4C8QF

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
b'SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
molecule tags Transcription
source organism Saccharomyces cerevisiae
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qF00
5GMKj 1YCYA 2Y90A 4PJOF 4C92E 5LJ3e 1I4K1 4NL3A 1KQ2A 4M75E 5LJ3j 4PJOE 4C8QG 4OP0A 2DVEA 2DXTA 5GAMf 3RIRA 3JCMd 3FIFA 4XU2A 3SWNA 4XTZA 3HFNA 4M77A 4M75B 5GAMd 5GAN8 3JCMW 4WF2A 4M7DE 3L1AA 5LJ3g 1WQWA 4J6YA 2RB6A 4PNOA 5GAMh 2DZCA 1N9SA 4M78E 5GAOm 2EWNA 5GAN3 3FJPA 5GAOl 4F7UB 3JCMc 4F7UF 1JRIA 1Y96B 2DEQA 2VXEA 1WPYA 3SWNC 5CAIA 3HSBA 1B34A 4HT8A 4M7DF 1B34B 2QTXA 3BDUA 1U1SA 2VXFA 5GAN7 4PJOB 2FB7A 2EJ9A 3L2ZA 3M4GA 4X9DA 3INZA 3EFRA 5LJ3d 3SWNB 2E65A 4PJOD 5LJ5g 4X9CA 4M78F 4M78B 3JCMg 4M7DC 4J6WA 3AHUA 4M77F 4C92B 3GIBA 2E41A 5GAOq 2E10A 4F7UE 5LJ5f 5LJ3h 3V8LA 5GAN6 4N0AA 3JCMP 5GANj 4XQ3A 2I2LA 2RM4A 4M75C 1U1TA 2YHTA 3SB2A 4NOYA 4C8QF 3FB9A 1BIAA 3RKYA 3JCMJ 4F7UA 5LJ5j 5GANf 4M7DA 5GMKm 1LNXA 4Y91A 5GANe 4M7AD 1BIBA 3V8KA 4JRIA 4N0AC 4M78A 1LOJA 1WNLA 4M75A 4XTXA 5GAN4 4QVDA 3QSUA 1TH7A 4EMKC 4NL2A 3EFSA 2EAYA 4M7AC 1I81A 2RD1A 3RKXA 2EJGA 3HFOA 4J5YA 2K57A 2DJZA 4C8QA 5GAOp 4V2SA 3RKWA 4J6XA 1X01A 4M78C 1LJOA 4A53A 4C92D 3BY7A 1M5Q1 4PJOG 4RCBA 4M75D 3V7CA 1D3BA 4M78D 4XU3A 5GANh 4EMKA 1HK9A 3JB9F 4DQ2A 4M7AA 4M75F 4F7UG 3JB9H 4JRKA 4JUVA 4C8QC 3JCMQ 5GAOr 1I5LA 4M7DD 4C92C 3JB9I 5LJ5e 2DXUA 3BFMA 5LJ5d 4HT9A 4QVCA 3JCMf 1HXDA 5I21A 3V7RA 3JCMb 4M7DB 4PJOC 3V8JA 1WQ7A 4M77G 3JB9D 3VU3C 3JCMh 4M77E 2ZGWA 4JLIA 4EMGA 4M7AG 2DTIA 3RESA 2DTOA 4A54A 2DZ9A 4C92A 3PGGA 3QO3A 2YLCA 1KQ1A 4C8QB 4PJOA 3RERA 1M8VA 2E1HA 4C8QD 4M7AE 2HNIA 5GAN5 3QUIA 3RUXA 1D3BB 1H641 5GMKe 3BW1A 1Y96A 4EMHA 5LJ5h 4XU1A 5LJ3f 2EJFA 4C92G 5GMKi 5GAMj 3JCMe 4M75G 1I8FA 4M7AF 2YLBA 4M78G 4M7AB 4MMLA 3JCMX 5GAMg 3JCMV 4XTWA 5GANd 4XTUA 4M77B 4HA8A 4C92F 5GMKl 5GAOn 1N9RA 3JB9J 2VC8A 4M7DG 1MGQA 2RA2A 3V7SA 4XTVA 4XTYA 4XU0A 4C8QE 2CGHA 4MMKA 4RCCA 1JBMA 5GAMe 5GMKh 4M77D 3JB9G 3QHSA 5GANg 4EMKB 2FYKA 2JN0A 5GAN2 2E64A 5DY9A 2DTHA 2DKGA 4M77C
chains in the Genus database with same CATH superfamily
2K3BA 1ACMB 2JTEA 1KQ2A 2QA4T 4PJOE 4OP0A 2HKQB 5CR2A 3JCMd 1Q82C 1EZZB 3DB4A 4M75B 3QIIA 2HQEA 1FYNA 2RMOA 1WPYA 1YP5A 2O4XB 2DERA 4GLKA 4BD3A 3CC4Q 2FB7A 1UGVA 4ZN3A 4CC2A 3R6OA 4LD6A 2E65A 2E6ZA 3J7AF 2O9VA 4DEYA 1QVFA 2E10A 1X6GA 2LJ3A 2EKHA 1KIKA 4ORZA 2X35A 3FB9A 1YJ9A 1AWJA 1SHFA 1YIJT 2ZCFB 1ZSZA 3OYLA 1K8AR 1ZSZB 1RUWA 3O8VA 4QVDA 2RI3A 3CC2A 1VIEA 1YCSB 2QEXT 3QKJA 3HFOA 1Y57A 3M0QA 5I22A 1RAAB 1ZA1B 5C0MA 4LN2A 4M78D 4AFSC 1QW1A 4J83A 2RN8A 1G3YA 1M2VA 4IUTA 1UDLA 4OB0B 2L2PA 1KQSS 2DTOA 1WX6A 2L3PA 4ZN1A 1YBYA 1WYXA 2EGCA 2VWFA 3UT1A 5CKDA 1KC8U 1V1CA 1RAEB 4XU1A 4C92G 1ZHIA 4PL6A 3EG0A 2LX9A 3MP8A 2G3RA 4E7LA 1VUBA 1ZQ1A 3EHRA 4ELYC 2RF0A 1QVFS 5GMKh 2CSQA 4EMKB 2BZXA 2YRDA 1VYVA 2XMFA 1XNIA 1H92A 5J3BA 3MPUB 3CMAA 2L3RA 3JCMW 4WF2A 1VQ8Q 3S6WA 2RK2A 3D7SB 3UF4A 1M1KU 3CPWA 4AT1B 4JJBA 1FWZA 4QQDA 1Y0MA 1UGSB 2VB6A 2KSSA 4M4ZA 3X25B 2DL4A 2LQ8A 3OYMA 5LJ3d 2LX7A 4M78B 5I2SA 1X75C 2KQWA 3M55A 1VA7A 2R5MA 4JRPA 2YUOA 1VIFA 5IXFA 1SF9A 2DIGA 5ECAA 5IXBA 4J7FA 4Y28E 1BK2A 4FM4B 1NLPC 2JNGA 5GJVB 4C8QA 3UATA 1VQ4T 1I0CA 2ROLA 4OMLA 3C95A 4JUVA 4LUEA 3X28B 4C8QC 4QVCA 2OJ2A 2LQNA 3V8JA 2CUBA 2A7YA 2RQUA 2K79A 1M1GA 1W6XA 2HD0A 3VRZA 4JLGA 3L2UA 4RTZA 2YLCA 1KQ1A 3CCUT 1QQJA 3I35A 1BBZA 2C06A 5IHIA 4O5VA 2MIOA 2PUOB 1FMWA 1NPRA 4OMPA 2PQWA 1VQ9T 3M57A 3X26B 4M7DG 3J81E 2D9TA 3QWXX 3CMET 4B9WA 3V7SA 4XU0A 3JB9G 1MUZA 4ANJA 4PJOF 1KJWA 1D0ZA 2COYA 1VOMA 2ATCB 4RTYA 2PVGB 3L2RA 2YUQA 1KQSA 4M77A 1UHFA 1NEBA 2HQHA 1WDXA 5LJ3g 3SHWA 2P84A 4R56A 3LWHA 3CD6A 3T9NA 3CCJA 5CAIA 2CYZB 4BE1A 3KFVA 3CMEA 2L5QA 1GL5A 4CC3A 1MMGA 3QPHA 2CUDA 5KYYA 5CCAA 1TU0B 3M4GA 3GNGA 1S72Q 5L8RE 5LJ5g 2KYMA 3E2UA 1TUDA 1AEYA 2WSFE 4QQGA 3GOXA 2VVKA 3H41A 4M7DA 2PVOB 1BIBA 1W2BP 4N0AC 1BI3A 3MP1A 1EX4A 2QASA 3PVLA 3QSUA 1K76A 3A5ZB 2V1RA 2LT4A 3P8BB 5HK3A 1I81A 1OI1A 3VUZA 3TSWA 2JW4A 4PFPA 3BY7A 1RAHB 2DLPA 2XKOC 3OS5A 4LDVA 3PFSA 2OAWA 3JCMQ 2CZ1B 1GFCA 4M7DD 1ZUYA 4ME7A 4ZGDB 4F14A 3LX7A 1M2OA 3CC4T 3VJPA 1SRLA 1RI9A 3EFOB 3RERA 1T3LA 4LE9A 1D3BB 3C0CA 2EJFA 3OYDA 1QVGP 3MEAA 4M78G 2D0QB 2CH4W 3RMQA 4OMFB 3CC4A 1KC8R 4QT7A 3CCRQ 3EH1A 4GBQA 2YWWA 1PG5B 4V2SA 5CK9A 1KD1C 3UA6A 2RPNA 4FYVB 1YJWA 3RIRA 4PFZA 2F5KA 4F16A 3GP8A 1WQWA 2RB6A 1YHQQ 2L8DA 1PD1A 4M78E 4IIOA 2LQWA 5DLOA 3SWNC 5CIUA 2DX1A 2D8HA 2QTXA 1TUGB 2EYZA 2PU9B 2GGRA 1JU5C 3TQ7P 3L2ZA 3INZA 5A0LA 2CSIA 5FU6C 3I56T 2QG9B 3JCMg 2R57A 3AHUA 1YJNQ 1IB8A 2XHCA 1MHNA 4EPCA 5GANj 1H3HA 3CBMA 2OTLA 1GCQC 5KYUB 1S72A 1R0CB 1TXQA 1PWTA 4LDWA 4J8OA 4OMQA 5GAN4 2DYIA 1GBRA 2JS2A 1N5ZA 1NPPA 3G1JA 1E7OA 2K2VA 1VQ6A 2HBPA 1B3QA 2JUFA 2RHUA 3QWYA 2DXUA 5LJ5d 1CKBA 1U06A 1OEBA 1YIJA 3OYFA 3EGXB 4DBQA 2ZGWA 3SEMA 2DTIA 1YJ9T 3OYEA 2OI3A 2RH2A 3PNWC 2LT1A 2X4WA 3RUXA 3E9GA 2JJ9A 5FU7C 4M77B 2EBPA 4C92F 1PSEA 1TWBA 4ZTJA 2LNHB 1PSFA 4KUIA 1M90R 4RCCA 3C4SA 2M02A 4HKEA 2PUKB 1CKAA 3H0HA 1WI7A 3A8MB 1G3SA 2RHZA 1Q7YU 1YITT 4HCCA 1JQQA 4J9DA 2RNAA 3FDRA 4M7DE 2B86A 1AD5A 3EG2A 4PNOA 1K73U 3CC2Q 3SD4A 2DF6A 3QJ6A 2LRQA 1TSFA 5GAOl 1NJIR 1VQ5A 2DEQA 1E6GA 4JZ3A 2EIFA 1NZ9A 1YJNT 3REAB 2BKDN 1XQHA 2YUNA 3Q1JA 3FJ5A 4MZMA 5CO7A 1UE9A 1QKXA 4E7JA 3VUBA 2A28A 3M58A 1Q86R 3QZ5B 2FRYA 4N4IA 4N0AA 2HSPA 3SB2A 1BIAA 2ZPEB 3UDCA 4BI4A 4E6RA 4JDSA 2NYSA 3HRUA 3CC7T 2J7IA 3LGFA 4M78A 3UA7A 1KD1R 2XDPA 2JTFA 2J6OA 2RQTA 4EMKC 3QYHB 2I0NA 2KE9A 1VYUA 2LQKA 3RKWA 4A4KA 1KFZA 2BE9B 2LMJA 4RCBA 2HZYA 4XU3A 5GANh 4EMKA 1MMNA 2KK4A 4J9HA 2JVVA 1I5LA 3DKMA 2KBTA 2HL3A 1R0BG 3I55T 3RBBB 4HVVA 2E5QA 4O6JA 2XDDA 3I5SA 3OYKA 3ER0A 1X6BA 1WZOA 1RADB 1NE8A 1KHIA 4AMCA 2HQXA 4EMHA 1K4US 1M1KC 3PE0A 2DMOA 3R6NA 4PJJA 3QDRB 2KRSA 3G4SA 5GAMj 4JS5A 2HBWA 1QP3A 1Q81C 1UJYA 2CZ7B 4HVUA 3SDZA 1BB9A 3CCEQ 3OW2A 5GANg 5HCKA 2O01E 2JN0A 1K8AC 5DY9A 2DKGA 2GCXA 3GNFB 4YTLA 1WHHA 1NM7A 2F2XA 5I2MA 2RI2A 1KQSP 4P5NA 2QYZA 4J9IA 1AT1B 3G7ZA 2LCLA 2WSCE 4C0FA 1N9SA 1UFFA 3JCMc 2K4YA 1HD3A 3EG1A 4D6WA 3CCSA 4A4EA 1XOVA 1D1CA 4M78F 2VUBA 2CP2A 1QCOA 2BZYA 5LJ3h 3MEVA 1IHVA 1YITQ 4M75C 1O75A 4NOYA 5LL6S 3A8LB 5IN1A 1E6HA 4B6MA 3V8KA 4MDWA 2MF2A 2F5TX 1B7TA 8AT1B 2MPXC 3OYCA 4AFUC 5AT1B 1JJ2S 1GCQA 4OGEA 2A36A 1AWOA 4F17A 5GAOp 2XD0A 2FG0A 1K8AU 1NG2A 2NUTA 5D6YA 4DOWA 4A4HA 5FU7B 2KY9A 3PMIA 1NJIC 2KXDA 1WHJA 5CKFA 1PRMC 2JTMA 4M77E 2XG8D 5KYXA 4VUBA 3OYBA 4BE2A 4C0GA 1N6AA 3L2QA 2VYTA 1Q86C 3CCJQ 3GPLA 2K5IA 3BW1A 1JXMA 1QCNA 1F1BB 3P8HA 1VQ5T 4JPBW 3FC3A 2J6FA 1QMCA 4Z8AA 2ED0A 2BZ8A 1YI2Q 1FMKA 3JCMV 4EIKA 3CCRT 3JB9J 2ECZA 