4J9GA

Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p7 at ph7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
b'PNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
molecule tags Transferase/unknown function
source organism Homo sapiens
publication title Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P7
rcsb
total genus 11
structure length 58
sequence length 58
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9gA00
1M3BA 2J6FA 3SHWA 2FPFA 2DRKA 3UA6A 2PTKA 2L3PA 4OMNA 1OOTA 4RTXA 1TUCA 2J6OA 2RPNA 1W70A 3M0PA 1IO6A 3M0TA 2EQIA 3M0RA 4J9HA 2RN8A 3PVLA 1X6BA 2NWMA 2A37A 1VA7A 2BTTA 2GTJA 1BBZA 1UE9A 3PVQA 3H0HA 3EG3A 1GRIA 5FWBA 1OEBA 1X2QA 1PWTA 4LUEA 1PHTA 4CC3A 3VS1A 4E6RA 1X43A 1WIEA 2V1QA 2ESWA 1ZSGA 2CDTA 1T0JA 1UJYA 1WXUA 2W0ZA 4OMQA 3EG2A 1GCQC 2A36A 2GBQA 2YSQA 3R6NA 2YUNA 4LUDA 1ZUYA 2HBWA 1AZGB 2C0IA 3I9QA 1TG0A 1NYGA 4JZ3A 1AD5A 2LZ6B 2AK5A 2DJQA 2EW3A 1PRLC 2DL7A 4RTZA 3UA7A 3PE0A 5IXBA 4AFSC 2EYXA 1SHGA 1WX6A 2O2OA 2RQRA 1FYNA 3I35A 2KXCA 4RUGA 3A98A 3I5RA 2JTEA 1J3TA 1XOVA 1M27C 2X3XD 2CH4W 5EC7A 3VS3A 1WI7A 4HCKA 2DL3A 1K9AA 2LJ0A 1M30A 1U5SA 4EIKA 1YCSB 4J9DA 2ABLA 2DF6A 3JV3A 1AWXA 1SPKA 2C0TA 2CSQA 3M0SA 1CSKA 1VYUA 3I5SA 4RTVA 1NEGA 1UG1A 3EHRA 1YWOA 2A28A 2AKLA 2BZYA 1AWJA 1UGVA 2YUOA 1QCFA 1RI9A 1WXBA 4GLMA 2NUZA 3RNJA 1ABOA 1K0XA 5I22A 2K2MA 4OMMA 1B3QA 2EVRA 2ED0A 2KRSA 2DA9A 2JM9A 2LQNA 2C0OA 2KNBB 3LH5A 3CQTA 2JS2A 1ZLMA 2FG0A 2DX1A 2LMJA 1BU1A 2LNHB 1JQQA 1I1JA 5GJWB 5IH2A 2V1RA 2CREA 1G83A 2KROA 2EKHA 2GTOA 1UTIA 2YUPA 2EGCA 4AFZC 4CC7A 1GCQA 4HVWA 5I11A 2HDAA 2HEQA 1H92A 1TUDA 2DILA 2BZXA 1HJDA 1S1NA 2CH4A 1G2BA 2DMOA 3ZL7C 4FSSA 2KRMA 2PNIA 4ESRA 2RQVA 1UUEA 4J9BA 4JPBW 1OPKA 4CC4B 2QDLA 2EBPA 4RTTA 1W1FA 2EYZA 2D0NA 2M51A 5ECAA 2O9SA 2AKKA 4GBQA 3NPFA 4J9IA 1V1CA 2KT1A 3FJ5A 1E7OA 1E6GA 1RLPC 1UECA 2RNAA 3M0UA 1GCPA 2DVJA 2ENMA 2KGTA 4X1VA 5IHKA 2K6DA 1HSQA 1QWEA 1X2KA 3H0FA 3VS0A 4CC2A 1YWPA 1ABQA 4OMPA 1KSWA 2B86A 2MOXA 3TSWA 4AG2C 2LJ1A 2JT4A 4J9GA 2F2VA 1M3CA 1MV0B 1K0SA 1JXMA 2D8JA 3UATA 1ZX6A 2EGAA 3VS7A 2JM8A 4HVUA 4HVVA 1N5ZA 1VYVA 2CSIA 5FWCA 4IIOA 4K11A 3NHNA 4AG1C 1JXOA 2J6KA 2GQIA 2EYWA 3O5ZA 1MUZA 1T3LA 3QWYA 3C0CA 1UHFA 4D8DA 1WXTA 1PRMC 2DRMA 2SEMA 1K1ZA 1U06A 2DE0X 4RTWA 1QLYA 2BZ8A 3UF4A 3QWXX 1B07A 1VYTA 4DEYA 4AFUC 1OV3A 2MIOA 1KFZA 1SRMA 2DL4A 1E6HA 2VKNA 1SRLA 1KIKA 2KE9A 1QKXA 2GNCA 2JMCA 2EGEA 3H0IA 2LP5A 2H8HA 1WA7A 1M8MA 2PZ1A 1UFFA 4OMOA 2P4RA 2DM1A 3GBQA 2FPDA 2G6FX 3ULRB 4JJDA 4JZ4A 2VVKA 1Z9QA 1ARKA 1W6XA 4R0KA 1X6GA 1PKTA 4LN2A 3KFVA 2KYBA 2KEAA 3TVTA 1WDXA 3EG0A 2DYBA 2DL5A 2OJ2A 3NMZC 2JS0A 2L2PA 1NLOC 2CT4A 2L3SA 1MV3A 2A08A 2JW4A 1I07A 1JU5C 1CKAA 2XMFA 3VS6A 1SSHA 1UDLA 2LJ3A 2DLPA 4RTUA 3REAB 4OMLA 4F14A 1I0CA 2K3BA 1OPLA 3M0QA 4AFQC 5L23A 2KXDA 2SRCA 2KBTA 5IXFA 1AOJA 2FRWA 2IIMA 2RQUA 1PKSA 1WFWA 4LE9A 2FEIA 2DNUA 5FW9A 1FMKA 2EPDA 2F2WA 2AZVA 3THKA 4F16A 4RTYA 2FRYA 2CUBA 2M0YA 1GFDA 2D8HA 4J9EA 1BK2A 4M4ZA 4Z8AA 4Y92A 1T0HA 1ZUKA 4A63B 1AWWA 4JJBA 1Y57A 1CKBA 1SEMA 2EYYA 4Z89A 4DEXA 2KYMA 5IHNA 1Y0MA 4JJCA 2DBMA 3SEMA 1NEBA 3EG1A 4IIMA 2ROLA 2HSPA 2FPEA 2KT8A 3NGPA 1A0NB 4HXJA 1K76A 1LCKA 1ZBJA 1NYFA 1PNJA 2L3QA 2ROTA 2J05A 2JXBA 2K7AA 1H8KA 4QT7A 3VS4A 2O31A 3U23A 2LQWA 2GGRA 1YNZA 3VS2A 4J9CA 3RBBB 3EHQA 2J7IA 1QKWA 1GBQA 1RLQC 2YUQA 5HCKA 2I0NA 2O88A 2OI3A 1YP5A 1EFNA 1AZEA 2HCKA 2KR3A 1M3AA 4Z88A 1KJWA 2DL8A 5GJVB 4KRTA 1X69A 3VS5A 1Z9ZA 5IHIA 1JEGA 2LX7A 1RUWA 1NG2A 2LCSA 1X27A 4J9FA 3IQLA 2K9GA 4D8KA 1T3SA 1QWFA 3REBB 2JMAA 1K4US 2KRNA 2X3WD 1UJ0A 4ORZA 1YN8A 2RQWA 2MCNA 1BB9A 2VWFA 2CT3A 2O9VA 2W10A 2DBKA 4LNPA 3VRZA 2E5KA 2AZSA 1GL5A 2RF0A 2OAWA 1AVZC 2F2XA 1JO8A 4F17A 3EGUA 4ZNXA 1GBRA 1AWOA 2J06A 2D1XA 2L0AA 2RMOA 2RQTA 1ZUUA 1GFCA 1HD3A 2K79A 2YDLA 1U3OA 2ED1A 3H41A 1WYXA 1AEYA 1UHCA 2FO0A 4WCIA 3VRYA 2YT6A 2CUDA 3TSZA 1NLPC 1H3HA 1SHFA 1WLPB 2ECZA 1NM7A
chains in the Genus database with same CATH superfamily
3G4SA 1M3BA 5EG2A 2J6FA 4M7AE 3SHWA 3JCMW 2FPFA 2XG8D 2PTKA 4XU1A 3M0TA 2Z0WA 4J9HA 2VGNA 1QVFS 3OMCA 3E19A 2BTTA 3JCMd 1PG5B 1BBZA 1QVFA 1BIBA 3EG3A 4KGZB 2RHXA 2OTLA 1X2QA 3VV0A 2ATCB 2FB7A 3QBYA 4E6RA 1X43A 1WIEA 1ZSGA 2XICA 4KH0B 1BIAA 2MWOA 3CCLQ 2W0ZA 4DOWA 3CBMA 2A36A 3EGDB 1M2OA 3CC2A 5KYYA 1TG0A 2KSSA 2LZ6B 2DJQA 2EW3A 1PRLC 1YFNA 1R0BG 3LWIA 3META 2NLUA 3QO3A 3UA7A 5IXBA 5GAOl 3PIOA 1K9MR 1KG1A 2KXCA 3ASKA 4IUTA 5GAMf 1M27C 4FSXA 4MZMA 5EC7A 4HCKA 4EMKC 4DBHA 1M30A 1U5SA 3OYDA 1G8XA 1VQNA 1YCSB 1MGQA 4R56A 3FJPA 1VQ4A 3E2UA 2DKGA 1SPKA 2C0TA 2QA4Q 4PJOD 1OX9A 2RK1A 4UC4A 3VU3C 1WJRA 2Y4XA 1AWJA 1UGVA 1QCFA 4N0AA 5GMKi 3G71A 2EQKA 3JCMX 5GAN4 2LNVA 3C4SA 2AT1B 2LQNA 3CQTA 1JRIA 1VQ5A 2LMJA 1BU1A 4MMLA 1W4SA 1BI2A 3CCEA 4HT8A 1YJNQ 3CCMA 5GJWB 4TVRA 2KROA 2DZCA 1QVGA 3WXMB 3HRUA 3JCMh 1UTIA 2YUPA 3P8HA 2QQAA 1GCQA 3C12A 1QVGS 5M9OA 3OYGA 5KYWA 1KC8C 1Q95G 4XTYA 4KUDK 3F70A 2DILA 2BZXA 1IREB 1AT1B 2JN0A 2DMOA 4FSSA 1H3ZA 4X34A 4O5VA 2RQVA 1UUEA 4C5EA 2VB6A 4M75B 4CC4B 1VQPT 3J81E 4M77G 2AKKA 1OZ2A 1YCYA 1RLPC 1WNLA 3H8ZA 4KGVB 5DM7R 4JRQA 2E4HA 2DVJA 4XU2A 5IHKA 1D0XA 3LYIA 4HCBA 3TEEA 1X2KA 1BI1A 3CCST 3H0FA 4M77B 1VQ7Q 4OMPA 1KSWA 1N27A 3TSWA 1OQKA 2EFIA 2YRCA 2P0PA 5KYXA 1LOJA 1K0SA 1QVGP 1PD1A 3BE3A 3EFOB 3MHXA 2K5IA 3CC4A 3DLLA 3CCJQ 3OS5A 3OYCA 3L2RA 1RAIB 2CSIA 2K4YA 3QG1A 4QQGA 2QAZA 4OB1B 2LQKA 3HKSA 4HCZA 4C8QC 1YJWQ 2M02A 2QYZA 2XK0A 3C0CA 3MO8A 1VQKA 3LW5E 4D8DA 3HHTB 3CC4Q 2DXCA 2HMAA 5KCHA 4XTZA 4RTWA 3CCJA 3UF4A 1B07A 1OX8A 8ATCB 4BY6C 1OULA 1M2VB 1C1AA 3DB4A 1E6HA 1SRLA 3TREA 3JSCA 4M78G 2K2VA 3GNGA 1WA7A 1QVPA 4KGXB 1QMCA 1D1AA 4XK8E 5CKFA 2DFUA 1JBMA 3CBPA 1UFFA 3JCMQ 2DZ9A 3G6EA 1WHGA 1VQMT 1SSFA 2RK2A 1RI0A 4JZ4A 4ELZC 1OYXA 1RABB 1Z9QA 1ARKA 3CD6A 3HTRA 5GAN3 2MK5A 1MHNA 3KFVA 4QVDA 3EG0A 2DYBA 2DL5A 2CS7A 3NMZC 2YRDA 3CMET 2CT4A 2L3SA 1B34A 2BKDN 5CQYA 3OW2P 2RA2A 1CKAA 4C92B 2XMFA 3JCMP 1SSHA 3REAB 4C8QF 2EQJA 4QKUA 1I0CA 2K3BA 1OPLA 1D1BA 2QXFA 3OA6A 5L23A 3TU4K 2KXDA 4LDVA 5IXFA 5LJ5e 1KQSS 2FRWA 1KD1C 2RQUA 1PKSA 3VUBA 1WFWA 3FC3A 3A8LB 2FEIA 4C0DB 3OYAA 