4J9GA

Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p7 at ph7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
b'PNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P7
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
total genus 11
structure length 58
sequence length 58
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9gA00
5IXBA 1NLOC 1Z9ZA 1ZUYA 1AWJA 2LX7A 1RUWA 2W0ZA 2F2WA 2RPNA 1ZBJA 2DL5A 1BK2A 1BU1A 1YCSB 3H0HA 4J9CA 1I07A 1Y0MA 4D8KA 2P4RA 2RMOA 1YWOA 1X2KA 2L3PA 1X69A 4RTWA 2E5KA 2CUBA 3M0PA 4J9FA 2V1RA 2KR3A 1SHFA 2YSQA 4IIOA 3VS1A 4J9IA 2DE0X 2EYXA 3PVLA 4OMOA 4CC3A 2X3WD 1NYFA 1FMKA 1GL5A 2A37A 4GBQA 4RTTA 3M0UA 2DRMA 2ABLA 2M51A 1W1FA 2V1QA 2OJ2A 2J7IA 5I22A 1Y57A 2A08A 3JV3A 1YN8A 1NG2A 5ECAA 2YDLA 2J6KA 4JPBW 1BB9A 2FRWA 3U23A 2VVKA 2HEQA 5L23A 4IIMA 4LE9A 2DNUA 3ULRB 2OAWA 2PZ1A 2DX1A 1G2BA 2MOXA 2LQWA 1UECA 4OMLA 3EGUA 1NM7A 1VYUA 4HVWA 2C0TA 1KJWA 3I5SA 1U06A 2KBTA 1WA7A 1U3OA 2LQNA 1UJYA 2L3SA 4Y92A 2DVJA 5GJVB 3VRYA 2RQTA 4ESRA 2GQIA 2KGTA 2PNIA 5IH2A 1K9AA 2AZVA 1VYVA 2RQRA 4JJDA 1WI7A 4Z89A 2D8HA 1OPKA 2O2OA 1M3CA 3UF4A 2EVRA 4JJCA 1JU5C 2EKHA 4EIKA 2CSQA 1WFWA 5EC7A 2FEIA 3VS7A 2ED1A 2FPFA 4F16A 2NWMA 2ESWA 1JEGA 5IHKA 2L2PA 2J6OA 1ARKA 1SRLA 4M4ZA 1GFDA 4HVVA 2FRYA 1WXBA 1I1JA 2AZSA 2LNHB 4RTXA 1W6XA 1OOTA 1PNJA 5FW9A 1X6GA 4Z8AA 1UJ0A 2O88A 2YUOA 2YUQA 3NMZC 4J9HA 5FWCA 1X2QA 1V1CA 3H41A 4J9DA 3A98A 2LCSA 1GCQC 3VS4A 1UHFA 3UA6A 1QCFA 2GNCA 3M0QA 2HSPA 1E6GA 3VS2A 2RQVA 2RQWA 2KROA 3CQTA 2KXCA 2LJ3A 2ECZA 2EGCA 2SEMA 1GCQA 3M0TA 2XMFA 1T3LA 3IQLA 4J9BA 3UATA 4GLMA 1ABQA 2RNAA 2H8HA 1S1NA 2PTKA 1T0HA 5IHIA 4LN2A 2KYMA 1MV0B 1ZUUA 2ROTA 2K3BA 2LJ0A 2KXDA 2MIOA 1QKWA 1RI9A 1M3AA 2DF6A 1RLPC 3EG0A 3FJ5A 1JXMA 1QWEA 3ZL7C 1T3SA 1MUZA 2C0OA 2F2VA 1CSKA 2K6DA 2KE9A 2HDAA 2JM8A 5HCKA 1KSWA 2A36A 2KEAA 2EGAA 2G6FX 2JTEA 3TSZA 4AFZC 1YP5A 4F17A 4QT7A 3EG2A 1YWPA 2DMOA 2OI3A 4F14A 3QWXX 1TUCA 4CC2A 1WDXA 1W70A 2GGRA 3LH5A 2SRCA 1YNZA 1ZX6A 4E6RA 5GJWB 2RN8A 2JM9A 2GTOA 2FO0A 1WIEA 1ABOA 2DILA 2BZXA 1G83A 3SHWA 1AZGB 3PVQA 3EG1A 2DBMA 1M3BA 2K79A 1Z9QA 4AG1C 1UHCA 4ZNXA 4DEYA 3VS3A 2KRSA 2HBWA 2EGEA 2J05A 2O9VA 1H8KA 2J06A 1UE9A 1FYNA 1EFNA 4AFUC 1H92A 2DJQA 4CC4B 2X3XD 4AFSC 5IXFA 3I35A 1AEYA 4OMQA 4HCKA 1GCPA 3M0RA 2VWFA 4JZ4A 2JS2A 3TVTA 4R0KA 4HXJA 1GFCA 1WX6A 1JQQA 3EHQA 1XOVA 1NEGA 5I11A 2CDTA 1AVZC 4DEXA 2DLPA 4AG2C 3NPFA 4FSSA 2BTTA 2ED0A 1MV3A 1ZLMA 3NGPA 1K0XA 2KT1A 1UFFA 2O9SA 4RTUA 2CREA 2LMJA 3KFVA 1BBZA 1LCKA 1OV3A 3PE0A 2KYBA 2JMAA 1SRMA 2K2MA 3H0FA 1ZSGA 1UGVA 3R6NA 3VS5A 1H3HA 1PHTA 1N5ZA 1AOJA 3UA7A 1K76A 2D0NA 3RNJA 2KNBB 1JXOA 2CT3A 1PKSA 2EQIA 2DRKA 4RUGA 1TG0A 2YUNA 2K9GA 2VKNA 1OPLA 1AWXA 4OMPA 1SHGA 3EHRA 1VA7A 1AZEA 2EYWA 3O5ZA 2CH4A 4JZ3A 2FPEA 1UG1A 3VS0A 2DL3A 1GBRA 1GBQA 2DM1A 2AKLA 3TSWA 1A0NB 4J9GA 2JW4A 2L3QA 2K7AA 4X1VA 4A63B 2FPDA 1K4US 2CT4A 2CH4W 2EW3A 1CKBA 4LUEA 2GBQA 1HSQA 1QLYA 2KT8A 4KRTA 2MCNA 2JT4A 2LP5A 1AD5A 3I5RA 1B07A 1JO8A 1OEBA 1RLQC 1X43A 1UDLA 3GBQA 2F2XA 3VS6A 2BZYA 2JMCA 2RF0A 3SEMA 4RTZA 3C0CA 2YT6A 1KFZA 2IIMA 2GTJA 3I9QA 2FG0A 4CC7A 3THKA 2J6FA 1E6HA 1HD3A 1M27C 1UUEA 4D8DA 2EYZA 2AKKA 1HJDA 1IO6A 2L0AA 2ENMA 2M0YA 1QKXA 1GRIA 2BZ8A 1I0CA 2YUPA 4JJBA 2DL7A 2KRMA 1TUDA 1NEBA 1PRLC 2JS0A 2RQUA 1WLPB 1PRMC 1K1ZA 1KIKA 4OMNA 4J9EA 2AK5A 1U5SA 3QWYA 3EG3A 5FWBA 2DA9A 4ORZA 1X27A 3RBBB 4HVUA 3REBB 3REAB 2DYBA 2I0NA 4AFQC 1WYXA 1UTIA 3H0IA 2HCKA 2NUZA 1M30A 2LJ1A 2LZ6B 2ROLA 1CKAA 2B86A 4RTYA 5IHNA 2EYYA 4WCIA 1PKTA 4Z88A 1NLPC 1J3TA 1PWTA 1SEMA 1AWOA 1SSHA 4LNPA 4OMMA 2D1XA 3VRZA 2A28A 2CSIA 1M8MA 1B3QA 1ZUKA 4LUDA 1E7OA 2EPDA 2QDLA 2D8JA 1K0SA 2EBPA 1QWFA 2O31A 4RTVA 1WXUA 2JXBA 2W10A 1X6BA 2DL8A 1WXTA 1NYGA 4K11A 2KRNA 2DBKA 3NHNA 1AWWA 2CUDA 2C0IA 3M0SA 1T0JA 1SPKA 2DL4A 1VYTA
chains in the Genus database with same CATH superfamily
3CPWA 1NLOC 1WHLA 3HKSA 1AWJA 2W0ZA 2QQBA 3E1SA 2EQJA 1OU9A 3H0HA 3LLRA 4J9CA 4D8KA 2FHDA 2HL3A 3JRZA 2P4RA 1M2VA 4M78G 3I56T 4IURA 1X69A 5FRMA 4B6MA 5LL6S 4ME7A 4A4KA 1UEBA 3LX7A 3GP8A 2KR3A 1K73C 4BB7A 3CXCA 1ZSZC 3PMTA 3ZBDA 4KULA 3VS1A 1QP2A 1X75C 2DE0X 4MZTA 3CCET 4PK4A 3I55A 3CCSA 3G6ET 1VQ7T 2X3WD 1NYFA 4C5EA 2OAUA 2K4YA 3FDRA 4CI0C 3MP6A 3HHTB 4M7AE 2J7IA 4OMFB 3TEEA 5I22A 2QGGA 3JV3A 2DIGA 3CCQA 1NG2A 2LTOA 2RJEA 1YFNA 5LJ3e 4TVRA 2FRWA 5GANe 1BCMA 5KYUA 4FT2A 2E6ZA 3L42A 2PZ1A 5KH6A 2XG8D 3H6ZA 3A8GB 2EFIA 2MOXA 2QA4Q 3A5ZB 3OYLA 1MGQA 1VQ5T 4HKEA 3EGUA 1NM7A 4RG8A 4DBRA 2FVUA 1I5LA 2NYSA 6AT1B 5GMKh 4M78A 3FEOA 2LQNA 1UJYA 5GAOp 1YIJT 2DVJA 2O01E 3VRYA 3CD6A 4N4GA 4M7AA 2VGNA 3X25B 4KGXB 3M5AA 3OYNA 1K9AA 2AZVA 2ZPIB 1VYVA 1C1AA 4HCZA 3CCJT 1IHWA 4Z89A 2D8HA 2LRQA 3CPWS 1M3CA 2WSCE 3CCVA 4PJJA 2COZA 4QKUA 3OYDA 2DERA 5EC7A 4RG2A 1S72Q 4KT0E 1VQNA 5IHKA 5IAYA 3E9FA 4QQGA 2DTHA 4J83A 3X20B 1I1JA 1WJQA 3HFNA 4PFZA 2YUQA 3NMZC 4J9HA 4C0FA 2P0KA 5GAN5 4FYWB 2XK0A 2JTFA 3H41A 4J9DA 3CPWP 3HRTA 2LCSA 1VQ4A 3UA6A 3PGGA 4JLGA 3RKYA 2L3RA 2DXBA 3HL8A 4HT8A 3OYYA 4WTOB 4XTZA 3NTHA 3VS2A 3CC4Q 5LJ5f 4LXCA 3A8OB 2Y90A 2YRCA 3OYMA 2ECZA 4J9BA 4XTXA 4M7DD 3GOXA 3CXCP 2CP2A 2NLUA 1NJIR 3LWIA 2IPOB 4M77E 4N4HA 4LN2A 2CZ0B 2G3RA 2ROTA 2KXDA 1VQOQ 5GAMd 3EH2A 2FB7A 1N27A 1UGRB 2MYSA 2YRDA 2F2VA 1CSKA 4ZGDB 2HDAA 2JM8A 2HQHA 1D0ZA 3TSZA 4AFZC 2GFAA 2DEQA 2E65A 1R0BG 1D1CA 1P92A 1YNZA 4PNOA 1ZX6A 4E6RA 4Z02A 4J6XA 4E7SA 3FB9A 3META 1ABOA 4FW1A 3SHWA 1AZGB 1XTDA 3EG1A 5FLXE 3EGDA 4E2FB 3CMAQ 2BE9B 3DLLA 3AHUA 3CPFA 2PUOB 1PCXA 1UHCA 2QQAA 1WQWA 5CKEA 2YLCA 3TCJA 1YJWA 2EGEA 5GMKm 3CC7Q 1UE9A 3VV0A 4IUVA 2E3HA 1VOMA 2LT4A 2X3XD 3G1JA 2P4TA 4HCKA 1M1KR 3M0RA 1D1AA 1GXIE 2VWFA 3M54A 3A8LB 2ZCFB 4R0KA 4HXJA 5KYXA 5GMKl 2ZZDA 4OGCA 4IUPA 4PJLA 5I11A 2DEUA 2CDTA 4BDZA 1AVZC 5KYWA 3DB3A 5GANj 4FSSA 2X51A 4M75F 2KT1A 3ER0A 4RTUA 2EJGA 2RHYA 2K2MA 3BDLA 2EYQA 2KDSA 1N5ZA 4FL6A 3S6WA 2DZCA 3UA7A 2HMAA 2F69A 2PQWA 1RABB 3KUFA 4XU0A 4E7JA 3CCST 2DIQA 1Q86R 2RO0A 1M90C 4RUGA 1TG0A 2EQMA 1NPPA 3FJPA 3CC2A 1SHGA 1I8FA 2RK1A 3G4SQ 3O5ZA 2KK4A 3CCQT 3VYHB 1NJIU 2E4HA 2YHTA 1A0NB 2I2LA 4A63B 2CT4A 