5GJVB

Structure of the mammalian voltage-gated calcium channel cav1.1 complex at near atomic resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
100
structure length
100
Chain Sequence
QGPHMALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVEGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1S
publication title Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
total genus 24
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2016-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5gjvB00
3IQLA 1X69A 2EGCA 2KRSA 1NM7A 4J9IA 2GQIA 2XMFA 2DE0X 3VS3A 2FG0A 2DVJA 2AKLA 5I22A 4KRTA 2DLPA 1U3OA 1W6XA 1SHGA 2DBKA 1UHFA 2GNCA 5EC7A 5IH2A 2RQTA 4HVWA 3VS5A 3UA7A 2DM1A 3A98A 4OMLA 1JXMA 2KXCA 2DMOA 4QT7A 3REBB 2RQUA 2ROTA 1ZUYA 2LX7A 4HXJA 4RTUA 4CC2A 2ESWA 2AZSA 5IXFA 1TG0A 3M0PA 1GCQC 1N5ZA 4CC4B 2ENMA 2ABLA 3ZL7C 1OOTA 3TSWA 2AK5A 1NLOC 2KBTA 1UJ0A 1WIEA 2FEIA 3NMZC 2F2XA 3M0RA 2V1QA 1J3TA 4X1VA 1ZSGA 1HD3A 4EIKA 1UGVA 2JT4A 2AZVA 2K79A 2P4RA 1Z9ZA 4LE9A 2K3BA 2L3SA 3C0CA 1AVZC 1X2KA 2JTEA 1UECA 1PRMC 1U06A 2BZXA 1I1JA 3EG2A 2MCNA 1RLPC 1E6HA 2RMOA 2EGEA 2VWFA 4IIOA 4LNPA 3SHWA 1G83A 2CREA 1ZBJA 4DEYA 4RTWA 2YUPA 3NGPA 1X6GA 3JV3A 3UATA 5GJVB 4AG1C 1PNJA 4JZ4A 4JJBA 5FW9A 2PZ1A 2O31A 4F17A 3THKA 1PKSA 1AWOA 2J06A 2D1XA 2KR3A 4A63B 1PHTA 1ABQA 1Z9QA 4CC7A 2D0NA 2GBQA 1SPKA 2ED1A 1UDLA 4E6RA 1E7OA 1M3CA 2RF0A 1RI9A 2HCKA 3NPFA 3RNJA 4RTVA 1WDXA 1GBRA 2C0IA 2O9SA 1U5SA 1VYTA 2FPEA 5ECAA 2DILA 2J6KA 1SEMA 1WXUA 2VVKA 2A28A 3M0UA 4J9FA 4OMMA 1K9AA 4RTYA 2LJ0A 2GTJA 1AZGB 2EYZA 3LH5A 3U23A 4RTTA 2K6DA 4Z88A 4J9GA 1WFWA 2LP5A 2JS2A 2A08A 3UF4A 2RQWA 2DRMA 2DL7A 3I9QA 3UA6A 4OMPA 1T3LA 1VA7A 5IHIA 1VYVA 4RTZA 1CKBA 1QWFA 1WLPB 3FJ5A 2C0TA 1BK2A 2X3WD 1T3SA 4OMQA 2YT6A 3PVQA 3SEMA 4WCIA 2L0AA 3VS0A 1I07A 1WX6A 1EFNA 1OPLA 2EW3A 2LJ1A 2MIOA 2DX1A 4AFZC 1JEGA 3VS6A 1CSKA 2EKHA 1ABOA 1NYGA 2KYMA 1CKAA 1W1FA 2RN8A 4M4ZA 3EG3A 2CH4A 1AZEA 3VS1A 1YCSB 3ULRB 1GCQA 4FSSA 2J6FA 1MV3A 1G2BA 1BU1A 1GCPA 2BZYA 1HJDA 1YN8A 1Y57A 4ORZA 5FWCA 2KE9A 1PWTA 2KRMA 1UUEA 2K2MA 4HCKA 2EYWA 1RUWA 2O2OA 2EBPA 2HEQA 2ROLA 3QWXX 3KFVA 2FRYA 1RLQC 2OAWA 4Z89A 2A37A 2M0YA 1UTIA 4ZNXA 2KT8A 1B3QA 2AKKA 4LN2A 1GBQA 1WI7A 5IHNA 1OPKA 2CT3A 1KSWA 4AFUC 2C0OA 1UHCA 1X2QA 1BBZA 2L3QA 2CUDA 3I5SA 5IHKA 2QDLA 1H8KA 2L2PA 1FYNA 1M3BA 1JXOA 2DJQA 1M8MA 2YUNA 3I35A 2KYBA 1M27C 1ZX6A 1H3HA 1MV0B 3PE0A 3VRYA 3EG0A 1ZUKA 1QLYA 2LQNA 4K11A 2K9GA 2EGAA 4D8KA 1QKXA 1ARKA 1KIKA 2RPNA 3TSZA 1A0NB 4HVVA 1SRMA 3VS7A 1H92A 1KFZA 2F2VA 2DL8A 1JO8A 2SEMA 2G6FX 1WYXA 1UFFA 2LMJA 1LCKA 1JQQA 2LNHB 2KT1A 2DBMA 2JMAA 3RBBB 1UG1A 3VS4A 2O88A 2DRKA 3M0SA 2YSQA 1GFCA 1V1CA 4J9EA 2EVRA 2DL5A 1K1ZA 2LQWA 1SSHA 2M51A 2NWMA 2J6OA 1YP5A 2BZ8A 3H41A 4JJCA 3H0IA 1T0JA 1UJYA 1TUDA 4JJDA 2OJ2A 1W70A 4F16A 2J05A 1MUZA 2VKNA 3O5ZA 4ESRA 2DNUA 3GBQA 4LUDA 2EYXA 1FMKA 2GTOA 4JPBW 2DYBA 1K0XA 1K76A 2OI3A 2DL4A 2JW4A 2KRNA 4AFSC 3EG1A 3NHNA 2DF6A 5I11A 4Y92A 1K0SA 1XOVA 4RTXA 1M3AA 1TUCA 4OMOA 4J9HA 2YDLA 1HSQA 2NUZA 2MOXA 1WXTA 3M0QA 1S1NA 4DEXA 1QKWA 1VYUA 3M0TA 1NEGA 2YUOA 2O9VA 1ZLMA 2IIMA 3I5RA 3VRZA 1SHFA 1OV3A 1PKTA 2X3XD 3EHRA 2HSPA 1GRIA 4F14A 2LZ6B 2ECZA 2GGRA 2CUBA 1AWWA 3CQTA 2KNBB 3EHQA 1GFDA 2JM9A 1OEBA 2FPFA 2DL3A 2F2WA 2K7AA 2KROA 1PRLC 1NLPC 2RQVA 2CH4W 3VS2A 2FRWA 3TVTA 5IXBA 4J9BA 2RNAA 2LJ3A 2JS0A 4RUGA 2EYYA 4CC3A 1Y0MA 1X43A 2L3PA 1AOJA 1AWXA 4IIMA 3REAB 2RQRA 2FPDA 4HVUA 1M30A 2W10A 1T0HA 4AG2C 2YUQA 2D8JA 1ZUUA 4AFQC 1NEBA 2W0ZA 1QWEA 2BTTA 1YWOA 2V1RA 1K4US 1YNZA 1GL5A 5L23A 1QCFA 2H8HA 1E6GA 4OMNA 2D8HA 2CDTA 2JM8A 3R6NA 2I0NA 4LUEA 3H0FA 2KGTA 2KEAA 2EPDA 2LCSA 1I0CA 1IO6A 1WXBA 1AWJA 1NG2A 1SRLA 4D8DA 3EGUA 1X27A 5HCKA 2CSQA 1YWPA 4JZ3A 2CT4A 1AEYA 1UE9A 4Z8AA 2JXBA 1JU5C 4GLMA 2FO0A 1AD5A 1KJWA 4J9CA 2HDAA 4J9DA 2B86A 2E5KA 1BB9A 2J7IA 2KXDA 2EQIA 1B07A 3H0HA 1WA7A 2ED0A 5GJWB 2DA9A 4GBQA 3PVLA 2SRCA 1X6BA 1NYFA 4R0KA 2CSIA 3QWYA 2A36A 5FWBA 2PNIA 2PTKA 2HBWA 2JMCA
chains in the Genus database with same CATH superfamily
4ZGDB 3IQLA 1YJ9A 2DD5A 2KVQG 5LJ3g 3PMTA 4J9IA 2GQIA 3CXCP 1G3SA 5J26A 2DE0X 4L59A 3VS3A 2FG0A 4M75B 3VV0A 2DVEA 3PIOA 3G71T 2DLPA 1U3OA 1YJ9Q 3CBOA 4MMKA 3QJYA 2JUFA 3QIIA 5EC7A 2RQTA 4DBRA 3LW5E 3UA7A 2YWWA 2KXCA 2DMOA 4QT7A 5GMKi 2QI2A 1SG5A 3CCUT 3RIRA 2HD0A 2O4XB 2ROTA 4N4HA 2ZPGB 3CCET 2BE7D 5CQYA 3V7RA 1UGRB 5IXFA 4M7DG 3HFNA 4CC4B 1W2BP 2ABLA 4QVDA 5DY9A 3TSWA 2AK5A 5FRNA 1NLOC 1UJ0A 4OB1B 4HCZA 1BI1A 3CXCA 1J3TA 4X1VA 1Q7YR 3QKJA 1ZSGA 3M57A 2L89A 4EIKA 2BE9B 3EAEA 5DM7R 5AYFA 3QYGB 1PC0A 1AVZC 1X2KA 2JTEA 1UECA 4BB7A 3QJ6A 2BZXA 1I1JA 2MCNA 2O01E 2RMOA 2VWFA 5GAMh 3M4GA 3TEEA 3MCAB 3HKSA 1M2OA 3UATA 3VKIA 2QXFA 4F7UA 1K8AR 1M2VA 2RHIA 1W2BA 2DYIA 2ZGWA 3C94A 5FW9A 2P0PA 3L2ZA 4C5EA 3D7SB 4EMKA 4F17A 1PKSA 1MNDA 3M9QA 1IRXA 2AT1B 3F70A 2D1XA 2J06A 4A63B 3WVDB 1ABQA 4CC7A 2GBQA 4C92E 1E7OA 2WSCE 4RTVA 2MPXC 2O9SA 1Q81R 1U1SA 1B34B 5GMKe 1EX4A 1SEMA 1WXUA 2VVKA 2XDBA 4X9CA 3MP8A 2ATCB 3M56A 2K4YA 1KC8R 2FB7A 3LH5A 3U23A 4RTTA 2K6DA 2DPPB 3UF4A 2RQWA 2DL7A 4OMPA 4BUGA 1VA7A 1KG1A 3P8BB 3L2VA 1QWFA 1WLPB 4AT1B 1JJ2P 3J7AF 1BK2A 2X3WD 1Q7YU 2IVWA 3CCQA 3CCMA 4E7IA 3SWNB 3SEMA 4WCIA 3VS0A 2PVDB 5C6SA 3OA6A 1WX6A 2FZKB 1EFNA 2CP6A 1NBEB 1IHWA 2DX1A 3VS6A 3NFCA 3CCQQ 1KHCA 3CCMQ 1CKAA 4BE1A 1VQ4T 3CCVA 4JS4A 5GAOq 4HT9A 1VQ4A 2DXUA 4FSSA 2LQKA 4C5GA 1MV3A 1K8AU 1W2BS 2NYSA 3CCRA 1BU1A 1GCPA 2E6ZA 3CCVQ 4ORZA 2KE9A 1PWTA 1EZZB 1VQ4Q 1UUEA 1OU8A 1M90R 3GNFB 3EGDA 4C0DB 3OS1A 3GF5A 4LDVA 4M75G 1JJ2A 1RUWA 4FW1A 3CCRQ 1BCOA 1FXXA 2HEQA 4OB3B 2ROLA 3CCLT 4HCBA 2R58A 4LDWA 3A8LB 4Z89A 1Q81U 4ATOA 4D6WA 2M0YA 3RKWA 