3L2WA 3GP8A 3MCAB 1UEBA 1Q86U 4F16A 4MDXA 4M78A 5FRMA 5GAN6 4DBQA 2VGMA 3EG9A 3O8VA 2CUBA 2M0YA 1GFDA 1VQ8A 4J9EA 1BK2A 4FW1A 4JLGA 2ZCFB 4M4ZA 1Q81C 4O6JA 5KYYB 3G4ST 2XDDA 1ZUKA 1VIEA 4ANJA 4N4GA 4M77A 4JJBA 2DXUA 5DLOA 1Q7YR 4DEXA 3V8JA 1R8OB 3UDCA 5KCOA 2ROLA 3I55A 2HSPA 2FPEA 1A0NB 3MEVA 4HXJA 2EQMA 4DBRA 2IPOB 1PM3A 2OTLT 1D0YA 4A53A 4QT7A 2O31A 2LQWA 2GGRA 4F7UE 3CCUQ 4KULA 4J9CA 1KQSP 1EZZB 2YUQA 1Q86R 1AZEA 4FT2A 1VQ6T 3CC2T 2B8AA 1XQHA 1KJWA 4RMOA 3CMAQ 1BKBA 1IZ6A 3HFNA 4Q5WA 1Z9ZA 5IHIA 5A0LA 2K9GA 3ZFJA 4D8KA 1QWFA 2JMAA 3QYHB 2RJDA 4PLLA 4R55A 4C8QA 2X3WD 1N6AA 2D9TA 4ORZA 5CQXA 1W2BP 3DLMA 1RAGB 3PTAA 2G3RA 2CT3A 1ZQ1A 1K9MC 3I56Q 3SWNB 1KQ2A 1TU0B 1AVZC 3CPWA 3EGDA 2E41A 1GBRA 2HKNA 2J06A 3KUFA 3CPWS 1VIFA 2VXEA 1ZUUA 1QQJA 1HD3A 2K79A 2YDLA 3G71T 2ED1A 3EH2A 4C92E 3HP9A 3M54A 1IRXA 2HQEA 1LPLA 1UHCA 4X9CA 3JCMe 3X24B 1H3HA 5FRNA 5GAMe 4A4KA 3CCET 3RR6A 1M1KC 4P5NA 4OGEA 3UA6A 5D7UA 4FT4A 1OOTA 1TUCA 1W70A 3M0PA 1IO6A 4Y28E 4Y91A 3MEWA 1VA7A 2LT4A 5FWBA 1OEBA 2X4YA 1WHMA 4M78E 4LUEA 1PHTA 5CR2A 3DB3A 4J8OA 2V1QA 1BCOA 4FM4B 5KE3A 5IAYA 2GCXA 2CDTA 1KC8U 2LC4A 2D6FA 1T0JA 1UJYA 1WXUA 1VQPA 2A0FB 4OMQA 4E7JA 1VQOQ 3LH0A 3M57A 5D6WA 1GCQC 5GAOn 3OS1A 2YSQA 5LL6S 2MPXC 4LUDA 1B34B 2EJFA 1ZUYA 3I9QA 2QGGA 4BUGA 1RACB 2X4WA 3PE0A 2EYXA 1YHQQ 3VYGA 4C0ZA 4M7AD 4IUPA 4RUGA 3D7SB 3CCSA 1QP2A 1XOVA 2X3XD 5KH6A 3E1SA 3VS3A 2CP7A 3OYKA 1NJIC 1XJWB 2LJ0A 3DKMA 1JB0E 3HL8A 2YRVA 4J9DA 2ABLA 4C0FA 1G3SA 3FEOA 3OYBA 3JCMJ 1ZBXA 2CSQA 5AYFA 3OW2S 5GANj 3I5SA 4RTVA 1NEGA 1UG1A 3OS2A 1Q82R 3HSBA 3OW2A 2BE9B 2E12A 9ATCB 3PIPA 2AKLA 2BZYA 3CCVA 1RI9A 3RMSA 3BY7A 1WXBA 4GLMA 5LJ5h 2QTVA 5LJ3g 3A1PA 2K5LA 1M9SA 3L42A 1K0XA 1DJ7B 4QW2A 2KNBB 3LH5A 5GMKm 2DX1A 2E6NA 4JLIA 3CCJT 4PLIA 3EFSA 4B9WA 2MI6A 4LDWA 2LVMA 4PJOE 2QQBA 1IGQA 2DTOA 3X26B 1G83A 3CCRQ 1KD1U 2GTOA 4PJOB 2EGCA 4AFZC 4HVWA 1C6VX 1OU8A 4FYVB 5GANd 3N5BB 1TUDA 1HJDA 2CH4A 1G2BA 3M59A 4C92G 4AT1B 1MNDA 3MP6A 3URGA 2FVUA 2LTOA 1MMNA 4XAXB 2DIGA 4J9BA 1OPKA 1VQMA 3OY9A 1W1FA 5D6XA 3FDRA 5J26A 4ATOA 3E9GA 2M51A 2O9SA 4C0DC 4J9IA 1V1CA 3CD6T 1E6GA 1E7OA 3OYLA 2HAXA 2RHYA 2ZPFB 2KGTA 4M7DA 3S6WA 4RKUE 2K6DA 4GLKA 1QWEA 2V8IA 5LJ3d 4C92F 1YWPA 2A7YA 1FXXA 1VQ9A 2JT4A 3JB9H 1MV0B 2FL7A 3L2UA 1JXMA 2ZZDA 1VQ8Q 1G5VA 2E3HA 3VS7A 4HVUA 4F7UG 4HVVA 2O01E 2H3JA 5FWCA 2QQRA 3J7AF 4K11A 2K3YA 2R5MA 4PJJA 2J6KA 4PNOA 4EDUA 4QQDA 2EYWA 2A3LA 1MUZA 1G3YA 1YBYA 5CKEA 2CZ7B 1KC8R 1UHFA 3P8BB 1WXTA 2DRMA 1TOVA 1K1ZA 1U06A 1R0CB 2BZ8A 3MJXA 2HQXA 1VYTA 1KD1R 4QQ6A 1PCXA 1MMDA 1OV3A 2MIOA 1KHIA 1KFZA 2DTIA 5GANh 1PC0A 1SRMA 4LD6A 2DL4A 2VKNA 5CKDA 1KIKA 1M8VA 3I55T 1QKXA 2GNCA 3LGFA 3ME9A 3QIIA 3MEAA 4E7SA 4PFOA 2ZGWA 2YXYA 3CCQQ 1MMAA 1VOMA 2DM1A 1VQLQ 3VYHB 2CKKA 2Y4YA 1Q7YC 3GBQA 2FPDA 3CC7Q 1M1KU 1Q82U 4M78F 1VQ6A 4ELYC 2I2LA 4JJDA 2VVKA 1KQ1A 4R0KA 1VQ4Q 1S72T 2KYBA 2MWPA 1WDXA 5GAMj 1XNIA 5IN1A 2OJ2A 2L2PA 2RJEA 4OMFB 2P84A 4D6WA 3G6EQ 1I07A 1M5Q1 1JU5C 1LJOA 4F7UA 3VS6A 1UDLA 3GOXA 2LJ3A 5CKBA 1YITT 1VQ6Q 1K8AU 4F14A 1VQ5Q 2K3XA 4II1A 5GAOm 3RDVA 2CZ1B 3CPFA 4ZGDB 1K73C 4NL3A 1AOJA 2RHUA 2ZPIB 3OYYA 5GAMh 4XU3A 2O4XB 4LE9A 1QW1A 3THKA 2JZ2A 5HY6A 2L3RA 5GAN2 2D8HA 1QCNA 2COWA 1I5LA 2WSFE 4M75F 4KUIA 5FU6C 4HKEA 4M77F 5I2MA 1SEMA 2EYYA 3JB9D 2LCLA 3EGXB 4JJCA 5GMKe 2DBMA 3GIBA 2CP2A 1K76A 4M77D 1FWZA 1NE8A 2L3QA 3GF5A 2ROTA 3PMTA 2JXBA 3LLRA 3VS4A 3CCSQ 1NJIU 1YNZA 3PT9A 3RBBB 4DQ2A 2J7IA 3CBOA 3OQ5A 2DJZA 1RLQC 2CYZB 2O88A 4EMKA 3VJPA 4M75G 3BDLA 4Z88A 1BI3A 2DL8A 3VS5A 1OZ3A 2XDPA 3OMGA 1Y96A 2EQUA 1Y71A 4C8QD 1X27A 1RAEB 2H3EB 3KXTA 2DD4A 4J9FA 1WQ7A 3C94A 3QJYA 3QPHA 4LXCA 1K4US 1YIJT 1KQSA 1W2BS 4FL6A 3JB9I 1ZSZC 1NBEB 4BI8B 3OYEA 2RQWA 4FYYB 3OYFA 2ZAEA 4VUBA 3FB9A 2D0QB 1GL5A 2OAWA 2F2XA 1JO8A 3P8DA 4B6MA 2RHZA 4F17A 4M7DG 4GY5A 3CCVT 1AWOA 3BDUA 2JTMA 3QUIA 2RMOA 5KYUB 2RQTA 1NJIR 1U3OA 1WJSA 1ACMB 1VQNQ 4CI0C 2KQWA 4WCIA 2COZA 3TSZA 1NLPC 1WLPB 3FIFA 3L2ZA 2ECZA 3GPLA 2PVGB 4Z02A 2LRQA 3I56A 2C06A 1Q81U 1FMWA 4A4HA 1Q82C 2DRKA 1Q7YU 2L3PA 4E7HA 3SB2A 5GAOr 4RTXA 2J6OA 2RPNA 2V8JA 5KYNA 5GMKj 2YHTA 1WHLA 3M0RA 2RN8A 4PJNA 4C8QE 3UPUA 2AHJB 4DOVA 2GTJA 3G7ZA 1ZSZA 3H0HA 3A8MB 2NUTB 1PWTA 3CMEQ 2OAUA 1VQ7A 1YI2T 1HK9A 4QVZA 1YJNA 4C8QG 2RI2A 4F7UB 5GAOq 3EG2A 4AMCA 2QEXQ 1V76A 4J6YA 2HBWA 2C0IA 1NPRA 1NYGA 4JZ3A 1LVKA 2AK5A 3HFOA 4RTZA 5LJ5j 4AFSC 4XQ3A 2E65A 1WX6A 2O2OA 2RQRA 2X4JA 1FYNA 4KH1B 3A98A 3I5RA 1M1FA 2Y90A 1J3TA 2CH4W 3G1JA 2HQHA 2GQVA 3RKXA 1VQ9T 1WI7A 2RI5A 4E2FB 2HNIA 1VQOA 1VQPQ 4ME7A 3RESA 1WQWA 1IGUA 2QDYB 2DF6A 3JV3A 4HA8A 3ZBDA 2EWNA 3M55A 1AWXA 5J39A 4N4HA 3M5AA 1YJ9Q 1X6OA 1CSKA 2QGFB 1YHQA 1IHVA 3EHRA 1YWOA 1M1KR 4M75D 2A28A 1LNXA 2YUOA 4PKCC 1QP3A 3RNJA 1ABOA 5GANg 5I22A 2RJFA 4OMMA 1B3QA 2ED0A 2KRSA 4NL2A 2DA9A 2JM9A 5GANe 1ZLMA 2XD0A 3SDZA 2MF2A 3CPWP 1HYOA 1O75A 3QKJA 4BI3A 2RI3A 1JQQA 3AHUA 1VQLA 1I1JA 5IH2A 2V1RA 2CREA 1BI0A 2EKHA 3TCJA 1N9SA 2FHDA 4RCCA 5KE2A 3QYGB 5GAN7 1H92A 2BE7D 1YJWT 1UGSB 4IURA 2YLBA 5GMKh 4OP0A 2FZGB 1S1NA 2M16A 2KMTA 2PVOB 5GAMd 4BB7A 2PUKB 4JRKA 2KDSA 3NTKA 2PNIA 2XU8A 3PNWC 2NYSA 4WF2A 2JVVA 3RUXA 2EBPA 4RTTA 4BE0A 2OTJT 1NPPA 5ECAA 4EMHA 2CP3A 3NPFA 4JUVA 4MZPA 2F69A 1GXIE 3CXCS 2KT1A 2YLCA 1S72A 1GCPA 4X1VA 3SFMA 4M78D 1HSQA 3J80E 3V7RA 1PD0A 5I2SA 4C92A 4CC2A 3CCQA 1ABQA 2B86A 4AG2C 1H641 2LJ1A 5GAOp 1YITA 2F2VA 2JTFA 1M3CA 2P0KA 4M7DF 1QCOA 2D8JA 3HRTA 3EG9B 1ZX6A 2EGAA 2P4TA 1M90C 4M75A 3CMAT 2JM8A 3LGLA 3S3MA 3CCEQ 2XIDA 3GNFB 2PU9B 5GAN5 3OBWA 2QASA 1N5ZA 1VYVA 4C92C 4HCCA 2YWWA 5CO7A 2L5QA 4KT0E 3X28B 2V26A 2JUFA 2GQIA 1X75C 1N9RA 1T3LA 3QWYA 1YITQ 3UWNA 4M75E 2SEMA 2DE0X 4L5GA 3OYIA 4LD9K 4J6WA 4EPCA 1TS9A 1G3TA 2CZ6B 4DEYA 3CCLA 4AFUC 3WVEB 5GAMg 1Y96B 2MAMA 4M7AC 1BYMA 2NUPB 5DLQE 2KE9A 2BUDA 2F5KA 4PJOG 1X01A 2JMCA 2EGEA 3H0IA 2JNGA 2LP5A 4M7DC 1M8MA 2R58A 1I5OB 2P4RA 3OBYA 4J7FA 1TSFA 4X9DA 2VUBA 2G6FX 2L89A 4M7AA 2DEQA 2FYKA 2DIQA 3PGGA 5A2QE 1PKTA 2CP0A 2PVDB 3PFSA 5GAN8 2KEAA 4EMGA 1WZOA 5LJ5f 2JS0A 3M9QA 2PUOB 2L8DA 3X25B 3CCUA 1MV3A 4NOYA 1EIFA 2JW4A 2WSCE 4ZN1A 3QSUA 1YIJA 3BW1A 