3VUBA 2PUKB 1QLYA 2MCNA 4JDSA 5LJ3h 1B07A 3HRUA 2NUPB 1B34A 1OX8A 5GAMf 1X43A 4B9WA 3G7ZA 2BZYA 2VASA 4GY5A 1YITQ 3FIFA 5CQYA 1D09B 3BFMA 3C0CA 1KFZA 3CD6T 2FG0A 4LDUA 1HD3A 3R6OA 2BIVA 2QTVA 3CCLA 4M7AD 2EAYA 4BD3A 4OB0B 1GRIA 2QQ9A 3D7SB 3CCVT 1I0CA 4XK8E 2DL7A 2KRMA 1NEBA 2K5LA 1FX7A 1VQNT 1K9MR 1VQKQ 1U5SA 3ZFJA 5DLOA 3OS5A 2QEXQ 3P8DA 1KD1R 5FWBA 2DA9A 3RBBB 2OTLQ 2ZGWA 5CK9A 5IN1A 4AMCA 4J6WA 1Q95G 1VQ4T 2B86A 4RTYA 3QG1A 1PC0A 3EH1A 1NLPC 1J3TA 1SEMA 3BE3A 2PVDB 1D3BB 4OMMA 2A28A 1B3QA 4LUDA 3DLMA 2COWA 4DQ2A 5KCHA 2O31A 1WXUA 1K8AC 4V2SA 2W10A 2HAXA 3NHNA 1JB0E 2DBKA 4DBFA 3GIBA 1AWWA 2COYA 3M0SA 3RR6A 3MEUA 5IXBA 3LW5E 1BU1A 1YCSB 5D6WA 3VKIA 1Y0MA 1M1KC 3QSUA 2D0QB 2L3PA 1Q86U 4BDYA 2E5KA 3QKJA 1BIAA 2CUBA 1I4K1 2M0OA 5HK3A 2V1RA 1SHFA 2HQXA 1VQ9Q 3PVLA 4CC3A 2VB6A 4ZTFA 2A37A 2JZ2A 1C6VX 3TU4K 3JCMX 4M7DF 2DRMA 4DOWA 1EZZB 1VUBA 2DJZA 3DKMA 3QPHA 1VQ6T 1RAGB 3I56Q 2A08A 4M77D 2J6KA 4JPBW 1QVGS 1BB9A 2B8AA 2JTMA 1D0YA 1WHMA 2HEQA 4JRQA 1W2BA 4LE9A 3CBOA 3QIIA 3ULRB 1VQLA 2DX1A 2PVOB 3RKXA 4M75B 1QP3A 3SWNB 3CCEQ 1YJWT 1VQ7Q 3G6EQ 3CCRA 5DLQE 3RDVA 4C8QE 4XU1A 4C92C 4Y91A 3H9NA 3UT1A 5CVIA 1QMCA 1VYUA 4HVWA 4UC4A 2HD0A 1EIFA 1JBMA 2K57A 1OZ3A 4PJOE 2KBTA 2V26A 1YJ9T 1U3OA 4KH1B 2X4JA 4FU6A 4F7UE 2L3SA 1OZ2A 4C5GA 1OX9A 5GJVB 5EG2A 4ESRA 3JCMg 2KGTA 2PNIA 5IH2A 3SD4A 3LGFA 2FYKA 4JJDA 2Y4YA 2O2OA 1VQ5Q 2EVRA 2NUTA 1KD1U 3M57A 4LDWA 1TS9A 4M75C 1KHCA 1JU5C 2EKHA 2FEIA 3JB9G 2P84A 2CP3A 2QQSA 2OTJA 4LDXA 1JEGA 1M4ZA 3EGXB 2L2PA 1YIJQ 1N6AA 4E7KA 1ARKA 1TUGB 5GANg 1AHJB 1R8OB 4X9CA 1OOTA 1G3TA 1PNJA 5FW9A 4Z8AA 3OW2S 5CAIA 1QVFS 2YUOA 3C4SA 3CCJQ 3CC2T 1GCQC 1VQPA 3VS4A 4EMKB 1K9MC 4PJOF 3INZA 4BACA 4F7UF 1BI3A 2RQVA 2RQWA 5HK0A 3CQTA 1UGPB 5GAN3 2SEMA 3IQLA 4GLMA 2HBPA 2L5QA 3MEAA 1PG5B 1W2BS 3JCMe 5LJ3d 5IHIA 5GANd 2EQKA 3OW2P 1BKBA 4EMHA 3LGLA 1O9SA 4M78E 1H3ZA 2LJ0A 5FROA 1JRIA 1I5OB 2VUBA 4XAXB 1QKWA 4C0DB 5GAN6 3QUIA 2CP0A 4J6YA 4BE0A 3FJ5A 4A4GA 1VQMT 1QWEA 1T3SA 1MMAA 2GCXA 4EMKC 3L2VA 3PIPA 4RMOA 2C0OA 1BCOA 5HCKA 1KSWA 2KEAA 3O8VA 3PMIA 1W2BP 2G6FX 3CCLT 2JTEA 3MPUB 4BY6B 4A4HA 2RI3A 4F04B 1G8XA 4PKCC 1YWPA 3SDZA 3OBYA 5C6SA 4O5VA 1TUCA 1WDXA 3V7RA 1W70A 1TH7A 4L5GA 3LH5A 1OQKA 3FRNA 4LDYA 2DPPB 3CCMA 2E3IA 2DXUA 5J39A 3A1PA 2LT1A 4L6V5 1IZ6A 1U8RA 2FZGB 2BZXA 2FZCB 4OB1B 3G71A 1G83A 2AIRB 3L2WA 2XDPA 3CMAA 2JOYA 2FZKB 4PJNA 2K79A 1TTHB 3CCUA 4MDXA 2QASA 2XIDA 1KC8R 1M2OA 4QVZA 4RKUE 3AT1B 4Q5WA 3VUZA 3GNGA 1WJRA 2RHIA 4AFUC 4M7AF 4NL2A 4EMGA 1W4SA 3C94A 5CKBA 5I2MA 2QI2A 3I35A 2RI5A 3P8BB 4M7DB 3TVTA 4ELZC 2WSFE 2D6FA 2X35A 3KBGA 3NPFA 2QXFA 3QXEB 1HYOA 3QDRB 1UFFA 1QCNA 2CREA 4HCBA 3NTKA 1M1FA 2JMAA 3H0FA 2HZYA 2WSEE 2RJFA 1ZSGA 1UGVA 3VS5A 1PHTA 2KNBB 1JXOA 2CT3A 2EQIA 2JUFA 1NZ9A 2QYZA 1RAEB 1MMDA 4IUQA 1M9SA 3UDCA 1V29B 4M7DC 2YUNA 4Y28E 4OMPA 1G5VA 2HKNA 1AZEA 1PD1A 2DTOA 2O4XB 1WQ7A 4JZ3A 2FPEA 4C92G 3A8HB 2DM1A 3CMEA 1IREB 4MMKA 4J9GA 4IKFA 3V7SA 2XKOC 5HKCA 1VQLT 4OVAA 2QG9B 5LJ3f 4X9DA 1LOJA 2GBQA 1HSQA 3CCSQ 3CCRT 2JT4A 2KMTA 1AD5A 4FSXA 4PJMA 3EG9B 4IUUA 3N5BB 4ANJA 1UDLA 1ACMB 1WPYA 3HFOA 5I2SA 1YITA 2CP6A 3CCQQ 3DB4A 4C8QB 4EPCA 3SEMA 2LX9A 2ZPBB 4RTZA 4EDUA 5GMKi 5GAN8 4M75G 1D0XA 2LQ8A 4CC7A 2LC4A 5AT1B 2QDYB 1RAFB 3WVDB 1YHQA 2J6FA 4PJOB 1KK7A 3J80E 1M27C 4D8DA 4F7UB 4M77F 2EYZA 2AKKA 4JRIA 3GPLA 1RI0A 2M0YA 1IXDA 4A4FA 4JJBA 1YJNA 2JS0A 2RQUA 3E2UA 1WLPB 2XI9A 1K1ZA 2OTJT 3JCMJ 4C92A 1KC8U 1M8VA 3M58A 4AT1B 2HNIA 3EG3A 4C8QD 3CD6Q 4WF2A 1VIEA 2H3JA 4L59A 2I0NA 3OYIA 4PJOD 3H0IA 2LZ6B 5GAN7 1VQPT 1CKAA 4KGVB 2DD5A 5IHNA 2EJ9A 1XJWB 2IVWA 3CCVQ 2E1HA 1PKTA 8ATCB 1PWTA 1SSHA 4GLKA 4HT9A 1ZBXA 4LNPA 4N0AC 4MDWA 3VRZA 1ZUKA 2LCLA 1VQNQ 1E7OA 2QDLA 4ZTJA 2D8JA 4C0GA 3HP9A 1K0SA 2EBPA 1QWFA 1Q82R 4M75A 4FYVB 1MNEA 1KC8C 3OYHA 1RAIB 4K11A 2LCCA 5J26A 1WGSA 5KYUB 1KQ1A 2C0IA 2VYTA 1T0JA 1SPKA 3M4YA 3I55T 1VYTA 3OSSC 1VQ4Q 5GAOr 1RUWA 2F2WA 2RPNA 1ZBJA 2DL5A 4J5YA 4N4IA 1BK2A 3JCMh 5CKHA 4BI8B 2KI7A 1ZA1B 1Y96A 2RMOA 1X2KA 1YI2A 4XU3A 1N8RR 4RTWA 3WXMB 1FMVA 1VQ8A 4J9FA 5KCOA 2YSQA 1NBEB 3EFSA 5D7UA 4IIOA 2HQEA 2K2VA 3BW1A 2DO3A 4J9IA 4M7AB 4OMOA 2E64A 5GANh 2K5IA 4RTTA 3M0UA 2ABLA 2M51A 1ZSZA 3EFOA 3CCMT 3QDFA 3EGXA 2V1QA 2E41A 2PU9B 1LVKA 2R5MA 5KYYB 1Y57A 3HTRA 2EKOA 3G71T 5ECAA 3QBYA 1UGSB 3CCUT 2VVKA 1JJ2S 4M78D 1DJ7B 5L23A 1NJIC 4IIMA 4OB2B 1G2BA 4QVDA 4EMKA 2L89A 3G6EA 2VXEA 3RKWA 2LQWA 1UECA 2XDDA 4OMLA 2C0TA 5KE3A 4A54A 4M7AC 3NTIA 1Y07A 3M55A 1VQ6Q 2HL5C 1WA7A 4D6WA 4Y92A 2R58A 1LNXA 2AHJB 1QVGA 2GQIA 5GMKe 1JJ2P 3F70A 3JCMV 2HSEB 1YJWQ 5GAOn 3UF4A 4JUVA 2E10A 1PD0A 1TU0B 2CSQA 2ZPGB 4M7DG 3OYBA 1YJ9Q 2FPFA 4CRIA 4O6JA 2ESWA 5A0DA 2WACA 2J6OA 4NL3A 4M4ZA 2AZSA 4RTXA 1W6XA 5CR2A 2O88A 1X6GA 3JB9J 7AT1B 3QYHB 4FCYA 1X2QA 1V1CA 3A98A 1Q82U 1UGQB 3V8LA 3KXTA 4HA8A 3M0QA 4ZN1A 2CGHA 1E6GA 3QZ5B 2V8KA 3CMET 4M77B 3CBMA 2KXCA 2EGCA 5CKFA 2RH2A 2XMFA 1T3LA 4PL6A 3UWNA 1Q7YU 4R55A 2F1LA 2H3EB 2RNAA 2H8HA 1T0HA 3QHSA 1N8RU 3OW2A 1QVFA 5DM7R 3CC2Q 2KSSA 2KYMA 3MP8A 4FYYB 1MV0B 2K3BA 3OMCA 2VC8A 3OYFA 2MK5A 4PFPA 4JS5A 4KGZB 1YITT 2CS7A 1RI9A 1Q82C 2DF6A 2R57A 1RLPC 4M7DA 3SB2A 2XD0A 4IUTA 1JXMA 2QGFB 4E7LA 1MUZA 1KQSS 2K6DA 1YHQT 1TSFA 3L2ZA 3MP1A 2X4YA 1Q86C 2YLBA 4M77C 1VIFA 4E7HA 2EGAA 3RERA 4F17A 3LWHA 4QT7A 2QA4A 4QQ6A 4F14A 4YTLA 1OU8A 5GAN2 1YJNT 1G3SA 5KYNA 5I21A 2SRCA 4PLIA 5GJWB 1VQMQ 2FO0A 2DILA 4P5NA 2M9UA 3OY9A 3V7CA 2X9HA 3PVQA 2X4WA 2DBMA 1M3BA 4FW2A 1QVGP 2V8JA 2KY9A 1Z9QA 4BE1A 4AG1C 3CCLQ 4JS4A 4FM4B 2VV5A 2HBWA 2O4XA 2O9VA 3NFCA 5LJ5g 1D1BA 1H8KA 1FYNA 1EFNA 3PT9A 3X28B 3SWNC 1OULA 2ZPHB 1S72A 1YCYA 1EX4A 4AFSC 2YWWA 1GCPA 2V8IA 3GLXA 3QYGB 2JS2A 3X26B 4OF1A 4B9XA 4DBHA 2GF7A 3EHQA 4A53A 1SSFA 3QJYA 1XOVA 3TREA 2DTIA 4C8QF 5GAOm 4DEXA 4AG2C 3JCMd 2RJDA 4E7IA 3J81E 2BTTA 1KQ2A 2ED0A 1MV3A 4XU2A 3L2UA 1ZLMA 1V76A 3M53A 2QQRA 1YI2T 1K0XA 1KD1C 3CC4A 5D6YA 1BBZA 1LCKA 1VQ8T 1OV3A 3PE0A 2KYBA 3JCMQ 2FL7A 1K76A 1NPRA 2D0NA 2E5QA 4PLLA 3RNJA 5GAOl 4BI3A 4LD9K 3ZEHA 2DRKA 4XTVA 2GQVA 2VKNA 1QVFP 1MMGA 1OPLA 3JCMW 1AWXA 2GFUA 5LJ5e 3PIOA 5GMKj 4NOYA 4C5IA 