2L3SA 1WXUA 1ZUUA 3A98A 3I56A 4KGVB 4HCBA 2WSEE 2FHDA 1JBMA 5KYUA 2X51A 3QZ9B 4CI0C 3QHSA 2RJDA 1GCPA 1YWPA 2LCCA 2DXTA 3FIFA 1KG1A 3VV0A 2HCKA 5KCOA 1K9MR 1X2QA 1D0YA 3QYGB 5FU6B 2SRCA 3BDUA 1PC0A 2E70A 3MO8A 1Y07A 4Y92A 1K73R 4ZNXA 1O9SA 1M1KR 1UG1A 2ZPGB 4LXCA 1QWEA 3WXMB 4MDXA 3FEOA 2JT4A 2E41A 1C6VX 2X4YA 3DB3A 5GAN6 4DBHA 1V29B 1KC8C 4FL6A 2DL5A 4OMOA 1T0JA 3EGDB 4F7UA 4J9CA 2JZ2A 3UPUA 4M7AD 2H8HA 2P0KA 1LOJA 1Q95G 1WNLA 2QXFA 3M53A 2ROTA 3CCSQ 1OYXA 3MEUA 2LVMA 2PVDB 1M5Q1 4PJOG 3MJXA 3L42A 5KCHA 1KD1U 1D1BA 1XTDA 3LW5E 3JB9F 1M4ZA 2EQIA 2QQ9A 1ABQA 4C92C 3V7RA 3EH2A 4CC7A 3JB9D 2OX7A 2YUPA 4JZ4A 3A8GB 1PM3A 2DZ9A 3M0TA 5I21A 9ATCB 5IAYA 4BY6C 4PJLA 5KE2A 1H641 3QXEB 2ENMA 2CREA 5LJ3f 4PJNA 1YN8A 3EAEA 5GAMg 2QA4Q 2X9HA 1N9RA 4KH0B 1H3ZA 3OW2P 4J9BA 1YNZA 1SEMA 4M77D 5GAN2 1VQPT 2K9GA 3LYIA 2OTLQ 3G71A 2DE0X 2CDTA 4M75E 3LH5A 2M0YA 1QVPA 3CCJT 2CZ6B 3OYNA 2BTTA 2DXCA 2R5AA 2IIMA 2V8JA 3VYHB 1YI2A 1VQ6Q 3CEYA 1I5OB 1OZ2A 3FLGA 4WTOB 2JM8A 3VS4A 4C5EA 2EW3A 2NLUA 2V8KA 4IKFA 1NYFA 4F04B 4E7SA 5GJWB 1J3TA 4XQ3A 2I2LA 2Y4XA 4FIBA 3M5AA 1WJRA 4RTVA 5M9OA 2RHXA 3TU4K 2AKKA 3CCUA 4XTXA 3CCVA 4FU6A 5KE3A 2ABLA 2RD1A 2NUPA 1WXTA 3RKXA 2D1XA 2DJZA 2E4HA 2XDBA 1RAIB 1VQMA 1LCKA 2XI9A 5HK0A 3V7CA 3E19A 2LZ6B 3PIPA 1K9MC 4KGZB 2FPEA 3OYJA 5D6WA 4DQ2A 8ATCB 1WIEA 2FRWA 1DJ7B 4OMMA 5FWBA 3JCMb 3JRZA 1VQOA 4M77G 3VU3C 1RABB 1Q7YC 3M54A 3M4YA 3BDLA 3CPWP 3RESA 1NYGA 4OVAA 3S3NA 3M59A 2F1LA 2E1HA 5KH6A 5GAN5 2GF7A 2LJ1A 4BDZA 3M0SA 1KHCA 4M75G 3JCMX 2BUDA 4FCYA 1X69A 2GFAA 3QJYA 2VC8A 2RA2A 7AT1B 1ZBXA 2ESWA 4N4GA 5CKEA 4KBMB 2DTHA 2IPOB 4M77C 3HKSA 4C5GA 3ME9A 5LJ3j 3G4ST 4IUPA 2HKNA 3CXCA 3HL8A 2EPDA 1YITA 2EQUA 2E12A 2X4JA 2C0OA 3EFOA 1RL2A 3OYGA 5FRMA 1G5VA 5A2QE 3FJPA 1BYMA 1ABOA 3MHXA 1U1SA 3I55A 4BY6B 3ZL7C 3CQTA 2MCNA 5KYYB 1W1FA 2HSEB 2QQBA 3CCLT 1P92A 1VQPQ 5CVIA 1WLPB 3CCQT 2QQAA 2CP6A 4DBRA 2RM4A 2PTKA 4C8QF 2FO0A 5GANf 3HTRA 1SHGA 3MEWA 1X43A 3HRTA 5FROA 4M7AC 4J5YA 3RNJA 2VASA 2ZPFB 1N8RC 1YI2T 2RQVA 1A0NB 1FMVA 4CC4B 4L6V5 4E2FB 3CCUQ 3CBOA 2HL5C 3OMGA 1C1AA 4X34A 5J26A 2J05A 1WQ7A 2A37A 4OF1A 2NUTB 2QEXA 1ZLMA 2KAFA 2V26A 4LD9K 3OA6A 5HY6A 1VQKT 3OSSC 1AZEA 2V8IA 1M3CA 2K3XA 3OY9A 3KBGA 2D8JA 2LTOA 2ZPHB 2C0IA 3S3MA 5I11A 1MGQA 2KDSA 3CMAT 2Y4YA 3I5RA 5GAMe 2EYXA 2FYKA 2CT4A 2HEQA 4Z89A 3CXCS 4D8DA 1V76A 5DLQE 1U3OA 4KRTA 4C92E 1I4K1 2EKOA 1W2BA 2KRNA 1SPKA 2HDAA 2DILA 4RG8A 1M90U 4XU2A 3PMTA 1N27A 4OMNA 3MKDA 3GF5A 1Q7YR 1D0XA 3EGDA 1CSKA 1OPKA 2DRKA 1KSWA 1WJSA 2M51A 2YXYA 4X9DA 2OTJA 2HAXA 2WACA 1PRLC 3EFRA 1NJIU 1VQ6T 1RI0A 2V1QA 2MI6A 2QDLA 2E3IA 3SFMA 4ZTFA 3I55Q 1VQLT 1YHQT 2KEAA 1YJNA 5LJ5j 3KUFA 1Q81R 4AG1C 2AIRB 1U5SA 3HRSA 4OB1B 4Y91A 2L3QA 1LVKA 3H6ZA 3G71T 1H8KA 3ZFJA 1S1NA 3OYYA 4AFZC 2P4TA 1Q82R 4C0DB 2XK0A 4JJDA 4A53A 4C92D 4M75D 4ZGEB 3OYHA 2KRMA 1M3AA 3JB9H 3U23A 4JRKA 2DAQA 1VQ7Q 1VQNQ 2EQMA 3CCQQ 1VQMT 4AG2C 3JCMh 5IHNA 3CCLA 4M7AG 2RI5A 1IREB 4ATOA 1OULA 3CXCP 3QO3A 2OAUA 2MOXA 1WHLA 2CP5A 1MNDA 3EGUA 4E7IA 1M2VB 4ZGJB 1YJWT 2Z0WA 1PCXA 4PKCC 4M7AB 2DD5A 1TTHB 4XTUA 4HA8A 3TREA 2CP0A 4QKUA 2EGAA 2QQRA 5FRNA 1EIFA 1PKSA 3CD6T 1WHMA 2FVUA 4LUDA 2KNBB 4A4FA 2KR3A 2DVEA 5CKBA 1SSFA 3RR6A 3VKIA 5KYXB 4XTZA 4FYXB 4UC4A 1OQKA 4J6YA 1VQ5Q 1WHKA 2GQIA 1NEGA 1ZX6A 2VGNA 3HSBA 1S72T 3I9QA 2D6FA 4BUGA 3OW2S 2DL3A 2E5KA 5KYWA 5GAN7 3QBYA 2O4XA 2KROA 1W4SA 4GY5A 3GIBA 1OU9A 3L2WA 5D6XA 2RHIA 5LJ5f 3G6EQ 3CCMT 1VQOQ 3FRNA 4E47A 3JCMJ 3ZBDA 1LNXA 1MV0B 1IO6A 1TH7A 4NL2A 3RDVA 1NBEB 4BACA 1ZSZC 2E3HA 2F2VA 4PLIA 1BI1A 2RK1A 2OTJQ 1TUCA 3UWNA 4M7AA 4F7UG 5HKCA 4NS5A 2EFIA 3VRYA 2BE7D 4N4HA 3H0FA 2VGMA 3VS5A 4EMGA 1YHQA 1UHCA 4C92A 3PGGA 1RLQC 3WVEB 1MV3A 3NTIA 4C8QD 1SG5A 1K73C 3C12A 1RLPC 2OTJT 3JCMe 4MMLA 2AZSA 2EGEA 3OS1A 4FSSA 1OX9A 3P8DA 2ZPBB 1GRIA 4C8QE 2EYYA 1X27A 2JOYA 4IUUA 4QVZA 2FZGB 4D8KA 3OYAA 4HVWA 4WCIA 1SRMA 3CCLQ 2A3LA 2RQWA 4KH1B 1VQPA 1VQ9Q 1ZUKA 4Z02A 3ASKA 2JMAA 5IHKA 2FPFA 4K11A 4LNPA 3SWNA 1W70A 3HFNA 4B9XA 2CZ0B 5GAMh 2P4RA 4DBFA 2GTOA 2ZZDA 2DD4A 2EWNA 1JO8A 5IT9E 2J06A 1QP2A 2PZ1A 2VXFA 2DA9A 2KYBA 1IGUA 3E1SA 1YJ9Q 2KI7A 4II1A 2LCSA 1K9MU 3MP6A 2YDLA 3JSCA 4PJOD 1VQ4A 4FT4A 3NFCA 3NGPA 4R0KA 4MZPA 3TSZA 5GAOq 3CCRA 2EYWA 4JRQA 4HCKA 2C0TA 3RKYA 4XK8E 2MAMA 2QEXQ 4TVRA 3AT1B 1HJDA 6AT1B 1KK7A 5GANe 2FZKB 4JRIA 2A08A 1OOTA 4E7HA 3PTAA 2MMPA 1UGRB 2QK0A 1VQLQ 3NTHA 1Q81U 5FLXE 2GFUA 2QTVA 1LJOA 4QW2A 3NHNA 2ED1A 3OYIA 1M30A 5GAOr 4PJMA 5LJ5e 1Q82U 2KT8A 1IGQA 1VQOT 2KMTA 1HSQA 2MYSA 2K3YA 3URGA 3HPWA 2LP5A 1AZGB 3M0RA 4XAXB 2HNIA 5AYFA 1QCFA 2CKKA 3HP9A 1I8FA 2YLBA 3CCVT 1D1AA 2QI2A 2YT6A 1NLOC 4BI3A 1HYOA 3JV3A 2SEMA 4C0DC 5C6SA 1FX7A 1VQ8A 5DM7R 1ZBJA 2KT1A 3I56Q 2QQSA 2LNVA 2Y90A 3RMSA 3G6ET 1OX8A 1IZ6A 3CC7A 1VQKA 3CCMQ 3CBPA 3DLLA 3EGXA 5GAN8 3CD6Q 1QKWA 2GBQA 2B8AA 2COZA 1VQ7T 3PIOA 1VQNT 1G2BA 4F7UF 1K0XA 3ZEHA 5CQXA 4HT8A 1B34B 3E9FA 3LGLA 3A8HB 2EVRA 1AOJA 1EFNA 2EJ9A 2IVWA 4E7KA 3TCJA 1WA7A 4Z88A 1OV3A 4M7DC 4J6WA 1X2KA 4M77F 4C92B 1VQ7A 1VQNA 3VS2A 4JJNK 2W10A 1G8XA 2J6KA 2X4XA 1QWFA 3WVDB 1Z9QA 5CKHA 1VQ4Q 4RMOA 1PHTA 2FEIA 3CCET 1GBQA 4J9EA 5EC7A 1FXXA 3CPWS 2EJGA 2K57A 2K6DA 2YRVA 4J6XA 1K1ZA 4IURA 1D3BA 3S3OA 2M16A 1TOVA 2DJQA 3JB9I 2RO0A 4Q5WA 1UUEA 3OBYA 4RG2A 3JCMf 1ARKA 1YWOA 4DOVA 1R8OB 4KULA 1M3BA 2MWOA 3ULRB 1RAGB 4PLLA 2KGTA 4FT2A 3VS0A 4C8QB 1M27C 3THKA 4A63B 1I07A 2F69A 4RTTA 3CCST 2P0QA 3OMCA 3A1PA 1AHJB 4C0ZA 2QA4A 3PVQA 5GMKi 1K9AA 2M9UA 4X1VA 5KYWB 1PD0A 4M7AF 2GNCA 4XTWA 2QDYB 3VYGA 5GMKl 1Y71A 2DK3A 3GLXA 1JB0E 4RTUA 4XTYA 2CGHA 3J80E 4HXJA 4RTWA 5GANd 1N8RU 3EG9A 4C5IA 4RKUE 2DM1A 2NUZA 5LJ3e 2RJCA 2DETA 4C8QG 3CMEQ 3LH0A 5GAMf 1ZSGA 1UJ0A 4FYYB 1JJ2A 2GTJA 1YJWQ 2EQKA 1WJQA 2RJFA 2DZCA 4KUDK 3VS6A 1W2BS 3L2VA 1JRIA 2MWPA 2ZPIB 4M7AE 1B34A 4IUVA 2YRCA 2H3JA 1MNEA 1IHWA 1UECA 1UGQB 3EG3A 1LPLA 3CCQA 2DEUA 4AFQC 3JAME 4X9CA 3REBB 5D7UA 2CS7A 4KGXB 1OZ3A 4F7UE 3CC7Q 3JCMP 3CCMA 2YHTA 2H3EB 3OSVA 1M90C 1M1FA 5GMKm 2DVJA 2AZVA 3QDFA 2DRMA 4FSXA 3META 4DEXA 3CMAQ 1IRXA 2G6FX 2JXBA 1UGPB 1OPLA 1RAFB 4MZTA 2O9SA 3H9NA 3M9QA 1X01A 3KXTA 3CCVQ 2O2OA 2LJ0A 2F2WA 4QQ6A 1WXBA 4FW2A 4LDXA 4J9FA 4J9GA 2BIVA 3BFMA 4PJOC 3N5BB 1R77A 2L0AA 2EYQA 1I1JA 2K2MA 1SSHA 4KT0E 1AVZC 3BE3A 4JLIA 5L23A 5A0DA 4PJOA 2K5LA 1M8VA 1JEGA 3H0IA 1Y96A 4OB2B 5LJ5h 2DFUA 3NPFA 1K0SA 1QLYA 1TS9A 1D09B 5GAOn 3VS1A 4RUGA 3F70A 1AWWA 3M0PA 3G6EA 2CT3A 1AWXA 5FW9A 2DIQA 2E6NA 1YCYA 2GQVA 2M1HA 4NL3A 2FZCB 2CP3A 2AKLA 3OQ5A 1ZA2B 2MK5A 1XJWB 1C0MA 3L1AA 1BKBA 3OS2A 3M0UA 5GAOm 4BI8B 1Y96B 3NMZC 2JM9A 4M7DF 1Z9ZA 1BU1A 2L89A 1MMDA 2X3WD 4JS4A 4PJOB 4CRIA 2DL7A 1U8RA 2QAZA 3SWNB 2YSQA 1MMAA 3A8OB 