2CT4A

Solution strutcure of the sh3 domain of the cdc42-interacting protein 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GSSGSSGGHCVAIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cdc42-interacting protein 4
publication title Solution Strutcure of the SH3 domain of the Cdc42-interacting protein 4
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ct4A00
1ZUKA 5FWBA 2DRMA 1U3OA 2KROA 1YCSB 3NMZC 1NLPC 1M3CA 2DF6A 2FRWA 2KGTA 3M0UA 1NEBA 2HDAA 2A08A 1X2KA 4OMNA 2SEMA 1M27C 4LUDA 1JXOA 4JZ4A 1VYUA 2GTOA 4HVVA 1QCFA 1UE9A 1SHFA 2DL5A 2W10A 2CREA 1UHCA 2YUPA 3UA6A 2KE9A 1Z9QA 2OAWA 3UA7A 3REBB 3VS5A 4AFSC 2KNBB 4JPBW 3RBBB 3SHWA 2FPFA 2AZSA 4OMMA 4JZ3A 3TVTA 4D8DA 2K6DA 1NYFA 2E5KA 2JM9A 1UJYA 2MIOA 4AG1C 1E7OA 1PHTA 4KRTA 4ORZA 4LNPA 1GBRA 2EGEA 2LX7A 4HXJA 4JJCA 4X1VA 3VS2A 1WX6A 1ZX6A 2CH4A 1BBZA 2ESWA 1YN8A 2O88A 3M0SA 2D8HA 2A37A 2FG0A 2VKNA 1WXTA 2RF0A 2OI3A 4Z88A 3M0TA 4RTVA 1AOJA 1G2BA 2KEAA 2M0YA 2DL4A 1EFNA 1Y57A 3EG1A 2DM1A 2DJQA 1HD3A 1SRLA 2AKKA 4CC4B 2J7IA 1KIKA 2EYXA 1ZUYA 3EGUA 1S1NA 1M30A 1JU5C 1YP5A 3M0RA 2P4RA 2A36A 2EW3A 2GGRA 2L2PA 2DYBA 1QKXA 3H0FA 2NUZA 1X69A 2K2MA 1XOVA 2J05A 4OMQA 4HCKA 2CUBA 2EGAA 1UHFA 2IIMA 2DE0X 1GCQA 4J9FA 4HVUA 4F16A 2X3XD 1K1ZA 1AWWA 2KXDA 1HSQA 2ED1A 2EKHA 1WLPB 1GBQA 2YSQA 4R0KA 2KRSA 1M8MA 2B86A 2L0AA 2YDLA 4IIOA 1B3QA 1H3HA 1FYNA 2AZVA 2O31A 1NYGA 2KYMA 3H0HA 1SSHA 1W6XA 3R6NA 1K0SA 2JS2A 2DL8A 2LNHB 3LH5A 1GRIA 1UJ0A 1WA7A 5IH2A 3VS3A 4FSSA 2D8JA 2C0OA 2GQIA 2PNIA 2LQWA 1JO8A 1ZBJA 4D8KA 1M3BA 4J9GA 1JEGA 1SEMA 2I0NA 4J9BA 2K3BA 5ECAA 2PZ1A 2RQTA 1KSWA 1ZLMA 3H0IA 3SEMA 3EHRA 2VVKA 1H8KA 2FO0A 2EYWA 2RQRA 1WDXA 2FPDA 2RQUA 2RPNA 2LP5A 4JJBA 2D1XA 2J6KA 5HCKA 4HVWA 4RTYA 3CQTA 4A63B 1MV3A 3PE0A 3M0PA 1AWOA 2JXBA 2HEQA 2J06A 4AFZC 3UF4A 1UTIA 1UG1A 1ZUUA 5I22A 1T3SA 2PTKA 1OV3A 2CT3A 1YWOA 2EYZA 1ABOA 1WIEA 2DL3A 2CSIA 2ECZA 2YT6A 4RTXA 2K7AA 2F2VA 4K11A 4RTUA 1SRMA 2DMOA 2KYBA 2CDTA 3UATA 3TSWA 2JW4A 4J9CA 1PRMC 3I9QA 3VS6A 2YUOA 3ZL7C 4DEXA 2AKLA 4RTTA 2ED0A 3C0CA 4J9IA 2EQIA 4LN2A 1Z9ZA 1ZSGA 5L23A 2SRCA 2DNUA 2RQWA 2H8HA 2A28A 1U5SA 1K76A 1VYVA 1TUCA 1LCKA 1U06A 1WYXA 2ENMA 2DBMA 2DBKA 2O9VA 5GJWB 2GBQA 5FWCA 1RI9A 1UGVA 3VS1A 4AG2C 4CC2A 2JS0A 1BU1A 1G83A 1UUEA 1J3TA 1WI7A 3M0QA 2LJ3A 1PWTA 1TG0A 4Y92A 2DLPA 4F14A 2FEIA 2RN8A 1I07A 1T0HA 1YWPA 1CSKA 2CSQA 1PRLC 1AD5A 4RTZA 2DX1A 1W70A 3VS4A 1Y0MA 2LQNA 4EIKA 2YUQA 2KBTA 1NG2A 2DA9A 3NGPA 2LCSA 1CKBA 1E6GA 4WCIA 3QWYA 1MV0B 2LJ0A 1K9AA 2HSPA 2JM8A 2QDLA 2KRMA 3REAB 1X6BA 1W1FA 2CUDA 1V1CA 2K79A 2K9GA 1X6GA 4LE9A 1B07A 2L3SA 1YNZA 1T3LA 1E6HA 2RMOA 2O2OA 4LUEA 1WXUA 2LJ1A 4CC3A 2M51A 2MOXA 2VWFA 2V1RA 3TSZA 2C0TA 1IO6A 2V1QA 3NPFA 4J9DA 2JT4A 3EG2A 3NHNA 4M4ZA 1VYTA 2EGCA 1GL5A 1AWJA 3FJ5A 2KRNA 2MCNA 3VS7A 1T0JA 3PVQA 2ABLA 4OMLA 4J9HA 1AZGB 1AWXA 1UECA 3A98A 1H92A 2RNAA 3I5SA 2RQVA 4RUGA 2X3WD 1JXMA 2KT8A 1QLYA 5FW9A 5I11A 5GJVB 3THKA 2EPDA 5IHNA 2L3QA 3U23A 2G6FX 1X27A 4CC7A 3EG0A 4JJDA 4ESRA 4ZNXA 1ABQA 2ROLA 4AFUC 1FMKA 4QT7A 4Z8AA 1GCPA 2C0IA 1CKAA 1RLQC 2J6FA 3PVLA 4J9EA 3EHQA 2GTJA 3VRYA 1AEYA 2LZ6B 2W0ZA 1KFZA 2JMCA 3I35A 2NWMA 1NLOC 2FRYA 1K4US 2HBWA 1AVZC 1OPKA 1BB9A 1OOTA 1BK2A 5IXBA 5IHKA 1GFCA 3KFVA 1OPLA 1GCQC 2BZ8A 1RLPC 1M3AA 3VS0A 2BTTA 3H41A 5IHIA 2JMAA 1UDLA 1MUZA 2BZXA 3QWXX 4F17A 4DEYA 4GBQA 1KJWA 4Z89A 2CH4W 2O9SA 1I1JA 1OEBA 1VA7A 2EBPA 4IIMA 3RNJA 2JTEA 1UFFA 1GFDA 2F2WA 1QWEA 2FPEA 2CT4A 1SPKA 1AZEA 5EC7A 2GNCA 5IXFA 4GLMA 1NEGA 2KXCA 2DVJA 1I0CA 1QKWA 2F2XA 1WFWA 1NM7A 2KR3A 3I5RA 1X2QA 4OMPA 1A0NB 1PKSA 3ULRB 3IQLA 3VRZA 2DRKA 1ARKA 4OMOA 2KT1A 2ROTA 1X43A 3JV3A 1PNJA 1PKTA 2L3PA 2DILA 2DL7A 2EYYA 1HJDA 3GBQA 2LMJA 1K0XA 1JQQA 1QWFA 4AFQC 2J6OA 3EG3A 4RTWA 2YUNA 1WXBA 2OJ2A 2AK5A 2BZYA 3O5ZA 4E6RA 2D0NA 2HCKA 1TUDA 1RUWA 2XMFA 1SHGA 1N5ZA 2EVRA
chains in the Genus database with same CATH superfamily
4BDZA 1ACMB 1VQ9A 5CKEA 2YLCA 2KROA 1OYXA 1YCSB 1M3CA 3QIIA 3CMAA 4R55A 1U8RA 2FRWA 5GMKe 3FC3A 2KGTA 4PFPA 2HDAA 4HT8A 1BI3A 3I56A 4JZ4A 2LTOA 2GTOA 2OX7A 5J26A 1VQLQ 1HXDA 1QCFA 2F69A 1UE9A 2GFAA 1U1SA 2CGHA 4M75C 2LCLA 2NLUA 3PIPA 4A4EA 2QDYB 4TVRA 4BY6C 4M7DD 3REBB 4KBMB 1VQ8Q 2QI2A 2IVWA 1Q86R 4GLKA 3SHWA 2KVQG 4KH1B 2RD1A 4JZ3A 1YJ9T 1NYFA 2E5KA 2JM9A 5KYWB 1E7OA 3GLXA 5GAOl 2ZAEA 2EKOA 3JB9J 4E7KA 4J8OA 1NPRA 2CH4A 4C92C 1QCNA 2O88A 4DBQA 4C0DC 1K8AC 3HKSA 3GPLA 2RHIA 4KGZB 1K8AU 2OI3A 4Z88A 4UC4A 1AOJA 4LXCA 4M75D 2P4TA 2KEAA 2OTLA 2FVUA 4PLLA 2H3EB 4C0ZA 1OZ3A 2EWNA 3C94A 1HD3A 4DBRA 4PJOF 3CCMQ 4GY5A 1RAIB 4AT1B 1OX8A 4A4KA 3L2ZA 2MWOA 1VQ5T 2DAQA 2YXYA 1YJ9Q 1X69A 4NL2A 2K2MA 4DOWA 3HP9A 1UHFA 2VGMA 1GCQA 4J9FA 2DTOA 3OW2A 4JS5A 4ATOA 1ZQ1A 1WLPB 1GBQA 1BYMA 2B86A 1PSEA 2K2VA 2YDLA 4IIOA 1B3QA 1H3HA 2NUTA 2AZVA 3LWIA 1NYGA 2FZKB 1TXQA 3CCJT 1YI2T 3R6NA 3M5AA 3A8HB 2XICA 1RAHB 3VS3A 5FRMA 5AYFA 3AHUA 2PNIA 1IGQA 2LQWA 1ZBJA 4OF1A 1M3BA 1SG5A 2EIFA 4J9BA 4ZTJA 5ECAA 3EGDA 1KSWA 1ZLMA 3HFOA 5KYXB 1VQ5Q 3SEMA 2FO0A 1WDXA 5DM7R 2RPNA 4M77G 2DKGA 1M1KR 4RTYA 3LW5E 3CQTA 1MV3A 3PE0A 1YCYA 2X51A 3X24B 3OW2S 3BW1A 5CQXA 1F1BB 3META 4M7DE 2JXBA 2WSFE 3L42A 1UTIA 5I22A 1T3SA 1OV3A 2MF2A 1ZSZA 1VQOA 2ZGWA 4RTXA 3CCQT 4K11A 2DMOA 2CDTA 2MYSA 3CCJQ 1YI2Q 1VUBA 3TSWA 4J9CA 3M59A 2CZ6B 1M2VA 3HHTB 4LN2A 3BDUA 3P8BB 1QW1A 2RQWA 4XTYA 2K3YA 1BI1A 1YIJT 2DFUA 4RKUE 1IGUA 4NL3A 1K76A 5HY6A 2DBMA 4Y91A 2CP2A 4PL6A 4M75E 1RI9A 1UGVA 1WZOA 2JS0A 3VYGA 1BU1A 4OMFB 1WNLA 2ZPFB 2LQ8A 4AMCA 1G5VA 3JB9F 4N0AC 4F14A 4M77A 1YITA 1YWPA 1CSKA 2H3JA 1PCXA 4M78G 1FMWA 4FW1A 4M77D 3TREA 1Y0MA 3CCQQ 4IUUA 1WHKA 1VQNA 1DJ7B 2YUQA 3CPWA 3NGPA 2LCSA 2QG9B 4EMHA 4JJNK 4WCIA 4FM4B 2LJ0A 4E7ZA 3LH0A 1X6BA 2DEQA 3V7SA 4C92E 3I55A 1V1CA 4M7AG 4IUQA 2KK4A 2RJFA 1YIJQ 3H6ZA 4L5GA 3EFRA 3GIBA 4P5NA 4EMKC 3FEOA 2O2OA 4LUEA 1PSFA 2EYQA 1KK7A 3EG9A 3OYFA 2XDBA 1WXUA 1Y7XA 2MOXA 3E1SA 2VWFA 5KYNA 3CCUQ 2V1QA 3EG2A 2QQBA 2EGCA 5LJ5h 3ZBDA 2X4XA 5GAMj 2QK0A 5L8RE 3LGLA 3L2UA 5LJ5d 1N6AA 1T0JA 3RUXA 3PVQA 4ANJA 4J7IA 4ELZC 2RQVA 1XJWB 2OAUA 3UT1A 5FW9A 2E70A 3RR6A 4M78A 4OB2B 5FU6B 5IHNA 3GP8A 