5GJVB

Structure of the mammalian voltage-gated calcium channel cav1.1 complex at near atomic resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
100
structure length
100
Chain Sequence
QGPHMALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVEGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1S
publication title Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 24
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2016-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5gjvB00
2J6OA 3RNJA 1AWWA 2EKHA 4KRTA 2J6KA 4ZNXA 1J3TA 3UA6A 2DL8A 1JXOA 2RQRA 2KRNA 4JZ4A 3FJ5A 2ROTA 2KYBA 2JTEA 2LX7A 2O31A 2FG0A 1E7OA 1GFDA 1YP5A 1OPKA 2DVJA 5I22A 2V1RA 4A63B 1SPKA 1PHTA 4RTUA 3NMZC 4HVVA 1ZBJA 2BZXA 1K0SA 2DMOA 2LCSA 1EFNA 3SHWA 4J9CA 2F2VA 2AZVA 3I5SA 4OMOA 3H0FA 1ZSGA 1Z9ZA 2FPEA 2VWFA 1WXTA 1HJDA 4CC4B 1JQQA 1GRIA 1GBQA 2OJ2A 2CUDA 1TUCA 3EGUA 2LJ0A 1LCKA 2LZ6B 1KJWA 2DNUA 2KXDA 2PNIA 2DLPA 2YDLA 1X27A 1AWXA 2GTOA 2AK5A 2D8HA 2L2PA 2LMJA 4RTXA 2FPDA 1JU5C 2HDAA 2I0NA 2RQWA 2CH4W 3VRYA 2KXCA 4RTTA 2AZSA 1W70A 2DBKA 1T0JA 3VS4A 2O9SA 4AFSC 1K4US 1T3LA 1NEGA 2M51A 1XOVA 2P4RA 3VS2A 1NLPC 2CSQA 2JW4A 1WX6A 2F2XA 4IIMA 4J9HA 2EYXA 2J06A 2KE9A 1PRMC 2QDLA 1UHFA 1CKAA 3LH5A 3TSZA 1AVZC 2KBTA 2K6DA 2W0ZA 4CC2A 3I35A 1QWEA 1PRLC 2XMFA 4RTYA 2DL7A 2AKKA 1WDXA 1TG0A 1UUEA 3QWYA 4OMQA 2DL3A 2HCKA 5FW9A 2A08A 1WIEA 1YNZA 2KYMA 3EHQA 2DJQA 1NEBA 2RQVA 3RBBB 3VS1A 1B3QA 2HSPA 1WI7A 4JZ3A 2NUZA 4E6RA 1X6BA 1MV3A 1AWJA 4QT7A 1AWOA 5GJVB 1E6GA 4LUDA 1KFZA 2LQNA 3IQLA 2KR3A 1RUWA 1S1NA 2GTJA 1OV3A 2EW3A 4ORZA 2RQTA 4HXJA 1M27C 2DE0X 5IHKA 1QCFA 2LP5A 4HVWA 1M30A 1H92A 1K0XA 2DYBA 3UF4A 1ZLMA 4OMPA 5FWBA 4JJCA 3QWXX 4AG1C 2DX1A 3O5ZA 5I11A 5FWCA 1PKSA 2A36A 3M0PA 2CT4A 1K76A 1TUDA 4CC3A 2C0IA 2HEQA 1KIKA 1SRLA 2KT8A 2ABLA 1UECA 5IHIA 2EGEA 3REBB 3EHRA 1HD3A 4J9IA 2MCNA 3EG1A 2D0NA 4DEXA 2K9GA 1T0HA 2J6FA 1UTIA 4F14A 1GFCA 2DL4A 2RF0A 1NM7A 2LJ1A 1NYFA 2VVKA 2DBMA 2RMOA 2YUOA 2ESWA 3JV3A 4R0KA 2EYYA 1M8MA 2D1XA 1AD5A 1KSWA 2JMAA 2A28A 1HSQA 1PNJA 5IHNA 2PZ1A 2GQIA 3NHNA 2BZ8A 4LE9A 2BTTA 1MUZA 3M0TA 1UGVA 2JXBA 2GBQA 1SEMA 2O88A 2FRYA 1FYNA 1UDLA 1WLPB 2DRKA 1PWTA 2ENMA 2YUPA 5GJWB 1QWFA 4FSSA 1X43A 3TSWA 1AZEA 2EBPA 2JMCA 2M0YA 2DRMA 2KT1A 4AFQC 2EVRA 3EG3A 3VS3A 2YUNA 2AKLA 2A37A 2MOXA 5HCKA 1RLPC 1PKTA 4J9BA 2J7IA 1I07A 2GNCA 2GGRA 1BB9A 2YSQA 3TVTA 1U06A 3VS6A 1ZUUA 4OMMA 1U3OA 4LNPA 2L3QA 4LN2A 5IXFA 2LJ3A 2YT6A 1VYUA 2L0AA 1OOTA 2CSIA 1V1CA 4X1VA 2FPFA 4F16A 4Y92A 1WXBA 1U5SA 2MIOA 3SEMA 3PVLA 2C0OA 4M4ZA 2C0TA 3VRZA 2B86A 2JM9A 1CKBA 1W6XA 1IO6A 1OEBA 2K3BA 1I1JA 3CQTA 2SEMA 2ED1A 1JXMA 1UG1A 4J9GA 1NG2A 4F17A 5L23A 1NLOC 1RLQC 1NYGA 1Y57A 2ROLA 1E6HA 1GCQA 4GLMA 3EG2A 2FRWA 1AEYA 2HBWA 3UATA 2J05A 1ABOA 2RN8A 3THKA 1K9AA 3NGPA 1X2QA 2CUBA 1FMKA 1N5ZA 3GBQA 5EC7A 2O9VA 4DEYA 2SRCA 4RTWA 4ESRA 1H3HA 3C0CA 2K7AA 1ABQA 3KFVA 2ED0A 2V1QA 4WCIA 2BZYA 1UFFA 2K2MA 2LQWA 1G2BA 2KEAA 1UHCA 1AZGB 2PTKA 1K1ZA 5IH2A 2W10A 1ZX6A 4IIOA 1UJ0A 2G6FX 1SSHA 1SHFA 4J9EA 2NWMA 4K11A 4D8DA 4AFZC 4LUEA 3M0UA 2CREA 2EGCA 1UJYA 1CSKA 1B07A 5ECAA 3VS7A 2KROA 3I9QA 1AOJA 2JS0A 1BBZA 2KRMA 4J9DA 4AG2C 2X3XD 1SRMA 2FO0A 2OAWA 1MV0B 2LNHB 2KNBB 2KRSA 4JPBW 1I0CA 1W1FA 1GCQC 2EYWA 2JS2A 3UA7A 5IXBA 2YUQA 2DILA 4CC7A 3H41A 1VYVA 1M3BA 4GBQA 2DM1A 1BK2A 3M0RA 3NPFA 1A0NB 1M3AA 2CT3A 2CDTA 1RI9A 2DA9A 3U23A 2KGTA 2RQUA 3ZL7C 4HVUA 4D8KA 3M0QA 4Z88A 1ARKA 1GBRA 1WXUA 2JT4A 4RTVA 2EPDA 2EQIA 1YWOA 2IIMA 1T3SA 2OI3A 2DF6A 4J9FA 3REAB 3H0HA 2ECZA 3EG0A 1YWPA 2F2WA 1Z9QA 1QKWA 2DL5A 4AFUC 2EGAA 1VYTA 3PVQA 1ZUKA 1G83A 3VS5A 1GL5A 4EIKA 2X3WD 4JJDA 1X2KA 1ZUYA 4HCKA 1WYXA 1X6GA 1QLYA 4OMNA 1GCPA 1VA7A 2RPNA 1SHGA 3R6NA 1Y0MA 1WFWA 1YCSB 1YN8A 1M3CA 4RTZA 3VS0A 2D8JA 4RUGA 2CH4A 2EYZA 2L3SA 4Z89A 3M0SA 1BU1A 2O2OA 3H0IA 1X69A 2JM8A 3ULRB 4OMLA 1JO8A 2FEIA 1WA7A 1H8KA 4Z8AA 2RNAA 3A98A 1QKXA 1OPLA 3PE0A 4JJBA 3I5RA 2L3PA 2VKNA 2E5KA 1JEGA 1UE9A 2H8HA 2K79A
chains in the Genus database with same CATH superfamily
3OW2P 1IXDA 2EKHA 3CCVQ 4UC4A 1J3TA 3QUIA 4JJNK 1JXOA 2QG9B 3OYJA 2ROTA 2KYBA 5FROA 1FMVA 2O31A 1E7OA 3PGGA 1UGQB 4CRIA 3JCMW 2V1RA 5KH6A 5GAOl 3RMQA 1B34B 4VUBA 2LC4A 4C0DB 2JOYA 1ZBJA 1EIFA 2LCSA 2P84A 4J9CA 4PJJA 1Q7YR 2F2VA 4HKEA 4OF1A 4DBFA 5M9OA 8AT1B 4PJOA 2DTIA 5KCOA 1VQ4Q 1ZSGA 3CMEA 4A4GA 1WXTA 1JQQA 2P0PA 3CC4T 1PCXA 1LCKA 2LZ6B 4J8OA 4J83A 1R0BG 2YDLA 2D8HA 4RTXA 1YJ9Q 2XDDA 2RQWA 4M77D 2KXCA 3DLLA 4ZN1A 1I5LA 4RTTA 4IKFA 3JCMQ 3CC2Q 2DBKA 3QZ9B 1YIJT 1BIAA 1NEGA 1MMNA 2BE9B 1Y96B 2EJFA 1YJNT 1WJRA 4C0ZA 2JW4A 2F2XA 3N5BB 2QA4T 2KE9A 2QDLA 2JZ2A 4A4FA 4ZTJA 1AVZC 2XKOC 4M7DG 2X4JA 1WHMA 1QWEA 2CS7A 1D1AA 1WDXA 2DERA 4OMQA 1PD0A 2E12A 1UGPB 3I55T 2A08A 1WIEA 1VQNA 3EHQA 1NEBA 2YRCA 2RQVA 1RABB 4C0FA 4JZ3A 4M78G 5CIUA 1AWJA 1XJWB 1YJNA 4LUDA 5GANg 2KR3A 1LOJA 3V7SA 3GOXA 2JUFA 2QA4A 2GTJA 1OV3A 1NPPA 2KVQG 2RQTA 3O8VA 4M7AB 4J7FA 1QVPA 2DE0X 3SD4A 1RAIB 3LGFA 4BE2A 1QVFP 2COWA 4JLIA 5FWBA 3QWXX 3E9FA 5D7UA 1U8RA 2DX1A 3OS5A 3I55A 1VQ8A 2X4XA 2HBPA 2K3XA 4LDYA 5KYWB 1XTDA 2CP0A 2A36A 3JB9H 1TUDA 1QW1A 1UGRB 4QVZA 4P5NA 2C0IA 2GCXA 1M9SA 2HEQA 3M54A 5KYXB 2RK1A 1K8AC 2ABLA 2KT8A 3REBB 3MEVA 3CCSA 3OYAA 3EHRA 1FMWA 2KMTA 1HD3A 3R6OA 2MCNA 2K5IA 1VQPA 2HL5C 3HRTA 3CC7Q 2C06A 2K9GA 2J6FA 3VJPA 4C8QA 3LX7A 1Q86C 3FDRA 2DBMA 3TU4K 4XTWA 2A7YA 2RJEA 2FZCB 3A5ZB 3G71T 3JV3A 1M8MA 1AD5A 2JMAA 1C1AA 5KYNA 2A28A 1HSQA 2BZ8A 4LE9A 1MUZA 2JXBA 2O88A 1FYNA 1WLPB 1TUGB 1VQMQ 4M75D 2EKOA 2YUPA 4ANJA 1QWFA 3JB9G 2EBPA 2JMCA 2DRMA 3MEWA 3EG9B 1TWBA 4IUVA 4NOYA 3BDLA 4LDVA 2PUOB 3MHXA 2AHJB 2OTLQ 1K8AU 2DEUA 4MMKA 1OX9A 1ZHIA 4IUPA 1X6OA 3G6ET 1PC0A 1VQLQ 3LYIA 1ZUUA 4OMMA 2LJ3A 3CEYA 1VYUA 3L2UA 3A8GB 3KXTA 3QJYA 1RAGB 1Q86U 4DA4A 3SEMA 3V8JA 3L2ZA 5LJ3j 2XDBA 2C0TA 4OB2B 5FU7B 3G4ST 2MF2A 5CQYA 3OW2S 1B34A 1QP3A 2K3BA 4Z02A 2QEXT 3OYMA 1I1JA 1TSFA 4QKUA 3G6EA 1MNEA 3PIOA 1UG1A 4ZGJB 5GANh 4BUGA 1NG2A 1K8AR 3OYLA 1YHQQ 1C6VX 4M7DD 2HBWA 4N0AC 2J05A 1YI2A 2LX9A 3NGPA 3LWHA 2MMPA 5A0LA 3G4SQ 2QQ9A 2SRCA 4FCYA 2L8DA 4A54A 5HKCA 5KYYB 4YTLA 2LVMA 2K7AA 