 1S1NA 2FYKA 4RTVA 3QIIA 4RUGA 1T0JA 3SWNB 1D3BB 2RI2A 1KD1C 1AT1B 1KSWA 3OYDA 4PJMA 2A08A 3O5ZA 3TU4K 1RAHB 5DLOA 1KD1R 2DVJA 3GBQA 3L2RA 2KEAA 4M7DA 3MKDA 3C0CA 2FB7A 5CKFA 1MHNA 5GJVB 2OAWA 3JCMV 2RHZA 2K2MA 4B6MA 5CKHA 3HRUA 4OMPA 5J26A 3CC7A 4CI0C 5FU7C 4JLIA 4BI8B 3CCVA 1X6BA 4NL2A 2FPEA 1OYXA 3JV3A 1ZBXA 4ZGJB 1TU0B 4N4IA 3CMAA 4BACA 5L8RE 1TTHB 2LT4A 3M5AA 4JZ3A 5FLXE 2DL5A 3QWXX 2FRYA 1Q7YC 3P8BB 4LDWA 3SDZA 1M1GA 3CCUT 4C8QA 1VQ9T 3OYYA 4JS5A 1KG1A 1JO8A 3X24B 2RI3A 2K57A 1PWTA 3FLGA 5FW9A 1PKSA 1TH7A 1GBQA 2DF6A 2QAZA 2GFUA 2QEXA 2C06A 1VYUA 3CCMA 4J6WA 4C5EA 1M8VA 4FT2A 3BFMA 1E6GA 4HVUA 1BI0A 3UT1A 4PJOC 2FPFA 3AHUA 5GANg 3M0QA 1X2QA 2LP5A 4JJBA 3U23A 2HNIA 2L3QA 3OW2S 4RTYA 1K73U 2MCNA 1GRIA 1QP3A 2L2PA 1LPLA 5KCHA 4PJJA 4PLLA 3PTAA 2CP3A 5I22A 3VS5A 2Y4XA 2EYQA 2QQ9A 4E7JA 1VQ4T 1VQOQ 4DBQA 2PTKA 4C0DB 3QSUA 2H3JA 1YHQQ 2HQEA 1KFZA 2KGTA 5KH6A 4OP0A 3QYGB 2C0TA 2ZPHB 3EH1A 1VIFA 2KRSA 4M7AG 2LMJA 3JCMh 2EYWA 2R57A 2V1RA 4HCKA 1WZOA 3WVEB 4A4FA 5I21A 3X28B 2HSEB 5GAN8 3OYNA 5CCAA 3E9GA 1QLYA 2YWWA 4RCCA 1PNJA 2A0FB 3QZ5B 3FEOA 5GANj 1A0NB 2JVVA 2KR3A 3CD6Q 2EJGA 3JB9F 5IT9E 4XTXA 3I9QA 1BKBA 2HEQA 2OTJT 4JRIA 2K3BA 4M7DD 4D6WA 1OX8A 1H92A 2YLCA 4GY5A 4DOVA 4GLKA 4L59A 4F7UF 4FM4B 1R0CB 1UTIA 2G3RA 2F5KA 2PVGB 3RMQA 1KC8U 1K1ZA 4IUQA 2ED1A 2AHJB 4C92D 1WHMA 1M3CA 3M0TA 3V7CA 1QVFS 3RNJA 1OOTA 4PJOE 3L42A 1IO6A 4DBRA 1I5LA 3OYIA 3VUBA 1M27C 1MUZA 3MEVA 3JCMJ 3UPUA 4JPBW 4OMLA 3M53A 2PUOB 1VQMA 4L6V5 1WNLA 4C8QD 4RTWA 2JTEA 1VQPA 4HXJA 1QCOA 3PNWC 1E7OA 1ZA1B 3BE3A 2CREA 2X4WA 2D0NA 4F7UB 4BDZA 4AFUC 1VQNT 1RAIB 2BZ8A 1F1BB 1M8MA 2JUFA 2VVKA 1GCQC 1UGPB 3CCUQ 2KAFA 5GAN2 5KYWB 3M0UA 4FYXB 5FU6B 1OU9A 1P92A 5CO7A 2O31A 2PQWA 4DQ2A 3J80E 4XTUA 3NTHA 4FYVB 4JZ4A 2NLUA 4J5YA 1FMWA 2K3XA 5D7UA 5EC7A 1VYVA 3VS3A 1YJWT 5GAN5 3PMIA 4JRKA 1M2VA 3BW1A 3THKA 4OB3B 2M0OA 3OYGA 1YCYA 2DNUA 2QXFA 4HT9A 2COWA 4X1VA 4EMKB 4RTXA 3HTRA 3CEYA 2EGEA 2RJCA 3S3MA 3OY9A 5CVIA 3CXCA 1UGSB 2DZ9A 2GFAA 5A0LA 3JRZA 1B34B 1D09B 1PHTA 5GMKh 4R0KA 2FL7A 1WI7A 1VQ4Q 2HD0A 5M9OA 3CBOA 2EGCA 4F14A 1YNZA 5IHIA 4M75A 2X4YA 3META 2F2XA 1Y7XA 1GCQA 3CCQQ 2EBPA 4PJNA 5KYYB 1RI0A 2GQIA 2MOXA 3MEUA 3QBYA 3JB9I 3DLLA 4RG8A 2XKOC 4IUUA 3QJYA 1VUBA 2WACA 4PJLA 1G8XA 2HQHA 1U3OA 1RLPC 5GAMd 2VGNA 1AOJA 2IVWA 3X25B 4IUTA 3UWNA 4OMNA 1QVGP 3R6OA 4E6RA 2RNAA 1WHGA 2OTJQ 4QW2A 1R8OB 1PD0A 4XK8E 1GBRA 3PVLA 1M1KC 1AWOA 2O2OA 5LJ3f 3VV0A 4Z8AA 2KRMA 4RG2A 2L5QA 1M1KR 2LJ1A 4M77C 2ECZA 5DLQE 3CMEA 4NOYA 4CRIA 2LRQA 1VYTA 2JZ2A 1XJWB 3SWNC 1Q82U 3URGA 3CPFA 5KYUA 2COZA 4A4KA 9ATCB 2NUTA 4ZNXA 3UF4A 3CC7T 1KIKA 5KYNA 2KT8A 4C5IA 3CCVT 2QYZA 3CCJA 5CQXA 1QCNA 1M90U 2AZVA 1Q81C 4MZPA 3CMAT 2J6OA 3ZL7C 2D1XA 1Q81R 4BI4A 1NYFA 2QG9B 2O4XA 2RHXA 3CBMA 3OB9A 3G6EA 5IHKA 3QXEB 1VQKA 1IHVA 2X51A 4ZGDB 2DLPA 2EIFA 4J6XA 2YRCA 3RKXA 2F69A 4XTVA 4Z89A 4B9WA 4PFZA 1VQNQ 4HVVA 1XOVA 1I0CA 2CSQA 3JCMg 3M59A 1YIJA 3QZ9B 1JRIA 3HSBA 1UEBA 5GAMj 2QEXT 3Q1JA 5HK0A 1OULA 3CCMT 1O75A 5J3BA 3JCMX 4FYWB 1NJIU 3OW2A 2QGGA 4NS5A 1ARKA 2FZGB 3GNFB 3NFCA 2PVOB 4A53A 1WGSA 1K0SA 1UGVA 2LTOA 1UG1A 2D8JA 3SWNA 2F5TX 5CKDA 2CP6A 4ATOA 1N5ZA 4X9DA 1YJWQ 3EAEA 2ZPGB 1TG0A 1EIFA 4FCYA 2RQVA 4BUGA 2KBTA 4M75D 1W70A 2RF0A 3IQLA 2EAYA 1YN8A 1RL2A 2ZGWA 4M77E 2M0YA 1AWXA 2E3HA 4QQGA 3VS2A 3JAME 1I07A 1WHJA 3H0HA 2PVDB 3M58A 2RO0A 3EGUA 1UFFA 5CKEA 3EFOB 4C0DC 2LX7A 1X75C 1K8AC 2KYMA 4J9DA 1NZ9A 2RPNA 1SSHA 1G3SA 2H8HA 1K8AR 1YI2Q 5GMKl 1ZQ1A 2JS0A 3OMCA 1N27A 1HK9A 3EH2A 2LQKA 3H41A 3L2ZA 3L1AA 4OF1A 2MAMA 1RADB 2W0ZA 3EG9B 2LT1A 4LD9K 2L3RA 4R55A 5GAN6 2VUBA 5FWCA 4M78F 1NG2A 5AT1B 1YITA 5KE3A 2P0PA 1IHWA 4E7SA 1R0BG 2I2LA 2K5IA 1E6HA 1QVFA 2LCLA 2CZ7B 2DL4A 1BK2A 2BE7D 2XIDA 1IB8A 4L5GA 3ZFJA 4V2SA 3DB4A 2VXFA 1N6AA 3M9QA 3C4SA 1C6VX 1K9MU 1D0ZA 2XDBA 3EGDB 2MWPA 5IHNA 2PU9B 3QKJA 1ACMB 2OX7A 5LJ3h 5GJWB 4C0FA 4XU0A 4XU3A 1C1AA 2D0QB 1VQMT 3OSSC 3I56Q 2CZ0B 1VQPT 3CC7Q 3FDRA 4OB0B 2GTOA 2M16A 3G71A 4J7IA 4M78B 1S72Q 3JCMQ 1KK7A 2EQIA 2KVQG 4HCBA 2CT4A 3OA6A 1WLPB 2MWOA 1M9SA 3A8HB 3OYCA 1VQ7A 4IKFA 4C8QG 3QPHA 1UJ0A 5GAN4 2E10A 2D6FA 2QASA 2E5QA 5HCKA 4EPCA 1JJ2P 2P0KA 3CCSA 1PRMC 4IIOA 4PL6A 3PT9A 1KJWA 3HFNA 1WJSA 1HSQA 1BCMA 2HSPA 4AT1B 2EFIA 1Q86U 3CCMQ 2YSQA 1D0XA 4JJDA 1Y57A 1VQ5A 2KT1A 5FU6C 2KMTA 2GCXA 1HJDA 2JMCA 1RAGB 2K79A 5HY6A 1OX9A 5LJ5f 4ZN3A 2K6DA 1PRLC 2NUPB 5GANe 2OTLA 1SKUB 2HDAA 4AFQC 2B86A 2LJ3A 7AT1B 4FU6A 1PD1A 3GF5A 5GMKj 3PVQA 2HL5C 1BI1A 1MNEA 5GAMh 4LDUA 2WSCE 2E1HA 2HBPA 2C0OA 1T3SA 2AKKA 4EMKC 2F2VA 1PM3A 1YBYA 4R56A 2JW4A 4BE0A 1SPKA 2VWFA 3FJ5A 2WSFE 1M5Q1 2OI3A 5D6XA 4F7UA 1M3AA 1JXOA 1X2KA 1TS9A 2XK0A 3GOXA 4PJOG 4E7ZA 2K9GA 2O88A 3KFVA 3M0RA 3EFSA 2DRKA 2DIQA 2E65A 1QWEA 3RDVA 1U1TA 4M7DF 2DMOA 2FRWA 2EQJA 2GTJA 2ENMA 4BB7A 2DKGA 3CPWP 3CC4A 4RTUA 5KYXA 3I55Q 1RAAB 3A5ZB 2GGRA 3OYHA 3M56A 2CP7A 4F7UE 1Y71A 3UA6A 2CUBA 1XTDA 3CCEA 4KGZB 4E2FB 4C92F 1YJNA 3X20B 3VYGA 3CMET 1YJ9Q 4ZN1A 4XAXB 1UJYA 1JBMA 4BD3A 2QDYB 2KYBA 4EMKA 3A8OB 4RTTA 2JJ9A 2O01E 2DX1A 3EG2A 4QQ6A 1M3BA 3T9NA 2ATCB 2K7AA 4DEXA 4PJOA 2MF2A 2P4TA 2A28A 1Y96B 4FL6A 4C8QF 1WXUA 2O9SA 2XICA 4MDXA 3CCJT 3PGGA 4M7DB 5CKBA 1VQ8A 2RHIA 1W2BP 1RLQC 2BZXA 1VQMQ 1VQPQ 3L2UA 2F1LA 4NL3A 3G6ET 4OMOA 1VQKT 1Z9ZA 1TUCA 2DPPB 2L0AA 4C92B 2V8JA 2EYZA 2YLBA 2FHDA 1BIAA 1YIJT 4LUDA 2DBKA 1D0YA 1NM7A 2SEMA 1T3LA 2MYSA 2A3LA 3OQ5A 5GANf 4QQDA 1UDLA 2M1HA 4C8QB 4UC4A 3CD6A 1D1CA 2L89A 1WFWA 1AZEA 4PFOA 1N8RC 1D1AA 2DD5A 4IIMA 1MMGA 1N8RR 4JLGA 3V8KA 5A2QE 3H0IA 5LJ3d 1JB0E 2GF7A 3FB9A 1VQ9Q 1K76A 2DE0X 4CC4B 3RKWA 2BE9B 5LJ5h 5D6YA 3MPUB 1KD1U 3VKIA 4M75G 3LLRA 1GFDA 1QQJA 2AZSA 2KDSA 2ABLA 3EHRA 1QVGS 1M30A 4LDXA 1VQ6A 2MI6A 2FZCB 3N5BB 4VUBA 5LJ3g 3LWIA 2AKLA 4E7LA 4LN2A 1OPKA 3D7SB 4JUVA 3HRSA 1RI9A 3RIRA 2EQKA 4QKUA 2LNVA 3VUZA 1KQSP 4M7AF 3CCRA 2DBMA 2QQAA 5FWBA 3OYKA 1W6XA 1PKTA 3MP8A 4F17A 2EGAA 5GAOl 2E6ZA 4N0AC 3PE0A 2Y90A 1YITT 2QQSA 4PK4A 5C6SA 3CCUA 1H8KA 4DBFA 2H3EB 2LZ6B 5GAOr 1Q7YU 4XU1A 2C0IA 1ZSGA 4PJOD 3CBPA 4A4EA 2KSSA 3PIPA 3LGLA 1UE9A 3LWHA 1LCKA 4ME7A 3V8LA 