1W2BA 2L3QA 4QVCA 4M78D 3U23A 2HKQB 2EQJA 2K3XA 1X27A 4LD6A 2P0QA 3N5BB 1ABQA 4AFUC 2E3IA 3E9FA 4A4FA 3CD6A 4FYXB 2XG8D 3GNFB 2E3HA 4C0FA 4M7AA 1VQMT 2L89A 2AHJB 2DXBA 4FYVB 4WTOB 4E7LA 1QCOA 8AT1B 4HCZA 4M7AD 4JRPA 1YJNT 3QYHB 3SB2A 3R6OA 3CCLT 2JMCA 4MZMA 2NWMA 1NLOC 2M1HA 2FRYA 1UGRB 3V8LA 3S6WA 4HA8A 1OX9A 5IXBA 1GFCA 2RB6A 4X9CA 1VQPQ 2XU8A 3J80E 5IHIA 1HK9A 1UDLA 2JMAA 1MUZA 2DXCA 1JJ2A 3QZ5B 2QQ9A 4GBQA 2CH4W 2O9SA 1VA7A 3QYGB 3CCSQ 3G4SA 3WVEB 1YHQT 5CAIA 2HBPA 4GLMA 2KXCA 4PJMA 1Y96B 2F2XA 1VQMA 1WFWA 1X2QA 2R58A 3OYIA 1A0NB 3F70A 4O6JA 3VU3C 3ULRB 3VRZA 1VOMA 2KT1A 1RACB 1YJNQ 2ATCB 1OU9A 1M4ZA 3CCLQ 3OS5A 3CBMA 1S72A 3FB9A 1M2VB 3GBQA 1K0XA 1JQQA 2K5LA 4RTWA 2YUNA 5CR2A 1ZBXA 2BZYA 3QJYA 5I2SA 1SHGA 4QVDA 1FMKA 1LOJA 1MGQA 3OYJA 3RIRA 2KMTA 5LJ5e 1NLPC 2CP3A 3M4YA 4DA4A 1OU8A 2PQWA 4IUPA 1YHQQ 4DOVA 4ZGDB 3JCMW 1FWZA 3A5ZB 1QVPA 1X2KA 1M27C 4LUDA 2JTFA 2CKKA 1JXOA 3BE3A 4JUVA 3MEWA 4HVVA 2DYIA 1SHFA 2HNIA 3TCJA 2DL5A 3OMCA 4DBHA 2W10A 2CREA 3D7SB 4FW2A 5LJ5g 2VXFA 2K5FA 2YUPA 4N4IA 1AHJB 3UA7A 3JCMd 3SWNA 4PKCC 1D1AA 1NPPA 3HTRA 3M58A 3SFMA 3S3NA 3RDVA 3CXCS 5GAN2 2FPFA 4OMMA 4D8DA 1YJWA 1D1BA 1UJYA 3SDZA 1PHTA 4KRTA 1M1GA 4ORZA 2ZPIB 2QEXA 4PFZA 3HRUA 1ZA2B 3X20B 6AT1B 3VS2A 4HT9A 3UWNA 2M16A 1QMCA 4J5YA 3L2RA 5LJ5f 2FZCB 2ESWA 1YN8A 1H641 2X4YA 3PIOA 1U1TA 1VIFA 4FIBA 3HPWA 4Z02A 2A37A 4BDYA 2VKNA 5D6XA 2RF0A 2DPPB 1G2BA 2G3RA 2M0YA 1VQ9T 4XTXA 1EFNA 1Y57A 1VQ7T 5CKFA 5KYUA 4M7DG 1R0CB 2AKKA 3LLRA 2LNVA 2J7IA 1VQ6A 3CMAT 2COWA 1Q82R 2EYXA 1ZUYA 1S1NA 1M30A 2F5TX 1K73R 2V8JA 2K57A 2DVEA 2EW3A 2GGRA 3CCVQ 2DYBA 5HK3A 2C06A 4OMQA 4HCKA 2CUBA 2EGAA 3QJ6A 4BB7A 5GANj 4HVUA 4PNOA 4NS5A 3J81E 1G3YA 3E9GA 1HSQA 4R0KA 4FSXA 2LDMA 2EQUA 1NZ9A 1FYNA 2X9HA 2F1LA 3C12A 2KYMA 1QVFA 3H0HA 1RAGB 1FXXA 2YWWA 1W6XA 1K0SA 4M75G 1VQ7A 3CC2A 2DL8A 4B9XA 1GRIA 1VQ9Q 2D8JA 2C0OA 3JB9H 2P0PA 2RO0A 3FLGA 1TUGB 1QVGP 2A7YA 4J9GA 3CMAQ 4HCBA 1JEGA 3VJPA 2I0NA 1HYOA 2K3BA 3H8ZA 3MHXA 1BIAA 2VVKA 3MPUB 2DTHA 4M7DA 2LP5A 3I56Q 2LX9A 2OTLT 3M57A 4XTVA 2E12A 3CC7A 3CMET 1M1KC 3JCMc 1AWOA 4C92G 2J06A 1M1KU 1R0BG 1X6OA 1UG1A 2LT1A 3CCEA 4BACA 3JCMe 1QVFS 1YWOA 2EYZA 2GQVA 3OY9A 4A54A 2DL3A 2YT6A 2DZ9A 3HRTA 2KYBA 3UATA 4Y28E 3T9NA 2IG0A 5CCAA 2JW4A 1H3ZA 4D6WA 1PRMC 3VS6A 2YUOA 2AKLA 2L5QA 3O8VA 2D0QB 3C0CA 4J9IA 2EQIA 3CCRT 1G3WA 1W4SA 1TU0B 2SRCA 2D6FA 2DNUA 3JCMg 5LJ3j 2H8HA 4M75A 3M56A 4M77F 1KQSA 4F7UE 3QBYA 1TUCA 1WYXA 3LYIA 2XHCA 2JOYA 2ZZDA 3UDCA 4DBFA 4ZN3A 3VS1A 2ZPGB 2OTLQ 3NFCA 3CMEA 4XU3A 4C0GA 1Q95G 3JAME 1WI7A 2COYA 4X34A 2JZ2A 3MEUA 4NOYA 1TG0A 1XQHA 1I07A 1AD5A 4RTZA 3JCMf 4O5VA 4C8QC 4OB3B 3WXMB 2LQNA 4C92A 1ZHIA 2QTXA 2QQSA 5A0DA 4E47A 3CCRA 3X25B 3BFMA 4C92D 4II1A 3QWYA 2HSPA 4EPCA 1KQSS 3G71A 4ME7A 3ZFJA 2K79A 1B07A 1TS9A 5GAN8 3AT1B 1E6HA 1P92A 3QHSA 1VQOT 3OSVA 1EIFA 3JCMQ 2M51A 2R5AA 1IREB 3EFOA 3EGXB 3PTAA 1RADB 2KRNA 4M78F 5CK9A 1BCMA 2ABLA 4J9HA 5KYYA 3A98A 5C6SA 1OI1A 2RI3A 1X01A 1Q81R 5KYUB 3RKXA 1QLYA 2QA4A 1KC8C 4RCBA 2DJZA 3C95A 1VQKA 5GJVB 4JRKA 2FZGB 2EPDA 1Q7YR 4M7AF 3RMSA 1I4K1 1NJIR 1WQWA 4A4GA 1UGPB 1FMVA 2YRCA 1YITT 3QKJA 1WHGA 5EG2A 4JJDA 1VQOQ 3OS0A 2M9UA 2HSEB 1PD1A 1VQNT 1KQ1A 5D6WA 1YBYA 1RLQC 5CQYA 2X4JA 1I8FA 4J9EA 3MJXA 4J6XA 2A0FB 3I55T 2GTJA 3VRYA 1KD1R 2LZ6B 1RI0A 2W0ZA 2E10A 1N8RR 1B7TA 2DXUA 2HBWA 4MDXA 1BB9A 3V7CA 4PK4A 1JBMA 2Y4XA 1WPYA 5IHKA 1OPLA 4BE2A 1RLPC 3VS0A 4PJOC 4LDUA 2BTTA 1WGSA 3VUBA 4ZTFA 2BZXA 4F17A 4DEYA 2RK1A 1KJWA 4Z89A 4OB1B 3TU4K 1KQ2A 2EBPA 3RNJA 3INZA 4M7DB 1UFFA 1YITQ 5C0MA 3OW2P 3G7ZA 1SPKA 1AZEA 5EC7A 1TOVA 3MEVA 4ZN1A 3DKMA 2DVJA 1I0CA 5DY9A 2OTJT 1QKWA 1LVKA 2E65A 5GAN6 1VQNQ 2X4WA 4Q5WA 3JCMP 1OQKA 3OYAA 4X9DA 2FB7A 2ROTA 4FU6A 4JRIA 2BKDN 1PNJA 3I55Q 2RJCA 1PKTA 1WHJA 2DILA 2DL7A 2EFIA 1HJDA 2VASA 3GF5A 5KE2A 5GAMh 1M90R 1SKUB 4N0AA 2J6OA 2JUFA 2JTMA 5GAMd 3CD6T 4MMKA 4VUBA 4FYYB 3OBYA 4E6RA 2E6ZA 4KGVB 4E7JA 1BKBA 2GCXA 2R5MA 4M75B 1TUDA 1RUWA 1NBEB 2EVRA 1KG1A 2V8IA 2DRMA 1U3OA 1KC8R 4RG8A 5GAOn 1N9RA 3FDRA 4C8QE 3CPWS 2OTJA 2F5KA 2JN0A 3M0UA 4LDWA 3WVDB 1K9MR 1NEBA 2A08A 3JCMV 4OMNA 3C4SA 3GNGA 3P8DA 3DLLA 4EMKA 1KHIA 3BDLA 1UHCA 4A53A 5HKCA 3UA6A 2A3LA 2KE9A 1FX7A 2OAWA 3G4ST 3MP1A 3S3MA 3OS1A 1D09B 2KNBB 4IUTA 4C0DB 3OQ5A 5KCHA 2AZSA 1PM3A 3CD6Q 2Y90A 3TVTA 2NUTB 4AG1C 2CP5A 1GBRA 2EGEA 5D7UA 1JB0E 3KXTA 2LX7A 4HXJA 4JJCA 4X1VA 4IKFA 2VUBA 4BE0A 1S72T 1ZX6A 3QUIA 1BBZA 4QVZA 4QQ6A 1EX4A 4LDYA 2D8HA 2FG0A 1W2BS 1C1AA 1WJQA 3EGDB 3M0TA 2EJGA 5KYYB 1G3SA 4IUVA 2HZYA 4E7HA 2ZCFB 3CPWP 2DL4A 5CIUA 3QXEB 3PFSA 2DM1A 4KGXB 3JB9I 4YTLA 2DJQA 1VQPA 5IN1A 3V8KA 4A4HA 4XU0A 4CC4B 1KIKA 1D0YA 2LQKA 1BCOA 2BIVA 1YP5A 5M9OA 1LNXA 1Q82C 2P4RA 2A36A 1VQMQ 1Q82U 1K73C 1QKXA 3OYDA 2LC4A 2NUZA 1ZSZB 1K73U 2J05A 2MK5A 2IIMA 4FCYA 4F16A 1AWWA 3NTHA 3H9NA 1S72Q 1IB8A 2WSCE 2KRSA 5I2MA 1M8MA 4CI0C 4F7UG 5CKBA 4KULA 3VKIA 2COZA 1JJ2S 4PJOE 5KH6A 5KYWA 2RM4A 3PGGA 1YJWT 2JS2A 4M7DF 5GAMe 4EDUA 2QEXT 3LH5A 1UJ0A 2MWPA 1M1FA 4HKEA 1XTDA 4FSSA 2GQIA 3OYNA 5GAOm 3MP6A 3M55A 1JO8A 3OYMA 3CC4A 2BE7D 1D1CA 1SEMA 5GMKh 3Q1JA 2PZ1A 3ER0A 5GMKj 4M77B 3H0IA 5GAMg 1H8KA 2EYWA 2JNGA 2RQRA 2FPDA 2RQUA 4XK8E 2VGNA 2RH2A 5GAOr 3OSSC 2D1XA 4HVWA 2VB6A 4A63B 1BI0A 2ZPEB 3M9QA 2DETA 5GAN5 2EAYA 1RAFB 1VQ6T 4AFZC 3ZEHA 1D0ZA 2LT4A 2L8DA 4M75F 2LRQA 2PTKA 1TSFA 3G1JA 1WIEA 2ECZA 2F2VA 4RTUA 5CKDA 1SRMA 1YJWQ 3OYCA 4HCCA 4FYWB 3EG9B 4DEXA 5GAMf 2QEXQ 4F7UA 2ED0A 2KY9A 2QGFB 1ZSGA 5L23A 4N4HA 2A28A 1U5SA 4MDWA 1U06A 1VQ4A 2L3RA 3V8JA 2DO3A 3QDRB 2DBKA 2O9VA 2CYZB 5GJWB 2VXEA 3CC2T 4C92F 5FWCA 3MEAA 4AG2C 4CC2A 1G83A 1UUEA 1J3TA 5GMKl 3A8GB 2LJ3A 1PWTA 2CS7A 4C5IA 1VQ6Q 3S3OA 4M78B 2FEIA 3OYYA 2RN8A 2CSQA 1T0HA 4EMKB 2E1HA 3MO8A 5AT1B 3HL8A 4FT2A 5GANh 1W70A 4QKUA 3LGFA 3EAEA 4V2SA 2KBTA 5GANd 3OYLA 2DA9A 3CXCP 2B8AA 1Y07A 3CC7T 1LJOA 3ASKA 4M7AB 2QDLA 2KRMA 1W1FA 2CUDA 3QZ9B 3G6EA 3CCET 3NTIA 1WHHA 2K9GA 4LE9A 4OGCA 2PUOB 4L6V5 4N4GA 5FU7B 2XK0A 5I21A 1TH7A 5FLXE 1G3TA 4CC3A 3VYHB 2V1RA 3TSZA 1M5Q1 2C0TA 4WF2A 1VQ7Q 1B34A 2JT4A 3EH1A 2JVVA 3OA6A 1VYTA 1GL5A 3FIFA 3HSBA 