4C8QF

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
b'SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qF00
1BIAA 4V2SA 4C92G 1YCYA 4C8QG 5GAMf 4M77C 3BDUA 5GMKe 4M7DE 4RCCA 1HXDA 3SWNA 1Y96A 2VC8A 4XTXA 5GAN6 5GAN7 4M75E 4A54A 4JLIA 3V8LA 4A53A 5I21A 2DXTA 2YHTA 2EJFA 4M78G 5GAN2 1X01A 4EMKB 4PJOD 2QTXA 4MMLA 3QHSA 4C92A 4F7UA 4XTZA 5LJ5f 3RKXA 4F7UF 5GAN3 2DZCA 4XU2A 3VU3C 2K57A 4NOYA 4PNOA 3JCMW 3HSBA 3V8JA 1H641 4XTWA 4J6XA 3V7CA 4EMKC 3JB9H 3BY7A 4M75B 5LJ3f 3V7SA 5LJ5g 1WPYA 2RD1A 2Y90A 3HFNA 4M7DC 5GAOq 4NL2A 3JCMQ 3SB2A 5GMKj 4C92E 2YLCA 4C8QE 4M75C 1I8FA 3BFMA 5LJ3g 4J5YA 4F7UG 5GMKh 4J6WA 4M7AA 4M7AF 4M7AD 5CAIA 4NL3A 2DJZA 3JCMV 2EJGA 3FJPA 4JRKA 4EMHA 4M78E 1B34B 4C92B 4C8QB 1U1SA 4HA8A 4M77D 5GANg 5GAOp 1LNXA 5GAN4 2ZGWA 5GAMg 4C92C 4C8QC 4EMGA 4PJOA 4PJOF 3L2ZA 4X9CA 4N0AC 4OP0A 4M7AG 4M78B 3RKWA 5GANe 2DKGA 4XTUA 3JCMf 5GANd 3EFRA 4XU1A 1LOJA 4M77G 5GAMe 3JCMJ 5GAMd 4M78C 1KQ1A 4DQ2A 4J6YA 4F7UE 1M8VA 3JCMg 1BIBA 4RCBA 3RESA 1LJOA 1Y96B 1D3BB 3SWNB 5GAN5 4M7DD 2HNIA 4PJOG 2DEQA 3FIFA 4M75D 1WQWA 3M4GA 3JCMc 2FYKA 5LJ5e 3SWNC 2DZ9A 1JBMA 1WNLA 4F7UB 5LJ5d 3JCMe 5GANj 4X9DA 4XU0A 4M77A 1I81A 5LJ3e 4M77F 1KQ2A 4XTYA 5LJ3d 3FB9A 4WF2A 3JB9D 4M7AE 5GAMj 5GANh 3GIBA 2DTOA 1WQ7A 4JUVA 4MMKA 2I2LA 2EWNA 2JN0A 4C8QD 5GAMh 2EJ9A 3EFSA 5GMKm 1MGQA 3JCMP 3AHUA 3BW1A 4M7AB 1HK9A 5GAOm 4M7DB 4QVCA 3V8KA 2E1HA 4EMKA 5LJ5j 4PJOE 2RA2A 2EAYA 2DTIA 4XTVA 2YLBA 4Y91A 4M78D 5GAN8 4M7AC 4M7DA 1M5Q1 5DY9A 5LJ3j 5LJ5h 4M7DF 3JCMh 1N9SA 1I5LA 2VXEA 1U1TA 2E10A 4M75A 5GMKl 4M75F 3RUXA 2FB7A 5GAOl 5LJ3h 3RIRA 4QVDA 1TH7A 3QO3A 4PJOB 4HT8A 1D3BA 3JCMd 3QUIA 3JB9J 4PJOC 3JB9F 2RB6A 1JRIA 4XQ3A 3JB9I 3RERA 2E64A 4M7DG 2CGHA 4M75G 1B34A 3JCMb 4M77E 1I4K1 2DTHA 3PGGA 3RKYA 3INZA 4C8QA 4C92F 4C92D 3HFOA 4C8QF 2E65A 4N0AA 4JRIA 2DVEA 3L1AA 4XU3A 2E41A 5GAOn 5GMKi 5GAOr 3QSUA 3JB9G 2RM4A 3V7RA 4M78A 4HT9A 2DXUA 4M77B 2VXFA 4M78F 5GANf 3JCMX 1N9RA
chains in the Genus database with same CATH superfamily
3HP9A 2D1XA 2KQWA 2OX7A 4OB3B 3U23A 1WHJA 2X3XD 5GMKe 4JJDA 1YI2T 4J9HA 4JJBA 4A54A 4QKUA 2KXCA 4Y92A 1RAFB 3VU3C 3JCMW 3OW2P 1M1KR 3BY7A 1WI7A 3OYGA 3OYKA 1TUCA 2LX9A 2YLCA 3QJ6A 4C0FA 4N4HA 2IIMA 4M7AF 3OS2A 2FVUA 1BU1A 4BE1A 2L3RA 4M77D 5A0GA 3G4SA 3CPWA 5KCOA 3QWXX 3CMEQ 2EQIA 2GNCA 2VB6A 4E7KA 4M4ZA 4EIKA 3PIPA 5GANd 3E9GA 1G2BA 3I5SA 2NUTA 4OMOA 1M90U 2EBPA 4J6YA 2FPFA 3RMQA 2X35A 4M7DD 2YT6A 2R58A 1JU5C 2HZYA 4BUGA 2K5IA 4A4EA 1K8AC 5CKBA 1VQKA 4BB7A 2QA4T 1RACB 5J39A 2ZPBB 2DXCA 2ENMA 4HKEA 1VQKQ 2BUDA 1ZSGA 4BD3A 5A0DA 2KRMA 4M78D 3M53A 4MZPA 3I55A 3CXCP 5CKFA 4OMLA 1MNEA 3HHTB 3RNJA 1E6HA 4OMQA 4XQ3A 5CK9A 2CGHA 2LDMA 4M75G 4OGCA 4M77E 4J9GA 3A1PA 2Z0WA 1CKAA 5GAOr 2C0TA 1NLOC 1OU9A 2KYMA 4OF1A 2VXFA 3JCMX 4C8QG 5CCAA 5GAMf 3GPLA 1UGSB 4M7DE 1HXDA 1M3BA 2QQAA 4C0GA 1PM3A 4A53A 1SSFA 2LTOA 3CCVQ 5GAN3 2V8IA 1D0ZA 4Z02A 4B9XA 1WYXA 3MP6A 1RL2A 2K79A 4RTTA 2DPPB 4O6JA 3OBWA 2SEMA 2YRDA 1N8RR 4F7UG 4M7AD 2ZPGB 4DEYA 4M78E 1B34B 4QVZA 2YUPA 2KXDA 2DL7A 1JJ2A 1TG0A 4EMGA 1U06A 2M0YA 4OP0A 1XTDA 4DBHA 3C94A 2LRQA 3LX7A 1LOJA 1M1FA 1O9SA 2AK5A 4C5GA 1LJOA 4ORZA 2E12A 4OB2B 1M2OA 1SHGA 3HKSA 4ELYC 4RTZA 4JJCA 4PJLA 1QKXA 2DZ9A 3PT9A 2LQWA 3LLRA 1YCSB 2K3XA 2DNUA 5LJ3d 1NYGA 2DVJA 1VIEA 2LQKA 4B6MA 3QYGB 2I2LA 2JMAA 3M57A 5GAMh 1VQ6Q 3OW2A 2YUQA 1WXTA 4LDXA 2EAYA 1EZZB 4M7AC 2E4HA 3F70A 1TUDA 2C0OA 2MWOA 2COWA 2FL7A 1Z9QA 3ZBDA 3G71A 1UTIA 3EHQA 2FZGB 3VS2A 2NUTB 4LD9K 1K73C 2QK0A 2EYQA 3G4ST 4N0AA 4L59A 4OMNA 3QZ5B 4JRIA 2GGRA 1WJSA 1M8MA 1G3WA 1N8RU 2QXFA 3P8DA 2RM4A 4CRIA 5EC7A 2RJCA 4J9EA 1NPPA 1K1ZA 4ZTFA 2CP7A 1UEBA 4LDUA 1S72A 2F5TX 2AZSA 1SRLA 1U3OA 4XAXB 1Y96A 5GAN7 1HYOA 1WX6A 2BE7D 5I21A 1GCQA 4IKFA 3ZL7C 3I56A 3JB9H 3V7SA 2OJ2A 3MP8A 1VQKT 1QP2A 2GBQA 1I8FA 2KY9A 4J6WA 2HQHA 1JEGA 3CXCA 3C12A 2G6FX 4EMHA 1LNXA 1K4US 4ATOA 4C0DB 3I55T 1KC8R 2ATCB 2RHUA 3EFRA 4KH0B 2LJ1A 2L2PA 2H8HA 3PMIA 1JQQA 3X28B 4DQ2A 3S3NA 3JCMg 2KRSA 1LCKA 1G5VA 1KG1A 3J7AF 3EG3A 2JZ2A 1PRLC 1YP5A 5FU7B 4XTYA 5GAMj 5FRMA 2A36A 3OS1A 2DXBA 2RPNA 3HTRA 1NLPC 2V26A 2FRYA 2M02A 3QZ9B 1OQKA 2DK3A 1WDXA 1OEBA 1Y57A 2PUOB 4KT0E 2EGEA 1VUBA 2HSPA 3MP1A 3OSVA 4E7IA 2LT1A 4KUDK 5A2QE 3M0TA 2C06A 2XKOC 2E64A 3PGGA 5J26A 2JS2A 1RAEB 1QP3A 2LP5A 3VS4A 1BBZA 3NHNA 3JCMc 4LD6A 2AIRB 2G3RA 2RHYA 3N5BB 4C92G 3VUZA 1X27A 4RMOA 4XTXA 2CKKA 2NWMA 3GF5A 1IGQA 3CCEA 2FG0A 3QHSA 4ANJA 2DL4A 4AMCA 4XTWA 3V7CA 2Y90A 2AZVA 2IG0A 1QVGS 4BY6B 1IHWA 2HL3A 2XI9A 2JS0A 3ULRB 5CAIA 2DJZA 1WXUA 4PK4A 1D09B 2O88A 5GANg 4HCBA 3A8GB 2CSIA 3FLGA 4PJOF 3G71T 1QVFS 3RKWA 3L2WA 3L2UA 3MEAA 1YHQA 4OVAA 5GAMe 3OBYA 1OI1A 1YHQQ 2RI5A 2XG8D 1Y96B 4IIOA 2KGTA 4AFUC 3DLLA 2RHIA 1SF9A 3EAEA 2CP2A 2L3PA 3CCQA 1Q7YC 1PD0A 1VQOA 1UGQB 3CD6A 5IHNA 2ZAEA 3TVTA 1S72T 1VQOQ 3A8LB 1FMKA 1TOVA 1Z9ZA 2X4XA 5HCKA 3EFSA 2KNBB 2RQVA 2K7AA 3V8KA 2PVGB 3G6EA 4E6RA 3X24B 1RAHB 1NEGA 1N9SA 3I56T 4M75A 2E10A 3NFCA 5GMKl 3FC3A 5GAOl 3GNGA 4KH1B 2D0QB 1JRIA 2ZPEB 4C8QA 1PRMC 2KK4A 3MEVA 1I1JA 2DVEA 2RK2A 3VYHB 4PJMA 1KQSS 2X4WA 4GLKA 2LJ3A 1N6AA 1WHHA 2KT1A 2KROA 2MMPA 3L2QA 2E5QA 2YHTA 1K0SA 4F7UA 3MEUA 3C0CA 1ZUUA 3RKXA 4QQDA 1FWZA 3LYIA 1NJIU 2A08A 2DYIA 3CMAA 5GAOq 4NL2A 1T0JA 3CMAQ 4RTWA 1Y7XA 1UDLA 4NL3A 2EJGA 4IUPA 4JRKA 4IUQA 2OTJA 2P4TA 2P0KA 2QA4Q 3R6OA 2OTJQ 1K8AR 2NLUA 5CKDA 4X9CA 3H0IA 2DKGA 3TSZA 4MZMA 4M77G 2LQ8A 1VQ9A 5AT1B 2DETA 4RCBA 1VQ9Q 1G3TA 4FYVB 1R8OB 2QQSA 1HJDA 1WHMA 3OSSC 3SHWA 4M77F 4OMMA 3FB9A 1WGSA 1OU8A 1Q86C 1SG5A 1ZA2B 2GF7A 3RMSA 1K76A 1ZSZA 2ZPHB 3BW1A 3JRZA 3CCET 3DB4A 1EX4A 2CSQA 4XTVA 2EYWA 1GFCA 4RUGA 1JXOA 4M7DF 1I5LA 3RUXA 2CYZB 4DBRA 3OYBA 2PNIA 5HKCA 3PMTA 3JCMd 1IREB 1VQ4A 4LN2A 2X3WD 4Z8AA 4TVRA 4PJOC 1YJ9A 2RQWA 1VQ4Q 1ZUYA 1YJ9Q 1B07A 3REAB 2ED0A 4AFZC 3OYJA 2L89A 2E6NA 5KYXA 4MDXA 4M78F 3NTKA 2HCKA 1YHQT 2LX7A 1X6BA 3UPUA 1S1NA 4WTOB 2LCLA 2P84A 1QQJA 1ZHIA 4E7LA 1IB8A 1JJ2P 5L8RE 4AT1B 2OAWA 3UATA 2GQVA 5LJ5f 2P0PA 4PNOA 1H641 3CCQT 2O4XA 2K2VA 1MMNA 4M75B 1VQOT 5AYFA 3CD6T 2CT3A 2DAQA 4J7FA 4D8DA 4J5YA 2GFUA 2RI3A 4X1VA 2YRCA 3G6ET 2QQBA 3LH5A 4C8QB 3NMZC 1MMAA 3CC2A 1AEYA 2RH2A 3QWYA 1BCOA 4KRTA 4M7AG 2FO0A 2HD0A 3QDFA 2JOYA 2L5QA 1GBRA 3VV0A 4LDWA 4J9DA 1WQWA 2K4YA 3VYGA 3OYMA 5IH2A 4HXJA 1YBYA 2CP0A 4F7UB 1Y07A 3ER0A 1VQ8A 2WSEE 1KIKA 3JB9D 3H0HA 1HD3A 2M16A 3E19A 1VQ8Q 3CC7A 4J83A 3G4SQ 3TEEA 2M1HA 1K73R 3WXMB 2R5MA 3CC7Q 4C0ZA 1YJWA 3JCMP 1NZ9A 3MEWA 2FZCB 1Q81C 1HK9A 1VQPA 1YJWQ 4D8KA 3EFOA 4Y91A 1JO8A 5LJ5h 1W2BS 4E2FB 4P5NA 1RI0A 1D1CA 1W4SA 3CMAT 1JB0E 2FZKB 2EQMA 1UHCA 1R0BG 4FU6A 4QQGA 4A4FA 4C92A 2OTJT 1NE8A 5IN1A 3SEMA 1PKSA 5FROA 