1MMGA 4LDYA 3MEUA 4OF1A 3LX7A 4OMLA 3CEYA 2COYA 2XDBA 2MYSA 5CVIA 3M0QA 3QXEB 2E10A 2RM4A 2SRCA 4BE2A 2KBTA 5HK0A 3CCMQ 2CGHA 1EX4A 3CCRA 1K8AC 2F2WA 2AZVA 2ZPHB 4J6XA 4RTYA 3V8KA 4PL6A 3QZ9B 3I56T 1QVFP 5KYWB 1T0HA 2QA4T 1U1TA 4BI4A 1KHCA 5IT9E 4C5HA 1Y57A 1CKBA 6AT1B 2KYMA 5IHNA 2X51A 4PJOC 3SEMA 4IIMA 4M78C 3ZEHA 1N8RR 2KT8A 5KYUA 2CP6A 3OSSC 1ZSZB 2WSEE 4E7KA 1LCKA 1ZBJA 1NYFA 1PNJA 2J05A 3SWNA 2K7AA 4XTWA 1H8KA 3EGXA 1B7TA 3M58A 1VQ7T 3VS2A 5LJ5g 1YI2A 1YJNT 1QKWA 2KK4A 1GBQA 5LJ3f 2I0NA 3JB9J 2OI3A 1YP5A 2RJCA 1EFNA 2HCKA 1RAAB 3JCMf 3JB9G 4ZTFA 4PK4A 4KRTA 4BACA 1YJ9A 1X69A 2XKOC 3M56A 1K73R 1RUWA 1NG2A 2KVQG 1ZA1B 4PFPA 4DBFA 1RADB 3REBB 5D6YA 1VQOT 3ER0A 2K57A 1D1CA 1PSEA 4C5GA 1VQKQ 2QG9B 2QEXT 1UJ0A 4PJOA 4JS5A 3KBGA 5J3BA 2VWFA 2O9VA 2DBKA 4OVAA 3G4SQ 4E7IA 2HZYA 1YHQT 2DO3A 2E70A 2WACA 2JJ9A 3CXCA 2D1XA 2L0AA 1SKUB 3FRNA 1GFCA 1RAHB 4OB2B 5A0GA 1WYXA 1UB4A 1AEYA 1KK7A 3VRYA 2YT6A 2CUDA 5AT1B 4C5IA 3M4GA 3RKYA 2HSEB 3HRSA 2IVWA 1FMVA 2VC8A 3L2VA 2FZCB 1UGRB 4PJLA 1VQLT 2FZKB 4OB3B 5HK3A 1VQMQ 3CC7A 1MNEA 4OMNA 1VUBA 2RO0A 3OS0A 3JRZA 4FW2A 2EQIA 1HXDA 2QQSA 3M53A 3PVLA 1X6BA 2NWMA 2A37A 4J5YA 1YJWA 4FYWB 5CCAA 1UE9A 3PVQA 2X35A 3JAME 1GRIA 5A0DA 4CC3A 3MP1A 1V29B 3VS1A 3LWHA 1U1SA 3INZA 3VKIA 2ESWA 4V2SA 3M4YA 2DERA 2DPPB 2RD1A 4KBMB 1WHJA 1R77A 2OTJA 1D0ZA 2GBQA 3R6NA 2YUNA 4E7LA 4N0AC 1XTDA 1AZGB 3GLXA 1OI1A 1AD5A 2DETA 2DL7A 2EAYA 5CKHA 2VASA 3S3NA 3RERA 1SHGA 1W2BA 4FU6A 3I35A 1TUGB 3V8LA 2JTEA 4L59A 3CCQT 3MP8A 4RG2A 1WJQA 2DL3A 1K9AA 5C6SA 2QTXA 4PFZA 1WGSA 4EIKA 4F7UF 3TQ7P 1F1BB 3CMAA 2RHIA 1IXDA 3EFOA 3M0SA 3QDRB 1VYUA 4JS4A 4JRIA 2VXFA 2NUPA 4M77C 4A4FA 3HPWA 1WPYA 2NUZA 4OGCA 2GFAA 4M7DB 2E64A 2K2MA 3X20B 2EVRA 1M90R 2C0OA 5FLXE 2OTLQ 2JS2A 4RCBA 2FG0A 2R57A 7AT1B 2EIFA 5L8RE 1M1GA 2GFUA 3A8OB 2LNHB 4DA4A 4C0GA 4XU0A 1G3WA 3CCLT 2R5AA 4IUUA 2CZ0B 5C0MA 2DXTA 3MPUB 2NUTA 2XI9A 3CC2Q 4M78B 2HKQB 4CC7A 5I11A 2HDAA 2HEQA 2KY9A 5LJ3e 4MDWA 1SF9A 3L2QA 4JRPA 1I81A 2RB6A 5GANf 4F04B 3JB9F 2V8KA 5FU7B 3ZL7C 3V7CA 2KRMA 3Q1JA 4ESRA 3T9NA 1D09B 3L1AA 1P92A 4PJMA 5FU6B 4JPBW 4M77E 2QDLA 5KYXB 3S3OA 2GF7A 2DK3A 3EH1A 2EYZA 2D0NA 2PQWA 4GBQA 3CXCP 2VV5A 1PSFA 1JJ2P 3FJ5A 3M0UA 1TTHB 1UECA 2RNAA 3I55Q 2DVEA 4LDXA 2ENMA 2IG0A 2LCCA 3QDFA 4A4GA 3QJ6A 3VS0A 2K5FA 3CCUT 2MOXA 2JOYA 3PMIA 4E7ZA 4J9GA 5GMKl 3A8HB 4L6V5 1VQNT 3UATA 1VQ4T 4JDSA 3C95A 5FROA 4NS5A 2LQ8A 4XTXA 2F1LA 2O4XA 1NZ9A 3NFCA 4IIOA 3CCRT 3WVDB 1FX7A 3NHNA 4AG1C 1JXOA 1U8RA 3JCMg 3O5ZA 3OSVA 4WTOB 2DD5A 1JJ2S 3AT1B 1PRMC 4BD3A 4IUVA 4FYXB 1VQ5T 1QLYA 1JJ2A 3RMQA 3MKDA 3SWNC 2QK0A 3QWXX 2XHCA 2QA4A 1AHJB 4BDYA 2KAFA 1O9SA 2X4XA 3CCMT 2E6ZA 2DTHA 3G71Q 4ZGEB 2F5TX 3OYJA 4RG8A 1D3BA 4OB0B 3R6OA 1M90U 1Q81R 4FIBA 2H8HA 1ZHIA 3BFMA 2PZ1A 4OMOA 2E1HA 1VQ9Q 3SD4A 4C8QB 4QVCA 2LDMA 3ULRB 4M7AF 2EYQA 3OYHA 1Y7XA 3FLGA 1N8RC 4M75C 1W6XA 1X6GA 4LN2A 4BE1A 2E3IA 1YJ9T 3TVTA 5CIUA 5DY9A 4LDUA 4MMKA 4J7IA 2DYIA 4B9XA 1NLOC 1ZA2B 3OYNA 1YI2Q 2A08A 1BCMA 5HKCA 1Q86C 3OYMA 2HBPA 2OX7A 1WHHA 2DLPA 3E9FA 3QHSA 4RTUA 2ZPBB 2QEXA 4A4EA 1K9MU 2KI7A 4M7AG 2AIRB 3CC4T 3RKWA 4AFQC 5CK9A 4M7DE 2IIMA 1RAFB 1IB8A 1Y07A 2E5QA 2DNUA 5FW9A 2RH2A 4M7AB 1FMKA 1YIJQ 2EPDA 4E47A 2DAQA 4BY6B 1VQKT 2FRYA 1WHKA 4XTVA 2CP5A 3NTIA 4MZTA 4Z8AA 4Y92A 1OU9A 2HL5C 4A63B 1AWWA 3V7SA 3CC7T 1N8RU 4J83A 4Z89A 3CCVQ 2OTJQ 1Y0MA 4YTLA 1IHWA 3NTHA 4CRIA 1NEBA 3EG1A 2BIVA 3CD6Q 5FU7C 1D3BB 3NGPA 1I4K1 1S72Q 2HL3A 3UT1A 2DEUA 5I21A 2X9HA 3H9NA 2ZPEB 2DXBA 3U23A 2QQ9A 5LJ5d 3G6ET 3EHQA 5HCKA 2EJ9A 2EJGA 4N4IA 4ZN3A 4BDZA 1I8FA 2KR3A 1M3AA 5CAIA 4C92D 5GJVB 4IUQA 4ZGJB 4FCYA 1UGPB 2M9UA 3RIRA 1TXQA 1M4ZA 1M2VA 2MMPA 2HD0A 1JEGA 1UGQB 2LX7A 4IKFA 2LCSA 3JCMc 3IQLA 3CMEA 1T3SA 1K8AR 4HT9A 3JCMV 3H6ZA 3EFRA 4PJOF 8AT1B 2KRNA 4EMKB 4ZTJA 1K73U 3VUZA 3OB9A 1YN8A 1C0MA 3JCMb 2MCNA 2VYTA 1BB9A 2M1HA 2W10A 1SG5A 4LNPA 3VRZA 2E5KA 3EAEA 2AZSA 2P0QA 2RF0A 5LJ3j 3EGUA 3QZ5B 4ZNXA 3A8GB 4JJNK 2QI2A 4A54A 2LT1A 1TH7A 4M7DD 4XTUA 3H41A 2EKOA 2LX9A 2FO0A 2ZPGB 1TWBA 2M0OA 1VQ8T 1SHFA 1NM7A 3A5ZB 5LJ3h 1RL2A
chains in the Genus database with same CATH topology
1M3BA 2J6FA 3SHWA 2FPFA 2DRKA 3UA6A 2PTKA 2L3PA 4OMNA 1OOTA 4RTXA 1TUCA 2J6OA 2RPNA 1W70A 3M0PA 1IO6A 3M0TA 2EQIA 3M0RA 4J9HA 2RN8A 3PVLA 1X6BA 2NWMA 2A37A 1VA7A 2BTTA 2GTJA 1BBZA 1UE9A 3PVQA 3H0HA 3EG3A 1GRIA 5FWBA 1OEBA 1X2QA 1PWTA 4LUEA 1PHTA 4CC3A 3VS1A 4E6RA 1X43A 1WIEA 2V1QA 2ESWA 1ZSGA 2CDTA 1T0JA 1UJYA 1WXUA 2W0ZA 4OMQA 3EG2A 1GCQC 2A36A 2GBQA 2YSQA 3R6NA 2YUNA 4LUDA 1ZUYA 2HBWA 1AZGB 2C0IA 3I9QA 1TG0A 1NYGA 4JZ3A 1AD5A 2LZ6B 2AK5A 2DJQA 2EW3A 1PRLC 2DL7A 4RTZA 3UA7A 3PE0A 5IXBA 4AFSC 2EYXA 1SHGA 1WX6A 2O2OA 2RQRA 1FYNA 3I35A 2KXCA 4RUGA 3A98A 3I5RA 2JTEA 1J3TA 1XOVA 1M27C 2X3XD 2CH4W 5EC7A 3VS3A 1WI7A 4HCKA 2DL3A 1K9AA 2LJ0A 1M30A 1U5SA 4EIKA 1YCSB 4J9DA 2ABLA 2DF6A 3JV3A 1AWXA 1SPKA 2C0TA 2CSQA 3M0SA 1CSKA 1VYUA 3I5SA 4RTVA 1NEGA 1UG1A 3EHRA 1YWOA 2A28A 2AKLA 2BZYA 1AWJA 1UGVA 2YUOA 1QCFA 1RI9A 1WXBA 4GLMA 2NUZA 3RNJA 1ABOA 1K0XA 5I22A 2K2MA 4OMMA 1B3QA 2EVRA 2ED0A 2KRSA 2DA9A 2JM9A 2LQNA 2C0OA 2KNBB 3LH5A 3CQTA 2JS2A 1ZLMA 2FG0A 2DX1A 2LMJA 1BU1A 2LNHB 1JQQA 1I1JA 5GJWB 5IH2A 2V1RA 2CREA 1G83A 2KROA 2EKHA 2GTOA 1UTIA 2YUPA 2EGCA 4AFZC 4CC7A 1GCQA 4HVWA 5I11A 2HDAA 2HEQA 1H92A 1TUDA 2DILA 2BZXA 1HJDA 1S1NA 2CH4A 1G2BA 2DMOA 3ZL7C 4FSSA 2KRMA 2PNIA 4ESRA 2RQVA 1UUEA 4J9BA 4JPBW 1OPKA 4CC4B 2QDLA 2EBPA 4RTTA 1W1FA 2EYZA 2D0NA 2M51A 5ECAA 2O9SA 2AKKA 4GBQA 3NPFA 4J9IA 1V1CA 2KT1A 3FJ5A 1E7OA 1E6GA 1RLPC 1UECA 2RNAA 3M0UA 1GCPA 2DVJA 2ENMA 2KGTA 4X1VA 5IHKA 2K6DA 1HSQA 1QWEA 1X2KA 3H0FA 3VS0A 4CC2A 1YWPA 1ABQA 4OMPA 1KSWA 2B86A 2MOXA 3TSWA 4AG2C 2LJ1A 2JT4A 4J9GA 2F2VA 1M3CA 1MV0B 1K0SA 1JXMA 2D8JA 3UATA 1ZX6A 2EGAA 3VS7A 2JM8A 4HVUA 4HVVA 1N5ZA 1VYVA 2CSIA 5FWCA 4IIOA 4K11A 3NHNA 4AG1C 1JXOA 2J6KA 2GQIA 2EYWA 3O5ZA 1MUZA 1T3LA 3QWYA 3C0CA 1UHFA 4D8DA 1WXTA 1PRMC 2DRMA 2SEMA 1K1ZA 1U06A 2DE0X 4RTWA 1QLYA 2BZ8A 3UF4A 3QWXX 1B07A 1VYTA 4DEYA 4AFUC 1OV3A 2MIOA 1KFZA 1SRMA 2DL4A 1E6HA 2VKNA 1SRLA 1KIKA 2KE9A 1QKXA 2GNCA 2JMCA 2EGEA 3H0IA 