4C8QF

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qF00
2EWNA 5DY9A 4M7DA 2JN0A 2DKGA 2K57A 2RB6A 1YCYA 5GAMj 4M77D 5GMKi 2FB7A 4MMLA 3AHUA 4HA8A 3JCMP 1WNLA 4N0AC 4F7UF 4EMKB 5GAOr 4PJOF 3QO3A 3RIRA 4XTUA 3V8LA 2E10A 3V7SA 1BIBA 4M7AB 5LJ3j 1MGQA 1JBMA 3JCMe 3JCMb 4EMKC 3L1AA 4M78B 1BIAA 1Y96B 5GAN3 5LJ5e 3BFMA 4M75A 3JCMf 5GAN4 3SWNC 2DTOA 3JB9H 4XU0A 2I2LA 1KQ2A 2VC8A 3FJPA 3JCMV 4JRIA 2YLCA 5GANh 1Y96A 5GANd 1LNXA 2EJ9A 4M77G 3BY7A 4XTXA 4HT9A 5GANg 1U1SA 5LJ3h 2YLBA 2YHTA 3SB2A 2DXUA 2DXTA 4C92F 3V7RA 5CAIA 5GANf 4XQ3A 5GMKe 4M7AF 4M77C 5GMKh 2EJFA 2CGHA 1I5LA 4PJOE 4C8QA 5LJ5g 4M78E 4M7DF 1D3BA 5GAMd 5GANe 1D3BB 2ZGWA 4C92G 4C92A 3BDUA 3JCMg 4EMHA 3PGGA 4Y91A 5GAMf 4QVDA 4XU2A 5GANj 2E64A 4M75G 2DJZA 1U1TA 4F7UA 2DTHA 4M78C 3JCMW 2EAYA 4EMGA 1H641 4J6XA 4C8QC 5LJ5j 4N0AA 3RKYA 3FIFA 4WF2A 4NOYA 5GAOm 3HSBA 1N9SA 4J5YA 4NL2A 4XTVA 4M78D 1B34A 3EFSA 3EFRA 4M75B 1KQ1A 4J6YA 5GAN5 1WPYA 3JB9G 2DEQA 4PJOC 5GAOp 4C92D 5LJ5f 4M75C 3SWNA 4HT8A 4M7AA 3HFOA 4M78G 3RERA 4M75D 4PJOB 2DTIA 1WQ7A 5GAMg 3JB9D 1I8FA 3M4GA 4XTZA 4XTYA 5GAOq 4RCCA 5GMKj 1M8VA 3JCMh 4A53A 3L2ZA 3JB9I 3RUXA 4M75E 5I21A 5GMKl 2VXFA 3VU3C 3SWNB 4M7DE 2E1HA 4X9CA 5LJ3e 4M77A 2DVEA 1M5Q1 2HNIA 5GAN7 4PNOA 4C92C 1B34B 2QTXA 4OP0A 4A54A 4C8QG 4XTWA 4M77F 4M77E 1TH7A 4M7DC 3JCMd 4JUVA 2VXEA 2FYKA 4J6WA 5GAN8 3JB9J 4M7AG 4M78A 1I4K1 5LJ5d 2E65A 5GAOl 2RA2A 4M77B 4C8QD 4M7DD 3INZA 4XU3A 2DZ9A 3QUIA 5LJ5h 4EMKA 3RESA 1JRIA 4C92B 4NL3A 4M7AD 5LJ3d 2RD1A 5LJ3f 3BW1A 4QVCA 3QHSA 1LOJA 4F7UE 4PJOA 4C8QB 2DZCA 4M7DB 5LJ3g 4M7DG 4MMKA 4PJOD 4RCBA 3JCMc 4X9DA 4M7AC 2EJGA 3RKXA 4C92E 5GAOn 3JCMQ 5GAN6 3V7CA 4M75F 4XU1A 5GAMh 5GAN2 4V2SA 2E41A 5GMKm 3JCMX 1WQWA 3GIBA 3RKWA 3QSUA 4M7AE 3V8KA 4JRKA 1HK9A 1I81A 1N9RA 1LJOA 1X01A 4JLIA 3FB9A 4M78F 3V8JA 4DQ2A 4C8QE 4C8QF 5GAMe 3JCMJ 4F7UB 2Y90A 4F7UG 1HXDA 2RM4A 4PJOG 3JB9F 3HFNA
chains in the Genus database with same CATH superfamily
3QYGB 1WNLA 2RQTA 3I55A 2C0OA 2ZPGB 2A7YA 1MGQA 1VQLA 2K2VA 2HSPA 1BU1A 1W4SA 1YWPA 3M58A 3BFMA 1AT1B 2J6FA 5EC7A 4ZGJB 4JRIA 2YLCA 4ELYC 4FYYB 4M77G 3MEVA 2HMAA 5J39A 3L2UA 4J9EA 1SG5A 3QZ5B 1I5LA 1D3BA 2BZYA 3ER0A 1QP2A 3N5BB 4C92G 2FPEA 5KYUB 5GAMf 4CRIA 2ROLA 2DAQA 2K7AA 2KBTA 3VRYA 4EMGA 1T0JA 1H641 1VQ8T 1KD1C 3RKYA 4E7KA 4KGVB 4M78D 2YSQA 4F14A 1OULA 2X3XD 1FMVA 2LJ3A 4WCIA 4K11A 4L6V5 2YUNA 3TQ7P 1NYFA 5J26A 3PIOA 3JCMh 4A53A 2DX1A 4FW2A 5A0GA 2LQNA 2RQWA 4E7IA 1VQMQ 4A54A 1PSFA 2L5QA 5IN1A 2VXEA 3OY9A 4J9GA 2NLUA 3MEAA 4M77B 4L59A 2YRCA 3E9GA 4EMKA 1JRIA 4BACA 2RQUA 3OYKA 2KK4A 4MMKA 3G1JA 4M7AC 1WIEA 5CKFA 3X26B 3ULRB 2KXCA 3HRUA 2AIRB 2QTVA 3CCVT 2EQUA 2QGGA 2NUTB 4A4EA 1N9RA 1ZSZB 3MP8A 4JLIA 2L3QA 4ZGEB 3GOXA 1U3OA 2AT1B 3G6EQ 3D7SB 4F7UF 4MDWA 4OB1B 4R55A 4Z89A 2J7IA 2L3RA 4EPCA 1VQ4T 1X69A 4XU0A 3MO8A 2C0IA 3VS0A 1WXBA 3LYIA 5LJ3h 1G3WA 1KSWA 3GP8A 1K8AR 1Q7YU 3EG2A 1HJDA 2CT3A 1TUCA 4C92A 4OMFB 2E3HA 4J83A 4J6XA 3H0IA 4C8QC 3I56A 2NUPB 3FIFA 3PIPA 3ASKA 2L3PA 2CZ6B 2NUPA 3EFRA 2J06A 1KQ1A 4NS5A 4RTZA 2A28A 3S3OA 4IIMA 3CCVQ 2XG8D 4FW1A 2ABLA 2LQ8A 2HDAA 1XNIA 1GRIA 1K8AU 5I21A 2DYBA 4OGCA 3G4SQ 2QA4Q 2LCCA 2K6DA 1GFDA 1PRLC 2DE0X 1B07A 1KIKA 1OZ2A 4DBQA 2EIFA 2RQVA 3I55Q 4M7DD 5L8RE 3X28B 4JZ4A 4NL3A 2KDSA 3OYYA 4J9FA 4M4ZA 3M56A 4A4GA 4LDUA 1WHJA 1YJWA 2A37A 4IUTA 1QCFA 2GTOA 2K79A 1PKTA 3H0FA 3MEUA 1MNEA 2JNGA 2DJQA 2K3XA 1Q7YC 3EFOA 3CCEA 3WVEB 2RJFA 3CCSQ 2Y90A 1XJWB 1Q82R 3EG3A 1K1ZA 2OX7A 2RB6A 4M77D 1VQ4Q 2FB7A 4HCCA 4EMKB 1RADB 1M4ZA 4XTUA 2A0FB 1IGQA 2E5QA 1VQ9A 2YXYA 3M4YA 4RG2A 1VQ7Q 2GBQA 3JCMf 2E12A 2PVOB 1D1CA 3JCMV 3CMAQ 1N8RU 4BE2A 4HT9A 3G7ZA 3FLGA 5HK3A 3Q1JA 4Z02A 1I07A 2CP7A 4M77C 3CCET 1UHFA 2KY9A 2XDBA 4C8QA 3CD6A 1QVFS 2JS0A 4JJDA 1MMNA 1SRMA 3JCMg 1PC0A 4XU2A 1YI2A 2GGRA 4XK8E 1KQSP 1VQ5Q 1ABOA 1KQSS 2GNCA 2CUBA 2DD4A 3CXCP 2FZKB 3VYGA 1Q7YR 1N8RR 4XTVA 2K5IA 3NPFA 2LJ1A 4OF1A 2F2VA 1M90R 3CEYA 2Z0WA 2PZ1A 1AOJA 1RACB 5CO7A 5GAN7 4C0DC 4XAXB 3FJ5A 3M57A 3CCSA 1YITT 3CCLQ 3T9NA 3H41A 2E65A 3GPLA 2X3WD 3RESA 4M7AD 2RD1A 2OTJA 1BBZA 2JTFA 1LOJA 3CMAT 4PJOA 3RMSA 5LJ3g 2BE7D 3TSWA 2GTJA 4LDWA 3ZEHA 4M75F 5GAMh 1Q86U 4OMLA 5KH6A 1Z9ZA 2LC4A 4PLLA 1FX7A 3QDFA 4HVVA 2WSFE 1JEGA 4KRTA 5IHKA 1UB4A 4J8OA 2Y4XA 1BYMA 4RTWA 3OBWA 1NYGA 2RHXA 1UECA 1V76A 2X4WA 3CCQQ 2HKQB 3DB3A 5IXBA 2P0KA 1UFFA 4A4FA 1VYTA 2O4XB 1H3ZA 3REAB 1BIAA 5LJ5e 3UDCA 3G71T 2DTOA 2JXBA 4FYVB 3QWXX 1M90C 5FU6C 1ABQA 4FT4A 1PKSA 2H3JA 5D6YA 1RAFB 2YLBA 1Y57A 4XQ3A 2F2WA 2VV5A 1RLQC 5GMKh 1VQPA 2ENMA 2L0AA 3OYJA 5GAMd 1OOTA 4MZMA 4EMHA 1BCOA 1AEYA 2PNIA 2A08A 2Y4YA 3MHXA 1QMCA 2BKDN 3EG0A 2EAYA 4JS5A 3S3MA 2X4XA 2QGFB 1GCQC 1G5VA 4IUQA 1WHMA 2HEQA 3UWNA 3CBMA 4ATOA 2FPFA 2OTJQ 3CPWA 2XDPA 2EVRA 2EYWA 3HFOA 3CC2T 2L3SA 2DTIA 2DXBA 3QWYA 1Q86R 1R0CB 2CP2A 2H8HA 3L2ZA 3JB9I 1S1NA 2QEXT 3CCLT 4OMOA 5FWBA 2DVEA 1R8OB 1M5Q1 3URGA 3CC7T 1B34B 1I5OB 4OP0A 3MJXA 2O9SA 4XTWA 2KNBB 4M7DC 1H8KA 4BY6B 3QJYA 4GBQA 5DLQE 2DETA 1NJIC 4GY5A 4RUGA 5KYUA 1WJQA 1X6GA 1M1KU 5GJWB 1IZ6A 4M7DB 4N4GA 3RBBB 5FROA 1Q81R 2M0YA 2RJEA 2K3BA 1PSEA 1X6BA 4V2SA 4ZN1A 1IRXA 4RTYA 1YHQA 4UC4A 4YTLA 3QJ6A 4PJNA 4C5IA 4E7HA 2RM4A 4FIBA 2DKGA 3M59A 2KR3A 3TVTA 1YFNA 3UA6A 4PJOF 1PWTA 1WXTA 3HTRA 2RJDA 4M75A 4OMMA 1FMWA 3SWNC 3JB9H 2DILA 1ZUYA 1ZHIA 2MCNA 3CCUA 4XTXA 1YHQT 3BY7A 4LNPA 4A4KA 1RABB 3A1PA 3PT9A 2M02A 2HZYA 1K9MU 1VQ8A 2D8JA 2W0ZA 5FU6B 1VIFA 3QKJA 1CKBA 2DTHA 2CZ0B 4LD9K 4M75B 4J6YA 3JB9G 5KCOA 3P8HA 4PJOC 2DL5A 1EZZB 4ZTJA 3OYAA 1M1GA 1UTIA 4O6JA 1IHVA 4PFPA 3EHRA 1YN8A 3X24B 2AZSA 1AVZC 5AT1B 3M53A 4E7SA 2HBPA 2J6OA 1M2VA 2LCLA 1IB8A 1K73C 4CC2A 1HD3A 3CMET 1ZBXA 4CC3A 3MEWA 3MKDA 1OI1A 5M9OA 2PVDB 5A0LA 1EX4A 4M7DG 1NPPA 5FU7C 1NEBA 2NUZA 2F5TX 3RKWA 2QI2A 1YITA 2FG0A 1VQMT 2K9GA 3H6ZA 1I81A 1OPLA 1FXXA 3J80E 3V8JA 1YJNT 3EGXA 4JPBW 4ZGDB 3S3NA 2D0QB 2KRSA 3VS2A 2QXFA 1UGRB 2HKNA 2RHIA 5GMKi 1PD0A 1YIJQ 3V8LA 3KBGA 4AG1C 1RAHB 2QQ9A 2F1LA 4M78B 4ELZC 2D8HA 2A3LA 5GANd 2VWFA 3C95A 1GCPA 1H92A 1ZBJA 5LJ5g 2ZPBB 5GANe 1SPKA 2YWWA 3OSSC 2DNUA 4LDVA 3HRSA 4C5HA 5GANj 4F7UA 4HKEA 1IREB 3CXCA 3L2QA 2K5FA 4DEXA 4NL2A 4PLIA 4QVZA 1NBEB 3G71A 1MMDA 3CCMT 4Y28E 4C0ZA 4QW2A 1RL2A 2G3RA 5LJ5f 3CMEA 2CDTA 1MHNA 1WQ7A 1KG1A 4XTYA 2HAXA 4RCCA 5GMKj 2F2XA 1KD1R 3VUZA 2VXFA 5KYWA 4M7DE 2CT4A 2E1HA 1K73R 3SD4A 2DFUA 3TREA 4PNOA 4J9BA 2JMCA 4M77F 1VQLQ 3KUFA 4JS4A 3JB9J 2JS2A 2K4YA 3EH1A 3CCQA 2DBMA 1G3SA 2RI5A 2KE9A 3UPUA 2RI3A 2DF6A 3INZA 2KAFA 1LVKA 2X4JA 1BI2A 3X25B 4PJOD 2EGEA 5CKBA 2DRKA 2K5LA 3MCAB 3CC4Q 4LD6A 1UGSB 3JCMQ 1WI7A 4FSSA 2P4RA 1X01A 1K4US 3FB9A 4DQ2A 4F7UB 2WSEE 2HCKA 1YIJA 4J7IA 