4J9GA

Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p7 at ph7
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
PNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/unknown function
molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P7
rcsb
source organism Homo sapiens
total genus 11
structure length 58
sequence length 58
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9gA00
3JV3A 1ARKA 2RQTA 1GCQA 1M3CA 1OPKA 1AWWA 1H3HA 2A36A 2LJ0A 2V1RA 1EFNA 2ECZA 2K7AA 1V1CA 2RNAA 3UATA 1VYTA 2LJ1A 2BTTA 4RTUA 2KGTA 1KSWA 2VKNA 2LQWA 4AFZC 2D0NA 1WLPB 2BZYA 2FPFA 3NGPA 2KEAA 2YT6A 1WDXA 1MV0B 2FRWA 1UE9A 1UJ0A 1X27A 2JM9A 1CSKA 1G83A 2DRKA 2KXCA 1SHGA 3M0RA 1ZUYA 1AZGB 1WXBA 2VWFA 4LNPA 3VS4A 4CC4B 2AKLA 1J3TA 2F2VA 4OMLA 5HCKA 2DMOA 1AZEA 5EC7A 1PKSA 1X2QA 1MV3A 1HJDA 2L2PA 3EG2A 3PE0A 1QWEA 2K9GA 4FSSA 2DNUA 3EG3A 5IXBA 2KRSA 4IIMA 1ZBJA 2JT4A 1TG0A 2KYBA 4CC3A 2K79A 1KJWA 2L0AA 1WXUA 4OMNA 1BU1A 1NYGA 1ZSGA 1AWXA 1S1NA 5GJVB 2JS2A 1AOJA 2YUPA 4LN2A 2J06A 4K11A 3VS6A 1K0XA 1QLYA 2YUNA 2JXBA 1K4US 2JMCA 4WCIA 1FYNA 2KRNA 1YP5A 2LP5A 1SPKA 1HD3A 2LNHB 1JO8A 1SRLA 1PWTA 2RQVA 1X6GA 1GCPA 5FWCA 1GBRA 1ABOA 2FO0A 2OI3A 4KRTA 2EBPA 4F14A 3EHRA 4JJBA 2KRMA 2PZ1A 3ULRB 2J6FA 2KROA 3O5ZA 1GRIA 2ENMA 2JW4A 1TUCA 1ZX6A 1BBZA 2JTEA 2YSQA 5I11A 1AD5A 2YDLA 4Z89A 3LH5A 2PNIA 4J9HA 4HCKA 4ORZA 1SRMA 2LZ6B 1YCSB 2LCSA 2K6DA 2CH4A 1NG2A 3NPFA 3A98A 2RPNA 4GLMA 4LE9A 2D8HA 1W6XA 4RTTA 1YN8A 2PTKA 2DF6A 2X3XD 2EGCA 2DM1A 2J7IA 5GJWB 1Y0MA 1UJYA 2AKKA 1ZLMA 2HBWA 1QKWA 1JU5C 1QWFA 2DL7A 3SHWA 2GNCA 1PRMC 1H8KA 2W0ZA 3UF4A 2FRYA 1NM7A 3UA6A 2VVKA 1H92A 1WXTA 2ED1A 3KFVA 1AEYA 1VYUA 2J6OA 2J05A 3EG0A 3NMZC 2DJQA 5IXFA 3EHQA 2A37A 1QKXA 4LUDA 1K9AA 2DILA 2DL4A 2O88A 2M0YA 2KNBB 2YUQA 4DEYA 2LMJA 3U23A 3H0IA 3TVTA 1M3BA 1X69A 2OJ2A 2L3QA 2O9SA 2V1QA 2NWMA 2DLPA 2KYMA 3ZL7C 3I5SA 1G2BA 2F2WA 2OAWA 2AK5A 1BK2A 3NHNA 5L23A 4Z88A 1W70A 1UG1A 2SEMA 1GL5A 1CKAA 2ROTA 2LJ3A 2O31A 5I22A 2KT1A 1UFFA 4RTVA 2RMOA 4JZ4A 1OV3A 2JM8A 2AZSA 1QCFA 1YNZA 2CUDA 2RF0A 2I0NA 2HCKA 1LCKA 1JQQA 2DRMA 4J9FA 4JJCA 4OMPA 5ECAA 2O2OA 1XOVA 2H8HA 1UHCA 2EYWA 2A28A 1AVZC 1WIEA 2DL5A 1WX6A 2DL3A 2EYZA 1WYXA 3M0SA 3REAB 2FG0A 2GQIA 2X3WD 2CT3A 2W10A 5IHKA 1UHFA 2DL8A 1U06A 1JXOA 1WI7A 2IIMA 2BZXA 2C0IA 2LX7A 2MIOA 2XMFA 1NEGA 1JXMA 2NUZA 2KR3A 4HXJA 4JZ3A 1VYVA 4AG2C 3GBQA 2BZ8A 3H0FA 3EG1A 1UGVA 4LUEA 4E6RA 2ABLA 3M0TA 4J9IA 2RQWA 1K1ZA 4F16A 4JPBW 1E6GA 1M8MA 1GCQC 2KXDA 2ESWA 4OMMA 2C0TA 3RNJA 1JEGA 4Z8AA 4GBQA 4HVWA 1VA7A 4AFQC 2CSQA 2ED0A 4F17A 2L3PA 2AZVA 2JS0A 1T0JA 3VS0A 4EIKA 4RTYA 2DYBA 2EVRA 3VS5A 2D8JA 5FW9A 2MOXA 4Y92A 1Z9ZA 4J9CA 2CT4A 1SSHA 3H41A 2J6KA 2A08A 4J9DA 3QWYA 1AWJA 3H0HA 2DBKA 1I1JA 1OEBA 1SHFA 1BB9A 2DVJA 2CDTA 4JJDA 1ZUKA 3I35A 2M51A 4RTZA 4QT7A 4OMOA 1K0SA 1M30A 4RTWA 4CC2A 1RUWA 3PVLA 1B3QA 1KIKA 1M27C 3VS1A 4A63B 2HSPA 3I5RA 4RUGA 1GBQA 2KBTA 3M0UA 2B86A 1X2KA 1YWOA 1NYFA 2EQIA 2JMAA 3REBB 2YUOA 2L3SA 2RN8A 2E5KA 2K3BA 4M4ZA 1Z9QA 1ABQA 1RLQC 2GGRA 1E6HA 2EGAA 1UDLA 2F2XA 3C0CA 5IH2A 1MUZA 1TUDA 4X1VA 2FPDA 3M0QA 2CH4W 1K76A 3VRZA 3I9QA 3UA7A 2EPDA 1I07A 2O9VA 4R0KA 1N5ZA 5IHNA 4RTXA 5FWBA 2KE9A 4ZNXA 3EGUA 1GFCA 2EW3A 1PHTA 1T3LA 1HSQA 2K2MA 1PNJA 4J9GA 1SEMA 3SEMA 3VRYA 2DBMA 2QDLA 2CSIA 1PRLC 1NLPC 2EYYA 2FEIA 3M0PA 1NEBA 2HEQA 2P4RA 1UUEA 1U3OA 1X6BA 2CUBA 2G6FX 3QWXX 3TSZA 1RLPC 1OPLA 1M3AA 1ZUUA 1UECA 1W1FA 2CREA 4OMQA 1RI9A 2EYXA 4J9BA 1KFZA 2DE0X 1YWPA 2C0OA 2DA9A 3FJ5A 1WA7A 2GBQA 4HVUA 2GTJA 3R6NA 2LQNA 3VS2A 1A0NB 1WFWA 4J9EA 1NLOC 4AG1C 1I0CA 2FPEA 1B07A 1GFDA 2SRCA 1AWOA 1OOTA 3VS3A 3PVQA 2EGEA 4CC7A 2DX1A 4IIOA 3IQLA 5IHIA 2RQRA 2RQUA 3RBBB 2EKHA 3VS7A 1Y57A 4DEXA 4D8DA 3CQTA 1T3SA 1E7OA 1CKBA 1FMKA 2HDAA 1U5SA 1IO6A 2KT8A 4HVVA 1PKTA 2GTOA 3THKA 4AFUC 4ESRA 1X43A 2MCNA 4AFSC 1T0HA 3TSWA 2ROLA 2D1XA 1UTIA 4D8KA
chains in the Genus database with same CATH superfamily
3JV3A 4XAXB 1ARKA 1M3CA 3BE3A 3C94A 2MAMA 2DTHA 1VIEA 1VQ8Q 1AWWA 3CPWS 2V1RA 1NJIC 1V1CA 2L3RA 4RTUA 1C0MA 3RESA 1VQKT 1DJ7B 2BZYA 1C1AA 3NGPA 1V29B 5DY9A 3OY9A 4LDXA 1UE9A 2DETA 5M9OA 1KQSP 1G83A 3L1AA 1WXBA 2LDMA 3QYGB 5HCKA 1AZEA 2HQXA 1VQNA 1X2QA 1HJDA 2X4YA 2B8AA 4ATOA 3HRSA 3I56T 3TEEA 5IXBA 1Y71A 2KRSA 1UGPB 4C8QB 2MI6A 3OYDA 2FZKB 5FU6C 2K79A 1KJWA 4XK8E 1BU1A 2RO0A 1NYGA 1AWXA 2MK5A 1M8VA 1AOJA 1VQKA 2J06A 4K11A 1M2VA 4A4GA 2QGGA 2XIDA 1FYNA 3EFSA 3JB9I 4HA8A 3CC4Q 1SPKA 2COWA 4FYWB 3M4YA 2QA4Q 1PWTA 3EGXA 1MNEA 3OS1A 1M1KC 2EBPA 1PM3A 4JJBA 2PZ1A 3X26B 3TU4K 2XICA 2J6FA 2DIGA 1BKBA 1WHKA 5CCAA 2ENMA 1SF9A 3I56A 3CC2A 3CCJQ 2XD0A 3LH5A 1VQMT 1QP2A 4N0AA 3FRNA 2LCSA 4BY6C 2CH4A 3QIIA 2K5FA 1NG2A 2RPNA 4GLMA 4M7AC 3EH2A 1W6XA 4RTTA 2FB7A 2YLBA 2ZZDA 2F5KA 1VQOT 2DM1A 1YFNA 1VQ6A 1K8AR 4IUUA 1RAIB 2AKKA 3ZEHA 1KC8C 5KYUB 3SHWA 1VQ4Q 2GNCA 1YBYA 4J83A 1Q82U 3JCMc 1OU8A 1NM7A 2FRYA 2M1HA 3FLGA 1N9SA 3HL8A 4R56A 3CMET 1JJ2A 1WXTA 1W2BP 1G3TA 1VQ9Q 2CP6A 4N4HA 1ZHIA 1Q81U 3OMCA 3ME9A 1K9AA 3GPLA 4PLLA 1VQMA 3UT1A 4DEYA 1YHQT 4HT8A 1R0CB 5AT1B 1BI0A 3M9QA 1M90U 2CP2A 1EZZB 4M78G 2X51A 2NWMA 2K4YA 2DLPA 2WSEE 4M78F 4RCBA 1VQOA 1RAGB 4E7ZA 5CR2A 2E65A 1TWBA 4PJLA 2AK5A 1BK2A 3JB9G 2LNVA 2XDPA 4FT2A 3JB9F 4F7UB 1UG1A 1G8XA 5KE2A 5I22A 2KT1A 3CMEA 5LJ3f 3X28B 3PMIA 2AZSA 2RF0A 1M5Q1 1LCKA 1JQQA 4HKEA 2DRMA 3AHUA 1UB4A 1YHQA 3PGGA 3KUFA 4PL6A 1G3SA 3CCRT 1WIEA 2DL3A 2KDSA 4C92G 3L2ZA 2R5MA 3M0SA 3REAB 4FYVB 4C92F 2PUOB 4VUBA 3PNWC 1KD1U 3M58A 2HNIA 3M4GA 1JXOA 2BZXA 2QDYB 3L2QA 2GFAA 2X9HA 2MIOA 2XMFA 4FL6A 5KYYB 1NEGA 2BKDN 1I5OB 4JZ3A 2KR3A 3GBQA 2DAQA 1WHLA 2ABLA 3M0TA 3X24B 1M1GA 2HSEB 4F16A 5A0DA 1E6GA 1M8MA 1BI2A 1Q86R 2DERA 2EIFA 4HVWA 4XU1A 3G71T 1FXXA 2ED0A 2CS7A 2KI7A 2BE7D 3L2WA 4EIKA 3CCRA 4M7AD 4OP0A 5CKFA 5D6XA 3A1PA 4Y92A 2DEUA 3QZ9B 4F7UE 1BI1A 2BUDA 4LDWA 4PJOG 3A8MB 3EGDB 1D1BA 4PJOF 3RUXA 3QWYA 1AWJA 4IUTA 2LCCA 3FEOA 3RR6A 5FU7C 2MWOA 1I1JA 1OEBA 4BACA 4MZPA 5KH6A 3OW2A 1BB9A 4M7AA 1KQ1A 1YJWQ 2CDTA 1ACMB 2M51A 4RTZA 1QVFS 1K0SA 1RUWA 3PVLA 1M27C 1RAEB 3VS1A 3PT9A 3G4SA 1GBQA 3M0UA 2Y4XA 4M77C 3G71A 1YWOA 