2CT4A

Solution strutcure of the sh3 domain of the cdc42-interacting protein 4
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
70
structure length
70
Chain Sequence
GSSGSSGGHCVAIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Cdc42-interacting protein 4
publication title Solution Strutcure of the SH3 domain of the Cdc42-interacting protein 4
rcsb
source organism Homo sapiens
total genus 6
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ct4A00
2C0OA 1WDXA 2DYBA 2DVJA 2DNUA 1SHFA 2FRYA 1JQQA 2DF6A 2C0IA 5I11A 4HVUA 3NPFA 2VWFA 2HCKA 1QKXA 1PHTA 2ED1A 4CC7A 2EYYA 3PE0A 1ZSGA 2X3XD 2CT3A 2KROA 1OPLA 2J05A 2LP5A 3THKA 4D8KA 1WA7A 1Y0MA 2DRMA 2EVRA 1Y57A 4RTVA 3GBQA 2V1RA 4HVVA 1UE9A 3M0TA 2FG0A 1H3HA 1VYUA 4CC3A 3I35A 1W1FA 1VA7A 4K11A 4HVWA 3VS7A 2RF0A 2K9GA 1NYGA 3SEMA 2BTTA 2NWMA 4IIMA 1B07A 1RI9A 2K79A 4ORZA 1FMKA 1ABOA 1H92A 2KRMA 1G83A 1GCPA 1M3BA 2W10A 1GFCA 3SHWA 2ROLA 3M0SA 4CC2A 3H0FA 1JXOA 2PZ1A 2YUOA 1UECA 1UDLA 3M0UA 2JTEA 1WXTA 4J9FA 2EGEA 2EPDA 2L3QA 1YN8A 2JM9A 2KT1A 1MV3A 2VKNA 2O2OA 1NLPC 4J9CA 2O9SA 3REBB 3ULRB 1PRLC 1WLPB 2F2XA 1SRMA 1X27A 2D1XA 3KFVA 4D8DA 2DRKA 4LUEA 1ZUYA 2I0NA 2J6FA 4AFUC 1AWWA 2LQWA 1X43A 2KE9A 2CH4W 2KT8A 2K6DA 1G2BA 2EQIA 1SEMA 5IHKA 1CSKA 2F2WA 2EGCA 3A98A 2E5KA 1VYTA 5GJWB 3VS4A 2CT4A 2DA9A 5FWBA 5L23A 4HXJA 2KEAA 3VS6A 2KYMA 1SHGA 2LJ3A 1E7OA 3RBBB 1W70A 1QWEA 2ABLA 2EW3A 2D8JA 4AFZC 1Z9QA 3ZL7C 1RUWA 2EKHA 2K2MA 2KXDA 2EGAA 4X1VA 3PVQA 2IIMA 2SEMA 2GTOA 1Z9ZA 4AFQC 3U23A 2EBPA 1CKAA 2RQRA 1ZUKA 1AZEA 1AVZC 4M4ZA 2YUNA 1M3CA 1SPKA 3UA7A 2D8HA 3TSWA 4ZNXA 1MUZA 1WYXA 5FWCA 1TG0A 2DLPA 4Z89A 1UHCA 2PNIA 2AZVA 4AG1C 4J9BA 4LUDA 1U3OA 2KXCA 4OMNA 2AZSA 1UHFA 2J7IA 2ENMA 1KJWA 1N5ZA 2BZYA 4J9IA 4JPBW 1RLPC 3I9QA 4OMOA 1YWOA 2YT6A 2ED0A 2C0TA 4RTWA 3R6NA 1T3LA 4J9HA 1W6XA 3O5ZA 1PNJA 1U06A 3H41A 1OEBA 2FPFA 4R0KA 4Z88A 1JO8A 1GBRA 2LX7A 4WCIA 2CSIA 1M3AA 3I5SA 2DE0X 2YSQA 2AK5A 1GFDA 2GNCA 3EG0A 2GBQA 4JZ4A 3C0CA 1T0JA 1X2QA 1I07A 3M0RA 1U5SA 2RNAA 1NM7A 2GQIA 1UGVA 4CC4B 2GGRA 1UG1A 3EG2A 1WI7A 5IHNA 1X2KA 1YWPA 2L3PA 1JEGA 1UUEA 5FW9A 2V1QA 1AD5A 2KNBB 1GRIA 4IIOA 3VS0A 2DM1A 1PRMC 1S1NA 1QKWA 2AKKA 2DMOA 2CDTA 2D0NA 4RTYA 1K4US 1TUCA 1K9AA 1OOTA 1V1CA 3H0HA 3IQLA 4J9GA 2LQNA 2A36A 1B3QA 1JXMA 1WFWA 3VRYA 1ZX6A 2YUQA 3TVTA 3UATA 4F14A 2CUBA 1WX6A 2J06A 2BZXA 1UTIA 1J3TA 1ZBJA 3UA6A 2RMOA 3CQTA 4A63B 2CREA 1BB9A 2CSQA 2K3BA 1ZLMA 4JJBA 2KRNA 1KSWA 2G6FX 1UJYA 1NEBA 3EGUA 2M51A 3LH5A 4RTTA 1M30A 2A08A 1ARKA 3JV3A 1EFNA 4JJDA 4JZ3A 1K76A 1MV0B 2OI3A 1I0CA 2FPDA 2F2VA 2JW4A 5IHIA 1JU5C 2LCSA 4OMLA 3TSZA 4F17A 2DX1A 4RTZA 1SSHA 2L0AA 4J9DA 1HD3A 1A0NB 3VS5A 1NYFA 2A37A 4ESRA 2YUPA 4OMQA 1NLOC 3EHRA 5HCKA 2DL4A 2J6OA 2QDLA 1E6GA 2J6KA 4E6RA 3FJ5A 1K1ZA 4AG2C 2RN8A 4GBQA 1PKSA 2MOXA 2KRSA 1K0SA 4Y92A 2O9VA 1GCQC 1K0XA 1RLQC 2XMFA 2PTKA 2H8HA 2ECZA 2SRCA 3M0PA 1AWJA 1X6GA 1IO6A 2EYXA 4LN2A 2FRWA 2HDAA 2DJQA 2DL5A 2LZ6B 2ESWA 3VS3A 2RQUA 3EG1A 2B86A 1GL5A 2ROTA 2M0YA 2L3SA 4OMPA 3REAB 1SRLA 3VS2A 1FYNA 2HSPA 2DBKA 2CH4A 4LNPA 1CKBA 2MCNA 1X6BA 4RUGA 4LE9A 1BK2A 2LNHB 2A28A 5IXBA 2DL8A 2HBWA 2RPNA 5I22A 5IH2A 2CUDA 4GLMA 2KBTA 2FO0A 1BU1A 4F16A 2OAWA 2VVKA 1AEYA 1QWFA 2FEIA 3H0IA 2JS2A 2EYZA 1GCQA 1WIEA 2DL3A 1GBQA 1XOVA 1BBZA 3EHQA 4QT7A 1WXUA 2K7AA 2BZ8A 3I5RA 4KRTA 2KR3A 1HJDA 1T3SA 2P4RA 2X3WD 2JMAA 2MIOA 1AZGB 1WXBA 2JMCA 3RNJA 2O31A 2EYWA 2JM8A 2LJ1A 2DL7A 1QLYA 2JT4A 2JXBA 1KFZA 3M0QA 1TUDA 2RQWA 3QWYA 1OV3A 4DEXA 1LCKA 2O88A 1VYVA 3PVLA 1H8KA 3VRZA 1QCFA 1KIKA 4J9EA 5ECAA 1AOJA 3NGPA 2LMJA 1OPKA 2KYBA 1T0HA 4Z8AA 2RQVA 4HCKA 1PKTA 1I1JA 1AWOA 1ABQA 2GTJA 2LJ0A 5EC7A 1PWTA 2YDLA 3UF4A 2RQTA 4JJCA 4EIKA 1AWXA 1ZUUA 1NG2A 4OMMA 1YP5A 1M8MA 3NMZC 4RTXA 2L2PA 1YCSB 4RTUA 5GJVB 4AFSC 4DEYA 3VS1A 2NUZA 1X69A 4FSSA 1UFFA 2AKLA 1NEGA 5IXFA 1M27C 2DILA 1YNZA 2OJ2A 2W0ZA 1UJ0A 2KGTA 2DBMA 1HSQA 2JS0A 1E6HA 2HEQA 3EG3A 2FPEA 3QWXX 3NHNA
chains in the Genus database with same CATH superfamily
1BIBA 2DVJA 2DIGA 1SHFA 3X24B 1PSEA 2DKGA 5GAOl 5I11A 3F70A 5FU6B 3SB2A 4CC7A 3CPWP 4EMKC 1F1BB 3M4YA 2CYZB 1WHGA 3CCEA 2H3EB 2DJZA 3M54A 5J26A 1MMNA 2EVRA 4J5YA 5GMKe 4BE2A 3RKYA 4PFZA 3OYKA 1VYUA 2Y4XA 5C0MA 3SEMA 1B07A 3EH2A 1YCYA 4L6V5 2K79A 1ABOA 3MEWA 2KRMA 2LVMA 3HTRA 3A8GB 1PSFA 8ATCB 3M0SA 3CD6A 2PZ1A 4BI3A 1VQ9A 1UECA 3UWNA 3M0UA 5FRNA 4J9FA 4B9XA 2E65A 3OQ5A 5FU7B 2LQ8A 1MV3A 1YHQA 2VKNA 2F5KA 2M02A 4RCBA 4F7UF 2O9SA 1PRLC 1YFNA 4DQ2A 3A5ZB 1SRMA 3OYCA 2ZPBB 4ZTJA 4J6YA 1ZUYA 4AFUC 2FB7A 2X35A 4MZPA 5C6SA 3G6ET 4ZN3A 4C92D 5IHKA 2CS7A 1AHJB 3I55A 4PJOE 3OYFA 5CKHA 1MMDA 2OTJQ 3JCMV 1UGRB 1VYTA 2E10A 5FWBA 5L23A 4FIBA 4XU0A 1E7OA 1QWEA 2EW3A 3ZL7C 3E19A 3G71Q 2KI7A 4OGCA 4M77F 1JJ2P 2VASA 2DZ9A 2KY9A 5GAN8 3L2ZA 2QXFA 2GTOA 2RM4A 1I5OB 1LJOA 3HFOA 3G4SQ 1CKAA 1EX4A 1YJNQ 2RQRA 5FU7C 1KQ1A 4M78F 4QVCA 1AZEA 4N4HA 3GPLA 4XTVA 1PM3A 1ZSZA 2PVGB 2IPOB 2D8HA 1ACMB 1MUZA 2F1LA 4AG1C 1BCOA 1QVFP 2ZAEA 2FZGB 2CGHA 4OB2B 2ENMA 3CCSA 4OB0B 4JPBW 1MNDA 2ED0A 3FJPA 1KC8U 3CXCP 3H41A 1OEBA 2D9TA 2FPFA 4R0KA 4ZGJB 1OU9A 4Z88A 4XTYA 1NPPA 3OSVA 1WPYA 3OYNA 1VQOQ 2LCLA 1RADB 1GFDA 1O75A 2GBQA 4HKEA 4F04B 1UGVA 2YXYA 4NL3A 4Z02A 5CCAA 4M7DC 4WF2A 2BE9B 5IHNA 1X2KA 4BD3A 2R5MA 5LJ5j 2EQUA 1AD5A 3CCUT 4C0DB 2QK0A 5KYUB 5GAMj 1PRMC 4LD9K 1S1NA 2DMOA 1TSFA 3L2QA 1M1FA 1NJIR 3EAEA 1TUCA 2QGGA 1N8RU 1R77A 1K9AA 4QVDA 4J9GA 1BIAA 4PJOA 1D09B 5GANf 2VYTA 1AT1B 2YRDA 1VQ6T 1D0ZA 4F14A 1NJIC 4E7IA 4MZMA 1WX6A 3JB9H 1RAGB 2R58A 2BZXA 3QDRB 2ATCB 3LYIA 3FDRA 1YJWA 2CZ1B 3CQTA 4JS4A 2CREA 1OI1A 2K3BA 3QHSA 3GNGA 1VQLT 3V8JA 4E47A 3EGDB 1KSWA 1NEBA 3RIRA 2NUPB 1D3BA 1VQ8Q 4JRQA 4QW2A 1ARKA 1YI2Q 4JZ3A 4AMCA 1K73U 2DTIA 3JCMe 1X01A 3GP8A 3GLXA 4J7FA 4M75E 4C0GA 4OMLA 2QDYB 4LDVA 2DD4A 4RTZA 2L0AA 3OYJA 5KYWA 1HD3A 4LDYA 2QYZA 5KYYA 3CCVA 2YUPA 1NLOC 4N4IA 2CP5A 2K3XA 2QDLA 4GBQA 1TWBA 2AIRB 2MOXA 4A4GA 2YHTA 5KE3A 2ECZA 4FCYA 1VQNT 2FRWA 1EIFA 2DL5A 1G8XA 4BUGA 1ZQ1A 2JUFA 1LVKA 5HK0A 2A0FB 2HAXA 3M56A 2K5IA 2DZCA 3EFOA 2K2VA 4C5GA 1ZSZB 2K5FA 5GAN7 1VQKT 3REAB 2RI2A 4EMHA 5L8RE 4NOYA 4LNPA 2CZ7B 