3ZL7C 5HKCA 2YUOA 2E3IA 2DPPB 1ACMB 3JCMe 2QAZA 4E7ZA 4EMKC 2XHCA 3OYEA 1VQ7T 1PM3A 2EKOA 3UATA 1XOVA 3CQTA 3I56Q 5KCHA 6AT1B 1ZUKA 2JOYA 4C0FA 5GANg 4C92F 4BDZA 1YI2T 2NYSA 1KC8C 3CCJQ 2L89A 3CCVA 2ECZA 4IIOA 2O31A 2XDDA 3CPFA 2HL5C 4OB0B 1M1FA 2RH2A 1RAEB 4E2FB 4NOYA 1VYUA 5I2MA 1B34A 5FLXE 5LL6S 4ANJA 2PUKB 3CCUT 1ZUUA 1G83A 4DBFA 1Y0MA 5CKEA 4M75D 2ED1A 4BI8B 1K9MR 2QG9B 4LDYA 1JXMA 5CCAA 1ZLMA 1VQLT 3VU3C 2RK2A 5CQXA 3H0HA 2CSQA 1PD1A 4PFOA 4JJBA 1YJ9A 4C92C 2B86A 3OS0A 2FRWA 1BB9A 1KFZA 1NPRA 1WGSA 1I4K1 2CH4W 2KSSA 1M2OA 1YJNA 2KVQG 2MWPA 1UEBA 2IPOB 4F7UE 3I56T 2EGCA 3OB9A 3WXMB 5GAOn 2A36A 2GF7A 3LWHA 2XI9A 3VV0A 3TSZA 2LNHB 3E19A 5FRMA 1FWZA 2LZ6B 2V26A 5CK9A 1FMKA 1HK9A 2V1RA 3JAME 3FDRA 1R77A 1UJ0A 2JT4A 4D8KA 3JCMJ 2L2PA 1N6AA 4F7UG 1HXDA 3M0SA 1E6HA 3JSCA 3E9FA 2SRCA 2BZXA 3QO3A 4BE1A 2EYXA 4DBRA 3IQLA 5I2SA 2ROTA 1NE8A 1G2BA 3OS1A 2C06A 3THKA 1VQMA 1SEMA 2ZPEB 2HBWA 2YHTA 1WHGA 3SB2A 2ZPFB 1X6OA 2BUDA 3JV3A 3GNGA 2D6FA 4P5NA 3RMQA 1BCMA 5C0MA 3BDUA 4KUIA 1T3LA 1Q95G 4KGXB 3RR6A 2DVJA 3META 2IVWA 1X2KA 4RTVA 3H8ZA 4N0AA 5IHIA 5D7UA 4L5GA 1ZA1B 1KHCA 2R5AA 1ZQ1A 2DEQA 1UGQB 2EYQA 4CI0C 2EPDA 3UA7A 3GF5A 4DA4A 3JB9D 1M8MA 2KYMA 2DIGA 4CC7A 4M75E 5FW9A 2XICA 5A0DA 1Q86C 3PNWC 1ZSZA 2QTXA 2X4YA 4BUGA 4C5GA 2XU8A 4DEYA 2VASA 5LJ5d 3HKSA 1M90U 3TU4K 1YJWT 2KGTA 2M1HA 2OTJT 1UG1A 2RPNA 2CYZB 4QT7A 4C8QB 1IHWA 2DMOA 3RKXA 4C92E 3QDRB 3JCMX 1S72T 3LGLA 1GXIE 1VQ6A 3CC7Q 8AT1B 2EQJA 3CPWP 2K2MA 1NG2A 2EKHA 2K57A 3AHUA 1BI0A 1VQOT 1UJYA 2KROA 1K9AA 3CD6Q 1RAIB 2E10A 3V7SA 4WTOB 1QQJA 3L1AA 2HL3A 3LH5A 5GAN3 2YRDA 1QCOA 1M27C 2JM8A 3OYHA 3DLMA 2FEIA 1QW1A 1Y96A 3M5AA 3NTKA 1DJ7B 1GFCA 3FRNA 2DYIA 1O9SA 4RTUA 2CGHA 1K73U 2O9VA 1QWEA 1D3BB 1I1JA 2D9TA 3PGGA 5HCKA 1UGVA 2MIOA 1SHGA 3OYFA 3CC2A 4M75G 2DJZA 4HVWA 3M0UA 3ZBDA 1M3BA 5GAOm 1ZX6A 1WPYA 2E6ZA 1AWOA 3F70A 5J3BA 2EYZA 2JUFA 4LUEA 3M4GA 4PK4A 1NLOC 2VB6A 3PVQA 4F04B 3CCQT 2COYA 1W2BP 2OJ2A 3U23A 1RI0A 2GCXA 4BD3A 3LW5E 4M77E 3C4SA 1NJIR 1VQ9Q 1Y7XA 5C6SA 4JUVA 2FYKA 3C94A 3SDZA 4JRPA 1G8XA 3QPHA 2CZ7B 4O5VA 4C92B 1HSQA 2F69A 2QQAA 2P0QA 5LJ3d 2QASA 3L2WA 2LCSA 5D6WA 4Q5WA 3EG9B 3NHNA 3JCMc 1VQPQ 1X75C 4X9DA 2KQWA 4FT2A 1B3QA 3I5RA 3CCRA 3I5SA 1MV0B 3KXTA 5KYYB 3E2UA 2VVKA 3NMZC 2EQIA 4BE0A 4VUBA 4M7DA 2KRMA 1YCYA 3A5ZB 1D1BA 4OMPA 2KYBA 2EQKA 1X27A 1SHFA 1U8RA 5HK0A 2HQHA 5KYXA 5I11A 3OBYA 1Y96B 2LP5A 3I35A 2NUTA 3M0PA 1VQKA 3UF4A 2KT8A 1QP3A 1OQKA 1JJ2P 1TUGB 2I2LA 1QVFP 1TSFA 2VC8A 2ZZDA 5GAN2 1K9MC 3EGDA 2R58A 2OTLA 2MAMA 3AT1B 1KK7A 3CC2Q 2QDLA 2CP6A 2R57A 4Y91A 4E47A 1GL5A 1SSFA 1PNJA 3EFOB 4J7FA 5LJ5j 2BE9B 1N9SA 1JJ2A 4D6WA 3EFSA 8ATCB 1VQKT 1VQ5T 1J3TA 3OQ5A 4RTXA 4M75C 4RG8A 1OYXA 4M78G 1VUBA 2WSCE 1I8FA 2XK0A 4IKFA 3C0CA 1SRLA 2DD5A 1XQHA 1VQ4A 5KYYA 2M16A 2V8KA 1M3AA 2QQBA 2E70A 5GJVB 1QVGA 4II1A 1PRMC 2E6NA 2IIMA 4J9IA 1JJ2S 2MPXC 4QKUA 1W1FA 1YHQQ 4GLMA 1W70A 3CCMQ 4RKUE 3EG9A 2P4TA 3A98A 2CP0A 2V8JA 2DO3A 4FYXB 1WLPB 2DZCA 4IUVA 5IXFA 1G3TA 1G3YA 3OW2A 4HCBA 1X2QA 2RMOA 4X1VA 1FYNA 2JTMA 1K8AC 2MYSA 3G6ET 4JJNK 3QSUA 1XTDA 4QQDA 1VIEA 1RI9A 4PJOG 3PTAA 2KXDA 1N8RC 3OYBA 3J7AF 2HSEB 2FHDA 4MMLA 2ZCFB 1D0XA 5GAOr 1OX8A 3PMIA 1UDLA 2CUDA 4JDSA 1WJRA 1C1AA 1SSHA 1A0NB 2L8DA 1E7OA 2RF0A 3ZFJA 2HD0A 5CR2A 2J6KA 2NWMA 2YDLA 4LE9A 7AT1B 2IG0A 5GANh 3GLXA 4ME7A 4M7AF 4BI3A 1N27A 2YRVA 4M7DF 2MWOA 4M78E 5IT9E 3DKMA 3CCJT 3CXCS 1Y71A 1EFNA 3CMEQ 1VQNQ 2LX7A 3MPUB 1OV3A 2E64A 2DK3A 2QYZA 3OYIA 2J05A 4KUDK 4EIKA 3OS5A 2AHJB 4J5YA 2CKKA 1Q82C 1YNZA 5ECAA 3SFMA 2RNAA 5GAOp 1BK2A 2EYYA 1ZSZC 1IGUA 2H3EB 2M9UA 2GFAA 5CKHA 3SHWA 3A8GB 3SWNB 4M77A 1T0HA 2LT1A 2QEXQ 4DBHA 2E5KA 3JCMd 4BI4A 4FU6A 4B9WA 1PCXA 4PL6A 2XMFA 3VRZA 5AYFA 1JB0E 2KEAA 4FM4B 1JO8A 2RHYA 3EGDB 3OYCA 2OAWA 5FU7B 3MP6A 4AFUC 4RTTA 5GAN6 1YP5A 2E4HA 1X43A 3V8KA 5FWCA 3VS7A 5IAYA 4C8QE 2HQXA 5KYXB 3G4SA 2QA4A 1M1KR 2EWNA 3BDLA 3NTHA 2KMTA 2DERA 2JZ2A 3SEMA 3FEOA 1BIBA 5LJ3j 2AKKA 4MDXA 3CBOA 3VS4A 2LJ0A 1WYXA 1QKXA 2JTEA 4A4HA 3QBYA 3LWIA 2JJ9A 4PJJA 1KC8U 1M1KC 5IH2A 4QQGA 3PMTA 1M9SA 2ZGWA 4OVAA 1E6GA 1TU0B 3JCMW 1AD5A 1NLPC 1UHCA 3UT1A 1C6VX 3TEEA 1UUEA 2FO0A 2PUOB 3CC4A 3RNJA 4IURA 4M7AA 2M51A 1MMAA 3ME9A 1F1BB 4C0GA 2M0OA 4XTZA 2OTLT 3VS1A 5I22A 4C0DB 2LNVA 1D0YA 1M30A 2PU9B 3OMCA 2O01E 2XD0A 2CREA 4KULA 1AHJB 5A2QE 1WXUA 3QZ9B 3OYDA 3P8DA 2P0PA 4MZPA 2AK5A 1AWWA 1Q82U 1YJWQ 4XU3A 3A8MB 1YI2Q 1VOMA 1P92A 2FZGB 1KHIA 5LJ3f 3BW1A 4QVCA 3QHSA 2B8AA 4HCKA 4BB7A 1KD1U 3H9NA 3OYGA 2D1XA 4KGZB 1VQ6Q 4FCYA 5KE3A 2BIVA 2FPDA 2EW3A 2VGNA 2E41A 2DL7A 1TOVA 3EGUA 1Q81C 2LT4A 2ZPHB 2XKOC 3QIIA 2RK1A 3PVLA 3JRZA 1I0CA 4LXCA 1W6XA 2JN0A 3HPWA 1YCSB 2DA9A 3OMGA 3JCMP 2RO0A 1YJNQ 4AMCA 3OW2P 1JBMA 3M0RA 3VS5A 1WHLA 3JCMb 3FC3A 4JRQA 4N4IA 1MV3A 1QLYA 3I55T 1Z9QA 2KRNA 4N4HA 1ZA2B 1LCKA 3CCST 1KQ2A 1TUDA 2VUBA 4D8DA 2KI7A 1AWJA 2DXUA 5GANf 3TCJA 4PJOE 3KFVA 1WJSA 3NGPA 3OYMA 4QVDA 1D1AA 4FL6A 3M54A 3P8BB 1EIFA 3HL8A 2G6FX 3CCMA 2DIQA 4WF2A 1TS9A 3CBPA 2BZ8A 1JU5C 2LRQA 5L23A 1NEGA 2QQSA 2LMJA 4EDUA 1MUZA 5GAOq 3I9QA 3CCJA 1M8VA 1Y07A 3PFSA 3NFCA 3HHTB 4OB3B 4X9CA 1NZ9A 2QEXA 2ED0A 2DL4A 1WA7A 4C8QG 4Z88A 3CCEQ 1TG0A 5DM7R 5GAN8 9ATCB 2W10A 3LH0A 2RA2A 4PJMA 1K0SA 1VYVA 4E7JA 1VQ6T 2DZ9A 1VQ5A 2CZ1B 4B6MA 1WFWA 3O8VA 3CCRT 2BTTA 2EQMA 3E1SA 1LJOA 2JW4A 1K76A 1VQNA 1H3HA 1R0BG 5KE2A 4FYWB 1GCQA 4OMQA 3RIRA 4M7AB 4J9HA 3CCLA 3A8LB 1KQSA 1N5ZA 4JJCA 2FZCB 3EAEA 3FJPA 2RN8A 4ZTFA 1GBRA 2GQVA 3LX7A 4J9DA 2HQEA 3G4ST 2QA4T 1WDXA 2DL3A 1D0ZA 4CC4B 4DOVA 2O2OA 1JXOA 3CMAA 1BKBA 5CVIA 1C0MA 2OI3A 2P84A 3QYHB 4R56A 1WHKA 1BI3A 5FRNA 4PFZA 5GAN5 4BY6C 1QVPA 2AZVA 4HT8A 3RERA 5GAMg 1V29B 3DLLA 1VQOQ 3PE0A 3RUXA 1T3SA 1YJ9T 5LJ3e 4E7LA 1JQQA 2RQRA 4AFZC 4TVRA 3M9QA 1SKUB 2FL7A 1QVFA 2ATCB 4ESRA 4M78A 1S72Q 4BDYA 3DB4A 3CCRQ 5GAOl 4GLKA 2RJCA 4JZ3A 4AFSC 1QKWA 2MMPA 2KT1A 4PKCC 4RMOA 1K0XA 2DL8A 4LN2A 3CD6T 3V7CA 4C5EA 4XU1A 3VKIA 4AFQC 5GMKm 5CKDA 2LDMA 4A63B 3GIBA 2COWA 2VYTA 4ZN3A 2DEUA 1SF9A 4C8QF 3LLRA 5GAMe 4HXJA 4LUDA 3HFNA 2CH4A 5DY9A 4KBMB 5GAMj 2EBPA 4HA8A 4HVUA 4AG2C 5D6XA 1OZ3A 4DOWA 4X34A 2DRMA 1CKAA 2O88A 1RAGB 1CSKA 5GAN4 3WVDB 1AZGB 1VQ9T 2C0TA 1YJ9Q 3VUBA 1LNXA 2EJ9A 3CC7A 1ARKA 1BI1A 2QK0A 3V7RA 3VS3A 5GMKe 1YWOA 4OMNA 1M3CA 2PQWA 4KH1B 2AKLA 2ESWA 3A8HB 1VQNT 1PHTA 2JM9A 3X20B 1U1TA 3S6WA 1YITQ 1NM7A 3O5ZA 2SEMA 1QWFA 4B9XA 2V1QA 1S72A 2VGMA 2PTKA 1VQPT 2JMAA 2COZA 2QQRA 2OAUA 4C92D 5KYWB 4QQ6A 2DM1A 1RUWA 4PJOB 2X9HA 1VQOA 2X35A 2CP3A 2LTOA 2YT6A 5GMKl 5CQYA 1V1CA 2CSIA 1D09B 4OGEA 1Q81U 2WACA 2MK5A 2RHUA 1QCNA 2MF2A 1U5SA 1TH7A 1O75A 3M0TA 4J6WA 4KH0B 1WX6A 1GBQA 2MOXA 1MMGA 5HY6A 