1UG1A 1VQOA 1GBQA 2AKLA 3TSWA 3E19A 2JW4A 4M7AG 3X24B 3FLGA 1ZA2B 4J8OA 2IG0A 2CH4W 2EW3A 3JSCA 2MWPA 5J3BA 2ZPFB 1F1BB 4LUEA 2KT8A 1N9SA 2A3LA 4KRTA 5L8RE 3QJ6A 3JB9F 2DVEA 1QQJA 2DD4A 1RLQC 3GBQA 2F2XA 3VS6A 2JMCA 3MO8A 2GTJA 1IRXA 3EFRA 2JJ9A 3MKDA 2RHUA 1TOVA 4J7IA 2CYZB 1VQLQ 2ZAEA 1E6HA 4C0DC 1IGUA 3CCRQ 1IO6A 2L0AA 3OYGA 2YXYA 1AT1B 2YUPA 2YRVA 4M78F 3CC7A 2RD1A 1TUDA 3RESA 5HY6A 1TWBA 1WZOA 1PRMC 1G3WA 4BY6C 1KIKA 2AK5A 3QWYA 2KQWA 4ORZA 1WHHA 4HVUA 5CQXA 3REBB 3REAB 3FC3A 2DYBA 3PTAA 5M9OA 2NUPA 4AFQC 1Q81R 1WYXA 2R5AA 1M30A 2ROLA 3QZ9B 1M90R 4XTWA 5KYYA 4WCIA 2LDMA 1M8MA 2OTJQ 2EPDA 4QW2A 2E6NA 3V8JA 3TQ7P 1QCOA 2DFUA 3CXCS 1RACB 2JXBA 2XICA 1ZQ1A 2DL8A 3OYAA 2CKKA 1R0CB 3T9NA 1MMNA 3BDUA 3S3MA 2LQKA 5GAMg 2DL4A 3EG2A 3JCMf 2EIFA 3Q1JA 3GNFB 1ZUYA 1Z9ZA 3OB9A 2LX7A 1VQPQ 1RAHB 1RADB 4M77G 2DK3A 1XNIA 4ZGEB 1I07A 1N9RA 3G4SA 4X34A 1UB4A 1C0MA 1YWOA 4LD6A 1RAAB 2EWNA 3M0PA 3OYKA 1WHGA 1PM3A 4MZMA 1QVPA 2C06A 2EYXA 2QA4T 5GANf 1WNLA 3I55Q 1FMKA 1GL5A 4C0ZA 1D3BA 4GBQA 3URGA 4C92E 2KAFA 1W1FA 2NUTB 5FU6B 1QW1A 2OJ2A 2MF2A 1B7TA 1YN8A 4C5HA 2YDLA 3OYEA 3U23A 2MWOA 3RMSA 3V8KA 2DNUA 2OAWA 4XQ3A 2A0FB 1TXQA 3L2QA 2DAQA 2XDBA 5GAMe 2LVMA 5CCAA 2KVQG 1KJWA 4M77A 3I5SA 1U06A 3CCMQ 2CZ1B 1VQ6A 2Z0WA 4M75E 1S72T 1WHJA 3LYIA 1IHVA 3OA6A 2P0QA 1X01A 1VQKA 3G71Q 2QEXA 5FU6C 4JRPA 1M2VB 2RQTA 1PSFA 2RM4A 4QVCA 3CCUQ 2RA2A 3RUXA 3M59A 5LJ5j 3C95A 3SFMA 1PSEA 1K8AR 1JJ2A 2OTLA 4C8QC 4R56A 2RQRA 1HK9A 1WI7A 2M1HA 3BY7A 1OPKA 3MHXA 2VGMA 4OGEA 4C92F 3P8HA 2JVVA 4II1A 3L1AA 4PJOC 1BIBA 4JJCA 2E70A 4EIKA 1WFWA 1YJ9A 3VS7A 3CC4T 2ED1A 3J7AF 5CO7A 4F16A 1Q81U 2NWMA 4ZN3A 3MJXA 1M90U 1SRLA 2JN0A 3MCAB 1GFDA 4E47A 1M1GA 4HVVA 2FRYA 2PVGB 3SWNA 1WXBA 2MMPA 2MI6A 2LNHB 4BE2A 3VYGA 1UJ0A 2DETA 3PNWC 5FWCA 2CZ7B 3CBPA 4MZPA 5LJ3j 3OS2A 2OX7A 1UHFA 2M16A 2X4XA 1QCFA 1U1SA 5AYFA 3JCMb 2GNCA 2HSPA 1Q7YR 1VQOT 2DZ9A 2KROA 2QK0A 1OI1A 2AT1B 2LJ3A 5A0LA 5LJ5h 1GCQA 3M0TA 1YBYA 1Q81C 3GF5A 4M78B 3UATA 3JB9D 3QO3A 4VUBA 1ABQA 1VQ9A 3HSBA 1S1NA 2PTKA 3UPUA 4MMLA 4RCBA 1SKUB 1MNDA 1ZUUA 2RK2A 5FRNA 4OB3B 2MIOA 4XTYA 1M3AA 3CMEQ 3EG0A 3I56A 3ZL7C 2DXCA 2RB6A 2DXTA 1FMWA 2KE9A 4A4EA 4ZGJB 1RL2A 3CMAT 4QQDA 2A36A 2VXFA 1YP5A 3L2RA 1WJSA 3CCEA 2OI3A 2DMOA 4M78C 1VQ7A 2D9TA 3CC7T 3E9GA 2QAZA 3QWXX 3HRSA 4CC2A 2GGRA 1HXDA 4BI4A 2JNGA 2RN8A 1VQMA 2JM9A 2K3XA 2QTXA 1WIEA 2GTOA 1MHNA 1KQSA 4HCCA 4BUGA 1YHQQ 3JCMc 3JB9I 3OQ5A 9ATCB 2BUDA 4ZNXA 4DEYA 3VS3A 2KRSA 2HKQB 2J05A 4E7ZA 5A0GA 1VQ5A 1YJNQ 2J06A 5C0MA 1OYXA 4PFOA 3PFSA 2L8DA 1K8AU 2K5FA 3ME9A 2DJQA 2F5KA 1H92A 4CC4B 5DY9A 5IXFA 3S3NA 1AEYA 4OMQA 1YIJA 4JZ4A 1NE8A 5GAN4 1KG1A 1GFCA 1WX6A 1JQQA 3OS0A 4DA4A 1K73R 1SF9A 1NEGA 3OMGA 4DOVA 3CCJA 1I81A 4ELYC 1M1KU 2DLPA 2ATCB 4M7DE 2K3YA 1X6OA 2BKDN 3OS1A 3RIRA 3G4ST 1ZHIA 3LH0A 2DYIA 8AT1B 3NGPA 1KHIA 1SG5A 2MPXC 2O9SA 4KUDK 2LMJA 3KFVA 4KBMB 1SRMA 5GAMj 3OYCA 1H641 1H3HA 3R6NA 2MAMA 3HPWA 1AOJA 4JRKA 2DKGA 2P0PA 1PKSA 2F5TX 4DBQA 3EGDB 5GAOq 2K9GA 2LNVA 3ASKA 2M02A 2Y4XA 4NS5A 3M56A 3VU3C 3EHRA 1VA7A 1Y7XA 2A7YA 2EYWA 2E12A 2CH4A 5CIUA 3VS0A 1FWZA 2DL3A 1LJOA 5A2QE 5D6XA 4JJNK 1YI2Q 1GBRA 3MEVA 3C12A 1VQ8Q 4FT4A 2L3QA 2K7AA 4X1VA 4C92B 1IGQA 2FPDA 3MEWA 1K4US 4XTUA 1CKBA 3JAME 5IT9E 3JB9H 1R77A 2LP5A 3CEYA 3I5RA 3M4GA 2RHZA 1Q7YC 2XU8A 2EJFA 1JO8A 3VJPA 1OEBA 5FU7B 5KYXB 4C8QG 4J7FA 1N8RC 5CKDA 1LPLA 5KYWB 5GAMh 1VQKT 2RF0A 3M9QA 2QEXT 2YT6A 2IIMA 3I9QA 4PJOG 3OYJA 1M5Q1 3H8ZA 1U1TA 2CZ6B 3THKA 4F7UG 4LDVA 3OSVA 3OBWA 4KH0B 1KQSP 2OTLT 4C92D 4JLIA 4KUIA 2BE7D 1UUEA 4RCCA 1HJDA 2EQUA 2ENMA 1QKXA 2BZ8A 1Y71A 4FYXB 1PRLC 3WVEB 4OMNA 4J9EA 4ATOA 5FU7C 1Y96B 1X27A 2RJCA 3S3OA 1WHKA 1K9MU 2CP5A 4OP0A 4M75D 1UTIA 5KE2A 3EG9A 2HCKA 2NUZA 3RMQA 2LJ1A 2CP7A 3EAEA 1IB8A 2EYYA 1BYMA 4Z88A 1BI2A 1AWOA 4C8QA 1BI1A 2D1XA 3A8MB 1G3YA 2CSIA 1ZSZB 2ZPEB 3EFOB 1B34B 1K73U 1O75A 5LJ3g 5LJ5d 1XQHA 1FXXA 2RI2A 2RHXA 4PJOA 4FIBA 1BI0A 4RTVA 1X6BA 1VQ9T 1WXTA 4F7UA 1NYGA 2KRNA 2XHCA 3JCMP 4N0AA 2CUDA
chains in the Genus database with same CATH topology
5IXBA 1NLOC 1Z9ZA 1ZUYA 1AWJA 2LX7A 1RUWA 2W0ZA 2F2WA 2RPNA 1ZBJA 2DL5A 1BK2A 1BU1A 1YCSB 3H0HA 4J9CA 1I07A 1Y0MA 4D8KA 2P4RA 2RMOA 1YWOA 1X2KA 2L3PA 1X69A 4RTWA 2E5KA 2CUBA 3M0PA 4J9FA 2V1RA 2KR3A 1SHFA 2YSQA 4IIOA 3VS1A 4J9IA 2DE0X 2EYXA 3PVLA 4OMOA 4CC3A 2X3WD 1NYFA 1FMKA 1GL5A 2A37A 4GBQA 4RTTA 3M0UA 2DRMA 2ABLA 2M51A 1W1FA 2V1QA 2OJ2A 2J7IA 5I22A 1Y57A 2A08A 3JV3A 1YN8A 1NG2A 5ECAA 2YDLA 2J6KA 4JPBW 1BB9A 2FRWA 3U23A 2VVKA 2HEQA 5L23A 4IIMA 4LE9A 2DNUA 3ULRB 2OAWA 2PZ1A 2DX1A 1G2BA 2MOXA 2LQWA 1UECA 4OMLA 3EGUA 1NM7A 1VYUA 4HVWA 2C0TA 1KJWA 3I5SA 1U06A 2KBTA 1WA7A 1U3OA 2LQNA 1UJYA 2L3SA 4Y92A 2DVJA 5GJVB 3VRYA 2RQTA 4ESRA 2GQIA 2KGTA 2PNIA 5IH2A 1K9AA 2AZVA 1VYVA 2RQRA 4JJDA 1WI7A 4Z89A 2D8HA 1OPKA 2O2OA 1M3CA 3UF4A 2EVRA 4JJCA 1JU5C 2EKHA 4EIKA 2CSQA 1WFWA 5EC7A 2FEIA 3VS7A 2ED1A 2FPFA 4F16A 2NWMA 2ESWA 1JEGA 5IHKA 2L2PA 2J6OA 1ARKA 1SRLA 4M4ZA 1GFDA 4HVVA 2FRYA 1WXBA 1I1JA 2AZSA 2LNHB 4RTXA 1W6XA 1OOTA 1PNJA 5FW9A 1X6GA 4Z8AA 1UJ0A 2O88A 2YUOA 2YUQA 3NMZC 4J9HA 5FWCA 1X2QA 1V1CA 3H41A 4J9DA 3A98A 2LCSA 1GCQC 3VS4A 1UHFA 3UA6A 1QCFA 2GNCA 3M0QA 2HSPA 1E6GA 3VS2A 2RQVA 2RQWA 2KROA 3CQTA 2KXCA 2LJ3A 2ECZA 2EGCA 2SEMA 1GCQA 3M0TA 2XMFA 1T3LA 3IQLA 4J9BA 3UATA 4GLMA 1ABQA 2RNAA 2H8HA 1S1NA 2PTKA 1T0HA 5IHIA 4LN2A 2KYMA 1MV0B 1ZUUA 2ROTA 2K3BA 2LJ0A 2KXDA 2MIOA 1QKWA 1RI9A 1M3AA 2DF6A 1RLPC 3EG0A 3FJ5A 1JXMA 1QWEA 3ZL7C 1T3SA 1MUZA 2C0OA 2F2VA 1CSKA 2K6DA 2KE9A 2HDAA 2JM8A 5HCKA 1KSWA 2A36A 2KEAA 2EGAA 2G6FX 2JTEA 3TSZA 4AFZC 1YP5A 4F17A 4QT7A 3EG2A 1YWPA 2DMOA 2OI3A 4F14A 3QWXX 1TUCA 4CC2A 1WDXA 1W70A 2GGRA 3LH5A 2SRCA 1YNZA 1ZX6A 4E6RA 5GJWB 2RN8A 2JM9A 2GTOA 2FO0A 1WIEA 1ABOA 2DILA 2BZXA 1G83A 3SHWA 1AZGB 3PVQA 3EG1A 2DBMA 1M3BA 2K79A 1Z9QA 4AG1C 1UHCA 4ZNXA 4DEYA 3VS3A 2KRSA 2HBWA 2EGEA 2J05A 2O9VA 1H8KA 2J06A 1UE9A 1FYNA 1EFNA 4AFUC 1H92A 2DJQA 4CC4B 2X3XD 4AFSC 5IXFA 3I35A 1AEYA 4OMQA 4HCKA 1GCPA 3M0RA 2VWFA 4JZ4A 2JS2A 3TVTA 4R0KA 4HXJA 1GFCA 1WX6A 1JQQA 3EHQA 1XOVA 1NEGA 5I11A 2CDTA 1AVZC 