4M7DG 4JJNK 1ZBXA 2DL8A 2RPNA 4GLMA 1Q7YU 5HKCA 1BU1A 4F16A 4ZGDB 2OAWA 3QKJA 2XDPA 1WIEA 4QQ6A 1GBQA 3CCQT 3EHQA 2KVQG 1WXUA 4NS5A 5FROA 2MWOA 2RA2A 2BZ8A 2AT1B 5LL6S 4F7UE 3Q1JA 3OYIA 1LOJA 2DEQA 1B7TA 2OAUA 3QO3A 4JRKA 2M0OA 2P4RA 2JMAA 4P5NA 1AZGB 2LC4A 3CCLQ 1FMWA 2O31A 1RAIB 1YJ9A 4HCCA 4LDWA 5LJ3f 2RQWA 3QWYA 2DEUA 1ZSZC 3CCMT 1H8KA 1XJWB 4C92F 2MYSA 4BY6B 2NYSA 4OB1B 4PK4A 2YRCA 2MF2A 4IUVA 4M77E 1WQWA 5LJ5g 1QW1A 1WJQA 2GTJA 5LJ3h 4LDXA 1Y71A 2YDLA 3AT1B 1AWXA 2QA4A 5GMKh 4M78E 4XTWA 2LT1A 3RKWA 1YP5A 1MNEA 4PJOB 4Y28E 3NMZC 2EQKA 2E3HA 3KXTA 3H6ZA 5GJVB 4E7ZA 5GANd 4XU2A 2RJEA 2NUZA 1X69A 4MDWA 4FSSA 3CCUQ 1IREB 2IVWA 2AKLA 2VXFA 3KUFA 5D6WA 2DILA 1YNZA 4HCBA 1VQMA 4BE1A 1UJ0A 4DBFA 2KGTA 3FRNA 1HSQA 3BW1A 1D1CA 2ZPFB 2HMAA 4C0ZA 2C06A 2FPEA 1C6VX 3NHNA 3FIFA 4N0AC 4TVRA 4C8QE 3S6WA 2FRYA 1JQQA 3CPFA 1VQ6Q 2C0IA 3G7ZA 3CC7A 3CCJT 2QEXT 3NPFA 2VWFA 3V7SA 4C8QD 1VOMA 1FX7A 2WACA 4B6MA 4KH0B 2CT3A 1M8VA 2LP5A 3THKA 4D8KA 4DBQA 5KYWB 3OMGA 2CZ6B 2P0KA 2DRMA 5KYYB 1VQLQ 3QBYA 4FT4A 1Y57A 3N5BB 2V1RA 3M57A 4F7UA 4PKCC 2NUTA 3E9FA 3UT1A 1QMCA 4CC3A 1VA7A 4HVWA 2RF0A 4O6JA 2BTTA 2DVEA 1YBYA 4IIMA 3ER0A 4DBRA 4RKUE 3QUIA 2DAQA 2VGMA 1M90R 1WZOA 1VQ5Q 3OW2S 1GCPA 1G5VA 1KHCA 2CP7A 2W10A 2HQXA 2RD1A 4EMGA 1VQPA 1JXOA 1OYXA 2CP6A 1WXTA 3BFMA 2L3QA 1YN8A 1M90C 1Q86R 2KT1A 2D6FA 1NLPC 4JDSA 4XU3A 1QQJA 2KK4A 3CMET 5IT9E 1W2BS 1WLPB 2F2XA 5DY9A 5DLQE 1X27A 1KQSS 1VQOT 4PLIA 1V29B 4M78A 2KE9A 4PFOA 5GMKm 1Q86C 1KQ2A 2RHIA 2CZ0B 3SWNC 4DOVA 1CSKA 2F2WA 1VQNQ 3BDUA 1OU8A 5LJ5f 2YWWA 2E5KA 4OF1A 3CC4T 3VS4A 1KC8R 5GAMf 2LJ3A 4R56A 3OS1A 3CMAA 3PTAA 3V7RA 3P8BB 1VQKQ 2KXDA 2EGAA 4LXCA 3DB4A 4KULA 2SEMA 4WTOB 1KC8C 2R57A 1M2OA 5GAMh 2I2LA 1AVZC 4KUIA 4M4ZA 4X9CA 3SDZA 2XKOC 4QQGA 4YTLA 2L8DA 3NTKA 4M75B 2PU9B 5CK9A 3OMCA 4Z89A 1YITQ 2PNIA 4E7JA 5KYUA 3JCMJ 3JCMP 1M2VB 1K9MU 1U3OA 2KXCA 4LD6A 3JCMX 3OW2A 3P8DA 1BI0A 2XICA 5CIUA 3I56A 2ZPIB 1KJWA 3L2RA 2ZCFB 1H3ZA 4R55A 4L5GA 1VQ8T 4BI8B 4RTWA 2QQ9A 4J9HA 1YI2T 1V76A 1PNJA 3WVDB 3L2VA 3CCMQ 1UGPB 2MK5A 5LJ3j 1JO8A 1W2BA 1JB0E 1IZ6A 3TEEA 2LX7A 1SF9A 1KQSA 2YSQA 2AK5A 5GMKj 2XU8A 3LGLA 3LGFA 5CKDA 1I07A 1U5SA 3M58A 1UG1A 2XG8D 2RK2A 3EG2A 2HL3A 3EGDA 4LDUA 2EYQA 2NUPA 4M7AC 1K73R 1TH7A 3TQ7P 2KNBB 3M59A 1GRIA 2NLUA 2DM1A 2VXEA 1QVGS 2EQJA 3ASKA 4PFPA 2AKKA 2CDTA 2D0NA 1S72A 2DXTA 4RTYA 4FU6A 5FU6C 3JB9D 1K73C 3H0HA 1V1CA 3IQLA 5GMKl 2LQNA 5GANg 3OYBA 4C0FA 2A36A 2X51A 2E3IA 4C92E 1B3QA 1WFWA 1K8AR 1ZX6A 2YUQA 4IUUA 4BACA 3UATA 3EG9B 2CUBA 4OGEA 2J06A 2YRVA 2NUTB 1UTIA 4F7UB 1QP3A 1J3TA 1O9SA 2RMOA 1YIJA 3CCRT 1G3WA 1IGUA 2QG9B 1ZLMA 1K8AC 4JJBA 3X26B 3OA6A 2ZPGB 7AT1B 4CI0C 3CCJQ 2QEXQ 3LH5A 4FYYB 1G3YA 1MMAA 2LT4A 2EWNA 3UDCA 1K76A 1MV0B 5GMKi 3CCET 2FPDA 3JRZA 4C5IA 3MJXA 2JW4A 3M53A 1IGQA 1JU5C 3V8LA 4C5EA 1UGSB 2LCSA 1XTDA 3TSZA 3EGXB 4M77B 5AYFA 3ZEHA 2KQWA 1SSHA 3FB9A 3CCLT 1N9SA 3MEVA 2A37A 1Q7YR 1OULA 4M78B 3LWIA 3NFCA 4OMQA 1NPRA 3OYAA 2J6KA 1FMVA 2QTVA 4AG2C 2Z0WA 1PKSA 3CD6T 2O9VA 5LJ5d 1QVGA 1VQ9T 2MWPA 1Q7YC 5GAMd 2RJFA 1X6GA 1JRIA 3QJ6A 3CMEQ 3LH0A 1HXDA 4AT1B 4C8QF 4DBHA 2DJQA 4DA4A 1P92A 1VQ4A 5J3BA 2LDMA 2ESWA 5CKEA 3VS3A 2RQUA 3VYHB 3QZ5B 2L3SA 4C8QB 3CC4Q 3MEUA 3FEOA 1VQ7A 2ZZDA 3RERA 1QCNA 3BY7A 4FYVB 2M1HA 2DXCA 1Q81U 3OYEA 4RUGA 1BK2A 2LNHB 2A28A 3OYHA 2HBWA 4M7AG 3CEYA 4A4HA 1AEYA 2DIQA 2FEIA 2EYZA 1GCQA 1ZHIA 1XOVA 2GFAA 5LJ5e 3RDVA 3BE3A 1VIEA 3J7AF 2HNIA 1Q82R 2KR3A 3NTIA 1T3SA 5IAYA 2X3WD 4HCZA 2MIOA 3WVEB 1MHNA 1PG5B 3RNJA 2JM8A 3MP8A 1N27A 2IG0A 5LJ3g 2JXBA 3H9NA 3LLRA 1Q82C 1OV3A 4DEXA 1LCKA 1VYVA 1OZ2A 1SSFA 3CCST 3OY9A 1WJSA 4C0DC 4EPCA 2JTFA 3CBPA 1T0HA 1ABQA 5FRMA 2LJ0A 4ME7A 3UF4A 3OBYA 4KGVB 2RQTA 4JJCA 6AT1B 1VQ5T 1D0XA 2OTLQ 1ZUUA 5CR2A 4IUQA 2E41A 1NG2A 1D0YA 2YLBA 1PCXA 1I5LA 3QYHB 3QIIA 1ZA1B 3CCQA 3CC2Q 3VS1A 3CPWA 3HHTB 4FYWB 1UFFA 2XI9A 4KH1B 4OP0A 1NEGA 5EG2A 2M9UA 3QXEB 4XTUA 3X28B 2O01E 1I4K1 1M1KU 3OYGA 3LX7A 4M7AD 4HT9A 2HEQA 2RI5A 3NTHA 4A54A 2EQMA 4Y91A 2DYIA 2C0OA 1WDXA 2DYBA 1JBMA 3RESA 2Y90A 2WSCE 2DF6A 3T9NA 4HVUA 3H8ZA 2HCKA 1XQHA 2QAZA 1X75C 4JS5A 3PE0A 4MDXA 2VC8A 2J05A 1B34A 3CCRQ 1WA7A 1YJWT 1BI3A 2V8JA 4DOWA 1KD1U 3CBMA 2FL7A 3GBQA 4D6WA 4HVVA 3AHUA 3M0TA 4II1A 1H3HA 4MMLA 5KCOA 2NWMA 3JAME 4HA8A 2RJCA 1QP2A 3CCEQ 3OW2P 4X34A 4MMKA 1I81A 2XD0A 1YITT 1M3BA 1RABB 3SHWA 2ROLA 3INZA 5GAN2 1QCOA 3H0FA 2YUOA 3JB9F 2EFIA 1IXDA 2EGEA 2EPDA 3EH1A 2X4XA 2JM9A 2RHZA 3C95A 4PJLA 3CCVT 1W2BP 2OTJA 4J9CA 1KQSP 3REBB 3TU4K 1IHVA 3CD6Q 2D1XA 4FW2A 3KFVA 1K9MR 1VQ9Q 3CBOA 3M55A 2XHCA 3MHXA 4JRIA 4M75A 3PIOA 2I0NA 2J6FA 1AWWA 1X43A 2K6DA 1G2BA 1M2VA 2EQIA 2K5LA 5CAIA 3G71A 3C12A 1YHQQ 4C92B 2EGCA 3A98A 4ZTFA 2XK0A 2P0PA 3G4SA 5GAMg 4XTXA 2DA9A 1K9MC 1YJNA 4HXJA 3VS6A 2PUKB 4FM4B 2KYMA 1SHGA 3VU3C 3A8OB 3RBBB 4BB7A 2CP2A 4NL2A 1TS9A 4AFZC 1Z9QA 1W4SA 1RUWA 2EKHA 2K2MA 3I55Q 3PVQA 3D7SB 2P4TA 1Z9ZA 4A4FA 4M7DE 1NE8A 2EBPA 4IKFA 3GF5A 2H3JA 3GOXA 1NJIU 1M3CA 4M7DD 2WSFE 4J7IA 3UA7A 4FYXB 4BY6C 3TSWA 4JLIA 2MMPA 4ZNXA 4KGXB 1TG0A 2V26A 4J83A 2AZVA 3O8VA 4LUDA 1UHFA 2J7IA 2KDSA 1MGQA 1VQOA 5M9OA 2BZYA 1RLPC 1QVPA 3I9QA 4OMOA 2YT6A 4VUBA 2BE7D 1YJ9T 3VUZA 4PJOC 2E4HA 1WHMA 2HBPA 1TUGB 3O5ZA 1U06A 5KCHA 3EG9A 1GBRA 4BI4A 3CCSQ 5GANe 4WCIA 2CSIA 1M3AA 3I5SA 1BYMA 3EG0A 3FC3A 1T0JA 2RHYA 2JJ9A 2RNAA 2COYA 1NM7A 2GQIA 2GGRA 1WI7A 1YWPA 2QA4T 2R5AA 1QVGP 4IIOA 3VS0A 1Y7XA 2FVUA 4PNOA 1QKWA 1WNLA 2GFUA 2EJFA 1U8RA 1VUBA 1X6OA 4PJJA 1K4US 3EGXA 4M77A 3HRSA 2LCCA 1B34B 3M5AA 2BUDA 3VRYA 3TVTA 2F5TX 5GAOn 4ZGEB 1R8OB 2PUOB 2JVVA 2JNGA 3S3OA 1VQ8A 1HYOA 3SD4A 4BDZA 5I2MA 3WXMB 5GAN6 2QQRA 1YI2A 2QTXA 1ZBJA 3UA6A 3JCMc 2D0QB 2P0QA 2KRNA 2G6FX 1UJYA 5GAN5 1VIFA 3EGUA 2M51A 3CC7T 4RTTA 3C4SA 4MZTA 1M30A 4QKUA 3JV3A 1BCMA 3PGGA 1YJWQ 2F2VA 4GLKA 4KT0E 5IHIA 4PJNA 4J6XA 3JCMQ 1RAAB 3OYMA 1NBEB 2E6NA 3A1PA 3HFNA 4C8QA 3V7CA 4EMKB 5LJ3d 1BKBA 2HQEA 2DETA 4J9DA 3VS5A 3S3NA 2KSSA 4ESRA 4XAXB 1U1SA 5HCKA 5IN1A 4E6RA 2J6OA 4M7AF 3FJ5A 1OQKA 1K1ZA 4BE0A 1N8RR 3OBWA 3L2WA 1K0SA 4Y92A 3PMTA 2HZYA 1VQPT 1K0XA 1RLQC 1N6AA 3G6EA 2HQHA 3CCVQ 2SRCA 3M0PA 