4C8QF

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qF00
4V2SA 4M78B 3BW1A 3V8LA 3JB9I 3M4GA 3FB9A 3QO3A 5GMKm 1D3BA 1JBMA 3QUIA 4C92A 2CGHA 1KQ2A 4PJOD 4M75G 4M78F 4J6WA 1HXDA 5GAN4 3FJPA 4M7AB 5GANe 5GAN3 3V7RA 4PJOB 2DZCA 4NOYA 3GIBA 3JCMX 2DKGA 3JB9J 4M7DG 2QTXA 3EFRA 5GMKj 3JB9G 1M8VA 5GAOq 4M7AF 4XTUA 4C8QC 1B34B 4RCCA 5I21A 4NL2A 3INZA 4OP0A 5LJ5e 5GMKi 3JB9H 2YLBA 1WNLA 3JCMh 1HK9A 4M78D 2RD1A 3RESA 5GMKh 4XQ3A 4F7UE 1LJOA 3JCMf 4DQ2A 3JCMe 4C8QA 5GAN8 4M77C 2K57A 4RCBA 2E1HA 3V8JA 3QSUA 3HFNA 4M78E 4XTVA 3RIRA 1U1TA 2E65A 2EJ9A 3JCMV 3V8KA 4QVCA 4M7AD 4HA8A 4XTZA 3EFSA 1D3BB 4MMKA 4C92B 4X9CA 4F7UG 4M77A 1LOJA 4WF2A 3JCMJ 4M75C 4M77B 4J6YA 4M7AE 5GAOl 1Y96A 4M78G 4PJOE 3BDUA 1I8FA 2EWNA 5CAIA 2DJZA 4C92F 3HFOA 5LJ3j 4M7DC 2DXTA 3QHSA 4M77F 4N0AC 4JUVA 1WQWA 2VXEA 2EAYA 4JLIA 4M75A 3V7CA 5GAMd 2EJGA 4M7DE 4M7AG 2VXFA 4XU1A 2E10A 4PJOG 5LJ3d 2EJFA 1M5Q1 3RKWA 3VU3C 4XTXA 3JCMb 2DZ9A 4M7DA 4N0AA 2I2LA 5LJ3h 4M75F 5GAMg 5GMKe 3RERA 1BIAA 5LJ3f 4C8QB 5LJ3g 4C92D 2JN0A 2DTOA 2DTIA 2RA2A 4M77D 4EMKA 4A53A 4JRIA 5GAN6 5GAOn 4C8QF 2DEQA 1U1SA 4C92E 3SB2A 1N9RA 4NL3A 5GMKl 1I5LA 5GAMj 1Y96B 2VC8A 4HT9A 2DVEA 4M78C 4M75D 3BFMA 4X9DA 1I4K1 1LNXA 2FB7A 3JCMc 3AHUA 4HT8A 2YLCA 4C92G 1YCYA 1JRIA 4F7UA 2Y90A 1WQ7A 5GANj 1KQ1A 3PGGA 4M75B 1TH7A 1H641 4M77G 3SWNA 2DTHA 4J6XA 4M7AC 4A54A 4M78A 4XU2A 4C8QD 5GAMh 5GAN5 4PJOC 2YHTA 4EMKC 3L1AA 5GANd 5GAMe 4J5YA 5GAMf 4F7UF 2HNIA 4M7DB 5GAOm 1WPYA 5LJ3e 4C8QE 4EMGA 5GANh 4M7AA 1MGQA 4JRKA 5LJ5j 4MMLA 4PJOA 2DXUA 5GANf 2RM4A 3RKYA 5GANg 3JCMP 3FIFA 3JB9F 4M7DF 4EMKB 5GAN7 3RUXA 2FYKA 4EMHA 5LJ5d 4XU0A 1BIBA 1N9SA 4M77E 4XU3A 4C8QG 1B34A 3SWNC 2E64A 5GAOp 4PJOF 5GAOr 4XTWA 5DY9A 4QVDA 3JCMd 3HSBA 5LJ5h 3V7SA 3BY7A 4PNOA 3L2ZA 4XTYA 5LJ5f 5LJ5g 2RB6A 1I81A 4Y91A 3JCMQ 1X01A 3JB9D 3RKXA 4C92C 5GAN2 4F7UB 4M75E 4M7DD 3JCMg 3SWNB 2ZGWA 2E41A 3JCMW
chains in the Genus database with same CATH superfamily
2O9SA 1PWTA 1QWFA 1Q86R 3R6NA 3CXCS 3CCMA 3HKSA 2LRQA 3FJ5A 5GANe 1ARKA 1UGQB 4M7DG 3AT1B 2QDYB 1D1AA 1OI1A 5LJ5e 3M59A 1BBZA 3CQTA 3RESA 5IHIA 3CCQT 1M2OA 4JLGA 4E7SA 2FHDA 4QQGA 3FRNA 2F5KA 1YITT 2VKNA 2M0YA 2V26A 4WF2A 4Y28E 2F69A 4A63B 1K8AR 2EWNA 3VS2A 1VQOT 1VYTA 3CMEA 1K8AU 4N0AC 8ATCB 3VKIA 2EAYA 1JU5C 1K73R 3G6ET 4LUDA 4XU1A 2DLPA 5LJ3d 4PL6A 4FL6A 2DL3A 2GQVA 1M1KU 2YXYA 2QAZA 3URGA 3RERA 3OYHA 4B6MA 1YWPA 4RG8A 2HMAA 1PRMC 2WSEE 3GPLA 2K2VA 2XIDA 3VS1A 4ZTFA 4IURA 4M78C 3BFMA 2DBMA 2K3YA 1YCYA 5GANj 4RTXA 1A0NB 4OMLA 1WYXA 1RAGB 3NPFA 5GANh 1VQNA 5LJ5j 3OYLA 2QEXT 2MPXC 2E5QA 3UF4A 1N8RR 5IN1A 3H0IA 5KYWB 3T9NA 3EAEA 5LJ5h 3M0TA 1VQMT 1JJ2A 5GAN2 4DBHA 1QVGP 4F7UB 1YJWT 3SD4A 2JZ2A 3CCQA 3JB9D 2ZGWA 1VIFA 3EGXA 3CXCA 3EFOB 2RQVA 2E3HA 2CZ1B 1BI1A 4M75G 4M78F 2YUOA 5GAN4 1M27C 2BZYA 1ZA2B 4JJCA 2K9GA 3CCJA 2PUKB 2QTXA 2L8DA 1Y07A 3EFRA 2VASA 4FT2A 4RTUA 1MV3A 3SFMA 2CH4A 5CKHA 1VQPA 4ATOA 5IH2A 4QT7A 3IQLA 4M78E 1UB4A 2RI5A 1AWOA 2DAQA 3OYYA 4M4ZA 3I55T 3OMCA 1NE8A 3PIOA 5CAIA 1VQKT 3CCVT 3UPUA 1WHJA 4N4GA 4F16A 1M5Q1 2E70A 4M7DA 1FX7A 2D8HA 1WI7A 2KEAA 1UDLA 3VYHB 1VQLT 3MHXA 1NZ9A 1U1SA 4BY6B 2QQRA 4IUTA 5FU7C 4BE1A 2CP6A 2ZPBB 4HT9A 3AHUA 4C0DB 1OX9A 3CMAT 4AG2C 4ELZC 4IUVA 2E6NA 1MMDA 1X75C 2CT4A 4DEXA 3VS5A 1YJ9Q 4QKUA 2RK2A 2KYBA 2A36A 3CCSQ 3C0CA 2HBPA 4EMKB 1Y57A 2VV5A 4MZTA 2A0FB 2CREA 4AG1C 1S72T 1CSKA 1R0BG 1KC8U 3RNJA 2RB6A 4L5GA 3RKXA 2AHJB 1N6AA 2QA4Q 4V2SA 2DE0X 2XU8A 3QZ9B 3V8LA 2J6KA 3M4GA 4PJOD 3THKA 2CP2A 1BU1A 2X4YA 5GAN3 2H3EB 3PNWC 5DLQE 2KVQG 1X6BA 5KCOA 1K0XA 1VQ6Q 2ZPIB 3MKDA 5GMKi 3GNGA 1TUDA 2DL4A 2EYQA 1M9SA 2DNUA 2V1RA 3KBGA 2K3BA 1GBQA 2L3RA 4DEYA 3J80E 2OAWA 3FDRA 1WXTA 3BDUA 2ED0A 1PSEA 1AT1B 2DJZA 2ZPGB 2DXTA 4J7IA 5J26A 4CI0C 3EGUA 4JLIA 4M75A 1G3TA 1UTIA 1V29B 3VU3C 3X26B 2HAXA 5KE2A 2XDDA 4J83A 1GL5A 3OS1A 1EIFA 4BY6C 2HKQB 5GMKe 1BIAA 1YHQT 3MP8A 4C92D 2JN0A 2DK3A 2DTOA 1NEBA 1WLPB 1WZOA 2G6FX 5GAN6 1YITQ 4RMOA 2X51A 2NUPA 4J9FA 1ZSGA 1Q82U 2GTJA 5AT1B 1VQOQ 3L2VA 3O5ZA 4KUDK 3G6EQ 3L42A 1TH7A 2DEUA 2MWPA 4EMKC 2FRYA 5GAMe 5CQXA 1PNJA 4EMGA 2QK0A 3UDCA 5GANf 3JCMP 1OEBA 3VRYA 3CXCP 2RHZA 2LQWA 3CCUT 4MDXA 3META 1G3YA 5KYXA 4XTWA 2HD0A 2K6DA 2DFUA 5FWBA 1GFDA 5LJ5f 4FW2A 1RL2A 1KD1U 2JS0A 3PIPA 3O8VA 3PFSA 2A37A 3LX7A 2BZ8A 5KYYB 1PSFA 2CUDA 1VQ5Q 4LDVA 3KUFA 3QO3A 2JNGA 1D3BA 4OB2B 1HXDA 3MEVA 2QEXQ 3OYDA 5KCHA 3S3OA 5GMKj 1M8VA 1RLPC 2HQEA 3TCJA 1M8MA 1DJ7B 3A1PA 3PE0A 4J9BA 1VQMQ 3PTAA 4GLKA 2OTJT 3EG9B 4LDUA 5GMKh 2K2MA 1YJWQ 2AZVA 1LJOA 2LT1A 3I35A 3VJPA 1AHJB 2QQ9A 3H0HA 1ABOA 2XD0A 3V8JA 2QI2A 1KK7A 4C92B 1M3CA 2L5QA 2X4XA 3CCEA 3H8ZA 1BCMA 4HCZA 4R0KA 3SDZA 4LDYA 2PVDB 2P0QA 1UG1A 2FO0A 2HQHA 4FT4A 1W1FA 1AOJA 4XTXA 4BI8B 1JO8A 1X6GA 1G2BA 4M75F 2ZPEB 4PJLA 1FMVA 2D1XA 4OB3B 2LZ6B 3KXTA 3I55Q 1TXQA 3TSWA 1Q81U 1YIJA 1YFNA 4NL3A 2K5IA 2F5TX 1SRLA 2AIRB 1VQKQ 3CCVQ 4OMMA 2OI3A 5DLOA 1KQ1A 3HP9A 2HEQA 5CKEA 4PJOC 2DD4A 5GANd 4J5YA 4R55A 2JJ9A 5HK0A 1M1FA 1M4ZA 4LUEA 4DBRA 1SEMA 1JEGA 4HCKA 2DXUA 1VQLQ 1XJWB 2WSCE 3PMTA 5LJ5d 2EYYA 4C8QG 3PVLA 2MK5A 1M90U 1LPLA 1XTDA 2LQ8A 1Y71A 3OYFA 3HSBA 4PJNA 1X2KA 3CMAQ 2RO0A 5M9OA 1KIKA 1UE9A 1Q7YC 2E12A 2RI2A 4PKCC 1B3QA 1JBMA 2GFAA 1ZLMA 1H3HA 1GCPA 2FG0A 4C0GA 1HD3A 2MOXA 2NUTA 4FW1A 4OMPA 2OX7A 3RMSA 2M0OA 1CKBA 1C0MA 3VS6A 3OYNA 1FWZA 1RLQC 3OSVA 3OS2A 2R58A 4BDYA 2VVKA 4BUGA 2COWA 1XNIA 3G7ZA 1WXUA 3ASKA 4M78D 3OYGA 2G3RA 3JCMe 3BE3A 2LCLA 3REBB 1YI2T 4QVCA 4HCBA 2DPPB 3QYHB 2DYBA 2ATCB 2E4HA 5KE3A 4PJOE 1O75A 2O4XA 4ZTJA 2GFUA 1B7TA 1NJIC 3VUBA 5D6YA 3G4SA 2KSSA 3QJYA 4F14A 4HXJA 2LMJA 5FU6C 2O01E 3A5ZB 2EGAA 4FCYA 2LQKA 4OF1A 2HCKA 3GBQA 1VQ9Q 3CC2Q 3SB2A 2LNVA 5A0LA 2QASA 1ZBXA 2JMCA 1H8KA 2GCXA 5I22A 1QWEA 1VOMA 2PVGB 4M7AC 3M56A 1JXMA 3CCRA 1YHQQ 3EGDB 1K9AA 2OJ2A 1XQHA 4BI3A 1RI9A 3A8GB 1QVFS 4J8OA 5DM7R 3SEMA 2MIOA 4AT1B 1B34A 2PQWA 5DY9A 1QP2A 5CR2A 3BY7A 3L2ZA 4C5GA 3CCLA 2QQSA 3SWNB 1VUBA 3JCMW 4M78B 4QVZA 1FYNA 3JB9I 3MO8A 3HL8A 1N27A 3FJPA 3ZEHA 2DIQA 4N4HA 5FWCA 3JB9J 5GAOq 4M7AF 1ZQ1A 4D8KA 3CBPA 4XTUA 1IO6A 4L6V5 1PM3A 4JPBW 1ZUYA 2CH4W 3P8BB 4E7KA 1S1NA 1NLPC 4C8QA 2K57A 2CT3A 1MNEA 3CC4A 4DBQA 1JJ2S 1P92A 4F7UG 3L2QA 1Q86U 4M7AE 4FYVB 1O9SA 3E19A 5CKBA 3GOXA 1T3LA 1UHCA 2FRWA 2DBKA 3RBBB 3V7CA 5CK9A 3RKWA 4FSSA 1KSWA 1Z9ZA 3OYBA 2OTJQ 2DL7A 2NUZA 1HYOA 5IT9E 4GLMA 2EQIA 5LJ3g 2AKKA 1YJ9A 1UGVA 2V8IA 3CCSA 2CUBA 4XK8E 1KQSP 1Q7YR 2MMPA 1YJNA 1N9RA 3H6ZA 1Q7YU 2CP0A 1Y96B 3WVEB 4HT8A 4K11A 4FM4B 2RHXA 4DOWA 3PGGA 1H641 1WA7A 1K73U 1RAFB 2QA4A 2HSEB 1NEGA 4E2FB 1QVFA 1FMKA 1AWXA 4KGZB 2KGTA 3PVQA 4EMHA 3S6WA 2C0TA 3SWNC 4J7FA 4VUBA 1QW1A 3OYJA 4HVWA 