1TXQA 2LQWA 3C12A 3CC4T 3QUIA 5LJ5h 1ZSGA 1UE9A 4ZNXA 2F5KA 4F17A 1B7TA 2GFUA 2EJGA 3G71Q 4IUPA 1W2BS 3L42A 4KT0E 4IUUA 3EG1A 4M7AE 2XIDA 3EHQA 1VQKQ 4AT1B 4M78F 1TTHB 3JB9F 2LVMA 1UGPB 2I0NA 3GNFB 2FRYA 5IHNA 3OA6A 4N0AC 2LQKA 2V8IA 4J9CA 2PVGB 5KYNA 2RI2A 3EGXB 3RDVA 2X51A 3EH2A 1HYOA 4Z8AA 3QG1A 1TWBA 1VQ7A 2LX9A 5CIUA 3LGFA 2QDYB 3VJPA 1U1SA 4HCZA 3QXEB 3BE3A 3M55A 2DXTA 5CAIA 2EJFA 3HRTA 1OU8A 2CP5A 5EG2A 4FSXA 1OX9A 3OSVA 3GBQA 4M78C 3R6OA 1IXDA 1QVGP 3CCUQ 3HSBA 4JLGA 1WHHA 2GQIA 2DLPA 2ZPIB 4MZTA 1U06A 1M2VB 1VA7A 2MI6A 2FVUA 1OEBA 3A8OB 1IO6A 2O4XA 1QVGS 1VQ8Q 3VYHB 3SWNA 1WZOA 3VS6A 3J81E 2YUPA 1YIJT 3HP9A 1KJWA 2HNIA 1LPLA 1AWXA 2DXCA 1RAAB 3R6NA 2DBKA 5DLOA 4PJLA 3OW2S 4M7AG 1YBYA 3OYNA 3OYLA 1MNDA 1OPKA 4C8QD 3L2VA 4E6RA 2JVVA 2D0NA 1PG5B 3NTIA 1W2BA 4ORZA 3CPWS 3G6EA 4RCBA 4LDXA 4Y92A 2EGAA 2OTLQ 2VKNA 2ZAEA 2R5MA 3L2RA 4R0KA 1WQWA 3MP1A 2CS7A 2RHZA 2K3YA 4JRKA 4F16A 1AZEA 1RLPC 4OB2B 1NJIU 3OS2A 1KC8R 2EFIA 2YUQA 3M0QA 3REBB 1OU9A
chains in the Genus database with same CATH topology
3QYGB 2JN0A 2DKGA 2K57A 3HPWA 3M59A 3AHUA 1BI0A 3OMGA 3JCMP 2RO0A 1WNLA 3I55A 1VQOT 5FRNA 4PJOF 2ZPGB 2A7YA 2E10A 3V7SA 1MGQA 1JBMA 2K2VA 3JCMb 4JRQA 3FC3A 1VQLA 3L1AA 4N4IA 1W4SA 5GAN3 3M58A 3I55T 2RJDA 3BFMA 4M75A 4N4HA 3SWNC 3JB9H 3CCST 4ZGJB 3OYHA 1KQ2A 3DLMA 1ZHIA 4JRIA 2YLCA 1QW1A 1Y96A 4ELYC 4XTXA 2VUBA 3M5AA 3BY7A 3MEVA 4M77G 5J39A 3CCUA 1YHQT 3NTKA 3L2UA 1DJ7B 2DXUA 4A4KA 5GANf 3FRNA 1O9SA 3TCJA 2CGHA 3QZ5B 1K73U 1I5LA 4PJOE 3PT9A 1D3BA 1K9MU 3ER0A 3N5BB 1QP2A 1VQ8A 1D3BB 4C92G 1WJSA 2D9TA 3OYMA 3PGGA 5FU6B 5GAMf 4QVDA 1VIFA 4FL6A 3CC2A 3OYFA 3QKJA 4M75G 2DJZA 4CRIA 2DTHA 2DAQA 4EMGA 3M54A 1H641 1VQ8T 3P8BB 1EIFA 3HL8A 3RKYA 3ZBDA 3CCMA 1KD1C 2DIQA 4WF2A 5GAOm 4E7KA 3CBPA 4M78D 2CZ0B 4LD9K 4M75B 4J6YA 3JB9G 1WPYA 2E6ZA 5KCOA 3F70A 3P8HA 4ZTJA 2LRQA 4PJOC 4L6V5 1M1GA 3OYAA 4O6JA 5J3BA 2QQSA 2JUFA 5J26A 4EDUA 3M4GA 5GAOq 3PIOA 3CCJA 1M8VA 1Y07A 3JCMh 4A53A 3X24B 3CCQT 3M53A 3PFSA 2HBPA 3NFCA 3HHTB 4OB3B 4X9CA 1NZ9A 1RI0A 2GCXA 5A0GA 2QEXA 4E7IA 2LCLA 4BD3A 3LW5E 4A54A 4C8QG 4M77E 3C4SA 1PSFA 2L5QA 1K73C 1Y7XA 5C6SA 4JUVA 5IN1A 2FYKA 2VXEA 5DM7R 5GAN8 3OY9A 3C94A 2NLUA 3CMET 1ZBXA 3SDZA 3LH0A 3MEWA 3MEAA 1OI1A 2RA2A 4M77B 4L59A 4JRPA 3QPHA 2CZ7B 3E9GA 5M9OA 4O5VA 2DZ9A 4E7JA 1VQ6T 2PVDB 4EMKA 1VQ5A 1JRIA 4C92B 2F69A 2QQAA 2P0QA 5A0LA 5LJ3d 4BACA 3L2WA 2CZ1B 3OYKA 2KK4A 5D6WA 4Q5WA 1NPPA 4MMKA 5FU7C 3O8VA 3JCMc 3CCRT 4M7DG 1X75C 4X9DA 4M7AC 5CKFA 2KQWA 3X26B 4FT2A 2F5TX 3HRUA 2EQMA 3E1SA 3CCVT 2EQUA 3RKWA 3CCRA 2QI2A 1YITA 1VQMT 3H6ZA 4A4EA 1I81A 1N9RA 1LJOA 3MP8A 1FXXA 4JLIA 3J80E 3V8JA 4ZGEB 1VQNA 1YJNT 3KXTA 4ZGDB 3GOXA 4M7AF 3S3NA 4BE0A 2D0QB 4VUBA 4M7DA 1YCYA 1UGRB 2QXFA 2RHIA 3A5ZB 5KE2A 5GMKi 2EQKA 4F7UF 3RIRA 3V8LA 4MDWA 1U8RA 5HK0A 4M7AB 4OB1B 3KBGA 4R55A 3CCLA 3A8LB 3OBYA 2QQ9A 1KQSA 4M78B 1Y96B 2L3RA 4EPCA 1VQ4T 1VQKA 4ELZC 1QP3A 4XU0A 2I2LA 2VC8A 3EAEA 3FJPA 3MO8A 2ZZDA 2A3LA 5GANd 3C95A 3LYIA 5LJ3h 4ZTFA 1G3WA 5GAN2 3GP8A 1K9MC 2GQVA 3LX7A 2R58A 1Q7YU 2HQEA 5LJ5g 2ZPBB 3G4ST 2QA4T 2OTLA 5GANe 2MAMA 3OSSC 4C92A 2R57A 4Y91A 4E47A 1SSFA 3HRSA 4LDVA 4C5HA 4DOVA 4OMFB 4F7UA 5GANj 4HKEA 1IREB 4J7FA 4J83A 5LJ5j 4J6XA 4C8QC 3I56A 3CXCA 3CMAA 3L2QA 1BKBA 2K5FA 3FIFA 5CVIA 3PIPA 1N9SA 1JJ2A 4NL2A 4PLIA 3QYHB 4QVZA 3G71A 3ASKA 3EFSA 1BI3A 2CZ6B 3EFRA 4NS5A 1KQ1A 4D6WA 4R56A 3CCMT 1VQ5T 5GAN5 1VQKT 4Y28E 4C0ZA 3S3OA 3OQ5A 4QW2A 4BY6C 1RL2A 2G3RA 4M75C 4RG8A 5LJ5f 3CMEA 1QVPA 4HT8A 1OYXA 4M78G 1VUBA 2XG8D 3RERA 2WSCE 1MHNA 1WQ7A 5GAMg 1I8FA 1V29B 2LQ8A 2XK0A 4XTYA 3DLLA 2HAXA 4IKFA 1KG1A 1XNIA 4RCCA 5GMKj 3RUXA 3VUZA 1K8AU 5I21A 4OGCA 2VXFA 2DD5A 4M7DE 2E1HA 2LCCA 5LJ3e 1YJ9T 1XQHA 4E7LA 3SD4A 1VQ4A 2M16A 2V8KA 4TVRA 2QQBA 2E70A 3M9QA 1QVGA 3TREA 4PNOA 2FL7A 1QVFA 4M77F 4II1A 1OZ2A 2E6NA 3KUFA 4JS4A 3JB9J 1JJ2S 4M78A 2K4YA 3CCQA 2EIFA 4BDYA 3DB4A 1G3SA 5GAOl 2RI5A 4GLKA 2RI3A 3UPUA 4RKUE 4M7DD 2RJCA 3INZA 5L8RE 3X28B 2KAFA 2MMPA 2P4TA 2X4JA 1BI2A 4NL3A 4PKCC 4RMOA 2V8JA 2KDSA 2DO3A 3OYYA 4IUVA 2DZCA 3X25B 3M56A 4A4GA 4PJOD 4LDUA 5CKBA 2K5LA 1G3TA 3MCAB 1YJWA 4IUTA 1G3YA 4LD6A 1UGSB 3JCMQ 3OW2A 4HCBA 3CD6T 3V7CA 4C5EA 4XU1A 3VKIA 5GMKm 2JTMA 2LDMA 5CKDA 1K8AC 3GIBA 3G6ET 4JJNK 3QSUA 3MEUA 1XTDA 2JNGA 2VYTA 1X01A 3FB9A 2K3XA 4ZN3A 1Q7YC 3CCEA 3WVEB 2RJFA 4DQ2A 4QQDA 4C8QF 5GAMe 3LLRA 1VIEA 4F7UB 2Y90A 2WSEE 4PJOG 3PTAA 3HFNA 1N8RC 5DY9A 3OYBA 2RB6A 4KBMB 3J7AF 1YIJA 5GAMj 4M77D 2FB7A 2FHDA 4MMLA 1M1KU 2ZCFB 4HA8A 4HCCA 4J7IA 5GAOr 4EMKB 5HKCA 1M4ZA 4XTUA 3PMIA 5D6XA 4JDSA 1OZ3A 2DPPB 2E5QA 1WJRA 4DOWA 3JCMe 1VQ9A 4X34A 3M4YA 4RG2A 4EMKC 2XHCA 3OYEA 2L8DA 1VQ7T 2EKOA 3JCMf 5GAN4 2E12A 3WVDB 2PVOB 3ZFJA 2HD0A 1XOVA 1VQ9T 5CR2A 3JCMV 5GANh 3VUBA 2IG0A 1LNXA 2EJ9A 3GLXA 5KCHA 3CC7A 4BE2A 3G7ZA 2JOYA 4C0FA 5GANg 4HT9A 3FLGA 4ME7A 5HK3A 4C92F 1BI1A 3Q1JA 4Z02A 3V7RA 4BDZA 5GMKe 4BI3A 1N27A 2YRVA 4M77C 1YI2T 3CCET 3CD6A 1KC8C 2KY9A 2XDBA 4C8QA 4M7DF 2MWOA 4M78E 5IT9E 3DKMA 3CCJT 1QVFS 3CXCS 1Y71A 2L89A 2PQWA 3JCMg 3A8HB 3CCVA 2QA4A 1VQNT 4XU2A 1YI2A 2XDDA 3CPFA 2E64A 2DK3A 3X20B 1U1TA 3S6WA 4OB0B 3OYIA 1M1FA 4XK8E 2RH2A 4KUDK 4B9XA 1KQSS 3OS5A 1S72A 2DD4A 2VGMA 2AHJB 4NOYA 4J5YA 3VYGA 2CKKA 1VQPT 4XTVA 5I2MA 1Q82C 1B34A 5FLXE 2K5IA 3SFMA 5LL6S 2QQRA 2OAUA 2PUKB 3CCUT 5GAOp 4C92D 4OF1A 4QQ6A 3CEYA 5CKEA 4M75D 4BI8B 4PJOB 1VQOA 2M9UA 2X35A 2GFAA 5CKHA 2LTOA 4LDYA 3A8GB 5CCAA 5GMKl 1VQLT 3VU3C 3SWNB 2RK2A 4OGEA 5CQYA 5CQXA 4M77A 1Q81U 5CO7A 2WACA 4C0DC 5GAN7 4XAXB 2RHUA 1YJ9A 2LT1A 4C92C 2MF2A 1YITT 3M57A 3CCSA 3OS0A 1TH7A 1O75A 3JCMd 4BI4A 4J6WA 4FU6A 3T9NA 1NPRA 4B9WA 1WGSA 1I4K1 2E65A 3GPLA 5HY6A 4PL6A 2KSSA 3C12A 3CC4T 1YJNA 3QUIA 5AYFA 5LJ5h 3RESA 4M7AD 1JB0E 2KVQG 2MWPA 2RD1A 1UEBA 2OTJA 2JTFA 4F7UE 1LOJA 4FM4B 3I56T 3CMAT 3RMSA 2F5KA 5LJ3g 4PJOA 3OB9A 3WXMB 2RHYA 2GFUA 4LDWA 3ZEHA 3OYCA 2EJGA 5GAOn 2GF7A 3LWHA 4IUPA 1W2BS 3L42A 2XI9A 3MP6A 4KT0E 5FU7B 3VV0A 5GAN6 4M75F 3E19A 5GAMh 4IUUA 1Q86U 5FRMA 1FWZA 5CK9A 4M7AE 3V8KA 2XIDA 1HK9A 5KH6A 2LC4A 4PLLA 1FX7A 5IAYA 3JAME 3FDRA 4M78F 4C8QE 2WSFE 2HQXA 3JCMJ 1N6AA 4F7UG 1HXDA 1UB4A 3JB9F 2LVMA 3JSCA 4J8OA 3G4SA 1UGPB 2EWNA 3GNFB 2Y4XA 3BDLA 3E9FA 3OA6A 1BYMA 3OBWA 3NTHA 2RHXA 2KMTA 4N0AC 2X4WA 2JZ2A 2LQKA 3DB3A 3QO3A 2V8IA 2P0KA 4BE1A 4A4FA 3FEOA 1BIBA 5LJ3j 2PVGB 2RI2A 2O4XB 4MDXA 1H3ZA 5I2SA 3CBOA 1BIAA 5LJ5e 1NE8A 3QG1A 4A4HA 3UDCA 3G71T 2DTOA 1M90C 3QBYA 1VQ7A 5FU6C 2LX9A 5CIUA 4FT4A 3LGFA 3OS1A 2C06A 1VQMA 3LWIA 2QDYB 2H3JA 3VJPA 1KC8U 5D6YA 2ZPEB 1U1SA 4HCZA 2YLBA 3QXEB 1M1KC 2YHTA 3SB2A 3M55A 2DXTA 5CAIA 2ZPFB 4XQ3A 1X6OA 2BUDA 2VV5A 5GMKh 1VQPA 