1ABQA 1NPRA 1S72T 2BZYA 2DAQA 4M78D 1UFFA 4IURA 1G2BA 3CCLT 1AZGB 3EFRA 1WHLA 2QEXA 3T9NA 3CCJQ 2MI6A 5IH2A 2V8IA 2DD4A 2W10A 1OX8A 1OZ3A 3I56Q 4IIOA 1KHCA 3CD6Q 1RL2A 1UJ0A 3MP1A 1YCYA 1SSHA 4ELZC 2FVUA 2NWMA 2QGFB 4MDXA 4KULA 2EJGA 1UJYA 2QQRA 2V8KA 4J9DA 4MZPA 1OU8A 2K57A 5LL6S 3SB2A 3CBOA 5FU6C 1QCNA 1S72A 4M75A 1GCQC 2RH2A 2JS2A 4J6WA 2YUQA 4C92C 2XHCA 4KT0E 3CCLA 2QDYB 3QKJA 2YHTA 2HKNA 1A0NB 3U23A 1KHIA 2WSEE 2KGTA 3ZL7C 4EMKA 5EG2A 1OU9A 2VASA 1QVFA 4Z88A 1BI1A 4PJOB 3JRZA 4V2SA 2EPDA 1M1FA 3A8LB 1N27A 2IIMA 5CKBA 1T3SA 1Y71A 1VQ9T 2DF6A 3H0HA 1I4K1 2ECZA 3H9NA 3OSVA 1YWPA 1VQ6T 1N9SA 1ZUKA 3META 4CI0C 1GL5A 3EAEA 4EIKA 2X3WD 2OX7A 2GQVA 4HCKA 3QZ5B 1QLYA 2L3RA 1GCPA 1FXXA 1TOVA 4QQ6A 3MO8A 1Y7XA 1WFWA 2YWWA 4M77C 3JB9J 2P4TA 3QPHA 3EH2A 4RUGA 1SG5A 2CH4A 4BDYA 3E19A 1VQ6Q 2EYZA 1LJOA 7AT1B 3QDRB 4Z89A 1MMGA 4M7AF 1QVFS 3H0IA 1LPLA 5GAN6 2RNAA 3A98A 2RHIA 2VKNA 2FZGB 2H3EB 3ER0A 4A4KA 1OQKA 2K79A 1R77A 4KRTA 2J6KA 3MPUB 4ZGEB 1VQ7Q 3JCMP 4ZNXA 3CPWP 3QYHB 2JVVA 5GAMj 2RQRA 3KUFA 1YITT 3HFOA 5C6SA 5LJ3g 4JZ4A 4C5HA 2VGNA 2JTEA 1N9RA 1YP5A 1OPKA 3BY7A 4A63B 1PHTA 3OYHA 3EG9A 4HVVA 3Q1JA 5HY6A 4II1A 2DMOA 3P8HA 4E7ZA 2RJCA 2RM4A 5FU6B 3CMAT 3I5SA 4NS5A 3WVEB 3OYBA 4KH1B 1TU0B 2VWFA 2L89A 3JCMe 1HJDA 5C0MA 1YITA 3UDCA 1TUCA 2LDMA 1KJWA 2DNUA 2DLPA 2XK0A 3RESA 1VQKQ 1W2BP 2L2PA 2FPDA 3OYYA 4F7UG 2I0NA 3JCMf 3QIIA 1H3ZA 3CMAQ 2OTJT 1BYMA 3JCMd 1W70A 3E1SA 5KE2A 4C8QB 4M7AE 1XOVA 2P4RA 3ASKA 2NUPA 4OB1B 1ZA2B 1WX6A 4IIMA 5CK9A 1PRMC 2LQKA 1CKAA 3NTKA 3H8ZA 3CCQT 2K6DA 1ZA1B 4CC2A 2DXCA 4BI3A 2CP3A 1PRLC 3L2QA 2DL7A 5KYYA 2MAMA 3CCVT 1TG0A 1HK9A 1UUEA 3DB4A 2R5AA 4M75C 2HQEA 1AT1B 3QWYA 8ATCB 2EJ9A 1YNZA 3H6ZA 1M8VA 2EWNA 2VV5A 1B3QA 4JLGA 1WI7A 4E6RA 1AWOA 1RADB 1LVKA 1E6GA 4B6MA 1JB0E 3CCQQ 1O9SA 2FL7A 1KG1A 4AT1B 2VB6A 1VIFA 2XU8A 2BIVA 3QJ6A 4HXJA 3HSBA 3JCMc 1M90C 2BE7D 1YBYA 2H3JA 5IHKA 1H92A 1K0XA 1U1SA 4L6V5 2E4HA 1VQ4T 3TCJA 2DXBA 1KC8R 2PQWA 4C92D 2K3YA 2M9UA 4E7IA 5FWCA 1PKSA 5LJ5e 3FB9A 5LJ3h 2EQKA 4CC3A 1D0XA 4BE0A 1KK7A 5GMKe 1UECA 1WHHA 3GLXA 5GANf 3OYKA 1YJ9T 1UB4A 2OAUA 1XNIA 2E5QA 1BKBA 3EG1A 2D0NA 1G3YA 4M7DC 5LJ5f 3CC2T 1AHJB 1GFCA 5LJ5d 2ZGWA 3JSCA 5J26A 1NJIC 3RKXA 2E70A 2YUOA 5GAMg 3CMEQ 1TTHB 5CVIA 3S6WA 4J6YA 2EYYA 3PFSA 2HD0A 1FWZA 2PZ1A 1M90U 3GIBA 4M78C 3NHNA 4XU2A 4FYVB 3M0TA 4OGEA 1UGVA 2DTHA 3V8KA 3PIPA 2GBQA 4BY6B 1U1TA 1PWTA 2E6NA 4PJOF 1WQ7A 3OQ5A 1YJ9A 1QQJA 4XTZA 1QCOA 1ZSZC 1M2VA 2M0YA 2ZPFB 2PUKB 5GMKl 4AFQC 4N0AA 3MCAB 2EVRA 4M7AG 3EG3A 2HQHA 2YUNA 2A37A 3MJXA 4FIBA 4LDUA 3CC4A 4NL2A 1BB9A 4M75B 2ZPGB 1U06A 1KD1C 4LDXA 1U3OA 2CYZB 2EFIA 4LNPA 2KK4A 4JS4A 2HNIA 4MDWA 1M2OA 2CZ6B 5IN1A 3OMGA 2FPFA 1NJIU 1M90R 2PVGB 2WACA 4F16A 3X20B 3OBWA 4PJLA 2VXFA 3PVLA 4KGVB 2C0OA 4M4ZA 3JCMX 1YIJA 4EMKB 2E1HA 4OB0B 2KY9A 2L5QA 2JM9A 2HL3A 2RO0A 1WNLA 3QSUA 4DBQA 3CPWS 2BUDA 1W4SA 2ED1A 1JXMA 2K5FA 4F17A 3OYEA 5GAN3 2LCCA 1Y57A 1NYGA 1Y07A 1D0YA 2QQAA 1E6HA 1GCQA 2M02A 3QO3A 4C92A 4B9WA 2RN8A 4MMLA 2DYIA 3CC7T 2CUBA 1N5ZA 5EC7A 2LTOA 4ESRA 4IUUA 1PSEA 4A4EA 1KD1U 2IVWA 2ED0A 1VQ8Q 2YRVA 4HCZA 2QQSA 1UHCA 4AMCA 1K1ZA 2GFAA 3D7SB 1JJ2P 4M7DB 4PJOE 1G3WA 2ZPBB 2KSSA 1VQMT 4C0GA 4L5GA 2G6FX 2XG8D 9ATCB 1SHFA 2X9HA 2NUTA 5HK3A 2QYZA 2HMAA 3QBYA 3QYGB 4K11A 1VQPQ 3M0UA 2EGCA 2KQWA 3CC7A 5ECAA 1AOJA 1KQSP 5GAOn 2KRMA 4AG2C 2X35A 2OTLT 1R8OB 2FO0A 3OSSC 4PFOA 2EQMA 1MV0B 4M77A 2KRSA 2CGHA 5GAMh 1VQLT 1I0CA 5DLQE 1D3BB 5IXBA 2DILA 4CC7A 5CQXA 3H41A 2M1HA 4X9DA 1MMDA 4E7JA 1MNDA 1VYVA 4KBMB 3E9GA 4GBQA 5J3BA 4C8QF 2QTXA 3QXEB 3OW2A 2YXYA 3NPFA 1PD1A 5AYFA 4KUDK 4D6WA 1VQMA 2CT3A 3M4YA 4HA8A 3LWIA 3M0QA 1ARKA 3G71A 1GBRA 2JT4A 1RAFB 4RTVA 1HXDA 3REAB 4J9FA 2OTLA 2F2WA 4F7UA 4JS5A 3PVQA 2E65A 3LLRA 3HRSA 2YLCA 3VYGA 1YHQT 1X6GA 3QHSA 2HZYA 3OMCA 2LRQA 2FHDA 1SHGA 3SWNC 4E7HA 4DOWA 3V7RA 3GPLA 3UPUA 3VS0A 3JCMb 2RD1A 4KH0B 3CCEQ 4RCBA 4DBHA 3RERA 2NUPB 4QVDA 4N4IA 2ZZDA 1Q95G 3CCJT 1H8KA 3EFOA 3FC3A 4JJBA 3I5RA 2E5KA 3I56T 1KQ1A 3CD6T 3C4SA 2JNGA 3RNJA 1YHQA 1AWWA 3S3OA 1YI2Q 4QQGA 2DL8A 1Q86R 4L59A 3G4SA 2KRNA 4J5YA 5KYUA 4XTVA 2DZCA 2LX7A 1GFDA 2B8AA 2DVJA 1VQOT 4HCCA 4PJOG 4C8QE 2RHYA 1EX4A 4JRQA 3ZFJA 3CCJA 2JTMA 3NMZC 4ZTFA 2BZXA 1K0SA 3I56A 2HAXA 1EFNA 3CD6A 4BI4A 1D1BA 3CCRT 2AZVA 4M77E 2FPEA 1IB8A 3BDUA 1UEBA 1PG5B 4JRIA 1VIEA 4B9XA 1GBQA 2OJ2A 2CUDA 1VQOQ 4OGCA 2LJ0A 1G5VA 5LJ3f 3X26B 3CCMQ 2QGGA 3A8OB 2DFUA 3WXMB 2DETA 1X27A 2D6FA 3PNWC 2AK5A 2LMJA 3OS1A 1N6AA 2XD0A 2O4XA 3CCRQ 2CH4W 3VRYA 3VUZA 3E2UA 2Y4XA 3VS4A 3EGXA 4M75F 2O9SA 1K4US 1T3LA 3CBMA 3CXCP 5GAN5 2DD5A 1NLPC 4J9HA 3DKMA 3OS0A 1XQHA 2J06A 1LNXA 2P0QA 4XU1A 1UGSB 4WTOB 3TSZA 3SWNB 2LQ8A 5KE3A 2W0ZA 1WZOA 1IGUA 5KCHA 5I21A 3JB9D 5D6XA 1VQ7T 3FRNA 3M57A 4LD9K 2DL3A 1M2VB 5FW9A 2VC8A 1FX7A 2DJQA 1G3TA 4Y28E 3RBBB 2HSPA 3VS1A 5A0GA 5GAN7 3TEEA 3OS2A 3MKDA 3JCMV 4M7DA 3F70A 1X6BA 4KGZB 1VQ9A 1BCMA 1MV3A 2K5LA 4QT7A 1VQ6A 3GNFB 2RJFA 1RUWA 3L2VA 3HPWA 1S1NA 2AIRB 2EW3A 3J81E 2HKQB 1D1CA 1OYXA 4M78A 1M27C 2LP5A 3LH0A 5DLOA 1M30A 5GAOm 4IUQA 2DYBA 1VQ7A 1OULA 1K9MC 4M7DF 1D3BA 1ZSZA 3O5ZA 2RB6A 2CT4A 4R55A 4FT4A 1YJWQ 1VQ5Q 4C8QG 2V8JA 5CAIA 1VQKT 3S3MA 1SRLA 4GY5A 2EGEA 4M78F 1QMCA 4J6XA 4EMGA 4J9IA 1BCOA 2LT1A 4DEXA 2GF7A 4C92B 4M75E 1T0HA 4DOVA 4F14A 2RF0A 3BE3A 1NM7A 2LJ1A 2VVKA 2ESWA 1EZZB 2DEQA 2A0FB 4RKUE 3OYFA 3A8HB 1PNJA 5IHNA 2GQIA 2BTTA 4RG8A 1SEMA 1O75A 1VQKA 2DRKA 1UDLA 1HYOA 5I2MA 1K9MU 1IHWA 2NUTB 3CMAA 2CZ1B 2V26A 4FYWB 1Q7YC 1WHKA 3LGLA 2AKLA 4PJMA 3FIFA 5HCKA 2F69A 1IRXA 1RLPC 1PKTA 3SFMA 4J9BA 2J7IA 2KI7A 3UT1A 4M77B 3VS6A 4A4HA 4GLKA 4BE1A 2RI5A 5IXFA 2YT6A 3M4GA 1V1CA 3OA6A 5LJ5j 4X1VA 3BFMA 1X01A 4Y92A 2OTJA 3RKWA 2DXUA 4M7DE 4XU3A 3MEAA 5GMKj 1SKUB 3ME9A 1B7TA 4FW2A 3CCUQ 3VRZA 1K9MR 1C0MA 2PVOB 2B86A 1WPYA 1W6XA 1RAAB 2K2VA 3RUXA 3VYHB 4EMHA 3CQTA 3BW1A 2SEMA 3M59A 3JB9I 4M78E 5FRMA 3CCQA 4F7UB 3KBGA 2MK5A 2X4WA 1NLOC 1RLQC 2DO3A 3HP9A 1Q7YU 3CCVA 5GAN4 1AEYA 5GANe 3L2WA 1X2QA 4PJNA 3URGA 1NE8A 2O9VA 4DEYA 5CKFA 3G7ZA 3CMET 2WSFE 3KFVA 2V1QA 4M7AC 1IZ6A 2K2MA 1WJSA 2KEAA 3CXCA 2PTKA 4OP0A 5GANd 1TS9A 3NTIA 