3REBB 4FSXA 2K3BA 2F69A 5GAN4 4PFZA 1ABQA 3EH1A 2EGAA 2F2XA 3C0CA 3HSBA 3RKYA 5GANh 4N4IA 1NJIR 4IURA 2CH4W 3QBYA 5J39A 3VRZA 2FZGB 3I9QA 1Y96A 3EG9A 5A0GA 1PC0A 5KCHA 2E6NA 5CAIA 3OMGA 1N5ZA 4M75B 2CZ7B 2QQSA 3ZFJA 1YJNQ 3F70A 4Z02A 4M7DC 1QW1A 3EGUA 2PVDB 1T3LA 4A4HA 1IRXA 1HSQA 1P92A 1YJ9Q 3OYIA 5GAOq 4J9GA 2CSIA 3A8LB 1NLPC 4L6V5 3EFOA 2L8DA 1ZQ1A 1NBEB 1NEBA 3QPHA 2EAYA 3OQ5A 1PSEA 1NE8A 1U3OA 2EFIA 2G6FX 2M0OA 1M3AA 3BFMA 1ZUUA 4OB2B 4DBRA 3VU3C 2EWNA 3I55Q 2IVWA 3JCMh 5KE3A 1V76A 3SB2A 2K5IA 3GP8A 2GBQA 3JCMe 4C0GA 4RG8A 2RA2A 4AG1C 2VV5A 1EIFA 1S72T 3OSSC 5CKEA 1GFDA 4C0DC 3PVQA 4IUVA 2EGEA 2QK0A 4IUPA 1UGQB 5IHIA 2RQRA 8ATCB 3NTHA 4J8OA 3LYIA 2G3RA 1E7OA 1D0ZA 2HDAA 4ZN1A 1M1KR 2BIVA 1KK7A 4HVVA 5I2MA 1XJWB 2DD5A 2V8KA 3ER0A 4AFUC 4C8QG 4ESRA 1X43A 2RHUA 4AFSC 1T0HA 4C8QF 2ROLA 1OI1A 2XG8D 1M9SA 2R58A 4D8KA 1R77A 1ZSZC 4EMKA 2A36A 1IZ6A 2QGFB 3LWIA 2K7AA 1Q7YR 2RNAA 3CCMT 3L2RA 3UATA 1VYTA 2BTTA 1S72A 4J6YA 5IN1A 2VKNA 5LJ3h 2D0NA 4ZTJA 2VUBA 2KEAA 5FLXE 3CCLT 2FRWA 4M78E 2JM9A 2H3EB 3QDFA 5GAN5 1CSKA 4M77D 2DRKA 4ZN3A 5LJ3e 5GAMh 1VQNQ 1JRIA 1SHGA 4XQ3A 3VS4A 3E9GA 1YI2Q 2VGNA 2AKLA 2DMOA 1PKSA 3C4SA 4XU3A 4Y28E 1R8OB 2DXBA 3DKMA 4KUIA 4BD3A 3MCAB 1QWEA 2K9GA 2QQRA 3EG3A 1OQKA 1FX7A 1TG0A 3G6ET 4M77A 4CC3A 3FIFA 2K5LA 1VQKQ 2L0AA 1IGQA 3CCMA 4M7DD 3TREA 2QTXA 1JJ2P 2JS2A 2KK4A 2XHCA 1VQ5T 3OYGA 1SKUB 2EQJA 3VS6A 5GAN2 1QLYA 4J7FA 5EG2A 4C92E 3CBMA 3JCMV 1QMCA 2KRNA 3CCLA 3CMAT 1HD3A 5AYFA 4X9CA 1HXDA 3CD6Q 1VUBA 1ABOA 2FO0A 4M7DA 3I56Q 1Q82C 3EHRA 2KRMA 2ZPGB 3E19A 1GRIA 3WXMB 3OYNA 4EDUA 2EYQA 2YSQA 4Z89A 3L2UA 4FW1A 2CP3A 3G6EA 3HHTB 4ORZA 2LZ6B 1B34A 2RK2A 3UDCA 3JB9J 2L89A 1YCSB 2K6DA 3CCVT 3CCUQ 1HK9A 2O4XA 3NPFA 3A98A 4LE9A 2D8HA 1VQ5A 5LJ5g 4MDXA 2X3XD 2J7IA 3CXCS 1EX4A 1Q95G 2FZCB 3CMAA 2DL7A 4PJOE 1OZ3A 3OYEA 1PRMC 3WVEB 1H8KA 2ZPBB 5A2QE 2VVKA 2ED1A 1K8AU 4GY5A 1AEYA 1N9RA 1VYUA 2J6OA 3KBGA 5IXFA 3CPWA 3EHQA 2P4TA 3DLMA 2DL4A 3V7SA 5KYXA 1D0XA 2YUQA 3E2UA 1VQ7A 1M2VB 3TVTA 1VQOQ 1M3BA 3CCVA 1PD1A 2L3QA 2D0QB 1ZSZA 1D1CA 1Y07A 2KYMA 3EGXB 4JS5A 2P0PA 2DO3A 3I5SA 2F2WA 2HD0A 5FROA 2CZ0B 2RK1A 3NHNA 1N27A 5L23A 2JUFA 2XU8A 3CMEQ 2HZYA 3CC2T 2RHZA 2SEMA 4V2SA 5CQXA 2K57A 2RMOA 3VKIA 4JZ4A 3NFCA 4A4EA 1OV3A 1WZOA 2YRDA 4MZTA 5GMKi 5IT9E 2CUDA 1QCFA 1YNZA 1ZBXA 2K3YA 4J6XA 3OBYA 4J9FA 1G3WA 3QJYA 3RMQA 4OMPA 1VQ6T 2FHDA 4E7KA 5GANf 2VXEA 2H8HA 4OB1B 2EYWA 4ZGJB 3OW2P 1WHJA 2EYZA 3MHXA 3OA6A 2X3WD 2CT3A 2W10A 1KQ2A 3CC7Q 4JRIA 2DL8A 3MP6A 1M1FA 2C0IA 2CGHA 2E3IA 1M2OA 2LX7A 2HQEA 4OVAA 2JVVA 3OYKA 1JXMA 2F1LA 2VGMA 2VYTA 4HXJA 4ZGDB 1B7TA 1VYVA 1WPYA 1UGVA 4OGCA 5LJ3j 2DZCA 4X34A 4E6RA 4J9IA 4JPBW 3PTAA 2OX7A 1MGQA 1GCQC 2KXDA 1JB0E 4OMMA 4RG2A 1JEGA 1VQ8T 1YIJT 2PVOB 3CCRQ 2XI9A 2CSQA 2Y90A 2JS0A 2EJ9A 2KQWA 1T0JA 3JCMf 2JTFA 4XTXA 4DBFA 1FMVA 1Q86U 4FW2A 1Z9ZA 4J9CA 4C8QE 2PUKB 1SSHA 3UPUA 4M75G 3HKSA 4XTVA 4BB7A 5CIUA 4E7JA 3JCMJ 3QUIA 4M75F 1I81A 2GF7A 2OAUA 1QCOA 5LJ3d 4LD9K 4XU0A 1SHFA 4PLIA 2HMAA 1NPRA 3LGFA 1N8RU 1LJOA 2X35A 4OMOA 5L8RE 1KIKA 4BDZA 1RAFB 1VQ8A 1YIJA 4JRQA 3M59A 1X2KA 1NYFA 2MYSA 2YUOA 2RN8A 2E5KA 5FU6B 1K9MC 1QQJA 2LT4A 2GGRA 1E6HA 2HL3A 1TUDA 1K76A 2QA4T 2V8IA 3UA7A 4DBQA 2I2LA 1XNIA 2E70A 2DEQA 5GAMf 5FWBA 4ZNXA 2KAFA 1NJIU 1PNJA 3CCJT 4C0ZA 3SWNC 2QDLA 2EYYA 4BUGA 1AHJB 2M02A 4JRKA 4E7LA 2RI5A 3M0PA 4ELZC 3PFSA 3INZA 4JLGA 4J7IA 1UUEA 3BDUA 1WHGA 1X6BA 3TSZA 4XTWA 4KGVB 1XTDA 3V8JA 1OPLA 1OYXA 1WJQA 4FCYA 2RJCA 2RHIA 5GAOm 2CREA 2JNGA 4J6WA 1RI9A 1QVGS 3CC4A 5CKBA 1YWPA 2DA9A 1GXIE 4M7AB 1WA7A 4HVUA 1VQ4T 2QA4A 2GTJA 2LQNA 5KYWA 1A0NB 1WFWA 3MP8A 4EMKC 3G4ST 1KQSS 2E41A 2DD4A 4E7HA 4F7UA 3JSCA 4WF2A 2SRCA 1OOTA 2QG9B 1MMDA 4M78C 4PFPA 3IQLA 2RJFA 4DA4A 3RBBB 4N4GA 4KGXB 2E10A 3CCJA 1PD0A 1T3SA 1CKBA 2K3XA 2KT8A 1LVKA 2EQKA 3MKDA 1PKTA 3O8VA 3THKA 4OB0B 1IGUA 3M56A 4IKFA 3PMTA 2E3HA 1IB8A 3TSWA 2K2VA 2GCXA 2D1XA 2O01E 1WJSA 1Y96B 3EG9B 2RQTA 1GCQA 2RI2A 2MWPA 1M1KU 1K73C 4KUDK 3S3MA 5CVIA 2LJ0A 1EFNA 1VQPT 1VQ4A 2JTMA 4O6JA 4E2FB 4F04B 5KYYA 1BCOA 1QVFA 2KGTA 1KSWA 2LQWA 4AFZC 4C92C 4HCZA 3EFOB 1WLPB 2FPFA 2E5QA 2YT6A 2OTLT 1WDXA 1MV0B 3J81E 2M9UA 4KT0E 3DLLA 1Q7YU 1IHWA 4KH0B 2KXCA 3QDRB 3M0RA 1ZUYA 2ZPIB 3MP1A 2QXFA 2F2VA 4OMLA 4QQDA 4LDVA 4DBHA 2CZ1B 3S6WA 1MV3A 2YRVA 1RADB 3OS2A 4C0FA 5GANe 3HRUA 4FSSA 2DNUA 3RDVA 4BI4A 4IIMA 1D0YA 3CCMQ 1ZBJA 3S3OA 3QKJA 2KYBA 1VQPA 2RB6A 4O5VA 1WXUA 3S3NA 2AT1B 4OMNA 3CCET 5HY6A 3OBWA 1ZSGA 1BYMA 1S1NA 5GJVB 1X01A 3OYJA 2YUPA 3D7SB 1YITT 3H6ZA 3CPWP 1MMAA 1K0XA 2YUNA 2JXBA 3CCQT 1RACB 5D6YA 4WCIA 2OTLA 1W2BS 4PJOC 3JRZA 5GAOr 1JO8A 3MEVA 4ZGEB 1X6GA 1GCPA 1GBRA 4P5NA 1PSFA 3CCST 2OI3A 3BDLA 6AT1B 2E12A 2Y4YA 4F14A 4EMHA 4OMFB 3ULRB 2KROA 3O5ZA 4MZMA 4LD6A 3G6EQ 2JW4A 1TUCA 3SWNA 2QEXT 1WHMA 2DJZA 3E9FA 4JDSA 1I4K1 4J9HA 3MPUB 2VXFA 4HCKA 1SRMA 1TTHB 3Q1JA 4D6WA 3CCEA 1D1AA 4M78D 3N5BB 2GQVA 5GAOp 2EJFA 1YITA 1D3BA 2PTKA 2DF6A 5FU7B 2EGCA 5GAOl 3CCQA 1OX9A 4Y91A 1Y0MA 2R57A 1VQLT 3JB9D 1UJYA 1ZLMA 2HBWA 4M75E 4OB3B 1QWFA 4PK4A 4A53A 1N6AA 4FU6A 3META 5HKCA 2W0ZA 3J7AF 3CCSA 2FVUA 4R55A 2E4HA 4M78A 4M77B 5DLOA 4ELYC 3NMZC 1BIAA 2J05A 3EG0A 2DJQA 3M5AA 1NPPA 4LUDA 1IXDA 2QEXA 2DILA 4C5GA 2A3LA 1IHVA 4J5YA 2O88A 3ZBDA 2PQWA 2KNBB 2RHYA 3CCVQ 1KC8R 5A0LA 1LPLA 3CEYA 3H0IA 1YJNT 4C92D 4XTZA 4RCCA 8AT1B 2E6ZA 2YHTA 5GAMe 2D9TA 2KSSA 1G2BA 2E1HA 4M7DB 1VQLA 3X25B 4AT1B 2DXTA 2V8JA 4FYYB 4Z88A 5I2SA 2GFUA 4NS5A 2WSCE 4C92A 3OS0A 4RTVA 2M16A 2JM8A 3OB9A 1B34B 2I0NA 3VYHB 4CRIA 3PIOA 4JJCA 1KG1A 2OTJT 5ECAA 4LDYA 4B6MA 1K9MR 2Z0WA 1XOVA 1UHCA 2A28A 1UGRB 1YJNA 4C8QC 3OYCA 3J80E 1WJRA 3OYYA 1TUGB 2QQAA 4PJOD 5IHKA 4M77E 3CC2Q 1UHFA 3OSVA 4C0DB 1U06A 1WI7A 2IIMA 3KXTA 3JCMb 2QI2A 3CBPA 1Q81C 4WTOB 1SSFA 4AG2C 3AT1B 3H0FA 2CP7A 2COZA 5KYXB 1VQ7T 2JJ9A 2HBPA 1K1ZA 4KBMB 3L2VA 2YRCA 1VQ6Q 1FMWA 1WNLA 1N8RC 2YWWA 4PJOA 4Z8AA 5DLQE 1D09B 4GBQA 1M90C 1MMNA 5LL6S 5GAOn 5GANj 2OTJA 4KH1B 1ZSZB 4M7DE 4RTYA 3FB9A 2EVRA 3CXCA 2QASA 2D8JA 1XQHA 3UWNA 4YTLA 1O9SA 2NUPA 4DQ2A 1I5LA 4LXCA 3OYFA 2C06A 3A5ZB 2VC8A 2MF2A 4BI3A 2X4WA 2ZGWA 5CQYA 