4DEXA 2DLPA 4AG2C 3NPFA 4FSSA 2BTTA 2ED0A 1MV3A 1ZLMA 3NGPA 1K0XA 2KT1A 1UFFA 2O9SA 4RTUA 2CREA 2LMJA 3KFVA 1BBZA 1LCKA 1OV3A 3PE0A 2KYBA 2JMAA 1SRMA 2K2MA 3H0FA 1ZSGA 1UGVA 3R6NA 3VS5A 1H3HA 1PHTA 1N5ZA 1AOJA 3UA7A 1K76A 2D0NA 3RNJA 2KNBB 1JXOA 2CT3A 1PKSA 2EQIA 2DRKA 4RUGA 1TG0A 2YUNA 2K9GA 2VKNA 1OPLA 1AWXA 4OMPA 1SHGA 3EHRA 1VA7A 1AZEA 2EYWA 3O5ZA 2CH4A 4JZ3A 2FPEA 1UG1A 3VS0A 2DL3A 1GBRA 1GBQA 2DM1A 2AKLA 3TSWA 1A0NB 4J9GA 2JW4A 2L3QA 2K7AA 4X1VA 4A63B 2FPDA 1K4US 2CT4A 2CH4W 2EW3A 1CKBA 4LUEA 2GBQA 1HSQA 1QLYA 2KT8A 4KRTA 2MCNA 2JT4A 2LP5A 1AD5A 3I5RA 1B07A 1JO8A 1OEBA 1RLQC 1X43A 1UDLA 3GBQA 2F2XA 3VS6A 2BZYA 2JMCA 2RF0A 3SEMA 4RTZA 3C0CA 2YT6A 1KFZA 2IIMA 2GTJA 3I9QA 2FG0A 4CC7A 3THKA 2J6FA 1E6HA 1HD3A 1M27C 1UUEA 4D8DA 2EYZA 2AKKA 1HJDA 1IO6A 2L0AA 2ENMA 2M0YA 1QKXA 1GRIA 2BZ8A 1I0CA 2YUPA 4JJBA 2DL7A 2KRMA 1TUDA 1NEBA 1PRLC 2JS0A 2RQUA 1WLPB 1PRMC 1K1ZA 1KIKA 4OMNA 4J9EA 2AK5A 1U5SA 3QWYA 3EG3A 5FWBA 2DA9A 4ORZA 1X27A 3RBBB 4HVUA 3REBB 3REAB 2DYBA 2I0NA 4AFQC 1WYXA 1UTIA 3H0IA 2HCKA 2NUZA 1M30A 2LJ1A 2LZ6B 2ROLA 1CKAA 2B86A 4RTYA 5IHNA 2EYYA 4WCIA 1PKTA 4Z88A 1NLPC 1J3TA 1PWTA 1SEMA 1AWOA 1SSHA 4LNPA 4OMMA 2D1XA 3VRZA 2A28A 2CSIA 1M8MA 1B3QA 1ZUKA 4LUDA 1E7OA 2EPDA 2QDLA 2D8JA 1K0SA 2EBPA 1QWFA 2O31A 4RTVA 1WXUA 2JXBA 2W10A 1X6BA 2DL8A 1WXTA 1NYGA 4K11A 2KRNA 2DBKA 3NHNA 1AWWA 2CUDA 2C0IA 3M0SA 1T0JA 1SPKA 2DL4A 1VYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IXB A;  1NLO C;  1Z9Z A;  1ZUY A;  1AWJ A;  2LX7 A;  1RUW A;  2W0Z A;  2F2W A;  2RPN A;  1ZBJ A;  2DL5 A;  1BK2 A;  1BU1 A;  1YCS B;  3H0H A;  4J9C A;  1I07 A;  1Y0M A;  4D8K A;  2P4R A;  2RMO A;  1YWO A;  1X2K A;  2L3P A;  1X69 A;  4RTW A;  2E5K A;  2CUB A;  3M0P A;  4J9F A;  2V1R A;  2KR3 A;  1SHF A;  2YSQ A;  4IIO A;  3VS1 A;  4J9I A;  2DE0 X;  2EYX A;  3PVL A;  4OMO A;  4CC3 A;  2X3W D;  1NYF A;  1FMK A;  1GL5 A;  2A37 A;  4GBQ A;  4RTT A;  3M0U A;  2DRM A;  2ABL A;  2M51 A;  1W1F A;  2V1Q A;  2OJ2 A;  2J7I A;  5I22 A;  1Y57 A;  2A08 A;  3JV3 A;  1YN8 A;  1NG2 A;  5ECA A;  2YDL A;  2J6K A;  4JPB W;  1BB9 A;  2FRW A;  3U23 A;  2VVK A;  2HEQ A;  5L23 A;  4IIM A;  4LE9 A;  2DNU A;  3ULR B;  2OAW A;  2PZ1 A;  2DX1 A;  1G2B A;  2MOX A;  2LQW A;  1UEC A;  4OML A;  3EGU A;  1NM7 A;  1VYU A;  4HVW A;  2C0T A;  1KJW A;  3I5S A;  1U06 A;  2KBT A;  1WA7 A;  1U3O A;  2LQN A;  1UJY A;  2L3S A;  4Y92 A;  2DVJ A;  5GJV B;  3VRY A;  2RQT A;  4ESR A;  2GQI A;  2KGT A;  2PNI A;  5IH2 A;  1K9A A;  2AZV A;  1VYV A;  2RQR A;  4JJD A;  1WI7 A;  4Z89 A;  2D8H A;  1OPK A;  2O2O A;  1M3C A;  3UF4 A;  2EVR A;  4JJC A;  1JU5 C;  2EKH A;  4EIK A;  2CSQ A;  1WFW A;  5EC7 A;  2FEI A;  3VS7 A;  2ED1 A;  2FPF A;  4F16 A;  2NWM A;  2ESW A;  1JEG A;  5IHK A;  2L2P A;  2J6O A;  1ARK A;  1SRL A;  4M4Z A;  1GFD A;  4HVV A;  2FRY A;  1WXB A;  1I1J A;  2AZS A;  2LNH B;  4RTX A;  1W6X A;  1OOT A;  1PNJ A;  5FW9 A;  1X6G A;  4Z8A A;  1UJ0 A;  2O88 A;  2YUO A;  2YUQ A;  3NMZ C;  4J9H A;  5FWC A;  1X2Q A;  1V1C A;  3H41 A;  4J9D A;  3A98 A;  2LCS A;  1GCQ C;  3VS4 A;  1UHF A;  3UA6 A;  1QCF A;  2GNC A;  3M0Q A;  2HSP A;  1E6G A;  3VS2 A;  2RQV A;  2RQW A;  2KRO A;  3CQT A;  2KXC A;  2LJ3 A;  2ECZ A;  2EGC A;  2SEM A;  1GCQ A;  3M0T A;  2XMF A;  1T3L A;  3IQL A;  4J9B A;  3UAT A;  4GLM A;  1ABQ A;  2RNA A;  2H8H A;  1S1N A;  2PTK A;  1T0H A;  5IHI A;  4LN2 A;  2KYM A;  1MV0 B;  1ZUU A;  2ROT A;  2K3B A;  2LJ0 A;  2KXD A;  2MIO A;  1QKW A;  1RI9 A;  1M3A A;  2DF6 A;  1RLP C;  3EG0 A;  3FJ5 A;  1JXM A;  1QWE A;  3ZL7 C;  1T3S A;  1MUZ A;  2C0O A;  2F2V A;  1CSK A;  2K6D A;  2KE9 A;  2HDA A;  2JM8 A;  5HCK A;  1KSW A;  2A36 A;  2KEA A;  2EGA A;  2G6F X;  2JTE A;  3TSZ A;  4AFZ C;  1YP5 A;  4F17 A;  4QT7 A;  3EG2 A;  1YWP A;  2DMO A;  2OI3 A;  4F14 A;  3QWX X;  1TUC A;  4CC2 A;  1WDX A;  1W70 A;  2GGR A;  3LH5 A;  2SRC A;  1YNZ A;  1ZX6 A;  4E6R A;  5GJW B;  2RN8 A;  2JM9 A;  2GTO A;  2FO0 A;  1WIE A;  1ABO A;  2DIL A;  2BZX A;  1G83 A;  3SHW A;  1AZG B;  3PVQ A;  3EG1 A;  2DBM A;  1M3B A;  2K79 A;  1Z9Q A;  4AG1 C;  1UHC A;  4ZNX A;  4DEY A;  3VS3 A;  2KRS A;  2HBW A;  2EGE A;  2J05 A;  2O9V A;  1H8K A;  2J06 A;  1UE9 A;  1FYN A;  1EFN A;  4AFU C;  1H92 A;  2DJQ A;  4CC4 B;  2X3X D;  4AFS C;  5IXF A;  3I35 A;  1AEY A;  4OMQ A;  4HCK A;  1GCP A;  3M0R A;  2VWF A;  4JZ4 A;  2JS2 A;  3TVT A;  4R0K A;  4HXJ A;  1GFC A;  1WX6 A;  1JQQ A;  3EHQ A;  1XOV A;  1NEG A;  5I11 A;  2CDT A;  1AVZ C;  4DEX A;  2DLP A;  4AG2 C;  3NPF A;  4FSS A;  2BTT A;  2ED0 A;  1MV3 A;  1ZLM A;  3NGP A;  1K0X A;  2KT1 A;  1UFF A;  2O9S A;  4RTU A;  2CRE A;  2LMJ A;  3KFV A;  1BBZ A;  1LCK A;  1OV3 A;  3PE0 A;  2KYB A;  2JMA A;  1SRM A;  2K2M A;  3H0F A;  1ZSG A;  1UGV A;  3R6N A;  3VS5 A;  1H3H A;  1PHT A;  1N5Z A;  1AOJ A;  3UA7 A;  1K76 A;  2D0N A;  3RNJ A;  2KNB B;  1JXO A;  2CT3 A;  1PKS A;  2EQI A;  2DRK A;  4RUG A;  1TG0 A;  2YUN A;  2K9G A;  2VKN A;  1OPL A;  1AWX A;  4OMP A;  1SHG A;  3EHR A;  1VA7 A;  1AZE A;  2EYW A;  3O5Z A;  2CH4 A;  4JZ3 A;  2FPE A;  1UG1 A;  3VS0 A;  2DL3 A;  1GBR A;  1GBQ A;  2DM1 A;  2AKL A;  3TSW A;  1A0N B;  4J9G A;  2JW4 A;  2L3Q A;  2K7A A;  4X1V A;  4A63 B;  2FPD A;  1K4U S;  2CT4 A;  2CH4 W;  2EW3 A;  1CKB A;  4LUE A;  2GBQ A;  1HSQ A;  1QLY A;  2KT8 A;  4KRT A;  2MCN A;  2JT4 A;  2LP5 A;  1AD5 A;  3I5R A;  1B07 A;  1JO8 A;  1OEB A;  1RLQ C;  1X43 A;  1UDL A;  3GBQ A;  2F2X A;  3VS6 A;  2BZY A;  2JMC A;  2RF0 A;  3SEM A;  4RTZ A;  3C0C A;  2YT6 A;  1KFZ A;  2IIM A;  2GTJ A;  3I9Q A;  2FG0 A;  4CC7 A;  3THK A;  2J6F A;  1E6H A;  1HD3 A;  1M27 C;  1UUE A;  4D8D A;  2EYZ A;  2AKK A;  1HJD A;  1IO6 A;  2L0A A;  2ENM A;  2M0Y A;  1QKX A;  1GRI A;  2BZ8 A;  1I0C A;  2YUP A;  4JJB A;  2DL7 A;  2KRM A;  1TUD A;  1NEB A;  1PRL C;  2JS0 A;  2RQU A;  1WLP B;  1PRM C;  1K1Z A;  1KIK A;  4OMN A;  4J9E A;  2AK5 A;  1U5S A;  3QWY A;  3EG3 A;  5FWB A;  2DA9 A;  4ORZ A;  1X27 A;  3RBB B;  4HVU A;  3REB B;  3REA B;  2DYB A;  2I0N A;  4AFQ C;  1WYX A;  1UTI A;  3H0I A;  2HCK A;  2NUZ A;  1M30 A;  2LJ1 A;  2LZ6 B;  2ROL A;  1CKA A;  2B86 A;  4RTY A;  5IHN A;  2EYY A;  4WCI A;  1PKT A;  4Z88 A;  1NLP C;  1J3T A;  1PWT A;  1SEM A;  1AWO A;  1SSH A;  4LNP A;  4OMM A;  2D1X A;  3VRZ A;  2A28 A;  2CSI A;  1M8M A;  1B3Q A;  1ZUK A;  4LUD A;  1E7O A;  2EPD A;  2QDL A;  2D8J A;  1K0S A;  2EBP A;  1QWF A;  2O31 A;  4RTV A;  1WXU A;  2JXB A;  2W10 A;  1X6B A;  2DL8 A;  1WXT A;  1NYG A;  4K11 A;  2KRN A;  2DBK A;  3NHN A;  1AWW A;  2CUD A;  2C0I A;  3M0S A;  1T0J A;  1SPK A;  2DL4 A;  1VYT A; 