2LP5A 2H8HA 1WA7A 1M8MA 2PZ1A 1UFFA 4OMOA 2P4RA 2DM1A 3GBQA 2FPDA 2G6FX 3ULRB 4JJDA 4JZ4A 2VVKA 1Z9QA 1ARKA 1W6XA 4R0KA 1X6GA 1PKTA 4LN2A 3KFVA 2KYBA 2KEAA 3TVTA 1WDXA 3EG0A 2DYBA 2DL5A 2OJ2A 3NMZC 2JS0A 2L2PA 1NLOC 2CT4A 2L3SA 1MV3A 2A08A 2JW4A 1I07A 1JU5C 1CKAA 2XMFA 3VS6A 1SSHA 1UDLA 2LJ3A 2DLPA 4RTUA 3REAB 4OMLA 4F14A 1I0CA 2K3BA 1OPLA 3M0QA 4AFQC 5L23A 2KXDA 2SRCA 2KBTA 5IXFA 1AOJA 2FRWA 2IIMA 2RQUA 1PKSA 1WFWA 4LE9A 2FEIA 2DNUA 5FW9A 1FMKA 2EPDA 2F2WA 2AZVA 3THKA 4F16A 4RTYA 2FRYA 2CUBA 2M0YA 1GFDA 2D8HA 4J9EA 1BK2A 4M4ZA 4Z8AA 4Y92A 1T0HA 1ZUKA 4A63B 1AWWA 4JJBA 1Y57A 1CKBA 1SEMA 2EYYA 4Z89A 4DEXA 2KYMA 5IHNA 1Y0MA 4JJCA 2DBMA 3SEMA 1NEBA 3EG1A 4IIMA 2ROLA 2HSPA 2FPEA 2KT8A 3NGPA 1A0NB 4HXJA 1K76A 1LCKA 1ZBJA 1NYFA 1PNJA 2L3QA 2ROTA 2J05A 2JXBA 2K7AA 1H8KA 4QT7A 3VS4A 2O31A 3U23A 2LQWA 2GGRA 1YNZA 3VS2A 4J9CA 3RBBB 3EHQA 2J7IA 1QKWA 1GBQA 1RLQC 2YUQA 5HCKA 2I0NA 2O88A 2OI3A 1YP5A 1EFNA 1AZEA 2HCKA 2KR3A 1M3AA 4Z88A 1KJWA 2DL8A 5GJVB 4KRTA 1X69A 3VS5A 1Z9ZA 5IHIA 1JEGA 2LX7A 1RUWA 1NG2A 2LCSA 1X27A 4J9FA 3IQLA 2K9GA 4D8KA 1T3SA 1QWFA 3REBB 2JMAA 1K4US 2KRNA 2X3WD 1UJ0A 4ORZA 1YN8A 2RQWA 2MCNA 1BB9A 2VWFA 2CT3A 2O9VA 2W10A 2DBKA 4LNPA 3VRZA 2E5KA 2AZSA 1GL5A 2RF0A 2OAWA 1AVZC 2F2XA 1JO8A 4F17A 3EGUA 4ZNXA 1GBRA 1AWOA 2J06A 2D1XA 2L0AA 2RMOA 2RQTA 1ZUUA 1GFCA 1HD3A 2K79A 2YDLA 1U3OA 2ED1A 3H41A 1WYXA 1AEYA 1UHCA 2FO0A 4WCIA 3VRYA 2YT6A 2CUDA 3TSZA 1NLPC 1H3HA 1SHFA 1WLPB 2ECZA 1NM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M3B A;  2J6F A;  3SHW A;  2FPF A;  2DRK A;  3UA6 A;  2PTK A;  2L3P A;  4OMN A;  1OOT A;  4RTX A;  1TUC A;  2J6O A;  2RPN A;  1W70 A;  3M0P A;  1IO6 A;  3M0T A;  2EQI A;  3M0R A;  4J9H A;  2RN8 A;  3PVL A;  1X6B A;  2NWM A;  2A37 A;  1VA7 A;  2BTT A;  2GTJ A;  1BBZ A;  1UE9 A;  3PVQ A;  3H0H A;  3EG3 A;  1GRI A;  5FWB A;  1OEB A;  1X2Q A;  1PWT A;  4LUE A;  1PHT A;  4CC3 A;  3VS1 A;  4E6R A;  1X43 A;  1WIE A;  2V1Q A;  2ESW A;  1ZSG A;  2CDT A;  1T0J A;  1UJY A;  1WXU A;  2W0Z A;  4OMQ A;  3EG2 A;  1GCQ C;  2A36 A;  2GBQ A;  2YSQ A;  3R6N A;  2YUN A;  4LUD A;  1ZUY A;  2HBW A;  1AZG B;  2C0I A;  3I9Q A;  1TG0 A;  1NYG A;  4JZ3 A;  1AD5 A;  2LZ6 B;  2AK5 A;  2DJQ A;  2EW3 A;  1PRL C;  2DL7 A;  4RTZ A;  3UA7 A;  3PE0 A;  5IXB A;  4AFS C;  2EYX A;  1SHG A;  1WX6 A;  2O2O A;  2RQR A;  1FYN A;  3I35 A;  2KXC A;  4RUG A;  3A98 A;  3I5R A;  2JTE A;  1J3T A;  1XOV A;  1M27 C;  2X3X D;  2CH4 W;  5EC7 A;  3VS3 A;  1WI7 A;  4HCK A;  2DL3 A;  1K9A A;  2LJ0 A;  1M30 A;  1U5S A;  4EIK A;  1YCS B;  4J9D A;  2ABL A;  2DF6 A;  3JV3 A;  1AWX A;  1SPK A;  2C0T A;  2CSQ A;  3M0S A;  1CSK A;  1VYU A;  3I5S A;  4RTV A;  1NEG A;  1UG1 A;  3EHR A;  1YWO A;  2A28 A;  2AKL A;  2BZY A;  1AWJ A;  1UGV A;  2YUO A;  1QCF A;  1RI9 A;  1WXB A;  4GLM A;  2NUZ A;  3RNJ A;  1ABO A;  1K0X A;  5I22 A;  2K2M A;  4OMM A;  1B3Q A;  2EVR A;  2ED0 A;  2KRS A;  2DA9 A;  2JM9 A;  2LQN A;  2C0O A;  2KNB B;  3LH5 A;  3CQT A;  2JS2 A;  1ZLM A;  2FG0 A;  2DX1 A;  2LMJ A;  1BU1 A;  2LNH B;  1JQQ A;  1I1J A;  5GJW B;  5IH2 A;  2V1R A;  2CRE A;  1G83 A;  2KRO A;  2EKH A;  2GTO A;  1UTI A;  2YUP A;  2EGC A;  4AFZ C;  4CC7 A;  1GCQ A;  4HVW A;  5I11 A;  2HDA A;  2HEQ A;  1H92 A;  1TUD A;  2DIL A;  2BZX A;  1HJD A;  1S1N A;  2CH4 A;  1G2B A;  2DMO A;  3ZL7 C;  4FSS A;  2KRM A;  2PNI A;  4ESR A;  2RQV A;  1UUE A;  4J9B A;  4JPB W;  1OPK A;  4CC4 B;  2QDL A;  2EBP A;  4RTT A;  1W1F A;  2EYZ A;  2D0N A;  2M51 A;  5ECA A;  2O9S A;  2AKK A;  4GBQ A;  3NPF A;  4J9I A;  1V1C A;  2KT1 A;  3FJ5 A;  1E7O A;  1E6G A;  1RLP C;  1UEC A;  2RNA A;  3M0U A;  1GCP A;  2DVJ A;  2ENM A;  2KGT A;  4X1V A;  5IHK A;  2K6D A;  1HSQ A;  1QWE A;  1X2K A;  3H0F A;  3VS0 A;  4CC2 A;  1YWP A;  1ABQ A;  4OMP A;  1KSW A;  2B86 A;  2MOX A;  3TSW A;  4AG2 C;  2LJ1 A;  2JT4 A;  4J9G A;  2F2V A;  1M3C A;  1MV0 B;  1K0S A;  1JXM A;  2D8J A;  3UAT A;  1ZX6 A;  2EGA A;  3VS7 A;  2JM8 A;  4HVU A;  4HVV A;  1N5Z A;  1VYV A;  2CSI A;  5FWC A;  4IIO A;  4K11 A;  3NHN A;  4AG1 C;  1JXO A;  2J6K A;  2GQI A;  2EYW A;  3O5Z A;  1MUZ A;  1T3L A;  3QWY A;  3C0C A;  1UHF A;  4D8D A;  1WXT A;  1PRM C;  2DRM A;  2SEM A;  1K1Z A;  1U06 A;  2DE0 X;  4RTW A;  1QLY A;  2BZ8 A;  3UF4 A;  3QWX X;  1B07 A;  1VYT A;  4DEY A;  4AFU C;  1OV3 A;  2MIO A;  1KFZ A;  1SRM A;  2DL4 A;  1E6H A;  2VKN A;  1SRL A;  1KIK A;  2KE9 A;  1QKX A;  2GNC A;  2JMC A;  2EGE A;  3H0I A;  2LP5 A;  2H8H A;  1WA7 A;  1M8M A;  2PZ1 A;  1UFF A;  4OMO A;  2P4R A;  2DM1 A;  3GBQ A;  2FPD A;  2G6F X;  3ULR B;  4JJD A;  4JZ4 A;  2VVK A;  1Z9Q A;  1ARK A;  1W6X A;  4R0K A;  1X6G A;  1PKT A;  4LN2 A;  3KFV A;  2KYB A;  2KEA A;  3TVT A;  1WDX A;  3EG0 A;  2DYB A;  2DL5 A;  2OJ2 A;  3NMZ C;  2JS0 A;  2L2P A;  1NLO C;  2CT4 A;  2L3S A;  1MV3 A;  2A08 A;  2JW4 A;  1I07 A;  1JU5 C;  1CKA A;  2XMF A;  3VS6 A;  1SSH A;  1UDL A;  2LJ3 A;  2DLP A;  4RTU A;  3REA B;  4OML A;  4F14 A;  1I0C A;  2K3B A;  1OPL A;  3M0Q A;  4AFQ C;  5L23 A;  2KXD A;  2SRC A;  2KBT A;  5IXF A;  1AOJ A;  2FRW A;  2IIM A;  2RQU A;  1PKS A;  1WFW A;  4LE9 A;  2FEI A;  2DNU A;  5FW9 A;  1FMK A;  2EPD A;  2F2W A;  2AZV A;  3THK A;  4F16 A;  4RTY A;  2FRY A;  2CUB A;  2M0Y A;  1GFD A;  2D8H A;  4J9E A;  1BK2 A;  4M4Z A;  4Z8A A;  4Y92 A;  1T0H A;  1ZUK A;  4A63 B;  1AWW A;  4JJB A;  1Y57 A;  1CKB A;  1SEM A;  2EYY A;  4Z89 A;  4DEX A;  2KYM A;  5IHN A;  1Y0M A;  4JJC A;  2DBM A;  3SEM A;  1NEB A;  3EG1 A;  4IIM A;  2ROL A;  2HSP A;  2FPE A;  2KT8 A;  3NGP A;  1A0N B;  4HXJ A;  1K76 A;  1LCK A;  1ZBJ A;  1NYF A;  1PNJ A;  2L3Q A;  2ROT A;  2J05 A;  2JXB A;  2K7A A;  1H8K A;  4QT7 A;  3VS4 A;  2O31 A;  3U23 A;  2LQW A;  2GGR A;  1YNZ A;  3VS2 A;  4J9C A;  3RBB B;  3EHQ A;  2J7I A;  1QKW A;  1GBQ A;  1RLQ C;  2YUQ A;  5HCK A;  2I0N A;  2O88 A;  2OI3 A;  1YP5 A;  1EFN A;  1AZE A;  2HCK A;  2KR3 A;  1M3A A;  4Z88 A;  1KJW A;  2DL8 A;  5GJV B;  4KRT A;  1X69 A;  3VS5 A;  1Z9Z A;  5IHI A;  1JEG A;  2LX7 A;  1RUW A;  1NG2 A;  2LCS A;  1X27 A;  4J9F A;  3IQL A;  2K9G A;  4D8K A;  1T3S A;  1QWF A;  3REB B;  2JMA A;  1K4U S;  2KRN A;  2X3W D;  1UJ0 A;  4ORZ A;  1YN8 A;  2RQW A;  2MCN A;  1BB9 A;  2VWF A;  2CT3 A;  2O9V A;  2W10 A;  2DBK A;  4LNP A;  3VRZ A;  2E5K A;  2AZS A;  1GL5 A;  2RF0 A;  2OAW A;  1AVZ C;  2F2X A;  1JO8 A;  4F17 A;  3EGU A;  4ZNX A;  1GBR A;  1AWO A;  2J06 A;  2D1X A;  2L0A A;  2RMO A;  2RQT A;  1ZUU A;  1GFC A;  1HD3 A;  2K79 A;  2YDL A;  1U3O A;  2ED1 A;  3H41 A;  1WYX A;  1AEY A;  1UHC A;  2FO0 A;  4WCI A;  3VRY A;  2YT6 A;  2CUD A;  3TSZ A;  1NLP C;  1H3H A;  1SHF A;  1WLP B;  2ECZ A;  1NM7 A; 