4J9DA 1VQMQ 2DPPB 1YI2T 2JZ2A 4BE0A 3H0HA 1BCMA 1ZA1B 2LX9A 4FIBA 2NUTA 1YIJQ 4JJDA 2RM4A 4GLKA 4EMGA 1UGSB 4QT7A 4CC2A 4RTWA 5GANd 1X75C 2EQMA 5LJ5f 4A63B 2QAZA 4QW2A 4C5IA 3I5RA 4B9XA 2B86A 1TU0B 1QVGP 2EJGA 4PJMA 2JMAA 2L3SA 2HL5C 2QQ9A 2HAXA 1FWZA 1OULA 4QQ6A 4M7AG 1KD1C 1Z9QA 1C6VX 5GANg 1K73R 4NL3A 4M7AF 5GAN6 2BE9B 5GMKm 2E64A 1W4SA 3OYAA 1MUZA 3BY7A 3FJPA 3HP9A 2FPDA 3M0QA 3GIBA 3RKWA 4MMLA 4CI0C 2DZ9A 3CD6T 1YI2A 3QO3A 3P8HA 1YHQQ 1I07A 2O9VA 1LOJA 3MEUA 4R0KA 5IHNA 3CBOA 3MJXA 3MEWA 4RTXA 3V7CA 2KE9A 2EW3A 1PHTA 2K2MA 4TVRA 3JCMd 1AT1B 2X4JA 1SEMA 1QVPA 4II1A 2DBMA 3VV0A 1PRLC 2CYZB 3C12A 2FEIA 1Y7XA 4ZTFA 2WACA 4C8QD 2HQHA 2P4RA 3A8HB 3FDRA 3CCUT 2YXYA 1QVFP 1RLPC 4RMOA 3JCMg 3RERA 1UECA 3MO8A 1PG5B 5KCOA 4OMQA 2EYXA 5KYNA 2EQUA 2DE0X 3LWHA 3R6NA 2LTOA 3QHSA 3VS2A 3CD6A 3GOXA 5GAN8 4JRPA 5GAMj 1I0CA 4C8QA 2NYSA 2FPEA 2LQ8A 2DVEA 4OGEA 3SD4A 1AWOA 3EAEA 3VS3A 4BE2A 3LGLA 4BDYA 2ZPHB 4IIOA 4MMKA 2KVQG 1Y57A 4D8DA 3CQTA 1IO6A 1Q7YC 3VUBA 3P8DA 2XDBA 2GTOA 4XTYA 3LW5E 3CCUA 5FRNA 2MCNA 3SFMA 4QQGA 4AMCA 4X9DA 1BIBA 1QCNA 3DB4A 5D6WA 1JJ2S 3OYHA 1HYOA 3QXEB 5GAMd 3G4SQ 1OPKA 1H3HA 2ECZA 3G71Q 2LJ1A 5LJ3g 4A4FA 2CZ6B 2CP5A 2LCLA 1KHCA 3FC3A 5CO7A 5GAMg 1UJ0A 1X27A 1RABB 1QP3A 4PFOA 1AZGB 2VWFA 4LNPA 1NZ9A 4CC4B 3CC4T 1J3TA 2DXCA 5EC7A 2LQKA 2P0QA 3HFOA 4EPCA 2L2PA 2H3JA 1ZA2B 3EG2A 3PE0A 5KYUA 3G7ZA 5KYWB 1G3YA 4DOWA 2JOYA 1VQPQ 3CC7T 1U1SA 2AHJB 5GMKh 2JT4A 2RI3A 4QKUA 2DIQA 2LVMA 5GMKe 3LH0A 3V8LA 4PJNA 2IG0A 2OTLQ 4LN2A 4E47A 4E7SA 2DKGA 5GMKl 1K4US 5HK0A 2JMCA 3OYMA 1OU9A 4M75C 1YP5A 2LP5A 3HRTA 1OX8A 2LNHB 4M77G 2JN0A 1SRLA 3H8ZA 4XTUA 2RQVA 5FWCA 4M77F 2KY9A 4BY6B 3JB9H 2ATCB 3LX7A 4DOVA 2QYZA 4KRTA 4BE1A 2PVGB 3V8KA 1QVGA 4HT9A 1ZX6A 1BBZA 2JTEA 5I11A 3CC7A 1VQ9T 1WHHA 1AD5A 2YDLA 3CCEQ 1KQSA 2PNIA 5GAN7 3GNFB 3JCMW 1YITQ 2RD1A 4M7DG 3CCQQ 3CPFA 2MPXC 3DB3A 1Q82R 2RH2A 2PU9B 5J26A 4M7DF 1YN8A 4PJJA 5GJWB 2F5TX 2RHXA 5LJ5h 1BI3A 1R0BG 2CKKA 1Q81R 2MMPA 3CCSQ 3QSUA 1QKWA 3HFNA 1JU5C 4NL2A 3V7RA 1RI0A 4HCBA 5LJ5e 3M55A 3QYHB 2X4XA 3UF4A 3UA6A 1WQ7A 2HKQB 1S72Q 2NLUA 1H92A 3GNGA 3KFVA 2QEXQ 4QVDA 1N8RR 1PCXA 1X6OA 1M4ZA 3OW2S 1M90R 2A37A 1QKXA 3OS5A 1F1BB 3URGA 1VQ9A 1SG5A 3JAME 2M0YA 2LMJA 5IAYA 3U23A 3GLXA 3EFRA 1X69A 2OJ2A 2O9SA 1VQLQ 7AT1B 2V1QA 2DTIA 4RKUE 4M7AE 3ZL7C 4A54A 1KC8U 3RMSA 2OAWA 1MHNA 2V26A 1KHIA 2RJDA 3TQ7P 1W70A 3H9NA 1GL5A 3EGDA 3L42A 3SWNB 4PNOA 3CXCP 1CKAA 2ROTA 2LJ3A 2O31A 1UFFA 1VOMA 4ANJA 3G1JA 3T9NA 4FT4A 3GF5A 2A0FB 3E1SA 2HCKA 3CCLQ 2O2OA 1KD1R 3MEAA 3QZ5B 3C95A 1D3BB 5FRMA 3VJPA 1AVZC 3RIRA 1RL2A 1H641 2DL5A 3PIPA 1WX6A 2VASA 1LNXA 3RKXA 1IREB 1WYXA 4L59A 2AIRB 1W2BA 2ZPFB 2RJEA 2FG0A 2GQIA 2LC4A 2WSFE 4M75D 4EMKB 4QVZA 4XU2A 1YCYA 3QG1A 1K9MU 3R6OA 2XDDA 1RAHB 1K8AC 4M78B 4JJNK 2NUZA 2DYIA 2BZ8A 3EG1A 4LUEA 5CKDA 2ZPEB 2RQWA 3VYGA 2P84A 3BW1A 3JCMP 1VQ5Q 5J3BA 4KULA 2ESWA 2OTJQ 4M75A 2C0TA 2D6FA 1VIFA 4C5HA 3RNJA 1YJWT 1VA7A 3HPWA 4AFQC 3CMAQ 3SDZA 4F17A 2L3PA 2AZVA 1TOVA 3VS0A 1WQWA 3QJ6A 1TH7A 2DYBA 3VS5A 5FW9A 2MOXA 4MDWA 1TSFA 2CT4A 4LDUA 5D7UA 5GMKj 3H41A 2J6KA 2A08A 1G5VA 2KMTA 1O75A 4C92B 2DBKA 4Q5WA 1VQ7Q 4IUQA 1UEBA 3A8GB 5HK3A 1MMGA 2DVJA 1RAAB 1I8FA 1ZUKA 2A7YA 3I35A 2YLCA 1M30A 1JBMA 4JS4A 2R5AA 1B3QA 3HTRA 5DM7R 2HSPA 1YJWA 1YJ9T 4FYXB 4RUGA 1WGSA 2KBTA 4L5GA 2EQIA 4HCCA 2CP0A 3JCMQ 4PKCC 4M4ZA 2DTOA 3P8BB 2P0KA 1RLQC 1UDLA 5IH2A 4X1VA 1MNDA 1TS9A 3LLRA 3TCJA 4JLIA 3I55T 2EPDA 1OZ2A 2L5QA 4NOYA 4FM4B 1K73U 2O4XB 4JUVA 5GAN3 3M54A 4PJOB 1GFCA 2EKOA 4OF1A 2ZAEA 5LJ5j 1U1TA 3SEMA 3VRYA 2COYA 3OYLA 4QVCA 1YJ9A 1Q86C 1U8RA 5CKHA 4N0AC 2QQBA 2NUPB 2HEQA 2CUBA 3QWXX 4B9WA 2LRQA 2XKOC 2XK0A 1W1FA 4KGZB 4E7IA 4J9BA 1KFZA 2FL7A 2C0OA 3FJ5A 3WVDB 9ATCB 3I55A 3A8OB 2NUTB 4J9EA 4C5EA 1NLOC 2FYKA 4UC4A 1B07A 1TXQA 2QTVA 2DK3A 3X20B 5LJ5d 2LT1A 5CK9A 2DFUA 2ZCFB 4ME7A 3OYBA 4CC7A 2DX1A 2RQUA 5C6SA 2DXUA 2EKHA 3VUZA 4A4KA 3M53A 3VS7A 4BI8B 4DEXA 2HKNA 3M57A 1FMKA 1U5SA 5C0MA 2IPOB 3ASKA 1H3ZA 1VQNT 4F7UG 3JCMX 3NTKA 3NTIA 5I21A 2VB6A 4F7UF 1UTIA
chains in the Genus database with same CATH topology
3JV3A 1ARKA 2RQTA 1GCQA 1M3CA 1OPKA 1AWWA 1H3HA 2A36A 2LJ0A 2V1RA 1EFNA 2ECZA 2K7AA 1V1CA 2RNAA 3UATA 1VYTA 2LJ1A 2BTTA 4RTUA 2KGTA 1KSWA 2VKNA 2LQWA 4AFZC 2D0NA 1WLPB 2BZYA 2FPFA 3NGPA 2KEAA 2YT6A 1WDXA 1MV0B 2FRWA 1UE9A 1UJ0A 1X27A 2JM9A 1CSKA 1G83A 2DRKA 2KXCA 1SHGA 3M0RA 1ZUYA 1AZGB 1WXBA 2VWFA 4LNPA 3VS4A 4CC4B 2AKLA 1J3TA 2F2VA 4OMLA 5HCKA 2DMOA 1AZEA 5EC7A 1PKSA 1X2QA 1MV3A 1HJDA 2L2PA 3EG2A 3PE0A 1QWEA 2K9GA 4FSSA 2DNUA 3EG3A 5IXBA 2KRSA 4IIMA 1ZBJA 2JT4A 1TG0A 2KYBA 4CC3A 2K79A 1KJWA 2L0AA 1WXUA 4OMNA 1BU1A 1NYGA 1ZSGA 1AWXA 1S1NA 5GJVB 2JS2A 1AOJA 2YUPA 4LN2A 2J06A 4K11A 3VS6A 1K0XA 1QLYA 2YUNA 2JXBA 1K4US 2JMCA 4WCIA 1FYNA 2KRNA 1YP5A 2LP5A 1SPKA 1HD3A 2LNHB 1JO8A 1SRLA 1PWTA 2RQVA 1X6GA 1GCPA 5FWCA 1GBRA 1ABOA 2FO0A 2OI3A 4KRTA 2EBPA 4F14A 3EHRA 4JJBA 2KRMA 2PZ1A 3ULRB 2J6FA 2KROA 3O5ZA 1GRIA 2ENMA 2JW4A 1TUCA 1ZX6A 1BBZA 2JTEA 2YSQA 5I11A 1AD5A 2YDLA 4Z89A 3LH5A 2PNIA 4J9HA 4HCKA 4ORZA 1SRMA 2LZ6B 1YCSB 2LCSA 2K6DA 2CH4A 1NG2A 3NPFA 3A98A 2RPNA 4GLMA 4LE9A 2D8HA 1W6XA 4RTTA 1YN8A 2PTKA 2DF6A 2X3XD 2EGCA 2DM1A 2J7IA 5GJWB 1Y0MA 1UJYA 2AKKA 1ZLMA 2HBWA 1QKWA 1JU5C 1QWFA 2DL7A 3SHWA 2GNCA 1PRMC 1H8KA 2W0ZA 3UF4A 2FRYA 1NM7A 3UA6A 2VVKA 1H92A 1WXTA 2ED1A 3KFVA 1AEYA 1VYUA 2J6OA 2J05A 3EG0A 3NMZC 2DJQA 5IXFA 3EHQA 2A37A 1QKXA 4LUDA 1K9AA 2DILA 2DL4A 2O88A 2M0YA 2KNBB 2YUQA 4DEYA 2LMJA 3U23A 3H0IA 3TVTA 1M3BA 1X69A 2OJ2A 2L3QA 2O9SA 2V1QA 2NWMA 2DLPA 2KYMA 3ZL7C 3I5SA 1G2BA 2F2WA 2OAWA 2AK5A 1BK2A 3NHNA 5L23A 4Z88A 1W70A 1UG1A 2SEMA 1GL5A 1CKAA 2ROTA 2LJ3A 2O31A 5I22A 2KT1A 1UFFA 4RTVA 2RMOA 4JZ4A 1OV3A 2JM8A 2AZSA 1QCFA 1YNZA 2CUDA 2RF0A 2I0NA 2HCKA 1LCKA 1JQQA 2DRMA 4J9FA 4JJCA 4OMPA 5ECAA 2O2OA 1XOVA 2H8HA 1UHCA 2EYWA 2A28A 1AVZC 1WIEA 2DL5A 1WX6A 2DL3A 2EYZA 1WYXA 3M0SA 3REAB 2FG0A 2GQIA 2X3WD 2CT3A 2W10A 5IHKA 1UHFA 2DL8A 1U06A 1JXOA 1WI7A 2IIMA 2BZXA 2C0IA 2LX7A 2MIOA 2XMFA 1NEGA 1JXMA 2NUZA 2KR3A 4HXJA 4JZ3A 1VYVA 4AG2C 3GBQA 2BZ8A 3H0FA 3EG1A 1UGVA 