2YDLA 4NS5A 2EKHA 1D1BA 1NEBA 4M77C 1VQ9T 1TSFA 1OZ2A 3I55Q 2CP6A 1X2QA 1IO6A 4FT2A 2CH4A 1UJ0A 5IAYA 2GTJA 2HEQA 1M1KU 1MUZA 2LCCA 1KK7A 4EMKC 4JS4A 4M7DC 1IXDA 1OPKA 2RQRA 4HVWA 7AT1B 5CIUA 2EW3A 2AHJB 3FJPA 1YJNA 4HA8A 4HVVA 2HMAA 1YFNA 1M30A 2DL3A 2JT4A 2BZXA 1QKWA 1UFFA 1YJNQ 2X9HA 3CEYA 4JRQA 1IRXA 2CUDA 2EVRA 1VQ4T 3OQ5A 1YJ9T 1ACMB 4M78C 2EQJA 4PKCC 1KJWA 2BTTA 3RESA 1M3AA 2PZ1A 3LGLA 2PVDB 5KE3A 2QI2A 1MV0B 3UT1A 2O4XB 1WXBA 2EJ9A 2AKLA 1MGQA 1K9MC 2HSEB 3H8ZA 2D0NA 2RN8A 3OS5A 5LJ5j 1M90C 1RAGB 5GAN8 3VKIA 1EFNA 3CCJA 2CS7A 3NTIA 2VXEA 2JM9A 4FIBA 1AZEA 2I0NA 1UB4A 3CCJQ 4A4KA 1RUWA 2XDDA 2DLPA 5IXBA 2ZZDA 4LE9A 1PKTA 5KYUA 3A98A 2RB6A 2DIGA 4J9FA 3OW2S 5KE2A 4AFSC 3CC2T 2O9VA 4KGZB 2HQXA 4Z89A 2VKNA 4KBMB 1PC0A 1N9RA 2YUOA 5I22A 4JLIA 3V8LA 2LC4A 3G71Q 2EJFA 1VIFA 2K5LA 4BE2A 2CDTA 3EFOB 4PLIA 4KGVB 1RLQC 4AFQC 1VQ8T 4LUEA 5A0LA 2NUPA 3JCMQ 3CC7T 2DBKA 3QKJA 4C5HA 3I9QA 1YJWT 2M0OA 1VQPT 4E7HA 2MK5A 4C92B 4FSXA 6AT1B 2QASA 2XIDA 2Y4XA 1S72Q 5HK3A 1Q7YR 4ME7A 2MPXC 1QCNA 1PSFA 1QVFP 5L23A 5HY6A 3ASKA 2B86A 2RI2A 2E3IA 4PJNA 2F69A 5FRNA 3QYHB 4RG8A 3I56Q 2H3JA 2NYSA 3CCLA 2CREA 4M75D 2GFAA 1AHJB 3EGXA 4LUDA 2FYKA 5LJ5e 3SWNC 3CCLQ 4JRPA 5FWCA 2MF2A 2RHXA 3R6NA 2O9SA 4XK8E 2RMOA 1VOMA 4OMFB 3GIBA 1ZX6A 4C8QD 2A37A 1FMVA 3FDRA 2PU9B 2IPOB 2DD4A 5HK0A 4CC4B 1AZGB 3JCMh 4HCKA 2KSSA 4KULA 1WHGA 2ZPIB 1N5ZA 4GLMA 1MNDA 2RJEA 4QQ6A 2JUFA 5ECAA 3EHRA 1PWTA 1YJNT 2X4YA 1OOTA 3CCUA 2ROTA 4RTUA 3A8OB 3L2RA 5GANf 1O75A 5IT9E 2RJDA 1H92A 4J9IA 2X4JA 4M75E 1T3LA 4PJJA 2QTXA 2AKKA 4XTZA 3V8JA 4J6XA 3MPUB 1UUEA 1KFZA 4HCZA 2QQ9A 1ZA1B 5KYWA 4C8QE 1TXQA 4M7AA 3JV3A 2O01E 4MDWA 3JAME 1B7TA 3OYHA 2QDYB 1SPKA 4BI3A 3CCJT 1KC8U 1RI9A 1M9SA 3GBQA 1V1CA 1ZBJA 4XTUA 3CCEQ 3QG1A 3M0UA 5KCHA 3META 3M0RA 4F7UE 3PIOA 1C6VX 2PUKB 4A63B 2EGCA 4PJOG 1AT1B 2YWWA 3E2UA 2E3HA 3RDVA 4D6WA 2HBPA 2P0QA 4N4GA 1VQNA 1I81A 3KFVA 1M1GA 5GANh 2NUZA 3L42A 4JZ3A 2F2VA 3S6WA 1Y0MA 4E7SA 3BE3A 4ESRA 2GTOA 2RA2A 3OYAA 5LL6S 4UC4A 1QVGA 2EGAA 2FEIA 3EGDA 3QJYA 3RIRA 4QVDA 4HT8A 2J06A 1D3BA 3M0PA 3QUIA 2WSCE 1NG2A 3O8VA 4E7ZA 1SRMA 3OYIA 3CCQQ 3OYDA 2DO3A 3DKMA 2HAXA 3RKYA 1K9AA 1QVFA 3CD6Q 3HFOA 1ARKA 2ZPFB 3EGXB 1UGRB 2MOXA 3V7RA 2JVVA 2YUNA 4MZTA 3G6EQ 2MIOA 4V2SA 1PNJA 1A0NB 1YCYA 2V1QA 1IGUA 3VRZA 2A7YA 1J3TA 2KDSA 3CCLT 2DXTA 4EPCA 1CSKA 1QWFA 2K57A 4NOYA 3E1SA 3VS6A 4J7IA 3ME9A 2KT8A 3M59A 3M4YA 5LJ3f 3OYCA 3HFNA 3SB2A 2CZ6B 2JJ9A 5GJWB 2JW4A 3JCMV 2E70A 2RK1A 1AD5A 4OB1B 3JSCA 1TS9A 3VJPA 3C95A 2GCXA 1Q81R 1Q82C 1AWXA 2QDLA 5GAMd 1SEMA 2DRMA 3J80E 3SD4A 1KQSA 1FMWA 2KR3A 4L5GA 1QWEA 4JPBW 3CCUT 1JBMA 3JCMe 3CPFA 5GANj 4X9DA 3PVQA 2COZA 1XOVA 3RR6A 2VWFA 2COYA 5KYWB 1WQ7A 1X43A 2XMFA 5GMKm 3OYNA 3AHUA 4M7AB 5GAOm 3EH1A 4QVCA 2O31A 2QTVA 3TU4K 3GNFB 4F17A 1W2BP 1UGPB 1BI0A 3Q1JA 3S3OA 5LJ3h 3QXEB 1TH7A 2KEAA 3HRTA 1G83A 1ZQ1A 3TCJA 5FLXE 4QT7A 2J6KA 3JB9F 5FW9A 1AWWA 4M7DG 4OB0B 1KSWA 2LT4A 4E7JA 2GQIA 1MMDA 3LH0A 1U5SA 2DE0X 5GAOn 5GMKi 1NBEB 3QSUA 9ATCB 4JS5A 3CBOA 3VRYA 1VQ5A 4DEXA 2LCSA 2XHCA 4FM4B 3A8MB 3MHXA 4FT4A 2EIFA 3H9NA 1I0CA 1MV3A 2CP3A 4M78G 1X01A 4ZGEB 3UWNA 2K6DA 1VQNT 1QCOA 3HSBA 3TREA 4A4HA 1PHTA 1WPYA 3EGDB 3H0FA 2PVOB 3OYFA 4C92E 1Q95G 3SDZA 4YTLA 3MJXA 2H3EB 5GAOp 1K8AU 1Y71A 1YWPA 2VYTA 2E5KA 2QGGA 2VV5A 3UF4A 1VQMA 5DLQE 5D6XA 5GANe 4C0DC 3WVDB 1VQMQ 4XU1A 1NJIC 2QAZA 5EG2A 1FX7A 1K9MR 3JCMJ 2JM8A 1HSQA 1M90R 1TU0B 2HNIA 4ZN1A 4BI4A 4IUTA 1YITA 2FPDA 2J05A 1YITQ 3P8HA 2CZ1B 2DTOA 3CC2Q 3PTAA 5FU7C 3MCAB 1SSHA 4ZNXA 1RLPC 2E1HA 3X25B 1U8RA 4L6V5 1M5Q1 5LJ3j 2K9GA 4CC2A 3GP8A 3GOXA 1KD1C 3UA6A 3CPWS 4FYXB 1ABOA 5FU6B 1VYUA 1C0MA 1XNIA 1PSEA 2D8HA 4BDZA 3X26B 1OX8A 2LNVA 2ABLA 2E41A 1BI2A 3T9NA 1OX9A 1W70A 1D0XA 3M58A 3KXTA 1VQPQ 1BKBA 4HVUA 4F04B 1BIAA 4F16A 2DERA 5KH6A 2JTFA 3CMEA 3BDUA 2DILA 1M3CA 3CCRA 2IVWA 5GAN6 4FCYA 3CCRQ 4N4IA 1N27A 2PTKA 2KI7A 2DZCA 2RNAA 1K9MU 2V1RA 3CC4A 1P92A 5LJ5g 5CVIA 4FYWB 3CC4Q 1ZUKA 3C4SA 1MMGA 2K3BA 4CC3A 1W2BA 4PFPA 4GBQA 2XU8A 3FRNA 4BY6C 1GL5A 2F2XA 1G8XA 2FHDA 2DEUA 1V29B 1ZSZB 2K5FA 4PJOA 2MAMA 4N0AC 2ZCFB 4DOVA 2EFIA 4DOWA 2J6OA 2K3YA 1KQ1A 2BKDN 4KUIA 2RF0A 3FIFA 3M4GA 1R77A 4LDYA 3CCMA 4ZTJA 4XU0A 2JTMA 5LJ3e 3CCMQ 1VQ5T 1QMCA 1GCQC 4ZGDB 1K73U 2EYXA 3CBMA 2KAFA 5KYXB 1SHFA 3M54A 1AWOA 4BDYA 4CI0C 2YLBA 5D6WA 2F5KA 3QPHA 3EG1A 3PVLA 1OZ3A 5I11A 3OYEA 2D6FA 4M75F 2FB7A 3WVEB 3NGPA 3QO3A 1WZOA 3OYLA 1GXIE 1JJ2S 3O5ZA 3CCVA 1T3SA 2VUBA 1T0HA 3I35A 3UA7A 5J3BA 4C8QF 4RTYA 5IHIA 1VQMT 1VQ7A 3EH2A 3S3MA 5GAN4 2JNGA 5CR2A 3A8HB 1VQ7Q 4ZGJB 2CUBA 4J9CA 2B8AA 5I2MA 2EYZA 2RO0A 2DD5A 3M0QA 3LW5E 4RG2A 5D7UA 4GY5A 3HPWA 5GAN2 2KE9A 1VA7A 1YITT 4F14A 4F7UF 2MCNA 3VS3A 1WLPB 2HDAA 2RJFA 3VS1A 2F2WA 1YIJA 1X6OA 2F1LA 3URGA 2WSFE 2XDBA 3OA6A 1YIJQ 2KRNA 2K2MA 2P4RA 2KVQG 8AT1B 1VQ6A 5GAMg 3OS0A 3L2ZA 1M1KC 4FYYB 3JCMf 2ED1A 1PD1A 4O5VA 4C5EA 4J9BA 2M9UA 4OGEA 1M8VA 5KYNA 1BIBA 4RTVA 5GAN5 4BE0A 1QVGP 3BDLA 2MI6A 1QCFA 5I2SA 4DA4A 2LJ0A 4FW2A 4PL6A 1GRIA 4M77A 4M7AE 2EQKA 2LVMA 1PG5B 2MWPA 3VS5A 3VUBA 4LDVA 4C5IA 1WHKA 4RTXA 3CMET 1RABB 4MMKA 3CCRT 5CO7A 3GLXA 4PFZA 4EMKA 3CCSA 2BZ8A 1V76A 3CBPA 2L0AA 3CCSQ 4M7DA 4ELZC 2DX1A 1U1TA 3CC4T 3CXCS 4PJOB 1AVZC 1CKBA 4IUUA 3JCMb 5IXFA 2DTHA 4X34A 2OAUA 1QW1A 1FXXA 2SRCA 1QLYA 4QW2A 2J6FA 4M78A 2DXUA 2RQTA 4PFOA 5DLOA 2VASA 2XK0A 1DJ7B 5FWBA 2XICA 3MO8A 1VYVA 3CCMT 3M0SA 4XU2A 1D0YA 1BB9A 2DJQA 1UGVA 2RD1A 1KHIA 1Q82R 2DFUA 4M75C 3BFMA 1KQSP 3CCUQ 4DBQA 2VVKA 2D8JA 4OMPA 2JMCA 2DL8A 2X51A 4J8OA 1Q7YU 1YWOA 1GBQA 4C8QC 1AOJA 1H3ZA 4RKUE 3CCVT 2WACA 1IZ6A 2FPEA 2O2OA 2V8KA 1N8RC 2LNHB 5KYUB 2HQEA 2DL5A 2W0ZA 3EG0A 1UE9A 3QDRB 5KYYA 5LJ5d 4JZ4A 4FW1A 1H3HA 1XQHA 1VQ7T 3PFSA 3RBBB 1NM7A 1OV3A 4BI8B 2L8DA 1UECA 1E6GA 1WJRA 5FU6C 2JN0A 4IUVA 5C0MA 1Q86R 2OTLA 2RQUA 2EKOA 2C0IA 2OTLQ 3OYYA 3LWHA 3X20B 5C6SA 3EGUA 2LMJA 4VUBA 2ROLA 4K11A 2EPDA 2QGFB 4B9WA 3MKDA 2KBTA 1R0CB 1YIJT 3JB9I 3RERA 1VQNQ 3EG2A 2QQRA 2NUPB 4DBFA 1M2VA 4R55A 1X2KA 5IHKA 4C92F 4Y28E 1Q82U 2E65A 3FEOA 2KYBA 1VQ6T 5CKEA 4M77B 4EDUA 5D6YA 2AT1B 1UHFA 5DM7R 3SWNA 3NTHA 2L3QA 4HCCA 1NPRA 4LNPA 3EG9A 2R57A 3QBYA 4EMKB 1VQLA 1ZSZC 2W10A 2LQNA 4M7DB 1VQLQ 2VGNA 1W1FA 1WIEA 4A4GA 2QEXA 2XD0A 1NJIR 2QEXQ 1GFDA 2M51A 3THKA 2YXYA 5CQXA 5GMKh 2HKNA 1OPLA 1MHNA 2YRVA 3CCST 2VGMA 3H41A 1U1SA 3A5ZB 2ZGWA 1F1BB 1G3SA 1Q86U 2MYSA 4M78B 1ABQA 2BIVA 1UG1A 1YN8A 1BYMA 2A0FB 1G3YA 3J81E 1YI2A 2A3LA 2DEQA 2R5AA 2CP5A 8ATCB 2V8JA 1YI2Q 2DA9A 3NPFA 2FRWA 1KD1R 1OULA 4FL6A 4WF2A 1KC8C 4Q5WA 5CKHA 1H8KA 3HRUA 4R56A 3LWIA 1B3QA 1WJQA 4AG1C 1E7OA 4IURA 1C1AA 1WA7A 4JDSA 1VYTA 2A28A 2HKQB 2EQUA 4II1A 3L2VA 