2AIRB 3A8MB 2HD0A 3CBPA 4C5EA 2HMAA 3MP8A 3P8HA 3VS7A 1V29B 5IAYA 4ZGEB 4OMLA 5CO7A 1AZGB 3L2WA 1MNEA 1WJRA 2RNAA 2X3WD 1XNIA 1JXMA 2HQHA 2EJFA 1Q81C 1Q81U 2QYZA 4L59A 3M4GA 1VQLA 3CC7Q 3RERA 3URGA 1Q7YC 1PD0A 3PMTA 1SF9A 4J6WA 1Q7YU 1NJIC 4KH0B 3CCEQ 1VQ8A 1NJIU 1PC0A 3PMIA 1QP3A 3SD4A 3CCMT 4BE1A 3DB3A 4ESRA 4ZNXA 2ROLA 2MPXC 4Z8AA 4QT7A 1GCPA 4XTUA 5LJ3h 1M9SA 2C0IA 1CKAA 2QASA 2J6FA 3OYHA 3UPUA 5LJ3d 1AT1B 5KCOA 5FU6C 3G71T 1AEYA 3RKWA 2CP6A 2YRDA 3QO3A 3DLMA 4C8QG 3I35A 1M2OA 1K4US 4IURA 1AVZC 1OOTA 1BK2A 1KD1C 4XTWA 1N8RC 1KD1U 2PVDB 2O4XA 1GCQC 1N8RU 1M3AA 3M54A 1N27A 3H41A 3CMEQ 1WJSA 1R77A 3LX7A 3OYBA 4KT0E 1I1JA 2VV5A 2JTEA 4PJJA 3A8OB 2F2WA 1V76A 4MZTA 3CCMA 1I5LA 2CT4A 1QQJA 3QPHA 5DLQE 2LCCA 5IXFA 1BI2A 1NEGA 2EQMA 2PVOB 3SWNB 2QA4T 2I2LA 3OYGA 2BUDA 1VQKT 1NM7A 5IT9E 2KR3A 3I5RA 1YJ9A 4OMPA 1QVFP 1PKSA 3CCRQ 4JDSA 3IQLA 2KI7A 1O9SA 5LL6S 5GANe 2V8KA 5GMKi 1X43A 1VIEA 3G71Q 5FROA 2RJEA 1C6VX 2QQAA 1I81A 2GF7A 2CP7A 4F7UB 1QWFA 4AFQC 2DD5A 3CBOA 2HKNA 2OJ2A 1M90C 3O5ZA 2PUKB 5GANg 1M90U 2HCKA 4C8QA 2XMFA 1WQ7A 4CRIA 1O75A 1ZUKA 5FWBA 4C8QD 1ZSZC 3NMZC 4E2FB 2DF6A 5A2QE 2EQKA 1KC8U 2RK2A 2QA4Q 3JSCA 1VQ5A 2SEMA 1R8OB 1VQKQ 2Z0WA 1K9MC 8ATCB 1VYUA 1K9MU 2M02A 4KUIA 2E6NA 2XKOC 5GANf 4FT4A 1Z9QA 4JRQA 5CVIA 3LWHA 1Y96A 3E2UA 3VS5A 4AFSC 1IXDA 4JPBW 3RBBB 1KQSP 4PJOG 1N9SA 3OBWA 2K4YA 4OP0A 4LD9K 4PJLA 1UB4A 1UEBA 2K6DA 2YLBA 5GAOq 3CCJA 1YI2A 2P0KA 2MIOA 2CZ7B 4M77C 4LNPA 1D0XA 1WHMA 5LJ3e 5GAOp 2QTVA 1WX6A 4BI4A 5GAN4 1BIBA 1K8AR 1B34B 2RA2A 4B9WA 1Y71A 3M0SA 2PVGB 1WXTA 3DB4A 4PLIA 4RTVA 4OB0B 4LDVA 2DTIA 5LJ3g 4JLIA 1ZA1B 3CCUT 3EG1A 3GOXA 2DD4A 4E7IA 2XD0A 2XDPA 2E41A 1SRLA 2V26A 2JJ9A 4OGEA 4RCCA 3EGUA 4EMGA 1WHLA 2X35A 1JU5C 3CEYA 3HFNA 2XDDA 1TTHB 3M0RA 2L2PA 5J3BA 1IHVA 3CCQA 3H0FA 1MNDA 1RABB 2NUPA 4JS4A 1XOVA 2YHTA 2CP0A 2DE0X 3OMGA 3EFSA 4PJOA 2X3XD 1K1ZA 2KXDA 5LJ3f 4OVAA 2ED1A 2EKHA 2YSQA 4PJOD 2LVMA 3M53A 1YIJA 2L0AA 4XU1A 2O31A 5A0LA 4M78C 2DERA 1SSHA 3CCUA 4BY6B 2D9TA 2LNHB 1WA7A 5IH2A 1G8XA 3OS2A 2HL5C 3CPFA 2DIGA 2O4XB 4D8KA 5GAN7 1YFNA 5LJ5j 2OTJQ 3TQ7P 4M7AC 4FL6A 2RQTA 2P84A 3VUZA 3X28B 3EHRA 1IHWA 1JRIA 2QXFA 4JJBA 4JLGA 2FL7A 2J6KA 3MCAB 3OB9A 5FU7C 5HCKA 3MKDA 3V7RA 4ZGJB 1VQPT 4C92B 4F7UF 4J6YA 4KUDK 3M0PA 2HEQA 3UF4A 4B6MA 1ZUUA 4F04B 1IRXA 2M0OA 5J39A 5D6YA 1OULA 3CCST 2CT3A 3JB9G 5GMKm 1ABOA 2CSIA 3X26B 5KE3A 2K7AA 2DK3A 2HAXA 3I9QA 2WSEE 5A0GA 3ZL7C 3HRSA 4RTTA 3OYEA 2DEUA 3EFOB 1Z9ZA 2MAMA 2HQEA 2DIQA 1D3BA 4RMOA 3RESA 3A8LB 2R57A 2CZ1B 4C8QB 5HK0A 1VYVA 1MMNA 1LCKA 2ZPHB 4XAXB 2KQWA 2ENMA 2DXTA 2RI2A 5CKHA 3NTKA 1OZ2A 2GBQA 2E4HA 3G4SQ 3JCMJ 4XTZA 3PT9A 1M8VA 3M0QA 4Y92A 3CC4T 2DLPA 2VC8A 2XI9A 3CCSA 2EJ9A 1PRLC 3QDFA 3JCMX 3JCMb 1RAEB 2QQRA 2DX1A 1MMDA 4R56A 3VS4A 4EIKA 4M77E 2MI6A 3KBGA 4PFOA 1NG2A 3PNWC 3QSUA 2QGGA 1CKBA 1E6GA 3L1AA 1MV0B 1K9AA 2JM8A 3REAB 4E7SA 1YJNA 3JB9D 3CCLA 1X6GA 2L3SA 2HL3A 1YNZA 1T3LA 2RMOA 3BY7A 3EH2A 2LJ1A 3ME9A 2FHDA 4BD3A 1IO6A 2BE9B 5GAN3 3NPFA 4J9DA 3NHNA 4M4ZA 1EZZB 1AWJA 3FJ5A 3SWNC 3CXCA 1W2BP 2KSSA 2NYSA 2MCNA 2GFUA 2E64A 3CC4Q 3RKYA 4BI3A 1AWXA 1UECA 1KHCA 1H92A 1VQ4T 1YHQA 3I5SA 4RUGA 4ELYC 2RHUA 2KT8A 4BUGA 4LDXA 5I11A 2RJDA 2XIDA 3THKA 4XQ3A 2DZCA 2IPOB 1TWBA 1C0MA 1QVGA 3VV0A 2G6FX 3JCMh 2NUPB 7AT1B 4CC7A 3EG0A 4M78E 5DLOA 1MHNA 4PJOB 2VYTA 4XU2A 3FJPA 3CCVT 3A1PA 3PVLA 1JJ2P 1Q86C 5FRNA 1I5OB 3EHQA 4C5HA 2RI5A 2Y4YA 1Q86U 3G6ET 2FYKA 4BI8B 4J7FA 3L2QA 4M7AE 2O01E 1X75C 1KFZA 3FRNA 1NE8A 1OPKA 1VQ4Q 3L2VA 4C5GA 3EGXA 1UGSB 3KFVA 2BZ8A 1LPLA 9ATCB 4QW2A 1QVGS 3QWXX 2KDSA 3RMQA 5KYXA 2KAFA 3KUFA 2QAZA 4DQ2A 1OEBA 2K5IA 4IIMA 1GFDA 1QWEA 2FPEA 2YRVA 1QP2A 2WACA 2GNCA 1GXIE 4QQDA 2PU9B 3CCVA 4MMLA 2HQXA 4RG2A 2E5QA 4MZPA 2RHYA 1VQLT 2RHZA 3QG1A 4C8QF 2DRKA 1ARKA 1RAAB 4OMOA 2RHXA 3I56T 3JV3A 3OYKA 1MMAA 3E19A 3G6EQ 2L3PA 1RL2A 2EYYA 3TEEA 1VQ8T 3J7AF 4M7DC 4PJNA 4J83A 2LMJA 1IZ6A 2CZ0B 3CC2Q 1SSFA 2MMPA 4QQGA 3EG3A 1WXBA 2AK5A 1D3BB 1MMGA 2ZPBB 2D0NA 2AT1B 3JRZA 1PG5B 1UGQB 1N5ZA
chains in the Genus database with same CATH topology
1ZUKA 5FWBA 2DRMA 1U3OA 2KROA 1YCSB 3NMZC 1NLPC 1M3CA 2DF6A 2FRWA 2KGTA 3M0UA 1NEBA 2HDAA 2A08A 1X2KA 4OMNA 2SEMA 1M27C 4LUDA 1JXOA 4JZ4A 1VYUA 2GTOA 4HVVA 1QCFA 1UE9A 1SHFA 2DL5A 2W10A 2CREA 1UHCA 2YUPA 3UA6A 2KE9A 1Z9QA 2OAWA 3UA7A 3REBB 3VS5A 4AFSC 2KNBB 4JPBW 3RBBB 3SHWA 2FPFA 2AZSA 4OMMA 4JZ3A 3TVTA 4D8DA 2K6DA 1NYFA 2E5KA 2JM9A 1UJYA 2MIOA 4AG1C 1E7OA 1PHTA 4KRTA 4ORZA 4LNPA 1GBRA 2EGEA 2LX7A 4HXJA 4JJCA 4X1VA 3VS2A 1WX6A 1ZX6A 2CH4A 1BBZA 2ESWA 1YN8A 2O88A 3M0SA 2D8HA 2A37A 2FG0A 2VKNA 1WXTA 2RF0A 2OI3A 4Z88A 3M0TA 4RTVA 1AOJA 1G2BA 2KEAA 2M0YA 2DL4A 1EFNA 1Y57A 3EG1A 2DM1A 2DJQA 1HD3A 1SRLA 2AKKA 4CC4B 2J7IA 1KIKA 2EYXA 1ZUYA 3EGUA 1S1NA 1M30A 1JU5C 1YP5A 3M0RA 2P4RA 2A36A 2EW3A 2GGRA 2L2PA 2DYBA 1QKXA 3H0FA 2NUZA 1X69A 2K2MA 1XOVA 2J05A 4OMQA 4HCKA 2CUBA 2EGAA 1UHFA 2IIMA 2DE0X 1GCQA 4J9FA 4HVUA 4F16A 2X3XD 1K1ZA 1AWWA 2KXDA 1HSQA 2ED1A 2EKHA 1WLPB 1GBQA 2YSQA 4R0KA 2KRSA 1M8MA 2B86A 2L0AA 2YDLA 4IIOA 1B3QA 1H3HA 1FYNA 2AZVA 2O31A 1NYGA 2KYMA 3H0HA 1SSHA 1W6XA 3R6NA 1K0SA 2JS2A 2DL8A 2LNHB 3LH5A 1GRIA 1UJ0A 1WA7A 5IH2A 3VS3A 4FSSA 2D8JA 2C0OA 2GQIA 2PNIA 2LQWA 1JO8A 1ZBJA 4D8KA 1M3BA 4J9GA 1JEGA 1SEMA 2I0NA 4J9BA 2K3BA 5ECAA 2PZ1A 2RQTA 1KSWA 1ZLMA 3H0IA 3SEMA 3EHRA 2VVKA 1H8KA 2FO0A 2EYWA 2RQRA 1WDXA 2FPDA 2RQUA 2RPNA 2LP5A 4JJBA 2D1XA 2J6KA 5HCKA 4HVWA 4RTYA 3CQTA 4A63B 1MV3A 3PE0A 3M0PA 1AWOA 2JXBA 2HEQA 2J06A 4AFZC 3UF4A 1UTIA 1UG1A 1ZUUA 5I22A 1T3SA 2PTKA 1OV3A 2CT3A 1YWOA 2EYZA 1ABOA 1WIEA 2DL3A 2CSIA 2ECZA 2YT6A 4RTXA 2K7AA 2F2VA 4K11A 4RTUA 1SRMA 2DMOA 2KYBA 2CDTA 3UATA 3TSWA 2JW4A 4J9CA 1PRMC 3I9QA 3VS6A 2YUOA 3ZL7C 4DEXA 2AKLA 4RTTA 2ED0A 3C0CA 4J9IA 2EQIA 4LN2A 1Z9ZA 1ZSGA 5L23A 2SRCA 2DNUA 2RQWA 2H8HA 2A28A 1U5SA 1K76A 1VYVA 1TUCA 1LCKA 1U06A 1WYXA 2ENMA 2DBMA 2DBKA 2O9VA 5GJWB 2GBQA 5FWCA 1RI9A 1UGVA 3VS1A 4AG2C 4CC2A 2JS0A 1BU1A 1G83A 1UUEA 1J3TA 1WI7A 3M0QA 2LJ3A 1PWTA 1TG0A 4Y92A 2DLPA 4F14A 2FEIA 2RN8A 1I07A 1T0HA 1YWPA 1CSKA 2CSQA 1PRLC 1AD5A 4RTZA 2DX1A 