4FSSA 5A0DA 5LJ3j 2DEQA 1V76A 2HZYA 4M7AB 2ED0A 2OAUA 1QKXA 4ESRA 4JJNK 1I5OB 3G4SA 2GQVA 3I5SA 4KUIA 3OS5A 4JS4A 4J9BA 4IUPA 3G71T 3OYJA 4E7IA 3I5RA 3P8HA 1ZUYA 3CQTA 3WXMB 1JEGA 2IPOB 1G2BA 1YFNA 3RESA 3EFOA 5CIUA 3V7RA 3RUXA 1VQ7T 2LCSA 5GAMg 5GAOn 2XI9A 3E1SA 2K5LA 2YUOA 3QDFA 3G6EQ 2JT4A 3H6ZA 2EJ9A 2DJZA 3S6WA 1VQKQ 4M78C 3EG1A 3CCST 2DYBA 3CCQA 4Y91A 1N9SA 4CC7A 2ZZDA 3VS1A 1U1SA 4OGCA 2F2WA 3JCMP 1OEBA 4M77G 5I11A 3JCMe 2R5MA 1WHLA 2CP0A 2DRMA 3TSZA 2FPDA 1VQ5T 2AT1B 5GMKm 1WQWA 4FW2A 2FVUA 1GCPA 4M75F 1I1JA 4II1A 2Z0WA 2YUPA 2EKHA 2ZPIB 2OTLT 3DKMA 1BCOA 2BZYA 3EGDA 2DL8A 5ECAA 2QA4A 4ELZC 4RKUE 1G3TA 3NGPA 4BDYA 3LH5A 2X4JA 1SF9A 1M2VB 1AWWA 4HCCA 1K9AA 1VQLA 4M77A 4MZMA 3C95A 1Q95G 3OMGA 2ZPBB 2X3WD 3JB9H 4M78A 2P4RA 4CC2A 1QCFA 1K73C 3CC2A 1D3BA 1Y0MA 3FJPA 1K73R 2HBWA 1K4US 1SHFA 2CYZB 5CQYA 1UGQB 1AZGB 5CAIA 1NLOC 4DBHA 2X35A 3MHXA 4HCZA 4M75B 5AYFA 2RQRA 4DOWA 1WQ7A 1IRXA 3VS6A 2K3YA 4LDVA 3HFOA 3SD4A 2VV5A 3MCAB 2XDPA 5GMKi 1LJOA 2CS7A 1M2OA 1GFCA 3CC4T 1R77A 4M78E 1VIEA 3BY7A 1NEGA 1ZX6A 4QVZA 2DL7A 3HL8A 3VJPA 1YITQ 2VYTA 2RHUA 5IN1A 3CCET 3G1JA 3QO3A 1RABB 4FT4A 2W10A 1YJNT 4EMHA 1NPRA 3KUFA 1OZ2A 2LNHB 8ATCB 3VRZA 1SG5A 2L3PA 2NUPA 5KE2A 2COYA 2EVRA 4BY6B 2EPDA 5I2SA 1MV3A 2KI7A 4P5NA 3OYEA 5LJ5d 1JJ2S 2HCKA 2AIRB 2ROTA 2JS2A 2JXBA 2KE9A 2D9TA 5I2MA 5L23A 1VQ8T 5HK3A 4MDWA 2RD1A 1PSEA 2DTOA 4A4HA 5KCOA 1GXIE 3JSCA 1KC8C 4JRPA 1QVPA 2DXTA 2OJ2A 5LJ5g 2DK3A 3JCMf 1KC8R 3OS0A 3P8DA 4M7DC 1RACB 2L3SA 3UA7A 3HKSA 2ZPEB 2RMOA 2DXUA 1VQ7Q 3REBB 2QGFB 1BB9A 2MK5A 1ZSZB 1MV0B 5GMKe 3CCLA 1CKAA 4FIBA 3DB3A 1KHCA 2SRCA 1I81A 2DJQA 2PNIA 3CCSQ 4XQ3A 2B8AA 1YI2A 1FMVA 4C92C 2J05A 1LNXA 3M57A 3NMZC 3M54A 1VA7A 5DY9A 3TEEA 1JQQA 2V26A 4J6YA 4LUEA 3OYMA 3QYHB 3CCVQ 3PIOA 1UHFA 2LVMA 3INZA 3VYHB 3CMAQ 2RI5A 4Y28E 1VQ5Q 2LDMA 1NYGA 1X6OA 4C8QC 3OBWA 2NYSA 2IIMA 1G3YA 2R5AA 2VXEA 1W4SA 1BI3A 4M77D 4LNPA 2X3XD 4Q5WA 4TVRA 3LH0A 3PFSA 2QQBA 1QVGA 4IUVA 2OTLQ 4M78D 2O9VA 5LJ5j 1AVZC 2K5FA 4X9CA 1HD3A 3VS7A 1K0XA 2EQMA 2V1QA 2MMPA 1Y96A 3JB9G 1WHKA 4EMGA 3OS1A 2QEXQ 4F04B 1M1KU 2A7YA 4J7FA 4ZGEB 4KBMB 1VQ6T 3A8MB 1BIBA 3F70A 3CPWS 1ZUKA 3VRYA 2R58A 2RJEA 5J39A 3EG3A 1YWPA 4F7UG 2J06A 3VU3C 3I56A 1W1FA 2RQTA 1Y07A 4PLIA 3CXCP 1KHIA 4C92A 3CCRT 2J6FA 2QTVA 3O8VA 3M0PA 1S72A 3ME9A 4OB2B 1QW1A 4QVDA 4ZTFA 2XD0A 1Q81U 4DA4A 3RMSA 3ZEHA 4M7DE 4M4ZA 2HKQB 3ASKA 4N4HA 1Q7YR 3A1PA 3CC4Q 4O5VA 4AG1C 2JOYA 4OMMA 1W2BS 3EGXB 5GANd 4N4GA 1PG5B 3HRTA 2VASA 2RJDA 4C92E 4D8DA 3CCEQ 3E9FA 3HP9A 4F16A 3E19A 1YJNQ 2BTTA 4E47A 1X43A 4KT0E 2PUKB 3MJXA 1AWJA 2DFUA 2KNBB 2M51A 5KYWA 2JMAA 3GLXA 4J9FA 3G4ST 4JDSA 4C8QE 1MMNA 1TSFA 4B9XA 2DL3A 1MMDA 4A63B 4CC3A 2DILA 2E41A 1PSFA 4J9IA 4M7AC 1VQ8Q 2DTIA 4RMOA 2XG8D 4KULA 3SEMA 4PFPA 3SFMA 5IH2A 1NEBA 2WSEE 3TREA 3FC3A 2KK4A 1QWFA 2LJ0A 2E3IA 1WJQA 4OMFB 1Q82C 2DM1A 2DEUA 5IXBA 1U5SA 3UDCA 3CCQT 1U8RA 1Q82R 1QKWA 3ER0A 1FYNA 1LVKA 1OZ3A 2VB6A 3BDLA 4FSXA 3C94A 2RJFA 3KBGA 1B34A 2V8IA 2JTFA 4D8KA 1M90C 1IZ6A 1BU1A 3S3NA 1HYOA 2VKNA 1IGUA 1K8AU 1M90R 4ELYC 2CSIA 2EYYA 3J81E 1TUGB 1VQOA 2YT6A 3TQ7P 4GLMA 4BI3A 3A8LB 1YHQA 1UB4A 5KYYA 4OVAA 4KUDK 5GAN7 5GAOm 2IG0A 1D1BA 3I55A 1B3QA 4GBQA 3QG1A 2YHTA 3LX7A 2QA4T 1FX7A 1U06A 1KQSS 2L8DA 2CZ1B 3LW5E 3M4GA 2EKOA 2JM9A 3OW2P 4M7AA 1SRLA 1G5VA 2PZ1A 1NJIC 4IURA 1YJ9A 3S3OA 2E70A 2KXCA 2YRVA 1NJIR 1TUDA 1VQLT 2K4YA 2V8KA 2CP2A 2RA2A 3JCMb 1V29B 3UATA 3HPWA 1CKBA 3CC2T 1VQ6Q 4MMKA 4HT8A 1KQ2A 4HA8A 2A36A 2X4XA 2XHCA 1OI1A 3J7AF 1YWOA 1NBEB 1IGQA 3RKYA 5LJ3e 3JB9D 2E4HA 2ZCFB 1H3ZA 3ULRB 5D6WA 3JB9J 4M7AE 2RK1A 3QUIA 1BI2A 2LQWA 2CH4W 4LXCA 3CCRQ 1X6GA 2MIOA 2DZCA 2Y4YA 2HAXA 2KQWA 2DVEA 2E5KA 3M0SA 5CK9A 4FYYB 3V8JA 4M75C 2EWNA 4J9CA 3L2WA 4AFZC 2EYXA 3H9NA 5FU7B 3SHWA 4PJOF 4EIKA 2XDDA 1WIEA 4J8OA 2DETA
chains in the Genus database with same CATH topology
4M75F 2Y4XA 2XDBA 2EYQA 4II1A 2QQ9A 2ZPIB 2MWPA 2EQUA 2PU9B 2RK2A 4E7JA 3MEAA 3QKJA 4JRQA 1VQ4T 1JJ2A 3DKMA 4E7HA 3LGFA 5LJ3h 2QA4A 4MZTA 4C0DB 3G7ZA 2H3JA 4ELZC 3QSUA 2HQEA 4RKUE 4C0FA 1G3TA 4XU0A 4BDYA 5KH6A 4OP0A 2X4JA 1XNIA 3QYGB 2ZPHB 1VIFA 4XU3A 2D0QB 2HQXA 3BDUA 1VQMT 3OSSC 4M7AG 2CZ0B 3GIBA 1VQPT 3FDRA 4HCCA 4OB0B 1VQLA 3JCMh 2M16A 4M77A 4MZMA 2R57A 3C95A 4J7IA 4M78B 3WVEB 4A4FA 5I21A 3OMGA 3X28B 5GAN8 3OYNA 2ZPBB 5CCAA 4BY6C 3E9GA 3C12A 3JCMQ 3JB9H 2KVQG 4M78A 4HCBA 3OA6A 1VQ9A 5FRNA 2MWOA 1M9SA 3A8HB 1K73C 3OYCA 1VQ7A 3CC2A 4IKFA 1D3BA 4RCCA 3QPHA 4C8QG 3QZ5B 4Z02A 3FJPA 3FEOA 2E10A 5GAN4 2JVVA 2CYZB 5GANj 2D6FA 2E5QA 5CQYA 4PJOB 1K9MC 1UGQB 2EJGA 5CAIA 1I8FA 4EPCA 2P0KA 2X35A 3JB9F 3MHXA 4XTXA 3ZBDA 3CCSA 2QTXA 4HCZA 4M75B 5AYFA 3X26B 1BKBA 2QI2A 4ZTJA 2OTJT 4JRIA 4DOWA 1WQ7A 2RH2A 4PL6A 3M55A 3PT9A 3CCLT 3HFNA 1WJSA 5GAMe 2K3YA 4LDVA 3HFOA 1FXXA 4XTZA 4D6WA 4M7DD 3SD4A 1HXDA 2EFIA 1WJRA 2VV5A 2YLCA 3MCAB 4GLKA 2XDPA 4GY5A 4DOVA 5GMKi 1LJOA 1Q86U 2CS7A 4L59A 1YI2T 3CC4T 4F7UF 4M78E 4FM4B 1VIEA 2CZ6B 3BY7A 2G3RA 3KXTA 4QVZA 2F5KA 2LX9A 2PVGB 3HL8A 3RMQA 1VQ5A 2DD4A 3VJPA 1KC8U 1MGQA 2VYTA 1WPYA 5FU6C 4IUQA 5IAYA 2KMTA 2GCXA 2RHUA 1M1FA 3FRNA 5IN1A 2AHJB 3CCET 2KY9A 3OYFA 4OGEA 5HY6A 4C92D 5LJ5f 3QO3A 4FT4A 2JN0A 3V7CA 4ZN3A 4EMHA 1NPRA 1YJNT 1QVFS 3KUFA 4PJOE 4M7AD 5GANe 1OZ2A 2OTLA 3L42A 2RM4A 1I5LA 1VQ4A 3OYIA 3VUBA 4N0AA 3MEVA 3JCMJ 3UPUA 5KE2A 4FU6A 4M75E 4BY6B 1K8AC 3GF5A 4XTWA 3L2QA 5GMKj 2XU8A 1O9SA 5I2SA 1BI1A 3OYAA 3M53A 5FROA 4P5NA 3OYEA 3QHSA 1DJ7B 2PUOB 5LJ5d 5GAMh 1JJ2S 1ZHIA 4C5HA 4L6V5 1WNLA 1I4K1 4LDUA 4C8QD 3OSVA 3G71A 2WSCE 1VQPA 2E1HA 2HBPA 3CPWA 4EMKC 2E12A 1YBYA 4R56A 2D9TA 4BE0A 1Q86C 5I2MA 1VQ8T 3PNWC 3SB2A 5HK3A 4MDWA 2RD1A 5FRMA 1PSEA 2LQ8A 2DTOA 2X4WA 4A4HA 3HHTB 4M78G 4F7UB 4BDZA 5KCOA 1GXIE 1VQNT 5CR2A 2WSFE 3JSCA 1KC8C 4JRPA 2VC8A 1M5Q1 3PMTA 1NPPA 1QVPA 5A0GA 2DXTA 5D6XA 4F7UA 5LJ5g 2BKDN 2DK3A 3JCMf 3DLMA 1FWZA 2JUFA 1BYMA 2RB6A 3OS0A 1SSFA 3P8DA 4M7DC 5GANh 1UGPB 2KAFA 5GAN2 3A8GB 3HKSA 3NTIA 2ZPEB 2P0QA 2XK0A 3I56T 2DXUA 1XQHA 3GOXA 3H8ZA 4PJOG 2OTJA 4E7KA 5FU6B 5GMKe 1P92A 3V7SA 5CO7A 4XTYA 3EFSA 4FIBA 2DIQA 3DB3A 2E65A 1S72T 