2DPPB 2XU8A 1U1TA 2RQRA 5CQYA 2CP7A 2JS0A 4E7ZA 2K7AA 1UTIA 1BCMA 1GXIE 3PT9A 2DO3A 2AT1B 3EFSA 1JXOA 2EAYA 1YIJQ 1BI2A 3QG1A 3DLMA 2X3XD 4M78C 4R55A 1WFWA 2IG0A 2XIDA 3LLRA 3HHTB 1TG0A 1T3SA 2FPDA 1VQ9A 1OU8A 4M75F 3OBWA 2LDMA 4HT9A 4M7DB 1UEBA 1HXDA 1QVFP 2DBMA 4HCZA 2DXBA 4FW1A 4OGCA 3X24B 1JJ2P 3TEEA 2M0OA 4ESRA 2XICA 5GMKe 2D0NA 2QGFB 4FYWB 2PNIA 2W0ZA 1Y7XA 3EHQA 3G4SQ 3CCEA 1B07A 3OB9A 1GFDA 1UB4A 2DNUA 3IQLA 5KYNA 3EG9B 3C94A 2NWMA 5GMKj 3GBQA 2HMAA 5EG2A 2COWA 4LDUA 3TVTA 5GAMd 2DL8A 3NTKA 3X20B 2CH4A 4BDYA 1VQLA 1N8RR 4L5GA 5GAN3 1VQMQ 4F7UB 3VS3A 2VXEA 4BE0A 1Q86U 1X6OA 1WGSA 3CPFA 1WHGA 3CC2T 4PK4A 4JJCA 4LDYA 1IXDA 4C5HA 1G3WA 3MCAB 2JMCA 2KVQG 2O31A 1PNJA 2R58A 4BB7A 3V8LA 1M8MA 4IIMA 2FL7A 1VQ8T 2LC4A 3G71Q 1SKUB 2RHYA 1VYTA 4M75A 2DYBA 2EQJA 2K5FA 2NUPB 2DBKA 1G83A 2A0FB 1HK9A 1T0HA 5A0GA 5J39A 2QGGA 4PFOA 2VV5A 4DA4A 1VQKQ 3VS7A 1M9SA 4ELZC 1BCOA 4GLMA 1G3TA 2KXCA 2AK5A 4A4GA 3LWIA 4RTXA 4A54A 3OS0A 4J7IA 4IUQA 2O88A 3QUIA 2ZAEA 5IH2A 3M56A 3H8ZA 4EDUA 2VKNA 1RACB 2RJEA 3O5ZA 1QVGS 1QVGA 5FWCA 1PKTA 4XTVA 2P0PA 4MMKA 1YFNA 2AHJB 2OTLT 1BI0A 4L59A 4OB3B 2E64A
chains in the Genus database with same CATH topology
3A8MB 3HKSA 2LNVA 2Y90A 1G3SA 3RMSA 3G6ET 2RHZA 4C5GA 3ME9A 5LJ3j 3G4ST 2QA4T 4OP0A 1YITT 1IZ6A 1Q7YU 4HCCA 3CC7A 4IUPA 4PJOE 5CR2A 1VQKA 3CXCA 2PUKB 3CBPA 3HL8A 3JCMd 3DLLA 2EQUA 3FDRA 1YITA 3DB4A 5GAN8 1Q82C 4M7DE 4M75B 2E12A 2X4JA 3QIIA 2HQEA 4PNOA 1K73U 3SD4A 2B8AA 1RL2A 3PIOA 3OYGA 1VQ7T 1VQNT 3QJ6A 2LRQA 5FRMA 5A2QE 3FJPA 1G5VA 5GAOl 4F7UF 1BYMA 1VQ5A 3MHXA 2DEQA 3ZEHA 1WPYA 5CQXA 2EIFA 4HT8A 1B34B 2O4XB 3E9FA 1NZ9A 3LGLA 1U1SA 4GLKA 4BY6B 4BD3A 3I55A 1YJNT 3A8HB 2FB7A 2BKDN 2EJ9A 1XQHA 2IVWA 4ZN3A 4E7KA 3Q1JA 2QQBA 3R6OA 3TCJA 4MZMA 5CO7A 4R55A 4LD6A 3CCLT 1P92A 2E65A 2E6ZA 4E7JA 3VUBA 3J7AF 3M58A 5CVIA 4M7DC 4J6WA 4M77F 4C92B 3QZ5B 2QQAA 3CCQT 1QVFA 2E10A 1VQ7A 1VQNA 4N4IA 4N0AA 4JJNK 2RM4A 3SB2A 2X35A 4C8QF 3FB9A 1BIAA 2ZPEB 3UDCA 4BI4A 1YJ9A 5GANf 2X4XA 4OB3B 4JDSA 3WVDB 1YIJT 2ZCFB 3HRUA 3OYLA 3CC7T 5CKHA 4RMOA 3MEWA 3LGFA 4M78A 3CCET 3O8VA 4QVDA 2RI3A 2XDPA 2JTFA 4EMKC 3CC2A 1VIEA 3HRTA 3QYHB 5FROA 2QEXT 1FXXA 3QKJA 3CPWS 4M7AC 2EJGA 3HFOA 4J5YA 2K57A 2LQKA 2YRVA 3RKWA 4J6XA 4A4KA 2ZPFB 5C0MA 4RCBA 1N8RC 1YI2T 4IURA 1D3BA 4M78D 3S3OA 4XU3A 5GANh 4EMKA 1QW1A 4J83A 2KK4A 4L6V5 2M16A 1G3YA 2JVVA 3CBOA 1I5LA 3DKMA 3JB9I 2RO0A 4Q5WA 3OBYA 4RG2A 3JCMf 3I55T 3OMGA 4IUTA 4X34A 4OB0B 5J26A 1WQ7A 2E5QA 4DOVA 1R8OB 4KULA 4O6JA 2XDDA 1KQSS 3OYKA 4OF1A 2QEXA 2DTOA 2MWOA 3ER0A 4PLLA 1NE8A 4FT2A 1KHIA 4C8QB 4ZN1A 1YBYA 2KAFA 4LD9K 3OA6A 2HQXA 5HY6A 2F69A 3CCST 3UT1A 5CKDA 2P0QA 4EMHA 1KC8U 3OMCA 1M1KC 1VQKT 3OSSC 1AHJB 4XU1A 4C0ZA 3QDRB 3G4SA 2QA4A 4C92G 2V8IA 5GMKi 2M9UA 5GAMj 2K3XA 1ZHIA 3OY9A 4JS5A 4M7AF 3KBGA 1QP3A 4PL6A 1Q81C 2CZ7B 2QDYB 4XTWA 2LTOA 3VYGA 5GMKl 2LX9A 3MP8A 2G3RA 2ZPHB 3SDZA 3S3MA 4E7LA 1MGQA 1VUBA 1ZQ1A 2KDSA 1Y71A 4ELYC 3CMAT 2Y4YA 2DK3A 3GLXA 1JB0E 4XTYA 2CGHA 5GMKh 1QVFS 5GAMe 3J80E 3OW2A 5GANg 4EMKB 2FYKA 2JN0A 2O01E 1K8AC 5DY9A 5GANd 2DKGA 1N8RU 3CXCS 2GCXA 3GNFB 4YTLA 4C5IA 4RKUE 5DLQE 4C92E 5I2MA 1I4K1 2EKOA 2RI2A 1XNIA 2RJCA 5LJ3e 4C8QG 1W2BA 4P5NA 3LH0A 5GAMf 5J3BA 3CMAA 4RG8A 2L3RA 1JJ2A 1M90U 4XU2A 3G7ZA 3JCMW 3PMTA 2LCLA 4WF2A 2WSCE 2EQKA 1WJQA 4C0FA 2RJFA 2DZCA 3S6WA 1N27A 1N9SA 2RK2A 4KUDK 1M1KU 3CPWA 1FWZA 3GF5A 4QQDA 1W2BS 3JCMc 3L2VA 1JRIA 2K4YA 2MWPA 2ZPIB 4M7AE 1B34A 4IUVA 1WJSA 4D6WA 3CCSA 4A4EA 1UGSB 2H3JA 2KSSA 1UGQB 3X25B 4X9DA 2OTJA 2HAXA 2WACA 3CCQA 2LQ8A 3OYMA 3EFRA 5LJ3d 1NJIU 3JAME 1XOVA 1VQ6T 1RI0A 4X9CA 2MI6A 4M78F 4M78B 2VUBA 3SFMA 2CS7A 1OZ3A 4ZTFA 4F7UE 5I2SA 1X75C 5LJ3h 2KQWA 3JCMP 3M55A 3MEVA 3CCMA 1VQLT 2R5MA 4M75C 4JRPA 2YHTA 1O75A 4NOYA 5LL6S 1YHQT 1VIFA 3OSVA 1YJNA 5LJ5j 1M90C 3KUFA 3A8LB 1M1FA 5GMKm 5IN1A 2DIGA 3HRSA 4OB1B 4FSXA 3META 4J7FA 4Y91A 4Y28E 3V8KA 2MF2A 4FM4B 2F5TX 3H6ZA 4MDWA 2JNGA 3G71T 3OYCA 3ZFJA 3OYYA 1JJ2S 2P4TA 1UGPB 4OGEA 4MZTA 4C8QA 5GAOp 2XD0A 3M9QA 4C0DB 2XK0A 1X01A 4A53A 3KXTA 4C92D 1VQ4T 1K8AU 4M75D 5D6YA 4QQ6A 4DOWA 4ZGEB 4A4HA 3OYHA 3C95A 5FU7B 2KY9A 3PMIA 1NJIC 3JB9H 4LDXA 4JRKA 4JUVA 3X28B 4C8QC 2DAQA 2BIVA 3BFMA 4QVCA 4PJOC 3N5BB 5I21A 2EYQA 4KT0E 2EQMA 5CKFA 3V8JA 1VQMT 2JTMA 3JCMh 2A7YA 4M77E 2XG8D 3CCLA 4JLIA 4M7AG 2RI5A 1M1GA 4VUBA 3OYBA 2HD0A 1IREB 4ATOA 4BE2A 4C0GA 4JLGA 1N6AA 5A0DA 3L2UA 3QO3A 3L2QA 2YLCA 1KQ1A 4PJOA 2K5LA 2OAUA 2VYTA 1M8VA 3CCUT 1Q86C 3GPLA 2K5IA 3BW1A 1Y96A 4OB2B 5LJ5h 2C06A 3P8HA 4E7IA 1VQ5T 4ZGJB 1YJWT 4M7DF 3FC3A 4O5VA 4PKCC 2PUOB 4M7AB 2DD5A 1NPRA 3JCMV 2PQWA 1VQ9T 4XTUA 4HA8A 3M57A 3X26B 5GAOn 3CCRT 3JB9J 4M7DG 3J81E 3TREA 2D9TA 3I56A 3CMET 4B9WA 3V7SA 2WSEE 4HCBA 4XU0A 2FHDA 2QQRA 3F70A 5FRNA 1JBMA 1EIFA 3QZ9B 4CI0C 3JB9G 3QHSA 3G6EA 3CD6T 2FVUA 2RJDA 4PJOF 2DIQA 2E6NA 1YCYA 2GQVA 2M1HA 4A4FA 4NL3A 2LCCA 2DVEA 2DXTA 5CKBA 1SSFA 2PVGB 3FIFA 3L2RA 3VKIA 3OQ5A 1KQSA 4XTZA 1KG1A 4M77A 4UC4A 3VV0A 3L1AA 5LJ3g 4J6YA 5KCOA 1BKBA 3OS2A 5GAOm 4BI8B 4R56A 3LWHA 3CD6A 3T9NA 3CCJA 1Y96B 2VGNA 2CYZB 3QYGB 5FU6B 5CAIA 4BE1A 1S72T 3CMEA 2D6FA 3HSBA 2L89A 4BUGA 2L5QA 3BDUA 3OW2S 5GAN7 3QPHA 2E70A 3QBYA 4JS4A 3MO8A 4CRIA 1Y07A 4PJOB 5CCAA 1U8RA 1O9SA 3M4GA 3GNGA 2O4XA 2ZPGB 3SWNB 3A8OB 5L8RE 1W4SA 3WXMB 5LJ5g 4MDXA 4GY5A 3FEOA 3GIBA 2E41A 3L2WA 2X4YA 3DB3A 5D6XA 2DPPB 2RHIA 5GAN6 2WSFE 5LJ5f 3CCMT 2XU8A 1V29B 1KC8C 4FL6A 1U1TA 4QQGA 3FRNA 4E47A 3GOXA 5CQYA 4F7UA 3JCMJ 4M7DA 3ZBDA 2JZ2A 1LNXA 3UPUA 4M7AD 2PVOB 1BIBA 2P0KA 4N0AC 1GXIE 1BI3A 1LOJA 1WNLA 3MP1A 2QXFA 3PT9A 3M53A 3QSUA 1TH7A 3A5ZB 2DO3A 4NL2A 3EFSA 2LT4A 3P8BB 1OYXA 2EAYA 4BACA 5HK3A 1I81A 1OI1A 3VUZA 1BI2A 3MEUA 3DLMA 3QG1A 4PLIA 4M78C 1BI1A 2LVMA 2RK1A 2PVDB 1M5Q1 2IG0A 2XIDA 3BY7A 3L42A 3HHTB 2XKOC 3LLRA 4PJOG 5KCHA 1KD1U 3OS5A 1XTDA 4LDVA 3LW5E 3JB9F 1M4ZA 3PFSA 3UWNA 1VQ9A 4M7AA 4M75F 4F7UG 2QQ9A 5HKCA 3JCMQ 2CZ1B 4NS5A 4M7DD 3OBWA 2LDMA 4C92C 2EFIA 4HT9A 1UEBA 4M7DB 1HXDA 4N4HA 3V7RA 4ME7A 4ZGDB 4HCZA 3LX7A 2DXBA 3JB9D 4OGCA 3X24B 3CC4T 2VGMA 4EMGA 3VJPA 1YHQA 3A8GB 2DZ9A 4C92A 3PGGA 5IAYA 3TEEA 2M0OA 3WVEB 3RERA 2XICA 3NTIA 4BY6C 4C8QD 5KE2A 1K73C 1D3BB 1H641 5GMKe 3QXEB 3C12A 5LJ3f 2EJFA 3OYDA 3MEAA 2OTJT 3JCMe 1Y7XA 3EAEA 4M78G 4MMLA 5GAMg 2D0QB 3CCEA 1N9RA 3OS1A 3RMQA 1H3ZA 3OB9A 4OMFB 3CC4A 3P8DA 2ZPBB 4C8QE 1UB4A 4M77D 5GAN2 4IUUA 2JOYA 1VQPT 4QVZA 3OYAA 4V2SA 3C94A 5CK9A 3LYIA 5GMKj 2A3LA 1VQPA 1KD1C 3G71A 4Z02A 3ASKA 4M75E 1YJWA 5EG2A 3RIRA 1QVPA 3CCJT 2F5KA 2CZ6B 4LDUA 3OYNA 3SWNA 3HFNA 5GAMd 3GP8A 3NTKA 3X20B 4B9XA 1WQWA 2CZ0B 2DXCA 2RB6A 5GAMh 4BDYA 2R5AA 2ZZDA 4L5GA 1VQLA 2L8DA 1KQ2A 2DD4A 4M78E 2EWNA 5GAN3 2V8JA 