4J9GA

Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p7 at ph7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
PNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P7
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
total genus 11
structure length 58
sequence length 58
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9gA00
2RMOA 4CC4B 2LCSA 2L3SA 2W0ZA 2RQVA 4JPBW 3VRZA 2C0IA 2AZSA 5IXFA 2HEQA 2RF0A 2YT6A 4RTZA 2JS2A 5GJWB 1AVZC 1AWWA 4Z89A 2KXDA 1YN8A 4QT7A 1PRLC 4D8DA 1RUWA 1WFWA 1WXUA 4ESRA 2K79A 1OOTA 4IIOA 4RTTA 1AWOA 4Y92A 3SHWA 2EVRA 2KRSA 3ULRB 3RBBB 1SHGA 1X6BA 2EKHA 3UA7A 4RTYA 1X43A 2K2MA 1KSWA 3PE0A 4J9GA 1VYVA 4AG1C 1BU1A 2J7IA 3M0QA 1OPLA 2W10A 3VS5A 2QDLA 1JXMA 2NWMA 1BK2A 2KROA 3VS7A 2LJ3A 2YDLA 4Z88A 2YUOA 2EYWA 3VS1A 2D1XA 1GBQA 1VYUA 2FPFA 2RQRA 1ARKA 1AZEA 2LJ1A 4OMMA 5FWCA 1W6XA 1YWOA 2EGCA 5IH2A 2DVJA 2GTJA 1E6GA 3EG1A 3VS6A 2ABLA 1TUCA 3REAB 3VRYA 2DM1A 1NEBA 5IHIA 2M51A 2LZ6B 4OMNA 4J9CA 2K3BA 1G83A 4J9FA 1NYGA 1YP5A 4HVWA 4CC3A 3NHNA 2CT4A 2K9GA 1H8KA 2DE0X 2SEMA 1T3LA 1CSKA 1UDLA 4RTXA 1X27A 2VWFA 1H3HA 1QKXA 4HVUA 1UHCA 1UGVA 1JXOA 3H41A 3A98A 2DLPA 5L23A 3H0IA 3ZL7C 1I0CA 2K6DA 4JJCA 3R6NA 3EGUA 2V1QA 1QLYA 1Y0MA 3M0PA 3QWYA 2KYMA 3I35A 1CKAA 2DF6A 1PRMC 1AZGB 2KRNA 4J9EA 2JT4A 2DL8A 2A36A 4LE9A 3EG0A 4LUEA 1GCPA 3M0UA 1HD3A 1WA7A 2DL3A 1WXBA 3LH5A 2EBPA 4F14A 2L3QA 2E5KA 1EFNA 2YUNA 1AEYA 4HVVA 1RI9A 1NYFA 1HJDA 2KT1A 4WCIA 2B86A 4Z8AA 1ZSGA 1VYTA 1W70A 1M3CA 1SHFA 4HXJA 2KR3A 1NLPC 1QCFA 2LP5A 2JMCA 5I22A 2DJQA 1RLQC 3C0CA 2JW4A 4J9IA 1QKWA 2EQIA 1PNJA 2ROTA 1LCKA 2J6KA 1KJWA 4F17A 1HSQA 1V1CA 2AKLA 2FRYA 5IHNA 3KFVA 1WLPB 2CDTA 1MV0B 2LQWA 2BZXA 4LN2A 2J06A 1UG1A 3H0HA 3NGPA 1T0JA 1QWEA 2MCNA 2ESWA 5ECAA 2FG0A 1K0SA 2P4RA 3GBQA 1A0NB 4AG2C 3RNJA 2HCKA 4RUGA 2AKKA 2F2VA 3EG3A 2LJ0A 1SSHA 2L3PA 1ZUUA 4J9BA 2KE9A 2KXCA 2G6FX 2JMAA 2FEIA 1U06A 1GL5A 3EHRA 1OV3A 2KNBB 3VS3A 2M0YA 3VS4A 4CC7A 1UTIA 1X2QA 2CH4W 4RTUA 1NEGA 2RNAA 1WIEA 2MOXA 2D8HA 4ORZA 4IIMA 1TUDA 2F2WA 4HCKA 1PWTA 3CQTA 3EG2A 2RN8A 3PVQA 4AFSC 4E6RA 4A63B 2YUQA 5EC7A 1W1FA 3VS2A 2ED0A 3UF4A 2BZ8A 4OMPA 2GNCA 2JXBA 1WXTA 2YUPA 2IIMA 1VA7A 1JEGA 4KRTA 4J9HA 1OPKA 3VS0A 2GTOA 2X3XD 3SEMA 3NPFA 2CSQA 4EIKA 1K76A 1GBRA 2AK5A 1RLPC 3FJ5A 1U3OA 4LNPA 1K1ZA 1UECA 2YSQA 3M0TA 2JM8A 1X6GA 1AWXA 2J6FA 1KIKA 2JS0A 3JV3A 5IHKA 2X3WD 1UJ0A 2DL5A 2O9VA 2GQIA 1E6HA 2ENMA 4JZ4A 2CREA 1G2BA 3I5SA 1UFFA 2ED1A 2O2OA 2DYBA 1ZUKA 2KRMA 4J9DA 1NG2A 2LX7A 1T0HA 3TSWA 3NMZC 2FO0A 4ZNXA 4AFUC 2D0NA 1FMKA 2JTEA 1Y57A 1GCQA 2EYXA 2L2PA 4JZ3A 1ZLMA 1GFDA 4OMQA 1PHTA 2KYBA 1AWJA 2OI3A 1BBZA 2ROLA 2AZVA 1CKBA 3EHQA 1U5SA 2KEAA 1M3AA 1PKSA 5FWBA 2K7AA 3QWXX 2CUBA 1OEBA 5GJVB 3REBB 1I07A 4OMLA 4D8KA 1X2KA 2F2XA 1GRIA 4DEYA 2CUDA 4DEXA 2C0OA 2EGAA 2DMOA 2DA9A 2KGTA 2OJ2A 1WYXA 1XOVA 4GBQA 1N5ZA 2DL7A 1H92A 1Z9ZA 2FRWA 1ABOA 2I0NA 3M0SA 1WI7A 4K11A 2XMFA 2HDAA 1UE9A 1Z9QA 1UHFA 2C0TA 2J6OA 1MV3A 2RQWA 1K9AA 1UUEA 1GCQC 1PKTA 2O9SA 1E7OA 1ZX6A 1ZBJA 1YNZA 4R0KA 4JJDA 1IO6A 1YCSB 4OMOA 3THKA 2EGEA 4CC2A 2HSPA 1B3QA 2RQUA 3H0FA 4JJBA 3TSZA 2BZYA 2DL4A 3PVLA 1ZUYA 2EYZA 2CT3A 2ECZA 1BB9A 1FYNA 1JO8A 2DILA 1M30A 1KFZA 1GFCA 1AD5A 5I11A 2O88A 2D8JA 1NLOC 1SPKA 2FPDA 3O5ZA 3UA6A 2PTKA 4RTVA 1M8MA 4LUDA 3I5RA 2O31A 5HCKA 2EPDA 1SEMA 2PZ1A 2CSIA 2EW3A 2DBKA 1S1NA 2DRMA 2KBTA 4AFZC 2DX1A 2PNIA 5IXBA 1SRMA 1K4US 2EYYA 5FW9A 2DBMA 1AOJA 1WX6A 2HBWA 3TVTA 1JQQA 1SRLA 1NM7A 2GBQA 2J05A 4AFQC 1ABQA 1X69A 2MIOA 3U23A 2LQNA 2VVKA 2A08A 2FPEA 4X1VA 2LMJA 3UATA 2DNUA 4M4ZA 2CH4A 1T3SA 3M0RA 2DRKA 2NUZA 1YWPA 2RQTA 2L0AA 1J3TA 4FSSA 3IQLA 2JM9A 2KT8A 1WDXA 2BTTA 2V1RA 4F16A 1TG0A 1MUZA 1M3BA 2VKNA 1JU5C 1UJYA 2RPNA 2A37A 2OAWA 1K0XA 2LNHB 2SRCA 2GGRA 1I1JA 1B07A 1QWFA 4RTWA 1M27C 3I9QA 2H8HA 2A28A 4GLMA
chains in the Genus database with same CATH superfamily
5CO7A 4C0DC 4BACA 4KH0B 4N4HA 2C0IA 2RF0A 4RTZA 4DBQA 1WFWA 4BB7A 2DJZA 4ME7A 1N8RC 3EFRA 4RTTA 4C92C 3OYBA 3ULRB 4A4KA 1QVFS 2Y90A 1BKBA 2JUFA 4M75C 3CC4T 1VQ4A 1Q81R 3NFCA 3OBWA 1BU1A 4P5NA 1BCMA 4M7DD 2E41A 2NWMA 3CPWS 2KROA 4X9DA 1YJWT 4Z88A 3UT1A 1I4K1 2YUOA 2EYWA 2D1XA 2DZ9A 1MMDA 1VYUA 4E7JA 4HA8A 2FPFA 2YRCA 3ER0A 3MP6A 1YWOA 2M0OA 2GTJA 2ZAEA 1I8FA 2OX7A 3VS6A 5DM7R 4QVCA 3G1JA 4DOVA 2MPXC 2DM1A 3V7RA 3PMIA 1YITA 4OMNA 5KYXA 1G83A 4J9FA 1YP5A 1G5VA 4ELYC 3OYGA 2CT4A 1BIAA 1H8KA 3G6EQ 4J7IA 1QMCA 1OX9A 4C92D 1KQSS 1CSKA 1H3HA 2COZA 1UGVA 2MYSA 1JXOA 3H41A 1M8VA 3CCQT 1HK9A 3A98A 3CCLQ 1JJ2P 3ZL7C 1YIJA 1SSFA 2HKQB 3R6NA 1BI0A 4C8QC 1K9MU 3JB9I 1AZGB 2KRNA 2G3RA 3EGXA 1N9RA 4FYWB 1IB8A 1HD3A 2EAYA 2E5KA 2YUNA 1AEYA 2A3LA 1Q81C 1OU8A 2YRVA 3VUBA 1WQ7A 2JNGA 2CZ6B 3E9GA 5GANd 3CMAQ 1VIFA 1HJDA 1C6VX 3CCVQ 4BY6C 1ZSGA 4M7AA 1G8XA 4PJMA 3HHTB 1SHFA 2KR3A 4OB3B 2R58A 3J7AF 1YJNQ 1NLPC 3M4YA 5I22A 4KUDK 2ZPFB 4E7LA 1C0MA 3L2ZA 4O5VA 4BD3A 3NTHA 5GANh 5FRMA 3HFNA 5L8RE 2JJ9A 1KJWA 5GAOq 3I56Q 1KG1A 4F17A 4C8QD 4XU1A 1V1CA 1S72T 3M53A 3KFVA 1M4ZA 4M78F 5LJ3d 2LQWA 1MV0B 1OZ3A 3CC4A 4BE2A 3H0HA 1U8RA 2K5IA 5ECAA 2FG0A 3QJ6A 2F1LA 4J6XA 1BYMA 1VQ5Q 3QZ9B 4PFPA 3R6OA 1Q7YR 2GF7A 4XTWA 4KUIA 3M4GA 3OS1A 3S3MA 2F2VA 3EG3A 5LJ3h 3CD6A 1HXDA 2RH2A 4PJOC 3M56A 1BI3A 2KXCA 2JMAA 2DO3A 1KQ2A 1NPPA 2M0YA 1TUGB 1UTIA 2CH4W 4M7AB 3V8KA 3CMEA 4F04B 2QEXA 1G3WA 1WIEA 4PKCC 3KUFA 4FM4B 2MOXA 4IIMA 1N8RU 1VQ6Q 3HPWA 2F2WA 4HCKA 1PWTA 4M7DG 1YJ9A 4DBHA 4AFSC 4E6RA 2QQ9A 2L8DA 4CI0C 1W1FA 1OULA 3JCMd 4RG2A 1M1KR 3CC2T 1N9SA 5GMKj 3CCET 2BZ8A 4N4IA 2IIMA 2ZPGB 4A4GA 2GTOA 3SEMA 3MJXA 4O6JA 2YWWA 1XNIA 1K76A 4M77F 1GBRA 3FJ5A 2EYQA 2YSQA 2V8KA 3M0TA 5KYYA 4C92G 2JM8A 1X6GA 1AWXA 2J6FA 4PJOD 2VXFA 3JV3A 1MHNA 1Q95G 2DL5A 1JJ2A 3I55T 2ENMA 4M75G 1G2BA 4E7SA 1UFFA 2ED1A 1JRIA 4X34A 3C95A 2HMAA 2RI2A 3A8LB 1ZUKA 2CS7A 1NG2A 2LX7A 2P84A 4MZTA 3OBYA 2CGHA 2FO0A 1FMWA 2JTEA 1GCQA 3G71T 1Q7YC 1GFDA 1Y7XA 1PHTA 2KYBA 2LX9A 4IURA 3JCMe 1QP3A 2ROLA 3CCSQ 2AZVA 5GANg 4NS5A 4E7IA 3M5AA 3JB9F 1PKSA 2DEUA 5FWBA 1M90R 3QWXX 2CUBA 1OEBA 5GJVB 3N5BB 2JOYA 4OMLA 2F2XA 1GRIA 1ZBXA 2CUDA 2LQKA 2C0OA 1VQ8Q 2OJ2A 