3CCLA 2PQWA 4DQ2A 1KHCA 1U1TA 3OS2A 4M7DF 3J80E 1I81A 3JCMd 2EQJA 1QP2A 4WF2A 4XTUA 4BB7A 3NTHA 4XQ3A 2NLUA 4J5YA 2B8AA 2K3XA 2DKGA 4MMLA 1YI2A 3CC4A 1W2BA 4C92C 4C0ZA 1LNXA 3L2VA 3M57A 1YJWT 5GAN5 3PMIA 3GP8A 4JRKA 3M54A 5DY9A 3GPLA 4LD6A 3TEEA 3A5ZB 1VQMA 2ZPFB 4J6YA 3OYHA 2LCCA 3M56A 3QYHB 3OYMA 4F7UE 3BW1A 1Y71A 5HKCA 1XTDA 5C0MA 4OB3B 3PIOA 3CCEA 2LVMA 3VYHB 2M0OA 3INZA 4C92F 5GAOp 3OYGA 1YCYA 1YJNA 3X20B 2QXFA 4HT9A 3VYGA 3CMET 2RI5A 4Y28E 4ZN1A 4EMKB 1N9RA 2LDMA 4XAXB 1JBMA 1LOJA 4BD3A 1KQ1A 1X6OA 2QDYB 4C8QC 3CEYA 2RJCA 4EMKA 3OBWA 3A8OB 3S3MA 2O01E 3OY9A 1X01A 5CVIA 3CXCA 2R5AA 1G3YA 1UGSB 2DZ9A 1W4SA 1BI3A 2GFAA 2VXEA 3GNGA 4M77D 4QQ6A 2K2VA 4Q5WA 4TVRA 3LH0A 3T9NA 1M4ZA 3PFSA 5A0LA 3JRZA 1B34B 4BE1A 4PJOA 2QQBA 5GMKh 1QVGA 4IUVA 2FL7A 2MF2A 2P4TA 4M78D 4RCBA 2HD0A 5M9OA 3CBOA 5LJ5j 1Y96B 2K5FA 4FL6A 4X9CA 4C8QF 2VGMA 2EQMA 2XICA 2E6NA 3OYBA 4M75A 3FIFA 4MDXA 2MMPA 2X4YA 1Y96A 3META 3CCJT 3PGGA 3JB9G 4EMGA 4M7DB 5CKBA 3OS1A 1VQ8A 1M1KU 2RHIA 2A7YA 4J7FA 3RERA 1Y7XA 4ZGEB 4YTLA 4OB1B 4KBMB 1VQ6T 3A8MB 1BIBA 2JTMA 5DM7R 3L2UA 5GAMf 1VQNA 2EJFA 3F70A 1RI0A 4O6JA 3CPWS 4NL3A 1N8RU 2R58A 3G6ET 2RJEA 3MEUA 5J39A 3QBYA 2BIVA 2DTHA 2M9UA 1VQKT 5IT9E 3JB9I 3DLLA 2DPPB 4F7UG 3VU3C 4RG8A 2XKOC 2E64A 4IUUA 3I56A 3QJYA 2V8JA 4C92B 4BE2A 2YLBA 1Y07A 3LYIA 2CKKA 1VUBA 1BIAA 2FHDA 2WACA 3MP6A 4PLIA 1KHIA 4C92A 3M4YA 3CCRT 1YIJT 5GAMd 5GAN3 1H641 2VGNA 3O8VA 3JCMW 1S72A 2IVWA 3ME9A 3X25B 4IUTA 1QW1A 4OB2B 3UWNA 4QVDA 1UGRB 3R6OA 3WVDB 5LJ5e 2DXBA 4ZTFA 2A3LA 2XD0A 1Q81U 5EG2A 3OQ5A 5GANf 4DA4A 4QW2A 4EDUA 4QQDA 3RMSA 1R8OB 3ZEHA 2M1HA 4M7DE 3NTKA 4C8QB 1YJWA 2DIGA 4LDYA 1AHJB 3ASKA 4J83A 4UC4A 5LL6S 4C5GA 3CD6A 4XK8E 1M1KC 3MO8A 5LJ3f 4PNOA 4N4HA 3VV0A 4RG2A 2L5QA 4O5VA 2L89A 2JOYA 4M77C 2LC4A 4PKCC 5DLQE 1W2BS 5GANd 4N4GA 3CMEA 1VQOT 1N8RC 4NOYA 4CRIA 2DD5A 2LRQA 3HRTA 2RJDA 3OBYA 2JZ2A 4JLGA 3V8KA 4C92E 5A2QE 1YHQT 1KQSA 3SWNC 1Q82U 3URGA 3E9FA 3HP9A 2DXCA 4M77F 3E19A 4A4GA 3CPFA 5LJ3d 1JB0E 2GF7A 3FB9A 3MEWA 4A4KA 4E47A 3I55T 4KT0E 2PUKB 3CC7T 2BUDA 3RKWA 4C5IA 3MP1A 3CCVT 3GLXA 5LJ5h 5GAOq 3CCJA 3CXCS 5CQXA 5D6YA 1KD1U 1M90U 2RHYA 3VKIA 4M75G 3LLRA 3G4ST 1Q81C 2CGHA 4JDSA 4MZPA 3CMAT 2JNGA 4C8QE 2DAQA 2KDSA 3TCJA 1YJ9T 4B9XA 1QVGS 2O4XB 4LDXA 1VQ6A 2MI6A 4M7DG 4BI4A 1IREB 4VUBA 3N5BB 4XU2A 2O4XA 2E41A 2RHXA 1NE8A 3CBMA 1PSFA 3OB9A 4C0GA 3LWIA 3G6EA 4E7LA 3QXEB 4M7AC 4A54A 3CD6T 2DTIA 1VQKA 4RMOA 2XG8D 4ZGDB 2EIFA 4JUVA 4J6XA 4KULA 3HRSA 3SFMA 3RKXA 2F69A 2WSEE 3TREA 3RIRA 4HKEA 2EQKA 4XTVA 3FC3A 2KK4A 4B9WA 5LJ3g 2LNVA 3VUZA 1XOVA 3JCMg 3M59A 1YIJA 3CCRA 4M7AF 3QZ9B 1JRIA 1WJQA 1UEBA 1G3WA 5GAMj 2QEXT 3HSBA 2QQAA 2DO3A 3Q1JA 3EFRA 3OYKA 4C92G 4OMFB 4X34A 5HK0A 1Q82C 3OYLA 3QJ6A 3CCMT 3MP8A 3JCMc 3CCQT 2QQRA 3UDCA 5GAOl 1U8RA 1O75A 5J3BA 4M77B 3JCMX 3QDRB 4QVCA 2E6ZA 4N0AC 1NJIU 3ER0A 3OW2A 1OZ3A 4NS5A 3BDLA 4FSXA 3C94A 2Y90A 3GNFB 2FYKA 2QQSA 3NFCA 1YITT 3QIIA 2PVOB 2RJFA 1WGSA 3KBGA 1B34A 3SWNB 4A53A 2V8IA 5C6SA 1D3BB 2RI2A 2JTFA 2LTOA 1KD1C 1IZ6A 3CCUA 1M90C 3S3NA 2OTLT 3OYDA 3TU4K 5GAOr 4XU1A 3SWNA 1Q7YU 1K8AU 2F5TX 5DLOA 4ELYC 5CKDA 3J81E 3L2RA 4ATOA 4M7DA 4X9DA 1VQOA 3EAEA 4PJOD 2FB7A 2ZPGB 3CBPA 4A4EA 2KSSA 1EIFA 4BI3A 5CKFA 1MHNA 3A8LB 3PIPA 1YHQA 4BUGA 3LGLA 3JCMV 1UB4A 4M75D 3LWHA 4ME7A 2RHZA 4OVAA 3V8LA 4KUDK 5GAN7 5CKHA 5GAOm 5A0DA 2EAYA 2IG0A 3HRUA 5LJ3j 5J26A 2DEQA 3I55A 1RL2A 2ZGWA 3CC7A 4CI0C 3QG1A 2YHTA 3LX7A 2QA4T 5FU7C 4JLIA 4M7AB 4BI8B 1FX7A 4M77E 3CCVA 1KQSS 2L8DA 2CZ1B 2OAUA 3LW5E 3M4GA 4NL2A 2EKOA 4JJNK 1OYXA 4M7AA 1ZBXA 4ZGJB 3G4SA 4N4IA 4QQGA 1NJIC 1G5VA 2GQVA 3CMAA 4IURA 1YJ9A 4KUIA 3S3OA 2E70A 2YRVA 3OS5A 3JAME 4JS4A 2PVDB 3M58A 2RO0A 5L8RE 4BACA 4IUPA 1VQLT 2LT4A 3M5AA 3G71T 3OYJA 2K4YA 4E7IA 5CKEA 5FLXE 2V8KA 3P8HA 3WXMB 2RA2A 4C0DC 3JCMb 1Q7YC 1V29B 1X75C 3P8BB 4LDWA 3RESA 1M1GA 3SDZA 3CCUT 4C8QA 1VQ9T 3OYYA 1NZ9A 5CIUA 3HPWA 3V7RA 4JS5A 1KG1A 3RUXA 1VQ7T 1G3SA 3CC2T 5GAMg 3X24B 5GAOn 2RI3A 4MMKA 4HT8A 2K57A 5GMKl 3FLGA 1KQ2A 1TH7A 1ZQ1A 2X4XA 2K5LA 2XI9A 3E1SA 4HA8A 3OMCA 1N27A 1HK9A 2XHCA 1OI1A 2LQKA 3H6ZA 2EJ9A 2GFUA 2DJZA 3L1AA 3L2ZA 3S6WA 2QEXA 3J7AF 4OF1A 2MAMA 4M78C 2C06A 5LJ3e 3RKYA 3JB9D 2ZCFB 3CCMA 3CCST 4J6WA 3CCQA 4C5EA 4Y91A 1M8VA 1H3ZA 5D6WA 1N9SA 2LT1A 4LD9K 2L3RA 4FT2A 3JB9J 2RK1A 4R55A 3BFMA 2ZZDA 4M7AE 3QUIA 1BI2A 5GAN6 2VUBA 1U1SA 4M78F 4OGCA 1BI0A 3JCMP 1YITA 4M77G 3UT1A 5KE3A 4PJOC 2P0PA 2DZCA 2Y4YA 3JCMe 2HAXA 2KQWA 3AHUA 2I2LA 5GANg 2DVEA 2R5MA 2K5IA 2HNIA 5CK9A 1QVFA 2LCLA 2CZ7B 3V8JA 4M75C 3OW2S 1K73U 2EWNA 2XIDA 4L5GA 3L2WA 3ZFJA 1VQ5T 5FU7B 4V2SA 3DB4A 5GMKm 1WQWA 4PJOF 2VXFA 1N6AA 1QP3A 3M9QA 3C4SA 2XDDA 2FVUA 4J8OA 5KCHA 1K9MU 4PLLA 3PTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 F;  2Y90 A;  2FYK A;  4EMK C;  2E64 A;  4A53 A;  4C92 B;  1B34 A;  3SWN B;  2YLB A;  1D3B B;  1BIA A;  3SB2 A;  2RD1 A;  4C92 A;  5GAO r;  4XU1 A;  3SWN A;  2DTO A;  5GAM d;  5LJ3 h;  5GAN 3;  1H64 1;  3JCM W;  3QSU A;  4M78 G;  4F7U B;  4QVD A;  4XU0 A;  4M7D A;  4X9D A;  4PJO D;  2FB7 A;  2VC8 A;  1M5Q 1;  5LJ5 e;  4OP0 A;  2DXT A;  4F7U A;  5LJ5 g;  5GAN f;  4XU3 A;  3BDU A;  3JCM f;  4M7A G;  3GIB A;  2RB6 A;  3JCM V;  4M7D E;  4M75 D;  4M7D C;  5GAN h;  3V8L A;  4C8Q B;  5GAN 2;  3JCM h;  5GAN 7;  4M77 A;  5GAO m;  5I21 A;  2DXU A;  4M78 B;  2EAY A;  5LJ3 j;  4PJO G;  5GAN 8;  2DEQ A;  3JCM Q;  3JB9 H;  2ZGW A;  4M78 A;  4PNO A;  5LJ3 f;  5GMK e;  2YHT A;  3V7S A;  4XTY A;  3EFS A;  2E65 A;  4JLI A;  4M7A B;  4M77 E;  4DQ2 A;  1U1T A;  4M77 C;  4M7D F;  3M4G A;  1D3B A;  4NL2 A;  1I81 A;  5GAN d;  4RCC A;  4C8Q G;  3JCM d;  4WF2 A;  4NOY A;  4XTU A;  4M7A A;  3FJP A;  4XQ3 A;  4J5Y A;  5GAN 4;  2E10 A;  5GAN j;  4MML A;  2DKG A;  4PJO B;  3V8K A;  4C92 E;  4C92 C;  1LNX A;  2EJG A;  3SWN C;  5CAI A;  1I8F A;  5GAN 5;  4M77 F;  3JB9 F;  4JRK A;  4XTX A;  5DY9 A;  2QTX A;  4M75 B;  5LJ3 d;  4J6Y A;  4JRI A;  3FB9 A;  2RA2 A;  3JCM b;  1WQ7 A;  4F7U E;  3BW1 A;  3RES A;  3HFN A;  3RKW A;  4C8Q A;  5GAM e;  3INZ A;  3V7R A;  4C92 F;  5GAO p;  3HFO