4J9GA

Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p7 at ph7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
PNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P7
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
molecule keywords Tyrosine-protein kinase ABL1
total genus 11
structure length 58
sequence length 58
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9gA00
2YUOA 1WXBA 2OI3A 3PE0A 2L2PA 3M0SA 4HVWA 1PRMC 4HCKA 1W70A 1ARKA 1X2KA 2RNAA 2E5KA 3EHQA 1FMKA 2XMFA 2HSPA 2JT4A 4GLMA 1KSWA 1E6HA 3I35A 2IIMA 2K7AA 1MV3A 2YUPA 2KNBB 1QKWA 1WXTA 1X6GA 3EG3A 2CSIA 1B3QA 4LUDA 2ED1A 1SEMA 2KXDA 2KROA 2KXCA 2FPDA 3VS4A 1T3LA 5EC7A 2NWMA 2RN8A 4D8KA 4FSSA 1QLYA 4J9EA 2MOXA 2LZ6B 4A63B 3VS5A 3UATA 3QWXX 1PWTA 1HD3A 2DBMA 1UG1A 2J6KA 4DEXA 1NM7A 2YUNA 2O31A 1QKXA 4CC7A 4RTUA 1JQQA 4J9GA 2BZ8A 3SHWA 1QWEA 1M8MA 2DL4A 1UJYA 5IHNA 2D0NA 1QWFA 2J05A 1LCKA 1UHFA 2CDTA 4OMPA 3CQTA 2ECZA 2FPEA 2JS2A 3VS2A 1BBZA 1H3HA 2LJ0A 2LJ1A 1H8KA 3LH5A 2L3PA 4OMLA 1TG0A 1ZSGA 2AZVA 1YP5A 4RTWA 5FWBA 2ROTA 2K3BA 1A0NB 3VS3A 2EYWA 1SRLA 4J9IA 4HVVA 2K79A 1K9AA 2JM8A 4OMQA 1BK2A 2RQTA 1VYVA 1Y57A 3TVTA 5I22A 3EGUA 2VWFA 3H0IA 3VRZA 4F17A 4IIMA 4QT7A 1KFZA 3GBQA 2KEAA 2X3XD 2L0AA 4LN2A 2GGRA 1OPKA 1K76A 2CH4A 2DL7A 5GJVB 3EG0A 1N5ZA 2DL3A 2F2XA 2J6OA 1ZUYA 4Z8AA 1UE9A 1TUCA 2DA9A 2A36A 2YT6A 2GNCA 2KRNA 2DL8A 2RF0A 4OMOA 2CH4W 2BZXA 4JJBA 3RNJA 1AZGB 2EYYA 1U06A 1WXUA 2EYZA 3C0CA 1OV3A 2EGCA 2J06A 2RQWA 1Z9ZA 1BU1A 1CKAA 1X43A 2C0TA 2O9SA 5IHKA 1X69A 2JXBA 1PKTA 2AK5A 2ED0A 1GBQA 2JS0A 3M0RA 1NYGA 3U23A 2C0OA 3UA7A 2RQRA 1E6GA 1UHCA 3PVLA 3REBB 4ESRA 1SHFA 3A98A 2JW4A 1WA7A 1M3AA 1AWJA 1UJ0A 1JO8A 1SSHA 1K0SA 2P4RA 1YCSB 2DRKA 1GCQA 3VS7A 4AG1C 1K0XA 1HSQA 1WI7A 5L23A 5I11A 2D8HA 1AD5A 1G2BA 2ESWA 4CC2A 2LP5A 2ENMA 1Y0MA 4JJDA 1KJWA 1VA7A 4X1VA 1FYNA 4J9DA 1PRLC 3EHRA 5FWCA 2PTKA 1OEBA 5IH2A 1UGVA 4RTTA 2PZ1A 4R0KA 2DLPA 1AWOA 1T0HA 3UA6A 2HCKA 2K9GA 1SHGA 1AWWA 4LE9A 2K6DA 2F2VA 1M3CA 2JMCA 2RQVA 4E6RA 4Z89A 1JXMA 2HEQA 2EPDA 1T3SA 4Y92A 4DEYA 2RMOA 2FEIA 2J7IA 1UUEA 4RTYA 3JV3A 4AFQC 1K1ZA 1WIEA 2KRMA 2DE0X 2VVKA 2JMAA 3M0PA 4HVUA 2G6FX 2SRCA 3IQLA 1AOJA 1PKSA 1K4US 1U5SA 2BTTA 2YSQA 1GCPA 1I0CA 2PNIA 1WX6A 2EGEA 1X6BA 2DVJA 2EBPA 3M0UA 1RUWA 1M27C 3VRYA 2HDAA 1OPLA 2AKKA 2GBQA 1WYXA 2A37A 3KFVA 1YWPA 4F16A 2CREA 2KR3A 4D8DA 2M0YA 3ZL7C 2DMOA 2DF6A 2EVRA 1VYUA 3EG1A 1HJDA 2DBKA 3PVQA 2QDLA 3H0FA 2EW3A 2DX1A 1UECA 1JEGA 2NUZA 4AFZC 3I5SA 2FRWA 1XOVA 2VKNA 3NMZC 1GCQC 1PNJA 2LMJA 2KT1A 2FRYA 2CUBA 4J9FA 1G83A 2KBTA 1MUZA 1JXOA 1KIKA 1GBRA 2KRSA 1OOTA 1AVZC 3H41A 3I5RA 1GFDA 3VS1A 4F14A 1RLPC 1NLPC 4ORZA 4WCIA 3O5ZA 2RQUA 1VYTA 2W10A 4K11A 3VS6A 3NHNA 1QCFA 2KT8A 1YWOA 2KYBA 1E7OA 3NGPA 4JJCA 4KRTA 1Z9QA 1TUDA 2FG0A 2O2OA 1WDXA 2C0IA 2CSQA 4OMMA 2MCNA 1YN8A 2L3QA 2MIOA 4AG2C 3VS0A 1ZUKA 1I07A 4J9HA 4J9BA 2DRMA 3SEMA 1H92A 4RUGA 2EGAA 2LQWA 1J3TA 2GTJA 3QWYA 5IHIA 1U3OA 2A08A 4RTXA 4RTVA 2EYXA 1NG2A 1NEBA 1MV0B 5FW9A 3TSWA 5IXBA 1X2QA 1IO6A 2DM1A 2X3WD 2JTEA 3EG2A 1UTIA 2SEMA 2FPFA 4M4ZA 1I1JA 2DJQA 2W0ZA 2EKHA 4EIKA 2OAWA 1ZX6A 2LQNA 2GQIA 2DYBA 2DL5A 2A28A 2EQIA 2GTOA 1ZLMA 3THKA 3RBBB 4AFUC 4AFSC 2BZYA 3UF4A 2L3SA 1WFWA 3I9QA 2D1XA 1NEGA 1NYFA 1SRMA 2ROLA 2O88A 1UFFA 3H0HA 5HCKA 4LUEA 1ABQA 1W1FA 4JZ3A 4JZ4A 2JM9A 4IIOA 1PHTA 1M3BA 4J9CA 2FO0A 5GJWB 1X27A 1W6XA 1GL5A 2LNHB 1RLQC 3TSZA 3REAB 1RI9A 1EFNA 1ABOA 2B86A 2AZSA 2CT4A 1UDLA 2KYMA 2HBWA 1NLOC 2F2WA 1GFCA 2V1RA 3FJ5A 3ULRB 1BB9A 2M51A 1CSKA 2DILA 4CC4B 2H8HA 3M0QA 2I0NA 4OMNA 1V1CA 2CUDA 1B07A 2ABLA 2DNUA 2YUQA 2V1QA 4HXJA 4JPBW 1SPKA 1M30A 2CT3A 5ECAA 5IXFA 3R6NA 1CKBA 4RTZA 2OJ2A 2LJ3A 2J6FA 1GRIA 1T0JA 4GBQA 4Z88A 4CC3A 2K2MA 2LCSA 2O9VA 4ZNXA 2KE9A 3M0TA 1AEYA 2LX7A 2KGTA 1ZUUA 1AWXA 3NPFA 1YNZA 2RPNA 1ZBJA 1S1NA 2AKLA 2D8JA 1AZEA 2YDLA 4LNPA 1WLPB 1JU5C
chains in the Genus database with same CATH superfamily
2OI3A 2NUPA 2RJEA 4HCKA 3CCST 4OB1B 4II1A 1X6OA 2XMFA 4OB2B 1KSWA 1K73C 5A0DA 1YIJA 2KNBB 2HL5C 1X6GA 1K73R 2JTMA 3I56Q 1SEMA 3VS4A 4C92B 2DIGA 4A54A 2NWMA 2RN8A 4D8KA 1S72T 5HK3A 4M7DA 4A4GA 1MHNA 1YJNQ 1VQ9A 1UEBA 1UG1A 4DEXA 1VQPQ 2YUNA 3I55Q 4CC7A 5CCAA 1JQQA 4J9GA 1JBMA 1P92A 1VQ7A 1XQHA 1UJYA 2CZ6B 4M7AE 4LXCA 2J05A 5CIUA 2LJ0A 3J80E 2D0QB 3X20B 4OMLA 2NUTA 5LJ3h 2QG9B 1YIJT 2JVVA 1ZSGA 1QVFA 1PCXA 1OI1A 3A8GB 4M78A 1R0CB 2MAMA 2K3BA 5GAOn 3VS3A 3S3OA 1VQKT 2M02A 3CD6A 4MZMA 5LJ5d 3V8LA 4OMQA 1BK2A 3JCMd 2RQTA 1Y57A 3EFOB 2KAFA 3TVTA 2COWA 4J5YA 1V76A 2VWFA 4M78E 4IIMA 3GBQA 3PMIA 4M77C 1OPKA 2CH4A 2PVGB 2DL7A 2F2XA 2RHIA 1ZUYA 5KYUA 2DA9A 2YT6A 2ZPBB 2KRNA 3CXCP 1D1CA 4OMOA 1XNIA 3RNJA 1AZGB 3UT1A 2Z0WA 3QZ5B 3I55T 2J06A 1Z9ZA 1CKAA 5CKHA 2C0TA 2O9SA 5KYXA 3OSSC 2ZPIB 2OAUA 3BY7A 1X69A 1G3SA 2Y4XA 1XTDA 1G3TA 2ED0A 2EQJA 1WHJA 3DLMA 3M55A 2RQRA 2P0KA 3G1JA 4V2SA 1VQOA 1UJ0A 2L89A 2DRKA 4AG1C 3OW2S 5L23A 1M2VA 2D8HA 1Q81U 2HZYA 3QSUA 2ESWA 2E1HA 2M9UA 5KYUB 4JJDA 1ZQ1A 4MMLA 3M58A 4X1VA 2FZCB 3CMET 4E7SA 2PZ1A 4M78C 3CCRT 1AWOA 2KVQG 1B7TA 2HCKA 4N0AA 2K9GA 4EMKA 3I56A 2PVOB 4M78B 1K9MR 3S6WA 2WSFE 2K6DA 2F2VA 1TH7A 1JXMA 2BUDA 2HEQA 2XK0A 4XQ3A 3SWNA 3L2WA 2RMOA 2RM4A 1KG1A 1G3WA 1R8OB 1UUEA 2QQSA 3CCQT 4RTYA 2OTJA 1K1ZA 1MGQA 1YFNA 2AIRB 4M77A 1C1AA 4HVUA 4BB7A 5FU6C 1I4K1 1PKSA 1U5SA 2YSQA 4KUIA 5LJ5e 1I0CA 1WX6A 2EGEA 1ZSZC 4R56A 1WHKA 2L5QA 4R55A 3FB9A 2HDAA 3CCUQ 2H3EB 2BIVA 5LJ5h 3CCRQ 4F16A 2KR3A 5GAOq 2M0YA 2YRVA 2MPXC 3A8LB 2DBKA 5GAMg 2E3IA 1KK7A 3MEAA 2NUZA 4PJOD 1YJ9A 4AFZC 3I5SA 1YCYA 2FRWA 2FHDA 3NMZC 3GNFB 3E2UA 3L2VA 1VQKA 1IZ6A 3OYDA 4J9FA 4NOYA 2LDMA 2KBTA 3P8BB 1MUZA 2BE7D 3G4SA 2QGFB 1OOTA 1AVZC 4XTVA 4LDXA 3FRNA 2E10A 4WCIA 4PFOA 2Y90A 3QO3A 2MWOA 3O5ZA 2RQUA 1VYTA 2VYTA 3VS6A 2RH2A 3FC3A 3CCLA 4M7AF 4FL6A 3CCMT 4KRTA 3T9NA 4EMHA 3A5ZB 2QGGA 1FWZA 1WDXA 2VUBA 3O8VA 3OA6A 1VQMT 5C6SA 2LX9A 1QCNA 2MIOA 4X9CA 2DYIA 4J9HA 4FCYA 2CP6A 1J3TA 3FLGA 4EMKB 4ME7A 4RTXA 3CC2T 2EQKA 1M90U 1MV0B 5GAN4 5FW9A 1X2QA 1IO6A 1TS9A 2SEMA 4C0GA 3V8KA 1M5Q1 2W0ZA 3H8ZA 1ZX6A 1RACB 1Y71A 3DLLA 5GAOr 3M4GA 1K8AC 4MZPA 4ZN3A 1FMVA 