3EFOB 1ZX6A 3HKSA 1BIBA 4Q5WA 3A1PA 3JCMg 4J9EA 2P0KA 4M75G 4D8DA 4AFZC 5GAOp 1VQ4A 4E7LA 1B07A 2KROA 3M5AA 4PFZA 1SRMA 2LCLA 3SWNA 4DBRA 3PMIA 2KNBB 3SDZA 5KYUB 4O5VA 1W1FA 2MWOA 3OB9A 2ZPIB 4XAXB 3EH1A 4E47A 1D0ZA 4C8QD 1SF9A 4Y91A 3CXCS 2DM1A 1BK2A 3JAME 3CC2A 3CPWA 1RI9A 3GF5A 1WHJA 4HVUA 2WSCE 2IPOB 2QQBA 1VQNT 2XIDA 1SSFA 2QI2A 1GXIE 3M58A 3EG0A 4OB3B 3CC4Q 3AT1B 2CP2A 1Z9QA 3J80E 3RKYA 1QKWA 4PLIA 2DL5A 2FZKB 2EGAA 4AFUC 1VYTA 5GAN2 1ACMB 1RAHB 1H641 1ZUYA 1I8FA 4OMNA 3V7CA 3INZA 1VA7A 1JBMA 3AHUA 2RPNA 3R6NA 2CKKA 2O4XB 1VQNQ 1Y0MA 3MEUA 3QDFA 1K73C 5A2QE 5HK0A 2EAYA 1M3CA 4QW2A 1YIJQ 5GMKi 3UWNA 3CBPA 3EGXB 4BD3A 4F04B 1VQ8T 4PK4A 2Y90A 2KAFA 1YJNQ 3M0SA 1BU1A 2O2OA 4FU6A 1X69A 2GFUA 2QA4Q 1R0CB 2R57A 3LW5E 3OYGA 1JO8A 2FEIA 1WA7A 4Z8AA 1TXQA 1W2BA 1MHNA 1OPLA 3PE0A 4RG2A 4PFPA 3CCST 5FU7C 5CKEA 2J6OA 4PNOA 3FEOA 5LJ5g 3P8DA 1VQPT 3OBYA 3RR6A 3X24B 3UA6A 1NJIR 3I55Q 3FJ5A 2COYA 2DXTA 2FG0A 2BKDN 3OY9A 4LD6A 4ZGDB 5I22A 3CPFA 4BACA 4C92F 3HRUA 1RI0A 2E64A 3CCSQ 1SPKA 3OYDA 4RTUA 1K73U 1W2BS 3SHWA 4M78B 2DJZA 1QP2A 3WVDB 2JJ9A 3JCMh 2YLBA 4E7KA 2QAZA 4OMOA 3H0FA 2DK3A 1Z9ZA 1F1BB 2DZ9A 3VV0A 3EGDA 3PT9A 5CCAA 4CC4B 1GRIA 1ZSZB 3EGUA 1KD1R 2KXDA 2PNIA 3L42A 4E7SA 2DPPB 5CR2A 1AWXA 4FL6A 2GTOA 1BI2A 1MMAA 3J7AF 2RHUA 1JU5C 4C5EA 2K4YA 2HDAA 2NYSA 1Q81C 2ATCB 4A53A 2XI9A 2AZSA 1PM3A 4JRKA 2X4YA 2DVEA 4M77F 1T0JA 1K73R 4AFSC 2M51A 3CCET 3VS2A 3G71Q 2PU9B 2CSQA 2DIGA 2VYTA 1VQLA 4ELYC 2EYXA 1IGQA 2EQUA 4R56A 1M4ZA 1UHFA 5CKDA 3LH5A 4X9CA 1Q82C 4PKCC 2KBTA 4X34A 3I35A 3C94A 4PJOC 4IUTA 2XMFA 4RTYA 2AKKA 1YI2T 4FT2A 4E2FB 4M7AD 4KGXB 2HCKA 2XICA 2KYMA 4EDUA 1M1GA 4F7UF 1QVGP 2NUZA 2M16A 2HQXA 5GJVB 4C92E 3NTHA 2QASA 2G3RA 3CCEA 3G6EQ 1KFZA 4FYXB 2LQNA 3IQLA 2R58A 1Q81U 4ORZA 2EYQA 5CKHA 1ZQ1A 2EIFA 3M9QA 1QCFA 4HVWA 4PL6A 3A8MB 3UF4A 4KUIA 1ZLMA 4OMPA 4JJCA 4JUVA 2JN0A 5LJ5h 4AG1C 5I11A 2HSEB 1Q82U 2E41A 2CP6A 2ZPEB 5GMKh 2RK2A 2QEXQ 4HT8A 4BB7A 3M0PA 1K76A 3CCMT 5FRNA 1N8RC 3GNGA 1BI0A 5LJ3e 1KIKA 1M5Q1 5IHIA 4EPCA 3DLMA 3C12A 1I81A 2CZ7B 2NLUA 4RMOA 1Q81R 3TQ7P 3V8LA 3FLGA 1UTIA 2DL4A 1JRIA 2CZ0B 1NYFA 1Y96A 2RMOA 4R0KA 1S72Q 5LJ3d 2D1XA 2MWPA 1KSWA 4WF2A 5J39A 1VQOA 2EQJA 2QK0A 1IREB 3RDVA 3CCLQ 1NZ9A 4N4GA 3CCMA 4XU0A 4JDSA 1Q82R 2FRYA 2QXFA 2ENMA 3M55A 1OZ2A 5GJWB 2ZPHB 3ZEHA 2RHZA 4FSSA 1X43A 3TSWA 4DQ2A 1AZEA 2YRDA 1P92A 3M53A 3CCRA 4BI8B 3HTRA 2KT1A 4F7UE 2X51A 4TVRA 3VS3A 2LT4A 1N8RU 2MOXA 4C5GA 2A3LA 3X28B 4HT9A 4PLLA 1I07A 1JJ2A 2GNCA 4N4HA 2COZA 2GGRA 2YSQA 3TVTA 5I2SA 3QG1A 4XQ3A 4M7AA 5DY9A 2L3QA 4LN2A 3X25B 2L0AA 4C8QC 1OOTA 2CSIA 2VUBA 1I5OB 1WXBA 1U5SA 2MIOA 4XK8E 2RI2A 1M1KC 1BI3A 4FYYB 1KQSA 2MPXC 2D0QB 2F5KA 5KYWA 3OYNA 4J7IA 1ZBXA 1CKBA 4C92G 1IO6A 1OEBA 2DIQA 2D9TA 1VQ9Q 3VUBA 1YJWT 1VQ5T 1WJQA 2RHXA 5KYXA 2IG0A 3C95A 2CP5A 3PMTA 4J9GA 5D6YA 1N8RR 2QTVA 5L23A 2Z0WA 3FJPA 2ROLA 1JJ2S 3L2RA 4GLMA 3EG2A 4OMFB 2FRWA 3UATA 2RJDA 3DB3A 1ABOA 4XTUA 3THKA 4JRPA 1K9AA 1VOMA 4QQDA 1D09B 1TH7A 1RACB 1FMKA 3GBQA 4QVCA 1DJ7B 2E6ZA 4RTWA 2JTFA 3C0CA 1H3HA 2M0OA 3VKIA 3VU3C 4ATOA 1YFNA 4WCIA 1KQSS 4OVAA 1X75C 2DKGA 3OYCA 5CO7A 2FB7A 2PVDB 2LQWA 4LDWA 1YJWA 1VQ5A 3P8BB 2VGMA 2R5MA 3RIRA 1M1KU 4FM4B 2F5TX 4ME7A 4MZMA 5AT1B 4M77G 2E3HA 4LUEA 4MZTA 2CREA 1WHGA 1CSKA 3VS7A 3I9QA 4HCBA 3GP8A 4C0DC 3S3NA 3MP6A 2JS0A 1BBZA 1YITQ 2ZAEA 2X3XD 3HHTB 2CP7A 5DM7R 1KC8C 2OAWA 2LNHB 1QVGA 5GMKm 4JPBW 4PJOD 3OYIA 4C5IA 2O01E 2FYKA 2EYWA 3UA7A 4FW1A 1VUBA 4XTXA 4ZN3A 5GAMe 1IHVA 1M3BA 4BDZA 2LNVA 3PTAA 3M0RA 3RMSA 1M3AA 3G1JA 2CDTA 2DA9A 2RQUA 3HFNA 1M1KR 5IT9E 4D8KA 3ZBDA 3CCUT 3L1AA 2RA2A 5D6WA 1WXUA 5GAOq 2I2LA 3NFCA 1V76A 1G8XA 2EQIA 5GAMf 1YWOA 4BY6C 2OI3A 3EGDB 5FLXE 5GANj 2AT1B 5GAMd 1MGQA 4RCCA 1OI1A 1WGSA 1RAEB 1G83A 4LXCA 2RI3A 4NL3A 3VS5A 4JJDA 1QVGS 1X2KA 3TREA 1WYXA 4FSXA 2KDSA 3JCMJ 5IAYA 2DTOA 1PSFA 4XTYA 1KQ2A 1WQWA 5L8RE 1KC8U 3MP8A 2OTJQ 2E3IA 3EFSA 1YCSB 2MYSA 1YN8A 2ZCFB 4O6JA 4RTZA 3JB9F 5GAOr 2D8JA 2E10A 1V29B 3CCUA 3HL8A 5A0DA 2L3SA 2JM8A 5GAN8 2VXEA 2XDPA 3ULRB 4OMLA 3M56A 1NBEB 6AT1B 1QKXA 2F1LA 2L3PA 1JEGA 1UE9A 2Y4YA 1G3SA 4EMKC 2H8HA
chains in the Genus database with same CATH topology
2J6OA 3RNJA 1AWWA 2EKHA 4KRTA 2J6KA 4ZNXA 1J3TA 3UA6A 2DL8A 1JXOA 2RQRA 2KRNA 4JZ4A 3FJ5A 2ROTA 2KYBA 2JTEA 2LX7A 2O31A 2FG0A 1E7OA 1GFDA 1YP5A 1OPKA 2DVJA 5I22A 2V1RA 4A63B 1SPKA 1PHTA 4RTUA 3NMZC 4HVVA 1ZBJA 2BZXA 1K0SA 2DMOA 2LCSA 1EFNA 3SHWA 4J9CA 2F2VA 2AZVA 3I5SA 4OMOA 3H0FA 1ZSGA 1Z9ZA 2FPEA 2VWFA 1WXTA 1HJDA 4CC4B 1JQQA 1GRIA 1GBQA 2OJ2A 2CUDA 1TUCA 3EGUA 2LJ0A 1LCKA 2LZ6B 1KJWA 2DNUA 2KXDA 2PNIA 2DLPA 2YDLA 1X27A 1AWXA 2GTOA 2AK5A 2D8HA 2L2PA 2LMJA 4RTXA 2FPDA 1JU5C 2HDAA 2I0NA 2RQWA 2CH4W 3VRYA 2KXCA 4RTTA 2AZSA 1W70A 2DBKA 1T0JA 3VS4A 2O9SA 4AFSC 1K4US 1T3LA 1NEGA 2M51A 1XOVA 2P4RA 3VS2A 1NLPC 2CSQA 2JW4A 1WX6A 2F2XA 4IIMA 4J9HA 2EYXA 2J06A 2KE9A 1PRMC 2QDLA 1UHFA 1CKAA 3LH5A 3TSZA 1AVZC 2KBTA 2K6DA 2W0ZA 4CC2A 3I35A 1QWEA 1PRLC 2XMFA 4RTYA 2DL7A 2AKKA 1WDXA 1TG0A 1UUEA 3QWYA 4OMQA 2DL3A 2HCKA 5FW9A 2A08A 1WIEA 1YNZA 2KYMA 3EHQA 2DJQA 1NEBA 2RQVA 3RBBB 3VS1A 1B3QA 2HSPA 1WI7A 4JZ3A 2NUZA 4E6RA 1X6BA 1MV3A 1AWJA 4QT7A 1AWOA 5GJVB 1E6GA 4LUDA 1KFZA 2LQNA 3IQLA 2KR3A 1RUWA 1S1NA 2GTJA 1OV3A 2EW3A 4ORZA 2RQTA 4HXJA 1M27C 2DE0X 5IHKA 1QCFA 2LP5A 4HVWA 1M30A 1H92A 1K0XA 2DYBA 3UF4A 1ZLMA 4OMPA 5FWBA 4JJCA 3QWXX 4AG1C 2DX1A 3O5ZA 5I11A 5FWCA 1PKSA 2A36A 3M0PA 2CT4A 1K76A 1TUDA 4CC3A 2C0IA 2HEQA 1KIKA 1SRLA 2KT8A 2ABLA 1UECA 5IHIA 2EGEA 3REBB 3EHRA 1HD3A 4J9IA 2MCNA 3EG1A 2D0NA 4DEXA 2K9GA 1T0HA 2J6FA 1UTIA 4F14A 1GFCA 2DL4A 2RF0A 1NM7A 2LJ1A 1NYFA 2VVKA 2DBMA 2RMOA 2YUOA 2ESWA 3JV3A 4R0KA 2EYYA 1M8MA 2D1XA 1AD5A 1KSWA 2JMAA 2A28A 1HSQA 1PNJA 5IHNA 2PZ1A 2GQIA 3NHNA 2BZ8A 4LE9A 2BTTA 1MUZA 3M0TA 1UGVA 2JXBA 2GBQA 1SEMA 2O88A 2FRYA 1FYNA 1UDLA 1WLPB 2DRKA 1PWTA 2ENMA 2YUPA 5GJWB 1QWFA 4FSSA 1X43A 3TSWA 1AZEA 2EBPA 2JMCA 2M0YA 2DRMA 2KT1A 4AFQC 2EVRA 3EG3A 3VS3A 2YUNA 2AKLA 2A37A 2MOXA 5HCKA 1RLPC 1PKTA 4J9BA 2J7IA 1I07A 2GNCA 2GGRA 1BB9A 2YSQA 3TVTA 1U06A 3VS6A 1ZUUA 4OMMA 1U3OA 4LNPA 2L3QA 4LN2A 5IXFA 