A;  1YCY A;  4XTZ A;  3RUX A;  5LJ5 h;  5GAM g;  5GAO q;  4M7D D;  5GAO n;  4HT9 A;  1HXD A;  4MMK A;  2YLC A;  2K57 A;  4HT8 A;  5GMK l;  5GMK i;  4EMK B;  1KQ2 A;  1N9R A;  1LJO A;  1TH7 A;  4HA8 A;  4M75 G;  2CGH A;  1LOJ A;  1JBM A;  1HK9 A;  1KQ1 A;  4C8Q E;  4C8Q C;  4PJO E;  2EJ9 A;  3L2Z A;  2DJZ A;  3L1A A;  4F7U F;  4M78 E;  4EMK A;  4PJO C;  4M78 C;  3BY7 A;  1X01 A;  5LJ3 e;  3RKY A;  4M77 D;  2DZ9 A;  2VXE A;  3JB9 D;  4M7D G;  4J6W A;  5LJ3 g;  1MGQ A;  4XU2 A;  2E41 A;  4Y91 A;  1WPY A;  1M8V A;  1N9S A;  4PJO A;  1B34 B;  5GMK h;  3JB9 J;  4M7A E;  4RCB A;  3BFM A;  4M78 D;  4A54 A;  4M7A C;  2DTI A;  3QUI A;  5LJ5 j;  1Y96 B;  5GAN 6;  4X9C A;  4C8Q F;  4JUV A;  4J6X A;  1U1S A;  4C92 D;  4M78 F;  5LJ5 f;  3QO3 A;  3V7C A;  2JN0 A;  3FIF A;  4M75 A;  3RKX A;  4EMH A;  3JCM P;  1Y96 A;  4M77 G;  3RIR A;  3PGG A;  4XTV A;  3JB9 G;  5GAN e;  2DZC A;  4EMG A;  4M7A D;  2RM4 A;  4M7D B;  1I5L A;  3JCM e;  3AHU A;  2I2L A;  5GAN g;  2DVE A;  3JCM g;  4N0A A;  4M7A F;  3RER A;  2HNI A;  3JCM J;  3HSB A;  1JRI A;  5GAM j;  3V8J A;  4M75 E;  4M75 C;  3EFR A;  4XTW A;  2EWN A;  4C92 G;  5GMK j;  1BIB A;  5GAM f;  3JCM c;  2EJF A;  4V2S A;  5GAO l;  5GMK m;  1WQW A;  4PJO F;  4NL3 A;  4M77 B;  3JCM X;  2VXF A;  4QVC A;  4N0A C;  3QHS A;  5LJ5 d;  2DTH A;  5GAM h;  3JB9 I;  1WNL A;  1I4K 1;  4C8Q D;  4F7U G;  2E1H A;  3VU3 C; 
#chains in the Genus database with same CATH topology
 1WXT A;  2RK2 A;  2EQU A;  1JJ2 A;  3R6N A;  3MEA A;  4JRQ A;  4E7H A;  1TXQ A;  3LGF A;  2QDL A;  4FW1 A;  1UEC A;  4MZT A;  5IXF A;  3G7Z A;  4J9G A;  5KYX B;  1EFN A;  2FG0 A;  2HKN A;  1XNI A;  2YUQ A;  1ZA2 B;  1SHG A;  2HQX A;  3BDU A;  3GIB A;  2YDL A;  4KRT A;  2YXY A;  1QVF P;  4BY6 C;  3C12 A;  3G4S Q;  3H0F A;  1VQ9 A;  5FRN A;  6AT1 B;  2ROL A;  2RN8 A;  4Z02 A;  1G83 A;  4PJO B;  2HMA A;  1K9M C;  1ZBJ A;  1I8F A;  3ZBD A;  2QTX A;  3X26 B;  4ZTJ A;  1K9M R;  2QI2 A;  2RH2 A;  3M55 A;  3CCL T;  3CME Q;  5GAM e;  2AK5 A;  1FXX A;  4XTZ A;  1PC0 A;  1HXD A;  1WJR A;  2X9H A;  1YI2 T;  3NHN A;  2CZ6 B;  3KXT A;  3I35 A;  2LX9 A;  2DD4 A;  1MGQ A;  4WTO B;  1H3H A;  1WPY A;  1ZSZ C;  5IAY A;  1M1F A;  3FRN A;  4AMC A;  1PCX A;  4KH0 B;  1NLP C;  3RBB B;  3CCJ Q;  2KY9 A;  3OYF A;  2XMF A;  1RAF B;  4OGE A;  1MND A;  1WYX A;  2JN0 A;  2DER A;  1ABQ A;  3QWY A;  4Z88 A;  4M7A D;  3A98 A;  4KGV B;  2RM4 A;  1VQ4 A;  1SEM A;  3E2U A;  4N0A A;  1J3T A;  2M02 A;  4M75 E;  1ZUU A;  4XTW A;  3L2Q A;  2XU8 A;  1O9S A;  4OMQ A;  2NWM A;  3OYA A;  5FRO A;  2CDT A;  3QHS A;  1DJ7 B;  1YCS B;  1ZHI A;  4C5H A;  1I4K 1;  2MPX C;  2ZAE A;  3OSV A;  3VS4 A;  2RQW A;  3TVT A;  3CPW A;  2CUD A;  2QA4 Q;  2E12 A;  3EG9 A;  1AD5 A;  1YIJ Q;  1YP5 A;  2CH4 A;  1Q86 C;  3SB2 A;  5FRM A;  2D8H A;  3RR6 A;  2LQ8 A;  1Q86 R;  3HHT B;  4M78 G;  4HVW A;  5CR2 A;  2KRN A;  2P84 A;  1VQL Q;  2VC8 A;  3PMT A;  4Y92 A;  1NPP A;  5A0G A;  2BKD N;  1FMK A;  3DLM A;  1FWZ A;  1TOV A;  1BYM A;  2RB6 A;  1OU8 A;  2DA9 A;  1SSF A;  5GAN h;  3A8G B;  3NTI A;  3I56 T;  2P0Q A;  1XQH A;  3CC2 Q;  3H8Z A;  2OTJ A;  1EX4 A;  1ABO A;  3NPF A;  4E7K A;  1WXB A;  1ZLM A;  2KXD A;  3V7S A;  4XTY A;  1S72 T;  3OS2 A;  1ZSZ A;  4JJC A;  3JCM d;  4WF2 A;  1QP2 A;  4MML A;  1JXM A;  1OQK A;  1W2B A;  1WDX A;  4C0Z A;  3L2V A;  1UHC A;  3GP8 A;  2KRO A;  3GPL A;  4LD6 A;  2FZK B;  2ZPF B;  2LCC A;  3REA B;  5HKC A;  5C0M A;  4ORZ A;  1EZZ B;  5GAO p;  4QT7 A;  2J6K A;  1N9R A;  1LOJ A;  1X27 A;  1KQ1 A;  1UUE A;  1X01 A;  3GNG A;  2K2V A;  1M4Z A;  4KH1 B;  4BE1 A;  1X69 A;  1RAE B;  2GBQ A;  4RCB A;  2VGM A;  4J9E A;  1QMC A;  3AT1 B;  2E6N A;  3OYB A;  3FIF A;  1WHH A;  1TWB A;  4RTZ A;  3RER A;  1WA7 A;  2LQN A;  4YTL A;  4OB1 B;  1SRM A;  3TSW A;  2JTM A;  4WCI A;  5DM7 R;  5GAM f;  1VQN A;  2EJF A;  4O6J A;  1N8R U;  2BIV A;  2DTH A;  2M9U A;  2E64 A;  2A37 A;  4BE2 A;  1AEY A;  3LYI A;  2CKK A;  3MP6 A;  3M4Y A;  5GAN 3;  1H64 1;  3JCM W;  1VOM A;  2HL3 A;  1UGR B;  3WVD B;  4DEY A;  1MMA A;  4AG2 C;  1WX6 A;  2DXB A;  5LJ5 e;  5EG2 A;  1GL5 A;  4EDU A;  1B07 A;  1Z9Q A;  3NTK A;  3CCL Q;  1YJW A;  2DIG A;  2NUZ A;  1AHJ B;  4J83 A;  4LDY A;  5LL6 S;  4C5G A;  2G6F X;  2I0N A;  3MO8 A;  4PNO A;  2LC4 A;  4PKC C;  1CSK A;  2JM8 A;  1VQO T;  2EW3 A;  4LE9 A;  3EGX A;  2FO0 A;  3OBY A;  5KYU B;  3G71 Q;  1YHQ T;  1KQS A;  2YRD A;  3EG0 A;  2NUT B;  2DXC A;  4M77 F;  4A4G A;  1C0M A;  4KGX B;  3MEW A;  3I55 T;  2GNC A;  1IXD A;  2BUD A;  1BBZ A;  1OPL A;  2QK0 A;  3MP1 A;  4ANJ A;  4K11 A;  5GAO q;  3VS0 A;  1T0H A;  3CXC S;  2RHY A;  1OV3 A;  1B7T A;  2CGH A;  2CP5 A;  2JNG A;  2DAQ A;  1YJ9 T;  3TCJ A;  2O4X B;  2ESW A;  1V1C A;  2CT3 A;  4M7D G;  1IRE B;  2J7I A;  4XU2 A;  4C0G A;  1NE8 A;  4A54 A;  3CD6 T;  8AT1 B;  3EHQ A;  1RUW A;  2FEI A;  4HKE A;  2RQU A;  2YUN A;  1G3W A;  2DO3 A;  3EFR A;  4C92 G;  2DYI A;  4X34 A;  3OYL A;  3QJ6 A;  3JCM c;  2QQR A;  4M77 B;  3QDR B;  4QVC A;  4AFS C;  4J9H A;  1JU5 C;  1S1N A;  2FYK A;  4RTV A;  3QII A;  4RUG A;  1T0J A;  3SWN B;  1D3B B;  2RI2 A;  1KD1 C;  1AT1 B;  1KSW A;  3OYD A;  4PJM A;  2A08 A;  3O5Z A;  3TU4 K;  1RAH B;  5DLO A;  1KD1 R;  2DVJ A;  3GBQ A;  3L2R A;  2KEA A;  4M7D A;  3MKD A;  3C0C A;  2FB7 A;  5CKF A;  1MHN A;  5GJV B;  2OAW A;  3JCM V;  2RHZ A;  2K2M A;  4B6M A;  5CKH A;  3HRU A;  4OMP A;  5J26 A;  3CC7 A;  4CI0 C;  5FU7 C;  4JLI A;  4BI8 B;  3CCV A;  1X6B A;  4NL2 A;  2FPE A;  1OYX A;  3JV3 A;  1ZBX A;  4ZGJ B;  1TU0 B;  4N4I A;  3CMA A;  4BAC A;  5L8R E;  1TTH B;  2LT4 A;  3M5A A;  4JZ3 A;  5FLX E;  2DL5 A;  3QWX X;  2FRY A;  1Q7Y C;  3P8B B;  4LDW A;  3SDZ A;  1M1G A;  3CCU T;  4C8Q A;  1VQ9 T;  3OYY A;  4JS5 A;  1KG1 A;  1JO8 A;  3X24 B;  2RI3 A;  2K57 A;  1PWT A;  3FLG A;  5FW9 A;  1PKS A;  1TH7 A;  1GBQ A;  2DF6 A;  2QAZ A;  2GFU A;  2QEX A;  2C06 A;  1VYU A;  3CCM A;  4J6W A;  4C5E A;  1M8V A;  4FT2 A;  3BFM A;  1E6G A;  4HVU A;  1BI0 A;  3UT1 A;  4PJO C;  2FPF