1W70A 3VS4A 1Y0MA 2LQNA 4EIKA 2YUQA 2KBTA 1NG2A 2DA9A 3NGPA 2LCSA 1CKBA 1E6GA 4WCIA 3QWYA 1MV0B 2LJ0A 1K9AA 2HSPA 2JM8A 2QDLA 2KRMA 3REAB 1X6BA 1W1FA 2CUDA 1V1CA 2K79A 2K9GA 1X6GA 4LE9A 1B07A 2L3SA 1YNZA 1T3LA 1E6HA 2RMOA 2O2OA 4LUEA 1WXUA 2LJ1A 4CC3A 2M51A 2MOXA 2VWFA 2V1RA 3TSZA 2C0TA 1IO6A 2V1QA 3NPFA 4J9DA 2JT4A 3EG2A 3NHNA 4M4ZA 1VYTA 2EGCA 1GL5A 1AWJA 3FJ5A 2KRNA 2MCNA 3VS7A 1T0JA 3PVQA 2ABLA 4OMLA 4J9HA 1AZGB 1AWXA 1UECA 3A98A 1H92A 2RNAA 3I5SA 2RQVA 4RUGA 2X3WD 1JXMA 2KT8A 1QLYA 5FW9A 5I11A 5GJVB 3THKA 2EPDA 5IHNA 2L3QA 3U23A 2G6FX 1X27A 4CC7A 3EG0A 4JJDA 4ESRA 4ZNXA 1ABQA 2ROLA 4AFUC 1FMKA 4QT7A 4Z8AA 1GCPA 2C0IA 1CKAA 1RLQC 2J6FA 3PVLA 4J9EA 3EHQA 2GTJA 3VRYA 1AEYA 2LZ6B 2W0ZA 1KFZA 2JMCA 3I35A 2NWMA 1NLOC 2FRYA 1K4US 2HBWA 1AVZC 1OPKA 1BB9A 1OOTA 1BK2A 5IXBA 5IHKA 1GFCA 3KFVA 1OPLA 1GCQC 2BZ8A 1RLPC 1M3AA 3VS0A 2BTTA 3H41A 5IHIA 2JMAA 1UDLA 1MUZA 2BZXA 3QWXX 4F17A 4DEYA 4GBQA 1KJWA 4Z89A 2CH4W 2O9SA 1I1JA 1OEBA 1VA7A 2EBPA 4IIMA 3RNJA 2JTEA 1UFFA 1GFDA 2F2WA 1QWEA 2FPEA 2CT4A 1SPKA 1AZEA 5EC7A 2GNCA 5IXFA 4GLMA 1NEGA 2KXCA 2DVJA 1I0CA 1QKWA 2F2XA 1WFWA 1NM7A 2KR3A 3I5RA 1X2QA 4OMPA 1A0NB 1PKSA 3ULRB 3IQLA 3VRZA 2DRKA 1ARKA 4OMOA 2KT1A 2ROTA 1X43A 3JV3A 1PNJA 1PKTA 2L3PA 2DILA 2DL7A 2EYYA 1HJDA 3GBQA 2LMJA 1K0XA 1JQQA 1QWFA 4AFQC 2J6OA 3EG3A 4RTWA 2YUNA 1WXBA 2OJ2A 2AK5A 2BZYA 3O5ZA 4E6RA 2D0NA 2HCKA 1TUDA 1RUWA 2XMFA 1SHGA 1N5ZA 2EVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUK A;  5FWB A;  2DRM A;  1U3O A;  2KRO A;  1YCS B;  3NMZ C;  1NLP C;  1M3C A;  2DF6 A;  2FRW A;  2KGT A;  3M0U A;  1NEB A;  2HDA A;  2A08 A;  1X2K A;  4OMN A;  2SEM A;  1M27 C;  4LUD A;  1JXO A;  4JZ4 A;  1VYU A;  2GTO A;  4HVV A;  1QCF A;  1UE9 A;  1SHF A;  2DL5 A;  2W10 A;  2CRE A;  1UHC A;  2YUP A;  3UA6 A;  2KE9 A;  1Z9Q A;  2OAW A;  3UA7 A;  3REB B;  3VS5 A;  4AFS C;  2KNB B;  4JPB W;  3RBB B;  3SHW A;  2FPF A;  2AZS A;  4OMM A;  4JZ3 A;  3TVT A;  4D8D A;  2K6D A;  1NYF A;  2E5K A;  2JM9 A;  1UJY A;  2MIO A;  4AG1 C;  1E7O A;  1PHT A;  4KRT A;  4ORZ A;  4LNP A;  1GBR A;  2EGE A;  2LX7 A;  4HXJ A;  4JJC A;  4X1V A;  3VS2 A;  1WX6 A;  1ZX6 A;  2CH4 A;  1BBZ A;  2ESW A;  1YN8 A;  2O88 A;  3M0S A;  2D8H A;  2A37 A;  2FG0 A;  2VKN A;  1WXT A;  2RF0 A;  2OI3 A;  4Z88 A;  3M0T A;  4RTV A;  1AOJ A;  1G2B A;  2KEA A;  2M0Y A;  2DL4 A;  1EFN A;  1Y57 A;  3EG1 A;  2DM1 A;  2DJQ A;  1HD3 A;  1SRL A;  2AKK A;  4CC4 B;  2J7I A;  1KIK A;  2EYX A;  1ZUY A;  3EGU A;  1S1N A;  1M30 A;  1JU5 C;  1YP5 A;  3M0R A;  2P4R A;  2A36 A;  2EW3 A;  2GGR A;  2L2P A;  2DYB A;  1QKX A;  3H0F A;  2NUZ A;  1X69 A;  2K2M A;  1XOV A;  2J05 A;  4OMQ A;  4HCK A;  2CUB A;  2EGA A;  1UHF A;  2IIM A;  2DE0 X;  1GCQ A;  4J9F A;  4HVU A;  4F16 A;  2X3X D;  1K1Z A;  1AWW A;  2KXD A;  1HSQ A;  2ED1 A;  2EKH A;  1WLP B;  1GBQ A;  2YSQ A;  4R0K A;  2KRS A;  1M8M A;  2B86 A;  2L0A A;  2YDL A;  4IIO A;  1B3Q A;  1H3H A;  1FYN A;  2AZV A;  2O31 A;  1NYG A;  2KYM A;  3H0H A;  1SSH A;  1W6X A;  3R6N A;  1K0S A;  2JS2 A;  2DL8 A;  2LNH B;  3LH5 A;  1GRI A;  1UJ0 A;  1WA7 A;  5IH2 A;  3VS3 A;  4FSS A;  2D8J A;  2C0O A;  2GQI A;  2PNI A;  2LQW A;  1JO8 A;  1ZBJ A;  4D8K A;  1M3B A;  4J9G A;  1JEG A;  1SEM A;  2I0N A;  4J9B A;  2K3B A;  5ECA A;  2PZ1 A;  2RQT A;  1KSW A;  1ZLM A;  3H0I A;  3SEM A;  3EHR A;  2VVK A;  1H8K A;  2FO0 A;  2EYW A;  2RQR A;  1WDX A;  2FPD A;  2RQU A;  2RPN A;  2LP5 A;  4JJB A;  2D1X A;  2J6K A;  5HCK A;  4HVW A;  4RTY A;  3CQT A;  4A63 B;  1MV3 A;  3PE0 A;  3M0P A;  1AWO A;  2JXB A;  2HEQ A;  2J06 A;  4AFZ C;  3UF4 A;  1UTI A;  1UG1 A;  1ZUU A;  5I22 A;  1T3S A;  2PTK A;  1OV3 A;  2CT3 A;  1YWO A;  2EYZ A;  1ABO A;  1WIE A;  2DL3 A;  2CSI A;  2ECZ A;  2YT6 A;  4RTX A;  2K7A A;  2F2V A;  4K11 A;  4RTU A;  1SRM A;  2DMO A;  2KYB A;  2CDT A;  3UAT A;  3TSW A;  2JW4 A;  4J9C A;  1PRM C;  3I9Q A;  3VS6 A;  2YUO A;  3ZL7 C;  4DEX A;  2AKL A;  4RTT A;  2ED0 A;  3C0C A;  4J9I A;  2EQI A;  4LN2 A;  1Z9Z A;  1ZSG A;  5L23 A;  2SRC A;  2DNU A;  2RQW A;  2H8H A;  2A28 A;  1U5S A;  1K76 A;  1VYV A;  1TUC A;  1LCK A;  1U06 A;  1WYX A;  2ENM A;  2DBM A;  2DBK A;  2O9V A;  5GJW B;  2GBQ A;  5FWC A;  1RI9 A;  1UGV A;  3VS1 A;  4AG2 C;  4CC2 A;  2JS0 A;  1BU1 A;  1G83 A;  1UUE A;  1J3T A;  1WI7 A;  3M0Q A;  2LJ3 A;  1PWT A;  1TG0 A;  4Y92 A;  2DLP A;  4F14 A;  2FEI A;  2RN8 A;  1I07 A;  1T0H A;  1YWP A;  1CSK A;  2CSQ A;  1PRL C;  1AD5 A;  4RTZ A;  2DX1 A;  1W70 A;  3VS4 A;  1Y0M A;  2LQN A;  4EIK A;  2YUQ A;  2KBT A;  1NG2 A;  2DA9 A;  3NGP A;  2LCS A;  1CKB A;  1E6G A;  4WCI A;  3QWY A;  1MV0 B;  2LJ0 A;  1K9A A;  2HSP A;  2JM8 A;  2QDL A;  2KRM A;  3REA B;  1X6B A;  1W1F A;  2CUD A;  1V1C A;  2K79 A;  2K9G A;  1X6G A;  4LE9 A;  1B07 A;  2L3S A;  1YNZ A;  1T3L A;  1E6H A;  2RMO A;  2O2O A;  4LUE A;  1WXU A;  2LJ1 A;  4CC3 A;  2M51 A;  2MOX A;  2VWF A;  2V1R A;  3TSZ A;  2C0T A;  1IO6 A;  2V1Q A;  3NPF A;  4J9D A;  2JT4 A;  3EG2 A;  3NHN A;  4M4Z A;  1VYT A;  2EGC A;  1GL5 A;  1AWJ A;  3FJ5 A;  2KRN A;  2MCN A;  3VS7 A;  1T0J A;  3PVQ A;  2ABL A;  4OML A;  4J9H A;  1AZG B;  1AWX A;  1UEC A;  3A98 A;  1H92 A;  2RNA A;  3I5S A;  2RQV A;  4RUG A;  2X3W D;  1JXM A;  2KT8 A;  1QLY A;  5FW9 A;  5I11 A;  5GJV B;  3THK A;  2EPD A;  5IHN A;  2L3Q A;  3U23 A;  2G6F X;  1X27 A;  4CC7 A;  3EG0 A;  4JJD A;  4ESR A;  4ZNX A;  1ABQ A;  2ROL A;  4AFU C;  1FMK A;  4QT7 A;  4Z8A A;  1GCP A;  2C0I A;  1CKA A;  1RLQ C;  2J6F A;  3PVL A;  4J9E A;  3EHQ A;  2GTJ A;  3VRY A;  1AEY A;  2LZ6 B;  2W0Z A;  1KFZ A;  2JMC A;  3I35 A;  2NWM A;  1NLO C;  2FRY A;  1K4U S;  2HBW A;  1AVZ C;  1OPK A;  1BB9 A;  1OOT A;  1BK2 A;  5IXB A;  5IHK A;  1GFC A;  3KFV A;  1OPL A;  1GCQ C;  2BZ8 A;  1RLP C;  1M3A A;  3VS0 A;  2BTT A;  3H41 A;  5IHI A;  2JMA A;  1UDL A;  1MUZ A;  2BZX A;  3QWX X;  4F17 A;  4DEY A;  4GBQ A;  1KJW A;  4Z89 A;  2CH4 W;  2O9S A;  1I1J A;  1OEB A;  1VA7 A;  2EBP A;  4IIM A;  3RNJ A;  2JTE A;  1UFF A;  1GFD A;  2F2W A;  1QWE A;  2FPE A;  2CT4 A;  1SPK A;  1AZE A;  5EC7 A;  2GNC A;  5IXF A;  4GLM A;  1NEG A;  2KXC A;  2DVJ A;  1I0C A;  1QKW A;  2F2X A;  1WFW A;  1NM7 A;  2KR3 A;  3I5R A;  1X2Q A;  4OMP A;  1A0N B;  1PKS A;  3ULR B;  3IQL A;  3VRZ A;  2DRK A;  1ARK A;  4OMO A;  2KT1 A;  2ROT A;  1X43 A;  3JV3 A;  1PNJ A;  1PKT A;  2L3P A;  2DIL A;  2DL7 A;  2EYY A;  1HJD A;  3GBQ A;  2LMJ A;  1K0X A;  1JQQ A;  1QWF A;  4AFQ C;  2J6O A;  3EG3 A;  4RTW A;  2YUN A;  1WXB A;  2OJ2 A;  2AK5 A;  2BZY A;  3O5Z A;  4E6R A;  2D0N A;  2HCK A;  1TUD A;  1RUW A;  2XMF A;  1SHG A;  1N5Z A;  2EVR A; 