4LUEA 4E6RA 2ABLA 3M0TA 4J9IA 2RQWA 1K1ZA 4F16A 4JPBW 1E6GA 1M8MA 1GCQC 2KXDA 2ESWA 4OMMA 2C0TA 3RNJA 1JEGA 4Z8AA 4GBQA 4HVWA 1VA7A 4AFQC 2CSQA 2ED0A 4F17A 2L3PA 2AZVA 2JS0A 1T0JA 3VS0A 4EIKA 4RTYA 2DYBA 2EVRA 3VS5A 2D8JA 5FW9A 2MOXA 4Y92A 1Z9ZA 4J9CA 2CT4A 1SSHA 3H41A 2J6KA 2A08A 4J9DA 3QWYA 1AWJA 3H0HA 2DBKA 1I1JA 1OEBA 1SHFA 1BB9A 2DVJA 2CDTA 4JJDA 1ZUKA 3I35A 2M51A 4RTZA 4QT7A 4OMOA 1K0SA 1M30A 4RTWA 4CC2A 1RUWA 3PVLA 1B3QA 1KIKA 1M27C 3VS1A 4A63B 2HSPA 3I5RA 4RUGA 1GBQA 2KBTA 3M0UA 2B86A 1X2KA 1YWOA 1NYFA 2EQIA 2JMAA 3REBB 2YUOA 2L3SA 2RN8A 2E5KA 2K3BA 4M4ZA 1Z9QA 1ABQA 1RLQC 2GGRA 1E6HA 2EGAA 1UDLA 2F2XA 3C0CA 5IH2A 1MUZA 1TUDA 4X1VA 2FPDA 3M0QA 2CH4W 1K76A 3VRZA 3I9QA 3UA7A 2EPDA 1I07A 2O9VA 4R0KA 1N5ZA 5IHNA 4RTXA 5FWBA 2KE9A 4ZNXA 3EGUA 1GFCA 2EW3A 1PHTA 1T3LA 1HSQA 2K2MA 1PNJA 4J9GA 1SEMA 3SEMA 3VRYA 2DBMA 2QDLA 2CSIA 1PRLC 1NLPC 2EYYA 2FEIA 3M0PA 1NEBA 2HEQA 2P4RA 1UUEA 1U3OA 1X6BA 2CUBA 2G6FX 3QWXX 3TSZA 1RLPC 1OPLA 1M3AA 1ZUUA 1UECA 1W1FA 2CREA 4OMQA 1RI9A 2EYXA 4J9BA 1KFZA 2DE0X 1YWPA 2C0OA 2DA9A 3FJ5A 1WA7A 2GBQA 4HVUA 2GTJA 3R6NA 2LQNA 3VS2A 1A0NB 1WFWA 4J9EA 1NLOC 4AG1C 1I0CA 2FPEA 1B07A 1GFDA 2SRCA 1AWOA 1OOTA 3VS3A 3PVQA 2EGEA 4CC7A 2DX1A 4IIOA 3IQLA 5IHIA 2RQRA 2RQUA 3RBBB 2EKHA 3VS7A 1Y57A 4DEXA 4D8DA 3CQTA 1T3SA 1E7OA 1CKBA 1FMKA 2HDAA 1U5SA 1IO6A 2KT8A 4HVVA 1PKTA 2GTOA 3THKA 4AFUC 4ESRA 1X43A 2MCNA 4AFSC 1T0HA 3TSWA 2ROLA 2D1XA 1UTIA 4D8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JV3 A;  1ARK A;  2RQT A;  1GCQ A;  1M3C A;  1OPK A;  1AWW A;  1H3H A;  2A36 A;  2LJ0 A;  2V1R A;  1EFN A;  2ECZ A;  2K7A A;  1V1C A;  2RNA A;  3UAT A;  1VYT A;  2LJ1 A;  2BTT A;  4RTU A;  2KGT A;  1KSW A;  2VKN A;  2LQW A;  4AFZ C;  2D0N A;  1WLP B;  2BZY A;  2FPF A;  3NGP A;  2KEA A;  2YT6 A;  1WDX A;  1MV0 B;  2FRW A;  1UE9 A;  1UJ0 A;  1X27 A;  2JM9 A;  1CSK A;  1G83 A;  2DRK A;  2KXC A;  1SHG A;  3M0R A;  1ZUY A;  1AZG B;  1WXB A;  2VWF A;  4LNP A;  3VS4 A;  4CC4 B;  2AKL A;  1J3T A;  2F2V A;  4OML A;  5HCK A;  2DMO A;  1AZE A;  5EC7 A;  1PKS A;  1X2Q A;  1MV3 A;  1HJD A;  2L2P A;  3EG2 A;  3PE0 A;  1QWE A;  2K9G A;  4FSS A;  2DNU A;  3EG3 A;  5IXB A;  2KRS A;  4IIM A;  1ZBJ A;  2JT4 A;  1TG0 A;  2KYB A;  4CC3 A;  2K79 A;  1KJW A;  2L0A A;  1WXU A;  4OMN A;  1BU1 A;  1NYG A;  1ZSG A;  1AWX A;  1S1N A;  5GJV B;  2JS2 A;  1AOJ A;  2YUP A;  4LN2 A;  2J06 A;  4K11 A;  3VS6 A;  1K0X A;  1QLY A;  2YUN A;  2JXB A;  1K4U S;  2JMC A;  4WCI A;  1FYN A;  2KRN A;  1YP5 A;  2LP5 A;  1SPK A;  1HD3 A;  2LNH B;  1JO8 A;  1SRL A;  1PWT A;  2RQV A;  1X6G A;  1GCP A;  5FWC A;  1GBR A;  1ABO A;  2FO0 A;  2OI3 A;  4KRT A;  2EBP A;  4F14 A;  3EHR A;  4JJB A;  2KRM A;  2PZ1 A;  3ULR B;  2J6F A;  2KRO A;  3O5Z A;  1GRI A;  2ENM A;  2JW4 A;  1TUC A;  1ZX6 A;  1BBZ A;  2JTE A;  2YSQ A;  5I11 A;  1AD5 A;  2YDL A;  4Z89 A;  3LH5 A;  2PNI A;  4J9H A;  4HCK A;  4ORZ A;  1SRM A;  2LZ6 B;  1YCS B;  2LCS A;  2K6D A;  2CH4 A;  1NG2 A;  3NPF A;  3A98 A;  2RPN A;  4GLM A;  4LE9 A;  2D8H A;  1W6X A;  4RTT A;  1YN8 A;  2PTK A;  2DF6 A;  2X3X D;  2EGC A;  2DM1 A;  2J7I A;  5GJW B;  1Y0M A;  1UJY A;  2AKK A;  1ZLM A;  2HBW A;  1QKW A;  1JU5 C;  1QWF A;  2DL7 A;  3SHW A;  2GNC A;  1PRM C;  1H8K A;  2W0Z A;  3UF4 A;  2FRY A;  1NM7 A;  3UA6 A;  2VVK A;  1H92 A;  1WXT A;  2ED1 A;  3KFV A;  1AEY A;  1VYU A;  2J6O A;  2J05 A;  3EG0 A;  3NMZ C;  2DJQ A;  5IXF A;  3EHQ A;  2A37 A;  1QKX A;  4LUD A;  1K9A A;  2DIL A;  2DL4 A;  2O88 A;  2M0Y A;  2KNB B;  2YUQ A;  4DEY A;  2LMJ A;  3U23 A;  3H0I A;  3TVT A;  1M3B A;  1X69 A;  2OJ2 A;  2L3Q A;  2O9S A;  2V1Q A;  2NWM A;  2DLP A;  2KYM A;  3ZL7 C;  3I5S A;  1G2B A;  2F2W A;  2OAW A;  2AK5 A;  1BK2 A;  3NHN A;  5L23 A;  4Z88 A;  1W70 A;  1UG1 A;  2SEM A;  1GL5 A;  1CKA A;  2ROT A;  2LJ3 A;  2O31 A;  5I22 A;  2KT1 A;  1UFF A;  4RTV A;  2RMO A;  4JZ4 A;  1OV3 A;  2JM8 A;  2AZS A;  1QCF A;  1YNZ A;  2CUD A;  2RF0 A;  2I0N A;  2HCK A;  1LCK A;  1JQQ A;  2DRM A;  4J9F A;  4JJC A;  4OMP A;  5ECA A;  2O2O A;  1XOV A;  2H8H A;  1UHC A;  2EYW A;  2A28 A;  1AVZ C;  1WIE A;  2DL5 A;  1WX6 A;  2DL3 A;  2EYZ A;  1WYX A;  3M0S A;  3REA B;  2FG0 A;  2GQI A;  2X3W D;  2CT3 A;  2W10 A;  5IHK A;  1UHF A;  2DL8 A;  1U06 A;  1JXO A;  1WI7 A;  2IIM A;  2BZX A;  2C0I A;  2LX7 A;  2MIO A;  2XMF A;  1NEG A;  1JXM A;  2NUZ A;  2KR3 A;  4HXJ A;  4JZ3 A;  1VYV A;  4AG2 C;  3GBQ A;  2BZ8 A;  3H0F A;  3EG1 A;  1UGV A;  4LUE A;  4E6R A;  2ABL A;  3M0T A;  4J9I A;  2RQW A;  1K1Z A;  4F16 A;  4JPB W;  1E6G A;  1M8M A;  1GCQ C;  2KXD A;  2ESW A;  4OMM A;  2C0T A;  3RNJ A;  1JEG A;  4Z8A A;  4GBQ A;  4HVW A;  1VA7 A;  4AFQ C;  2CSQ A;  2ED0 A;  4F17 A;  2L3P A;  2AZV A;  2JS0 A;  1T0J A;  3VS0 A;  4EIK A;  4RTY A;  2DYB A;  2EVR A;  3VS5 A;  2D8J A;  5FW9 A;  2MOX A;  4Y92 A;  1Z9Z A;  4J9C A;  2CT4 A;  1SSH A;  3H41 A;  2J6K A;  2A08 A;  4J9D A;  3QWY A;  1AWJ A;  3H0H A;  2DBK A;  1I1J A;  1OEB A;  1SHF A;  1BB9 A;  2DVJ A;  2CDT A;  4JJD A;  1ZUK A;  3I35 A;  2M51 A;  4RTZ A;  4QT7 A;  4OMO A;  1K0S A;  1M30 A;  4RTW A;  4CC2 A;  1RUW A;  3PVL A;  1B3Q A;  1KIK A;  1M27 C;  3VS1 A;  4A63 B;  2HSP A;  3I5R A;  4RUG A;  1GBQ A;  2KBT A;  3M0U A;  2B86 A;  1X2K A;  1YWO A;  1NYF A;  2EQI A;  2JMA A;  3REB B;  2YUO A;  2L3S A;  2RN8 A;  2E5K A;  2K3B A;  4M4Z A;  1Z9Q A;  1ABQ A;  1RLQ C;  2GGR A;  1E6H A;  2EGA A;  1UDL A;  2F2X A;  3C0C A;  5IH2 A;  1MUZ A;  1TUD A;  4X1V A;  2FPD A;  3M0Q A;  2CH4 W;  1K76 A;  3VRZ A;  3I9Q A;  3UA7 A;  2EPD A;  1I07 A;  2O9V A;  4R0K A;  1N5Z A;  5IHN A;  4RTX A;  5FWB A;  2KE9 A;  4ZNX A;  3EGU A;  1GFC A;  2EW3 A;  1PHT A;  1T3L A;  1HSQ A;  2K2M A;  1PNJ A;  4J9G A;  1SEM A;  3SEM A;  3VRY A;  2DBM A;  2QDL A;  2CSI A;  1PRL C;  1NLP C;  2EYY A;  2FEI A;  3M0P A;  1NEB A;  2HEQ A;  2P4R A;  1UUE A;  1U3O A;  1X6B A;  2CUB A;  2G6F X;  3QWX X;  3TSZ A;  1RLP C;  1OPL A;  1M3A A;  1ZUU A;  1UEC A;  1W1F A;  2CRE A;  4OMQ A;  1RI9 A;  2EYX A;  4J9B A;  1KFZ A;  2DE0 X;  1YWP A;  2C0O A;  2DA9 A;  3FJ5 A;  1WA7 A;  2GBQ A;  4HVU A;  2GTJ A;  3R6N A;  2LQN A;  3VS2 A;  1A0N B;  1WFW A;  4J9E A;  1NLO C;  4AG1 C;  1I0C A;  2FPE A;  1B07 A;  1GFD A;  2SRC A;  1AWO A;  1OOT A;  3VS3 A;  3PVQ A;  2EGE A;  4CC7 A;  2DX1 A;  4IIO A;  3IQL A;  5IHI A;  2RQR A;  2RQU A;  3RBB B;  2EKH A;  3VS7 A;  1Y57 A;  4DEX A;  4D8D A;  3CQT A;  1T3S A;  1E7O A;  1CKB A;  1FMK A;  2HDA A;  1U5S A;  1IO6 A;  2KT8 A;  4HVV A;  1PKT A;  2GTO A;  3THK A;  4AFU C;  4ESR A;  1X43 A;  2MCN A;  4AFS C;  1T0H A;  3TSW A;  2ROL A;  2D1X A;  1UTI A;  4D8K A; 