1BCMA 3KUFA 5DY9A 1ZBXA 3I5RA 2OI3A 2DMOA 3D7SB 3M55A 1RAAB 4E47A 2CT4A 3M5AA 3CPWP 1RADB 1EIFA 4AG2C 1AWJA 1I4K1 3INZA 5CQYA 4C92D 3G1JA 1KHCA 3DB3A 3UDCA 3AT1B 4JLGA 4XU3A 1I5OB 5KYYB 3JB9G 3PNWC 4HT9A 3G7ZA 1X6GA 1BK2A 2QA4A 2JXBA 3IQLA 1K0XA 4Z88A 4BACA 1SKUB 1M27C 2CH4W 4RCCA 2VC8A 2BZYA 3ZEHA 4PJOD 4MMLA 2J7IA 2KMTA 4ZN3A 1RAIB 4PLLA 3FJ5A 2DBMA 5GMKj 2EYYA 2CZ0B 3VS0A 5LJ3g 3VS7A 1X75C 1W6XA 2OTLT 1YNZA 1KD1U 3HRSA 1LPLA 1TTHB 3PE0A 1VQ5Q 1D1AA 1M2VB 1PCXA 4WCIA 3ZFJA 1M4ZA 1LVKA 4LXCA 4C92C 3TSWA 1I07A 2QG9B 4KGXB 1WHLA 3SFMA 1Q81U 2DIQA 1TWBA 3HL8A 3LGFA 4JJNK 1BI3A 4R0KA 3H6ZA 3SWNB 1D3BB 3P8BB 1WFWA 3OY9A 4CC7A 1BI1A 3EG9B 2L3SA 1WNLA 2HBWA 1KQ2A 2QYZA 2RHZA 2E6ZA 3OB9A 2LZ6B 1OYXA 1QVPA 2DF6A 3M56A 4JUVA 1IHVA 1UJYA 2EWNA 4FSSA 1TUGB 2ESWA 4PJOE 1VQLT 2PQWA 2DTIA 2HL5C 1ZLMA 1X69A 2D9TA 1XJWB 2QEXT 3CQTA 2DRKA 2CZ7B 3JB9J 3QIIA 3KBGA 3TQ7P 1FYNA 3REBB 4IIMA 1B34A 5GJVB 3OMCA 1NYFA 2ECZA 5M9OA 2BE9B 2DYBA 3DLMA 3E9FA 1JXMA 2JTEA 3L1AA 3OMGA 1GCPA 2Y4YA 2XDPA 2YSQA 2DM1A 3M9QA
chains in the Genus database with same CATH topology
3HP9A 1N6AA 1O75A 3A8HB 5CR2A 4ZGJB 5IT9E 2KQWA 2RJDA 4OB3B 2B8AA 5I2MA 2MMPA 3L2QA 5GMKe 2RO0A 2DD5A 4RG2A 3LW5E 2X4JA 1YI2T 4M75E 4A54A 2E5QA 4GY5A 2YHTA 3HPWA 5GAN2 2QTXA 1YITT 4F7UA 3MEUA 4XTZA 3RKXA 4F7UF 3VU3C 3JCMW 4QQDA 3V8JA 1FWZA 3LYIA 4J6XA 1NJIU 3BY7A 4HCZA 2QQ9A 3OYGA 3OYKA 3CMAA 5GAOq 4NL2A 2LX9A 2RJFA 2YLCA 4C8QE 3QJ6A 4C0FA 1Y7XA 4N4HA 4M7AA 1YIJA 1X6OA 2O01E 3URGA 3OS2A 4M7AF 4NL3A 2FVUA 2WSFE 4MDWA 2XDBA 3JAME 2EJGA 4IUPA 3OA6A 4JRKA 3OYHA 4BE1A 4IUQA 2OTJA 2L3RA 2P4TA 4M77D 5A0GA 2QDYB 2P0KA 4BI3A 2KVQG 3G4SA 5KCOA 3R6OA 3CPWA 3CCJT 1KC8U 5GAN4 1VQ6A 5GAMg 2NLUA 3OS0A 1M9SA 4E7KA 3L2ZA 4X9CA 5CKDA 1M1KC 3PIPA 2DKGA 4XTUA 3JCMf 5GANd 3E9GA 4O5VA 4C5EA 3QG1A 2M9UA 4OGEA 4MZMA 5KCHA 3META 4M77G 2LQ8A 1M90U 1M8VA 4F7UE 1VQ9A 4J6YA 3PIOA 2PUKB 3RMQA 1BIBA 2X35A 4RCBA 5GAN5 4BE0A 4M7DD 1G3TA 4PJOG 1R8OB 3BDLA 2MI6A 2QQSA 2R58A 5I2SA 4DA4A 4D6WA 2HBPA 2P0QA 4PL6A 4BUGA 2K5IA 4N4GA 1VQNA 3OSSC 4A4EA 4M77A 1I81A 4M77F 4M7AE 2EQKA 3FB9A 2LVMA 1K8AC 2MWPA 1M1GA 5CKBA 5GANh 3VUBA 4LDVA 4C5IA 1VQKA 3L42A 4BB7A 2QA4T 1WGSA 5J39A 2ZPBB 2DXCA 3CMET 1Q86C 4MMKA 2GF7A 4HKEA 3CCRT 5CO7A 3S6WA 3GLXA 3RMSA 3BW1A 2ZPHB 2BUDA 3JRZA 4BD3A 5A0DA 4EMKA 3CCSA 3DB4A 3CCET 2RA2A 3CBPA 4XTVA 3OYAA 4M78D 4M7DA 5LL6S 3M53A 4ELZC 4UC4A 1QVGA 4M7DF 1I5LA 4MZPA 1U1TA 3CC4T 3CXCS 3RUXA 3I55A 5CKFA 2CYZB 3OYBA 3QJYA 3RIRA 4QVDA 5HKCA 4PJOB 3HHTB 4HT8A 1D3BA 3PMTA 3JCMd 1IREB 1VQ4A 3QUIA 2WSCE 3O8VA 4TVRA 4PJOC 1YJ9A 4XQ3A 4IUUA 3OYIA 5CK9A 3OYDA 2CGHA 2LDMA 2DO3A 4M75G 3DKMA 4OGCA 4M77E 3RKYA 2DTHA 3JCMb 2HAXA 1QVFA 3HFOA 4X34A 2OAUA 3OYJA 1QW1A 2L89A 2ZPFB 1FXXA 2E6NA 1UGRB 5GAOr 4MDXA 4QW2A 4OF1A 4M78A 2JVVA 2DXUA 3V7RA 4MZTA 4M78F 2VXFA 3NTKA 3JCMX 4V2SA 1YHQT 1YCYA 4C8QG 5CCAA 5DLOA 5GAMf 3GPLA 3UPUA 2LCLA 1UGSB 4M7DE 1HXDA 2A7YA 2XK0A 4E7LA 1DJ7B 1ZHIA 2KDSA 2QQAA 4C0GA 3CCLT 2XICA 3MO8A 4A53A 2DXTA 5L8RE 1SSFA 2LTOA 4EPCA 3CCMT 2GQVA 5LJ5f 5GAN3 2P0PA 2V8IA 4XU2A 2K57A 3E1SA 4NOYA 4PNOA 3MP6A 4J7IA 1H641 3CCQT 2O4XA 1RL2A 2K2VA 3ME9A 4M75B 3M59A 3M4YA 5LJ3f 1VQOT 5AYFA 3OYCA 2RD1A 3CD6T 1KHIA 3HFNA 2DPPB 3SB2A 2DAQA 4J7FA 4M75C 2CZ6B 3BFMA 4O6JA 3OBWA 4B9XA 4J5YA 2GFUA 2RI3A 4F7UG 4M7AD 3JCMV 2ZPGB 2E70A 3G6ET 2RK1A 2QQBA 4M78E 1B34B 4QVZA 4C8QB 4J8OA 4OB1B 1Q7YU 3CC2A 3JSCA 1JJ2A 2RH2A 4C8QC 4EMGA 4OP0A 1XTDA 4M7AG 3VJPA 2HD0A 3C94A 3C95A 1H3ZA 4RKUE 3CCVT 2LRQA 3LX7A 2GCXA 1LOJA 1Q82C 1M1FA 2WACA 5GAMd 1O9SA 1IZ6A 2JOYA 2L5QA 3VV0A 4LDWA 4C5GA 3J80E 3M9QA 3SD4A 2V8KA 1LJOA 1N8RC 1KQSA 4L5GA 2E12A 4OB2B 4ELYC 3HKSA 1WQWA 2HQEA 2K4YA 3VYGA 3OYMA 3CCUT 1YBYA 2DZ9A 1JBMA 3PT9A 3QDRB 4F7UB 5LJ5d 3JCMe 1XQHA 1Y07A 3CPFA 3LLRA 4X9DA 2K3XA 5GANj 1VQ7T 3PFSA 3ER0A 1VQ8A 2WSEE 1XOVA 5LJ3d 3JB9D 4BI8B 1VIEA 2M16A 2L8DA 2LQKA 3E19A 3CC7A 4J83A 1WJRA 3TEEA 1WQ7A 2M1HA 5FU6C 3QYGB 2I2LA 5GAMh 2JN0A 3M57A 3WXMB 3OW2A 2R5MA 4IUVA 5C0MA 5GMKm 4C0ZA 3OYNA 1YJWA 3JCMP 1NZ9A 3MEWA 1Q81C 4M7AB 1HK9A 5GAOm 2OTLA 4QVCA 3AHUA 4LDXA 1VQPA 2EKOA 2EAYA 3OYYA 4Y91A 3GNFB 3TU4K 4M7AC 5LJ5h 3X20B 5C6SA 3LWHA 1W2BS 1UGPB 3F70A 4VUBA 4P5NA 1RI0A 1BI0A 3Q1JA 1W4SA 5LJ3h 3S3OA 2MWOA 3QXEB 1TH7A 2FL7A 3CMAT 3ZBDA 3G71A 3HRTA 1JB0E 1ZQ1A 3TCJA 5FLXE 4B9WA 2EQMA 3JB9F 1YIJT 4FU6A 3JB9I 3RERA 4M7DG 4LD9K 2QQRA 4QQGA 4OB0B 1K73C 2LT4A 4R55A 4A4FA 4C92A 2OTJT 1NE8A 5IN1A 4C92F 4Y28E 2EYQA 4E7JA 3G4ST 2E65A 4N0AA 4L59A 3FEOA 1Q82U 3QZ5B 4JRIA 3LH0A 1VQ6T 1WJSA 5FROA 1G3WA 5GAOn 5GMKi 5CKEA 1N8RU 2QXFA 3P8DA 3QSUA 2RM4A 4JS5A 3CBOA 4CRIA 4M77B 2RJCA 4NS5A 1VQ5A 4EDUA 1NPPA 2XHCA 5D6YA 4FM4B 3A8MB 3MHXA 4ZTFA 4FT4A 1UEBA 4LDUA 4M77C 5DM7R 2F5TX 2EIFA 1VQ9T 1S72A 4XAXB 3SWNA 1OZ2A 1Y96A 3NTHA 4FT2A 5GAN7 4HCCA 1NPRA 5I21A 5IAYA 4M78G 1X01A 2R57A 3QBYA 3UWNA 4EMKB 4ZGEB 1M1KU 1VQLA 4IKFA 2LCCA 1VQNT 3HSBA 4M7DB 2VGNA 3I56A 4EMKC 3TREA 3JB9H 4A4GA 3V7SA 4A4HA 4JS4A 2QEXA 3MP8A 2XD0A 1WPYA 1VQKT 4M7DC 2PVOB 3OYFA 1QP2A 4C92E 3SDZA 1I8FA 2KY9A 5CQXA 5GMKh 4J6WA 5CIUA 1MHNA 2YRVA 3CXCA 3CCST 2AHJB 3C12A 3FJPA 4EMHA 4YTLA 2VGMA 1YJNA 1U1SA 4HA8A 5GAOp 3A5ZB 1K8AU 1LNXA 1Y71A 2ZGWA 4ATOA 4C0DB 1G3SA 2VYTA 3I55T 3CEYA 4JRQA 1Q86U 2VV5A 1VQMA 5DLQE 4M78B 2BIVA 2RHUA 5D6XA 5GANe 4C0DC 3EFRA 3WVDB 1VQ4T 3OQ5A 4XU1A 1BYMA 1NJIC 1YJ9T 5EG2A 1FX7A 3PMIA 3JCMJ 3X28B 4M78C 1G3YA 4DQ2A 3S3NA 3JCMg 3J81E 2EQJA 4PKCC 3RESA 1YI2A 2A3LA 2HNIA 2DEQA 2R5AA 4ZN1A 1G5VA 4BI4A 4IUTA 1KG1A 3J7AF 2V8JA 3LGLA 2JZ2A 2PVDB 1YITA 5KE3A 2QI2A 5FU7B 4XTYA 2O4XB 3UT1A 4FL6A 4WF2A 1KC8C 5GAMj 3P8HA 4Q5WA 3OS1A 2DXBA 5FRMA 5CKHA 2CZ1B 2DTOA 3HRUA 4R56A 3LWIA 3PTAA 5FU7C 1WJQA 3MCAB 2EJ9A 4IURA 4JDSA 1MGQA 1K9MC 3H8ZA 3OS5A 3QZ9B 2EQUA 4II1A 2E1HA 5LJ5j 3X25B 3L2VA 1U8RA 1M90C 2DK3A 4L6V5 5GAN8 3VKIA 1M5Q1 3KUFA 5DY9A 5LJ3j 3CCJA 2PUOB 2CS7A 3NTIA 1ZBXA 2VXEA 4KT0E 4FIBA 1UB4A 1VUBA 4A4KA 3MP1A 3OSVA 2XDDA 4E7IA 2LT1A 3GP8A 3GOXA 2ZZDA 1KD1C 3M55A 4E47A 3CPWS 4KUDK 3M5AA 5A2QE 5FU6B 2C06A 2XKOC 2RB6A 1EIFA 2E64A 2DIGA 1XNIA 3OW2S 1PSEA 1I4K1 3PGGA 5KE2A 4BDZA 3INZA 5CQYA 4C92D 3CC2T 3X26B 1KHCA 2LNVA 3DB3A 3UDCA 4JLGA 5J26A 2HQXA 4XU3A 2E41A 3JB9G 1BI2A 1QP3A 3T9NA 3PNWC 3M58A 4HT9A 4KBMB 3JCMc 3KXTA 1BKBA 1N9RA 4LD6A 1BIAA 2G3RA 3G7ZA 2RHYA 3N5BB 4C92G 5KH6A 2QA4A 2JTFA 3CMEA 3BDUA 3VUZA 4BACA 4RMOA 4RCCA 3CCRA 2VC8A 4XTXA 2IVWA 2CKKA 5GAN6 3GF5A 4JLIA 3V8LA 2LC4A 3ZEHA 2EJFA 3CCEA 4N4IA 1VIFA 1N27A 2K5LA 3QHSA 4MMLA 4BE2A 4PJOD 2KMTA 2DZCA 4ZN3A 1K9MU 4PLIA 4XTWA 3V7CA 1VQ8T 3CC4A 1P92A 4PLLA 5LJ5g 5CVIA 5A0LA 2Y90A 3C4SA 3JCMQ 5GMKj 3CC7T 2IG0A 3QKJA 