2EJFA 3GNGA 3HRTA 4QQGA 3OYJA 5GAMd 3PMTA 2D6FA 4P5NA 3RMQA 1M9SA 2ZGWA 4MZMA 4OVAA 3BDUA 4EMHA 5C0MA 5EG2A 4KUIA 4FSXA 2Y4YA 3OSVA 3MHXA 3JCMW 3META 2IVWA 4M78C 2BKDN 3R6OA 2EAYA 4JS5A 3UT1A 3S3MA 2X4XA 3H8ZA 4N0AA 3HSBA 4L5GA 4JLGA 1G5VA 3TEEA 4IUQA 2ZPIB 4MZTA 3CC4A 1KHCA 2PUOB 2R5AA 3UWNA 1ZQ1A 2DEQA 2FVUA 2MI6A 3CBMA 1UGQB 2EYQA 3A8OB 4CI0C 4ATOA 2O4XA 1QVGS 3CPWA 3VYHB 2XDPA 3SWNA 4IURA 3CC2T 3HFOA 4M7AA 3GF5A 2DTIA 2DXBA 3ME9A 4C0GA 4DA4A 3JB9D 2M0OA 4XTZA 3J81E 1N8RU 1YIJT 2DIGA 2OTLT 3L2ZA 3JB9I 4M75E 2QEXT 4C0DB 3CCLT 3HP9A 2LNVA 2DVEA 1R8OB 1M5Q1 2HNIA 2XICA 5A0DA 2PU9B 3OMCA 2O01E 1Q86C 2XD0A 3PNWC 3URGA 3CC7T 4KULA 2DXCA 1B34B 1AHJB 2QTXA 4OP0A 2X4YA 4XTWA 5A2QE 4BUGA 3QZ9B 5DLOA 4M7DC 3OYDA 3OW2S 4C5GA 4M7AG 2XU8A 3P8DA 1YBYA 2P0PA 4MZPA 3OYNA 3OYLA 4BY6B 3QJYA 5LJ5d 3HKSA 1M90U 4C8QD 3TU4K 3L2VA 1YJWT 1Q82U 5DLQE 2M1HA 4XU3A 3A8MB 1NJIC 4GY5A 1P92A 2JVVA 2OTJT 1WJQA 1KHIA 3NTIA 3BW1A 5LJ3f 3QHSA 4QVCA 2B8AA 2CYZB 1IZ6A 4BB7A 4C8QB 3G6EA 3CPWS 1W2BA 1KD1U 4RCBA 4M7DB 4LDXA 4N4GA 5FROA 2RJEA 3RKXA 4C92E 3OYGA 5KE3A 2BIVA 1PSEA 2R5MA 3QDRB 2VGNA 4V2SA 3L2RA 2E41A 3JCMX 1S72T 1WQWA 3LGLA 4ZN1A 3MP1A 2CS7A 1YHQA 1Q81C 1VQ6A 2RHZA 2LT4A 1GXIE 2K3YA 4JRKA 2ZPHB 2EQJA 1NJIU 4OB2B 4UC4A 2XKOC 4YTLA 3OS2A 3QJ6A 2EFIA 2RK1A 3QIIA 2RM4A 3JRZA 4C5IA 4E7HA 4FIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWN A;  5DY9 A;  4M7D A;  2JN0 A;  2DKG A;  2K57 A;  2RB6 A;  1YCY A;  5GAM j;  4M77 D;  5GMK i;  2FB7 A;  4MML A;  3AHU A;  4HA8 A;  3JCM P;  1WNL A;  4N0A C;  4F7U F;  4EMK B;  5GAO r;  4PJO F;  3QO3 A;  3RIR A;  4XTU A;  3V8L A;  2E10 A;  3V7S A;  1BIB A;  4M7A B;  5LJ3 j;  1MGQ A;  1JBM A;  3JCM e;  3JCM b;  4EMK C;  3L1A A;  4M78 B;  1BIA A;  1Y96 B;  5GAN 3;  5LJ5 e;  3BFM A;  4M75 A;  3JCM f;  5GAN 4;  3SWN C;  2DTO A;  3JB9 H;  4XU0 A;  2I2L A;  1KQ2 A;  2VC8 A;  3FJP A;  3JCM V;  4JRI A;  2YLC A;  5GAN h;  1Y96 A;  5GAN d;  1LNX A;  2EJ9 A;  4M77 G;  3BY7 A;  4XTX A;  4HT9 A;  5GAN g;  1U1S A;  5LJ3 h;  2YLB A;  2YHT A;  3SB2 A;  2DXU A;  2DXT A;  4C92 F;  3V7R A;  5CAI A;  5GAN f;  4XQ3 A;  5GMK e;  4M7A F;  4M77 C;  5GMK h;  2EJF A;  2CGH A;  1I5L A;  4PJO E;  4C8Q A;  5LJ5 g;  4M78 E;  4M7D F;  1D3B A;  5GAM d;  5GAN e;  1D3B B;  2ZGW A;  4C92 G;  4C92 A;  3BDU A;  3JCM g;  4EMH A;  3PGG A;  4Y91 A;  5GAM f;  4QVD A;  4XU2 A;  5GAN j;  2E64 A;  4M75 G;  2DJZ A;  1U1T A;  4F7U A;  2DTH A;  4M78 C;  3JCM W;  2EAY A;  4EMG A;  1H64 1;  4J6X A;  4C8Q C;  5LJ5 j;  4N0A A;  3RKY A;  3FIF A;  4WF2 A;  4NOY A;  5GAO m;  3HSB A;  1N9S A;  4J5Y A;  4NL2 A;  4XTV A;  4M78 D;  1B34 A;  3EFS A;  3EFR A;  4M75 B;  1KQ1 A;  4J6Y A;  5GAN 5;  1WPY A;  3JB9 G;  2DEQ A;  4PJO C;  5GAO p;  4C92 D;  5LJ5 f;  4M75 C;  3SWN A;  4HT8 A;  4M7A A;  3HFO A;  4M78 G;  3RER A;  4M75 D;  4PJO B;  2DTI A;  1WQ7 A;  5GAM g;  3JB9 D;  1I8F A;  3M4G A;  4XTZ A;  4XTY A;  5GAO q;  4RCC A;  5GMK j;  1M8V A;  3JCM h;  4A53 A;  3L2Z A;  3JB9 I;  3RUX A;  4M75 E;  5I21 A;  5GMK l;  2VXF A;  3VU3 C;  3SWN B;  4M7D E;  2E1H A;  4X9C A;  5LJ3 e;  4M77 A;  2DVE A;  1M5Q 1;  2HNI A;  5GAN 7;  4PNO A;  4C92 C;  1B34 B;  2QTX A;  4OP0 A;  4A54 A;  4C8Q G;  4XTW A;  4M77 F;  4M77 E;  1TH7 A;  4M7D C;  3JCM d;  4JUV A;  2VXE A;  2FYK A;  4J6W A;  5GAN 8;  3JB9 J;  4M7A G;  4M78 A;  1I4K 1;  5LJ5 d;  2E65 A;  5GAO l;  2RA2 A;  4M77 B;  4C8Q D;  4M7D D;  3INZ A;  4XU3 A;  2DZ9 A;  3QUI A;  5LJ5 h;  4EMK A;  3RES A;  1JRI A;  4C92 B;  4NL3 A;  4M7A D;  5LJ3 d;  2RD1 A;  5LJ3 f;  3BW1 A;  4QVC A;  3QHS A;  1LOJ A;  4F7U E;  4PJO A;  4C8Q B;  2DZC A;  4M7D B;  5LJ3 g;  4M7D G;  4MMK A;  4PJO D;  4RCB A;  3JCM c;  4X9D A;  4M7A C;  2EJG A;  3RKX A;  4C92 E;  5GAO n;  3JCM Q;  5GAN 6;  3V7C A;  4M75 F;  4XU1 A;  5GAM h;  5GAN 2;  4V2S A;  2E41 A;  5GMK m;  3JCM X;  1WQW A;  3GIB A;  3RKW A;  3QSU A;  4M7A E;  3V8K A;  4JRK A;  1HK9 A;  1I81 A;  1N9R A;  1LJO A;  1X01 A;  4JLI A;  3FB9 A;  4M78 F;  3V8J A;  4DQ2 A;  4C8Q E;  4C8Q F;  5GAM e;  3JCM J;  4F7U B;  2Y90 A;  4F7U G;  1HXD A;  2RM4 A;  4PJO G;  3JB9 F;  3HFN A; 
#chains in the Genus database with same CATH topology
 3QYG B;  1WNL A;  2RQT A;  3I55 A;  2C0O A;  2ZPG B;  2A7Y A;  1MGQ A;  1VQL A;  2K2V A;  2HSP A;  1BU1 A;  1W4S A;  1YWP A;  3M58 A;  3BFM A;  1AT1 B;  2J6F A;  5EC7 A;  4ZGJ B;  4JRI A;  2YLC A;  4ELY C;  4FYY B;  4M77 G;  3MEV A;  2HMA A;  5J39 A;  3L2U A;  4J9E A;  1SG5 A;  3QZ5 B;  1I5L A;  1D3B A;  2BZY A;  3ER0 A;  1QP2 A;  3N5B B;  4C92 G;  2FPE A;  5KYU B;  5GAM f;  4CRI A;  2ROL A;  2DAQ A;  2K7A A;  2KBT A;  3VRY A;  4EMG A;  1T0J A;  1H64 1;  1VQ8 T;  1KD1 C;  3RKY A;  4E7K A;  4KGV B;  4M78 D;  2YSQ A;  4F14 A;  1OUL A;  2X3X D;  1FMV A;  2LJ3 A;  4WCI A;  4K11 A;  4L6V 5;  2YUN A;  3TQ7 P;  1NYF A;  5J26 A;  3PIO A;  3JCM h;  4A53 A;  2DX1 A;  4FW2 A;  5A0G A;  2LQN A;  2RQW A;  4E7I A;  1VQM Q;  4A54 A;  1PSF A;  2L5Q A;  5IN1 A;  2VXE A;  3OY9 A;  4J9G A;  2NLU A;  3MEA A;  4M77 B;  4L59 A;  2YRC A;  3E9G A;  4EMK A;  1JRI A;  4BAC A;  2RQU A;  3OYK A;  2KK4 A;  4MMK A;  3G1J A;  4M7A C;  1WIE A;  5CKF A;  3X26 B;  3ULR B;  2KXC A;  3HRU A;  2AIR B;  2QTV A;  3CCV T;  2EQU A;  2QGG A;  2NUT B;  4A4E A;  1N9R A;  1ZSZ B;  3MP8 A;  4JLI A;  2L3Q A;  4ZGE B;  3GOX A;  1U3O A;  2AT1 B;  3G6E Q;  3D7S B;  4F7U F;  4MDW A;  4OB1 B;  4R55 A;  4Z89 A;  2J7I A;  2L3R A;  4EPC A;  1VQ4 T;  1X69 A;  4XU0 A;  3MO8 A;  2C0I A;  3VS0 A;  1WXB A;  3LYI A;  5LJ3 h;  1G3W A;  1KSW A;  3GP8 A;  1K8A R;  1Q7Y U;  3EG2 A;  1HJD A;  2CT3 A;  1TUC A;  4C92 A;  4OMF B;  2E3H A;  4J83 A;  4J6X A;  3H0I A;  4C8Q C;  3I56 A;  2NUP B;  3FIF A;  3PIP A;  3ASK A;  2L3P A;  2CZ6 B;  2NUP A;  3EFR A;  2J06 A;  1KQ1 A;  4NS5 A;  4RTZ A;  2A28 A;  3S3O A;  4IIM A;  3CCV Q;  2XG8 D;  4FW1 A;  2ABL A;  2LQ8 A;  2HDA A;  1XNI A;  1GRI A;  1K8A U;  5I21 A;  2DYB A;  4OGC A;  3G4S Q;  2QA4 Q;  2LCC A;  2K6D A;  1GFD A;  1PRL C;  2DE0 X;  1B07 A;  1KIK A;  1OZ2 A;  4DBQ A;  2EIF A;  2RQV A;  3I55 Q;  4M7D D;  5L8R E;  3X28 B;  4JZ4 A;  4NL3 A;  2KDS A;  3OYY A;  4J9F A;  4M4Z A;  3M56 A;  4A4G A;  4LDU A;  1WHJ A;  1YJW A;  2A37 A;  4IUT A;  1QCF A;  2GTO A;  2K79 A;  1PKT A;  3H0F A;  3MEU A;  1MNE A;  2JNG A;  2DJQ A;  2K3X A;  1Q7Y C;  3EFO A;  3CCE A;  3WVE B;  2RJF A;  3CCS Q;  2Y90 A;  1XJW B;  1Q82 R;  3EG3 A;  1K1Z A;  2OX7 A;  2RB6 A;  4M77 D;  1VQ4 Q;  2FB7 A;  4HCC A;  4EMK B;  1RAD B;  1M4Z A;  4XTU A;  2A0F B;  1IGQ A;  2E5Q A;  1VQ9 A;  2YXY A;  3M4Y A;  4RG2 A;  