1Y96B 1AWJA 3JCMf 1IO6A 4PJOG 1N8RC 3HL8A 2OTLT 4IURA 2L89A 3PT9A 5CO7A 1UGQB 2GQVA 3EG1A 3OYYA 2B86A 3ZBDA 1DJ7B 5DLOA 3MEAA 4OMPA 4A4KA 2DD5A 4FT2A 3JCMh 3CC2T 5LJ3e 3M4GA 2HSPA 9ATCB 4M75C 2K4YA 1CKBA 2MCNA 3HSBA 3ZFJA 5CQYA 1KG1A 5IXBA 2FYKA 2E5QA 2KBTA 2CP0A 2FO0A 3CMAT 3CCLA 2VVKA 3JB9I 1QWFA 3H0IA 2JS2A 2DL3A 4OVAA 1BBZA 3PIPA 1BI2A 2DXUA 2JTMA 2PVDB 2K7AA 3I5RA 4J6WA 4KRTA 4E2FB 3HKSA 5CKFA 1HJDA 2V8IA 3EFSA 5CVIA 2JMCA 3PMIA 2DL7A 3OYLA 1QLYA 4HT8A 4RCCA 2VGNA 1M1KR 3M0QA 3PFSA 5KYNA 1FXXA 3PVLA 2DO3A 2V8KA 1QCFA 2VV5A 3TCJA 1KIKA 2RJDA 4J9EA 3I56T 1AOJA 4C5HA 2ZPEB 4B9WA 1YJ9Q 1OPKA 1M1KC 4Z8AA 2RQVA 4HCKA 1WHHA 2L5QA 5EC7A 1D1BA 1PWTA 5KYXA 3CCUA 1OZ3A 5GAOr 3KBGA 4PJOD 4OMMA 1KD1R 4XK8E 1C1AA 4Q5WA 4RTXA 1M90U 3RR6A 4AFSC 3HRUA 5CKBA 4M7DF 5A2QE 2QA4Q 1I8FA 2DK3A 1KD1C 2LTOA 5IXFA 1M27C 1VQ6A 2OJ2A 2XDBA 3QDFA 1Q86U 4M7DB 3E9GA 1PC0A 1OX8A 2DBMA 2WSEE 4JLGA 1S72T 3EG3A 1TXQA 3QWXX 1YHQT 3L2UA 2QI2A 1VQLA 1M4ZA 2DNUA 3VJPA 3QJYA 2P84A 1XNIA 3EFRA 4EDUA 1VQMQ 3RMQA 1QKXA 1PHTA 2ED1A 1PD0A 2EYYA 4M77C 1ZSGA 2X3XD 3DLLA 2QQBA 2KROA 1OPLA 3I55T 1UEBA 2VUBA 1YIJT 4IUPA 1Y0MA 3CPWS 3MP6A 1VQ5A 4XU1A 3VKIA 2FZCB 5J39A 2A7YA 4M78C 4RTVA 3VV0A 1IHWA 1UE9A 5A0LA 3CC7Q 2FG0A 4M75G 3I35A 1W1FA 4K11A 4FW1A 3VS7A 4C92A 2K9GA 1NYGA 3LW5E 3HP9A 3MPUB 3URGA 3FLGA 1RI9A 3MO8A 4E7HA 4ORZA 4X9DA 1FMKA 2HSEB 4BDYA 1H92A 1G83A 2HKNA 2LX9A 1GFCA 2COWA 5GAMe 3BDLA 4JUVA 4CC2A 1R0BG 4N0AA 1LPLA 3JCMd 1UDLA 1RACB 2JTEA 1Y07A 1GXIE 1Q95G 1VQNA 2O2OA 3HPWA 2EJ9A 2VB6A 4JRPA 4C8QC 3ULRB 1WGSA 4D8DA 1VQPQ 2DRKA 3M9QA 4LUEA 2QQSA 2LQWA 2FHDA 2CH4W 2KT8A 1SEMA 1VQKA 2RHUA 2PQWA 4UC4A 2CKKA 2OX7A 4E7LA 1G3SA 1UB4A 5GJWB 2CT4A 1KK7A 2KEAA 5GANh 2LQKA 3QSUA 3OS0A 1VQ4T 2XDDA 1W70A 4KUDK 1N9RA 3E2UA 2ABLA 2BIVA 2HL5C 1RAFB 2D8JA 4IUTA 3MP1A 3SFMA 2XIDA 4X1VA 3HRTA 2IIMA 3L42A 1EZZB 1YITA 4AFQC 4J8OA 1JJ2S 3U23A 1VQ7T 1BI1A 3OSSC 1ZUKA 2RB6A 4M7AE 2YUNA 4F7UG 2RH2A 3CMAQ 1SPKA 4PLLA 4M75D 4CRIA 1WYXA 5FWCA 2DLPA 1G3TA 2LNVA 3RUXA 1UHCA 4J9BA 1K8AU 3SWNA 4OMNA 2AZSA 3CCMA 1QVFS 4O5VA 8AT1B 5DM7R 5KYXB 1N5ZA 4J9IA 3X25B 5I21A 5GAN3 3DLMA 1IB8A 5FLXE 1YWOA 2F69A 2C0TA 2E64A 3R6NA 1T3LA 1W6XA 2DTHA 3OYDA 4M77G 2YLCA 3CXCS 4OB3B 3I56Q 2X9HA 3X20B 2DE0X 2GNCA 4M78G 4JZ4A 3G6EQ 1TTHB 3QPHA 3C0CA 3S3MA 1X2QA 4FSXA 3M0RA 1U1TA 2RHXA 4CC4B 2DTOA 4KGZB 3DB3A 2DXBA 2L3PA 1JEGA 1UUEA 3MCAB 2V1QA 1IRXA 2X4WA 5FW9A 4ANJA 3UPUA 3L1AA 1R0CB 1PD1A 1SG5A 3R6OA 3GIBA 5CQXA 5GAOq 2O4XA 2PVOB 2ZGWA 1RL2A 2JOYA 4L59A 1JJ2A 1OOTA 3V8KA 4EMKA 2ZPHB 2EJGA 1JXMA 1HK9A 2E12A 1WHJA 4C8QG 2QEXA 3CCJA 4N4GA 4FL6A 1WJRA 2KMTA 1S72Q 3E1SA 4ELYC 4A63B 1BB9A 2EKOA 2CSQA 4RG2A 1QVFA 2DFUA 3PNWC 2B8AA 4M7AA 1WHKA 1Y96A 2A08A 1EFNA 1SKUB 4PJOF 4JJDA 1YIJQ 4PL6A 2OI3A 2QQAA 5I2SA 1I0CA 3OS2A 2KAFA 1C0MA 1TOVA 4KBMB 2FZKB 3CXCA 4M77D 3QYGB 4F17A 5AT1B 2DX1A 3C94A 2BKDN 2G3RA 1RAHB 2L3RA 4M78D 1A0NB 1NYFA 2JZ2A 1Q82U 4E7KA 2DPPB 2RO0A 3EHRA 3QZ9B 2DL4A 2GF7A 1E6GA 3CMEA 2RI3A 4XTZA 4C92C 2RN8A 2COZA 2MAMA 2KRSA 1RAEB 3RMSA 1GCQC 2A3LA 2XMFA 2X4JA 2PTKA 2H8HA 3QG1A 2M16A 5KH6A 1D3BB 3A8MB 2AHJB 2E70A 2RK1A 3JCMg 1MMGA 3CC4A 2OTJT 3GNFB 5A0GA 2EYXA 4LN2A 2HDAA 5D6YA 2LZ6B 2EAYA 2HD0A 3LWHA 5GANj 1TU0B 1GL5A 2E6ZA 4ELZC 4ATOA 5A0DA 2ROTA 3G71T 2M0YA 2Y4YA 1SRLA 5GAOm 2QASA 3VS2A 2K3YA 3J80E 1FYNA 3MKDA 3G4ST 2DBKA 2CH4A 3A8HB 1VQ4Q 1YJNT 1X6BA 3A8LB 4LE9A 3SWNB 5IH2A 5I22A 2CUDA 2EIFA 3JCMb 1M9SA 2JN0A 4QT7A 1VQ7Q 2HKQB 5KE2A 3P8HA 2GCXA 4QVZA 3J81E 1WXBA 5D7UA 3JB9J 1VQMT 4OMFB 3ME9A 2EYWA 2K57A 2LJ1A 3VUBA 2JT4A 4A53A 1KFZA 3RKXA 4E7SA 1TUDA 3G1JA 1M5Q1 3TREA 4A4EA 4QQDA 3EFOB 2O88A 3DKMA 2OTLA 3VRZA 2LRQA 4M7DA 2MPXC 5ECAA 3NGPA 3OS5A 2LMJA 2KYBA 1KHIA 4GY5A 5HY6A 1PKTA 1I1JA 1AWOA 1OX9A 5GAOp 4ZN1A 3CC2A 2DERA 2O4XB 4EIKA 5GAN4 4V2SA 1FWZA 1M8MA 4RG8A 2CP3A 3META 1Q81R 2L2PA 5D6XA 1M1GA 1YCSB 5HK3A 4RTUA 3JB9G 5LJ5h 4DEYA 2MI6A 1NZ9A 2QGFB 1WQ7A 4XQ3A 4M75F 3JSCA 3VYGA 1Q81C 2W0ZA 4C92G 1WHLA 4RMOA 3JCMW 3OB9A 4PJMA 1RI0A 3CCQQ 2JS0A 4M7AB 1H641 1E6HA 2E1HA 1D1AA 2X4YA 1ZA2B 3CCRA 1LNXA
chains in the Genus database with same CATH topology
2C0OA 1WDXA 2DYBA 2DVJA 2DNUA 1SHFA 2FRYA 1JQQA 2DF6A 2C0IA 5I11A 4HVUA 3NPFA 2VWFA 2HCKA 1QKXA 1PHTA 2ED1A 4CC7A 2EYYA 3PE0A 1ZSGA 2X3XD 2CT3A 2KROA 1OPLA 2J05A 2LP5A 3THKA 4D8KA 1WA7A 1Y0MA 2DRMA 2EVRA 1Y57A 4RTVA 3GBQA 2V1RA 4HVVA 1UE9A 3M0TA 2FG0A 1H3HA 1VYUA 4CC3A 3I35A 1W1FA 1VA7A 4K11A 4HVWA 3VS7A 2RF0A 2K9GA 1NYGA 3SEMA 2BTTA 2NWMA 4IIMA 1B07A 1RI9A 2K79A 4ORZA 1FMKA 1ABOA 1H92A 2KRMA 1G83A 1GCPA 1M3BA 2W10A 1GFCA 3SHWA 2ROLA 3M0SA 4CC2A 3H0FA 1JXOA 2PZ1A 2YUOA 1UECA 1UDLA 3M0UA 2JTEA 1WXTA 4J9FA 2EGEA 2EPDA 2L3QA 1YN8A 2JM9A 2KT1A 1MV3A 2VKNA 2O2OA 1NLPC 4J9CA 2O9SA 3REBB 3ULRB 1PRLC 1WLPB 2F2XA 1SRMA 1X27A 2D1XA 3KFVA 4D8DA 2DRKA 4LUEA 1ZUYA 2I0NA 2J6FA 4AFUC 1AWWA 2LQWA 1X43A 2KE9A 2CH4W 2KT8A 2K6DA 1G2BA 2EQIA 1SEMA 5IHKA 1CSKA 2F2WA 2EGCA 3A98A 2E5KA 1VYTA 5GJWB 3VS4A 2CT4A 2DA9A 5FWBA 5L23A 4HXJA 2KEAA 3VS6A 2KYMA 1SHGA 2LJ3A 1E7OA 3RBBB 1W70A 1QWEA 2ABLA 2EW3A 2D8JA 4AFZC 1Z9QA 3ZL7C 1RUWA 2EKHA 2K2MA 2KXDA 2EGAA 4X1VA 3PVQA 2IIMA 2SEMA 2GTOA 1Z9ZA 4AFQC 3U23A 2EBPA 1CKAA 2RQRA 1ZUKA 1AZEA 1AVZC 4M4ZA 2YUNA 1M3CA 1SPKA 3UA7A 2D8HA 3TSWA 4ZNXA 1MUZA 1WYXA 5FWCA 1TG0A 2DLPA 4Z89A 1UHCA 2PNIA 2AZVA 4AG1C 4J9BA 4LUDA 1U3OA 2KXCA 4OMNA 2AZSA 1UHFA 2J7IA 2ENMA 1KJWA 1N5ZA 2BZYA 4J9IA 4JPBW 1RLPC 3I9QA 4OMOA 1YWOA 2YT6A 2ED0A 2C0TA 4RTWA 3R6NA 1T3LA 4J9HA 1W6XA 3O5ZA 1PNJA 1U06A 3H41A 1OEBA 2FPFA 4R0KA 4Z88A 1JO8A 1GBRA 2LX7A 4WCIA 2CSIA 1M3AA 3I5SA 2DE0X 2YSQA 2AK5A 1GFDA 2GNCA 3EG0A 2GBQA 4JZ4A 3C0CA 1T0JA 1X2QA 1I07A 3M0RA 1U5SA 2RNAA 1NM7A 2GQIA 1UGVA 4CC4B 2GGRA 1UG1A 3EG2A 1WI7A 5IHNA 1X2KA 1YWPA 2L3PA 1JEGA 1UUEA 5FW9A 2V1QA 1AD5A 2KNBB 1GRIA 4IIOA 3VS0A 2DM1A 1PRMC 1S1NA 1QKWA 2AKKA 2DMOA 2CDTA 2D0NA 4RTYA 1K4US 1TUCA 1K9AA 1OOTA 1V1CA 3H0HA 3IQLA 4J9GA 2LQNA 2A36A 1B3QA 1JXMA 1WFWA 3VRYA 1ZX6A 2YUQA 3TVTA 3UATA 4F14A 2CUBA 1WX6A 2J06A 2BZXA 1UTIA 1J3TA 1ZBJA 3UA6A 2RMOA 3CQTA 4A63B 2CREA 1BB9A 2CSQA 2K3BA 1ZLMA 