4C8QF

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qF00
4M78F 3RIRA 4M7DB 2E65A 1BIAA 3SWNC 5GAOp 2YHTA 1KQ2A 1WQWA 4M7AG 4M7DC 5GAMj 1M8VA 5LJ5g 4C8QG 4EMKB 4JRIA 4PJOB 3BFMA 4J6XA 4M75G 4M7DF 1D3BA 1X01A 3V7SA 4C92A 1YCYA 4X9CA 2E41A 4J5YA 2YLBA 4F7UF 5GAN6 5GAMe 2VXFA 4NL3A 3JCMP 4XTZA 5GAMh 5LJ3j 3L1AA 1JBMA 3V8KA 4C8QF 4EMKA 5GANh 1LOJA 5LJ5e 1WNLA 4JLIA 4DQ2A 2E1HA 2DTOA 4EMHA 4XU2A 3QSUA 3JB9F 2DZCA 2DEQA 2DXTA 4MMKA 5GMKe 3M4GA 4XU0A 3QHSA 4M78G 2DVEA 4M7DD 3BY7A 3FIFA 5GAN2 3JB9H 4M77B 4M77D 5GAMd 1LJOA 2RM4A 1B34B 1N9SA 2EJFA 1TH7A 4PJOF 4M78D 4JUVA 2VC8A 3QO3A 4NL2A 5LJ5f 3JCMc 1I8FA 3JB9G 3HSBA 4EMGA 4PJOC 5LJ3g 1JRIA 4EMKC 4QVDA 4XTXA 5GANd 3L2ZA 5GMKi 1I5LA 4M77A 2DXUA 5GMKj 3SWNB 4Y91A 1B34A 5LJ3d 4N0AA 1U1TA 3PGGA 4F7UG 4QVCA 5GAN3 4M7DG 4J6YA 1Y96B 4XU1A 2ZGWA 3FJPA 3JCMb 2HNIA 3RKYA 5GAN7 5LJ3f 4XTUA 1U1SA 4C8QE 5GMKm 5GAOm 4PJOA 3RKWA 4C92G 5I21A 4M78C 3SB2A 3V7RA 1WQ7A 4C8QB 2VXEA 1LNXA 4M75B 3JCMW 1KQ1A 2E10A 2RA2A 3HFOA 4PJOE 5GANf 5GANg 3GIBA 3JB9I 3EFSA 4M77C 4M7AB 2FB7A 1HXDA 1I4K1 1I81A 4C92E 4RCBA 2CGHA 5GAOn 2I2LA 4M77F 4NOYA 3JCMV 4A53A 5GMKh 1WPYA 3RUXA 3RERA 5LJ5d 4C92B 3JCMX 3V8JA 5GAOq 3JCMJ 3JB9J 2RB6A 3VU3C 4XTYA 5LJ5h 3HFNA 4C92C 3JB9D 5GAOl 4M7AA 3V7CA 4M7DE 1D3BB 2DTHA 4XTVA 4F7UE 5GAN4 1HK9A 1Y96A 4C92D 4M78A 3JCMf 3QUIA 3INZA 4N0AC 3JCMg 2K57A 4J6WA 2EAYA 4M77G 4PNOA 3SWNA 1BIBA 4M75F 4OP0A 4F7UB 5GAN5 4HT9A 2EJGA 5GAN8 4M7DA 3JCMd 4M75C 4M7AF 4HT8A 4C8QA 4M78B 4XU3A 4C8QC 5LJ3h 5CAIA 2DTIA 4M75A 2Y90A 4MMLA 3JCMh 4M7AC 2DJZA 4M78E 3BW1A 2FYKA 5GANe 4RCCA 5GAMf 5GAOr 3RESA 5DY9A 2EJ9A 4XTWA 4M77E 5GMKl 1H641 2YLCA 4V2SA 4X9DA 3V8LA 2JN0A 4JRKA 2E64A 4WF2A 5GANj 4HA8A 3AHUA 1N9RA 4M75E 5GAMg 5LJ5j 3EFRA 4PJOD 3BDUA 2DZ9A 2DKGA 5LJ3e 2EWNA 3RKXA 3JCMe 4A54A 4M7AE 4M7AD 2QTXA 2RD1A 1M5Q1 3JCMQ 4XQ3A 4PJOG 4M75D 4F7UA 1MGQA 4C8QD 3FB9A 4C92F
chains in the Genus database with same CATH superfamily
5FU7C 1KHIA 1WXTA 3O5ZA 1BBZA 2E3IA 2L8DA 4J6XA 4KH0B 1JU5C 3CMEQ 2QGFB 1RAGB 1Y71A 2XICA 3OS2A 1JBMA 2NYSA 3M57A 4J8OA 2EQIA 3BY7A 3FIFA 2HCKA 1D09B 2DYIA 4M77D 1RAFB 3OYYA 5FWBA 2HSPA 1YJNT 2LRQA 2KY9A 2CUDA 4EMKC 3FEOA 3S3NA 3HP9A 3CC7A 3OBYA 1JQQA 1KD1R 3M53A 2A08A 3H0HA 3VYHB 2F2XA 3SDZA 4Z88A 5CQYA 2JUFA 3OYKA 3LGFA 2CP0A 2FZCB 1YBYA 3GIBA 3VV0A 1FYNA 4C92B 5GAOq 3CCQT 5I22A 2LCLA 3ZL7C 3GLXA 4RTXA 2DX1A 4E6RA 3H8ZA 5GAN8 1B7TA 3CCVT 1M4ZA 2HKQB 4BY6C 4J7IA 1BI3A 1Q82U 1JXMA 3JCMh 4KUDK 1YHQT 3GF5A 1RAEB 1LCKA 1VQNA 2IPOB 1ZX6A 4RMOA 5DY9A 2HQXA 2ZCFB 3A8GB 2QI2A 3CMAQ 1IB8A 1VA7A 1VIFA 1TTHB 2P0QA 1XTDA 4KGZB 5KYWB 1GCQC 1M5Q1 1O75A 3I35A 3CBOA 3CCJQ 3R6NA 2QEXA 4M78F 1S72T 4M7DB 1K8AU 1VUBA 2QQSA 1AD5A 1J3TA 2DERA 1D3BA 2NUPA 3V7SA 3I9QA 1O9SA 1X6GA 5GAN6 5GAMe 2JT4A 1WIEA 3UATA 1NPRA 5IT9E 3CMAT 4EMHA 3UDCA 4BY6B 2DZCA 3NGPA 3OYNA 3CBMA 2R5MA 1UTIA 3OYBA 2MI6A 4F16A 4N4HA 2ZZDA 1IHVA 2CH4A 1OPLA 2RM4A 2CP2A 4LD9K 1X75C 1NYGA 1VQ8Q 1VQ7T 4FW1A 4ELYC 5IH2A 4HVUA 1I5LA 3A98A 1G3WA 5LJ3d 4B9XA 3QXEB 1ZSZC 3P8HA 4PJLA 2HBWA 1ZHIA 3TSWA 5DM7R 3D7SB 2RI3A 2LCSA 5KCOA 2D8HA 3SB2A 3GP8A 1AOJA 2VXEA 3JCMW 2RF0A 1BU1A 4FYYB 5GANf 1QVFS 3JB9I 1I4K1 3CC2T 2L0AA 3I56Q 5LJ5d 2NUPB 1U8RA 1YJ9Q 5LJ5h 4M7AA 2XD0A 5GAN4 2L5QA 2J05A 4QW2A 1RLQC 2F69A 2QDLA 1VQPT 4PNOA 4M75F 2VYTA 4MZPA 3OMGA 4M7DA 2VASA 4Q5WA 2ZPFB 2KYMA 1Q82R 2LC4A 3SEMA 2NUZA 4FYXB 4X1VA 2QGGA 3CC4A 3LGLA 3R6OA 1G2BA 1OOTA 1WYXA 1NJIR 2JTMA 3M55A 1K9MU 2D0NA 3WVEB 1SEMA 2RJCA 2HAXA 5EC7A 1CKAA 2K2VA 4PJOG 4M75D 2EW3A 4CC3A 2PZ1A 2RHIA 5FWCA 4WCIA 4FW2A 3E9GA 1YITT 2XIDA 5LJ5g 3NTIA 3CXCA 4J9CA 3T9NA 3L2RA 4A4HA 1Q86C 4OMLA 4X9CA 3JCMP 2VXFA 4AFUC 2FPDA 1VQKQ 4C8QF 5GANh 4JLIA 1ZA2B 4DA4A 3J81E 5KYXB 1OI1A 3CXCP 1VQ4Q 2RK1A 2QA4A 4E7HA 1H8KA 1W4SA 3QO3A 1Z9ZA 3HSBA 4PJOC 3A1PA 1JRIA 4J9GA 5GMKi 1JJ2P 3DLMA 2PTKA 4JS4A 5KE3A 1KQSS 2E5KA 3MKDA 1IGUA 4PJOA 4FU6A 1RAIB 2FRYA 1QP2A 2BE7D 1ZSZA 1VYTA 2PVGB 3MEWA 3EFSA 1I81A 4C92E 4RCBA 2YUQA 3RUXA 2PU9B 4PFOA 2K3BA 4DEYA 2JW4A 2MOXA 3MO8A 3CCMT 5GAOl 1K1ZA 2OTJA 2I0NA 3UF4A 1BCOA 2EJGA 3JCMd 4MZTA 4JS5A 1X6OA 1VQ9Q 3CPWS 3UT1A 3VS1A 2DTIA 4M7AC 2OAUA 1OULA 2EQKA 2LMJA 3EHQA 3VS3A 5KYYA 1PC0A 2CT3A 2JN0A 1CKBA 1V76A 2QK0A 2EKHA 3LLRA 2CSIA 2M1HA 3BDUA 2DKGA 3OB9A 1WHMA 2RO0A 3G71T 2V8IA 2O9SA 2KT1A 4C8QG 2BKDN 4PJOB 2MMPA 5J3BA 4C0DB 2M16A 1K4US 3V8KA 1X43A 2VUBA 3REAB 1UHFA 3JB9F 4BD3A 2EQMA 4MMKA 2COWA 4XU0A 1VQ5A 1SKUB 1YWOA 3HTRA 2YT6A 1KG1A 1ZBJA 2VC8A 3ZBDA 3LYIA 5IHIA 5J26A 3CCRA 3FDRA 2BZXA 3QWXX 2IG0A 4DBQA 3EG2A 1BKBA 2H3EB 4IIMA 2D0QB 2F1LA 5KH6A 3M54A 4F7UG 1UFFA 2CDTA 3CD6T 1R77A 2DK3A 2XI9A 3TEEA 1AWJA 1ZSZB 5GMKm 2CH4W 2DYBA 3A5ZB 1AZGB 5CR2A 1K0SA 2RH2A 3VJPA 3VUBA 1M1KC 4EPCA 1QCNA 1JEGA 1AHJB 1Y07A 1ZLMA 3CXCS 2DAQA 1X2QA 2RNAA 2KYBA 5I11A 2K57A 1RLPC 1FXXA 2J06A 2QA4T 1VQMQ 4PJMA 2IVWA 3PE0A 3QYHB 4IIOA 1UGSB 5IHNA 2GFUA 3I5SA 4AFZC 4ESRA 1QVGA 3CCLQ 1UEBA 2CUBA 1WJQA 1N9RA 1U3OA 3E9FA 3BDLA 1YITA 1NEBA 2CZ6B 1MV0B 1XOVA 4OB0B 3MP6A 4RUGA 1YCSB 1WQWA 1QWEA 3OW2A 4LUEA 4M75G 5FROA 4F14A 3MPUB 3ZEHA 2ROTA 3CD6A 2EBPA 5LJ3j 4LNPA 3OY9A 3LX7A 3CCRT 2DXTA 1VQPQ 4O5VA 5GAMd 2A37A 1M90C 3OS1A 1RAAB 2DEUA 3I55Q 1V29B 3CC2Q 2ZPIB 2BZYA 2KGTA 4MZMA 1MNDA 5FW9A 4J6YA 3FJPA 3F70A 4DBFA 4C8QE 3PNWC 5GAOm 4JJDA 1KD1C 3M0SA 4C8QB 3KXTA 2BTTA 4OMPA 5HY6A 3ASKA 3DLLA 2DL4A 4TVRA 1D1CA 4BB7A 1HSQA 5KYUA 2FB7A 3L2UA 2JTEA 3CEYA 3GNFB 1VQ8T 3QBYA 2CSQA 2X35A 4XTVA 3LH0A 1FMVA 1IO6A 1WXBA 4J83A 4OMQA 4AT1B 2DL8A 5CK9A 1M90U 2EAYA 2K5LA 2K3XA 2JNGA 1VQOQ 7AT1B 4BI8B 5ECAA 2LT4A 3X25B 5CAIA 3QZ5B 1M1KR 4LDXA 3CCET 4BE1A 1MMAA 2EFIA 2EVRA 2K79A 5GANe 4JJNK 3UA6A 3VS7A 4XTWA 5HKCA 2VB6A 2OTJT 4RKUE 2MWOA 1QW1A 4KRTA 4ATOA 3QKJA 5LJ3e 2EWNA 4M7AD 2QEXT 2RD1A 3TQ7P 1XQHA 2GF7A 2RHYA 3OYCA 1TUCA 3EFOA 2DE0X 1KD1U 5KYNA 1BIAA 2WSFE 3EGDA 1KQ2A 1JB0E 1KC8C 1W6XA 3BFMA 4Y28E 4NL3A 4XK8E 3GBQA 2FZGB 2K6DA 3OYAA 5LJ5e 2X4YA 5I2SA 2E1HA 3CBPA 3OYDA 1SSHA 4FSSA 1TXQA 2DD4A 2OTLA 2DVEA 1YHQA 2DM1A 1WHHA 3CCRQ 4E7KA 1WHGA 2NLUA 4J9EA 4ELZC 5LJ5f 2XDPA 1KFZA 1RL2A 1NJIC 2HL5C 3FLGA 2GTOA 1B34A 1U1TA 2MAMA 2V8JA 1W2BS 4ZNXA 2JMCA 4XTUA 3X24B 2DA9A 1T0HA 3PVQA 2D1XA 1IXDA 2O2OA 2XKOC 1G3SA 4RTWA 1TOVA 2QYZA 4M75B 3OS0A 3HFOA 2CYZB 1QQJA 1PD0A 4BI3A 3VRZA 2ZPBB 3A8OB 5GAOn 3JCMV 1KJWA 2ESWA 1GBRA 4LD6A 4ORZA 4RTTA 5KCHA 5DLQE 3CCST 3JB9D 1X27A 1Y96A 3CC4T 2D8JA 3PIPA 2R57A 5C0MA 1YJWQ 2CKKA 1TU0B 3M9QA 1YJNA 4NS5A 1H92A 5CKEA 2PUOB 5LJ3h 4R55A 2E12A 2DL3A 1Y57A 3G4SQ 2HQEA 2EJ9A 3HHTB 5A2QE 1WXUA 1D1BA 1YFNA 4E7ZA 4M4ZA 4LN2A 1G8XA 2IIMA 1E6HA 5GJWB 2KK4A 3L2WA 3DB4A 4M7AE 2A28A 