2CZ0B 4Z02A 1QVGS 5LJ3g 4C5HA 4BY6B 1X75C 1W2BA 1YJWT 2M0OA 2OTLT 2XI9A 5CAIA 1KD1U 1VQPT 2DJZA 3HRSA 2XU8A 3FRNA 4E7HA 4BY6C 4C92B 5GANg 4HCBA 3A8GB 3FLGA 4FSXA 2XIDA 2Y4XA 3ZFJA 2FHDA 1M4ZA 5HK3A 1V29B 4C92C 4ME7A 2K5FA 4PJOA 4PJOF 2MAMA 3G71T 4N0AC 2ZCFB 4DOVA 1QVFS 3RKWA 1PSFA 3SFMA 2EFIA 3L2WA 2DIQA 1Q81U 4DOWA 5HY6A 3L2UA 3ASKA 3HL8A 2RI2A 3LGFA 3MEAA 4OVAA 1YHQA 5GAMe 4JJNK 2F69A 2K3YA 3OBYA 1KQ1A 2BKDN 3QYHB 4RG8A 1BI3A 1OI1A 5FRNA 4KUIA 2H3JA 2RI5A 3H6ZA 2XG8D 1Y96B 1D3BB 3P8BB 3SWNB 3DLLA 3CCLA 2RHIA 3FIFA 4M75D 3OY9A 2GFAA 3M4GA 1BI1A 1AHJB 2FYKA 5LJ5e 3SWNC 4JRPA 4LDYA 1WNLA 3CCMA 4ZTJA 3EAEA 2MF2A 4XU0A 2RHXA 2JTMA 4XK8E 5LJ3e 3CCQA 1VQ5T 1Q7YC 1KQ2A 4OMFB 1VQOA 1UGQB 2RHZA 4ZGDB 3GIBA 2E6ZA 3CD6A 3OB9A 1K73U 1OYXA 1QVPA 3CBMA 3M56A 2KAFA 4JUVA 1S72T 3A8LB 2EWNA 4C8QD 2X4XA 3M54A 3EFSA 3FDRA 4BDYA 3V8KA 2PU9B 2PVGB 4PJOE 3G6EA 2PQWA 2DTIA 4CI0C 1VQLT 2YLBA 5D6WA 2DD4A 2F5KA 5HK0A 3X24B 2D9TA 3JCMh 3QPHA 1N9SA 3I56T 1OZ3A 4M75A 2E10A 2KSSA 3NFCA 5GMKl 4M75F 3OYEA 3FC3A 2FB7A 2D6FA 5GAOl 4KULA 3WVEB 2QEXT 3QO3A 3GNGA 3OYLA 2ZPIB 1GXIE 2D0QB 1JJ2S 3CCVA 2CZ7B 3S3MA 3JB9J 2VUBA 3KBGA 3QIIA 2RJEA 1JRIA 2JUFA 4QQ6A 1B34A 2ZPEB 5J3BA 4C8QA 3OMCA 1YJNT 4C8QF 2KK4A 5M9OA 3MEVA 3DLMA 2X4YA 3E9FA 3CCUA 2DVEA 3L1AA 2RK2A 3OMGA 3VYHB 1KQSS 1VQMT 1VQ7A 2Y4YA 3A8OB 2X4WA 2XDPA 4GLKA 3L2RA 5GANf 2JNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIA A;  4V2S A;  4C92 G;  1YCY A;  4C8Q G;  5GAM f;  4M77 C;  3BDU A;  5GMK e;  4M7D E;  4RCC A;  1HXD A;  3SWN A;  1Y96 A;  2VC8 A;  4XTX A;  5GAN 6;  5GAN 7;  4M75 E;  4A54 A;  4JLI A;  3V8L A;  4A53 A;  5I21 A;  2DXT A;  2YHT A;  2EJF A;  4M78 G;  5GAN 2;  1X01 A;  4EMK B;  4PJO D;  2QTX A;  4MML A;  3QHS A;  4C92 A;  4F7U A;  4XTZ A;  5LJ5 f;  3RKX A;  4F7U F;  5GAN 3;  2DZC A;  4XU2 A;  3VU3 C;  2K57 A;  4NOY A;  4PNO A;  3JCM W;  3HSB A;  3V8J A;  1H64 1;  4XTW A;  4J6X A;  3V7C A;  4EMK C;  3JB9 H;  3BY7 A;  4M75 B;  5LJ3 f;  3V7S A;  5LJ5 g;  1WPY A;  2RD1 A;  2Y90 A;  3HFN A;  4M7D C;  5GAO q;  4NL2 A;  3JCM Q;  3SB2 A;  5GMK j;  4C92 E;  2YLC A;  4C8Q E;  4M75 C;  1I8F A;  3BFM A;  5LJ3 g;  4J5Y A;  4F7U G;  5GMK h;  4J6W A;  4M7A A;  4M7A F;  4M7A D;  5CAI A;  4NL3 A;  2DJZ A;  3JCM V;  2EJG A;  3FJP A;  4JRK A;  4EMH A;  4M78 E;  1B34 B;  4C92 B;  4C8Q B;  1U1S A;  4HA8 A;  4M77 D;  5GAN g;  5GAO p;  1LNX A;  5GAN 4;  2ZGW A;  5GAM g;  4C92 C;  4C8Q C;  4EMG A;  4PJO A;  4PJO F;  3L2Z A;  4X9C A;  4N0A C;  4OP0 A;  4M7A G;  4M78 B;  3RKW A;  5GAN e;  2DKG A;  4XTU A;  3JCM f;  5GAN d;  3EFR A;  4XU1 A;  1LOJ A;  4M77 G;  5GAM e;  3JCM J;  5GAM d;  4M78 C;  1KQ1 A;  4DQ2 A;  4J6Y A;  4F7U E;  1M8V A;  3JCM g;  1BIB A;  4RCB A;  3RES A;  1LJO A;  1Y96 B;  1D3B B;  3SWN B;  5GAN 5;  4M7D D;  2HNI A;  4PJO G;  2DEQ A;  3FIF A;  4M75 D;  1WQW A;  3M4G A;  3JCM c;  2FYK A;  5LJ5 e;  3SWN C;  2DZ9 A;  1JBM A;  1WNL A;  4F7U B;  5LJ5 d;  3JCM e;  5GAN j;  4X9D A;  4XU0 A;  4M77 A;  1I81 A;  5LJ3 e;  4M77 F;  1KQ2 A;  4XTY A;  5LJ3 d;  3FB9 A;  4WF2 A;  3JB9 D;  4M7A E;  5GAM j;  5GAN h;  3GIB A;  2DTO A;  1WQ7 A;  4JUV A;  4MMK A;  2I2L A;  2EWN A;  2JN0 A;  4C8Q D;  5GAM h;  2EJ9 A;  3EFS A;  5GMK m;  1MGQ A;  3JCM P;  3AHU A;  3BW1 A;  4M7A B;  1HK9 A;  5GAO m;  4M7D B;  4QVC A;  3V8K A;  2E1H A;  4EMK A;  5LJ5 j;  4PJO E;  2RA2 A;  2EAY A;  2DTI A;  4XTV A;  2YLB A;  4Y91 A;  4M78 D;  5GAN 8;  4M7A C;  4M7D A;  1M5Q 1;  5DY9 A;  5LJ3 j;  5LJ5 h;  4M7D F;  3JCM h;  1N9S A;  1I5L A;  2VXE A;  1U1T A;  2E10 A;  4M75 A;  5GMK l;  4M75 F;  3RUX A;  2FB7 A;  5GAO l;  5LJ3 h;  3RIR A;  4QVD A;  1TH7 A;  3QO3 A;  4PJO B;  4HT8 A;  1D3B A;  3JCM d;  3QUI A;  3JB9 J;  4PJO C;  3JB9 F;  2RB6 A;  1JRI A;  4XQ3 A;  3JB9 I;  3RER A;  2E64 A;  4M7D G;  2CGH A;  4M75 G;  1B34 A;  3JCM b;  4M77 E;  1I4K 1;  2DTH A;  3PGG A;  3RKY A;  3INZ A;  4C8Q A;  4C92 F;  4C92 D;  3HFO A;  4C8Q F;  2E65 A;  4N0A A;  4JRI A;  2DVE A;  3L1A A;  4XU3 A;  2E41 A;  5GAO n;  5GMK i;  5GAO r;  3QSU A;  3JB9 G;  2RM4 A;  3V7R A;  4M78 A;  4HT9 A;  2DXU A;  4M77 B;  2VXF A;  4M78 F;  5GAN f;  3JCM X;  1N9R A; 
#chains in the Genus database with same CATH topology
 3HP9 A;  2D1X A;  2KQW A;  2OX7 A;  4OB3 B;  3U23 A;  1WHJ A;  2X3X D;  5GMK e;  4JJD A;  1YI2 T;  4J9H A;  4JJB A;  4A54 A;  4QKU A;  2KXC A;  4Y92 A;  1RAF B;  3VU3 C;  3JCM W;  3OW2 P;  1M1K R;  3BY7 A;  1WI7 A;  3OYG A;  3OYK A;  1TUC A;  2LX9 A;  2YLC A;  3QJ6 A;  4C0F A;  4N4H A;  2IIM A;  4M7A F;  3OS2 A;  2FVU A;  1BU1 A;  4BE1 A;  2L3R A;  4M77 D;  5A0G A;  3G4S A;  3CPW A;  5KCO A;  3QWX X;  3CME Q;  2EQI A;  2GNC A;  2VB6 A;  4E7K A;  4M4Z A;  4EIK A;  3PIP A;  5GAN d;  3E9G A;  1G2B A;  3I5S A;  2NUT A;  4OMO A;  1M90 U;  2EBP A;  4J6Y A;  2FPF A;  3RMQ A;  2X35 A;  4M7D D;  2YT6 A;  2R58 A;  1JU5 C;  2HZY A;  4BUG A;  2K5I A;  4A4E A;  1K8A C;  5CKB A;  1VQK A;  4BB7 A;  2QA4 T;  1RAC B;  5J39 A;  2ZPB B;  2DXC A;  2ENM A;  4HKE A;  1VQK Q;  2BUD A;  1ZSG A;  4BD3 A;  5A0D A;  2KRM A;  4M78 D;  3M53 A;  4MZP A;  3I55 A;  3CXC P;  5CKF A;  4OML A;  1MNE A;  3HHT B;  3RNJ A;  1E6H A;  4OMQ A;  4XQ3 A;  5CK9 A;  2CGH A;  2LDM A;  4M75 G;  4OGC A;  4M77 E;  4J9G A;  3A1P A;  2Z0W A;  1CKA A;  5GAO r;  2C0T A;  1NLO C;  1OU9 A;  2KYM A;  4OF1 A;  2VXF A;  3JCM X;  4C8Q G;  5CCA A;  5GAM f;  3GPL A;  1UGS B;  4M7D E;  1HXD A;  1M3B A;  2QQA A;  4C0G A;  1PM3 A;  4A53 A;  1SSF A;  2LTO A;  3CCV Q;  5GAN 3;  2V8I A;  1D0Z A;  4Z02 A;  4B9X A;  1WYX A;  3MP6 A;  1RL2 A;  2K79 A;  4RTT A;  2DPP B;  4O6J A;  3OBW A;  2SEM A;  2YRD A;  1N8R R;  4F7U G;  4M7A D;  2ZPG B;  4DEY A;  4M78 E;  1B34 B;  4QVZ A;  2YUP A;  2KXD A;  2DL7 A;  1JJ2 A;  1TG0 A;  4EMG A;  1U06 A;  2M0Y A;  4OP0 A;  1XTD A;  4DBH A;  3C94 A;  2LRQ A;  3LX7 A;  1LOJ A;  1M1F A;  1O9S A;  2AK5 A;  4C5G A;  1LJO A;  4ORZ A;  2E12 A;  4OB2 B;  1M2O A;  1SHG A;  3HKS A;  4ELY C;  4RTZ A;  4JJC A;  4PJL A;  1QKX A;  2DZ9 A;  3PT9 A;  2LQW A;  3LLR A;  1YCS B;  2K3X A;  2DNU A;  5LJ3 d;  1NYG A;  2DVJ A;  1VIE A;  2LQK A;  4B6M A;  3QYG B;  2I2L A;  2JMA A;  3M57 A;  5GAM h;  1VQ6 Q;  3OW2 A;  2YUQ A;  1WXT A;  4LDX A;  2EAY A;  1EZZ B;  4M7A C;  2E4H A;  3F70 A;  1TUD A;  2C0O A;  2MWO A;  2COW A;  2FL7 A;  1Z9Q A;  3ZBD A;  3G71 A;  1UTI A;  3EHQ A;  2FZG B;  3VS2 A;  2NUT B;  4LD9 K;  1K73 C;  2QK0 A;  2EYQ A;  3G4S T;  4N0A A;  4L59 A;  4OMN A;  3QZ5 B;  4JRI A;  2GGR A;  1WJS A;  1M8M A;  1G3W A;  1N8R U;  2QXF A;  3P8D A;  2RM4 A;  4CRI A;  5EC7 A;  2RJC A;  