#chains in the Genus database with same CATH topology
 3G4S A;  1M3B A;  5EG2 A;  2J6F A;  4M7A E;  3SHW A;  3JCM W;  2FPF A;  2XG8 D;  2PTK A;  4XU1 A;  3M0T A;  2Z0W A;  4J9H A;  2VGN A;  1QVF S;  3OMC A;  3E19 A;  2BTT A;  3JCM d;  1PG5 B;  1BBZ A;  1QVF A;  1BIB A;  3EG3 A;  4KGZ B;  2RHX A;  2OTL A;  1X2Q A;  3VV0 A;  2ATC B;  2FB7 A;  3QBY A;  4E6R A;  1X43 A;  1WIE A;  1ZSG A;  2XIC A;  4KH0 B;  1BIA A;  2MWO A;  3CCL Q;  2W0Z A;  4DOW A;  3CBM A;  2A36 A;  3EGD B;  1M2O A;  3CC2 A;  5KYY A;  1TG0 A;  2KSS A;  2LZ6 B;  2DJQ A;  2EW3 A;  1PRL C;  1YFN A;  1R0B G;  3LWI A;  3MET A;  2NLU A;  3QO3 A;  3UA7 A;  5IXB A;  5GAO l;  3PIO A;  1K9M R;  1KG1 A;  2KXC A;  3ASK A;  4IUT A;  5GAM f;  1M27 C;  4FSX A;  4MZM A;  5EC7 A;  4HCK A;  4EMK C;  4DBH A;  1M30 A;  1U5S A;  3OYD A;  1G8X A;  1VQN A;  1YCS B;  1MGQ A;  4R56 A;  3FJP A;  1VQ4 A;  3E2U A;  2DKG A;  1SPK A;  2C0T A;  2QA4 Q;  4PJO D;  1OX9 A;  2RK1 A;  4UC4 A;  3VU3 C;  1WJR A;  2Y4X A;  1AWJ A;  1UGV A;  1QCF A;  4N0A A;  5GMK i;  3G71 A;  2EQK A;  3JCM X;  5GAN 4;  2LNV A;  3C4S A;  2AT1 B;  2LQN A;  3CQT A;  1JRI A;  1VQ5 A;  2LMJ A;  1BU1 A;  4MML A;  1W4S A;  1BI2 A;  3CCE A;  4HT8 A;  1YJN Q;  3CCM A;  5GJW B;  4TVR A;  2KRO A;  2DZC A;  1QVG A;  3WXM B;  3HRU A;  3JCM h;  1UTI A;  2YUP A;  3P8H A;  2QQA A;  1GCQ A;  3C12 A;  1QVG S;  5M9O A;  3OYG A;  5KYW A;  1KC8 C;  1Q95 G;  4XTY A;  4KUD K;  3F70 A;  2DIL A;  2BZX A;  1IRE B;  1AT1 B;  2JN0 A;  2DMO A;  4FSS A;  1H3Z A;  4X34 A;  4O5V A;  2RQV A;  1UUE A;  4C5E A;  2VB6 A;  4M75 B;  4CC4 B;  1VQP T;  3J81 E;  4M77 G;  2AKK A;  1OZ2 A;  1YCY A;  1RLP C;  1WNL A;  3H8Z A;  4KGV B;  5DM7 R;  4JRQ A;  2E4H A;  2DVJ A;  4XU2 A;  5IHK A;  1D0X A;  3LYI A;  4HCB A;  3TEE A;  1X2K A;  1BI1 A;  3CCS T;  3H0F A;  4M77 B;  1VQ7 Q;  4OMP A;  1KSW A;  1N27 A;  3TSW A;  1OQK A;  2EFI A;  2YRC A;  2P0P A;  5KYX A;  1LOJ A;  1K0S A;  1QVG P;  1PD1 A;  3BE3 A;  3EFO B;  3MHX A;  2K5I A;  3CC4 A;  3DLL A;  3CCJ Q;  3OS5 A;  3OYC A;  3L2R A;  1RAI B;  2CSI A;  2K4Y A;  3QG1 A;  4QQG A;  2QAZ A;  4OB1 B;  2LQK A;  3HKS A;  4HCZ A;  4C8Q C;  1YJW Q;  2M02 A;  2QYZ A;  2XK0 A;  3C0C A;  3MO8 A;  1VQK A;  3LW5 E;  4D8D A;  3HHT B;  3CC4 Q;  2DXC A;  2HMA A;  5KCH A;  4XTZ A;  4RTW A;  3CCJ A;  3UF4 A;  1B07 A;  1OX8 A;  8ATC B;  4BY6 C;  1OUL A;  1M2V B;  1C1A A;  3DB4 A;  1E6H A;  1SRL A;  3TRE A;  3JSC A;  4M78 G;  2K2V A;  3GNG A;  1WA7 A;  1QVP A;  4KGX B;  1QMC A;  1D1A A;  4XK8 E;  5CKF A;  2DFU A;  1JBM A;  3CBP A;  1UFF A;  3JCM Q;  2DZ9 A;  3G6E A;  1WHG A;  1VQM T;  1SSF A;  2RK2 A;  1RI0 A;  4JZ4 A;  4ELZ C;  1OYX A;  1RAB B;  1Z9Q A;  1ARK A;  3CD6 A;  3HTR A;  5GAN 3;  2MK5 A;  1MHN A;  3KFV A;  4QVD A;  3EG0 A;  2DYB A;  2DL5 A;  2CS7 A;  3NMZ C;  2YRD A;  3CME T;  2CT4 A;  2L3S A;  1B34 A;  2BKD N;  5CQY A;  3OW2 P;  2RA2 A;  1CKA A;  4C92 B;  2XMF A;  3JCM P;  1SSH A;  3REA B;  4C8Q F;  2EQJ A;  4QKU A;  1I0C A;  2K3B A;  1OPL A;  1D1B A;  2QXF A;  3OA6 A;  5L23 A;  3TU4 K;  2KXD A;  4LDV A;  5IXF A;  5LJ5 e;  1KQS S;  2FRW A;  1KD1 C;  2RQU A;  1PKS A;  3VUB A;  1WFW A;  3FC3 A;  3A8L B;  2FEI A;  4C0D B;  3OYA A;  3L2W A;  3GP8 A;  3MCA B;  1UEB A;  1Q86 U;  4F16 A;  4MDX A;  4M78 A;  5FRM A;  5GAN 6;  4DBQ A;  2VGM A;  3EG9 A;  3O8V A;  2CUB A;  2M0Y A;  1GFD A;  1VQ8 A;  4J9E A;  1BK2 A;  4FW1 A;  4JLG A;  2ZCF B;  4M4Z A;  1Q81 C;  4O6J A;  5KYY B;  3G4S T;  2XDD A;  1ZUK A;  1VIE A;  4ANJ A;  4N4G A;  4M77 A;  4JJB A;  2DXU A;  5DLO A;  1Q7Y R;  4DEX A;  3V8J A;  1R8O B;  3UDC A;  5KCO A;  2ROL A;  3I55 A;  2HSP A;  2FPE A;  1A0N B;  3MEV A;  4HXJ A;  2EQM A;  4DBR A;  2IPO B;  1PM3 A;  2OTL T;  1D0Y A;  4A53 A;  4QT7 A;  2O31 A;  2LQW A;  2GGR A;  4F7U E;  3CCU Q;  4KUL A;  4J9C A;  1KQS P;  1EZZ B;  2YUQ A;  1Q86 R;  1AZE A;  4FT2 A;  1VQ6 T;  3CC2 T;  2B8A A;  1XQH A;  1KJW A;  4RMO A;  3CMA Q;  1BKB A;  1IZ6 A;  3HFN A;  4Q5W A;  1Z9Z A;  5IHI A;  5A0L A;  2K9G A;  3ZFJ A;  4D8K A;  1QWF A;  2JMA A;  3QYH B;  2RJD A;  4PLL A;  4R55 A;  4C8Q A;  2X3W D;  1N6A A;  2D9T A;  4ORZ A;  5CQX A;  1W2B P;  3DLM A;  1RAG B;  3PTA A;  2G3R A;  2CT3 A;  1ZQ1 A;  1K9M C;  3I56 Q;  3SWN B;  1KQ2 A;  1TU0 B;  1AVZ C;  3CPW A;  3EGD A;  2E41 A;  1GBR A;  2HKN A;  2J06 A;  3KUF A;  3CPW S;  1VIF A;  2VXE A;  1ZUU A;  1QQJ A;  1HD3 A;  2K79 A;  2YDL A;  3G71 T;  2ED1 A;  3EH2 A;  4C92 E;  3HP9 A;  3M54 A;  1IRX A;  2HQE A;  1LPL A;  1UHC A;  4X9C A;  3JCM e;  3X24 B;  1H3H A;  5FRN A;  5GAM e;  4A4K A;  3CCE T;  3RR6 A;  1M1K C;  4P5N A;  4OGE A;  3UA6 A;  5D7U A;  4FT4 A;  1OOT A;  1TUC A;  1W70 A;  3M0P A;  1IO6 A;  4Y28 E;  4Y91 A;  3MEW A;  1VA7 A;  2LT4 A;  5FWB A;  1OEB A;  2X4Y A;  1WHM A;  4M78 E;  4LUE A;  1PHT A;  5CR2 A;  3DB3 A;  4J8O A;  2V1Q A;  1BCO A;  4FM4 B;  5KE3 A;  5IAY A;  2GCX A;  2CDT A;  1KC8 U;  2LC4 A;  2D6F A;  1T0J A;  1UJY A;  1WXU A;  1VQP A;  2A0F B;  4OMQ A;  4E7J A;  1VQO Q;  3LH0 A;  3M57 A;  5D6W A;  1GCQ C;  5GAO n;  3OS1 A;  2YSQ A;  5LL6 S;  2MPX C;  4LUD A;  1B34 B;  2EJF A;  1ZUY A;  3I9Q A;  2QGG A;  4BUG A;  1RAC B;  2X4W A;  3PE0 A;  2EYX A;  1YHQ Q;  3VYG A;  4C0Z A;  4M7A D;  4IUP A;  4RUG A;  3D7S B;  3CCS A;  1QP2 A;  1XOV A;  2X3X D;  5KH6 A;  3E1S A;  3VS3 A;  2CP7 A;  3OYK A;  1NJI C;  1XJW B;  2LJ0 A;  3DKM A;  1JB0 E;  3HL8 A;  2YRV A;  4J9D A;  2ABL A;  4C0F A;  1G3S A;  