2FPFA 4MDWA 3EGDB 3OYJA 4JPBW 4XQ3A 1QVGS 2QAZA 1RI0A 1UHCA 4J9HA 2E70A 4C92F 2J6KA 4OF1A 2YHTA 2FO0A 4HKEA 1K8AR 3URGA 4C92A 1QVFA 2C0TA 1NE8A 1VQ6T 1VQ9A 1YJWT 2O9VA 4R0KA 2JS0A 2L3PA 1TSFA 1EIFA 3CC4Q 3PIOA 3IQLA 1B34B 2M0OA 3CCSQ 4M78D 1LPLA 4DBRA 4EMGA 2KXDA 3CMAA 4M77A 1YIJA 4Y91A 3P8BB 3PGGA 4HCZA 4ZN1A 1M8MA 1QP3A 3RKYA 5LJ3f 3I5RA 4A63B 3MCAB 8ATCB 1RI9A 2XU8A 2VGMA 5D7UA 1UB4A 3PT9A 3MEAA 1KIKA 1OZ2A 1Q81R 3OW2S 2RQWA 3QIIA 2ENMA 2DPPB 2LP5A 2HL3A 4NOYA 1WPYA 5HK3A 3JCMJ 2LTOA 2EKOA 2KRNA 1BI1A 3L2QA 1FWZA 4C92D 3QUIA 4AFSC 2GNCA 1OPKA 2AT1B 1VQNT 1NYFA 2RMOA 2VV5A 4M78E 5CKDA 2QG9B 1VQ4A 2QXFA 2B86A 2YLCA 1TUDA 1D1AA 5GANj 4HA8A 3RR6A 3C94A 9ATCB 3JAME 2E6ZA 1M27C 3CCQA 3EG1A 1PKTA 1OYXA 1YN8A 5AT1B 3E1SA 4B6MA 5C6SA 5D6YA 3RMQA 3CCUT 2EYYA 2H3JA 2LZ6B 1AWOA 2JM9A 4PL6A 4LE9A 4QQ6A 2O4XA 1I1JA 2VKNA 1F1BB 3CCEQ 1KHCA 3OS5A 2C06A 3SFMA 4F7UF 3LW5E 4N4IA 4XTZA 3H0IA 5GAMh 3KFVA 3QSUA 2GQVA 1VQ4T 3QHSA 4BACA 4C5HA 4M77B 4EIKA 4PJOF 1SHGA 3JCMc 2BZ8A 5FU6C 5GANd 5GMKj 2VGNA 2JS2A 3MP1A 1VQOT 4XU1A 1EFNA 3MEUA 3H9NA 5GAN7 3H6ZA 3M0PA 2LVMA 1QVFP 1U5SA 1PCXA 3CCLA 2MK5A 3EG9B 3RNJA 1A0NB 1YWPA 5GANg 3UPUA 4OMNA 4N4GA 2QQRA 3QG1A 4A53A 2LJ1A 1DJ7B 3I55T 3E2UA 2G3RA 3EGUA 2EQJA 1G5VA 1B07A 1SPKA 4GLKA 4JJCA 1C1AA 5L8RE 3CPWA 4HXJA 1YIJT 1WJSA 2DJQA 1MV3A 3KBGA 4M7AF 5CKBA 2DJZA 2DMOA 4Y92A 5GAMf 1Q81U 1OQKA 2HZYA 3M0TA 1SRMA 3OYHA 3AHUA 4Z8AA 1ACMB 4M75E 2LX9A 4L6V5 4RTZA 5HCKA 2QQAA 1YIJQ 4RG8A 3I56A 2QTXA 3OYEA 2O4XB 2P0KA 2YRVA 4PFZA 4FT4A 3CCLT 3E19A 4OMMA 4FYVB 5D6WA 1VYVA 1VQOA 2DXBA 1RABB 2JZ2A 4C5IA 5A0LA 5CKHA 2W10A 5L23A 1M3AA 2DO3A 3OYIA 1GRIA 3WXMB 2PNIA 2E5QA 1TH7A 4JUVA 3EHRA 1KQSP 4C0FA 1I8FA 4ZGDB 2Y4YA 1AVZC 1NEGA 1NPPA 3OYGA 4QVCA 1U06A 2ZGWA 1S72Q 1U1SA 2P0PA 4C92G 3SD4A 4M78C 2KE9A 1Q95G 1W2BA 1QMCA 2PVOB 2RHZA 3CCUA 2DIQA 2E10A 4J9BA 3GNGA 1VQKA 2YUNA 4M77F 2XK0A 4Z89A 3V8JA 3Q1JA 1GCPA 4C0DC 1PKSA 4A4FA 4M78A 4BI4A 3INZA 2V1QA 4OP0A 1PSEA 8AT1B 3CD6Q 1NZ9A 2CZ0B 3JSCA 2FPEA 2RK2A 3EGXB 3RMSA 1K0XA 2OTLT 3BW1A 2RJEA 4KUIA 5CO7A 2O01E 3TCJA 1WZOA 5HK0A 2L3SA 2OAWA 1YI2Q 2J6FA 3CCVQ 5LJ5j 1ZUKA 3JCMe 1I07A 2ZPEB 4XAXB 3JCMQ 3VRYA 2L89A 1Q7YC 1KC8R 2O88A 2M0YA 4LDVA 2E6NA 2XDBA 4IKFA 4Z02A 4OVAA 2RPNA 4OB3B 3EH1A 1X6BA 3HRTA 2EYQA 1OU9A 4JDSA 2DNUA 1YI2T 4DQ2A 1SG5A 1VQMA 2W0ZA 3CCEA 5GMKe 2KSSA 3S6WA 1M30A 1YP5A 5CVIA 4E47A 1Q7YR 2FZKB 4E2FB 4QVDA 4JRQA 3OMCA 4E7SA 1VQ9T 1VQ6A 1OZ3A 4N0AA 5GAN3 4VUBA 2DRMA 4KH1B 3QWYA 2AZVA 2F5TX 1VQ8A 1OX9A 3OW2P 2KNBB 1SHFA 2FRWA 5CQXA 5I21A 3CCMQ 2KMTA 4K11A 2C0OA 3FJ5A 2YWWA 5IXFA 3QDFA 1H3ZA 2KXCA 1XNIA 2A0FB 2KRMA 3PMTA 4FCYA 1LVKA 4E7JA 1UGRB 1ZQ1A 2BUDA 3SWNA 3TU4K 4X34A 1NLPC 5I2MA 4BE0A 4OGCA 2COZA 3MP8A 1Q7YU 3NPFA 4A4KA 2EGCA 3UWNA 3M0RA 1HD3A 1H641 4P5NA 3G4SA 3CCSA 1FMWA 3TREA 1ZBXA 2ZPGB 3U23A 4J9FA 1QWFA 1VQLT 2E3HA 4ZN3A 4FIBA 3X26B 4YTLA 1W2BP 2X4JA 1RADB 1UGVA 3RIRA 2HDAA 3LH5A 2E65A 1K76A 2Z0WA 3PVLA 2HBPA 2NWMA 2ZAEA 4CC2A 4M7DF 3CPWP 1PWTA 3J7AF 2ROLA 1X01A 5IHKA 5KYXA 3VS2A 3EG3A 1ZSGA 1UUEA 1WNLA 4OB2B 1GFCA 1BI0A 1ABQA 4ME7A 2M9UA 3TVTA 2WACA 1M3CA 2F2VA 3JB9G 4J7FA 2OX7A 3VUZA 3M56A 4ZGJB 3GPLA 3FRNA 1IRXA 3G6EQ 1BB9A 4FM4B 2G6FX 3C0CA 3EH2A 3CPFA 1UJYA 1WQ7A 4FYWB 4C5GA 2RN8A 3X20B 2RA2A 1AZEA 1QKXA 3HL8A 3M59A 1TS9A 1X69A 2HMAA 1ZA1B 4J9DA 3JCMX 3JB9J 2X4XA 3VU3C 4XTYA 2KEAA 1K9AA 1NG2A 1V1CA 1HK9A 2F2WA 4DBHA 3C12A 2QEXQ 1K9MC 5A0DA 3C95A 3N5BB 1W70A 1UE9A 2PUKB 5KYYB 3VS6A 4GBQA 1WGSA 4M78B 4C8QC 4QQDA 4M75A 2Y90A 2X51A 1OEBA 1VQ5T 4KGVB 2KQWA 4OGEA 3OA6A 4RCCA 3REBB 2CP7A 2CZ7B 1IREB 4M77E 4BDYA 2A36A 4X9DA 2CZ1B 2LNHB 2LQKA 3CCJT 2E64A 4KBMB 1M1GA 2CREA 1D0XA 1QVGP 2FVUA 4IUTA 4F17A 2DD5A 2OI3A 4PJOD 5EG2A 2B8AA 2HSEB 2HD0A 1K8AC 2RJFA 2K7AA 2K4YA 2YDLA 3LWHA 2AZSA 2KVQG 2QQBA 4UC4A 2LJ3A 3SWNC 5GAOp 1NBEB 3NHNA 1GL5A 5GAMj 2EYXA 6AT1B 5A0GA 2OJ2A 2YLBA 1PSFA 2DVJA 1TUGB 2QTVA 1LOJA 1C0MA 1MMNA 4E7LA 1EZZB 4WTOB 3M4GA 3P8DA 1PRMC 4M78G 2DIGA 1JJ2S 5GAN2 5FU7B 3CQTA 1LJOA 3EGXA 1N9SA 1ZUUA 4D8KA 1Q82C 2DBKA 2R5AA 2K3YA 3ER0A 3CCQQ 4DEXA 4HVVA 1QCOA 5IXBA 2ATCB 2KAFA 2YXYA 3O8VA 5CKFA 1UJ0A 3CCMA 3A8MB 4IUQA 4DOWA 3M4YA 4GY5A 2QQ9A 3LWIA 4PJOE 2RQVA 4EDUA 4ZTFA 2ED1A 2CS7A 1I0CA 2HKNA 2P4RA 3NMZC 3RERA 1H3HA 2KROA 2LDMA 3V7CA 1SF9A 2JVVA 4F7UE 2LNVA 3JCMg 1EX4A 4OMOA 1WDXA 1K73C 1CSKA 1MMDA 2EYZA 3A8LB 2H8HA 2RI5A 3H0FA 4R56A 3V8LA 4RTVA 2ECZA 3DB3A 1YNZA 2KI7A 2ABLA 4ZTJA 4KULA 2RQRA 5GAMg 4OMFB 2J7IA 3OYLA 1MUZA 4IUPA 3NTKA 2E4HA 1PHTA 2FG0A 3FB9A 2ED0A 1BI2A 1UGPB 4C0ZA 2AKKA 2GGRA 4BUGA 4JRIA 5DLOA 4QVZA 3ULRB 2E41A 2EQUA 3QPHA 1ABOA 1M8VA 2DTOA 3OSVA 4RTUA 2L3QA 2V1RA 3OSSC 1SSFA 2J6OA 2LCCA 2DLPA 4NL2A 4BE2A 4D8DA 2DXUA 3L42A 4O6JA 4QT7A 4A4EA 4HVWA 1N8RR 2XDDA 1KC8U 3CCUQ 1GXIE 3FC3A 1T3LA 1HJDA 3G71A 1NLOC 4C0GA 2RI2A 5CIUA 1D0YA 1BYMA 1Q86R 1KSWA 1K9MR 1M2OA 3PTAA 1AWXA 3QYGB 2AIRB 4M7DE 4PK4A 3OYFA 2LX7A 3WVDB 3CCJA 4MDXA 4N0AC 5CCAA 1PRLC 1BIBA 5GAN5 4HT9A 1RUWA 1XJWB 4HCBA 4M75C 4HT8A 4C8QA 1N27A 2V8KA 4FSXA 4MMLA 2RHXA 3CC7Q 2A3LA 2DRKA 1TG0A 2AK5A 3HPWA 3EAEA 3OQ5A 1KK7A 4V2SA 3J80E 1VIEA 3NFCA 4FL6A 4WF2A 2Y4XA 2LT1A 2JJ9A 1WX6A 1IGQA 3MJXA 2CT4A 3GOXA 1PG5B 4JZ3A 1OV3A 1T0JA 2DXCA 1S72A 1UG1A 4QQGA 2YUOA 2EGAA 1PD1A 2LJ0A 4B9WA 4F7UA 1MGQA 2M51A 1VOMA 1M2VA 4EMKB 1I5OB 2X3XD 2OTLQ 1MNEA 2PVDB 2DF6A 3VS4A 2K5IA 1OU8A 2RQUA 2NUTA 3MEVA 1SRLA 1JO8A 2YUPA 4LDUA 4M7DD 1OX8A 2P84A 2JXBA 2JOYA 1KQSA 1W1FA 3CCVA 1ARKA 4ANJA 5LJ3g 4PJNA 3SWNB 3BE3A 4AMCA 1Y96B 4ZGEB 1Z9QA 2CP5A 1NJIU 2L3RA 4DOVA 1QLYA 5FLXE 4CC7A 1VQKT 2K5FA 1LNXA 2XG8D 1NM7A 1UDLA 2A7YA 1VQLA 3SHWA 3QDRB 4M77C 4HCKA 1HXDA 1BK2A 1IZ6A 1WHLA 1Q86U 2RB6A 1WHJA 3G4ST 4OB1B 1D3BB 2L2PA 2NUTB 3JCMf 1JJ2A 2COYA 2MPXC 4J6WA 4F7UB 4IURA 1B3QA 3QZ9B 3PFSA 2XMFA 1N8RU 2GQIA 1Y0MA 1GCQA 4JJBA 1AT1B 2RJDA 5FU6B 4II1A 1VQPA 1TWBA 2C0IA 2KBTA 2GCXA 2XHCA 4CRIA 2D6FA 3QJYA 5D6XA 4J9IA 4A54A 3CC2A 1Q81C 2RQTA 1M3BA 1QVPA 3HRSA 4PKCC 1G3TA 1YJ9T 2RHUA 4PJJA 3I56T 1QKWA 5FRNA 2K2MA 3META 1RAHB 2MIOA 3VYGA 2DILA 2SEMA 4IUUA 3VS0A 2V26A 2BIVA 4J5YA 4LDWA 3L1AA 4AFQC 1PNJA 2KR3A 1JXOA 4L5GA 3PMIA 4XU2A 4L59A 2DEQA 1VQ7A 4RG2A 2DL7A 2FL7A 2DL5A 1N8RC 2GFAA 3NTHA 2FHDA 1VQMT 1T3SA 4XTXA 1VQ7Q 3L2ZA 2QA4Q 1YI2A 2VVKA 4KT0E 3EFOB 4BDZA 2F5KA 3THKA 2HNIA 2LQ8A 1HYOA 1R8OB 5KYWA 3RKWA 2KDSA 4HCCA 4F04B 3V7RA 3MHXA 2JM8A 1E7OA 2MF2A 2JTFA 5IN1A 3VS5A 4PFPA 2CGHA 2PQWA 2I2LA 2OTJQ 1WJRA 1G83A 3DKMA 1IHWA 2GTJA 1FX7A 4JZ4A 3QJ6A 1WFWA 2EGEA 1BCMA 2MWPA 2X3WD 4IUVA 4C92C 2DTHA 2SRCA 5J39A 1GFDA 3OBWA 3KUFA 2DETA 3G6EA 1R0CB 1K73R 1D0ZA 5M9OA 2R58A 1VQ5Q 1YHQQ 2DFUA 