3VYHB 1YI2A 4F7UB 5DLOA 5IT9E 2VXEA 3SWNC 3CEYA 1OZ2A 1QP2A 5CIUA 4BE0A 2QTXA 1Q86U 3FLGA 1X6OA 2VXFA 1WGSA 3CPFA 2PU9B 3CC2T 3E1SA 3L2ZA 4C5EA 4II1A 1K9MU 3INZA 4LDYA 3MP6A 5A0LA 3JSCA 2NLUA 2V8KA 5FU6C 1VQ4A 4PJOD 4C5HA 4FT4A 3NFCA 3I56T 1G3WA 3MCAB 3JCMg 2R57A 4MZPA 3AHUA 2KVQG 5GAOq 3CCRA 4IKFA 4JRQA 2XHCA 1MHNA 2R58A 4BB7A 3V8LA 4EPCA 5GANj 4XQ3A 2I2LA 2Y4XA 2FL7A 3CBMA 3M5AA 4FIBA 4XK8E 2MAMA 1WJRA 3RKYA 1VQ8T 2LC4A 2OTLA 4TVRA 5M9OA 2RHXA 1S72A 5GANe 2RHYA 4JRIA 4LDWA 4J8OA 3TU4K 4M75A 3CCUA 4XTXA 5GAN4 4E7HA 3PTAA 2EQJA 2K5FA 2MMPA 1UGRB 3CCVA 4FU6A 5KE3A 2RD1A 3RKXA 3NTHA 1Q81U 5FLXE 2DJZA 1NPPA 2XDBA 1VQMA 2GFUA 2K2VA 1VQ6A 1LJOA 2XI9A 5HK0A 3V7CA 2HBPA 3E19A 4QW2A 3OYIA 3PIPA 1K9MC 1HK9A 3OYJA 5A0GA 2JUFA 5D6WA 4DQ2A 2RHUA 5J39A 5GAOr 5LJ5e 2DXUA 5LJ5d 1Q82U 2VV5A 1DJ7B 4DA4A 3JCMb 1M9SA 3JRZA 1VQOT 1VQOA 2KMTA 4M77G 3VU3C 1YIJA 4ELZC 3OYFA 1Q7YC 3M54A 1G3TA 3M4YA 2ZGWA 3BDLA 3LWIA 2DTIA 2K3YA 3RESA 4A4GA 4OVAA 4A54A 3URGA 3S3NA 3HPWA 3OS0A 1YJ9T 4J7IA 3OYEA 3M59A 4IUQA 2E1HA 4XAXB 2RH2A 2HNIA 5KH6A 3PNWC 2LT1A 3QUIA 2X4WA 3RUXA 5GAN5 2GF7A 5AYFA 3E9GA 3M56A 3H8ZA 4EDUA 4BDZA 2CKKA 3HP9A 1KHCA 4M75G 1I8FA 2RJEA 2YLBA 2BUDA 3JCMX 3CCVT 5FU7C 2QI2A 2GFAA 4M77B 4C92F 4BI3A 1QVGS 1PSEA 3QJYA 1QVGA 2VC8A 4ZTJA 2RA2A 4C0DC 1FX7A 5C6SA 4XTVA 2P0PA 1PSFA 1ZBXA 4KUIA 4MMKA 4N4GA 4RCCA 3C4SA 2AHJB 4HKEA 1VQ8A 2OTLT 1BI0A 5CKEA 4L59A 5DM7R 4KBMB 2E64A 2QQSA 2DTHA 4M77C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMK j;  1YCY A;  2Y90 A;  4PJO F;  4C92 E;  5LJ3 e;  1I4K 1;  4NL3 A;  1KQ2 A;  4M75 E;  5LJ3 j;  4PJO E;  4C8Q G;  4OP0 A;  2DVE A;  2DXT A;  5GAM f;  3RIR A;  3JCM d;  3FIF A;  4XU2 A;  3SWN A;  4XTZ A;  3HFN A;  4M77 A;  4M75 B;  5GAM d;  5GAN 8;  3JCM W;  4WF2 A;  4M7D E;  3L1A A;  5LJ3 g;  1WQW A;  4J6Y A;  2RB6 A;  4PNO A;  5GAM h;  2DZC A;  1N9S A;  4M78 E;  5GAO m;  2EWN A;  5GAN 3;  3FJP A;  5GAO l;  4F7U B;  3JCM c;  4F7U F;  1JRI A;  1Y96 B;  2DEQ A;  2VXE A;  1WPY A;  3SWN C;  5CAI A;  3HSB A;  1B34 A;  4HT8 A;  4M7D F;  1B34 B;  2QTX A;  3BDU A;  1U1S A;  2VXF A;  5GAN 7;  4PJO B;  2FB7 A;  2EJ9 A;  3L2Z A;  3M4G A;  4X9D A;  3INZ A;  3EFR A;  5LJ3 d;  3SWN B;  2E65 A;  4PJO D;  5LJ5 g;  4X9C A;  4M78 F;  4M78 B;  3JCM g;  4M7D C;  4J6W A;  3AHU A;  4M77 F;  4C92 B;  3GIB A;  2E41 A;  5GAO q;  2E10 A;  4F7U E;  5LJ5 f;  5LJ3 h;  3V8L A;  5GAN 6;  4N0A A;  3JCM P;  5GAN j;  4XQ3 A;  2I2L A;  2RM4 A;  4M75 C;  1U1T A;  2YHT A;  3SB2 A;  4NOY A;  4C8Q F;  3FB9 A;  1BIA A;  3RKY A;  3JCM J;  4F7U A;  5LJ5 j;  5GAN f;  4M7D A;  5GMK m;  1LNX A;  4Y91 A;  5GAN e;  4M7A D;  1BIB A;  3V8K A;  4JRI A;  4N0A C;  4M78 A;  1LOJ A;  1WNL A;  4M75 A;  4XTX A;  5GAN 4;  4QVD A;  3QSU A;  1TH7 A;  4EMK C;  4NL2 A;  3EFS A;  2EAY A;  4M7A C;  1I81 A;  2RD1 A;  3RKX A;  2EJG A;  3HFO A;  4J5Y A;  2K57 A;  2DJZ A;  4C8Q A;  5GAO p;  4V2S A;  3RKW A;  4J6X A;  1X01 A;  4M78 C;  1LJO A;  4A53 A;  4C92 D;  3BY7 A;  1M5Q 1;  4PJO G;  4RCB A;  4M75 D;  3V7C A;  1D3B A;  4M78 D;  4XU3 A;  5GAN h;  4EMK A;  1HK9 A;  3JB9 F;  4DQ2 A;  4M7A A;  4M75 F;  4F7U G;  3JB9 H;  4JRK A;  4JUV A;  4C8Q C;  3JCM Q;  5GAO r;  1I5L A;  4M7D D;  4C92 C;  3JB9 I;  5LJ5 e;  2DXU A;  3BFM A;  5LJ5 d;  4HT9 A;  4QVC A;  3JCM f;  1HXD A;  5I21 A;  3V7R A;  3JCM b;  4M7D B;  4PJO C;  3V8J A;  1WQ7 A;  4M77 G;  3JB9 D;  3VU3 C;  3JCM h;  4M77 E;  2ZGW A;  4JLI A;  4EMG A;  4M7A G;  2DTI A;  3RES A;  2DTO A;  4A54 A;  2DZ9 A;  4C92 A;  3PGG A;  3QO3 A;  2YLC A;  1KQ1 A;  4C8Q B;  4PJO A;  3RER A;  1M8V A;  2E1H A;  4C8Q D;  4M7A E;  2HNI A;  5GAN 5;  3QUI A;  3RUX A;  1D3B B;  1H64 1;  5GMK e;  3BW1 A;  1Y96 A;  4EMH A;  5LJ5 h;  4XU1 A;  5LJ3 f;  2EJF A;  4C92 G;  5GMK i;  5GAM j;  3JCM e;  4M75 G;  1I8F A;  4M7A F;  2YLB A;  4M78 G;  4M7A B;  4MML A;  3JCM X;  5GAM g;  3JCM V;  4XTW A;  5GAN d;  4XTU A;  4M77 B;  4HA8 A;  4C92 F;  5GMK l;  5GAO n;  1N9R A;  3JB9 J;  2VC8 A;  4M7D G;  1MGQ A;  2RA2 A;  3V7S A;  4XTV A;  4XTY A;  4XU0 A;  4C8Q E;  2CGH A;  4MMK A;  4RCC A;  1JBM A;  5GAM e;  5GMK h;  4M77 D;  3JB9 G;  3QHS A;  5GAN g;  4EMK B;  2FYK A;  2JN0 A;  5GAN 2;  2E64 A;  5DY9 A;  2DTH A;  2DKG A;  4M77 C; 
#chains in the Genus database with same CATH topology
 2K3B A;  1ACM B;  2JTE A;  1KQ2 A;  2QA4 T;  4PJO E;  4OP0 A;  2HKQ B;  5CR2 A;  3JCM d;  1Q82 C;  1EZZ B;  3DB4 A;  4M75 B;  3QII A;  2HQE A;  1FYN A;  2RMO A;  1WPY A;  1YP5 A;  2O4X B;  2DER A;  4GLK A;  4BD3 A;  3CC4 Q;  2FB7 A;  1UGV A;  4ZN3 A;  4CC2 A;  3R6O A;  4LD6 A;  2E65 A;  2E6Z A;  3J7A F;  2O9V A;  4DEY A;  1QVF A;  2E10 A;  1X6G A;  2LJ3 A;  2EKH A;  1KIK A;  4ORZ A;  2X35 A;  3FB9 A;  1YJ9 A;  1AWJ A;  1SHF A;  1YIJ T;  2ZCF B;  1ZSZ A;  3OYL A;  1K8A R;  1ZSZ B;  1RUW A;  3O8V A;  4QVD A;  2RI3 A;  3CC2 A;  1VIE A;  1YCS B;  2QEX T;  3QKJ A;  3HFO A;  1Y57 A;  3M0Q A;  5I22 A;  1RAA B;  1ZA1 B;  5C0M A;  4LN2 A;  4M78 D;  4AFS C;  1QW1 A;  4J83 A;  2RN8 A;  1G3Y A;  1M2V A;  4IUT A;  1UDL A;  4OB0 B;  2L2P A;  1KQS S;  2DTO A;  1WX6 A;  2L3P A;  4ZN1 A;  1YBY A;  1WYX A;  2EGC A;  2VWF A;  3UT1 A;  5CKD A;  1KC8 U;  1V1C A;  1RAE B;  4XU1 A;  4C92 G;  1ZHI A;  4PL6 A;  3EG0 A;  2LX9 A;  3MP8 A;  2G3R A;  4E7L A;  1VUB A;  1ZQ1 A;  3EHR A;  4ELY C;  2RF0 A;  1QVF S;  5GMK h;  2CSQ A;  4EMK B;  2BZX A;  2YRD A;  1VYV A;  2XMF A;  1XNI A;  1H92 A;  5J3B A;  3MPU B;  3CMA A;  2L3R A;  3JCM W;  4WF2 A;  1VQ8 Q;  3S6W A;  2RK2 A;  3D7S B;  3UF4 A;  1M1K U;  3CPW A;  4AT1 B;  4JJB A;  1FWZ A;  4QQD A;  1Y0M A;  1UGS B;  2VB6 A;  2KSS A;  4M4Z A;  3X25 B;  2DL4 A;  2LQ8 A;  3OYM A;  5LJ3 d;  2LX7 A;  4M78 B;  5I2S A;  1X75 C;  2KQW A;  3M55 A;  1VA7 A;  2R5M A;  4JRP A;  2YUO A;  1VIF A;  5IXF A;  1SF9 A;  2DIG A;  5ECA A;  5IXB A;  4J7F A;  4Y28 E;  1BK2 A;  4FM4 B;  1NLP C;  2JNG A;  5GJV B;  4C8Q A;  3UAT A;  1VQ4 T;  1I0C A;  2ROL A;  4OML A;  3C95 A;  4JUV A;  4LUE A;  3X28 B;  4C8Q C;  4QVC A;  2OJ2 A;  2LQN A;  3V8J A;  2CUB A;  2A7Y A;  2RQU A;  2K79 A;  1M1G A;  1W6X A;  2HD0 A;  3VRZ A;  4JLG A;  3L2U A;  4RTZ A;  2YLC A;  1KQ1 A;  3CCU T;  1QQJ A;  3I35 A;  1BBZ A;  2C06 A;  5IHI A;  4O5V A;  2MIO A;  2PUO B;  1FMW A;  1NPR A;  4OMP A;  2PQW A;  1VQ9 T;  3M57 A;  3X26 B;  4M7D G;  3J81 E;  2D9T A;  3QWX X;  3CME T;  4B9W A;  3V7S A;  4XU0 A;  3JB9 G;  1MUZ A;  4ANJ A;  4PJO F;  1KJW A;  1D0Z A;  2COY A;  1VOM A;  2ATC B;  4RTY A;  2PVG B;  3L2R A;  2YUQ A;  1KQS A;  4M77 A;  1UHF A;  1NEB A;  2HQH A;  1WDX A;  5LJ3 g;  3SHW A;  2P84 A;  4R56 A;  