1VQ7 Q;  2GBQ A;  3JCM f;  2E12 A;  2PVO B;  1D1C A;  3JCM V;  3CMA Q;  1N8R U;  4BE2 A;  4HT9 A;  3G7Z A;  3FLG A;  5HK3 A;  3Q1J A;  4Z02 A;  1I07 A;  2CP7 A;  4M77 C;  3CCE T;  1UHF A;  2KY9 A;  2XDB A;  4C8Q A;  3CD6 A;  1QVF S;  2JS0 A;  4JJD A;  1MMN A;  1SRM A;  3JCM g;  1PC0 A;  4XU2 A;  1YI2 A;  2GGR A;  4XK8 E;  1KQS P;  1VQ5 Q;  1ABO A;  1KQS S;  2GNC A;  2CUB A;  2DD4 A;  3CXC P;  2FZK B;  3VYG A;  1Q7Y R;  1N8R R;  4XTV A;  2K5I A;  3NPF A;  2LJ1 A;  4OF1 A;  2F2V A;  1M90 R;  3CEY A;  2Z0W A;  2PZ1 A;  1AOJ A;  1RAC B;  5CO7 A;  5GAN 7;  4C0D C;  4XAX B;  3FJ5 A;  3M57 A;  3CCS A;  1YIT T;  3CCL Q;  3T9N A;  3H41 A;  2E65 A;  3GPL A;  2X3W D;  3RES A;  4M7A D;  2RD1 A;  2OTJ A;  1BBZ A;  2JTF A;  1LOJ A;  3CMA T;  4PJO A;  3RMS A;  5LJ3 g;  2BE7 D;  3TSW A;  2GTJ A;  4LDW A;  3ZEH A;  4M75 F;  5GAM h;  1Q86 U;  4OML A;  5KH6 A;  1Z9Z A;  2LC4 A;  4PLL A;  1FX7 A;  3QDF A;  4HVV A;  2WSF E;  1JEG A;  4KRT A;  5IHK A;  1UB4 A;  4J8O A;  2Y4X A;  1BYM A;  4RTW A;  3OBW A;  1NYG A;  2RHX A;  1UEC A;  1V76 A;  2X4W A;  3CCQ Q;  2HKQ B;  3DB3 A;  5IXB A;  2P0K A;  1UFF A;  4A4F A;  1VYT A;  2O4X B;  1H3Z A;  3REA B;  1BIA A;  5LJ5 e;  3UDC A;  3G71 T;  2DTO A;  2JXB A;  4FYV B;  3QWX X;  1M90 C;  5FU6 C;  1ABQ A;  4FT4 A;  1PKS A;  2H3J A;  5D6Y A;  1RAF B;  2YLB A;  1Y57 A;  4XQ3 A;  2F2W A;  2VV5 A;  1RLQ C;  5GMK h;  1VQP A;  2ENM A;  2L0A A;  3OYJ A;  5GAM d;  1OOT A;  4MZM A;  4EMH A;  1BCO A;  1AEY A;  2PNI A;  2A08 A;  2Y4Y A;  3MHX A;  1QMC A;  2BKD N;  3EG0 A;  2EAY A;  4JS5 A;  3S3M A;  2X4X A;  2QGF B;  1GCQ C;  1G5V A;  4IUQ A;  1WHM A;  2HEQ A;  3UWN A;  3CBM A;  4ATO A;  2FPF A;  2OTJ Q;  3CPW A;  2XDP A;  2EVR A;  2EYW A;  3HFO A;  3CC2 T;  2L3S A;  2DTI A;  2DXB A;  3QWY A;  1Q86 R;  1R0C B;  2CP2 A;  2H8H A;  3L2Z A;  3JB9 I;  1S1N A;  2QEX T;  3CCL T;  4OMO A;  5FWB A;  2DVE A;  1R8O B;  1M5Q 1;  3URG A;  3CC7 T;  1B34 B;  1I5O B;  4OP0 A;  3MJX A;  2O9S A;  4XTW A;  2KNB B;  4M7D C;  1H8K A;  4BY6 B;  3QJY A;  4GBQ A;  5DLQ E;  2DET A;  1NJI C;  4GY5 A;  4RUG A;  5KYU A;  1WJQ A;  1X6G A;  1M1K U;  5GJW B;  1IZ6 A;  4M7D B;  4N4G A;  3RBB B;  5FRO A;  1Q81 R;  2M0Y A;  2RJE A;  2K3B A;  1PSE A;  1X6B A;  4V2S A;  4ZN1 A;  1IRX A;  4RTY A;  1YHQ A;  4UC4 A;  4YTL A;  3QJ6 A;  4PJN A;  4C5I A;  4E7H A;  2RM4 A;  4FIB A;  2DKG A;  3M59 A;  2KR3 A;  3TVT A;  1YFN A;  3UA6 A;  4PJO F;  1PWT A;  1WXT A;  3HTR A;  2RJD A;  4M75 A;  4OMM A;  1FMW A;  3SWN C;  3JB9 H;  2DIL A;  1ZUY A;  1ZHI A;  2MCN A;  3CCU A;  4XTX A;  1YHQ T;  3BY7 A;  4LNP A;  4A4K A;  1RAB B;  3A1P A;  3PT9 A;  2M02 A;  2HZY A;  1K9M U;  1VQ8 A;  2D8J A;  2W0Z A;  5FU6 B;  1VIF A;  3QKJ A;  1CKB A;  2DTH A;  2CZ0 B;  4LD9 K;  4M75 B;  4J6Y A;  3JB9 G;  5KCO A;  3P8H A;  4PJO C;  2DL5 A;  1EZZ B;  4ZTJ A;  3OYA A;  1M1G A;  1UTI A;  4O6J A;  1IHV A;  4PFP A;  3EHR A;  1YN8 A;  3X24 B;  2AZS A;  1AVZ C;  5AT1 B;  3M53 A;  4E7S A;  2HBP A;  2J6O A;  1M2V A;  2LCL A;  1IB8 A;  1K73 C;  4CC2 A;  1HD3 A;  3CME T;  1ZBX A;  4CC3 A;  3MEW A;  3MKD A;  1OI1 A;  5M9O A;  2PVD B;  5A0L A;  1EX4 A;  4M7D G;  1NPP A;  5FU7 C;  1NEB A;  2NUZ A;  2F5T X;  3RKW A;  2QI2 A;  1YIT A;  2FG0 A;  1VQM T;  2K9G A;  3H6Z A;  1I81 A;  1OPL A;  1FXX A;  3J80 E;  3V8J A;  1YJN T;  3EGX A;  4JPB W;  4ZGD B;  3S3N A;  2D0Q B;  2KRS A;  3VS2 A;  2QXF A;  1UGR B;  2HKN A;  2RHI A;  5GMK i;  1PD0 A;  1YIJ Q;  3V8L A;  3KBG A;  4AG1 C;  1RAH B;  2QQ9 A;  2F1L A;  4M78 B;  4ELZ C;  2D8H A;  2A3L A;  5GAN d;  2VWF A;  3C95 A;  1GCP A;  1H92 A;  1ZBJ A;  5LJ5 g;  2ZPB B;  5GAN e;  1SPK A;  2YWW A;  3OSS C;  2DNU A;  4LDV A;  3HRS A;  4C5H A;  5GAN j;  4F7U A;  4HKE A;  1IRE B;  3CXC A;  3L2Q A;  2K5F A;  4DEX A;  4NL2 A;  4PLI A;  4QVZ A;  1NBE B;  3G71 A;  1MMD A;  3CCM T;  4Y28 E;  4C0Z A;  4QW2 A;  1RL2 A;  2G3R A;  5LJ5 f;  3CME A;  2CDT A;  1MHN A;  1WQ7 A;  1KG1 A;  4XTY A;  2HAX A;  4RCC A;  5GMK j;  2F2X A;  1KD1 R;  3VUZ A;  2VXF A;  5KYW A;  4M7D E;  2CT4 A;  2E1H A;  1K73 R;  3SD4 A;  2DFU A;  3TRE A;  4PNO A;  4J9B A;  2JMC A;  4M77 F;  1VQL Q;  3KUF A;  4JS4 A;  3JB9 J;  2JS2 A;  2K4Y A;  3EH1 A;  3CCQ A;  2DBM A;  1G3S A;  2RI5 A;  2KE9 A;  3UPU A;  2RI3 A;  2DF6 A;  3INZ A;  2KAF A;  1LVK A;  2X4J A;  1BI2 A;  3X25 B;  4PJO D;  2EGE A;  5CKB A;  2DRK A;  2K5L A;  3MCA B;  3CC4 Q;  4LD6 A;  1UGS B;  3JCM Q;  1WI7 A;  4FSS A;  2P4R A;  1X01 A;  1K4U S;  3FB9 A;  4DQ2 A;  4F7U B;  2WSE E;  2HCK A;  1YIJ A;  4J7I A;  3ZL7 C;  5HKC A;  2YUO A;  2E3I A;  2DPP B;  1ACM B;  3JCM e;  2QAZ A;  4E7Z A;  4EMK C;  2XHC A;  3OYE A;  1VQ7 T;  1PM3 A;  2EKO A;  3UAT A;  1XOV A;  3CQT A;  3I56 Q;  5KCH A;  6AT1 B;  1ZUK A;  2JOY A;  4C0F A;  5GAN g;  4C92 F;  4BDZ A;  1YI2 T;  2NYS A;  1KC8 C;  3CCJ Q;  2L89 A;  3CCV A;  2ECZ A;  4IIO A;  2O31 A;  2XDD A;  3CPF A;  2HL5 C;  4OB0 B;  1M1F A;  2RH2 A;  1RAE B;  4E2F B;  4NOY A;  1VYU A;  5I2M A;  1B34 A;  5FLX E;  5LL6 S;  4ANJ A;  2PUK B;  3CCU T;  1ZUU A;  1G83 A;  4DBF A;  1Y0M A;  5CKE A;  4M75 D;  2ED1 A;  4BI8 B;  1K9M R;  2QG9 B;  4LDY A;  1JXM A;  5CCA A;  1ZLM A;  1VQL T;  3VU3 C;  2RK2 A;  5CQX A;  3H0H A;  2CSQ A;  1PD1 A;  4PFO A;  4JJB A;  1YJ9 A;  4C92 C;  2B86 A;  3OS0 A;  2FRW A;  1BB9 A;  1KFZ A;  1NPR A;  1WGS A;  1I4K 1;  2CH4 W;  2KSS A;  1M2O A;  1YJN A;  2KVQ G;  2MWP A;  1UEB A;  2IPO B;  4F7U E;  3I56 T;  2EGC A;  3OB9 A;  3WXM B;  5GAO n;  2A36 A;  2GF7 A;  3LWH A;  2XI9 A;  3VV0 A;  3TSZ A;  2LNH B;  3E19 A;  5FRM A;  1FWZ A;  2LZ6 B;  2V26 A;  5CK9 A;  1FMK A;  1HK9 A;  2V1R A;  3JAM E;  3FDR A;  1R77 A;  1UJ0 A;  2JT4 A;  4D8K A;  3JCM J;  2L2P A;  1N6A A;  4F7U G;  1HXD A;  3M0S A;  1E6H A;  3JSC A;  3E9F A;  2SRC A;  2BZX A;  3QO3 A;  4BE1 A;  2EYX A;  4DBR A;  3IQL A;  5I2S A;  2ROT A;  1NE8 A;  1G2B A;  3OS1 A;  2C06 A;  3THK A;  1VQM A;  1SEM A;  2ZPE B;  2HBW A;  2YHT A;  1WHG A;  3SB2 A;  2ZPF B;  1X6O A;  2BUD A;  3JV3 A;  3GNG A;  2D6F A;  4P5N A;  3RMQ A;  1BCM A;  5C0M A;  3BDU A;  4KUI A;  1T3L A;  1Q95 G;  4KGX B;  3RR6 A;  2DVJ A;  3MET A;  2IVW A;  1X2K A;  4RTV A;  3H8Z A;  4N0A A;  5IHI A;  5D7U A;  4L5G A;  1ZA1 B;  1KHC A;  2R5A A;  1ZQ1 A;  2DEQ A;  1UGQ B;  2EYQ A;  4CI0 C;  2EPD A;  3UA7 A;  3GF5 A;  4DA4 A;  3JB9 D;  1M8M A;  2KYM A;  2DIG A;  4CC7 A;  4M75 E;  5FW9 A;  2XIC A;  5A0D A;  1Q86 C;  3PNW C;  1ZSZ A;  2QTX A;  2X4Y A;  4BUG A;  4C5G A;  2XU8 A;  4DEY A;  2VAS A;  5LJ5 d;  3HKS A;  1M90 U;  3TU4 K;  1YJW T;  2KGT A;  2M1H A;  2OTJ T;  1UG1 A;  2RPN A;  2CYZ B;  4QT7 A;  4C8Q B;  1IHW A;  2DMO A;  3RKX A;  4C92 E;  3QDR B;  3JCM X;  1S72 T;  3LGL A;  1GXI E;  1VQ6 A;  3CC7 Q;  8AT1 B;  2EQJ A;  3CPW P;  2K2M A;  1NG2 A;  2EKH A;  2K57 A;  3AHU A;  1BI0 A;  1VQO T;  1UJY A;  2KRO A;  1K9A A;  3CD6 Q;  1RAI B;  2E10 A;  3V7S A;  4WTO B;  1QQJ A;  3L1A A;  2HL3 A;  3LH5 A;  5GAN 3;  2YRD A;  1QCO A;  1M27 C;  2JM8 A;  3OYH A;  3DLM A;  2FEI A;  1QW1 A;  1Y96 A;  3M5A A;  3NTK A;  1DJ7 B;  1GFC A;  3FRN A;  2DYI A;  1O9S A;  4RTU A;  2CGH A;  1K73 U;  2O9V A;  1QWE A;  1D3B B;  1I1J A;  2D9T A;  3PGG A;  5HCK A;  1UGV A;  2MIO A;  1SHG A;  3OYF A;  3CC2 A;  4M75 G;  2DJZ A;  4HVW A;  3M0U A;  3ZBD A;  1M3B A;  5GAO m;  1ZX6 A;  1WPY A;  2E6Z A;  1AWO A;  3F70 A;  5J3B A;  2EYZ A;  2JUF A;  4LUE A;  3M4G A;  4PK4 A;  1NLO C;  2VB6 A;  3PVQ A;  4F04 B;  3CCQ T;  2COY A;  1W2B P;  2OJ2 A;  3U23 A;  1RI0 A;  2GCX A;  4BD3 A;  3LW5 E;  4M77 E;  3C4S A;  1NJI R;  1VQ9 Q;  1Y7X A;  5C6S A;  4JUV A;  2FYK A;  3C94 A;  3SDZ A;  4JRP A;  1G8X A;  3QPH A;  2CZ7 B;  4O5V A;  4C92 B;  1HSQ A;  2F69 A;  2QQA A;  2P0Q A;  5LJ3 d;  2QAS A;  3L2W A;  2LCS A;  5D6W A;  4Q5W A;  3EG9 B;  3NHN A;  3JCM c;  1VQP Q;  1X75 C;  4X9D A;  2KQW A;  4FT2 A;  1B3Q A;  3I5R A;  3CCR A;  3I5S A;  1MV0 B;  3KXT A;  5KYY B;  3E2U A;  2VVK A;  3NMZ C;  2EQI A;  4BE0 A;  4VUB A;  4M7D A;  2KRM A;  1YCY A;  3A5Z B;  1D1B A;  4OMP A;  2KYB A;  2EQK A;  1X27 A;  1SHF A;  1U8R A;  5HK0 A;  2HQH A;  5KYX A;  5I11 A;  3OBY A;  1Y96 B;  2LP5 A;  3I35 A;  2NUT A;  3M0P A;  1VQK A;  3UF4 A;  2KT8 A;  1QP3 A;  1OQK A;  1JJ2 P;  1TUG B;  2I2L A;  1QVF P;  1TSF A;  2VC8 A;  2ZZD A;  5GAN 2;  1K9M C;  3EGD A;  2R58 A;  2OTL A;  2MAM A;  3AT1 B;  1KK7 A;  3CC2 Q;  2QDL A;  2CP6 A;  2R57 A;  4Y91 A;  4E47 A;  1GL5 A;  1SSF A;  1PNJ A;  3EFO B;  4J7F A;  5LJ5 j;  2BE9 B;  1N9S A;  1JJ2 A;  4D6W A;  3EFS A;  8ATC B;  1VQK T;  1VQ5 T;  1J3T A;  3OQ5 A;  4RTX A;  4M75 C;  4RG8 A;  1OYX A;  4M78 G;  1VUB A;  2WSC E;  1I8F A;  2XK0 A;  4IKF A;  3C0C A;  1SRL A;  2DD5 A;  1XQH A;  1VQ4 A;  5KYY A;  2M16 A;  2V8K A;  1M3A A;  2QQB A;  2E70 A;  5GJV B;  1QVG A;  4II1 A;  1PRM C;  2E6N A;  2IIM A;  4J9I A;  1JJ2 S;  2MPX C;  4QKU A;  1W1F A;  1YHQ Q;  4GLM A;  1W70 A;  3CCM Q;  4RKU E;  3EG9 A;  2P4T A;  3A98 A;  2CP0 A;  2V8J A;  2DO3 A;  4FYX B;  1WLP B;  2DZC A;  4IUV A;  5IXF A;  1G3T A;  1G3Y A;  3OW2 A;  4HCB A;  1X2Q A;  2RMO A;  4X1V A;  1FYN A;  2JTM A;  1K8A C;  2MYS A;  3G6E T;  4JJN K;  3QSU A;  1XTD A;  4QQD A;  1VIE A;  1RI9 A;  4PJO G;  3PTA A;  2KXD A;  1N8R C;  3OYB A;  3J7A F;  2HSE B;  2FHD A;  4MML A;  2ZCF B;  1D0X A;  5GAO r;  1OX8 A;  3PMI A;  1UDL A;  2CUD A;  4JDS A;  1WJR A;  1C1A A;  1SSH A;  1A0N B;  2L8D A;  1E7O A;  2RF0 A;  3ZFJ A;  2HD0 A;  5CR2 A;  2J6K A;  2NWM A;  2YDL A;  4LE9 A;  7AT1 B;  2IG0 A;  5GAN h;  3GLX A;  4ME7 A;  4M7A F;  4BI3 A;  1N27 A;  2YRV A;  4M7D F;  2MWO A;  4M78 E;  5IT9 E;  3DKM A;  3CCJ T;  3CXC S;  1Y71 A;  1EFN A;  3CME Q;  1VQN Q;  2LX7 A;  3MPU B;  1OV3 A;  2E64 A;  2DK3 A;  2QYZ A;  3OYI A;  2J05 A;  4KUD K;  4EIK A;  3OS5 A;  2AHJ B;  4J5Y A;  2CKK A;  1Q82 C;  1YNZ A;  5ECA A;  3SFM A;  2RNA A;  5GAO p;  1BK2 A;  2EYY A;  1ZSZ C;  1IGU A;  2H3E B;  2M9U A;  2GFA A;  5CKH A;  3SHW A;  3A8G B;  3SWN B;  4M77 A;  1T0H A;  2LT1 A;  2QEX Q;  4DBH A;  2E5K A;  3JCM d;  4BI4 A;  4FU6 A;  4B9W A;  1PCX A;  4PL6 A;  2XMF A;  3VRZ A;  5AYF A;  1JB0 E;  2KEA A;  4FM4 B;  1JO8 A;  2RHY A;  3EGD B;  3OYC A;  2OAW A;  5FU7 B;  3MP6 A;  4AFU C;  4RTT A;  5GAN 6;  1YP5 A;  2E4H A;  1X43 A;  3V8K A;  5FWC A;  3VS7 A;  5IAY A;  4C8Q E;  2HQX A;  5KYX B;  3G4S A;  2QA4 A;  1M1K R;  2EWN A;  3BDL A;  3NTH A;  2KMT A;  2DER A;  2JZ2 A;  3SEM A;  3FEO A;  1BIB A;  5LJ3 j;  2AKK A;  4MDX A;  3CBO A;  3VS4 A;  2LJ0 A;  1WYX A;  1QKX A;  2JTE A;  4A4H A;  3QBY A;  3LWI A;  2JJ9 A;  4PJJ A;  1KC8 U;  1M1K C;  5IH2 A;  4QQG A;  3PMT A;  1M9S A;  2ZGW A;  4OVA A;  1E6G A;  1TU0 B;  3JCM W;  1AD5 A;  1NLP C;  1UHC A;  3UT1 A;  1C6V X;  3TEE A;  1UUE A;  2FO0 A;  2PUO B;  3CC4 A;  3RNJ A;  4IUR A;  4M7A A;  2M51 A;  1MMA A;  3ME9 A;  1F1B B;  4C0G A;  2M0O A;  4XTZ A;  2OTL T;  3VS1 A;  5I22 A;  4C0D B;  2LNV A;  1D0Y A;  1M30 A;  2PU9 B;  3OMC A;  2O01 E;  2XD0 A;  2CRE A;  4KUL A;  1AHJ B;  5A2Q E;  1WXU A;  3QZ9 B;  3OYD A;  3P8D A;  2P0P A;  4MZP A;  2AK5 A;  1AWW A;  1Q82 U;  1YJW Q;  4XU3 A;  3A8M B;  1YI2 Q;  1VOM A;  1P92 A;  2FZG B;  1KHI A;  5LJ3 f;  3BW1 A;  4QVC A;  3QHS A;  2B8A A;  4HCK A;  4BB7 A;  1KD1 U;  3H9N A;  3OYG A;  2D1X A;  4KGZ B;  1VQ6 Q;  4FCY A;  5KE3 A;  2BIV A;  2FPD A;  2EW3 A;  2VGN A;  2E41 A;  2DL7 A;  1TOV A;  3EGU A;  1Q81 C;  2LT4 A;  2ZPH B;  2XKO C;  3QII A;  2RK1 A;  3PVL A;  3JRZ A;  1I0C A;  4LXC A;  1W6X A;  2JN0 A;  3HPW A;  1YCS B;  2DA9 A;  3OMG A;  3JCM P;  2RO0 A;  1YJN Q;  4AMC A;  3OW2 P;  1JBM A;  3M0R A;  3VS5 A;  1WHL A;  3JCM b;  3FC3 A;  4JRQ A;  4N4I A;  1MV3 A;  1QLY A;  3I55 T;  1Z9Q A;  2KRN A;  4N4H A;  1ZA2 B;  1LCK A;  3CCS T;  1KQ2 A;  1TUD A;  2VUB A;  4D8D A;  2KI7 A;  1AWJ A;  2DXU A;  5GAN f;  3TCJ A;  4PJO E;  3KFV A;  1WJS A;  3NGP A;  3OYM A;  4QVD A;  1D1A A;  4FL6 A;  3M54 A;  3P8B B;  1EIF A;  3HL8 A;  2G6F X;  3CCM A;  2DIQ A;  4WF2 A;  1TS9 A;  3CBP A;  2BZ8 A;  1JU5 C;  2LRQ A;  5L23 A;  1NEG A;  2QQS A;  2LMJ A;  4EDU A;  1MUZ A;  5GAO q;  3I9Q A;  3CCJ A;  1M8V A;  1Y07 A;  3PFS A;  3NFC A;  3HHT B;  4OB3 B;  4X9C A;  1NZ9 A;  2QEX A;  2ED0 A;  2DL4 A;  1WA7 A;  4C8Q G;  4Z88 A;  3CCE Q;  1TG0 A;  5DM7 R;  5GAN 8;  9ATC B;  2W10 A;  3LH0 A;  2RA2 A;  4PJM A;  1K0S A;  1VYV A;  4E7J A;  1VQ6 T;  2DZ9 A;  1VQ5 A;  2CZ1 B;  4B6M A;  1WFW A;  3O8V A;  3CCR T;  2BTT A;  2EQM A;  3E1S A;  1LJO A;  2JW4 A;  1K76 A;  1VQN A;  1H3H A;  1R0B G;  5KE2 A;  4FYW B;  1GCQ A;  4OMQ A;  3RIR A;  4M7A B;  4J9H A;  3CCL A;  3A8L B;  1KQS A;  1N5Z A;  4JJC A;  2FZC B;  3EAE A;  3FJP A;  2RN8 A;  4ZTF A;  1GBR A;  2GQV A;  3LX7 A;  4J9D A;  2HQE A;  3G4S T;  2QA4 T;  1WDX A;  2DL3 A;  1D0Z A;  4CC4 B;  4DOV A;  2O2O A;  1JXO A;  3CMA A;  1BKB A;  5CVI A;  1C0M A;  2OI3 A;  2P84 A;  3QYH B;  4R56 A;  1WHK A;  1BI3 A;  5FRN A;  4PFZ A;  5GAN 5;  4BY6 C;  1QVP A;  2AZV A;  4HT8 A;  3RER A;  5GAM g;  1V29 B;  3DLL A;  1VQO Q;  3PE0 A;  3RUX A;  1T3S A;  1YJ9 T;  5LJ3 e;  4E7L A;  1JQQ A;  2RQR A;  4AFZ C;  4TVR A;  3M9Q A;  1SKU B;  2FL7 A;  1QVF A;  2ATC B;  4ESR A;  4M78 A;  1S72 Q;  4BDY A;  