1VQ6A 5FU7B 3X28B 1NJIR 2P4TA 1VQ5T 5CCAA 1NJIU 3FB9A 4OMFB 2CGHA 1M30A 2YWWA 2X4JA 3H9NA 3HHTB 3ME9A 1IRXA 3VUZA 1G83A 2DZCA 3JB9G 2EW3A 3TVTA 4E7HA 4RCCA 2RJDA 1N8RU 2EYXA 4ORZA 1MMGA 1VQ4T 2H3JA 1RAHB 1YP5A 1SHGA 4XTVA 1UJYA 3EHQA 1U1TA 1NM7A 2AKLA 3EFSA 2KT8A 3MEAA 4M77A 4ZGDB 1PKSA 1YITA 1K4US 4ANJA 2LP5A 1VQOA 3QWXX 1PG5B 5HY6A 1QCNA 5KYUB 5GAMd 3I56T 2HKNA 2LTOA 3G6EA 4IUUA 2LC4A 2EJFA 1JQQA 1X6OA 2EQKA 4JDSA 4NS5A 2QDLA 2P0PA 1YI2Q 1SHFA 2D6FA 1X69A 2W10A 3A8MB 4LDWA 3OB9A 5CVIA 2V8KA 5FROA 5KYWA 3L2RA 1EFNA 2DVEA 3I5RA 2VGNA 4M75D 3M0RA 1WHKA 3M0QA 4F7UA 1W2BS 3EFOA 4OGCA 4B9WA 2XHCA 1M2VB 1OQKA 4Z89A 1N5ZA 3OW2P 1T0JA 3NHNA 2L89A 1OZ2A 2FPEA 2QEXA 2DETA 2RQWA 5ECAA 4C0ZA 2X4WA 1TG0A 2QXFA 3H41A 4KUIA 1VQMA 3M54A 1YJWA 3UT1A 3FEOA 1BCOA 3CCMQ 1LCKA 2YSQA 2KT1A 1ZUKA 2C0IA 3V7RA 1X43A 4OMNA 2CKKA 1K9MC 4OMQA 1RI0A 2FZCB 4NL2A 3INZA 2GBQA 1WNLA 1I1JA 1U3OA 2ENMA 2H8HA 3U23A 4AFUC 4KH1B 2V8JA 2YUNA 3MJXA 5I2SA 4MMKA 1LOJA 4OB0B 5A2QE 1GFCA 2ED1A 3I55A 2YRDA 3HFOA 3DKMA 4M7DC 4O5VA 1NG2A 4M77F 4RTWA 1VQKA 3CCVA 1SKUB 2EJGA 4J9HA 5C6SA 3E1SA 1IHVA 2BTTA 2DZ9A 2L3QA 2RPNA 3M5AA 4KRTA 2JM8A 1VQ7T 1MNDA 2KMTA 3Q1JA 3JRZA 2DTIA 2RA2A 4EMKA 1VQLA 1VQ9T 3CC2T 2DX1A 2QQBA 1QVFP 2F2WA 1W2BA 2A3LA 2NYSA 5A0DA 4ZN1A 4C92G 2ZZDA 5KYNA 3CMAA 4FYYB 4J6XA 5FRMA 4F7UF 2K3XA 1OU8A 2CSIA 2GGRA 2MCNA 4M7DF 2CS7A 3RUXA 4KH0B 1TOVA 4XU3A 1F1BB 2X9HA 4L59A 3G71T 2KE9A 3JCMd 1BK2A 4EIKA 1S72A 2K4YA 4HCCA 4PNOA 1YNZA 4X1VA 4XTYA 3S3MA 4KGXB 1I81A 3JCMQ 3DLLA 2EIFA 2KK4A 3A8OB 3R6OA 3N5BB 5CKDA 4PFZA 4M7DE 2RHYA 5GMKm 2CYZB 1JJ2P 3NTKA 1X27A 3CCJQ 4PJOB 4Z8AA 2DKGA 1WGSA 4IUPA 2JTEA 3X25B 3OS5A 3J7AF 4PJJA 3LGFA 4JJBA 3ZFJA 4E6RA 2V1QA 1GCQC 5KH6A 4DQ2A 1TTHB 1BYMA 3CBMA 2XI9A 4AFZC 1BB9A 4M7AD 2QG9B 1ABQA 2DL5A 4M75C 3CC2A 3OYKA 2WSFE 2KI7A 4F17A 1VA7A 1WQWA 4FYXB 1VQ8T 2ZPHB 5EC7A 3LWHA 1AWWA 4C5EA 2M02A 3TU4K 1VQ4Q 1R8OB 1WHHA 1YHQA 3NMZC 1OYXA 3G1JA 3CC7T 2EVRA 1LVKA 2JT4A 2BE7D 5GAOn 3BDLA 4IIMA 1PRLC 1BI0A 3RMQA 1ZHIA 1EX4A 4FSXA 5GAMj 2CP7A 2D0NA 1WIEA 2FB7A 1KG1A 2NWMA 3I56Q 4OB1B 1BKBA 5KYYA 1K9MR 1E6GA 2GTOA 4XU2A 5GAMh 5FW9A 3ER0A 2W0ZA 2FPDA 5CO7A 5GAOm 2YRCA 3CPWS 2YT6A 1YBYA 2PU9B 5GANg 2RQTA 2EBPA 2KROA 5FU6B 1QKWA 4PLLA 2LDMA 3OS0A 3NTIA 3CCUA 1BIBA 5IXBA 3UATA 2XG8D 3TEEA 1G3WA 3F70A 2O2OA 3EG9A 2COZA 2RK1A 4CC3A 5LJ5g 1D0XA 4M75E 2PZ1A 2E41A 1X2QA 1OOTA 3C94A 3HRTA 4CRIA 1MMAA 2YUPA 4C92A 3D7SB 3EG2A 4M7AB 2DYIA 4AFSC 4J9IA 4HKEA 1ZSZB 2O88A 4XAXB 3M53A 3MP1A 3JAME 1MV0B 2P4RA 4BACA 4JRPA 4E7LA 2OTJA 5AYFA 2F2XA 3QXEB 3QSUA 2ROTA 1C6VX 3OBYA 4MDWA 3M57A 4HVUA 3CD6Q 1K0SA 2ECZA 3JCMJ 2CZ6B 1E6HA 4M78G 1VYUA 4EPCA 1QKXA 3QHSA 3VS7A 2OTLT 1ZBJA 1D1CA 2E10A 1NPPA 4X34A 2HBWA 1CKAA 2GF7A 3MCAB 3LLRA 4QQ6A 2LJ3A 1W2BP 3E2UA 2LCSA 4LD9K 1RUWA 1YWOA 2F1LA 2LT4A 1M1KC 3X20B 2RQRA 4X9DA 2KRSA 1Q95G 3CPWA 5GAN5 4KBMB 1WDXA 2DA9A 3OYMA 1VQ7Q 1Y7XA 2HNIA 1M3BA 1PD0A 1MGQA 3EG1A 4JRKA 1FXXA 2JUFA 2FYKA 3TQ7P 2RQUA 3J81E 5FRNA 1I0CA 3EH1A 1IXDA 2Y4YA 2FL7A 2BE9B 2CDTA 4QW2A 1SG5A 2YDLA 4J9EA 4LE9A 5C0MA 3TSZA 5CKFA 3BW1A 4JRQA 3OY9A 1ZSZC 3CCMT 4KGVB 1QQJA 4J6WA 3LW5E 2BZXA 3GIBA 1AD5A 1WJSA 1WJRA 2M1HA 2MWOA 1ZUUA 3G71Q 3OYAA 1R0CB 2X35A 1D09B 4OGEA 3JCMh 2A28A 3PT9A 3HFNA 3RIRA 2KBTA 2K5FA 3EH2A 3CEYA 3OA6A 1YI2A 3M55A 2HSPA 4HA8A 4UC4A 4XTZA 1GXIE 2I0NA 2LX7A 4ELYC 4J6YA 1RACB 3M58A 1D1BA 2EYWA 2JVVA 2K5LA 2RF0A 3C95A 3L2UA 3CMET 3OMGA 2OAUA 2BUDA 4JUVA 4AFQC 4JS4A 2VXFA 5GJWB 2BKDN 3JCMb 1VIEA 4N0AA 2JXBA 5A0GA 2JW4A 3EGDA 3ZBDA 1NYFA 2FZKB 4IIOA 4M77D 2RI3A 1D0YA 1GRIA 3QBYA 2KXDA 3RDVA 2KQWA 1I4K1 2WACA 2YLCA 3LGLA 3SWNA 1VQ8Q 4A54A 4M78A 1NLOC 1NYGA 3QG1A 5GAMf 2DERA 3HRSA 1VQNT 3CC7Q 2FVUA 4J9DA 1AWJA 4ZGEB 3REAB 2EGCA 1KJWA 2XMFA 3A8LB 2RMOA 2JOYA 4J9CA 2LJ1A 2RJFA 2B86A 1M3AA 5GAOr 2E64A 4QVDA 5D7UA 4N4IA 2X3WD 4Z02A 3UA7A 2J06A 3JSCA 5GJVB 4M7DD 1IGQA 1QVPA 4BE2A 2FEIA 3I5SA 3QKJA 2Y4XA 1KC8C 4KULA 3OYIA 3MPUB 3HRUA 3JV3A 4RKUE 3CCJT 4AMCA 3S3NA 4LDXA 3LH0A 3TREA 1AZEA 4C8QC 1M1KR 1VQPT 1IZ6A 4BD3A 3FC3A 3JB9H 2RD1A 4XQ3A 1NPRA 4WCIA 3EGXB 2KDSA 1K1ZA 3QPHA 1QMCA 4A4EA 4R56A 1W4SA 1WHGA 4M77B 4B9XA 1Y96A 1I07A 3SHWA 2EYZA 3DB3A 4A4GA 3G4SQ 1J3TA 1UGSB 2VXEA 3OYCA 4JZ4A 2KAFA 1IHWA 3C12A 1WFWA 3QDRB 5GAMg 3I9QA 4YTLA 2HZYA 4JS5A 2XKOC 3A98A 4C8QF 2EGEA 7AT1B 3X24B 3CPWP 2MYSA 1U5SA 2OTLQ 2COYA 2AZSA 4A4HA 1PC0A 1WQ7A 2Y90A 3LYIA 2J6OA 1Q82C 4E47A 2DRMA 1JXOA 2JTFA 3CCRQ 5J39A 2J7IA 4M7DB 4C8QE 1TUGB 3VYGA 2GQIA 2RM4A 2MI6A 4Z88A 2IIMA 2ZAEA 2EQUA 1AZGB 1PHTA 2HL5C 4PJMA 3CCLQ 1X01A 1UGPB 2HDAA 2R5AA 1FMWA 1VQ5A 2PUOB 3M4YA 1QCFA 3LH5A 2A08A 4EDUA 4MZPA 1UGRB 1KD1C 3L2WA 4E7ZA 2JS2A 2K7AA 4NOYA 3NTHA 5KYUA 2QGFB 2KR3A 2IPOB 4FYWB 2M16A 4OP0A 1ZA1B 1R77A 3CC4Q 3JCMf 5D6WA 2DL8A 4M77C 4RCBA 2E1HA 1VQ4A 3RR6A 1AEYA 2EJ9A 2E65A 2O31A 4E7IA 1WX6A 4X9CA 5D6XA 3CD6T 1U8RA 4RTTA 2QQAA 4PFPA 4RG2A 3OQ5A 2DF6A 2ZPFB 2B8AA 3FLGA 2E3IA 2XDBA 3I56A 4PJOG 3QIIA 1UFFA 1SPKA 2DXCA 1M2VA 2LNHB 2KXCA 4DBFA 2LX9A 2PNIA 2EQMA 5IHKA 1WHLA 1OV3A 3VRZA 1W6XA 1RAIB 3WVDB 1YJNQ 2AK5A 3A8HB 4OMOA 3NGPA 1KC8R 1RAAB 1I5LA 1QP3A 1W70A 3CMEQ 1AVZC 2IG0A 3GNFB 1LNXA 3JCMc 1BI3A 3NFCA 2LVMA 3UA6A 4M75B 2DTHA 1Q81C 9ATCB 4Y92A 2L2PA 3OBWA 1PCXA 2VWFA 5LJ3e 3OYEA 2DIGA 5I2MA 3ULRB 4MMLA 2JTMA 2CZ0B 1EZZB 2RHUA 4GBQA 4P5NA 3P8DA 2NUPB 1H92A 4M77E 5J3BA 4IUQA 2IVWA 1V1CA 2CSQA 2MF2A 4KT0E 5HKCA 2JM9A 3QYGB 3GP8A 1JB0E 3JCMg 1M1GA 4D6WA 1OPKA 1M90C 2X3XD 4ESRA 3QUIA 1GCQA 1KQ2A 1VQNQ 1WXBA 3M0SA 1UHFA 3CD6A 1IGUA 2R57A 2AT1B 1TUCA 1Z9QA 3VV0A 1HSQA 4LNPA 1G5VA 4ZGJB 1SSHA 3HPWA 4PK4A 5HK3A 2KRNA 2DRKA 4JZ3A 5KYXB 3MEWA 1OX8A 2YLBA 1HK9A 3CCQQ 3EG3A 4F7UE 2QTVA 4PLIA 4J9GA 5LL6S 2P84A 2XDPA 4LD6A 1T3SA 1Q82R 4BDZA 1D3BB 4C0DC 1SRMA 3CCET 2MAMA 1MHNA 5LJ3j 3MEUA 2XK0A 1BI2A 6AT1B 1VQPQ 4M7AG 2P0KA 2J6FA 2QGGA 5LJ3h 2EKOA 1VQ7A 1MMNA 3P8HA 1KQSS 2HL3A 2K79A 1WJQA 1OPLA 1YN8A 2DEQA 4LN2A 1YIJT 1VQ9A 3VS3A 2DJQA 3QJ6A 2QYZA 2VC8A 4F04B 1RABB 1KD1R 2Z0WA 4ZN3A 3DLMA 4WTOB 1QCOA 5IAYA 3L1AA 2ZCFB 3GF5A 3DB4A 3PMIA 8AT1B 2HQXA 4PJOA 2L0AA 3JB9F 5IXFA 4CC4B 2M51A 3VS0A 4CC7A 3MP6A 2C0OA 4BB7A 1K76A 2C06A 3VS4A 1UEBA 2LCCA 3G71A 2L3SA 3M0UA 5EG2A 4GY5A 4C0FA 2FZGB 1H3ZA 2L3PA 4QQDA 1K9MU 2F2VA 1PKTA 4RTVA 2O9VA 3JCMX 5L23A 1V76A 4O6JA 2EPDA 2KY9A 2D9TA 2EFIA 1ACMB 2DXBA 1I5OB 1QVGS 5I21A 1OULA 4OVAA 4RTYA 3M9QA 5GAN8 3OSSC 3CPFA 4JJNK 1B07A 2RHIA 1Q81R 2FPFA 2EKHA 3C4SA 2ROLA 1VYVA 1I8FA 2DO3A 2NUTB 5CQYA 1HJDA 3G4ST 4RTZA 2VUBA 3QDFA 3EHRA 1RAEB 2YUQA 1Q86C 3HTRA 1VQ8A 1KQSA 1OU9A 1IB8A 4A4FA 1KHIA 5HCKA 5CIUA 4C5HA 4A53A 3CC7A 2YRVA 5IHNA 1T0HA 