1VQ8A 1YFNA 3JCMg 1MMNA 1GBQA 1WI7A 3OS5A 4LN2A 1VQKT 2QA4T 4E7KA 1BBZA 1RL2A 1H641 2RJFA 1KC8U 4XU3A 1VQ8Q 1VQKA 3A8MB 1H8KA 1OI1A 1FYNA 1JXOA 2EJFA 3AHUA 1ZX6A 3JCMc 3VRYA 2XD0A 4K11A 1KIKA 4RCBA 1QKXA 4ZGEB 2L5QA 2RPNA 1VQKQ 4C8QE 1KFZA 4IUVA 2P0KA 1RABB 2M9UA 3KUFA 2SEMA 2PVOB 3VJPA 2RJCA 4MZMA 4XTUA 3G7ZA 2O88A 7AT1B 4IUQA 2YSQA 1GFCA 1LNXA 2XHCA 4NS5A 1XTDA 2EVRA 1K1ZA 2LQWA 2M51A 3BE3A 5FROA 1S72A 1UJYA 5GAOr 1R0BG 4F16A 2VKNA 3O5ZA 2E64A 4EDUA 1M90U 2DNUA 1X75C 4C0ZA 1SSFA 1D0XA 5FRMA 2D6FA 1S72Q 1JJ2S 4LUDA 3QPHA 1FMKA 2PUKB 4JPBW 3VYHB 1SKUB 2QEXA 1C1AA 1N27A 1K76A 2DL4A 1KD1R 3PMIA 2KRNA 2ZZDA 3HHTB 4C8QC 4MDWA 4C0DC 1BKBA 1K0SA 2QEXQ 2LRQA 1M3AA 1PM3A 5KYUB 4J9HA 2YDLA 5GAMf 1HSQA 2NUZA 3JB9D 2QASA 2COYA 2H3EB 1ZSZB 4V2SA 4KUIA 3ZBDA 1MHNA 2VASA 4DEXA 3KXTA 1VYUA 3EFOB 5GAN6 2O9VA 3J81E 1ZLMA 5CKFA 2I2LA 3MP1A 4FYXB 3CC7A 2ECZA 1PSFA 1WHLA 1AWWA 3CQTA 5GAMe 3OYNA 2X35A 3EHQA 1QQJA 1TU0B 3CPWP 4C92D 2JM9A 2FPFA 2KROA 3OYGA 2MWPA 3CC7Q 5KE3A 2GQVA 1FX7A 2DZCA 2RQVA 4J9BA 4RUGA 1SF9A 2L3PA 2RI3A 4FU6A 1AWXA 3HSBA 1OU9A 5GMKm 3CC2T 2DZ9A 4HVUA 4X9DA 1BIBA 2W10A 2YUQA 1VQ9T 2M1HA 2W0ZA 1TH7A 5D6WA 2I0NA 3UDCA 4FSXA 3SFMA 4BDZA 2KEAA 3FB9A 4PNOA 1M1GA 3CPWA 2COWA 4DBHA 3OYEA 4D8DA 2XK0A 2LTOA 4Z8AA 2VV5A 1QCOA 1YHQA 5L8RE 2HQXA 4GY5A 2JZ2A 3CMAA 1D09B 1QVPA 2NLUA 4M78E 2HDAA 1NE8A 3A1PA 5LJ5h 4ZTFA 2J7IA 1NPPA 2KXDA 3M53A 3H0HA 3QHSA 2VYTA 1YHQQ 1Q82R 5GAN7 2SRCA 3JCMe 2BIVA 3OS0A 4PJNA 3JRZA 3CMAQ 1M90C 2X4WA 5FWBA 5DLQE 1VQPA 2PNIA 3OSVA 2RH2A 3DLLA 2DAQA 2KRSA 4KGZB 2LQ8A 3OYIA 4QKUA 1K73C 2YRVA 4FT2A 1UB4A 4HA8A 1VQPQ 3TREA 2P0QA 2EJGA 3CD6A 1W6XA 1SHGA 2HQHA 2DEUA 5IH2A 4HVWA 1KQSA 3X26B 1VQNA 2DM1A 4OMLA 1JXMA 3X28B 1YIJA 4HKEA 3REBB 1V76A 4M77F 5GANg 3CD6Q 1BCMA 1MMAA 1UEBA 2LX7A 4HXJA 3RDVA 5KYYA 3OSSC 3QDFA 1WJRA 2V8IA 2ESWA 4DBFA 3EGXB 4M7DE 4M78C 1NJIR 1VQNQ 3I55A 4KH0B 1YIJQ 2QTXA 4C8QD 3CCJT 1OOTA 4J7IA 2MI6A 1RADB 2NUTA 1UGPB 4MMLA 3CC4T 3I55Q 2RA2A 3CPWS 2X4XA 1HD3A 2RHYA 5C0MA 1UGVA 3CEYA 2JT4A 2MK5A 1K9MR 1U1TA 2K79A 3DKMA 1TTHB 1ZHIA 2QQSA 1LVKA 1Z9ZA 4JRKA 2QYZA 2K3BA 3EG9A 3H9NA 1U06A 3QZ5B 1RAGB 1ZBXA 3V7SA 3L2UA 3SHWA 3L2WA 4DEYA 2JNGA 2EYQA 1X6GA 4PJLA 5LJ3h 2QDYB 3OW2P 3JB9H 2OTJA 4AG1C 4M77E 3G4ST 1KD1C 1Y7XA 4M7DC 1VQOA 1MMGA 1YJNT 2O31A 3A8OB 4RMOA 2OTJQ 2YRCA 4FYYB 4A4KA 1Z9QA 4M7AF 2ED1A 1UDLA 2E41A 4E6RA 1VQMT 1KQSS 1WNLA 1VQOQ 4PJOF 3NPFA 2C0IA 2RI5A 1YCYA 3A8HB 4LDYA 2FPEA 2R57A 4QQGA 3X24B 2XKOC 4MDXA 2EIFA 4BY6B 3M0UA 4F7UF 4J9FA 1K9AA 2LJ0A 3LX7A 2Y4YA 3M55A 2EYZA 2OTLT 3QSUA 2JS2A 2A08A 4BE2A 3I9QA 4F7UB 3OW2A 1M2VB 2LNVA 1WPYA 1Y07A 1VYVA 4N4GA 4RTZA 4DOVA 1O75A 1KK7A 4E7HA 2MAMA 2C0TA 4IURA 4M77C 3BDLA 4EMKB 2XIDA 1IGQA 1K9MU 2L0AA 3G71A 3RKXA 3OS2A 1I07A 4KUDK 1YITT 2P84A 2KYMA 3QG1A 4FM4B 4FYWB 3VU3C 4XQ3A 1YITA 3CCUA 3G71Q 2IPOB 3S3OA 4M7AE 3EH2A 3EG3A 4PJOE 1LPLA 2ZPBB 1WHHA 2Y90A 1JB0E 3VS1A 3CCEA 1WHKA 3L2QA 1FMVA 3H8ZA 3PTAA 1YITQ 2CYZB 3CCUQ 3FIFA 4B9WA 3M54A 2DKGA 4MZTA 2R5MA 2KRMA 3CCEQ 4KGXB 1AT1B 2H3JA 3GLXA 4HCKA 5KH6A 4M75E 4OVAA 4J5YA 1N9SA 2JVVA 3T9NA 3OBYA 3DLMA 1RLQC 3QXEB 2A37A 4OMFB 2DTOA 4ZTJA 5LJ5f 3JCMX 2AKKA 2WSEE 4M78D 1MMDA 3QDRB 5IHNA 3UPUA 1KSWA 4L5GA 1Q82C 4IUTA 3UWNA 5AT1B 1VIFA 2JTFA 2L2PA 4M77G 2R5AA 2DJQA 5I21A 3OW2S 4M7AC 4RKUE 1H3HA 1QW1A 4PJOC 3EG0A 1ZUKA 2YHTA 3TSZA 5GANe 3M4YA 3DB3A 3VS7A 5LJ5e 3EGDB 2PUOB 3FEOA 1ZA1B 3ZFJA 2XDDA 3MJXA 4C0GA 4N0AC 1IGUA 2PVGB 4M75C 1UFFA 2LMJA 1JQQA 4J8OA 2JMAA 3RBBB 3GOXA 1UG1A 1RI0A 5I2SA 3PFSA 4DA4A 3MEUA 4J9EA 1N8RU 2DL5A 1NJIC 1ACMB 1SSHA 2J6OA 2M0OA 4JRIA 4M7DD 4IUPA 1T0JA 4EPCA 1TUDA 4PL6A 2OJ2A 3HFOA 1W70A 1MUZA 1ZQ1A 4A4HA 4J6YA 4KT0E 1XJWB 5A0LA 1WQ7A 1OX9A 2GTOA 5CO7A 2KDSA 3I56T 2OI3A 1HXDA 2JW4A 3JCMh 2GF7A 6AT1B 5KYWA 5GAN2 4Y92A 2QQBA 4RTXA 1G5VA 4M7AG 1TUCA 1D1AA 4C92A 4OMOA 4PJOG 1QVGP 5LJ3f 4XU1A 2QTVA 1W4SA 2ZPFB 3RESA 5A2QE 4P5NA 3M0TA 1TWBA 1NEGA 2YUOA 4E2FB 4M77D 4F7UG 1RAFB 4C5IA 4DBQA 3OYJA 4L6V5 2RK1A 4LD6A 2HSEB 4VUBA 1SHFA 3URGA 4F14A 2LZ6B 5CCAA 3CBPA 4E7JA 4Q5WA 3BFMA 1WHJA 3CCLA 5LL6S 3X20B 5LJ3e 5GAMd 5GMKj 3META 2F2WA 4ANJA 1PRLC 3RMSA 2CP0A 2CZ6B 5GMKl 3FLGA 3CCLQ 3VS2A 4A54A 5IXBA 2DETA 2LJ3A 2QA4A 1QVGA 8AT1B 2RJDA 3G1JA 3REAB 4II1A 2E12A 1QMCA 2E5QA 2E10A 4A4FA 2D8JA 2QA4Q 2RB6A 1NEBA 1QWEA 2BTTA 4XAXB 2EAYA 2H8HA 3SB2A 1YJWT 4O6JA 2JM8A 1G3YA 1R8OB 3R6NA 2QAZA 4UC4A 3JCMJ 2KGTA 3PT9A 3WXMB 2EPDA 3SWNC 1IO6A 1AWJA 1NG2A 3NTIA 2RD1A 3EGUA 1X27A 2XU8A 1UE9A 3RR6A 1BYMA 3G6ET 4M7AD 2FO0A 4PJOD 1LJOA 1BB9A 1VQ7T 2XG8D 2EQIA 5HKCA 5GJWB 5FLXE 4GBQA 1X6BA 4R56A 2DXBA 5CAIA 3QO3A 1NYFA 1Q7YC 3JCMd 4XU2A 4FL6A 2JMCA 3RUXA 4M75D 3L1AA 1VQ6T 4XTWA 2RO0A 2EGCA 1NM7A 2BKDN 3VYGA 1VQ6A 4C8QA 1VIEA 5HY6A 2DVJA 4MZPA 2DBKA 4KGVB 2X4YA 1UHFA 4XTXA 4HT8A 2VC8A 1G3WA 1VQ6Q 4Y28E 3OYKA 3VS5A 3QZ9B 1QVGS 3PIPA 1K8AC 5D6YA 4DOWA 4JDSA 1OZ3A 3JAME 3EH1A 1WJSA 3OYYA 4PLIA 2DIGA 4RTUA 4CC2A 2AZSA 2CP7A 4J6WA 1TG0A 3M0PA 1GCQC 1N5ZA 2ENMA 2AHJB 2F5TX 4JJNK 4BI3A 2E70A 4E47A 4BE0A 2KBTA 1KQ1A 3E9GA 1WIEA 2FEIA 1Q81C 2FZCB 1I5OB 2V1QA 3EFRA 1Q86U 2AZVA 3OB9A 3OMCA 3CPFA 2DJZA 4OGCA 4LE9A 1KC8C 3ME9A 2Y4XA 1VQLT 3OYMA 1PRMC 5HK0A 3LLRA 3OYDA 3S3NA 3EG2A 5CKDA 2EGEA 4HCCA 5KE2A 4KBMB 1D1BA 3CC2A 1PD0A 1ZBJA 2XDPA 4RTWA 5KYYB 3NGPA 1I4K1 1VQ9A 2ZAEA 2OAUA 3HPWA 4JZ4A 3JCMf 5KCHA 1VUBA 3CC2Q 2ZPIB 2GCXA 2NUTB 3FC3A 2IG0A 4FCYA 1VOMA 4N4IA 5D7UA 3THKA 1VQ9Q 3RERA 1D0YA 4PLLA 1C6VX 2FVUA 1KQSP 2FL7A 2D0NA 2HKQB 2XICA 3P8DA 1RI9A 2HCKA 3RNJA 5CR2A 5GANh 1GBRA 3EG9B 1U5SA 5CVIA 3V8LA 5ECAA 1RACB 4C0FA 3QUIA 3SDZA 4FT4A 3GIBA 3M5AA 1ZSZC 4RTYA 1V29B 4BI4A 1AZGB 4Z88A 4J9GA 1LOJA 