#chains in the Genus database with same CATH topology
 3CPW A;  1NLO C;  1WHL A;  3HKS A;  1AWJ A;  2W0Z A;  2QQB A;  3E1S A;  2EQJ A;  1OU9 A;  3H0H A;  3LLR A;  4J9C A;  4D8K A;  2FHD A;  2HL3 A;  3JRZ A;  2P4R A;  1M2V A;  4M78 G;  3I56 T;  4IUR A;  1X69 A;  5FRM A;  4B6M A;  5LL6 S;  4ME7 A;  4A4K A;  1UEB A;  3LX7 A;  3GP8 A;  2KR3 A;  1K73 C;  4BB7 A;  3CXC A;  1ZSZ C;  3PMT A;  3ZBD A;  4KUL A;  3VS1 A;  1QP2 A;  1X75 C;  2DE0 X;  4MZT A;  3CCE T;  4PK4 A;  3I55 A;  3CCS A;  3G6E T;  1VQ7 T;  2X3W D;  1NYF A;  4C5E A;  2OAU A;  2K4Y A;  3FDR A;  4CI0 C;  3MP6 A;  3HHT B;  4M7A E;  2J7I A;  4OMF B;  3TEE A;  5I22 A;  2QGG A;  3JV3 A;  2DIG A;  3CCQ A;  1NG2 A;  2LTO A;  2RJE A;  1YFN A;  5LJ3 e;  4TVR A;  2FRW A;  5GAN e;  1BCM A;  5KYU A;  4FT2 A;  2E6Z A;  3L42 A;  2PZ1 A;  5KH6 A;  2XG8 D;  3H6Z A;  3A8G B;  2EFI A;  2MOX A;  2QA4 Q;  3A5Z B;  3OYL A;  1MGQ A;  1VQ5 T;  4HKE A;  3EGU A;  1NM7 A;  4RG8 A;  4DBR A;  2FVU A;  1I5L A;  2NYS A;  6AT1 B;  5GMK h;  4M78 A;  3FEO A;  2LQN A;  1UJY A;  5GAO p;  1YIJ T;  2DVJ A;  2O01 E;  3VRY A;  3CD6 A;  4N4G A;  4M7A A;  2VGN A;  3X25 B;  4KGX B;  3M5A A;  3OYN A;  1K9A A;  2AZV A;  2ZPI B;  1VYV A;  1C1A A;  4HCZ A;  3CCJ T;  1IHW A;  4Z89 A;  2D8H A;  2LRQ A;  3CPW S;  1M3C A;  2WSC E;  3CCV A;  4PJJ A;  2COZ A;  4QKU A;  3OYD A;  2DER A;  5EC7 A;  4RG2 A;  1S72 Q;  4KT0 E;  1VQN A;  5IHK A;  5IAY A;  3E9F A;  4QQG A;  2DTH A;  4J83 A;  3X20 B;  1I1J A;  1WJQ A;  3HFN A;  4PFZ A;  2YUQ A;  3NMZ C;  4J9H A;  4C0F A;  2P0K A;  5GAN 5;  4FYW B;  2XK0 A;  2JTF A;  3H41 A;  4J9D A;  3CPW P;  3HRT A;  2LCS A;  1VQ4 A;  3UA6 A;  3PGG A;  4JLG A;  3RKY A;  2L3R A;  2DXB A;  3HL8 A;  4HT8 A;  3OYY A;  4WTO B;  4XTZ A;  3NTH A;  3VS2 A;  3CC4 Q;  5LJ5 f;  4LXC A;  3A8O B;  2Y90 A;  2YRC A;  3OYM A;  2ECZ A;  4J9B A;  4XTX A;  4M7D D;  3GOX A;  3CXC P;  2CP2 A;  2NLU A;  1NJI R;  3LWI A;  2IPO B;  4M77 E;  4N4H A;  4LN2 A;  2CZ0 B;  2G3R A;  2ROT A;  2KXD A;  1VQO Q;  5GAM d;  3EH2 A;  2FB7 A;  1N27 A;  1UGR B;  2MYS A;  2YRD A;  2F2V A;  1CSK A;  4ZGD B;  2HDA A;  2JM8 A;  2HQH A;  1D0Z A;  3TSZ A;  4AFZ C;  2GFA A;  2DEQ A;  2E65 A;  1R0B G;  1D1C A;  1P92 A;  1YNZ A;  4PNO A;  1ZX6 A;  4E6R A;  4Z02 A;  4J6X A;  4E7S A;  3FB9 A;  3MET A;  1ABO A;  4FW1 A;  3SHW A;  1AZG B;  1XTD A;  3EG1 A;  5FLX E;  3EGD A;  4E2F B;  3CMA Q;  2BE9 B;  3DLL A;  3AHU A;  3CPF A;  2PUO B;  1PCX A;  1UHC A;  2QQA A;  1WQW A;  5CKE A;  2YLC A;  3TCJ A;  1YJW A;  2EGE A;  5GMK m;  3CC7 Q;  1UE9 A;  3VV0 A;  4IUV A;  2E3H A;  1VOM A;  2LT4 A;  2X3X D;  3G1J A;  2P4T A;  4HCK A;  1M1K R;  3M0R A;  1D1A A;  1GXI E;  2VWF A;  3M54 A;  3A8L B;  2ZCF B;  4R0K A;  4HXJ A;  5KYX A;  5GMK l;  2ZZD A;  4OGC A;  4IUP A;  4PJL A;  5I11 A;  2DEU A;  2CDT A;  4BDZ A;  1AVZ C;  5KYW A;  3DB3 A;  5GAN j;  4FSS A;  2X51 A;  4M75 F;  2KT1 A;  3ER0 A;  4RTU A;  2EJG A;  2RHY A;  2K2M A;  3BDL A;  2EYQ A;  2KDS A;  1N5Z A;  4FL6 A;  3S6W A;  2DZC A;  3UA7 A;  2HMA A;  2F69 A;  2PQW A;  1RAB B;  3KUF A;  4XU0 A;  4E7J A;  3CCS T;  2DIQ A;  1Q86 R;  2RO0 A;  1M90 C;  4RUG A;  1TG0 A;  2EQM A;  1NPP A;  3FJP A;  3CC2 A;  1SHG A;  1I8F A;  2RK1 A;  3G4S Q;  3O5Z A;  2KK4 A;  3CCQ T;  3VYH B;  1NJI U;  2E4H A;  2YHT A;  1A0N B;  2I2L A;  4A63 B;  2CT4 A;  3VUB A;  2PUK B;  1QLY A;  2MCN A;  4JDS A;  5LJ3 h;  1B07 A;  3HRU A;  2NUP B;  1B34 A;  1OX8 A;  5GAM f;  1X43 A;  4B9W A;  3G7Z A;  2BZY A;  2VAS A;  4GY5 A;  1YIT Q;  3FIF A;  5CQY A;  1D09 B;  3BFM A;  3C0C A;  1KFZ A;  3CD6 T;  2FG0 A;  4LDU A;  1HD3 A;  3R6O A;  2BIV A;  2QTV A;  3CCL A;  4M7A D;  2EAY A;  4BD3 A;  4OB0 B;  1GRI A;  2QQ9 A;  3D7S B;  3CCV T;  1I0C A;  4XK8 E;  2DL7 A;  2KRM A;  1NEB A;  2K5L A;  1FX7 A;  1VQN T;  1K9M R;  1VQK Q;  1U5S A;  3ZFJ A;  5DLO A;  3OS5 A;  2QEX Q;  3P8D A;  1KD1 R;  5FWB A;  2DA9 A;  3RBB B;  2OTL Q;  2ZGW A;  5CK9 A;  5IN1 A;  4AMC A;  4J6W A;  1Q95 G;  1VQ4 T;  2B86 A;  4RTY A;  3QG1 A;  1PC0 A;  3EH1 A;  1NLP C;  1J3T A;  1SEM A;  3BE3 A;  2PVD B;  1D3B B;  4OMM A;  2A28 A;  1B3Q A;  4LUD A;  3DLM A;  2COW A;  4DQ2 A;  5KCH A;  2O31 A;  1WXU A;  1K8A C;  4V2S A;  2W10 A;  2HAX A;  3NHN A;  1JB0 E;  2DBK A;  4DBF A;  3GIB A;  1AWW A;  2COY A;  3M0S A;  3RR6 A;  3MEU A;  5IXB A;  3LW5 E;  1BU1 A;  1YCS B;  5D6W A;  3VKI A;  1Y0M A;  1M1K C;  3QSU A;  2D0Q B;  2L3P A;  1Q86 U;  4BDY A;  2E5K A;  3QKJ A;  1BIA A;  2CUB A;  1I4K 1;  2M0O A;  5HK3 A;  2V1R A;  1SHF A;  2HQX A;  1VQ9 Q;  3PVL A;  4CC3 A;  2VB6 A;  4ZTF A;  2A37 A;  2JZ2 A;  1C6V X;  3TU4 K;  3JCM X;  4M7D F;  2DRM A;  4DOW A;  1EZZ B;  1VUB A;  2DJZ A;  3DKM A;  3QPH A;  1VQ6 T;  1RAG B;  3I56 Q;  2A08 A;  4M77 D;  2J6K A;  4JPB W;  1QVG S;  1BB9 A;  2B8A A;  2JTM A;  1D0Y A;  1WHM A;  2HEQ A;  4JRQ A;  1W2B A;  4LE9 A;  3CBO A;  3QII A;  3ULR B;  1VQL A;  2DX1 A;  2PVO B;  3RKX A;  4M75 B;  1QP3 A;  3SWN B;  3CCE Q;  1YJW T;  1VQ7 Q;  3G6E Q;  3CCR A;  5DLQ E;  3RDV A;  4C8Q E;  4XU1 A;  4C92 C;  4Y91 A;  3H9N A;  3UT1 A;  5CVI A;  1QMC A;  1VYU A;  4HVW A;  4UC4 A;  2HD0 A;  1EIF A;  1JBM A;  2K57 A;  1OZ3 A;  4PJO E;  2KBT A;  2V26 A;  1YJ9 T;  1U3O A;  4KH1 B;  2X4J A;  4FU6 A;  4F7U E;  2L3S A;  1OZ2 A;  4C5G A;  1OX9 A;  5GJV B;  5EG2 A;  4ESR A;  3JCM g;  2KGT A;  2PNI A;  5IH2 A;  3SD4 A;  3LGF A;  2FYK A;  4JJD A;  2Y4Y A;  2O2O A;  1VQ5 Q;  2EVR A;  2NUT A;  1KD1 U;  3M57 A;  4LDW A;  1TS9 A;  