2LJ3A 2YT6A 1VYUA 2L0AA 1OOTA 2CSIA 1V1CA 4X1VA 2FPFA 4F16A 4Y92A 1WXBA 1U5SA 2MIOA 3SEMA 3PVLA 2C0OA 4M4ZA 2C0TA 3VRZA 2B86A 2JM9A 1CKBA 1W6XA 1IO6A 1OEBA 2K3BA 1I1JA 3CQTA 2SEMA 2ED1A 1JXMA 1UG1A 4J9GA 1NG2A 4F17A 5L23A 1NLOC 1RLQC 1NYGA 1Y57A 2ROLA 1E6HA 1GCQA 4GLMA 3EG2A 2FRWA 1AEYA 2HBWA 3UATA 2J05A 1ABOA 2RN8A 3THKA 1K9AA 3NGPA 1X2QA 2CUBA 1FMKA 1N5ZA 3GBQA 5EC7A 2O9VA 4DEYA 2SRCA 4RTWA 4ESRA 1H3HA 3C0CA 2K7AA 1ABQA 3KFVA 2ED0A 2V1QA 4WCIA 2BZYA 1UFFA 2K2MA 2LQWA 1G2BA 2KEAA 1UHCA 1AZGB 2PTKA 1K1ZA 5IH2A 2W10A 1ZX6A 4IIOA 1UJ0A 2G6FX 1SSHA 1SHFA 4J9EA 2NWMA 4K11A 4D8DA 4AFZC 4LUEA 3M0UA 2CREA 2EGCA 1UJYA 1CSKA 1B07A 5ECAA 3VS7A 2KROA 3I9QA 1AOJA 2JS0A 1BBZA 2KRMA 4J9DA 4AG2C 2X3XD 1SRMA 2FO0A 2OAWA 1MV0B 2LNHB 2KNBB 2KRSA 4JPBW 1I0CA 1W1FA 1GCQC 2EYWA 2JS2A 3UA7A 5IXBA 2YUQA 2DILA 4CC7A 3H41A 1VYVA 1M3BA 4GBQA 2DM1A 1BK2A 3M0RA 3NPFA 1A0NB 1M3AA 2CT3A 2CDTA 1RI9A 2DA9A 3U23A 2KGTA 2RQUA 3ZL7C 4HVUA 4D8KA 3M0QA 4Z88A 1ARKA 1GBRA 1WXUA 2JT4A 4RTVA 2EPDA 2EQIA 1YWOA 2IIMA 1T3SA 2OI3A 2DF6A 4J9FA 3REAB 3H0HA 2ECZA 3EG0A 1YWPA 2F2WA 1Z9QA 1QKWA 2DL5A 4AFUC 2EGAA 1VYTA 3PVQA 1ZUKA 1G83A 3VS5A 1GL5A 4EIKA 2X3WD 4JJDA 1X2KA 1ZUYA 4HCKA 1WYXA 1X6GA 1QLYA 4OMNA 1GCPA 1VA7A 2RPNA 1SHGA 3R6NA 1Y0MA 1WFWA 1YCSB 1YN8A 1M3CA 4RTZA 3VS0A 2D8JA 4RUGA 2CH4A 2EYZA 2L3SA 4Z89A 3M0SA 1BU1A 2O2OA 3H0IA 1X69A 2JM8A 3ULRB 4OMLA 1JO8A 2FEIA 1WA7A 1H8KA 4Z8AA 2RNAA 3A98A 1QKXA 1OPLA 3PE0A 4JJBA 3I5RA 2L3PA 2VKNA 2E5KA 1JEGA 1UE9A 2H8HA 2K79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J6O A;  3RNJ A;  1AWW A;  2EKH A;  4KRT A;  2J6K A;  4ZNX A;  1J3T A;  3UA6 A;  2DL8 A;  1JXO A;  2RQR A;  2KRN A;  4JZ4 A;  3FJ5 A;  2ROT A;  2KYB A;  2JTE A;  2LX7 A;  2O31 A;  2FG0 A;  1E7O A;  1GFD A;  1YP5 A;  1OPK A;  2DVJ A;  5I22 A;  2V1R A;  4A63 B;  1SPK A;  1PHT A;  4RTU A;  3NMZ C;  4HVV A;  1ZBJ A;  2BZX A;  1K0S A;  2DMO A;  2LCS A;  1EFN A;  3SHW A;  4J9C A;  2F2V A;  2AZV A;  3I5S A;  4OMO A;  3H0F A;  1ZSG A;  1Z9Z A;  2FPE A;  2VWF A;  1WXT A;  1HJD A;  4CC4 B;  1JQQ A;  1GRI A;  1GBQ A;  2OJ2 A;  2CUD A;  1TUC A;  3EGU A;  2LJ0 A;  1LCK A;  2LZ6 B;  1KJW A;  2DNU A;  2KXD A;  2PNI A;  2DLP A;  2YDL A;  1X27 A;  1AWX A;  2GTO A;  2AK5 A;  2D8H A;  2L2P A;  2LMJ A;  4RTX A;  2FPD A;  1JU5 C;  2HDA A;  2I0N A;  2RQW A;  2CH4 W;  3VRY A;  2KXC A;  4RTT A;  2AZS A;  1W70 A;  2DBK A;  1T0J A;  3VS4 A;  2O9S A;  4AFS C;  1K4U S;  1T3L A;  1NEG A;  2M51 A;  1XOV A;  2P4R A;  3VS2 A;  1NLP C;  2CSQ A;  2JW4 A;  1WX6 A;  2F2X A;  4IIM A;  4J9H A;  2EYX A;  2J06 A;  2KE9 A;  1PRM C;  2QDL A;  1UHF A;  1CKA A;  3LH5 A;  3TSZ A;  1AVZ C;  2KBT A;  2K6D A;  2W0Z A;  4CC2 A;  3I35 A;  1QWE A;  1PRL C;  2XMF A;  4RTY A;  2DL7 A;  2AKK A;  1WDX A;  1TG0 A;  1UUE A;  3QWY A;  4OMQ A;  2DL3 A;  2HCK A;  5FW9 A;  2A08 A;  1WIE A;  1YNZ A;  2KYM A;  3EHQ A;  2DJQ A;  1NEB A;  2RQV A;  3RBB B;  3VS1 A;  1B3Q A;  2HSP A;  1WI7 A;  4JZ3 A;  2NUZ A;  4E6R A;  1X6B A;  1MV3 A;  1AWJ A;  4QT7 A;  1AWO A;  5GJV B;  1E6G A;  4LUD A;  1KFZ A;  2LQN A;  3IQL A;  2KR3 A;  1RUW A;  1S1N A;  2GTJ A;  1OV3 A;  2EW3 A;  4ORZ A;  2RQT A;  4HXJ A;  1M27 C;  2DE0 X;  5IHK A;  1QCF A;  2LP5 A;  4HVW A;  1M30 A;  1H92 A;  1K0X A;  2DYB A;  3UF4 A;  1ZLM A;  4OMP A;  5FWB A;  4JJC A;  3QWX X;  4AG1 C;  2DX1 A;  3O5Z A;  5I11 A;  5FWC A;  1PKS A;  2A36 A;  3M0P A;  2CT4 A;  1K76 A;  1TUD A;  4CC3 A;  2C0I A;  2HEQ A;  1KIK A;  1SRL A;  2KT8 A;  2ABL A;  1UEC A;  5IHI A;  2EGE A;  3REB B;  3EHR A;  1HD3 A;  4J9I A;  2MCN A;  3EG1 A;  2D0N A;  4DEX A;  2K9G A;  1T0H A;  2J6F A;  1UTI A;  4F14 A;  1GFC A;  2DL4 A;  2RF0 A;  1NM7 A;  2LJ1 A;  1NYF A;  2VVK A;  2DBM A;  2RMO A;  2YUO A;  2ESW A;  3JV3 A;  4R0K A;  2EYY A;  1M8M A;  2D1X A;  1AD5 A;  1KSW A;  2JMA A;  2A28 A;  1HSQ A;  1PNJ A;  5IHN A;  2PZ1 A;  2GQI A;  3NHN A;  2BZ8 A;  4LE9 A;  2BTT A;  1MUZ A;  3M0T A;  1UGV A;  2JXB A;  2GBQ A;  1SEM A;  2O88 A;  2FRY A;  1FYN A;  1UDL A;  1WLP B;  2DRK A;  1PWT A;  2ENM A;  2YUP A;  5GJW B;  1QWF A;  4FSS A;  1X43 A;  3TSW A;  1AZE A;  2EBP A;  2JMC A;  2M0Y A;  2DRM A;  2KT1 A;  4AFQ C;  2EVR A;  3EG3 A;  3VS3 A;  2YUN A;  2AKL A;  2A37 A;  2MOX A;  5HCK A;  1RLP C;  1PKT A;  4J9B A;  2J7I A;  1I07 A;  2GNC A;  2GGR A;  1BB9 A;  2YSQ A;  3TVT A;  1U06 A;  3VS6 A;  1ZUU A;  4OMM A;  1U3O A;  4LNP A;  2L3Q A;  4LN2 A;  5IXF A;  2LJ3 A;  2YT6 A;  1VYU A;  2L0A A;  1OOT A;  2CSI A;  1V1C A;  4X1V A;  2FPF A;  4F16 A;  4Y92 A;  1WXB A;  1U5S A;  2MIO A;  3SEM A;  3PVL A;  2C0O A;  4M4Z A;  2C0T A;  3VRZ A;  2B86 A;  2JM9 A;  1CKB A;  1W6X A;  1IO6 A;  1OEB A;  2K3B A;  1I1J A;  3CQT A;  2SEM A;  2ED1 A;  1JXM A;  1UG1 A;  4J9G A;  1NG2 A;  4F17 A;  5L23 A;  1NLO C;  1RLQ C;  1NYG A;  1Y57 A;  2ROL A;  1E6H A;  1GCQ A;  4GLM A;  3EG2 A;  2FRW A;  1AEY A;  2HBW A;  3UAT A;  2J05 A;  1ABO A;  2RN8 A;  3THK A;  1K9A A;  3NGP A;  1X2Q A;  2CUB A;  1FMK A;  1N5Z A;  3GBQ A;  5EC7 A;  2O9V A;  4DEY A;  2SRC A;  4RTW A;  4ESR A;  1H3H A;  3C0C A;  2K7A A;  1ABQ A;  3KFV A;  2ED0 A;  2V1Q A;  4WCI A;  2BZY A;  1UFF A;  2K2M A;  2LQW A;  1G2B A;  2KEA A;  1UHC A;  1AZG B;  2PTK A;  1K1Z A;  5IH2 A;  2W10 A;  1ZX6 A;  4IIO A;  1UJ0 A;  2G6F X;  1SSH A;  1SHF A;  4J9E A;  2NWM A;  4K11 A;  4D8D A;  4AFZ C;  4LUE A;  3M0U A;  2CRE A;  2EGC A;  1UJY A;  1CSK A;  1B07 A;  5ECA A;  3VS7 A;  2KRO A;  3I9Q A;  1AOJ A;  2JS0 A;  1BBZ A;  2KRM A;  4J9D A;  4AG2 C;  2X3X D;  1SRM A;  2FO0 A;  2OAW A;  1MV0 B;  2LNH B;  2KNB B;  2KRS A;  4JPB W;  1I0C A;  1W1F A;  1GCQ C;  2EYW A;  2JS2 A;  3UA7 A;  5IXB A;  2YUQ A;  2DIL A;  4CC7 A;  3H41 A;  1VYV A;  1M3B A;  4GBQ A;  2DM1 A;  1BK2 A;  3M0R A;  3NPF A;  1A0N B;  1M3A A;  2CT3 A;  2CDT A;  1RI9 A;  2DA9 A;  3U23 A;  2KGT A;  2RQU A;  3ZL7 C;  4HVU A;  4D8K A;  3M0Q A;  4Z88 A;  1ARK A;  1GBR A;  1WXU A;  2JT4 A;  4RTV A;  2EPD A;  2EQI A;  1YWO A;  2IIM A;  1T3S A;  2OI3 A;  2DF6 A;  4J9F A;  3REA B;  3H0H A;  2ECZ A;  3EG0 A;  1YWP A;  2F2W A;  1Z9Q A;  1QKW A;  2DL5 A;  4AFU C;  2EGA A;  1VYT A;  3PVQ A;  1ZUK A;  1G83 A;  3VS5 A;  1GL5 A;  4EIK A;  2X3W D;  4JJD A;  1X2K A;  1ZUY A;  4HCK A;  1WYX A;  1X6G A;  1QLY A;  4OMN A;  1GCP A;  1VA7 A;  2RPN A;  1SHG A;  3R6N A;  1Y0M A;  1WFW A;  1YCS B;  1YN8 A;  1M3C A;  4RTZ A;  3VS0 A;  2D8J A;  4RUG A;  2CH4 A;  2EYZ A;  2L3S A;  4Z89 A;  3M0S A;  1BU1 A;  2O2O A;  3H0I A;  1X69 A;  2JM8 A;  3ULR B;  4OML A;  1JO8 A;  2FEI A;  1WA7 A;  1H8K A;  4Z8A A;  2RNA A;  3A98 A;  1QKX A;  1OPL A;  3PE0 A;  4JJB A;  3I5R A;  2L3P A;  2VKN A;  2E5K A;  1JEG A;  1UE9 A;  2H8H A;  2K79 A; 