3FEO A;  3OYB A;  3JCM J;  1ZBX A;  2CSQ A;  5AYF A;  3OW2 S;  5GAN j;  3I5S A;  4RTV A;  1NEG A;  1UG1 A;  3OS2 A;  1Q82 R;  3HSB A;  3OW2 A;  2BE9 B;  2E12 A;  9ATC B;  3PIP A;  2AKL A;  2BZY A;  3CCV A;  1RI9 A;  3RMS A;  3BY7 A;  1WXB A;  4GLM A;  5LJ5 h;  2QTV A;  5LJ3 g;  3A1P A;  2K5L A;  1M9S A;  3L42 A;  1K0X A;  1DJ7 B;  4QW2 A;  2KNB B;  3LH5 A;  5GMK m;  2DX1 A;  2E6N A;  4JLI A;  3CCJ T;  4PLI A;  3EFS A;  4B9W A;  2MI6 A;  4LDW A;  2LVM A;  4PJO E;  2QQB A;  1IGQ A;  2DTO A;  3X26 B;  1G83 A;  3CCR Q;  1KD1 U;  2GTO A;  4PJO B;  2EGC A;  4AFZ C;  4HVW A;  1C6V X;  1OU8 A;  4FYV B;  5GAN d;  3N5B B;  1TUD A;  1HJD A;  2CH4 A;  1G2B A;  3M59 A;  4C92 G;  4AT1 B;  1MND A;  3MP6 A;  3URG A;  2FVU A;  2LTO A;  1MMN A;  4XAX B;  2DIG A;  4J9B A;  1OPK A;  1VQM A;  3OY9 A;  1W1F A;  5D6X A;  3FDR A;  5J26 A;  4ATO A;  3E9G A;  2M51 A;  2O9S A;  4C0D C;  4J9I A;  1V1C A;  3CD6 T;  1E6G A;  1E7O A;  3OYL A;  2HAX A;  2RHY A;  2ZPF B;  2KGT A;  4M7D A;  3S6W A;  4RKU E;  2K6D A;  4GLK A;  1QWE A;  2V8I A;  5LJ3 d;  4C92 F;  1YWP A;  2A7Y A;  1FXX A;  1VQ9 A;  2JT4 A;  3JB9 H;  1MV0 B;  2FL7 A;  3L2U A;  1JXM A;  2ZZD A;  1VQ8 Q;  1G5V A;  2E3H A;  3VS7 A;  4HVU A;  4F7U G;  4HVV A;  2O01 E;  2H3J A;  5FWC A;  2QQR A;  3J7A F;  4K11 A;  2K3Y A;  2R5M A;  4PJJ A;  2J6K A;  4PNO A;  4EDU A;  4QQD A;  2EYW A;  2A3L A;  1MUZ A;  1G3Y A;  1YBY A;  5CKE A;  2CZ7 B;  1KC8 R;  1UHF A;  3P8B B;  1WXT A;  2DRM A;  1TOV A;  1K1Z A;  1U06 A;  1R0C B;  2BZ8 A;  3MJX A;  2HQX A;  1VYT A;  1KD1 R;  4QQ6 A;  1PCX A;  1MMD A;  1OV3 A;  2MIO A;  1KHI A;  1KFZ A;  2DTI A;  5GAN h;  1PC0 A;  1SRM A;  4LD6 A;  2DL4 A;  2VKN A;  5CKD A;  1KIK A;  1M8V A;  3I55 T;  1QKX A;  2GNC A;  3LGF A;  3ME9 A;  3QII A;  3MEA A;  4E7S A;  4PFO A;  2ZGW A;  2YXY A;  3CCQ Q;  1MMA A;  1VOM A;  2DM1 A;  1VQL Q;  3VYH B;  2CKK A;  2Y4Y A;  1Q7Y C;  3GBQ A;  2FPD A;  3CC7 Q;  1M1K U;  1Q82 U;  4M78 F;  1VQ6 A;  4ELY C;  2I2L A;  4JJD A;  2VVK A;  1KQ1 A;  4R0K A;  1VQ4 Q;  1S72 T;  2KYB A;  2MWP A;  1WDX A;  5GAM j;  1XNI A;  5IN1 A;  2OJ2 A;  2L2P A;  2RJE A;  4OMF B;  2P84 A;  4D6W A;  3G6E Q;  1I07 A;  1M5Q 1;  1JU5 C;  1LJO A;  4F7U A;  3VS6 A;  1UDL A;  3GOX A;  2LJ3 A;  5CKB A;  1YIT T;  1VQ6 Q;  1K8A U;  4F14 A;  1VQ5 Q;  2K3X A;  4II1 A;  5GAO m;  3RDV A;  2CZ1 B;  3CPF A;  4ZGD B;  1K73 C;  4NL3 A;  1AOJ A;  2RHU A;  2ZPI B;  3OYY A;  5GAM h;  4XU3 A;  2O4X B;  4LE9 A;  1QW1 A;  3THK A;  2JZ2 A;  5HY6 A;  2L3R A;  5GAN 2;  2D8H A;  1QCN A;  2COW A;  1I5L A;  2WSF E;  4M75 F;  4KUI A;  5FU6 C;  4HKE A;  4M77 F;  5I2M A;  1SEM A;  2EYY A;  3JB9 D;  2LCL A;  3EGX B;  4JJC A;  5GMK e;  2DBM A;  3GIB A;  2CP2 A;  1K76 A;  4M77 D;  1FWZ A;  1NE8 A;  2L3Q A;  3GF5 A;  2ROT A;  3PMT A;  2JXB A;  3LLR A;  3VS4 A;  3CCS Q;  1NJI U;  1YNZ A;  3PT9 A;  3RBB B;  4DQ2 A;  2J7I A;  3CBO A;  3OQ5 A;  2DJZ A;  1RLQ C;  2CYZ B;  2O88 A;  4EMK A;  3VJP A;  4M75 G;  3BDL A;  4Z88 A;  1BI3 A;  2DL8 A;  3VS5 A;  1OZ3 A;  2XDP A;  3OMG A;  1Y96 A;  2EQU A;  1Y71 A;  4C8Q D;  1X27 A;  1RAE B;  2H3E B;  3KXT A;  2DD4 A;  4J9F A;  1WQ7 A;  3C94 A;  3QJY A;  3QPH A;  4LXC A;  1K4U S;  1YIJ T;  1KQS A;  1W2B S;  4FL6 A;  3JB9 I;  1ZSZ C;  1NBE B;  4BI8 B;  3OYE A;  2RQW A;  4FYY B;  3OYF A;  2ZAE A;  4VUB A;  3FB9 A;  2D0Q B;  1GL5 A;  2OAW A;  2F2X A;  1JO8 A;  3P8D A;  4B6M A;  2RHZ A;  4F17 A;  4M7D G;  4GY5 A;  3CCV T;  1AWO A;  3BDU A;  2JTM A;  3QUI A;  2RMO A;  5KYU B;  2RQT A;  1NJI R;  1U3O A;  1WJS A;  1ACM B;  1VQN Q;  4CI0 C;  2KQW A;  4WCI A;  2COZ A;  3TSZ A;  1NLP C;  1WLP B;  3FIF A;  3L2Z A;  2ECZ A;  3GPL A;  2PVG B;  4Z02 A;  2LRQ A;  3I56 A;  2C06 A;  1Q81 U;  1FMW A;  4A4H A;  1Q82 C;  2DRK A;  1Q7Y U;  2L3P A;  4E7H A;  3SB2 A;  5GAO r;  4RTX A;  2J6O A;  2RPN A;  2V8J A;  5KYN A;  5GMK j;  2YHT A;  1WHL A;  3M0R A;  2RN8 A;  4PJN A;  4C8Q E;  3UPU A;  2AHJ B;  4DOV A;  2GTJ A;  3G7Z A;  1ZSZ A;  3H0H A;  3A8M B;  2NUT B;  1PWT A;  3CME Q;  2OAU A;  1VQ7 A;  1YI2 T;  1HK9 A;  4QVZ A;  1YJN A;  4C8Q G;  2RI2 A;  4F7U B;  5GAO q;  3EG2 A;  4AMC A;  2QEX Q;  1V76 A;  4J6Y A;  2HBW A;  2C0I A;  1NPR A;  1NYG A;  4JZ3 A;  1LVK A;  2AK5 A;  3HFO A;  4RTZ A;  5LJ5 j;  4AFS C;  4XQ3 A;  2E65 A;  1WX6 A;  2O2O A;  2RQR A;  2X4J A;  1FYN A;  4KH1 B;  3A98 A;  3I5R A;  1M1F A;  2Y90 A;  1J3T A;  2CH4 W;  3G1J A;  2HQH A;  2GQV A;  3RKX A;  1VQ9 T;  1WI7 A;  2RI5 A;  4E2F B;  2HNI A;  1VQO A;  1VQP Q;  4ME7 A;  3RES A;  1WQW A;  1IGU A;  2QDY B;  2DF6 A;  3JV3 A;  4HA8 A;  3ZBD A;  2EWN A;  3M55 A;  1AWX A;  5J39 A;  4N4H A;  3M5A A;  1YJ9 Q;  1X6O A;  1CSK A;  2QGF B;  1YHQ A;  1IHV A;  3EHR A;  1YWO A;  1M1K R;  4M75 D;  2A28 A;  1LNX A;  2YUO A;  4PKC C;  1QP3 A;  3RNJ A;  1ABO A;  5GAN g;  5I22 A;  2RJF A;  4OMM A;  1B3Q A;  2ED0 A;  2KRS A;  4NL2 A;  2DA9 A;  2JM9 A;  5GAN e;  1ZLM A;  2XD0 A;  3SDZ A;  2MF2 A;  3CPW P;  1HYO A;  1O75 A;  3QKJ A;  4BI3 A;  2RI3 A;  1JQQ A;  3AHU A;  1VQL A;  1I1J A;  5IH2 A;  2V1R A;  2CRE A;  1BI0 A;  2EKH A;  3TCJ A;  1N9S A;  2FHD A;  4RCC A;  5KE2 A;  3QYG B;  5GAN 7;  1H92 A;  2BE7 D;  1YJW T;  1UGS B;  4IUR A;  2YLB A;  5GMK h;  4OP0 A;  2FZG B;  1S1N A;  2M16 A;  2KMT A;  2PVO B;  5GAM d;  4BB7 A;  2PUK B;  4JRK A;  2KDS A;  3NTK A;  2PNI A;  2XU8 A;  3PNW C;  2NYS A;  4WF2 A;  2JVV A;  3RUX A;  2EBP A;  4RTT A;  4BE0 A;  2OTJ T;  1NPP A;  5ECA A;  4EMH A;  2CP3 A;  3NPF A;  4JUV A;  4MZP A;  2F69 A;  1GXI E;  3CXC S;  2KT1 A;  2YLC A;  1S72 A;  1GCP A;  4X1V A;  3SFM A;  4M78 D;  1HSQ A;  3J80 E;  3V7R A;  1PD0 A;  5I2S A;  4C92 A;  4CC2 A;  3CCQ A;  1ABQ A;  2B86 A;  4AG2 C;  1H64 1;  2LJ1 A;  5GAO p;  1YIT A;  2F2V A;  2JTF A;  1M3C A;  2P0K A;  4M7D F;  1QCO A;  2D8J A;  3HRT A;  3EG9 B;  1ZX6 A;  2EGA A;  2P4T A;  1M90 C;  4M75 A;  3CMA T;  2JM8 A;  3LGL A;  3S3M A;  3CCE Q;  2XID A;  3GNF B;  2PU9 B;  5GAN 5;  3OBW A;  2QAS A;  1N5Z A;  1VYV A;  4C92 C;  4HCC A;  2YWW A;  5CO7 A;  2L5Q A;  4KT0 