4QKUA 2FYKA 2BZYA 3UF4A 5KE3A 4HT9A 1SKUB 2M0OA 1WFWA 3I9QA 1VQ5T 2ROLA 3MEUA 5I2MA 2LCCA 2HD0A 4JZ4A 4PLIA 3RESA 1N6AA 4IIOA 5GJWB 3CCEA 4HCBA 4M75A 4HA8A 5CAIA 1MMDA 1RLQC 2XD0A 1EFNA 1VQ7T 4BE2A 1UDLA 2KYMA 2HBWA 2HQEA 4C8QC 1NLOC 4B9WA 4PFZA 5GAN8 3FJ5A 3OS0A 1MMAA 3ULRB 1BB9A 3CXCA 1RAEB 2H8HA 4L59A 1KHIA 1M2VB 5GMKm 1D3BB 1V1CA 3MKDA 2DNUA 1OU9A 4HXJA 2CZ1B 4XU3A 1SPKA 5ECAA 4M75B 1BI0A 2EKOA 4RTZA 4RMOA 3RR6A 4FYWB 4QVCA 1BYMA 4JRPA 3M5AA 1X01A 4C8QA 4E7ZA 5GANf 4ZNXA 5KCHA 2KE9A 3V7RA 3PNWC 4ZGJB 3NPFA 3QUIA 2RPNA 1TSFA 1ZBJA 4FT4A 2HQHA 2AKLA 2D8JA 1TWBA 5IN1A 2I2LA 1VQKQ 2YDLA 2YUOA 2E3HA 1RAIB 4LD9K 2EIFA 2WSCE 3M0SA 3JCMf 1QVFP 1X2KA 1YJ9T 4UC4A 2E5KA 2DTOA 2HSPA 2JT4A 5I21A 4GLMA 3FIFA 1BIBA 4MZTA 1E6HA 3FEOA 5AYFA 1MV3A 7AT1B 1QKWA 3CCMA 2QDYB 4LUDA 1WHHA 2ED1A 1ZA2B 2KXCA 2QA4Q 1VQNT 1D0XA 3KUFA 3QBYA 2O4XA 5LJ3g 2EWNA 4ANJA 1QLYA 4J9EA 1QVFS 4A63B 2K57A 1PWTA 2DBMA 2V26A 2J6KA 4M75F 2GQVA 1NM7A 2VGMA 3HP9A 2AT1B 3JAME 2P0QA 1YJ9Q 3CPWA 1QWEA 3TU4K 1M8MA 3E9GA 2D0NA 2VB6A 3L1AA 1LCKA 2K3XA 4OF1A 3CQTA 5DM7R 4F7UB 1YITT 2FPEA 4J6XA 1Q81C 3OYAA 4PJOA 2JS2A 1VQLT 3JSCA 3AT1B 1BBZA 1H3HA 3OYEA 4JLIA 2LJ1A 1MNDA 3CCVA 3NTKA 4C92E 2JTFA 3CC2A 4O5VA 1TG0A 3PMTA 3FJPA 3CCRA 1Q86R 2AZVA 3EGXA 1S72Q 2E5QA 1UGPB 5FWBA 4NL2A 2ROTA 1O75A 4DA4A 3JB9G 4PLLA 1V29B 4A4KA 2EYWA 3FDRA 1SRLA 2EQUA 4J9IA 4BY6B 5GAMf 2D6FA 3DKMA 4JLGA 5DLOA 3NFCA 1Q95G 3H0IA 3VRZA 3R6OA 1KFZA 3JCMW 2ZPGB 1U1TA 1LNXA 2X3XD 2L0AA 3X24B 1K76A 1U8RA 1Q86C 1R0BG 5GJVB 2GF7A 1NPRA 3A8HB 5A2QE 3EG0A 1K73U 1IRXA 5GMKh 3CMEA 2QK0A 2A36A 5DLQE 3MPUB 3TQ7P 2RF0A 5KE2A 4ELYC 4JJBA 4DOWA 1Q81R 4QVZA 2YLCA 1Q7YC 1I8FA 2EGCA 1M1KC 1R77A 1RADB 3EGDA 2LNVA 5IHKA 4XU0A 4GLKA 2AK5A 4IUUA 4F7UE 4BE0A 5CKFA 2HQXA 2C0OA 1E6GA 1UHCA 1QP2A 3CC7A 3A98A 3P8DA 1M3AA 3OYMA 1JO8A 3CMAA 3MEVA 4BE1A 1QVGS 3VS7A 3EFRA 4J6YA 1WI7A 2DXUA 3GIBA 4M77E 2DZCA 3HFNA 4CC2A 2LP5A 1PSEA 2LRQA 4CI0C 2DPPB 2YHTA 3S3NA 4M77G 4JRKA 3EHRA 2PTKA 1FX7A 5KCOA 4C5GA 1I81A 1YJNA 4R0KA 3ASKA 5GMKl 3EFSA 2A3LA 4M75C 2RK2A 3EH1A 1KC8C 5CO7A 4DOVA 1M3CA 1AHJB 4YTLA 2JUFA 3EH2A 4C5EA 5C0MA 3SB2A 1G5VA 2EPDA 3OW2A 3J7AF 1OX8A 1WQ7A 3OS1A 4A53A 2ZAEA 2RHYA 5LJ5g 2IG0A 3HL8A 3UPUA 4C8QB 1NZ9A 1OX9A 4AFQC 3CCUA 5KH6A 1WIEA 2DXTA 3OW2P 1UB4A 1QW1A 1AOJA 3M9QA 2FB7A 1K4US 2BTTA 1LOJA 2PNIA 3L2ZA 1X6BA 2V8IA 1M27C 2OTJT 4E7LA 3GF5A 4BY6C 1WYXA 4IURA 1D3BA 3KFVA 3ME9A 2CREA 5D6YA 2EYQA 3J81E 1M9SA 3ZL7C 3TREA 3CMEQ 1SG5A 2DF6A 3HTRA 2E41A 2DD5A 4JJNK 1VYUA 2OTLA 1YJNT 1IHWA 3PFSA 3H0FA 2XHCA 2EJ9A 3QZ9B 2DO3A 2DX1A 1NJIU 4DQ2A 1UECA 2XG8D 1ZBXA 2OX7A 1Y96A 1JEGA 3QHSA 1G8XA 2PUOB 3V7SA 8ATCB 3CCSA 2GCXA 1BI2A 2LMJA 2DZ9A 3G71Q 3QXEB 2KT1A 1RABB 1OULA 3LWIA 2E70A 1G83A 5FLXE 4PK4A 2KRSA 2CP3A 4JUVA 4EMKC 4M75E 3GLXA 2CP0A 1NLPC 1RL2A 2QAZA 2WACA 3D7SB 2XDDA 1W4SA 1YI2Q 3RKXA 2KYBA 4HCZA 1PC0A 1VQ4A 1QQJA 3X28B 2HBPA 1Z9QA 3G6EA 1TUDA 2JOYA 2DJZA 4AMCA 2C0IA 2CSQA 1WHMA 2MCNA 2QXFA 3QJ6A 2L3QA 1D09B 4M78F 2DETA 1IGUA 1ZUKA 3C12A 1ZHIA 4AT1B 2QQRA 2YWWA 2QTXA 1YHQT 2X51A 4KULA 2DRMA 2WSEE 1H92A 4JS5A 4RUGA 2EGAA 3G71T 1UGQB 1U3OA 4RTVA 4FYYB 1I5LA 1M1KR 4KGZB 4C92G 1VQ6T 2DTHA 4C5IA 4OGCA 2DM1A 2JTEA 1BKBA 2FPFA 2LC4A 4M4ZA 1OU8A 2YLBA 1KQSA 2EKHA 3QPHA 2DERA 2OAWA 3GNGA 2DYBA 3TEEA 2QEXA 1Q82U 1YIJQ 3THKA 3BDLA 3RBBB 1NJIR 1M90C 1VQ4Q 1D1AA 1M1GA 4KBMB 1VQ8T 2NYSA 4C0FA 4N4GA 1NYFA 2DK3A 1B34B 4EPCA 3OYIA 5HCKA 4LUEA 2QA4T 1VQNQ 1W1FA 3CPWP 4PJOB 1WHLA 1YHQQ 1M3BA 3RKWA 4OB0B 1W6XA 2LNHB 4XU1A 3JCMg 3G4ST 1RI9A 3G71A 1OYXA 1C0MA 1VQ8A 1UGSB 3DB3A 3RERA 2GFAA 2V1RA 2EJGA 3BDUA 2QI2A 2M51A 5CKBA 3UWNA 2DILA 4CC4B 3M0QA 2I0NA 1TOVA 2HAXA 1RAFB 2CUDA 2K3YA 1KQ2A 3QDFA 3CCUT 1GXIE 3NTHA 2V1QA 2HNIA 3CBPA 4JPBW 4KGXB 1M30A 2CT3A 5IXFA 4WF2A 3R6NA 1VQ4T 5GMKj 2A0FB 3VKIA 1KQSS 4M75D 3CC7T 3JCMJ 4GBQA 4Z88A 4L6V5 5GANe 2M16A 2KY9A 4E7KA 4XTZA 3CCQQ 3JB9H 2LCSA 2O9VA 4QQDA 4NL3A 1KD1R 3M0TA 5LL6S 4XK8E 1YNZA 3WXMB 2RI5A 1YHQA 2EQMA 2BE9B 2ZPHB 1AZEA 1N9SA 1WXBA 2L2PA 3NTIA 1W70A 1ARKA 4PNOA 1FMWA 2RNAA 4BI4A 3EHQA 2DFUA 2HSEB 3I35A 5HKCA 2KSSA 2R5MA 1UGRB 1WXTA 3EG3A 1EIFA 1LVKA 2CSIA 4ZGEB 1B3QA 3ER0A 3RUXA 3M57A 2KXDA 2KROA 2YXYA 1QVPA 2FPDA 2BKDN 2PUKB 4JDSA 1EZZB 1VIFA 1BI1A 3TCJA 2LT4A 4GY5A 2Y4YA 3I56T 3OMCA 2LZ6B 3VS5A 3UATA 3QWXX 3JCMc 3LGFA 5DY9A 1HD3A 3MO8A 4FYXB 2D9TA 1WZOA 1ACMB 1NBEB 4XTYA 3WVDB 1VQMQ 5KYXB 2DL4A 5IHNA 2MI6A 1QWFA 5LJ3j 3GP8A 4FU6A 2CDTA 1N8RC 3HSBA 2E12A 3JCMb 1H8KA 3CCEQ 1N27A 3EGDB 2ZZDA 3CCLQ 4XTWA 3WVEB 4C8QG 2DIQA 4J8OA 2AHJB 4ELZC 4RTWA 1M2OA 3JCMh 3I55A 3QDRB 3HKSA 3VYGA 2VGNA 5LJ3f 1Q86U 1YJWA 1WPYA 1NPPA 2QASA 3L42A 3OMGA 2DEQA 3PT9A 2K79A 4HVVA 1K9AA 1VYVA 1ZSZB 1SF9A 3MCAB 4RKUE 5FRMA 1K9MC 4M7AB 4F17A 3ZBDA 1M1KU 1MNEA 1O9SA 3OYYA 3HRTA 2X9HA 4M7AG 1VQLA 3PIOA 4IUVA 2KQWA 1EX4A 1N5ZA 4C92D 5GAOp 1QMCA 4Z8AA 1TUCA 2FZKB 2CP2A 1RAAB 4RCCA 1DJ7B 4FW2A 3E19A 2XI9A 2XKOC 4EMGA 2EYZA 3C0CA 3BFMA 2RQWA 4ZTFA 1BU1A 1X43A 4A4EA 3M56A 1YJWQ 4C0DB 4ATOA 4PJJA 4BD3A 4PL6A 1PKTA 4PKCC 1NYGA 2OTLT 3UA7A 3PVLA 3REBB 3H6ZA 1SHFA 1WHGA 1WA7A 1AWJA 4L5GA 1FXXA 3M54A 1SSHA 3C4SA 2X4WA 1N9RA 2DTIA 2P4RA 4FYVB 1GCQA 1VQPA 1WQWA 5CK9A 3AHUA 5HK0A 1K0XA 1HSQA 5I11A 3CBMA 3LX7A 1AD5A 4FM4B 3H9NA 2R57A 1FYNA 5FWCA 1KQSP 1UGVA 4RTTA 3RKYA 3KXTA 2PQWA 3L2UA 3MP6A 2DLPA 3CC2Q 1Y96B 2QYZA 2RJFA 3UA6A 4M7DC 5A0GA 3OYHA 4OGEA 1QVGP 2ZGWA 4LE9A 4IUPA 2OTLQ 4J7IA 1WJQA 2JMCA 2RQVA 4E6RA 4QQGA 1H641 2O4XB 1I5OB 1JRIA 4Y92A 4DEYA 2J7IA 3VUZA 4M77B 3CCJT 2KRMA 2JMAA 3M0PA 4J7FA 5LJ5f 3JCMX 2G6FX 4C92C 1KC8U 3OS2A 4M7AD 3M0UA 1RUWA 1H3ZA 4EDUA 2GBQA 5KYYB 3OBYA 2C06A 1BCMA 2PVDB 2A37A 3M4YA 4PFPA 1YWPA 2XIDA 3E9FA 3LH0A 5GMKe 1HXDA 4BI8B 4D8DA 3RMQA 1N8RR 3CMAT 1JJ2P 1M8VA 1Q7YU 3CCET 2EVRA 4RG8A 1HJDA 3PVQA 1MMNA 2JNGA 3QYHB 2P84A 1OZ2A 1NE8A 2K5FA 1XOVA 2VKNA 1PG5B 4B9XA 2X4JA 3OYGA 5GAOm 1U1SA 2YRCA 2CUBA 3OYKA 1W2BA 4N4HA 5GANj 5GANd 1KIKA 4M7AC 3L2QA 3VU3C 3CCLT 1M90R 3I5RA 2F69A 1GFDA 1NJIC 3P8HA 4F14A 1VOMA 4LD6A 3OYBA 3CMAQ 3CPFA 1W2BP 2X35A 2W10A 1LPLA 2NLUA 3NHNA 1ZA1B 