3LWH A;  3CD6 A;  3T9N A;  3CCJ A;  5CAI A;  2CYZ B;  4BE1 A;  3KFV A;  3CME A;  2L5Q A;  1GL5 A;  4CC3 A;  1MMG A;  3QPH A;  2CUD A;  5KYY A;  5CCA A;  1TU0 B;  3M4G A;  3GNG A;  1S72 Q;  5L8R E;  5LJ5 g;  2KYM A;  3E2U A;  1TUD A;  1AEY A;  2WSF E;  4QQG A;  3GOX A;  2VVK A;  3H41 A;  4M7D A;  2PVO B;  1BIB A;  1W2B P;  4N0A C;  1BI3 A;  3MP1 A;  1EX4 A;  2QAS A;  3PVL A;  3QSU A;  1K76 A;  3A5Z B;  2V1R A;  2LT4 A;  3P8B B;  5HK3 A;  1I81 A;  1OI1 A;  3VUZ A;  3TSW A;  2JW4 A;  4PFP A;  3BY7 A;  1RAH B;  2DLP A;  2XKO C;  3OS5 A;  4LDV A;  3PFS A;  2OAW A;  3JCM Q;  2CZ1 B;  1GFC A;  4M7D D;  1ZUY A;  4ME7 A;  4ZGD B;  4F14 A;  3LX7 A;  1M2O A;  3CC4 T;  3VJP A;  1SRL A;  1RI9 A;  3EFO B;  3RER A;  1T3L A;  4LE9 A;  1D3B B;  3C0C A;  2EJF A;  3OYD A;  1QVG P;  3MEA A;  4M78 G;  2D0Q B;  2CH4 W;  3RMQ A;  4OMF B;  3CC4 A;  1KC8 R;  4QT7 A;  3CCR Q;  3EH1 A;  4GBQ A;  2YWW A;  1PG5 B;  4V2S A;  5CK9 A;  1KD1 C;  3UA6 A;  2RPN A;  4FYV B;  1YJW A;  3RIR A;  4PFZ A;  2F5K A;  4F16 A;  3GP8 A;  1WQW A;  2RB6 A;  1YHQ Q;  2L8D A;  1PD1 A;  4M78 E;  4IIO A;  2LQW A;  5DLO A;  3SWN C;  5CIU A;  2DX1 A;  2D8H A;  2QTX A;  1TUG B;  2EYZ A;  2PU9 B;  2GGR A;  1JU5 C;  3TQ7 P;  3L2Z A;  3INZ A;  5A0L A;  2CSI A;  5FU6 C;  3I56 T;  2QG9 B;  3JCM g;  2R57 A;  3AHU A;  1YJN Q;  1IB8 A;  2XHC A;  1MHN A;  4EPC A;  5GAN j;  1H3H A;  3CBM A;  2OTL A;  1GCQ C;  5KYU B;  1S72 A;  1R0C B;  1TXQ A;  1PWT A;  4LDW A;  4J8O A;  4OMQ A;  5GAN 4;  2DYI A;  1GBR A;  2JS2 A;  1N5Z A;  1NPP A;  3G1J A;  1E7O A;  2K2V A;  1VQ6 A;  2HBP A;  1B3Q A;  2JUF A;  2RHU A;  3QWY A;  2DXU A;  5LJ5 d;  1CKB A;  1U06 A;  1OEB A;  1YIJ A;  3OYF A;  3EGX B;  4DBQ A;  2ZGW A;  3SEM A;  2DTI A;  1YJ9 T;  3OYE A;  2OI3 A;  2RH2 A;  3PNW C;  2LT1 A;  2X4W A;  3RUX A;  3E9G A;  2JJ9 A;  5FU7 C;  4M77 B;  2EBP A;  4C92 F;  1PSE A;  1TWB A;  4ZTJ A;  2LNH B;  1PSF A;  4KUI A;  1M90 R;  4RCC A;  3C4S A;  2M02 A;  4HKE A;  2PUK B;  1CKA A;  3H0H A;  1WI7 A;  3A8M B;  1G3S A;  2RHZ A;  1Q7Y U;  1YIT T;  4HCC A;  1JQQ A;  4J9D A;  2RNA A;  3FDR A;  4M7D E;  2B86 A;  1AD5 A;  3EG2 A;  4PNO A;  1K73 U;  3CC2 Q;  3SD4 A;  2DF6 A;  3QJ6 A;  2LRQ A;  1TSF A;  5GAO l;  1NJI R;  1VQ5 A;  2DEQ A;  1E6G A;  4JZ3 A;  2EIF A;  1NZ9 A;  1YJN T;  3REA B;  2BKD N;  1XQH A;  2YUN A;  3Q1J A;  3FJ5 A;  4MZM A;  5CO7 A;  1UE9 A;  1QKX A;  4E7J A;  3VUB A;  2A28 A;  3M58 A;  1Q86 R;  3QZ5 B;  2FRY A;  4N4I A;  4N0A A;  2HSP A;  3SB2 A;  1BIA A;  2ZPE B;  3UDC A;  4BI4 A;  4E6R A;  4JDS A;  2NYS A;  3HRU A;  3CC7 T;  2J7I A;  3LGF A;  4M78 A;  3UA7 A;  1KD1 R;  2XDP A;  2JTF A;  2J6O A;  2RQT A;  4EMK C;  3QYH B;  2I0N A;  2KE9 A;  1VYU A;  2LQK A;  3RKW A;  4A4K A;  1KFZ A;  2BE9 B;  2LMJ A;  4RCB A;  2HZY A;  4XU3 A;  5GAN h;  4EMK A;  1MMN A;  2KK4 A;  4J9H A;  2JVV A;  1I5L A;  3DKM A;  2KBT A;  2HL3 A;  1R0B G;  3I55 T;  3RBB B;  4HVV A;  2E5Q A;  4O6J A;  2XDD A;  3I5S A;  3OYK A;  3ER0 A;  1X6B A;  1WZO A;  1RAD B;  1NE8 A;  1KHI A;  4AMC A;  2HQX A;  4EMH A;  1K4U S;  1M1K C;  3PE0 A;  2DMO A;  3R6N A;  4PJJ A;  3QDR B;  2KRS A;  3G4S A;  5GAM j;  4JS5 A;  2HBW A;  1QP3 A;  1Q81 C;  1UJY A;  2CZ7 B;  4HVU A;  3SDZ A;  1BB9 A;  3CCE Q;  3OW2 A;  5GAN g;  5HCK A;  2O01 E;  2JN0 A;  1K8A C;  5DY9 A;  2DKG A;  2GCX A;  3GNF B;  4YTL A;  1WHH A;  1NM7 A;  2F2X A;  5I2M A;  2RI2 A;  1KQS P;  4P5N A;  2QYZ A;  4J9I A;  1AT1 B;  3G7Z A;  2LCL A;  2WSC E;  4C0F A;  1N9S A;  1UFF A;  3JCM c;  2K4Y A;  1HD3 A;  3EG1 A;  4D6W A;  3CCS A;  4A4E A;  1XOV A;  1D1C A;  4M78 F;  2VUB A;  2CP2 A;  1QCO A;  2BZY A;  5LJ3 h;  3MEV A;  1IHV A;  1YIT Q;  4M75 C;  1O75 A;  4NOY A;  5LL6 S;  3A8L B;  5IN1 A;  1E6H A;  4B6M A;  3V8K A;  4MDW A;  2MF2 A;  2F5T X;  1B7T A;  8AT1 B;  2MPX C;  3OYC A;  4AFU C;  5AT1 B;  1JJ2 S;  1GCQ A;  4OGE A;  2A36 A;  1AWO A;  4F17 A;  5GAO p;  2XD0 A;  2FG0 A;  1K8A U;  1NG2 A;  2NUT A;  5D6Y A;  4DOW A;  4A4H A;  5FU7 B;  2KY9 A;  3PMI A;  1NJI C;  2KXD A;  1WHJ A;  5CKF A;  1PRM C;  2JTM A;  4M77 E;  2XG8 D;  5KYX A;  4VUB A;  3OYB A;  4BE2 A;  4C0G A;  1N6A A;  3L2Q A;  2VYT A;  1Q86 C;  3CCJ Q;  3GPL A;  2K5I A;  3BW1 A;  1JXM A;  1QCN A;  1F1B B;  3P8H A;  1VQ5 T;  4JPB W;  3FC3 A;  2J6F A;  1QMC A;  4Z8A A;  2ED0 A;  2BZ8 A;  1YI2 Q;  1FMK A;  3JCM V;  4EIK A;  3CCR T;  3JB9 J;  2ECZ A;  2L3S A;  1WXU A;  1ZUU A;  3A98 A;  3I56 A;  4KGV B;  4HCB A;  2WSE E;  2FHD A;  1JBM A;  5KYU A;  2X51 A;  3QZ9 B;  4CI0 C;  3QHS A;  2RJD A;  1GCP A;  1YWP A;  2LCC A;  2DXT A;  3FIF A;  1KG1 A;  3VV0 A;  2HCK A;  5KCO A;  1K9M R;  1X2Q A;  1D0Y A;  3QYG B;  5FU6 B;  2SRC A;  3BDU A;  1PC0 A;  2E70 A;  3MO8 A;  1Y07 A;  4Y92 A;  1K73 R;  4ZNX A;  1O9S A;  1M1K R;  1UG1 A;  2ZPG B;  4LXC A;  1QWE A;  3WXM B;  4MDX A;  3FEO A;  2JT4 A;  2E41 A;  1C6V X;  2X4Y A;  3DB3 A;  5GAN 6;  4DBH A;  1V29 B;  1KC8 C;  4FL6 A;  2DL5 A;  4OMO A;  1T0J A;  3EGD B;  4F7U A;  4J9C A;  2JZ2 A;  3UPU A;  4M7A D;  2H8H A;  2P0K A;  1LOJ A;  1Q95 G;  1WNL A;  2QXF A;  3M53 A;  2ROT A;  3CCS Q;  1OYX A;  3MEU A;  2LVM A;  2PVD B;  1M5Q 1;  4PJO G;  3MJX A;  3L42 A;  5KCH A;  1KD1 U;  1D1B A;  1XTD A;  3LW5 E;  3JB9 F;  1M4Z A;  2EQI A;  2QQ9 A;  1ABQ A;  4C92 C;  3V7R A;  3EH2 A;  4CC7 A;  3JB9 D;  2OX7 A;  2YUP A;  4JZ4 A;  3A8G B;  1PM3 A;  2DZ9 A;  3M0T A;  5I21 A;  9ATC B;  5IAY A;  4BY6 C;  4PJL A;  5KE2 A;  1H64 1;  3QXE B;  2ENM A;  2CRE A;  5LJ3 f;  4PJN A;  1YN8 A;  3EAE A;  5GAM g;  2QA4 Q;  2X9H A;  1N9R A;  4KH0 B;  1H3Z A;  3OW2 P;  4J9B A;  1YNZ A;  1SEM A;  4M77 D;  5GAN 2;  1VQP T;  2K9G A;  3LYI A;  2OTL Q;  3G71 A;  2DE0 X;  2CDT A;  4M75 E;  3LH5 A;  2M0Y A;  1QVP A;  3CCJ T;  2CZ6 B;  3OYN A;  2BTT A;  2DXC A;  2R5A A;  2IIM A;  2V8J A;  3VYH B;  1YI2 A;  1VQ6 Q;  3CEY A;  1I5O B;  1OZ2 A;  3FLG A;  4WTO B;  2JM8 A;  3VS4 A;  4C5E A;  2EW3 A;  2NLU A;  2V8K A;  4IKF A;  1NYF A;  4F04 B;  4E7S A;  5GJW B;  1J3T A;  4XQ3 A;  2I2L A;  2Y4X A;  4FIB A;  3M5A A;  1WJR A;  4RTV A;  5M9O A;  2RHX A;  3TU4 K;  2AKK A;  3CCU A;  4XTX A;  3CCV A;  4FU6 A;  5KE3 A;  2ABL A;  2RD1 A;  2NUP A;  1WXT A;  3RKX A;  2D1X A;  2DJZ A;  2E4H A;  2XDB A;  1RAI B;  1VQM A;  1LCK A;  2XI9 A;  5HK0 A;  3V7C A;  3E19 A;  2LZ6 B;  3PIP A;  1K9M C;  4KGZ B;  2FPE A;  3OYJ A;  5D6W A;  4DQ2 A;  8ATC B;  1WIE A;  2FRW A;  1DJ7 B;  4OMM A;  5FWB A;  3JCM b;  3JRZ A;  1VQO A;  4M77 G;  3VU3 C;  1RAB B;  1Q7Y C;  3M54 A;  3M4Y A;  3BDL A;  3CPW P;  3RES A;  1NYG A;  4OVA A;  3S3N A;  3M59 A;  2F1L A;  2E1H A;  