4M75 C;  1KHC A;  1JU5 C;  2EKH A;  2FEI A;  3JB9 G;  2P84 A;  2CP3 A;  2QQS A;  2OTJ A;  4LDX A;  1JEG A;  1M4Z A;  3EGX B;  2L2P A;  1YIJ Q;  1N6A A;  4E7K A;  1ARK A;  1TUG B;  5GAN g;  1AHJ B;  1R8O B;  4X9C A;  1OOT A;  1G3T A;  1PNJ A;  5FW9 A;  4Z8A A;  3OW2 S;  5CAI A;  1QVF S;  2YUO A;  3C4S A;  3CCJ Q;  3CC2 T;  1GCQ C;  1VQP A;  3VS4 A;  4EMK B;  1K9M C;  4PJO F;  3INZ A;  4BAC A;  4F7U F;  1BI3 A;  2RQV A;  2RQW A;  5HK0 A;  3CQT A;  1UGP B;  5GAN 3;  2SEM A;  3IQL A;  4GLM A;  2HBP A;  2L5Q A;  3MEA A;  1PG5 B;  1W2B S;  3JCM e;  5LJ3 d;  5IHI A;  5GAN d;  2EQK A;  3OW2 P;  1BKB A;  4EMH A;  3LGL A;  1O9S A;  4M78 E;  1H3Z A;  2LJ0 A;  5FRO A;  1JRI A;  1I5O B;  2VUB A;  4XAX B;  1QKW A;  4C0D B;  5GAN 6;  3QUI A;  2CP0 A;  4J6Y A;  4BE0 A;  3FJ5 A;  4A4G A;  1VQM T;  1QWE A;  1T3S A;  1MMA A;  2GCX A;  4EMK C;  3L2V A;  3PIP A;  4RMO A;  2C0O A;  1BCO A;  5HCK A;  1KSW A;  2KEA A;  3O8V A;  3PMI A;  1W2B P;  2G6F X;  3CCL T;  2JTE A;  3MPU B;  4BY6 B;  4A4H A;  2RI3 A;  4F04 B;  1G8X A;  4PKC C;  1YWP A;  3SDZ A;  3OBY A;  5C6S A;  4O5V A;  1TUC A;  1WDX A;  3V7R A;  1W70 A;  1TH7 A;  4L5G A;  3LH5 A;  1OQK A;  3FRN A;  4LDY A;  2DPP B;  3CCM A;  2E3I A;  2DXU A;  5J39 A;  3A1P A;  2LT1 A;  4L6V 5;  1IZ6 A;  1U8R A;  2FZG B;  2BZX A;  2FZC B;  4OB1 B;  3G71 A;  1G83 A;  2AIR B;  3L2W A;  2XDP A;  3CMA A;  2JOY A;  2FZK B;  4PJN A;  2K79 A;  1TTH B;  3CCU A;  4MDX A;  2QAS A;  2XID A;  1KC8 R;  1M2O A;  4QVZ A;  4RKU E;  3AT1 B;  4Q5W A;  3VUZ A;  3GNG A;  1WJR A;  2RHI A;  4AFU C;  4M7A F;  4NL2 A;  4EMG A;  1W4S A;  3C94 A;  5CKB A;  5I2M A;  2QI2 A;  3I35 A;  2RI5 A;  3P8B B;  4M7D B;  3TVT A;  4ELZ C;  2WSF E;  2D6F A;  2X35 A;  3KBG A;  3NPF A;  2QXF A;  3QXE B;  1HYO A;  3QDR B;  1UFF A;  1QCN A;  2CRE A;  4HCB A;  3NTK A;  1M1F A;  2JMA A;  3H0F A;  2HZY A;  2WSE E;  2RJF A;  1ZSG A;  1UGV A;  3VS5 A;  1PHT A;  2KNB B;  1JXO A;  2CT3 A;  2EQI A;  2JUF A;  1NZ9 A;  2QYZ A;  1RAE B;  1MMD A;  4IUQ A;  1M9S A;  3UDC A;  1V29 B;  4M7D C;  2YUN A;  4Y28 E;  4OMP A;  1G5V A;  2HKN A;  1AZE A;  1PD1 A;  2DTO A;  2O4X B;  1WQ7 A;  4JZ3 A;  2FPE A;  4C92 G;  3A8H B;  2DM1 A;  3CME A;  1IRE B;  4MMK A;  4J9G A;  4IKF A;  3V7S A;  2XKO C;  5HKC A;  1VQL T;  4OVA A;  2QG9 B;  5LJ3 f;  4X9D A;  1LOJ A;  2GBQ A;  1HSQ A;  3CCS Q;  3CCR T;  2JT4 A;  2KMT A;  1AD5 A;  4FSX A;  4PJM A;  3EG9 B;  4IUU A;  3N5B B;  4ANJ A;  1UDL A;  1ACM B;  1WPY A;  3HFO A;  5I2S A;  1YIT A;  2CP6 A;  3CCQ Q;  3DB4 A;  4C8Q B;  4EPC A;  3SEM A;  2LX9 A;  2ZPB B;  4RTZ A;  4EDU A;  5GMK i;  5GAN 8;  4M75 G;  1D0X A;  2LQ8 A;  4CC7 A;  2LC4 A;  5AT1 B;  2QDY B;  1RAF B;  3WVD B;  1YHQ A;  2J6F A;  4PJO B;  1KK7 A;  3J80 E;  1M27 C;  4D8D A;  4F7U B;  4M77 F;  2EYZ A;  2AKK A;  4JRI A;  3GPL A;  1RI0 A;  2M0Y A;  1IXD A;  4A4F A;  4JJB A;  1YJN A;  2JS0 A;  2RQU A;  3E2U A;  1WLP B;  2XI9 A;  1K1Z A;  2OTJ T;  3JCM J;  4C92 A;  1KC8 U;  1M8V A;  3M58 A;  4AT1 B;  2HNI A;  3EG3 A;  4C8Q D;  3CD6 Q;  4WF2 A;  1VIE A;  2H3J A;  4L59 A;  2I0N A;  3OYI A;  4PJO D;  3H0I A;  2LZ6 B;  5GAN 7;  1VQP T;  1CKA A;  4KGV B;  2DD5 A;  5IHN A;  2EJ9 A;  1XJW B;  2IVW A;  3CCV Q;  2E1H A;  1PKT A;  8ATC B;  1PWT A;  1SSH A;  4GLK A;  4HT9 A;  1ZBX A;  4LNP A;  4N0A C;  4MDW A;  3VRZ A;  1ZUK A;  2LCL A;  1VQN Q;  1E7O A;  2QDL A;  4ZTJ A;  2D8J A;  4C0G A;  3HP9 A;  1K0S A;  2EBP A;  1QWF A;  1Q82 R;  4M75 A;  4FYV B;  1MNE A;  1KC8 C;  3OYH A;  1RAI B;  4K11 A;  2LCC A;  5J26 A;  1WGS A;  5KYU B;  1KQ1 A;  2C0I A;  2VYT A;  1T0J A;  1SPK A;  3M4Y A;  3I55 T;  1VYT A;  3OSS C;  1VQ4 Q;  5GAO r;  1RUW A;  2F2W A;  2RPN A;  1ZBJ A;  2DL5 A;  4J5Y A;  4N4I A;  1BK2 A;  3JCM h;  5CKH A;  4BI8 B;  2KI7 A;  1ZA1 B;  1Y96 A;  2RMO A;  1X2K A;  1YI2 A;  4XU3 A;  1N8R R;  4RTW A;  3WXM B;  1FMV A;  1VQ8 A;  4J9F A;  5KCO A;  2YSQ A;  1NBE B;  3EFS A;  5D7U A;  4IIO A;  2HQE A;  2K2V A;  3BW1 A;  2DO3 A;  4J9I A;  4M7A B;  4OMO A;  2E64 A;  5GAN h;  2K5I A;  4RTT A;  3M0U A;  2ABL A;  2M51 A;  1ZSZ A;  3EFO A;  3CCM T;  3QDF A;  3EGX A;  2V1Q A;  2E41 A;  2PU9 B;  1LVK A;  2R5M A;  5KYY B;  1Y57 A;  3HTR A;  2EKO A;  3G71 T;  5ECA A;  3QBY A;  1UGS B;  3CCU T;  2VVK A;  1JJ2 S;  4M78 D;  1DJ7 B;  5L23 A;  1NJI C;  4IIM A;  4OB2 B;  1G2B A;  4QVD A;  4EMK A;  2L89 A;  3G6E A;  2VXE A;  3RKW A;  2LQW A;  1UEC A;  2XDD A;  4OML A;  2C0T A;  5KE3 A;  4A54 A;  4M7A C;  3NTI A;  1Y07 A;  3M55 A;  1VQ6 Q;  2HL5 C;  1WA7 A;  4D6W A;  4Y92 A;  2R58 A;  1LNX A;  2AHJ B;  1QVG A;  2GQI A;  5GMK e;  1JJ2 P;  3F70 A;  3JCM V;  2HSE B;  1YJW Q;  5GAO n;  3UF4 A;  4JUV A;  2E10 A;  1PD0 A;  1TU0 B;  2CSQ A;  2ZPG B;  4M7D G;  3OYB A;  1YJ9 Q;  2FPF A;  4CRI A;  4O6J A;  2ESW A;  5A0D A;  2WAC A;  2J6O A;  4NL3 A;  4M4Z A;  2AZS A;  4RTX A;  1W6X A;  5CR2 A;  2O88 A;  1X6G A;  3JB9 J;  7AT1 B;  3QYH B;  4FCY A;  1X2Q A;  1V1C A;  3A98 A;  1Q82 U;  1UGQ B;  3V8L A;  3KXT A;  4HA8 A;  3M0Q A;  4ZN1 A;  2CGH A;  1E6G A;  3QZ5 B;  2V8K A;  3CME T;  4M77 B;  3CBM A;  2KXC A;  2EGC A;  5CKF A;  2RH2 A;  2XMF A;  1T3L A;  4PL6 A;  3UWN A;  1Q7Y U;  4R55 A;  2F1L A;  2H3E B;  2RNA A;  2H8H A;  1T0H A;  3QHS A;  1N8R U;  3OW2 A;  1QVF A;  5DM7 R;  3CC2 Q;  2KSS A;  2KYM A;  3MP8 A;  4FYY B;  1MV0 B;  2K3B A;  3OMC A;  2VC8 A;  3OYF A;  2MK5 A;  4PFP A;  4JS5 A;  4KGZ B;  1YIT T;  2CS7 A;  1RI9 A;  1Q82 C;  2DF6 A;  2R57 A;  1RLP C;  4M7D A;  3SB2 A;  2XD0 A;  4IUT A;  1JXM A;  2QGF B;  4E7L A;  1MUZ A;  1KQS S;  2K6D A;  1YHQ T;  1TSF A;  3L2Z A;  3MP1 A;  2X4Y A;  1Q86 C;  2YLB A;  4M77 C;  1VIF A;  4E7H A;  2EGA A;  3RER A;  4F17 A;  3LWH A;  4QT7 A;  2QA4 A;  4QQ6 A;  4F14 A;  4YTL A;  1OU8 A;  5GAN 2;  1YJN T;  1G3S A;  5KYN A;  5I21 A;  2SRC A;  4PLI A;  5GJW B;  1VQM Q;  2FO0 A;  2DIL A;  4P5N A;  2M9U A;  3OY9 A;  3V7C A;  2X9H A;  3PVQ A;  2X4W A;  2DBM A;  1M3B A;  4FW2 A;  1QVG P;  2V8J A;  2KY9 A;  1Z9Q A;  4BE1 A;  4AG1 C;  3CCL Q;  4JS4 A;  