#chains in the Genus database with same CATH topology
 3OW2 P;  1IXD A;  2EKH A;  3CCV Q;  4UC4 A;  1J3T A;  3QUI A;  4JJN K;  1JXO A;  2QG9 B;  3OYJ A;  2ROT A;  2KYB A;  5FRO A;  1FMV A;  2O31 A;  1E7O A;  3PGG A;  1UGQ B;  4CRI A;  3JCM W;  2V1R A;  5KH6 A;  5GAO l;  3RMQ A;  1B34 B;  4VUB A;  2LC4 A;  4C0D B;  2JOY A;  1ZBJ A;  1EIF A;  2LCS A;  2P84 A;  4J9C A;  4PJJ A;  1Q7Y R;  2F2V A;  4HKE A;  4OF1 A;  4DBF A;  5M9O A;  8AT1 B;  4PJO A;  2DTI A;  5KCO A;  1VQ4 Q;  1ZSG A;  3CME A;  4A4G A;  1WXT A;  1JQQ A;  2P0P A;  3CC4 T;  1PCX A;  1LCK A;  2LZ6 B;  4J8O A;  4J83 A;  1R0B G;  2YDL A;  2D8H A;  4RTX A;  1YJ9 Q;  2XDD A;  2RQW A;  4M77 D;  2KXC A;  3DLL A;  4ZN1 A;  1I5L A;  4RTT A;  4IKF A;  3JCM Q;  3CC2 Q;  2DBK A;  3QZ9 B;  1YIJ T;  1BIA A;  1NEG A;  1MMN A;  2BE9 B;  1Y96 B;  2EJF A;  1YJN T;  1WJR A;  4C0Z A;  2JW4 A;  2F2X A;  3N5B B;  2QA4 T;  2KE9 A;  2QDL A;  2JZ2 A;  4A4F A;  4ZTJ A;  1AVZ C;  2XKO C;  4M7D G;  2X4J A;  1WHM A;  1QWE A;  2CS7 A;  1D1A A;  1WDX A;  2DER A;  4OMQ A;  1PD0 A;  2E12 A;  1UGP B;  3I55 T;  2A08 A;  1WIE A;  1VQN A;  3EHQ A;  1NEB A;  2YRC A;  2RQV A;  1RAB B;  4C0F A;  4JZ3 A;  4M78 G;  5CIU A;  1AWJ A;  1XJW B;  1YJN A;  4LUD A;  5GAN g;  2KR3 A;  1LOJ A;  3V7S A;  3GOX A;  2JUF A;  2QA4 A;  2GTJ A;  1OV3 A;  1NPP A;  2KVQ G;  2RQT A;  3O8V A;  4M7A B;  4J7F A;  1QVP A;  2DE0 X;  3SD4 A;  1RAI B;  3LGF A;  4BE2 A;  1QVF P;  2COW A;  4JLI A;  5FWB A;  3QWX X;  3E9F A;  5D7U A;  1U8R A;  2DX1 A;  3OS5 A;  3I55 A;  1VQ8 A;  2X4X A;  2HBP A;  2K3X A;  4LDY A;  5KYW B;  1XTD A;  2CP0 A;  2A36 A;  3JB9 H;  1TUD A;  1QW1 A;  1UGR B;  4QVZ A;  4P5N A;  2C0I A;  2GCX A;  1M9S A;  2HEQ A;  3M54 A;  5KYX B;  2RK1 A;  1K8A C;  2ABL A;  2KT8 A;  3REB B;  3MEV A;  3CCS A;  3OYA A;  3EHR A;  1FMW A;  2KMT A;  1HD3 A;  3R6O A;  2MCN A;  2K5I A;  1VQP A;  2HL5 C;  3HRT A;  3CC7 Q;  2C06 A;  2K9G A;  2J6F A;  3VJP A;  4C8Q A;  3LX7 A;  1Q86 C;  3FDR A;  2DBM A;  3TU4 K;  4XTW A;  2A7Y A;  2RJE A;  2FZC B;  3A5Z B;  3G71 T;  3JV3 A;  1M8M A;  1AD5 A;  2JMA A;  1C1A A;  5KYN A;  2A28 A;  1HSQ A;  2BZ8 A;  4LE9 A;  1MUZ A;  2JXB A;  2O88 A;  1FYN A;  1WLP B;  1TUG B;  1VQM Q;  4M75 D;  2EKO A;  2YUP A;  4ANJ A;  1QWF A;  3JB9 G;  2EBP A;  2JMC A;  2DRM A;  3MEW A;  3EG9 B;  1TWB A;  4IUV A;  4NOY A;  3BDL A;  4LDV A;  2PUO B;  3MHX A;  2AHJ B;  2OTL Q;  1K8A U;  2DEU A;  4MMK A;  1OX9 A;  1ZHI A;  4IUP A;  1X6O A;  3G6E T;  1PC0 A;  1VQL Q;  3LYI A;  1ZUU A;  4OMM A;  2LJ3 A;  3CEY A;  1VYU A;  3L2U A;  3A8G B;  3KXT A;  3QJY A;  1RAG B;  1Q86 U;  4DA4 A;  3SEM A;  3V8J A;  3L2Z A;  5LJ3 j;  2XDB A;  2C0T A;  4OB2 B;  5FU7 B;  3G4S T;  2MF2 A;  5CQY A;  3OW2 S;  1B34 A;  1QP3 A;  2K3B A;  4Z02 A;  2QEX T;  3OYM A;  1I1J A;  1TSF A;  4QKU A;  3G6E A;  1MNE A;  3PIO A;  1UG1 A;  4ZGJ B;  5GAN h;  4BUG A;  1NG2 A;  1K8A R;  3OYL A;  1YHQ Q;  1C6V X;  4M7D D;  2HBW A;  4N0A C;  2J05 A;  1YI2 A;  2LX9 A;  3NGP A;  3LWH A;  2MMP A;  5A0L A;  3G4S Q;  2QQ9 A;  2SRC A;  4FCY A;  2L8D A;  4A54 A;  5HKC A;  5KYY B;  4YTL A;  2LVM A;  2K7A A;  1ABQ A;  1NPR A;  1S72 T;  2BZY A;  2DAQ A;  4M78 D;  1UFF A;  4IUR A;  1G2B A;  3CCL T;  1AZG B;  3EFR A;  1WHL A;  2QEX A;  3T9N A;  3CCJ Q;  2MI6 A;  5IH2 A;  2V8I A;  2DD4 A;  2W10 A;  1OX8 A;  1OZ3 A;  3I56 Q;  4IIO A;  1KHC A;  3CD6 Q;  1RL2 A;  1UJ0 A;  3MP1 A;  1YCY A;  1SSH A;  4ELZ C;  2FVU A;  2NWM A;  2QGF B;  4MDX A;  4KUL A;  2EJG A;  1UJY A;  2QQR A;  2V8K A;  4J9D A;  4MZP A;  1OU8 A;  2K57 A;  5LL6 S;  3SB2 A;  3CBO A;  5FU6 C;  1QCN A;  1S72 A;  4M75 A;  1GCQ C;  2RH2 A;  2JS2 A;  4J6W A;  2YUQ A;  4C92 C;  2XHC A;  4KT0 E;  3CCL A;  2QDY B;  3QKJ A;  2YHT A;  2HKN A;  1A0N B;  3U23 A;  1KHI A;  2WSE E;  2KGT A;  3ZL7 C;  4EMK A;  5EG2 A;  1OU9 A;  2VAS A;  1QVF A;  4Z88 A;  1BI1 A;  4PJO B;  3JRZ A;  4V2S A;  2EPD A;  1M1F A;  3A8L B;  1N27 A;  2IIM A;  5CKB A;  1T3S A;  1Y71 A;  1VQ9 T;  2DF6 A;  3H0H A;  1I4K 1;  2ECZ A;  3H9N A;  3OSV A;  1YWP A;  1VQ6 T;  1N9S A;  1ZUK A;  3MET A;  4CI0 C;  1GL5 A;  3EAE A;  4EIK A;  2X3W D;  2OX7 A;  2GQV A;  4HCK A;  3QZ5 B;  1QLY A;  2L3R A;  1GCP A;  1FXX A;  1TOV A;  4QQ6 A;  3MO8 A;  1Y7X A;  1WFW A;  2YWW A;  4M77 C;  3JB9 J;  2P4T A;  3QPH A;  3EH2 A;  4RUG A;  1SG5 A;  2CH4 A;  4BDY A;  3E19 A;  1VQ6 Q;  2EYZ A;  1LJO A;  7AT1 B;  3QDR B;  4Z89 A;  1MMG A;  4M7A F;  1QVF S;  3H0I A;  1LPL A;  5GAN 6;  2RNA A;  3A98 A;  2RHI A;  2VKN A;  2FZG B;  2H3E B;  3ER0 A;  4A4K A;  1OQK A;  2K79 A;  1R77 A;  4KRT A;  2J6K A;  3MPU B;  4ZGE B;  1VQ7 Q;  3JCM P;  4ZNX A;  3CPW P;  3QYH B;  2JVV A;  5GAM j;  2RQR A;  3KUF A;  1YIT T;  3HFO A;  5C6S A;  5LJ3 g;  4JZ4 A;  4C5H A;  2VGN A;  2JTE A;  1N9R A;  1YP5 A;  1OPK A;  3BY7 A;  4A63 B;  1PHT A;  3OYH A;  3EG9 A;  4HVV A;  3Q1J A;  5HY6 A;  4II1 A;  2DMO A;  3P8H A;  4E7Z A;  2RJC A;  2RM4 A;  5FU6 B;  3CMA T;  3I5S A;  4NS5 A;  3WVE B;  3OYB A;  4KH1 B;  1TU0 B;  2VWF A;  2L89 A;  3JCM e;  1HJD A;  5C0M A;  1YIT A;  3UDC A;  1TUC A;  2LDM A;  1KJW A;  2DNU A;  2DLP A;  2XK0 A;  3RES A;  1VQK Q;  1W2B P;  2L2P A;  2FPD A;  3OYY A;  4F7U G;  2I0N A;  3JCM f;  3QII A;  1H3Z A;  3CMA Q;  2OTJ T;  1BYM A;  3JCM d;  1W70 A;  3E1S A;  5KE2 A;  4C8Q B;  4M7A E;  1XOV A;  2P4R A;  3ASK A;  2NUP A;  4OB1 B;  1ZA2 B;  1WX6 A;  4IIM A;  5CK9 A;  1PRM C;  2LQK