#chains in the Genus database with same CATH topology
 4BDZ A;  1ACM B;  1VQ9 A;  5CKE A;  2YLC A;  2KRO A;  1OYX A;  1YCS B;  1M3C A;  3QII A;  3CMA A;  4R55 A;  1U8R A;  2FRW A;  5GMK e;  3FC3 A;  2KGT A;  4PFP A;  2HDA A;  4HT8 A;  1BI3 A;  3I56 A;  4JZ4 A;  2LTO A;  2GTO A;  2OX7 A;  5J26 A;  1VQL Q;  1HXD A;  1QCF A;  2F69 A;  1UE9 A;  2GFA A;  1U1S A;  2CGH A;  4M75 C;  2LCL A;  2NLU A;  3PIP A;  4A4E A;  2QDY B;  4TVR A;  4BY6 C;  4M7D D;  3REB B;  4KBM B;  1VQ8 Q;  2QI2 A;  2IVW A;  1Q86 R;  4GLK A;  3SHW A;  2KVQ G;  4KH1 B;  2RD1 A;  4JZ3 A;  1YJ9 T;  1NYF A;  2E5K A;  2JM9 A;  5KYW B;  1E7O A;  3GLX A;  5GAO l;  2ZAE A;  2EKO A;  3JB9 J;  4E7K A;  4J8O A;  1NPR A;  2CH4 A;  4C92 C;  1QCN A;  2O88 A;  4DBQ A;  4C0D C;  1K8A C;  3HKS A;  3GPL A;  2RHI A;  4KGZ B;  1K8A U;  2OI3 A;  4Z88 A;  4UC4 A;  1AOJ A;  4LXC A;  4M75 D;  2P4T A;  2KEA A;  2OTL A;  2FVU A;  4PLL A;  2H3E B;  4C0Z A;  1OZ3 A;  2EWN A;  3C94 A;  1HD3 A;  4DBR A;  4PJO F;  3CCM Q;  4GY5 A;  1RAI B;  4AT1 B;  1OX8 A;  4A4K A;  3L2Z A;  2MWO A;  1VQ5 T;  2DAQ A;  2YXY A;  1YJ9 Q;  1X69 A;  4NL2 A;  2K2M A;  4DOW A;  3HP9 A;  1UHF A;  2VGM A;  1GCQ A;  4J9F A;  2DTO A;  3OW2 A;  4JS5 A;  4ATO A;  1ZQ1 A;  1WLP B;  1GBQ A;  1BYM A;  2B86 A;  1PSE A;  2K2V A;  2YDL A;  4IIO A;  1B3Q A;  1H3H A;  2NUT A;  2AZV A;  3LWI A;  1NYG A;  2FZK B;  1TXQ A;  3CCJ T;  1YI2 T;  3R6N A;  3M5A A;  3A8H B;  2XIC A;  1RAH B;  3VS3 A;  5FRM A;  5AYF A;  3AHU A;  2PNI A;  1IGQ A;  2LQW A;  1ZBJ A;  4OF1 A;  1M3B A;  1SG5 A;  2EIF A;  4J9B A;  4ZTJ A;  5ECA A;  3EGD A;  1KSW A;  1ZLM A;  3HFO A;  5KYX B;  1VQ5 Q;  3SEM A;  2FO0 A;  1WDX A;  5DM7 R;  2RPN A;  4M77 G;  2DKG A;  1M1K R;  4RTY A;  3LW5 E;  3CQT A;  1MV3 A;  3PE0 A;  1YCY A;  2X51 A;  3X24 B;  3OW2 S;  3BW1 A;  5CQX A;  1F1B B;  3MET A;  4M7D E;  2JXB A;  2WSF E;  3L42 A;  1UTI A;  5I22 A;  1T3S A;  1OV3 A;  2MF2 A;  1ZSZ A;  1VQO A;  2ZGW A;  4RTX A;  3CCQ T;  4K11 A;  2DMO A;  2CDT A;  2MYS A;  3CCJ Q;  1YI2 Q;  1VUB A;  3TSW A;  4J9C A;  3M59 A;  2CZ6 B;  1M2V A;  3HHT B;  4LN2 A;  3BDU A;  3P8B B;  1QW1 A;  2RQW A;  4XTY A;  2K3Y A;  1BI1 A;  1YIJ T;  2DFU A;  4RKU E;  1IGU A;  4NL3 A;  1K76 A;  5HY6 A;  2DBM A;  4Y91 A;  2CP2 A;  4PL6 A;  4M75 E;  1RI9 A;  1UGV A;  1WZO A;  2JS0 A;  3VYG A;  1BU1 A;  4OMF B;  1WNL A;  2ZPF B;  2LQ8 A;  4AMC A;  1G5V A;  3JB9 F;  4N0A C;  4F14 A;  4M77 A;  1YIT A;  1YWP A;  1CSK A;  2H3J A;  1PCX A;  4M78 G;  1FMW A;  4FW1 A;  4M77 D;  3TRE A;  1Y0M A;  3CCQ Q;  4IUU A;  1WHK A;  1VQN A;  1DJ7 B;  2YUQ A;  3CPW A;  3NGP A;  2LCS A;  2QG9 B;  4EMH A;  4JJN K;  4WCI A;  4FM4 B;  2LJ0 A;  4E7Z A;  3LH0 A;  1X6B A;  2DEQ A;  3V7S A;  4C92 E;  3I55 A;  1V1C A;  4M7A G;  4IUQ A;  2KK4 A;  2RJF A;  1YIJ Q;  3H6Z A;  4L5G A;  3EFR A;  3GIB A;  4P5N A;  4EMK C;  3FEO A;  2O2O A;  4LUE A;  1PSF A;  2EYQ A;  1KK7 A;  3EG9 A;  3OYF A;  2XDB A;  1WXU A;  1Y7X A;  2MOX A;  3E1S A;  2VWF A;  5KYN A;  3CCU Q;  2V1Q A;  3EG2 A;  2QQB A;  2EGC A;  5LJ5 h;  3ZBD A;  2X4X A;  5GAM j;  2QK0 A;  5L8R E;  3LGL A;  3L2U A;  5LJ5 d;  1N6A A;  1T0J A;  3RUX A;  3PVQ A;  4ANJ A;  4J7I A;  4ELZ C;  2RQV A;  1XJW B;  2OAU A;  3UT1 A;  5FW9 A;  2E70 A;  3RR6 A;  4M78 A;  4OB2 B;  5FU6 B;  5IHN A;  3GP8 A;  1W2B A;  2L3Q A;  4QVC A;  4M78 D;  3U23 A;  2HKQ B;  2EQJ A;  2K3X A;  1X27 A;  4LD6 A;  2P0Q A;  3N5B B;  1ABQ A;  4AFU C;  2E3I A;  3E9F A;  4A4F A;  3CD6 A;  4FYX B;  2XG8 D;  3GNF B;  2E3H A;  4C0F A;  4M7A A;  1VQM T;  2L89 A;  2AHJ B;  2DXB A;  4FYV B;  4WTO B;  4E7L A;  1QCO A;  8AT1 B;  4HCZ A;  4M7A D;  4JRP A;  1YJN T;  3QYH B;  3SB2 A;  3R6O A;  3CCL T;  2JMC A;  4MZM A;  2NWM A;  1NLO C;  2M1H A;  2FRY A;  1UGR B;  3V8L A;  3S6W A;  4HA8 A;  1OX9 A;  5IXB A;  1GFC A;  2RB6 A;  4X9C A;  1VQP Q;  2XU8 A;  3J80 E;  5IHI A;  1HK9 A;  1UDL A;  2JMA A;  1MUZ A;  2DXC A;  1JJ2 A;  3QZ5 B;  2QQ9 A;  4GBQ A;  2CH4 W;  2O9S A;  1VA7 A;  3QYG B;  3CCS Q;  3G4S A;  3WVE B;  1YHQ T;  5CAI A;  2HBP A;  4GLM A;  2KXC A;  4PJM A;  1Y96 B;  2F2X A;  1VQM A;  1WFW A;  1X2Q A;  2R58 A;  3OYI A;  1A0N B;  3F70 A;  4O6J A;  3VU3 C;  3ULR B;  3VRZ A;  1VOM A;  2KT1 A;  1RAC B;  1YJN Q;  2ATC B;  1OU9 A;  1M4Z A;  3CCL Q;  3OS5 A;  3CBM A;  1S72 A;  3FB9 A;  1M2V B;  3GBQ A;  1K0X A;  1JQQ A;  2K5L A;  4RTW A;  2YUN A;  5CR2 A;  1ZBX A;  2BZY A;  3QJY A;  5I2S A;  1SHG A;  4QVD A;  1FMK A;  1LOJ A;  1MGQ A;  3OYJ A;  3RIR A;  2KMT A;  5LJ5 e;  1NLP C;  2CP3 A;  3M4Y A;  4DA4 A;  1OU8 A;  2PQW A;  4IUP A;  1YHQ Q;  4DOV A;  4ZGD B;  3JCM W;  1FWZ A;  3A5Z B;  1QVP A;  1X2K A;  1M27 C;  4LUD A;  2JTF A;  2CKK A;  1JXO A;  3BE3 A;  4JUV A;  3MEW A;  4HVV A;  2DYI A;  1SHF A;  2HNI A;  3TCJ A;  2DL5 A;  3OMC A;  4DBH A;  2W10 A;  2CRE A;  3D7S B;  4FW2 A;  5LJ5 g;  2VXF A;  2K5F A;  2YUP A;  4N4I A;  1AHJ B;  3UA7 A;  3JCM d;  3SWN A;  4PKC C;  1D1A A;  1NPP A;  3HTR A;  3M58 A;  3SFM A;  3S3N A;  3RDV A;  3CXC S;  5GAN 2;  2FPF A;  4OMM A;  4D8D A;  1YJW A;  1D1B A;  1UJY A;  3SDZ A;  1PHT A;  4KRT A;  1M1G A;  4ORZ A;  2ZPI B;  2QEX A;  4PFZ A;  3HRU A;  1ZA2 B;  3X20 B;  6AT1 B;  3VS2 A;  4HT9 A;  3UWN A;  2M16 A;  1QMC A;  4J5Y A;  3L2R A;  5LJ5 f;  2FZC B;  2ESW A;  1YN8 A;  1H64 1;  2X4Y A;  3PIO A;  1U1T A;  1VIF A;  4FIB A;  3HPW A;  4Z02 A;  2A37 A;  4BDY A;  2VKN A;  5D6X A;  2RF0 A;  2DPP B;  1G2B A;  2G3R A;  2M0Y A;  1VQ9 T;  4XTX A;  