4RG2A 3VJPA 3SD4A 5IT9E 5FU7C 5CQYA 3N5BB 3CCJQ 4DBHA 2O2OA 3OY9A 1M4ZA 4BDYA 1YN8A 4JRIA 4WTOB 4M7DD 4QVDA 3JCMP 4QQ6A 4AG2C 3VS0A 1VQMA 1IGQA 1I07A 4J9BA 4KUDK 1PM3A 5GAMh 4MMKA 5CKEA 3MHXA 3V8JA 2LQWA 3QWYA 1Q82C 2DKGA 2YRDA 2A08A 4C8QD 2R5AA 1SSFA 2E64A 3EFOA 5IXBA 1VQ6Q 1VQ6A 4IUQA 3EG9A 1UTIA 4P5NA 1I1JA 3OQ5A 2G3RA 1BIAA 2GQIA 2A28A 2DXCA 2DXBA 1WNLA 4C92A 3RIRA 1C6VX 3G6ET 4HT8A 3CXCS 6AT1B 2NUTB 1YI2A 1AT1B 3LLRA 3RMSA 1SRMA 2ZPFB 1KHCA 2CS7A 1UFFA 5GAMj 2KDSA 4JZ3A 4E47A 2LTOA 2JM9A 2R58A 1PHTA 4J9CA 3JB9J 3TSZA 2RK1A 4E7HA 1VQ5A 3E1SA 3PIPA 3CCSQ 2F2WA 2HL3A 4FT2A 1VQ8Q 1PD0A 1KD1C 3VYHB 3M53A 5HY6A 2IPOB 4KT0E 3CPWS 4OMNA 1B07A 2ABLA 3CCJA 5A0LA 2V8JA 4C0DC 5GANh 2RJCA 1CKBA 3F70A 2OJ2A 1D0ZA 5KYWB 3EG9B 2CGHA 3OYJA 2MYSA 3BW1A 3META 3EGXB 3JRZA 2QA4A 2X4YA 1OZ3A 4FIBA 1AWXA 4M75G 2E4HA 2JZ2A 2F1LA 3A1PA 3CCMQ 1S1NA 2K4YA 2OTJQ 3HPWA 4O6JA 4F7UA 3PE0A 3OBWA 4HVWA 1PRMC 5CVIA 5EG2A 1FMKA 1JJ2S 4OP0A 3RDVA 2K5IA 2IIMA 3VUBA 2K7AA 2YUPA 1WGSA 2KMTA 2HKQB 3HFOA 2LT1A 5KYNA 1T3LA 5EC7A 3M59A 4FSSA 3HRSA 3JB9F 2MOXA 4DBFA 3CD6Q 4C5HA 1F1BB 1YBYA 2RO0A 1TXQA 2O31A 1QKXA 4RTUA 3OSVA 2E6NA 2BZ8A 5LJ3d 3SHWA 3C95A 3SWNB 4MDXA 3SFMA 1UHFA 3DB4A 4NS5A 2EJFA 2RJDA 4OMPA 2CP7A 2ECZA 1VQ5Q 2F5KA 3VS2A 1IXDA 2JN0A 1Y7XA 1VUBA 3CCVT 2MF2A 3LH5A 3A8OB 3QG1A 2L3PA 2MMPA 4BI3A 1VQ7Q 2GFUA 2DEUA 2XDPA 1K9MU 2RI3A 1YP5A 4X9DA 3JCMV 3JB9D 1PD1A 4M78D 5IAYA 2QEXT 1A0NB 3CEYA 3KBGA 4M78G 2JM8A 4Y91A 1W2BS 4HCCA 5D6XA 2MWPA 5I22A 2E6ZA 4OVAA 1VQOQ 3EGUA 4LDUA 5J39A 2VXEA 2L3RA 4QT7A 4FW1A 4C92F 5FROA 4DBRA 2KEAA 4XTXA 5GAN3 3C94A 4F7UF 4LN2A 2GGRA 2RHZA 4FSXA 2K2VA 2DL3A 2J6OA 2M1HA 1UE9A 2GNCA 5AT1B 2DL8A 2MK5A 2CH4W 2BZXA 2EYYA 1TTHB 1U06A 1WXUA 9ATCB 1OV3A 3MP1A 1VQ9T 2QTVA 5GAOl 2JJ9A 4ZTJA 1QP3A 2JXBA 2CYZB 5CR2A 1GBQA 1WJRA 2JS0A 3M0RA 3U23A 2RD1A 4BACA 1PSFA 2LQ8A 4ESRA 4F7UG 2LCLA 3GOXA 2JW4A 8AT1B 3HHTB 5GANg 1K0SA 1Q7YR 1YCSB 3JCMQ 4D6WA 1N8RU 3LYIA 5GAMe 5GAN7 1G2BA 3LW5E 4C8QF 5I2SA 2ENMA 2XICA 1YJWT 1QCOA 1Y0MA 1KJWA 1VA7A 4PJOC 1IHVA 1M1FA 2KI7A 4HKEA 3OYNA 4J9DA 1PRLC 5J26A 1OEBA 2F5TX 2LVMA 4KH1B 5IH2A 3VV0A 4OB3B 4CRIA 3EAEA 2QQAA 1T0HA 1BI3A 4OMFB 5GMKi 1SHGA 4Q5WA 1AWWA 5J3BA 3JCMe 3INZA 2DAQA 3LWHA 3Q1JA 4Z89A 4PJLA 1T3SA 4C8QE 3S3MA 5D6WA 4LDWA 2FEIA 2NUPB 4LDVA 3JB9I 3JV3A 1G3YA 2DE0X 2VVKA 3MJXA 3V7CA 2SRCA 3IQLA 3ZEHA 1VQ9Q 2PU9B 3OB9A 1TU0B 2HKNA 1GCPA 2CZ0B 2DVJA 2EBPA 3VRYA 2P0PA 2V8KA 1OPLA 4C0ZA 2AKKA 1S72A 3BE3A 2H3JA 3GPLA 2LQKA 2DMOA 2DVEA 2DD4A 1IB8A 1ZSZA 5FU6B 3QIIA 5CKDA 3OYFA 3EG1A 2IVWA 2KK4A 5CQXA 2QDLA 4IKFA 2EW3A 2EFIA 1VIEA 3OS5A 2FL7A 4M7AA 1RI0A 1GCQC 1BCOA 1PNJA 4X34A 3G6EQ 2ATCB 2FRYA 3SWNC 2HMAA 1JXOA 4F04B 1GBRA 1MMGA 1VQPT 3H41A 4M7DE 3A8MB 3VS1A 1K8AR 1RLPC 5LJ3e 4ORZA 2VASA 2B8AA 3URGA 4ZN1A 4K11A 3CC7Q 1QCFA 2KT8A 1YWOA 3CCVQ 1E7OA 3ZFJA 3NGPA 4N4IA 2RA2A 4E2FB 1XJWB 4JJCA 1YI2T 4IUTA 2E65A 4A4FA 4JS4A 2RHUA 3CBOA 2QEXQ 2FG0A 2VC8A 5GAMd 1HK9A 4OMMA 4XTUA 1WJSA 2FVUA 3CC4T 5L8RE 1TUGB 5M9OA 4E7IA 1X75C 4Y28E 3CC4A 4J6WA 1IREB 4BUGA 2VXFA 4XU2A 4M7DF 3SEMA 3QJYA 4E7JA 2GTJA 2FZGB 4M77D 5IHIA 4PJOE 2CP5A 1K8AU 2CZ7B 1D0YA 1NG2A 2EYXA 1YITQ 4RCBA 1NEBA 3QKJA 1VQLQ 4XAXB 1LJOA 4A4HA 2O01E 3TSWA 5FRNA 4LDYA 1VQNA 2X3WD 5GAN5 2XU8A 3EG2A 3SDZA 4ZGDB 2VV5A 3X25B 4EIKA 2DJQA 1HYOA 1RAHB 2LQNA 2DL5A 1KC8R 2EQIA 2GTOA 2EAYA 1ZLMA 1JJ2A 2A7YA 2X4XA 3CD6T 2XDBA 4AFUC 1JB0E 4KH0B 1KQ1A 4PJOG 4AFSC 3OYCA 4PJOF 2L3SA 4M7DG 3MEWA 2CKKA 2COYA 2COZA 2D1XA 2K5LA 1NEGA 4JRQA 2QQ9A 3CCQA 2O88A 5LJ5j 3H0HA 1ABQA 2P4TA 3G7ZA 2FO0A 3G4SQ 1X27A 1GL5A 4B6MA 4PJNA 3REAB 3L2RA 1ABOA 5GAN2 3QYGB 5D7UA 3HRUA 2B86A 4KGVB 2AZSA 1RAGB 2CT4A 1B34A 4BDZA 5FU7B 1GFCA 3CC4Q 5GAN6 1Q82R 4N0AC 2RB6A 1CSKA 3LGLA 4PJMA 1QVGA 4DBQA 3OYLA 4M77F 5KYYA 2YUQA 5KYWA 4QW2A 4M7DB 3MP8A 2LJ3A 2J6FA 1GRIA 1T0JA 4MDWA 4VUBA 2ZCFB 2QQBA 4Z02A 1D1BA 4TVRA 1VQOT 2RI2A 4CC3A 3X26B 2K2MA 1KD1U 1OQKA 3PGGA 1YITA 1AEYA 2LX7A 4J83A 3UDCA 2KGTA 1ZUUA 2ZPEB 1Y07A 2L8DA 3PTAA 2RHXA 4LNPA 1WLPB 1JU5C
chains in the Genus database with same CATH topology
2YUOA 1WXBA 2OI3A 3PE0A 2L2PA 3M0SA 4HVWA 1PRMC 4HCKA 1W70A 1ARKA 1X2KA 2RNAA 2E5KA 3EHQA 1FMKA 2XMFA 2HSPA 2JT4A 4GLMA 1KSWA 1E6HA 3I35A 2IIMA 2K7AA 1MV3A 2YUPA 2KNBB 1QKWA 1WXTA 1X6GA 3EG3A 2CSIA 1B3QA 4LUDA 2ED1A 1SEMA 2KXDA 2KROA 2KXCA 2FPDA 3VS4A 1T3LA 5EC7A 2NWMA 2RN8A 4D8KA 4FSSA 1QLYA 4J9EA 2MOXA 2LZ6B 4A63B 3VS5A 3UATA 3QWXX 1PWTA 1HD3A 2DBMA 1UG1A 2J6KA 4DEXA 1NM7A 2YUNA 2O31A 1QKXA 4CC7A 4RTUA 1JQQA 4J9GA 2BZ8A 3SHWA 1QWEA 1M8MA 2DL4A 1UJYA 5IHNA 2D0NA 1QWFA 2J05A 1LCKA 1UHFA 2CDTA 4OMPA 3CQTA 2ECZA 2FPEA 2JS2A 3VS2A 1BBZA 1H3HA 2LJ0A 2LJ1A 1H8KA 3LH5A 2L3PA 4OMLA 1TG0A 1ZSGA 2AZVA 1YP5A 4RTWA 5FWBA 2ROTA 2K3BA 1A0NB 3VS3A 2EYWA 1SRLA 4J9IA 4HVVA 2K79A 1K9AA 2JM8A 4OMQA 1BK2A 2RQTA 1VYVA 1Y57A 3TVTA 5I22A 3EGUA 2VWFA 3H0IA 3VRZA 4F17A 4IIMA 4QT7A 1KFZA 3GBQA 2KEAA 2X3XD 2L0AA 4LN2A 2GGRA 1OPKA 1K76A 2CH4A 2DL7A 5GJVB 3EG0A 1N5ZA 2DL3A 2F2XA 2J6OA 1ZUYA 4Z8AA 1UE9A 1TUCA 2DA9A 2A36A 2YT6A 2GNCA 2KRNA 2DL8A 2RF0A 4OMOA 2CH4W 2BZXA 4JJBA 3RNJA 1AZGB 2EYYA 1U06A 1WXUA 2EYZA 3C0CA 1OV3A 2EGCA 2J06A 2RQWA 1Z9ZA 1BU1A 1CKAA 1X43A 2C0TA 2O9SA 5IHKA 1X69A 2JXBA 1PKTA 2AK5A 2ED0A 1GBQA 2JS0A 3M0RA 1NYGA 3U23A 2C0OA 3UA7A 2RQRA 1E6GA 1UHCA 3PVLA 3REBB 4ESRA 1SHFA 3A98A 2JW4A 1WA7A 1M3AA 1AWJA 1UJ0A 1JO8A 1SSHA 1K0SA 2P4RA 1YCSB 2DRKA 1GCQA 3VS7A 4AG1C 1K0XA 1HSQA 1WI7A 5L23A 5I11A 2D8HA 1AD5A 1G2BA 2ESWA 4CC2A 2LP5A 2ENMA 1Y0MA 4JJDA 1KJWA 1VA7A 4X1VA 1FYNA 4J9DA 1PRLC 3EHRA 5FWCA 2PTKA 1OEBA 5IH2A 1UGVA 4RTTA 2PZ1A 4R0KA 2DLPA 1AWOA 1T0HA 3UA6A 2HCKA 2K9GA 1SHGA 1AWWA 4LE9A 2K6DA 2F2VA 1M3CA 2JMCA 2RQVA 4E6RA 4Z89A 1JXMA 2HEQA 2EPDA 1T3SA 4Y92A 4DEYA 2RMOA 2FEIA 2J7IA 1UUEA 4RTYA 3JV3A 4AFQC 1K1ZA 1WIEA 2KRMA 2DE0X 2VVKA 2JMAA 3M0PA 4HVUA 2G6FX 2SRCA 3IQLA 1AOJA 1PKSA 1K4US 1U5SA 2BTTA 2YSQA 1GCPA 1I0CA 2PNIA 1WX6A 2EGEA 1X6BA 2DVJA 2EBPA 3M0UA 1RUWA 1M27C 3VRYA 2HDAA 1OPLA 2AKKA 2GBQA 1WYXA 2A37A 3KFVA 1YWPA 4F16A 2CREA 2KR3A 4D8DA 2M0YA 3ZL7C 2DMOA 2DF6A 2EVRA 1VYUA 