2CZ7B 1M90R 4TVRA 2NLUA 5GMKl 1SF9A 2DMOA 2KNBB 5I11A 2O4XB 2DILA 1JRIA 4C8QD 2YHTA 5FLXE 2DM1A 3OW2S 3CCRT 4Q5WA 1IREB 4II1A 2CP5A 1K8AC 1WPYA 2DD5A 1Y0MA 4M7AA 3RKYA 4BE0A 3FIFA 2RNAA 1K73C 1ZSZA 1N9SA 4PFOA 4C5IA 1G3SA 1S72Q 4PJOF 3V7SA 3E9FA 4DA4A 4CC2A 4DOVA 4Y91A 2CP3A 2DVJA 3QWYA 4C92C 3CCLT 5L8RE 2E6ZA 2RJEA 4ZNXA 1TSFA 2LQNA 2J05A 4A4KA 3CBOA 1UJ0A 3H0FA 4HVVA 4JJDA 1MUZA 1NBEB 2RJCA 4FIBA 1QVGA 1UUEA 4RUGA 3LWIA 1G8XA 3UWNA 1B34B 2XICA 1RADB 2D0QB 4LXCA 3CC4T 1XOVA 2PVOB 2EQJA 1D0ZA 3JCMV 3V8KA 1N8RC 1UECA 2M9UA 3M0PA 2ABLA 3WXMB 2GNCA 4FU6A 5GAOl 2ESWA 3QZ5B 4C92F 3EG0A 1OZ3A 1TU0B 2PTKA 1QLYA 2OTLA 3KFVA 2A7YA 2I2LA 2JMAA 2VYTA 5LJ3f 4C8QB 2KRMA 1YJ9T 3E9GA 3CCST 4JRIA 2LJ0A 1YCSB 1SSFA 1YJNT 4C92E 3CCEQ 1KHCA 1C1AA 2KYMA 1TS9A 4D8DA 2SEMA 2RH2A 3ZL7C 1ZX6A 2E5KA 3OW2A 4M77G 2VGMA 4IKFA 4ME7A 1U06A 2QA4T 1PD1A 2SRCA 2RN8A 2BIVA 4E7JA 1TWBA 2D8JA 1GBRA 1E7OA 1KFZA 5GAN7 3CCUQ 1YIJQ 3GLXA 4BI4A 4XU0A 2R5MA 5GAOp 1WHMA 4MZMA 1VQ6T 2VB6A
chains in the Genus database with same CATH topology
5CKDA 2R5AA 1Q7YC 1VQ5A 2E12A 2PUOB 2RI2A 3M4YA 4PKCC 4M7DE 2RHYA 5GMKm 1JBMA 2GFAA 4MZPA 4EDUA 3CXCS 1UGRB 2CYZB 3CCMA 3HKSA 2LRQA 3L2WA 1KD1C 3NTKA 4C0GA 5GANe 4PJOB 1UGQB 4NOYA 2DKGA 1WGSA 3NTHA 4IUPA 3RMSA 2M0OA 4M7DG 3X25B 3OS5A 3J7AF 3OYNA 1FWZA 3OSVA 2QDYB 3OS2A 3LGFA 2R58A 2M16A 1OI1A 4OP0A 5LJ5e 4BDYA 3M59A 3ZFJA 4BUGA 4M78D 1XNIA 3G7ZA 3ASKA 3RESA 3OYGA 2G3RA 5KH6A 3JCMe 4DQ2A 3JCMf 4JLGA 3CCQT 5D6WA 4M77C 4RCBA 2E1HA 2FHDA 1VQ4A 1BYMA 2LCLA 3CBMA 4QQGA 2XI9A 1YI2T 2EJ9A 2E65A 4QVCA 3FRNA 4M7AD 4HCBA 2F5KA 4E7IA 2DPPB 3QYHB 4X9CA 1YITT 5D6XA 3CD6T 4WF2A 5KE3A 4M75C 4Y28E 1U8RA 2F69A 3CC2A 4PJOE 1O75A 2EWNA 2O4XA 4ZTJA 3OYKA 2QQAA 4RG2A 1VQOT 2GFUA 2WSFE 3OQ5A 3CMEA 1K8AU 1NJIC 3VUBA 4N0AC 5D6YA 3VKIA 3G4SA 1WQWA 2ZPFB 2EAYA 2B8AA 3FLGA 2KSSA 3QJYA 2XDBA 3I56A 4XU1A 3G6ET 5LJ3d 4PJOG 4PL6A 2ZPHB 4FL6A 1VQ8T 3LWHA 3QIIA 2GQVA 4C5EA 5FU6C 1M1KU 2DXCA 3TU4K 1R8OB 2O01E 3URGA 3RERA 2LX9A 3A5ZB 2EQMA 1YHQA 3OYHA 1OYXA 3CC7T 2LQKA 4RG8A 4OF1A 3WVDB 3A8HB 5GAOn 2WSEE 3BDLA 3SB2A 3GPLA 2K2VA 2XIDA 1BI0A 2LNVA 1I5LA 3RMQA 1QP3A 1ZHIA 4FSXA 5A0LA 5GAMj 4IURA 2IG0A 4ZTFA 4M78C 3GNFB 1ZBXA 3BFMA 1LNXA 2FB7A 2K3YA 1BI3A 3JCMc 3NFCA 1KG1A 2LVMA 1YCYA 2GCXA 4OB1B 1BKBA 5GANj 4M75B 2DTHA 2PVGB 1Q81C 4M7AC 3M56A 4XU2A 5GAMh 3OBWA 3ER0A 3CCRA 5GAOm 5CO7A 5LJ3e 3OYEA 5GANh 3CPWS 2DIGA 1XQHA 5I2MA 4BI3A 1VQNA 5LJ5j 1YBYA 4MMLA 2JTMA 2CZ0B 2PU9B 3OYLA 5GANg 2RHUA 2QEXT 2E5QA 5FU6B 3A8GB 4P5NA 1QVFS 4PLLA 2LDMA 3P8DA 4J8OA 5DM7R 3NTIA 3OS0A 3CCUA 1BIBA 4M77E 5J3BA 5IN1A 1B34A 2PQWA 4IUQA 2XG8D 2IVWA 3EAEA 5DY9A 1QP2A 3T9NA 3TEEA 5LJ5h 2MF2A 5CR2A 1G3WA 3BY7A 3F70A 3L2ZA 1VQMT 5LJ5g 2RK1A 1JJ2A 4KT0E 4C5GA 5HKCA 3JB9D 5GAN2 4F7UB 1YJWT 3QYGB 4M75E 3SD4A 2JZ2A 3GP8A 1JB0E 2QQSA 3SWNB 1M1GA 1VIFA 1VUBA 2E41A 2ZGWA 3JCMg 4D6WA 3CXCA 3JCMW 4M78B 1M90C 4QVZA 3C94A 3HRTA 3JB9I 4CRIA 2CZ1B 3QUIA 1BI1A 3MO8A 4C92A 3HL8A 1KQ2A 1N27A 4M75G 4M78F 5GAN4 3CD6A 3FJPA 4M7AB 2R57A 3ZEHA 2DIQA 3VV0A 3CCJA 4N4HA 2PUKB 2QTXA 2L8DA 1Y07A 3EFRA 4HKEA 3JB9J 1G5VA 4FT2A 4ZGJB 5GAOq 1ZQ1A 4M7AF 3HPWA 5HK3A 4XAXB 3CBPA 3M53A 3MP1A 4XTUA 3JAME 3SFMA 3MEWA 4L6V5 4BACA 5CKHA 1VQPA 3P8BB 4ATOA 4JRPA 2YLBA 4E7LA 1HK9A 4E7KA 2OTJA 5AYFA 4F7UE 4C8QA 4PLIA 3QXEB 2K57A 3CC4A 3QSUA 1JJ2S 4M78E 5LL6S 1UB4A 2RI5A 3OBYA 2DAQA 4MDWA 2XDPA 4LD6A 3M57A 4BDZA 1D3BB 3OYYA 1P92A 4C0DC 4F7UG 3L2QA 2CZ6B 3I55T 3JCMJ 1Q86U 3CCET 4M7AE 3OMCA 4M78G 1O9SA 1NE8A 3E19A 5CKBA 5CAIA 3PIOA 3GOXA 4EPCA 2MAMA 1MHNA 5LJ3j 1VQKT 3QHSA 3MEUA 2XK0A 3CCVT 3UPUA 2OTLT 3V7CA 1BI2A 4M7AG 4N4GA 2E10A 5CK9A 1NPPA 3RKWA 1M5Q1 2P0KA 4X34A 3OYBA 2E70A 4M7DA 2GF7A 3MCAB 1FX7A 3LLRA 5LJ3h 4QQ6A 2EKOA 5IT9E 1VQ7A 5LJ3g 3P8HA 1KQSS 1YJ9A 3VYHB 1WJQA 1VQLT 2V8IA 4LD9K 3CCSA 3MHXA 1NZ9A 2LT4A 2DEQA 1U1SA 4XK8E 1M1KC 2MMPA 4BY6B 1YIJT 1YJNA 1VQ9A 1N9RA 2QQRA 4IUTA 5FU7C 3X20B 4BE1A 3QJ6A 2ZPBB 3H6ZA 1Q7YU 1Y96B 2VC8A 3WVEB 4HT9A 4X9DA 3AHUA 4HT8A 4C0DB 4ZN3A 4FM4B 3CMAT 2RHXA 3DLMA 3PGGA 4DOWA 4ELZC 1H641 4IUVA 2E6NA 3CPWA 5GAN5 1K73U 4KBMB 5IAYA 3L1AA 2QA4A 2ZCFB 3OYMA 1Y7XA 2HNIA 3GF5A 1X75C 3DB4A 3PMIA 1QVFA 2RK2A 2HQXA 1MGQA 4JRKA 1FXXA 4PJOA 3JB9F 2HBPA 4EMKB 2JUFA 2FYKA 4EMHA 2VV5A 3MP6A 4BB7A 3S6WA 4MZTA 3J81E 5FRNA 2C06A 1UEBA 3SWNC 2LCCA 2Y4YA 2FL7A 4J7FA 4VUBA 3G71A 1S72T 1KC8U 5EG2A 4GY5A 1QW1A 4QW2A 4C0FA 3OYJA 2RB6A 4L5GA 1VQ6A 3RKXA 2AHJB 5FU7B 1H3ZA 3X28B 1N6AA 2P4TA 5C0MA 4QQDA 1VQ5T 4V2SA 5CKFA 5CCAA 3BW1A 2XU8A 3QZ9B 3V8LA 1NJIU 3M4GA 3FB9A 1K9MU 4JRQA 4OMFB 3OY9A 2CGHA 4PJOD 3CCMT 2X4JA 3HHTB 3ME9A 2X4YA 4J6WA 5GAN3 3LW5E 3VUZA 3PNWC 2DZCA 3GIBA 3JCMX 4O6JA 5DLQE 1WJSA 2KY9A 2KVQG 2D9TA 3JB9G 1WJRA 2M1HA 2MWOA 5KCOA 3OYAA 2EFIA 2DXBA 4E7HA 1QVGS 4RCCA 2RJDA 2X35A 5I21A 1N8RU 2ZPIB 5GMKi 3GNGA 4OGEA 3JCMh 4OVAA 3M9QA 3PT9A 5GAN8 2H3JA 1VQ4T 3OSSC 3HFNA 2EYQA 4XTVA 1M9SA 3RIRA 2K5FA 1U1TA 3CPFA 4JJNK 3KBGA 3CEYA 3OA6A 2RHIA 3M55A 4HA8A 1YI2A 4UC4A 4XTZA 3EFSA 2L3RA 1GXIE 3MEAA 4M77A 4ZGDB 3C4SA 3J80E 1YITA 4ELYC 4J6YA 3FDRA 3M58A 2JVVA 2K5LA 3BDUA 1I8FA 2DO3A 3C95A 1PSEA 2DJZA 5CQYA 3L2UA 3CMET 3OMGA 1VQOA 2ZPGB 2OAUA 5HY6A 2DXTA 2BUDA 2VUBA 4J7IA 3G4ST 4JUVA 5J26A 4CI0C 4JLIA 4M75A 5GAMd 3I56T 4JS4A 1G3TA 2LTOA 2VXFA 2BKDN 1V29B 3VU3C 4IUUA 2LC4A 2EJFA 3X26B 3G6EA 1Q86C 1VQ8A 1KQSA 3JCMb 2HAXA 5KE2A 2XDDA 4J83A 1X6OA 1VIEA 4N0AA 2EQKA 3OS1A 1EIFA 4JDSA 4BY6C 4NS5A 5A0GA 5GMKe 4A4FA 1BIAA 1KHIA 3MP8A 1YHQT 4C92D 2JN0A 2P0PA 2DK3A 3ZBDA 2DTOA 5CIUA 4C5HA 2D6FA 4M77D 4A53A 3CC7A 2RI3A 5GAN6 2YRVA 4RMOA 2CZ7B 3A8MB 4TVRA 4LDWA 3OB9A 3QBYA 2NLUA 5CVIA 1Q82U 2V8KA 5FROA 5GMKl 3L2RA 2DVEA 2KQWA 2VGNA 2O4XB 4M75D 1I4K1 3L2VA 2WACA 2YLCA 1JRIA 4F7UA 4KUDK 3LGLA 3SWNA 3L42A 1TH7A 1W2BS 4A54A 4M78A 4C8QD 2MWPA 2YHTA 4OGCA 3QG1A 4B9WA 5FLXE 4EMKC 4Q5WA 1IREB 5CQXA 5GAMe 5GAMf 3CCRT 3OW2S 2XHCA 4II1A 1K8AC 1WPYA 4EMGA 2DD5A 3HRSA 1VQNT 4M7AA 2FVUA 4ZGEB 3UDCA 2L89A 5GANf 3RKYA 3JCMP 4BE0A 1OZ2A 3FIFA 3A8LB 2RHZA 2QEXA 1K73C 3CCUT 4C0ZA 2JOYA 2X4WA 4MDXA 3META 1G3YA 2RJFA 1N9SA 4C5IA 2QXFA 1G3SA 2E64A 5GAOr 4PJOF 4XTWA 4QVDA 2HD0A 4N4IA 3V7SA 3E9FA 4Z02A 4DA4A 4KUIA 5LJ5f 4DOVA 1RL2A 3JSCA 4Y91A 3M54A 3PIPA 1VQMA 3CCLT 4C92C 3O8VA 3PFSA 1KD1U 4M7DD 1QVPA 3LX7A 5L8RE 2E6ZA 3UT1A 2RJEA 1PSFA 3FEOA 4BE2A 1YJWA 4LDVA 3KUFA 3QKJA 2Y4XA 1KC8C 3QO3A 2JNGA 1D3BA 4KULA 3OYIA 4A4KA 3CBOA 3HRUA 4OB2B 1HXDA 3MEVA 3OYDA 4RKUE 2RJCA 4FIBA 3V7RA 5KCHA 3CCJT 1QVGA 3S3OA 3S3NA 4LDXA 2CKKA 5GMKj 1M8VA 3LWIA 1K9MC 3UWNA 2HQEA 3TCJA 1RI0A 3LH0A 3TREA 4C8QC 1B34B 2XICA 1DJ7B 1VQPT 4NL2A 3INZA 1IZ6A 4BD3A 