#chains in the Genus database with same CATH topology
 3JV3 A;  4XAX B;  1ARK A;  1M3C A;  3BE3 A;  3C94 A;  2MAM A;  2DTH A;  1VIE A;  1VQ8 Q;  1AWW A;  3CPW S;  2V1R A;  1NJI C;  1V1C A;  2L3R A;  4RTU A;  1C0M A;  3RES A;  1VQK T;  1DJ7 B;  2BZY A;  1C1A A;  3NGP A;  1V29 B;  5DY9 A;  3OY9 A;  4LDX A;  1UE9 A;  2DET A;  5M9O A;  1KQS P;  1G83 A;  3L1A A;  1WXB A;  2LDM A;  3QYG B;  5HCK A;  1AZE A;  2HQX A;  1VQN A;  1X2Q A;  1HJD A;  2X4Y A;  2B8A A;  4ATO A;  3HRS A;  3I56 T;  3TEE A;  5IXB A;  1Y71 A;  2KRS A;  1UGP B;  4C8Q B;  2MI6 A;  3OYD A;  2FZK B;  5FU6 C;  2K79 A;  1KJW A;  4XK8 E;  1BU1 A;  2RO0 A;  1NYG A;  1AWX A;  2MK5 A;  1M8V A;  1AOJ A;  1VQK A;  2J06 A;  4K11 A;  1M2V A;  4A4G A;  2QGG A;  2XID A;  1FYN A;  3EFS A;  3JB9 I;  4HA8 A;  3CC4 Q;  1SPK A;  2COW A;  4FYW B;  3M4Y A;  2QA4 Q;  1PWT A;  3EGX A;  1MNE A;  3OS1 A;  1M1K C;  2EBP A;  1PM3 A;  4JJB A;  2PZ1 A;  3X26 B;  3TU4 K;  2XIC A;  2J6F A;  2DIG A;  1BKB A;  1WHK A;  5CCA A;  2ENM A;  1SF9 A;  3I56 A;  3CC2 A;  3CCJ Q;  2XD0 A;  3LH5 A;  1VQM T;  1QP2 A;  4N0A A;  3FRN A;  2LCS A;  4BY6 C;  2CH4 A;  3QII A;  2K5F A;  1NG2 A;  2RPN A;  4GLM A;  4M7A C;  3EH2 A;  1W6X A;  4RTT A;  2FB7 A;  2YLB A;  2ZZD A;  2F5K A;  1VQO T;  2DM1 A;  1YFN A;  1VQ6 A;  1K8A R;  4IUU A;  1RAI B;  2AKK A;  3ZEH A;  1KC8 C;  5KYU B;  3SHW A;  1VQ4 Q;  2GNC A;  1YBY A;  4J83 A;  1Q82 U;  3JCM c;  1OU8 A;  1NM7 A;  2FRY A;  2M1H A;  3FLG A;  1N9S A;  3HL8 A;  4R56 A;  3CME T;  1JJ2 A;  1WXT A;  1W2B P;  1G3T A;  1VQ9 Q;  2CP6 A;  4N4H A;  1ZHI A;  1Q81 U;  3OMC A;  3ME9 A;  1K9A A;  3GPL A;  4PLL A;  1VQM A;  3UT1 A;  4DEY A;  1YHQ T;  4HT8 A;  1R0C B;  5AT1 B;  1BI0 A;  3M9Q A;  1M90 U;  2CP2 A;  1EZZ B;  4M78 G;  2X51 A;  2NWM A;  2K4Y A;  2DLP A;  2WSE E;  4M78 F;  4RCB A;  1VQO A;  1RAG B;  4E7Z A;  5CR2 A;  2E65 A;  1TWB A;  4PJL A;  2AK5 A;  1BK2 A;  3JB9 G;  2LNV A;  2XDP A;  4FT2 A;  3JB9 F;  4F7U B;  1UG1 A;  1G8X A;  5KE2 A;  5I22 A;  2KT1 A;  3CME A;  5LJ3 f;  3X28 B;  3PMI A;  2AZS A;  2RF0 A;  1M5Q 1;  1LCK A;  1JQQ A;  4HKE A;  2DRM A;  3AHU A;  1UB4 A;  1YHQ A;  3PGG A;  3KUF A;  4PL6 A;  1G3S A;  3CCR T;  1WIE A;  2DL3 A;  2KDS A;  4C92 G;  3L2Z A;  2R5M A;  3M0S A;  3REA B;  4FYV B;  4C92 F;  2PUO B;  4VUB A;  3PNW C;  1KD1 U;  3M58 A;  2HNI A;  3M4G A;  1JXO A;  2BZX A;  2QDY B;  3L2Q A;  2GFA A;  2X9H A;  2MIO A;  2XMF A;  4FL6 A;  5KYY B;  1NEG A;  2BKD N;  1I5O B;  4JZ3 A;  2KR3 A;  3GBQ A;  2DAQ A;  1WHL A;  2ABL A;  3M0T A;  3X24 B;  1M1G A;  2HSE B;  4F16 A;  5A0D A;  1E6G A;  1M8M A;  1BI2 A;  1Q86 R;  2DER A;  2EIF A;  4HVW A;  4XU1 A;  3G71 T;  1FXX A;  2ED0 A;  2CS7 A;  2KI7 A;  2BE7 D;  3L2W A;  4EIK A;  3CCR A;  4M7A D;  4OP0 A;  5CKF A;  5D6X A;  3A1P A;  4Y92 A;  2DEU A;  3QZ9 B;  4F7U E;  1BI1 A;  2BUD A;  4LDW A;  4PJO G;  3A8M B;  3EGD B;  1D1B A;  4PJO F;  3RUX A;  3QWY A;  1AWJ A;  4IUT A;  2LCC A;  3FEO A;  3RR6 A;  5FU7 C;  2MWO A;  1I1J A;  1OEB A;  4BAC A;  4MZP A;  5KH6 A;  3OW2 A;  1BB9 A;  4M7A A;  1KQ1 A;  1YJW Q;  2CDT A;  1ACM B;  2M51 A;  4RTZ A;  1QVF S;  1K0S A;  1RUW A;  3PVL A;  1M27 C;  1RAE B;  3VS1 A;  3PT9 A;  3G4S A;  1GBQ A;  3M0U A;  2Y4X A;  4M77 C;  3G71 A;  1YWO A;  3REB B;  4FSX A;  2K3B A;  2F69 A;  5GAN 4;  4PFZ A;  1ABQ A;  3EH1 A;  2EGA A;  2F2X A;  3C0C A;  3HSB A;  3RKY A;  5GAN h;  4N4I A;  1NJI R;  4IUR A;  2CH4 W;  3QBY A;  5J39 A;  3VRZ A;  2FZG B;  3I9Q A;  1Y96 A;  3EG9 A;  5A0G A;  1PC0 A;  5KCH A;  2E6N A;  5CAI A;  3OMG A;  1N5Z A;  4M75 B;  2CZ7 B;  2QQS A;  3ZFJ A;  1YJN Q;  3F70 A;  4Z02 A;  4M7D C;  1QW1 A;  3EGU A;  2PVD B;  1T3L A;  4A4H A;  1IRX A;  1HSQ A;  1P92 A;  1YJ9 Q;  3OYI A;  5GAO q;  4J9G A;  2CSI A;  3A8L B;  1NLP C;  4L6V 5;  3EFO A;  2L8D A;  1ZQ1 A;  1NBE B;  1NEB A;  3QPH A;  2EAY A;  3OQ5 A;  1PSE A;  1NE8 A;  1U3O A;  2EFI A;  2G6F X;  2M0O A;  1M3A A;  3BFM A;  1ZUU A;  4OB2 B;  4DBR A;  3VU3 C;  2EWN A;  3I55 Q;  2IVW A;  3JCM h;  5KE3 A;  1V76 A;  3SB2 A;  2K5I A;  3GP8 A;  2GBQ A;  3JCM e;  4C0G A;  4RG8 A;  2RA2 A;  4AG1 C;  2VV5 A;  1EIF A;  1S72 T;  3OSS C;  5CKE A;  1GFD A;  4C0D C;  3PVQ A;  4IUV A;  2EGE A;  2QK0 A;  4IUP A;  1UGQ B;  5IHI A;  2RQR A;  8ATC B;  3NTH A;  4J8O A;  3LYI A;  2G3R A;  1E7O A;  1D0Z A;  2HDA A;  4ZN1 A;  1M1K R;  2BIV A;  1KK7 A;  4HVV A;  5I2M A;  1XJW B;  2DD5 A;  2V8K A;  3ER0 A;  4AFU C;  4C8Q G;  4ESR A;  1X43 A;  2RHU A;  4AFS C;  1T0H A;  4C8Q F;  2ROL A;  1OI1 A;  2XG8 D;  1M9S A;  2R58 A;  4D8K A;  1R77 A;  1ZSZ C;  4EMK A;  2A36 A;  1IZ6 A;  2QGF B;  3LWI A;  2K7A A;  1Q7Y R;  2RNA A;  3CCM T;  3L2R A;  3UAT A;  1VYT A;  2BTT A;  1S72 A;  4J6Y A;  5IN1 A;  2VKN A;  5LJ3 h;  2D0N A;  4ZTJ A;  2VUB A;  2KEA A;  5FLX E;  3CCL T;  2FRW A;  4M78 E;  2JM9 A;  2H3E B;  3QDF A;  5GAN 5;  1CSK A;  4M77 D;  2DRK A;  4ZN3 A;  5LJ3 e;  5GAM h;  1VQN Q;  1JRI A;  1SHG A;  4XQ3 A;  3VS4 A;  3E9G A;  1YI2 Q;  2VGN A;  2AKL A;  2DMO A;  1PKS A;  3C4S A;  4XU3 A;  4Y28 E;  1R8O B;  2DXB A;  3DKM A;  4KUI A;  4BD3 A;  3MCA B;  1QWE A;  2K9G A;  2QQR A;  3EG3 A;  1OQK A;  1FX7 A;  1TG0 A;  3G6E T;  4M77 A;  4CC3 A;  3FIF A;  2K5L A;  1VQK Q;  2L0A A;  1IGQ A;  3CCM A;  4M7D D;  3TRE A;  2QTX A;  1JJ2 P;  2JS2 A;  2KK4 A;  2XHC A;  1VQ5 T;  3OYG A;  1SKU B;  2EQJ A;  3VS6 A;  5GAN 2;  1QLY A;  4J7F A;  5EG2 A;  4C92 E;  3CBM A;  3JCM V;  1QMC A;  2KRN A;  3CCL A;  