4J9E A;  1NPP A;  1K1Z A;  4ZTF A;  2CP7 A;  1UEB A;  4LDU A;  1S72 A;  2F5T X;  2AZS A;  1SRL A;  1U3O A;  4XAX B;  1Y96 A;  5GAN 7;  1HYO A;  1WX6 A;  2BE7 D;  5I21 A;  1GCQ A;  4IKF A;  3ZL7 C;  3I56 A;  3JB9 H;  3V7S A;  2OJ2 A;  3MP8 A;  1VQK T;  1QP2 A;  2GBQ A;  1I8F A;  2KY9 A;  4J6W A;  2HQH A;  1JEG A;  3CXC A;  3C12 A;  2G6F X;  4EMH A;  1LNX A;  1K4U S;  4ATO A;  4C0D B;  3I55 T;  1KC8 R;  2ATC B;  2RHU A;  3EFR A;  4KH0 B;  2LJ1 A;  2L2P A;  2H8H A;  3PMI A;  1JQQ A;  3X28 B;  4DQ2 A;  3S3N A;  3JCM g;  2KRS A;  1LCK A;  1G5V A;  1KG1 A;  3J7A F;  3EG3 A;  2JZ2 A;  1PRL C;  1YP5 A;  5FU7 B;  4XTY A;  5GAM j;  5FRM A;  2A36 A;  3OS1 A;  2DXB A;  2RPN A;  3HTR A;  1NLP C;  2V26 A;  2FRY A;  2M02 A;  3QZ9 B;  1OQK A;  2DK3 A;  1WDX A;  1OEB A;  1Y57 A;  2PUO B;  4KT0 E;  2EGE A;  1VUB A;  2HSP A;  3MP1 A;  3OSV A;  4E7I A;  2LT1 A;  4KUD K;  5A2Q E;  3M0T A;  2C06 A;  2XKO C;  2E64 A;  3PGG A;  5J26 A;  2JS2 A;  1RAE B;  1QP3 A;  2LP5 A;  3VS4 A;  1BBZ A;  3NHN A;  3JCM c;  4LD6 A;  2AIR B;  2G3R A;  2RHY A;  3N5B B;  4C92 G;  3VUZ A;  1X27 A;  4RMO A;  4XTX A;  2CKK A;  2NWM A;  3GF5 A;  1IGQ A;  3CCE A;  2FG0 A;  3QHS A;  4ANJ A;  2DL4 A;  4AMC A;  4XTW A;  3V7C A;  2Y90 A;  2AZV A;  2IG0 A;  1QVG S;  4BY6 B;  1IHW A;  2HL3 A;  2XI9 A;  2JS0 A;  3ULR B;  5CAI A;  2DJZ A;  1WXU A;  4PK4 A;  1D09 B;  2O88 A;  5GAN g;  4HCB A;  3A8G B;  2CSI A;  3FLG A;  4PJO F;  3G71 T;  1QVF S;  3RKW A;  3L2W A;  3L2U A;  3MEA A;  1YHQ A;  4OVA A;  5GAM e;  3OBY A;  1OI1 A;  1YHQ Q;  2RI5 A;  2XG8 D;  1Y96 B;  4IIO A;  2KGT A;  4AFU C;  3DLL A;  2RHI A;  1SF9 A;  3EAE A;  2CP2 A;  2L3P A;  3CCQ A;  1Q7Y C;  1PD0 A;  1VQO A;  1UGQ B;  3CD6 A;  5IHN A;  2ZAE A;  3TVT A;  1S72 T;  1VQO Q;  3A8L B;  1FMK A;  1TOV A;  1Z9Z A;  2X4X A;  5HCK A;  3EFS A;  2KNB B;  2RQV A;  2K7A A;  3V8K A;  2PVG B;  3G6E A;  4E6R A;  3X24 B;  1RAH B;  1NEG A;  1N9S A;  3I56 T;  4M75 A;  2E10 A;  3NFC A;  5GMK l;  3FC3 A;  5GAO l;  3GNG A;  4KH1 B;  2D0Q B;  1JRI A;  2ZPE B;  4C8Q A;  1PRM C;  2KK4 A;  3MEV A;  1I1J A;  2DVE A;  2RK2 A;  3VYH B;  4PJM A;  1KQS S;  2X4W A;  4GLK A;  2LJ3 A;  1N6A A;  1WHH A;  2KT1 A;  2KRO A;  2MMP A;  3L2Q A;  2E5Q A;  2YHT A;  1K0S A;  4F7U A;  3MEU A;  3C0C A;  1ZUU A;  3RKX A;  4QQD A;  1FWZ A;  3LYI A;  1NJI U;  2A08 A;  2DYI A;  3CMA A;  5GAO q;  4NL2 A;  1T0J A;  3CMA Q;  4RTW A;  1Y7X A;  1UDL A;  4NL3 A;  2EJG A;  4IUP A;  4JRK A;  4IUQ A;  2OTJ A;  2P4T A;  2P0K A;  2QA4 Q;  3R6O A;  2OTJ Q;  1K8A R;  2NLU A;  5CKD A;  4X9C A;  3H0I A;  2DKG A;  3TSZ A;  4MZM A;  4M77 G;  2LQ8 A;  1VQ9 A;  5AT1 B;  2DET A;  4RCB A;  1VQ9 Q;  1G3T A;  4FYV B;  1R8O B;  2QQS A;  1HJD A;  1WHM A;  3OSS C;  3SHW A;  4M77 F;  4OMM A;  3FB9 A;  1WGS A;  1OU8 A;  1Q86 C;  1SG5 A;  1ZA2 B;  2GF7 A;  3RMS A;  1K76 A;  1ZSZ A;  2ZPH B;  3BW1 A;  3JRZ A;  3CCE T;  3DB4 A;  1EX4 A;  2CSQ A;  4XTV A;  2EYW A;  1GFC A;  4RUG A;  1JXO A;  4M7D F;  1I5L A;  3RUX A;  2CYZ B;  4DBR A;  3OYB A;  2PNI A;  5HKC A;  3PMT A;  3JCM d;  1IRE B;  1VQ4 A;  4LN2 A;  2X3W D;  4Z8A A;  4TVR A;  4PJO C;  1YJ9 A;  2RQW A;  1VQ4 Q;  1ZUY A;  1YJ9 Q;  1B07 A;  3REA B;  2ED0 A;  4AFZ C;  3OYJ A;  2L89 A;  2E6N A;  5KYX A;  4MDX A;  4M78 F;  3NTK A;  2HCK A;  1YHQ T;  2LX7 A;  1X6B A;  3UPU A;  1S1N A;  4WTO B;  2LCL A;  2P84 A;  1QQJ A;  1ZHI A;  4E7L A;  1IB8 A;  1JJ2 P;  5L8R E;  4AT1 B;  2OAW A;  3UAT A;  2GQV A;  5LJ5 f;  2P0P A;  4PNO A;  1H64 1;  3CCQ T;  2O4X A;  2K2V A;  1MMN A;  4M75 B;  1VQO T;  5AYF A;  3CD6 T;  2CT3 A;  2DAQ A;  4J7F A;  4D8D A;  4J5Y A;  2GFU A;  2RI3 A;  4X1V A;  2YRC A;  3G6E T;  2QQB A;  3LH5 A;  4C8Q B;  3NMZ C;  1MMA A;  3CC2 A;  1AEY A;  2RH2 A;  3QWY A;  1BCO A;  4KRT A;  4M7A G;  2FO0 A;  2HD0 A;  3QDF A;  2JOY A;  2L5Q A;  1GBR A;  3VV0 A;  4LDW A;  4J9D A;  1WQW A;  2K4Y A;  3VYG A;  3OYM A;  5IH2 A;  4HXJ A;  1YBY A;  2CP0 A;  4F7U B;  1Y07 A;  3ER0 A;  1VQ8 A;  2WSE E;  1KIK A;  3JB9 D;  3H0H A;  1HD3 A;  2M16 A;  3E19 A;  1VQ8 Q;  3CC7 A;  4J83 A;  3G4S Q;  3TEE A;  2M1H A;  1K73 R;  3WXM B;  2R5M A;  3CC7 Q;  4C0Z A;  1YJW A;  3JCM P;  1NZ9 A;  3MEW A;  2FZC B;  1Q81 C;  1HK9 A;  1VQP A;  1YJW Q;  4D8K A;  3EFO A;  4Y91 A;  1JO8 A;  5LJ5 h;  1W2B S;  4E2F B;  4P5N A;  1RI0 A;  1D1C A;  1W4S A;  3CMA T;  1JB0 E;  2FZK B;  2EQM A;  1UHC A;  1R0B G;  4FU6 A;  4QQG A;  4A4F A;  4C92 A;  2OTJ T;  1NE8 A;  5IN1 A;  3SEM A;  1PKS A;  5FRO A;  2YDL A;  4NS5 A;  2EKH A;  1D1B A;  1NEB A;  4M77 C;  1VQ9 T;  1TSF A;  1OZ2 A;  3I55 Q;  2CP6 A;  1X2Q A;  1IO6 A;  4FT2 A;  2CH4 A;  1UJ0 A;  5IAY A;  2GTJ A;  2HEQ A;  1M1K U;  1MUZ A;  2LCC A;  1KK7 A;  4EMK C;  4JS4 A;  4M7D C;  1IXD A;  1OPK A;  2RQR A;  4HVW A;  7AT1 B;  5CIU A;  2EW3 A;  2AHJ B;  3FJP A;  1YJN A;  4HA8 A;  4HVV A;  2HMA A;  1YFN A;  1M30 A;  2DL3 A;  2JT4 A;  2BZX A;  1QKW A;  1UFF A;  1YJN Q;  2X9H A;  3CEY A;  4JRQ A;  1IRX A;  2CUD A;  2EVR A;  1VQ4 T;  3OQ5 A;  1YJ9 T;  1ACM B;  4M78 C;  2EQJ A;  4PKC C;  1KJW A;  2BTT A;  3RES A;  1M3A A;  2PZ1 A;  3LGL A;  2PVD B;  5KE3 A;  2QI2 A;  1MV0 B;  3UT1 A;  2O4X B;  1WXB A;  2EJ9 A;  2AKL A;  1MGQ A;  1K9M C;  2HSE B;  3H8Z A;  2D0N A;  2RN8 A;  3OS5 A;  5LJ5 j;  1M90 C;  1RAG B;  5GAN 8;  3VKI A;  1EFN A;  3CCJ A;  2CS7 A;  3NTI A;  2VXE A;  2JM9 A;  4FIB A;  1AZE A;  2I0N A;  1UB4 A;  3CCJ Q;  4A4K A;  1RUW A;  2XDD A;  2DLP A;  5IXB A;  2ZZD A;  4LE9 A;  1PKT A;  5KYU A;  3A98 A;  2RB6 A;  2DIG A;  4J9F A;  3OW2 S;  5KE2 A;  4AFS C;  3CC2 T;  2O9V A;  4KGZ B;  2HQX A;  4Z89 A;  2VKN A;  4KBM B;  1PC0 A;  1N9R A;  2YUO A;  5I22 A;  4JLI A;  3V8L A;  2LC4 A;  3G71 Q;  2EJF A;  1VIF A;  2K5L A;  4BE2 A;  2CDT A;  3EFO B;  4PLI A;  4KGV B;  1RLQ C;  4AFQ C;  1VQ8 T;  4LUE A;  5A0L A;  2NUP A;  3JCM Q;  3CC7 T;  2DBK A;  3QKJ A;  4C5H A;  3I9Q A;  1YJW T;  2M0O A;  1VQP T;  4E7H A;  2MK5 A;  4C92 B;  4FSX A;  6AT1 B;  2QAS A;  2XID A;  2Y4X A;  1S72 Q;  5HK3 A;  1Q7Y R;  4ME7 A;  2MPX C;  1QCN A;  1PSF A;  1QVF P;  5L23 A;  5HY6 A;  3ASK A;  2B86 A;  2RI2 A;  2E3I A;  4PJN A;  2F69 A;  5FRN A;  3QYH B;  4RG8 A;  3I56 Q;  2H3J A;  2NYS A;  3CCL A;  2CRE A;  4M75 D;  2GFA A;  1AHJ B;  3EGX A;  4LUD A;  2FYK A;  5LJ5 e;  3SWN C;  3CCL Q;  4JRP A;  5FWC A;  2MF2 A;  2RHX A;  3R6N A;  2O9S A;  4XK8 E;  2RMO A;  1VOM A;  4OMF B;  3GIB A;  1ZX6 A;  4C8Q D;  2A37 A;  1FMV A;  3FDR A;  2PU9 B;  2IPO B;  2DD4 A;  5HK0 A;  4CC4 B;  1AZG B;  3JCM h;  4HCK A;  2KSS A;  4KUL A;  1WHG A;  2ZPI B;  1N5Z A;  4GLM A;  1MND A;  2RJE A;  4QQ6 A;  2JUF A;  5ECA A;  3EHR A;  1PWT A;  1YJN T;  2X4Y A;  1OOT A;  3CCU A;  2ROT A;  4RTU A;  3A8O B;  3L2R A;  5GAN f;  1O75 A;  5IT9 E;  2RJD A;  1H92 A;  4J9I A;  2X4J A;  4M75 E;  1T3L A;  4PJJ A;  2QTX A;  2AKK A;  4XTZ A;  3V8J A;  4J6X A;  3MPU B;  1UUE A;  1KFZ A;  4HCZ A;  2QQ9 A;  1ZA1 B;  5KYW A;  4C8Q E;  1TXQ A;  4M7A A;  3JV3 A;  2O01 E;  4MDW A;  3JAM E;  1B7T A;  3OYH A;  2QDY B;  1SPK A;  4BI3 A;  3CCJ T;  1KC8 U;  1RI9 A;  1M9S A;  3GBQ A;  1V1C A;  1ZBJ A;  4XTU A;  3CCE Q;  3QG1 A;  3M0U A;  5KCH A;  3MET A;  3M0R A;  4F7U E;  3PIO A;  1C6V X;  2PUK B;  4A63 B;  2EGC A;  4PJO G;  1AT1 B;  2YWW A;  3E2U A;  2E3H A;  3RDV A;  4D6W A;  2HBP A;  2P0Q A;  4N4G A;  1VQN A;  1I81 A;  3KFV A;  1M1G A;  5GAN h;  2NUZ A;  3L42 A;  4JZ3 A;  2F2V A;  3S6W A;  1Y0M A;  4E7S A;  3BE3 A;  4ESR A;  2GTO A;  2RA2 A;  3OYA A;  5LL6 S;  4UC4 A;  1QVG A;  2EGA A;  2FEI A;  3EGD A;  3QJY A;  3RIR A;  4QVD A;  4HT8 A;  2J06 A;  1D3B A;  3M0P A;  3QUI A;  2WSC E;  1NG2 A;  3O8V A;  4E7Z A;  1SRM A;  3OYI A;  3CCQ Q;  3OYD A;  2DO3 A;  3DKM A;  2HAX A;  3RKY A;  1K9A A;  1QVF A;  3CD6 Q;  3HFO A;  1ARK A;  2ZPF B;  3EGX B;  1UGR B;  2MOX A;  3V7R A;  2JVV A;  2YUN A;  4MZT A;  3G6E Q;  2MIO A;  4V2S A;  1PNJ A;  1A0N B;  1YCY A;  2V1Q A;  1IGU A;  3VRZ A;  2A7Y A;  1J3T A;  2KDS A;  3CCL T;  2DXT A;  4EPC A;  1CSK A;  1QWF A;  2K57 A;  4NOY A;  3E1S A;  3VS6 A;  4J7I A;  3ME9 A;  2KT8 A;  3M59 A;  3M4Y A;  5LJ3 f;  3OYC A;  3HFN A;  3SB2 A;  2CZ6 B;  2JJ9 A;  5GJW B;  2JW4 A;  3JCM V;  2E70 A;  2RK1 A;  1AD5 A;  4OB1 B;  3JSC A;  1TS9 A;  3VJP A;  3C95 A;  2GCX A;  1Q81 R;  1Q82 C;  1AWX A;  2QDL A;  5GAM d;  1SEM A;  2DRM A;  3J80 E;  3SD4 A;  1KQS A;  1FMW A;  2KR3 A;  4L5G A;  1QWE A;  4JPB W;  3CCU T;  1JBM A;  3JCM e;  3CPF A;  5GAN j;  4X9D A;  3PVQ A;  2COZ A;  1XOV A;  3RR6 A;  2VWF A;  2COY A;  5KYW B;  1WQ7 A;  1X43 A;  2XMF A;  5GMK m;  3OYN A;  3AHU A;  4M7A B;  5GAO m;  3EH1 A;  4QVC A;  2O31 A;  2QTV A;  3TU4 K;  3GNF B;  4F17 A;  1W2B P;  1UGP B;  1BI0 A;  3Q1J A;  3S3O A;  5LJ3 h;  3QXE B;  1TH7 A;  2KEA A;  3HRT A;  1G83 A;  1ZQ1 A;  3TCJ A;  5FLX E;  4QT7 A;  2J6K A;  3JB9 F;  5FW9 A;  1AWW A;  4M7D G;  4OB0 B;  1KSW A;  2LT4 A;  4E7J A;  2GQI A;  1MMD A;  3LH0 A;  1U5S A;  2DE0 X;  5GAO n;  5GMK i;  1NBE B;  3QSU A;  9ATC B;  4JS5 A;  3CBO A;  3VRY A;  1VQ5 A;  4DEX A;  2LCS A;  2XHC A;  4FM4 B;  3A8M B;  3MHX A;  4FT4 A;  2EIF A;  3H9N A;  1I0C A;  1MV3 A;  2CP3 A;  4M78 G;  1X01 A;  4ZGE B;  3UWN A;  2K6D A;  1VQN T;  1QCO A;  3HSB A;  3TRE A;  4A4H A;  1PHT A;  1WPY A;  3EGD B;  3H0F A;  2PVO B;  3OYF A;  4C92 E;  1Q95 G;  3SDZ A;  4YTL A;  3MJX A;  2H3E B;  5GAO p;  1K8A U;  1Y71 A;  1YWP A;  2VYT A;  2E5K A;  2QGG A;  2VV5 A;  3UF4 A;  1VQM A;  5DLQ E;  5D6X A;  5GAN e;  4C0D C;  3WVD B;  1VQM Q;  4XU1 A;  1NJI C;  2QAZ A;  5EG2 A;  1FX7 A;  1K9M R;  3JCM J;  2JM8 A;  1HSQ A;  1M90 R;  1TU0 B;  2HNI A;  4ZN1 A;  4BI4 A;  4IUT A;  1YIT A;  2FPD A;  2J05 A;  1YIT Q;  3P8H A;  2CZ1 B;  2DTO A;  3CC2 Q;  3PTA A;  5FU7 C;  3MCA B;  1SSH A;  4ZNX A;  1RLP C;  2E1H A;  3X25 B;  1U8R A;  4L6V 5;  1M5Q 1;  5LJ3 j;  2K9G A;  4CC2 A;  3GP8 A;  3GOX A;  1KD1 C;  3UA6 A;  3CPW S;  4FYX B;  1ABO A;  5FU6 B;  1VYU A;  1C0M A;  1XNI A;  1PSE A;  2D8H A;  4BDZ A;  3X26 B;  1OX8 A;  2LNV A;  2ABL A;  2E41 A;  1BI2 A;  3T9N A;  1OX9 A;  1W70 A;  1D0X A;  3M58 A;  3KXT A;  1VQP Q;  1BKB A;  4HVU A;  4F04 B;  1BIA A;  4F16 A;  2DER A;  5KH6 A;  2JTF A;  3CME A;  3BDU A;  2DIL A;  1M3C A;  3CCR A;  2IVW A;  5GAN 6;  4FCY A;  3CCR Q;  4N4I A;  1N27 A;  2PTK A;  2KI7 A;  2DZC A;  2RNA A;  1K9M U;  2V1R A;  3CC4 A;  1P92 A;  5LJ5 g;  5CVI A;  4FYW B;  3CC4 Q;  1ZUK A;  3C4S A;  1MMG A;  2K3B A;  4CC3 A;  1W2B A;  4PFP A;  4GBQ A;  2XU8 A;  3FRN A;  4BY6 C;  1GL5 A;  2F2X A;  1G8X A;  2FHD A;  2DEU A;  1V29 B;  1ZSZ B;  2K5F A;  4PJO A;  2MAM A;  4N0A C;  2ZCF B;  4DOV A;  2EFI A;  4DOW A;  2J6O A;  2K3Y A;  1KQ1 A;  2BKD N;  4KUI A;  2RF0 A;  3FIF A;  3M4G A;  1R77 A;  4LDY A;  3CCM A;  4ZTJ A;  4XU0 A;  2JTM A;  5LJ3 e;  3CCM Q;  1VQ5 T;  1QMC A;  1GCQ C;  4ZGD B;  1K73 U;  2EYX A;  3CBM A;  2KAF A;  5KYX B;  1SHF A;  3M54 A;  1AWO A;  4BDY A;  4CI0 C;  2YLB A;  5D6W A;  2F5K A;  3QPH A;  3EG1 A;  3PVL A;  1OZ3 A;  5I11 A;  3OYE A;  2D6F A;  4M75 F;  2FB7 A;  3WVE B;  3NGP A;  3QO3 A;  1WZO A;  3OYL A;  1GXI E;  1JJ2 S;  3O5Z A;  3CCV A;  1T3S A;  2VUB A;  1T0H A;  3I35 A;  3UA7 A;  5J3B A;  4C8Q F;  4RTY A;  5IHI A;  1VQM T;  1VQ7 A;  3EH2 A;  3S3M A;  5GAN 4;  2JNG A;  5CR2 A;  3A8H B;  1VQ7 Q;  4ZGJ B;  2CUB A;  4J9C A;  2B8A A;  5I2M A;  2EYZ A;  2RO0 A;  2DD5 A;  3M0Q A;  3LW5 E;  4RG2 A;  5D7U A;  4GY5 A;  3HPW A;  5GAN 2;  2KE9 A;  1VA7 A;  1YIT T;  4F14 A;  4F7U F;  2MCN A;  3VS3 A;  1WLP B;  2HDA A;  2RJF A;  3VS1 A;  2F2W A;  1YIJ A;  1X6O A;  2F1L A;  3URG A;  2WSF E;  2XDB A;  3OA6 A;  1YIJ Q;  2KRN A;  2K2M A;  2P4R A;  2KVQ G;  8AT1 B;  1VQ6 A;  5GAM g;  3OS0 A;  3L2Z A;  1M1K C;  4FYY B;  3JCM f;  2ED1 A;  1PD1 A;  4O5V A;  4C5E A;  4J9B A;  2M9U A;  4OGE A;  1M8V A;  5KYN A;  1BIB A;  4RTV A;  5GAN 5;  4BE0 A;  1QVG P;  3BDL A;  2MI6 A;  1QCF A;  5I2S A;  4DA4 A;  2LJ0 A;  4FW2 A;  4PL6 A;  1GRI A;  4M77 A;  4M7A E;  2EQK A;  2LVM A;  1PG5 B;  2MWP A;  3VS5 A;  3VUB A;  4LDV A;  4C5I A;  1WHK A;  4RTX A;  3CME T;  1RAB B;  4MMK A;  3CCR T;  5CO7 A;  3GLX A;  4PFZ A;  4EMK A;  3CCS A;  2BZ8 A;  1V76 A;  3CBP A;  2L0A A;  3CCS Q;  4M7D A;  4ELZ C;  2DX1 A;  1U1T A;  3CC4 T;  3CXC S;  4PJO B;  1AVZ C;  1CKB A;  4IUU A;  3JCM b;  5IXF A;  2DTH A;  4X34 A;  2OAU A;  1QW1 A;  1FXX A;  2SRC A;  1QLY A;  4QW2 A;  2J6F A;  4M78 A;  2DXU A;  2RQT A;  4PFO A;  5DLO A;  2VAS A;  2XK0 A;  1DJ7 B;  5FWB A;  2XIC A;  3MO8 A;  1VYV A;  3CCM T;  3M0S A;  4XU2 A;  1D0Y A;  1BB9 A;  2DJQ A;  1UGV A;  2RD1 A;  1KHI A;  1Q82 R;  2DFU A;  4M75 C;  3BFM A;  1KQS P;  3CCU Q;  4DBQ A;  2VVK A;  2D8J A;  4OMP A;  2JMC A;  2DL8 A;  2X51 A;  4J8O A;  1Q7Y U;  1YWO A;  1GBQ A;  4C8Q C;  1AOJ A;  1H3Z A;  4RKU E;  3CCV T;  2WAC A;  1IZ6 A;  2FPE A;  2O2O A;  2V8K A;  1N8R C;  2LNH B;  5KYU B;  2HQE A;  2DL5 A;  2W0Z A;  3EG0 A;  1UE9 A;  3QDR B;  5KYY A;  5LJ5 d;  4JZ4 A;  4FW1 A;  1H3H A;  1XQH A;  1VQ7 T;  3PFS A;  3RBB B;  1NM7 A;  1OV3 A;  4BI8 B;  2L8D A;  1UEC A;  1E6G A;  1WJR A;  5FU6 C;  2JN0 A;  4IUV A;  5C0M A;  1Q86 R;  2OTL A;  2RQU A;  2EKO A;  2C0I A;  2OTL Q;  3OYY A;  3LWH