1M9SA 1VYUA 3JV3A 1X2KA 3HRUA 1M1FA 2CP3A 3H41A 3EFRA 2KT8A 4D6WA 2X9HA 2DZ9A 1AEYA 3RKXA 2MYSA 4LDYA 1WLPB 3S3OA 2WSEE 3JRZA 1RACB 1K73U 1N6AA 1P92A 4E7IA 4PLIA 3G71Q 4M7AG 4M7DC 2YSQA 2D9TA 3EG0A 4KGXB 5AYFA 1ZUYA 2BE9B 3CC7T 1YCYA 1GBQA 3RBBB 2MCNA 2VWFA 1M2VB 4EMKA 1VQNQ 2HEQA 2M02A 3M0QA 1E6GA 1QCFA 2LQWA 3G6ET 3JB9H 4LUDA 1M1KU 1MHNA 2EJFA 1G3YA 1R0BG 1UGQB 3TSZA 2KRSA 3M58A 2K9GA 1WI7A 1C6VX 1YJNQ 2CP6A 4LXCA 3X28B 3S3MA 3VKIA 3HKSA 4M7DG 4QKUA 2DBMA 3JCMb 3G1JA 4FT2A 2EIFA 4RTYA 5KYUB 3G7ZA 4AG2C 1N5ZA 3CMET 4JRPA 2YRCA 4JLGA 1KQ1A 4PLLA 1S1NA 4M7AB 2O31A 1FMKA 2FEIA 5GMKh 3M0UA 2EPDA 2AKLA 3EG9A 4C5EA 3L2VA 2HQHA 3HFNA 3RDVA 1VQLQ 4A4GA 4CI0C 3AT1B 3ZFJA 4M77G 3M5AA 4AG1C 2YRDA 2QDYB 1VQ6Q 1MMGA 2ZPHB 5GJVB 2P4TA 4GLMA 4XU3A 5KE2A 1UECA 3OYMA 5FRMA 5LL6S 2EYWA 2FYKA 2LQNA 5GAOr 3RESA 3C4SA 5GMKl 1YJWA 1PM3A 1WHKA 2QASA 4JRKA 1WA7A 5IAYA 4CC4B 3A8HB 3I55A 1AWWA 2AHJB 1Y7XA 3UA7A 2JMAA 2WSCE 1YJ9A 2X4WA 1YITQ 3ME9A 3CMEA 1M90R 4C8QD 2GBQA
chains in the Genus database with same CATH topology
3E19A 5FU7C 1BI2A 5D6WA 1KHIA 1UGPB 1WQWA 4C0ZA 3OW2A 4BUGA 4JRIA 2L8DA 4J6XA 4M75G 5DLOA 4QVZA 5FROA 3ZEHA 2E41A 1VQOA 2EQUA 3CD6A 2DXBA 3QPHA 1Y71A 2XICA 2JZ2A 5LJ3j 3OS2A 1JBMA 4C5IA 1M8VA 2DTOA 3LX7A 3M57A 4J8OA 5A0LA 3OY9A 3CCRT 5CKHA 2DXTA 2DO3A 3OYIA 3OSVA 3BY7A 3FIFA 4O5VA 3OSSC 3WXMB 4M77D 5GAMd 2E5QA 1M90C 1SSFA 1TH7A 2LCCA 3OYYA 4NL2A 4JUVA 4BE2A 1YJNT 3OS1A 4C0FA 1I8FA 2LRQA 2KY9A 4ZGDB 4EMKC 1V29B 3FEOA 2Y4YA 2DXUA 2ZPIB 3L42A 4MZMA 4O6JA 4A4EA 3S3NA 1NPPA 3OYGA 3HP9A 4QVCA 4J6YA 2ZGWA 3CC7A 3FJPA 3OBYA 3F70A 2XDDA 3M53A 3VYHB 3SDZA 1U1SA 4C8QE 2P0PA 3PNWC 5GAOm 3FC3A 1KC8U 1GXIE 1KD1C 4C92G 3SD4A 4M78C 2JUFA 5CQYA 4C8QB 3OYKA 3KXTA 3LGFA 1W2BA 5HY6A 3ASKA 3G71A 2PVOB 3DLLA 2RHZA 1YBYA 4TVRA 2DIQA 2E10A 3CCUA 4C0GA 4BB7A 2RI2A 5CIUA 3GIBA 3GNGA 1BYMA 1VQKA 2FB7A 3L2UA 3CEYA 3VV0A 4M77F 2XK0A 4C92B 3PTAA 3V8JA 5GAOq 3GNFB 3Q1JA 3QBYA 3CCQT 1VQ8T 2LCLA 3QYGB 4C0DC 3GLXA 2X35A 4A4FA 4M7DE 4XTVA 3OYFA 3WVDB 3CCJA 3LH0A 4MDXA 4J83A 4M78A 4BI4A 5CK9A 1M90U 3INZA 4N0AC 5CCAA 3H8ZA 2EAYA 2K5LA 1BIBA 2K3XA 1PSEA 4OP0A 5GAN5 4HT9A 2JNGA 1NZ9A 2CZ0B 3JSCA 5GAN8 2RK2A 4BI8B 3CCVT 1M4ZA 4HCBA 4M75C 4BY6C 3RMSA 2LT4A 4J7IA 3X25B 4C8QA 4HT8A 1BI3A 1Q82U 5CAIA 1N27A 3QZ5B 2V8KA 4LDXA 4FSXA 4MMLA 2RHXA 3JCMh 1YHQT 4KUDK 3GF5A 2OTLT 2A3LA 3BW1A 3CCET 4BE1A 1VQNA 5GANe 2EFIA 3HPWA 4RMOA 3EAEA 4JJNK 2RJEA 5DY9A 3OQ5A 4KUIA 2HQXA 4XTWA 5CO7A 5HKCA 2O01E 4V2SA 3J80E 2ZCFB 1VIEA 3A8GB 3NFCA 4FL6A 2OTJT 4WF2A 2Y4XA 2LT1A 4RKUE 3TCJA 2MWOA 2QI2A 5HK0A 1QW1A 3GOXA 1VIFA 4ATOA 5LJ5j 3QKJA 5LJ3e 2EWNA 3JCMe 2DXCA 2P0QA 1XTDA 1S72A 4M7AD 2QEXT 2ZPEB 2RD1A 4XAXB 1M5Q1 4QQGA 3JCMQ 1XQHA 2GF7A 1O75A 2RHYA 2L89A 1Q7YC 3OYCA 4B9WA 3CBOA 4F7UA 1MGQA 2QEXA 4M78F 1S72T 1KD1U 4M7DB 1K8AU 1VUBA 1BIAA 2QQSA 2WSFE 4LDVA 1KQ2A 1JB0E 2E6NA 1KC8C 2XDBA 4EMKB 4IKFA 3BFMA 4Z02A 1D3BA 3V7SA 1O9SA 4OVAA 4Y28E 4NL3A 2PVDB 4OB3B 5GAMe 5GAN6 2K5IA 4XK8E 3HRTA 1NPRA 3OYAA 5IT9E 2EYQA 4JDSA 3MEVA 5LJ5e 2X4YA 4DQ2A 5I2SA 2E1HA 1YI2T 4EMHA 3CMAT 3UDCA 4BY6B 1VQMA 2DZCA 3CBPA 3OYNA 3CBMA 3OYDA 3CCEA 5GMKe 2R5MA 2DD4A 4LDUA 2OTLA 2KSSA 2DVEA 3S6WA 3OYBA 1YHQA 2MI6A 4M7DD 4N4HA 2ZZDA 2JOYA 1KQSA 2RM4A 4E7KA 4LD9K 1X75C 5CVIA 2NLUA 4E47A 4ELZC 5LJ5f 3CCVA 2XDPA 1VQ7T 1RL2A 4ELYC 1NJIC 5LJ3g 4QVDA 4JRQA 3OMCA 1I5LA 1VQ9T 1VQ6A 3FLGA 3SWNB 1G3WA 1B34A 5LJ3d 1OZ3A 4N0AA 1U1TA 4B9XA 2MAMA 3QXEB 3P8HA 5GAN3 1Y96B 4VUBA 2V8JA 4ZGEB 1W2BS 2F5TX 1ZHIA 1VQ8A 5DM7R 1NJIU 4XTUA 2L3RA 3X24B 4DOVA 5CQXA 2RI3A 5KCOA 5I21A 3GP8A 3SB2A 5FLXE 1VQKT 2K5FA 2KMTA 2XKOC 1G3SA 2VXEA 1LNXA 4M75B 3JCMW 3OS0A 2XG8D 3HFOA 2CYZB 5GANf 2A7YA 4BI3A 1VQLA 1QVFS 3JB9I 3QDRB 4M77C 2ZPBB 1HXDA 3A8OB 1I4K1 3CC2T 5GAOn 1IZ6A 3JCMV 1H3ZA 1Q86U 5LJ5d 1U8RA 1XNIA 4LD6A 2RB6A 3PMTA 5LJ5h 5KCHA 5DLQE 3CCST 3JB9D 4M7AA 2XD0A 3G4ST 4OB1B 1D3BB 5GAN4 2L5QA 1Y96A 4E7JA 4QW2A 3JCMf 1UGRB 2F69A 3CC4T 1VQPT 1JJ2A 1ZQ1A 4J6WA 4M7DG 2BUDA 4PNOA 3SWNA 4M75F 2VYTA 4IURA 4X34A 4F7UB 2R57A 4MZPA 5C0MA 3PIPA 3OMGA 5I2MA 4Q5WA 2CKKA 4M7DA 2ZPFB 4BE0A 3QZ9B 3M9QA 1YJNA 3PFSA 4NS5A 1N8RU 5CKEA 4OGCA 2PUOB 3MP8A 5LJ3h 4R55A 2E12A 2LC4A 1Q7YU 2RJDA 5FU6B 4A4KA 4II1A 3UWNA 2HQEA 2EJ9A 3CC4A 3HHTB 1H641 5A2QE 1VQPA 3LGLA 4P5NA 3R6OA 2GCXA 3G4SA 2XHCA 3CCSA 3TREA 4CRIA 2D6FA 3QJYA 5D6XA 2JTMA 1ZBXA 3M55A 2ZPGB 1K9MU 3WVEB 2KK4A 3L2WA 2RJCA 3DB4A 4A54A 2HAXA 3CC2A 4M7AE 1Q81C 4MDWA 3OYJA 1QVPA 4XQ3A 3HRSA 4PKCC 4ZN3A 2K2VA 1QVGS 1VQLT 4FIBA 4PJOG 1RI0A 3X26B 4M75D 1G3TA 1YJ9T 4YTLA 2RHUA 2E70A 4C92F 2X4JA 4OF1A 3I56T 3RIRA 5FRNA 2RHIA 2E65A 2YHTA 3META 3E9GA 4HKEA 1YITT 2XIDA 5LJ5g 3NTIA 2HBPA 3VYGA 3CXCA 3URGA 4M7DF 3T9NA 3L2RA 3J7AF 4A4HA 1Q86C 4IUUA 1X01A 4C92A 1QVFA 4X9CA 4J5YA 2BIVA 3JCMP 2VXFA 1NE8A 4LDWA 3L1AA 4C8QF 1VQ6T 1VQ9A 5GANh 1WNLA 4JLIA 1YJWT 4OB2B 4L5GA 3PMIA 4XU2A 4DA4A 4L59A 2DEQA 1VQ7A 3J81E 4RG2A 1EIFA 1BI0A 1OI1A 2FL7A 3PIOA 4ME7A 2M9UA 2RK1A 1B34B 2QA4A 4E7HA 1W4SA 2M0OA 2GFAA 4M78D 1N8RC 3QO3A 2WACA 3NTHA 3JB9G 3HSBA 2FHDA 4EMGA 1VQMT 4PJOC 1JRIA 4J7FA 4XTXA 3L2ZA 5GMKi 3CMAA 4M77A 3VUZA 1YI2A 1YIJA 3M56A 4Y91A 4ZGJB 3GPLA 3P8BB 3DLMA 3FRNA 4KT0E 4JS4A 3PGGA 5KE3A 4HCZA 4BDZA 4ZN1A 2F5KA 1KQSS 4FM4B 2HNIA 1QP3A 2LQ8A 3RKYA 5LJ3f 1R8OB 4PJOA 3MCAB 3RKWA 3CPFA 2KDSA 4FU6A 4HCCA 3V7RA 1WQ7A 2XU8A 2VGMA 1QP2A 3MHXA 1UB4A 4C5GA 3PT9A 3X20B 2RA2A 2PVGB 3MEAA 2MF2A 1OZ2A 2JTFA 3OW2S 3MEWA 3EFSA 3QIIA 5IN1A 1I81A 3HL8A 4RCBA 2CGHA 2PQWA 3M59A 2DPPB 4C92E 2I2LA 3TU4K 4NOYA 1WJRA 3DKMA 1WPYA 2PU9B 3RUXA 1FX7A 5HK3A 3JCMX 3JCMJ 3JB9J 2X4XA 2LTOA 3QJ6A 3VU3C 4XTYA 3MO8A 3CCMT 2MWPA 4C92C 2EKOA 4IUVA 5GAOl 1BI1A 2DTHA 1FWZA 3L2QA 2OTJA 1HK9A 5J39A 4C92D 3C12A 3QUIA 1K9MC 5A0DA 3C95A 3N5BB 2EJGA 1VQNT 2PUKB 3OBWA 4MZTA 3JCMd 4JS5A 1WGSA 1X6OA 4M78B 3KUFA 4C8QC 3CPWS 3UT1A 4QQDA 2DTIA 2VV5A 4M75A 2Y90A 3G6EA 4M7AC 2OAUA 4M78E 1VQ5T 4OGEA 2EQKA 2KQWA 5CKDA 3OA6A 5M9OA 2R58A 4RCCA 1VQ4A 2CZ7B 2QXFA 1IREB 4M77E 4BDYA 2YLCA 4X9DA 2CZ1B 2LQKA 2JN0A 3CCJT 1M9SA 2E64A 5GANj 4HA8A 4KBMB 1M1GA 3C94A 3JAME 2FVUA 4IUTA 2E6ZA 1M1FA 3HRUA 3LLRA 3CCQA 2DD5A 3EFRA 1OYXA 2M1HA 3BDUA 5EG2A 2DZ9A 2B8AA 2DKGA 4D6WA 4PJOD 3RKXA 2HD0A 1K8AC 3OB9A 3E1SA 2RJFA 2K4YA 4LDYA 5C6SA 5D6YA 3S3OA 2WSEE 3RMQA 3LWHA 2RO0A 3JRZA 3CCUT 3G71T 2KVQG 2H3JA 2QQBA 1K73U 1N6AA 1P92A 4PL6A 4QQ6A 4UC4A 2O4XA 2V8IA 4PLIA 3SWNC 5GAOp 4E7IA 4M7AG 4M7DC 5GAMj 2D9TA 4C8QG 2BKDN 4PJOB 5AYFA 2MMPA 5J3BA 1KHCA 4C0DB 3OS5A 5A0GA 2C06A 1YCYA 3SFMA 3CC7T 2YLBA 2M16A 3LW5E 4F7UF 1PSFA 4N4IA 4XTZA 5GAMh 3V8KA 4EMKA 1LOJA 4E7LA 2VUBA 3QSUA 2GQVA 1VQ4T 