4FM4 B;  2VV5 A;  2HBW A;  2O4X A;  2O9V A;  3NFC A;  5LJ5 g;  1D1B A;  1H8K A;  1FYN A;  1EFN A;  3PT9 A;  3X28 B;  3SWN C;  1OUL A;  2ZPH B;  1S72 A;  1YCY A;  1EX4 A;  4AFS C;  2YWW A;  1GCP A;  2V8I A;  3GLX A;  3QYG B;  2JS2 A;  3X26 B;  4OF1 A;  4B9X A;  4DBH A;  2GF7 A;  3EHQ A;  4A53 A;  1SSF A;  3QJY A;  1XOV A;  3TRE A;  2DTI A;  4C8Q F;  5GAO m;  4DEX A;  4AG2 C;  3JCM d;  2RJD A;  4E7I A;  3J81 E;  2BTT A;  1KQ2 A;  2ED0 A;  1MV3 A;  4XU2 A;  3L2U A;  1ZLM A;  1V76 A;  3M53 A;  2QQR A;  1YI2 T;  1K0X A;  1KD1 C;  3CC4 A;  5D6Y A;  1BBZ A;  1LCK A;  1VQ8 T;  1OV3 A;  3PE0 A;  2KYB A;  3JCM Q;  2FL7 A;  1K76 A;  1NPR A;  2D0N A;  2E5Q A;  4PLL A;  3RNJ A;  5GAO l;  4BI3 A;  4LD9 K;  3ZEH A;  2DRK A;  4XTV A;  2GQV A;  2VKN A;  1QVF P;  1MMG A;  1OPL A;  3JCM W;  1AWX A;  2GFU A;  5LJ5 e;  3PIO A;  5GMK j;  4NOY A;  4C5I A;  1UG1 A;  1VQO A;  1GBQ A;  2AKL A;  3TSW A;  3E19 A;  2JW4 A;  4M7A G;  3X24 B;  3FLG A;  1ZA2 B;  4J8O A;  2IG0 A;  2CH4 W;  2EW3 A;  3JSC A;  2MWP A;  5J3B A;  2ZPF B;  1F1B B;  4LUE A;  2KT8 A;  1N9S A;  2A3L A;  4KRT A;  5L8R E;  3QJ6 A;  3JB9 F;  2DVE A;  1QQJ A;  2DD4 A;  1RLQ C;  3GBQ A;  2F2X A;  3VS6 A;  2JMC A;  3MO8 A;  2GTJ A;  1IRX A;  3EFR A;  2JJ9 A;  3MKD A;  2RHU A;  1TOV A;  4J7I A;  2CYZ B;  1VQL Q;  2ZAE A;  1E6H A;  4C0D C;  1IGU A;  3CCR Q;  1IO6 A;  2L0A A;  3OYG A;  2YXY A;  1AT1 B;  2YUP A;  2YRV A;  4M78 F;  3CC7 A;  2RD1 A;  1TUD A;  3RES A;  5HY6 A;  1TWB A;  1WZO A;  1PRM C;  1G3W A;  4BY6 C;  1KIK A;  2AK5 A;  3QWY A;  2KQW A;  4ORZ A;  1WHH A;  4HVU A;  5CQX A;  3REB B;  3REA B;  3FC3 A;  2DYB A;  3PTA A;  5M9O A;  2NUP A;  4AFQ C;  1Q81 R;  1WYX A;  2R5A A;  1M30 A;  2ROL A;  3QZ9 B;  1M90 R;  4XTW A;  5KYY A;  4WCI A;  2LDM A;  1M8M A;  2OTJ Q;  2EPD A;  4QW2 A;  2E6N A;  3V8J A;  3TQ7 P;  1QCO A;  2DFU A;  3CXC S;  1RAC B;  2JXB A;  2XIC A;  1ZQ1 A;  2DL8 A;  3OYA A;  2CKK A;  1R0C B;  3T9N A;  1MMN A;  3BDU A;  3S3M A;  2LQK A;  5GAM g;  2DL4 A;  3EG2 A;  3JCM f;  2EIF A;  3Q1J A;  3GNF B;  1ZUY A;  1Z9Z A;  3OB9 A;  2LX7 A;  1VQP Q;  1RAH B;  1RAD B;  4M77 G;  2DK3 A;  1XNI A;  4ZGE B;  1I07 A;  1N9R A;  3G4S A;  4X34 A;  1UB4 A;  1C0M A;  1YWO A;  4LD6 A;  1RAA B;  2EWN A;  3M0P A;  3OYK A;  1WHG A;  1PM3 A;  4MZM A;  1QVP A;  2C06 A;  2EYX A;  2QA4 T;  5GAN f;  1WNL A;  3I55 Q;  1FMK A;  1GL5 A;  4C0Z A;  1D3B A;  4GBQ A;  3URG A;  4C92 E;  2KAF A;  1W1F A;  2NUT B;  5FU6 B;  1QW1 A;  2OJ2 A;  2MF2 A;  1B7T A;  1YN8 A;  4C5H A;  2YDL A;  3OYE A;  3U23 A;  2MWO A;  3RMS A;  3V8K A;  2DNU A;  2OAW A;  4XQ3 A;  2A0F B;  1TXQ A;  3L2Q A;  2DAQ A;  2XDB A;  5GAM e;  2LVM A;  5CCA A;  2KVQ G;  1KJW A;  4M77 A;  3I5S A;  1U06 A;  3CCM Q;  2CZ1 B;  1VQ6 A;  2Z0W A;  4M75 E;  1S72 T;  1WHJ A;  3LYI A;  1IHV A;  3OA6 A;  2P0Q A;  1X01 A;  1VQK A;  3G71 Q;  2QEX A;  5FU6 C;  4JRP A;  1M2V B;  2RQT A;  1PSF A;  2RM4 A;  4QVC A;  3CCU Q;  2RA2 A;  3RUX A;  3M59 A;  5LJ5 j;  3C95 A;  3SFM A;  1PSE A;  1K8A R;  1JJ2 A;  2OTL A;  4C8Q C;  4R56 A;  2RQR A;  1HK9 A;  1WI7 A;  2M1H A;  3BY7 A;  1OPK A;  3MHX A;  2VGM A;  4OGE A;  4C92 F;  3P8H A;  2JVV A;  4II1 A;  3L1A A;  4PJO C;  1BIB A;  4JJC A;  2E70 A;  4EIK A;  1WFW A;  1YJ9 A;  3VS7 A;  3CC4 T;  2ED1 A;  3J7A F;  5CO7 A;  4F16 A;  1Q81 U;  2NWM A;  4ZN3 A;  3MJX A;  1M90 U;  1SRL A;  2JN0 A;  3MCA B;  1GFD A;  4E47 A;  1M1G A;  4HVV A;  2FRY A;  2PVG B;  3SWN A;  1WXB A;  2MMP A;  2MI6 A;  2LNH B;  4BE2 A;  3VYG A;  1UJ0 A;  2DET A;  3PNW C;  5FWC A;  2CZ7 B;  3CBP A;  4MZP A;  5LJ3 j;  3OS2 A;  2OX7 A;  1UHF A;  2M16 A;  2X4X A;  1QCF A;  1U1S A;  5AYF A;  3JCM b;  2GNC A;  2HSP A;  1Q7Y R;  1VQO T;  2DZ9 A;  2KRO A;  2QK0 A;  1OI1 A;  2AT1 B;  2LJ3 A;  5A0L A;  5LJ5 h;  1GCQ A;  3M0T A;  1YBY A;  1Q81 C;  3GF5 A;  4M78 B;  3UAT A;  3JB9 D;  3QO3 A;  4VUB A;  1ABQ A;  1VQ9 A;  3HSB A;  1S1N A;  2PTK A;  3UPU A;  4MML A;  4RCB A;  1SKU B;  1MND A;  1ZUU A;  2RK2 A;  5FRN A;  4OB3 B;  2MIO A;  4XTY A;  1M3A A;  3CME Q;  3EG0 A;  3I56 A;  3ZL7 C;  2DXC A;  2RB6 A;  2DXT A;  1FMW A;  2KE9 A;  4A4E A;  4ZGJ B;  1RL2 A;  3CMA T;  4QQD A;  2A36 A;  2VXF A;  1YP5 A;  3L2R A;  1WJS A;  3CCE A;  2OI3 A;  2DMO A;  4M78 C;  1VQ7 A;  2D9T A;  3CC7 T;  3E9G A;  2QAZ A;  3QWX X;  3HRS A;  4CC2 A;  2GGR A;  1HXD A;  4BI4 A;  2JNG A;  2RN8 A;  1VQM A;  2JM9 A;  2K3X A;  2QTX A;  1WIE A;  2GTO A;  1MHN A;  1KQS A;  4HCC A;  4BUG A;  1YHQ Q;  3JCM c;  3JB9 I;  3OQ5 A;  9ATC B;  2BUD A;  4ZNX A;  4DEY A;  3VS3 A;  2KRS A;  2HKQ B;  2J05 A;  4E7Z A;  5A0G A;  1VQ5 A;  1YJN Q;  2J06 A;  5C0M A;  1OYX A;  4PFO A;  3PFS A;  2L8D A;  1K8A U;  2K5F A;  3ME9 A;  2DJQ A;  2F5K A;  1H92 A;  4CC4 B;  5DY9 A;  5IXF A;  3S3N A;  1AEY A;  4OMQ A;  1YIJ A;  4JZ4 A;  1NE8 A;  5GAN 4;  1KG1 A;  1GFC A;  1WX6 A;  1JQQ A;  3OS0 A;  4DA4 A;  1K73 R;  1SF9 A;  1NEG A;  3OMG A;  4DOV A;  3CCJ A;  1I81 A;  4ELY C;  1M1K U;  2DLP A;  2ATC B;  4M7D E;  2K3Y A;  1X6O A;  2BKD N;  3OS1 A;  3RIR A;  3G4S T;  1ZHI A;  3LH0 A;  2DYI A;  8AT1 B;  3NGP A;  1KHI A;  1SG5 A;  2MPX C;  2O9S A;  4KUD K;  2LMJ A;  3KFV A;  4KBM B;  1SRM A;  5GAM j;  3OYC A;  1H64 1;  1H3H A;  3R6N A;  2MAM A;  3HPW A;  1AOJ A;  4JRK A;  2DKG A;  2P0P A;  1PKS A;  2F5T X;  4DBQ A;  3EGD B;  5GAO q;  2K9G A;  2LNV A;  3ASK A;  2M02 A;  2Y4X A;  4NS5 A;  3M56 A;  3VU3 C;  3EHR A;  1VA7 A;  1Y7X A;  2A7Y A;  2EYW A;  2E12 A;  2CH4 A;  5CIU A;  3VS0 A;  1FWZ A;  2DL3 A;  1LJO A;  5A2Q E;  5D6X A;  4JJN K;  1YI2 Q;  1GBR A;  3MEV A;  3C12 A;  1VQ8 Q;  4FT4 A;  2L3Q A;  2K7A A;  4X1V A;  4C92 B;  1IGQ A;  2FPD A;  3MEW A;  1K4U S;  4XTU A;  1CKB A;  3JAM E;  5IT9 E;  3JB9 H;  1R77 A;  2LP5 A;  3CEY A;  3I5R A;  3M4G A;  2RHZ A;  1Q7Y C;  2XU8 A;  2EJF A;  1JO8 A;  3VJP A;  1OEB A;  5FU7 B;  5KYX B;  4C8Q G;  4J7F A;  1N8R C;  5CKD A;  1LPL A;  5KYW B;  5GAM h;  1VQK T;  2RF0 A;  3M9Q A;  2QEX T;  2YT6 A;  2IIM A;  3I9Q A;  4PJO G;  3OYJ A;  1M5Q 1;  3H8Z A;  1U1T A;  2CZ6 B;  3THK A;  4F7U G;  4LDV A;  3OSV A;  3OBW A;  4KH0 B;  1KQS P;  2OTL T;  4C92 D;  4JLI A;  4KUI A;  2BE7 D;  1UUE A;  4RCC A;  1HJD A;  2EQU A;  2ENM A;  1QKX A;  2BZ8 A;  1Y71 A;  4FYX B;  1PRL C;  3WVE B;  4OMN A;  4J9E A;  4ATO A;  5FU7 C;  1Y96 B;  1X27 A;  2RJC A;  3S3O A;  1WHK A;  1K9M U;  2CP5 A;  4OP0 A;  4M75 D;  1UTI A;  5KE2 A;  3EG9 A;  2HCK A;  2NUZ A;  3RMQ A;  2LJ1 A;  2CP7 A;  3EAE A;  1IB8 A;  2EYY A;  1BYM A;  4Z88 A;  1BI2 A;  1AWO A;  4C8Q A;  1BI1 A;  2D1X A;  3A8M B;  1G3Y A;  2CSI A;  1ZSZ B;  2ZPE B;  3EFO B;  1B34 B;  1K73 U;  1O75 A;  5LJ3 g;  5LJ5 d;  1XQH A;  1FXX A;  2RI2 A;  2RHX A;  4PJO A;  4FIB A;  1BI0 A;  4RTV A;  1X6B A;  1VQ9 T;  1WXT A;  4F7U A;  1NYG A;  2KRN A;  2XHC A;  3JCM P;  4N0A A;  2CUD A; 