3PTAA 3FC3A 3JB9H 4GLKA 1WNLA 2D0QB 2OTJT 2RD1A 4LDUA 5GMKh 4XQ3A 2LT1A 1LJOA 3VJPA 1AHJB 2QQ9A 3CC4T 1XOVA 1NPRA 2XD0A 2PVOB 2EQJA 2V8JA 3V8JA 2KDSA 3QPHA 2QI2A 3JCMV 3V8KA 1N8RC 2M9UA 5I2SA 4A4EA 4MMKA 4C92B 4R56A 2L5QA 1LOJA 1W4SA 2X4XA 4M77B 4OB0B 4FU6A 3WXMB 4B9XA 5GAOl 1Y96A 5A2QE 3I55A 3CCEA 3H8ZA 4HCZA 3QZ5B 4C92F 3DB3A 3SDZA 4LDYA 4A4GA 1OZ3A 3DKMA 1UGSB 2PVDB 3HFOA 4M7DC 4O5VA 2P0QA 4M77F 1VQKA 2VXEA 3CCVA 2EJGA 4FT4A 5C6SA 2OTLA 3OYCA 3E1SA 4XTXA 2KAFA 4BI8B 2DZ9A 3C12A 3M5AA 3QDRB 2A7YA 2I2LA 4M75F 5GAMg 2ZPEB 1VQ7T 4YTLA 2VYTA 5LJ3f 4C8QB 3Q1JA 2KMTA 1YJ9T 4JS5A 2XKOC 3JRZA 3CCLA 2DTIA 2RA2A 3E9GA 4EMKA 3CCST 4OB3B 4JRIA 1VQLA 4C8QF 1SSFA 1YJNT 3X24B 4C92E 1KHCA 3KXTA 1VQ9T 1Q81U 3CC2T 1YIJA 4NL3A 2K5IA 2F5TX 2QQBA 1W2BA 2A3LA 2RH2A 5A0DA 4ZN1A 4C92G 2ZZDA 4A4HA 5DLOA 3OW2A 1WQ7A 2Y90A 1KQ1A 3LYIA 4M77G 2VGMA 3CMAA 4IKFA 4J6XA 4ME7A 5FRMA 3HP9A 4E47A 1Q82C 5CKEA 2JTFA 2QA4T 4PJOC 2DD4A 5J39A 5GANd 4J5YA 4M7DB 4F7UF 4R55A 2K3XA 2BIVA 4E7JA 5HK0A 4C8QE 1M1FA 1M4ZA 3VYGA 2DXUA 4M7DF 2RM4A 2MI6A 2WSCE 5GAN7 2CS7A 3RUXA 3GLXA 4BI4A 3PMTA 5LJ5d 4XU0A 4XU3A 2EQUA 4C8QG 4L59A 2R5MA 5GAOp 3G71T 1M90U 1XTDA 2LQ8A 1Y71A 3JCMd 3OYFA 3HSBA 1S72A 2K4YA 4HCCA 4MZMA 4PNOA 1VQ6T 4XTYA 3S3MA 3CCQA 1I81A 3JCMQ 3DLLA 1X01A 2EIFA 2RO0A 2KK4A 1UGPB 3A8OB 5M9OA 3R6OA 3N5BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V2S A;  4M78 B;  3BW1 A;  3V8L A;  3JB9 I;  3M4G A;  3FB9 A;  3QO3 A;  5GMK m;  1D3B A;  1JBM A;  3QUI A;  4C92 A;  2CGH A;  1KQ2 A;  4PJO D;  4M75 G;  4M78 F;  4J6W A;  1HXD A;  5GAN 4;  3FJP A;  4M7A B;  5GAN e;  5GAN 3;  3V7R A;  4PJO B;  2DZC A;  4NOY A;  3GIB A;  3JCM X;  2DKG A;  3JB9 J;  4M7D G;  2QTX A;  3EFR A;  5GMK j;  3JB9 G;  1M8V A;  5GAO q;  4M7A F;  4XTU A;  4C8Q C;  1B34 B;  4RCC A;  5I21 A;  4NL2 A;  3INZ A;  4OP0 A;  5LJ5 e;  5GMK i;  3JB9 H;  2YLB A;  1WNL A;  3JCM h;  1HK9 A;  4M78 D;  2RD1 A;  3RES A;  5GMK h;  4XQ3 A;  4F7U E;  1LJO A;  3JCM f;  4DQ2 A;  3JCM e;  4C8Q A;  5GAN 8;  4M77 C;  2K57 A;  4RCB A;  2E1H A;  3V8J A;  3QSU A;  3HFN A;  4M78 E;  4XTV A;  3RIR A;  1U1T A;  2E65 A;  2EJ9 A;  3JCM V;  3V8K A;  4QVC A;  4M7A D;  4HA8 A;  4XTZ A;  3EFS A;  1D3B B;  4MMK A;  4C92 B;  4X9C A;  4F7U G;  4M77 A;  1LOJ A;  4WF2 A;  3JCM J;  4M75 C;  4M77 B;  4J6Y A;  4M7A E;  5GAO l;  1Y96 A;  4M78 G;  4PJO E;  3BDU A;  1I8F A;  2EWN A;  5CAI A;  2DJZ A;  4C92 F;  3HFO A;  5LJ3 j;  4M7D C;  2DXT A;  3QHS A;  4M77 F;  4N0A C;  4JUV A;  1WQW A;  2VXE A;  2EAY A;  4JLI A;  4M75 A;  3V7C A;  5GAM d;  2EJG A;  4M7D E;  4M7A G;  2VXF A;  4XU1 A;  2E10 A;  4PJO G;  5LJ3 d;  2EJF A;  1M5Q 1;  3RKW A;  3VU3 C;  4XTX A;  3JCM b;  2DZ9 A;  4M7D A;  4N0A A;  2I2L A;  5LJ3 h;  4M75 F;  5GAM g;  5GMK e;  3RER A;  1BIA A;  5LJ3 f;  4C8Q B;  5LJ3 g;  4C92 D;  2JN0 A;  2DTO A;  2DTI A;  2RA2 A;  4M77 D;  4EMK A;  4A53 A;  4JRI A;  5GAN 6;  5GAO n;  4C8Q F;  2DEQ A;  1U1S A;  4C92 E;  3SB2 A;  1N9R A;  4NL3 A;  5GMK l;  1I5L A;  5GAM j;  1Y96 B;  2VC8 A;  4HT9 A;  2DVE A;  4M78 C;  4M75 D;  3BFM A;  4X9D A;  1I4K 1;  1LNX A;  2FB7 A;  3JCM c;  3AHU A;  4HT8 A;  2YLC A;  4C92 G;  1YCY A;  1JRI A;  4F7U A;  2Y90 A;  1WQ7 A;  5GAN j;  1KQ1 A;  3PGG A;  4M75 B;  1TH7 A;  1H64 1;  4M77 G;  3SWN A;  2DTH A;  4J6X A;  4M7A C;  4A54 A;  4M78 A;  4XU2 A;  4C8Q D;  5GAM h;  5GAN 5;  4PJO C;  2YHT A;  4EMK C;  3L1A A;  5GAN d;  5GAM e;  4J5Y A;  5GAM f;  4F7U F;  2HNI A;  4M7D B;  5GAO m;  1WPY A;  5LJ3 e;  4C8Q E;  4EMG A;  5GAN h;  4M7A A;  1MGQ A;  4JRK A;  5LJ5 j;  4MML A;  4PJO A;  2DXU A;  5GAN f;  2RM4 A;  3RKY A;  5GAN g;  3JCM P;  3FIF A;  3JB9 F;  4M7D F;  4EMK B;  5GAN 7;  3RUX A;  2FYK A;  4EMH A;  5LJ5 d;  4XU0 A;  1BIB A;  1N9S A;  4M77 E;  4XU3 A;  4C8Q G;  1B34 A;  3SWN C;  2E64 A;  5GAO p;  4PJO F;  5GAO r;  4XTW A;  5DY9 A;  4QVD A;  3JCM d;  3HSB A;  5LJ5 h;  3V7S A;  3BY7 A;  4PNO A;  3L2Z A;  4XTY A;  5LJ5 f;  5LJ5 g;  2RB6 A;  1I81 A;  4Y91 A;  3JCM Q;  1X01 A;  3JB9 D;  3RKX A;  4C92 C;  5GAN 2;  4F7U B;  4M75 E;  4M7D D;  3JCM g;  3SWN B;  2ZGW A;  2E41 A;  3JCM W; 
#chains in the Genus database with same CATH topology
 2O9S A;  1PWT A;  1QWF A;  1Q86 R;  3R6N A;  3CXC S;  3CCM A;  3HKS A;  2LRQ A;  3FJ5 A;  5GAN e;  1ARK A;  1UGQ B;  4M7D G;  3AT1 B;  2QDY B;  1D1A A;  1OI1 A;  5LJ5 e;  3M59 A;  1BBZ A;  3CQT A;  3RES A;  5IHI A;  3CCQ T;  1M2O A;  4JLG A;  4E7S A;  2FHD A;  4QQG A;  3FRN A;  2F5K A;  1YIT T;  2VKN A;  2M0Y A;  2V26 A;  4WF2 A;  4Y28 E;  2F69 A;  4A63 B;  1K8A R;  2EWN A;  3VS2 A;  1VQO T;  1VYT A;  3CME A;  1K8A U;  4N0A C;  8ATC B;  3VKI A;  2EAY A;  1JU5 C;  1K73 R;  3G6E T;  4LUD A;  4XU1 A;  2DLP A;  5LJ3 d;  4PL6 A;  4FL6 A;  2DL3 A;  2GQV A;  1M1K U;  2YXY A;  2QAZ A;  3URG A;  3RER A;  3OYH A;  4B6M A;  1YWP A;  4RG8 A;  2HMA A;  1PRM C;  2WSE E;  3GPL A;  2K2V A;  2XID A;  3VS1 A;  4ZTF A;  4IUR A;  4M78 C;  3BFM A;  2DBM A;  2K3Y A;  1YCY A;  5GAN j;  4RTX A;  1A0N B;  4OML A;  1WYX A;  1RAG B;  3NPF A;  5GAN h;  1VQN A;  5LJ5 j;  3OYL A;  2QEX T;  2MPX C;  2E5Q A;  3UF4 A;  1N8R R;  5IN1 A;  3H0I A;  5KYW B;  3T9N A;  3EAE A;  5LJ5 h;  3M0T A;  1VQM T;  1JJ2 A;  5GAN 2;  4DBH A;  1QVG P;  4F7U B;  1YJW T;  3SD4 A;  2JZ2 A;  3CCQ A;  3JB9 D;  2ZGW A;  1VIF A;  3EGX A;  3CXC A;  3EFO B;  2RQV A;  2E3H A;  2CZ1 B;  1BI1 A;  4M75 G;  4M78 F;  2YUO A;  5GAN 4;  1M27 C;  2BZY A;  1ZA2 B;  4JJC A;  2K9G A;  3CCJ A;  2PUK B;  2QTX A;  2L8D A;  1Y07 A;  3EFR A;  2VAS A;  4FT2 A;  4RTU A;  1MV3 A;  3SFM A;  2CH4 A;  5CKH A;  1VQP A;  4ATO A;  5IH2 A;  4QT7 A;  3IQL A;  4M78 E;  1UB4 A;  2RI5 A;  1AWO A;  2DAQ A;  3OYY A;  4M4Z A;  3I55 T;  3OMC A;  1NE8 A;  3PIO A;  5CAI A;  1VQK T;  3CCV T;  3UPU A;  1WHJ A;  4N4G A;  4F16 A;  1M5Q 1;  2E70 A;  4M7D A;  1FX7 A;  2D8H A;  1WI7 A;  2KEA A;  1UDL A;  3VYH B;  1VQL T;  3MHX A;  1NZ9 A;  1U1S A;  4BY6 B;  2QQR A;  4IUT A;  5FU7 C;  4BE1 A;  2CP6 A;  2ZPB B;  4HT9 A;  3AHU A;  4C0D B;  1OX9 A;  3CMA T;  4AG2 C;  4ELZ C;  4IUV A;  2E6N A;  1MMD A;  1X75 C;  2CT4 A;  4DEX A;  3VS5 A;  1YJ9 Q;  4QKU A;  2RK2 A;  2KYB A;  2A36 A;  3CCS Q;  3C0C A;  2HBP A;  4EMK B;  1Y57 A;  2VV5 A;  4MZT A;  2A0F B;  2CRE A;  4AG1 C;  1S72 T;  1CSK A;  1R0B G;  1KC8 U;  3RNJ A;  2RB6 A;  4L5G A;  3RKX A;  2AHJ B;  1N6A A;  2QA4 Q;  4V2S A;  2DE0 X;  2XU8 A;  3QZ9 B;  3V8L A;  2J6K A;  3M4G A;  4PJO D;  3THK A;  2CP2 A;  1BU1 A;  2X4Y A;  5GAN 3;  2H3E B;  3PNW C;  5DLQ E;  2KVQ G;  1X6B A;  5KCO A;  1K0X A;  1VQ6 Q;  2ZPI B;  