1WFWA 2LP5A 3N5BB 3UA6A 5GAMj 1PSEA 2LC4A 2DTHA 5IT9E 1CKBA 4EMGA 4BD3A 1WJQA 4QVZA 1IZ6A 2RHZA 5FU6B 3PVQA 4B6MA 2GFUA 2LCLA 1OPLA 2EW3A 4AFZC 3Q1JA 1CSKA 1PG5B 1ABOA 4PJMA 1NYGA 2VGNA 1W1FA 2RN8A 4M4ZA 2RI2A 2RHXA 2K3XA 4A53A 4M78A 1YCSB 2J6FA 1HYOA 5DLOA 1G2BA 1IXDA 2YXYA 2BZYA 3CCJA 4R55A 1YN8A 1Y57A 5FWCA 1PCXA 4LXCA 2K2MA 1MGQA 1QP2A 2QK0A 3CC4A 3INZA 2G3RA 2EYWA 2K5IA 2O2OA 2EBPA 3A5ZB 3CCJQ 4O5VA 2FRYA 5KYNA 2E4HA 2OAWA 2CZ1B 2F5KA 2KT8A 1FMWA 3CC4Q 5CIUA 5CKHA 1OPKA 2CT3A 2LX9A 2C0OA 1UHCA 1X2QA 3TU4K 1D1CA 3V7CA 2L3QA 4XTVA 2RK2A 3X25B 2LT4A 5IHKA 3MEVA 4KULA 1M3BA 3FJPA 3LGLA 2YUNA 2KYBA 4X34A 3O8VA 1M27C 2OX7A 5GAN5 1G8XA 3G4SA 2LQNA 1QLYA 2A0FB 4M7DA 2K9GA 1ARKA 4F04B 1A0NB 4HVVA 1SRMA 5GANd 3NTHA 2HZYA 1R0CB 2F2VA 1YJNA 2DD4A 2DL8A 5LJ5d 2CZ0B 3HTRA 2KK4A 3G4SQ 2Z0WA 4ELYC 3H6ZA 3GP8A 1VQMA 1QVFS 2LNHB 3CMET 1YJNQ 3VS4A 3CMEA 4PJJA 1O9SA 1VQMQ 2NWMA 2HL5C 1YP5A 2BZ8A 3H41A 4JJCA 3LWIA 3L42A 2X51A 2OTLA 1MNEA 1KQ2A 3CMEQ 1OULA 1I8FA 4ESRA 4RCCA 2DXCA 2E3IA 4M77A 1UGQB 3GBQA 2EYXA 5A0GA 2OTLQ 3GNGA 1JBMA 2V8KA 2DYBA 2KSSA 1K0XA 2VXEA 3SD4A 4AFSC 2DF6A 3C12A 4XTYA 4XU0A 5I11A 3MPUB 1XOVA 2X4JA 3MEAA 2YLCA 1N8RR 3JB9F 3A8GB 1UGSB 4Z02A 9ATCB 3BDUA 1D3BA 1S1NA 2HMAA 4PKCC 2YRDA 1M1FA 3RKYA 4F7UE 2K57A 3E9FA 2HL3A 3VRZA 1OV3A 1PKTA 3OMGA 5CKEA 3GPLA 2X3XD 2HSPA 2KAFA 1GRIA 2ZPHB 4BI8B 2GGRA 2CUBA 4IUUA 3WVEB 2KNBB 5GANf 1GFDA 4C92F 3OY9A 5LJ3d 5GAOm 5KYWB 2DL3A 3S6WA 3VUZA 4OF1A 1BI2A 3C95A 2E1HA 2NUPA 1NLPC 5KYXA 1DJ7B 1QP3A 2V26A 1WQWA 1Y96A 2CH4W 4QW2A 3TVTA 2FZGB 2HKNA 3PNWC 4C92B 3HRUA 2JS0A 2CP3A 1Y0MA 3CBMA 4BY6C 4LDUA 4M7AA 4CI0C 4WTOB 4PJOA 4AG2C 1N6AA 1ZUUA 1YWOA 2V1RA 1YNZA 4NL3A 1Q95G 3JCMV 1E6GA 4OMNA 2D8HA 2CDTA 3TQ7P 3QYHB 1TSFA 1P92A 2EQJA 4N0AA 2E3HA 4M75A 4EMKC 3PGGA 1M9SA 4E7SA 1WXBA 1SRLA 1AEYA 3M58A 3C4SA 4TVRA 4ZGJB 2JXBA 3R6OA 3OQ5A 4ELZC 1JU5C 5EG2A 2CKKA 4GLMA 1AD5A 2O4XA 2RHUA 4J9DA 2B86A 2PQWA 2E5KA 3MKDA 3V8JA 2YLBA 1BI3A 4J6XA 3PVLA 3QWYA 1OQKA 2PTKA 3LWHA 2HBWA 1K9MC 5GAMg 1IHVA 2QQAA 1X69A 3EFSA 5IAYA 2L8DA 3I56A 2XMFA 3CCQT 4A4EA 3CCMT 3CXCS 1H3ZA 2AKLA 5I22A 2EFIA 4KRTA 2E6NA 2VXFA 3I56Q 2FHDA 2GNCA 1YBYA 3ER0A 1XQHA 3A98A 3MEWA 1RAHB 2QGGA 1YI2T 4ZN3A 3CCVT 2RQUA 2PU9B 1ZUYA 3LGFA 1YI2A 5GANj 2XI9A 4C92C 5LJ5j 2DXTA 2L3RA 5M9OA 4BACA 2FYKA 4CRIA 3CCRT 2P4TA 3ZEHA 2DIQA 3ZL7C 4C8QF 1YI2Q 1G3TA 2LDMA 4A4GA 3NMZC 2F2XA 3BW1A 3M0RA 3V8KA 1WGSA 4C8QB 2RM4A 3OYLA 3CCST 3ASKA 1NPRA 3JSCA 2P4RA 1VQ8T 2L3SA 3C0CA 5A0DA 3CCSA 1NZ9A 3DB4A 1K73R 4JS5A 2HBPA 1B34A 2WSFE 4FYVB 4GLKA 1RLPC 1E6HA 4IIOA 1TUGB 4LNPA 3JB9G 4FW2A 5GAOp 1G83A 2JN0A 4J83A 2CREA 2KY9A 3P8HA 2YUPA 3CCSQ 2CGHA 1IREB 2CP5A 3JV3A 2A3LA 1ZA2B 1GXIE 5GJVB 2D0QB 5FU7B 1D0ZA 4NOYA 1PNJA 1YJWA 4JJBA 2K5LA 2PZ1A 2EKOA 5GAN8 1I5LA 1Q86R 4JUVA 3SWNA 1AWOA 1BI0A 2KR3A 3E1SA 1PHTA 2MYSA 1YJWQ 1SPKA 4ME7A 1N8RC 1U8RA 1M3CA 2AIRB 2RF0A 4JLGA 4C92G 1WDXA 4KH1B 3G6EA 2K2VA 2M16A 4J7FA 1VYTA 2DILA 2VUBA 2J6KA 2A28A 1VQ7A 4AMCA 4OMMA 2WACA 1M1KR 2GTJA 3G6EQ 1S72T 2CP2A 1M5Q1 2DRMA 2MWOA 1T3LA 4XTZA 4Y91A 5IHIA 1VQ7Q 5LJ3j 1IB8A 3JCMW 1WHGA 1WZOA 3FJ5A 5GAN3 2QEXT 1T3SA 4OMQA 2DERA 2YT6A 1RAAB 1TOVA 2DEQA 2ZPEB 3MHXA 2HAXA 1K73U 2LJ1A 2MIOA 1JEGA 2EKHA 3TCJA 3OYFA 4QVCA 3HRTA 5KCOA 1AZEA 2CH4A 2BUDA 4RG8A 1GCQA 1QCNA 3ULRB 4LD9K 4OP0A 3AT1B 3UT1A 3VUBA 2QQRA 1HJDA 1TS9A 1N9RA 1Y71A 5GAOn 3MP6A 3KBGA 3CC7T 2X9HA 5FU7C 4IKFA 3NTKA 3QWXX 2QGFB 3KFVA 1X6OA 2KQWA 8ATCB 4XK8E 3E19A 1WHMA 2VGMA 2C06A 1UTIA 4ZNXA 1B3QA 1VQLA 4M78F 3OYCA 2JTMA 2EWNA 4AFUC 2LCCA 5IN1A 3JCMb 1M1KU 4E7ZA 2D9TA 2CUDA 3I5SA 4M78B 2QDLA 1VQLQ 1BIAA 4PFZA 3I35A 1M8MA 1EIFA 2QQ9A 1MV0B 2F69A 3PE0A 2EGAA 4D8KA 1OYXA 2VB6A 1H92A 1AHJB 2A7YA 2E65A 4FIBA 4C8QG 4QQDA 4B9XA 4DQ2A 4JRQA 1JO8A 1JRIA 2HQEA 1QVFP 1KD1U 2G6FX 3QBYA 1WYXA 4BDYA 1LCKA 1TXQA 2KT1A 4ZN1A 1F1BB 2DBMA 4OB0B 5D6XA 3LH0A 2DRKA 3M0SA 5KYUA 1YHQT 1V1CA 2DTIA 3L2RA 3CMAT 1ZSZA 3OYHA 3LYIA 3FRNA 5HK3A 4M7DF 2JJ9A 3H0IA 3RMQA 3FDRA 3BY7A 3EFOA 4JJDA 2J05A 3JB9J 2K5FA 2DO3A 2F1LA 1VQPT 4M7DB 1VQ5T 3E2UA 4PFPA 5J3BA 1VQ5A 5GMKh 1RAEB 5CK9A 3EG1A 1QVFA 3NHNA 1HK9A 1OZ2A 2LT1A 1PD1A 4QQ6A 3CD6T 5J39A 1VQ5Q 1OX8A 2M02A 1VQNT 2MOXA 1WXTA 3M0QA 1YIJT 4YTLA 1QKWA 3OBWA 2CS7A 3J80E 3HL8A 4NL2A 2EQMA 5LJ5g 3I55T 2IIMA 3I5RA 1Q86C 3EHRA 2EQUA 5GAOl 4M77B 3JCMP 4OB2B 2CZ7B 4OGEA 4PFOA 4E7LA 3MO8A 1OEBA 2JOYA 2KI7A 2K7AA 1I81A 2COZA 1KHIA 2FRWA 2EQKA 2MMPA 1M1KC 1R77A 2RNAA 1M4ZA 2EYYA 4CC3A 1X43A 1AOJA 2QG9B 4IIMA 1D3BB 2KMTA 4EMHA 2RQRA 2FPDA 1M30A 2HNIA 1T0HA 2ZCFB 1Q82U 3HP9A 1C0MA 1B7TA 4AFQC 1X01A 2GFAA 2OTJT 2DK3A 1K4US 5GAN4 3OYAA 5L23A 4LDXA 1GL5A 1QCFA 5CQXA 3JB9I 3HRSA 1VQOT 1XNIA 2B8AA 4LUEA 3M59A 2RJEA 3H0FA 4JRPA 2V8JA 2EJ9A 4C5HA 4RG2A 5FU6C 2LCSA 1I0CA 5HCKA 2CSQA 1YWPA 4JZ3A 2CT4A 3JCMQ 1M8VA 3OYBA 2LVMA 2NUPB 5KYXB 5CKBA 1Y96B 2K3YA 4PK4A 4WF2A 2DFUA 1KJWA 4J9CA 4M78G 2MF2A 1B07A 1WA7A 4M7AB 2ED0A 1RAIB 2DA9A 3EGXA 4PJOB 5I2MA 4R0KA 3S3MA 1NJIU 2CSIA 1FWZA 2A36A 4JLIA 1YJ9T 4M75F
chains in the Genus database with same CATH topology