3DB4 A;  3CCR Q;  5GAO l;  4GLK A;  2RJC A;  4JZ3 A;  4AFS C;  1QKW A;  2MMP A;  2KT1 A;  4PKC C;  4RMO A;  1K0X A;  2DL8 A;  4LN2 A;  3CD6 T;  3V7C A;  4C5E A;  4XU1 A;  3VKI A;  4AFQ C;  5GMK m;  5CKD A;  2LDM A;  4A63 B;  3GIB A;  2COW A;  2VYT A;  4ZN3 A;  2DEU A;  1SF9 A;  4C8Q F;  3LLR A;  5GAM e;  4HXJ A;  4LUD A;  3HFN A;  2CH4 A;  5DY9 A;  4KBM B;  5GAM j;  2EBP A;  4HA8 A;  4HVU A;  4AG2 C;  5D6X A;  1OZ3 A;  4DOW A;  4X34 A;  2DRM A;  1CKA A;  2O88 A;  1RAG B;  1CSK A;  5GAN 4;  3WVD B;  1AZG B;  1VQ9 T;  2C0T A;  1YJ9 Q;  3VUB A;  1LNX A;  2EJ9 A;  3CC7 A;  1ARK A;  1BI1 A;  2QK0 A;  3V7R A;  3VS3 A;  5GMK e;  1YWO A;  4OMN A;  1M3C A;  2PQW A;  4KH1 B;  2AKL A;  2ESW A;  3A8H B;  1VQN T;  1PHT A;  2JM9 A;  3X20 B;  1U1T A;  3S6W A;  1YIT Q;  1NM7 A;  3O5Z A;  2SEM A;  1QWF A;  4B9X A;  2V1Q A;  1S72 A;  2VGM A;  2PTK A;  1VQP T;  2JMA A;  2COZ A;  2QQR A;  2OAU A;  4C92 D;  5KYW B;  4QQ6 A;  2DM1 A;  1RUW A;  4PJO B;  2X9H A;  1VQO A;  2X35 A;  2CP3 A;  2LTO A;  2YT6 A;  5GMK l;  5CQY A;  1V1C A;  2CSI A;  1D09 B;  4OGE A;  1Q81 U;  2WAC A;  2MK5 A;  2RHU A;  1QCN A;  2MF2 A;  1U5S A;  1TH7 A;  1O75 A;  3M0T A;  4J6W A;  4KH0 B;  1WX6 A;  1GBQ A;  2MOX A;  1MMG A;  5HY6 A;  1TXQ A;  2LQW A;  3C12 A;  3CC4 T;  3QUI A;  5LJ5 h;  1ZSG A;  1UE9 A;  4ZNX A;  2F5K A;  4F17 A;  1B7T A;  2GFU A;  2EJG A;  3G71 Q;  4IUP A;  1W2B S;  3L42 A;  4KT0 E;  4IUU A;  3EG1 A;  4M7A E;  2XID A;  3EHQ A;  1VQK Q;  4AT1 B;  4M78 F;  1TTH B;  3JB9 F;  2LVM A;  1UGP B;  2I0N A;  3GNF B;  2FRY A;  5IHN A;  3OA6 A;  4N0A C;  2LQK A;  2V8I A;  4J9C A;  2PVG B;  5KYN A;  2RI2 A;  3EGX B;  3RDV A;  2X51 A;  3EH2 A;  1HYO A;  4Z8A A;  3QG1 A;  1TWB A;  1VQ7 A;  2LX9 A;  5CIU A;  3LGF A;  2QDY B;  3VJP A;  1U1S A;  4HCZ A;  3QXE B;  3BE3 A;  3M55 A;  2DXT A;  5CAI A;  2EJF A;  3HRT A;  1OU8 A;  2CP5 A;  5EG2 A;  4FSX A;  1OX9 A;  3OSV A;  3GBQ A;  4M78 C;  3R6O A;  1IXD A;  1QVG P;  3CCU Q;  3HSB A;  4JLG A;  1WHH A;  2GQI A;  2DLP A;  2ZPI B;  4MZT A;  1U06 A;  1M2V B;  1VA7 A;  2MI6 A;  2FVU A;  1OEB A;  3A8O B;  1IO6 A;  2O4X A;  1QVG S;  1VQ8 Q;  3VYH B;  3SWN A;  1WZO A;  3VS6 A;  3J81 E;  2YUP A;  1YIJ T;  3HP9 A;  1KJW A;  2HNI A;  1LPL A;  1AWX A;  2DXC A;  1RAA B;  3R6N A;  2DBK A;  5DLO A;  4PJL A;  3OW2 S;  4M7A G;  1YBY A;  3OYN A;  3OYL A;  1MND A;  1OPK A;  4C8Q D;  3L2V A;  4E6R A;  2JVV A;  2D0N A;  1PG5 B;  3NTI A;  1W2B A;  4ORZ A;  3CPW S;  3G6E A;  4RCB A;  4LDX A;  4Y92 A;  2EGA A;  2OTL Q;  2VKN A;  2ZAE A;  2R5M A;  3L2R A;  4R0K A;  1WQW A;  3MP1 A;  2CS7 A;  2RHZ A;  2K3Y A;  4JRK A;  4F16 A;  1AZE A;  1RLP C;  4OB2 B;  1NJI U;  3OS2 A;  1KC8 R;  2EFI A;  2YUQ A;  3M0Q A;  3REB B;  1OU9 A; 
#chains in the Genus database with same CATH homology
 3QYG B;  2JN0 A;  2DKG A;  2K57 A;  3HPW A;  3M59 A;  3AHU A;  1BI0 A;  3OMG A;  3JCM P;  2RO0 A;  1WNL A;  3I55 A;  1VQO T;  5FRN A;  4PJO F;  2ZPG B;  2A7Y A;  2E10 A;  3V7S A;  1MGQ A;  1JBM A;  2K2V A;  3JCM b;  4JRQ A;  3FC3 A;  1VQL A;  3L1A A;  4N4I A;  1W4S A;  5GAN 3;  3M58 A;  3I55 T;  2RJD A;  3BFM A;  4M75 A;  4N4H A;  3SWN C;  3JB9 H;  3CCS T;  4ZGJ B;  3OYH A;  1KQ2 A;  3DLM A;  1ZHI A;  4JRI A;  2YLC A;  1QW1 A;  1Y96 A;  4ELY C;  4XTX A;  2VUB A;  3M5A A;  3BY7 A;  3MEV A;  4M77 G;  5J39 A;  3CCU A;  1YHQ T;  3NTK A;  3L2U A;  1DJ7 B;  2DXU A;  4A4K A;  5GAN f;  3FRN A;  1O9S A;  3TCJ A;  2CGH A;  3QZ5 B;  1K73 U;  1I5L A;  4PJO E;  3PT9 A;  1D3B A;  1K9M U;  3ER0 A;  3N5B B;  1QP2 A;  1VQ8 A;  1D3B B;  4C92 G;  1WJS A;  2D9T A;  3OYM A;  3PGG A;  5FU6 B;  5GAM f;  4QVD A;  1VIF A;  4FL6 A;  3CC2 A;  3OYF A;  3QKJ A;  4M75 G;  2DJZ A;  4CRI A;  2DTH A;  2DAQ A;  4EMG A;  3M54 A;  1H64 1;  1VQ8 T;  3P8B B;  1EIF A;  3HL8 A;  3RKY A;  3ZBD A;  3CCM A;  1KD1 C;  2DIQ A;  4WF2 A;  5GAO m;  4E7K A;  3CBP A;  4M78 D;  2CZ0 B;  4LD9 K;  4M75 B;  4J6Y A;  3JB9 G;  1WPY A;  2E6Z A;  5KCO A;  3F70 A;  3P8H A;  4ZTJ A;  2LRQ A;  4PJO C;  4L6V 5;  1M1G A;  3OYA A;  4O6J A;  5J3B A;  2QQS A;  2JUF A;  5J26 A;  4EDU A;  3M4G A;  5GAO q;  3PIO A;  3CCJ A;  1M8V A;  1Y07 A;  3JCM h;  4A53 A;  3X24 B;  3CCQ T;  3M53 A;  3PFS A;  2HBP A;  3NFC A;  3HHT B;  4OB3 B;  4X9C A;  1NZ9 A;  1RI0 A;  2GCX A;  5A0G A;  2QEX A;  4E7I A;  2LCL A;  4BD3 A;  3LW5 E;  4A54 A;  4C8Q G;  4M77 E;  3C4S A;  1PSF A;  2L5Q A;  1K73 C;  1Y7X A;  5C6S A;  4JUV A;  5IN1 A;  2FYK A;  2VXE A;  5DM7 R;  5GAN 8;  3OY9 A;  3C94 A;  2NLU A;  3CME T;  1ZBX A;  3SDZ A;  3LH0 A;  3MEW A;  3MEA A;  1OI1 A;  2RA2 A;  4M77 B;  4L59 A;  4JRP A;  3QPH A;  2CZ7 B;  3E9G A;  5M9O A;  4O5V A;  2DZ9 A;  4E7J A;  1VQ6 T;  2PVD B;  4EMK A;  1VQ5 A;  1JRI A;  4C92 B;  2F69 A;  2QQA A;  2P0Q A;  5A0L A;  5LJ3 d;  4BAC A;  3L2W A;  2CZ1 B;  3OYK A;  2KK4 A;  5D6W A;  4Q5W A;  1NPP A;  4MMK A;  5FU7 C;  3O8V A;  3JCM c;  3CCR T;  4M7D G;  1X75 C;  4X9D A;  4M7A C;  5CKF A;  2KQW A;  3X26 B;  4FT2 A;  2F5T X;  3HRU A;  2EQM A;  3E1S A;  3CCV T;  2EQU A;  3RKW A;  3CCR A;  2QI2 A;  1YIT A;  1VQM T;  3H6Z A;  4A4E A;  1I81 A;  1N9R A;  1LJO A;  3MP8 A;  1FXX A;  4JLI A;  3J80 E;  3V8J A;  4ZGE B;  1VQN A;  1YJN T;  3KXT A;  4ZGD B;  3GOX A;  4M7A F;  3S3N A;  4BE0 A;  2D0Q B;  4VUB A;  4M7D A;  1YCY A;  1UGR B;  2QXF A;  2RHI A;  3A5Z B;  5KE2 A;  5GMK i;  2EQK A;  4F7U F;  3RIR A;  3V8L A;  4MDW A;  1U8R A;  5HK0 A;  4M7A B;  4OB1 B;  3KBG A;  4R55 A;  3CCL A;  3A8L B;  3OBY A;  2QQ9 A;  1KQS A;  4M78 B;  1Y96 B;  2L3R A;  4EPC A;  1VQ4 T;  1VQK A;  4ELZ C;  1QP3 A;  4XU0 A;  2I2L A;  2VC8 A;  3EAE A;  3FJP A;  3MO8 A;  2ZZD A;  2A3L A;  5GAN d;  3C95 A;  3LYI A;  5LJ3 h;  4ZTF A;  1G3W A;  5GAN 2;  3GP8 A;  1K9M C;  2GQV A;  3LX7 A;  2R58 A;  1Q7Y U;  2HQE A;  5LJ5 g;  2ZPB B;  3G4S T;  2QA4 T;  2OTL A;  5GAN e;  2MAM A;  3OSS C;  4C92 A;  2R57 A;  4Y91 A;  4E47 A;  1SSF A;  3HRS A;  4LDV A;  4C5H A;  4DOV A;  4OMF B;  4F7U A;  5GAN j;  4HKE A;  1IRE B;  4J7F A;  4J83 A;  5LJ5 j;  4J6X A;  4C8Q C;  3I56 A;  3CXC A;  3CMA A;  3L2Q A;  1BKB A;  2K5F A;  3FIF A;  5CVI A;  3PIP A;  1N9S A;  1JJ2 A;  4NL2 A;  4PLI A;  3QYH B;  4QVZ A;  3G71 A;  3ASK A;  3EFS A;  1BI3 A;  2CZ6 B;  3EFR A;  4NS5 A;  1KQ1 A;  4D6W A;  4R56 A;  3CCM T;  1VQ5 T;  5GAN 5;  1VQK T;  4Y28 E;  4C0Z A;  3S3O A;  3OQ5 A;  4QW2 A;  4BY6 C;  1RL2 A;  2G3R A;  4M75 C;  4RG8 A;  5LJ5 f;  3CME A;  1QVP A;  4HT8 A;  1OYX A;  4M78 G;  1VUB A;  2XG8 D;  3RER A;  2WSC E;  1MHN A;  1WQ7 A;  5GAM g;  1I8F A;  1V29 B;  2LQ8 A;  2XK0 A;  