5KH6 A;  5GAN 5;  2GF7 A;  2LJ1 A;  4BDZ A;  3M0S A;  1KHC A;  4M75 G;  3JCM X;  2BUD A;  4FCY A;  1X69 A;  2GFA A;  3QJY A;  2VC8 A;  2RA2 A;  7AT1 B;  1ZBX A;  2ESW A;  4N4G A;  5CKE A;  4KBM B;  2DTH A;  2IPO B;  4M77 C;  3HKS A;  4C5G A;  3ME9 A;  5LJ3 j;  3G4S T;  4IUP A;  2HKN A;  3CXC A;  3HL8 A;  2EPD A;  1YIT A;  2EQU A;  2E12 A;  2X4J A;  2C0O A;  3EFO A;  1RL2 A;  3OYG A;  5FRM A;  1G5V A;  5A2Q E;  3FJP A;  1BYM A;  1ABO A;  3MHX A;  1U1S A;  3I55 A;  4BY6 B;  3ZL7 C;  3CQT A;  2MCN A;  5KYY B;  1W1F A;  2HSE B;  2QQB A;  3CCL T;  1P92 A;  1VQP Q;  5CVI A;  1WLP B;  3CCQ T;  2QQA A;  2CP6 A;  4DBR A;  2RM4 A;  2PTK A;  4C8Q F;  2FO0 A;  5GAN f;  3HTR A;  1SHG A;  3MEW A;  1X43 A;  3HRT A;  5FRO A;  4M7A C;  4J5Y A;  3RNJ A;  2VAS A;  2ZPF B;  1N8R C;  1YI2 T;  2RQV A;  1A0N B;  1FMV A;  4CC4 B;  4L6V 5;  4E2F B;  3CCU Q;  3CBO A;  2HL5 C;  3OMG A;  1C1A A;  4X34 A;  5J26 A;  2J05 A;  1WQ7 A;  2A37 A;  4OF1 A;  2NUT B;  2QEX A;  1ZLM A;  2KAF A;  2V26 A;  4LD9 K;  3OA6 A;  5HY6 A;  1VQK T;  3OSS C;  1AZE A;  2V8I A;  1M3C A;  2K3X A;  3OY9 A;  3KBG A;  2D8J A;  2LTO A;  2ZPH B;  2C0I A;  3S3M A;  5I11 A;  1MGQ A;  2KDS A;  3CMA T;  2Y4Y A;  3I5R A;  5GAM e;  2EYX A;  2FYK A;  2CT4 A;  2HEQ A;  4Z89 A;  3CXC S;  4D8D A;  1V76 A;  5DLQ E;  1U3O A;  4KRT A;  4C92 E;  1I4K 1;  2EKO A;  1W2B A;  2KRN A;  1SPK A;  2HDA A;  2DIL A;  4RG8 A;  1M90 U;  4XU2 A;  3PMT A;  1N27 A;  4OMN A;  3MKD A;  3GF5 A;  1Q7Y R;  1D0X A;  3EGD A;  1CSK A;  1OPK A;  2DRK A;  1KSW A;  1WJS A;  2M51 A;  2YXY A;  4X9D A;  2OTJ A;  2HAX A;  2WAC A;  1PRL C;  3EFR A;  1NJI U;  1VQ6 T;  1RI0 A;  2V1Q A;  2MI6 A;  2QDL A;  2E3I A;  3SFM A;  4ZTF A;  3I55 Q;  1VQL T;  1YHQ T;  2KEA A;  1YJN A;  5LJ5 j;  3KUF A;  1Q81 R;  4AG1 C;  2AIR B;  1U5S A;  3HRS A;  4OB1 B;  4Y91 A;  2L3Q A;  1LVK A;  3H6Z A;  3G71 T;  1H8K A;  3ZFJ A;  1S1N A;  3OYY A;  4AFZ C;  2P4T A;  1Q82 R;  4C0D B;  2XK0 A;  4JJD A;  4A53 A;  4C92 D;  4M75 D;  4ZGE B;  3OYH A;  2KRM A;  1M3A A;  3JB9 H;  3U23 A;  4JRK A;  2DAQ A;  1VQ7 Q;  1VQN Q;  2EQM A;  3CCQ Q;  1VQM T;  4AG2 C;  3JCM h;  5IHN A;  3CCL A;  4M7A G;  2RI5 A;  1IRE B;  4ATO A;  1OUL A;  3CXC P;  3QO3 A;  2OAU A;  2MOX A;  1WHL A;  2CP5 A;  1MND A;  3EGU A;  4E7I A;  1M2V B;  4ZGJ B;  1YJW T;  2Z0W A;  1PCX A;  4PKC C;  4M7A B;  2DD5 A;  1TTH B;  4XTU A;  4HA8 A;  3TRE A;  2CP0 A;  4QKU A;  2EGA A;  2QQR A;  5FRN A;  1EIF A;  1PKS A;  3CD6 T;  1WHM A;  2FVU A;  4LUD A;  2KNB B;  4A4F A;  2KR3 A;  2DVE A;  5CKB A;  1SSF A;  3RR6 A;  3VKI A;  5KYX B;  4XTZ A;  4FYX B;  4UC4 A;  1OQK A;  4J6Y A;  1VQ5 Q;  1WHK A;  2GQI A;  1NEG A;  1ZX6 A;  2VGN A;  3HSB A;  1S72 T;  3I9Q A;  2D6F A;  4BUG A;  3OW2 S;  2DL3 A;  2E5K A;  5KYW A;  5GAN 7;  3QBY A;  2O4X A;  2KRO A;  1W4S A;  4GY5 A;  3GIB A;  1OU9 A;  3L2W A;  5D6X A;  2RHI A;  5LJ5 f;  3G6E Q;  3CCM T;  1VQO Q;  3FRN A;  4E47 A;  3JCM J;  3ZBD A;  1LNX A;  1MV0 B;  1IO6 A;  1TH7 A;  4NL2 A;  3RDV A;  1NBE B;  4BAC A;  1ZSZ C;  2E3H A;  2F2V A;  4PLI A;  1BI1 A;  2RK1 A;  2OTJ Q;  1TUC A;  3UWN A;  4M7A A;  4F7U G;  5HKC A;  4NS5 A;  2EFI A;  3VRY A;  2BE7 D;  4N4H A;  3H0F A;  2VGM A;  3VS5 A;  4EMG A;  1YHQ A;  1UHC A;  4C92 A;  3PGG A;  1RLQ C;  3WVE B;  1MV3 A;  3NTI A;  4C8Q D;  1SG5 A;  1K73 C;  3C12 A;  1RLP C;  2OTJ T;  3JCM e;  4MML A;  2AZS A;  2EGE A;  3OS1 A;  4FSS A;  1OX9 A;  3P8D A;  2ZPB B;  1GRI A;  4C8Q E;  2EYY A;  1X27 A;  2JOY A;  4IUU A;  4QVZ A;  2FZG B;  4D8K A;  3OYA A;  4HVW A;  4WCI A;  1SRM A;  3CCL Q;  2A3L A;  2RQW A;  4KH1 B;  1VQP A;  1VQ9 Q;  1ZUK A;  4Z02 A;  3ASK A;  2JMA A;  5IHK A;  2FPF A;  4K11 A;  4LNP A;  3SWN A;  1W70 A;  3HFN A;  4B9X A;  2CZ0 B;  5GAM h;  2P4R A;  4DBF A;  2GTO A;  2ZZD A;  2DD4 A;  2EWN A;  1JO8 A;  5IT9 E;  2J06 A;  1QP2 A;  2PZ1 A;  2VXF A;  2DA9 A;  2KYB A;  1IGU A;  3E1S A;  1YJ9 Q;  2KI7 A;  4II1 A;  2LCS A;  1K9M U;  3MP6 A;  2YDL A;  3JSC A;  4PJO D;  1VQ4 A;  4FT4 A;  3NFC A;  3NGP A;  4R0K A;  4MZP A;  3TSZ A;  5GAO q;  3CCR A;  2EYW A;  4JRQ A;  4HCK A;  2C0T A;  3RKY A;  4XK8 E;  2MAM A;  2QEX Q;  4TVR A;  3AT1 B;  1HJD A;  6AT1 B;  1KK7 A;  5GAN e;  2FZK B;  4JRI A;  2A08 A;  1OOT A;  4E7H A;  3PTA A;  2MMP A;  1UGR B;  2QK0 A;  1VQL Q;  3NTH A;  1Q81 U;  5FLX E;  2GFU A;  2QTV A;  1LJO A;  4QW2 A;  3NHN A;  2ED1 A;  3OYI A;  1M30 A;  5GAO r;  4PJM A;  5LJ5 e;  1Q82 U;  2KT8 A;  1IGQ A;  1VQO T;  2KMT A;  1HSQ A;  2MYS A;  2K3Y A;  3URG A;  3HPW A;  2LP5 A;  1AZG B;  3M0R A;  4XAX B;  2HNI A;  5AYF A;  1QCF A;  2CKK A;  3HP9 A;  1I8F A;  2YLB A;  3CCV T;  1D1A A;  2QI2 A;  2YT6 A;  1NLO C;  4BI3 A;  1HYO A;  3JV3 A;  2SEM A;  4C0D C;  5C6S A;  1FX7 A;  1VQ8 A;  5DM7 R;  1ZBJ A;  2KT1 A;  3I56 Q;  2QQS A;  2LNV A;  2Y90 A;  3RMS A;  3G6E T;  1OX8 A;  1IZ6 A;  3CC7 A;  1VQK A;  3CCM Q;  3CBP A;  3DLL A;  3EGX A;  5GAN 8;  3CD6 Q;  1QKW A;  2GBQ A;  2B8A A;  2COZ A;  1VQ7 T;  3PIO A;  1VQN T;  1G2B A;  4F7U F;  1K0X A;  3ZEH A;  5CQX A;  4HT8 A;  1B34 B;  3E9F A;  3LGL A;  3A8H B;  2EVR A;  1AOJ A;  1EFN A;  2EJ9 A;  2IVW A;  4E7K A;  3TCJ A;  1WA7 A;  4Z88 A;  1OV3 A;  4M7D C;  4J6W A;  1X2K A;  4M77 F;  4C92 B;  1VQ7 A;  1VQN A;  3VS2 A;  4JJN K;  2W10 A;  1G8X A;  2J6K A;  2X4X A;  1QWF A;  3WVD B;  1Z9Q A;  5CKH A;  1VQ4 Q;  4RMO A;  1PHT A;  2FEI A;  3CCE T;  1GBQ A;  4J9E A;  5EC7 A;  1FXX A;  3CPW S;  2EJG A;  2K57 A;  2K6D A;  2YRV A;  4J6X A;  1K1Z A;  4IUR A;  1D3B A;  3S3O A;  2M16 A;  1TOV A;  2DJQ A;  3JB9 I;  2RO0 A;  4Q5W A;  1UUE A;  3OBY A;  4RG2 A;  3JCM f;  1ARK A;  1YWO A;  4DOV A;  1R8O B;  4KUL A;  1M3B A;  2MWO A;  3ULR B;  1RAG B;  4PLL A;  2KGT A;  4FT2 A;  3VS0 A;  4C8Q B;  1M27 C;  3THK A;  4A63 B;  1I07 A;  2F69 A;  4RTT A;  3CCS T;  2P0Q A;  3OMC A;  3A1P A;  1AHJ B;  4C0Z A;  2QA4 A;  3PVQ A;  5GMK i;  1K9A A;  2M9U A;  4X1V A;  5KYW B;  1PD0 A;  4M7A F;  2GNC A;  4XTW A;  2QDY B;  3VYG A;  5GMK l;  1Y71 A;  2DK3 A;  3GLX A;  1JB0 E;  4RTU A;  4XTY A;  2CGH A;  3J80 E;  4HXJ A;  4RTW A;  5GAN d;  1N8R U;  3EG9 A;  4C5I A;  4RKU E;  2DM1 A;  2NUZ A;  5LJ3 e;  2RJC A;  2DET A;  4C8Q G;  3CME Q;  3LH0 A;  5GAM f;  1ZSG A;  1UJ0 A;  4FYY B;  1JJ2 A;  2GTJ A;  1YJW Q;  2EQK A;  1WJQ A;  2RJF A;  2DZC A;  4KUD K;  3VS6 A;  1W2B S;  3L2V A;  1JRI A;  2MWP A;  2ZPI B;  4M7A E;  1B34 A;  4IUV A;  2YRC A;  2H3J A;  1MNE A;  1IHW A;  1UEC A;  1UGQ B;  3EG3 A;  1LPL A;  3CCQ A;  2DEU A;  4AFQ C;  3JAM E;  4X9C A;  3REB B;  5D7U A;  2CS7 A;  4KGX B;  1OZ3 A;  4F7U E;  3CC7 Q;  