3MKD A;  5GMK i;  3GNG A;  1TUD A;  2DL4 A;  2EYQ A;  1M9S A;  2DNU A;  2V1R A;  3KBG A;  2K3B A;  1GBQ A;  2L3R A;  4DEY A;  3J80 E;  2OAW A;  3FDR A;  1WXT A;  3BDU A;  2ED0 A;  1PSE A;  1AT1 B;  2DJZ A;  2ZPG B;  2DXT A;  4J7I A;  5J26 A;  4CI0 C;  3EGU A;  4JLI A;  4M75 A;  1G3T A;  1UTI A;  1V29 B;  3VU3 C;  3X26 B;  2HAX A;  5KE2 A;  2XDD A;  4J83 A;  1GL5 A;  3OS1 A;  1EIF A;  4BY6 C;  2HKQ B;  5GMK e;  1BIA A;  1YHQ T;  3MP8 A;  4C92 D;  2JN0 A;  2DK3 A;  2DTO A;  1NEB A;  1WLP B;  1WZO A;  2G6F X;  5GAN 6;  1YIT Q;  4RMO A;  2X51 A;  2NUP A;  4J9F A;  1ZSG A;  1Q82 U;  2GTJ A;  5AT1 B;  1VQO Q;  3L2V A;  3O5Z A;  4KUD K;  3G6E Q;  3L42 A;  1TH7 A;  2DEU A;  2MWP A;  4EMK C;  2FRY A;  5GAM e;  5CQX A;  1PNJ A;  4EMG A;  2QK0 A;  3UDC A;  5GAN f;  3JCM P;  1OEB A;  3VRY A;  3CXC P;  2RHZ A;  2LQW A;  3CCU T;  4MDX A;  3MET A;  1G3Y A;  5KYX A;  4XTW A;  2HD0 A;  2K6D A;  2DFU A;  5FWB A;  1GFD A;  5LJ5 f;  4FW2 A;  1RL2 A;  1KD1 U;  2JS0 A;  3PIP A;  3O8V A;  3PFS A;  2A37 A;  3LX7 A;  2BZ8 A;  5KYY B;  1PSF A;  2CUD A;  1VQ5 Q;  4LDV A;  3KUF A;  3QO3 A;  2JNG A;  1D3B A;  4OB2 B;  1HXD A;  3MEV A;  2QEX Q;  3OYD A;  5KCH A;  3S3O A;  5GMK j;  1M8V A;  1RLP C;  2HQE A;  3TCJ A;  1M8M A;  1DJ7 B;  3A1P A;  3PE0 A;  4J9B A;  1VQM Q;  3PTA A;  4GLK A;  2OTJ T;  3EG9 B;  4LDU A;  5GMK h;  2K2M A;  1YJW Q;  2AZV A;  1LJO A;  2LT1 A;  3I35 A;  3VJP A;  1AHJ B;  2QQ9 A;  3H0H A;  1ABO A;  2XD0 A;  3V8J A;  2QI2 A;  1KK7 A;  4C92 B;  1M3C A;  2L5Q A;  2X4X A;  3CCE A;  3H8Z A;  1BCM A;  4HCZ A;  4R0K A;  3SDZ A;  4LDY A;  2PVD B;  2P0Q A;  1UG1 A;  2FO0 A;  2HQH A;  4FT4 A;  1W1F A;  1AOJ A;  4XTX A;  4BI8 B;  1JO8 A;  1X6G A;  1G2B A;  4M75 F;  2ZPE B;  4PJL A;  1FMV A;  2D1X A;  4OB3 B;  2LZ6 B;  3KXT A;  3I55 Q;  1TXQ A;  3TSW A;  1Q81 U;  1YIJ A;  1YFN A;  4NL3 A;  2K5I A;  2F5T X;  1SRL A;  2AIR B;  1VQK Q;  3CCV Q;  4OMM A;  2OI3 A;  5DLO A;  1KQ1 A;  3HP9 A;  2HEQ A;  5CKE A;  4PJO C;  2DD4 A;  5GAN d;  4J5Y A;  4R55 A;  2JJ9 A;  5HK0 A;  1M1F A;  1M4Z A;  4LUE A;  4DBR A;  1SEM A;  1JEG A;  4HCK A;  2DXU A;  1VQL Q;  1XJW B;  2WSC E;  3PMT A;  5LJ5 d;  2EYY A;  4C8Q G;  3PVL A;  2MK5 A;  1M90 U;  1LPL A;  1XTD A;  2LQ8 A;  1Y71 A;  3OYF A;  3HSB A;  4PJN A;  1X2K A;  3CMA Q;  2RO0 A;  5M9O A;  1KIK A;  1UE9 A;  1Q7Y C;  2E12 A;  2RI2 A;  4PKC C;  1B3Q A;  1JBM A;  2GFA A;  1ZLM A;  1H3H A;  1GCP A;  2FG0 A;  4C0G A;  1HD3 A;  2MOX A;  2NUT A;  4FW1 A;  4OMP A;  2OX7 A;  3RMS A;  2M0O A;  1CKB A;  1C0M A;  3VS6 A;  3OYN A;  1FWZ A;  1RLQ C;  3OSV A;  3OS2 A;  2R58 A;  4BDY A;  2VVK A;  4BUG A;  2COW A;  1XNI A;  3G7Z A;  1WXU A;  3ASK A;  4M78 D;  3OYG A;  2G3R A;  3JCM e;  3BE3 A;  2LCL A;  3REB B;  1YI2 T;  4QVC A;  4HCB A;  2DPP B;  3QYH B;  2DYB A;  2ATC B;  2E4H A;  5KE3 A;  4PJO E;  1O75 A;  2O4X A;  4ZTJ A;  2GFU A;  1B7T A;  1NJI C;  3VUB A;  5D6Y A;  3G4S A;  2KSS A;  3QJY A;  4F14 A;  4HXJ A;  2LMJ A;  5FU6 C;  2O01 E;  3A5Z B;  2EGA A;  4FCY A;  2LQK A;  4OF1 A;  2HCK A;  3GBQ A;  1VQ9 Q;  3CC2 Q;  3SB2 A;  2LNV A;  5A0L A;  2QAS A;  1ZBX A;  2JMC A;  1H8K A;  2GCX A;  5I22 A;  1QWE A;  1VOM A;  2PVG B;  4M7A C;  3M56 A;  1JXM A;  3CCR A;  1YHQ Q;  3EGD B;  1K9A A;  2OJ2 A;  1XQH A;  4BI3 A;  1RI9 A;  3A8G B;  1QVF S;  4J8O A;  5DM7 R;  3SEM A;  2MIO A;  4AT1 B;  1B34 A;  2PQW A;  5DY9 A;  1QP2 A;  5CR2 A;  3BY7 A;  3L2Z A;  4C5G A;  3CCL A;  2QQS A;  3SWN B;  1VUB A;  3JCM W;  4M78 B;  4QVZ A;  1FYN A;  3JB9 I;  3MO8 A;  3HL8 A;  1N27 A;  3FJP A;  3ZEH A;  2DIQ A;  4N4H A;  5FWC A;  3JB9 J;  5GAO q;  4M7A F;  1ZQ1 A;  4D8K A;  3CBP A;  4XTU A;  1IO6 A;  4L6V 5;  1PM3 A;  4JPB W;  1ZUY A;  2CH4 W;  3P8B B;  4E7K A;  1S1N A;  1NLP C;  4C8Q A;  2K57 A;  2CT3 A;  1MNE A;  3CC4 A;  4DBQ A;  1JJ2 S;  1P92 A;  4F7U G;  3L2Q A;  1Q86 U;  4M7A E;  4FYV B;  1O9S A;  3E19 A;  5CKB A;  3GOX A;  1T3L A;  1UHC A;  2FRW A;  2DBK A;  3RBB B;  3V7C A;  5CK9 A;  3RKW A;  4FSS A;  1KSW A;  1Z9Z A;  3OYB A;  2OTJ Q;  2DL7 A;  2NUZ A;  1HYO A;  5IT9 E;  4GLM A;  2EQI A;  5LJ3 g;  2AKK A;  1YJ9 A;  1UGV A;  2V8I A;  3CCS A;  2CUB A;  4XK8 E;  1KQS P;  1Q7Y R;  2MMP A;  1YJN A;  1N9R A;  3H6Z A;  1Q7Y U;  2CP0 A;  1Y96 B;  3WVE B;  4HT8 A;  4K11 A;  4FM4 B;  2RHX A;  4DOW A;  3PGG A;  1H64 1;  1WA7 A;  1K73 U;  1RAF B;  2QA4 A;  2HSE B;  1NEG A;  4E2F B;  1QVF A;  1FMK A;  1AWX A;  4KGZ B;  2KGT A;  3PVQ A;  4EMH A;  3S6W A;  2C0T A;  3SWN C;  4J7F A;  4VUB A;  1QW1 A;  3OYJ A;  4HVW A;  1VQ6 A;  5FU7 B;  3X28 B;  1NJI R;  2P4T A;  1VQ5 T;  5CCA A;  1NJI U;  3FB9 A;  4OMF B;  2CGH A;  1M30 A;  2YWW A;  2X4J A;  3H9N A;  3HHT B;  3ME9 A;  1IRX A;  3VUZ A;  1G83 A;  2DZC A;  3JB9 G;  2EW3 A;  3TVT A;  4E7H A;  4RCC A;  2RJD A;  1N8R U;  2EYX A;  4ORZ A;  1MMG A;  1VQ4 T;  2H3J A;  1RAH B;  1YP5 A;  1SHG A;  4XTV A;  1UJY A;  3EHQ A;  1U1T A;  1NM7 A;  2AKL A;  3EFS A;  2KT8 A;  3MEA A;  4M77 A;  4ZGD B;  1PKS A;  1YIT A;  1K4U S;  4ANJ A;  2LP5 A;  1VQO A;  3QWX X;  1PG5 B;  5HY6 A;  1QCN A;  5KYU B;  5GAM d;  3I56 T;  2HKN A;  2LTO A;  3G6E A;  4IUU A;  2LC4 A;  2EJF A;  1JQQ A;  1X6O A;  2EQK A;  4JDS A;  4NS5 A;  2QDL A;  2P0P A;  1YI2 Q;  1SHF A;  2D6F A;  1X69 A;  2W10 A;  3A8M B;  4LDW A;  3OB9 A;  5CVI A;  2V8K A;  5FRO A;  5KYW A;  3L2R A;  1EFN A;  2DVE A;  3I5R A;  2VGN A;  4M75 D;  3M0R A;  1WHK A;  3M0Q A;  4F7U A;  1W2B S;  3EFO A;  4OGC A;  4B9W A;  2XHC A;  1M2V B;  1OQK A;  4Z89 A;  1N5Z A;  3OW2 P;  1T0J A;  3NHN A;  2L89 A;  1OZ2 A;  2FPE A;  2QEX A;  2DET A;  2RQW A;  5ECA A;  4C0Z A;  2X4W A;  1TG0 A;  2QXF A;  3H41 A;  4KUI A;  1VQM A;  3M54 A;  1YJW A;  3UT1 A;  3FEO A;  1BCO A;  3CCM Q;  1LCK A;  2YSQ A;  2KT1 A;  1ZUK A;  2C0I A;  3V7R A;  1X43 A;  4OMN A;  2CKK A;  1K9M C;  4OMQ A;  1RI0 A;  2FZC B;  4NL2 A;  3INZ A;  2GBQ A;  1WNL A;  1I1J A;  1U3O A;  2ENM A;  2H8H A;  3U23 A;  4AFU C;  4KH1 B;  2V8J A;  2YUN A;  3MJX A;  5I2S A;  4MMK A;  1LOJ A;  4OB0 B;  5A2Q E;  1GFC A;  2ED1 A;  3I55 A;  2YRD A;  3HFO A;  3DKM A;  4M7D C;  4O5V A;  1NG2 A;  4M77 F;  4RTW A;  1VQK A;  3CCV A;  1SKU B;  2EJG A;  4J9H A;  5C6S A;  3E1S A;  1IHV A;  2BTT A;  2DZ9 A;  2L3Q A;  2RPN A;  3M5A A;  4KRT A;  2JM8 A;  1VQ7 T;  1MND A;  2KMT A;  3Q1J A;  3JRZ A;  2DTI A;  2RA2 A;  4EMK A;  1VQL A;  1VQ9 T;  3CC2 T;  2DX1 A;  2QQB A;  1QVF P;  2F2W A;  1W2B A;  2A3L A;  2NYS A;  5A0D A;  4ZN1 A;  4C92 G;  2ZZD A;  5KYN A;  3CMA A;  4FYY B;  4J6X A;  5FRM A;  4F7U F;  2K3X A;  1OU8 A;  2CSI A;  2GGR