4JJBA 2KRNA 1KSWA 2G6FX 1UJYA 1NEBA 3EGUA 2M51A 3LH5A 4RTTA 1M30A 2A08A 1ARKA 3JV3A 1EFNA 4JJDA 4JZ3A 1K76A 1MV0B 2OI3A 1I0CA 2FPDA 2F2VA 2JW4A 5IHIA 1JU5C 2LCSA 4OMLA 3TSZA 4F17A 2DX1A 4RTZA 1SSHA 2L0AA 4J9DA 1HD3A 1A0NB 3VS5A 1NYFA 2A37A 4ESRA 2YUPA 4OMQA 1NLOC 3EHRA 5HCKA 2DL4A 2J6OA 2QDLA 1E6GA 2J6KA 4E6RA 3FJ5A 1K1ZA 4AG2C 2RN8A 4GBQA 1PKSA 2MOXA 2KRSA 1K0SA 4Y92A 2O9VA 1GCQC 1K0XA 1RLQC 2XMFA 2PTKA 2H8HA 2ECZA 2SRCA 3M0PA 1AWJA 1X6GA 1IO6A 2EYXA 4LN2A 2FRWA 2HDAA 2DJQA 2DL5A 2LZ6B 2ESWA 3VS3A 2RQUA 3EG1A 2B86A 1GL5A 2ROTA 2M0YA 2L3SA 4OMPA 3REAB 1SRLA 3VS2A 1FYNA 2HSPA 2DBKA 2CH4A 4LNPA 1CKBA 2MCNA 1X6BA 4RUGA 4LE9A 1BK2A 2LNHB 2A28A 5IXBA 2DL8A 2HBWA 2RPNA 5I22A 5IH2A 2CUDA 4GLMA 2KBTA 2FO0A 1BU1A 4F16A 2OAWA 2VVKA 1AEYA 1QWFA 2FEIA 3H0IA 2JS2A 2EYZA 1GCQA 1WIEA 2DL3A 1GBQA 1XOVA 1BBZA 3EHQA 4QT7A 1WXUA 2K7AA 2BZ8A 3I5RA 4KRTA 2KR3A 1HJDA 1T3SA 2P4RA 2X3WD 2JMAA 2MIOA 1AZGB 1WXBA 2JMCA 3RNJA 2O31A 2EYWA 2JM8A 2LJ1A 2DL7A 1QLYA 2JT4A 2JXBA 1KFZA 3M0QA 1TUDA 2RQWA 3QWYA 1OV3A 4DEXA 1LCKA 2O88A 1VYVA 3PVLA 1H8KA 3VRZA 1QCFA 1KIKA 4J9EA 5ECAA 1AOJA 3NGPA 2LMJA 1OPKA 2KYBA 1T0HA 4Z8AA 2RQVA 4HCKA 1PKTA 1I1JA 1AWOA 1ABQA 2GTJA 2LJ0A 5EC7A 1PWTA 2YDLA 3UF4A 2RQTA 4JJCA 4EIKA 1AWXA 1ZUUA 1NG2A 4OMMA 1YP5A 1M8MA 3NMZC 4RTXA 2L2PA 1YCSB 4RTUA 5GJVB 4AFSC 4DEYA 3VS1A 2NUZA 1X69A 4FSSA 1UFFA 2AKLA 1NEGA 5IXFA 1M27C 2DILA 1YNZA 2OJ2A 2W0ZA 1UJ0A 2KGTA 2DBMA 1HSQA 2JS0A 1E6HA 2HEQA 3EG3A 2FPEA 3QWXX 3NHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0O A;  1WDX A;  2DYB A;  2DVJ A;  2DNU A;  1SHF A;  2FRY A;  1JQQ A;  2DF6 A;  2C0I A;  5I11 A;  4HVU A;  3NPF A;  2VWF A;  2HCK A;  1QKX A;  1PHT A;  2ED1 A;  4CC7 A;  2EYY A;  3PE0 A;  1ZSG A;  2X3X D;  2CT3 A;  2KRO A;  1OPL A;  2J05 A;  2LP5 A;  3THK A;  4D8K A;  1WA7 A;  1Y0M A;  2DRM A;  2EVR A;  1Y57 A;  4RTV A;  3GBQ A;  2V1R A;  4HVV A;  1UE9 A;  3M0T A;  2FG0 A;  1H3H A;  1VYU A;  4CC3 A;  3I35 A;  1W1F A;  1VA7 A;  4K11 A;  4HVW A;  3VS7 A;  2RF0 A;  2K9G A;  1NYG A;  3SEM A;  2BTT A;  2NWM A;  4IIM A;  1B07 A;  1RI9 A;  2K79 A;  4ORZ A;  1FMK A;  1ABO A;  1H92 A;  2KRM A;  1G83 A;  1GCP A;  1M3B A;  2W10 A;  1GFC A;  3SHW A;  2ROL A;  3M0S A;  4CC2 A;  3H0F A;  1JXO A;  2PZ1 A;  2YUO A;  1UEC A;  1UDL A;  3M0U A;  2JTE A;  1WXT A;  4J9F A;  2EGE A;  2EPD A;  2L3Q A;  1YN8 A;  2JM9 A;  2KT1 A;  1MV3 A;  2VKN A;  2O2O A;  1NLP C;  4J9C A;  2O9S A;  3REB B;  3ULR B;  1PRL C;  1WLP B;  2F2X A;  1SRM A;  1X27 A;  2D1X A;  3KFV A;  4D8D A;  2DRK A;  4LUE A;  1ZUY A;  2I0N A;  2J6F A;  4AFU C;  1AWW A;  2LQW A;  1X43 A;  2KE9 A;  2CH4 W;  2KT8 A;  2K6D A;  1G2B A;  2EQI A;  1SEM A;  5IHK A;  1CSK A;  2F2W A;  2EGC A;  3A98 A;  2E5K A;  1VYT A;  5GJW B;  3VS4 A;  2CT4 A;  2DA9 A;  5FWB A;  5L23 A;  4HXJ A;  2KEA A;  3VS6 A;  2KYM A;  1SHG A;  2LJ3 A;  1E7O A;  3RBB B;  1W70 A;  1QWE A;  2ABL A;  2EW3 A;  2D8J A;  4AFZ C;  1Z9Q A;  3ZL7 C;  1RUW A;  2EKH A;  2K2M A;  2KXD A;  2EGA A;  4X1V A;  3PVQ A;  2IIM A;  2SEM A;  2GTO A;  1Z9Z A;  4AFQ C;  3U23 A;  2EBP A;  1CKA A;  2RQR A;  1ZUK A;  1AZE A;  1AVZ C;  4M4Z A;  2YUN A;  1M3C A;  1SPK A;  3UA7 A;  2D8H A;  3TSW A;  4ZNX A;  1MUZ A;  1WYX A;  5FWC A;  1TG0 A;  2DLP A;  4Z89 A;  1UHC A;  2PNI A;  2AZV A;  4AG1 C;  4J9B A;  4LUD A;  1U3O A;  2KXC A;  4OMN A;  2AZS A;  1UHF A;  2J7I A;  2ENM A;  1KJW A;  1N5Z A;  2BZY A;  4J9I A;  4JPB W;  1RLP C;  3I9Q A;  4OMO A;  1YWO A;  2YT6 A;  2ED0 A;  2C0T A;  4RTW A;  3R6N A;  1T3L A;  4J9H A;  1W6X A;  3O5Z A;  1PNJ A;  1U06 A;  3H41 A;  1OEB A;  2FPF A;  4R0K A;  4Z88 A;  1JO8 A;  1GBR A;  2LX7 A;  4WCI A;  2CSI A;  1M3A A;  3I5S A;  2DE0 X;  2YSQ A;  2AK5 A;  1GFD A;  2GNC A;  3EG0 A;  2GBQ A;  4JZ4 A;  3C0C A;  1T0J A;  1X2Q A;  1I07 A;  3M0R A;  1U5S A;  2RNA A;  1NM7 A;  2GQI A;  1UGV A;  4CC4 B;  2GGR A;  1UG1 A;  3EG2 A;  1WI7 A;  5IHN A;  1X2K A;  1YWP A;  2L3P A;  1JEG A;  1UUE A;  5FW9 A;  2V1Q A;  1AD5 A;  2KNB B;  1GRI A;  4IIO A;  3VS0 A;  2DM1 A;  1PRM C;  1S1N A;  1QKW A;  2AKK A;  2DMO A;  2CDT A;  2D0N A;  4RTY A;  1K4U S;  1TUC A;  1K9A A;  1OOT A;  1V1C A;  3H0H A;  3IQL A;  4J9G A;  2LQN A;  2A36 A;  1B3Q A;  1JXM A;  1WFW A;  3VRY A;  1ZX6 A;  2YUQ A;  3TVT A;  3UAT A;  4F14 A;  2CUB A;  1WX6 A;  2J06 A;  2BZX A;  1UTI A;  1J3T A;  1ZBJ A;  3UA6 A;  2RMO A;  3CQT A;  4A63 B;  2CRE A;  1BB9 A;  2CSQ A;  2K3B A;  1ZLM A;  4JJB A;  2KRN A;  1KSW A;  2G6F X;  1UJY A;  1NEB A;  3EGU A;  2M51 A;  3LH5 A;  4RTT A;  1M30 A;  2A08 A;  1ARK A;  3JV3 A;  1EFN A;  4JJD A;  4JZ3 A;  1K76 A;  1MV0 B;  2OI3 A;  1I0C A;  2FPD A;  2F2V A;  2JW4 A;  5IHI A;  1JU5 C;  2LCS A;  4OML A;  3TSZ A;  4F17 A;  2DX1 A;  4RTZ A;  1SSH A;  2L0A A;  4J9D A;  1HD3 A;  1A0N B;  3VS5 A;  1NYF A;  2A37 A;  4ESR A;  2YUP A;  4OMQ A;  1NLO C;  3EHR A;  5HCK A;  2DL4 A;  2J6O A;  2QDL A;  1E6G A;  2J6K A;  4E6R A;  3FJ5 A;  1K1Z A;  4AG2 C;  2RN8 A;  4GBQ A;  1PKS A;  2MOX A;  2KRS A;  1K0S A;  4Y92 A;  2O9V A;  1GCQ C;  1K0X A;  1RLQ C;  2XMF A;  2PTK A;  2H8H A;  2ECZ A;  2SRC A;  3M0P A;  1AWJ A;  1X6G A;  1IO6 A;  2EYX A;  4LN2 A;  2FRW A;  2HDA A;  2DJQ A;  2DL5 A;  2LZ6 B;  2ESW A;  3VS3 A;  2RQU A;  3EG1 A;  2B86 A;  1GL5 A;  2ROT A;  2M0Y A;  2L3S A;  4OMP A;  3REA B;  1SRL A;  3VS2 A;  1FYN A;  2HSP A;  2DBK A;  2CH4 A;  4LNP A;  1CKB A;  2MCN A;  1X6B A;  4RUG A;  4LE9 A;  1BK2 A;  2LNH B;  2A28 A;  5IXB A;  2DL8 A;  2HBW A;  2RPN A;  5I22 A;  5IH2 A;  2CUD A;  4GLM A;  2KBT A;  2FO0 A;  1BU1 A;  4F16 A;  2OAW A;  2VVK A;  1AEY A;  1QWF A;  2FEI A;  3H0I A;  2JS2 A;  2EYZ A;  1GCQ A;  1WIE A;  2DL3 A;  1GBQ A;  1XOV A;  1BBZ A;  3EHQ A;  4QT7 A;  1WXU A;  2K7A A;  2BZ8 A;  3I5R A;  4KRT A;  2KR3 A;  1HJD A;  1T3S A;  2P4R A;  2X3W D;  2JMA A;  2MIO A;  1AZG B;  1WXB A;  2JMC A;  3RNJ A;  2O31 A;  2EYW A;  2JM8 A;  2LJ1 A;  2DL7 A;  1QLY A;  2JT4 A;  2JXB A;  1KFZ A;  3M0Q A;  1TUD A;  2RQW A;  3QWY A;  1OV3 A;  4DEX A;  1LCK A;  2O88 A;  1VYV A;  3PVL A;  1H8K A;  3VRZ A;  1QCF A;  1KIK A;  4J9E A;  5ECA A;  1AOJ A;  3NGP A;  2LMJ A;  1OPK A;  2KYB A;  1T0H A;  4Z8A A;  2RQV A;  4HCK A;  1PKT A;  1I1J A;  1AWO A;  1ABQ A;  2GTJ A;  2LJ0 A;  5EC7 A;  1PWT A;  2YDL A;  3UF4 A;  2RQT A;  4JJC A;  4EIK A;  1AWX A;  1ZUU A;  1NG2 A;  4OMM A;  1YP5 A;  1M8M A;  3NMZ C;  4RTX A;  2L2P A;  1YCS B;  4RTU A;  5GJV B;  4AFS C;  4DEY A;  3VS1 A;  2NUZ A;  1X69 A;  4FSS A;  1UFF A;  2AKL A;  1NEG A;  5IXF A;  1M27 C;  2DIL A;  1YNZ A;  2OJ2 A;  2W0Z A;  1UJ0 A;  2KGT A;  2DBM A;  1HSQ A;  2JS0 A;  1E6H A;  2HEQ A;  3EG3 A;  2FPE A;  3QWX X;  3NHN A; 