A;  3AHU A;  5GAN g;  3M0Q A;  1X2Q A;  2LP5 A;  4JJB A;  3U23 A;  2HNI A;  2L3Q A;  3OW2 S;  4RTY A;  1K73 U;  2MCN A;  1GRI A;  1QP3 A;  2L2P A;  1LPL A;  5KCH A;  4PJJ A;  4PLL A;  3PTA A;  2CP3 A;  5I22 A;  3VS5 A;  2Y4X A;  2EYQ A;  2QQ9 A;  4E7J A;  1VQ4 T;  1VQO Q;  4DBQ A;  2PTK A;  4C0D B;  3QSU A;  2H3J A;  1YHQ Q;  2HQE A;  1KFZ A;  2KGT A;  5KH6 A;  4OP0 A;  3QYG B;  2C0T A;  2ZPH B;  3EH1 A;  1VIF A;  2KRS A;  4M7A G;  2LMJ A;  3JCM h;  2EYW A;  2R57 A;  2V1R A;  4HCK A;  1WZO A;  3WVE B;  4A4F A;  5I21 A;  3X28 B;  2HSE B;  5GAN 8;  3OYN A;  5CCA A;  3E9G A;  1QLY A;  2YWW A;  4RCC A;  1PNJ A;  2A0F B;  3QZ5 B;  3FEO A;  5GAN j;  1A0N B;  2JVV A;  2KR3 A;  3CD6 Q;  2EJG A;  3JB9 F;  5IT9 E;  4XTX A;  3I9Q A;  1BKB A;  2HEQ A;  2OTJ T;  4JRI A;  2K3B A;  4M7D D;  4D6W A;  1OX8 A;  1H92 A;  2YLC A;  4GY5 A;  4DOV A;  4GLK A;  4L59 A;  4F7U F;  4FM4 B;  1R0C B;  1UTI A;  2G3R A;  2F5K A;  2PVG B;  3RMQ A;  1KC8 U;  1K1Z A;  4IUQ A;  2ED1 A;  2AHJ B;  4C92 D;  1WHM A;  1M3C A;  3M0T A;  3V7C A;  1QVF S;  3RNJ A;  1OOT A;  4PJO E;  3L42 A;  1IO6 A;  4DBR A;  1I5L A;  3OYI A;  3VUB A;  1M27 C;  1MUZ A;  3MEV A;  3JCM J;  3UPU A;  4JPB W;  4OML A;  3M53 A;  2PUO B;  1VQM A;  4L6V 5;  1WNL A;  4C8Q D;  4RTW A;  2JTE A;  1VQP A;  4HXJ A;  1QCO A;  3PNW C;  1E7O A;  1ZA1 B;  3BE3 A;  2CRE A;  2X4W A;  2D0N A;  4F7U B;  4BDZ A;  4AFU C;  1VQN T;  1RAI B;  2BZ8 A;  1F1B B;  1M8M A;  2JUF A;  2VVK A;  1GCQ C;  1UGP B;  3CCU Q;  2KAF A;  5GAN 2;  5KYW B;  3M0U A;  4FYX B;  5FU6 B;  1OU9 A;  1P92 A;  5CO7 A;  2O31 A;  2PQW A;  4DQ2 A;  3J80 E;  4XTU A;  3NTH A;  4FYV B;  4JZ4 A;  2NLU A;  4J5Y A;  1FMW A;  2K3X A;  5D7U A;  5EC7 A;  1VYV A;  3VS3 A;  1YJW T;  5GAN 5;  3PMI A;  4JRK A;  1M2V A;  3BW1 A;  3THK A;  4OB3 B;  2M0O A;  3OYG A;  1YCY A;  2DNU A;  2QXF A;  4HT9 A;  2COW A;  4X1V A;  4EMK B;  4RTX A;  3HTR A;  3CEY A;  2EGE A;  2RJC A;  3S3M A;  3OY9 A;  5CVI A;  3CXC A;  1UGS B;  2DZ9 A;  2GFA A;  5A0L A;  3JRZ A;  1B34 B;  1D09 B;  1PHT A;  5GMK h;  4R0K A;  2FL7 A;  1WI7 A;  1VQ4 Q;  2HD0 A;  5M9O A;  3CBO A;  2EGC A;  4F14 A;  1YNZ A;  5IHI A;  4M75 A;  2X4Y A;  3MET A;  2F2X A;  1Y7X A;  1GCQ A;  3CCQ Q;  2EBP A;  4PJN A;  5KYY B;  1RI0 A;  2GQI A;  2MOX A;  3MEU A;  3QBY A;  3JB9 I;  3DLL A;  4RG8 A;  2XKO C;  4IUU A;  3QJY A;  1VUB A;  2WAC A;  4PJL A;  1G8X A;  2HQH A;  1U3O A;  1RLP C;  5GAM d;  2VGN A;  1AOJ A;  2IVW A;  3X25 B;  4IUT A;  3UWN A;  4OMN A;  1QVG P;  3R6O A;  4E6R A;  2RNA A;  1WHG A;  2OTJ Q;  4QW2 A;  1R8O B;  1PD0 A;  4XK8 E;  1GBR A;  3PVL A;  1M1K C;  1AWO A;  2O2O A;  5LJ3 f;  3VV0 A;  4Z8A A;  2KRM A;  4RG2 A;  2L5Q A;  1M1K R;  2LJ1 A;  4M77 C;  2ECZ A;  5DLQ E;  3CME A;  4NOY A;  4CRI A;  2LRQ A;  1VYT A;  2JZ2 A;  1XJW B;  3SWN C;  1Q82 U;  3URG A;  3CPF A;  5KYU A;  2COZ A;  4A4K A;  9ATC B;  2NUT A;  4ZNX A;  3UF4 A;  3CC7 T;  1KIK A;  5KYN A;  2KT8 A;  4C5I A;  3CCV T;  2QYZ A;  3CCJ A;  5CQX A;  1QCN A;  1M90 U;  2AZV A;  1Q81 C;  4MZP A;  3CMA T;  2J6O A;  3ZL7 C;  2D1X A;  1Q81 R;  4BI4 A;  1NYF A;  2QG9 B;  2O4X A;  2RHX A;  3CBM A;  3OB9 A;  3G6E A;  5IHK A;  3QXE B;  1VQK A;  1IHV A;  2X51 A;  4ZGD B;  2DLP A;  2EIF A;  4J6X A;  2YRC A;  3RKX A;  2F69 A;  4XTV A;  4Z89 A;  4B9W A;  4PFZ A;  1VQN Q;  4HVV A;  1XOV A;  1I0C A;  2CSQ A;  3JCM g;  3M59 A;  1YIJ A;  3QZ9 B;  1JRI A;  3HSB A;  1UEB A;  5GAM j;  2QEX T;  3Q1J A;  5HK0 A;  1OUL A;  3CCM T;  1O75 A;  5J3B A;  3JCM X;  4FYW B;  1NJI U;  3OW2 A;  2QGG A;  4NS5 A;  1ARK A;  2FZG B;  3GNF B;  3NFC A;  2PVO B;  4A53 A;  1WGS A;  1K0S A;  1UGV A;  2LTO A;  1UG1 A;  2D8J A;  3SWN A;  2F5T X;  5CKD A;  2CP6 A;  4ATO A;  1N5Z A;  4X9D A;  1YJW Q;  3EAE A;  2ZPG B;  1TG0 A;  1EIF A;  4FCY A;  2RQV A;  4BUG A;  2KBT A;  4M75 D;  1W70 A;  2RF0 A;  3IQL A;  2EAY A;  1YN8 A;  1RL2 A;  2ZGW A;  4M77 E;  2M0Y A;  1AWX A;  2E3H A;  4QQG A;  3VS2 A;  3JAM E;  1I07 A;  1WHJ A;  3H0H A;  2PVD B;  3M58 A;  2RO0 A;  3EGU A;  1UFF A;  5CKE A;  3EFO B;  4C0D C;  2LX7 A;  1X75 C;  1K8A C;  2KYM A;  4J9D A;  1NZ9 A;  2RPN A;  1SSH A;  1G3S A;  2H8H A;  1K8A R;  1YI2 Q;  5GMK l;  1ZQ1 A;  2JS0 A;  3OMC A;  1N27 A;  1HK9 A;  3EH2 A;  2LQK A;  3H41 A;  3L2Z A;  3L1A A;  4OF1 A;  2MAM A;  1RAD B;  2W0Z A;  3EG9 B;  2LT1 A;  4LD9 K;  2L3R A;  4R55 A;  5GAN 6;  2VUB A;  5FWC A;  4M78 F;  1NG2 A;  5AT1 B;  1YIT A;  5KE3 A;  2P0P A;  1IHW A;  4E7S A;  1R0B G;  2I2L A;  2K5I A;  1E6H A;  1QVF A;  2LCL A;  2CZ7 B;  2DL4 A;  1BK2 A;  2BE7 D;  2XID A;  1IB8 A;  4L5G A;  3ZFJ A;  4V2S A;  3DB4 A;  2VXF A;  1N6A A;  3M9Q A;  3C4S A;  1C6V X;  1K9M U;  1D0Z A;  2XDB A;  3EGD B;  2MWP A;  5IHN A;  2PU9 B;  3QKJ A;  1ACM B;  2OX7 A;  5LJ3 h;  5GJW B;  4C0F A;  4XU0 A;  4XU3 A;  1C1A A;  2D0Q B;  1VQM T;  3OSS C;  3I56 Q;  2CZ0 B;  1VQP T;  3CC7 Q;  3FDR A;  4OB0 B;  2GTO A;  2M16 A;  3G71 A;  4J7I A;  4M78 B;  1S72 Q;  3JCM Q;  1KK7 A;  2EQI A;  2KVQ G;  4HCB A;  2CT4 A;  3OA6 A;  1WLP B;  2MWO A;  1M9S A;  3A8H B;  3OYC A;  1VQ7 A;  4IKF A;  4C8Q G;  3QPH A;  1UJ0 A;  5GAN 4;  2E10 A;  2D6F A;  2QAS A;  2E5Q A;  5HCK A;  4EPC A;  1JJ2 P;  2P0K A;  3CCS A;  1PRM C;  4IIO A;  4PL6 A;  3PT9 A;  1KJW A;  3HFN A;  1WJS A;  1HSQ A;  1BCM A;  2HSP A;  4AT1 B;  2EFI A;  1Q86 U;  3CCM Q;  2YSQ A;  1D0X A;  4JJD A;  1Y57 A;  1VQ5 A;  2KT1 A;  5FU6 C;  2KMT A;  2GCX A;  1HJD A;  2JMC A;  1RAG B;  2K79 A;  5HY6 A;  1OX9 A;  5LJ5 f;  4ZN3 A;  2K6D A;  1PRL C;  2NUP B;  5GAN e;  2OTL A;  1SKU B;  2HDA A;  4AFQ C;  2B86 A;  2LJ3 A;  7AT1 B;  4FU6 A;  1PD1 A;  3GF5 A;  5GMK j;  3PVQ A;  2HL5 C;  1BI1 A;  1MNE A;  5GAM h;  4LDU A;  2WSC E;  2E1H A;  2HBP A;  2C0O A;  1T3S A;  2AKK A;  4EMK C;  2F2V A;  1PM3 A;  1YBY A;  4R56 A;  2JW4 A;  4BE0 A;  1SPK A;  2VWF A;  3FJ5 A;  2WSF E;  1M5Q 1;  2OI3 A;  5D6X A;  4F7U A;  1M3A A;  1JXO A;  1X2K A;  1TS9 A;  2XK0 A;  3GOX A;  4PJO G;  4E7Z A;  2K9G A;  2O88 A;  3KFV A;  3M0R A;  3EFS A;  