A;  2MCN A;  4M7D F;  2CS7 A;  3RUX A;  4KH0 B;  1TOV A;  4XU3 A;  1F1B B;  2X9H A;  4L59 A;  3G71 T;  2KE9 A;  3JCM d;  1BK2 A;  4EIK A;  1S72 A;  2K4Y A;  4HCC A;  4PNO A;  1YNZ A;  4X1V A;  4XTY A;  3S3M A;  4KGX B;  1I81 A;  3JCM Q;  3DLL A;  2EIF A;  2KK4 A;  3A8O B;  3R6O A;  3N5B B;  5CKD A;  4PFZ A;  4M7D E;  2RHY A;  5GMK m;  2CYZ B;  1JJ2 P;  3NTK A;  1X27 A;  3CCJ Q;  4PJO B;  4Z8A A;  2DKG A;  1WGS A;  4IUP A;  2JTE A;  3X25 B;  3OS5 A;  3J7A F;  4PJJ A;  3LGF A;  4JJB A;  3ZFJ A;  4E6R A;  2V1Q A;  1GCQ C;  5KH6 A;  4DQ2 A;  1TTH B;  1BYM A;  3CBM A;  2XI9 A;  4AFZ C;  1BB9 A;  4M7A D;  2QG9 B;  1ABQ A;  2DL5 A;  4M75 C;  3CC2 A;  3OYK A;  2WSF E;  2KI7 A;  4F17 A;  1VA7 A;  1WQW A;  4FYX B;  1VQ8 T;  2ZPH B;  5EC7 A;  3LWH A;  1AWW A;  4C5E A;  2M02 A;  3TU4 K;  1VQ4 Q;  1R8O B;  1WHH A;  1YHQ A;  3NMZ C;  1OYX A;  3G1J A;  3CC7 T;  2EVR A;  1LVK A;  2JT4 A;  2BE7 D;  5GAO n;  3BDL A;  4IIM A;  1PRL C;  1BI0 A;  3RMQ A;  1ZHI A;  1EX4 A;  4FSX A;  5GAM j;  2CP7 A;  2D0N A;  1WIE A;  2FB7 A;  1KG1 A;  2NWM A;  3I56 Q;  4OB1 B;  1BKB A;  5KYY A;  1K9M R;  1E6G A;  2GTO A;  4XU2 A;  5GAM h;  5FW9 A;  3ER0 A;  2W0Z A;  2FPD A;  5CO7 A;  5GAO m;  2YRC A;  3CPW S;  2YT6 A;  1YBY A;  2PU9 B;  5GAN g;  2RQT A;  2EBP A;  2KRO A;  5FU6 B;  1QKW A;  4PLL A;  2LDM A;  3OS0 A;  3NTI A;  3CCU A;  1BIB A;  5IXB A;  3UAT A;  2XG8 D;  3TEE A;  1G3W A;  3F70 A;  2O2O A;  3EG9 A;  2COZ A;  2RK1 A;  4CC3 A;  5LJ5 g;  1D0X A;  4M75 E;  2PZ1 A;  2E41 A;  1X2Q A;  1OOT A;  3C94 A;  3HRT A;  4CRI A;  1MMA A;  2YUP A;  4C92 A;  3D7S B;  3EG2 A;  4M7A B;  2DYI A;  4AFS C;  4J9I A;  4HKE A;  1ZSZ B;  2O88 A;  4XAX B;  3M53 A;  3MP1 A;  3JAM E;  1MV0 B;  2P4R A;  4BAC A;  4JRP A;  4E7L A;  2OTJ A;  5AYF A;  2F2X A;  3QXE B;  3QSU A;  2ROT A;  1C6V X;  3OBY A;  4MDW A;  3M57 A;  4HVU A;  3CD6 Q;  1K0S A;  2ECZ A;  3JCM J;  2CZ6 B;  1E6H A;  4M78 G;  1VYU A;  4EPC A;  1QKX A;  3QHS A;  3VS7 A;  2OTL T;  1ZBJ A;  1D1C A;  2E10 A;  1NPP A;  4X34 A;  2HBW A;  1CKA A;  2GF7 A;  3MCA B;  3LLR A;  4QQ6 A;  2LJ3 A;  1W2B P;  3E2U A;  2LCS A;  4LD9 K;  1RUW A;  1YWO A;  2F1L A;  2LT4 A;  1M1K C;  3X20 B;  2RQR A;  4X9D A;  2KRS A;  1Q95 G;  3CPW A;  5GAN 5;  4KBM B;  1WDX A;  2DA9 A;  3OYM A;  1VQ7 Q;  1Y7X A;  2HNI A;  1M3B A;  1PD0 A;  1MGQ A;  3EG1 A;  4JRK A;  1FXX A;  2JUF A;  2FYK A;  3TQ7 P;  2RQU A;  3J81 E;  5FRN A;  1I0C A;  3EH1 A;  1IXD A;  2Y4Y A;  2FL7 A;  2BE9 B;  2CDT A;  4QW2 A;  1SG5 A;  2YDL A;  4J9E A;  4LE9 A;  5C0M A;  3TSZ A;  5CKF A;  3BW1 A;  4JRQ A;  3OY9 A;  1ZSZ C;  3CCM T;  4KGV B;  1QQJ A;  4J6W A;  3LW5 E;  2BZX A;  3GIB A;  1AD5 A;  1WJS A;  1WJR A;  2M1H A;  2MWO A;  1ZUU A;  3G71 Q;  3OYA A;  1R0C B;  2X35 A;  1D09 B;  4OGE A;  3JCM h;  2A28 A;  3PT9 A;  3HFN A;  3RIR A;  2KBT A;  2K5F A;  3EH2 A;  3CEY A;  3OA6 A;  1YI2 A;  3M55 A;  2HSP A;  4HA8 A;  4UC4 A;  4XTZ A;  1GXI E;  2I0N A;  2LX7 A;  4ELY C;  4J6Y A;  1RAC B;  3M58 A;  1D1B A;  2EYW A;  2JVV A;  2K5L A;  2RF0 A;  3C95 A;  3L2U A;  3CME T;  3OMG A;  2OAU A;  2BUD A;  4JUV A;  4AFQ C;  4JS4 A;  2VXF A;  5GJW B;  2BKD N;  3JCM b;  1VIE A;  4N0A A;  2JXB A;  5A0G A;  2JW4 A;  3EGD A;  3ZBD A;  1NYF A;  2FZK B;  4IIO A;  4M77 D;  2RI3 A;  1D0Y A;  1GRI A;  3QBY A;  2KXD A;  3RDV A;  2KQW A;  1I4K 1;  2WAC A;  2YLC A;  3LGL A;  3SWN A;  1VQ8 Q;  4A54 A;  4M78 A;  1NLO C;  1NYG A;  3QG1 A;  5GAM f;  2DER A;  3HRS A;  1VQN T;  3CC7 Q;  2FVU A;  4J9D A;  1AWJ A;  4ZGE B;  3REA B;  2EGC A;  1KJW A;  2XMF A;  3A8L B;  2RMO A;  2JOY A;  4J9C A;  2LJ1 A;  2RJF A;  2B86 A;  1M3A A;  5GAO r;  2E64 A;  4QVD A;  5D7U A;  4N4I A;  2X3W D;  4Z02 A;  3UA7 A;  2J06 A;  3JSC A;  5GJV B;  4M7D D;  1IGQ A;  1QVP A;  4BE2 A;  2FEI A;  3I5S A;  3QKJ A;  2Y4X A;  1KC8 C;  4KUL A;  3OYI A;  3MPU B;  3HRU A;  3JV3 A;  4RKU E;  3CCJ T;  4AMC A;  3S3N A;  4LDX A;  3LH0 A;  3TRE A;  1AZE A;  4C8Q C;  1M1K R;  1VQP T;  1IZ6 A;  4BD3 A;  3FC3 A;  3JB9 H;  2RD1 A;  4XQ3 A;  1NPR A;  4WCI A;  3EGX B;  2KDS A;  1K1Z A;  3QPH A;  1QMC A;  4A4E A;  4R56 A;  1W4S A;  1WHG A;  4M77 B;  4B9X A;  1Y96 A;  1I07 A;  3SHW A;  2EYZ A;  3DB3 A;  4A4G A;  3G4S Q;  1J3T A;  1UGS B;  2VXE A;  3OYC A;  4JZ4 A;  2KAF A;  1IHW A;  3C12 A;  1WFW A;  3QDR B;  5GAM g;  3I9Q A;  4YTL A;  2HZY A;  4JS5 A;  2XKO C;  3A98 A;  4C8Q F;  2EGE A;  7AT1 B;  3X24 B;  3CPW P;  2MYS A;  1U5S A;  2OTL Q;  2COY A;  2AZS A;  4A4H A;  1PC0 A;  1WQ7 A;  2Y90 A;  3LYI A;  2J6O A;  1Q82 C;  4E47 A;  2DRM A;  1JXO A;  2JTF A;  3CCR Q;  5J39 A;  2J7I A;  4M7D B;  4C8Q E;  1TUG B;  3VYG A;  2GQI A;  2RM4 A;  2MI6 A;  4Z88 A;  2IIM A;  2ZAE A;  2EQU A;  1AZG B;  1PHT A;  2HL5 C;  4PJM A;  3CCL Q;  1X01 A;  1UGP B;  2HDA A;  2R5A A;  1FMW A;  1VQ5 A;  2PUO B;  3M4Y A;  1QCF A;  3LH5 A;  2A08 A;  4EDU A;  4MZP A;  1UGR B;  1KD1 C;  3L2W A;  4E7Z A;  2JS2 A;  2K7A A;  4NOY A;  3NTH A;  5KYU A;  2QGF B;  2KR3 A;  2IPO B;  4FYW B;  2M16 A;  4OP0 A;  1ZA1 B;  1R77 A;  3CC4 Q;  3JCM f;  5D6W A;  2DL8 A;  4M77 C;  4RCB A;  2E1H A;  1VQ4 A;  3RR6 A;  1AEY A;  2EJ9 A;  2E65 A;  2O31 A;  4E7I A;  1WX6 A;  4X9C A;  5D6X A;  3CD6 T;  1U8R A;  4RTT A;  2QQA A;  4PFP A;  4RG2 A;  3OQ5 A;  2DF6 A;  2ZPF B;  2B8A A;  3FLG A;  2E3I A;  2XDB A;  3I56 A;  4PJO G;  3QII A;  1UFF A;  1SPK A;  2DXC A;  1M2V A;  2LNH B;  2KXC A;  4DBF A;  2LX9 A;  2PNI A;  2EQM A;  5IHK A;  1WHL A;  1OV3 A;  3VRZ A;  1W6X A;  1RAI B;  3WVD B;  1YJN Q;  2AK5 A;  3A8H B;  4OMO A;  3NGP A;  1KC8 R;  1RAA B;  1I5L A;  1QP3 A;  1W70 A;  3CME Q;  1AVZ C;  2IG0 A;  3GNF B;  1LNX A;  3JCM c;  1BI3 A;  3NFC A;  2LVM A;  3UA6 A;  4M75 B;  2DTH A;  1Q81 C;  9ATC B;  4Y92 A;  2L2P A;  3OBW A;  1PCX A;  2VWF A;  5LJ3 e;  3OYE A;  2DIG A;  5I2M A;  3ULR B;  4MML A;  2JTM A;  2CZ0 B;  1EZZ B;  2RHU A;  4GBQ A;  4P5N A;  3P8D A;  2NUP B;  1H92 A;  4M77 E;  5J3B A;  4IUQ A;  2IVW A;  1V1C A;  2CSQ A;  2MF2 A;  4KT0 E;  5HKC A;  2JM9 A;  3QYG B;  3GP8 A;  1JB0 E;  3JCM g;  1M1G A;  4D6W A;  1OPK A;  1M90 C;  2X3X D;  4ESR A;  3QUI A;  1GCQ A;  1KQ2 A;  1VQN Q;  1WXB A;  3M0S A;  1UHF A;  3CD6 A;  1IGU A;  2R57 A;  2AT1 B;  1TUC A;  1Z9Q A;  3VV0 A;  1HSQ A;  4LNP A;  1G5V A;  4ZGJ B;  1SSH A;  3HPW A;  4PK4 A;  5HK3 A;  2KRN A;  2DRK A;  4JZ3 A;  5KYX B;  3MEW A;  1OX8 A;  2YLB A;  1HK9 A;  3CCQ Q;  3EG3 A;  4F7U E;  2QTV A;  4PLI A;  4J9G A;  5LL6 S;  2P84 A;  2XDP A;  4LD6 A;  1T3S A;  1Q82 R;  4BDZ A;  1D3B B;  4C0D C;  1SRM A;  3CCE T;  2MAM A;  1MHN A;  