3JB9F 4BD3A 2EQMA 4MMKA 3M4GA 3P8DA 3QHSA 4M78G 4XU0A 1VQ5A 2DIGA 1JJ2S 5GAN2 3G6ET 4BACA 4C5HA 3JB9H 4M77B 5FU7B 1LJOA 1M1KU 1MHNA 1N9SA 2EJFA 4PJOF 1Q82C 1KG1A 1G3YA 1UGQB 2R5AA 2K3YA 2VC8A 3ER0A 3ZBDA 3JCMc 3LYIA 5J26A 3CCRA 3FDRA 3M58A 5FU6C 5GANd 2IG0A 5GMKj 2KAFA 1BKBA 5KH6A 2VGNA 2D0QB 3X28B 3S3MA 3O8VA 3M54A 4F7UG 3VKIA 3HKSA 3MP1A 1VQOT 3CD6T 2DK3A 2XI9A 4XU1A 5CKFA 3CCMA 3A8MB 3JCMb 3TEEA 4FT2A 3MEUA 2EIFA 4IUQA 4DOWA 5GAN7 3H6ZA 3M4YA 5GMKm 2LVMA 4GY5A 3G7ZA 2QQ9A 3CCLA 3A5ZB 3CMET 4JRPA 4JLGA 4PLLA 1KQ1A 3LWIA 4PJOE 5CR2A 2RH2A 5GANg 3VJPA 3VUBA 4EDUA 4EPCA 3UPUA 4ZTFA 4M7AB 1M1KC 4N4GA 2QQRA 2CS7A 3QG1A 1AHJB 4A53A 5GMKh 1DJ7B 3I55T 4C5EA 3RERA 1Y07A 2G3RA 3CXCS 2DAQA 2EQJA 1G5VA 3L2VA 3HFNA 2LDMA 4GLKA 3V7CA 2JVVA 4F7UE 4A4GA 2LNVA 4CI0C 5L8RE 3JCMg 2K57A 4M77G 3ZFJA 3CPWA 1YIJT 1K73C 1WJSA 3M5AA 1FXXA 3KBGA 2QDYB 2ZPHB 2P4TA 4M7AF 4XU3A 5KE2A 2QA4T 3OYMA 5FRMA 2IVWA 5LL6S 5CKBA 2DJZA 2FYKA 3QYHB 1UGSB 3A8LB 5GAMf 5GAOr 3RESA 2RI5A 3C4SA 5GMKl 1YJWA 4R56A 2GFUA 1QVGA 3V8LA 4JRKA 1Q81U 1UEBA 5IAYA 1WJQA 3DB3A 3OYHA 1N9RA 3AHUA 4M75E 4ZTJA 2LX9A 4KULA 3A8HB 3E9FA 5GAMg 4L6V5 4OMFB 3I55A 3BDLA 1YITA 3OYLA 2AHJB 1Y7XA 2QQAA 4RG8A 3I56A 2QTXA 2CZ6B 3OYEA 2O4XB 2P0KA 2YRVA 2WSCE 1YJ9A 2X4WA 4IUPA 3NTKA 3ME9A 1XOVA 4OB0B 4FT4A 3CMEA 4C8QD 3MP6A 3FB9A 3CCLT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M78 F;  3RIR A;  4M7D B;  2E65 A;  1BIA A;  3SWN C;  5GAO p;  2YHT A;  1KQ2 A;  1WQW A;  4M7A G;  4M7D C;  5GAM j;  1M8V A;  5LJ5 g;  4C8Q G;  4EMK B;  4JRI A;  4PJO B;  3BFM A;  4J6X A;  4M75 G;  4M7D F;  1D3B A;  1X01 A;  3V7S A;  4C92 A;  1YCY A;  4X9C A;  2E41 A;  4J5Y A;  2YLB A;  4F7U F;  5GAN 6;  5GAM e;  2VXF A;  4NL3 A;  3JCM P;  4XTZ A;  5GAM h;  5LJ3 j;  3L1A A;  1JBM A;  3V8K A;  4C8Q F;  4EMK A;  5GAN h;  1LOJ A;  5LJ5 e;  1WNL A;  4JLI A;  4DQ2 A;  2E1H A;  2DTO A;  4EMH A;  4XU2 A;  3QSU A;  3JB9 F;  2DZC A;  2DEQ A;  2DXT A;  4MMK A;  5GMK e;  3M4G A;  4XU0 A;  3QHS A;  4M78 G;  2DVE A;  4M7D D;  3BY7 A;  3FIF A;  5GAN 2;  3JB9 H;  4M77 B;  4M77 D;  5GAM d;  1LJO A;  2RM4 A;  1B34 B;  1N9S A;  2EJF A;  1TH7 A;  4PJO F;  4M78 D;  4JUV A;  2VC8 A;  3QO3 A;  4NL2 A;  5LJ5 f;  3JCM c;  1I8F A;  3JB9 G;  3HSB A;  4EMG A;  4PJO C;  5LJ3 g;  1JRI A;  4EMK C;  4QVD A;  4XTX A;  5GAN d;  3L2Z A;  5GMK i;  1I5L A;  4M77 A;  2DXU A;  5GMK j;  3SWN B;  4Y91 A;  1B34 A;  5LJ3 d;  4N0A A;  1U1T A;  3PGG A;  4F7U G;  4QVC A;  5GAN 3;  4M7D G;  4J6Y A;  1Y96 B;  4XU1 A;  2ZGW A;  3FJP A;  3JCM b;  2HNI A;  3RKY A;  5GAN 7;  5LJ3 f;  4XTU A;  1U1S A;  4C8Q E;  5GMK m;  5GAO m;  4PJO A;  3RKW A;  4C92 G;  5I21 A;  4M78 C;  3SB2 A;  3V7R A;  1WQ7 A;  4C8Q B;  2VXE A;  1LNX A;  4M75 B;  3JCM W;  1KQ1 A;  2E10 A;  2RA2 A;  3HFO A;  4PJO E;  5GAN f;  5GAN g;  3GIB A;  3JB9 I;  3EFS A;  4M77 C;  4M7A B;  2FB7 A;  1HXD A;  1I4K 1;  1I81 A;  4C92 E;  4RCB A;  2CGH A;  5GAO n;  2I2L A;  4M77 F;  4NOY A;  3JCM V;  4A53 A;  5GMK h;  1WPY A;  3RUX A;  3RER A;  5LJ5 d;  4C92 B;  3JCM X;  3V8J A;  5GAO q;  3JCM J;  3JB9 J;  2RB6 A;  3VU3 C;  4XTY A;  5LJ5 h;  3HFN A;  4C92 C;  3JB9 D;  5GAO l;  4M7A A;  3V7C A;  4M7D E;  1D3B B;  2DTH A;  4XTV A;  4F7U E;  5GAN 4;  1HK9 A;  1Y96 A;  4C92 D;  4M78 A;  3JCM f;  3QUI A;  3INZ A;  4N0A C;  3JCM g;  2K57 A;  4J6W A;  2EAY A;  4M77 G;  4PNO A;  3SWN A;  1BIB A;  4M75 F;  4OP0 A;  4F7U B;  5GAN 5;  4HT9 A;  2EJG A;  5GAN 8;  4M7D A;  3JCM d;  4M75 C;  4M7A F;  4HT8 A;  4C8Q A;  4M78 B;  4XU3 A;  4C8Q C;  5LJ3 h;  5CAI A;  2DTI A;  4M75 A;  2Y90 A;  4MML A;  3JCM h;  4M7A C;  2DJZ A;  4M78 E;  3BW1 A;  2FYK A;  5GAN e;  4RCC A;  5GAM f;  5GAO r;  3RES A;  5DY9 A;  2EJ9 A;  4XTW A;  4M77 E;  5GMK l;  1H64 1;  2YLC A;  4V2S A;  4X9D A;  3V8L A;  2JN0 A;  4JRK A;  2E64 A;  4WF2 A;  5GAN j;  4HA8 A;  3AHU A;  1N9R A;  4M75 E;  5GAM g;  5LJ5 j;  3EFR A;  4PJO D;  3BDU A;  2DZ9 A;  2DKG A;  5LJ3 e;  2EWN A;  3RKX A;  3JCM e;  4A54 A;  4M7A E;  4M7A D;  2QTX A;  2RD1 A;  1M5Q 1;  3JCM Q;  4XQ3 A;  4PJO G;  4M75 D;  4F7U A;  1MGQ A;  4C8Q D;  3FB9 A;  4C92 F; 
#chains in the Genus database with same CATH topology
 5FU7 C;  1KHI A;  1WXT A;  3O5Z A;  1BBZ A;  2E3I A;  2L8D A;  4J6X A;  4KH0 B;  1JU5 C;  3CME Q;  2QGF B;  1RAG B;  1Y71 A;  2XIC A;  3OS2 A;  1JBM A;  2NYS A;  3M57 A;  4J8O A;  2EQI A;  3BY7 A;  3FIF A;  2HCK A;  1D09 B;  2DYI A;  4M77 D;  1RAF B;  3OYY A;  5FWB A;  2HSP A;  1YJN T;  2LRQ A;  2KY9 A;  2CUD A;  4EMK C;  3FEO A;  3S3N A;  3HP9 A;  3CC7 A;  3OBY A;  1JQQ A;  1KD1 R;  3M53 A;  2A08 A;  3H0H A;  3VYH B;  2F2X A;  3SDZ A;  4Z88 A;  5CQY A;  2JUF A;  3OYK A;  3LGF A;  2CP0 A;  2FZC B;  1YBY A;  3GIB A;  3VV0 A;  1FYN A;  4C92 B;  5GAO q;  3CCQ T;  5I22 A;  2LCL A;  3ZL7 C;  3GLX A;  4RTX A;  2DX1 A;  4E6R A;  3H8Z A;  5GAN 8;  1B7T A;  3CCV T;  1M4Z A;  2HKQ B;  4BY6 C;  4J7I A;  1BI3 A;  1Q82 U;  1JXM A;  3JCM h;  4KUD K;  1YHQ T;  3GF5 A;  1RAE B;  1LCK A;  1VQN A;  2IPO B;  1ZX6 A;  4RMO A;  5DY9 A;  2HQX A;  2ZCF B;  3A8G B;  2QI2 A;  3CMA Q;  1IB8 A;  1VA7 A;  1VIF A;  1TTH B;  2P0Q A;  1XTD A;  4KGZ B;  5KYW B;  1GCQ C;  1M5Q 1;  1O75 A;  3I35 A;  3CBO A;  3CCJ Q;  3R6N A;  2QEX A;  4M78 F;  1S72 T;  4M7D B;  1K8A U;  1VUB A;  2QQS A;  1AD5 A;  1J3T A;  2DER A;  1D3B A;  2NUP A;  3V7S A;  3I9Q A;  1O9S A;  1X6G A;  5GAN 6;  5GAM e;  2JT4 A;  1WIE A;  3UAT A;  1NPR A;  5IT9 E;  3CMA T;  4EMH A;  3UDC A;  4BY6 B;  2DZC A;  3NGP A;  3OYN A;  3CBM A;  2R5M A;  1UTI A;  3OYB A;  2MI6 A;  4F16 A;  4N4H A;  2ZZD A;  1IHV A;  2CH4 A;  1OPL A;  2RM4 A;  2CP2 A;  4LD9 K;  1X75 C;  1NYG A;  1VQ8 Q;  1VQ7 T;  4FW1 A;  4ELY C;  5IH2 A;  4HVU A;  1I5L A;  3A98 A;  1G3W A;  5LJ3 d;  4B9X A;  3QXE B;  1ZSZ C;  3P8H A;  4PJL A;  2HBW A;  1ZHI A;  3TSW A;  5DM7 R;  3D7S B;  2RI3 A;  2LCS A;  5KCO A;  2D8H A;  3SB2 A;  3GP8 A;  1AOJ A;  2VXE A;  3JCM W;  2RF0 A;  1BU1 A;  4FYY B;  5GAN f;  1QVF S;  3JB9 I;  1I4K 1;  3CC2 T;  2L0A A;  3I56 Q;  5LJ5 d;  2NUP B;  1U8R A;  1YJ9 Q;  5LJ5 h;  4M7A A;  2XD0 A;  5GAN 4;  2L5Q A;  2J05 A;  4QW2 A;  1RLQ C;  2F69 A;  2QDL A;  1VQP T;  4PNO A;  4M75 F;  2VYT A;  4MZP A;  3OMG A;  4M7D A;  2VAS A;  4Q5W A;  2ZPF B;  2KYM A;  1Q82 R;  2LC4 A;  3SEM A;  2NUZ A;  4FYX B;  4X1V A;  2QGG A;  3CC4 A;  3LGL A;  3R6O A;  1G2B A;  1OOT A;  1WYX A;  1NJI R;  2JTM A;  3M55 A;  1K9M U;  2D0N A;  3WVE B;  1SEM A;  2RJC A;  2HAX A;  5EC7 A;  1CKA A;  2K2V A;  4PJO G;  4M75 D;  2EW3 A;  4CC3 A;  2PZ1 A;  2RHI A;  5FWC A;  4WCI A;  