2DRK A;  2DIQ A;  2E65 A;  1QWE A;  3RDV A;  1U1T A;  4M7D F;  2DMO A;  2FRW A;  2EQJ A;  2GTJ A;  2ENM A;  4BB7 A;  2DKG A;  3CPW P;  3CC4 A;  4RTU A;  5KYX A;  3I55 Q;  1RAA B;  3A5Z B;  2GGR A;  3OYH A;  3M56 A;  2CP7 A;  4F7U E;  1Y71 A;  3UA6 A;  2CUB A;  1XTD A;  3CCE A;  4KGZ B;  4E2F B;  4C92 F;  1YJN A;  3X20 B;  3VYG A;  3CME T;  1YJ9 Q;  4ZN1 A;  4XAX B;  1UJY A;  1JBM A;  4BD3 A;  2QDY B;  2KYB A;  4EMK A;  3A8O B;  4RTT A;  2JJ9 A;  2O01 E;  2DX1 A;  3EG2 A;  4QQ6 A;  1M3B A;  3T9N A;  2ATC B;  2K7A A;  4DEX A;  4PJO A;  2MF2 A;  2P4T A;  2A28 A;  1Y96 B;  4FL6 A;  4C8Q F;  1WXU A;  2O9S A;  2XIC A;  4MDX A;  3CCJ T;  3PGG A;  4M7D B;  5CKB A;  1VQ8 A;  2RHI A;  1W2B P;  1RLQ C;  2BZX A;  1VQM Q;  1VQP Q;  3L2U A;  2F1L A;  4NL3 A;  3G6E T;  4OMO A;  1VQK T;  1Z9Z A;  1TUC A;  2DPP B;  2L0A A;  4C92 B;  2V8J A;  2EYZ A;  2YLB A;  2FHD A;  1BIA A;  1YIJ T;  4LUD A;  2DBK A;  1D0Y A;  1NM7 A;  2SEM A;  1T3L A;  2MYS A;  2A3L A;  3OQ5 A;  5GAN f;  4QQD A;  1UDL A;  2M1H A;  4C8Q B;  4UC4 A;  3CD6 A;  1D1C A;  2L89 A;  1WFW A;  1AZE A;  4PFO A;  1N8R C;  1D1A A;  2DD5 A;  4IIM A;  1MMG A;  1N8R R;  4JLG A;  3V8K A;  5A2Q E;  3H0I A;  5LJ3 d;  1JB0 E;  2GF7 A;  3FB9 A;  1VQ9 Q;  1K76 A;  2DE0 X;  4CC4 B;  3RKW A;  2BE9 B;  5LJ5 h;  5D6Y A;  3MPU B;  1KD1 U;  3VKI A;  4M75 G;  3LLR A;  1GFD A;  1QQJ A;  2AZS A;  2KDS A;  2ABL A;  3EHR A;  1QVG S;  1M30 A;  4LDX A;  1VQ6 A;  2MI6 A;  2FZC B;  3N5B B;  4VUB A;  5LJ3 g;  3LWI A;  2AKL A;  4E7L A;  4LN2 A;  1OPK A;  3D7S B;  4JUV A;  3HRS A;  1RI9 A;  3RIR A;  2EQK A;  4QKU A;  2LNV A;  3VUZ A;  1KQS P;  4M7A F;  3CCR A;  2DBM A;  2QQA A;  5FWB A;  3OYK A;  1W6X A;  1PKT A;  3MP8 A;  4F17 A;  2EGA A;  5GAO l;  2E6Z A;  4N0A C;  3PE0 A;  2Y90 A;  1YIT T;  2QQS A;  4PK4 A;  5C6S A;  3CCU A;  1H8K A;  4DBF A;  2H3E B;  2LZ6 B;  5GAO r;  1Q7Y U;  4XU1 A;  2C0I A;  1ZSG A;  4PJO D;  3CBP A;  4A4E A;  2KSS A;  3PIP A;  3LGL A;  1UE9 A;  3LWH A;  1LCK A;  4ME7 A;  3V8L A;  4FSS A;  5A0D A;  5LJ3 j;  2DEQ A;  1V76 A;  2HZY A;  4M7A B;  2ED0 A;  2OAU A;  1QKX A;  4ESR A;  4JJN K;  1I5O B;  3G4S A;  2GQV A;  3I5S A;  4KUI A;  3OS5 A;  4JS4 A;  4J9B A;  4IUP A;  3G71 T;  3OYJ A;  4E7I A;  3I5R A;  3P8H A;  1ZUY A;  3CQT A;  3WXM B;  1JEG A;  2IPO B;  1G2B A;  1YFN A;  3RES A;  3EFO A;  5CIU A;  3V7R A;  3RUX A;  1VQ7 T;  2LCS A;  5GAM g;  5GAO n;  2XI9 A;  3E1S A;  2K5L A;  2YUO A;  3QDF A;  3G6E Q;  2JT4 A;  3H6Z A;  2EJ9 A;  2DJZ A;  3S6W A;  1VQK Q;  4M78 C;  3EG1 A;  3CCS T;  2DYB A;  3CCQ A;  4Y91 A;  1N9S A;  4CC7 A;  2ZZD A;  3VS1 A;  1U1S A;  4OGC A;  2F2W A;  3JCM P;  1OEB A;  4M77 G;  5I11 A;  3JCM e;  2R5M A;  1WHL A;  2CP0 A;  2DRM A;  3TSZ A;  2FPD A;  1VQ5 T;  2AT1 B;  5GMK m;  1WQW A;  4FW2 A;  2FVU A;  1GCP A;  4M75 F;  1I1J A;  4II1 A;  2Z0W A;  2YUP A;  2EKH A;  2ZPI B;  2OTL T;  3DKM A;  1BCO A;  2BZY A;  3EGD A;  2DL8 A;  5ECA A;  2QA4 A;  4ELZ C;  4RKU E;  1G3T A;  3NGP A;  4BDY A;  3LH5 A;  2X4J A;  1SF9 A;  1M2V B;  1AWW A;  4HCC A;  1K9A A;  1VQL A;  4M77 A;  4MZM A;  3C95 A;  1Q95 G;  3OMG A;  2ZPB B;  2X3W D;  3JB9 H;  4M78 A;  2P4R A;  4CC2 A;  1QCF A;  1K73 C;  3CC2 A;  1D3B A;  1Y0M A;  3FJP A;  1K73 R;  2HBW A;  1K4U S;  1SHF A;  2CYZ B;  5CQY A;  1UGQ B;  1AZG B;  5CAI A;  1NLO C;  4DBH A;  2X35 A;  3MHX A;  4HCZ A;  4M75 B;  5AYF A;  2RQR A;  4DOW A;  1WQ7 A;  1IRX A;  3VS6 A;  2K3Y A;  4LDV A;  3HFO A;  3SD4 A;  2VV5 A;  3MCA B;  2XDP A;  5GMK i;  1LJO A;  2CS7 A;  1M2O A;  1GFC A;  3CC4 T;  1R77 A;  4M78 E;  1VIE A;  3BY7 A;  1NEG A;  1ZX6 A;  4QVZ A;  2DL7 A;  3HL8 A;  3VJP A;  1YIT Q;  2VYT A;  2RHU A;  5IN1 A;  3CCE T;  3G1J A;  3QO3 A;  1RAB B;  4FT4 A;  2W10 A;  1YJN T;  4EMH A;  1NPR A;  3KUF A;  1OZ2 A;  2LNH B;  8ATC B;  3VRZ A;  1SG5 A;  2L3P A;  2NUP A;  5KE2 A;  2COY A;  2EVR A;  4BY6 B;  2EPD A;  5I2S A;  1MV3 A;  2KI7 A;  4P5N A;  3OYE A;  5LJ5 d;  1JJ2 S;  2HCK A;  2AIR B;  2ROT A;  2JS2 A;  2JXB A;  2KE9 A;  2D9T A;  5I2M A;  5L23 A;  1VQ8 T;  5HK3 A;  4MDW A;  2RD1 A;  1PSE A;  2DTO A;  4A4H A;  5KCO A;  1GXI E;  3JSC A;  1KC8 C;  4JRP A;  1QVP A;  2DXT A;  2OJ2 A;  5LJ5 g;  2DK3 A;  3JCM f;  1KC8 R;  3OS0 A;  3P8D A;  4M7D C;  1RAC B;  2L3S A;  3UA7 A;  3HKS A;  2ZPE B;  2RMO A;  2DXU A;  1VQ7 Q;  3REB B;  2QGF B;  1BB9 A;  2MK5 A;  1ZSZ B;  1MV0 B;  5GMK e;  3CCL A;  1CKA A;  4FIB A;  3DB3 A;  1KHC A;  2SRC A;  1I81 A;  2DJQ A;  2PNI A;  3CCS Q;  4XQ3 A;  2B8A A;  1YI2 A;  1FMV A;  4C92 C;  2J05 A;  1LNX A;  3M57 A;  3NMZ C;  3M54 A;  1VA7 A;  5DY9 A;  3TEE A;  1JQQ A;  2V26 A;  4J6Y A;  4LUE A;  3OYM A;  3QYH B;  3CCV Q;  3PIO A;  1UHF A;  2LVM A;  3INZ A;  3VYH B;  3CMA Q;  2RI5 A;  4Y28 E;  1VQ5 Q;  2LDM A;  1NYG A;  1X6O A;  4C8Q C;  3OBW A;  2NYS A;  2IIM A;  1G3Y A;  2R5A A;  2VXE A;  1W4S A;  1BI3 A;  4M77 D;  4LNP A;  2X3X D;  4Q5W A;  4TVR A;  3LH0 A;  3PFS A;  2QQB A;  1QVG A;  4IUV A;  2OTL Q;  4M78 D;  2O9V A;  5LJ5 j;  1AVZ C;  2K5F A;  4X9C A;  1HD3 A;  3VS7 A;  1K0X A;  2EQM A;  2V1Q A;  2MMP A;  1Y96 A;  3JB9 G;  1WHK A;  4EMG A;  3OS1 A;  2QEX Q;  4F04 B;  1M1K U;  2A7Y A;  4J7F A;  4ZGE B;  4KBM B;  1VQ6 T;  3A8M B;  1BIB A;  3F70 A;  3CPW S;  1ZUK A;  3VRY A;  2R58 A;  2RJE A;  5J39 A;  3EG3 A;  1YWP A;  4F7U G;  2J06 A;  3VU3 C;  3I56 A;  1W1F A;  2RQT A;  1Y07 A;  4PLI A;  3CXC P;  1KHI A;  4C92 A;  3CCR T;  2J6F A;  2QTV A;  3O8V A;  3M0P A;  1S72 A;  3ME9 A;  4OB2 B;  1QW1 A;  4QVD A;  4ZTF A;  2XD0 A;  1Q81 U;  4DA4 A;  3RMS A;  3ZEH A;  4M7D E;  4M4Z A;  2HKQ B;  3ASK A;  4N4H A;  1Q7Y R;  3A1P A;  3CC4 Q;  4O5V A;  4AG1 C;  2JOY A;  4OMM A;  1W2B S;  3EGX B;  5GAN d;  4N4G A;  1PG5 B;  3HRT A;  2VAS A;  2RJD A;  4C92 E;  4D8D A;  3CCE Q;  3E9F A;  3HP9 A;  4F16 A;  3E19 A;  1YJN Q;  2BTT A;  4E47 A;  1X43 A;  4KT0 E;  2PUK B;  3MJX A;  1AWJ A;  2DFU A;  2KNB B;  2M51 A;  5KYW A;  2JMA A;  3GLX A;  4J9F A;  3G4S T;  4JDS A;  4C8Q E;  1MMN A;  1TSF A;  4B9X A;  2DL3 