#chains in the Genus database with same CATH topology
 1BIB A;  2DVJ A;  2DIG A;  1SHF A;  3X24 B;  1PSE A;  2DKG A;  5GAO l;  5I11 A;  3F70 A;  5FU6 B;  3SB2 A;  4CC7 A;  3CPW P;  4EMK C;  1F1B B;  3M4Y A;  2CYZ B;  1WHG A;  3CCE A;  2H3E B;  2DJZ A;  3M54 A;  5J26 A;  1MMN A;  2EVR A;  4J5Y A;  5GMK e;  4BE2 A;  3RKY A;  4PFZ A;  3OYK A;  1VYU A;  2Y4X A;  5C0M A;  3SEM A;  1B07 A;  3EH2 A;  1YCY A;  4L6V 5;  2K79 A;  1ABO A;  3MEW A;  2KRM A;  2LVM A;  3HTR A;  3A8G B;  1PSF A;  8ATC B;  3M0S A;  3CD6 A;  2PZ1 A;  4BI3 A;  1VQ9 A;  1UEC A;  3UWN A;  3M0U A;  5FRN A;  4J9F A;  4B9X A;  2E65 A;  3OQ5 A;  5FU7 B;  2LQ8 A;  1MV3 A;  1YHQ A;  2VKN A;  2F5K A;  2M02 A;  4RCB A;  4F7U F;  2O9S A;  1PRL C;  1YFN A;  4DQ2 A;  3A5Z B;  1SRM A;  3OYC A;  2ZPB B;  4ZTJ A;  4J6Y A;  1ZUY A;  4AFU C;  2FB7 A;  2X35 A;  4MZP A;  5C6S A;  3G6E T;  4ZN3 A;  4C92 D;  5IHK A;  2CS7 A;  1AHJ B;  3I55 A;  4PJO E;  3OYF A;  5CKH A;  1MMD A;  2OTJ Q;  3JCM V;  1UGR B;  1VYT A;  2E10 A;  5FWB A;  5L23 A;  4FIB A;  4XU0 A;  1E7O A;  1QWE A;  2EW3 A;  3ZL7 C;  3E19 A;  3G71 Q;  2KI7 A;  4OGC A;  4M77 F;  1JJ2 P;  2VAS A;  2DZ9 A;  2KY9 A;  5GAN 8;  3L2Z A;  2QXF A;  2GTO A;  2RM4 A;  1I5O B;  1LJO A;  3HFO A;  3G4S Q;  1CKA A;  1EX4 A;  1YJN Q;  2RQR A;  5FU7 C;  1KQ1 A;  4M78 F;  4QVC A;  1AZE A;  4N4H A;  3GPL A;  4XTV A;  1PM3 A;  1ZSZ A;  2PVG B;  2IPO B;  2D8H A;  1ACM B;  1MUZ A;  2F1L A;  4AG1 C;  1BCO A;  1QVF P;  2ZAE A;  2FZG B;  2CGH A;  4OB2 B;  2ENM A;  3CCS A;  4OB0 B;  4JPB W;  1MND A;  2ED0 A;  3FJP A;  1KC8 U;  3CXC P;  3H41 A;  1OEB A;  2D9T A;  2FPF A;  4R0K A;  4ZGJ B;  1OU9 A;  4Z88 A;  4XTY A;  1NPP A;  3OSV A;  1WPY A;  3OYN A;  1VQO Q;  2LCL A;  1RAD B;  1GFD A;  1O75 A;  2GBQ A;  4HKE A;  4F04 B;  1UGV A;  2YXY A;  4NL3 A;  4Z02 A;  5CCA A;  4M7D C;  4WF2 A;  2BE9 B;  5IHN A;  1X2K A;  4BD3 A;  2R5M A;  5LJ5 j;  2EQU A;  1AD5 A;  3CCU T;  4C0D B;  2QK0 A;  5KYU B;  5GAM j;  1PRM C;  4LD9 K;  1S1N A;  2DMO A;  1TSF A;  3L2Q A;  1M1F A;  1NJI R;  3EAE A;  1TUC A;  2QGG A;  1N8R U;  1R77 A;  1K9A A;  4QVD A;  4J9G A;  1BIA A;  4PJO A;  1D09 B;  5GAN f;  2VYT A;  1AT1 B;  2YRD A;  1VQ6 T;  1D0Z A;  4F14 A;  1NJI C;  4E7I A;  4MZM A;  1WX6 A;  3JB9 H;  1RAG B;  2R58 A;  2BZX A;  3QDR B;  2ATC B;  3LYI A;  3FDR A;  1YJW A;  2CZ1 B;  3CQT A;  4JS4 A;  2CRE A;  1OI1 A;  2K3B A;  3QHS A;  3GNG A;  1VQL T;  3V8J A;  4E47 A;  3EGD B;  1KSW A;  1NEB A;  3RIR A;  2NUP B;  1D3B A;  1VQ8 Q;  4JRQ A;  4QW2 A;  1ARK A;  1YI2 Q;  4JZ3 A;  4AMC A;  1K73 U;  2DTI A;  3JCM e;  1X01 A;  3GP8 A;  3GLX A;  4J7F A;  4M75 E;  4C0G A;  4OML A;  2QDY B;  4LDV A;  2DD4 A;  4RTZ A;  2L0A A;  3OYJ A;  5KYW A;  1HD3 A;  4LDY A;  2QYZ A;  5KYY A;  3CCV A;  2YUP A;  1NLO C;  4N4I A;  2CP5 A;  2K3X A;  2QDL A;  4GBQ A;  1TWB A;  2AIR B;  2MOX A;  4A4G A;  2YHT A;  5KE3 A;  2ECZ A;  4FCY A;  1VQN T;  2FRW A;  1EIF A;  2DL5 A;  1G8X A;  4BUG A;  1ZQ1 A;  2JUF A;  1LVK A;  5HK0 A;  2A0F B;  2HAX A;  3M56 A;  2K5I A;  2DZC A;  3EFO A;  2K2V A;  4C5G A;  1ZSZ B;  2K5F A;  5GAN 7;  1VQK T;  3REA B;  2RI2 A;  4EMH A;  5L8R E;  4NOY A;  4LNP A;  2CZ7 B;  4M7D G;  4JJN K;  1ZBX A;  2DL8 A;  2RPN A;  4GLM A;  1Q7Y U;  5HKC A;  1BU1 A;  4F16 A;  4ZGD B;  2OAW A;  3QKJ A;  2XDP A;  1WIE A;  4QQ6 A;  1GBQ A;  3CCQ T;  3EHQ A;  2KVQ G;  1WXU A;  4NS5 A;  5FRO A;  2MWO A;  2RA2 A;  2BZ8 A;  2AT1 B;  5LL6 S;  4F7U E;  3Q1J A;  3OYI A;  1LOJ A;  2DEQ A;  1B7T A;  2OAU A;  3QO3 A;  4JRK A;  2M0O A;  2P4R A;  2JMA A;  4P5N A;  1AZG B;  2LC4 A;  3CCL Q;  1FMW A;  2O31 A;  1RAI B;  1YJ9 A;  4HCC A;  4LDW A;  5LJ3 f;  2RQW A;  3QWY A;  2DEU A;  1ZSZ C;  3CCM T;  1H8K A;  1XJW B;  4C92 F;  2MYS A;  4BY6 B;  2NYS A;  4OB1 B;  4PK4 A;  2YRC A;  2MF2 A;  4IUV A;  4M77 E;  1WQW A;  5LJ5 g;  1QW1 A;  1WJQ A;  2GTJ A;  5LJ3 h;  4LDX A;  1Y71 A;  2YDL A;  3AT1 B;  1AWX A;  2QA4 A;  5GMK h;  4M78 E;  4XTW A;  2LT1 A;  3RKW A;  1YP5 A;  1MNE A;  4PJO B;  4Y28 E;  3NMZ C;  2EQK A;  2E3H A;  3KXT A;  3H6Z A;  5GJV B;  4E7Z A;  5GAN d;  4XU2 A;  2RJE A;  2NUZ A;  1X69 A;  4MDW A;  4FSS A;  3CCU Q;  1IRE B;  2IVW A;  2AKL A;  2VXF A;  3KUF A;  5D6W A;  2DIL A;  1YNZ A;  4HCB A;  1VQM A;  4BE1 A;  1UJ0 A;  4DBF A;  2KGT A;  3FRN A;  1HSQ A;  3BW1 A;  1D1C A;  2ZPF B;  2HMA A;  4C0Z A;  2C06 A;  2FPE A;  1C6V X;  3NHN A;  3FIF A;  4N0A C;  4TVR A;  4C8Q E;  3S6W A;  2FRY A;  1JQQ A;  3CPF A;  1VQ6 Q;  2C0I A;  3G7Z A;  3CC7 A;  3CCJ T;  2QEX T;  3NPF A;  2VWF A;  3V7S A;  4C8Q D;  1VOM A;  1FX7 A;  2WAC A;  4B6M A;  4KH0 B;  2CT3 A;  1M8V A;  2LP5 A;  3THK A;  4D8K A;  4DBQ A;  5KYW B;  3OMG A;  2CZ6 B;  2P0K A;  2DRM A;  5KYY B;  1VQL Q;  3QBY A;  4FT4 A;  1Y57 A;  3N5B B;  2V1R A;  3M57 A;  4F7U A;  4PKC C;  2NUT A;  3E9F A;  3UT1 A;  1QMC A;  4CC3 A;  1VA7 A;  4HVW A;  2RF0 A;  4O6J A;  2BTT A;  2DVE A;  1YBY A;  4IIM A;  3ER0 A;  4DBR A;  4RKU E;  3QUI A;  2DAQ A;  2VGM A;  1M90 R;  1WZO A;  1VQ5 Q;  3OW2 S;  1GCP A;  1G5V A;  1KHC A;  2CP7 A;  2W10 A;  2HQX A;  2RD1 A;  4EMG A;  1VQP A;  1JXO A;  1OYX A;  2CP6 A;  1WXT A;  3BFM A;  2L3Q A;  1YN8 A;  1M90 C;  1Q86 R;  2KT1 A;  2D6F A;  1NLP C;  4JDS A;  4XU3 A;  1QQJ A;  2KK4 A;  3CME T;  5IT9 E;  1W2B S;  1WLP B;  2F2X A;  5DY9 A;  5DLQ E;  1X27 A;  1KQS S;  1VQO T;  4PLI A;  1V29 B;  4M78 A;  2KE9 A;  4PFO A;  5GMK m;  1Q86 C;  1KQ2 A;  2RHI