1WYXA 2OTLQ 4GBQA 1N5ZA 2FRWA 1ABOA 2I0NA 3OW2S 2LVMA 1WI7A 1P92A 2HDAA 4MMKA 2LTOA 1Q81U 1KD1R 2C0TA 3MPUB 5LJ3g 1KHIA 2EKOA 3CC7T 1VQKT 1E7OA 5GAN4 1ZBJA 4J8OA 2X9HA 2D6FA 4NOYA 1YCSB 4OMOA 1QQJA 1VQ7Q 2EGEA 4CC2A 1D0XA 3QDFA 4C8QG 2QA4Q 3H0FA 2VB6A 5LJ5j 3MEUA 4KH1B 4LDWA 1VQLT 2BE7D 2EYZA 2MF2A 4EMKC 1M5Q1 3CCMQ 1IXDA 1BB9A 4KGZB 1GFCA 4M78C 5CQXA 2O88A 1SPKA 5GANf 2P4TA 3UA6A 1AHJB 2QDYB 3I5RA 3SWNC 5HCKA 2KVQG 1ZSZA 4KGXB 3CC2A 2CSIA 2HZYA 4M7DF 3ZBDA 4A4HA 2DBKA 3CCEA 2A7YA 2KBTA 5M9OA 2V26A 4CRIA 2QTXA 3JCMV 1K4US 2ATCB 5GAN6 5GAN3 1MMGA 2KQWA 2HBWA 2K3XA 3E2UA 2EWNA 5D6XA 5LJ3f 1MGQA 2MIOA 1UGQB 2A08A 4JS5A 3UATA 4M4ZA 3M0RA 4E7KA 3OYYA 4LXCA 4BDZA 2RQTA 3DKMA 2CYZB 3G7ZA 3PFSA 5CKHA 3I55A 4LD9K 2K3YA 4RCCA 4C92F 4DBRA 4PLIA 2RI5A 3A5ZB 1KD1C 5GAN5 2VUBA 1UJYA 1UGPB 1I5OB 5I2MA 4M75A 3G71A 5KCOA 4RTWA 5CIUA 3LX7A 3MEAA 1U1SA 3FDRA 3VYHB 3DB3A 4M77C 1RAHB 1W2BS 4PJOG 4CC4B 2LCSA 2L3SA 4JPBW 2IPOB 3JCMc 1M1FA 3JAME 4IKFA 1FMVA 3OYLA 4QQ6A 5GJWB 1AVZC 3A8MB 4D8DA 2FZGB 2DD5A 4B9WA 2XI9A 2CKKA 2M9UA 2EQUA 4Y92A 2B8AA 2KRSA 3RBBB 1SHGA 3UA7A 1VQPQ 1VQ4T 4TVRA 4RTYA 1IGUA 3CC7A 3FEOA 2K2MA 4M7DE 1C1AA 1NZ9A 5GAOr 1PM3A 4FT2A 3DLLA 1VYVA 2J7IA 1Q7YU 4ZTJA 3EFOB 8AT1B 2PVDB 2QQSA 2EQKA 2X4YA 2M02A 3HL8A 3Q1JA 1VQLA 2LDMA 4V2SA 2RQRA 4F7UG 1AZEA 2PVGB 2LJ1A 2XU8A 4J83A 1W6XA 2EGCA 5FU6C 2DVJA 4PL6A 3X28B 4PFZA 4C8QF 7AT1B 1RAAB 3DLMA 1MMNA 1YITT 1FWZA 1NEBA 1KC8R 2AT1B 2LZ6B 3OMCA 4A54A 2PUOB 8ATCB 3CBMA 4LDXA 2K9GA 2DE0X 3S6WA 4M75E 2E12A 3GOXA 4JDSA 4C5HA 3BDUA 1X27A 1WQWA 1YCYA 3JCMQ 1YHQA 2DLPA 1YIJT 2DFUA 3CCUT 2RHYA 2PQWA 3EGDA 3H0IA 2HKNA 3QXEB 2K6DA 3QSUA 3WVDB 1S72Q 1Y0MA 2DIQA 5AT1B 3I35A 1QVGS 3QYGB 1RL2A 4J9EA 3QIIA 4OF1A 4LDVA 2A36A 4BI8B 4HCZA 3M9QA 1R8OB 2OTJQ 3M0UA 3X25B 2DL3A 2P0KA 1H641 1NPRA 3QDRB 4HVVA 3CCJQ 3RIRA 1WHMA 4BUGA 4KULA 2XDPA 1Q86R 2QYZA 1RAIB 1TOVA 4WCIA 2NUPB 1VQ9Q 9ATCB 3V7SA 1M90U 4HXJA 5D6WA 1QCFA 1WZOA 2DJQA 4PJOF 4PJLA 2ZCFB 2JW4A 4IUVA 4J9IA 4M78G 4XU2A 4C8QE 2CP7A 2X4JA 2ROTA 3CXCS 3VUZA 1LCKA 2J6KA 1WHGA 4C0ZA 1HSQA 1KC8C 1KK7A 2AKLA 1PD1A 1VQNT 1KD1U 2CDTA 4LN2A 3NGPA 4B9XA 2QGGA 2DAQA 2ESWA 1OQKA 1SKUB 3GBQA 5FU7B 1G3TA 4E2FB 3RNJA 2HCKA 3M58A 4QW2A 3CD6T 4RUGA 2AKKA 3V7CA 2YLCA 1RAFB 1SSHA 4C5GA 2KE9A 3RDVA 2G6FX 2WSEE 1GL5A 3CMET 3VS3A 2QEXT 4EPCA 6AT1B 3H6ZA 3FRNA 1NEGA 4KBMB 4F7UF 2RNAA 2K5LA 1PG5B 3T9NA 1YJ9T 1TUDA 1EX4A 3RKWA 2QI2A 4PJNA 1IRXA 2CP3A 2RN8A 3PVQA 1K73R 5EC7A 4E7ZA 2F69A 1Q86C 1M2OA 1LOJA 2K57A 1QVFP 5I2SA 2YHTA 1W4SA 4Q5WA 4M77G 2YUPA 1VA7A 3HSBA 2CZ7B 3BW1A 4WTOB 4QVDA 3CCUA 2BE9B 4EMHA 2X3XD 3PMTA 1V29B 2CSQA 4RG8A 3CPWP 4PJOE 3ZEHA 1G3SA 5GAOm 3UDCA 2MK5A 4ZN3A 4LNPA 1WHHA 3C94A 2EJFA 2FVUA 2RD1A 2RI3A 1KQ1A 3QJYA 5IHKA 3GIBA 3PIPA 2O9VA 3OS2A 2MAMA 1VQ7A 3I5SA 2O2OA 2QG9B 3JB9G 1IZ6A 1R0BG 3KBGA 1T0HA 3BE3A 5KYXB 4BE1A 2V8IA 5D7UA 4AFUC 2D0NA 5IT9E 1EIFA 1FMKA 1TS9A 1Y57A 3EAEA 4QQDA 3OSVA 1AWJA 1BBZA 4AT1B 3P8HA 1YI2T 2KEAA 3HP9A 1M3AA 3JCMP 2M1HA 2K7AA 2EQMA 3ME9A 4E47A 1VQOQ 2L5QA 3OB9A 2DXCA 3GPLA 3F70A 2DMOA 1X6OA 3L2QA 3JCMb 1WNLA 4EMKA 1B34A 2GQVA 3JB9H 2OAUA 4M78A 1VQNA 1IREB 2HNIA 3EGXB 1K73C 4JLGA 1WPYA 2F5KA 3CBOA 1QVPA 1EZZB 2J6OA 2E65A 4IUTA 3CEYA 2RQWA 1UUEA 4JJDA 1IO6A 2XK0A 3OYIA 3HRTA 2HSPA 3CCRT 4JJBA 3E19A 3VKIA 1ZUYA 5GANj 2ECZA 1JO8A 1XJWB 3TREA 2RHXA 2XDBA 2XD0A 2D8JA 3G4SQ 1KC8U 2COYA 1TSFA 2FPDA 2PTKA 5CR2A 4LUDA 1X75C 3MEWA 4D6WA 1I81A 2VGNA 1AT1B 2RHUA 2PZ1A 2E3IA 4UC4A 3PNWC 4B6MA 2GFUA 2DRMA 1B34B 3PTAA 5GMKe 2DX1A 4FW2A 3V8LA 2CP0A 4LDYA 2JZ2A 3JCMh 5FW9A 5LJ3j 2GCXA 2RA2A 3MP8A 3GNFB 2DBMA 4C0FA 3TVTA 4M77A 1JQQA 1NM7A 2J05A 2HSEB 1ABQA 1QVFA 3U23A 2VVKA 2O4XA 3HTRA 2DTOA 4M78E 2NYSA 4N0AC 4J7FA 1YWPA 2EJ9A 2L0AA 5HK0A 2FHDA 4C0GA 3EG9A 2E5QA 3IQLA 2EFIA 2RJDA 2JM9A 2KT8A 3CPWA 1WDXA 2DD4A 4OB0B 4Z02A 2V1RA 1MNEA 4MMLA 5A2QE 4WF2A 1Q86U 4PK4A 1M3BA 1K0XA 2A37A 2ZPIB 2LNHB 5GAMe 3I9QA 3QG1A 2A28A 2X4WA 1ZA2B 2VXEA 1YI2A 2BKDN 2RMOA 3M57A 2W0ZA 3L2WA 2RQVA 3VRZA 5KYUA 1YITQ 3G6ET 2QASA 1QP2A 2HEQA 2KXDA 1YN8A 4EDUA 1RUWA 4ESRA 1RAGB 5IAYA 1OOTA 4IIOA 2LCCA 1QW1A 1M1KC 3SHWA 1JBMA 4EMGA 5KYYB 3J81E 1X6BA 2EKHA 5KYNA 1YIJQ 2MMPA 4J9GA 3H9NA 4HT8A 2LNVA 3OS5A 3JSCA 3M0QA 2JVVA 1VQMQ 1BK2A 3VS7A 3CCRA 4M7AC 3BDLA 4M77E 3VS1A 1GBQA 1U1TA 5LJ5e 3S3OA 2KAFA 1UEBA 5FWCA 2WSCE 2BUDA 3CMAT 3CCVT 4E7HA 2ABLA 3V8JA 1XTDA 3VRYA 5HK3A 2M51A 3RESA 5J26A 4J9CA 2K3BA 2DPPB 3OA6A 1K73U 1NYGA 4CC3A 1YJNT 4M7DA 3JCMg 4FSXA 2RHIA 2EQJA 3OW2P 1DJ7B 1OI1A 2V8JA 2EJGA 2PUKB 1UDLA 4RTXA 2VWFA 1QKXA 3WXMB 3I56T 1YHQT 1M90C 1UHCA 4FL6A 2ZPHB 3OYMA 4OB2B 2E70A 2R5AA 1M2VA 5L23A 5EG2A 1VIEA 3AHUA 2L3RA 3S3NA 1R0CB 2V1QA 1QLYA 4XAXB 3M0PA 3QWYA 4M7AD 3A8HB 2KYMA 3CC4Q 1B7TA 2P0PA 2DF6A 3JB9J 1PRMC 4J5YA 1VQ5T 5C0MA 4LE9A 3EG0A 4C92A 3FB9A 2LC4A 1WHLA 1K9MR 1YJWQ 2XIDA 2EBPA 3MCAB 4F14A 5I21A 1Q82R 1EFNA 3CD6Q 5CVIA 4OVAA 4QQGA 1NYFA 1D09B 1ZSZB 3QPHA 2P0QA 1D3BA 4A4EA 4MDXA 3CMEQ 3JCMJ 2B86A 1VQ6T 2KMTA 2QEXQ 4M7DB 2VGMA 2D9TA 3G6EA 4IUQA 3OYJA 3JCMf 4L59A 4MZPA 1YJ9Q 2M16A 1YBYA 4J6YA 3C0CA 3META 1QKWA 3P8DA 2EQIA 4C0DB 3AT1B 1M2VB 5A0DA 5DLOA 2DYIA 3CCLA 2FRYA 3CCQQ 2BZXA 2J06A 1UG1A 1O75A 2K4YA 2Z0WA 4DQ2A 2QK0A 1K0SA 2P4RA 4C92B 4ZGDB 4AG2C 1NBEB 4M75B 4XU3A 2L3PA 2XKOC 3KXTA 1ZUUA 4J9BA 4C5EA 1ZA1B 4L5GA 1W2BP 4C8QA 3CMAA 3VS4A 4CC7A 3RMSA 3H8ZA 3CCVA 2DTHA 4C92E 2O01E 2JTFA 5KE3A 3CCST 2X4XA 4FT4A 2D8HA 1BI1A 1M1KU 1WJQA 4ATOA 1YJNA 3CQTA 2KK4A 1TXQA 3RR6A 2C06A 4A63B 2YUQA 1N8RR 3VS2A 1D1CA 2ED0A 3TEEA 1VQOA 2LT1A 1VQ8T 3I56A 1UGSB 2OTLT 5GAOn 4LDUA 1JEGA 3QHSA 5CAIA 1R77A 5GMKl 2KI7A 2LRQA 3GF5A 2HQXA 2K2VA 3NPFA 5KH6A 3OW2A 2AHJB 2VV5A 3UPUA 1FXXA 2AK5A 1RLPC 1U3OA 1VQ5A 1UECA 3OY9A 4XTUA 2RHZA 2QXFA 2IG0A 2X3WD 1VQ7T 4MDWA 2GQIA 1E6HA 4C8QB 4ZN1A 4LD6A 2QQAA 1OZ2A 3ASKA 2E4HA 2ZZDA 3TSWA 3CCMT 3LWHA 1ZHIA 2I2LA 4M7AG 1VQ6A 2EYXA 2L2PA 3HRUA 3OS0A 4OMQA 2D0QB 2KDSA 2OI3A 3QO3A 1CKBA 3EHQA 4JRKA 3RKXA 3G4SA 1U5SA 5GMKm 3A8GB 1LJOA 1M9SA 4PJOA 1BI2A 4II1A 3FIFA 4N4GA 5GAN7 2XDDA 3P8BB 4BY6B 1X2KA 3EGDB 3OYAA 3CC2Q 