A;  1MMD A;  4A63 B;  4CC3 A;  2DIL A;  2E41 A;  1PSF A;  4J9I A;  4M7A C;  1VQ8 Q;  2DTI A;  4RMO A;  2XG8 D;  4KUL A;  3SEM A;  4PFP A;  3SFM A;  5IH2 A;  1NEB A;  2WSE E;  3TRE A;  3FC3 A;  2KK4 A;  1QWF A;  2LJ0 A;  2E3I A;  1WJQ A;  4OMF B;  1Q82 C;  2DM1 A;  2DEU A;  5IXB A;  1U5S A;  3UDC A;  3CCQ T;  1U8R A;  1Q82 R;  1QKW A;  3ER0 A;  1FYN A;  1LVK A;  1OZ3 A;  2VB6 A;  3BDL A;  4FSX A;  3C94 A;  2RJF A;  3KBG A;  1B34 A;  2V8I A;  2JTF A;  4D8K A;  1M90 C;  1IZ6 A;  1BU1 A;  3S3N A;  1HYO A;  2VKN A;  1IGU A;  1K8A U;  1M90 R;  4ELY C;  2CSI A;  2EYY A;  3J81 E;  1TUG B;  1VQO A;  2YT6 A;  3TQ7 P;  4GLM A;  4BI3 A;  3A8L B;  1YHQ A;  1UB4 A;  5KYY A;  4OVA A;  4KUD K;  5GAN 7;  5GAO m;  2IG0 A;  1D1B A;  3I55 A;  1B3Q A;  4GBQ A;  3QG1 A;  2YHT A;  3LX7 A;  2QA4 T;  1FX7 A;  1U06 A;  1KQS S;  2L8D A;  2CZ1 B;  3LW5 E;  3M4G A;  2EKO A;  2JM9 A;  3OW2 P;  4M7A A;  1SRL A;  1G5V A;  2PZ1 A;  1NJI C;  4IUR A;  1YJ9 A;  3S3O A;  2E70 A;  2KXC A;  2YRV A;  1NJI R;  1TUD A;  1VQL T;  2K4Y A;  2V8K A;  2CP2 A;  2RA2 A;  3JCM b;  1V29 B;  3UAT A;  3HPW A;  1CKB A;  3CC2 T;  1VQ6 Q;  4MMK A;  4HT8 A;  1KQ2 A;  4HA8 A;  2A36 A;  2X4X A;  2XHC A;  1OI1 A;  3J7A F;  1YWO A;  1NBE B;  1IGQ A;  3RKY A;  5LJ3 e;  3JB9 D;  2E4H A;  2ZCF B;  1H3Z A;  3ULR B;  5D6W A;  3JB9 J;  4M7A E;  2RK1 A;  3QUI A;  1BI2 A;  2LQW A;  2CH4 W;  4LXC A;  3CCR Q;  1X6G A;  2MIO A;  2DZC A;  2Y4Y A;  2HAX A;  2KQW A;  2DVE A;  2E5K A;  3M0S A;  5CK9 A;  4FYY B;  3V8J A;  4M75 C;  2EWN A;  4J9C A;  3L2W A;  4AFZ C;  2EYX A;  3H9N A;  5FU7 B;  3SHW A;  4PJO F;  4EIK A;  2XDD A;  1WIE A;  4J8O A;  2DET A; 
#chains in the Genus database with same CATH homology
 4M75 F;  2Y4X A;  2XDB A;  2EYQ A;  4II1 A;  2QQ9 A;  2ZPI B;  2MWP A;  2EQU A;  2PU9 B;  2RK2 A;  4E7J A;  3MEA A;  3QKJ A;  4JRQ A;  1VQ4 T;  1JJ2 A;  3DKM A;  4E7H A;  3LGF A;  5LJ3 h;  2QA4 A;  4MZT A;  4C0D B;  3G7Z A;  2H3J A;  4ELZ C;  3QSU A;  2HQE A;  4RKU E;  4C0F A;  1G3T A;  4XU0 A;  4BDY A;  5KH6 A;  4OP0 A;  2X4J A;  1XNI A;  3QYG B;  2ZPH B;  1VIF A;  4XU3 A;  2D0Q B;  2HQX A;  3BDU A;  1VQM T;  3OSS C;  4M7A G;  2CZ0 B;  3GIB A;  1VQP T;  3FDR A;  4HCC A;  4OB0 B;  1VQL A;  3JCM h;  2M16 A;  4M77 A;  4MZM A;  2R57 A;  3C95 A;  4J7I A;  4M78 B;  3WVE B;  4A4F A;  5I21 A;  3OMG A;  3X28 B;  5GAN 8;  3OYN A;  2ZPB B;  5CCA A;  4BY6 C;  3E9G A;  3C12 A;  3JCM Q;  3JB9 H;  2KVQ G;  4M78 A;  4HCB A;  3OA6 A;  1VQ9 A;  5FRN A;  2MWO A;  1M9S A;  3A8H B;  1K73 C;  3OYC A;  1VQ7 A;  3CC2 A;  4IKF A;  1D3B A;  4RCC A;  3QPH A;  4C8Q G;  3QZ5 B;  4Z02 A;  3FJP A;  3FEO A;  2E10 A;  5GAN 4;  2JVV A;  2CYZ B;  5GAN j;  2D6F A;  2E5Q A;  5CQY A;  4PJO B;  1K9M C;  1UGQ B;  2EJG A;  5CAI A;  1I8F A;  4EPC A;  2P0K A;  2X35 A;  3JB9 F;  3MHX A;  4XTX A;  3ZBD A;  3CCS A;  2QTX A;  4HCZ A;  4M75 B;  5AYF A;  3X26 B;  1BKB A;  2QI2 A;  4ZTJ A;  2OTJ T;  4JRI A;  4DOW A;  1WQ7 A;  2RH2 A;  4PL6 A;  3M55 A;  3PT9 A;  3CCL T;  3HFN A;  1WJS A;  5GAM e;  2K3Y A;  4LDV A;  3HFO A;  1FXX A;  4XTZ A;  4D6W A;  4M7D D;  3SD4 A;  1HXD A;  2EFI A;  1WJR A;  2VV5 A;  2YLC A;  3MCA B;  4GLK A;  2XDP A;  4GY5 A;  4DOV A;  5GMK i;  1LJO A;  1Q86 U;  2CS7 A;  4L59 A;  1YI2 T;  3CC4 T;  4F7U F;  4M78 E;  4FM4 B;  1VIE A;  2CZ6 B;  3BY7 A;  2G3R A;  3KXT A;  4QVZ A;  2F5K A;  2LX9 A;  2PVG B;  3HL8 A;  3RMQ A;  1VQ5 A;  2DD4 A;  3VJP A;  1KC8 U;  1MGQ A;  2VYT A;  1WPY A;  5FU6 C;  4IUQ A;  5IAY A;  2KMT A;  2GCX A;  2RHU A;  1M1F A;  3FRN A;  5IN1 A;  2AHJ B;  3CCE T;  2KY9 A;  3OYF A;  4OGE A;  5HY6 A;  4C92 D;  5LJ5 f;  3QO3 A;  4FT4 A;  2JN0 A;  3V7C A;  4ZN3 A;  4EMH A;  1NPR A;  1YJN T;  1QVF S;  3KUF A;  4PJO E;  4M7A D;  5GAN e;  1OZ2 A;  2OTL A;  3L42 A;  2RM4 A;  1I5L A;  1VQ4 A;  3OYI A;  3VUB A;  4N0A A;  3MEV A;  3JCM J;  3UPU A;  5KE2 A;  4FU6 A;  4M75 E;  4BY6 B;  1K8A C;  3GF5 A;  4XTW A;  3L2Q A;  5GMK j;  2XU8 A;  1O9S A;  5I2S A;  1BI1 A;  3OYA A;  3M53 A;  5FRO A;  4P5N A;  3OYE A;  3QHS A;  1DJ7 B;  2PUO B;  5LJ5 d;  5GAM h;  1JJ2 S;  1ZHI A;  4C5H A;  4L6V 5;  1WNL A;  1I4K 1;  4LDU A;  4C8Q D;  3OSV A;  3G71 A;  2WSC E;  1VQP A;  2E1H A;  2HBP A;  3CPW A;  4EMK C;  2E12 A;  1YBY A;  4R56 A;  2D9T A;  4BE0 A;  1Q86 C;  5I2M A;  1VQ8 T;  3PNW C;  3SB2 A;  5HK3 A;  4MDW A;  2RD1 A;  5FRM A;  1PSE A;  2LQ8 A;  2DTO A;  2X4W A;  4A4H A;  3HHT B;  4M78 G;  4F7U B;  4BDZ A;  5KCO A;  1GXI E;  1VQN T;  5CR2 A;  2WSF E;  3JSC A;  1KC8 C;  4JRP A;  2VC8 A;  1M5Q 1;  3PMT A;  1NPP A;  1QVP A;  5A0G A;  2DXT A;  5D6X A;  4F7U A;  5LJ5 g;  2BKD N;  2DK3 A;  3JCM f;  3DLM A;  1FWZ A;  2JUF A;  1BYM A;  2RB6 A;  3OS0 A;  1SSF A;  3P8D A;  4M7D C;  5GAN h;  1UGP B;  2KAF A;  5GAN 2;  3A8G B;  3HKS A;  3NTI A;  2ZPE B;  2P0Q A;  2XK0 A;  3I56 T;  2DXU A;  1XQH A;  3GOX A;  3H8Z A;  4PJO G;  2OTJ A;  4E7K A;  5FU6 B;  5GMK e;  1P92 A;  3V7S A;  5CO7 A;  4XTY A;  3EFS A;  4FIB A;  2DIQ A;  3DB3 A;  2E65 A;  1S72 T;  3CCL A;  2PQW A;  4DQ2 A;  1KHC A;  1U1T A;  3OS2 A;  4M7D F;  3J80 E;  1I81 A;  3JCM d;  2EQJ A;  1QP2 A;  4WF2 A;  4XTU A;  4BB7 A;  3NTH A;  4XQ3 A;  2NLU A;  4J5Y A;  2B8A A;  2K3X A;  2DKG A;  4MML A;  1YI2 A;  3CC4 A;  1W2B A;  4C92 C;  4C0Z A;  1LNX A;  3L2V A;  3M57 A;  1YJW T;  5GAN 5;  3PMI A;  3GP8 A;  4JRK A;  3M54 A;  5DY9 A;  3GPL A;  4LD6 A;  3TEE A;  3A5Z B;  1VQM A;  2ZPF B;  4J6Y A;  3OYH A;  2LCC A;  3M56 A;  3QYH B;  3OYM A;  4F7U E;  3BW1 A;  1Y71 A;  5HKC A;  1XTD A;  5C0M A;  4OB3 B;  3PIO A;  3CCE A;  2LVM A;  3VYH B;  2M0O A;  3INZ A;  4C92 F;  5GAO p;  3OYG A;  1YCY A;  1YJN A;  3X20 B;  2QXF A;  4HT9 A;  3VYG A;  3CME T;  2RI5 A;  4Y28 E;  4ZN1 A;  4EMK B;  1N9R A;  2LDM A;  4XAX B;  1JBM A;  1LOJ A;  4BD3 A;  1KQ1 A;  1X6O A;  2QDY B;  4C8Q C;  3CEY A;  2RJC A;  4EMK A;  3OBW A;  3A8O B;  3S3M A;  2O01 E;  3OY9 A;  1X01 A;  5CVI A;  3CXC A;  2R5A A;  1G3Y A;  1UGS B;  2DZ9 A;  1W4S A;  1BI3 A;  2GFA A;  2VXE A;  3GNG A;  4M77 D;  