3IQLA 1X69A 2EGCA 2KRSA 1NM7A 4J9IA 2GQIA 2XMFA 2DE0X 3VS3A 2FG0A 2DVJA 2AKLA 5I22A 4KRTA 2DLPA 1U3OA 1W6XA 1SHGA 2DBKA 1UHFA 2GNCA 5EC7A 5IH2A 2RQTA 4HVWA 3VS5A 3UA7A 2DM1A 3A98A 4OMLA 1JXMA 2KXCA 2DMOA 4QT7A 3REBB 2RQUA 2ROTA 1ZUYA 2LX7A 4HXJA 4RTUA 4CC2A 2ESWA 2AZSA 5IXFA 1TG0A 3M0PA 1GCQC 1N5ZA 4CC4B 2ENMA 2ABLA 3ZL7C 1OOTA 3TSWA 2AK5A 1NLOC 2KBTA 1UJ0A 1WIEA 2FEIA 3NMZC 2F2XA 3M0RA 2V1QA 1J3TA 4X1VA 1ZSGA 1HD3A 4EIKA 1UGVA 2JT4A 2AZVA 2K79A 2P4RA 1Z9ZA 4LE9A 2K3BA 2L3SA 3C0CA 1AVZC 1X2KA 2JTEA 1UECA 1PRMC 1U06A 2BZXA 1I1JA 3EG2A 2MCNA 1RLPC 1E6HA 2RMOA 2EGEA 2VWFA 4IIOA 4LNPA 3SHWA 1G83A 2CREA 1ZBJA 4DEYA 4RTWA 2YUPA 3NGPA 1X6GA 3JV3A 3UATA 5GJVB 4AG1C 1PNJA 4JZ4A 4JJBA 5FW9A 2PZ1A 2O31A 4F17A 3THKA 1PKSA 1AWOA 2J06A 2D1XA 2KR3A 4A63B 1PHTA 1ABQA 1Z9QA 4CC7A 2D0NA 2GBQA 1SPKA 2ED1A 1UDLA 4E6RA 1E7OA 1M3CA 2RF0A 1RI9A 2HCKA 3NPFA 3RNJA 4RTVA 1WDXA 1GBRA 2C0IA 2O9SA 1U5SA 1VYTA 2FPEA 5ECAA 2DILA 2J6KA 1SEMA 1WXUA 2VVKA 2A28A 3M0UA 4J9FA 4OMMA 1K9AA 4RTYA 2LJ0A 2GTJA 1AZGB 2EYZA 3LH5A 3U23A 4RTTA 2K6DA 4Z88A 4J9GA 1WFWA 2LP5A 2JS2A 2A08A 3UF4A 2RQWA 2DRMA 2DL7A 3I9QA 3UA6A 4OMPA 1T3LA 1VA7A 5IHIA 1VYVA 4RTZA 1CKBA 1QWFA 1WLPB 3FJ5A 2C0TA 1BK2A 2X3WD 1T3SA 4OMQA 2YT6A 3PVQA 3SEMA 4WCIA 2L0AA 3VS0A 1I07A 1WX6A 1EFNA 1OPLA 2EW3A 2LJ1A 2MIOA 2DX1A 4AFZC 1JEGA 3VS6A 1CSKA 2EKHA 1ABOA 1NYGA 2KYMA 1CKAA 1W1FA 2RN8A 4M4ZA 3EG3A 2CH4A 1AZEA 3VS1A 1YCSB 3ULRB 1GCQA 4FSSA 2J6FA 1MV3A 1G2BA 1BU1A 1GCPA 2BZYA 1HJDA 1YN8A 1Y57A 4ORZA 5FWCA 2KE9A 1PWTA 2KRMA 1UUEA 2K2MA 4HCKA 2EYWA 1RUWA 2O2OA 2EBPA 2HEQA 2ROLA 3QWXX 3KFVA 2FRYA 1RLQC 2OAWA 4Z89A 2A37A 2M0YA 1UTIA 4ZNXA 2KT8A 1B3QA 2AKKA 4LN2A 1GBQA 1WI7A 5IHNA 1OPKA 2CT3A 1KSWA 4AFUC 2C0OA 1UHCA 1X2QA 1BBZA 2L3QA 2CUDA 3I5SA 5IHKA 2QDLA 1H8KA 2L2PA 1FYNA 1M3BA 1JXOA 2DJQA 1M8MA 2YUNA 3I35A 2KYBA 1M27C 1ZX6A 1H3HA 1MV0B 3PE0A 3VRYA 3EG0A 1ZUKA 1QLYA 2LQNA 4K11A 2K9GA 2EGAA 4D8KA 1QKXA 1ARKA 1KIKA 2RPNA 3TSZA 1A0NB 4HVVA 1SRMA 3VS7A 1H92A 1KFZA 2F2VA 2DL8A 1JO8A 2SEMA 2G6FX 1WYXA 1UFFA 2LMJA 1LCKA 1JQQA 2LNHB 2KT1A 2DBMA 2JMAA 3RBBB 1UG1A 3VS4A 2O88A 2DRKA 3M0SA 2YSQA 1GFCA 1V1CA 4J9EA 2EVRA 2DL5A 1K1ZA 2LQWA 1SSHA 2M51A 2NWMA 2J6OA 1YP5A 2BZ8A 3H41A 4JJCA 3H0IA 1T0JA 1UJYA 1TUDA 4JJDA 2OJ2A 1W70A 4F16A 2J05A 1MUZA 2VKNA 3O5ZA 4ESRA 2DNUA 3GBQA 4LUDA 2EYXA 1FMKA 2GTOA 4JPBW 2DYBA 1K0XA 1K76A 2OI3A 2DL4A 2JW4A 2KRNA 4AFSC 3EG1A 3NHNA 2DF6A 5I11A 4Y92A 1K0SA 1XOVA 4RTXA 1M3AA 1TUCA 4OMOA 4J9HA 2YDLA 1HSQA 2NUZA 2MOXA 1WXTA 3M0QA 1S1NA 4DEXA 1QKWA 1VYUA 3M0TA 1NEGA 2YUOA 2O9VA 1ZLMA 2IIMA 3I5RA 3VRZA 1SHFA 1OV3A 1PKTA 2X3XD 3EHRA 2HSPA 1GRIA 4F14A 2LZ6B 2ECZA 2GGRA 2CUBA 1AWWA 3CQTA 2KNBB 3EHQA 1GFDA 2JM9A 1OEBA 2FPFA 2DL3A 2F2WA 2K7AA 2KROA 1PRLC 1NLPC 2RQVA 2CH4W 3VS2A 2FRWA 3TVTA 5IXBA 4J9BA 2RNAA 2LJ3A 2JS0A 4RUGA 2EYYA 4CC3A 1Y0MA 1X43A 2L3PA 1AOJA 1AWXA 4IIMA 3REAB 2RQRA 2FPDA 4HVUA 1M30A 2W10A 1T0HA 4AG2C 2YUQA 2D8JA 1ZUUA 4AFQC 1NEBA 2W0ZA 1QWEA 2BTTA 1YWOA 2V1RA 1K4US 1YNZA 1GL5A 5L23A 1QCFA 2H8HA 1E6GA 4OMNA 2D8HA 2CDTA 2JM8A 3R6NA 2I0NA 4LUEA 3H0FA 2KGTA 2KEAA 2EPDA 2LCSA 1I0CA 1IO6A 1WXBA 1AWJA 1NG2A 1SRLA 4D8DA 3EGUA 1X27A 5HCKA 2CSQA 1YWPA 4JZ3A 2CT4A 1AEYA 1UE9A 4Z8AA 2JXBA 1JU5C 4GLMA 2FO0A 1AD5A 1KJWA 4J9CA 2HDAA 4J9DA 2B86A 2E5KA 1BB9A 2J7IA 2KXDA 2EQIA 1B07A 3H0HA 1WA7A 2ED0A 5GJWB 2DA9A 4GBQA 3PVLA 2SRCA 1X6BA 1NYFA 4R0KA 2CSIA 3QWYA 2A36A 5FWBA 2PNIA 2PTKA 2HBWA 2JMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQL A;  1X69 A;  2EGC A;  2KRS A;  1NM7 A;  4J9I A;  2GQI A;  2XMF A;  2DE0 X;  3VS3 A;  2FG0 A;  2DVJ A;  2AKL A;  5I22 A;  4KRT A;  2DLP A;  1U3O A;  1W6X A;  1SHG A;  2DBK A;  1UHF A;  2GNC A;  5EC7 A;  5IH2 A;  2RQT A;  4HVW A;  3VS5 A;  3UA7 A;  2DM1 A;  3A98 A;  4OML A;  1JXM A;  2KXC A;  2DMO A;  4QT7 A;  3REB B;  2RQU A;  2ROT A;  1ZUY A;  2LX7 A;  4HXJ A;  4RTU A;  4CC2 A;  2ESW A;  2AZS A;  5IXF A;  1TG0 A;  3M0P A;  1GCQ C;  1N5Z A;  4CC4 B;  2ENM A;  2ABL A;  3ZL7 C;  1OOT A;  3TSW A;  2AK5 A;  1NLO C;  2KBT A;  1UJ0 A;  1WIE A;  2FEI A;  3NMZ C;  2F2X A;  3M0R A;  2V1Q A;  1J3T A;  4X1V A;  1ZSG A;  1HD3 A;  4EIK A;  1UGV A;  2JT4 A;  2AZV A;  2K79 A;  2P4R A;  1Z9Z A;  4LE9 A;  2K3B A;  2L3S A;  3C0C A;  1AVZ C;  1X2K A;  2JTE A;  1UEC A;  1PRM C;  1U06 A;  2BZX A;  1I1J A;  3EG2 A;  2MCN A;  1RLP C;  1E6H A;  2RMO A;  2EGE A;  2VWF A;  4IIO A;  4LNP A;  3SHW A;  1G83 A;  2CRE A;  1ZBJ A;  4DEY A;  4RTW A;  2YUP A;  3NGP A;  1X6G A;  3JV3 A;  3UAT A;  5GJV B;  4AG1 C;  1PNJ A;  4JZ4 A;  4JJB A;  5FW9 A;  2PZ1 A;  2O31 A;  4F17 A;  3THK A;  1PKS A;  1AWO A;  2J06 A;  2D1X A;  2KR3 A;  4A63 B;  1PHT A;  1ABQ A;  1Z9Q A;  4CC7 A;  2D0N A;  2GBQ A;  1SPK A;  2ED1 A;  1UDL A;  4E6R A;  1E7O A;  1M3C A;  2RF0 A;  1RI9 A;  2HCK A;  3NPF A;  3RNJ A;  4RTV A;  1WDX A;  1GBR A;  2C0I A;  2O9S A;  1U5S A;  1VYT A;  2FPE A;  5ECA A;  2DIL A;  2J6K A;  1SEM A;  1WXU A;  2VVK A;  2A28 A;  3M0U A;  4J9F A;  4OMM A;  1K9A A;  4RTY A;  2LJ0 A;  2GTJ A;  1AZG B;  2EYZ A;  3LH5 A;  3U23 A;  4RTT A;  2K6D A;  4Z88 A;  4J9G A;  1WFW A;  2LP5 A;  2JS2 A;  2A08 A;  3UF4 A;  2RQW A;  2DRM A;  2DL7 A;  3I9Q A;  3UA6 A;  4OMP A;  1T3L A;  1VA7 A;  5IHI A;  1VYV A;  4RTZ A;  1CKB A;  1QWF A;  1WLP B;  3FJ5 A;  2C0T A;  1BK2 A;  2X3W D;  1T3S A;  4OMQ A;  2YT6 A;  3PVQ A;  3SEM A;  4WCI A;  2L0A A;  3VS0 A;  1I07 A;  1WX6 A;  1EFN A;  1OPL A;  2EW3 A;  2LJ1 A;  2MIO A;  2DX1 A;  4AFZ C;  1JEG A;  3VS6 A;  1CSK A;  2EKH A;  1ABO A;  1NYG A;  2KYM A;  1CKA A;  1W1F A;  2RN8 A;  4M4Z A;  3EG3 A;  2CH4 A;  1AZE A;  3VS1 A;  1YCS B;  3ULR B;  1GCQ A;  4FSS A;  2J6F A;  1MV3 A;  1G2B A;  1BU1 A;  1GCP A;  2BZY A;  1HJD A;  1YN8 A;  1Y57 A;  4ORZ A;  5FWC A;  2KE9 A;  1PWT A;  2KRM A;  1UUE A;  2K2M A;  4HCK A;  2EYW A;  1RUW A;  2O2O A;  2EBP A;  2HEQ A;  2ROL A;  3QWX X;  3KFV A;  2FRY A;  1RLQ C;  2OAW A;  4Z89 A;  2A37 A;  2M0Y A;  1UTI A;  4ZNX A;  2KT8 A;  1B3Q A;  2AKK A;  4LN2 A;  1GBQ A;  1WI7 A;  5IHN A;  1OPK A;  2CT3 A;  1KSW A;  4AFU C;  2C0O A;  1UHC A;  1X2Q A;  1BBZ A;  2L3Q A;  2CUD A;  3I5S A;  5IHK A;  2QDL A;  1H8K A;  2L2P A;  1FYN A;  1M3B A;  1JXO A;  2DJQ A;  1M8M