3CMA T;  1HD3 A;  5AYF A;  4X9C A;  1HXD A;  3CD6 Q;  1VUB A;  1ABO A;  2FO0 A;  4M7D A;  3I56 Q;  1Q82 C;  3EHR A;  2KRM A;  2ZPG B;  3E19 A;  1GRI A;  3WXM B;  3OYN A;  4EDU A;  2EYQ A;  2YSQ A;  4Z89 A;  3L2U A;  4FW1 A;  2CP3 A;  3G6E A;  3HHT B;  4ORZ A;  2LZ6 B;  1B34 A;  2RK2 A;  3UDC A;  3JB9 J;  2L89 A;  1YCS B;  2K6D A;  3CCV T;  3CCU Q;  1HK9 A;  2O4X A;  3NPF A;  3A98 A;  4LE9 A;  2D8H A;  1VQ5 A;  5LJ5 g;  4MDX A;  2X3X D;  2J7I A;  3CXC S;  1EX4 A;  1Q95 G;  2FZC B;  3CMA A;  2DL7 A;  4PJO E;  1OZ3 A;  3OYE A;  1PRM C;  3WVE B;  1H8K A;  2ZPB B;  5A2Q E;  2VVK A;  2ED1 A;  1K8A U;  4GY5 A;  1AEY A;  1N9R A;  1VYU A;  2J6O A;  3KBG A;  5IXF A;  3CPW A;  3EHQ A;  2P4T A;  3DLM A;  2DL4 A;  3V7S A;  5KYX A;  1D0X A;  2YUQ A;  3E2U A;  1VQ7 A;  1M2V B;  3TVT A;  1VQO Q;  1M3B A;  3CCV A;  1PD1 A;  2L3Q A;  2D0Q B;  1ZSZ A;  1D1C A;  1Y07 A;  2KYM A;  3EGX B;  4JS5 A;  2P0P A;  2DO3 A;  3I5S A;  2F2W A;  2HD0 A;  5FRO A;  2CZ0 B;  2RK1 A;  3NHN A;  1N27 A;  5L23 A;  2JUF A;  2XU8 A;  3CME Q;  2HZY A;  3CC2 T;  2RHZ A;  2SEM A;  4V2S A;  5CQX A;  2K57 A;  2RMO A;  3VKI A;  4JZ4 A;  3NFC A;  4A4E A;  1OV3 A;  1WZO A;  2YRD A;  4MZT A;  5GMK i;  5IT9 E;  2CUD A;  1QCF A;  1YNZ A;  1ZBX A;  2K3Y A;  4J6X A;  3OBY A;  4J9F A;  1G3W A;  3QJY A;  3RMQ A;  4OMP A;  1VQ6 T;  2FHD A;  4E7K A;  5GAN f;  2VXE A;  2H8H A;  4OB1 B;  2EYW A;  4ZGJ B;  3OW2 P;  1WHJ A;  2EYZ A;  3MHX A;  3OA6 A;  2X3W D;  2CT3 A;  2W10 A;  1KQ2 A;  3CC7 Q;  4JRI A;  2DL8 A;  3MP6 A;  1M1F A;  2C0I A;  2CGH A;  2E3I A;  1M2O A;  2LX7 A;  2HQE A;  4OVA A;  2JVV A;  3OYK A;  1JXM A;  2F1L A;  2VGM A;  2VYT A;  4HXJ A;  4ZGD B;  1B7T A;  1VYV A;  1WPY A;  1UGV A;  4OGC A;  5LJ3 j;  2DZC A;  4X34 A;  4E6R A;  4J9I A;  4JPB W;  3PTA A;  2OX7 A;  1MGQ A;  1GCQ C;  2KXD A;  1JB0 E;  4OMM A;  4RG2 A;  1JEG A;  1VQ8 T;  1YIJ T;  2PVO B;  3CCR Q;  2XI9 A;  2CSQ A;  2Y90 A;  2JS0 A;  2EJ9 A;  2KQW A;  1T0J A;  3JCM f;  2JTF A;  4XTX A;  4DBF A;  1FMV A;  1Q86 U;  4FW2 A;  1Z9Z A;  4J9C A;  4C8Q E;  2PUK B;  1SSH A;  3UPU A;  4M75 G;  3HKS A;  4XTV A;  4BB7 A;  5CIU A;  4E7J A;  3JCM J;  3QUI A;  4M75 F;  1I81 A;  2GF7 A;  2OAU A;  1QCO A;  5LJ3 d;  4LD9 K;  4XU0 A;  1SHF A;  4PLI A;  2HMA A;  1NPR A;  3LGF A;  1N8R U;  1LJO A;  2X35 A;  4OMO A;  5L8R E;  1KIK A;  4BDZ A;  1RAF B;  1VQ8 A;  1YIJ A;  4JRQ A;  3M59 A;  1X2K A;  1NYF A;  2MYS A;  2YUO A;  2RN8 A;  2E5K A;  5FU6 B;  1K9M C;  1QQJ A;  2LT4 A;  2GGR A;  1E6H A;  2HL3 A;  1TUD A;  1K76 A;  2QA4 T;  2V8I A;  3UA7 A;  4DBQ A;  2I2L A;  1XNI A;  2E70 A;  2DEQ A;  5GAM f;  5FWB A;  4ZNX A;  2KAF A;  1NJI U;  1PNJ A;  3CCJ T;  4C0Z A;  3SWN C;  2QDL A;  2EYY A;  4BUG A;  1AHJ B;  2M02 A;  4JRK A;  4E7L A;  2RI5 A;  3M0P A;  4ELZ C;  3PFS A;  3INZ A;  4JLG A;  4J7I A;  1UUE A;  3BDU A;  1WHG A;  1X6B A;  3TSZ A;  4XTW A;  4KGV B;  1XTD A;  3V8J A;  1OPL A;  1OYX A;  1WJQ A;  4FCY A;  2RJC A;  2RHI A;  5GAO m;  2CRE A;  2JNG A;  4J6W A;  1RI9 A;  1QVG S;  3CC4 A;  5CKB A;  1YWP A;  2DA9 A;  1GXI E;  4M7A B;  1WA7 A;  4HVU A;  1VQ4 T;  2QA4 A;  2GTJ A;  2LQN A;  5KYW A;  1A0N B;  1WFW A;  3MP8 A;  4EMK C;  3G4S T;  1KQS S;  2E41 A;  2DD4 A;  4E7H A;  4F7U A;  3JSC A;  4WF2 A;  2SRC A;  1OOT A;  2QG9 B;  1MMD A;  4M78 C;  4PFP A;  3IQL A;  2RJF A;  4DA4 A;  3RBB B;  4N4G A;  4KGX B;  2E10 A;  3CCJ A;  1PD0 A;  1T3S A;  1CKB A;  2K3X A;  2KT8 A;  1LVK A;  2EQK A;  3MKD A;  1PKT A;  3O8V A;  3THK A;  4OB0 B;  1IGU A;  3M56 A;  4IKF A;  3PMT A;  2E3H A;  1IB8 A;  3TSW A;  2K2V A;  2GCX A;  2D1X A;  2O01 E;  1WJS A;  1Y96 B;  3EG9 B;  2RQT A;  1GCQ A;  2RI2 A;  2MWP A;  1M1K U;  1K73 C;  4KUD K;  3S3M A;  5CVI A;  2LJ0 A;  1EFN A;  1VQP T;  1VQ4 A;  2JTM A;  4O6J A;  4E2F B;  4F04 B;  5KYY A;  1BCO A;  1QVF A;  2KGT A;  1KSW A;  2LQW A;  4AFZ C;  4C92 C;  4HCZ A;  3EFO B;  1WLP B;  2FPF A;  2E5Q A;  2YT6 A;  2OTL T;  1WDX A;  1MV0 B;  3J81 E;  2M9U A;  4KT0 E;  3DLL A;  1Q7Y U;  1IHW A;  4KH0 B;  2KXC A;  3QDR B;  3M0R A;  1ZUY A;  2ZPI B;  3MP1 A;  2QXF A;  2F2V A;  4OML A;  4QQD A;  4LDV A;  4DBH A;  2CZ1 B;  3S6W A;  1MV3 A;  2YRV A;  1RAD B;  3OS2 A;  4C0F A;  5GAN e;  3HRU A;  4FSS A;  2DNU A;  3RDV A;  4BI4 A;  4IIM A;  1D0Y A;  3CCM Q;  1ZBJ A;  3S3O A;  3QKJ A;  2KYB A;  1VQP A;  2RB6 A;  4O5V A;  1WXU A;  3S3N A;  2AT1 B;  4OMN A;  3CCE T;  5HY6 A;  3OBW A;  1ZSG A;  1BYM A;  1S1N A;  5GJV B;  1X01 A;  3OYJ A;  2YUP A;  3D7S B;  1YIT T;  3H6Z A;  3CPW P;  1MMA A;  1K0X A;  2YUN A;  2JXB A;  3CCQ T;  1RAC B;  5D6Y A;  4WCI A;  2OTL A;  1W2B S;  4PJO C;  3JRZ A;  5GAO r;  1JO8 A;  3MEV A;  4ZGE B;  1X6G A;  1GCP A;  1GBR A;  4P5N A;  1PSF A;  3CCS T;  2OI3 A;  3BDL A;  6AT1 B;  2E12 A;  2Y4Y A;  4F14 A;  4EMH A;  4OMF B;  3ULR B;  2KRO A;  3O5Z A;  4MZM A;  4LD6 A;  3G6E Q;  2JW4 A;  1TUC A;  3SWN A;  2QEX T;  1WHM A;  2DJZ A;  3E9F A;  4JDS A;  1I4K 1;  4J9H A;  3MPU B;  2VXF A;  4HCK A;  1SRM A;  1TTH B;  3Q1J A;  4D6W A;  3CCE A;  1D1A A;  4M78 D;  3N5B B;  2GQV A;  5GAO p;  2EJF A;  1YIT A;  1D3B A;  2PTK A;  2DF6 A;  5FU7 B;  2EGC A;  5GAO l;  3CCQ A;  1OX9 A;  4Y91 A;  1Y0M A;  2R57 A;  1VQL T;  3JB9 D;  1UJY A;  1ZLM A;  2HBW A;  4M75 E;  4OB3 B;  1QWF A;  4PK4 A;  4A53 A;  1N6A A;  4FU6 A;  3MET A;  5HKC A;  2W0Z A;  3J7A F;  3CCS A;  2FVU A;  4R55 A;  2E4H A;  4M78 A;  4M77 B;  5DLO A;  4ELY C;  3NMZ C;  1BIA A;  2J05 A;  3EG0 A;  2DJQ A;  3M5A A;  1NPP A;  4LUD A;  1IXD A;  2QEX A;  2DIL A;  4C5G A;  2A3L A;  1IHV A;  4J5Y A;  2O88 A;  3ZBD A;  2PQW A;  2KNB B;  2RHY A;  3CCV Q;  1KC8 R;  5A0L A;  1LPL A;  3CEY A;  3H0I A;  1YJN T;  4C92 D;  4XTZ A;  4RCC A;  8AT1 B;  2E6Z A;  2YHT A;  5GAM e;  2D9T A;  2KSS A;  1G2B A;  2E1H A;  4M7D B;  1VQL A;  3X25 B;  4AT1 B;  2DXT A;  2V8J A;  4FYY B;  4Z88 A;  5I2S A;  2GFU A;  4NS5 A;  2WSC E;  4C92 A;  3OS0 A;  4RTV A;  2M16 A;  2JM8 A;  3OB9 A;  1B34 B;  2I0N A;  3VYH B;  4CRI A;  3PIO A;  4JJC A;  1KG1 A;  2OTJ T;  5ECA