3JCM P;  3CCM A;  2YHT A;  2H3E B;  3OSV A;  1M90 C;  1M1F A;  5GMK m;  2DVJ A;  2AZV A;  3QDF A;  2DRM A;  4FSX A;  3MET A;  4DEX A;  3CMA Q;  1IRX A;  2G6F X;  2JXB A;  1UGP B;  1OPL A;  1RAF B;  4MZT A;  2O9S A;  3H9N A;  3M9Q A;  1X01 A;  3KXT A;  3CCV Q;  2O2O A;  2LJ0 A;  2F2W A;  4QQ6 A;  1WXB A;  4FW2 A;  4LDX A;  4J9F A;  4J9G A;  2BIV A;  3BFM A;  4PJO C;  3N5B B;  1R77 A;  2L0A A;  2EYQ A;  1I1J A;  2K2M A;  1SSH A;  4KT0 E;  1AVZ C;  3BE3 A;  4JLI A;  5L23 A;  5A0D A;  4PJO A;  2K5L A;  1M8V A;  1JEG A;  3H0I A;  1Y96 A;  4OB2 B;  5LJ5 h;  2DFU A;  3NPF A;  1K0S A;  1QLY A;  1TS9 A;  1D09 B;  5GAO n;  3VS1 A;  4RUG A;  3F70 A;  1AWW A;  3M0P A;  3G6E A;  2CT3 A;  1AWX A;  5FW9 A;  2DIQ A;  2E6N A;  1YCY A;  2GQV A;  2M1H A;  4NL3 A;  2FZC B;  2CP3 A;  2AKL A;  3OQ5 A;  1ZA2 B;  2MK5 A;  1XJW B;  1C0M A;  3L1A A;  1BKB A;  3OS2 A;  3M0U A;  5GAO m;  4BI8 B;  1Y96 B;  3NMZ C;  2JM9 A;  4M7D F;  1Z9Z A;  1BU1 A;  2L89 A;  1MMD A;  2X3W D;  4JS4 A;  4PJO B;  4CRI A;  2DL7 A;  1U8R A;  2QAZ A;  3SWN B;  2YSQ A;  1MMA A;  3A8O B;  2DPP B;  2XU8 A;  1U1T A;  2RQR A;  5CQY A;  2CP7 A;  2JS0 A;  4E7Z A;  2K7A A;  1UTI A;  1BCM A;  1GXI E;  3PT9 A;  2DO3 A;  2AT1 B;  3EFS A;  1JXO A;  2EAY A;  1YIJ Q;  1BI2 A;  3QG1 A;  3DLM A;  2X3X D;  4M78 C;  4R55 A;  1WFW A;  2IG0 A;  2XID A;  3LLR A;  3HHT B;  1TG0 A;  1T3S A;  2FPD A;  1VQ9 A;  1OU8 A;  4M75 F;  3OBW A;  2LDM A;  4HT9 A;  4M7D B;  1UEB A;  1HXD A;  1QVF P;  2DBM A;  4HCZ A;  2DXB A;  4FW1 A;  4OGC A;  3X24 B;  1JJ2 P;  3TEE A;  2M0O A;  4ESR A;  2XIC A;  5GMK e;  2D0N A;  2QGF B;  4FYW B;  2PNI A;  2W0Z A;  1Y7X A;  3EHQ A;  3G4S Q;  3CCE A;  1B07 A;  3OB9 A;  1GFD A;  1UB4 A;  2DNU A;  3IQL A;  5KYN A;  3EG9 B;  3C94 A;  2NWM A;  5GMK j;  3GBQ A;  2HMA A;  5EG2 A;  2COW A;  4LDU A;  3TVT A;  5GAM d;  2DL8 A;  3NTK A;  3X20 B;  2CH4 A;  4BDY A;  1VQL A;  1N8R R;  4L5G A;  5GAN 3;  1VQM Q;  4F7U B;  3VS3 A;  2VXE A;  4BE0 A;  1Q86 U;  1X6O A;  1WGS A;  3CPF A;  1WHG A;  3CC2 T;  4PK4 A;  4JJC A;  4LDY A;  1IXD A;  4C5H A;  1G3W A;  3MCA B;  2JMC A;  2KVQ G;  2O31 A;  1PNJ A;  2R58 A;  4BB7 A;  3V8L A;  1M8M A;  4IIM A;  2FL7 A;  1VQ8 T;  2LC4 A;  3G71 Q;  1SKU B;  2RHY A;  1VYT A;  4M75 A;  2DYB A;  2EQJ A;  2K5F A;  2NUP B;  2DBK A;  1G83 A;  2A0F B;  1HK9 A;  1T0H A;  5A0G A;  5J39 A;  2QGG A;  4PFO A;  2VV5 A;  4DA4 A;  1VQK Q;  3VS7 A;  1M9S A;  4ELZ C;  1BCO A;  4GLM A;  1G3T A;  2KXC A;  2AK5 A;  4A4G A;  3LWI A;  4RTX A;  4A54 A;  3OS0 A;  4J7I A;  4IUQ A;  2O88 A;  3QUI A;  2ZAE A;  5IH2 A;  3M56 A;  3H8Z A;  4EDU A;  2VKN A;  1RAC B;  2RJE A;  3O5Z A;  1QVG S;  1QVG A;  5FWC A;  1PKT A;  4XTV A;  2P0P A;  4MMK A;  1YFN A;  2AHJ B;  2OTL T;  1BI0 A;  4L59 A;  4OB3 B;  2E64 A; 
#chains in the Genus database with same CATH homology
 3A8M B;  3HKS A;  2LNV A;  2Y90 A;  1G3S A;  3RMS A;  3G6E T;  2RHZ A;  4C5G A;  3ME9 A;  5LJ3 j;  3G4S T;  2QA4 T;  4OP0 A;  1YIT T;  1IZ6 A;  1Q7Y U;  4HCC A;  3CC7 A;  4IUP A;  4PJO E;  5CR2 A;  1VQK A;  3CXC A;  2PUK B;  3CBP A;  3HL8 A;  3JCM d;  3DLL A;  2EQU A;  3FDR A;  1YIT A;  3DB4 A;  5GAN 8;  1Q82 C;  4M7D E;  4M75 B;  2E12 A;  2X4J A;  3QII A;  2HQE A;  4PNO A;  1K73 U;  3SD4 A;  2B8A A;  1RL2 A;  3PIO A;  3OYG A;  1VQ7 T;  1VQN T;  3QJ6 A;  2LRQ A;  5FRM A;  5A2Q E;  3FJP A;  1G5V A;  5GAO l;  4F7U F;  1BYM A;  1VQ5 A;  3MHX A;  2DEQ A;  3ZEH A;  1WPY A;  5CQX A;  2EIF A;  4HT8 A;  1B34 B;  2O4X B;  3E9F A;  1NZ9 A;  3LGL A;  1U1S A;  4GLK A;  4BY6 B;  4BD3 A;  3I55 A;  1YJN T;  3A8H B;  2FB7 A;  2BKD N;  2EJ9 A;  1XQH A;  2IVW A;  4ZN3 A;  4E7K A;  3Q1J A;  2QQB A;  3R6O A;  3TCJ A;  4MZM A;  5CO7 A;  4R55 A;  4LD6 A;  3CCL T;  1P92 A;  2E65 A;  2E6Z A;  4E7J A;  3VUB A;  3J7A F;  3M58 A;  5CVI A;  4M7D C;  4J6W A;  4M77 F;  4C92 B;  3QZ5 B;  2QQA A;  3CCQ T;  1QVF A;  2E10 A;  1VQ7 A;  1VQN A;  4N4I A;  4N0A A;  4JJN K;  2RM4 A;  3SB2 A;  2X35 A;  4C8Q F;  3FB9 A;  1BIA A;  2ZPE B;  3UDC A;  4BI4 A;  1YJ9 A;  5GAN f;  2X4X A;  4OB3 B;  4JDS A;  3WVD B;  1YIJ T;  2ZCF B;  3HRU A;  3OYL A;  3CC7 T;  5CKH A;  4RMO A;  3MEW A;  3LGF A;  4M78 A;  3CCE T;  3O8V A;  4QVD A;  2RI3 A;  2XDP A;  2JTF A;  4EMK C;  3CC2 A;  1VIE A;  3HRT A;  3QYH B;  5FRO A;  2QEX T;  1FXX A;  3QKJ A;  3CPW S;  4M7A C;  2EJG A;  3HFO A;  4J5Y A;  2K57 A;  2LQK A;  2YRV A;  3RKW A;  4J6X A;  4A4K A;  2ZPF B;  5C0M A;  4RCB A;  1N8R C;  1YI2 T;  4IUR A;  1D3B A;  4M78 D;  3S3O A;  4XU3 A;  5GAN h;  4EMK A;  1QW1 A;  4J83 A;  2KK4 A;  4L6V 5;  2M16 A;  1G3Y A;  2JVV A;  3CBO A;  1I5L A;  3DKM A;  3JB9 I;  2RO0 A;  4Q5W A;  3OBY A;  4RG2 A;  3JCM f;  3I55 T;  3OMG A;  4IUT A;  4X34 A;  4OB0 B;  5J26 A;  1WQ7 A;  2E5Q A;  4DOV A;  1R8O B;  4KUL A;  4O6J A;  2XDD A;  1KQS S;  3OYK A;  4OF1 A;  2QEX A;  2DTO A;  2MWO A;  3ER0 A;  4PLL A;  1NE8 A;  4FT2 A;  1KHI A;  4C8Q B;  4ZN1 A;  1YBY A;  2KAF A;  4LD9 K;  3OA6 A;  2HQX A;  5HY6 A;  2F69 A;  3CCS T;  3UT1 A;  5CKD A;  2P0Q A;  4EMH A;  1KC8 U;  3OMC A;  1M1K C;  1VQK T;  3OSS C;  1AHJ B;  4XU1 A;  4C0Z A;  3QDR B;  3G4S A;  2QA4 A;  4C92 G;  2V8I A;  5GMK i;  2M9U A;  5GAM j;  2K3X A;  1ZHI A;  3OY9 A;  4JS5 A;  4M7A F;  3KBG A;  1QP3 A;  4PL6 A;  1Q81 C;  2CZ7 B;  2QDY B;  4XTW A;  2LTO A;  3VYG A;  5GMK l;  2LX9 A;  3MP8 A;  2G3R A;  2ZPH B;  3SDZ A;  3S3M A;  4E7L A;  1MGQ A;  1VUB A;  1ZQ1 A;  2KDS A;  1Y71 A;  4ELY C;  3CMA T;  2Y4Y A;  2DK3 A;  3GLX A;  1JB0 E;  4XTY A;  2CGH A;  5GMK h;  1QVF S;  5GAM e;  3J80 E;  3OW2 A;  5GAN g;  4EMK B;  2FYK A;  2JN0 A;  2O01 E;  1K8A C;  5DY9 A;  5GAN d;  2DKG A;  1N8R U;  3CXC S;  2GCX A;  3GNF B;  4YTL A;  4C5I A;  4RKU E;  5DLQ E;  4C92 E;  5I2M A;  1I4K 1;  2EKO A;  2RI2 A;  1XNI A;  2RJC A;  5LJ3 e;  4C8Q G;  1W2B A;  4P5N A;  3LH0 A;  5GAM f;  5J3B A;  3CMA A;  4RG8 A;  2L3R A;  1JJ2 A;  1M90 U;  4XU2 A;  3G7Z A;  3JCM W;  3PMT A;  2LCL A;  4WF2 A;  2WSC E;  2EQK A;  1WJQ A;  4C0F A;  2RJF A;  2DZC A;  3S6W A;  1N27 A;  1N9S A;  2RK2 A;  4KUD K;  1M1K U;  3CPW A;  1FWZ A;  3GF5 A;  4QQD A;  1W2B S;  3JCM c;  3L2V A;  1JRI A;  2K4Y A;  2MWP A;  2ZPI B;  4M7A E;  1B34 A;  4IUV A;  1WJS A;  4D6W A;  3CCS A;  4A4E A;  1UGS B;  2H3J A;  2KSS A;  1UGQ B;  3X25 B;  4X9D A;  2OTJ A;  2HAX A;  2WAC A;  3CCQ A;  2LQ8 A;  3OYM A;  3EFR A;  5LJ3 d;  1NJI U;  3JAM E;  1XOV A;  1VQ6 T;  1RI0 A;  4X9C A;  2MI6 A;  4M78 F;  4M78 B;  2VUB A;  3SFM A;  2CS7 A;  1OZ3 A;  4ZTF A;  4F7U E;  5I2S A;  1X75 C;  5LJ3 h;  2KQW A;  3JCM P;  3M55 A;  3MEV A;  3CCM A;  