A;  3X20 B;  5C6S A;  3EGU A;  2LMJ A;  4VUB A;  2ROL A;  4K11 A;  2EPD A;  2QGF B;  4B9W A;  3MKD A;  2KBT A;  1R0C B;  1YIJ T;  3JB9 I;  3RER A;  1VQN Q;  3EG2 A;  2QQR A;  2NUP B;  4DBF A;  1M2V A;  4R55 A;  1X2K A;  5IHK A;  4C92 F;  4Y28 E;  1Q82 U;  2E65 A;  3FEO A;  2KYB A;  1VQ6 T;  5CKE A;  4M77 B;  4EDU A;  5D6Y A;  2AT1 B;  1UHF A;  5DM7 R;  3SWN A;  3NTH A;  2L3Q A;  4HCC A;  1NPR A;  4LNP A;  3EG9 A;  2R57 A;  3QBY A;  4EMK B;  1VQL A;  1ZSZ C;  2W10 A;  2LQN A;  4M7D B;  1VQL Q;  2VGN A;  1W1F A;  1WIE A;  4A4G A;  2QEX A;  2XD0 A;  1NJI R;  2QEX Q;  1GFD A;  2M51 A;  3THK A;  2YXY A;  5CQX A;  5GMK h;  2HKN A;  1OPL A;  1MHN A;  2YRV A;  3CCS T;  2VGM A;  3H41 A;  1U1S A;  3A5Z B;  2ZGW A;  1F1B B;  1G3S A;  1Q86 U;  2MYS A;  4M78 B;  1ABQ A;  2BIV A;  1UG1 A;  1YN8 A;  1BYM A;  2A0F B;  1G3Y A;  3J81 E;  1YI2 A;  2A3L A;  2DEQ A;  2R5A A;  2CP5 A;  8ATC B;  2V8J A;  1YI2 Q;  2DA9 A;  3NPF A;  2FRW A;  1KD1 R;  1OUL A;  4FL6 A;  4WF2 A;  1KC8 C;  4Q5W A;  5CKH A;  1H8K A;  3HRU A;  4R56 A;  3LWI A;  1B3Q A;  1WJQ A;  4AG1 C;  1E7O A;  4IUR A;  1C1A A;  1WA7 A;  4JDS A;  1VYT A;  2A28 A;  2HKQ B;  2EQU A;  4II1 A;  3L2V A;  1BCM A;  3KUF A;  5DY9 A;  1ZBX A;  3I5R A;  2OI3 A;  2DMO A;  3D7S B;  3M55 A;  1RAA B;  4E47 A;  2CT4 A;  3M5A A;  3CPW P;  1RAD B;  1EIF A;  4AG2 C;  1AWJ A;  1I4K 1;  3INZ A;  5CQY A;  4C92 D;  3G1J A;  1KHC A;  3DB3 A;  3UDC A;  3AT1 B;  4JLG A;  4XU3 A;  1I5O B;  5KYY B;  3JB9 G;  3PNW C;  4HT9 A;  3G7Z A;  1X6G A;  1BK2 A;  2QA4 A;  2JXB A;  3IQL A;  1K0X A;  4Z88 A;  4BAC A;  1SKU B;  1M27 C;  2CH4 W;  4RCC A;  2VC8 A;  2BZY A;  3ZEH A;  4PJO D;  4MML A;  2J7I A;  2KMT A;  4ZN3 A;  1RAI B;  4PLL A;  3FJ5 A;  2DBM A;  5GMK j;  2EYY A;  2CZ0 B;  3VS0 A;  5LJ3 g;  3VS7 A;  1X75 C;  1W6X A;  2OTL T;  1YNZ A;  1KD1 U;  3HRS A;  1LPL A;  1TTH B;  3PE0 A;  1VQ5 Q;  1D1A A;  1M2V B;  1PCX A;  4WCI A;  3ZFJ A;  1M4Z A;  1LVK A;  4LXC A;  4C92 C;  3TSW A;  1I07 A;  2QG9 B;  4KGX B;  1WHL A;  3SFM A;  1Q81 U;  2DIQ A;  1TWB A;  3HL8 A;  3LGF A;  4JJN K;  1BI3 A;  4R0K A;  3H6Z A;  3SWN B;  1D3B B;  3P8B B;  1WFW A;  3OY9 A;  4CC7 A;  1BI1 A;  3EG9 B;  2L3S A;  1WNL A;  2HBW A;  1KQ2 A;  2QYZ A;  2RHZ A;  2E6Z A;  3OB9 A;  2LZ6 B;  1OYX A;  1QVP A;  2DF6 A;  3M56 A;  4JUV A;  1IHV A;  1UJY A;  2EWN A;  4FSS A;  1TUG B;  2ESW A;  4PJO E;  1VQL T;  2PQW A;  2DTI A;  2HL5 C;  1ZLM A;  1X69 A;  2D9T A;  1XJW B;  2QEX T;  3CQT A;  2DRK A;  2CZ7 B;  3JB9 J;  3QII A;  3KBG A;  3TQ7 P;  1FYN A;  3REB B;  4IIM A;  1B34 A;  5GJV B;  3OMC A;  1NYF A;  2ECZ A;  5M9O A;  2BE9 B;  2DYB A;  3DLM A;  3E9F A;  1JXM A;  2JTE A;  3L1A A;  3OMG A;  1GCP A;  2Y4Y A;  2XDP A;  2YSQ A;  2DM1 A;  3M9Q A; 
#chains in the Genus database with same CATH homology
 3HP9 A;  1N6A A;  1O75 A;  3A8H B;  5CR2 A;  4ZGJ B;  5IT9 E;  2KQW A;  2RJD A;  4OB3 B;  2B8A A;  5I2M A;  2MMP A;  3L2Q A;  5GMK e;  2RO0 A;  2DD5 A;  4RG2 A;  3LW5 E;  2X4J A;  1YI2 T;  4M75 E;  4A54 A;  2E5Q A;  4GY5 A;  2YHT A;  3HPW A;  5GAN 2;  2QTX A;  1YIT T;  4F7U A;  3MEU A;  4XTZ A;  3RKX A;  4F7U F;  3VU3 C;  3JCM W;  4QQD A;  3V8J A;  1FWZ A;  3LYI A;  4J6X A;  1NJI U;  3BY7 A;  4HCZ A;  2QQ9 A;  3OYG A;  3OYK A;  3CMA A;  5GAO q;  4NL2 A;  2LX9 A;  2RJF A;  2YLC A;  4C8Q E;  3QJ6 A;  4C0F A;  1Y7X A;  4N4H A;  4M7A A;  1YIJ A;  1X6O A;  2O01 E;  3URG A;  3OS2 A;  4M7A F;  4NL3 A;  2FVU A;  2WSF E;  4MDW A;  2XDB A;  3JAM E;  2EJG A;  4IUP A;  3OA6 A;  4JRK A;  3OYH A;  4BE1 A;  4IUQ A;  2OTJ A;  2L3R A;  2P4T A;  4M77 D;  5A0G A;  2QDY B;  2P0K A;  4BI3 A;  2KVQ G;  3G4S A;  5KCO A;  3R6O A;  3CPW A;  3CCJ T;  1KC8 U;  5GAN 4;  1VQ6 A;  5GAM g;  2NLU A;  3OS0 A;  1M9S A;  4E7K A;  3L2Z A;  4X9C A;  5CKD A;  1M1K C;  3PIP A;  2DKG A;  4XTU A;  3JCM f;  5GAN d;  3E9G A;  4O5V A;  4C5E A;  3QG1 A;  2M9U A;  4OGE A;  4MZM A;  5KCH A;  3MET A;  4M77 G;  2LQ8 A;  1M90 U;  1M8V A;  4F7U E;  1VQ9 A;  4J6Y A;  3PIO A;  2PUK B;  3RMQ A;  1BIB A;  2X35 A;  4RCB A;  5GAN 5;  4BE0 A;  4M7D D;  1G3T A;  4PJO G;  1R8O B;  3BDL A;  2MI6 A;  2QQS A;  2R58 A;  5I2S A;  4DA4 A;  4D6W A;  2HBP A;  2P0Q A;  4PL6 A;  4BUG A;  2K5I A;  4N4G A;  1VQN A;  3OSS C;  4A4E A;  4M77 A;  1I81 A;  4M77 F;  4M7A E;  2EQK A;  3FB9 A;  2LVM A;  1K8A C;  2MWP A;  1M1G A;  5CKB A;  5GAN h;  3VUB A;  4LDV A;  4C5I A;  1VQK A;  3L42 A;  4BB7 A;  2QA4 T;  1WGS A;  5J39 A;  2ZPB B;  2DXC A;  3CME T;  1Q86 C;  4MMK A;  2GF7 A;  4HKE A;  3CCR T;  5CO7 A;  3S6W A;  3GLX A;  3RMS A;  3BW1 A;  2ZPH B;  2BUD A;  3JRZ A;  4BD3 A;  5A0D A;  4EMK A;  3CCS A;  3DB4 A;  3CCE T;  2RA2 A;  3CBP A;  4XTV A;  3OYA A;  4M78 D;  4M7D A;  5LL6 S;  3M53 A;  4ELZ C;  4UC4 A;  1QVG A;  4M7D F;  1I5L A;  4MZP A;  1U1T A;  3CC4 T;  3CXC S;  3RUX A;  3I55 A;  5CKF A;  2CYZ B;  3OYB A;  3QJY A;  3RIR A;  4QVD A;  5HKC A;  4PJO B;  3HHT B;  4HT8 A;  1D3B A;  3PMT A;  3JCM d;  1IRE B;  1VQ4 A;  3QUI A;  2WSC E;  3O8V A;  4TVR A;  4PJO C;  1YJ9 A;  4XQ3 A;  4IUU A;  3OYI A;  5CK9 A;  3OYD A;  2CGH A;  2LDM A;  2DO3 A;  4M75 G;  3DKM A;  4OGC A;  4M77 E;  3RKY A;  2DTH A;  3JCM b;  2HAX A;  1QVF A;  3HFO A;  4X34 A;  2OAU A;  3OYJ A;  1QW1 A;  2L89 A;  2ZPF B;  1FXX A;  2E6N A;  1UGR B;  5GAO r;  4MDX A;  4QW2 A;  4OF1 A;  4M78 A;  2JVV A;  2DXU A;  3V7R A;  4MZT A;  4M78 F;  2VXF A;  3NTK A;  3JCM X;  4V2S A;  1YHQ T;  1YCY A;  4C8Q G;  5CCA A;  5DLO A;  5GAM f;  3GPL A;  3UPU A;  2LCL A;  1UGS B;  4M7D E;  1HXD A;  2A7Y A;  2XK0 A;  4E7L A;  1DJ7 B;  1ZHI A;  2KDS A;  2QQA A;  4C0G A;  3CCL T;  2XIC A;  3MO8 A;  4A53 A;  2DXT A;  5L8R E;  1SSF A;  2LTO A;  4EPC A;  3CCM T;  2GQV A;  5LJ5 f;  5GAN 3;  2P0P A;  2V8I A;  4XU2 A;  2K57 A;  3E1S A;  4NOY A;  4PNO A;  3MP6 A;  4J7I A;  1H64 1;  3CCQ T;  2O4X A;  1RL2 A;  2K2V A;  3ME9 A;  4M75 B;  3M59 A;  3M4Y A;  5LJ3 f;  1VQO T;  5AYF A;  3OYC A;  2RD1 A;  3CD6 T;  1KHI A;  3HFN A;  2DPP B;  3SB2 A;  2DAQ A;  4J7F A;  4M75 C;  2CZ6 B;  3BFM A;  4O6J A;  3OBW A;  4B9X A;  4J5Y A;  2GFU A;  2RI3 A;  4F7U G;  4M7A D;  3JCM V;  2ZPG B;  2E70 A;  3G6E T;  2RK1 A;  2QQB A;  4M78 E;  1B34 B;  4QVZ A;  4C8Q B;  4J8O A;  4OB1 B;  1Q7Y U;  3CC2 A;  3JSC A;  1JJ2 A;  2RH2 A;  4C8Q C;  4EMG A;  4OP0 A;  1XTD A;  4M7A G;  3VJP A;  2HD0 A;  3C94 A;  3C95 A;  1H3Z A;  4RKU E;  3CCV T;  2LRQ A;  3LX7 A;  2GCX A;  1LOJ A;  1Q82 C;  1M1F A;  2WAC A;  5GAM d;  1O9S A;  1IZ6 A;  2JOY A;  2L5Q A;  3VV0 A;  4LDW A;  4C5G A;  3J80 E;  3M9Q A;  3SD4 A;  2V8K A;  1LJO