4FW2 A;  3E9G A;  1YIT T;  2XID A;  5LJ5 g;  3NTI A;  3CXC A;  4J9C A;  3T9N A;  3L2R A;  4A4H A;  1Q86 C;  4OML A;  4X9C A;  3JCM P;  2VXF A;  4AFU C;  2FPD A;  1VQK Q;  4C8Q F;  5GAN h;  4JLI A;  1ZA2 B;  4DA4 A;  3J81 E;  5KYX B;  1OI1 A;  3CXC P;  1VQ4 Q;  2RK1 A;  2QA4 A;  4E7H A;  1H8K A;  1W4S A;  3QO3 A;  1Z9Z A;  3HSB A;  4PJO C;  3A1P A;  1JRI A;  4J9G A;  5GMK i;  1JJ2 P;  3DLM A;  2PTK A;  4JS4 A;  5KE3 A;  1KQS S;  2E5K A;  3MKD A;  1IGU A;  4PJO A;  4FU6 A;  1RAI B;  2FRY A;  1QP2 A;  2BE7 D;  1ZSZ A;  1VYT A;  2PVG B;  3MEW A;  3EFS A;  1I81 A;  4C92 E;  4RCB A;  2YUQ A;  3RUX A;  2PU9 B;  4PFO A;  2K3B A;  4DEY A;  2JW4 A;  2MOX A;  3MO8 A;  3CCM T;  5GAO l;  1K1Z A;  2OTJ A;  2I0N A;  3UF4 A;  1BCO A;  2EJG A;  3JCM d;  4MZT A;  4JS5 A;  1X6O A;  1VQ9 Q;  3CPW S;  3UT1 A;  3VS1 A;  2DTI A;  4M7A C;  2OAU A;  1OUL A;  2EQK A;  2LMJ A;  3EHQ A;  3VS3 A;  5KYY A;  1PC0 A;  2CT3 A;  2JN0 A;  1CKB A;  1V76 A;  2QK0 A;  2EKH A;  3LLR A;  2CSI A;  2M1H A;  3BDU A;  2DKG A;  3OB9 A;  1WHM A;  2RO0 A;  3G71 T;  2V8I A;  2O9S A;  2KT1 A;  4C8Q G;  2BKD N;  4PJO B;  2MMP A;  5J3B A;  4C0D B;  2M16 A;  1K4U S;  3V8K A;  1X43 A;  2VUB A;  3REA B;  1UHF A;  3JB9 F;  4BD3 A;  2EQM A;  4MMK A;  2COW A;  4XU0 A;  1VQ5 A;  1SKU B;  1YWO A;  3HTR A;  2YT6 A;  1KG1 A;  1ZBJ A;  2VC8 A;  3ZBD A;  3LYI A;  5IHI A;  5J26 A;  3CCR A;  3FDR A;  2BZX A;  3QWX X;  2IG0 A;  4DBQ A;  3EG2 A;  1BKB A;  2H3E B;  4IIM A;  2D0Q B;  2F1L A;  5KH6 A;  3M54 A;  4F7U G;  1UFF A;  2CDT A;  3CD6 T;  1R77 A;  2DK3 A;  2XI9 A;  3TEE A;  1AWJ A;  1ZSZ B;  5GMK m;  2CH4 W;  2DYB A;  3A5Z B;  1AZG B;  5CR2 A;  1K0S A;  2RH2 A;  3VJP A;  3VUB A;  1M1K C;  4EPC A;  1QCN A;  1JEG A;  1AHJ B;  1Y07 A;  1ZLM A;  3CXC S;  2DAQ A;  1X2Q A;  2RNA A;  2KYB A;  5I11 A;  2K57 A;  1RLP C;  1FXX A;  2J06 A;  2QA4 T;  1VQM Q;  4PJM A;  2IVW A;  3PE0 A;  3QYH B;  4IIO A;  1UGS B;  5IHN A;  2GFU A;  3I5S A;  4AFZ C;  4ESR A;  1QVG A;  3CCL Q;  1UEB A;  2CUB A;  1WJQ A;  1N9R A;  1U3O A;  3E9F A;  3BDL A;  1YIT A;  1NEB A;  2CZ6 B;  1MV0 B;  1XOV A;  4OB0 B;  3MP6 A;  4RUG A;  1YCS B;  1WQW A;  1QWE A;  3OW2 A;  4LUE A;  4M75 G;  5FRO A;  4F14 A;  3MPU B;  3ZEH A;  2ROT A;  3CD6 A;  2EBP A;  5LJ3 j;  4LNP A;  3OY9 A;  3LX7 A;  3CCR T;  2DXT A;  1VQP Q;  4O5V A;  5GAM d;  2A37 A;  1M90 C;  3OS1 A;  1RAA B;  2DEU A;  3I55 Q;  1V29 B;  3CC2 Q;  2ZPI B;  2BZY A;  2KGT A;  4MZM A;  1MND A;  5FW9 A;  4J6Y A;  3FJP A;  3F70 A;  4DBF A;  4C8Q E;  3PNW C;  5GAO m;  4JJD A;  1KD1 C;  3M0S A;  4C8Q B;  3KXT A;  2BTT A;  4OMP A;  5HY6 A;  3ASK A;  3DLL A;  2DL4 A;  4TVR A;  1D1C A;  4BB7 A;  1HSQ A;  5KYU A;  2FB7 A;  3L2U A;  2JTE A;  3CEY A;  3GNF B;  1VQ8 T;  3QBY A;  2CSQ A;  2X35 A;  4XTV A;  3LH0 A;  1FMV A;  1IO6 A;  1WXB A;  4J83 A;  4OMQ A;  4AT1 B;  2DL8 A;  5CK9 A;  1M90 U;  2EAY A;  2K5L A;  2K3X A;  2JNG A;  1VQO Q;  7AT1 B;  4BI8 B;  5ECA A;  2LT4 A;  3X25 B;  5CAI A;  3QZ5 B;  1M1K R;  4LDX A;  3CCE T;  4BE1 A;  1MMA A;  2EFI A;  2EVR A;  2K79 A;  5GAN e;  4JJN K;  3UA6 A;  3VS7 A;  4XTW A;  5HKC A;  2VB6 A;  2OTJ T;  4RKU E;  2MWO A;  1QW1 A;  4KRT A;  4ATO A;  3QKJ A;  5LJ3 e;  2EWN A;  4M7A D;  2QEX T;  2RD1 A;  3TQ7 P;  1XQH A;  2GF7 A;  2RHY A;  3OYC A;  1TUC A;  3EFO A;  2DE0 X;  1KD1 U;  5KYN A;  1BIA A;  2WSF E;  3EGD A;  1KQ2 A;  1JB0 E;  1KC8 C;  1W6X A;  3BFM A;  4Y28 E;  4NL3 A;  4XK8 E;  3GBQ A;  2FZG B;  2K6D A;  3OYA A;  5LJ5 e;  2X4Y A;  5I2S A;  2E1H A;  3CBP A;  3OYD A;  1SSH A;  4FSS A;  1TXQ A;  2DD4 A;  2OTL A;  2DVE A;  1YHQ A;  2DM1 A;  1WHH A;  3CCR Q;  4E7K A;  1WHG A;  2NLU A;  4J9E A;  4ELZ C;  5LJ5 f;  2XDP A;  1KFZ A;  1RL2 A;  1NJI C;  2HL5 C;  3FLG A;  2GTO A;  1B34 A;  1U1T A;  2MAM A;  2V8J A;  1W2B S;  4ZNX A;  2JMC A;  4XTU A;  3X24 B;  2DA9 A;  1T0H A;  3PVQ A;  2D1X A;  1IXD A;  2O2O A;  2XKO C;  1G3S A;  4RTW A;  1TOV A;  2QYZ A;  4M75 B;  3OS0 A;  3HFO A;  2CYZ B;  1QQJ A;  1PD0 A;  4BI3 A;  3VRZ A;  2ZPB B;  3A8O B;  5GAO n;  3JCM V;  1KJW A;  2ESW A;  1GBR A;  4LD6 A;  4ORZ A;  4RTT A;  5KCH A;  5DLQ E;  3CCS T;  3JB9 D;  1X27 A;  1Y96 A;  3CC4 T;  2D8J A;  3PIP A;  2R57 A;  5C0M A;  1YJW Q;  2CKK A;  1TU0 B;  3M9Q A;  1YJN A;  4NS5 A;  1H92 A;  5CKE A;  2PUO B;  5LJ3 h;  4R55 A;  2E12 A;  2DL3 A;  1Y57 A;  3G4S Q;  2HQE A;  2EJ9 A;  3HHT B;  5A2Q E;  1WXU A;  1D1B A;  1YFN A;  4E7Z A;  4M4Z A;  4LN2 A;  1G8X A;  2IIM A;  1E6H A;  5GJW B;  2KK4 A;  3L2W A;  3DB4 A;  4M7A E;  2A28 A;  2FPF A;  4MDW A;  3EGD B;  3OYJ A;  4JPB W;  4XQ3 A;  1QVG S;  2QAZ A;  1RI0 A;  1UHC A;  4J9H A;  2E70 A;  4C92 F;  2J6K A;  4OF1 A;  2YHT A;  2FO0 A;  4HKE A;  1K8A R;  3URG A;  4C92 A;  1QVF A;  2C0T A;  1NE8 A;  1VQ6 T;  1VQ9 A;  1YJW T;  2O9V A;  4R0K A;  2JS0 A;  2L3P A;  1TSF A;  1EIF A;  3CC4 Q;  3PIO A;  3IQL A;  1B34 B;  2M0O A;  3CCS Q;  4M78 D;  1LPL A;  4DBR A;  4EMG A;  2KXD A;  3CMA A;  4M77 A;  1YIJ A;  4Y91 A;  3P8B B;  3PGG A;  4HCZ A;  4ZN1 A;  1M8M A;  1QP3 A;  3RKY A;  5LJ3 f;  3I5R A;  4A63 B;  3MCA B;  8ATC B;  1RI9 A;  2XU8 A;  2VGM A;  5D7U A;  1UB4 A;  3PT9 A;  3MEA A;  1KIK A;  1OZ2 A;  1Q81 R;  3OW2 S;  2RQW A;  3QII A;  2ENM A;  2DPP B;  2LP5 A;  2HL3 A;  4NOY A;  1WPY A;  5HK3 A;  3JCM J;  2LTO A;  2EKO A;  2KRN A;  1BI1 A;  3L2Q A;  1FWZ A;  4C92 D;  3QUI A;  4AFS C;  2GNC A;  1OPK A;  2AT1 B;  1VQN T;  1NYF A;  2RMO A;  2VV5 A;  4M78 E;  5CKD A;  2QG9 B;  1VQ4 A;  2QXF A;  2B86 A;  2YLC A;  1TUD A;  1D1A A;  5GAN j;  4HA8 A;  3RR6 A;  3C94 A;  9ATC B;  3JAM E;  2E6Z A;  1M27 C;  3CCQ A;  3EG1 A;  1PKT A;  1OYX A;  1YN8 A;  5AT1 B;  3E1S A;  4B6M A;  5C6S A;  5D6Y A;  3RMQ A;  3CCU T;  2EYY A;  2H3J A;  2LZ6 B;  1AWO A;  2JM9 A;  4PL6 A;  4LE9 A;  4QQ6 A;  2O4X A;  1I1J A;  2VKN A;  1F1B B;  3CCE Q;  1KHC A;  3OS5 A;  2C06 A;  3SFM A;  4F7U F;  3LW5 E;  4N4I A;  4XTZ A;  3H0I A;  5GAM h;  3KFV A;  3QSU A;  2GQV A;  1VQ4 T;  3QHS A;  4BAC A;  4C5H A;  4M77 B;  4EIK A;  4PJO F;  1SHG A;  3JCM c;  2BZ8 A;  5FU6 C;  5GAN d;  5GMK j;  2VGN A;  2JS2 A;  3MP1 A;  1VQO T;  4XU1 A;  1EFN A;  3MEU A;  3H9N A;  5GAN 7;  3H6Z A;  3M0P A;  2LVM A;  1QVF P;  1U5S A;  1PCX A;  3CCL A;  2MK5 A;  3EG9 B;  3RNJ A;  1A0N B;  1YWP A;  5GAN g;  3UPU A;  4OMN A;  4N4G A;  2QQR A;  3QG1 A;  4A53 A;  2LJ1 A;  1DJ7 B;  3I55 T;  3E2U A;  2G3R A;  3EGU A;  2EQJ A;  1G5V A;  1B07 A;  1SPK A;  4GLK A;  4JJC A;  1C1A A;  5L8R E;  3CPW A;  4HXJ A;  1YIJ T;  1WJS A;  2DJQ A;  1MV3 A;  3KBG A;  4M7A F;  5CKB A;  2DJZ A;  2DMO A;  4Y92 A;  5GAM f;  1Q81 U;  1OQK A;  2HZY A;  3M0T A;  1SRM A;  3OYH A;  3AHU A;  4Z8A A;  1ACM B;  4M75 E;  2LX9 A;  4L6V 5;  4RTZ A;  5HCK A;  2QQA A;  1YIJ Q;  4RG8 A;  3I56 A;  2QTX A;  3OYE A;  2O4X B;  2P0K A;  2YRV A;  4PFZ A;  4FT4 A;  3CCL T;  3E19 A;  4OMM A;  4FYV B;  5D6W A;  1VYV A;  1VQO A;  2DXB A;  1RAB B;  2JZ2 A;  4C5I A;  5A0L A;  5CKH A;  2W10 A;  5L23 A;  1M3A A;  2DO3 A;  3OYI A;  1GRI A;  3WXM B;  2PNI A;  2E5Q A;  1TH7 A;  4JUV A;  3EHR A;  1KQS P;  4C0F A;  1I8F A;  4ZGD B;  2Y4Y A;  1AVZ C;  1NEG A;  1NPP A;  3OYG A;  4QVC A;  1U06 A;  2ZGW A;  1S72 Q;  1U1S A;  2P0P A;  4C92 G;  3SD4 A;  4M78 C;  2KE9 A;  1Q95 G;  1W2B A;  1QMC A;  2PVO B;  2RHZ A;  3CCU A;  2DIQ A;  2E10 A;  4J9B A;  3GNG A;  1VQK A;  2YUN A;  4M77 F;  2XK0 A;  4Z89 A;  3V8J A;  3Q1J A;  1GCP A;  4C0D C;  1PKS A;  4A4F A;  4M78 A;  4BI4 A;  3INZ A;  2V1Q A;  4OP0 A;  1PSE A;  8AT1 B;  3CD6 Q;  1NZ9 A;  2CZ0 B;  3JSC A;  2FPE A;  2RK2 A;  3EGX B;  3RMS A;  1K0X A;  2OTL T;  3BW1 A;  2RJE A;  4KUI A;  5CO7 A;  2O01 E;  3TCJ A;  1WZO A;  5HK0 A;  2L3S A;  2OAW A;  1YI2 Q;  2J6F A;  3CCV Q;  5LJ5 j;  1ZUK A;  3JCM e;  1I07 A;  2ZPE B;  4XAX B;  3JCM Q;  3VRY A;  2L89 A;  1Q7Y C;  1KC8 R;  2O88 A;  2M0Y A;  4LDV A;  2E6N A;  2XDB A;  4IKF A;  4Z02 A;  4OVA A;  2RPN A;  4OB3 B;  3EH1 A;  1X6B A;  3HRT A;  2EYQ A;  1OU9 A;  4JDS A;  2DNU A;  1YI2 T;  4DQ2 A;  1SG5 A;  1VQM A;  2W0Z A;  3CCE A;  5GMK e;  2KSS A;  3S6W A;  1M30 A;  1YP5 A;  5CVI A;  4E47 A;  1Q7Y R;  2FZK B;  4E2F B;  4QVD A;  4JRQ A;  3OMC A;  4E7S A;  1VQ9 T;  1VQ6 A;  1OZ3 A;  4N0A A;  5GAN 3;  4VUB A;  2DRM A;  4KH1 B;  3QWY A;  2AZV A;  2F5T X;  1VQ8 A;  1OX9 A;  3OW2 P;  2KNB B;  1SHF A;  2FRW A;  5CQX A;  5I21 A;  3CCM Q;  2KMT A;  4K11 A;  2C0O A;  3FJ5 A;  2YWW A;  5IXF A;  3QDF A;  1H3Z A;  2KXC A;  1XNI A;  2A0F B;  2KRM A;  3PMT A;  4FCY A;  1LVK A;  4E7J A;  1UGR B;  1ZQ1 A;  2BUD A;  3SWN A;  3TU4 K;  4X34 A;  1NLP C;  5I2M A;  4BE0 A;  4OGC A;  2COZ A;  3MP8 A;  1Q7Y U;  3NPF A;  4A4K A;  2EGC A;  3UWN A;  3M0R A;  1HD3 A;  1H64 1;  4P5N A;  3G4S A;  3CCS A;  1FMW A;  3TRE A;  1ZBX A;  2ZPG B;  3U23 A;  4J9F A;  1QWF A;  1VQL T;  2E3H A;  4ZN3 A;  4FIB A;  3X26 B;  4YTL A;  1W2B P;  2X4J A;  1RAD B;  1UGV A;  3RIR A;  2HDA A;  3LH5 A;  2E65 A;  1K76 A;  2Z0W A;  3PVL A;  2HBP A;  2NWM A;  2ZAE A;  4CC2 A;  4M7D F;  3CPW P;  1PWT A;  3J7A F;  2ROL A;  1X01 A;  5IHK A;  5KYX A;  3VS2 A;  3EG3 A;  1ZSG A;  1UUE A;  1WNL A;  4OB2 B;  1GFC A;  1BI0 A;  1ABQ A;  4ME7 A;  2M9U A;  3TVT A;  2WAC A;  1M3C A;  2F2V A;  3JB9 G;  4J7F A;  2OX7 A;  3VUZ A;  3M56 A;  4ZGJ B;  3GPL A;  3FRN A;  1IRX A;  3G6E Q;  1BB9 A;  4FM4 B;  2G6F X;  3C0C A;  3EH2 A;  3CPF A;  1UJY A;  1WQ7 A;  4FYW B;  4C5G A;  2RN8 A;  3X20 B;  2RA2 A;  1AZE A;  1QKX A;  3HL8 A;  3M59 A;  1TS9 A;  1X69 A;  2HMA A;  1ZA1 B;  4J9D A;  3JCM X;  3JB9 J;  2X4X A;  3VU3 C;  4XTY A;  2KEA A;  1K9A A;  1NG2 A;  1V1C A;  1HK9 A;  2F2W A;  4DBH A;  3C12 A;  2QEX Q;  1K9M C;  5A0D A;  3C95 A;  3N5B B;  1W70 A;  1UE9 A;  2PUK B;  5KYY B;  3VS6 A;  4GBQ A;  1WGS A;  4M78 B;  4C8Q C;  4QQD A;  4M75 A;  2Y90 A;  2X51 A;  1OEB A;  1VQ5 T;  4KGV B;  2KQW A;  4OGE A;  3OA6 A;  4RCC A;  3REB B;  2CP7 A;  2CZ7 B;  1IRE B;  4M77 E;  4BDY A;  2A36 A;  4X9D A;  2CZ1 B;  2LNH B;  2LQK A;  3CCJ T;  2E64 A;  4KBM B;  1M1G A;  2CRE A;  1D0X A;  1QVG P;  2FVU A;  4IUT A;  4F17 A;  2DD5 A;  2OI3 A;  4PJO D;  5EG2 A;  2B8A A;  2HSE B;  2HD0 A;  1K8A C;  2RJF A;  2K7A A;  2K4Y A;  2YDL A;  3LWH A;  2AZS A;  2KVQ G;  2QQB A;  4UC4 A;  2LJ3 A;  3SWN C;  5GAO p;  1NBE B;  3NHN A;  1GL5 A;  5GAM j;  2EYX A;  6AT1 B;  5A0G A;  2OJ2 A;  2YLB A;  1PSF A;  2DVJ A;  1TUG B;  2QTV A;  1LOJ A;  1C0M A;  1MMN A;  4E7L A;  1EZZ B;  4WTO B;  3M4G A;  3P8D A;  1PRM C;  4M78 G;  2DIG A;  1JJ2 S;  5GAN 2;  5FU7 B;  3CQT A;  1LJO A;  3EGX A;  1N9S A;  1ZUU A;  4D8K A;  1Q82 C;  2DBK A;  2R5A A;  2K3Y A;  3ER0 A;  3CCQ Q;  4DEX A;  4HVV A;  1QCO A;  5IXB A;  2ATC B;  2KAF A;  2YXY A;  3O8V A;  5CKF A;  1UJ0 A;  3CCM A;  3A8M B;  4IUQ A;  4DOW A;  3M4Y A;  4GY5 A;  2QQ9 A;  3LWI A;  4PJO E;  2RQV A;  4EDU A;  4ZTF A;  2ED1 A;  2CS7 A;  1I0C A;  2HKN A;  2P4R A;  3NMZ C;  3RER A;  1H3H A;  2KRO A;  2LDM A;  3V7C A;  1SF9 A;  2JVV A;  4F7U E;  2LNV A;  3JCM g;  1EX4 A;  4OMO A;  1WDX A;  1K73 C;  1CSK A;  1MMD A;  2EYZ A;  3A8L B;  2H8H A;  2RI5 A;  3H0F A;  4R56 A;  3V8L A;  4RTV A;  2ECZ A;  3DB3 A;  1YNZ A;  2KI7 A;  2ABL A;  4ZTJ A;  4KUL A;  2RQR A;  5GAM g;  4OMF B;  2J7I A;  3OYL A;  1MUZ A;  4IUP A;  3NTK A;  2E4H A;  1PHT A;  2FG0 A;  3FB9 A;  2ED0 A;  1BI2 A;  1UGP B;  4C0Z A;  2AKK A;  2GGR A;  4BUG A;  4JRI A;  5DLO A;  4QVZ A;  3ULR B;  2E41 A;  2EQU A;  3QPH A;  1ABO A;  1M8V A;  2DTO A;  3OSV A;  4RTU A;  2L3Q A;  2V1R A;  3OSS C;  1SSF A;  2J6O A;  2LCC A;  2DLP A;  4NL2 A;  4BE2 A;  4D8D A;  2DXU A;  3L42 A;  4O6J A;  4QT7 A;  4A4E A;  4HVW A;  1N8R R;  2XDD A;  1KC8 U;  3CCU Q;  1GXI E;  3FC3 A;  1T3L A;  1HJD A;  3G71 A;  1NLO C;  4C0G A;  2RI2 A;  5CIU A;  1D0Y A;  1BYM A;  1Q86 R;  1KSW A;  1K9M R;  1M2O A;  3PTA A;  1AWX A;  3QYG B;  2AIR B;  4M7D E;  4PK4 A;  3OYF A;  2LX7 A;  3WVD B;  3CCJ A;  4MDX A;  4N0A C;  5CCA A;  1PRL C;  1BIB A;  5GAN 5;  4HT9 A;  1RUW A;  1XJW B;  4HCB A;  4M75 C;  4HT8 A;  4C8Q A;  1N27 A;  2V8K A;  4FSX A;  4MML A;  2RHX A;  3CC7 Q;  2A3L A;  2DRK A;  1TG0 A;  2AK5 A;  3HPW A;  3EAE A;  3OQ5 A;  1KK7 A;  4V2S A;  3J80 E;  1VIE A;  3NFC A;  4FL6 A;  4WF2 A;  2Y4X A;  2LT1 A;  2JJ9 A;  1WX6 A;  1IGQ A;  3MJX A;  2CT4 A;  3GOX A;  1PG5 B;  4JZ3 A;  1OV3 A;  1T0J A;  2DXC A;  1S72 A;  1UG1 A;  4QQG A;  2YUO A;  2EGA A;  1PD1 A;  2LJ0 A;  4B9W A;  4F7U A;  1MGQ A;  2M51 A;  1VOM A;  1M2V A;  4EMK B;  1I5O B;  2X3X D;  2OTL Q;  1MNE A;  2PVD B;  2DF6 A;  3VS4 A;  2K5I A;  1OU8 A;  2RQU A;  2NUT A;  3MEV A;  1SRL A;  1JO8 A;  2YUP A;  4LDU A;  4M7D D;  1OX8 A;  2P84 A;  2JXB A;  2JOY A;  1KQS A;  1W1F A;  3CCV A;  1ARK A;  4ANJ A;  5LJ3 g;  4PJN A;  3SWN B;  3BE3 A;  4AMC A;  1Y96 B;  4ZGE B;  1Z9Q A;  2CP5 A;  1NJI U;  2L3R A;  4DOV A;  1QLY A;  5FLX E;  4CC7 A;  1VQK T;  2K5F A;  1LNX A;  2XG8 D;  1NM7 A;  1UDL A;  2A7Y A;  1VQL A;  3SHW A;  3QDR B;  4M77 C;  4HCK A;  1HXD A;  1BK2 A;  1IZ6 A;  1WHL A;  1Q86 U;  2RB6 A;  1WHJ A;  3G4S T;  4OB1 B;  1D3B B;  2L2P A;  2NUT B;  3JCM f;  1JJ2 A;  2COY A;  2MPX C;  4J6W A;  4F7U B;  4IUR A;  1B3Q A;  3QZ9 B;  3PFS A;  2XMF A;  1N8R U;  2GQI A;  1Y0M A;  1GCQ A;  4JJB A;  1AT1 B;  2RJD A;  5FU6 B;  4II1 A;  1VQP A;  1TWB A;  2C0I A;  2KBT A;  2GCX A;  2XHC A;  4CRI A;  2D6F A;  3QJY A;  5D6X A;  4J9I A;  4A54 A;  3CC2 A;  1Q81 C;  2RQT A;  1M3B A;  1QVP A;  3HRS A;  4PKC C;  1G3T A;  1YJ9 T;  2RHU A;  4PJJ A;  3I56 T;  1QKW A;  5FRN A;  2K2M A;  3MET A;  1RAH B;  2MIO A;  3VYG A;  2DIL A;  2SEM A;  4IUU A;  3VS0 A;  2V26 A;  2BIV A;  4J5Y A;  4LDW A;  3L1A A;  4AFQ C;  1PNJ A;  2KR3 A;  1JXO A;  4L5G A;  3PMI A;  4XU2 A;  4L59 A;  2DEQ A;  1VQ7 A;  4RG2 A;  2DL7 A;  2FL7 A;  2DL5 A;  1N8R C;  2GFA A;  3NTH A;  2FHD A;  1VQM T;  1T3S A;  4XTX A;  1VQ7 Q;  3L2Z A;  2QA4 Q;  1YI2 A;  2VVK A;  4KT0 E;  3EFO B;  4BDZ A;  2F5K A;  3THK A;  2HNI A;  2LQ8 A;  1HYO A;  1R8O B;  5KYW A;  3RKW A;  2KDS A;  4HCC A;  4F04 B;  3V7R A;  3MHX A;  2JM8 A;  1E7O A;  2MF2 A;  2JTF A;  5IN1 A;  3VS5 A;  4PFP A;  2CGH A;  2PQW A;  2I2L A;  2OTJ Q;  1WJR A;  1G83 A;  3DKM A;  1IHW A;  2GTJ A;  1FX7 A;  4JZ4 A;  3QJ6 A;  1WFW A;  2EGE A;  1BCM A;  2MWP A;  2X3W D;  4IUV A;  4C92 C;  2DTH A;  2SRC A;  5J39 A;  1GFD A;  3OBW A;  3KUF A;  2DET A;  3G6E A;  1R0C B;  1K73 R;  1D0Z A;  5M9O A;  2R58 A;  1VQ5 Q;  1YHQ Q;  2DFU A;  1M9S A;  1VYU A;  3JV3 A;  1X2K A;  3HRU A;  1M1F A;  2CP3 A;  3H41 A;  3EFR A;  2KT8 A;  4D6W A;  2X9H A;  2DZ9 A;  1AEY A;  3RKX A;  2MYS A;  4LDY A;  1WLP B;  3S3O A;  2WSE E;  3JRZ A;  1RAC B;  1K73 U;  1N6A A;  1P92 A;  4E7I A;  4PLI A;  3G71 Q;  4M7A G;  4M7D C;  2YSQ A;  2D9T A;  3EG0 A;  4KGX B;  5AYF A;  1ZUY A;  2BE9 B;  3CC7 T;  1YCY A;  1GBQ A;  3RBB B;  2MCN A;  2VWF A;  1M2V B;  4EMK A;  1VQN Q;  2HEQ A;  2M02 A;  3M0Q A;  1E6G A;  1QCF A;  2LQW A;  3G6E T;  3JB9 H;  4LUD A;  1M1K U;  1MHN A;  2EJF A;  1G3Y A;  1R0B G;  1UGQ B;  3TSZ A;  2KRS A;  3M58 A;  2K9G A;  1WI7 A;  1C6V X;  1YJN Q;  2CP6 A;  4LXC A;  3X28 B;  3S3M A;  3VKI A;  3HKS A;  4M7D G;  4QKU A;  2DBM A;  3JCM b;  3G1J A;  4FT2 A;  2EIF A;  4RTY A;  5KYU B;  3G7Z A;  4AG2 C;  1N5Z A;  3CME T;  4JRP A;  2YRC A;  4JLG A;  1KQ1 A;  4PLL A;  1S1N A;  4M7A B;  2O31 A;  1FMK A;  2FEI A;  5GMK h;  3M0U A;  2EPD A;  2AKL A;  3EG9 A;  4C5E A;  3L2V A;  2HQH A;  3HFN A;  3RDV A;  1VQL Q;  4A4G A;  4CI0 C;  3AT1 B;  3ZFJ A;  4M77 G;  3M5A A;  4AG1 C;  2YRD A;  2QDY B;  1VQ6 Q;  1MMG A;  2ZPH B;  5GJV B;  2P4T A;  4GLM A;  4XU3 A;  5KE2 A;  1UEC A;  3OYM A;  5FRM A;  5LL6 S;  2EYW A;  2FYK A;  2LQN A;  5GAO r;  3RES A;  3C4S A;  5GMK l;  1YJW A;  1PM3 A;  1WHK A;  2QAS A;  4JRK A;  1WA7 A;  5IAY A;  4CC4 B;  3A8H B;  3I55 A;  1AWW A;  2AHJ B;  1Y7X A;  3UA7 A;  2JMA A;  2WSC E;  1YJ9 A;  2X4W A;  1YIT Q;  3ME9 A;  3CME A;  1M90 R;  4C8Q D;  2GBQ A; 
#chains in the Genus database with same CATH homology
 3E19 A;  5FU7 C;  1BI2 A;  5D6W A;  1KHI A;  1UGP B;  1WQW A;  4C0Z A;  3OW2 A;  4BUG A;  4JRI A;  2L8D A;  4J6X A;  4M75 G;  5DLO A;  4QVZ A;  5FRO A;  3ZEH A;  2E41 A;  1VQO A;  2EQU A;  3CD6 A;  2DXB A;  3QPH A;  1Y71 A;  2XIC A;  2JZ2 A;  5LJ3 j;  3OS2 A;  1JBM A;  4C5I A;  1M8V A;  2DTO A;  3LX7 A;  3M57 A;  4J8O A;  5A0L A;  3OY9 A;  3CCR T;  5CKH A;  2DXT A;  2DO3 A;  3OYI A;  3OSV A;  3BY7 A;  3FIF A;  4O5V A;  3OSS C;  3WXM B;  4M77 D;  5GAM d;  2E5Q A;  1M90 C;  1SSF A;  1TH7 A;  2LCC A;  3OYY A;  4NL2 A;  4JUV A;  4BE2 A;  1YJN T;  3OS1 A;  4C0F A;  1I8F A;  2LRQ A;  2KY9 A;  4ZGD B;  4EMK C;  1V29 B;  3FEO A;  2Y4Y A;  2DXU A;  2ZPI B;  3L42 A;  4MZM A;  4O6J A;  4A4E A;  3S3N A;  1NPP A;  3OYG A;  3HP9 A;  4QVC A;  4J6Y A;  2ZGW A;  3CC7 A;  3FJP A;  3OBY A;  3F70 A;  2XDD A;  3M53 A;  3VYH B;  3SDZ A;  1U1S A;  4C8Q E;  2P0P A;  3PNW C;  5GAO m;  3FC3 A;  1KC8 U;  1GXI E;  1KD1 C;  4C92 G;  3SD4 A;  4M78 C;  2JUF A;  5CQY A;  4C8Q B;  3OYK A;  3KXT A;  3LGF A;  1W2B A;  5HY6 A;  3ASK A;  3G71 A;  2PVO B;  3DLL A;  2RHZ A;  1YBY A;  4TVR A;  2DIQ A;  2E10 A;  3CCU A;  4C0G A;  4BB7 A;  2RI2 A;  5CIU A;  3GIB A;  3GNG A;  1BYM A;  1VQK A;  2FB7 A;  3L2U A;  3CEY A;  3VV0 A;  4M77 F;  2XK0 A;  4C92 B;  3PTA A;  3V8J A;  5GAO q;  3GNF B;  3Q1J A;  3QBY A;  3CCQ T;  1VQ8 T;  2LCL A;  3QYG B;  4C0D C;  3GLX A;  2X35 A;  4A4F A;  4M7D E;  4XTV A;  3OYF A;  3WVD B;  3CCJ A;  3LH0 A;  4MDX A;  4J83 A;  4M78 A;  4BI4 A;  5CK9 A;  1M90 U;  3INZ A;  4N0A C;  5CCA A;  3H8Z A;  2EAY A;  2K5L A;  1BIB A;  2K3X A;  1PSE A;  4OP0 A;  5GAN 5;  4HT9 A;  2JNG A;  1NZ9 A;  2CZ0 B;  3JSC A;  5GAN 8;  2RK2 A;  4BI8 B;  3CCV T;  1M4Z A;  4HCB A;  4M75 C;  4BY6 C;  3RMS A;  2LT4 A;  4J7I A;  3X25 B;  4C8Q A;  4HT8 A;  1BI3 A;  1Q82 U;  5CAI A;  1N27 A;  3QZ5 B;  2V8K A;  4LDX A;  4FSX A;  4MML A;  2RHX A;  3JCM h;  1YHQ T;  4KUD K;  3GF5 A;  2OTL T;  2A3L A;  3BW1 A;  3CCE T;  4BE1 A;  1VQN A;  5GAN e;  2EFI A;  3HPW A;  4RMO A;  3EAE A;  4JJN K;  2RJE A;  5DY9 A;  3OQ5 A;  4KUI A;  2HQX A;  4XTW A;  5CO7 A;  5HKC A;  2O01 E;  4V2S A;  3J80 E;  2ZCF B;  1VIE A;  3A8G B;  3NFC A;  4FL6 A;  2OTJ T;  4WF2 A;  2Y4X A;  2LT1 A;  4RKU E;  3TCJ A;  2MWO A;  2QI2 A;  5HK0 A;  1QW1 A;  3GOX A;  1VIF A;  4ATO A;  5LJ5 j;  3QKJ A;  5LJ3 e;  2EWN A;  3JCM e;  2DXC A;  2P0Q A;  1XTD A;  1S72 A;  4M7A D;  2QEX T;  2ZPE B;  2RD1 A;  4XAX B;  1M5Q 1;  4QQG A;  3JCM Q;  1XQH A;  2GF7 A;  1O75 A;  2RHY A;  2L89 A;  1Q7Y C;  3OYC A;  4B9W A;  3CBO A;  4F7U A;  1MGQ A;  2QEX A;  4M78 F;  1S72 T;  1KD1 U;  4M7D B;  1K8A U;  1VUB A;  1BIA A;  2QQS A;  2WSF E;  4LDV A;  1KQ2 A;  1JB0 E;  2E6N A;  1KC8 C;  2XDB A;  4EMK B;  4IKF A;  3BFM A;  4Z02 A;  1D3B A;  3V7S A;  1O9S A;  4OVA A;  4Y28 E;  4NL3 A;  2PVD B;  4OB3 B;  5GAM e;  5GAN 6;  2K5I A;  4XK8 E;  3HRT A;  1NPR A;  3OYA A;  5IT9 E;  2EYQ A;  4JDS A;  3MEV A;  5LJ5 e;  2X4Y A;  4DQ2 A;  5I2S A;  2E1H A;  1YI2 T;  4EMH A;  3CMA T;  3UDC A;  4BY6 B;  1VQM A;  2DZC A;  3CBP A;  3OYN A;  3CBM A;  3OYD A;  3CCE A;  5GMK e;  2R5M A;  2DD4 A;  4LDU A;  2OTL A;  2KSS A;  2DVE A;  3S6W A;  3OYB A;  1YHQ A;  2MI6 A;  4M7D D;  4N4H A;  2ZZD A;  2JOY A;  1KQS A;  2RM4 A;  4E7K A;  4LD9 K;  1X75 C;  5CVI A;  2NLU A;  4E47 A;  4ELZ C;  5LJ5 f;  3CCV A;  2XDP A;  1VQ7 T;  1RL2 A;  4ELY C;  1NJI C;  5LJ3 g;  4QVD A;  4JRQ A;  3OMC A;  1I5L A;  1VQ9 T;  1VQ6 A;  3FLG A;  3SWN B;  1G3W A;  1B34 A;  5LJ3 d;  1OZ3 A;  4N0A A;  1U1T A;  4B9X A;  2MAM A;  3QXE B;  3P8H A;  5GAN 3;  1Y96 B;  4VUB A;  2V8J A;  4ZGE B;  1W2B S;  2F5T X;  1ZHI A;  1VQ8 A;  5DM7 R;  1NJI U;  4XTU A;  2L3R A;  3X24 B;  4DOV A;  5CQX A;  2RI3 A;  5KCO A;  5I21 A;  3GP8 