5LJ3 j;  3MEU A;  2XK0 A;  1BI2 A;  6AT1 B;  1VQP Q;  4M7A G;  2P0K A;  2J6F A;  2QGG A;  5LJ3 h;  2EKO A;  1VQ7 A;  1MMN A;  3P8H A;  1KQS S;  2HL3 A;  2K79 A;  1WJQ A;  1OPL A;  1YN8 A;  2DEQ A;  4LN2 A;  1YIJ T;  1VQ9 A;  3VS3 A;  2DJQ A;  3QJ6 A;  2QYZ A;  2VC8 A;  4F04 B;  1RAB B;  1KD1 R;  2Z0W A;  4ZN3 A;  3DLM A;  4WTO B;  1QCO A;  5IAY A;  3L1A A;  2ZCF B;  3GF5 A;  3DB4 A;  3PMI A;  8AT1 B;  2HQX A;  4PJO A;  2L0A A;  3JB9 F;  5IXF A;  4CC4 B;  2M51 A;  3VS0 A;  4CC7 A;  3MP6 A;  2C0O A;  4BB7 A;  1K76 A;  2C06 A;  3VS4 A;  1UEB A;  2LCC A;  3G71 A;  2L3S A;  3M0U A;  5EG2 A;  4GY5 A;  4C0F A;  2FZG B;  1H3Z A;  2L3P A;  4QQD A;  1K9M U;  2F2V A;  1PKT A;  4RTV A;  2O9V A;  3JCM X;  5L23 A;  1V76 A;  4O6J A;  2EPD A;  2KY9 A;  2D9T A;  2EFI A;  1ACM B;  2DXB A;  1I5O B;  1QVG S;  5I21 A;  1OUL A;  4OVA A;  4RTY A;  3M9Q A;  5GAN 8;  3OSS C;  3CPF A;  4JJN K;  1B07 A;  2RHI A;  1Q81 R;  2FPF A;  2EKH A;  3C4S A;  2ROL A;  1VYV A;  1I8F A;  2DO3 A;  2NUT B;  5CQY A;  1HJD A;  3G4S T;  4RTZ A;  2VUB A;  3QDF A;  3EHR A;  1RAE B;  2YUQ A;  1Q86 C;  3HTR A;  1VQ8 A;  1KQS A;  1OU9 A;  1IB8 A;  4A4F A;  1KHI A;  5HCK A;  5CIU A;  4C5H A;  4A53 A;  3CC7 A;  2YRV A;  5IHN A;  1T0H A;  2CZ7 B;  1M90 R;  4TVR A;  2NLU A;  5GMK l;  1SF9 A;  2DMO A;  2KNB B;  5I11 A;  2O4X B;  2DIL A;  1JRI A;  4C8Q D;  2YHT A;  5FLX E;  2DM1 A;  3OW2 S;  3CCR T;  4Q5W A;  1IRE B;  4II1 A;  2CP5 A;  1K8A C;  1WPY A;  2DD5 A;  1Y0M A;  4M7A A;  3RKY A;  4BE0 A;  3FIF A;  2RNA A;  1K73 C;  1ZSZ A;  1N9S A;  4PFO A;  4C5I A;  1G3S A;  1S72 Q;  4PJO F;  3V7S A;  3E9F A;  4DA4 A;  4CC2 A;  4DOV A;  4Y91 A;  2CP3 A;  2DVJ A;  3QWY A;  4C92 C;  3CCL T;  5L8R E;  2E6Z A;  2RJE A;  4ZNX A;  1TSF A;  2LQN A;  2J05 A;  4A4K A;  3CBO A;  1UJ0 A;  3H0F A;  4HVV A;  4JJD A;  1MUZ A;  1NBE B;  2RJC A;  4FIB A;  1QVG A;  1UUE A;  4RUG A;  3LWI A;  1G8X A;  3UWN A;  1B34 B;  2XIC A;  1RAD B;  2D0Q B;  4LXC A;  3CC4 T;  1XOV A;  2PVO B;  2EQJ A;  1D0Z A;  3JCM V;  3V8K A;  1N8R C;  1UEC A;  2M9U A;  3M0P A;  2ABL A;  3WXM B;  2GNC A;  4FU6 A;  5GAO l;  2ESW A;  3QZ5 B;  4C92 F;  3EG0 A;  1OZ3 A;  1TU0 B;  2PTK A;  1QLY A;  2OTL A;  3KFV A;  2A7Y A;  2I2L A;  2JMA A;  2VYT A;  5LJ3 f;  4C8Q B;  2KRM A;  1YJ9 T;  3E9G A;  3CCS T;  4JRI A;  2LJ0 A;  1YCS B;  1SSF A;  1YJN T;  4C92 E;  3CCE Q;  1KHC A;  1C1A A;  2KYM A;  1TS9 A;  4D8D A;  2SEM A;  2RH2 A;  3ZL7 C;  1ZX6 A;  2E5K A;  3OW2 A;  4M77 G;  2VGM A;  4IKF A;  4ME7 A;  1U06 A;  2QA4 T;  1PD1 A;  2SRC A;  2RN8 A;  2BIV A;  4E7J A;  1TWB A;  2D8J A;  1GBR A;  1E7O A;  1KFZ A;  5GAN 7;  3CCU Q;  1YIJ Q;  3GLX A;  4BI4 A;  4XU0 A;  2R5M A;  5GAO p;  1WHM A;  4MZM A;  1VQ6 T;  2VB6 A; 
#chains in the Genus database with same CATH homology
 5CKD A;  2R5A A;  1Q7Y C;  1VQ5 A;  2E12 A;  2PUO B;  2RI2 A;  3M4Y A;  4PKC C;  4M7D E;  2RHY A;  5GMK m;  1JBM A;  2GFA A;  4MZP A;  4EDU A;  3CXC S;  1UGR B;  2CYZ B;  3CCM A;  3HKS A;  2LRQ A;  3L2W A;  1KD1 C;  3NTK A;  4C0G A;  5GAN e;  4PJO B;  1UGQ B;  4NOY A;  2DKG A;  1WGS A;  3NTH A;  4IUP A;  3RMS A;  2M0O A;  4M7D G;  3X25 B;  3OS5 A;  3J7A F;  3OYN A;  1FWZ A;  3OSV A;  2QDY B;  3OS2 A;  3LGF A;  2R58 A;  2M16 A;  1OI1 A;  4OP0 A;  5LJ5 e;  4BDY A;  3M59 A;  3ZFJ A;  4BUG A;  4M78 D;  1XNI A;  3G7Z A;  3ASK A;  3RES A;  3OYG A;  2G3R A;  5KH6 A;  3JCM e;  4DQ2 A;  3JCM f;  4JLG A;  3CCQ T;  5D6W A;  4M77 C;  4RCB A;  2E1H A;  2FHD A;  1VQ4 A;  1BYM A;  2LCL A;  3CBM A;  4QQG A;  2XI9 A;  1YI2 T;  2EJ9 A;  2E65 A;  4QVC A;  3FRN A;  4M7A D;  4HCB A;  2F5K A;  4E7I A;  2DPP B;  3QYH B;  4X9C A;  1YIT T;  5D6X A;  3CD6 T;  4WF2 A;  5KE3 A;  4M75 C;  4Y28 E;  1U8R A;  2F69 A;  3CC2 A;  4PJO E;  1O75 A;  2EWN A;  2O4X A;  4ZTJ A;  3OYK A;  2QQA A;  4RG2 A;  1VQO T;  2GFU A;  2WSF E;  3OQ5 A;  3CME A;  1K8A U;  1NJI C;  3VUB A;  4N0A C;  5D6Y A;  3VKI A;  3G4S A;  1WQW A;  2ZPF B;  2EAY A;  2B8A A;  3FLG A;  2KSS A;  3QJY A;  2XDB A;  3I56 A;  4XU1 A;  3G6E T;  5LJ3 d;  4PJO G;  4PL6 A;  2ZPH B;  4FL6 A;  1VQ8 T;  3LWH A;  3QII A;  2GQV A;  4C5E A;  5FU6 C;  1M1K U;  2DXC A;  3TU4 K;  1R8O B;  2O01 E;  3URG A;  3RER A;  2LX9 A;  3A5Z B;  2EQM A;  1YHQ A;  3OYH A;  1OYX A;  3CC7 T;  2LQK A;  4RG8 A;  4OF1 A;  3WVD B;  3A8H B;  5GAO n;  2WSE E;  3BDL A;  3SB2 A;  3GPL A;  2K2V A;  2XID A;  1BI0 A;  2LNV A;  1I5L A;  3RMQ A;  1QP3 A;  1ZHI A;  4FSX A;  5A0L A;  5GAM j;  4IUR A;  2IG0 A;  4ZTF A;  4M78 C;  3GNF B;  1ZBX A;  3BFM A;  1LNX A;  2FB7 A;  2K3Y A;  1BI3 A;  3JCM c;  3NFC A;  1KG1 A;  2LVM A;  1YCY A;  2GCX A;  4OB1 B;  1BKB A;  5GAN j;  4M75 B;  2DTH A;  2PVG B;  1Q81 C;  4M7A C;  3M56 A;  4XU2 A;  5GAM h;  3OBW A;  3ER0 A;  3CCR A;  5GAO m;  5CO7 A;  5LJ3 e;  3OYE A;  5GAN h;  3CPW S;  2DIG A;  1XQH A;  5I2M A;  4BI3 A;  1VQN A;  5LJ5 j;  1YBY A;  4MML A;  2JTM A;  2CZ0 B;  2PU9 B;  3OYL A;  5GAN g;  2RHU A;  2QEX T;  2E5Q A;  5FU6 B;  3A8G B;  4P5N A;  1QVF S;  4PLL A;  2LDM A;  3P8D A;  4J8O A;  5DM7 R;  3NTI A;  3OS0 A;  3CCU A;  1BIB A;  4M77 E;  5J3B A;  5IN1 A;  1B34 A;  2PQW A;  4IUQ A;  2XG8 D;  2IVW A;  3EAE A;  5DY9 A;  1QP2 A;  3T9N A;  3TEE A;  5LJ5 h;  2MF2 A;  5CR2 A;  1G3W A;  3BY7 A;  3F70 A;  3L2Z A;  1VQM T;  5LJ5 g;  2RK1 A;  1JJ2 A;  4KT0 E;  4C5G A;  5HKC A;  3JB9 D;  5GAN 2;  4F7U B;  1YJW T;  3QYG B;  4M75 E;  3SD4 A;  2JZ2 A;  3GP8 A;  1JB0 E;  2QQS A;  3SWN B;  1M1G A;  1VIF A;  1VUB A;  2E41 A;  2ZGW A;  3JCM g;  4D6W A;  3CXC A;  3JCM W;  4M78 B;  1M90 C;  4QVZ A;  3C94 A;  3HRT A;  3JB9 I;  4CRI A;  2CZ1 B;  3QUI A;  1BI1 A;  3MO8 A;  4C92 A;  3HL8 A;  1KQ2 A;  1N27 A;  4M75 G;  4M78 F;  5GAN 4;  3CD6 A;  3FJP A;  4M7A B;  2R57 A;  3ZEH A;  2DIQ A;  3VV0 A;  3CCJ A;  4N4H A;  2PUK B;  2QTX A;  2L8D A;  1Y07 A;  3EFR A;  4HKE A;  3JB9 J;  1G5V A;  4FT2 A;  4ZGJ B;  5GAO q;  1ZQ1 A;  4M7A F;  3HPW A;  5HK3 A;  4XAX B;  3CBP A;  3M53 A;  3MP1 A;  4XTU A;  3JAM E;  3SFM A;  3MEW A;  4L6V 5;  4BAC A;  5CKH A;  1VQP A;  3P8B B;  4ATO A;  4JRP A;  2YLB A;  4E7L A;  1HK9 A;  4E7K A;  2OTJ A;  5AYF A;  4F7U E;  4C8Q A;  4PLI A;  3QXE B;  2K57 A;  3CC4 A;  3QSU A;  1JJ2 S;  4M78 E;  5LL6 S;  1UB4 A;  2RI5 A;  3OBY A;  2DAQ A;  4MDW A;  2XDP A;  4LD6 A;  3M57 A;  4BDZ A;  1D3B B;  3OYY A;  1P92 A;  4C0D C;  4F7U G;  3L2Q A;  2CZ6 B;  3I55 T;  3JCM J;  1Q86 U;  3CCE T;  4M7A E;  3OMC A;  4M78 G;  1O9S A;  1NE8 A;  3E19 A;  5CKB A;  5CAI A;  3PIO A;  3GOX A;  4EPC A;  2MAM A;  1MHN A;  5LJ3 j;  1VQK T;  3QHS A;  