A;  2CZ0 B;  3SWN C;  4DOV A;  1CSK A;  2F2W A;  1VQN Q;  3BDU A;  1OU8 A;  5LJ5 f;  2YWW A;  2E5K A;  4OF1 A;  3CC4 T;  3VS4 A;  1KC8 R;  5GAM f;  2LJ3 A;  4R56 A;  3OS1 A;  3CMA A;  3PTA A;  3V7R A;  3P8B B;  1VQK Q;  2KXD A;  2EGA A;  4LXC A;  3DB4 A;  4KUL A;  2SEM A;  4WTO B;  1KC8 C;  2R57 A;  1M2O A;  5GAM h;  2I2L A;  1AVZ C;  4KUI A;  4M4Z A;  4X9C A;  3SDZ A;  2XKO C;  4QQG A;  4YTL A;  2L8D A;  3NTK A;  4M75 B;  2PU9 B;  5CK9 A;  3OMC A;  4Z89 A;  1YIT Q;  2PNI A;  4E7J A;  5KYU A;  3JCM J;  3JCM P;  1M2V B;  1K9M U;  1U3O A;  2KXC A;  4LD6 A;  3JCM X;  3OW2 A;  3P8D A;  1BI0 A;  2XIC A;  5CIU A;  3I56 A;  2ZPI B;  1KJW A;  3L2R A;  2ZCF B;  1H3Z A;  4R55 A;  4L5G A;  1VQ8 T;  4BI8 B;  4RTW A;  2QQ9 A;  4J9H A;  1YI2 T;  1V76 A;  1PNJ A;  3WVD B;  3L2V A;  3CCM Q;  1UGP B;  2MK5 A;  5LJ3 j;  1JO8 A;  1W2B A;  1JB0 E;  1IZ6 A;  3TEE A;  2LX7 A;  1SF9 A;  1KQS A;  2YSQ A;  2AK5 A;  5GMK j;  2XU8 A;  3LGL A;  3LGF A;  5CKD A;  1I07 A;  1U5S A;  3M58 A;  1UG1 A;  2XG8 D;  2RK2 A;  3EG2 A;  2HL3 A;  3EGD A;  4LDU A;  2EYQ A;  2NUP A;  4M7A C;  1K73 R;  1TH7 A;  3TQ7 P;  2KNB B;  3M59 A;  1GRI A;  2NLU A;  2DM1 A;  2VXE A;  1QVG S;  2EQJ A;  3ASK A;  4PFP A;  2AKK A;  2CDT A;  2D0N A;  1S72 A;  2DXT A;  4RTY A;  4FU6 A;  5FU6 C;  3JB9 D;  1K73 C;  3H0H A;  1V1C A;  3IQL A;  5GMK l;  2LQN A;  5GAN g;  3OYB A;  4C0F A;  2A36 A;  2X51 A;  2E3I A;  4C92 E;  1B3Q A;  1WFW A;  1K8A R;  1ZX6 A;  2YUQ A;  4IUU A;  4BAC A;  3UAT A;  3EG9 B;  2CUB A;  4OGE A;  2J06 A;  2YRV A;  2NUT B;  1UTI A;  4F7U B;  1QP3 A;  1J3T A;  1O9S A;  2RMO A;  1YIJ A;  3CCR T;  1G3W A;  1IGU A;  2QG9 B;  1ZLM A;  1K8A C;  4JJB A;  3X26 B;  3OA6 A;  2ZPG B;  7AT1 B;  4CI0 C;  3CCJ Q;  2QEX Q;  3LH5 A;  4FYY B;  1G3Y A;  1MMA A;  2LT4 A;  2EWN A;  3UDC A;  1K76 A;  1MV0 B;  5GMK i;  3CCE T;  2FPD A;  3JRZ A;  4C5I A;  3MJX A;  2JW4 A;  3M53 A;  1IGQ A;  1JU5 C;  3V8L A;  4C5E A;  1UGS B;  2LCS A;  1XTD A;  3TSZ A;  3EGX B;  4M77 B;  5AYF A;  3ZEH A;  2KQW A;  1SSH A;  3FB9 A;  3CCL T;  1N9S A;  3MEV A;  2A37 A;  1Q7Y R;  1OUL A;  4M78 B;  3LWI A;  3NFC A;  4OMQ A;  1NPR A;  3OYA A;  2J6K A;  1FMV A;  2QTV A;  4AG2 C;  2Z0W A;  1PKS A;  3CD6 T;  2O9V A;  5LJ5 d;  1QVG A;  1VQ9 T;  2MWP A;  1Q7Y C;  5GAM d;  2RJF A;  1X6G A;  1JRI A;  3QJ6 A;  3CME Q;  3LH0 A;  1HXD A;  4AT1 B;  4C8Q F;  4DBH A;  2DJQ A;  4DA4 A;  1P92 A;  1VQ4 A;  5J3B A;  2LDM A;  2ESW A;  5CKE A;  3VS3 A;  2RQU A;  3VYH B;  3QZ5 B;  2L3S A;  4C8Q B;  3CC4 Q;  3MEU A;  3FEO A;  1VQ7 A;  2ZZD A;  3RER A;  1QCN A;  3BY7 A;  4FYV B;  2M1H A;  2DXC A;  1Q81 U;  3OYE A;  4RUG A;  1BK2 A;  2LNH B;  2A28 A;  3OYH A;  2HBW A;  4M7A G;  3CEY A;  4A4H A;  1AEY A;  2DIQ A;  2FEI A;  2EYZ A;  1GCQ A;  1ZHI A;  1XOV A;  2GFA A;  5LJ5 e;  3RDV A;  3BE3 A;  1VIE A;  3J7A F;  2HNI A;  1Q82 R;  2KR3 A;  3NTI A;  1T3S A;  5IAY A;  2X3W D;  4HCZ A;  2MIO A;  3WVE B;  1MHN A;  1PG5 B;  3RNJ A;  2JM8 A;  3MP8 A;  1N27 A;  2IG0 A;  5LJ3 g;  2JXB A;  3H9N A;  3LLR A;  1Q82 C;  1OV3 A;  4DEX A;  1LCK A;  1VYV A;  1OZ2 A;  1SSF A;  3CCS T;  3OY9 A;  1WJS A;  4C0D C;  4EPC A;  2JTF A;  3CBP A;  1T0H A;  1ABQ A;  5FRM A;  2LJ0 A;  4ME7 A;  3UF4 A;  3OBY A;  4KGV B;  2RQT A;  4JJC A;  6AT1 B;  1VQ5 T;  1D0X A;  2OTL Q;  1ZUU A;  5CR2 A;  4IUQ A;  2E41 A;  1NG2 A;  1D0Y A;  2YLB A;  1PCX A;  1I5L A;  3QYH B;  3QII A;  1ZA1 B;  3CCQ A;  3CC2 Q;  3VS1 A;  3CPW A;  3HHT B;  4FYW B;  1UFF A;  2XI9 A;  4KH1 B;  4OP0 A;  1NEG A;  5EG2 A;  2M9U A;  3QXE B;  4XTU A;  3X28 B;  2O01 E;  1I4K 1;  1M1K U;  3OYG A;  3LX7 A;  4M7A D;  4HT9 A;  2HEQ A;  2RI5 A;  3NTH A;  4A54 A;  2EQM A;  4Y91 A;  2DYI A;  2C0O A;  1WDX A;  2DYB A;  1JBM A;  3RES A;  2Y90 A;  2WSC E;  2DF6 A;  3T9N A;  4HVU A;  3H8Z A;  2HCK A;  1XQH A;  2QAZ A;  1X75 C;  4JS5 A;  3PE0 A;  4MDX A;  2VC8 A;  2J05 A;  1B34 A;  3CCR Q;  1WA7 A;  1YJW T;  1BI3 A;  2V8J A;  4DOW A;  1KD1 U;  3CBM A;  2FL7 A;  3GBQ A;  4D6W A;  4HVV A;  3AHU A;  3M0T A;  4II1 A;  1H3H A;  4MML A;  5KCO A;  2NWM A;  3JAM E;  4HA8 A;  2RJC A;  1QP2 A;  3CCE Q;  3OW2 P;  4X34 A;  4MMK A;  1I81 A;  2XD0 A;  1YIT T;  1M3B A;  1RAB B;  3SHW A;  2ROL A;  3INZ A;  5GAN 2;  1QCO A;  3H0F A;  2YUO A;  3JB9 F;  2EFI A;  1IXD A;  2EGE A;  2EPD A;  3EH1 A;  2X4X A;  2JM9 A;  2RHZ A;  3C95 A;  4PJL A;  3CCV T;  1W2B P;  2OTJ A;  4J9C A;  1KQS P;  3REB B;  3TU4 K;  1IHV A;  3CD6 Q;  2D1X A;  4FW2 A;  3KFV A;  1K9M R;  1VQ9 Q;  3CBO A;  3M55 A;  2XHC A;  3MHX A;  4JRI A;  4M75 A;  3PIO A;  2I0N A;  2J6F A;  1AWW A;  1X43 A;  2K6D A;  1G2B A;  1M2V A;  2EQI A;  2K5L A;  5CAI A;  3G71 A;  3C12 A;  1YHQ Q;  4C92 B;  2EGC A;  3A98 A;  4ZTF A;  2XK0 A;  2P0P A;  3G4S A;  5GAM g;  4XTX A;  2DA9 A;  1K9M C;  1YJN A;  4HXJ A;  3VS6 A;  2PUK B;  4FM4 B;  2KYM A;  1SHG A;  3VU3 C;  3A8O B;  3RBB B;  4BB7 A;  2CP2 A;  4NL2 A;  1TS9 A;  4AFZ C;  1Z9Q A;  1W4S A;  1RUW A;  2EKH A;  2K2M A;  3I55 Q;  3PVQ A;  3D7S B;  2P4T A;  1Z9Z A;  4A4F A;  4M7D E;  1NE8 A;  2EBP A;  4IKF A;  3GF5 A;  2H3J A;  3GOX A;  1NJI U;  1M3C A;  4M7D D;  2WSF E;  4J7I A;  3UA7 A;  4FYX B;  4BY6 C;  3TSW A;  4JLI A;  2MMP A;  4ZNX A;  4KGX B;  1TG0 A;  2V26 A;  4J83 A;  2AZV A;  3O8V A;  4LUD A;  1UHF A;  2J7I A;  2KDS A;  1MGQ A;  1VQO A;  5M9O A;  2BZY A;  1RLP C;  1QVP A;  3I9Q A;  4OMO A;  2YT6 A;  4VUB A;  2BE7 D;  1YJ9 T;  3VUZ A;  4PJO C;  2E4H A;  1WHM A;  2HBP A;  1TUG B;  3O5Z A;  1U06 A;  5KCH A;  3EG9 A;  1GBR A;  4BI4 A;  3CCS Q;  5GAN e;  4WCI A;  2CSI A;  1M3A A;  3I5S A;  1BYM A;  3EG0 A;  3FC3 A;  1T0J A;  2RHY A;  2JJ9 A;  2RNA A;  2COY A;  1NM7 A;  2GQI A;  2GGR A;  1WI7 A;  1YWP A;  2QA4 T;  2R5A A;  1QVG P;  4IIO A;  3VS0 A;  1Y7X A;  2FVU A;  4PNO A;  1QKW A;  1WNL A;  2GFU A;  2EJF A;  1U8R A;  1VUB A;  1X6O A;  4PJJ A;  1K4U S;  3EGX A;  4M77 A;  3HRS A;  2LCC A;  1B34 B;  3M5A A;  2BUD A;  3VRY A;  3TVT A;  2F5T X;  5GAO n;  4ZGE B;  1R8O B;  2PUO B;  2JVV A;  2JNG A;  3S3O A;  1VQ8 A;  