E;  3X28 B;  2V26 A;  2JUF A;  2GQI A;  1X75 C;  1N9R A;  1T3L A;  3QWY A;  1YIT Q;  3UWN A;  4M75 E;  2SEM A;  2DE0 X;  4L5G A;  3OYI A;  4LD9 K;  4J6W A;  4EPC A;  1TS9 A;  1G3T A;  2CZ6 B;  4DEY A;  3CCL A;  4AFU C;  3WVE B;  5GAM g;  1Y96 B;  2MAM A;  4M7A C;  1BYM A;  2NUP B;  5DLQ E;  2KE9 A;  2BUD A;  2F5K A;  4PJO G;  1X01 A;  2JMC A;  2EGE A;  3H0I A;  2JNG A;  2LP5 A;  4M7D C;  1M8M A;  2R58 A;  1I5O B;  2P4R A;  3OBY A;  4J7F A;  1TSF A;  4X9D A;  2VUB A;  2G6F X;  2L89 A;  4M7A A;  2DEQ A;  2FYK A;  2DIQ A;  3PGG A;  5A2Q E;  1PKT A;  2CP0 A;  2PVD B;  3PFS A;  5GAN 8;  2KEA A;  4EMG A;  1WZO A;  5LJ5 f;  2JS0 A;  3M9Q A;  2PUO B;  2L8D A;  3X25 B;  3CCU A;  1MV3 A;  4NOY A;  1EIF A;  2JW4 A;  2WSC E;  4ZN1 A;  3QSU A;  1YIJ A;  3BW1 A;  1MMG A;  4LDY A;  3MEU A;  4OF1 A;  3LX7 A;  4OML A;  3CEY A;  2COY A;  2XDB A;  2MYS A;  5CVI A;  3M0Q A;  3QXE B;  2E10 A;  2RM4 A;  2SRC A;  4BE2 A;  2KBT A;  5HK0 A;  3CCM Q;  2CGH A;  1EX4 A;  3CCR A;  1K8A C;  2F2W A;  2AZV A;  2ZPH B;  4J6X A;  4RTY A;  3V8K A;  4PL6 A;  3QZ9 B;  3I56 T;  1QVF P;  5KYW B;  1T0H A;  2QA4 T;  1U1T A;  4BI4 A;  1KHC A;  5IT9 E;  4C5H A;  1Y57 A;  1CKB A;  6AT1 B;  2KYM A;  5IHN A;  2X51 A;  4PJO C;  3SEM A;  4IIM A;  4M78 C;  3ZEH A;  1N8R R;  2KT8 A;  5KYU A;  2CP6 A;  3OSS C;  1ZSZ B;  2WSE E;  4E7K A;  1LCK A;  1ZBJ A;  1NYF A;  1PNJ A;  2J05 A;  3SWN A;  2K7A A;  4XTW A;  1H8K A;  3EGX A;  1B7T A;  3M58 A;  1VQ7 T;  3VS2 A;  5LJ5 g;  1YI2 A;  1YJN T;  1QKW A;  2KK4 A;  1GBQ A;  5LJ3 f;  2I0N A;  3JB9 J;  2OI3 A;  1YP5 A;  2RJC A;  1EFN A;  2HCK A;  1RAA B;  3JCM f;  3JB9 G;  4ZTF A;  4PK4 A;  4KRT A;  4BAC A;  1YJ9 A;  1X69 A;  2XKO C;  3M56 A;  1K73 R;  1RUW A;  1NG2 A;  2KVQ G;  1ZA1 B;  4PFP A;  4DBF A;  1RAD B;  3REB B;  5D6Y A;  1VQO T;  3ER0 A;  2K57 A;  1D1C A;  1PSE A;  4C5G A;  1VQK Q;  2QG9 B;  2QEX T;  1UJ0 A;  4PJO A;  4JS5 A;  3KBG A;  5J3B A;  2VWF A;  2O9V A;  2DBK A;  4OVA A;  3G4S Q;  4E7I A;  2HZY A;  1YHQ T;  2DO3 A;  2E70 A;  2WAC A;  2JJ9 A;  3CXC A;  2D1X A;  2L0A A;  1SKU B;  3FRN A;  1GFC A;  1RAH B;  4OB2 B;  5A0G A;  1WYX A;  1UB4 A;  1AEY A;  1KK7 A;  3VRY A;  2YT6 A;  2CUD A;  5AT1 B;  4C5I A;  3M4G A;  3RKY A;  2HSE B;  3HRS A;  2IVW A;  1FMV A;  2VC8 A;  3L2V A;  2FZC B;  1UGR B;  4PJL A;  1VQL T;  2FZK B;  4OB3 B;  5HK3 A;  1VQM Q;  3CC7 A;  1MNE A;  4OMN A;  1VUB A;  2RO0 A;  3OS0 A;  3JRZ A;  4FW2 A;  2EQI A;  1HXD A;  2QQS A;  3M53 A;  3PVL A;  1X6B A;  2NWM A;  2A37 A;  4J5Y A;  1YJW A;  4FYW B;  5CCA A;  1UE9 A;  3PVQ A;  2X35 A;  3JAM E;  1GRI A;  5A0D A;  4CC3 A;  3MP1 A;  1V29 B;  3VS1 A;  3LWH A;  1U1S A;  3INZ A;  3VKI A;  2ESW A;  4V2S A;  3M4Y A;  2DER A;  2DPP B;  2RD1 A;  4KBM B;  1WHJ A;  1R77 A;  2OTJ A;  1D0Z A;  2GBQ A;  3R6N A;  2YUN A;  4E7L A;  4N0A C;  1XTD A;  1AZG B;  3GLX A;  1OI1 A;  1AD5 A;  2DET A;  2DL7 A;  2EAY A;  5CKH A;  2VAS A;  3S3N A;  3RER A;  1SHG A;  1W2B A;  4FU6 A;  3I35 A;  1TUG B;  3V8L A;  2JTE A;  4L59 A;  3CCQ T;  3MP8 A;  4RG2 A;  1WJQ A;  2DL3 A;  1K9A A;  5C6S A;  2QTX A;  4PFZ A;  1WGS A;  4EIK A;  4F7U F;  3TQ7 P;  1F1B B;  3CMA A;  2RHI A;  1IXD A;  3EFO A;  3M0S A;  3QDR B;  1VYU A;  4JS4 A;  4JRI A;  2VXF A;  2NUP A;  4M77 C;  4A4F A;  3HPW A;  1WPY A;  2NUZ A;  4OGC A;  2GFA A;  4M7D B;  2E64 A;  2K2M A;  3X20 B;  2EVR A;  1M90 R;  2C0O A;  5FLX E;  2OTL Q;  2JS2 A;  4RCB A;  2FG0 A;  2R57 A;  7AT1 B;  2EIF A;  5L8R E;  1M1G A;  2GFU A;  3A8O B;  2LNH B;  4DA4 A;  4C0G A;  4XU0 A;  1G3W A;  3CCL T;  2R5A A;  4IUU A;  2CZ0 B;  5C0M A;  2DXT A;  3MPU B;  2NUT A;  2XI9 A;  3CC2 Q;  4M78 B;  2HKQ B;  4CC7 A;  5I11 A;  2HDA A;  2HEQ A;  2KY9 A;  5LJ3 e;  4MDW A;  1SF9 A;  3L2Q A;  4JRP A;  1I81 A;  2RB6 A;  5GAN f;  4F04 B;  3JB9 F;  2V8K A;  5FU7 B;  3ZL7 C;  3V7C A;  2KRM A;  3Q1J A;  4ESR A;  3T9N A;  1D09 B;  3L1A A;  1P92 A;  4PJM A;  5FU6 B;  4JPB W;  4M77 E;  2QDL A;  5KYX B;  3S3O A;  2GF7 A;  2DK3 A;  3EH1 A;  2EYZ A;  2D0N A;  2PQW A;  4GBQ A;  3CXC P;  2VV5 A;  1PSF A;  1JJ2 P;  3FJ5 A;  3M0U A;  1TTH B;  1UEC A;  2RNA A;  3I55 Q;  2DVE A;  4LDX A;  2ENM A;  2IG0 A;  2LCC A;  3QDF A;  4A4G A;  3QJ6 A;  3VS0 A;  2K5F A;  3CCU T;  2MOX A;  2JOY A;  3PMI A;  4E7Z A;  4J9G A;  5GMK l;  3A8H B;  4L6V 5;  1VQN T;  3UAT A;  1VQ4 T;  4JDS A;  3C95 A;  5FRO A;  4NS5 A;  2LQ8 A;  4XTX A;  2F1L A;  2O4X A;  1NZ9 A;  3NFC A;  4IIO A;  3CCR T;  3WVD B;  1FX7 A;  3NHN A;  4AG1 C;  1JXO A;  1U8R A;  3JCM g;  3O5Z A;  3OSV A;  4WTO B;  2DD5 A;  1JJ2 S;  3AT1 B;  1PRM C;  4BD3 A;  4IUV A;  4FYX B;  1VQ5 T;  1QLY A;  1JJ2 A;  3RMQ A;  3MKD A;  3SWN C;  2QK0 A;  3QWX X;  2XHC A;  2QA4 A;  1AHJ B;  4BDY A;  2KAF A;  1O9S A;  2X4X A;  3CCM T;  2E6Z A;  2DTH A;  3G71 Q;  4ZGE B;  2F5T X;  3OYJ A;  4RG8 A;  1D3B A;  4OB0 B;  3R6O A;  1M90 U;  1Q81 R;  4FIB A;  2H8H A;  1ZHI A;  3BFM A;  2PZ1 A;  4OMO A;  2E1H A;  1VQ9 Q;  3SD4 A;  4C8Q B;  4QVC A;  2LDM A;  3ULR B;  4M7A F;  2EYQ A;  3OYH A;  1Y7X A;  3FLG A;  1N8R C;  4M75 C;  1W6X A;  1X6G A;  4LN2 A;  4BE1 A;  2E3I A;  1YJ9 T;  3TVT A;  5CIU A;  5DY9 A;  4LDU A;  4MMK A;  4J7I A;  2DYI A;  4B9X A;  1NLO C;  1ZA2 B;  3OYN A;  1YI2 Q;  2A08 A;  1BCM A;  5HKC A;  1Q86 C;  3OYM A;  2HBP A;  2OX7 A;  1WHH A;  2DLP A;  3E9F A;  3QHS A;  4RTU A;  2ZPB B;  2QEX A;  4A4E A;  1K9M U;  2KI7 A;  4M7A G;  2AIR B;  3CC4 T;  3RKW A;  4AFQ C;  5CK9 A;  4M7D E;  2IIM A;  1RAF B;  1IB8 A;  1Y07 A;  2E5Q A;  2DNU A;  5FW9 A;  2RH2 A;  4M7A B;  1FMK A;  1YIJ Q;  2EPD A;  4E47 A;  2DAQ A;  4BY6 B;  1VQK T;  2FRY A;  1WHK A;  4XTV A;  2CP5 A;  3NTI A;  4MZT A;  4Z8A A;  4Y92 A;  1OU9 A;  2HL5 C;  4A63 B;  1AWW A;  3V7S A;  3CC7 T;  1N8R U;  4J83 A;  4Z89 A;  3CCV Q;  2OTJ Q;  1Y0M A;  4YTL A;  1IHW A;  3NTH A;  4CRI A;  1NEB A;  3EG1 A;  2BIV A;  3CD6 Q;  5FU7 C;  1D3B B;  3NGP A;  1I4K 1;  1S72 Q;  2HL3 A;  3UT1 A;  2DEU A;  5I21 A;  2X9H A;  3H9N A;  2ZPE B;  2DXB A;  3U23 A;  2QQ9 A;  5LJ5 d;  3G6E T;  3EHQ A;  5HCK A;  2EJ9 A;  2EJG A;  4N4I A;  4ZN3 A;  4BDZ A;  1I8F A;  2KR3 A;  1M3A A;  5CAI A;  4C92 D;  5GJV B;  4IUQ A;  4ZGJ B;  4FCY A;  1UGP B;  2M9U A;  3RIR A;  1TXQ A;  1M4Z A;  1M2V A;  2MMP A;  2HD0 A;  1JEG A;  1UGQ B;  2LX7 A;  4IKF A;  2LCS A;  3JCM c;  3IQL A;  3CME A;  1T3S A;  1K8A R;  4HT9 A;  3JCM V;  3H6Z A;  3EFR A;  4PJO F;  8AT1 B;  2KRN A;  4EMK B;  4ZTJ A;  1K73 U;  3VUZ A;  3OB9 A;  1YN8 A;  1C0M A;  3JCM b;  2MCN A;  2VYT A;  1BB9 A;  2M1H A;  2W10 A;  1SG5 A;  4LNP A;  3VRZ A;  2E5K A;  3EAE A;  2AZS A;  2P0Q A;  2RF0 A;  5LJ3 j;  3EGU A;  3QZ5 B;  4ZNX A;  3A8G B;  4JJN K;  2QI2 A;  4A54 A;  2LT1 A;  1TH7 A;  4M7D D;  4XTU A;  3H41 A;  2EKO A;  2LX9 A;  2FO0 A;  2ZPG B;  1TWB A;  2M0O A;  1VQ8 T;  1SHF A;  1NM7 A;  3A5Z B;  5LJ3 h;  1RL2 A; 