A;  3SB2 A;  5FLX E;  1VQK T;  2K5F A;  2KMT A;  2XKO C;  1G3S A;  2VXE A;  1LNX A;  4M75 B;  3JCM W;  3OS0 A;  2XG8 D;  3HFO A;  2CYZ B;  5GAN f;  2A7Y A;  4BI3 A;  1VQL A;  1QVF S;  3JB9 I;  3QDR B;  4M77 C;  2ZPB B;  1HXD A;  3A8O B;  1I4K 1;  3CC2 T;  5GAO n;  1IZ6 A;  3JCM V;  1H3Z A;  1Q86 U;  5LJ5 d;  1U8R A;  1XNI A;  4LD6 A;  2RB6 A;  3PMT A;  5LJ5 h;  5KCH A;  5DLQ E;  3CCS T;  3JB9 D;  4M7A A;  2XD0 A;  3G4S T;  4OB1 B;  1D3B B;  5GAN 4;  2L5Q A;  1Y96 A;  4E7J A;  4QW2 A;  3JCM f;  1UGR B;  2F69 A;  3CC4 T;  1VQP T;  1JJ2 A;  1ZQ1 A;  4J6W A;  4M7D G;  2BUD A;  4PNO A;  3SWN A;  4M75 F;  2VYT A;  4IUR A;  4X34 A;  4F7U B;  2R57 A;  4MZP A;  5C0M A;  3PIP A;  3OMG A;  5I2M A;  4Q5W A;  2CKK A;  4M7D A;  2ZPF B;  4BE0 A;  3QZ9 B;  3M9Q A;  1YJN A;  3PFS A;  4NS5 A;  1N8R U;  5CKE A;  4OGC A;  2PUO B;  3MP8 A;  5LJ3 h;  4R55 A;  2E12 A;  2LC4 A;  1Q7Y U;  2RJD A;  5FU6 B;  4A4K A;  4II1 A;  3UWN A;  2HQE A;  2EJ9 A;  3CC4 A;  3HHT B;  1H64 1;  5A2Q E;  1VQP A;  3LGL A;  4P5N A;  3R6O A;  2GCX A;  3G4S A;  2XHC A;  3CCS A;  3TRE A;  4CRI A;  2D6F A;  3QJY A;  5D6X A;  2JTM A;  1ZBX A;  3M55 A;  2ZPG B;  1K9M U;  3WVE B;  2KK4 A;  3L2W A;  2RJC A;  3DB4 A;  4A54 A;  2HAX A;  3CC2 A;  4M7A E;  1Q81 C;  4MDW A;  3OYJ A;  1QVP A;  4XQ3 A;  3HRS A;  4PKC C;  4ZN3 A;  2K2V A;  1QVG S;  1VQL T;  4FIB A;  4PJO G;  1RI0 A;  3X26 B;  4M75 D;  1G3T A;  1YJ9 T;  4YTL A;  2RHU A;  2E70 A;  4C92 F;  2X4J A;  4OF1 A;  3I56 T;  3RIR A;  5FRN A;  2RHI A;  2E65 A;  2YHT A;  3MET A;  3E9G A;  4HKE A;  1YIT T;  2XID A;  5LJ5 g;  3NTI A;  2HBP A;  3VYG A;  3CXC A;  3URG A;  4M7D F;  3T9N A;  3L2R A;  3J7A F;  4A4H A;  1Q86 C;  4IUU A;  1X01 A;  4C92 A;  1QVF A;  4X9C A;  4J5Y A;  2BIV A;  3JCM P;  2VXF A;  1NE8 A;  4LDW A;  3L1A A;  4C8Q F;  1VQ6 T;  1VQ9 A;  5GAN h;  1WNL A;  4JLI A;  1YJW T;  4OB2 B;  4L5G A;  3PMI A;  4XU2 A;  4DA4 A;  4L59 A;  2DEQ A;  1VQ7 A;  3J81 E;  4RG2 A;  1EIF A;  1BI0 A;  1OI1 A;  2FL7 A;  3PIO A;  4ME7 A;  2M9U A;  2RK1 A;  1B34 B;  2QA4 A;  4E7H A;  1W4S A;  2M0O A;  2GFA A;  4M78 D;  1N8R C;  3QO3 A;  2WAC A;  3NTH A;  3JB9 G;  3HSB A;  2FHD A;  4EMG A;  1VQM T;  4PJO C;  1JRI A;  4J7F A;  4XTX A;  3L2Z A;  5GMK i;  3CMA A;  4M77 A;  3VUZ A;  1YI2 A;  1YIJ A;  3M56 A;  4Y91 A;  4ZGJ B;  3GPL A;  3P8B B;  3DLM A;  3FRN A;  4KT0 E;  4JS4 A;  3PGG A;  5KE3 A;  4HCZ A;  4BDZ A;  4ZN1 A;  2F5K A;  1KQS S;  4FM4 B;  2HNI A;  1QP3 A;  2LQ8 A;  3RKY A;  5LJ3 f;  1R8O B;  4PJO A;  3MCA B;  3RKW A;  3CPF A;  2KDS A;  4FU6 A;  4HCC A;  3V7R A;  1WQ7 A;  2XU8 A;  2VGM A;  1QP2 A;  3MHX A;  1UB4 A;  4C5G A;  3PT9 A;  3X20 B;  2RA2 A;  2PVG B;  3MEA A;  2MF2 A;  1OZ2 A;  2JTF A;  3OW2 S;  3MEW A;  3EFS A;  3QII A;  5IN1 A;  1I81 A;  3HL8 A;  4RCB A;  2CGH A;  2PQW A;  3M59 A;  2DPP B;  4C92 E;  2I2L A;  3TU4 K;  4NOY A;  1WJR A;  3DKM A;  1WPY A;  2PU9 B;  3RUX A;  1FX7 A;  5HK3 A;  3JCM X;  3JCM J;  3JB9 J;  2X4X A;  2LTO A;  3QJ6 A;  3VU3 C;  4XTY A;  3MO8 A;  3CCM T;  2MWP A;  4C92 C;  2EKO A;  4IUV A;  5GAO l;  1BI1 A;  2DTH A;  1FWZ A;  3L2Q A;  2OTJ A;  1HK9 A;  5J39 A;  4C92 D;  3C12 A;  3QUI A;  1K9M C;  5A0D A;  3C95 A;  3N5B B;  2EJG A;  1VQN T;  2PUK B;  3OBW A;  4MZT A;  3JCM d;  4JS5 A;  1WGS A;  1X6O A;  4M78 B;  3KUF A;  4C8Q C;  3CPW S;  3UT1 A;  4QQD A;  2DTI A;  2VV5 A;  4M75 A;  2Y90 A;  3G6E A;  4M7A C;  2OAU A;  4M78 E;  1VQ5 T;  4OGE A;  2EQK A;  2KQW A;  5CKD A;  3OA6 A;  5M9O A;  2R58 A;  4RCC A;  1VQ4 A;  2CZ7 B;  2QXF A;  1IRE B;  4M77 E;  4BDY A;  2YLC A;  4X9D A;  2CZ1 B;  2LQK A;  2JN0 A;  3CCJ T;  1M9S A;  2E64 A;  5GAN j;  4HA8 A;  4KBM B;  1M1G A;  3C94 A;  3JAM E;  2FVU A;  4IUT A;  2E6Z A;  1M1F A;  3HRU A;  3LLR A;  3CCQ A;  2DD5 A;  3EFR A;  1OYX A;  2M1H A;  3BDU A;  5EG2 A;  2DZ9 A;  2B8A A;  2DKG A;  4D6W A;  4PJO D;  3RKX A;  2HD0 A;  1K8A C;  3OB9 A;  3E1S A;  2RJF A;  2K4Y A;  4LDY A;  5C6S A;  5D6Y A;  3S3O A;  2WSE E;  3RMQ A;  3LWH A;  2RO0 A;  3JRZ A;  3CCU T;  3G71 T;  2KVQ G;  2H3J A;  2QQB A;  1K73 U;  1N6A A;  1P92 A;  4PL6 A;  4QQ6 A;  4UC4 A;  2O4X A;  2V8I A;  4PLI A;  3SWN C;  5GAO p;  4E7I A;  4M7A G;  4M7D C;  5GAM j;  2D9T A;  4C8Q G;  2BKD N;  4PJO B;  5AYF A;  2MMP A;  5J3B A;  1KHC A;  4C0D B;  3OS5 A;  5A0G A;  2C06 A;  1YCY A;  3SFM A;  3CC7 T;  2YLB A;  2M16 A;  3LW5 E;  4F7U F;  1PSF A;  4N4I A;  4XTZ A;  5GAM h;  3V8K A;  4EMK A;  1LOJ A;  4E7L A;  2VUB A;  3QSU A;  2GQV A;  1VQ4 T;  3JB9 F;  4BD3 A;  2EQM A;  4MMK A;  3M4G A;  3P8D A;  3QHS A;  4M78 G;  4XU0 A;  1VQ5 A;  2DIG A;  1JJ2 S;  5GAN 2;  3G6E T;  4BAC A;  4C5H A;  3JB9 H;  4M77 B;  5FU7 B;  1LJO A;  1M1K U;  1MHN A;  1N9S A;  2EJF A;  4PJO F;  1Q82 C;  1KG1 A;  1G3Y A;  1UGQ B;  2R5A A;  2K3Y A;  2VC8 A;  3ER0 A;  3ZBD A;  3JCM c;  3LYI A;  5J26 A;  3CCR A;  3FDR A;  3M58 A;  5FU6 C;  5GAN d;  2IG0 A;  5GMK j;  2KAF A;  1BKB A;  5KH6 A;  2VGN A;  2D0Q B;  3X28 B;  3S3M A;  3O8V A;  3M54 A;  4F7U G;  3VKI A;  3HKS A;  3MP1 A;  1VQO T;  3CD6 T;  2DK3 A;  2XI9 A;  4XU1 A;  5CKF A;  3CCM A;  3A8M B;  3JCM b;  3TEE A;  4FT2 A;  3MEU A;  2EIF A;  4IUQ A;  4DOW A;  5GAN 7;  3H6Z A;  3M4Y A;  5GMK m;  2LVM A;  4GY5 A;  3G7Z A;  2QQ9 A;  3CCL A;  3A5Z B;  3CME T;  4JRP A;  4JLG A;  4PLL A;  1KQ1 A;  3LWI A;  4PJO E;  5CR2 A;  2RH2 A;  5GAN g;  3VJP A;  3VUB A;  4EDU A;  4EPC A;  3UPU A;  4ZTF A;  4M7A B;  1M1K C;  4N4G A;  2QQR A;  2CS7 A;  3QG1 A;  1AHJ B;  4A53 A;  5GMK h;  1DJ7 B;  3I55 T;  4C5E A;  3RER A;  1Y07 A;  2G3R A;  3CXC S;  2DAQ A;  2EQJ A;  1G5V A;  3L2V A;  3HFN A;  2LDM A;  4GLK A;  3V7C A;  2JVV A;  4F7U E;  4A4G A;  2LNV A;  4CI0 C;  5L8R E;  3JCM g;  2K57 A;  4M77 G;  3ZFJ A;  3CPW A;  1YIJ T;  1K73 C;  1WJS A;  3M5A A;  1FXX A;  3KBG A;  2QDY B;  2ZPH B;  2P4T A;  4M7A F;  4XU3 A;  5KE2 A;  2QA4 T;  3OYM A;  5FRM A;  2IVW A;  5LL6 S;  5CKB A;  2DJZ A;  2FYK A;  3QYH B;  1UGS B;  3A8L B;  5GAM f;  5GAO r;  3RES A;  2RI5 A;  3C4S A;  5GMK l;  1YJW A;  4R56 A;  2GFU A;  1QVG A;  3V8L A;  4JRK A;  1Q81 U;  1UEB A;  5IAY A;  1WJQ A;  3DB3 A;  3OYH A;  1N9R A;  3AHU A;  4M75 E;  4ZTJ A;  2LX9 A;  4KUL A;  3A8H B;  3E9F A;  5GAM g;  4L6V 5;  4OMF B;  3I55 A;  3BDL A;  1YIT A;  3OYL A;  2AHJ B;  1Y7X A;  2QQA A;  4RG8 A;  3I56 A;  2QTX A;  2CZ6 B;  3OYE A;  2O4X B;  2P0K A;  2YRV A;  2WSC E;  1YJ9 A;  2X4W A;  4IUP A;  3NTK A;  3ME9 A;  1XOV A;  4OB0 B;  4FT4 A;  3CME A;  4C8Q D;  3MP6 A;  3FB9 A;  3CCL T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...