1EFN A;  1Y57 A;  1VQ7 T;  5CKF A;  5KYU A;  4M7D G;  1R0C B;  2AKK A;  3LLR A;  2LNV A;  2J7I A;  1VQ6 A;  3CMA T;  2COW A;  1Q82 R;  2EYX A;  1ZUY A;  1S1N A;  1M30 A;  2F5T X;  1K73 R;  2V8J A;  2K57 A;  2DVE A;  2EW3 A;  2GGR A;  3CCV Q;  2DYB A;  5HK3 A;  2C06 A;  4OMQ A;  4HCK A;  2CUB A;  2EGA A;  3QJ6 A;  4BB7 A;  5GAN j;  4HVU A;  4PNO A;  4NS5 A;  3J81 E;  1G3Y A;  3E9G A;  1HSQ A;  4R0K A;  4FSX A;  2LDM A;  2EQU A;  1NZ9 A;  1FYN A;  2X9H A;  2F1L A;  3C12 A;  2KYM A;  1QVF A;  3H0H A;  1RAG B;  1FXX A;  2YWW A;  1W6X A;  1K0S A;  4M75 G;  1VQ7 A;  3CC2 A;  2DL8 A;  4B9X A;  1GRI A;  1VQ9 Q;  2D8J A;  2C0O A;  3JB9 H;  2P0P A;  2RO0 A;  3FLG A;  1TUG B;  1QVG P;  2A7Y A;  4J9G A;  3CMA Q;  4HCB A;  1JEG A;  3VJP A;  2I0N A;  1HYO A;  2K3B A;  3H8Z A;  3MHX A;  1BIA A;  2VVK A;  3MPU B;  2DTH A;  4M7D A;  2LP5 A;  3I56 Q;  2LX9 A;  2OTL T;  3M57 A;  4XTV A;  2E12 A;  3CC7 A;  3CME T;  1M1K C;  3JCM c;  1AWO A;  4C92 G;  2J06 A;  1M1K U;  1R0B G;  1X6O A;  1UG1 A;  2LT1 A;  3CCE A;  4BAC A;  3JCM e;  1QVF S;  1YWO A;  2EYZ A;  2GQV A;  3OY9 A;  4A54 A;  2DL3 A;  2YT6 A;  2DZ9 A;  3HRT A;  2KYB A;  3UAT A;  4Y28 E;  3T9N A;  2IG0 A;  5CCA A;  2JW4 A;  1H3Z A;  4D6W A;  1PRM C;  3VS6 A;  2YUO A;  2AKL A;  2L5Q A;  3O8V A;  2D0Q B;  3C0C A;  4J9I A;  2EQI A;  3CCR T;  1G3W A;  1W4S A;  1TU0 B;  2SRC A;  2D6F A;  2DNU A;  3JCM g;  5LJ3 j;  2H8H A;  4M75 A;  3M56 A;  4M77 F;  1KQS A;  4F7U E;  3QBY A;  1TUC A;  1WYX A;  3LYI A;  2XHC A;  2JOY A;  2ZZD A;  3UDC A;  4DBF A;  4ZN3 A;  3VS1 A;  2ZPG B;  2OTL Q;  3NFC A;  3CME A;  4XU3 A;  4C0G A;  1Q95 G;  3JAM E;  1WI7 A;  2COY A;  4X34 A;  2JZ2 A;  3MEU A;  4NOY A;  1TG0 A;  1XQH A;  1I07 A;  1AD5 A;  4RTZ A;  3JCM f;  4O5V A;  4C8Q C;  4OB3 B;  3WXM B;  2LQN A;  4C92 A;  1ZHI A;  2QTX A;  2QQS A;  5A0D A;  4E47 A;  3CCR A;  3X25 B;  3BFM A;  4C92 D;  4II1 A;  3QWY A;  2HSP A;  4EPC A;  1KQS S;  3G71 A;  4ME7 A;  3ZFJ A;  2K79 A;  1B07 A;  1TS9 A;  5GAN 8;  3AT1 B;  1E6H A;  1P92 A;  3QHS A;  1VQO T;  3OSV A;  1EIF A;  3JCM Q;  2M51 A;  2R5A A;  1IRE B;  3EFO A;  3EGX B;  3PTA A;  1RAD B;  2KRN A;  4M78 F;  5CK9 A;  1BCM A;  2ABL A;  4J9H A;  5KYY A;  3A98 A;  5C6S A;  1OI1 A;  2RI3 A;  1X01 A;  1Q81 R;  5KYU B;  3RKX A;  1QLY A;  2QA4 A;  1KC8 C;  4RCB A;  2DJZ A;  3C95 A;  1VQK A;  5GJV B;  4JRK A;  2FZG B;  2EPD A;  1Q7Y R;  4M7A F;  3RMS A;  1I4K 1;  1NJI R;  1WQW A;  4A4G A;  1UGP B;  1FMV A;  2YRC A;  1YIT T;  3QKJ A;  1WHG A;  5EG2 A;  4JJD A;  1VQO Q;  3OS0 A;  2M9U A;  2HSE B;  1PD1 A;  1VQN T;  1KQ1 A;  5D6W A;  1YBY A;  1RLQ C;  5CQY A;  2X4J A;  1I8F A;  4J9E A;  3MJX A;  4J6X A;  2A0F B;  3I55 T;  2GTJ A;  3VRY A;  1KD1 R;  2LZ6 B;  1RI0 A;  2W0Z A;  2E10 A;  1N8R R;  1B7T A;  2DXU A;  2HBW A;  4MDX A;  1BB9 A;  3V7C A;  4PK4 A;  1JBM A;  2Y4X A;  1WPY A;  5IHK A;  1OPL A;  4BE2 A;  1RLP C;  3VS0 A;  4PJO C;  4LDU A;  2BTT A;  1WGS A;  3VUB A;  4ZTF A;  2BZX A;  4F17 A;  4DEY A;  2RK1 A;  1KJW A;  4Z89 A;  4OB1 B;  3TU4 K;  1KQ2 A;  2EBP A;  3RNJ A;  3INZ A;  4M7D B;  1UFF A;  1YIT Q;  5C0M A;  3OW2 P;  3G7Z A;  1SPK A;  1AZE A;  5EC7 A;  1TOV A;  3MEV A;  4ZN1 A;  3DKM A;  2DVJ A;  1I0C A;  5DY9 A;  2OTJ T;  1QKW A;  1LVK A;  2E65 A;  5GAN 6;  1VQN Q;  2X4W A;  4Q5W A;  3JCM P;  1OQK A;  3OYA A;  4X9D A;  2FB7 A;  2ROT A;  4FU6 A;  4JRI A;  2BKD N;  1PNJ A;  3I55 Q;  2RJC A;  1PKT A;  1WHJ A;  2DIL A;  2DL7 A;  2EFI A;  1HJD A;  2VAS A;  3GF5 A;  5KE2 A;  5GAM h;  1M90 R;  1SKU B;  4N0A A;  2J6O A;  2JUF A;  2JTM A;  5GAM d;  3CD6 T;  4MMK A;  4VUB A;  4FYY B;  3OBY A;  4E6R A;  2E6Z A;  4KGV B;  4E7J A;  1BKB A;  2GCX A;  2R5M A;  4M75 B;  1TUD A;  1RUW A;  1NBE B;  2EVR A;  1KG1 A;  2V8I A;  2DRM A;  1U3O A;  1KC8 R;  4RG8 A;  5GAO n;  1N9R A;  3FDR A;  4C8Q E;  3CPW S;  2OTJ A;  2F5K A;  2JN0 A;  3M0U A;  4LDW A;  3WVD B;  1K9M R;  1NEB A;  2A08 A;  3JCM V;  4OMN A;  3C4S A;  3GNG A;  3P8D A;  3DLL A;  4EMK A;  1KHI A;  3BDL A;  1UHC A;  4A53 A;  5HKC A;  3UA6 A;  2A3L A;  2KE9 A;  1FX7 A;  2OAW A;  3G4S T;  3MP1 A;  3S3M A;  3OS1 A;  1D09 B;  2KNB B;  4IUT A;  4C0D B;  3OQ5 A;  5KCH A;  2AZS A;  1PM3 A;  3CD6 Q;  2Y90 A;  3TVT A;  2NUT B;  4AG1 C;  2CP5 A;  1GBR A;  2EGE A;  5D7U A;  1JB0 E;  3KXT A;  2LX7 A;  4HXJ A;  4JJC A;  4X1V A;  4IKF A;  2VUB A;  4BE0 A;  1S72 T;  1ZX6 A;  3QUI A;  1BBZ A;  4QVZ A;  4QQ6 A;  1EX4 A;  4LDY A;  2D8H A;  2FG0 A;  1W2B S;  1C1A A;  1WJQ A;  3EGD B;  3M0T A;  2EJG A;  5KYY B;  1G3S A;  4IUV A;  2HZY A;  4E7H A;  2ZCF B;  3CPW P;  2DL4 A;  5CIU A;  3QXE B;  3PFS A;  2DM1 A;  4KGX B;  3JB9 I;  4YTL A;  2DJQ A;  1VQP A;  5IN1 A;  3V8K A;  4A4H A;  4XU0 A;  4CC4 B;  1KIK A;  1D0Y A;  2LQK A;  1BCO A;  2BIV A;  1YP5 A;  5M9O A;  1LNX A;  1Q82 C;  2P4R A;  2A36 A;  1VQM Q;  1Q82 U;  1K73 C;  1QKX A;  3OYD A;  2LC4 A;  2NUZ A;  1ZSZ B;  1K73 U;  2J05 A;  2MK5 A;  2IIM A;  4FCY A;  4F16 A;  1AWW A;  3NTH A;  3H9N A;  1S72 Q;  1IB8 A;  2WSC E;  2KRS A;  5I2M A;  1M8M A;  4CI0 C;  4F7U G;  5CKB A;  4KUL A;  3VKI A;  2COZ A;  1JJ2 S;  4PJO E;  5KH6 A;  5KYW A;  2RM4 A;  3PGG A;  1YJW T;  2JS2 A;  4M7D F;  5GAM e;  4EDU A;  2QEX T;  3LH5 A;  1UJ0 A;  2MWP A;  1M1F A;  4HKE A;  1XTD A;  4FSS A;  2GQI A;  3OYN A;  5GAO m;  3MP6 A;  3M55 A;  1JO8 A;  3OYM A;  3CC4 A;  2BE7 D;  1D1C A;  1SEM A;  5GMK h;  3Q1J A;  2PZ1 A;  3ER0 A;  5GMK j;  4M77 B;  3H0I A;  5GAM g;  1H8K A;  2EYW A;  2JNG A;  2RQR A;  2FPD A;  2RQU A;  4XK8 E;  2VGN A;  2RH2 A;  5GAO r;  3OSS C;  2D1X A;  4HVW A;  2VB6 A;  4A63 B;  1BI0 A;  2ZPE B;  3M9Q A;  2DET A;  5GAN 5;  2EAY A;  1RAF B;  1VQ6 T;  4AFZ C;  3ZEH A;  1D0Z A;  2LT4 A;  2L8D A;  4M75 F;  2LRQ A;  2PTK A;  1TSF A;  3G1J A;  1WIE A;  2ECZ A;  2F2V A;  4RTU A;  5CKD A;  1SRM A;  1YJW Q;  3OYC A;  4HCC A;  4FYW B;  3EG9 B;  4DEX A;  5GAM f;  2QEX Q;  4F7U A;  2ED0 A;  2KY9 A;  2QGF B;  1ZSG A;  5L23 A;  4N4H A;  2A28 A;  1U5S A;  4MDW A;  1U06 A;  1VQ4 A;  2L3R A;  3V8J