3EG1A 1HJDA 2DBKA 3PVQA 2QDLA 3H0FA 2EW3A 2DX1A 1UECA 1JEGA 2NUZA 4AFZC 3I5SA 2FRWA 1XOVA 2VKNA 3NMZC 1GCQC 1PNJA 2LMJA 2KT1A 2FRYA 2CUBA 4J9FA 1G83A 2KBTA 1MUZA 1JXOA 1KIKA 1GBRA 2KRSA 1OOTA 1AVZC 3H41A 3I5RA 1GFDA 3VS1A 4F14A 1RLPC 1NLPC 4ORZA 4WCIA 3O5ZA 2RQUA 1VYTA 2W10A 4K11A 3VS6A 3NHNA 1QCFA 2KT8A 1YWOA 2KYBA 1E7OA 3NGPA 4JJCA 4KRTA 1Z9QA 1TUDA 2FG0A 2O2OA 1WDXA 2C0IA 2CSQA 4OMMA 2MCNA 1YN8A 2L3QA 2MIOA 4AG2C 3VS0A 1ZUKA 1I07A 4J9HA 4J9BA 2DRMA 3SEMA 1H92A 4RUGA 2EGAA 2LQWA 1J3TA 2GTJA 3QWYA 5IHIA 1U3OA 2A08A 4RTXA 4RTVA 2EYXA 1NG2A 1NEBA 1MV0B 5FW9A 3TSWA 5IXBA 1X2QA 1IO6A 2DM1A 2X3WD 2JTEA 3EG2A 1UTIA 2SEMA 2FPFA 4M4ZA 1I1JA 2DJQA 2W0ZA 2EKHA 4EIKA 2OAWA 1ZX6A 2LQNA 2GQIA 2DYBA 2DL5A 2A28A 2EQIA 2GTOA 1ZLMA 3THKA 3RBBB 4AFUC 4AFSC 2BZYA 3UF4A 2L3SA 1WFWA 3I9QA 2D1XA 1NEGA 1NYFA 1SRMA 2ROLA 2O88A 1UFFA 3H0HA 5HCKA 4LUEA 1ABQA 1W1FA 4JZ3A 4JZ4A 2JM9A 4IIOA 1PHTA 1M3BA 4J9CA 2FO0A 5GJWB 1X27A 1W6XA 1GL5A 2LNHB 1RLQC 3TSZA 3REAB 1RI9A 1EFNA 1ABOA 2B86A 2AZSA 2CT4A 1UDLA 2KYMA 2HBWA 1NLOC 2F2WA 1GFCA 2V1RA 3FJ5A 3ULRB 1BB9A 2M51A 1CSKA 2DILA 4CC4B 2H8HA 3M0QA 2I0NA 4OMNA 1V1CA 2CUDA 1B07A 2ABLA 2DNUA 2YUQA 2V1QA 4HXJA 4JPBW 1SPKA 1M30A 2CT3A 5ECAA 5IXFA 3R6NA 1CKBA 4RTZA 2OJ2A 2LJ3A 2J6FA 1GRIA 1T0JA 4GBQA 4Z88A 4CC3A 2K2MA 2LCSA 2O9VA 4ZNXA 2KE9A 3M0TA 1AEYA 2LX7A 2KGTA 1ZUUA 1AWXA 3NPFA 1YNZA 2RPNA 1ZBJA 1S1NA 2AKLA 2D8JA 1AZEA 2YDLA 4LNPA 1WLPB 1JU5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUO A;  1WXB A;  2OI3 A;  3PE0 A;  2L2P A;  3M0S A;  4HVW A;  1PRM C;  4HCK A;  1W70 A;  1ARK A;  1X2K A;  2RNA A;  2E5K A;  3EHQ A;  1FMK A;  2XMF A;  2HSP A;  2JT4 A;  4GLM A;  1KSW A;  1E6H A;  3I35 A;  2IIM A;  2K7A A;  1MV3 A;  2YUP A;  2KNB B;  1QKW A;  1WXT A;  1X6G A;  3EG3 A;  2CSI A;  1B3Q A;  4LUD A;  2ED1 A;  1SEM A;  2KXD A;  2KRO A;  2KXC A;  2FPD A;  3VS4 A;  1T3L A;  5EC7 A;  2NWM A;  2RN8 A;  4D8K A;  4FSS A;  1QLY A;  4J9E A;  2MOX A;  2LZ6 B;  4A63 B;  3VS5 A;  3UAT A;  3QWX X;  1PWT A;  1HD3 A;  2DBM A;  1UG1 A;  2J6K A;  4DEX A;  1NM7 A;  2YUN A;  2O31 A;  1QKX A;  4CC7 A;  4RTU A;  1JQQ A;  4J9G A;  2BZ8 A;  3SHW A;  1QWE A;  1M8M A;  2DL4 A;  1UJY A;  5IHN A;  2D0N A;  1QWF A;  2J05 A;  1LCK A;  1UHF A;  2CDT A;  4OMP A;  3CQT A;  2ECZ A;  2FPE A;  2JS2 A;  3VS2 A;  1BBZ A;  1H3H A;  2LJ0 A;  2LJ1 A;  1H8K A;  3LH5 A;  2L3P A;  4OML A;  1TG0 A;  1ZSG A;  2AZV A;  1YP5 A;  4RTW A;  5FWB A;  2ROT A;  2K3B A;  1A0N B;  3VS3 A;  2EYW A;  1SRL A;  4J9I A;  4HVV A;  2K79 A;  1K9A A;  2JM8 A;  4OMQ A;  1BK2 A;  2RQT A;  1VYV A;  1Y57 A;  3TVT A;  5I22 A;  3EGU A;  2VWF A;  3H0I A;  3VRZ A;  4F17 A;  4IIM A;  4QT7 A;  1KFZ A;  3GBQ A;  2KEA A;  2X3X D;  2L0A A;  4LN2 A;  2GGR A;  1OPK A;  1K76 A;  2CH4 A;  2DL7 A;  5GJV B;  3EG0 A;  1N5Z A;  2DL3 A;  2F2X A;  2J6O A;  1ZUY A;  4Z8A A;  1UE9 A;  1TUC A;  2DA9 A;  2A36 A;  2YT6 A;  2GNC A;  2KRN A;  2DL8 A;  2RF0 A;  4OMO A;  2CH4 W;  2BZX A;  4JJB A;  3RNJ A;  1AZG B;  2EYY A;  1U06 A;  1WXU A;  2EYZ A;  3C0C A;  1OV3 A;  2EGC A;  2J06 A;  2RQW A;  1Z9Z A;  1BU1 A;  1CKA A;  1X43 A;  2C0T A;  2O9S A;  5IHK A;  1X69 A;  2JXB A;  1PKT A;  2AK5 A;  2ED0 A;  1GBQ A;  2JS0 A;  3M0R A;  1NYG A;  3U23 A;  2C0O A;  3UA7 A;  2RQR A;  1E6G A;  1UHC A;  3PVL A;  3REB B;  4ESR A;  1SHF A;  3A98 A;  2JW4 A;  1WA7 A;  1M3A A;  1AWJ A;  1UJ0 A;  1JO8 A;  1SSH A;  1K0S A;  2P4R A;  1YCS B;  2DRK A;  1GCQ A;  3VS7 A;  4AG1 C;  1K0X A;  1HSQ A;  1WI7 A;  5L23 A;  5I11 A;  2D8H A;  1AD5 A;  1G2B A;  2ESW A;  4CC2 A;  2LP5 A;  2ENM A;  1Y0M A;  4JJD A;  1KJW A;  1VA7 A;  4X1V A;  1FYN A;  4J9D A;  1PRL C;  3EHR A;  5FWC A;  2PTK A;  1OEB A;  5IH2 A;  1UGV A;  4RTT A;  2PZ1 A;  4R0K A;  2DLP A;  1AWO A;  1T0H A;  3UA6 A;  2HCK A;  2K9G A;  1SHG A;  1AWW A;  4LE9 A;  2K6D A;  2F2V A;  1M3C A;  2JMC A;  2RQV A;  4E6R A;  4Z89 A;  1JXM A;  2HEQ A;  2EPD A;  1T3S A;  4Y92 A;  4DEY A;  2RMO A;  2FEI A;  2J7I A;  1UUE A;  4RTY A;  3JV3 A;  4AFQ C;  1K1Z A;  1WIE A;  2KRM A;  2DE0 X;  2VVK A;  2JMA A;  3M0P A;  4HVU A;  2G6F X;  2SRC A;  3IQL A;  1AOJ A;  1PKS A;  1K4U S;  1U5S A;  2BTT A;  2YSQ A;  1GCP A;  1I0C A;  2PNI A;  1WX6 A;  2EGE A;  1X6B A;  2DVJ A;  2EBP A;  3M0U A;  1RUW A;  1M27 C;  3VRY A;  2HDA A;  1OPL A;  2AKK A;  2GBQ A;  1WYX A;  2A37 A;  3KFV A;  1YWP A;  4F16 A;  2CRE A;  2KR3 A;  4D8D A;  2M0Y A;  3ZL7 C;  2DMO A;  2DF6 A;  2EVR A;  1VYU A;  3EG1 A;  1HJD A;  2DBK A;  3PVQ A;  2QDL A;  3H0F A;  2EW3 A;  2DX1 A;  1UEC A;  1JEG A;  2NUZ A;  4AFZ C;  3I5S A;  2FRW A;  1XOV A;  2VKN A;  3NMZ C;  1GCQ C;  1PNJ A;  2LMJ A;  2KT1 A;  2FRY A;  2CUB A;  4J9F A;  1G83 A;  2KBT A;  1MUZ A;  1JXO A;  1KIK A;  1GBR A;  2KRS A;  1OOT A;  1AVZ C;  3H41 A;  3I5R A;  1GFD A;  3VS1 A;  4F14 A;  1RLP C;  1NLP C;  4ORZ A;  4WCI A;  3O5Z A;  2RQU A;  1VYT A;  2W10 A;  4K11 A;  3VS6 A;  3NHN A;  1QCF A;  2KT8 A;  1YWO A;  2KYB A;  1E7O A;  3NGP A;  4JJC A;  4KRT A;  1Z9Q A;  1TUD A;  2FG0 A;  2O2O A;  1WDX A;  2C0I A;  2CSQ A;  4OMM A;  2MCN A;  1YN8 A;  2L3Q A;  2MIO A;  4AG2 C;  3VS0 A;  1ZUK A;  1I07 A;  4J9H A;  4J9B A;  2DRM A;  3SEM A;  1H92 A;  4RUG A;  2EGA A;  2LQW A;  1J3T A;  2GTJ A;  3QWY A;  5IHI A;  1U3O A;  2A08 A;  4RTX A;  4RTV A;  2EYX A;  1NG2 A;  1NEB A;  1MV0 B;  5FW9 A;  3TSW A;  5IXB A;  1X2Q A;  1IO6 A;  2DM1 A;  2X3W D;  2JTE A;  3EG2 A;  1UTI A;  2SEM A;  2FPF A;  4M4Z A;  1I1J A;  2DJQ A;  2W0Z A;  2EKH A;  4EIK A;  2OAW A;  1ZX6 A;  2LQN A;  2GQI A;  2DYB A;  2DL5 A;  2A28 A;  2EQI A;  2GTO A;  1ZLM A;  3THK A;  3RBB B;  4AFU C;  4AFS C;  2BZY A;  3UF4 A;  2L3S A;  1WFW A;  3I9Q A;  2D1X A;  1NEG A;  1NYF A;  1SRM A;  2ROL A;  2O88 A;  1UFF A;  3H0H A;  5HCK A;  4LUE A;  1ABQ A;  1W1F A;  4JZ3 A;  4JZ4 A;  2JM9 A;  4IIO A;  1PHT A;  1M3B A;  4J9C A;  2FO0 A;  5GJW B;  1X27 A;  1W6X A;  1GL5 A;  2LNH B;  1RLQ C;  3TSZ A;  3REA B;  1RI9 A;  1EFN A;  1ABO A;  2B86 A;  2AZS A;  2CT4 A;  1UDL A;  2KYM A;  2HBW A;  1NLO C;  2F2W A;  1GFC A;  2V1R A;  3FJ5 A;  3ULR B;  1BB9 A;  2M51 A;  1CSK A;  2DIL A;  4CC4 B;  2H8H A;  3M0Q A;  2I0N A;  4OMN A;  1V1C A;  2CUD A;  1B07 A;  2ABL A;  2DNU A;  2YUQ A;  2V1Q A;  4HXJ A;  4JPB W;  1SPK A;  1M30 A;  2CT3 A;  5ECA A;  5IXF A;  3R6N A;  1CKB A;  4RTZ A;  2OJ2 A;  2LJ3 A;  2J6F A;  1GRI A;  1T0J A;  4GBQ A;  4Z88 A;  4CC3 A;  2K2M A;  2LCS A;  2O9V A;  4ZNX A;  2KE9 A;  3M0T A;  1AEY A;  2LX7 A;  2KGT A;  1ZUU A;  1AWX A;  3NPF A;  1YNZ A;  2RPN A;  1ZBJ A;  1S1N A;  2AKL A;  2D8J A;  1AZE A;  2YDL A;  4LNP A;  1WLP B;  1JU5 C; 
#chains in the Genus database with same CATH topology
 2OI3 A;  2NUP A;  2RJE A;  4HCK A;  3CCS T;  4OB1 B;  4II1 A;  1X6O A;  2XMF A;  4OB2 B;  1KSW A;  1K73 C;  5A0D A;  1YIJ A;  2KNB B;  2HL5 C;  1X6G A;  1K73 R;  2JTM A;  3I56 Q;  1SEM A;  3VS4 A;  4C92 B;  2DIG A;  4A54 A;  2NWM A;  2RN8 A;  4D8K A;  1S72 T;  5HK3 A;  4M7D A;  4A4G A;  1MHN A;  1YJN Q;  1VQ9 A;  1UEB A;  1UG1 A;  4DEX A;  1VQP Q;  2YUN A;  3I55 Q;  4CC7 A;  5CCA A;  1JQQ A;  4J9G A;  1JBM A;  1P92 A;  1VQ7 A;  1XQH A;  1UJY A;  2CZ6 B;  4M7A E;  4LXC A;  2J05 A;  5CIU A;  2LJ0 A;  3J80 E;  2D0Q B;  3X20 B;  4OML A;  2NUT A;  5LJ3 h;  2QG9 B;  1YIJ T;  2JVV A;  1ZSG A;  1QVF A;  1PCX A;  1OI1 A;  3A8G B;  4M78 A;  1R0C B;  2MAM A;  2K3B A;  5GAO n;  3VS3 A;  3S3O A;  1VQK T;  2M02 A;  3CD6 A;  4MZM A;  5LJ5 d;  3V8L A;  4OMQ A;  1BK2 A;  3JCM d;  2RQT A;  1Y57 A;  3EFO B;  2KAF A;  3TVT A;  2COW A;  4J5Y A;  1V76 A;  2VWF A;  4M78 E;  4IIM A;  3GBQ A;  3PMI A;  4M77 C;  1OPK A;  2CH4 A;  2PVG B;  2DL7 A;  2F2X A;  2RHI A;  1ZUY A;  5KYU A;  2DA9 A;  2YT6 A;  2ZPB B;  2KRN A;  3CXC P;  1D1C A;  4OMO A;  1XNI A;  3RNJ A;  1AZG B;  3UT1 A;  2Z0W A;  3QZ5 B;  3I55 T;  2J06 A;  1Z9Z A;  1CKA A;  5CKH A;  2C0T A;  2O9S A;  5KYX A;  3OSS C;  2ZPI B;  2OAU A;  3BY7 A;  1X69 A;  1G3S A;  2Y4X A;  1XTD A;  1G3T A;  2ED0 A;  2EQJ A;  1WHJ A;  3DLM A;  3M55 A;  2RQR A;  2P0K A;  3G1J A;  4V2S A;  1VQO A;  1UJ0 A;  2L89 A;  2DRK A;  4AG1 C;  3OW2 S;  5L23 A;  1M2V A;  2D8H A;  1Q81 U;  2HZY A;  3QSU A;  2ESW A;  2E1H A;  2M9U A;  5KYU B;  4JJD A;  1ZQ1 A;  4MML A;  3M58 A;  4X1V A;  2FZC B;  3CME T;  4E7S A;  2PZ1 A;  4M78 C;  3CCR T;  1AWO A;  2KVQ G;  1B7T A;  2HCK A;  4N0A A;  2K9G A;  4EMK A;  3I56 A;  2PVO B;  4M78 B;  1K9M R;  3S6W A;  2WSF E;  2K6D A;  2F2V A;  1TH7 A;  1JXM A;  2BUD A;  2HEQ A;  2XK0 A;  4XQ3 A;  3SWN A;  3L2W A;  2RMO A;  2RM4 A;  1KG1 A;  1G3W A;  1R8O B;  1UUE A;  2QQS A;  3CCQ T;  4RTY A;  2OTJ A;  1K1Z A;  1MGQ A;  1YFN A;  2AIR B;  4M77 A;  1C1A A;  4HVU A;  4BB7 A;  5FU6 C;  1I4K 1;  1PKS A;  1U5S A;  2YSQ A;  4KUI A;  5LJ5 e;  1I0C A;  1WX6 A;  2EGE A;  1ZSZ C;  4R56 A;  1WHK A;  2L5Q A;  4R55 A;  3FB9 A;  2HDA A;  3CCU Q;  2H3E B;  2BIV A;  5LJ5 h;  3CCR Q;  4F16 A;  2KR3 A;  5GAO q;  2M0Y A;  2YRV A;  2MPX C;  3A8L B;  2DBK A;  5GAM g;  2E3I A;  1KK7 A;  3MEA A;  2NUZ A;  4PJO D;  1YJ9 A;  4AFZ C;  3I5S A;  1YCY A;  2FRW A;  2FHD A;  3NMZ C;  3GNF B;  3E2U A;  3L2V A;  1VQK A;  1IZ6 A;  3OYD A;  4J9F A;  4NOY A;  2LDM A;  2KBT A;  3P8B B;  1MUZ A;  2BE7 D;  3G4S A;  2QGF B;  1OOT A;  1AVZ C;  4XTV A;  4LDX A;  3FRN A;  2E10 A;  4WCI A;  4PFO A;  2Y90 A;  3QO3 A;  2MWO A;  3O5Z A;  2RQU A;  1VYT A;  2VYT A;  3VS6 A;  2RH2 A;  3FC3 A;  3CCL A;  4M7A F;  4FL6 A;  3CCM T;  4KRT A;  3T9N A;  4EMH A;  3A5Z B;  2QGG A;  1FWZ A;  1WDX A;  2VUB A;  3O8V A;  3OA6 A;  1VQM T;  5C6S A;  2LX9 A;  1QCN A;  2MIO A;  4X9C A;  2DYI A;  4J9H A;  4FCY A;  2CP6 A;  1J3T A;  3FLG A;  4EMK B;  4ME7 A;  4RTX A;  3CC2 T;  2EQK A;  1M90 U;  1MV0 B;  5GAN 4;  5FW9 A;  1X2Q A;  1IO6 A;  1TS9 A;  2SEM A;  4C0G A;  3V8K A;  1M5Q 1;  2W0Z A;  3H8Z A;  1ZX6 A;  1RAC B;  1Y71 A;  3DLL A;  5GAO r;  3M4G A;  1K8A C;  4MZP A;  4ZN3 A;  1FMV A;  4QKU A;  2FYK A;  2BZY A;  3UF4 A;  5KE3 A;  4HT9 A;  1SKU B;  2M0O A;  1WFW A;  3I9Q A;  1VQ5 T;  2ROL A;  3MEU A;  5I2M A;  2LCC A;  2HD0 A;  4JZ4 A;  4PLI A;  3RES A;  1N6A A;  4IIO A;  5GJW B;  3CCE A;  4HCB A;  4M75 A;  4HA8 A;  5CAI A;  1MMD A;  1RLQ C;  2XD0 A;  1EFN A;  1VQ7 T;  4BE2 A;  1UDL A;  2KYM A;  2HBW A;  2HQE A;  4C8Q C;  1NLO C;  4B9W A;  4PFZ A;  5GAN 8;  3FJ5 A;  3OS0 A;  1MMA A;  3ULR B;  1BB9 A;  3CXC A;  1RAE B;  2H8H A;  4L59 A;  1KHI A;  1M2V B;  5GMK m;  1D3B B;  1V1C A;  3MKD A;  2DNU A;  1OU9 A;  4HXJ A;  2CZ1 B;  4XU3 A;  1SPK A;  5ECA A;  4M75 B;  1BI0 A;  2EKO A;  4RTZ A;  4RMO A;  3RR6 A;  4FYW B;  4QVC A;  1BYM A;  4JRP A;  3M5A A;  1X01 A;  4C8Q A;  4E7Z A;  5GAN f;  4ZNX A;  5KCH A;  2KE9 A;  3V7R A;  3PNW C;  4ZGJ B;  3NPF A;  3QUI A;  2RPN A;  1TSF A;  1ZBJ A;  4FT4 A;  2HQH A;  2AKL A;  2D8J A;  1TWB A;  5IN1 A;  2I2L A;  1VQK Q;  2YDL A;  2YUO A;  2E3H A;  1RAI B;  4LD9 K;  2EIF A;  2WSC E;  3M0S A;  3JCM f;  1QVF P;  1X2K A;  1YJ9 T;  4UC4 A;  2E5K A;  2DTO A;  2HSP A;  2JT4 A;  5I21 A;  4GLM A;  3FIF A;  1BIB A;  4MZT A;  1E6H A;  3FEO A;  5AYF A;  1MV3 A;  7AT1 B;  1QKW A;  3CCM A;  2QDY B;  4LUD A;  1WHH A;  2ED1 A;  1ZA2 B;  2KXC A;  2QA4 Q;  1VQN T;  1D0X A;  3KUF A;  3QBY A;  2O4X A;  5LJ3 g;  2EWN A;  4ANJ A;  1QLY A;  4J9E A;  1QVF S;  4A63 B;  2K57 A;  1PWT A;  2DBM A;  2V26 A;  2J6K A;  4M75 F;  2GQV A;  1NM7 A;  2VGM A;  3HP9 A;  2AT1 B;  3JAM E;  2P0Q A;  1YJ9 Q;  3CPW A;  1QWE A;  3TU4 K;  1M8M A;  3E9G A;  2D0N A;  2VB6 A;  3L1A A;  1LCK A;  2K3X A;  4OF1 A;  3CQT A;  5DM7 R;  4F7U B;  1YIT T;  2FPE A;  4J6X A;  1Q81 C;  3OYA A;  4PJO A;  2JS2 A;  1VQL T;  3JSC A;  3AT1 B;  1BBZ A;  1H3H A;  3OYE A;  4JLI A;  2LJ1 A;  1MND A;  3CCV A;  3NTK A;  4C92 E;  2JTF A;  3CC2 A;  4O5V A;  1TG0 A;  3PMT A;  3FJP A;  3CCR A;  1Q86 R;  2AZV A;  3EGX A;  1S72 Q;  2E5Q A;  1UGP B;  5FWB A;  4NL2 A;  2ROT A;  1O75 A;  4DA4 A;  3JB9 G;  4PLL A;  1V29 B;  4A4K A;  2EYW A;  3FDR A;  1SRL A;  2EQU A;  4J9I A;  4BY6 B;  5GAM f;  2D6F A;  3DKM A;  4JLG A;  5DLO A;  3NFC A;  1Q95 G;  3H0I A;  3VRZ A;  3R6O A;  1KFZ A;  