A;  4LDY A;  4B6M A;  1K9M R;  2Z0W A;  1XOV A;  1UHC A;  2A28 A;  1UGR B;  1YJN A;  4C8Q C;  3OYC A;  3J80 E;  1WJR A;  3OYY A;  1TUG B;  2QQA A;  4PJO D;  5IHK A;  4M77 E;  3CC2 Q;  1UHF A;  3OSV A;  4C0D B;  1U06 A;  1WI7 A;  2IIM A;  3KXT A;  3JCM b;  2QI2 A;  3CBP A;  1Q81 C;  4WTO B;  1SSF A;  4AG2 C;  3AT1 B;  3H0F A;  2CP7 A;  2COZ A;  5KYX B;  1VQ7 T;  2JJ9 A;  2HBP A;  1K1Z A;  4KBM B;  3L2V A;  2YRC A;  1VQ6 Q;  1FMW A;  1WNL A;  1N8R C;  2YWW A;  4PJO A;  4Z8A A;  5DLQ E;  1D09 B;  4GBQ A;  1M90 C;  1MMN A;  5LL6 S;  5GAO n;  5GAN j;  2OTJ A;  4KH1 B;  1ZSZ B;  4M7D E;  4RTY A;  3FB9 A;  2EVR A;  3CXC A;  2QAS A;  2D8J A;  1XQH A;  3UWN A;  4YTL A;  1O9S A;  2NUP A;  4DQ2 A;  1I5L A;  4LXC A;  3OYF A;  2C06 A;  3A5Z B;  2VC8 A;  2MF2 A;  4BI3 A;  2X4W A;  2ZGW A;  5CQY A;  4J9D A;  1VQM Q;  2DPP B;  1YI2 T;  2JZ2 A;  4BE0 A;  3H0H A;  1BCM A;  1ZA1 B;  2LX9 A;  4FIB A;  2NUT A;  1YIJ Q;  4JJD A;  2RM4 A;  4GLK A;  4EMG A;  1UGS B;  4QT7 A;  4CC2 A;  4RTW A;  5GAN d;  1X75 C;  2EQM A;  5LJ5 f;  4A63 B;  2QAZ A;  4QW2 A;  4C5I A;  3I5R A;  4B9X A;  2B86 A;  1TU0 B;  1QVG P;  2EJG A;  4PJM A;  2JMA A;  2L3S A;  2HL5 C;  2QQ9 A;  2HAX A;  1FWZ A;  1OUL A;  4QQ6 A;  4M7A G;  1KD1 C;  1Z9Q A;  1C6V X;  5GAN g;  1K73 R;  4NL3 A;  4M7A F;  5GAN 6;  2BE9 B;  5GMK m;  2E64 A;  1W4S A;  3OYA A;  1MUZ A;  3BY7 A;  3FJP A;  3HP9 A;  2FPD A;  3M0Q A;  3GIB A;  3RKW A;  4MML A;  4CI0 C;  2DZ9 A;  3CD6 T;  1YI2 A;  3QO3 A;  3P8H A;  1YHQ Q;  1I07 A;  2O9V A;  1LOJ A;  3MEU A;  4R0K A;  5IHN A;  3CBO A;  3MJX A;  3MEW A;  4RTX A;  3V7C A;  2KE9 A;  2EW3 A;  1PHT A;  2K2M A;  4TVR A;  3JCM d;  1AT1 B;  2X4J A;  1SEM A;  1QVP A;  4II1 A;  2DBM A;  3VV0 A;  1PRL C;  2CYZ B;  3C12 A;  2FEI A;  1Y7X A;  4ZTF A;  2WAC A;  4C8Q D;  2HQH A;  2P4R A;  3A8H B;  3FDR A;  3CCU T;  2YXY A;  1QVF P;  1RLP C;  4RMO A;  3JCM g;  3RER A;  1UEC A;  3MO8 A;  1PG5 B;  5KCO A;  4OMQ A;  2EYX A;  5KYN A;  2EQU A;  2DE0 X;  3LWH A;  3R6N A;  2LTO A;  3QHS A;  3VS2 A;  3CD6 A;  3GOX A;  5GAN 8;  4JRP A;  5GAM j;  1I0C A;  4C8Q A;  2NYS A;  2FPE A;  2LQ8 A;  2DVE A;  4OGE A;  3SD4 A;  1AWO A;  3EAE A;  3VS3 A;  4BE2 A;  3LGL A;  4BDY A;  2ZPH B;  4IIO A;  4MMK A;  2KVQ G;  1Y57 A;  4D8D A;  3CQT A;  1IO6 A;  1Q7Y C;  3VUB A;  3P8D A;  2XDB A;  2GTO A;  4XTY A;  3LW5 E;  3CCU A;  5FRN A;  2MCN A;  3SFM A;  4QQG A;  4AMC A;  4X9D A;  1BIB A;  1QCN A;  3DB4 A;  5D6W A;  1JJ2 S;  3OYH A;  1HYO A;  3QXE B;  5GAM d;  3G4S Q;  1OPK A;  1H3H A;  2ECZ A;  3G71 Q;  2LJ1 A;  5LJ3 g;  4A4F A;  2CZ6 B;  2CP5 A;  2LCL A;  1KHC A;  3FC3 A;  5CO7 A;  5GAM g;  1UJ0 A;  1X27 A;  1RAB B;  1QP3 A;  4PFO A;  1AZG B;  2VWF A;  4LNP A;  1NZ9 A;  4CC4 B;  3CC4 T;  1J3T A;  2DXC A;  5EC7 A;  2LQK A;  2P0Q A;  3HFO A;  4EPC A;  2L2P A;  2H3J A;  1ZA2 B;  3EG2 A;  3PE0 A;  5KYU A;  3G7Z A;  5KYW B;  1G3Y A;  4DOW A;  2JOY A;  1VQP Q;  3CC7 T;  1U1S A;  2AHJ B;  5GMK h;  2JT4 A;  2RI3 A;  4QKU A;  2DIQ A;  2LVM A;  5GMK e;  3LH0 A;  3V8L A;  4PJN A;  2IG0 A;  2OTL Q;  4LN2 A;  4E47 A;  4E7S A;  2DKG A;  5GMK l;  1K4U S;  5HK0 A;  2JMC A;  3OYM A;  1OU9 A;  4M75 C;  1YP5 A;  2LP5 A;  3HRT A;  1OX8 A;  2LNH B;  4M77 G;  2JN0 A;  1SRL A;  3H8Z A;  4XTU A;  2RQV A;  5FWC A;  4M77 F;  2KY9 A;  4BY6 B;  3JB9 H;  2ATC B;  3LX7 A;  4DOV A;  2QYZ A;  4KRT A;  4BE1 A;  2PVG B;  3V8K A;  1QVG A;  4HT9 A;  1ZX6 A;  1BBZ A;  2JTE A;  5I11 A;  3CC7 A;  1VQ9 T;  1WHH A;  1AD5 A;  2YDL A;  3CCE Q;  1KQS A;  2PNI A;  5GAN 7;  3GNF B;  3JCM W;  1YIT Q;  2RD1 A;  4M7D G;  3CCQ Q;  3CPF A;  2MPX C;  3DB3 A;  1Q82 R;  2RH2 A;  2PU9 B;  5J26 A;  4M7D F;  1YN8 A;  4PJJ A;  5GJW B;  2F5T X;  2RHX A;  5LJ5 h;  1BI3 A;  1R0B G;  2CKK A;  1Q81 R;  2MMP A;  3CCS Q;  3QSU A;  1QKW A;  3HFN A;  1JU5 C;  4NL2 A;  3V7R A;  1RI0 A;  4HCB A;  5LJ5 e;  3M55 A;  3QYH B;  2X4X A;  3UF4 A;  3UA6 A;  1WQ7 A;  2HKQ B;  1S72 Q;  2NLU A;  1H92 A;  3GNG A;  3KFV A;  2QEX Q;  4QVD A;  1N8R R;  1PCX A;  1X6O A;  1M4Z A;  3OW2 S;  1M90 R;  2A37 A;  1QKX A;  3OS5 A;  1F1B B;  3URG A;  1VQ9 A;  1SG5 A;  3JAM E;  2M0Y A;  2LMJ A;  5IAY A;  3U23 A;  3GLX A;  3EFR A;  1X69 A;  2OJ2 A;  2O9S A;  1VQL Q;  7AT1 B;  2V1Q A;  2DTI A;  4RKU E;  4M7A E;  3ZL7 C;  4A54 A;  1KC8 U;  3RMS A;  2OAW A;  1MHN A;  2V26 A;  1KHI A;  2RJD A;  3TQ7 P;  1W70 A;  3H9N A;  1GL5 A;  3EGD A;  3L42 A;  3SWN B;  4PNO A;  3CXC P;  1CKA A;  2ROT A;  2LJ3 A;  2O31 A;  1UFF A;  1VOM A;  4ANJ A;  3G1J A;  3T9N A;  4FT4 A;  3GF5 A;  2A0F B;  3E1S A;  2HCK A;  3CCL Q;  2O2O A;  1KD1 R;  3MEA A;  3QZ5 B;  3C95 A;  1D3B B;  5FRM A;  3VJP A;  1AVZ C;  3RIR A;  1RL2 A;  1H64 1;  2DL5 A;  3PIP A;  1WX6 A;  2VAS A;  1LNX A;  3RKX A;  1IRE B;  1WYX A;  4L59 A;  2AIR B;  1W2B A;  2ZPF B;  2RJE A;  2FG0 A;  2GQI A;  2LC4 A;  2WSF E;  4M75 D;  4EMK B;  4QVZ A;  4XU2 A;  1YCY A;  3QG1 A;  1K9M U;  3R6O A;  2XDD A;  1RAH B;  1K8A C;  4M78 B;  4JJN K;  2NUZ A;  2DYI A;  2BZ8 A;  3EG1 A;  4LUE A;  5CKD A;  2ZPE B;  2RQW A;  3VYG A;  2P84 A;  3BW1 A;  3JCM P;  1VQ5 Q;  5J3B A;  4KUL A;  2ESW A;  2OTJ Q;  4M75 A;  2C0T A;  2D6F A;  1VIF A;  4C5H A;  3RNJ A;  1YJW T;  1VA7 A;  3HPW A;  4AFQ C;  3CMA Q;  3SDZ A;  4F17 A;  2L3P A;  2AZV A;  1TOV A;  3VS0 A;  1WQW A;  3QJ6 A;  1TH7 A;  2DYB A;  3VS5 A;  5FW9 A;  2MOX A;  4MDW A;  1TSF A;  2CT4 A;  4LDU A;  5D7U A;  5GMK j;  3H41 A;  2J6K A;  2A08 A;  1G5V A;  2KMT A;  1O75 A;  4C92 B;  2DBK A;  4Q5W A;  1VQ7 Q;  4IUQ A;  1UEB A;  3A8G B;  5HK3 A;  1MMG A;  2DVJ A;  1RAA B;  1I8F A;  1ZUK A;  2A7Y A;  3I35 A;  2YLC A;  1M30 A;  1JBM A;  4JS4 A;  2R5A A;  1B3Q A;  3HTR A;  5DM7 R;  2HSP A;  1YJW A;  1YJ9 T;  4FYX B;  4RUG A;  1WGS A;  2KBT A;  4L5G A;  2EQI A;  4HCC A;  2CP0 A;  3JCM Q;  4PKC C;  4M4Z A;  2DTO A;  3P8B B;  2P0K A;  1RLQ C;  1UDL A;  5IH2 A;  4X1V A;  1MND A;  1TS9 A;  3LLR A;  3TCJ A;  4JLI A;  3I55 T;  2EPD A;  1OZ2 A;  2L5Q A;  4NOY A;  4FM4 B;  1K73 U;  2O4X B;  4JUV A;  5GAN 3;  3M54 A;  4PJO B;  1GFC A;  2EKO A;  4OF1 A;  2ZAE A;  5LJ5 j;  1U1T A;  3SEM A;  3VRY A;  2COY A;  3OYL A;  4QVC A;  1YJ9 A;  1Q86 C;  1U8R A;  5CKH A;  4N0A C;  2QQB A;  2NUP B;  2HEQ A;  2CUB A;  3QWX X;  4B9W A;  2LRQ A;  2XKO C;  2XK0 A;  1W1F A;  4KGZ B;  4E7I A;  4J9B A;  1KFZ A;  2FL7 A;  2C0O A;  3FJ5 A;  3WVD B;  9ATC B;  3I55 A;  3A8O B;  2NUT B;  4J9E A;  4C5E A;  1NLO C;  2FYK A;  4UC4 A;  1B07 A;  1TXQ A;  2QTV A;  2DK3 A;  3X20 B;  5LJ5 d;  2LT1 A;  5CK9 A;  2DFU A;  2ZCF B;  4ME7 A;  3OYB A;  4CC7 A;  2DX1 A;  2RQU A;  5C6S A;  2DXU A;  2EKH A;  3VUZ A;  4A4K A;  3M53 A;  3VS7 A;  4BI8 B;  4DEX A;  2HKN A;  3M57 A;  1FMK A;  1U5S A;  5C0M A;  2IPO B;  3ASK A;  1H3Z A;  1VQN T;  4F7U G;  3JCM X;  3NTK A;  3NTI A;  5I21 A;  2VB6 A;  4F7U F;  1UTI A; 