4DEYA 2EGAA 2R5MA 3TQ7P 2KGTA 3CCEQ 2BIVA 1QCNA 1NE8A 2DL7A 3SB2A 1QVGP 1H92A 4J6WA 5IN1A 1WJSA 4XTXA 5CKEA 1KHCA 1UE9A 1Z9QA 1RADB 2E3HA 1UHFA 1MV3A 1K9AA 2QTVA 1PKTA 2LT4A 4FYXB 1H3ZA 2O9SA 2YLBA 4DBFA 1ZX6A 3NTIA 3MO8A 1JJ2S 2RK2A 3C12A 5J39A 4MZMA 5GAOl 2NLUA 2DVEA 3THKA 1F1BB 2K5FA 1B3QA 3I55Q 2RQUA 3O8VA 2A0FB 2HQEA 2DL4A 4FU6A 1ACMB 3PVLA 4ZGJB 4F7UA 2KY9A 1G3YA 2H3JA 1M30A 2FYKA 3CCSA 1AD5A 2YRDA 4PJJA 3PIOA 5I11A 1NLOC 3G71Q 4PJOB 1M8MA 3CXCP 5A0GA 2MWOA 4N0AA 3HFOA 2O31A 2EPDA 1W2BA 4FCYA 1SEMA 2DEQA 1QCOA 3EFSA 1WJRA 2EW3A 1VQ8A 2YXYA 2OTLA 1N6AA 2IVWA 2PNIA 5IXBA 2CZ1B 5FLXE 4OP0A 4JUVA 5GAOp 1AOJA 1D0ZA 1VQPT 4M75D 1GXIE 2ZPBB 3QUIA 4GLKA 1SRLA 3GNGA 2GBQA 4JRPA 4HCBA 4AFQC 3JRZA 1X69A 4FYVB 5CK9A 5KE2A 3CC7Q 2LQNA 2FL7A 2X51A 3OYDA 1VQKQ 2LMJA 1IHVA 5DY9A 1T3SA 3GLXA 3OMGA 2DRKA 1VQMA 2QA4A 4FSSA 1Q82U 3QYHB 4F7UB 5GMKi 4PFOA 3CCMA 2XG8D 1VQLQ 1MUZA 2OAWA 3QZ5B 2WSFE 1KQSP 1B07A 1QWFA 4OGEA 2QAZA 4R56A 4RMOA 4M7AF 2VC8A 3NTKA 2HL3A 2QGFB 4ZTFA 4F7UE 2AZSA 5IXFA 2YT6A 2JS2A 4ANJA 2WACA 1AWWA 4FYYB 4Z89A 4QT7A 1PRLC 3SD4A 1BIBA 1MMAA 1WXUA 3CPFA 2K79A 4BDYA 5A0LA 4KT0E 1AWOA 5FU7C 2EVRA 3SWNA 1YHQQ 2XICA 3CBPA 1OX8A 1X43A 4NL2A 1KSWA 1RI0A 2E1HA 2EIFA 3LH0A 3PE0A 4AG1C 1TH7A 3L2RA 5GMKh 1OPLA 2W10A 3VS5A 2QDLA 1QVGA 1JXMA 3VYGA 2OTJT 2LJ3A 2YDLA 4XQ3A 4Y91A 2HL5C 5CKBA 1YJWA 2RK1A 3CCJT 2DETA 1ARKA 4OMMA 2CP2A 5GANe 1M1GA 5IH2A 1PCXA 1E6GA 3EG1A 1RABB 1VQ9T 1TUCA 1NJIR 3REAB 2E6NA 5GAMd 4XU0A 1I5LA 5IHIA 4AMCA 4HVWA 3NHNA 4EMKB 2F5TX 2JN0A 3RUXA 4M78B 2CZ0B 3TCJA 2MWPA 2NUTA 2SEMA 1T3LA 3M54A 5FRNA 1RAEB 3LWIA 4HVUA 3FC3A 3SWNB 5GAMh 3LGFA 5C6SA 1WHJA 4JJNK 1K8AR 3CXCA 1ZQ1A 3FJPA 3RERA 5LJ3e 1VQPA 4M7AE 3CCQA 4PNOA 3RMQA 1I0CA 1VQ4Q 4JJCA 3EGUA 3TU4K 1CKAA 2DXTA 3UWNA 2GFAA 2JT4A 2DL8A 1SF9A 1LNXA 4LUEA 1GCPA 1WA7A 4OMFB 1WXBA 3LH5A 2L3QA 2RB6A 5LJ5d 1XQHA 4YTLA 1RI9A 3LLRA 2ZPEB 3EH1A 4ELZC 3J80E 3X20B 3DB4A 2KT1A 2VASA 4L6V5 4DA4A 3JCMX 3X26B 4Z8AA 3OYKA 1VYTA 2LQ8A 1W70A 1M3CA 5GAMj 4Y28E 4ZGEB 2NUTB 3VU3C 2LP5A 5LJ5h 2JMCA 2RJEA 1RLQC 3INZA 2QQBA 4JS4A 1KQSA 2RM4A 4M77B 1PNJA 2HQHA 3CCLT 1NJIC 4FW1A 3MHXA 5GAN2 2O4XB 3OSSC 2DXBA 5IHNA 1Y07A 1WLPB 3CCUQ 1S72A 1O9SA 3EG9B 1T0JA 1QWEA 2MCNA 4PLLA 2LCLA 1K8AC 5J3BA 1A0NB 2OTJA 3GP8A 4JRQA 4X9CA 2DK3A 5GAN8 1PC0A 2LJ0A 2H3EB 5CQYA 4VUBA 3L2VA 3CCJA 1VOMA 2FEIA 1U06A 2Y4YA 3EHRA 1OV3A 2KNBB 2FB7A 3BY7A 1X2QA 5KYUB 1MNDA 4RTUA 3VJPA 1TTHB 1VQ9A 3FLGA 5AYFA 3URGA 4BE0A 4ORZA 3PGGA 2FZCB 3EG2A 5GAMg 3OYEA 5FU6B 2CP5A 1SG5A 4DOWA 2L89A 1VQOT 2KSSA 3VV0A 2Y4XA 3UF4A 4IUPA 2GNCA 2JXBA 4OMPA 1WXTA 4R55A 4HKEA 4OB1B 5CKFA 4XTVA 5KCHA 4KRTA 4J9HA 1OPKA 3VS0A 2RJCA 1OYXA 2E64A 3E9FA 2ZGWA 4BI3A 1RACB 1VQNQ 3BFMA 1D1AA 4EIKA 3QBYA 4RCBA 1K1ZA 1JB0E 1OU9A 4A4FA 1KIKA 3X24B 3LW5E 2JS0A 1UJ0A 3QKJA 3A1PA 4HCCA 3MKDA 4JZ4A 2CREA 3HKSA 2E10A 2DYBA 2KRMA 3MEVA 4J9DA 2HD0A 4KGVB 3NMZC 1VUBA 4M78D 2PVOB 4ZNXA 3EFOA 5LJ5g 3OYHA 3G4ST 4HT9A 4JZ3A 3M59A 1ZLMA 4M75F 1Y96A 4QKUA 1Y71A 5CKDA 5GAMf 2AIRB 4BI4A 3L2UA 1HYOA 2PU9B 2DKGA 5FROA 5KYWA 3REBB 1I07A 4D8KA 1WGSA 3SFMA 1N27A 4DEXA 3SDZA 3RKYA 2DA9A 1XOVA 1UB4A 1Z9ZA 3M0SA 2FZKB 4K11A 2XMFA 3OQ5A 2DZCA 4A53A 2R57A 3L1AA 4IUUA 1TU0B 1GCQC 4C5IA 1LVKA 3LGLA 3OYCA 1YNZA 4R0KA 1VQKA 4NL3A 3OYFA 1YFNA 3LYIA 5DLQE 1BCOA 2CP6A 4JRIA 1X01A 2COWA 1D3BB 3TSZA 2BZYA 3L42A 5CCAA 1WHKA 1D1BA 2HBPA 4OGCA 2CT3A 1V76A 3A8OB 5LJ5f 1Y96B 1D0YA 1K9MC 1FYNA 2DILA 1PSEA 1UGRB 1KFZA 3HRSA 1NJIU 3WVEB 4M77D 1Q82C 3ZFJA 3O5ZA 4RTVA 3OYNA 4GY5A 2QQRA 1YI2Q 2MI6A 4XTZA 5KYWB 2DXUA 2XHCA 1IHWA 3EH2A 2NUPA 1S1NA 2DTIA 2DERA 4AFZC 1K8AU 1LPLA 1SRMA 1TWBA 4RKUE 2EYYA 2RO0A 5HY6A 1WX6A 5LL6S 4JLIA 4QVZA 3D7SB 3JB9D 3E1SA 2FPEA 2X35A 3PT9A 4X1VA 2DNUA 3JCMW 3MP1A 2CH4A 2JTMA 1VQMT 2QA4T 4FIBA 3M55A 2NUZA 2VYTA 5HKCA 1J3TA 5D6YA 1ZSZC 1IGQA 4XK8E 3CCRQ 2DIGA 2BTTA 1PSFA 4M7DC 2RJFA 4F16A 1TG0A 1FX7A 2VKNA 1JU5C 2RPNA 2SRCA 2GGRA 2E6ZA 1I1JA 1PD0A 2HAXA 3C4SA 1M27C 2H8HA 4XTYA 4GLMA
chains in the Genus database with same CATH topology
2RMOA 4CC4B 2LCSA 2L3SA 2W0ZA 2RQVA 4JPBW 3VRZA 2C0IA 2AZSA 5IXFA 2HEQA 2RF0A 2YT6A 4RTZA 2JS2A 5GJWB 1AVZC 1AWWA 4Z89A 2KXDA 1YN8A 4QT7A 1PRLC 4D8DA 1RUWA 1WFWA 1WXUA 4ESRA 2K79A 1OOTA 4IIOA 4RTTA 1AWOA 4Y92A 3SHWA 2EVRA 2KRSA 3ULRB 3RBBB 1SHGA 1X6BA 2EKHA 3UA7A 4RTYA 1X43A 2K2MA 1KSWA 3PE0A 4J9GA 1VYVA 4AG1C 1BU1A 2J7IA 3M0QA 1OPLA 2W10A 3VS5A 2QDLA 1JXMA 2NWMA 1BK2A 2KROA 3VS7A 2LJ3A 2YDLA 4Z88A 2YUOA 2EYWA 3VS1A 2D1XA 1GBQA 1VYUA 2FPFA 2RQRA 1ARKA 1AZEA 2LJ1A 4OMMA 5FWCA 1W6XA 1YWOA 2EGCA 5IH2A 2DVJA 2GTJA 1E6GA 3EG1A 3VS6A 2ABLA 1TUCA 3REAB 3VRYA 2DM1A 1NEBA 5IHIA 2M51A 2LZ6B 4OMNA 4J9CA 2K3BA 1G83A 4J9FA 1NYGA 1YP5A 4HVWA 4CC3A 3NHNA 2CT4A 2K9GA 1H8KA 2DE0X 2SEMA 1T3LA 1CSKA 1UDLA 4RTXA 1X27A 2VWFA 1H3HA 1QKXA 4HVUA 1UHCA 1UGVA 1JXOA 3H41A 3A98A 2DLPA 5L23A 3H0IA 3ZL7C 1I0CA 2K6DA 4JJCA 3R6NA 3EGUA 2V1QA 1QLYA 1Y0MA 3M0PA 3QWYA 2KYMA 3I35A 1CKAA 2DF6A 1PRMC 1AZGB 2KRNA 4J9EA 2JT4A 2DL8A 2A36A 4LE9A 3EG0A 4LUEA 1GCPA 3M0UA 1HD3A 1WA7A 2DL3A 1WXBA 3LH5A 2EBPA 4F14A 2L3QA 2E5KA 1EFNA 2YUNA 1AEYA 4HVVA 1RI9A 1NYFA 1HJDA 2KT1A 4WCIA 2B86A 4Z8AA 1ZSGA 1VYTA 1W70A 1M3CA 1SHFA 4HXJA 2KR3A 1NLPC 1QCFA 2LP5A 2JMCA 5I22A 2DJQA 1RLQC 3C0CA 2JW4A 4J9IA 1QKWA 2EQIA 1PNJA 2ROTA 1LCKA 2J6KA 1KJWA 4F17A 1HSQA 1V1CA 2AKLA 2FRYA 5IHNA 3KFVA 1WLPB 2CDTA 1MV0B 2LQWA 2BZXA 4LN2A 2J06A 1UG1A 3H0HA 3NGPA 1T0JA 1QWEA 2MCNA 2ESWA 5ECAA 2FG0A 1K0SA 2P4RA 3GBQA 1A0NB 4AG2C 3RNJA 2HCKA 4RUGA 2AKKA 2F2VA 3EG3A 2LJ0A 1SSHA 2L3PA 1ZUUA 4J9BA 2KE9A 2KXCA 2G6FX 2JMAA 2FEIA 1U06A 1GL5A 3EHRA 1OV3A 2KNBB 3VS3A 2M0YA 3VS4A 4CC7A 1UTIA 1X2QA 2CH4W 4RTUA 1NEGA 2RNAA 1WIEA 2MOXA 2D8HA 4ORZA 4IIMA 1TUDA 2F2WA 4HCKA 1PWTA 3CQTA 3EG2A 2RN8A 3PVQA 4AFSC 4E6RA 4A63B 2YUQA 5EC7A 1W1FA 3VS2A 2ED0A 3UF4A 2BZ8A 4OMPA 2GNCA 2JXBA 1WXTA 2YUPA 2IIMA 1VA7A 1JEGA 4KRTA 4J9HA 1OPKA 3VS0A 2GTOA 2X3XD 3SEMA 3NPFA 2CSQA 4EIKA 1K76A 1GBRA 2AK5A 1RLPC 3FJ5A 1U3OA 4LNPA 1K1ZA 1UECA 2YSQA 3M0TA 2JM8A 1X6GA 1AWXA 2J6FA 1KIKA 2JS0A 3JV3A 5IHKA 2X3WD 1UJ0A 