3JCM W;  2ZPG B;  1U1T A;  1LNX A;  2X3X D;  2L0A A;  3X24 B;  1K76 A;  1U8R A;  1Q86 C;  1R0B G;  5GJV B;  2GF7 A;  1NPR A;  3A8H B;  5A2Q E;  3EG0 A;  1K73 U;  1IRX A;  5GMK h;  3CME A;  2QK0 A;  2A36 A;  5DLQ E;  3MPU B;  3TQ7 P;  2RF0 A;  5KE2 A;  4ELY C;  4JJB A;  4DOW A;  1Q81 R;  4QVZ A;  2YLC A;  1Q7Y C;  1I8F A;  2EGC A;  1M1K C;  1R77 A;  1RAD B;  3EGD A;  2LNV A;  5IHK A;  4XU0 A;  4GLK A;  2AK5 A;  4IUU A;  4F7U E;  4BE0 A;  5CKF A;  2HQX A;  2C0O A;  1E6G A;  1UHC A;  1QP2 A;  3CC7 A;  3A98 A;  3P8D A;  1M3A A;  3OYM A;  1JO8 A;  3CMA A;  3MEV A;  4BE1 A;  1QVG S;  3VS7 A;  3EFR A;  4J6Y A;  1WI7 A;  2DXU A;  3GIB A;  4M77 E;  2DZC A;  3HFN A;  4CC2 A;  2LP5 A;  1PSE A;  2LRQ A;  4CI0 C;  2DPP B;  2YHT A;  3S3N A;  4M77 G;  4JRK A;  3EHR A;  2PTK A;  1FX7 A;  5KCO A;  4C5G A;  1I81 A;  1YJN A;  4R0K A;  3ASK A;  5GMK l;  3EFS A;  2A3L A;  4M75 C;  2RK2 A;  3EH1 A;  1KC8 C;  5CO7 A;  4DOV A;  1M3C A;  1AHJ B;  4YTL A;  2JUF A;  3EH2 A;  4C5E A;  5C0M A;  3SB2 A;  1G5V A;  2EPD A;  3OW2 A;  3J7A F;  1OX8 A;  1WQ7 A;  3OS1 A;  4A53 A;  2ZAE A;  2RHY A;  5LJ5 g;  2IG0 A;  3HL8 A;  3UPU A;  4C8Q B;  1NZ9 A;  1OX9 A;  4AFQ C;  3CCU A;  5KH6 A;  1WIE A;  2DXT A;  3OW2 P;  1UB4 A;  1QW1 A;  1AOJ A;  3M9Q A;  2FB7 A;  1K4U S;  2BTT A;  1LOJ A;  2PNI A;  3L2Z A;  1X6B A;  2V8I A;  1M27 C;  2OTJ T;  4E7L A;  3GF5 A;  4BY6 C;  1WYX A;  4IUR A;  1D3B A;  3KFV A;  3ME9 A;  2CRE A;  5D6Y A;  2EYQ A;  3J81 E;  1M9S A;  3ZL7 C;  3TRE A;  3CME Q;  1SG5 A;  2DF6 A;  3HTR A;  2E41 A;  2DD5 A;  4JJN K;  1VYU A;  2OTL A;  1YJN T;  1IHW A;  3PFS A;  3H0F A;  2XHC A;  2EJ9 A;  3QZ9 B;  2DO3 A;  2DX1 A;  1NJI U;  4DQ2 A;  1UEC A;  2XG8 D;  1ZBX A;  2OX7 A;  1Y96 A;  1JEG A;  3QHS A;  1G8X A;  2PUO B;  3V7S A;  8ATC B;  3CCS A;  2GCX A;  1BI2 A;  2LMJ A;  2DZ9 A;  3G71 Q;  3QXE B;  2KT1 A;  1RAB B;  1OUL A;  3LWI A;  2E70 A;  1G83 A;  5FLX E;  4PK4 A;  2KRS A;  2CP3 A;  4JUV A;  4EMK C;  4M75 E;  3GLX A;  2CP0 A;  1NLP C;  1RL2 A;  2QAZ A;  2WAC A;  3D7S B;  2XDD A;  1W4S A;  1YI2 Q;  3RKX A;  2KYB A;  4HCZ A;  1PC0 A;  1VQ4 A;  1QQJ A;  3X28 B;  2HBP A;  1Z9Q A;  3G6E A;  1TUD A;  2JOY A;  2DJZ A;  4AMC A;  2C0I A;  2CSQ A;  1WHM A;  2MCN A;  2QXF A;  3QJ6 A;  2L3Q A;  1D09 B;  4M78 F;  2DET A;  1IGU A;  1ZUK A;  3C12 A;  1ZHI A;  4AT1 B;  2QQR A;  2YWW A;  2QTX A;  1YHQ T;  2X51 A;  4KUL A;  2DRM A;  2WSE E;  1H92 A;  4JS5 A;  4RUG A;  2EGA A;  3G71 T;  1UGQ B;  1U3O A;  4RTV A;  4FYY B;  1I5L A;  1M1K R;  4KGZ B;  4C92 G;  1VQ6 T;  2DTH A;  4C5I A;  4OGC A;  2DM1 A;  2JTE A;  1BKB A;  2FPF A;  2LC4 A;  4M4Z A;  1OU8 A;  2YLB A;  1KQS A;  2EKH A;  3QPH A;  2DER A;  2OAW A;  3GNG A;  2DYB A;  3TEE A;  2QEX A;  1Q82 U;  1YIJ Q;  3THK A;  3BDL A;  3RBB B;  1NJI R;  1M90 C;  1VQ4 Q;  1D1A A;  1M1G A;  4KBM B;  1VQ8 T;  2NYS A;  4C0F A;  4N4G A;  1NYF A;  2DK3 A;  1B34 B;  4EPC A;  3OYI A;  5HCK A;  4LUE A;  2QA4 T;  1VQN Q;  1W1F A;  3CPW P;  4PJO B;  1WHL A;  1YHQ Q;  1M3B A;  3RKW A;  4OB0 B;  1W6X A;  2LNH B;  4XU1 A;  3JCM g;  3G4S T;  1RI9 A;  3G71 A;  1OYX A;  1C0M A;  1VQ8 A;  1UGS B;  3DB3 A;  3RER A;  2GFA A;  2V1R A;  2EJG A;  3BDU A;  2QI2 A;  2M51 A;  5CKB A;  3UWN A;  2DIL A;  4CC4 B;  3M0Q A;  2I0N A;  1TOV A;  2HAX A;  1RAF B;  2CUD A;  2K3Y A;  1KQ2 A;  3QDF A;  3CCU T;  1GXI E;  3NTH A;  2V1Q A;  2HNI A;  3CBP A;  4JPB W;  4KGX B;  1M30 A;  2CT3 A;  5IXF A;  4WF2 A;  3R6N A;  1VQ4 T;  5GMK j;  2A0F B;  3VKI A;  1KQS S;  4M75 D;  3CC7 T;  3JCM J;  4GBQ A;  4Z88 A;  4L6V 5;  5GAN e;  2M16 A;  2KY9 A;  4E7K A;  4XTZ A;  3CCQ Q;  3JB9 H;  2LCS A;  2O9V A;  4QQD A;  4NL3 A;  1KD1 R;  3M0T A;  5LL6 S;  4XK8 E;  1YNZ A;  3WXM B;  2RI5 A;  1YHQ A;  2EQM A;  2BE9 B;  2ZPH B;  1AZE A;  1N9S A;  1WXB A;  2L2P A;  3NTI A;  1W70 A;  1ARK A;  4PNO A;  1FMW A;  2RNA A;  4BI4 A;  3EHQ A;  2DFU A;  2HSE B;  3I35 A;  5HKC A;  2KSS A;  2R5M A;  1UGR B;  1WXT A;  3EG3 A;  1EIF A;  1LVK A;  2CSI A;  4ZGE B;  1B3Q A;  3ER0 A;  3RUX A;  3M57 A;  2KXD A;  2KRO A;  2YXY A;  1QVP A;  2FPD A;  2BKD N;  2PUK B;  4JDS A;  1EZZ B;  1VIF A;  1BI1 A;  3TCJ A;  2LT4 A;  4GY5 A;  2Y4Y A;  3I56 T;  3OMC A;  2LZ6 B;  3VS5 A;  3UAT A;  3QWX X;  3JCM c;  3LGF A;  5DY9 A;  1HD3 A;  3MO8 A;  4FYX B;  2D9T A;  1WZO A;  1ACM B;  1NBE B;  4XTY A;  3WVD B;  1VQM Q;  5KYX B;  2DL4 A;  5IHN A;  2MI6 A;  1QWF A;  5LJ3 j;  3GP8 A;  4FU6 A;  2CDT A;  1N8R C;  3HSB A;  2E12 A;  3JCM b;  1H8K A;  3CCE Q;  1N27 A;  3EGD B;  2ZZD A;  3CCL Q;  4XTW A;  3WVE B;  4C8Q G;  2DIQ A;  4J8O A;  2AHJ B;  4ELZ C;  4RTW A;  1M2O A;  3JCM h;  3I55 A;  3QDR B;  3HKS A;  3VYG A;  2VGN A;  5LJ3 f;  1Q86 U;  1YJW A;  1WPY A;  1NPP A;  2QAS A;  3L42 A;  3OMG A;  2DEQ A;  3PT9 A;  2K79 A;  4HVV A;  1K9A A;  1VYV A;  1ZSZ B;  1SF9 A;  3MCA B;  4RKU E;  5FRM A;  1K9M C;  4M7A B;  4F17 A;  3ZBD A;  1M1K U;  1MNE A;  1O9S A;  3OYY A;  3HRT A;  2X9H A;  4M7A G;  1VQL A;  3PIO A;  4IUV A;  2KQW A;  1EX4 A;  1N5Z A;  4C92 D;  5GAO p;  1QMC A;  4Z8A A;  1TUC A;  2FZK B;  2CP2 A;  1RAA B;  4RCC A;  1DJ7 B;  4FW2 A;  3E19 A;  2XI9 A;  2XKO C;  4EMG A;  2EYZ A;  3C0C A;  3BFM A;  2RQW A;  4ZTF A;  1BU1 A;  1X43 A;  4A4E A;  3M56 A;  1YJW Q;  4C0D B;  4ATO A;  4PJJ A;  4BD3 A;  4PL6 A;  1PKT A;  4PKC C;  1NYG A;  2OTL T;  3UA7 A;  3PVL A;  3REB B;  3H6Z A;  1SHF A;  1WHG A;  1WA7 A;  1AWJ A;  4L5G A;  1FXX A;  3M54 A;  1SSH A;  3C4S A;  2X4W A;  1N9R A;  2DTI A;  2P4R A;  4FYV B;  1GCQ A;  1VQP A;  1WQW A;  5CK9 A;  3AHU A;  5HK0 A;  1K0X A;  1HSQ A;  5I11 A;  3CBM A;  3LX7 A;  1AD5 A;  4FM4 B;  3H9N A;  2R57 A;  1FYN A;  5FWC A;  1KQS P;  1UGV A;  4RTT A;  3RKY A;  3KXT A;  2PQW A;  3L2U A;  3MP6 A;  2DLP A;  3CC2 Q;  1Y96 B;  2QYZ A;  2RJF A;  3UA6 A;  4M7D C;  5A0G A;  3OYH A;  4OGE A;  1QVG P;  2ZGW A;  4LE9 A;  4IUP A;  2OTL Q;  4J7I A;  1WJQ A;  2JMC A;  2RQV A;  4E6R A;  4QQG A;  1H64 1;  2O4X B;  1I5O B;  1JRI A;  4Y92 A;  4DEY A;  2J7I A;  3VUZ A;  4M77 B;  3CCJ T;  2KRM A;  2JMA A;  3M0P A;  4J7F A;  5LJ5 f;  3JCM X;  2G6F X;  4C92 C;  1KC8 U;  3OS2 A;  4M7A D;  3M0U A;  1RUW A;  1H3Z A;  4EDU A;  2GBQ A;  5KYY B;  3OBY A;  2C06 A;  1BCM A;  2PVD B;  2A37 A;  3M4Y A;  4PFP A;  1YWP A;  2XID A;  3E9F A;  3LH0 A;  5GMK e;  1HXD A;  4BI8 B;  4D8D A;  3RMQ A;  1N8R R;  3CMA T;  1JJ2 P;  1M8V A;  1Q7Y U;  3CCE T;  2EVR A;  4RG8 A;  1HJD A;  3PVQ A;  1MMN A;  2JNG A;  3QYH B;  2P84 A;  1OZ2 A;  1NE8 A;  2K5F A;  1XOV A;  2VKN A;  1PG5 B;  4B9X A;  2X4J A;  3OYG A;  5GAO m;  1U1S A;  2YRC A;  2CUB A;  3OYK A;  1W2B A;  4N4H A;  5GAN j;  5GAN d;  1KIK A;  4M7A C;  3L2Q A;  3VU3 C;  3CCL T;  1M90 R;  3I5R A;  2F69 A;  1GFD A;  1NJI C;  3P8H A;  4F14 A;  1VOM A;  4LD6 A;  3OYB A;  3CMA Q;  3CPF A;  1W2B P;  2X35 A;  2W10 A;  1LPL A;  2NLU A;  3NHN A;  1ZA1 B;  4RG2 A;  3VJP A;  3SD4 A;  5IT9 E;  5FU7 C;  5CQY A;  3N5B B;  3CCJ Q;  4DBH A;  2O2O A;  3OY9 A;  1M4Z A;  4BDY A;  1YN8 A;  4JRI A;  4WTO B;  4M7D D;  4QVD A;  3JCM P;  4QQ6 A;  4AG2 C;  3VS0 A;  1VQM A;  1IGQ A;  1I07 A;  4J9B A;  4KUD K;  1PM3 A;  5GAM h;  4MMK A;  5CKE A;  3MHX A;  3V8J A;  2LQW A;  3QWY A;  1Q82 C;  2DKG A;  2YRD A;  2A08 A;  4C8Q D;  2R5A A;  1SSF A;  2E64 A;  3EFO A;  5IXB A;  1VQ6 Q;  1VQ6 A;  4IUQ A;  3EG9 A;  1UTI A;  4P5N A;  1I1J A;  3OQ5 A;  2G3R A;  1BIA A;  2GQI A;  2A28 A;  2DXC A;  2DXB A;  1WNL A;  4C92 A;  3RIR A;  1C6V X;  3G6E T;  4HT8 A;  3CXC S;  6AT1 B;  2NUT B;  1YI2 A;  1AT1 B;  3LLR A;  3RMS A;  1SRM A;  2ZPF B;  1KHC A;  2CS7 A;  1UFF A;  5GAM j;  2KDS A;  4JZ3 A;  4E47 A;  2LTO A;  2JM9 A;  2R58 A;  1PHT A;  4J9C A;  3JB9 J;  3TSZ A;  2RK1 A;  4E7H A;  1VQ5 A;  3E1S A;  3PIP A;  3CCS Q;  2F2W A;  2HL3 A;  4FT2 A;  1VQ8 Q;  1PD0 A;  1KD1 C;  3VYH B;  3M53 A;  5HY6 A;  2IPO B;  4KT0 E;  3CPW S;  4OMN A;  1B07 A;  2ABL A;  3CCJ A;  5A0L A;  2V8J A;  4C0D C;  5GAN h;  2RJC A;  1CKB A;  3F70 A;  2OJ2 A;  1D0Z A;  5KYW B;  3EG9 B;  2CGH A;  3OYJ A;  2MYS A;  3BW1 A;  3MET A;  3EGX B;  3JRZ A;  2QA4 A;  2X4Y A;  1OZ3 A;  4FIB A;  1AWX A;  4M75 G;  2E4H A;  2JZ2 A;  2F1L A;  3A1P A;  3CCM Q;  1S1N A;  2K4Y A;  2OTJ Q;  3HPW A;  4O6J A;  4F7U A;  3PE0 A;  3OBW A;  4HVW A;  1PRM C;  5CVI A;  5EG2 A;  1FMK A;  1JJ2 S;  4OP0 A;  3RDV A;  2K5I A;  2IIM A;  3VUB A;  2K7A A;  2YUP A;  1WGS A;  2KMT A;  2HKQ B;  3HFO A;  2LT1 A;  5KYN A;  1T3L A;  5EC7 A;  3M59 A;  4FSS A;  3HRS A;  3JB9 F;  2MOX A;  4DBF A;  3CD6 Q;  4C5H A;  1F1B B;  1YBY A;  2RO0 A;  1TXQ A;  2O31 A;  1QKX A;  4RTU A;  3OSV A;  2E6N A;  2BZ8 A;  5LJ3 d;  3SHW A;  3C95 A;  3SWN B;  4MDX A;  3SFM A;  1UHF A;  3DB4 A;  4NS5 A;  2EJF A;  2RJD A;  4OMP A;  2CP7 A;  2ECZ A;  1VQ5 Q;  2F5K A;  3VS2 A;  1IXD A;  2JN0 A;  1Y7X A;  1VUB A;  3CCV T;  2MF2 A;  3LH5 A;  3A8O B;  3QG1 A;  2L3P A;  2MMP A;  4BI3 A;  1VQ7 Q;  2GFU A;  2DEU A;  2XDP A;  1K9M U;  2RI3 A;  1YP5 A;  4X9D A;  3JCM V;  3JB9 D;  1PD1 A;  4M78 D;  5IAY A;  2QEX T;  1A0N B;  3CEY A;  3KBG A;  4M78 G;  2JM8 A;  4Y91 A;  1W2B S;  4HCC A;  5D6X A;  2MWP A;  5I22 A;  2E6Z A;  4OVA A;  1VQO Q;  3EGU A;  4LDU A;  5J39 A;  2VXE A;  2L3R A;  4QT7 A;  4FW1 A;  4C92 F;  5FRO A;  4DBR A;  2KEA A;  4XTX A;  5GAN 3;  3C94 A;  4F7U F;  4LN2 A;  2GGR A;  2RHZ A;  4FSX A;  2K2V A;  2DL3 A;  2J6O A;  2M1H A;  1UE9 A;  2GNC A;  5AT1 B;  2DL8 A;  2MK5 A;  2CH4 W;  2BZX A;  2EYY A;  1TTH B;  1U06 A;  1WXU A;  9ATC B;  1OV3 A;  3MP1 A;  1VQ9 T;  2QTV A;  5GAO l;  2JJ9 A;  4ZTJ A;  1QP3 A;  2JXB A;  2CYZ B;  5CR2 A;  1GBQ A;  1WJR A;  2JS0 A;  3M0R A;  3U23 A;  2RD1 A;  4BAC A;  1PSF A;  2LQ8 A;  4ESR A;  4F7U G;  2LCL A;  3GOX A;  2JW4 A;  8AT1 B;  3HHT B;  5GAN g;  1K0S A;  1Q7Y R;  1YCS B;  3JCM Q;  4D6W A;  1N8R U;  3LYI A;  5GAM e;  5GAN 7;  1G2B A;  3LW5 E;  4C8Q F;  5I2S A;  2ENM A;  2XIC A;  1YJW T;  1QCO A;  1Y0M A;  1KJW A;  1VA7 A;  4PJO C;  1IHV A;  1M1F A;  2KI7 A;  4HKE A;  3OYN A;  4J9D A;  1PRL C;  5J26 A;  1OEB A;  2F5T X;  2LVM A;  4KH1 B;  5IH2 A;  3VV0 A;  4OB3 B;  4CRI A;  3EAE A;  2QQA A;  1T0H A;  1BI3 A;  4OMF B;  5GMK i;  1SHG A;  4Q5W A;  1AWW A;  5J3B A;  3JCM e;  3INZ A;  2DAQ A;  3LWH A;  3Q1J A;  4Z89 A;  4PJL A;  1T3S A;  4C8Q E;  3S3M A;  5D6W A;  4LDW A;  2FEI A;  2NUP B;  4LDV A;  3JB9 I;  3JV3 A;  1G3Y A;  2DE0 X;  2VVK A;  3MJX A;  3V7C A;  2SRC A;  3IQL A;  3ZEH A;  1VQ9 Q;  2PU9 B;  3OB9 A;  1TU0 B;  2HKN A;  1GCP A;  2CZ0 B;  2DVJ A;  2EBP A;  3VRY A;  2P0P A;  2V8K A;  1OPL A;  4C0Z A;  2AKK A;  1S72 A;  3BE3 A;  2H3J A;  3GPL A;  2LQK A;  2DMO A;  2DVE A;  2DD4 A;  1IB8 A;  1ZSZ A;  5FU6 B;  3QII A;  5CKD A;  3OYF A;  3EG1 A;  2IVW A;  2KK4 A;  5CQX A;  2QDL A;  4IKF A;  2EW3 A;  2EFI A;  1VIE A;  3OS5 A;  2FL7 A;  4M7A A;  1RI0 A;  1GCQ C;  1BCO A;  1PNJ A;  4X34 A;  3G6E Q;  2ATC B;  2FRY A;  3SWN C;  2HMA A;  1JXO A;  4F04 B;  1GBR A;  1MMG A;  1VQP T;  3H41 A;  4M7D E;  3A8M B;  3VS1 A;  1K8A R;  1RLP C;  5LJ3 e;  4ORZ A;  2VAS A;  2B8A A;  3URG A;  4ZN1 A;  4K11 A;  3CC7 Q;  1QCF A;  2KT8 A;  1YWO A;  3CCV Q;  1E7O A;  3ZFJ A;  3NGP A;  4N4I A;  2RA2 A;  4E2F B;  1XJW B;  4JJC A;  1YI2 T;  4IUT A;  2E65 A;  4A4F A;  4JS4 A;  2RHU A;  3CBO A;  2QEX Q;  2FG0 A;  2VC8 A;  5GAM d;  1HK9 A;  4OMM A;  4XTU A;  1WJS A;  2FVU A;  3CC4 T;  5L8R E;  1TUG B;  5M9O A;  4E7I A;  1X75 C;  4Y28 E;  3CC4 A;  4J6W A;  1IRE B;  4BUG A;  2VXF A;  4XU2 A;  4M7D F;  3SEM A;  3QJY A;  4E7J A;  2GTJ A;  2FZG B;  4M77 D;  5IHI A;  4PJO E;  2CP5 A;  1K8A U;  2CZ7 B;  1D0Y A;  1NG2 A;  2EYX A;  1YIT Q;  4RCB A;  1NEB A;  3QKJ A;  1VQL Q;  4XAX B;  1LJO A;  4A4H A;  2O01 E;  3TSW A;  5FRN A;  4LDY A;  1VQN A;  2X3W D;  5GAN 5;  2XU8 A;  3EG2 A;  3SDZ A;  4ZGD B;  2VV5 A;  3X25 B;  4EIK A;  2DJQ A;  1HYO A;  1RAH B;  2LQN A;  2DL5 A;  1KC8 R;  2EQI A;  2GTO A;  2EAY A;  1ZLM A;  1JJ2 A;  2A7Y A;  2X4X A;  3CD6 T;  2XDB A;  4AFU C;  1JB0 E;  4KH0 B;  1KQ1 A;  4PJO G;  4AFS C;  3OYC A;  4PJO F;  2L3S A;  4M7D G;  3MEW A;  2CKK A;  2COY A;  2COZ A;  2D1X A;  2K5L A;  1NEG A;  4JRQ A;  2QQ9 A;  3CCQ A;  2O88 A;  5LJ5 j;  3H0H A;  1ABQ A;  2P4T A;  3G7Z A;  2FO0 A;  3G4S Q;  1X27 A;  1GL5 A;  4B6M A;  4PJN A;  3REA B;  3L2R A;  1ABO A;  5GAN 2;  3QYG B;  5D7U A;  3HRU A;  2B86 A;  4KGV B;  2AZS A;  1RAG B;  2CT4 A;  1B34 A;  4BDZ A;  5FU7 B;  1GFC A;  3CC4 Q;  5GAN 6;  1Q82 R;  4N0A C;  2RB6 A;  1CSK A;  3LGL A;  4PJM A;  1QVG A;  4DBQ A;  3OYL A;  4M77 F;  5KYY A;  2YUQ A;  5KYW A;  4QW2 A;  4M7D B;  3MP8 A;  2LJ3 A;  2J6F A;  1GRI A;  1T0J A;  4MDW A;  4VUB A;  2ZCF B;  2QQB A;  4Z02 A;  1D1B A;  4TVR A;  1VQO T;  2RI2 A;  4CC3 A;  3X26 B;  2K2M A;  1KD1 U;  1OQK A;  3PGG A;  1YIT A;  1AEY A;  2LX7 A;  4J83 A;  3UDC A;  2KGT A;  1ZUU A;  2ZPE B;  1Y07 A;  2L8D A;  3PTA A;  2RHX A;  4LNP A;  1WLP B;  1JU5 C; 