A;  1CKA A;  3NTK A;  3H8Z A;  3CCQ T;  2K6D A;  1ZA1 B;  4CC2 A;  2DXC A;  4BI3 A;  2CP3 A;  1PRL C;  3L2Q A;  2DL7 A;  5KYY A;  2MAM A;  3CCV T;  1TG0 A;  1HK9 A;  1UUE A;  3DB4 A;  2R5A A;  4M75 C;  2HQE A;  1AT1 B;  3QWY A;  8ATC B;  2EJ9 A;  1YNZ A;  3H6Z A;  1M8V A;  2EWN A;  2VV5 A;  1B3Q A;  4JLG A;  1WI7 A;  4E6R A;  1AWO A;  1RAD B;  1LVK A;  1E6G A;  4B6M A;  1JB0 E;  3CCQ Q;  1O9S A;  2FL7 A;  1KG1 A;  4AT1 B;  2VB6 A;  1VIF A;  2XU8 A;  2BIV A;  3QJ6 A;  4HXJ A;  3HSB A;  3JCM c;  1M90 C;  2BE7 D;  1YBY A;  2H3J A;  5IHK A;  1H92 A;  1K0X A;  1U1S A;  4L6V 5;  2E4H A;  1VQ4 T;  3TCJ A;  2DXB A;  1KC8 R;  2PQW A;  4C92 D;  2K3Y A;  2M9U A;  4E7I A;  5FWC A;  1PKS A;  5LJ5 e;  3FB9 A;  5LJ3 h;  2EQK A;  4CC3 A;  1D0X A;  4BE0 A;  1KK7 A;  5GMK e;  1UEC A;  1WHH A;  3GLX A;  5GAN f;  3OYK A;  1YJ9 T;  1UB4 A;  2OAU A;  1XNI A;  2E5Q A;  1BKB A;  3EG1 A;  2D0N A;  1G3Y A;  4M7D C;  5LJ5 f;  3CC2 T;  1AHJ B;  1GFC A;  5LJ5 d;  2ZGW A;  3JSC A;  5J26 A;  1NJI C;  3RKX A;  2E70 A;  2YUO A;  5GAM g;  3CME Q;  1TTH B;  5CVI A;  3S6W A;  4J6Y A;  2EYY A;  3PFS A;  2HD0 A;  1FWZ A;  2PZ1 A;  1M90 U;  3GIB A;  4M78 C;  3NHN A;  4XU2 A;  4FYV B;  3M0T A;  4OGE A;  1UGV A;  2DTH A;  3V8K A;  3PIP A;  2GBQ A;  4BY6 B;  1U1T A;  1PWT A;  2E6N A;  4PJO F;  1WQ7 A;  3OQ5 A;  1YJ9 A;  1QQJ A;  4XTZ A;  1QCO A;  1ZSZ C;  1M2V A;  2M0Y A;  2ZPF B;  2PUK B;  5GMK l;  4AFQ C;  4N0A A;  3MCA B;  2EVR A;  4M7A G;  3EG3 A;  2HQH A;  2YUN A;  2A37 A;  3MJX A;  4FIB A;  4LDU A;  3CC4 A;  4NL2 A;  1BB9 A;  4M75 B;  2ZPG B;  1U06 A;  1KD1 C;  4LDX A;  1U3O A;  2CYZ B;  2EFI A;  4LNP A;  2KK4 A;  4JS4 A;  2HNI A;  4MDW A;  1M2O A;  2CZ6 B;  5IN1 A;  3OMG A;  2FPF A;  1NJI U;  1M90 R;  2PVG B;  2WAC A;  4F16 A;  3X20 B;  3OBW A;  4PJL A;  2VXF A;  3PVL A;  4KGV B;  2C0O A;  4M4Z A;  3JCM X;  1YIJ A;  4EMK B;  2E1H A;  4OB0 B;  2KY9 A;  2L5Q A;  2JM9 A;  2HL3 A;  2RO0 A;  1WNL A;  3QSU A;  4DBQ A;  3CPW S;  2BUD A;  1W4S A;  2ED1 A;  1JXM A;  2K5F A;  4F17 A;  3OYE A;  5GAN 3;  2LCC A;  1Y57 A;  1NYG A;  1Y07 A;  1D0Y A;  2QQA A;  1E6H A;  1GCQ A;  2M02 A;  3QO3 A;  4C92 A;  4B9W A;  2RN8 A;  4MML A;  2DYI A;  3CC7 T;  2CUB A;  1N5Z A;  5EC7 A;  2LTO A;  4ESR A;  4IUU A;  1PSE A;  4A4E A;  1KD1 U;  2IVW A;  2ED0 A;  1VQ8 Q;  2YRV A;  4HCZ A;  2QQS A;  1UHC A;  4AMC A;  1K1Z A;  2GFA A;  3D7S B;  1JJ2 P;  4M7D B;  4PJO E;  1G3W A;  2ZPB B;  2KSS A;  1VQM T;  4C0G A;  4L5G A;  2G6F X;  2XG8 D;  9ATC B;  1SHF A;  2X9H A;  2NUT A;  5HK3 A;  2QYZ A;  2HMA A;  3QBY A;  3QYG B;  4K11 A;  1VQP Q;  3M0U A;  2EGC A;  2KQW A;  3CC7 A;  5ECA A;  1AOJ A;  1KQS P;  5GAO n;  2KRM A;  4AG2 C;  2X35 A;  2OTL T;  1R8O B;  2FO0 A;  3OSS C;  4PFO A;  2EQM A;  1MV0 B;  4M77 A;  2KRS A;  2CGH A;  5GAM h;  1VQL T;  1I0C A;  5DLQ E;  1D3B B;  5IXB A;  2DIL A;  4CC7 A;  5CQX A;  3H41 A;  2M1H A;  4X9D A;  1MMD A;  4E7J A;  1MND A;  1VYV A;  4KBM B;  3E9G A;  4GBQ A;  5J3B A;  4C8Q F;  2QTX A;  3QXE B;  3OW2 A;  2YXY A;  3NPF A;  1PD1 A;  5AYF A;  4KUD K;  4D6W A;  1VQM A;  2CT3 A;  3M4Y A;  4HA8 A;  3LWI A;  3M0Q A;  1ARK A;  3G71 A;  1GBR A;  2JT4 A;  1RAF B;  4RTV A;  1HXD A;  3REA B;  4J9F A;  2OTL A;  2F2W A;  4F7U A;  4JS5 A;  3PVQ A;  2E65 A;  3LLR A;  3HRS A;  2YLC A;  3VYG A;  1YHQ T;  1X6G A;  3QHS A;  2HZY A;  3OMC A;  2LRQ A;  2FHD A;  1SHG A;  3SWN C;  4E7H A;  4DOW A;  3V7R A;  3GPL A;  3UPU A;  3VS0 A;  3JCM b;  2RD1 A;  4KH0 B;  3CCE Q;  4RCB A;  4DBH A;  3RER A;  2NUP B;  4QVD A;  4N4I A;  2ZZD A;  1Q95 G;  3CCJ T;  1H8K A;  3EFO A;  3FC3 A;  4JJB A;  3I5R A;  2E5K A;  3I56 T;  1KQ1 A;  3CD6 T;  3C4S A;  2JNG A;  3RNJ A;  1YHQ A;  1AWW A;  3S3O A;  1YI2 Q;  4QQG A;  2DL8 A;  1Q86 R;  4L59 A;  3G4S A;  2KRN A;  4J5Y A;  5KYU A;  4XTV A;  2DZC A;  2LX7 A;  1GFD A;  2B8A A;  2DVJ A;  1VQO T;  4HCC A;  4PJO G;  4C8Q E;  2RHY A;  1EX4 A;  4JRQ A;  3ZFJ A;  3CCJ A;  2JTM A;  3NMZ C;  4ZTF A;  2BZX A;  1K0S A;  3I56 A;  2HAX A;  1EFN A;  3CD6 A;  4BI4 A;  1D1B A;  3CCR T;  2AZV A;  4M77 E;  2FPE A;  1IB8 A;  3BDU A;  1UEB A;  1PG5 B;  4JRI A;  1VIE A;  4B9X A;  1GBQ A;  2OJ2 A;  2CUD A;  1VQO Q;  4OGC A;  2LJ0 A;  1G5V A;  5LJ3 f;  3X26 B;  3CCM Q;  2QGG A;  3A8O B;  2DFU A;  3WXM B;  2DET A;  1X27 A;  2D6F A;  3PNW C;  2AK5 A;  2LMJ A;  3OS1 A;  1N6A A;  2XD0 A;  2O4X A;  3CCR Q;  2CH4 W;  3VRY A;  3VUZ A;  3E2U A;  2Y4X A;  3VS4 A;  3EGX A;  4M75 F;  2O9S A;  1K4U S;  1T3L A;  3CBM A;  3CXC P;  5GAN 5;  2DD5 A;  1NLP C;  4J9H A;  3DKM A;  3OS0 A;  1XQH A;  2J06 A;  1LNX A;  2P0Q A;  4XU1 A;  1UGS B;  4WTO B;  3TSZ A;  3SWN B;  2LQ8 A;  5KE3 A;  2W0Z A;  1WZO A;  1IGU A;  5KCH A;  5I21 A;  3JB9 D;  5D6X A;  1VQ7 T;  3FRN A;  3M57 A;  4LD9 K;  2DL3 A;  1M2V B;  5FW9 A;  2VC8 A;  1FX7 A;  2DJQ A;  1G3T A;  4Y28 E;  3RBB B;  2HSP A;  3VS1 A;  5A0G A;  5GAN 7;  3TEE A;  3OS2 A;  3MKD A;  3JCM V;  4M7D A;  3F70 A;  1X6B A;  4KGZ B;  1VQ9 A;  1BCM A;  1MV3 A;  2K5L A;  4QT7 A;  1VQ6 A;  3GNF B;  2RJF A;  1RUW A;  3L2V A;  3HPW A;  1S1N A;  2AIR B;  2EW3 A;  3J81 E;  2HKQ B;  1D1C A;  1OYX A;  4M78 A;  1M27 C;  2LP5 A;  3LH0 A;  5DLO A;  1M30 A;  5GAO m;  4IUQ A;  2DYB A;  1VQ7 A;  1OUL A;  1K9M C;  4M7D F;  1D3B A;  1ZSZ A;  3O5Z A;  2RB6 A;  2CT4 A;  4R55 A;  4FT4 A;  1YJW Q;  1VQ5 Q;  4C8Q G;  2V8J A;  5CAI A;  1VQK T;  3S3M A;  1SRL A;  4GY5 A;  2EGE A;  4M78 F;  1QMC A;  4J6X A;  4EMG A;  4J9I A;  1BCO A;  2LT1 A;  4DEX A;  2GF7 A;  4C92 B;  4M75 E;  1T0H A;  4DOV A;  4F14 A;  2RF0 A;  3BE3 A;  1NM7 A;  2LJ1 A;  2VVK A;  2ESW A;  1EZZ B;  2DEQ A;  2A0F B;  4RKU E;  3OYF A;  3A8H B;  1PNJ A;  5IHN A;  2GQI A;  2BTT A;  4RG8 A;  1SEM A;  1O75 A;  1VQK A;  2DRK A;  1UDL A;  1HYO A;  5I2M A;  1K9M U;  1IHW A;  2NUT B;  3CMA A;  2CZ1 B;  2V26 A;  4FYW B;  1Q7Y C;  1WHK A;  3LGL A;  2AKL A;  4PJM A;  3FIF A;  5HCK A;  2F69 A;  1IRX A;  1RLP C;  1PKT A;  3SFM A;  4J9B A;  2J7I A;  2KI7 A;  3UT1 A;  4M77 B;  3VS6 A;  4A4H A;  4GLK A;  4BE1 A;  2RI5 