A;  2DO3 A;  3QDR B;  2DBK A;  2O9V A;  2CYZ B;  5GJW B;  2VXE A;  3CC2 T;  4C92 F;  5FWC A;  3MEA A;  4AG2 C;  4CC2 A;  1G83 A;  1UUE A;  1J3T A;  5GMK l;  3A8G B;  2LJ3 A;  1PWT A;  2CS7 A;  4C5I A;  1VQ6 Q;  3S3O A;  4M78 B;  2FEI A;  3OYY A;  2RN8 A;  2CSQ A;  1T0H A;  4EMK B;  2E1H A;  3MO8 A;  5AT1 B;  3HL8 A;  4FT2 A;  5GAN h;  1W70 A;  4QKU A;  3LGF A;  3EAE A;  4V2S A;  2KBT A;  5GAN d;  3OYL A;  2DA9 A;  3CXC P;  2B8A A;  1Y07 A;  3CC7 T;  1LJO A;  3ASK A;  4M7A B;  2QDL A;  2KRM A;  1W1F A;  2CUD A;  3QZ9 B;  3G6E A;  3CCE T;  3NTI A;  1WHH A;  2K9G A;  4LE9 A;  4OGC A;  2PUO B;  4L6V 5;  4N4G A;  5FU7 B;  2XK0 A;  5I21 A;  1TH7 A;  5FLX E;  1G3T A;  4CC3 A;  3VYH B;  2V1R A;  3TSZ A;  1M5Q 1;  2C0T A;  4WF2 A;  1VQ7 Q;  1B34 A;  2JT4 A;  3EH1 A;  2JVV A;  3OA6 A;  1VYT A;  1GL5 A;  3FIF A;  3HSB A;  2AIR B;  3A8M B;  2HD0 A;  3CBP A;  4C5E A;  2HMA A;  3MP8 A;  3P8H A;  3VS7 A;  1V29 B;  5IAY A;  4ZGE B;  4OML A;  5CO7 A;  1AZG B;  3L2W A;  1MNE A;  1WJR A;  2RNA A;  2X3W D;  1XNI A;  1JXM A;  2HQH A;  2EJF A;  1Q81 C;  1Q81 U;  2QYZ A;  4L59 A;  3M4G A;  1VQL A;  3CC7 Q;  3RER A;  3URG A;  1Q7Y C;  1PD0 A;  3PMT A;  1SF9 A;  4J6W A;  1Q7Y U;  1NJI C;  4KH0 B;  3CCE Q;  1VQ8 A;  1NJI U;  1PC0 A;  3PMI A;  1QP3 A;  3SD4 A;  3CCM T;  4BE1 A;  3DB3 A;  4ESR A;  4ZNX A;  2ROL A;  2MPX C;  4Z8A A;  4QT7 A;  1GCP A;  4XTU A;  5LJ3 h;  1M9S A;  2C0I A;  1CKA A;  2QAS A;  2J6F A;  3OYH A;  3UPU A;  5LJ3 d;  1AT1 B;  5KCO A;  5FU6 C;  3G71 T;  1AEY A;  3RKW A;  2CP6 A;  2YRD A;  3QO3 A;  3DLM A;  4C8Q G;  3I35 A;  1M2O A;  1K4U S;  4IUR A;  1AVZ C;  1OOT A;  1BK2 A;  1KD1 C;  4XTW A;  1N8R C;  1KD1 U;  2PVD B;  2O4X A;  1GCQ C;  1N8R U;  1M3A A;  3M54 A;  1N27 A;  3H41 A;  3CME Q;  1WJS A;  1R77 A;  3LX7 A;  3OYB A;  4KT0 E;  1I1J A;  2VV5 A;  2JTE A;  4PJJ A;  3A8O B;  2F2W A;  1V76 A;  4MZT A;  3CCM A;  1I5L A;  2CT4 A;  1QQJ A;  3QPH A;  5DLQ E;  2LCC A;  5IXF A;  1BI2 A;  1NEG A;  2EQM A;  2PVO B;  3SWN B;  2QA4 T;  2I2L A;  3OYG A;  2BUD A;  1VQK T;  1NM7 A;  5IT9 E;  2KR3 A;  3I5R A;  1YJ9 A;  4OMP A;  1QVF P;  1PKS A;  3CCR Q;  4JDS A;  3IQL A;  2KI7 A;  1O9S A;  5LL6 S;  5GAN e;  2V8K A;  5GMK i;  1X43 A;  1VIE A;  3G71 Q;  5FRO A;  2RJE A;  1C6V X;  2QQA A;  1I81 A;  2GF7 A;  2CP7 A;  4F7U B;  1QWF A;  4AFQ C;  2DD5 A;  3CBO A;  2HKN A;  2OJ2 A;  1M90 C;  3O5Z A;  2PUK B;  5GAN g;  1M90 U;  2HCK A;  4C8Q A;  2XMF A;  1WQ7 A;  4CRI A;  1O75 A;  1ZUK A;  5FWB A;  4C8Q D;  1ZSZ C;  3NMZ C;  4E2F B;  2DF6 A;  5A2Q E;  2EQK A;  1KC8 U;  2RK2 A;  2QA4 Q;  3JSC A;  1VQ5 A;  2SEM A;  1R8O B;  1VQK Q;  2Z0W A;  1K9M C;  8ATC B;  1VYU A;  1K9M U;  2M02 A;  4KUI A;  2E6N A;  2XKO C;  5GAN f;  4FT4 A;  1Z9Q A;  4JRQ A;  5CVI A;  3LWH A;  1Y96 A;  3E2U A;  3VS5 A;  4AFS C;  1IXD A;  4JPB W;  3RBB B;  1KQS P;  4PJO G;  1N9S A;  3OBW A;  2K4Y A;  4OP0 A;  4LD9 K;  4PJL A;  1UB4 A;  1UEB A;  2K6D A;  2YLB A;  5GAO q;  3CCJ A;  1YI2 A;  2P0K A;  2MIO A;  2CZ7 B;  4M77 C;  4LNP A;  1D0X A;  1WHM A;  5LJ3 e;  5GAO p;  2QTV A;  1WX6 A;  4BI4 A;  5GAN 4;  1BIB A;  1K8A R;  1B34 B;  2RA2 A;  4B9W A;  1Y71 A;  3M0S A;  2PVG B;  1WXT A;  3DB4 A;  4PLI A;  4RTV A;  4OB0 B;  4LDV A;  2DTI A;  5LJ3 g;  4JLI A;  1ZA1 B;  3CCU T;  3EG1 A;  3GOX A;  2DD4 A;  4E7I A;  2XD0 A;  2XDP A;  2E41 A;  1SRL A;  2V26 A;  2JJ9 A;  4OGE A;  4RCC A;  3EGU A;  4EMG A;  1WHL A;  2X35 A;  1JU5 C;  3CEY A;  3HFN A;  2XDD A;  1TTH B;  3M0R A;  2L2P A;  5J3B A;  1IHV A;  3CCQ A;  3H0F A;  1MND A;  1RAB B;  2NUP A;  4JS4 A;  1XOV A;  2YHT A;  2CP0 A;  2DE0 X;  3OMG A;  3EFS A;  4PJO A;  2X3X D;  1K1Z A;  2KXD A;  5LJ3 f;  4OVA A;  2ED1 A;  2EKH A;  2YSQ A;  4PJO D;  2LVM A;  3M53 A;  1YIJ A;  2L0A A;  4XU1 A;  2O31 A;  5A0L A;  4M78 C;  2DER A;  1SSH A;  3CCU A;  4BY6 B;  2D9T A;  2LNH B;  1WA7 A;  5IH2 A;  1G8X A;  3OS2 A;  2HL5 C;  3CPF A;  2DIG A;  2O4X B;  4D8K A;  5GAN 7;  1YFN A;  5LJ5 j;  2OTJ Q;  3TQ7 P;  4M7A C;  4FL6 A;  2RQT A;  2P84 A;  3VUZ A;  3X28 B;  3EHR A;  1IHW A;  1JRI A;  2QXF A;  4JJB A;  4JLG A;  2FL7 A;  2J6K A;  3MCA B;  3OB9 A;  5FU7 C;  5HCK A;  3MKD A;  3V7R A;  4ZGJ B;  1VQP T;  4C92 B;  4F7U F;  4J6Y A;  4KUD K;  3M0P A;  2HEQ A;  3UF4 A;  4B6M A;  1ZUU A;  4F04 B;  1IRX A;  2M0O A;  5J39 A;  5D6Y A;  1OUL A;  3CCS T;  2CT3 A;  3JB9 G;  5GMK m;  1ABO A;  2CSI A;  3X26 B;  5KE3 A;  2K7A A;  2DK3 A;  2HAX A;  3I9Q A;  2WSE E;  5A0G A;  3ZL7 C;  3HRS A;  4RTT A;  3OYE A;  2DEU A;  3EFO B;  1Z9Z A;  2MAM A;  2HQE A;  2DIQ A;  1D3B A;  4RMO A;  3RES A;  3A8L B;  2R57 A;  2CZ1 B;  4C8Q B;  5HK0 A;  1VYV A;  1MMN A;  1LCK A;  2ZPH B;  4XAX B;  2KQW A;  2ENM A;  2DXT A;  2RI2 A;  5CKH A;  3NTK A;  1OZ2 A;  2GBQ A;  2E4H A;  3G4S Q;  3JCM J;  4XTZ A;  3PT9 A;  1M8V A;  3M0Q A;  4Y92 A;  3CC4 T;  2DLP A;  2VC8 A;  2XI9 A;  3CCS A;  2EJ9 A;  1PRL C;  3QDF A;  3JCM X;  3JCM b;  1RAE B;  2QQR A;  2DX1 A;  1MMD A;  4R56 A;  3VS4 A;  4EIK A;  4M77 E;  2MI6 A;  3KBG A;  4PFO A;  1NG2 A;  3PNW C;  3QSU A;  2QGG A;  1CKB A;  1E6G A;  3L1A A;  1MV0 B;  1K9A A;  2JM8 A;  3REA B;  4E7S A;  1YJN A;  3JB9 D;  3CCL A;  1X6G A;  2L3S A;  2HL3 A;  1YNZ A;  1T3L A;  2RMO A;  3BY7 A;  3EH2 A;  2LJ1 A;  3ME9 A;  2FHD A;  4BD3 A;  1IO6 A;  2BE9 B;  5GAN 3;  3NPF A;  4J9D A;  3NHN A;  4M4Z A;  1EZZ B;  1AWJ A;  3FJ5 A;  3SWN C;  3CXC A;  1W2B P;  2KSS A;  2NYS A;  2MCN A;  2GFU A;  2E64 A;  3CC4 Q;  3RKY A;  4BI3 A;  1AWX A;  1UEC A;  1KHC A;  1H92 A;  1VQ4 T;  1YHQ A;  3I5S A;  4RUG A;  4ELY C;  2RHU A;  2KT8 A;  4BUG A;  4LDX A;  5I11 A;  2RJD A;  2XID A;  3THK A;  4XQ3 A;  2DZC A;  2IPO B;  1TWB A;  1C0M A;  1QVG A;  3VV0 A;  2G6F X;  3JCM h;  2NUP B;  7AT1 B;  4CC7 A;  3EG0 A;  4M78 E;  5DLO A;  1MHN A;  4PJO B;  2VYT A;  4XU2 A;  3FJP A;  3CCV T;  3A1P A;  3PVL A;  1JJ2 P;  1Q86 C;  5FRN A;  1I5O B;  3EHQ A;  4C5H A;  2RI5 A;  2Y4Y A;  1Q86 U;  3G6E T;  2FYK A;  4BI8 B;  4J7F A;  3L2Q A;  4M7A E;  2O01 E;  1X75 C;  1KFZ A;  3FRN A;  1NE8 A;  1OPK A;  1VQ4 Q;  3L2V A;  4C5G A;  3EGX A;  1UGS B;  3KFV A;  2BZ8 A;  1LPL A;  9ATC B;  4QW2 A;  1QVG S;  3QWX X;  2KDS A;  3RMQ A;  5KYX A;  2KAF A;  3KUF A;  2QAZ A;  4DQ2 A;  1OEB A;  2K5I A;  4IIM A;  1GFD A;  1QWE A;  2FPE A;  2YRV A;  1QP2 A;  2WAC A;  2GNC A;  1GXI E;  4QQD A;  2PU9 B;  3CCV A;  4MML A;  2HQX A;  4RG2 A;  2E5Q A;  4MZP A;  2RHY A;  1VQL T;  2RHZ A;  3QG1 A;  4C8Q F;  2DRK A;  1ARK A;  1RAA B;  4OMO A;  2RHX A;  3I56 T;  3JV3 A;  3OYK A;  1MMA A;  3E19 A;  3G6E Q;  2L3P A;  1RL2 A;  2EYY A;  3TEE A;  1VQ8 T;  3J7A F;  4M7D C;  4PJN A;  4J83 A;  2LMJ A;  1IZ6 A;  2CZ0 B;  3CC2 Q;  1SSF A;  2MMP A;  4QQG A;  3EG3 A;  1WXB A;  2AK5 A;  1D3B B;  1MMG A;  2ZPB B;  2D0N A;  2AT1 B;  3JRZ A;  1PG5 B;  1UGQ B;  1N5Z A; 