1HYO A;  3SD4 A;  4BDZ A;  5I2M A;  3WXM B;  5GAN 6;  2QQR A;  1YI2 A;  2QTX A;  1ZBJ A;  3UA6 A;  3JCM c;  2D0Q B;  2P0Q A;  2KRN A;  2G6F X;  1UJY A;  5GAN 5;  1VIF A;  3EGU A;  2M51 A;  3CC7 T;  4RTT A;  3C4S A;  4MZT A;  1M30 A;  4QKU A;  3JV3 A;  1BCM A;  3PGG A;  1YJW Q;  2F2V A;  4GLK A;  4KT0 E;  5IHI A;  4PJN A;  4J6X A;  3JCM Q;  1RAA B;  3OYM A;  1NBE B;  2E6N A;  3A1P A;  3HFN A;  4C8Q A;  3V7C A;  4EMK B;  5LJ3 d;  1BKB A;  2HQE A;  2DET A;  4J9D A;  3VS5 A;  3S3N A;  2KSS A;  4ESR A;  4XAX B;  1U1S A;  5HCK A;  5IN1 A;  4E6R A;  2J6O A;  4M7A F;  3FJ5 A;  1OQK A;  1K1Z A;  4BE0 A;  1N8R R;  3OBW A;  3L2W A;  1K0S A;  4Y92 A;  3PMT A;  2HZY A;  1VQP T;  1K0X A;  1RLQ C;  1N6A A;  3G6E A;  2HQH A;  3CCV Q;  2SRC A;  3M0P A;  1Y96 B;  1AWJ A;  3JCM f;  1IO6 A;  4PJO G;  1N8R C;  3HL8 A;  2OTL T;  4IUR A;  2L89 A;  3PT9 A;  5CO7 A;  1UGQ B;  2GQV A;  3EG1 A;  3OYY A;  2B86 A;  3ZBD A;  1DJ7 B;  5DLO A;  3MEA A;  4OMP A;  4A4K A;  2DD5 A;  4FT2 A;  3JCM h;  3CC2 T;  5LJ3 e;  3M4G A;  2HSP A;  9ATC B;  4M75 C;  2K4Y A;  1CKB A;  2MCN A;  3HSB A;  3ZFJ A;  5CQY A;  1KG1 A;  5IXB A;  2FYK A;  2E5Q A;  2KBT A;  2CP0 A;  2FO0 A;  3CMA T;  3CCL A;  2VVK A;  3JB9 I;  1QWF A;  3H0I A;  2JS2 A;  2DL3 A;  4OVA A;  1BBZ A;  3PIP A;  1BI2 A;  2DXU A;  2JTM A;  2PVD B;  2K7A A;  3I5R A;  4J6W A;  4KRT A;  4E2F B;  3HKS A;  5CKF A;  1HJD A;  2V8I A;  3EFS A;  5CVI A;  2JMC A;  3PMI A;  2DL7 A;  3OYL A;  1QLY A;  4HT8 A;  4RCC A;  2VGN A;  1M1K R;  3M0Q A;  3PFS A;  5KYN A;  1FXX A;  3PVL A;  2DO3 A;  2V8K A;  1QCF A;  2VV5 A;  3TCJ A;  1KIK A;  2RJD A;  4J9E A;  3I56 T;  1AOJ A;  4C5H A;  2ZPE B;  4B9W A;  1YJ9 Q;  1OPK A;  1M1K C;  4Z8A A;  2RQV A;  4HCK A;  1WHH A;  2L5Q A;  5EC7 A;  1D1B A;  1PWT A;  5KYX A;  3CCU A;  1OZ3 A;  5GAO r;  3KBG A;  4PJO D;  4OMM A;  1KD1 R;  4XK8 E;  1C1A A;  4Q5W A;  4RTX A;  1M90 U;  3RR6 A;  4AFS C;  3HRU A;  5CKB A;  4M7D F;  5A2Q E;  2QA4 Q;  1I8F A;  2DK3 A;  1KD1 C;  2LTO A;  5IXF A;  1M27 C;  1VQ6 A;  2OJ2 A;  2XDB A;  3QDF A;  1Q86 U;  4M7D B;  3E9G A;  1PC0 A;  1OX8 A;  2DBM A;  2WSE E;  4JLG A;  1S72 T;  3EG3 A;  1TXQ A;  3QWX X;  1YHQ T;  3L2U A;  2QI2 A;  1VQL A;  1M4Z A;  2DNU A;  3VJP A;  3QJY A;  2P84 A;  1XNI A;  3EFR A;  4EDU A;  1VQM Q;  3RMQ A;  1QKX A;  1PHT A;  2ED1 A;  1PD0 A;  2EYY A;  4M77 C;  1ZSG A;  2X3X D;  3DLL A;  2QQB A;  2KRO A;  1OPL A;  3I55 T;  1UEB A;  2VUB A;  1YIJ T;  4IUP A;  1Y0M A;  3CPW S;  3MP6 A;  1VQ5 A;  4XU1 A;  3VKI A;  2FZC B;  5J39 A;  2A7Y A;  4M78 C;  4RTV A;  3VV0 A;  1IHW A;  1UE9 A;  5A0L A;  3CC7 Q;  2FG0 A;  4M75 G;  3I35 A;  1W1F A;  4K11 A;  4FW1 A;  3VS7 A;  4C92 A;  2K9G A;  1NYG A;  3LW5 E;  3HP9 A;  3MPU B;  3URG A;  3FLG A;  1RI9 A;  3MO8 A;  4E7H A;  4ORZ A;  4X9D A;  1FMK A;  2HSE B;  4BDY A;  1H92 A;  1G83 A;  2HKN A;  2LX9 A;  1GFC A;  2COW A;  5GAM e;  3BDL A;  4JUV A;  4CC2 A;  1R0B G;  4N0A A;  1LPL A;  3JCM d;  1UDL A;  1RAC B;  2JTE A;  1Y07 A;  1GXI E;  1Q95 G;  1VQN A;  2O2O A;  3HPW A;  2EJ9 A;  2VB6 A;  4JRP A;  4C8Q C;  3ULR B;  1WGS A;  4D8D A;  1VQP Q;  2DRK A;  3M9Q A;  4LUE A;  2QQS A;  2LQW A;  2FHD A;  2CH4 W;  2KT8 A;  1SEM A;  1VQK A;  2RHU A;  2PQW A;  4UC4 A;  2CKK A;  2OX7 A;  4E7L A;  1G3S A;  1UB4 A;  5GJW B;  2CT4 A;  1KK7 A;  2KEA A;  5GAN h;  2LQK A;  3QSU A;  3OS0 A;  1VQ4 T;  2XDD A;  1W70 A;  4KUD K;  1N9R A;  3E2U A;  2ABL A;  2BIV A;  2HL5 C;  1RAF B;  2D8J A;  4IUT A;  3MP1 A;  3SFM A;  2XID A;  4X1V A;  3HRT A;  2IIM A;  3L42 A;  1EZZ B;  1YIT A;  4AFQ C;  4J8O A;  1JJ2 S;  3U23 A;  1VQ7 T;  1BI1 A;  3OSS C;  1ZUK A;  2RB6 A;  4M7A E;  2YUN A;  4F7U G;  2RH2 A;  3CMA Q;  1SPK A;  4PLL A;  4M75 D;  4CRI A;  1WYX A;  5FWC A;  2DLP A;  1G3T A;  2LNV A;  3RUX A;  1UHC A;  4J9B A;  1K8A U;  3SWN A;  4OMN A;  2AZS A;  3CCM A;  1QVF S;  4O5V A;  8AT1 B;  5DM7 R;  5KYX B;  1N5Z A;  4J9I A;  3X25 B;  5I21 A;  5GAN 3;  3DLM A;  1IB8 A;  5FLX E;  1YWO A;  2F69 A;  2C0T A;  2E64 A;  3R6N A;  1T3L A;  1W6X A;  2DTH A;  3OYD A;  4M77 G;  2YLC A;  3CXC S;  4OB3 B;  3I56 Q;  2X9H A;  3X20 B;  2DE0 X;  2GNC A;  4M78 G;  4JZ4 A;  3G6E Q;  1TTH B;  3QPH A;  3C0C A;  3S3M A;  1X2Q A;  4FSX A;  3M0R A;  1U1T A;  2RHX A;  4CC4 B;  2DTO A;  4KGZ B;  3DB3 A;  2DXB A;  2L3P A;  1JEG A;  1UUE A;  3MCA B;  2V1Q A;  1IRX A;  2X4W A;  5FW9 A;  4ANJ A;  3UPU A;  3L1A A;  1R0C B;  1PD1 A;  1SG5 A;  3R6O A;  3GIB A;  5CQX A;  5GAO q;  2O4X A;  2PVO B;  2ZGW A;  1RL2 A;  2JOY A;  4L59 A;  1JJ2 A;  1OOT A;  3V8K A;  4EMK A;  2ZPH B;  2EJG A;  1JXM A;  1HK9 A;  2E12 A;  1WHJ A;  4C8Q G;  2QEX A;  3CCJ A;  4N4G A;  4FL6 A;  1WJR A;  2KMT A;  1S72 Q;  3E1S A;  4ELY C;  4A63 B;  1BB9 A;  2EKO A;  2CSQ A;  4RG2 A;  1QVF A;  2DFU A;  3PNW C;  2B8A A;  4M7A A;  1WHK A;  1Y96 A;  2A08 A;  1EFN A;  1SKU B;  4PJO F;  4JJD A;  1YIJ Q;  4PL6 A;  2OI3 A;  2QQA A;  5I2S A;  1I0C A;  3OS2 A;  2KAF A;  1C0M A;  1TOV A;  4KBM B;  2FZK B;  3CXC A;  4M77 D;  3QYG B;  4F17 A;  5AT1 B;  2DX1 A;  3C94 A;  2BKD N;  2G3R A;  1RAH B;  2L3R A;  4M78 D;  1A0N B;  1NYF A;  2JZ2 A;  1Q82 U;  4E7K A;  2DPP B;  2RO0 A;  3EHR A;  3QZ9 B;  2DL4 A;  2GF7 A;  1E6G A;  3CME A;  2RI3 A;  4XTZ A;  4C92 C;  2RN8 A;  2COZ A;  2MAM A;  2KRS A;  1RAE B;  3RMS A;  1GCQ C;  2A3L A;  2XMF A;  2X4J A;  2PTK A;  2H8H A;  3QG1 A;  2M16 A;  5KH6 A;  1D3B B;  3A8M B;  2AHJ B;  2E70 A;  2RK1 A;  3JCM g;  1MMG A;  3CC4 A;  2OTJ T;  3GNF B;  5A0G A;  2EYX A;  4LN2 A;  2HDA A;  5D6Y A;  2LZ6 B;  2EAY A;  2HD0 A;  3LWH A;  5GAN j;  1TU0 B;  1GL5 A;  2E6Z A;  4ELZ C;  4ATO A;  5A0D A;  2ROT A;  3G71 T;  2M0Y A;  2Y4Y A;  1SRL A;  5GAO m;  2QAS A;  3VS2 A;  2K3Y A;  3J80 E;  1FYN A;  3MKD A;  3G4S T;  2DBK A;  2CH4 A;  3A8H B;  1VQ4 Q;  1YJN T;  1X6B A;  3A8L B;  4LE9 A;  3SWN B;  5IH2 A;  5I22 A;  2CUD A;  2EIF A;  3JCM b;  1M9S A;  2JN0 A;  4QT7 A;  1VQ7 Q;  2HKQ B;  5KE2 A;  3P8H A;  2GCX A;  4QVZ A;  3J81 E;  1WXB A;  5D7U A;  3JB9 J;  1VQM T;  4OMF B;  3ME9 A;  2EYW A;  2K57 A;  2LJ1 A;  3VUB A;  2JT4 A;  4A53 A;  1KFZ A;  3RKX A;  4E7S A;  1TUD A;  3G1J A;  1M5Q 1;  3TRE A;  4A4E A;  4QQD A;  3EFO B;  2O88 A;  3DKM A;  2OTL A;  3VRZ A;  2LRQ A;  4M7D A;  2MPX C;  5ECA A;  3NGP A;  3OS5 A;  2LMJ A;  2KYB A;  1KHI A;  4GY5 A;  5HY6 A;  1PKT A;  1I1J A;  1AWO A;  1OX9 A;  5GAO p;  4ZN1 A;  3CC2 A;  2DER A;  2O4X B;  4EIK A;  5GAN 4;  4V2S A;  1FWZ A;  1M8M A;  4RG8 A;  2CP3 A;  3MET A;  1Q81 R;  2L2P A;  5D6X A;  1M1G A;  1YCS B;  5HK3 A;  4RTU A;  3JB9 G;  5LJ5 h;  4DEY A;  2MI6 A;  1NZ9 A;  2QGF B;  1WQ7 A;  4XQ3 A;  4M75 F;  3JSC A;  3VYG A;  1Q81 C;  2W0Z A;  4C92 G;  1WHL A;  4RMO A;  3JCM W;  3OB9 A;  4PJM A;  1RI0 A;  3CCQ Q;  2JS0 A;  4M7A B;  1H64 1;  1E6H A;  2E1H A;  1D1A A;  2X4Y A;  1ZA2 B;  3CCR A;  1LNX A; 