#chains in the Genus database with same CATH homology
 3JV3 A;  1ARK A;  2RQT A;  1GCQ A;  1M3C A;  1OPK A;  1AWW A;  1H3H A;  2A36 A;  2LJ0 A;  2V1R A;  1EFN A;  2ECZ A;  2K7A A;  1V1C A;  2RNA A;  3UAT A;  1VYT A;  2LJ1 A;  2BTT A;  4RTU A;  2KGT A;  1KSW A;  2VKN A;  2LQW A;  4AFZ C;  2D0N A;  1WLP B;  2BZY A;  2FPF A;  3NGP A;  2KEA A;  2YT6 A;  1WDX A;  1MV0 B;  2FRW A;  1UE9 A;  1UJ0 A;  1X27 A;  2JM9 A;  1CSK A;  1G83 A;  2DRK A;  2KXC A;  1SHG A;  3M0R A;  1ZUY A;  1AZG B;  1WXB A;  2VWF A;  4LNP A;  3VS4 A;  4CC4 B;  2AKL A;  1J3T A;  2F2V A;  4OML A;  5HCK A;  2DMO A;  1AZE A;  5EC7 A;  1PKS A;  1X2Q A;  1MV3 A;  1HJD A;  2L2P A;  3EG2 A;  3PE0 A;  1QWE A;  2K9G A;  4FSS A;  2DNU A;  3EG3 A;  5IXB A;  2KRS A;  4IIM A;  1ZBJ A;  2JT4 A;  1TG0 A;  2KYB A;  4CC3 A;  2K79 A;  1KJW A;  2L0A A;  1WXU A;  4OMN A;  1BU1 A;  1NYG A;  1ZSG A;  1AWX A;  1S1N A;  5GJV B;  2JS2 A;  1AOJ A;  2YUP A;  4LN2 A;  2J06 A;  4K11 A;  3VS6 A;  1K0X A;  1QLY A;  2YUN A;  2JXB A;  1K4U S;  2JMC A;  4WCI A;  1FYN A;  2KRN A;  1YP5 A;  2LP5 A;  1SPK A;  1HD3 A;  2LNH B;  1JO8 A;  1SRL A;  1PWT A;  2RQV A;  1X6G A;  1GCP A;  5FWC A;  1GBR A;  1ABO A;  2FO0 A;  2OI3 A;  4KRT A;  2EBP A;  4F14 A;  3EHR A;  4JJB A;  2KRM A;  2PZ1 A;  3ULR B;  2J6F A;  2KRO A;  3O5Z A;  1GRI A;  2ENM A;  2JW4 A;  1TUC A;  1ZX6 A;  1BBZ A;  2JTE A;  2YSQ A;  5I11 A;  1AD5 A;  2YDL A;  4Z89 A;  3LH5 A;  2PNI A;  4J9H A;  4HCK A;  4ORZ A;  1SRM A;  2LZ6 B;  1YCS B;  2LCS A;  2K6D A;  2CH4 A;  1NG2 A;  3NPF A;  3A98 A;  2RPN A;  4GLM A;  4LE9 A;  2D8H A;  1W6X A;  4RTT A;  1YN8 A;  2PTK A;  2DF6 A;  2X3X D;  2EGC A;  2DM1 A;  2J7I A;  5GJW B;  1Y0M A;  1UJY A;  2AKK A;  1ZLM A;  2HBW A;  1QKW A;  1JU5 C;  1QWF A;  2DL7 A;  3SHW A;  2GNC A;  1PRM C;  1H8K A;  2W0Z A;  3UF4 A;  2FRY A;  1NM7 A;  3UA6 A;  2VVK A;  1H92 A;  1WXT A;  2ED1 A;  3KFV A;  1AEY A;  1VYU A;  2J6O A;  2J05 A;  3EG0 A;  3NMZ C;  2DJQ A;  5IXF A;  3EHQ A;  2A37 A;  1QKX A;  4LUD A;  1K9A A;  2DIL A;  2DL4 A;  2O88 A;  2M0Y A;  2KNB B;  2YUQ A;  4DEY A;  2LMJ A;  3U23 A;  3H0I A;  3TVT A;  1M3B A;  1X69 A;  2OJ2 A;  2L3Q A;  2O9S A;  2V1Q A;  2NWM A;  2DLP A;  2KYM A;  3ZL7 C;  3I5S A;  1G2B A;  2F2W A;  2OAW A;  2AK5 A;  1BK2 A;  3NHN A;  5L23 A;  4Z88 A;  1W70 A;  1UG1 A;  2SEM A;  1GL5 A;  1CKA A;  2ROT A;  2LJ3 A;  2O31 A;  5I22 A;  2KT1 A;  1UFF A;  4RTV A;  2RMO A;  4JZ4 A;  1OV3 A;  2JM8 A;  2AZS A;  1QCF A;  1YNZ A;  2CUD A;  2RF0 A;  2I0N A;  2HCK A;  1LCK A;  1JQQ A;  2DRM A;  4J9F A;  4JJC A;  4OMP A;  5ECA A;  2O2O A;  1XOV A;  2H8H A;  1UHC A;  2EYW A;  2A28 A;  1AVZ C;  1WIE A;  2DL5 A;  1WX6 A;  2DL3 A;  2EYZ A;  1WYX A;  3M0S A;  3REA B;  2FG0 A;  2GQI A;  2X3W D;  2CT3 A;  2W10 A;  5IHK A;  1UHF A;  2DL8 A;  1U06 A;  1JXO A;  1WI7 A;  2IIM A;  2BZX A;  2C0I A;  2LX7 A;  2MIO A;  2XMF A;  1NEG A;  1JXM A;  2NUZ A;  2KR3 A;  4HXJ A;  4JZ3 A;  1VYV A;  4AG2 C;  3GBQ A;  2BZ8 A;  3H0F A;  3EG1 A;  1UGV A;  4LUE A;  4E6R A;  2ABL A;  3M0T A;  4J9I A;  2RQW A;  1K1Z A;  4F16 A;  4JPB W;  1E6G A;  1M8M A;  1GCQ C;  2KXD A;  2ESW A;  4OMM A;  2C0T A;  3RNJ A;  1JEG A;  4Z8A A;  4GBQ A;  4HVW A;  1VA7 A;  4AFQ C;  2CSQ A;  2ED0 A;  4F17 A;  2L3P A;  2AZV A;  2JS0 A;  1T0J A;  3VS0 A;  4EIK A;  4RTY A;  2DYB A;  2EVR A;  3VS5 A;  2D8J A;  5FW9 A;  2MOX A;  4Y92 A;  1Z9Z A;  4J9C A;  2CT4 A;  1SSH A;  3H41 A;  2J6K A;  2A08 A;  4J9D A;  3QWY A;  1AWJ A;  3H0H A;  2DBK A;  1I1J A;  1OEB A;  1SHF A;  1BB9 A;  2DVJ A;  2CDT A;  4JJD A;  1ZUK A;  3I35 A;  2M51 A;  4RTZ A;  4QT7 A;  4OMO A;  1K0S A;  1M30 A;  4RTW A;  4CC2 A;  1RUW A;  3PVL A;  1B3Q A;  1KIK A;  1M27 C;  3VS1 A;  4A63 B;  2HSP A;  3I5R A;  4RUG A;  1GBQ A;  2KBT A;  3M0U A;  2B86 A;  1X2K A;  1YWO A;  1NYF A;  2EQI A;  2JMA A;  3REB B;  2YUO A;  2L3S A;  2RN8 A;  2E5K A;  2K3B A;  4M4Z A;  1Z9Q A;  1ABQ A;  1RLQ C;  2GGR A;  1E6H A;  2EGA A;  1UDL A;  2F2X A;  3C0C A;  5IH2 A;  1MUZ A;  1TUD A;  4X1V A;  2FPD A;  3M0Q A;  2CH4 W;  1K76 A;  3VRZ A;  3I9Q A;  3UA7 A;  2EPD A;  1I07 A;  2O9V A;  4R0K A;  1N5Z A;  5IHN A;  4RTX A;  5FWB A;  2KE9 A;  4ZNX A;  3EGU A;  1GFC A;  2EW3 A;  1PHT A;  1T3L A;  1HSQ A;  2K2M A;  1PNJ A;  4J9G A;  1SEM A;  3SEM A;  3VRY A;  2DBM A;  2QDL A;  2CSI A;  1PRL C;  1NLP C;  2EYY A;  2FEI A;  3M0P A;  1NEB A;  2HEQ A;  2P4R A;  1UUE A;  1U3O A;  1X6B A;  2CUB A;  2G6F X;  3QWX X;  3TSZ A;  1RLP C;  1OPL A;  1M3A A;  1ZUU A;  1UEC A;  1W1F A;  2CRE A;  4OMQ A;  1RI9 A;  2EYX A;  4J9B A;  1KFZ A;  2DE0 X;  1YWP A;  2C0O A;  2DA9 A;  3FJ5 A;  1WA7 A;  2GBQ A;  4HVU A;  2GTJ A;  3R6N A;  2LQN A;  3VS2 A;  1A0N B;  1WFW A;  4J9E A;  1NLO C;  4AG1 C;  1I0C A;  2FPE A;  1B07 A;  1GFD A;  2SRC A;  1AWO A;  1OOT A;  3VS3 A;  3PVQ A;  2EGE A;  4CC7 A;  2DX1 A;  4IIO A;  3IQL A;  5IHI A;  2RQR A;  2RQU A;  3RBB B;  2EKH A;  3VS7 A;  1Y57 A;  4DEX A;  4D8D A;  3CQT A;  1T3S A;  1E7O A;  1CKB A;  1FMK A;  2HDA A;  1U5S A;  1IO6 A;  2KT8 A;  4HVV A;  1PKT A;  2GTO A;  3THK A;  4AFU C;  4ESR A;  1X43 A;  2MCN A;  4AFS C;  1T0H A;  3TSW A;  2ROL A;  2D1X A;  1UTI A;  4D8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...