2DL5A 2O9VA 2GQIA 1E6HA 2ENMA 4JZ4A 2CREA 1G2BA 3I5SA 1UFFA 2ED1A 2O2OA 2DYBA 1ZUKA 2KRMA 4J9DA 1NG2A 2LX7A 1T0HA 3TSWA 3NMZC 2FO0A 4ZNXA 4AFUC 2D0NA 1FMKA 2JTEA 1Y57A 1GCQA 2EYXA 2L2PA 4JZ3A 1ZLMA 1GFDA 4OMQA 1PHTA 2KYBA 1AWJA 2OI3A 1BBZA 2ROLA 2AZVA 1CKBA 3EHQA 1U5SA 2KEAA 1M3AA 1PKSA 5FWBA 2K7AA 3QWXX 2CUBA 1OEBA 5GJVB 3REBB 1I07A 4OMLA 4D8KA 1X2KA 2F2XA 1GRIA 4DEYA 2CUDA 4DEXA 2C0OA 2EGAA 2DMOA 2DA9A 2KGTA 2OJ2A 1WYXA 1XOVA 4GBQA 1N5ZA 2DL7A 1H92A 1Z9ZA 2FRWA 1ABOA 2I0NA 3M0SA 1WI7A 4K11A 2XMFA 2HDAA 1UE9A 1Z9QA 1UHFA 2C0TA 2J6OA 1MV3A 2RQWA 1K9AA 1UUEA 1GCQC 1PKTA 2O9SA 1E7OA 1ZX6A 1ZBJA 1YNZA 4R0KA 4JJDA 1IO6A 1YCSB 4OMOA 3THKA 2EGEA 4CC2A 2HSPA 1B3QA 2RQUA 3H0FA 4JJBA 3TSZA 2BZYA 2DL4A 3PVLA 1ZUYA 2EYZA 2CT3A 2ECZA 1BB9A 1FYNA 1JO8A 2DILA 1M30A 1KFZA 1GFCA 1AD5A 5I11A 2O88A 2D8JA 1NLOC 1SPKA 2FPDA 3O5ZA 3UA6A 2PTKA 4RTVA 1M8MA 4LUDA 3I5RA 2O31A 5HCKA 2EPDA 1SEMA 2PZ1A 2CSIA 2EW3A 2DBKA 1S1NA 2DRMA 2KBTA 4AFZC 2DX1A 2PNIA 5IXBA 1SRMA 1K4US 2EYYA 5FW9A 2DBMA 1AOJA 1WX6A 2HBWA 3TVTA 1JQQA 1SRLA 1NM7A 2GBQA 2J05A 4AFQC 1ABQA 1X69A 2MIOA 3U23A 2LQNA 2VVKA 2A08A 2FPEA 4X1VA 2LMJA 3UATA 2DNUA 4M4ZA 2CH4A 1T3SA 3M0RA 2DRKA 2NUZA 1YWPA 2RQTA 2L0AA 1J3TA 4FSSA 3IQLA 2JM9A 2KT8A 1WDXA 2BTTA 2V1RA 4F16A 1TG0A 1MUZA 1M3BA 2VKNA 1JU5C 1UJYA 2RPNA 2A37A 2OAWA 1K0XA 2LNHB 2SRCA 2GGRA 1I1JA 1B07A 1QWFA 4RTWA 1M27C 3I9QA 2H8HA 2A28A 4GLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMO A;  4CC4 B;  2LCS A;  2L3S A;  2W0Z A;  2RQV A;  4JPB W;  3VRZ A;  2C0I A;  2AZS A;  5IXF A;  2HEQ A;  2RF0 A;  2YT6 A;  4RTZ A;  2JS2 A;  5GJW B;  1AVZ C;  1AWW A;  4Z89 A;  2KXD A;  1YN8 A;  4QT7 A;  1PRL C;  4D8D A;  1RUW A;  1WFW A;  1WXU A;  4ESR A;  2K79 A;  1OOT A;  4IIO A;  4RTT A;  1AWO A;  4Y92 A;  3SHW A;  2EVR A;  2KRS A;  3ULR B;  3RBB B;  1SHG A;  1X6B A;  2EKH A;  3UA7 A;  4RTY A;  1X43 A;  2K2M A;  1KSW A;  3PE0 A;  4J9G A;  1VYV A;  4AG1 C;  1BU1 A;  2J7I A;  3M0Q A;  1OPL A;  2W10 A;  3VS5 A;  2QDL A;  1JXM A;  2NWM A;  1BK2 A;  2KRO A;  3VS7 A;  2LJ3 A;  2YDL A;  4Z88 A;  2YUO A;  2EYW A;  3VS1 A;  2D1X A;  1GBQ A;  1VYU A;  2FPF A;  2RQR A;  1ARK A;  1AZE A;  2LJ1 A;  4OMM A;  5FWC A;  1W6X A;  1YWO A;  2EGC A;  5IH2 A;  2DVJ A;  2GTJ A;  1E6G A;  3EG1 A;  3VS6 A;  2ABL A;  1TUC A;  3REA B;  3VRY A;  2DM1 A;  1NEB A;  5IHI A;  2M51 A;  2LZ6 B;  4OMN A;  4J9C A;  2K3B A;  1G83 A;  4J9F A;  1NYG A;  1YP5 A;  4HVW A;  4CC3 A;  3NHN A;  2CT4 A;  2K9G A;  1H8K A;  2DE0 X;  2SEM A;  1T3L A;  1CSK A;  1UDL A;  4RTX A;  1X27 A;  2VWF A;  1H3H A;  1QKX A;  4HVU A;  1UHC A;  1UGV A;  1JXO A;  3H41 A;  3A98 A;  2DLP A;  5L23 A;  3H0I A;  3ZL7 C;  1I0C A;  2K6D A;  4JJC A;  3R6N A;  3EGU A;  2V1Q A;  1QLY A;  1Y0M A;  3M0P A;  3QWY A;  2KYM A;  3I35 A;  1CKA A;  2DF6 A;  1PRM C;  1AZG B;  2KRN A;  4J9E A;  2JT4 A;  2DL8 A;  2A36 A;  4LE9 A;  3EG0 A;  4LUE A;  1GCP A;  3M0U A;  1HD3 A;  1WA7 A;  2DL3 A;  1WXB A;  3LH5 A;  2EBP A;  4F14 A;  2L3Q A;  2E5K A;  1EFN A;  2YUN A;  1AEY A;  4HVV A;  1RI9 A;  1NYF A;  1HJD A;  2KT1 A;  4WCI A;  2B86 A;  4Z8A A;  1ZSG A;  1VYT A;  1W70 A;  1M3C A;  1SHF A;  4HXJ A;  2KR3 A;  1NLP C;  1QCF A;  2LP5 A;  2JMC A;  5I22 A;  2DJQ A;  1RLQ C;  3C0C A;  2JW4 A;  4J9I A;  1QKW A;  2EQI A;  1PNJ A;  2ROT A;  1LCK A;  2J6K A;  1KJW A;  4F17 A;  1HSQ A;  1V1C A;  2AKL A;  2FRY A;  5IHN A;  3KFV A;  1WLP B;  2CDT A;  1MV0 B;  2LQW A;  2BZX A;  4LN2 A;  2J06 A;  1UG1 A;  3H0H A;  3NGP A;  1T0J A;  1QWE A;  2MCN A;  2ESW A;  5ECA A;  2FG0 A;  1K0S A;  2P4R A;  3GBQ A;  1A0N B;  4AG2 C;  3RNJ A;  2HCK A;  4RUG A;  2AKK A;  2F2V A;  3EG3 A;  2LJ0 A;  1SSH A;  2L3P A;  1ZUU A;  4J9B A;  2KE9 A;  2KXC A;  2G6F X;  2JMA A;  2FEI A;  1U06 A;  1GL5 A;  3EHR A;  1OV3 A;  2KNB B;  3VS3 A;  2M0Y A;  3VS4 A;  4CC7 A;  1UTI A;  1X2Q A;  2CH4 W;  4RTU A;  1NEG A;  2RNA A;  1WIE A;  2MOX A;  2D8H A;  4ORZ A;  4IIM A;  1TUD A;  2F2W A;  4HCK A;  1PWT A;  3CQT A;  3EG2 A;  2RN8 A;  3PVQ A;  4AFS C;  4E6R A;  4A63 B;  2YUQ A;  5EC7 A;  1W1F A;  3VS2 A;  2ED0 A;  3UF4 A;  2BZ8 A;  4OMP A;  2GNC A;  2JXB A;  1WXT A;  2YUP A;  2IIM A;  1VA7 A;  1JEG A;  4KRT A;  4J9H A;  1OPK A;  3VS0 A;  2GTO A;  2X3X D;  3SEM A;  3NPF A;  2CSQ A;  4EIK A;  1K76 A;  1GBR A;  2AK5 A;  1RLP C;  3FJ5 A;  1U3O A;  4LNP A;  1K1Z A;  1UEC A;  2YSQ A;  3M0T A;  2JM8 A;  1X6G A;  1AWX A;  2J6F A;  1KIK A;  2JS0 A;  3JV3 A;  5IHK A;  2X3W D;  1UJ0 A;  2DL5 A;  2O9V A;  2GQI A;  1E6H A;  2ENM A;  4JZ4 A;  2CRE A;  1G2B A;  3I5S A;  1UFF A;  2ED1 A;  2O2O A;  2DYB A;  1ZUK A;  2KRM A;  4J9D A;  1NG2 A;  2LX7 A;  1T0H A;  3TSW A;  3NMZ C;  2FO0 A;  4ZNX A;  4AFU C;  2D0N A;  1FMK A;  2JTE A;  1Y57 A;  1GCQ A;  2EYX A;  2L2P A;  4JZ3 A;  1ZLM A;  1GFD A;  4OMQ A;  1PHT A;  2KYB A;  1AWJ A;  2OI3 A;  1BBZ A;  2ROL A;  2AZV A;  1CKB A;  3EHQ A;  1U5S A;  2KEA A;  1M3A A;  1PKS A;  5FWB A;  2K7A A;  3QWX X;  2CUB A;  1OEB A;  5GJV B;  3REB B;  1I07 A;  4OML A;  4D8K A;  1X2K A;  2F2X A;  1GRI A;  4DEY A;  2CUD A;  4DEX A;  2C0O A;  2EGA A;  2DMO A;  2DA9 A;  2KGT A;  2OJ2 A;  1WYX A;  1XOV A;  4GBQ A;  1N5Z A;  2DL7 A;  1H92 A;  1Z9Z A;  2FRW A;  1ABO A;  2I0N A;  3M0S A;  1WI7 A;  4K11 A;  2XMF A;  2HDA A;  1UE9 A;  1Z9Q A;  1UHF A;  2C0T A;  2J6O A;  1MV3 A;  2RQW A;  1K9A A;  1UUE A;  1GCQ C;  1PKT A;  2O9S A;  1E7O A;  1ZX6 A;  1ZBJ A;  1YNZ A;  4R0K A;  4JJD A;  1IO6 A;  1YCS B;  4OMO A;  3THK A;  2EGE A;  4CC2 A;  2HSP A;  1B3Q A;  2RQU A;  3H0F A;  4JJB A;  3TSZ A;  2BZY A;  2DL4 A;  3PVL A;  1ZUY A;  2EYZ A;  2CT3 A;  2ECZ A;  1BB9 A;  1FYN A;  1JO8 A;  2DIL A;  1M30 A;  1KFZ A;  1GFC A;  1AD5 A;  5I11 A;  2O88 A;  2D8J A;  1NLO C;  1SPK A;  2FPD A;  3O5Z A;  3UA6 A;  2PTK A;  4RTV A;  1M8M A;  4LUD A;  3I5R A;  2O31 A;  5HCK A;  2EPD A;  1SEM A;  2PZ1 A;  2CSI A;  2EW3 A;  2DBK A;  1S1N A;  2DRM A;  2KBT A;  4AFZ C;  2DX1 A;  2PNI A;  5IXB A;  1SRM A;  1K4U S;  2EYY A;  5FW9 A;  2DBM A;  1AOJ A;  1WX6 A;  2HBW A;  3TVT A;  1JQQ A;  1SRL A;  1NM7 A;  2GBQ A;  2J05 A;  4AFQ C;  1ABQ A;  1X69 A;  2MIO A;  3U23 A;  2LQN A;  2VVK A;  2A08 A;  2FPE A;  4X1V A;  2LMJ A;  3UAT A;  2DNU A;  4M4Z A;  2CH4 A;  1T3S A;  3M0R A;  2DRK A;  2NUZ A;  1YWP A;  2RQT A;  2L0A A;  1J3T A;  4FSS A;  3IQL A;  2JM9 A;  2KT8 A;  1WDX A;  2BTT A;  2V1R A;  4F16 A;  1TG0 A;  1MUZ A;  1M3B A;  2VKN A;  1JU5 C;  1UJY A;  2RPN A;  2A37 A;  2OAW A;  1K0X A;  2LNH B;  2SRC A;  2GGR A;  1I1J A;  1B07 A;  1QWF A;  4RTW A;  1M27 C;  3I9Q A;  2H8H A;  2A28 A;  4GLM A; 