#chains in the Genus database with same CATH homology
 5IXB A;  1NLO C;  1Z9Z A;  1ZUY A;  1AWJ A;  2LX7 A;  1RUW A;  2W0Z A;  2F2W A;  2RPN A;  1ZBJ A;  2DL5 A;  1BK2 A;  1BU1 A;  1YCS B;  3H0H A;  4J9C A;  1I07 A;  1Y0M A;  4D8K A;  2P4R A;  2RMO A;  1YWO A;  1X2K A;  2L3P A;  1X69 A;  4RTW A;  2E5K A;  2CUB A;  3M0P A;  4J9F A;  2V1R A;  2KR3 A;  1SHF A;  2YSQ A;  4IIO A;  3VS1 A;  4J9I A;  2DE0 X;  2EYX A;  3PVL A;  4OMO A;  4CC3 A;  2X3W D;  1NYF A;  1FMK A;  1GL5 A;  2A37 A;  4GBQ A;  4RTT A;  3M0U A;  2DRM A;  2ABL A;  2M51 A;  1W1F A;  2V1Q A;  2OJ2 A;  2J7I A;  5I22 A;  1Y57 A;  2A08 A;  3JV3 A;  1YN8 A;  1NG2 A;  5ECA A;  2YDL A;  2J6K A;  4JPB W;  1BB9 A;  2FRW A;  3U23 A;  2VVK A;  2HEQ A;  5L23 A;  4IIM A;  4LE9 A;  2DNU A;  3ULR B;  2OAW A;  2PZ1 A;  2DX1 A;  1G2B A;  2MOX A;  2LQW A;  1UEC A;  4OML A;  3EGU A;  1NM7 A;  1VYU A;  4HVW A;  2C0T A;  1KJW A;  3I5S A;  1U06 A;  2KBT A;  1WA7 A;  1U3O A;  2LQN A;  1UJY A;  2L3S A;  4Y92 A;  2DVJ A;  5GJV B;  3VRY A;  2RQT A;  4ESR A;  2GQI A;  2KGT A;  2PNI A;  5IH2 A;  1K9A A;  2AZV A;  1VYV A;  2RQR A;  4JJD A;  1WI7 A;  4Z89 A;  2D8H A;  1OPK A;  2O2O A;  1M3C A;  3UF4 A;  2EVR A;  4JJC A;  1JU5 C;  2EKH A;  4EIK A;  2CSQ A;  1WFW A;  5EC7 A;  2FEI A;  3VS7 A;  2ED1 A;  2FPF A;  4F16 A;  2NWM A;  2ESW A;  1JEG A;  5IHK A;  2L2P A;  2J6O A;  1ARK A;  1SRL A;  4M4Z A;  1GFD A;  4HVV A;  2FRY A;  1WXB A;  1I1J A;  2AZS A;  2LNH B;  4RTX A;  1W6X A;  1OOT A;  1PNJ A;  5FW9 A;  1X6G A;  4Z8A A;  1UJ0 A;  2O88 A;  2YUO A;  2YUQ A;  3NMZ C;  4J9H A;  5FWC A;  1X2Q A;  1V1C A;  3H41 A;  4J9D A;  3A98 A;  2LCS A;  1GCQ C;  3VS4 A;  1UHF A;  3UA6 A;  1QCF A;  2GNC A;  3M0Q A;  2HSP A;  1E6G A;  3VS2 A;  2RQV A;  2RQW A;  2KRO A;  3CQT A;  2KXC A;  2LJ3 A;  2ECZ A;  2EGC A;  2SEM A;  1GCQ A;  3M0T A;  2XMF A;  1T3L A;  3IQL A;  4J9B A;  3UAT A;  4GLM A;  1ABQ A;  2RNA A;  2H8H A;  1S1N A;  2PTK A;  1T0H A;  5IHI A;  4LN2 A;  2KYM A;  1MV0 B;  1ZUU A;  2ROT A;  2K3B A;  2LJ0 A;  2KXD A;  2MIO A;  1QKW A;  1RI9 A;  1M3A A;  2DF6 A;  1RLP C;  3EG0 A;  3FJ5 A;  1JXM A;  1QWE A;  3ZL7 C;  1T3S A;  1MUZ A;  2C0O A;  2F2V A;  1CSK A;  2K6D A;  2KE9 A;  2HDA A;  2JM8 A;  5HCK A;  1KSW A;  2A36 A;  2KEA A;  2EGA A;  2G6F X;  2JTE A;  3TSZ A;  4AFZ C;  1YP5 A;  4F17 A;  4QT7 A;  3EG2 A;  1YWP A;  2DMO A;  2OI3 A;  4F14 A;  3QWX X;  1TUC A;  4CC2 A;  1WDX A;  1W70 A;  2GGR A;  3LH5 A;  2SRC A;  1YNZ A;  1ZX6 A;  4E6R A;  5GJW B;  2RN8 A;  2JM9 A;  2GTO A;  2FO0 A;  1WIE A;  1ABO A;  2DIL A;  2BZX A;  1G83 A;  3SHW A;  1AZG B;  3PVQ A;  3EG1 A;  2DBM A;  1M3B A;  2K79 A;  1Z9Q A;  4AG1 C;  1UHC A;  4ZNX A;  4DEY A;  3VS3 A;  2KRS A;  2HBW A;  2EGE A;  2J05 A;  2O9V A;  1H8K A;  2J06 A;  1UE9 A;  1FYN A;  1EFN A;  4AFU C;  1H92 A;  2DJQ A;  4CC4 B;  2X3X D;  4AFS C;  5IXF A;  3I35 A;  1AEY A;  4OMQ A;  4HCK A;  1GCP A;  3M0R A;  2VWF A;  4JZ4 A;  2JS2 A;  3TVT A;  4R0K A;  4HXJ A;  1GFC A;  1WX6 A;  1JQQ A;  3EHQ A;  1XOV A;  1NEG A;  5I11 A;  2CDT A;  1AVZ C;  4DEX A;  2DLP A;  4AG2 C;  3NPF A;  4FSS A;  2BTT A;  2ED0 A;  1MV3 A;  1ZLM A;  3NGP A;  1K0X A;  2KT1 A;  1UFF A;  2O9S A;  4RTU A;  2CRE A;  2LMJ A;  3KFV A;  1BBZ A;  1LCK A;  1OV3 A;  3PE0 A;  2KYB A;  2JMA A;  1SRM A;  2K2M A;  3H0F A;  1ZSG A;  1UGV A;  3R6N A;  3VS5 A;  1H3H A;  1PHT A;  1N5Z A;  1AOJ A;  3UA7 A;  1K76 A;  2D0N A;  3RNJ A;  2KNB B;  1JXO A;  2CT3 A;  1PKS A;  2EQI A;  2DRK A;  4RUG A;  1TG0 A;  2YUN A;  2K9G A;  2VKN A;  1OPL A;  1AWX A;  4OMP A;  1SHG A;  3EHR A;  1VA7 A;  1AZE A;  2EYW A;  3O5Z A;  2CH4 A;  4JZ3 A;  2FPE A;  1UG1 A;  3VS0 A;  2DL3 A;  1GBR A;  1GBQ A;  2DM1 A;  2AKL A;  3TSW A;  1A0N B;  4J9G A;  2JW4 A;  2L3Q A;  2K7A A;  4X1V A;  4A63 B;  2FPD A;  1K4U S;  2CT4 A;  2CH4 W;  2EW3 A;  1CKB A;  4LUE A;  2GBQ A;  1HSQ A;  1QLY A;  2KT8 A;  4KRT A;  2MCN A;  2JT4 A;  2LP5 A;  1AD5 A;  3I5R A;  1B07 A;  1JO8 A;  1OEB A;  1RLQ C;  1X43 A;  1UDL A;  3GBQ A;  2F2X A;  3VS6 A;  2BZY A;  2JMC A;  2RF0 A;  3SEM A;  4RTZ A;  3C0C A;  2YT6 A;  1KFZ A;  2IIM A;  2GTJ A;  3I9Q A;  2FG0 A;  4CC7 A;  3THK A;  2J6F A;  1E6H A;  1HD3 A;  1M27 C;  1UUE A;  4D8D A;  2EYZ A;  2AKK A;  1HJD A;  1IO6 A;  2L0A A;  2ENM A;  2M0Y A;  1QKX A;  1GRI A;  2BZ8 A;  1I0C A;  2YUP A;  4JJB A;  2DL7 A;  2KRM A;  1TUD A;  1NEB A;  1PRL C;  2JS0 A;  2RQU A;  1WLP B;  1PRM C;  1K1Z A;  1KIK A;  4OMN A;  4J9E A;  2AK5 A;  1U5S A;  3QWY A;  3EG3 A;  5FWB A;  2DA9 A;  4ORZ A;  1X27 A;  3RBB B;  4HVU A;  3REB B;  3REA B;  2DYB A;  2I0N A;  4AFQ C;  1WYX A;  1UTI A;  3H0I A;  2HCK A;  2NUZ A;  1M30 A;  2LJ1 A;  2LZ6 B;  2ROL A;  1CKA A;  2B86 A;  4RTY A;  5IHN A;  2EYY A;  4WCI A;  1PKT A;  4Z88 A;  1NLP C;  1J3T A;  1PWT A;  1SEM A;  1AWO A;  1SSH A;  4LNP A;  4OMM A;  2D1X A;  3VRZ A;  2A28 A;  2CSI A;  1M8M A;  1B3Q A;  1ZUK A;  4LUD A;  1E7O A;  2EPD A;  2QDL A;  2D8J A;  1K0S A;  2EBP A;  1QWF A;  2O31 A;  4RTV A;  1WXU A;  2JXB A;  2W10 A;  1X6B A;  2DL8 A;  1WXT A;  1NYG A;  4K11 A;  2KRN A;  2DBK A;  3NHN A;  1AWW A;  2CUD A;  2C0I A;  3M0S A;  1T0J A;  1SPK A;  2DL4 A;  1VYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...