#chains in the Genus database with same CATH homology
 2C0O A;  1WDX A;  2DYB A;  2DVJ A;  2DNU A;  1SHF A;  2FRY A;  1JQQ A;  2DF6 A;  2C0I A;  5I11 A;  4HVU A;  3NPF A;  2VWF A;  2HCK A;  1QKX A;  1PHT A;  2ED1 A;  4CC7 A;  2EYY A;  3PE0 A;  1ZSG A;  2X3X D;  2CT3 A;  2KRO A;  1OPL A;  2J05 A;  2LP5 A;  3THK A;  4D8K A;  1WA7 A;  1Y0M A;  2DRM A;  2EVR A;  1Y57 A;  4RTV A;  3GBQ A;  2V1R A;  4HVV A;  1UE9 A;  3M0T A;  2FG0 A;  1H3H A;  1VYU A;  4CC3 A;  3I35 A;  1W1F A;  1VA7 A;  4K11 A;  4HVW A;  3VS7 A;  2RF0 A;  2K9G A;  1NYG A;  3SEM A;  2BTT A;  2NWM A;  4IIM A;  1B07 A;  1RI9 A;  2K79 A;  4ORZ A;  1FMK A;  1ABO A;  1H92 A;  2KRM A;  1G83 A;  1GCP A;  1M3B A;  2W10 A;  1GFC A;  3SHW A;  2ROL A;  3M0S A;  4CC2 A;  3H0F A;  1JXO A;  2PZ1 A;  2YUO A;  1UEC A;  1UDL A;  3M0U A;  2JTE A;  1WXT A;  4J9F A;  2EGE A;  2EPD A;  2L3Q A;  1YN8 A;  2JM9 A;  2KT1 A;  1MV3 A;  2VKN A;  2O2O A;  1NLP C;  4J9C A;  2O9S A;  3REB B;  3ULR B;  1PRL C;  1WLP B;  2F2X A;  1SRM A;  1X27 A;  2D1X A;  3KFV A;  4D8D A;  2DRK A;  4LUE A;  1ZUY A;  2I0N A;  2J6F A;  4AFU C;  1AWW A;  2LQW A;  1X43 A;  2KE9 A;  2CH4 W;  2KT8 A;  2K6D A;  1G2B A;  2EQI A;  1SEM A;  5IHK A;  1CSK A;  2F2W A;  2EGC A;  3A98 A;  2E5K A;  1VYT A;  5GJW B;  3VS4 A;  2CT4 A;  2DA9 A;  5FWB A;  5L23 A;  4HXJ A;  2KEA A;  3VS6 A;  2KYM A;  1SHG A;  2LJ3 A;  1E7O A;  3RBB B;  1W70 A;  1QWE A;  2ABL A;  2EW3 A;  2D8J A;  4AFZ C;  1Z9Q A;  3ZL7 C;  1RUW A;  2EKH A;  2K2M A;  2KXD A;  2EGA A;  4X1V A;  3PVQ A;  2IIM A;  2SEM A;  2GTO A;  1Z9Z A;  4AFQ C;  3U23 A;  2EBP A;  1CKA A;  2RQR A;  1ZUK A;  1AZE A;  1AVZ C;  4M4Z A;  2YUN A;  1M3C A;  1SPK A;  3UA7 A;  2D8H A;  3TSW A;  4ZNX A;  1MUZ A;  1WYX A;  5FWC A;  1TG0 A;  2DLP A;  4Z89 A;  1UHC A;  2PNI A;  2AZV A;  4AG1 C;  4J9B A;  4LUD A;  1U3O A;  2KXC A;  4OMN A;  2AZS A;  1UHF A;  2J7I A;  2ENM A;  1KJW A;  1N5Z A;  2BZY A;  4J9I A;  4JPB W;  1RLP C;  3I9Q A;  4OMO A;  1YWO A;  2YT6 A;  2ED0 A;  2C0T A;  4RTW A;  3R6N A;  1T3L A;  4J9H A;  1W6X A;  3O5Z A;  1PNJ A;  1U06 A;  3H41 A;  1OEB A;  2FPF A;  4R0K A;  4Z88 A;  1JO8 A;  1GBR A;  2LX7 A;  4WCI A;  2CSI A;  1M3A A;  3I5S A;  2DE0 X;  2YSQ A;  2AK5 A;  1GFD A;  2GNC A;  3EG0 A;  2GBQ A;  4JZ4 A;  3C0C A;  1T0J A;  1X2Q A;  1I07 A;  3M0R A;  1U5S A;  2RNA A;  1NM7 A;  2GQI A;  1UGV A;  4CC4 B;  2GGR A;  1UG1 A;  3EG2 A;  1WI7 A;  5IHN A;  1X2K A;  1YWP A;  2L3P A;  1JEG A;  1UUE A;  5FW9 A;  2V1Q A;  1AD5 A;  2KNB B;  1GRI A;  4IIO A;  3VS0 A;  2DM1 A;  1PRM C;  1S1N A;  1QKW A;  2AKK A;  2DMO A;  2CDT A;  2D0N A;  4RTY A;  1K4U S;  1TUC A;  1K9A A;  1OOT A;  1V1C A;  3H0H A;  3IQL A;  4J9G A;  2LQN A;  2A36 A;  1B3Q A;  1JXM A;  1WFW A;  3VRY A;  1ZX6 A;  2YUQ A;  3TVT A;  3UAT A;  4F14 A;  2CUB A;  1WX6 A;  2J06 A;  2BZX A;  1UTI A;  1J3T A;  1ZBJ A;  3UA6 A;  2RMO A;  3CQT A;  4A63 B;  2CRE A;  1BB9 A;  2CSQ A;  2K3B A;  1ZLM A;  4JJB A;  2KRN A;  1KSW A;  2G6F X;  1UJY A;  1NEB A;  3EGU A;  2M51 A;  3LH5 A;  4RTT A;  1M30 A;  2A08 A;  1ARK A;  3JV3 A;  1EFN A;  4JJD A;  4JZ3 A;  1K76 A;  1MV0 B;  2OI3 A;  1I0C A;  2FPD A;  2F2V A;  2JW4 A;  5IHI A;  1JU5 C;  2LCS A;  4OML A;  3TSZ A;  4F17 A;  2DX1 A;  4RTZ A;  1SSH A;  2L0A A;  4J9D A;  1HD3 A;  1A0N B;  3VS5 A;  1NYF A;  2A37 A;  4ESR A;  2YUP A;  4OMQ A;  1NLO C;  3EHR A;  5HCK A;  2DL4 A;  2J6O A;  2QDL A;  1E6G A;  2J6K A;  4E6R A;  3FJ5 A;  1K1Z A;  4AG2 C;  2RN8 A;  4GBQ A;  1PKS A;  2MOX A;  2KRS A;  1K0S A;  4Y92 A;  2O9V A;  1GCQ C;  1K0X A;  1RLQ C;  2XMF A;  2PTK A;  2H8H A;  2ECZ A;  2SRC A;  3M0P A;  1AWJ A;  1X6G A;  1IO6 A;  2EYX A;  4LN2 A;  2FRW A;  2HDA A;  2DJQ A;  2DL5 A;  2LZ6 B;  2ESW A;  3VS3 A;  2RQU A;  3EG1 A;  2B86 A;  1GL5 A;  2ROT A;  2M0Y A;  2L3S A;  4OMP A;  3REA B;  1SRL A;  3VS2 A;  1FYN A;  2HSP A;  2DBK A;  2CH4 A;  4LNP A;  1CKB A;  2MCN A;  1X6B A;  4RUG A;  4LE9 A;  1BK2 A;  2LNH B;  2A28 A;  5IXB A;  2DL8 A;  2HBW A;  2RPN A;  5I22 A;  5IH2 A;  2CUD A;  4GLM A;  2KBT A;  2FO0 A;  1BU1 A;  4F16 A;  2OAW A;  2VVK A;  1AEY A;  1QWF A;  2FEI A;  3H0I A;  2JS2 A;  2EYZ A;  1GCQ A;  1WIE A;  2DL3 A;  1GBQ A;  1XOV A;  1BBZ A;  3EHQ A;  4QT7 A;  1WXU A;  2K7A A;  2BZ8 A;  3I5R A;  4KRT A;  2KR3 A;  1HJD A;  1T3S A;  2P4R A;  2X3W D;  2JMA A;  2MIO A;  1AZG B;  1WXB A;  2JMC A;  3RNJ A;  2O31 A;  2EYW A;  2JM8 A;  2LJ1 A;  2DL7 A;  1QLY A;  2JT4 A;  2JXB A;  1KFZ A;  3M0Q A;  1TUD A;  2RQW A;  3QWY A;  1OV3 A;  4DEX A;  1LCK A;  2O88 A;  1VYV A;  3PVL A;  1H8K A;  3VRZ A;  1QCF A;  1KIK A;  4J9E A;  5ECA A;  1AOJ A;  3NGP A;  2LMJ A;  1OPK A;  2KYB A;  1T0H A;  4Z8A A;  2RQV A;  4HCK A;  1PKT A;  1I1J A;  1AWO A;  1ABQ A;  2GTJ A;  2LJ0 A;  5EC7 A;  1PWT A;  2YDL A;  3UF4 A;  2RQT A;  4JJC A;  4EIK A;  1AWX A;  1ZUU A;  1NG2 A;  4OMM A;  1YP5 A;  1M8M A;  3NMZ C;  4RTX A;  2L2P A;  1YCS B;  4RTU A;  5GJV B;  4AFS C;  4DEY A;  3VS1 A;  2NUZ A;  1X69 A;  4FSS A;  1UFF A;  2AKL A;  1NEG A;  5IXF A;  1M27 C;  2DIL A;  1YNZ A;  2OJ2 A;  2W0Z A;  1UJ0 A;  2KGT A;  2DBM A;  1HSQ A;  2JS0 A;  1E6H A;  2HEQ A;  3EG3 A;  2FPE A;  3QWX X;  3NHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...