4XTY A;  3DLL A;  2HAX A;  4IKF A;  1KG1 A;  1XNI A;  4RCC A;  5GMK j;  3RUX A;  3VUZ A;  1K8A U;  5I21 A;  4OGC A;  2VXF A;  2DD5 A;  4M7D E;  2E1H A;  2LCC A;  5LJ3 e;  1YJ9 T;  1XQH A;  4E7L A;  3SD4 A;  1VQ4 A;  2M16 A;  2V8K A;  4TVR A;  2QQB A;  2E70 A;  3M9Q A;  1QVG A;  3TRE A;  4PNO A;  2FL7 A;  1QVF A;  4M77 F;  4II1 A;  1OZ2 A;  2E6N A;  3KUF A;  4JS4 A;  3JB9 J;  1JJ2 S;  4M78 A;  2K4Y A;  3CCQ A;  2EIF A;  4BDY A;  3DB4 A;  1G3S A;  5GAO l;  2RI5 A;  4GLK A;  2RI3 A;  3UPU A;  4RKU E;  4M7D D;  2RJC A;  3INZ A;  5L8R E;  3X28 B;  2KAF A;  2MMP A;  2P4T A;  2X4J A;  1BI2 A;  4NL3 A;  4PKC C;  4RMO A;  2V8J A;  2KDS A;  2DO3 A;  3OYY A;  4IUV A;  2DZC A;  3X25 B;  3M56 A;  4A4G A;  4PJO D;  4LDU A;  5CKB A;  2K5L A;  1G3T A;  3MCA B;  1YJW A;  4IUT A;  1G3Y A;  4LD6 A;  1UGS B;  3JCM Q;  3OW2 A;  4HCB A;  3CD6 T;  3V7C A;  4C5E A;  4XU1 A;  3VKI A;  5GMK m;  2JTM A;  2LDM A;  5CKD A;  1K8A C;  3GIB A;  3G6E T;  4JJN K;  3QSU A;  3MEU A;  1XTD A;  2JNG A;  2VYT A;  1X01 A;  3FB9 A;  2K3X A;  4ZN3 A;  1Q7Y C;  3CCE A;  3WVE B;  2RJF A;  4DQ2 A;  4QQD A;  4C8Q F;  5GAM e;  3LLR A;  1VIE A;  4F7U B;  2Y90 A;  2WSE E;  4PJO G;  3PTA A;  3HFN A;  1N8R C;  5DY9 A;  3OYB A;  2RB6 A;  4KBM B;  3J7A F;  1YIJ A;  5GAM j;  4M77 D;  2FB7 A;  2FHD A;  4MML A;  1M1K U;  2ZCF B;  4HA8 A;  4HCC A;  4J7I A;  5GAO r;  4EMK B;  5HKC A;  1M4Z A;  4XTU A;  3PMI A;  5D6X A;  4JDS A;  1OZ3 A;  2DPP B;  2E5Q A;  1WJR A;  4DOW A;  3JCM e;  1VQ9 A;  4X34 A;  3M4Y A;  4RG2 A;  4EMK C;  2XHC A;  3OYE A;  2L8D A;  1VQ7 T;  2EKO A;  3JCM f;  5GAN 4;  2E12 A;  3WVD B;  2PVO B;  3ZFJ A;  2HD0 A;  1XOV A;  1VQ9 T;  5CR2 A;  3JCM V;  5GAN h;  3VUB A;  2IG0 A;  1LNX A;  2EJ9 A;  3GLX A;  5KCH A;  3CC7 A;  4BE2 A;  3G7Z A;  2JOY A;  4C0F A;  5GAN g;  4HT9 A;  3FLG A;  4ME7 A;  5HK3 A;  4C92 F;  1BI1 A;  3Q1J A;  4Z02 A;  3V7R A;  4BDZ A;  5GMK e;  4BI3 A;  1N27 A;  2YRV A;  4M77 C;  1YI2 T;  3CCE T;  3CD6 A;  1KC8 C;  2KY9 A;  2XDB A;  4C8Q A;  4M7D F;  2MWO A;  4M78 E;  5IT9 E;  3DKM A;  3CCJ T;  1QVF S;  3CXC S;  1Y71 A;  2L89 A;  2PQW A;  3JCM g;  3A8H B;  3CCV A;  2QA4 A;  1VQN T;  4XU2 A;  1YI2 A;  2XDD A;  3CPF A;  2E64 A;  2DK3 A;  3X20 B;  1U1T A;  3S6W A;  4OB0 B;  3OYI A;  1M1F A;  4XK8 E;  2RH2 A;  4KUD K;  4B9X A;  1KQS S;  3OS5 A;  1S72 A;  2DD4 A;  2VGM A;  2AHJ B;  4NOY A;  4J5Y A;  3VYG A;  2CKK A;  1VQP T;  4XTV A;  5I2M A;  1Q82 C;  1B34 A;  5FLX E;  2K5I A;  3SFM A;  5LL6 S;  2QQR A;  2OAU A;  2PUK B;  3CCU T;  5GAO p;  4C92 D;  4OF1 A;  4QQ6 A;  3CEY A;  5CKE A;  4M75 D;  4BI8 B;  4PJO B;  1VQO A;  2M9U A;  2X35 A;  2GFA A;  5CKH A;  2LTO A;  4LDY A;  3A8G B;  5CCA A;  5GMK l;  1VQL T;  3VU3 C;  3SWN B;  2RK2 A;  4OGE A;  5CQY A;  5CQX A;  4M77 A;  1Q81 U;  5CO7 A;  2WAC A;  4C0D C;  5GAN 7;  4XAX B;  2RHU A;  1YJ9 A;  2LT1 A;  4C92 C;  2MF2 A;  1YIT T;  3M57 A;  3CCS A;  3OS0 A;  1TH7 A;  1O75 A;  3JCM d;  4BI4 A;  4J6W A;  4FU6 A;  3T9N A;  1NPR A;  4B9W A;  1WGS A;  1I4K 1;  2E65 A;  3GPL A;  5HY6 A;  4PL6 A;  2KSS A;  3C12 A;  3CC4 T;  1YJN A;  3QUI A;  5AYF A;  5LJ5 h;  3RES A;  4M7A D;  1JB0 E;  2KVQ G;  2MWP A;  2RD1 A;  1UEB A;  2OTJ A;  2JTF A;  4F7U E;  1LOJ A;  4FM4 B;  3I56 T;  3CMA T;  3RMS A;  2F5K A;  5LJ3 g;  4PJO A;  3OB9 A;  3WXM B;  2RHY A;  2GFU A;  4LDW A;  3ZEH A;  3OYC A;  2EJG A;  5GAO n;  2GF7 A;  3LWH A;  4IUP A;  1W2B S;  3L42 A;  2XI9 A;  3MP6 A;  4KT0 E;  5FU7 B;  3VV0 A;  5GAN 6;  4M75 F;  3E19 A;  5GAM h;  4IUU A;  1Q86 U;  5FRM A;  1FWZ A;  5CK9 A;  4M7A E;  3V8K A;  2XID A;  1HK9 A;  5KH6 A;  2LC4 A;  4PLL A;  1FX7 A;  5IAY A;  3JAM E;  3FDR A;  4M78 F;  4C8Q E;  2WSF E;  2HQX A;  3JCM J;  1N6A A;  4F7U G;  1HXD A;  1UB4 A;  3JB9 F;  2LVM A;  3JSC A;  4J8O A;  3G4S A;  1UGP B;  2EWN A;  3GNF B;  2Y4X A;  3BDL A;  3E9F A;  3OA6 A;  1BYM A;  3OBW A;  3NTH A;  2RHX A;  2KMT A;  4N0A C;  2X4W A;  2JZ2 A;  2LQK A;  3DB3 A;  3QO3 A;  2V8I A;  2P0K A;  4BE1 A;  4A4F A;  3FEO A;  1BIB A;  5LJ3 j;  2PVG B;  2RI2 A;  2O4X B;  4MDX A;  1H3Z A;  5I2S A;  3CBO A;  1BIA A;  5LJ5 e;  1NE8 A;  3QG1 A;  4A4H A;  3UDC A;  3G71 T;  2DTO A;  1M90 C;  3QBY A;  1VQ7 A;  5FU6 C;  2LX9 A;  5CIU A;  4FT4 A;  3LGF A;  3OS1 A;  2C06 A;  1VQM A;  3LWI A;  2QDY B;  2H3J A;  3VJP A;  1KC8 U;  5D6Y A;  2ZPE B;  1U1S A;  4HCZ A;  2YLB A;  3QXE B;  1M1K C;  2YHT A;  3SB2 A;  3M55 A;  2DXT A;  5CAI A;  2ZPF B;  4XQ3 A;  1X6O A;  2BUD A;  2VV5 A;  5GMK h;  1VQP A;  2EJF A;  3GNG A;  3HRT A;  4QQG A;  3OYJ A;  5GAM d;  3PMT A;  2D6F A;  4P5N A;  3RMQ A;  1M9S A;  2ZGW A;  4MZM A;  4OVA A;  3BDU A;  4EMH A;  5C0M A;  5EG2 A;  4KUI A;  4FSX A;  2Y4Y A;  3OSV A;  3MHX A;  3JCM W;  3MET A;  2IVW A;  4M78 C;  2BKD N;  3R6O A;  2EAY A;  4JS5 A;  3UT1 A;  3S3M A;  2X4X A;  3H8Z A;  4N0A A;  3HSB A;  4L5G A;  4JLG A;  1G5V A;  3TEE A;  4IUQ A;  2ZPI B;  4MZT A;  3CC4 A;  1KHC A;  2PUO B;  2R5A A;  3UWN A;  1ZQ1 A;  2DEQ A;  2FVU A;  2MI6 A;  3CBM A;  1UGQ B;  2EYQ A;  3A8O B;  4CI0 C;  4ATO A;  2O4X A;  1QVG S;  3CPW A;  3VYH B;  2XDP A;  3SWN A;  4IUR A;  3CC2 T;  3HFO A;  4M7A A;  3GF5 A;  2DTI A;  2DXB A;  3ME9 A;  4C0G A;  4DA4 A;  3JB9 D;  2M0O A;  4XTZ A;  3J81 E;  1N8R U;  1YIJ T;  2DIG A;  2OTL T;  3L2Z A;  3JB9 I;  4M75 E;  2QEX T;  4C0D B;  3CCL T;  3HP9 A;  2LNV A;  2DVE A;  1R8O B;  1M5Q 1;  2HNI A;  2XIC A;  5A0D A;  2PU9 B;  3OMC A;  2O01 E;  1Q86 C;  2XD0 A;  3PNW C;  3URG A;  3CC7 T;  4KUL A;  2DXC A;  1B34 B;  1AHJ B;  2QTX A;  4OP0 A;  2X4Y A;  4XTW A;  5A2Q E;  4BUG A;  3QZ9 B;  5DLO A;  4M7D C;  3OYD A;  3OW2 S;  4C5G A;  4M7A G;  2XU8 A;  3P8D A;  1YBY A;  2P0P A;  4MZP A;  3OYN A;  3OYL A;  4BY6 B;  3QJY A;  5LJ5 d;  3HKS A;  1M90 U;  4C8Q D;  3TU4 K;  3L2V A;  1YJW T;  1Q82 U;  5DLQ E;  2M1H A;  4XU3 A;  3A8M B;  1NJI C;  4GY5 A;  1P92 A;  2JVV A;  2OTJ T;  1WJQ A;  1KHI A;  3NTI A;  3BW1 A;  5LJ3 f;  3QHS A;  4QVC A;  2B8A A;  2CYZ B;  1IZ6 A;  4BB7 A;  4C8Q B;  3G6E A;  3CPW S;  1W2B A;  1KD1 U;  4RCB A;  4M7D B;  4LDX A;  4N4G A;  5FRO A;  2RJE A;  3RKX A;  4C92 E;  3OYG A;  5KE3 A;  2BIV A;  1PSE A;  2R5M A;  3QDR B;  2VGN A;  4V2S A;  3L2R A;  2E41 A;  3JCM X;  1S72 T;  1WQW A;  3LGL A;  4ZN1 A;  3MP1 A;  2CS7 A;  1YHQ A;  1Q81 C;  1VQ6 A;  2RHZ A;  2LT4 A;  1GXI E;  2K3Y A;  4JRK A;  2ZPH B;  2EQJ A;  1NJI U;  4OB2 B;  4UC4 A;  2XKO C;  4YTL A;  3OS2 A;  3QJ6 A;  2EFI A;  2RK1 A;  3QII A;  2RM4 A;  3JRZ A;  4C5I A;  4E7H A;  4FIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...