#chains in the Genus database with same CATH homology
 1ZUK A;  5FWB A;  2DRM A;  1U3O A;  2KRO A;  1YCS B;  3NMZ C;  1NLP C;  1M3C A;  2DF6 A;  2FRW A;  2KGT A;  3M0U A;  1NEB A;  2HDA A;  2A08 A;  1X2K A;  4OMN A;  2SEM A;  1M27 C;  4LUD A;  1JXO A;  4JZ4 A;  1VYU A;  2GTO A;  4HVV A;  1QCF A;  1UE9 A;  1SHF A;  2DL5 A;  2W10 A;  2CRE A;  1UHC A;  2YUP A;  3UA6 A;  2KE9 A;  1Z9Q A;  2OAW A;  3UA7 A;  3REB B;  3VS5 A;  4AFS C;  2KNB B;  4JPB W;  3RBB B;  3SHW A;  2FPF A;  2AZS A;  4OMM A;  4JZ3 A;  3TVT A;  4D8D A;  2K6D A;  1NYF A;  2E5K A;  2JM9 A;  1UJY A;  2MIO A;  4AG1 C;  1E7O A;  1PHT A;  4KRT A;  4ORZ A;  4LNP A;  1GBR A;  2EGE A;  2LX7 A;  4HXJ A;  4JJC A;  4X1V A;  3VS2 A;  1WX6 A;  1ZX6 A;  2CH4 A;  1BBZ A;  2ESW A;  1YN8 A;  2O88 A;  3M0S A;  2D8H A;  2A37 A;  2FG0 A;  2VKN A;  1WXT A;  2RF0 A;  2OI3 A;  4Z88 A;  3M0T A;  4RTV A;  1AOJ A;  1G2B A;  2KEA A;  2M0Y A;  2DL4 A;  1EFN A;  1Y57 A;  3EG1 A;  2DM1 A;  2DJQ A;  1HD3 A;  1SRL A;  2AKK A;  4CC4 B;  2J7I A;  1KIK A;  2EYX A;  1ZUY A;  3EGU A;  1S1N A;  1M30 A;  1JU5 C;  1YP5 A;  3M0R A;  2P4R A;  2A36 A;  2EW3 A;  2GGR A;  2L2P A;  2DYB A;  1QKX A;  3H0F A;  2NUZ A;  1X69 A;  2K2M A;  1XOV A;  2J05 A;  4OMQ A;  4HCK A;  2CUB A;  2EGA A;  1UHF A;  2IIM A;  2DE0 X;  1GCQ A;  4J9F A;  4HVU A;  4F16 A;  2X3X D;  1K1Z A;  1AWW A;  2KXD A;  1HSQ A;  2ED1 A;  2EKH A;  1WLP B;  1GBQ A;  2YSQ A;  4R0K A;  2KRS A;  1M8M A;  2B86 A;  2L0A A;  2YDL A;  4IIO A;  1B3Q A;  1H3H A;  1FYN A;  2AZV A;  2O31 A;  1NYG A;  2KYM A;  3H0H A;  1SSH A;  1W6X A;  3R6N A;  1K0S A;  2JS2 A;  2DL8 A;  2LNH B;  3LH5 A;  1GRI A;  1UJ0 A;  1WA7 A;  5IH2 A;  3VS3 A;  4FSS A;  2D8J A;  2C0O A;  2GQI A;  2PNI A;  2LQW A;  1JO8 A;  1ZBJ A;  4D8K A;  1M3B A;  4J9G A;  1JEG A;  1SEM A;  2I0N A;  4J9B A;  2K3B A;  5ECA A;  2PZ1 A;  2RQT A;  1KSW A;  1ZLM A;  3H0I A;  3SEM A;  3EHR A;  2VVK A;  1H8K A;  2FO0 A;  2EYW A;  2RQR A;  1WDX A;  2FPD A;  2RQU A;  2RPN A;  2LP5 A;  4JJB A;  2D1X A;  2J6K A;  5HCK A;  4HVW A;  4RTY A;  3CQT A;  4A63 B;  1MV3 A;  3PE0 A;  3M0P A;  1AWO A;  2JXB A;  2HEQ A;  2J06 A;  4AFZ C;  3UF4 A;  1UTI A;  1UG1 A;  1ZUU A;  5I22 A;  1T3S A;  2PTK A;  1OV3 A;  2CT3 A;  1YWO A;  2EYZ A;  1ABO A;  1WIE A;  2DL3 A;  2CSI A;  2ECZ A;  2YT6 A;  4RTX A;  2K7A A;  2F2V A;  4K11 A;  4RTU A;  1SRM A;  2DMO A;  2KYB A;  2CDT A;  3UAT A;  3TSW A;  2JW4 A;  4J9C A;  1PRM C;  3I9Q A;  3VS6 A;  2YUO A;  3ZL7 C;  4DEX A;  2AKL A;  4RTT A;  2ED0 A;  3C0C A;  4J9I A;  2EQI A;  4LN2 A;  1Z9Z A;  1ZSG A;  5L23 A;  2SRC A;  2DNU A;  2RQW A;  2H8H A;  2A28 A;  1U5S A;  1K76 A;  1VYV A;  1TUC A;  1LCK A;  1U06 A;  1WYX A;  2ENM A;  2DBM A;  2DBK A;  2O9V A;  5GJW B;  2GBQ A;  5FWC A;  1RI9 A;  1UGV A;  3VS1 A;  4AG2 C;  4CC2 A;  2JS0 A;  1BU1 A;  1G83 A;  1UUE A;  1J3T A;  1WI7 A;  3M0Q A;  2LJ3 A;  1PWT A;  1TG0 A;  4Y92 A;  2DLP A;  4F14 A;  2FEI A;  2RN8 A;  1I07 A;  1T0H A;  1YWP A;  1CSK A;  2CSQ A;  1PRL C;  1AD5 A;  4RTZ A;  2DX1 A;  1W70 A;  3VS4 A;  1Y0M A;  2LQN A;  4EIK A;  2YUQ A;  2KBT A;  1NG2 A;  2DA9 A;  3NGP A;  2LCS A;  1CKB A;  1E6G A;  4WCI A;  3QWY A;  1MV0 B;  2LJ0 A;  1K9A A;  2HSP A;  2JM8 A;  2QDL A;  2KRM A;  3REA B;  1X6B A;  1W1F A;  2CUD A;  1V1C A;  2K79 A;  2K9G A;  1X6G A;  4LE9 A;  1B07 A;  2L3S A;  1YNZ A;  1T3L A;  1E6H A;  2RMO A;  2O2O A;  4LUE A;  1WXU A;  2LJ1 A;  4CC3 A;  2M51 A;  2MOX A;  2VWF A;  2V1R A;  3TSZ A;  2C0T A;  1IO6 A;  2V1Q A;  3NPF A;  4J9D A;  2JT4 A;  3EG2 A;  3NHN A;  4M4Z A;  1VYT A;  2EGC A;  1GL5 A;  1AWJ A;  3FJ5 A;  2KRN A;  2MCN A;  3VS7 A;  1T0J A;  3PVQ A;  2ABL A;  4OML A;  4J9H A;  1AZG B;  1AWX A;  1UEC A;  3A98 A;  1H92 A;  2RNA A;  3I5S A;  2RQV A;  4RUG A;  2X3W D;  1JXM A;  2KT8 A;  1QLY A;  5FW9 A;  5I11 A;  5GJV B;  3THK A;  2EPD A;  5IHN A;  2L3Q A;  3U23 A;  2G6F X;  1X27 A;  4CC7 A;  3EG0 A;  4JJD A;  4ESR A;  4ZNX A;  1ABQ A;  2ROL A;  4AFU C;  1FMK A;  4QT7 A;  4Z8A A;  1GCP A;  2C0I A;  1CKA A;  1RLQ C;  2J6F A;  3PVL A;  4J9E A;  3EHQ A;  2GTJ A;  3VRY A;  1AEY A;  2LZ6 B;  2W0Z A;  1KFZ A;  2JMC A;  3I35 A;  2NWM A;  1NLO C;  2FRY A;  1K4U S;  2HBW A;  1AVZ C;  1OPK A;  1BB9 A;  1OOT A;  1BK2 A;  5IXB A;  5IHK A;  1GFC A;  3KFV A;  1OPL A;  1GCQ C;  2BZ8 A;  1RLP C;  1M3A A;  3VS0 A;  2BTT A;  3H41 A;  5IHI A;  2JMA A;  1UDL A;  1MUZ A;  2BZX A;  3QWX X;  4F17 A;  4DEY A;  4GBQ A;  1KJW A;  4Z89 A;  2CH4 W;  2O9S A;  1I1J A;  1OEB A;  1VA7 A;  2EBP A;  4IIM A;  3RNJ A;  2JTE A;  1UFF A;  1GFD A;  2F2W A;  1QWE A;  2FPE A;  2CT4 A;  1SPK A;  1AZE A;  5EC7 A;  2GNC A;  5IXF A;  4GLM A;  1NEG A;  2KXC A;  2DVJ A;  1I0C A;  1QKW A;  2F2X A;  1WFW A;  1NM7 A;  2KR3 A;  3I5R A;  1X2Q A;  4OMP A;  1A0N B;  1PKS A;  3ULR B;  3IQL A;  3VRZ A;  2DRK A;  1ARK A;  4OMO A;  2KT1 A;  2ROT A;  1X43 A;  3JV3 A;  1PNJ A;  1PKT A;  2L3P A;  2DIL A;  2DL7 A;  2EYY A;  1HJD A;  3GBQ A;  2LMJ A;  1K0X A;  1JQQ A;  1QWF A;  4AFQ C;  2J6O A;  3EG3 A;  4RTW A;  2YUN A;  1WXB A;  2OJ2 A;  2AK5 A;  2BZY A;  3O5Z A;  4E6R A;  2D0N A;  2HCK A;  1TUD A;  1RUW A;  2XMF A;  1SHG A;  1N5Z A;  2EVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...