A;  5IXF A;  2YT6 A;  3M4G A;  1V1C A;  3OA6 A;  5LJ5 j;  4X1V A;  3BFM A;  1X01 A;  4Y92 A;  2OTJ A;  3RKW A;  2DXU A;  4M7D E;  4XU3 A;  3MEA A;  5GMK j;  1SKU B;  3ME9 A;  1B7T A;  4FW2 A;  3CCU Q;  3VRZ A;  1K9M R;  1C0M A;  2PVO B;  2B86 A;  1WPY A;  1W6X A;  1RAA B;  2K2V A;  3RUX A;  3VYH B;  4EMH A;  3CQT A;  3BW1 A;  2SEM A;  3M59 A;  3JB9 I;  4M78 E;  5FRM A;  3CCQ A;  4F7U B;  3KBG A;  2MK5 A;  2X4W A;  1NLO C;  1RLQ C;  2DO3 A;  3HP9 A;  1Q7Y U;  3CCV A;  5GAN 4;  1AEY A;  5GAN e;  3L2W A;  1X2Q A;  4PJN A;  3URG A;  1NE8 A;  2O9V A;  4DEY A;  5CKF A;  3G7Z A;  3CME T;  2WSF E;  3KFV A;  2V1Q A;  4M7A C;  1IZ6 A;  2K2M A;  1WJS A;  2KEA A;  3CXC A;  2PTK A;  4OP0 A;  5GAN d;  1TS9 A;  3NTI A;  3EFO B;  1ZX6 A;  3HKS A;  1BIB A;  4Q5W A;  3A1P A;  3JCM g;  4J9E A;  2P0K A;  4M75 G;  4D8D A;  4AFZ C;  5GAO p;  1VQ4 A;  4E7L A;  1B07 A;  2KRO A;  3M5A A;  4PFZ A;  1SRM A;  2LCL A;  3SWN A;  4DBR A;  3PMI A;  2KNB B;  3SDZ A;  5KYU B;  4O5V A;  1W1F A;  2MWO A;  3OB9 A;  2ZPI B;  4XAX B;  3EH1 A;  4E47 A;  1D0Z A;  4C8Q D;  1SF9 A;  4Y91 A;  3CXC S;  2DM1 A;  1BK2 A;  3JAM E;  3CC2 A;  3CPW A;  1RI9 A;  3GF5 A;  1WHJ A;  4HVU A;  2WSC E;  2IPO B;  2QQB A;  1VQN T;  2XID A;  1SSF A;  2QI2 A;  1GXI E;  3M58 A;  3EG0 A;  4OB3 B;  3CC4 Q;  3AT1 B;  2CP2 A;  1Z9Q A;  3J80 E;  3RKY A;  1QKW A;  4PLI A;  2DL5 A;  2FZK B;  2EGA A;  4AFU C;  1VYT A;  5GAN 2;  1ACM B;  1RAH B;  1H64 1;  1ZUY A;  1I8F A;  4OMN A;  3V7C A;  3INZ A;  1VA7 A;  1JBM A;  3AHU A;  2RPN A;  3R6N A;  2CKK A;  2O4X B;  1VQN Q;  1Y0M A;  3MEU A;  3QDF A;  1K73 C;  5A2Q E;  5HK0 A;  2EAY A;  1M3C A;  4QW2 A;  1YIJ Q;  5GMK i;  3UWN A;  3CBP A;  3EGX B;  4BD3 A;  4F04 B;  1VQ8 T;  4PK4 A;  2Y90 A;  2KAF A;  1YJN Q;  3M0S A;  1BU1 A;  2O2O A;  4FU6 A;  1X69 A;  2GFU A;  2QA4 Q;  1R0C B;  2R57 A;  3LW5 E;  3OYG A;  1JO8 A;  2FEI A;  1WA7 A;  4Z8A A;  1TXQ A;  1W2B A;  1MHN A;  1OPL A;  3PE0 A;  4RG2 A;  4PFP A;  3CCS T;  5FU7 C;  5CKE A;  2J6O A;  4PNO A;  3FEO A;  5LJ5 g;  3P8D A;  1VQP T;  3OBY A;  3RR6 A;  3X24 B;  3UA6 A;  1NJI R;  3I55 Q;  3FJ5 A;  2COY A;  2DXT A;  2FG0 A;  2BKD N;  3OY9 A;  4LD6 A;  4ZGD B;  5I22 A;  3CPF A;  4BAC A;  4C92 F;  3HRU A;  1RI0 A;  2E64 A;  3CCS Q;  1SPK A;  3OYD A;  4RTU A;  1K73 U;  1W2B S;  3SHW A;  4M78 B;  2DJZ A;  1QP2 A;  3WVD B;  2JJ9 A;  3JCM h;  2YLB A;  4E7K A;  2QAZ A;  4OMO A;  3H0F A;  2DK3 A;  1Z9Z A;  1F1B B;  2DZ9 A;  3VV0 A;  3EGD A;  3PT9 A;  5CCA A;  4CC4 B;  1GRI A;  1ZSZ B;  3EGU A;  1KD1 R;  2KXD A;  2PNI A;  3L42 A;  4E7S A;  2DPP B;  5CR2 A;  1AWX A;  4FL6 A;  2GTO A;  1BI2 A;  1MMA A;  3J7A F;  2RHU A;  1JU5 C;  4C5E A;  2K4Y A;  2HDA A;  2NYS A;  1Q81 C;  2ATC B;  4A53 A;  2XI9 A;  2AZS A;  1PM3 A;  4JRK A;  2X4Y A;  2DVE A;  4M77 F;  1T0J A;  1K73 R;  4AFS C;  2M51 A;  3CCE T;  3VS2 A;  3G71 Q;  2PU9 B;  2CSQ A;  2DIG A;  2VYT A;  1VQL A;  4ELY C;  2EYX A;  1IGQ A;  2EQU A;  4R56 A;  1M4Z A;  1UHF A;  5CKD A;  3LH5 A;  4X9C A;  1Q82 C;  4PKC C;  2KBT A;  4X34 A;  3I35 A;  3C94 A;  4PJO C;  4IUT A;  2XMF A;  4RTY A;  2AKK A;  1YI2 T;  4FT2 A;  4E2F B;  4M7A D;  4KGX B;  2HCK A;  2XIC A;  2KYM A;  4EDU A;  1M1G A;  4F7U F;  1QVG P;  2NUZ A;  2M16 A;  2HQX A;  5GJV B;  4C92 E;  3NTH A;  2QAS A;  2G3R A;  3CCE A;  3G6E Q;  1KFZ A;  4FYX B;  2LQN A;  3IQL A;  2R58 A;  1Q81 U;  4ORZ A;  2EYQ A;  5CKH A;  1ZQ1 A;  2EIF A;  3M9Q A;  1QCF A;  4HVW A;  4PL6 A;  3A8M B;  3UF4 A;  4KUI A;  1ZLM A;  4OMP A;  4JJC A;  4JUV A;  2JN0 A;  5LJ5 h;  4AG1 C;  5I11 A;  2HSE B;  1Q82 U;  2E41 A;  2CP6 A;  2ZPE B;  5GMK h;  2RK2 A;  2QEX Q;  4HT8 A;  4BB7 A;  3M0P A;  1K76 A;  3CCM T;  5FRN A;  1N8R C;  3GNG A;  1BI0 A;  5LJ3 e;  1KIK A;  1M5Q 1;  5IHI A;  4EPC A;  3DLM A;  3C12 A;  1I81 A;  2CZ7 B;  2NLU A;  4RMO A;  1Q81 R;  3TQ7 P;  3V8L A;  3FLG A;  1UTI A;  2DL4 A;  1JRI A;  2CZ0 B;  1NYF A;  1Y96 A;  2RMO A;  4R0K A;  1S72 Q;  5LJ3 d;  2D1X A;  2MWP A;  1KSW A;  4WF2 A;  5J39 A;  1VQO A;  2EQJ A;  2QK0 A;  1IRE B;  3RDV A;  3CCL Q;  1NZ9 A;  4N4G A;  3CCM A;  4XU0 A;  4JDS A;  1Q82 R;  2FRY A;  2QXF A;  2ENM A;  3M55 A;  1OZ2 A;  5GJW B;  2ZPH B;  3ZEH A;  2RHZ A;  4FSS A;  1X43 A;  3TSW A;  4DQ2 A;  1AZE A;  2YRD A;  1P92 A;  3M53 A;  3CCR A;  4BI8 B;  3HTR A;  2KT1 A;  4F7U E;  2X51 A;  4TVR A;  3VS3 A;  2LT4 A;  1N8R U;  2MOX A;  4C5G A;  2A3L A;  3X28 B;  4HT9 A;  4PLL A;  1I07 A;  1JJ2 A;  2GNC A;  4N4H A;  2COZ A;  2GGR A;  2YSQ A;  3TVT A;  5I2S A;  3QG1 A;  4XQ3 A;  4M7A A;  5DY9 A;  2L3Q A;  4LN2 A;  3X25 B;  2L0A A;  4C8Q C;  1OOT A;  2CSI A;  2VUB A;  1I5O B;  1WXB A;  1U5S A;  2MIO A;  4XK8 E;  2RI2 A;  1M1K C;  1BI3 A;  4FYY B;  1KQS A;  2MPX C;  2D0Q B;  2F5K A;  5KYW A;  3OYN A;  4J7I A;  1ZBX A;  1CKB A;  4C92 G;  1IO6 A;  1OEB A;  2DIQ A;  2D9T A;  1VQ9 Q;  3VUB A;  1YJW T;  1VQ5 T;  1WJQ A;  2RHX A;  5KYX A;  2IG0 A;  3C95 A;  2CP5 A;  3PMT A;  4J9G A;  5D6Y A;  1N8R R;  2QTV A;  5L23 A;  2Z0W A;  3FJP A;  2ROL A;  1JJ2 S;  3L2R A;  4GLM A;  3EG2 A;  4OMF B;  2FRW A;  3UAT A;  2RJD A;  3DB3 A;  1ABO A;  4XTU A;  3THK A;  4JRP A;  1K9A A;  1VOM A;  4QQD A;  1D09 B;  1TH7 A;  1RAC B;  1FMK A;  3GBQ A;  4QVC A;  1DJ7 B;  2E6Z A;  4RTW A;  2JTF A;  3C0C A;  1H3H A;  2M0O A;  3VKI A;  3VU3 C;  4ATO A;  1YFN A;  4WCI A;  1KQS S;  4OVA A;  1X75 C;  2DKG A;  3OYC A;  5CO7 A;  2FB7 A;  2PVD B;  2LQW A;  4LDW A;  1YJW A;  1VQ5 A;  3P8B B;  2VGM A;  2R5M A;  3RIR A;  1M1K U;  4FM4 B;  2F5T X;  4ME7 A;  4MZM A;  5AT1 B;  4M77 G;  2E3H A;  4LUE A;  4MZT A;  2CRE A;  1WHG A;  1CSK A;  3VS7 A;  3I9Q A;  4HCB A;  3GP8 A;  4C0D C;  3S3N A;  3MP6 A;  2JS0 A;  1BBZ A;  1YIT Q;  2ZAE A;  2X3X D;  3HHT B;  2CP7 A;  5DM7 R;  1KC8 C;  2OAW A;  2LNH B;  1QVG A;  5GMK m;  4JPB W;  4PJO D;  3OYI A;  4C5I A;  2O01 E;  2FYK A;  2EYW A;  3UA7 A;  4FW1 A;  1VUB A;  4XTX A;  4ZN3 A;  5GAM e;  1IHV A;  1M3B A;  4BDZ A;  2LNV A;  3PTA A;  3M0R A;  3RMS A;  1M3A A;  3G1J A;  2CDT A;  2DA9 A;  2RQU A;  3HFN A;  1M1K R;  5IT9 E;  4D8K A;  3ZBD A;  3CCU T;  3L1A A;  2RA2 A;  5D6W A;  1WXU A;  5GAO q;  2I2L A;  3NFC A;  1V76 A;  1G8X A;  2EQI A;  5GAM f;  1YWO A;  4BY6 C;  2OI3 A;  3EGD B;  5FLX E;  5GAN j;  2AT1 B;  5GAM d;  1MGQ A;  4RCC A;  1OI1 A;  1WGS A;  1RAE B;  1G83 A;  4LXC A;  2RI3 A;  4NL3 A;  3VS5 A;  4JJD A;  1QVG S;  1X2K A;  3TRE A;  1WYX A;  4FSX A;  2KDS A;  3JCM J;  5IAY A;  2DTO A;  1PSF A;  4XTY A;  1KQ2 A;  1WQW A;  5L8R E;  1KC8 U;  3MP8 A;  2OTJ Q;  2E3I A;  3EFS A;  1YCS B;  2MYS A;  1YN8 A;  2ZCF B;  4O6J A;  4RTZ A;  3JB9 F;  5GAO r;  2D8J A;  2E10 A;  1V29 B;  3CCU A;  3HL8 A;  5A0D A;  2L3S A;  2JM8 A;  5GAN 8;  2VXE A;  2XDP A;  3ULR B;  4OML A;  3M56 A;  1NBE B;  6AT1 B;  1QKX A;  2F1L A;  2L3P A;  1JEG A;  1UE9 A;  2Y4Y A;  1G3S A;  4EMK C;  2H8H A; 