3MEU A;  2XK0 A;  3CCV T;  3UPU A;  2OTL T;  3V7C A;  1BI2 A;  4M7A G;  4N4G A;  2E10 A;  5CK9 A;  1NPP A;  3RKW A;  1M5Q 1;  2P0K A;  4X34 A;  3OYB A;  2E70 A;  4M7D A;  2GF7 A;  3MCA B;  1FX7 A;  3LLR A;  5LJ3 h;  4QQ6 A;  2EKO A;  5IT9 E;  1VQ7 A;  5LJ3 g;  3P8H A;  1KQS S;  1YJ9 A;  3VYH B;  1WJQ A;  1VQL T;  2V8I A;  4LD9 K;  3CCS A;  3MHX A;  1NZ9 A;  2LT4 A;  2DEQ A;  1U1S A;  4XK8 E;  1M1K C;  2MMP A;  4BY6 B;  1YIJ T;  1YJN A;  1VQ9 A;  1N9R A;  2QQR A;  4IUT A;  5FU7 C;  3X20 B;  4BE1 A;  3QJ6 A;  2ZPB B;  3H6Z A;  1Q7Y U;  1Y96 B;  2VC8 A;  3WVE B;  4HT9 A;  4X9D A;  3AHU A;  4HT8 A;  4C0D B;  4ZN3 A;  4FM4 B;  3CMA T;  2RHX A;  3DLM A;  3PGG A;  4DOW A;  4ELZ C;  1H64 1;  4IUV A;  2E6N A;  3CPW A;  5GAN 5;  1K73 U;  4KBM B;  5IAY A;  3L1A A;  2QA4 A;  2ZCF B;  3OYM A;  1Y7X A;  2HNI A;  3GF5 A;  1X75 C;  3DB4 A;  3PMI A;  1QVF A;  2RK2 A;  2HQX A;  1MGQ A;  4JRK A;  1FXX A;  4PJO A;  3JB9 F;  2HBP A;  4EMK B;  2JUF A;  2FYK A;  4EMH A;  2VV5 A;  3MP6 A;  4BB7 A;  3S6W A;  4MZT A;  3J81 E;  5FRN A;  2C06 A;  1UEB A;  3SWN C;  2LCC A;  2Y4Y A;  2FL7 A;  4J7F A;  4VUB A;  3G71 A;  1S72 T;  1KC8 U;  5EG2 A;  4GY5 A;  1QW1 A;  4QW2 A;  4C0F A;  3OYJ A;  2RB6 A;  4L5G A;  1VQ6 A;  3RKX A;  2AHJ B;  5FU7 B;  1H3Z A;  3X28 B;  1N6A A;  2P4T A;  5C0M A;  4QQD A;  1VQ5 T;  4V2S A;  5CKF A;  5CCA A;  3BW1 A;  2XU8 A;  3QZ9 B;  3V8L A;  1NJI U;  3M4G A;  3FB9 A;  1K9M U;  4JRQ A;  4OMF B;  3OY9 A;  2CGH A;  4PJO D;  3CCM T;  2X4J A;  3HHT B;  3ME9 A;  2X4Y A;  4J6W A;  5GAN 3;  3LW5 E;  3VUZ A;  3PNW C;  2DZC A;  3GIB A;  3JCM X;  4O6J A;  5DLQ E;  1WJS A;  2KY9 A;  2KVQ G;  2D9T A;  3JB9 G;  1WJR A;  2M1H A;  2MWO A;  5KCO A;  3OYA A;  2EFI A;  2DXB A;  4E7H A;  1QVG S;  4RCC A;  2RJD A;  2X35 A;  5I21 A;  1N8R U;  2ZPI B;  5GMK i;  3GNG A;  4OGE A;  3JCM h;  4OVA A;  3M9Q A;  3PT9 A;  5GAN 8;  2H3J A;  1VQ4 T;  3OSS C;  3HFN A;  2EYQ A;  4XTV A;  1M9S A;  3RIR A;  2K5F A;  1U1T A;  3CPF A;  4JJN K;  3KBG A;  3CEY A;  3OA6 A;  2RHI A;  3M55 A;  4HA8 A;  1YI2 A;  4UC4 A;  4XTZ A;  3EFS A;  2L3R A;  1GXI E;  3MEA A;  4M77 A;  4ZGD B;  3C4S A;  3J80 E;  1YIT A;  4ELY C;  4J6Y A;  3FDR A;  3M58 A;  2JVV A;  2K5L A;  3BDU A;  1I8F A;  2DO3 A;  3C95 A;  1PSE A;  2DJZ A;  5CQY A;  3L2U A;  3CME T;  3OMG A;  1VQO A;  2ZPG B;  2OAU A;  5HY6 A;  2DXT A;  2BUD A;  2VUB A;  4J7I A;  3G4S T;  4JUV A;  5J26 A;  4CI0 C;  4JLI A;  4M75 A;  5GAM d;  3I56 T;  4JS4 A;  1G3T A;  2LTO A;  2VXF A;  2BKD N;  1V29 B;  3VU3 C;  4IUU A;  2LC4 A;  2EJF A;  3X26 B;  3G6E A;  1Q86 C;  1VQ8 A;  1KQS A;  3JCM b;  2HAX A;  5KE2 A;  2XDD A;  4J83 A;  1X6O A;  1VIE A;  4N0A A;  2EQK A;  3OS1 A;  1EIF A;  4JDS A;  4BY6 C;  4NS5 A;  5A0G A;  5GMK e;  4A4F A;  1BIA A;  1KHI A;  3MP8 A;  1YHQ T;  4C92 D;  2JN0 A;  2P0P A;  2DK3 A;  3ZBD A;  2DTO A;  5CIU A;  4C5H A;  2D6F A;  4M77 D;  4A53 A;  3CC7 A;  2RI3 A;  5GAN 6;  2YRV A;  4RMO A;  2CZ7 B;  3A8M B;  4TVR A;  4LDW A;  3OB9 A;  3QBY A;  2NLU A;  5CVI A;  1Q82 U;  2V8K A;  5FRO A;  5GMK l;  3L2R A;  2DVE A;  2KQW A;  2VGN A;  2O4X B;  4M75 D;  1I4K 1;  3L2V A;  2WAC A;  2YLC A;  1JRI A;  4F7U A;  4KUD K;  3LGL A;  3SWN A;  3L42 A;  1TH7 A;  1W2B S;  4A54 A;  4M78 A;  4C8Q D;  2MWP A;  2YHT A;  4OGC A;  3QG1 A;  4B9W A;  5FLX E;  4EMK C;  4Q5W A;  1IRE B;  5CQX A;  5GAM e;  5GAM f;  3CCR T;  3OW2 S;  2XHC A;  4II1 A;  1K8A C;  1WPY A;  4EMG A;  2DD5 A;  3HRS A;  1VQN T;  4M7A A;  2FVU A;  4ZGE B;  3UDC A;  2L89 A;  5GAN f;  3RKY A;  3JCM P;  4BE0 A;  1OZ2 A;  3FIF A;  3A8L B;  2RHZ A;  2QEX A;  1K73 C;  3CCU T;  4C0Z A;  2JOY A;  2X4W A;  4MDX A;  3MET A;  1G3Y A;  2RJF A;  1N9S A;  4C5I A;  2QXF A;  1G3S A;  2E64 A;  5GAO r;  4PJO F;  4XTW A;  4QVD A;  2HD0 A;  4N4I A;  3V7S A;  3E9F A;  4Z02 A;  4DA4 A;  4KUI A;  5LJ5 f;  4DOV A;  1RL2 A;  3JSC A;  4Y91 A;  3M54 A;  3PIP A;  1VQM A;  3CCL T;  4C92 C;  3O8V A;  3PFS A;  1KD1 U;  4M7D D;  1QVP A;  3LX7 A;  5L8R E;  2E6Z A;  3UT1 A;  2RJE A;  1PSF A;  3FEO A;  4BE2 A;  1YJW A;  4LDV A;  3KUF A;  3QKJ A;  2Y4X A;  1KC8 C;  3QO3 A;  2JNG A;  1D3B A;  4KUL A;  3OYI A;  4A4K A;  3CBO A;  3HRU A;  4OB2 B;  1HXD A;  3MEV A;  3OYD A;  4RKU E;  2RJC A;  4FIB A;  3V7R A;  5KCH A;  3CCJ T;  1QVG A;  3S3O A;  3S3N A;  4LDX A;  2CKK A;  5GMK j;  1M8V A;  3LWI A;  1K9M C;  3UWN A;  2HQE A;  3TCJ A;  1RI0 A;  3LH0 A;  3TRE A;  4C8Q C;  1B34 B;  2XIC A;  1DJ7 B;  1VQP T;  4NL2 A;  3INZ A;  1IZ6 A;  4BD3 A;  3PTA A;  3FC3 A;  3JB9 H;  4GLK A;  1WNL A;  2D0Q B;  2OTJ T;  2RD1 A;  4LDU A;  5GMK h;  4XQ3 A;  2LT1 A;  1LJO A;  3VJP A;  1AHJ B;  2QQ9 A;  3CC4 T;  1XOV A;  1NPR A;  2XD0 A;  2PVO B;  2EQJ A;  2V8J A;  3V8J A;  2KDS A;  3QPH A;  2QI2 A;  3JCM V;  3V8K A;  1N8R C;  2M9U A;  5I2S A;  4A4E A;  4MMK A;  4C92 B;  4R56 A;  2L5Q A;  1LOJ A;  1W4S A;  2X4X A;  4M77 B;  4OB0 B;  4FU6 A;  3WXM B;  4B9X A;  5GAO l;  1Y96 A;  5A2Q E;  3I55 A;  3CCE A;  3H8Z A;  4HCZ A;  3QZ5 B;  4C92 F;  3DB3 A;  3SDZ A;  4LDY A;  4A4G A;  1OZ3 A;  3DKM A;  1UGS B;  2PVD B;  3HFO A;  4M7D C;  4O5V A;  2P0Q A;  4M77 F;  1VQK A;  2VXE A;  3CCV A;  2EJG A;  4FT4 A;  5C6S A;  2OTL A;  3OYC A;  3E1S A;  4XTX A;  2KAF A;  4BI8 B;  2DZ9 A;  3C12 A;  3M5A A;  3QDR B;  2A7Y A;  2I2L A;  4M75 F;  5GAM g;  2ZPE B;  1VQ7 T;  4YTL A;  2VYT A;  5LJ3 f;  4C8Q B;  3Q1J A;  2KMT A;  1YJ9 T;  4JS5 A;  2XKO C;  3JRZ A;  3CCL A;  2DTI A;  2RA2 A;  3E9G A;  4EMK A;  3CCS T;  4OB3 B;  4JRI A;  1VQL A;  4C8Q F;  1SSF A;  1YJN T;  3X24 B;  4C92 E;  1KHC A;  3KXT A;  1VQ9 T;  1Q81 U;  3CC2 T;  1YIJ A;  4NL3 A;  2K5I A;  2F5T X;  2QQB A;  1W2B A;  2A3L A;  2RH2 A;  5A0D A;  4ZN1 A;  4C92 G;  2ZZD A;  4A4H A;  5DLO A;  3OW2 A;  1WQ7 A;  2Y90 A;  1KQ1 A;  3LYI A;  4M77 G;  2VGM A;  3CMA A;  4IKF A;  4J6X A;  4ME7 A;  5FRM A;  3HP9 A;  4E47 A;  1Q82 C;  5CKE A;  2JTF A;  2QA4 T;  4PJO C;  2DD4 A;  5J39 A;  5GAN d;  4J5Y A;  4M7D B;  4F7U F;  4R55 A;  2K3X A;  2BIV A;  4E7J A;  5HK0 A;  4C8Q E;  1M1F A;  1M4Z A;  3VYG A;  2DXU A;  4M7D F;  2RM4 A;  2MI6 A;  2WSC E;  5GAN 7;  2CS7 A;  3RUX A;  3GLX A;  4BI4 A;  3PMT A;  5LJ5 d;  4XU0 A;  4XU3 A;  2EQU A;  4C8Q G;  4L59 A;  2R5M A;  5GAO p;  3G71 T;  1M90 U;  1XTD A;  2LQ8 A;  1Y71 A;  3JCM d;  3OYF A;  3HSB A;  1S72 A;  2K4Y A;  4HCC A;  4MZM A;  4PNO A;  1VQ6 T;  4XTY A;  3S3M A;  3CCQ A;  1I81 A;  3JCM Q;  3DLL A;  1X01 A;  2EIF A;  2RO0 A;  2KK4 A;  1UGP B;  3A8O B;  5M9O A;  3R6O A;  3N5B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...