#chains in the Genus database with same CATH homology
 1M3B A;  2J6F A;  3SHW A;  2FPF A;  2DRK A;  3UA6 A;  2PTK A;  2L3P A;  4OMN A;  1OOT A;  4RTX A;  1TUC A;  2J6O A;  2RPN A;  1W70 A;  3M0P A;  1IO6 A;  3M0T A;  2EQI A;  3M0R A;  4J9H A;  2RN8 A;  3PVL A;  1X6B A;  2NWM A;  2A37 A;  1VA7 A;  2BTT A;  2GTJ A;  1BBZ A;  1UE9 A;  3PVQ A;  3H0H A;  3EG3 A;  1GRI A;  5FWB A;  1OEB A;  1X2Q A;  1PWT A;  4LUE A;  1PHT A;  4CC3 A;  3VS1 A;  4E6R A;  1X43 A;  1WIE A;  2V1Q A;  2ESW A;  1ZSG A;  2CDT A;  1T0J A;  1UJY A;  1WXU A;  2W0Z A;  4OMQ A;  3EG2 A;  1GCQ C;  2A36 A;  2GBQ A;  2YSQ A;  3R6N A;  2YUN A;  4LUD A;  1ZUY A;  2HBW A;  1AZG B;  2C0I A;  3I9Q A;  1TG0 A;  1NYG A;  4JZ3 A;  1AD5 A;  2LZ6 B;  2AK5 A;  2DJQ A;  2EW3 A;  1PRL C;  2DL7 A;  4RTZ A;  3UA7 A;  3PE0 A;  5IXB A;  4AFS C;  2EYX A;  1SHG A;  1WX6 A;  2O2O A;  2RQR A;  1FYN A;  3I35 A;  2KXC A;  4RUG A;  3A98 A;  3I5R A;  2JTE A;  1J3T A;  1XOV A;  1M27 C;  2X3X D;  2CH4 W;  5EC7 A;  3VS3 A;  1WI7 A;  4HCK A;  2DL3 A;  1K9A A;  2LJ0 A;  1M30 A;  1U5S A;  4EIK A;  1YCS B;  4J9D A;  2ABL A;  2DF6 A;  3JV3 A;  1AWX A;  1SPK A;  2C0T A;  2CSQ A;  3M0S A;  1CSK A;  1VYU A;  3I5S A;  4RTV A;  1NEG A;  1UG1 A;  3EHR A;  1YWO A;  2A28 A;  2AKL A;  2BZY A;  1AWJ A;  1UGV A;  2YUO A;  1QCF A;  1RI9 A;  1WXB A;  4GLM A;  2NUZ A;  3RNJ A;  1ABO A;  1K0X A;  5I22 A;  2K2M A;  4OMM A;  1B3Q A;  2EVR A;  2ED0 A;  2KRS A;  2DA9 A;  2JM9 A;  2LQN A;  2C0O A;  2KNB B;  3LH5 A;  3CQT A;  2JS2 A;  1ZLM A;  2FG0 A;  2DX1 A;  2LMJ A;  1BU1 A;  2LNH B;  1JQQ A;  1I1J A;  5GJW B;  5IH2 A;  2V1R A;  2CRE A;  1G83 A;  2KRO A;  2EKH A;  2GTO A;  1UTI A;  2YUP A;  2EGC A;  4AFZ C;  4CC7 A;  1GCQ A;  4HVW A;  5I11 A;  2HDA A;  2HEQ A;  1H92 A;  1TUD A;  2DIL A;  2BZX A;  1HJD A;  1S1N A;  2CH4 A;  1G2B A;  2DMO A;  3ZL7 C;  4FSS A;  2KRM A;  2PNI A;  4ESR A;  2RQV A;  1UUE A;  4J9B A;  4JPB W;  1OPK A;  4CC4 B;  2QDL A;  2EBP A;  4RTT A;  1W1F A;  2EYZ A;  2D0N A;  2M51 A;  5ECA A;  2O9S A;  2AKK A;  4GBQ A;  3NPF A;  4J9I A;  1V1C A;  2KT1 A;  3FJ5 A;  1E7O A;  1E6G A;  1RLP C;  1UEC A;  2RNA A;  3M0U A;  1GCP A;  2DVJ A;  2ENM A;  2KGT A;  4X1V A;  5IHK A;  2K6D A;  1HSQ A;  1QWE A;  1X2K A;  3H0F A;  3VS0 A;  4CC2 A;  1YWP A;  1ABQ A;  4OMP A;  1KSW A;  2B86 A;  2MOX A;  3TSW A;  4AG2 C;  2LJ1 A;  2JT4 A;  4J9G A;  2F2V A;  1M3C A;  1MV0 B;  1K0S A;  1JXM A;  2D8J A;  3UAT A;  1ZX6 A;  2EGA A;  3VS7 A;  2JM8 A;  4HVU A;  4HVV A;  1N5Z A;  1VYV A;  2CSI A;  5FWC A;  4IIO A;  4K11 A;  3NHN A;  4AG1 C;  1JXO A;  2J6K A;  2GQI A;  2EYW A;  3O5Z A;  1MUZ A;  1T3L A;  3QWY A;  3C0C A;  1UHF A;  4D8D A;  1WXT A;  1PRM C;  2DRM A;  2SEM A;  1K1Z A;  1U06 A;  2DE0 X;  4RTW A;  1QLY A;  2BZ8 A;  3UF4 A;  3QWX X;  1B07 A;  1VYT A;  4DEY A;  4AFU C;  1OV3 A;  2MIO A;  1KFZ A;  1SRM A;  2DL4 A;  1E6H A;  2VKN A;  1SRL A;  1KIK A;  2KE9 A;  1QKX A;  2GNC A;  2JMC A;  2EGE A;  3H0I A;  2LP5 A;  2H8H A;  1WA7 A;  1M8M A;  2PZ1 A;  1UFF A;  4OMO A;  2P4R A;  2DM1 A;  3GBQ A;  2FPD A;  2G6F X;  3ULR B;  4JJD A;  4JZ4 A;  2VVK A;  1Z9Q A;  1ARK A;  1W6X A;  4R0K A;  1X6G A;  1PKT A;  4LN2 A;  3KFV A;  2KYB A;  2KEA A;  3TVT A;  1WDX A;  3EG0 A;  2DYB A;  2DL5 A;  2OJ2 A;  3NMZ C;  2JS0 A;  2L2P A;  1NLO C;  2CT4 A;  2L3S A;  1MV3 A;  2A08 A;  2JW4 A;  1I07 A;  1JU5 C;  1CKA A;  2XMF A;  3VS6 A;  1SSH A;  1UDL A;  2LJ3 A;  2DLP A;  4RTU A;  3REA B;  4OML A;  4F14 A;  1I0C A;  2K3B A;  1OPL A;  3M0Q A;  4AFQ C;  5L23 A;  2KXD A;  2SRC A;  2KBT A;  5IXF A;  1AOJ A;  2FRW A;  2IIM A;  2RQU A;  1PKS A;  1WFW A;  4LE9 A;  2FEI A;  2DNU A;  5FW9 A;  1FMK A;  2EPD A;  2F2W A;  2AZV A;  3THK A;  4F16 A;  4RTY A;  2FRY A;  2CUB A;  2M0Y A;  1GFD A;  2D8H A;  4J9E A;  1BK2 A;  4M4Z A;  4Z8A A;  4Y92 A;  1T0H A;  1ZUK A;  4A63 B;  1AWW A;  4JJB A;  1Y57 A;  1CKB A;  1SEM A;  2EYY A;  4Z89 A;  4DEX A;  2KYM A;  5IHN A;  1Y0M A;  4JJC A;  2DBM A;  3SEM A;  1NEB A;  3EG1 A;  4IIM A;  2ROL A;  2HSP A;  2FPE A;  2KT8 A;  3NGP A;  1A0N B;  4HXJ A;  1K76 A;  1LCK A;  1ZBJ A;  1NYF A;  1PNJ A;  2L3Q A;  2ROT A;  2J05 A;  2JXB A;  2K7A A;  1H8K A;  4QT7 A;  3VS4 A;  2O31 A;  3U23 A;  2LQW A;  2GGR A;  1YNZ A;  3VS2 A;  4J9C A;  3RBB B;  3EHQ A;  2J7I A;  1QKW A;  1GBQ A;  1RLQ C;  2YUQ A;  5HCK A;  2I0N A;  2O88 A;  2OI3 A;  1YP5 A;  1EFN A;  1AZE A;  2HCK A;  2KR3 A;  1M3A A;  4Z88 A;  1KJW A;  2DL8 A;  5GJV B;  4KRT A;  1X69 A;  3VS5 A;  1Z9Z A;  5IHI A;  1JEG A;  2LX7 A;  1RUW A;  1NG2 A;  2LCS A;  1X27 A;  4J9F A;  3IQL A;  2K9G A;  4D8K A;  1T3S A;  1QWF A;  3REB B;  2JMA A;  1K4U S;  2KRN A;  2X3W D;  1UJ0 A;  4ORZ A;  1YN8 A;  2RQW A;  2MCN A;  1BB9 A;  2VWF A;  2CT3 A;  2O9V A;  2W10 A;  2DBK A;  4LNP A;  3VRZ A;  2E5K A;  2AZS A;  1GL5 A;  2RF0 A;  2OAW A;  1AVZ C;  2F2X A;  1JO8 A;  4F17 A;  3EGU A;  4ZNX A;  1GBR A;  1AWO A;  2J06 A;  2D1X A;  2L0A A;  2RMO A;  2RQT A;  1ZUU A;  1GFC A;  1HD3 A;  2K79 A;  2YDL A;  1U3O A;  2ED1 A;  3H41 A;  1WYX A;  1AEY A;  1UHC A;  2FO0 A;  4WCI A;  3VRY A;  2YT6 A;  2CUD A;  3TSZ A;  1NLP C;  1H3H A;  1SHF A;  1WLP B;  2ECZ A;  1NM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...