#chains in the Genus database with same CATH topology
 5CO7 A;  4C0D C;  4BAC A;  4KH0 B;  4N4H A;  2C0I A;  2RF0 A;  4RTZ A;  4DBQ A;  1WFW A;  4BB7 A;  2DJZ A;  4ME7 A;  1N8R C;  3EFR A;  4RTT A;  4C92 C;  3OYB A;  3ULR B;  4A4K A;  1QVF S;  2Y90 A;  1BKB A;  2JUF A;  4M75 C;  3CC4 T;  1VQ4 A;  1Q81 R;  3NFC A;  3OBW A;  1BU1 A;  4P5N A;  1BCM A;  4M7D D;  2E41 A;  2NWM A;  3CPW S;  2KRO A;  4X9D A;  1YJW T;  4Z88 A;  3UT1 A;  1I4K 1;  2YUO A;  2EYW A;  2D1X A;  2DZ9 A;  1MMD A;  1VYU A;  4E7J A;  4HA8 A;  2FPF A;  2YRC A;  3ER0 A;  3MP6 A;  1YWO A;  2M0O A;  2GTJ A;  2ZAE A;  1I8F A;  2OX7 A;  3VS6 A;  5DM7 R;  4QVC A;  3G1J A;  4DOV A;  2MPX C;  2DM1 A;  3V7R A;  3PMI A;  1YIT A;  4OMN A;  5KYX A;  1G83 A;  4J9F A;  1YP5 A;  1G5V A;  4ELY C;  3OYG A;  2CT4 A;  1BIA A;  1H8K A;  3G6E Q;  4J7I A;  1QMC A;  1OX9 A;  4C92 D;  1KQS S;  1CSK A;  1H3H A;  2COZ A;  1UGV A;  2MYS A;  1JXO A;  3H41 A;  1M8V A;  3CCQ T;  1HK9 A;  3A98 A;  3CCL Q;  1JJ2 P;  3ZL7 C;  1YIJ A;  1SSF A;  2HKQ B;  3R6N A;  1BI0 A;  4C8Q C;  1K9M U;  3JB9 I;  1AZG B;  2KRN A;  2G3R A;  3EGX A;  1N9R A;  4FYW B;  1IB8 A;  1HD3 A;  2EAY A;  2E5K A;  2YUN A;  1AEY A;  2A3L A;  1Q81 C;  1OU8 A;  2YRV A;  3VUB A;  1WQ7 A;  2JNG A;  2CZ6 B;  3E9G A;  5GAN d;  3CMA Q;  1VIF A;  1HJD A;  1C6V X;  3CCV Q;  4BY6 C;  1ZSG A;  4M7A A;  1G8X A;  4PJM A;  3HHT B;  1SHF A;  2KR3 A;  4OB3 B;  2R58 A;  3J7A F;  1YJN Q;  1NLP C;  3M4Y A;  5I22 A;  4KUD K;  2ZPF B;  4E7L A;  1C0M A;  3L2Z A;  4O5V A;  4BD3 A;  3NTH A;  5GAN h;  5FRM A;  3HFN A;  5L8R E;  2JJ9 A;  1KJW A;  5GAO q;  3I56 Q;  1KG1 A;  4F17 A;  4C8Q D;  4XU1 A;  1V1C A;  1S72 T;  3M53 A;  3KFV A;  1M4Z A;  4M78 F;  5LJ3 d;  2LQW A;  1MV0 B;  1OZ3 A;  3CC4 A;  4BE2 A;  3H0H A;  1U8R A;  2K5I A;  5ECA A;  2FG0 A;  3QJ6 A;  2F1L A;  4J6X A;  1BYM A;  1VQ5 Q;  3QZ9 B;  4PFP A;  3R6O A;  1Q7Y R;  2GF7 A;  4XTW A;  4KUI A;  3M4G A;  3OS1 A;  3S3M A;  2F2V A;  3EG3 A;  5LJ3 h;  3CD6 A;  1HXD A;  2RH2 A;  4PJO C;  3M56 A;  1BI3 A;  2KXC A;  2JMA A;  2DO3 A;  1KQ2 A;  1NPP A;  2M0Y A;  1TUG B;  1UTI A;  2CH4 W;  4M7A B;  3V8K A;  3CME A;  4F04 B;  2QEX A;  1G3W A;  1WIE A;  4PKC C;  3KUF A;  4FM4 B;  2MOX A;  4IIM A;  1N8R U;  1VQ6 Q;  3HPW A;  2F2W A;  4HCK A;  1PWT A;  4M7D G;  1YJ9 A;  4DBH A;  4AFS C;  4E6R A;  2QQ9 A;  2L8D A;  4CI0 C;  1W1F A;  1OUL A;  3JCM d;  4RG2 A;  1M1K R;  3CC2 T;  1N9S A;  5GMK j;  3CCE T;  2BZ8 A;  4N4I A;  2IIM A;  2ZPG B;  4A4G A;  2GTO A;  3SEM A;  3MJX A;  4O6J A;  2YWW A;  1XNI A;  1K76 A;  4M77 F;  1GBR A;  3FJ5 A;  2EYQ A;  2YSQ A;  2V8K A;  3M0T A;  5KYY A;  4C92 G;  2JM8 A;  1X6G A;  1AWX A;  2J6F A;  4PJO D;  2VXF A;  3JV3 A;  1MHN A;  1Q95 G;  2DL5 A;  1JJ2 A;  3I55 T;  2ENM A;  4M75 G;  1G2B A;  4E7S A;  1UFF A;  2ED1 A;  1JRI A;  4X34 A;  3C95 A;  2HMA A;  2RI2 A;  3A8L B;  1ZUK A;  2CS7 A;  1NG2 A;  2LX7 A;  2P84 A;  4MZT A;  3OBY A;  2CGH A;  2FO0 A;  1FMW A;  2JTE A;  1GCQ A;  3G71 T;  1Q7Y C;  1GFD A;  1Y7X A;  1PHT A;  2KYB A;  2LX9 A;  4IUR A;  3JCM e;  1QP3 A;  2ROL A;  3CCS Q;  2AZV A;  5GAN g;  4NS5 A;  4E7I A;  3M5A A;  3JB9 F;  1PKS A;  2DEU A;  5FWB A;  1M90 R;  3QWX X;  2CUB A;  1OEB A;  5GJV B;  3N5B B;  2JOY A;  4OML A;  2F2X A;  1GRI A;  1ZBX A;  2CUD A;  2LQK A;  2C0O A;  1VQ8 Q;  2OJ2 A;  1WYX A;  2OTL Q;  4GBQ A;  1N5Z A;  2FRW A;  1ABO A;  2I0N A;  3OW2 S;  2LVM A;  1WI7 A;  1P92 A;  2HDA A;  4MMK A;  2LTO A;  1Q81 U;  1KD1 R;  2C0T A;  3MPU B;  5LJ3 g;  1KHI A;  2EKO A;  3CC7 T;  1VQK T;  1E7O A;  5GAN 4;  1ZBJ A;  4J8O A;  2X9H A;  2D6F A;  4NOY A;  1YCS B;  4OMO A;  1QQJ A;  1VQ7 Q;  2EGE A;  4CC2 A;  1D0X A;  3QDF A;  4C8Q G;  2QA4 Q;  3H0F A;  2VB6 A;  5LJ5 j;  3MEU A;  4KH1 B;  4LDW A;  1VQL T;  2BE7 D;  2EYZ A;  2MF2 A;  4EMK C;  1M5Q 1;  3CCM Q;  1IXD A;  1BB9 A;  4KGZ B;  1GFC A;  4M78 C;  5CQX A;  2O88 A;  1SPK A;  5GAN f;  2P4T A;  3UA6 A;  1AHJ B;  2QDY B;  3I5R A;  3SWN C;  5HCK A;  2KVQ G;  1ZSZ A;  4KGX B;  3CC2 A;  2CSI A;  2HZY A;  4M7D F;  3ZBD A;  4A4H A;  2DBK A;  3CCE A;  2A7Y A;  2KBT A;  5M9O A;  2V26 A;  4CRI A;  2QTX A;  3JCM V;  1K4U S;  2ATC B;  5GAN 6;  5GAN 3;  1MMG A;  2KQW A;  2HBW A;  2K3X A;  3E2U A;  2EWN A;  5D6X A;  5LJ3 f;  1MGQ A;  2MIO A;  1UGQ B;  2A08 A;  4JS5 A;  3UAT A;  4M4Z A;  3M0R A;  4E7K A;  3OYY A;  4LXC A;  4BDZ A;  2RQT A;  3DKM A;  2CYZ B;  3G7Z A;  3PFS A;  5CKH A;  3I55 A;  4LD9 K;  2K3Y A;  4RCC A;  4C92 F;  4DBR A;  4PLI A;  2RI5 A;  3A5Z B;  1KD1 C;  5GAN 5;  2VUB A;  1UJY A;  1UGP B;  1I5O B;  5I2M A;  4M75 A;  3G71 A;  5KCO A;  4RTW A;  5CIU A;  3LX7 A;  3MEA A;  1U1S A;  3FDR A;  3VYH B;  3DB3 A;  4M77 C;  1RAH B;  1W2B S;  4PJO G;  4CC4 B;  2LCS A;  2L3S A;  4JPB W;  2IPO B;  3JCM c;  1M1F A;  3JAM E;  4IKF A;  1FMV A;  3OYL A;  4QQ6 A;  5GJW B;  1AVZ C;  3A8M B;  4D8D A;  2FZG B;  2DD5 A;  4B9W A;  2XI9 A;  2CKK A;  2M9U A;  2EQU A;  4Y92 A;  2B8A A;  2KRS A;  3RBB B;  1SHG A;  3UA7 A;  1VQP Q;  1VQ4 T;  4TVR A;  4RTY A;  1IGU A;  3CC7 A;  3FEO A;  2K2M A;  4M7D E;  1C1A A;  1NZ9 A;  5GAO r;  1PM3 A;  4FT2 A;  3DLL A;  1VYV A;  2J7I A;  1Q7Y U;  4ZTJ A;  3EFO B;  8AT1 B;  2PVD B;  2QQS A;  2EQK A;  2X4Y A;  2M02 A;  3HL8 A;  3Q1J A;  1VQL A;  2LDM A;  4V2S A;  2RQR A;  4F7U G;  1AZE A;  2PVG B;  2LJ1 A;  2XU8 A;  4J83 A;  1W6X A;  2EGC A;  5FU6 C;  2DVJ A;  4PL6 A;  3X28 B;  4PFZ A;  4C8Q F;  7AT1 B;  1RAA B;  3DLM A;  1MMN A;  1YIT T;  