#chains in the Genus database with same CATH homology
 2YUO A;  1WXB A;  2OI3 A;  3PE0 A;  2L2P A;  3M0S A;  4HVW A;  1PRM C;  4HCK A;  1W70 A;  1ARK A;  1X2K A;  2RNA A;  2E5K A;  3EHQ A;  1FMK A;  2XMF A;  2HSP A;  2JT4 A;  4GLM A;  1KSW A;  1E6H A;  3I35 A;  2IIM A;  2K7A A;  1MV3 A;  2YUP A;  2KNB B;  1QKW A;  1WXT A;  1X6G A;  3EG3 A;  2CSI A;  1B3Q A;  4LUD A;  2ED1 A;  1SEM A;  2KXD A;  2KRO A;  2KXC A;  2FPD A;  3VS4 A;  1T3L A;  5EC7 A;  2NWM A;  2RN8 A;  4D8K A;  4FSS A;  1QLY A;  4J9E A;  2MOX A;  2LZ6 B;  4A63 B;  3VS5 A;  3UAT A;  3QWX X;  1PWT A;  1HD3 A;  2DBM A;  1UG1 A;  2J6K A;  4DEX A;  1NM7 A;  2YUN A;  2O31 A;  1QKX A;  4CC7 A;  4RTU A;  1JQQ A;  4J9G A;  2BZ8 A;  3SHW A;  1QWE A;  1M8M A;  2DL4 A;  1UJY A;  5IHN A;  2D0N A;  1QWF A;  2J05 A;  1LCK A;  1UHF A;  2CDT A;  4OMP A;  3CQT A;  2ECZ A;  2FPE A;  2JS2 A;  3VS2 A;  1BBZ A;  1H3H A;  2LJ0 A;  2LJ1 A;  1H8K A;  3LH5 A;  2L3P A;  4OML A;  1TG0 A;  1ZSG A;  2AZV A;  1YP5 A;  4RTW A;  5FWB A;  2ROT A;  2K3B A;  1A0N B;  3VS3 A;  2EYW A;  1SRL A;  4J9I A;  4HVV A;  2K79 A;  1K9A A;  2JM8 A;  4OMQ A;  1BK2 A;  2RQT A;  1VYV A;  1Y57 A;  3TVT A;  5I22 A;  3EGU A;  2VWF A;  3H0I A;  3VRZ A;  4F17 A;  4IIM A;  4QT7 A;  1KFZ A;  3GBQ A;  2KEA A;  2X3X D;  2L0A A;  4LN2 A;  2GGR A;  1OPK A;  1K76 A;  2CH4 A;  2DL7 A;  5GJV B;  3EG0 A;  1N5Z A;  2DL3 A;  2F2X A;  2J6O A;  1ZUY A;  4Z8A A;  1UE9 A;  1TUC A;  2DA9 A;  2A36 A;  2YT6 A;  2GNC A;  2KRN A;  2DL8 A;  2RF0 A;  4OMO A;  2CH4 W;  2BZX A;  4JJB A;  3RNJ A;  1AZG B;  2EYY A;  1U06 A;  1WXU A;  2EYZ A;  3C0C A;  1OV3 A;  2EGC A;  2J06 A;  2RQW A;  1Z9Z A;  1BU1 A;  1CKA A;  1X43 A;  2C0T A;  2O9S A;  5IHK A;  1X69 A;  2JXB A;  1PKT A;  2AK5 A;  2ED0 A;  1GBQ A;  2JS0 A;  3M0R A;  1NYG A;  3U23 A;  2C0O A;  3UA7 A;  2RQR A;  1E6G A;  1UHC A;  3PVL A;  3REB B;  4ESR A;  1SHF A;  3A98 A;  2JW4 A;  1WA7 A;  1M3A A;  1AWJ A;  1UJ0 A;  1JO8 A;  1SSH A;  1K0S A;  2P4R A;  1YCS B;  2DRK A;  1GCQ A;  3VS7 A;  4AG1 C;  1K0X A;  1HSQ A;  1WI7 A;  5L23 A;  5I11 A;  2D8H A;  1AD5 A;  1G2B A;  2ESW A;  4CC2 A;  2LP5 A;  2ENM A;  1Y0M A;  4JJD A;  1KJW A;  1VA7 A;  4X1V A;  1FYN A;  4J9D A;  1PRL C;  3EHR A;  5FWC A;  2PTK A;  1OEB A;  5IH2 A;  1UGV A;  4RTT A;  2PZ1 A;  4R0K A;  2DLP A;  1AWO A;  1T0H A;  3UA6 A;  2HCK A;  2K9G A;  1SHG A;  1AWW A;  4LE9 A;  2K6D A;  2F2V A;  1M3C A;  2JMC A;  2RQV A;  4E6R A;  4Z89 A;  1JXM A;  2HEQ A;  2EPD A;  1T3S A;  4Y92 A;  4DEY A;  2RMO A;  2FEI A;  2J7I A;  1UUE A;  4RTY A;  3JV3 A;  4AFQ C;  1K1Z A;  1WIE A;  2KRM A;  2DE0 X;  2VVK A;  2JMA A;  3M0P A;  4HVU A;  2G6F X;  2SRC A;  3IQL A;  1AOJ A;  1PKS A;  1K4U S;  1U5S A;  2BTT A;  2YSQ A;  1GCP A;  1I0C A;  2PNI A;  1WX6 A;  2EGE A;  1X6B A;  2DVJ A;  2EBP A;  3M0U A;  1RUW A;  1M27 C;  3VRY A;  2HDA A;  1OPL A;  2AKK A;  2GBQ A;  1WYX A;  2A37 A;  3KFV A;  1YWP A;  4F16 A;  2CRE A;  2KR3 A;  4D8D A;  2M0Y A;  3ZL7 C;  2DMO A;  2DF6 A;  2EVR A;  1VYU A;  3EG1 A;  1HJD A;  2DBK A;  3PVQ A;  2QDL A;  3H0F A;  2EW3 A;  2DX1 A;  1UEC A;  1JEG A;  2NUZ A;  4AFZ C;  3I5S A;  2FRW A;  1XOV A;  2VKN A;  3NMZ C;  1GCQ C;  1PNJ A;  2LMJ A;  2KT1 A;  2FRY A;  2CUB A;  4J9F A;  1G83 A;  2KBT A;  1MUZ A;  1JXO A;  1KIK A;  1GBR A;  2KRS A;  1OOT A;  1AVZ C;  3H41 A;  3I5R A;  1GFD A;  3VS1 A;  4F14 A;  1RLP C;  1NLP C;  4ORZ A;  4WCI A;  3O5Z A;  2RQU A;  1VYT A;  2W10 A;  4K11 A;  3VS6 A;  3NHN A;  1QCF A;  2KT8 A;  1YWO A;  2KYB A;  1E7O A;  3NGP A;  4JJC A;  4KRT A;  1Z9Q A;  1TUD A;  2FG0 A;  2O2O A;  1WDX A;  2C0I A;  2CSQ A;  4OMM A;  2MCN A;  1YN8 A;  2L3Q A;  2MIO A;  4AG2 C;  3VS0 A;  1ZUK A;  1I07 A;  4J9H A;  4J9B A;  2DRM A;  3SEM A;  1H92 A;  4RUG A;  2EGA A;  2LQW A;  1J3T A;  2GTJ A;  3QWY A;  5IHI A;  1U3O A;  2A08 A;  4RTX A;  4RTV A;  2EYX A;  1NG2 A;  1NEB A;  1MV0 B;  5FW9 A;  3TSW A;  5IXB A;  1X2Q A;  1IO6 A;  2DM1 A;  2X3W D;  2JTE A;  3EG2 A;  1UTI A;  2SEM A;  2FPF A;  4M4Z A;  1I1J A;  2DJQ A;  2W0Z A;  2EKH A;  4EIK A;  2OAW A;  1ZX6 A;  2LQN A;  2GQI A;  2DYB A;  2DL5 A;  2A28 A;  2EQI A;  2GTO A;  1ZLM A;  3THK A;  3RBB B;  4AFU C;  4AFS C;  2BZY A;  3UF4 A;  2L3S A;  1WFW A;  3I9Q A;  2D1X A;  1NEG A;  1NYF A;  1SRM A;  2ROL A;  2O88 A;  1UFF A;  3H0H A;  5HCK A;  4LUE A;  1ABQ A;  1W1F A;  4JZ3 A;  4JZ4 A;  2JM9 A;  4IIO A;  1PHT A;  1M3B A;  4J9C A;  2FO0 A;  5GJW B;  1X27 A;  1W6X A;  1GL5 A;  2LNH B;  1RLQ C;  3TSZ A;  3REA B;  1RI9 A;  1EFN A;  1ABO A;  2B86 A;  2AZS A;  2CT4 A;  1UDL A;  2KYM A;  2HBW A;  1NLO C;  2F2W A;  1GFC A;  2V1R A;  3FJ5 A;  3ULR B;  1BB9 A;  2M51 A;  1CSK A;  2DIL A;  4CC4 B;  2H8H A;  3M0Q A;  2I0N A;  4OMN A;  1V1C A;  2CUD A;  1B07 A;  2ABL A;  2DNU A;  2YUQ A;  2V1Q A;  4HXJ A;  4JPB W;  1SPK A;  1M30 A;  2CT3 A;  5ECA A;  5IXF A;  3R6N A;  1CKB A;  4RTZ A;  2OJ2 A;  2LJ3 A;  2J6F A;  1GRI A;  1T0J A;  4GBQ A;  4Z88 A;  4CC3 A;  2K2M A;  2LCS A;  2O9V A;  4ZNX A;  2KE9 A;  3M0T A;  1AEY A;  2LX7 A;  2KGT A;  1ZUU A;  1AWX A;  3NPF A;  1YNZ A;  2RPN A;  1ZBJ A;  1S1N A;  2AKL A;  2D8J A;  1AZE A;  2YDL A;  4LNP A;  1WLP B;  1JU5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...