A;  2YUN A;  3I35 A;  2KYB A;  1M27 C;  1ZX6 A;  1H3H A;  1MV0 B;  3PE0 A;  3VRY A;  3EG0 A;  1ZUK A;  1QLY A;  2LQN A;  4K11 A;  2K9G A;  2EGA A;  4D8K A;  1QKX A;  1ARK A;  1KIK A;  2RPN A;  3TSZ A;  1A0N B;  4HVV A;  1SRM A;  3VS7 A;  1H92 A;  1KFZ A;  2F2V A;  2DL8 A;  1JO8 A;  2SEM A;  2G6F X;  1WYX A;  1UFF A;  2LMJ A;  1LCK A;  1JQQ A;  2LNH B;  2KT1 A;  2DBM A;  2JMA A;  3RBB B;  1UG1 A;  3VS4 A;  2O88 A;  2DRK A;  3M0S A;  2YSQ A;  1GFC A;  1V1C A;  4J9E A;  2EVR A;  2DL5 A;  1K1Z A;  2LQW A;  1SSH A;  2M51 A;  2NWM A;  2J6O A;  1YP5 A;  2BZ8 A;  3H41 A;  4JJC A;  3H0I A;  1T0J A;  1UJY A;  1TUD A;  4JJD A;  2OJ2 A;  1W70 A;  4F16 A;  2J05 A;  1MUZ A;  2VKN A;  3O5Z A;  4ESR A;  2DNU A;  3GBQ A;  4LUD A;  2EYX A;  1FMK A;  2GTO A;  4JPB W;  2DYB A;  1K0X A;  1K76 A;  2OI3 A;  2DL4 A;  2JW4 A;  2KRN A;  4AFS C;  3EG1 A;  3NHN A;  2DF6 A;  5I11 A;  4Y92 A;  1K0S A;  1XOV A;  4RTX A;  1M3A A;  1TUC A;  4OMO A;  4J9H A;  2YDL A;  1HSQ A;  2NUZ A;  2MOX A;  1WXT A;  3M0Q A;  1S1N A;  4DEX A;  1QKW A;  1VYU A;  3M0T A;  1NEG A;  2YUO A;  2O9V A;  1ZLM A;  2IIM A;  3I5R A;  3VRZ A;  1SHF A;  1OV3 A;  1PKT A;  2X3X D;  3EHR A;  2HSP A;  1GRI A;  4F14 A;  2LZ6 B;  2ECZ A;  2GGR A;  2CUB A;  1AWW A;  3CQT A;  2KNB B;  3EHQ A;  1GFD A;  2JM9 A;  1OEB A;  2FPF A;  2DL3 A;  2F2W A;  2K7A A;  2KRO A;  1PRL C;  1NLP C;  2RQV A;  2CH4 W;  3VS2 A;  2FRW A;  3TVT A;  5IXB A;  4J9B A;  2RNA A;  2LJ3 A;  2JS0 A;  4RUG A;  2EYY A;  4CC3 A;  1Y0M A;  1X43 A;  2L3P A;  1AOJ A;  1AWX A;  4IIM A;  3REA B;  2RQR A;  2FPD A;  4HVU A;  1M30 A;  2W10 A;  1T0H A;  4AG2 C;  2YUQ A;  2D8J A;  1ZUU A;  4AFQ C;  1NEB A;  2W0Z A;  1QWE A;  2BTT A;  1YWO A;  2V1R A;  1K4U S;  1YNZ A;  1GL5 A;  5L23 A;  1QCF A;  2H8H A;  1E6G A;  4OMN A;  2D8H A;  2CDT A;  2JM8 A;  3R6N A;  2I0N A;  4LUE A;  3H0F A;  2KGT A;  2KEA A;  2EPD A;  2LCS A;  1I0C A;  1IO6 A;  1WXB A;  1AWJ A;  1NG2 A;  1SRL A;  4D8D A;  3EGU A;  1X27 A;  5HCK A;  2CSQ A;  1YWP A;  4JZ3 A;  2CT4 A;  1AEY A;  1UE9 A;  4Z8A A;  2JXB A;  1JU5 C;  4GLM A;  2FO0 A;  1AD5 A;  1KJW A;  4J9C A;  2HDA A;  4J9D A;  2B86 A;  2E5K A;  1BB9 A;  2J7I A;  2KXD A;  2EQI A;  1B07 A;  3H0H A;  1WA7 A;  2ED0 A;  5GJW B;  2DA9 A;  4GBQ A;  3PVL A;  2SRC A;  1X6B A;  1NYF A;  4R0K A;  2CSI A;  3QWY A;  2A36 A;  5FWB A;  2PNI A;  2PTK A;  2HBW A;  2JMC A; 
#chains in the Genus database with same CATH topology
 4ZGD B;  3IQL A;  1YJ9 A;  2DD5 A;  2KVQ G;  5LJ3 g;  3PMT A;  4J9I A;  2GQI A;  3CXC P;  1G3S A;  5J26 A;  2DE0 X;  4L59 A;  3VS3 A;  2FG0 A;  4M75 B;  3VV0 A;  2DVE A;  3PIO A;  3G71 T;  2DLP A;  1U3O A;  1YJ9 Q;  3CBO A;  4MMK A;  3QJY A;  2JUF A;  3QII A;  5EC7 A;  2RQT A;  4DBR A;  3LW5 E;  3UA7 A;  2YWW A;  2KXC A;  2DMO A;  4QT7 A;  5GMK i;  2QI2 A;  1SG5 A;  3CCU T;  3RIR A;  2HD0 A;  2O4X B;  2ROT A;  4N4H A;  2ZPG B;  3CCE T;  2BE7 D;  5CQY A;  3V7R A;  1UGR B;  5IXF A;  4M7D G;  3HFN A;  4CC4 B;  1W2B P;  2ABL A;  4QVD A;  5DY9 A;  3TSW A;  2AK5 A;  5FRN A;  1NLO C;  1UJ0 A;  4OB1 B;  4HCZ A;  1BI1 A;  3CXC A;  1J3T A;  4X1V A;  1Q7Y R;  3QKJ A;  1ZSG A;  3M57 A;  2L89 A;  4EIK A;  2BE9 B;  3EAE A;  5DM7 R;  5AYF A;  3QYG B;  1PC0 A;  1AVZ C;  1X2K A;  2JTE A;  1UEC A;  4BB7 A;  3QJ6 A;  2BZX A;  1I1J A;  2MCN A;  2O01 E;  2RMO A;  2VWF A;  5GAM h;  3M4G A;  3TEE A;  3MCA B;  3HKS A;  1M2O A;  3UAT A;  3VKI A;  2QXF A;  4F7U A;  1K8A R;  1M2V A;  2RHI A;  1W2B A;  2DYI A;  2ZGW A;  3C94 A;  5FW9 A;  2P0P A;  3L2Z A;  4C5E A;  3D7S B;  4EMK A;  4F17 A;  1PKS A;  1MND A;  3M9Q A;  1IRX A;  2AT1 B;  3F70 A;  2D1X A;  2J06 A;  4A63 B;  3WVD B;  1ABQ A;  4CC7 A;  2GBQ A;  4C92 E;  1E7O A;  2WSC E;  4RTV A;  2MPX C;  2O9S A;  1Q81 R;  1U1S A;  1B34 B;  5GMK e;  1EX4 A;  1SEM A;  1WXU A;  2VVK A;  2XDB A;  4X9C A;  3MP8 A;  2ATC B;  3M56 A;  2K4Y A;  1KC8 R;  2FB7 A;  3LH5 A;  3U23 A;  4RTT A;  2K6D A;  2DPP B;  3UF4 A;  2RQW A;  2DL7 A;  4OMP A;  4BUG A;  1VA7 A;  1KG1 A;  3P8B B;  3L2V A;  1QWF A;  1WLP B;  4AT1 B;  1JJ2 P;  3J7A F;  1BK2 A;  2X3W D;  1Q7Y U;  2IVW A;  3CCQ A;  3CCM A;  4E7I A;  3SWN B;  3SEM A;  4WCI A;  3VS0 A;  2PVD B;  5C6S A;  3OA6 A;  1WX6 A;  2FZK B;  1EFN A;  2CP6 A;  1NBE B;  1IHW A;  2DX1 A;  3VS6 A;  3NFC A;  3CCQ Q;  1KHC A;  3CCM Q;  1CKA A;  4BE1 A;  1VQ4 T;  3CCV A;  4JS4 A;  5GAO q;  4HT9 A;  1VQ4 A;  2DXU A;  4FSS A;  2LQK A;  4C5G A;  1MV3 A;  1K8A U;  1W2B S;  2NYS A;  3CCR A;  1BU1 A;  1GCP A;  2E6Z A;  3CCV Q;  4ORZ A;  2KE9 A;  1PWT A;  1EZZ B;  1VQ4 Q;  1UUE A;  1OU8 A;  1M90 R;  3GNF B;  3EGD A;  4C0D B;  3OS1 A;  3GF5 A;  4LDV A;  4M75 G;  1JJ2 A;  1RUW A;  4FW1 A;  3CCR Q;  1BCO A;  1FXX A;  2HEQ A;  4OB3 B;  2ROL A;  3CCL T;  4HCB A;  2R58 A;  4LDW A;  3A8L B;  4Z89 A;  1Q81 U;  4ATO A;  4D6W A;  2M0Y A;  3RKW A;  1VQ8 A;  1YFN A;  3JCM g;  1MMN A;  1GBQ A;  1WI7 A;  3OS5 A;  4LN2 A;  1VQK T;  2QA4 T;  4E7K A;  1BBZ A;  1RL2 A;  1H64 1;  2RJF A;  1KC8 U;  4XU3 A;  1VQ8 Q;  1VQK A;  3A8M B;  1H8K A;  1OI1 A;  1FYN A;  1JXO A;  2EJF A;  3AHU A;  1ZX6 A;  3JCM c;  3VRY A;  2XD0 A;  4K11 A;  1KIK A;  4RCB A;  1QKX A;  4ZGE B;  2L5Q A;  2RPN A;  1VQK Q;  4C8Q E;  1KFZ A;  4IUV A;  2P0K A;  1RAB B;  2M9U A;  3KUF A;  2SEM A;  2PVO B;  3VJP A;  2RJC A;  4MZM A;  4XTU A;  3G7Z A;  2O88 A;  7AT1 B;  4IUQ A;  2YSQ A;  1GFC A;  1LNX A;  2XHC A;  4NS5 A;  1XTD A;  2EVR A;  1K1Z A;  2LQW A;  2M51 A;  3BE3 A;  5FRO A;  1S72 A;  1UJY A;  5GAO r;  1R0B G;  4F16 A;  2VKN A;  3O5Z A;  2E64 A;  4EDU A;  1M90 U;  2DNU A;  1X75 C;  4C0Z A;  1SSF