1FWZ A;  1NEB A;  1KC8 R;  2AT1 B;  2LZ6 B;  3OMC A;  4A54 A;  2PUO B;  8ATC B;  3CBM A;  4LDX A;  2K9G A;  2DE0 X;  3S6W A;  4M75 E;  2E12 A;  3GOX A;  4JDS A;  4C5H A;  3BDU A;  1X27 A;  1WQW A;  1YCY A;  3JCM Q;  1YHQ A;  2DLP A;  1YIJ T;  2DFU A;  3CCU T;  2RHY A;  2PQW A;  3EGD A;  3H0I A;  2HKN A;  3QXE B;  2K6D A;  3QSU A;  3WVD B;  1S72 Q;  1Y0M A;  2DIQ A;  5AT1 B;  3I35 A;  1QVG S;  3QYG B;  1RL2 A;  4J9E A;  3QII A;  4OF1 A;  4LDV A;  2A36 A;  4BI8 B;  4HCZ A;  3M9Q A;  1R8O B;  2OTJ Q;  3M0U A;  3X25 B;  2DL3 A;  2P0K A;  1H64 1;  1NPR A;  3QDR B;  4HVV A;  3CCJ Q;  3RIR A;  1WHM A;  4BUG A;  4KUL A;  2XDP A;  1Q86 R;  2QYZ A;  1RAI B;  1TOV A;  4WCI A;  2NUP B;  1VQ9 Q;  9ATC B;  3V7S A;  1M90 U;  4HXJ A;  5D6W A;  1QCF A;  1WZO A;  2DJQ A;  4PJO F;  4PJL A;  2ZCF B;  2JW4 A;  4IUV A;  4J9I A;  4M78 G;  4XU2 A;  4C8Q E;  2CP7 A;  2X4J A;  2ROT A;  3CXC S;  3VUZ A;  1LCK A;  2J6K A;  1WHG A;  4C0Z A;  1HSQ A;  1KC8 C;  1KK7 A;  2AKL A;  1PD1 A;  1VQN T;  1KD1 U;  2CDT A;  4LN2 A;  3NGP A;  4B9X A;  2QGG A;  2DAQ A;  2ESW A;  1OQK A;  1SKU B;  3GBQ A;  5FU7 B;  1G3T A;  4E2F B;  3RNJ A;  2HCK A;  3M58 A;  4QW2 A;  3CD6 T;  4RUG A;  2AKK A;  3V7C A;  2YLC A;  1RAF B;  1SSH A;  4C5G A;  2KE9 A;  3RDV A;  2G6F X;  2WSE E;  1GL5 A;  3CME T;  3VS3 A;  2QEX T;  4EPC A;  6AT1 B;  3H6Z A;  3FRN A;  1NEG A;  4KBM B;  4F7U F;  2RNA A;  2K5L A;  1PG5 B;  3T9N A;  1YJ9 T;  1TUD A;  1EX4 A;  3RKW A;  2QI2 A;  4PJN A;  1IRX A;  2CP3 A;  2RN8 A;  3PVQ A;  1K73 R;  5EC7 A;  4E7Z A;  2F69 A;  1Q86 C;  1M2O A;  1LOJ A;  2K57 A;  1QVF P;  5I2S A;  2YHT A;  1W4S A;  4Q5W A;  4M77 G;  2YUP A;  1VA7 A;  3HSB A;  2CZ7 B;  3BW1 A;  4WTO B;  4QVD A;  3CCU A;  2BE9 B;  4EMH A;  2X3X D;  3PMT A;  1V29 B;  2CSQ A;  4RG8 A;  3CPW P;  4PJO E;  3ZEH A;  1G3S A;  5GAO m;  3UDC A;  2MK5 A;  4ZN3 A;  4LNP A;  1WHH A;  3C94 A;  2EJF A;  2FVU A;  2RD1 A;  2RI3 A;  1KQ1 A;  3QJY A;  5IHK A;  3GIB A;  3PIP A;  2O9V A;  3OS2 A;  2MAM A;  1VQ7 A;  3I5S A;  2O2O A;  2QG9 B;  3JB9 G;  1IZ6 A;  1R0B G;  3KBG A;  1T0H A;  3BE3 A;  5KYX B;  4BE1 A;  2V8I A;  5D7U A;  4AFU C;  2D0N A;  5IT9 E;  1EIF A;  1FMK A;  1TS9 A;  1Y57 A;  3EAE A;  4QQD A;  3OSV A;  1AWJ A;  1BBZ A;  4AT1 B;  3P8H A;  1YI2 T;  2KEA A;  3HP9 A;  1M3A A;  3JCM P;  2M1H A;  2K7A A;  2EQM A;  3ME9 A;  4E47 A;  1VQO Q;  2L5Q A;  3OB9 A;  2DXC A;  3GPL A;  3F70 A;  2DMO A;  1X6O A;  3L2Q A;  3JCM b;  1WNL A;  4EMK A;  1B34 A;  2GQV A;  3JB9 H;  2OAU A;  4M78 A;  1VQN A;  1IRE B;  2HNI A;  3EGX B;  1K73 C;  4JLG A;  1WPY A;  2F5K A;  3CBO A;  1QVP A;  1EZZ B;  2J6O A;  2E65 A;  4IUT A;  3CEY A;  2RQW A;  1UUE A;  4JJD A;  1IO6 A;  2XK0 A;  3OYI A;  3HRT A;  2HSP A;  3CCR T;  4JJB A;  3E19 A;  3VKI A;  1ZUY A;  5GAN j;  2ECZ A;  1JO8 A;  1XJW B;  3TRE A;  2RHX A;  2XDB A;  2XD0 A;  2D8J A;  3G4S Q;  1KC8 U;  2COY A;  1TSF A;  2FPD A;  2PTK A;  5CR2 A;  4LUD A;  1X75 C;  3MEW A;  4D6W A;  1I81 A;  2VGN A;  1AT1 B;  2RHU A;  2PZ1 A;  2E3I A;  4UC4 A;  3PNW C;  4B6M A;  2GFU A;  2DRM A;  1B34 B;  3PTA A;  5GMK e;  2DX1 A;  4FW2 A;  3V8L A;  2CP0 A;  4LDY A;  2JZ2 A;  3JCM h;  5FW9 A;  5LJ3 j;  2GCX A;  2RA2 A;  3MP8 A;  3GNF B;  2DBM A;  4C0F A;  3TVT A;  4M77 A;  1JQQ A;  1NM7 A;  2J05 A;  2HSE B;  1ABQ A;  1QVF A;  3U23 A;  2VVK A;  2O4X A;  3HTR A;  2DTO A;  4M78 E;  2NYS A;  4N0A C;  4J7F A;  1YWP A;  2EJ9 A;  2L0A A;  5HK0 A;  2FHD A;  4C0G A;  3EG9 A;  2E5Q A;  3IQL A;  2EFI A;  2RJD A;  2JM9 A;  2KT8 A;  3CPW A;  1WDX A;  2DD4 A;  4OB0 B;  4Z02 A;  2V1R A;  1MNE A;  4MML A;  5A2Q E;  4WF2 A;  1Q86 U;  4PK4 A;  1M3B A;  1K0X A;  2A37 A;  2ZPI B;  2LNH B;  5GAM e;  3I9Q A;  3QG1 A;  2A28 A;  2X4W A;  1ZA2 B;  2VXE A;  1YI2 A;  2BKD N;  2RMO A;  3M57 A;  2W0Z A;  3L2W A;  2RQV A;  3VRZ A;  5KYU A;  1YIT Q;  3G6E T;  2QAS A;  1QP2 A;  2HEQ A;  2KXD A;  1YN8 A;  4EDU A;  1RUW A;  4ESR A;  1RAG B;  5IAY A;  1OOT A;  4IIO A;  2LCC A;  1QW1 A;  1M1K C;  3SHW A;  1JBM A;  4EMG A;  5KYY B;  3J81 E;  1X6B A;  2EKH A;  5KYN A;  1YIJ Q;  2MMP A;  4J9G A;  3H9N A;  4HT8 A;  2LNV A;  3OS5 A;  3JSC A;  3M0Q A;  2JVV A;  1VQM Q;  1BK2 A;  3VS7 A;  3CCR A;  4M7A C;  3BDL A;  4M77 E;  3VS1 A;  1GBQ A;  1U1T A;  5LJ5 e;  3S3O A;  2KAF A;  1UEB A;  5FWC A;  2WSC E;  2BUD A;  3CMA T;  3CCV T;  4E7H A;  2ABL A;  3V8J A;  1XTD A;  3VRY A;  5HK3 A;  2M51 A;  3RES A;  5J26 A;  4J9C A;  2K3B A;  2DPP B;  3OA6 A;  1K73 U;  1NYG A;  4CC3 A;  1YJN T;  4M7D A;  3JCM g;  4FSX A;  2RHI A;  2EQJ A;  3OW2 P;  1DJ7 B;  1OI1 A;  2V8J A;  2EJG A;  2PUK B;  1UDL A;  4RTX A;  2VWF A;  1QKX A;  3WXM B;  3I56 T;  1YHQ T;  1M90 C;  1UHC A;  4FL6 A;  2ZPH B;  3OYM A;  4OB2 B;  2E70 A;  2R5A A;  1M2V A;  5L23 A;  5EG2 A;  1VIE A;  3AHU A;  2L3R A;  3S3N A;  1R0C B;  2V1Q A;  1QLY A;  4XAX B;  3M0P A;  3QWY A;  4M7A D;  3A8H B;  2KYM A;  3CC4 Q;  1B7T A;  2P0P A;  2DF6 A;  3JB9 J;  1PRM C;  4J5Y A;  1VQ5 T;  5C0M A;  4LE9 A;  3EG0 A;  4C92 A;  3FB9 A;  2LC4 A;  1WHL A;  1K9M R;  1YJW Q;  2XID A;  2EBP A;  3MCA B;  4F14 A;  5I21 A;  1Q82 R;  1EFN A;  3CD6 Q;  5CVI A;  4OVA A;  4QQG A;  1NYF A;  1D09 B;  1ZSZ B;  3QPH A;  2P0Q A;  1D3B A;  4A4E A;  4MDX A;  3CME Q;  3JCM J;  2B86 A;  1VQ6 T;  2KMT A;  2QEX Q;  4M7D B;  2VGM A;  2D9T A;  3G6E A;  4IUQ A;  3OYJ A;  3JCM f;  4L59 A;  4MZP A;  1YJ9 Q;  2M16 A;  1YBY A;  4J6Y A;  3C0C A;  3MET A;  1QKW A;  3P8D A;  2EQI A;  4C0D B;  3AT1 B;  1M2V B;  5A0D A;  5DLO A;  2DYI A;  3CCL A;  2FRY A;  3CCQ Q;  2BZX A;  2J06 A;  1UG1 A;  1O75 A;  2K4Y A;  2Z0W A;  4DQ2 A;  2QK0 A;  1K0S A;  2P4R A;  4C92 B;  4ZGD B;  4AG2 C;  1NBE B;  4M75 B;  4XU3 A;  2L3P A;  2XKO C;  3KXT A;  1ZUU A;  4J9B A;  4C5E A;  1ZA1 B;  4L5G A;  1W2B P;  4C8Q A;  3CMA A;  3VS4 A;  4CC7 A;  3RMS A;  3H8Z A;  3CCV A;  2DTH A;  4C92 E;  2O01 E;  2JTF A;  5KE3 A;  3CCS T;  2X4X A;  4FT4 A;  2D8H A;  1BI1 A;  1M1K U;  1WJQ A;  4ATO A;  1YJN A;  3CQT A;  2KK4 A;  1TXQ A;  3RR6 A;  2C06 A;  