4QQ6 A;  2K2V A;  4Q5W A;  4TVR A;  3LH0 A;  3T9N A;  1M4Z A;  3PFS A;  5A0L A;  3JRZ A;  1B34 B;  4BE1 A;  4PJO A;  2QQB A;  5GMK h;  1QVG A;  4IUV A;  2FL7 A;  2MF2 A;  2P4T A;  4M78 D;  4RCB A;  2HD0 A;  5M9O A;  3CBO A;  5LJ5 j;  1Y96 B;  2K5F A;  4FL6 A;  4X9C A;  4C8Q F;  2VGM A;  2EQM A;  2XIC A;  2E6N A;  3OYB A;  4M75 A;  3FIF A;  4MDX A;  2MMP A;  2X4Y A;  1Y96 A;  3MET A;  3CCJ T;  3PGG A;  3JB9 G;  4EMG A;  4M7D B;  5CKB A;  3OS1 A;  1VQ8 A;  1M1K U;  2RHI A;  2A7Y A;  4J7F A;  3RER A;  1Y7X A;  4ZGE B;  4YTL A;  4OB1 B;  4KBM B;  1VQ6 T;  3A8M B;  1BIB A;  2JTM A;  5DM7 R;  3L2U A;  5GAM f;  1VQN A;  2EJF A;  3F70 A;  1RI0 A;  4O6J A;  3CPW S;  4NL3 A;  1N8R U;  2R58 A;  3G6E T;  2RJE A;  3MEU A;  5J39 A;  3QBY A;  2BIV A;  2DTH A;  2M9U A;  1VQK T;  5IT9 E;  3JB9 I;  3DLL A;  2DPP B;  4F7U G;  3VU3 C;  4RG8 A;  2XKO C;  2E64 A;  4IUU A;  3I56 A;  3QJY A;  2V8J A;  4C92 B;  4BE2 A;  2YLB A;  1Y07 A;  3LYI A;  2CKK A;  1VUB A;  1BIA A;  2FHD A;  2WAC A;  3MP6 A;  4PLI A;  1KHI A;  4C92 A;  3M4Y A;  3CCR T;  1YIJ T;  5GAM d;  5GAN 3;  1H64 1;  2VGN A;  3O8V A;  3JCM W;  1S72 A;  2IVW A;  3ME9 A;  3X25 B;  4IUT A;  1QW1 A;  4OB2 B;  3UWN A;  4QVD A;  1UGR B;  3R6O A;  3WVD B;  5LJ5 e;  2DXB A;  4ZTF A;  2A3L A;  2XD0 A;  1Q81 U;  5EG2 A;  3OQ5 A;  5GAN f;  4DA4 A;  4QW2 A;  4EDU A;  4QQD A;  3RMS A;  1R8O B;  3ZEH A;  2M1H A;  4M7D E;  3NTK A;  4C8Q B;  1YJW A;  2DIG A;  4LDY A;  1AHJ B;  3ASK A;  4J83 A;  4UC4 A;  5LL6 S;  4C5G A;  3CD6 A;  4XK8 E;  1M1K C;  3MO8 A;  5LJ3 f;  4PNO A;  4N4H A;  3VV0 A;  4RG2 A;  2L5Q A;  4O5V A;  2L89 A;  2JOY A;  4M77 C;  2LC4 A;  4PKC C;  5DLQ E;  1W2B S;  5GAN d;  4N4G A;  3CME A;  1VQO T;  1N8R C;  4NOY A;  4CRI A;  2DD5 A;  2LRQ A;  3HRT A;  2RJD A;  3OBY A;  2JZ2 A;  4JLG A;  3V8K A;  4C92 E;  5A2Q E;  1YHQ T;  1KQS A;  3SWN C;  1Q82 U;  3URG A;  3E9F A;  3HP9 A;  2DXC A;  4M77 F;  3E19 A;  4A4G A;  3CPF A;  5LJ3 d;  1JB0 E;  2GF7 A;  3FB9 A;  3MEW A;  4A4K A;  4E47 A;  3I55 T;  4KT0 E;  2PUK B;  3CC7 T;  2BUD A;  3RKW A;  4C5I A;  3MP1 A;  3CCV T;  3GLX A;  5LJ5 h;  5GAO q;  3CCJ A;  3CXC S;  5CQX A;  5D6Y A;  1KD1 U;  1M90 U;  2RHY A;  3VKI A;  4M75 G;  3LLR A;  3G4S T;  1Q81 C;  2CGH A;  4JDS A;  4MZP A;  3CMA T;  2JNG A;  4C8Q E;  2DAQ A;  2KDS A;  3TCJ A;  1YJ9 T;  4B9X A;  1QVG S;  2O4X B;  4LDX A;  1VQ6 A;  2MI6 A;  4M7D G;  4BI4 A;  1IRE B;  4VUB A;  3N5B B;  4XU2 A;  2O4X A;  2E41 A;  2RHX A;  1NE8 A;  3CBM A;  1PSF A;  3OB9 A;  4C0G A;  3LWI A;  3G6E A;  4E7L A;  3QXE B;  4M7A C;  4A54 A;  3CD6 T;  2DTI A;  1VQK A;  4RMO A;  2XG8 D;  4ZGD B;  2EIF A;  4JUV A;  4J6X A;  4KUL A;  3HRS A;  3SFM A;  3RKX A;  2F69 A;  2WSE E;  3TRE A;  3RIR A;  4HKE A;  2EQK A;  4XTV A;  3FC3 A;  2KK4 A;  4B9W A;  5LJ3 g;  2LNV A;  3VUZ A;  1XOV A;  3JCM g;  3M59 A;  1YIJ A;  3CCR A;  4M7A F;  3QZ9 B;  1JRI A;  1WJQ A;  1UEB A;  1G3W A;  5GAM j;  2QEX T;  3HSB A;  2QQA A;  2DO3 A;  3Q1J A;  3EFR A;  3OYK A;  4C92 G;  4OMF B;  4X34 A;  5HK0 A;  1Q82 C;  3OYL A;  3QJ6 A;  3CCM T;  3MP8 A;  3JCM c;  3CCQ T;  2QQR A;  3UDC A;  5GAO l;  1U8R A;  1O75 A;  5J3B A;  4M77 B;  3JCM X;  3QDR B;  4QVC A;  2E6Z A;  4N0A C;  1NJI U;  3ER0 A;  3OW2 A;  1OZ3 A;  4NS5 A;  3BDL A;  4FSX A;  3C94 A;  2Y90 A;  3GNF B;  2FYK A;  2QQS A;  3NFC A;  1YIT T;  3QII A;  2PVO B;  2RJF A;  1WGS A;  3KBG A;  1B34 A;  3SWN B;  4A53 A;  2V8I A;  5C6S A;  1D3B B;  2RI2 A;  2JTF A;  2LTO A;  1KD1 C;  1IZ6 A;  3CCU A;  1M90 C;  3S3N A;  2OTL T;  3OYD A;  3TU4 K;  5GAO r;  4XU1 A;  3SWN A;  1Q7Y U;  1K8A U;  2F5T X;  5DLO A;  4ELY C;  5CKD A;  3J81 E;  3L2R A;  4ATO A;  4M7D A;  4X9D A;  1VQO A;  3EAE A;  4PJO D;  2FB7 A;  2ZPG B;  3CBP A;  4A4E A;  2KSS A;  1EIF A;  4BI3 A;  5CKF A;  1MHN A;  3A8L B;  3PIP A;  1YHQ A;  4BUG A;  3LGL A;  3JCM V;  1UB4 A;  4M75 D;  3LWH A;  4ME7 A;  2RHZ A;  4OVA A;  3V8L A;  4KUD K;  5GAN 7;  5CKH A;  5GAO m;  5A0D A;  2EAY A;  2IG0 A;  3HRU A;  5LJ3 j;  5J26 A;  2DEQ A;  3I55 A;  1RL2 A;  2ZGW A;  3CC7 A;  4CI0 C;  3QG1 A;  2YHT A;  3LX7 A;  2QA4 T;  5FU7 C;  4JLI A;  4M7A B;  4BI8 B;  1FX7 A;  4M77 E;  3CCV A;  1KQS S;  2L8D A;  2CZ1 B;  2OAU A;  3LW5 E;  3M4G A;  4NL2 A;  2EKO A;  4JJN K;  1OYX A;  4M7A A;  1ZBX A;  4ZGJ B;  3G4S A;  4N4I A;  4QQG A;  1NJI C;  1G5V A;  2GQV A;  3CMA A;  4IUR A;  1YJ9 A;  4KUI A;  3S3O A;  2E70 A;  2YRV A;  3OS5 A;  3JAM E;  4JS4 A;  2PVD B;  3M58 A;  2RO0 A;  5L8R E;  4BAC A;  4IUP A;  1VQL T;  2LT4 A;  3M5A A;  3G71 T;  3OYJ A;  2K4Y A;  4E7I A;  5CKE A;  5FLX E;  2V8K A;  3P8H A;  3WXM B;  2RA2 A;  4C0D C;  3JCM b;  1Q7Y C;  1V29 B;  1X75 C;  3P8B B;  4LDW A;  3RES A;  1M1G A;  3SDZ A;  3CCU T;  4C8Q A;  1VQ9 T;  3OYY A;  1NZ9 A;  5CIU A;  3HPW A;  3V7R A;  4JS5 A;  1KG1 A;  3RUX A;  1VQ7 T;  1G3S A;  3CC2 T;  5GAM g;  3X24 B;  5GAO n;  2RI3 A;  4MMK A;  4HT8 A;  2K57 A;  5GMK l;  3FLG A;  1KQ2 A;  1TH7 A;  1ZQ1 A;  2X4X A;  2K5L A;  2XI9 A;  3E1S A;  4HA8 A;  3OMC A;  1N27 A;  1HK9 A;  2XHC A;  1OI1 A;  2LQK A;  3H6Z A;  2EJ9 A;  2GFU A;  2DJZ A;  3L1A A;  3L2Z A;  3S6W A;  2QEX A;  3J7A F;  4OF1 A;  2MAM A;  4M78 C;  2C06 A;  5LJ3 e;  3RKY A;  3JB9 D;  2ZCF B;  3CCM A;  3CCS T;  4J6W A;  3CCQ A;  4C5E A;  4Y91 A;  1M8V A;  1H3Z A;  5D6W A;  1N9S A;  2LT1 A;  4LD9 K;  2L3R A;  4FT2 A;  3JB9 J;  2RK1 A;  4R55 A;  3BFM A;  2ZZD A;  4M7A E;  3QUI A;  1BI2 A;  5GAN 6;  2VUB A;  1U1S A;  4M78 F;  4OGC A;  1BI0 A;  3JCM P;  1YIT A;  4M77 G;  3UT1 A;  5KE3 A;  4PJO C;  2P0P A;  2DZC A;  2Y4Y A;  3JCM e;  2HAX A;  2KQW A;  3AHU A;  2I2L A;  5GAN g;  2DVE A;  2R5M A;  2K5I A;  2HNI A;  5CK9 A;  1QVF A;  2LCL A;  2CZ7 B;  3V8J A;  4M75 C;  3OW2 S;  1K73 U;  2EWN A;  2XID A;  4L5G A;  3L2W A;  3ZFJ A;  1VQ5 T;  5FU7 B;  4V2S A;  3DB4 A;  5GMK m;  1WQW A;  4PJO F;  2VXF A;  1N6A A;  1QP3 A;  3M9Q A;  3C4S A;  2XDD A;  2FVU A;  4J8O A;  5KCH A;  1K9M U;  4PLL A;  3PTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...