A;  1N8R C;  1KQS A;  4L5G A;  2E12 A;  4OB2 B;  4ELY C;  3HKS A;  1WQW A;  2HQE A;  2K4Y A;  3VYG A;  3OYM A;  3CCU T;  1YBY A;  2DZ9 A;  1JBM A;  3PT9 A;  3QDR B;  4F7U B;  5LJ5 d;  3JCM e;  1XQH A;  1Y07 A;  3CPF A;  3LLR A;  4X9D A;  2K3X A;  5GAN j;  1VQ7 T;  3PFS A;  3ER0 A;  1VQ8 A;  2WSE E;  1XOV A;  5LJ3 d;  3JB9 D;  4BI8 B;  1VIE A;  2M16 A;  2L8D A;  2LQK A;  3E19 A;  3CC7 A;  4J83 A;  1WJR A;  3TEE A;  1WQ7 A;  2M1H A;  5FU6 C;  3QYG B;  2I2L A;  5GAM h;  2JN0 A;  3M57 A;  3WXM B;  3OW2 A;  2R5M A;  4IUV A;  5C0M A;  5GMK m;  4C0Z A;  3OYN A;  1YJW A;  3JCM P;  1NZ9 A;  3MEW A;  1Q81 C;  4M7A B;  1HK9 A;  5GAO m;  2OTL A;  4QVC A;  3AHU A;  4LDX A;  1VQP A;  2EKO A;  2EAY A;  3OYY A;  4Y91 A;  3GNF B;  3TU4 K;  4M7A C;  5LJ5 h;  3X20 B;  5C6S A;  3LWH A;  1W2B S;  1UGP B;  3F70 A;  4VUB A;  4P5N A;  1RI0 A;  1BI0 A;  3Q1J A;  1W4S A;  5LJ3 h;  3S3O A;  2MWO A;  3QXE B;  1TH7 A;  2FL7 A;  3CMA T;  3ZBD A;  3G71 A;  3HRT A;  1JB0 E;  1ZQ1 A;  3TCJ A;  5FLX E;  4B9W A;  2EQM A;  3JB9 F;  1YIJ T;  4FU6 A;  3JB9 I;  3RER A;  4M7D G;  4LD9 K;  2QQR A;  4QQG A;  4OB0 B;  1K73 C;  2LT4 A;  4R55 A;  4A4F A;  4C92 A;  2OTJ T;  1NE8 A;  5IN1 A;  4C92 F;  4Y28 E;  2EYQ A;  4E7J A;  3G4S T;  2E65 A;  4N0A A;  4L59 A;  3FEO A;  1Q82 U;  3QZ5 B;  4JRI A;  3LH0 A;  1VQ6 T;  1WJS A;  5FRO A;  1G3W A;  5GAO n;  5GMK i;  5CKE A;  1N8R U;  2QXF A;  3P8D A;  3QSU A;  2RM4 A;  4JS5 A;  3CBO A;  4CRI A;  4M77 B;  2RJC A;  4NS5 A;  1VQ5 A;  4EDU A;  1NPP A;  2XHC A;  5D6Y A;  4FM4 B;  3A8M B;  3MHX A;  4ZTF A;  4FT4 A;  1UEB A;  4LDU A;  4M77 C;  5DM7 R;  2F5T X;  2EIF A;  1VQ9 T;  1S72 A;  4XAX B;  3SWN A;  1OZ2 A;  1Y96 A;  3NTH A;  4FT2 A;  5GAN 7;  4HCC A;  1NPR A;  5I21 A;  5IAY A;  4M78 G;  1X01 A;  2R57 A;  3QBY A;  3UWN A;  4EMK B;  4ZGE B;  1M1K U;  1VQL A;  4IKF A;  2LCC A;  1VQN T;  3HSB A;  4M7D B;  2VGN A;  3I56 A;  4EMK C;  3TRE A;  3JB9 H;  4A4G A;  3V7S A;  4A4H A;  4JS4 A;  2QEX A;  3MP8 A;  2XD0 A;  1WPY A;  1VQK T;  4M7D C;  2PVO B;  3OYF A;  1QP2 A;  4C92 E;  3SDZ A;  1I8F A;  2KY9 A;  5CQX A;  5GMK h;  4J6W A;  5CIU A;  1MHN A;  2YRV A;  3CXC A;  3CCS T;  2AHJ B;  3C12 A;  3FJP A;  4EMH A;  4YTL A;  2VGM A;  1YJN A;  1U1S A;  4HA8 A;  5GAO p;  3A5Z B;  1K8A U;  1LNX A;  1Y71 A;  2ZGW A;  4ATO A;  4C0D B;  1G3S A;  2VYT A;  3I55 T;  3CEY A;  4JRQ A;  1Q86 U;  2VV5 A;  1VQM A;  5DLQ E;  4M78 B;  2BIV A;  2RHU A;  5D6X A;  5GAN e;  4C0D C;  3EFR A;  3WVD B;  1VQ4 T;  3OQ5 A;  4XU1 A;  1BYM A;  1NJI C;  1YJ9 T;  5EG2 A;  1FX7 A;  3PMI A;  3JCM J;  3X28 B;  4M78 C;  1G3Y A;  4DQ2 A;  3S3N A;  3JCM g;  3J81 E;  2EQJ A;  4PKC C;  3RES A;  1YI2 A;  2A3L A;  2HNI A;  2DEQ A;  2R5A A;  4ZN1 A;  1G5V A;  4BI4 A;  4IUT A;  1KG1 A;  3J7A F;  2V8J A;  3LGL A;  2JZ2 A;  2PVD B;  1YIT A;  5KE3 A;  2QI2 A;  5FU7 B;  4XTY A;  2O4X B;  3UT1 A;  4FL6 A;  4WF2 A;  1KC8 C;  5GAM j;  3P8H A;  4Q5W A;  3OS1 A;  2DXB A;  5FRM A;  5CKH A;  2CZ1 B;  2DTO A;  3HRU A;  4R56 A;  3LWI A;  3PTA A;  5FU7 C;  1WJQ A;  3MCA B;  2EJ9 A;  4IUR A;  4JDS A;  1MGQ A;  1K9M C;  3H8Z A;  3OS5 A;  3QZ9 B;  2EQU A;  4II1 A;  2E1H A;  5LJ5 j;  3X25 B;  3L2V A;  1U8R A;  1M90 C;  2DK3 A;  4L6V 5;  5GAN 8;  3VKI A;  1M5Q 1;  3KUF A;  5DY9 A;  5LJ3 j;  3CCJ A;  2PUO B;  2CS7 A;  3NTI A;  1ZBX A;  2VXE A;  4KT0 E;  4FIB A;  1UB4 A;  1VUB A;  4A4K A;  3MP1 A;  3OSV A;  2XDD A;  4E7I A;  2LT1 A;  3GP8 A;  3GOX A;  2ZZD A;  1KD1 C;  3M55 A;  4E47 A;  3CPW S;  4KUD K;  3M5A A;  5A2Q E;  5FU6 B;  2C06 A;  2XKO C;  2RB6 A;  1EIF A;  2E64 A;  2DIG A;  1XNI A;  3OW2 S;  1PSE A;  1I4K 1;  3PGG A;  5KE2 A;  4BDZ A;  3INZ A;  5CQY A;  4C92 D;  3CC2 T;  3X26 B;  1KHC A;  2LNV A;  3DB3 A;  3UDC A;  4JLG A;  5J26 A;  2HQX A;  4XU3 A;  2E41 A;  3JB9 G;  1BI2 A;  1QP3 A;  3T9N A;  3PNW C;  3M58 A;  4HT9 A;  4KBM B;  3JCM c;  3KXT A;  1BKB A;  1N9R A;  4LD6 A;  1BIA A;  2G3R A;  3G7Z A;  2RHY A;  3N5B B;  4C92 G;  5KH6 A;  2QA4 A;  2JTF A;  3CME A;  3BDU A;  3VUZ A;  4BAC A;  4RMO A;  4RCC A;  3CCR A;  2VC8 A;  4XTX A;  2IVW A;  2CKK A;  5GAN 6;  3GF5 A;  4JLI A;  3V8L A;  2LC4 A;  3ZEH A;  2EJF A;  3CCE A;  4N4I A;  1VIF A;  1N27 A;  2K5L A;  3QHS A;  4MML A;  4BE2 A;  4PJO D;  2KMT A;  2DZC A;  4ZN3 A;  1K9M U;  4PLI A;  4XTW A;  3V7C A;  1VQ8 T;  3CC4 A;  1P92 A;  4PLL A;  5LJ5 g;  5CVI A;  5A0L A;  2Y90 A;  3C4S A;  3JCM Q;  5GMK j;  3CC7 T;  2IG0 A;  3QKJ A;  2CZ0 B;  4Z02 A;  1QVG S;  5LJ3 g;  4C5H A;  4BY6 B;  1X75 C;  1W2B A;  1YJW T;  2M0O A;  2OTL T;  2XI9 A;  5CAI A;  1KD1 U;  1VQP T;  2DJZ A;  3HRS A;  2XU8 A;  3FRN A;  4E7H A;  4BY6 C;  4C92 B;  5GAN g;  4HCB A;  3A8G B;  3FLG A;  4FSX A;  2XID A;  2Y4X A;  3ZFJ A;  2FHD A;  1M4Z A;  5HK3 A;  1V29 B;  4C92 C;  4ME7 A;  2K5F A;  4PJO A;  4PJO F;  2MAM A;  3G71 T;  4N0A C;  2ZCF B;  4DOV A;  1QVF S;  3RKW A;  1PSF A;  3SFM A;  2EFI A;  3L2W A;  2DIQ A;  1Q81 U;  4DOW A;  5HY6 A;  3L2U A;  3ASK A;  3HL8 A;  2RI2 A;  3LGF A;  3MEA A;  4OVA A;  1YHQ A;  5GAM e;  4JJN K;  2F69 A;  2K3Y A;  3OBY A;  1KQ1 A;  2BKD N;  3QYH B;  4RG8 A;  1BI3 A;  1OI1 A;  5FRN A;  4KUI A;  2H3J A;  2RI5 A;  3H6Z A;  2XG8 D;  1Y96 B;  1D3B B;  3P8B B;  3SWN B;  3DLL A;  3CCL A;  2RHI A;  3FIF A;  4M75 D;  3OY9 A;  2GFA A;  3M4G A;  1BI1 A;  1AHJ B;  2FYK A;  5LJ5 e;  3SWN C;  4JRP A;  4LDY A;  1WNL A;  3CCM A;  4ZTJ A;  3EAE A;  2MF2 A;  4XU0 A;  2RHX A;  2JTM A;  4XK8 E;  5LJ3 e;  3CCQ A;  1VQ5 T;  1Q7Y C;  1KQ2 A;  4OMF B;  1VQO A;  1UGQ B;  2RHZ A;  4ZGD B;  3GIB A;  2E6Z A;  3CD6 A;  3OB9 A;  1K73 U;  1OYX A;  1QVP A;  3CBM A;  3M56 A;  2KAF A;  4JUV A;  1S72 T;  3A8L B;  2EWN A;  4C8Q D;  2X4X A;  3M54 A;  3EFS A;  3FDR A;  4BDY A;  3V8K A;  2PU9 B;  2PVG B;  4PJO E;  3G6E A;  2PQW A;  2DTI A;  4CI0 C;  1VQL T;  2YLB A;  5D6W A;  2DD4 A;  2F5K A;  5HK0 A;  3X24 B;  2D9T A;  3JCM h;  3QPH A;  1N9S A;  3I56 T;  1OZ3 A;  4M75 A;  2E10 A;  2KSS A;  3NFC A;  5GMK l;  4M75 F;  3OYE A;  3FC3 A;  2FB7 A;  2D6F A;  5GAO l;  4KUL A;  3WVE B;  2QEX T;  3QO3 A;  3GNG A;  3OYL A;  2ZPI B;  1GXI E;  2D0Q B;  1JJ2 S;  3CCV A;  2CZ7 B;  3S3M A;  3JB9 J;  2VUB A;  3KBG A;  3QII A;  2RJE A;  1JRI A;  2JUF A;  4QQ6 A;  1B34 A;  2ZPE B;  5J3B A;  4C8Q A;  3OMC A;  1YJN T;  4C8Q F;  2KK4 A;  5M9O A;  3MEV A;  3DLM A;  2X4Y A;  3E9F A;  3CCU A;  2DVE A;  3L1A A;  2RK2 A;  3OMG A;  3VYH B;  1KQS S;  1VQM T;  1VQ7 A;  2Y4Y A;  3A8O B;  2X4W A;  2XDP A;  4GLK A;  3L2R A;  5GAN f;  2JNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...