4A63 B;  2YUQ A;  1N8R R;  3VS2 A;  1D1C A;  2ED0 A;  3TEE A;  1VQO A;  2LT1 A;  1VQ8 T;  3I56 A;  1UGS B;  2OTL T;  5GAO n;  4LDU A;  1JEG A;  3QHS A;  5CAI A;  1R77 A;  5GMK l;  2KI7 A;  2LRQ A;  3GF5 A;  2HQX A;  2K2V A;  3NPF A;  5KH6 A;  3OW2 A;  2AHJ B;  2VV5 A;  3UPU A;  1FXX A;  2AK5 A;  1RLP C;  1U3O A;  1VQ5 A;  1UEC A;  3OY9 A;  4XTU A;  2RHZ A;  2QXF A;  2IG0 A;  2X3W D;  1VQ7 T;  4MDW A;  2GQI A;  1E6H A;  4C8Q B;  4ZN1 A;  4LD6 A;  2QQA A;  1OZ2 A;  3ASK A;  2E4H A;  2ZZD A;  3TSW A;  3CCM T;  3LWH A;  1ZHI A;  2I2L A;  4M7A G;  1VQ6 A;  2EYX A;  2L2P A;  3HRU A;  3OS0 A;  4OMQ A;  2D0Q B;  2KDS A;  2OI3 A;  3QO3 A;  1CKB A;  3EHQ A;  4JRK A;  3RKX A;  3G4S A;  1U5S A;  5GMK m;  3A8G B;  1LJO A;  1M9S A;  4PJO A;  1BI2 A;  4II1 A;  3FIF A;  4N4G A;  5GAN 7;  2XDD A;  3P8B B;  4BY6 B;  1X2K A;  3EGD B;  3OYA A;  3CC2 Q;  4DEY A;  2EGA A;  2R5M A;  3TQ7 P;  2KGT A;  3CCE Q;  2BIV A;  1QCN A;  1NE8 A;  2DL7 A;  3SB2 A;  1QVG P;  1H92 A;  4J6W A;  5IN1 A;  1WJS A;  4XTX A;  5CKE A;  1KHC A;  1UE9 A;  1Z9Q A;  1RAD B;  2E3H A;  1UHF A;  1MV3 A;  1K9A A;  2QTV A;  1PKT A;  2LT4 A;  4FYX B;  1H3Z A;  2O9S A;  2YLB A;  4DBF A;  1ZX6 A;  3NTI A;  3MO8 A;  1JJ2 S;  2RK2 A;  3C12 A;  5J39 A;  4MZM A;  5GAO l;  2NLU A;  2DVE A;  3THK A;  1F1B B;  2K5F A;  1B3Q A;  3I55 Q;  2RQU A;  3O8V A;  2A0F B;  2HQE A;  2DL4 A;  4FU6 A;  1ACM B;  3PVL A;  4ZGJ B;  4F7U A;  2KY9 A;  1G3Y A;  2H3J A;  1M30 A;  2FYK A;  3CCS A;  1AD5 A;  2YRD A;  4PJJ A;  3PIO A;  5I11 A;  1NLO C;  3G71 Q;  4PJO B;  1M8M A;  3CXC P;  5A0G A;  2MWO A;  4N0A A;  3HFO A;  2O31 A;  2EPD A;  1W2B A;  4FCY A;  1SEM A;  2DEQ A;  1QCO A;  3EFS A;  1WJR A;  2EW3 A;  1VQ8 A;  2YXY A;  2OTL A;  1N6A A;  2IVW A;  2PNI A;  5IXB A;  2CZ1 B;  5FLX E;  4OP0 A;  4JUV A;  5GAO p;  1AOJ A;  1D0Z A;  1VQP T;  4M75 D;  1GXI E;  2ZPB B;  3QUI A;  4GLK A;  1SRL A;  3GNG A;  2GBQ A;  4JRP A;  4HCB A;  4AFQ C;  3JRZ A;  1X69 A;  4FYV B;  5CK9 A;  5KE2 A;  3CC7 Q;  2LQN A;  2FL7 A;  2X51 A;  3OYD A;  1VQK Q;  2LMJ A;  1IHV A;  5DY9 A;  1T3S A;  3GLX A;  3OMG A;  2DRK A;  1VQM A;  2QA4 A;  4FSS A;  1Q82 U;  3QYH B;  4F7U B;  5GMK i;  4PFO A;  3CCM A;  2XG8 D;  1VQL Q;  1MUZ A;  2OAW A;  3QZ5 B;  2WSF E;  1KQS P;  1B07 A;  1QWF A;  4OGE A;  2QAZ A;  4R56 A;  4RMO A;  4M7A F;  2VC8 A;  3NTK A;  2HL3 A;  2QGF B;  4ZTF A;  4F7U E;  2AZS A;  5IXF A;  2YT6 A;  2JS2 A;  4ANJ A;  2WAC A;  1AWW A;  4FYY B;  4Z89 A;  4QT7 A;  1PRL C;  3SD4 A;  1BIB A;  1MMA A;  1WXU A;  3CPF A;  2K79 A;  4BDY A;  5A0L A;  4KT0 E;  1AWO A;  5FU7 C;  2EVR A;  3SWN A;  1YHQ Q;  2XIC A;  3CBP A;  1OX8 A;  1X43 A;  4NL2 A;  1KSW A;  1RI0 A;  2E1H A;  2EIF A;  3LH0 A;  3PE0 A;  4AG1 C;  1TH7 A;  3L2R A;  5GMK h;  1OPL A;  2W10 A;  3VS5 A;  2QDL A;  1QVG A;  1JXM A;  3VYG A;  2OTJ T;  2LJ3 A;  2YDL A;  4XQ3 A;  4Y91 A;  2HL5 C;  5CKB A;  1YJW A;  2RK1 A;  3CCJ T;  2DET A;  1ARK A;  4OMM A;  2CP2 A;  5GAN e;  1M1G A;  5IH2 A;  1PCX A;  1E6G A;  3EG1 A;  1RAB B;  1VQ9 T;  1TUC A;  1NJI R;  3REA B;  2E6N A;  5GAM d;  4XU0 A;  1I5L A;  5IHI A;  4AMC A;  4HVW A;  3NHN A;  4EMK B;  2F5T X;  2JN0 A;  3RUX A;  4M78 B;  2CZ0 B;  3TCJ A;  2MWP A;  2NUT A;  2SEM A;  1T3L A;  3M54 A;  5FRN A;  1RAE B;  3LWI A;  4HVU A;  3FC3 A;  3SWN B;  5GAM h;  3LGF A;  5C6S A;  1WHJ A;  4JJN K;  1K8A R;  3CXC A;  1ZQ1 A;  3FJP A;  3RER A;  5LJ3 e;  1VQP A;  4M7A E;  3CCQ A;  4PNO A;  3RMQ A;  1I0C A;  1VQ4 Q;  4JJC A;  3EGU A;  3TU4 K;  1CKA A;  2DXT A;  3UWN A;  2GFA A;  2JT4 A;  2DL8 A;  1SF9 A;  1LNX A;  4LUE A;  1GCP A;  1WA7 A;  4OMF B;  1WXB A;  3LH5 A;  2L3Q A;  2RB6 A;  5LJ5 d;  1XQH A;  4YTL A;  1RI9 A;  3LLR A;  2ZPE B;  3EH1 A;  4ELZ C;  3J80 E;  3X20 B;  3DB4 A;  2KT1 A;  2VAS A;  4L6V 5;  4DA4 A;  3JCM X;  3X26 B;  4Z8A A;  3OYK A;  1VYT A;  2LQ8 A;  1W70 A;  1M3C A;  5GAM j;  4Y28 E;  4ZGE B;  2NUT B;  3VU3 C;  2LP5 A;  5LJ5 h;  2JMC A;  2RJE A;  1RLQ C;  3INZ A;  2QQB A;  4JS4 A;  1KQS A;  2RM4 A;  4M77 B;  1PNJ A;  2HQH A;  3CCL T;  1NJI C;  4FW1 A;  3MHX A;  5GAN 2;  2O4X B;  3OSS C;  2DXB A;  5IHN A;  1Y07 A;  1WLP B;  3CCU Q;  1S72 A;  1O9S A;  3EG9 B;  1T0J A;  1QWE A;  2MCN A;  4PLL A;  2LCL A;  1K8A C;  5J3B A;  1A0N B;  2OTJ A;  3GP8 A;  4JRQ A;  4X9C A;  2DK3 A;  5GAN 8;  1PC0 A;  2LJ0 A;  2H3E B;  5CQY A;  4VUB A;  3L2V A;  3CCJ A;  1VOM A;  2FEI A;  1U06 A;  2Y4Y A;  3EHR A;  1OV3 A;  2KNB B;  2FB7 A;  3BY7 A;  1X2Q A;  5KYU B;  1MND A;  4RTU A;  3VJP A;  1TTH B;  1VQ9 A;  3FLG A;  5AYF A;  3URG A;  4BE0 A;  4ORZ A;  3PGG A;  2FZC B;  3EG2 A;  5GAM g;  3OYE A;  5FU6 B;  2CP5 A;  1SG5 A;  4DOW A;  2L89 A;  1VQO T;  2KSS A;  3VV0 A;  2Y4X A;  3UF4 A;  4IUP A;  2GNC A;  2JXB A;  4OMP A;  1WXT A;  4R55 A;  4HKE A;  4OB1 B;  5CKF A;  4XTV A;  5KCH A;  4KRT A;  4J9H A;  1OPK A;  3VS0 A;  2RJC A;  1OYX A;  2E64 A;  3E9F A;  2ZGW A;  4BI3 A;  1RAC B;  1VQN Q;  3BFM A;  1D1A A;  4EIK A;  3QBY A;  4RCB A;  1K1Z A;  1JB0 E;  1OU9 A;  4A4F A;  1KIK A;  3X24 B;  3LW5 E;  2JS0 A;  1UJ0 A;  3QKJ A;  3A1P A;  4HCC A;  3MKD A;  4JZ4 A;  2CRE A;  3HKS A;  2E10 A;  2DYB A;  2KRM A;  3MEV A;  4J9D A;  2HD0 A;  4KGV B;  3NMZ C;  1VUB A;  4M78 D;  2PVO B;  4ZNX A;  3EFO A;  5LJ5 g;  3OYH A;  3G4S T;  4HT9 A;  4JZ3 A;  3M59 A;  1ZLM A;  4M75 F;  1Y96 A;  4QKU A;  1Y71 A;  5CKD A;  5GAM f;  2AIR B;  4BI4 A;  3L2U A;  1HYO A;  2PU9 B;  2DKG A;  5FRO A;  5KYW A;  3REB B;  1I07 A;  4D8K A;  1WGS A;  3SFM A;  1N27 A;  4DEX A;  3SDZ A;  3RKY A;  2DA9 A;  1XOV A;  1UB4 A;  1Z9Z A;  3M0S A;  2FZK B;  4K11 A;  2XMF A;  3OQ5 A;  2DZC A;  4A53 A;  2R57 A;  3L1A A;  4IUU A;  1TU0 B;  1GCQ C;  4C5I A;  1LVK A;  3LGL A;  3OYC A;  1YNZ A;  4R0K A;  1VQK A;  4NL3 A;  3OYF A;  1YFN A;  3LYI A;  5DLQ E;  1BCO A;  2CP6 A;  4JRI A;  1X01 A;  2COW A;  1D3B B;  3TSZ A;  2BZY A;  3L42 A;  5CCA A;  1WHK A;  1D1B A;  2HBP A;  4OGC A;  2CT3 A;  1V76 A;  3A8O B;  5LJ5 f;  1Y96 B;  1D0Y A;  1K9M C;  1FYN A;  2DIL A;  1PSE A;  1UGR B;  1KFZ A;  3HRS A;  1NJI U;  3WVE B;  4M77 D;  1Q82 C;  3ZFJ A;  3O5Z A;  4RTV A;  3OYN A;  4GY5 A;  2QQR A;  1YI2 Q;  2MI6 A;  4XTZ A;  5KYW B;  2DXU A;  2XHC A;  1IHW A;  3EH2 A;  2NUP A;  1S1N A;  2DTI A;  2DER A;  4AFZ C;  1K8A U;  1LPL A;  1SRM A;  1TWB A;  4RKU E;  2EYY A;  2RO0 A;  5HY6 A;  1WX6 A;  5LL6 S;  4JLI A;  4QVZ A;  3D7S B;  3JB9 D;  3E1S A;  2FPE A;  2X35 A;  3PT9 A;  4X1V A;  2DNU A;  3JCM W;  3MP1 A;  2CH4 A;  2JTM A;  1VQM T;  2QA4 T;  4FIB A;  3M55 A;  2NUZ A;  2VYT A;  5HKC A;  1J3T A;  5D6Y A;  1ZSZ C;  1IGQ A;  4XK8 E;  3CCR Q;  2DIG A;  2BTT A;  1PSF A;  4M7D C;  2RJF A;  4F16 A;  1TG0 A;  1FX7 A;  2VKN A;  1JU5 C;  2RPN A;  2SRC A;  2GGR A;  2E6Z A;  1I1J A;  1PD0 A;  2HAX A;  3C4S A;  1M27 C;  2H8H A;  4XTY A;  4GLM A; 