A;  1D0X A;  5FRM A;  2D6F A;  1S72 Q;  1JJ2 S;  4LUD A;  3QPH A;  1FMK A;  2PUK B;  4JPB W;  3VYH B;  1SKU B;  2QEX A;  1C1A A;  1N27 A;  1K76 A;  2DL4 A;  1KD1 R;  3PMI A;  2KRN A;  2ZZD A;  3HHT B;  4C8Q C;  4MDW A;  4C0D C;  1BKB A;  1K0S A;  2QEX Q;  2LRQ A;  1M3A A;  1PM3 A;  5KYU B;  4J9H A;  2YDL A;  5GAM f;  1HSQ A;  2NUZ A;  3JB9 D;  2QAS A;  2COY A;  2H3E B;  1ZSZ B;  4V2S A;  4KUI A;  3ZBD A;  1MHN A;  2VAS A;  4DEX A;  3KXT A;  1VYU A;  3EFO B;  5GAN 6;  2O9V A;  3J81 E;  1ZLM A;  5CKF A;  2I2L A;  3MP1 A;  4FYX B;  3CC7 A;  2ECZ A;  1PSF A;  1WHL A;  1AWW A;  3CQT A;  5GAM e;  3OYN A;  2X35 A;  3EHQ A;  1QQJ A;  1TU0 B;  3CPW P;  4C92 D;  2JM9 A;  2FPF A;  2KRO A;  3OYG A;  2MWP A;  3CC7 Q;  5KE3 A;  2GQV A;  1FX7 A;  2DZC A;  2RQV A;  4J9B A;  4RUG A;  1SF9 A;  2L3P A;  2RI3 A;  4FU6 A;  1AWX A;  3HSB A;  1OU9 A;  5GMK m;  3CC2 T;  2DZ9 A;  4HVU A;  4X9D A;  1BIB A;  2W10 A;  2YUQ A;  1VQ9 T;  2M1H A;  2W0Z A;  1TH7 A;  5D6W A;  2I0N A;  3UDC A;  4FSX A;  3SFM A;  4BDZ A;  2KEA A;  3FB9 A;  4PNO A;  1M1G A;  3CPW A;  2COW A;  4DBH A;  3OYE A;  4D8D A;  2XK0 A;  2LTO A;  4Z8A A;  2VV5 A;  1QCO A;  1YHQ A;  5L8R E;  2HQX A;  4GY5 A;  2JZ2 A;  3CMA A;  1D09 B;  1QVP A;  2NLU A;  4M78 E;  2HDA A;  1NE8 A;  3A1P A;  5LJ5 h;  4ZTF A;  2J7I A;  1NPP A;  2KXD A;  3M53 A;  3H0H A;  3QHS A;  2VYT A;  1YHQ Q;  1Q82 R;  5GAN 7;  2SRC A;  3JCM e;  2BIV A;  3OS0 A;  4PJN A;  3JRZ A;  3CMA Q;  1M90 C;  2X4W A;  5FWB A;  5DLQ E;  1VQP A;  2PNI A;  3OSV A;  2RH2 A;  3DLL A;  2DAQ A;  2KRS A;  4KGZ B;  2LQ8 A;  3OYI A;  4QKU A;  1K73 C;  2YRV A;  4FT2 A;  1UB4 A;  4HA8 A;  1VQP Q;  3TRE A;  2P0Q A;  2EJG A;  3CD6 A;  1W6X A;  1SHG A;  2HQH A;  2DEU A;  5IH2 A;  4HVW A;  1KQS A;  3X26 B;  1VQN A;  2DM1 A;  4OML A;  1JXM A;  3X28 B;  1YIJ A;  4HKE A;  3REB B;  1V76 A;  4M77 F;  5GAN g;  3CD6 Q;  1BCM A;  1MMA A;  1UEB A;  2LX7 A;  4HXJ A;  3RDV A;  5KYY A;  3OSS C;  3QDF A;  1WJR A;  2V8I A;  2ESW A;  4DBF A;  3EGX B;  4M7D E;  4M78 C;  1NJI R;  1VQN Q;  3I55 A;  4KH0 B;  1YIJ Q;  2QTX A;  4C8Q D;  3CCJ T;  1OOT A;  4J7I A;  2MI6 A;  1RAD B;  2NUT A;  1UGP B;  4MML A;  3CC4 T;  3I55 Q;  2RA2 A;  3CPW S;  2X4X A;  1HD3 A;  2RHY A;  5C0M A;  1UGV A;  3CEY A;  2JT4 A;  2MK5 A;  1K9M R;  1U1T A;  2K79 A;  3DKM A;  1TTH B;  1ZHI A;  2QQS A;  1LVK A;  1Z9Z A;  4JRK A;  2QYZ A;  2K3B A;  3EG9 A;  3H9N A;  1U06 A;  3QZ5 B;  1RAG B;  1ZBX A;  3V7S A;  3L2U A;  3SHW A;  3L2W A;  4DEY A;  2JNG A;  2EYQ A;  1X6G A;  4PJL A;  5LJ3 h;  2QDY B;  3OW2 P;  3JB9 H;  2OTJ A;  4AG1 C;  4M77 E;  3G4S T;  1KD1 C;  1Y7X A;  4M7D C;  1VQO A;  1MMG A;  1YJN T;  2O31 A;  3A8O B;  4RMO A;  2OTJ Q;  2YRC A;  4FYY B;  4A4K A;  1Z9Q A;  4M7A F;  2ED1 A;  1UDL A;  2E41 A;  4E6R A;  1VQM T;  1KQS S;  1WNL A;  1VQO Q;  4PJO F;  3NPF A;  2C0I A;  2RI5 A;  1YCY A;  3A8H B;  4LDY A;  2FPE A;  2R57 A;  4QQG A;  3X24 B;  2XKO C;  4MDX A;  2EIF A;  4BY6 B;  3M0U A;  4F7U F;  4J9F A;  1K9A A;  2LJ0 A;  3LX7 A;  2Y4Y A;  3M55 A;  2EYZ A;  2OTL T;  3QSU A;  2JS2 A;  2A08 A;  4BE2 A;  3I9Q A;  4F7U B;  3OW2 A;  1M2V B;  2LNV A;  1WPY A;  1Y07 A;  1VYV A;  4N4G A;  4RTZ A;  4DOV A;  1O75 A;  1KK7 A;  4E7H A;  2MAM A;  2C0T A;  4IUR A;  4M77 C;  3BDL A;  4EMK B;  2XID A;  1IGQ A;  1K9M U;  2L0A A;  3G71 A;  3RKX A;  3OS2 A;  1I07 A;  4KUD K;  1YIT T;  2P84 A;  2KYM A;  3QG1 A;  4FM4 B;  4FYW B;  3VU3 C;  4XQ3 A;  1YIT A;  3CCU A;  3G71 Q;  2IPO B;  3S3O A;  4M7A E;  3EH2 A;  3EG3 A;  4PJO E;  1LPL A;  2ZPB B;  1WHH A;  2Y90 A;  1JB0 E;  3VS1 A;  3CCE A;  1WHK A;  3L2Q A;  1FMV A;  3H8Z A;  3PTA A;  1YIT Q;  2CYZ B;  3CCU Q;  3FIF A;  4B9W A;  3M54 A;  2DKG A;  4MZT A;  2R5M A;  2KRM A;  3CCE Q;  4KGX B;  1AT1 B;  2H3J A;  3GLX A;  4HCK A;  5KH6 A;  4M75 E;  4OVA A;  4J5Y A;  1N9S A;  2JVV A;  3T9N A;  3OBY A;  3DLM A;  1RLQ C;  3QXE B;  2A37 A;  4OMF B;  2DTO A;  4ZTJ A;  5LJ5 f;  3JCM X;  2AKK A;  2WSE E;  4M78 D;  1MMD A;  3QDR B;  5IHN A;  3UPU A;  1KSW A;  4L5G A;  1Q82 C;  4IUT A;  3UWN A;  5AT1 B;  1VIF A;  2JTF A;  2L2P A;  4M77 G;  2R5A A;  2DJQ A;  5I21 A;  3OW2 S;  4M7A C;  4RKU E;  1H3H A;  1QW1 A;  4PJO C;  3EG0 A;  1ZUK A;  2YHT A;  3TSZ A;  5GAN e;  3M4Y A;  3DB3 A;  3VS7 A;  5LJ5 e;  3EGD B;  2PUO B;  3FEO A;  1ZA1 B;  3ZFJ A;  2XDD A;  3MJX A;  4C0G A;  4N0A C;  1IGU A;  2PVG B;  4M75 C;  1UFF A;  2LMJ A;  1JQQ A;  4J8O A;  2JMA A;  3RBB B;  3GOX A;  1UG1 A;  1RI0 A;  5I2S A;  3PFS A;  4DA4 A;  3MEU A;  4J9E A;  1N8R U;  2DL5 A;  1NJI C;  1ACM B;  1SSH A;  2J6O A;  2M0O A;  4JRI A;  4M7D D;  4IUP A;  1T0J A;  4EPC A;  1TUD A;  4PL6 A;  2OJ2 A;  3HFO A;  1W70 A;  1MUZ A;  1ZQ1 A;  4A4H A;  4J6Y A;  4KT0 E;  1XJW B;  5A0L A;  1WQ7 A;  1OX9 A;  2GTO A;  5CO7 A;  2KDS A;  3I56 T;  2OI3 A;  1HXD A;  2JW4 A;  3JCM h;  2GF7 A;  6AT1 B;  5KYW A;  5GAN 2;  4Y92 A;  2QQB A;  4RTX A;  1G5V A;  4M7A G;  1TUC A;  1D1A A;  4C92 A;  4OMO A;  4PJO G;  1QVG P;  5LJ3 f;  4XU1 A;  2QTV A;  1W4S A;  2ZPF B;  3RES A;  5A2Q E;  4P5N A;  3M0T A;  1TWB A;  1NEG A;  2YUO A;  4E2F B;  4M77 D;  4F7U G;  1RAF B;  4C5I A;  4DBQ A;  3OYJ A;  4L6V 5;  2RK1 A;  4LD6 A;  2HSE B;  4VUB A;  1SHF A;  3URG A;  4F14 A;  2LZ6 B;  5CCA A;  3CBP A;  4E7J A;  4Q5W A;  3BFM A;  1WHJ A;  3CCL A;  5LL6 S;  3X20 B;  5LJ3 e;  5GAM d;  5GMK j;  3MET A;  2F2W A;  4ANJ A;  1PRL C;  3RMS A;  2CP0 A;  2CZ6 B;  5GMK l;  3FLG A;  3CCL Q;  3VS2 A;  4A54 A;  5IXB A;  2DET A;  2LJ3 A;  2QA4 A;  1QVG A;  8AT1 B;  2RJD A;  3G1J A;  3REA B;  4II1 A;  2E12 A;  1QMC A;  2E5Q A;  2E10 