#chains in the Genus database with same CATH homology
 2J6O A;  3RNJ A;  1AWW A;  2EKH A;  4KRT A;  2J6K A;  4ZNX A;  1J3T A;  3UA6 A;  2DL8 A;  1JXO A;  2RQR A;  2KRN A;  4JZ4 A;  3FJ5 A;  2ROT A;  2KYB A;  2JTE A;  2LX7 A;  2O31 A;  2FG0 A;  1E7O A;  1GFD A;  1YP5 A;  1OPK A;  2DVJ A;  5I22 A;  2V1R A;  4A63 B;  1SPK A;  1PHT A;  4RTU A;  3NMZ C;  4HVV A;  1ZBJ A;  2BZX A;  1K0S A;  2DMO A;  2LCS A;  1EFN A;  3SHW A;  4J9C A;  2F2V A;  2AZV A;  3I5S A;  4OMO A;  3H0F A;  1ZSG A;  1Z9Z A;  2FPE A;  2VWF A;  1WXT A;  1HJD A;  4CC4 B;  1JQQ A;  1GRI A;  1GBQ A;  2OJ2 A;  2CUD A;  1TUC A;  3EGU A;  2LJ0 A;  1LCK A;  2LZ6 B;  1KJW A;  2DNU A;  2KXD A;  2PNI A;  2DLP A;  2YDL A;  1X27 A;  1AWX A;  2GTO A;  2AK5 A;  2D8H A;  2L2P A;  2LMJ A;  4RTX A;  2FPD A;  1JU5 C;  2HDA A;  2I0N A;  2RQW A;  2CH4 W;  3VRY A;  2KXC A;  4RTT A;  2AZS A;  1W70 A;  2DBK A;  1T0J A;  3VS4 A;  2O9S A;  4AFS C;  1K4U S;  1T3L A;  1NEG A;  2M51 A;  1XOV A;  2P4R A;  3VS2 A;  1NLP C;  2CSQ A;  2JW4 A;  1WX6 A;  2F2X A;  4IIM A;  4J9H A;  2EYX A;  2J06 A;  2KE9 A;  1PRM C;  2QDL A;  1UHF A;  1CKA A;  3LH5 A;  3TSZ A;  1AVZ C;  2KBT A;  2K6D A;  2W0Z A;  4CC2 A;  3I35 A;  1QWE A;  1PRL C;  2XMF A;  4RTY A;  2DL7 A;  2AKK A;  1WDX A;  1TG0 A;  1UUE A;  3QWY A;  4OMQ A;  2DL3 A;  2HCK A;  5FW9 A;  2A08 A;  1WIE A;  1YNZ A;  2KYM A;  3EHQ A;  2DJQ A;  1NEB A;  2RQV A;  3RBB B;  3VS1 A;  1B3Q A;  2HSP A;  1WI7 A;  4JZ3 A;  2NUZ A;  4E6R A;  1X6B A;  1MV3 A;  1AWJ A;  4QT7 A;  1AWO A;  5GJV B;  1E6G A;  4LUD A;  1KFZ A;  2LQN A;  3IQL A;  2KR3 A;  1RUW A;  1S1N A;  2GTJ A;  1OV3 A;  2EW3 A;  4ORZ A;  2RQT A;  4HXJ A;  1M27 C;  2DE0 X;  5IHK A;  1QCF A;  2LP5 A;  4HVW A;  1M30 A;  1H92 A;  1K0X A;  2DYB A;  3UF4 A;  1ZLM A;  4OMP A;  5FWB A;  4JJC A;  3QWX X;  4AG1 C;  2DX1 A;  3O5Z A;  5I11 A;  5FWC A;  1PKS A;  2A36 A;  3M0P A;  2CT4 A;  1K76 A;  1TUD A;  4CC3 A;  2C0I A;  2HEQ A;  1KIK A;  1SRL A;  2KT8 A;  2ABL A;  1UEC A;  5IHI A;  2EGE A;  3REB B;  3EHR A;  1HD3 A;  4J9I A;  2MCN A;  3EG1 A;  2D0N A;  4DEX A;  2K9G A;  1T0H A;  2J6F A;  1UTI A;  4F14 A;  1GFC A;  2DL4 A;  2RF0 A;  1NM7 A;  2LJ1 A;  1NYF A;  2VVK A;  2DBM A;  2RMO A;  2YUO A;  2ESW A;  3JV3 A;  4R0K A;  2EYY A;  1M8M A;  2D1X A;  1AD5 A;  1KSW A;  2JMA A;  2A28 A;  1HSQ A;  1PNJ A;  5IHN A;  2PZ1 A;  2GQI A;  3NHN A;  2BZ8 A;  4LE9 A;  2BTT A;  1MUZ A;  3M0T A;  1UGV A;  2JXB A;  2GBQ A;  1SEM A;  2O88 A;  2FRY A;  1FYN A;  1UDL A;  1WLP B;  2DRK A;  1PWT A;  2ENM A;  2YUP A;  5GJW B;  1QWF A;  4FSS A;  1X43 A;  3TSW A;  1AZE A;  2EBP A;  2JMC A;  2M0Y A;  2DRM A;  2KT1 A;  4AFQ C;  2EVR A;  3EG3 A;  3VS3 A;  2YUN A;  2AKL A;  2A37 A;  2MOX A;  5HCK A;  1RLP C;  1PKT A;  4J9B A;  2J7I A;  1I07 A;  2GNC A;  2GGR A;  1BB9 A;  2YSQ A;  3TVT A;  1U06 A;  3VS6 A;  1ZUU A;  4OMM A;  1U3O A;  4LNP A;  2L3Q A;  4LN2 A;  5IXF A;  2LJ3 A;  2YT6 A;  1VYU A;  2L0A A;  1OOT A;  2CSI A;  1V1C A;  4X1V A;  2FPF A;  4F16 A;  4Y92 A;  1WXB A;  1U5S A;  2MIO A;  3SEM A;  3PVL A;  2C0O A;  4M4Z A;  2C0T A;  3VRZ A;  2B86 A;  2JM9 A;  1CKB A;  1W6X A;  1IO6 A;  1OEB A;  2K3B A;  1I1J A;  3CQT A;  2SEM A;  2ED1 A;  1JXM A;  1UG1 A;  4J9G A;  1NG2 A;  4F17 A;  5L23 A;  1NLO C;  1RLQ C;  1NYG A;  1Y57 A;  2ROL A;  1E6H A;  1GCQ A;  4GLM A;  3EG2 A;  2FRW A;  1AEY A;  2HBW A;  3UAT A;  2J05 A;  1ABO A;  2RN8 A;  3THK A;  1K9A A;  3NGP A;  1X2Q A;  2CUB A;  1FMK A;  1N5Z A;  3GBQ A;  5EC7 A;  2O9V A;  4DEY A;  2SRC A;  4RTW A;  4ESR A;  1H3H A;  3C0C A;  2K7A A;  1ABQ A;  3KFV A;  2ED0 A;  2V1Q A;  4WCI A;  2BZY A;  1UFF A;  2K2M A;  2LQW A;  1G2B A;  2KEA A;  1UHC A;  1AZG B;  2PTK A;  1K1Z A;  5IH2 A;  2W10 A;  1ZX6 A;  4IIO A;  1UJ0 A;  2G6F X;  1SSH A;  1SHF A;  4J9E A;  2NWM A;  4K11 A;  4D8D A;  4AFZ C;  4LUE A;  3M0U A;  2CRE A;  2EGC A;  1UJY A;  1CSK A;  1B07 A;  5ECA A;  3VS7 A;  2KRO A;  3I9Q A;  1AOJ A;  2JS0 A;  1BBZ A;  2KRM A;  4J9D A;  4AG2 C;  2X3X D;  1SRM A;  2FO0 A;  2OAW A;  1MV0 B;  2LNH B;  2KNB B;  2KRS A;  4JPB W;  1I0C A;  1W1F A;  1GCQ C;  2EYW A;  2JS2 A;  3UA7 A;  5IXB A;  2YUQ A;  2DIL A;  4CC7 A;  3H41 A;  1VYV A;  1M3B A;  4GBQ A;  2DM1 A;  1BK2 A;  3M0R A;  3NPF A;  1A0N B;  1M3A A;  2CT3 A;  2CDT A;  1RI9 A;  2DA9 A;  3U23 A;  2KGT A;  2RQU A;  3ZL7 C;  4HVU A;  4D8K A;  3M0Q A;  4Z88 A;  1ARK A;  1GBR A;  1WXU A;  2JT4 A;  4RTV A;  2EPD A;  2EQI A;  1YWO A;  2IIM A;  1T3S A;  2OI3 A;  2DF6 A;  4J9F A;  3REA B;  3H0H A;  2ECZ A;  3EG0 A;  1YWP A;  2F2W A;  1Z9Q A;  1QKW A;  2DL5 A;  4AFU C;  2EGA A;  1VYT A;  3PVQ A;  1ZUK A;  1G83 A;  3VS5 A;  1GL5 A;  4EIK A;  2X3W D;  4JJD A;  1X2K A;  1ZUY A;  4HCK A;  1WYX A;  1X6G A;  1QLY A;  4OMN A;  1GCP A;  1VA7 A;  2RPN A;  1SHG A;  3R6N A;  1Y0M A;  1WFW A;  1YCS B;  1YN8 A;  1M3C A;  4RTZ A;  3VS0 A;  2D8J A;  4RUG A;  2CH4 A;  2EYZ A;  2L3S A;  4Z89 A;  3M0S A;  1BU1 A;  2O2O A;  3H0I A;  1X69 A;  2JM8 A;  3ULR B;  4OML A;  1JO8 A;  2FEI A;  1WA7 A;  1H8K A;  4Z8A A;  2RNA A;  3A98 A;  1QKX A;  1OPL A;  3PE0 A;  4JJB A;  3I5R A;  2L3P A;  2VKN A;  2E5K A;  1JEG A;  1UE9 A;  2H8H A;  2K79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...