#chains in the Genus database with same CATH homology
 2RMO A;  4CC4 B;  2LCS A;  2L3S A;  2W0Z A;  2RQV A;  4JPB W;  3VRZ A;  2C0I A;  2AZS A;  5IXF A;  2HEQ A;  2RF0 A;  2YT6 A;  4RTZ A;  2JS2 A;  5GJW B;  1AVZ C;  1AWW A;  4Z89 A;  2KXD A;  1YN8 A;  4QT7 A;  1PRL C;  4D8D A;  1RUW A;  1WFW A;  1WXU A;  4ESR A;  2K79 A;  1OOT A;  4IIO A;  4RTT A;  1AWO A;  4Y92 A;  3SHW A;  2EVR A;  2KRS A;  3ULR B;  3RBB B;  1SHG A;  1X6B A;  2EKH A;  3UA7 A;  4RTY A;  1X43 A;  2K2M A;  1KSW A;  3PE0 A;  4J9G A;  1VYV A;  4AG1 C;  1BU1 A;  2J7I A;  3M0Q A;  1OPL A;  2W10 A;  3VS5 A;  2QDL A;  1JXM A;  2NWM A;  1BK2 A;  2KRO A;  3VS7 A;  2LJ3 A;  2YDL A;  4Z88 A;  2YUO A;  2EYW A;  3VS1 A;  2D1X A;  1GBQ A;  1VYU A;  2FPF A;  2RQR A;  1ARK A;  1AZE A;  2LJ1 A;  4OMM A;  5FWC A;  1W6X A;  1YWO A;  2EGC A;  5IH2 A;  2DVJ A;  2GTJ A;  1E6G A;  3EG1 A;  3VS6 A;  2ABL A;  1TUC A;  3REA B;  3VRY A;  2DM1 A;  1NEB A;  5IHI A;  2M51 A;  2LZ6 B;  4OMN A;  4J9C A;  2K3B A;  1G83 A;  4J9F A;  1NYG A;  1YP5 A;  4HVW A;  4CC3 A;  3NHN A;  2CT4 A;  2K9G A;  1H8K A;  2DE0 X;  2SEM A;  1T3L A;  1CSK A;  1UDL A;  4RTX A;  1X27 A;  2VWF A;  1H3H A;  1QKX A;  4HVU A;  1UHC A;  1UGV A;  1JXO A;  3H41 A;  3A98 A;  2DLP A;  5L23 A;  3H0I A;  3ZL7 C;  1I0C A;  2K6D A;  4JJC A;  3R6N A;  3EGU A;  2V1Q A;  1QLY A;  1Y0M A;  3M0P A;  3QWY A;  2KYM A;  3I35 A;  1CKA A;  2DF6 A;  1PRM C;  1AZG B;  2KRN A;  4J9E A;  2JT4 A;  2DL8 A;  2A36 A;  4LE9 A;  3EG0 A;  4LUE A;  1GCP A;  3M0U A;  1HD3 A;  1WA7 A;  2DL3 A;  1WXB A;  3LH5 A;  2EBP A;  4F14 A;  2L3Q A;  2E5K A;  1EFN A;  2YUN A;  1AEY A;  4HVV A;  1RI9 A;  1NYF A;  1HJD A;  2KT1 A;  4WCI A;  2B86 A;  4Z8A A;  1ZSG A;  1VYT A;  1W70 A;  1M3C A;  1SHF A;  4HXJ A;  2KR3 A;  1NLP C;  1QCF A;  2LP5 A;  2JMC A;  5I22 A;  2DJQ A;  1RLQ C;  3C0C A;  2JW4 A;  4J9I A;  1QKW A;  2EQI A;  1PNJ A;  2ROT A;  1LCK A;  2J6K A;  1KJW A;  4F17 A;  1HSQ A;  1V1C A;  2AKL A;  2FRY A;  5IHN A;  3KFV A;  1WLP B;  2CDT A;  1MV0 B;  2LQW A;  2BZX A;  4LN2 A;  2J06 A;  1UG1 A;  3H0H A;  3NGP A;  1T0J A;  1QWE A;  2MCN A;  2ESW A;  5ECA A;  2FG0 A;  1K0S A;  2P4R A;  3GBQ A;  1A0N B;  4AG2 C;  3RNJ A;  2HCK A;  4RUG A;  2AKK A;  2F2V A;  3EG3 A;  2LJ0 A;  1SSH A;  2L3P A;  1ZUU A;  4J9B A;  2KE9 A;  2KXC A;  2G6F X;  2JMA A;  2FEI A;  1U06 A;  1GL5 A;  3EHR A;  1OV3 A;  2KNB B;  3VS3 A;  2M0Y A;  3VS4 A;  4CC7 A;  1UTI A;  1X2Q A;  2CH4 W;  4RTU A;  1NEG A;  2RNA A;  1WIE A;  2MOX A;  2D8H A;  4ORZ A;  4IIM A;  1TUD A;  2F2W A;  4HCK A;  1PWT A;  3CQT A;  3EG2 A;  2RN8 A;  3PVQ A;  4AFS C;  4E6R A;  4A63 B;  2YUQ A;  5EC7 A;  1W1F A;  3VS2 A;  2ED0 A;  3UF4 A;  2BZ8 A;  4OMP A;  2GNC A;  2JXB A;  1WXT A;  2YUP A;  2IIM A;  1VA7 A;  1JEG A;  4KRT A;  4J9H A;  1OPK A;  3VS0 A;  2GTO A;  2X3X D;  3SEM A;  3NPF A;  2CSQ A;  4EIK A;  1K76 A;  1GBR A;  2AK5 A;  1RLP C;  3FJ5 A;  1U3O A;  4LNP A;  1K1Z A;  1UEC A;  2YSQ A;  3M0T A;  2JM8 A;  1X6G A;  1AWX A;  2J6F A;  1KIK A;  2JS0 A;  3JV3 A;  5IHK A;  2X3W D;  1UJ0 A;  2DL5 A;  2O9V A;  2GQI A;  1E6H A;  2ENM A;  4JZ4 A;  2CRE A;  1G2B A;  3I5S A;  1UFF A;  2ED1 A;  2O2O A;  2DYB A;  1ZUK A;  2KRM A;  4J9D A;  1NG2 A;  2LX7 A;  1T0H A;  3TSW A;  3NMZ C;  2FO0 A;  4ZNX A;  4AFU C;  2D0N A;  1FMK A;  2JTE A;  1Y57 A;  1GCQ A;  2EYX A;  2L2P A;  4JZ3 A;  1ZLM A;  1GFD A;  4OMQ A;  1PHT A;  2KYB A;  1AWJ A;  2OI3 A;  1BBZ A;  2ROL A;  2AZV A;  1CKB A;  3EHQ A;  1U5S A;  2KEA A;  1M3A A;  1PKS A;  5FWB A;  2K7A A;  3QWX X;  2CUB A;  1OEB A;  5GJV B;  3REB B;  1I07 A;  4OML A;  4D8K A;  1X2K A;  2F2X A;  1GRI A;  4DEY A;  2CUD A;  4DEX A;  2C0O A;  2EGA A;  2DMO A;  2DA9 A;  2KGT A;  2OJ2 A;  1WYX A;  1XOV A;  4GBQ A;  1N5Z A;  2DL7 A;  1H92 A;  1Z9Z A;  2FRW A;  1ABO A;  2I0N A;  3M0S A;  1WI7 A;  4K11 A;  2XMF A;  2HDA A;  1UE9 A;  1Z9Q A;  1UHF A;  2C0T A;  2J6O A;  1MV3 A;  2RQW A;  1K9A A;  1UUE A;  1GCQ C;  1PKT A;  2O9S A;  1E7O A;  1ZX6 A;  1ZBJ A;  1YNZ A;  4R0K A;  4JJD A;  1IO6 A;  1YCS B;  4OMO A;  3THK A;  2EGE A;  4CC2 A;  2HSP A;  1B3Q A;  2RQU A;  3H0F A;  4JJB A;  3TSZ A;  2BZY A;  2DL4 A;  3PVL A;  1ZUY A;  2EYZ A;  2CT3 A;  2ECZ A;  1BB9 A;  1FYN A;  1JO8 A;  2DIL A;  1M30 A;  1KFZ A;  1GFC A;  1AD5 A;  5I11 A;  2O88 A;  2D8J A;  1NLO C;  1SPK A;  2FPD A;  3O5Z A;  3UA6 A;  2PTK A;  4RTV A;  1M8M A;  4LUD A;  3I5R A;  2O31 A;  5HCK A;  2EPD A;  1SEM A;  2PZ1 A;  2CSI A;  2EW3 A;  2DBK A;  1S1N A;  2DRM A;  2KBT A;  4AFZ C;  2DX1 A;  2PNI A;  5IXB A;  1SRM A;  1K4U S;  2EYY A;  5FW9 A;  2DBM A;  1AOJ A;  1WX6 A;  2HBW A;  3TVT A;  1JQQ A;  1SRL A;  1NM7 A;  2GBQ A;  2J05 A;  4AFQ C;  1ABQ A;  1X69 A;  2MIO A;  3U23 A;  2LQN A;  2VVK A;  2A08 A;  2FPE A;  4X1V A;  2LMJ A;  3UAT A;  2DNU A;  4M4Z A;  2CH4 A;  1T3S A;  3M0R A;  2DRK A;  2NUZ A;  1YWP A;  2RQT A;  2L0A A;  1J3T A;  4FSS A;  3IQL A;  2JM9 A;  2KT8 A;  1WDX A;  2BTT A;  2V1R A;  4F16 A;  1TG0 A;  1MUZ A;  1M3B A;  2VKN A;  1JU5 C;  1UJY A;  2RPN A;  2A37 A;  2OAW A;  1K0X A;  2LNH B;  2SRC A;  2GGR A;  1I1J A;  1B07 A;  1QWF A;  4RTW A;  1M27 C;  3I9Q A;  2H8H A;  2A28 A;  4GLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...