A;  4A4F A;  2D8J A;  2QA4 Q;  2RB6 A;  1NEB A;  1QWE A;  2BTT A;  4XAX B;  2EAY A;  2H8H A;  3SB2 A;  1YJW T;  4O6J A;  2JM8 A;  1G3Y A;  1R8O B;  3R6N A;  2QAZ A;  4UC4 A;  3JCM J;  2KGT A;  3PT9 A;  3WXM B;  2EPD A;  3SWN C;  1IO6 A;  1AWJ A;  1NG2 A;  3NTI A;  2RD1 A;  3EGU A;  1X27 A;  2XU8 A;  1UE9 A;  3RR6 A;  1BYM A;  3G6E T;  4M7A D;  2FO0 A;  4PJO D;  1LJO A;  1BB9 A;  1VQ7 T;  2XG8 D;  2EQI A;  5HKC A;  5GJW B;  5FLX E;  4GBQ A;  1X6B A;  4R56 A;  2DXB A;  5CAI A;  3QO3 A;  1NYF A;  1Q7Y C;  3JCM d;  4XU2 A;  4FL6 A;  2JMC A;  3RUX A;  4M75 D;  3L1A A;  1VQ6 T;  4XTW A;  2RO0 A;  2EGC A;  1NM7 A;  2BKD N;  3VYG A;  1VQ6 A;  4C8Q A;  1VIE A;  5HY6 A;  2DVJ A;  4MZP A;  2DBK A;  4KGV B;  2X4Y A;  1UHF A;  4XTX A;  4HT8 A;  2VC8 A;  1G3W A;  1VQ6 Q;  4Y28 E;  3OYK A;  3VS5 A;  3QZ9 B;  1QVG S;  3PIP A;  1K8A C;  5D6Y A;  4DOW A;  4JDS A;  1OZ3 A;  3JAM E;  3EH1 A;  1WJS A;  3OYY A;  4PLI A;  2DIG A;  4RTU A;  4CC2 A;  2AZS A;  2CP7 A;  4J6W A;  1TG0 A;  3M0P A;  1GCQ C;  1N5Z A;  2ENM A;  2AHJ B;  2F5T X;  4JJN K;  4BI3 A;  2E70 A;  4E47 A;  4BE0 A;  2KBT A;  1KQ1 A;  3E9G A;  1WIE A;  2FEI A;  1Q81 C;  2FZC B;  1I5O B;  2V1Q A;  3EFR A;  1Q86 U;  2AZV A;  3OB9 A;  3OMC A;  3CPF A;  2DJZ A;  4OGC A;  4LE9 A;  1KC8 C;  3ME9 A;  2Y4X A;  1VQL T;  3OYM A;  1PRM C;  5HK0 A;  3LLR A;  3OYD A;  3S3N A;  3EG2 A;  5CKD A;  2EGE A;  4HCC A;  5KE2 A;  4KBM B;  1D1B A;  3CC2 A;  1PD0 A;  1ZBJ A;  2XDP A;  4RTW A;  5KYY B;  3NGP A;  1I4K 1;  1VQ9 A;  2ZAE A;  2OAU A;  3HPW A;  4JZ4 A;  3JCM f;  5KCH A;  1VUB A;  3CC2 Q;  2ZPI B;  2GCX A;  2NUT B;  3FC3 A;  2IG0 A;  4FCY A;  1VOM A;  4N4I A;  5D7U A;  3THK A;  1VQ9 Q;  3RER A;  1D0Y A;  4PLL A;  1C6V X;  2FVU A;  1KQS P;  2FL7 A;  2D0N A;  2HKQ B;  2XIC A;  3P8D A;  1RI9 A;  2HCK A;  3RNJ A;  5CR2 A;  5GAN h;  1GBR A;  3EG9 B;  1U5S A;  5CVI A;  3V8L A;  5ECA A;  1RAC B;  4C0F A;  3QUI A;  3SDZ A;  4FT4 A;  3GIB A;  3M5A A;  1ZSZ C;  4RTY A;  1V29 B;  4BI4 A;  1AZG B;  4Z88 A;  4J9G A;  1LOJ A;  1WFW A;  2LP5 A;  3N5B B;  3UA6 A;  5GAM j;  1PSE A;  2LC4 A;  2DTH A;  5IT9 E;  1CKB A;  4EMG A;  4BD3 A;  1WJQ A;  4QVZ A;  1IZ6 A;  2RHZ A;  5FU6 B;  3PVQ A;  4B6M A;  2GFU A;  2LCL A;  1OPL A;  2EW3 A;  4AFZ C;  3Q1J A;  1CSK A;  1PG5 B;  1ABO A;  4PJM A;  1NYG A;  2VGN A;  1W1F A;  2RN8 A;  4M4Z A;  2RI2 A;  2RHX A;  2K3X A;  4A53 A;  4M78 A;  1YCS B;  2J6F A;  1HYO A;  5DLO A;  1G2B A;  1IXD A;  2YXY A;  2BZY A;  3CCJ A;  4R55 A;  1YN8 A;  1Y57 A;  5FWC A;  1PCX A;  4LXC A;  2K2M A;  1MGQ A;  1QP2 A;  2QK0 A;  3CC4 A;  3INZ A;  2G3R A;  2EYW A;  2K5I A;  2O2O A;  2EBP A;  3A5Z B;  3CCJ Q;  4O5V A;  2FRY A;  5KYN A;  2E4H A;  2OAW A;  2CZ1 B;  2F5K A;  2KT8 A;  1FMW A;  3CC4 Q;  5CIU A;  5CKH A;  1OPK A;  2CT3 A;  2LX9 A;  2C0O A;  1UHC A;  1X2Q A;  3TU4 K;  1D1C A;  3V7C A;  2L3Q A;  4XTV A;  2RK2 A;  3X25 B;  2LT4 A;  5IHK A;  3MEV A;  4KUL A;  1M3B A;  3FJP A;  3LGL A;  2YUN A;  2KYB A;  4X34 A;  3O8V A;  1M27 C;  2OX7 A;  5GAN 5;  1G8X A;  3G4S A;  2LQN A;  1QLY A;  2A0F B;  4M7D A;  2K9G A;  1ARK A;  4F04 B;  1A0N B;  4HVV A;  1SRM A;  5GAN d;  3NTH A;  2HZY A;  1R0C B;  2F2V A;  1YJN A;  2DD4 A;  2DL8 A;  5LJ5 d;  2CZ0 B;  3HTR A;  2KK4 A;  3G4S Q;  2Z0W A;  4ELY C;  3H6Z A;  3GP8 A;  1VQM A;  1QVF S;  2LNH B;  3CME T;  1YJN Q;  3VS4 A;  3CME A;  4PJJ A;  1O9S A;  1VQM Q;  2NWM A;  2HL5 C;  1YP5 A;  2BZ8 A;  3H41 A;  4JJC A;  3LWI A;  3L42 A;  2X51 A;  2OTL A;  1MNE A;  1KQ2 A;  3CME Q;  1OUL A;  1I8F A;  4ESR A;  4RCC A;  2DXC A;  2E3I A;  4M77 A;  1UGQ B;  3GBQ A;  2EYX A;  5A0G A;  2OTL Q;  3GNG A;  1JBM A;  2V8K A;  2DYB A;  2KSS A;  1K0X A;  2VXE A;  3SD4 A;  4AFS C;  2DF6 A;  3C12 A;  4XTY A;  4XU0 A;  5I11 A;  3MPU B;  1XOV A;  2X4J A;  3MEA A;  2YLC A;  1N8R R;  3JB9 F;  3A8G B;  1UGS B;  4Z02 A;  9ATC B;  3BDU A;  1D3B A;  1S1N A;  2HMA A;  4PKC C;  2YRD A;  1M1F A;  3RKY A;  4F7U E;  2K57 A;  3E9F A;  2HL3 A;  3VRZ A;  1OV3 A;  1PKT A;  3OMG A;  5CKE A;  3GPL A;  2X3X D;  2HSP A;  2KAF A;  1GRI A;  2ZPH B;  4BI8 B;  2GGR A;  2CUB A;  4IUU A;  3WVE B;  2KNB B;  5GAN f;  1GFD A;  4C92 F;  3OY9 A;  5LJ3 d;  5GAO m;  5KYW B;  2DL3 A;  3S6W A;  3VUZ A;  4OF1 A;  1BI2 A;  3C95 A;  2E1H A;  2NUP A;  1NLP C;  5KYX A;  1DJ7 B;  1QP3 A;  2V26 A;  1WQW A;  1Y96 A;  2CH4 W;  4QW2 A;  3TVT A;  2FZG B;  2HKN A;  3PNW C;  4C92 B;  3HRU A;  2JS0 A;  2CP3 A;  1Y0M A;  3CBM A;  4BY6 C;  4LDU A;  4M7A A;  4CI0 C;  4WTO B;  4PJO A;  4AG2 C;  1N6A A;  1ZUU A;  1YWO A;  2V1R A;  1YNZ A;  4NL3 A;  1Q95 G;  3JCM V;  1E6G A;  4OMN A;  2D8H A;  2CDT A;  3TQ7 P;  3QYH B;  1TSF A;  1P92 A;  2EQJ A;  4N0A A;  2E3H A;  4M75 A;  4EMK C;  3PGG A;  1M9S A;  4E7S A;  1WXB A;  1SRL A;  1AEY A;  3M58 A;  3C4S A;  4TVR A;  4ZGJ B;  2JXB A;  3R6O A;  3OQ5 A;  4ELZ C;  1JU5 C;  5EG2 A;  2CKK A;  4GLM A;  1AD5 A;  2O4X A;  2RHU A;  4J9D A;  2B86 A;  2PQW A;  2E5K A;  3MKD A;  3V8J A;  2YLB A;  1BI3 A;  4J6X A;  3PVL A;  3QWY A;  1OQK A;  2PTK A;  3LWH A;  2HBW A;  1K9M C;  5GAM g;  1IHV A;  2QQA A;  1X69 A;  3EFS A;  5IAY A;  2L8D A;  3I56 A;  2XMF A;  3CCQ T;  4A4E A;  3CCM T;  3CXC S;  1H3Z A;  2AKL A;  5I22 A;  2EFI A;  4KRT A;  2E6N A;  2VXF A;  3I56 Q;  2FHD A;  2GNC A;  1YBY A;  3ER0 A;  1XQH A;  3A98 A;  3MEW A;  1RAH B;  2QGG A;  1YI2 T;  4ZN3 A;  3CCV T;  2RQU A;  2PU9 B;  1ZUY A;  3LGF A;  1YI2 A;  5GAN j;  2XI9 A;  4C92 C;  5LJ5 j;  2DXT A;  2L3R A;  5M9O A;  4BAC A;  2FYK A;  4CRI A;  3CCR T;  2P4T A;  3ZEH A;  2DIQ A;  3ZL7 C;  4C8Q F;  1YI2 Q;  1G3T A;  2LDM