1VQL T;  2R5M A;  4M75 C;  4JRP A;  2YHT A;  1O75 A;  4NOY A;  5LL6 S;  1YHQ T;  1VIF A;  3OSV A;  1YJN A;  5LJ5 j;  1M90 C;  3KUF A;  3A8L B;  1M1F A;  5GMK m;  5IN1 A;  2DIG A;  3HRS A;  4OB1 B;  4FSX A;  3MET A;  4J7F A;  4Y91 A;  4Y28 E;  3V8K A;  2MF2 A;  4FM4 B;  2F5T X;  3H6Z A;  4MDW A;  2JNG A;  3G71 T;  3OYC A;  3ZFJ A;  3OYY A;  1JJ2 S;  2P4T A;  1UGP B;  4OGE A;  4MZT A;  4C8Q A;  5GAO p;  2XD0 A;  3M9Q A;  4C0D B;  2XK0 A;  1X01 A;  4A53 A;  3KXT A;  4C92 D;  1VQ4 T;  1K8A U;  4M75 D;  5D6Y A;  4QQ6 A;  4DOW A;  4ZGE B;  4A4H A;  3OYH A;  3C95 A;  5FU7 B;  2KY9 A;  3PMI A;  1NJI C;  3JB9 H;  4LDX A;  4JRK A;  4JUV A;  3X28 B;  4C8Q C;  2DAQ A;  2BIV A;  3BFM A;  4QVC A;  4PJO C;  3N5B B;  5I21 A;  2EYQ A;  4KT0 E;  2EQM A;  5CKF A;  3V8J A;  1VQM T;  2JTM A;  3JCM h;  2A7Y A;  4M77 E;  2XG8 D;  3CCL A;  4JLI A;  4M7A G;  2RI5 A;  1M1G A;  4VUB A;  3OYB A;  2HD0 A;  1IRE B;  4ATO A;  4BE2 A;  4C0G A;  4JLG A;  1N6A A;  5A0D A;  3L2U A;  3QO3 A;  3L2Q A;  2YLC A;  1KQ1 A;  4PJO A;  2K5L A;  2OAU A;  2VYT A;  1M8V A;  3CCU T;  1Q86 C;  3GPL A;  2K5I A;  3BW1 A;  1Y96 A;  4OB2 B;  5LJ5 h;  2C06 A;  3P8H A;  4E7I A;  1VQ5 T;  4ZGJ B;  1YJW T;  4M7D F;  3FC3 A;  4O5V A;  4PKC C;  2PUO B;  4M7A B;  2DD5 A;  1NPR A;  3JCM V;  2PQW A;  1VQ9 T;  4XTU A;  4HA8 A;  3M57 A;  3X26 B;  5GAO n;  3CCR T;  3JB9 J;  4M7D G;  3J81 E;  3TRE A;  2D9T A;  3I56 A;  3CME T;  4B9W A;  3V7S A;  2WSE E;  4HCB A;  4XU0 A;  2FHD A;  2QQR A;  3F70 A;  5FRN A;  1JBM A;  1EIF A;  3QZ9 B;  4CI0 C;  3JB9 G;  3QHS A;  3G6E A;  3CD6 T;  2FVU A;  2RJD A;  4PJO F;  2DIQ A;  2E6N A;  1YCY A;  2GQV A;  2M1H A;  4A4F A;  4NL3 A;  2LCC A;  2DVE A;  2DXT A;  5CKB A;  1SSF A;  2PVG B;  3FIF A;  3L2R A;  3VKI A;  3OQ5 A;  1KQS A;  4XTZ A;  1KG1 A;  4M77 A;  4UC4 A;  3VV0 A;  3L1A A;  5LJ3 g;  4J6Y A;  5KCO A;  1BKB A;  3OS2 A;  5GAO m;  4BI8 B;  4R56 A;  3LWH A;  3CD6 A;  3T9N A;  3CCJ A;  1Y96 B;  2VGN A;  2CYZ B;  3QYG B;  5FU6 B;  5CAI A;  4BE1 A;  1S72 T;  3CME A;  2D6F A;  3HSB A;  2L89 A;  4BUG A;  2L5Q A;  3BDU A;  3OW2 S;  5GAN 7;  3QPH A;  2E70 A;  3QBY A;  4JS4 A;  3MO8 A;  4CRI A;  1Y07 A;  4PJO B;  5CCA A;  1U8R A;  1O9S A;  3M4G A;  3GNG A;  2O4X A;  2ZPG B;  3SWN B;  3A8O B;  5L8R E;  1W4S A;  3WXM B;  5LJ5 g;  4MDX A;  4GY5 A;  3FEO A;  3GIB A;  2E41 A;  3L2W A;  2X4Y A;  3DB3 A;  5D6X A;  2DPP B;  2RHI A;  5GAN 6;  2WSF E;  5LJ5 f;  3CCM T;  2XU8 A;  1V29 B;  1KC8 C;  4FL6 A;  1U1T A;  4QQG A;  3FRN A;  4E47 A;  3GOX A;  5CQY A;  4F7U A;  3JCM J;  4M7D A;  3ZBD A;  2JZ2 A;  1LNX A;  3UPU A;  4M7A D;  2PVO B;  1BIB A;  2P0K A;  4N0A C;  1GXI E;  1BI3 A;  1LOJ A;  1WNL A;  3MP1 A;  2QXF A;  3PT9 A;  3M53 A;  3QSU A;  1TH7 A;  3A5Z B;  2DO3 A;  4NL2 A;  3EFS A;  2LT4 A;  3P8B B;  1OYX A;  2EAY A;  4BAC A;  5HK3 A;  1I81 A;  1OI1 A;  3VUZ A;  1BI2 A;  3MEU A;  3DLM A;  3QG1 A;  4PLI A;  4M78 C;  1BI1 A;  2LVM A;  2RK1 A;  2PVD B;  1M5Q 1;  2IG0 A;  2XID A;  3BY7 A;  3L42 A;  3HHT B;  2XKO C;  3LLR A;  4PJO G;  5KCH A;  1KD1 U;  3OS5 A;  1XTD A;  4LDV A;  3LW5 E;  3JB9 F;  1M4Z A;  3PFS A;  3UWN A;  1VQ9 A;  4M7A A;  4M75 F;  4F7U G;  2QQ9 A;  5HKC A;  3JCM Q;  2CZ1 B;  4NS5 A;  4M7D D;  3OBW A;  2LDM A;  4C92 C;  2EFI A;  4HT9 A;  1UEB A;  4M7D B;  1HXD A;  4N4H A;  3V7R A;  4ME7 A;  4ZGD B;  4HCZ A;  3LX7 A;  2DXB A;  3JB9 D;  4OGC A;  3X24 B;  3CC4 T;  2VGM A;  4EMG A;  3VJP A;  1YHQ A;  3A8G B;  2DZ9 A;  4C92 A;  3PGG A;  5IAY A;  3TEE A;  2M0O A;  3WVE B;  3RER A;  2XIC A;  3NTI A;  4BY6 C;  4C8Q D;  5KE2 A;  1K73 C;  1D3B B;  1H64 1;  5GMK e;  3QXE B;  3C12 A;  5LJ3 f;  2EJF A;  3OYD A;  3MEA A;  2OTJ T;  3JCM e;  1Y7X A;  3EAE A;  4M78 G;  4MML A;  5GAM g;  2D0Q B;  3CCE A;  1N9R A;  3OS1 A;  3RMQ A;  1H3Z A;  3OB9 A;  4OMF B;  3CC4 A;  3P8D A;  2ZPB B;  4C8Q E;  1UB4 A;  4M77 D;  5GAN 2;  4IUU A;  2JOY A;  1VQP T;  4QVZ A;  3OYA A;  4V2S A;  3C94 A;  5CK9 A;  3LYI A;  5GMK j;  2A3L A;  1VQP A;  1KD1 C;  3G71 A;  4Z02 A;  3ASK A;  4M75 E;  1YJW A;  5EG2 A;  3RIR A;  1QVP A;  3CCJ T;  2F5K A;  2CZ6 B;  4LDU A;  3OYN A;  3SWN A;  3HFN A;  5GAM d;  3GP8 A;  3NTK A;  3X20 B;  4B9X A;  1WQW A;  2CZ0 B;  2DXC A;  2RB6 A;  5GAM h;  4BDY A;  2R5A A;  2ZZD A;  4L5G A;  1VQL A;  2L8D A;  1KQ2 A;  2DD4 A;  4M78 E;  2EWN A;  5GAN 3;  2V8J A;  3VYH B;  1YI2 A;  4F7U B;  5DLO A;  5IT9 E;  2VXE A;  3SWN C;  3CEY A;  1OZ2 A;  1QP2 A;  5CIU A;  4BE0 A;  2QTX A;  1Q86 U;  3FLG A;  1X6O A;  2VXF A;  1WGS A;  3CPF A;  2PU9 B;  3CC2 T;  3E1S A;  3L2Z A;  4C5E A;  4II1 A;  1K9M U;  3INZ A;  4LDY A;  3MP6 A;  5A0L A;  3JSC A;  2NLU A;  2V8K A;  5FU6 C;  1VQ4 A;  4PJO D;  4C5H A;  4FT4 A;  3NFC A;  3I56 T;  1G3W A;  3MCA B;  3JCM g;  2R57 A;  4MZP A;  3AHU A;  2KVQ G;  5GAO q;  3CCR A;  4IKF A;  4JRQ A;  2XHC A;  1MHN A;  2R58 A;  4BB7 A;  3V8L A;  4EPC A;  5GAN j;  4XQ3 A;  2I2L A;  2Y4X A;  2FL7 A;  3CBM A;  3M5A A;  4FIB A;  4XK8 E;  2MAM A;  1WJR A;  3RKY A;  1VQ8 T;  2LC4 A;  2OTL A;  4TVR A;  5M9O A;  2RHX A;  1S72 A;  5GAN e;  2RHY A;  4JRI A;  4LDW A;  4J8O A;  3TU4 K;  4M75 A;  3CCU A;  4XTX A;  5GAN 4;  4E7H A;  3PTA A;  2EQJ A;  2K5F A;  2MMP A;  1UGR B;  3CCV A;  4FU6 A;  5KE3 A;  2RD1 A;  3RKX A;  3NTH A;  1Q81 U;  5FLX E;  2DJZ A;  1NPP A;  2XDB A;  1VQM A;  2GFU A;  2K2V A;  1VQ6 A;  1LJO A;  2XI9 A;  5HK0 A;  3V7C A;  2HBP A;  3E19 A;  4QW2 A;  3OYI A;  3PIP A;  1K9M C;  1HK9 A;  3OYJ A;  5A0G A;  2JUF A;  5D6W A;  4DQ2 A;  2RHU A;  5J39 A;  5GAO r;  5LJ5 e;  2DXU A;  5LJ5 d;  1Q82 U;  2VV5 A;  1DJ7 B;  4DA4 A;  3JCM b;  1M9S A;  3JRZ A;  1VQO T;  1VQO A;  2KMT A;  4M77 G;  3VU3 C;  1YIJ A;  4ELZ C;  3OYF A;  1Q7Y C;  3M54 A;  1G3T A;  3M4Y A;  2ZGW A;  3BDL A;  3LWI A;  2DTI A;  2K3Y A;  3RES A;  4A4G A;  4OVA A;  4A54 A;  3URG A;  3S3N A;  3HPW A;  3OS0 A;  1YJ9 T;  4J7I A;  3OYE A;  3M59 A;  4IUQ A;  2E1H A;  4XAX B;  2RH2 A;  2HNI A;  5KH6 A;  3PNW C;  2LT1 A;  3QUI A;  2X4W A;  3RUX A;  5GAN 5;  2GF7 A;  5AYF A;  3E9G A;  3M56 A;  3H8Z A;  4EDU A;  4BDZ A;  2CKK A;  3HP9 A;  1KHC A;  4M75 G;  1I8F A;  2RJE A;  2YLB A;  2BUD A;  3JCM X;  3CCV T;  5FU7 C;  2QI2 A;  2GFA A;  4M77 B;  4C92 F;  4BI3 A;  1QVG S;  1PSE A;  3QJY A;  1QVG A;  2VC8 A;  4ZTJ A;  2RA2 A;  4C0D C;  1FX7 A;  5C6S A;  4XTV A;  2P0P A;  1PSF A;  1ZBX A;  4KUI A;  4MMK A;  4N4G A;  4RCC A;  3C4S A;  2AHJ B;  4HKE A;  1VQ8 A;  2OTL T;  1BI0 A;  5CKE A;  4L59 A;  5DM7 R;  4KBM B;  2E64 A;  2QQS A;  2DTH A;  4M77 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...