A;  4A4G A;  3NMZ C;  2F2X A;  3BW1 A;  3M0R A;  3V8K A;  1WGS A;  4C8Q B;  2RM4 A;  3OYL A;  3CCS T;  3ASK A;  1NPR A;  3JSC A;  2P4R A;  1VQ8 T;  2L3S A;  3C0C A;  5A0D A;  3CCS A;  1NZ9 A;  3DB4 A;  1K73 R;  4JS5 A;  2HBP A;  1B34 A;  2WSF E;  4FYV B;  4GLK A;  1RLP C;  1E6H A;  4IIO A;  1TUG B;  4LNP A;  3JB9 G;  4FW2 A;  5GAO p;  1G83 A;  2JN0 A;  4J83 A;  2CRE A;  2KY9 A;  3P8H A;  2YUP A;  3CCS Q;  2CGH A;  1IRE B;  2CP5 A;  3JV3 A;  2A3L A;  1ZA2 B;  1GXI E;  5GJV B;  2D0Q B;  5FU7 B;  1D0Z A;  4NOY A;  1PNJ A;  1YJW A;  4JJB A;  2K5L A;  2PZ1 A;  2EKO A;  5GAN 8;  1I5L A;  1Q86 R;  4JUV A;  3SWN A;  1AWO A;  1BI0 A;  2KR3 A;  3E1S A;  1PHT A;  2MYS A;  1YJW Q;  1SPK A;  4ME7 A;  1N8R C;  1U8R A;  1M3C A;  2AIR B;  2RF0 A;  4JLG A;  4C92 G;  1WDX A;  4KH1 B;  3G6E A;  2K2V A;  2M16 A;  4J7F A;  1VYT A;  2DIL A;  2VUB A;  2J6K A;  2A28 A;  1VQ7 A;  4AMC A;  4OMM A;  2WAC A;  1M1K R;  2GTJ A;  3G6E Q;  1S72 T;  2CP2 A;  1M5Q 1;  2DRM A;  2MWO A;  1T3L A;  4XTZ A;  4Y91 A;  5IHI A;  1VQ7 Q;  5LJ3 j;  1IB8 A;  3JCM W;  1WHG A;  1WZO A;  3FJ5 A;  5GAN 3;  2QEX T;  1T3S A;  4OMQ A;  2DER A;  2YT6 A;  1RAA B;  1TOV A;  2DEQ A;  2ZPE B;  3MHX A;  2HAX A;  1K73 U;  2LJ1 A;  2MIO A;  1JEG A;  2EKH A;  3TCJ A;  3OYF A;  4QVC A;  3HRT A;  5KCO A;  1AZE A;  2CH4 A;  2BUD A;  4RG8 A;  1GCQ A;  1QCN A;  3ULR B;  4LD9 K;  4OP0 A;  3AT1 B;  3UT1 A;  3VUB A;  2QQR A;  1HJD A;  1TS9 A;  1N9R A;  1Y71 A;  5GAO n;  3MP6 A;  3KBG A;  3CC7 T;  2X9H A;  5FU7 C;  4IKF A;  3NTK A;  3QWX X;  2QGF B;  3KFV A;  1X6O A;  2KQW A;  8ATC B;  4XK8 E;  3E19 A;  1WHM A;  2VGM A;  2C06 A;  1UTI A;  4ZNX A;  1B3Q A;  1VQL A;  4M78 F;  3OYC A;  2JTM A;  2EWN A;  4AFU C;  2LCC A;  5IN1 A;  3JCM b;  1M1K U;  4E7Z A;  2D9T A;  2CUD A;  3I5S A;  4M78 B;  2QDL A;  1VQL Q;  1BIA A;  4PFZ A;  3I35 A;  1M8M A;  1EIF A;  2QQ9 A;  1MV0 B;  2F69 A;  3PE0 A;  2EGA A;  4D8K A;  1OYX A;  2VB6 A;  1H92 A;  1AHJ B;  2A7Y A;  2E65 A;  4FIB A;  4C8Q G;  4QQD A;  4B9X A;  4DQ2 A;  4JRQ A;  1JO8 A;  1JRI A;  2HQE A;  1QVF P;  1KD1 U;  2G6F X;  3QBY A;  1WYX A;  4BDY A;  1LCK A;  1TXQ A;  2KT1 A;  4ZN1 A;  1F1B B;  2DBM A;  4OB0 B;  5D6X A;  3LH0 A;  2DRK A;  3M0S A;  5KYU A;  1YHQ T;  1V1C A;  2DTI A;  3L2R A;  3CMA T;  1ZSZ A;  3OYH A;  3LYI A;  3FRN A;  5HK3 A;  4M7D F;  2JJ9 A;  3H0I A;  3RMQ A;  3FDR A;  3BY7 A;  3EFO A;  4JJD A;  2J05 A;  3JB9 J;  2K5F A;  2DO3 A;  2F1L A;  1VQP T;  4M7D B;  1VQ5 T;  3E2U A;  4PFP A;  5J3B A;  1VQ5 A;  5GMK h;  1RAE B;  5CK9 A;  3EG1 A;  1QVF A;  3NHN A;  1HK9 A;  1OZ2 A;  2LT1 A;  1PD1 A;  4QQ6 A;  3CD6 T;  5J39 A;  1VQ5 Q;  1OX8 A;  2M02 A;  1VQN T;  2MOX A;  1WXT A;  3M0Q A;  1YIJ T;  4YTL A;  1QKW A;  3OBW A;  2CS7 A;  3J80 E;  3HL8 A;  4NL2 A;  2EQM A;  5LJ5 g;  3I55 T;  2IIM A;  3I5R A;  1Q86 C;  3EHR A;  2EQU A;  5GAO l;  4M77 B;  3JCM P;  4OB2 B;  2CZ7 B;  4OGE A;  4PFO A;  4E7L A;  3MO8 A;  1OEB A;  2JOY A;  2KI7 A;  2K7A A;  1I81 A;  2COZ A;  1KHI A;  2FRW A;  2EQK A;  2MMP A;  1M1K C;  1R77 A;  2RNA A;  1M4Z A;  2EYY A;  4CC3 A;  1X43 A;  1AOJ A;  2QG9 B;  4IIM A;  1D3B B;  2KMT A;  4EMH A;  2RQR A;  2FPD A;  1M30 A;  2HNI A;  1T0H A;  2ZCF B;  1Q82 U;  3HP9 A;  1C0M A;  1B7T A;  4AFQ C;  1X01 A;  2GFA A;  2OTJ T;  2DK3 A;  1K4U S;  5GAN 4;  3OYA A;  5L23 A;  4LDX A;  1GL5 A;  1QCF A;  5CQX A;  3JB9 I;  3HRS A;  1VQO T;  1XNI A;  2B8A A;  4LUE A;  3M59 A;  2RJE A;  3H0F A;  4JRP A;  2V8J A;  2EJ9 A;  4C5H A;  4RG2 A;  5FU6 C;  2LCS A;  1I0C A;  5HCK A;  2CSQ A;  1YWP A;  4JZ3 A;  2CT4 A;  3JCM Q;  1M8V A;  3OYB A;  2LVM A;  2NUP B;  5KYX B;  5CKB A;  1Y96 B;  2K3Y A;  4PK4 A;  4WF2 A;  2DFU A;  1KJW A;  4J9C A;  4M78 G;  2MF2 A;  1B07 A;  1WA7 A;  4M7A B;  2ED0 A;  1RAI B;  2DA9 A;  3EGX A;  4PJO B;  5I2M A;  4R0K A;  3S3M A;  1NJI U;  2CSI A;  1FWZ A;  2A36 A;  4JLI A;  1YJ9 T;  4M75 F; 
#chains in the Genus database with same CATH homology
 3IQL A;  1X69 A;  2EGC A;  2KRS A;  1NM7 A;  4J9I A;  2GQI A;  2XMF A;  2DE0 X;  3VS3 A;  2FG0 A;  2DVJ A;  2AKL A;  5I22 A;  4KRT A;  2DLP A;  1U3O A;  1W6X A;  1SHG A;  2DBK A;  1UHF A;  2GNC A;  5EC7 A;  5IH2 A;  2RQT A;  4HVW A;  3VS5 A;  3UA7 A;  2DM1 A;  3A98 A;  4OML A;  1JXM A;  2KXC A;  2DMO A;  4QT7 A;  3REB B;  2RQU A;  2ROT A;  1ZUY A;  2LX7 A;  4HXJ A;  4RTU A;  4CC2 A;  2ESW A;  2AZS A;  5IXF A;  1TG0 A;  3M0P A;  1GCQ C;  1N5Z A;  4CC4 B;  2ENM A;  2ABL A;  3ZL7 C;  1OOT A;  3TSW A;  2AK5 A;  1NLO C;  2KBT A;  1UJ0 A;  1WIE A;  2FEI A;  3NMZ C;  2F2X A;  3M0R A;  2V1Q A;  1J3T A;  4X1V A;  1ZSG A;  1HD3 A;  4EIK A;  1UGV A;  2JT4 A;  2AZV A;  2K79 A;  2P4R A;  1Z9Z A;  4LE9 A;  2K3B A;  2L3S A;  3C0C A;  1AVZ C;  1X2K A;  2JTE A;  1UEC A;  1PRM C;  1U06 A;  2BZX A;  1I1J A;  3EG2 A;  2MCN A;  1RLP C;  1E6H A;  2RMO A;  2EGE A;  2VWF A;  4IIO A;  4LNP A;  3SHW A;  1G83 A;  2CRE A;  1ZBJ A;  4DEY A;  4RTW A;  2YUP A;  3NGP A;  1X6G A;  3JV3 A;  3UAT A;  5GJV B;  4AG1 C;  1PNJ A;  4JZ4 A;  4JJB A;  5FW9 A;  2PZ1 A;  2O31 A;  4F17 A;  3THK A;  1PKS A;  1AWO A;  2J06 A;  2D1X A;  2KR3 A;  4A63 B;  1PHT A;  1ABQ A;  1Z9Q A;  4CC7 A;  2D0N A;  2GBQ A;  1SPK A;  2ED1 A;  1UDL A;  4E6R A;  1E7O A;  1M3C A;  2RF0 A;  1RI9 A;  2HCK A;  3NPF A;  3RNJ A;  4RTV A;  1WDX A;  1GBR A;  2C0I A;  2O9S A;  1U5S A;  1VYT A;  2FPE A;  5ECA A;  2DIL A;  2J6K A;  1SEM A;  1WXU A;  2VVK A;  2A28 A;  3M0U A;  4J9F A;  4OMM A;  1K9A A;  4RTY A;  2LJ0 A;  2GTJ A;  1AZG B;  2EYZ A;  3LH5 A;  3U23 A;  4RTT A;  2K6D A;  4Z88 A;  4J9G A;  1WFW A;  2LP5 A;  2JS2 A;  2A08 A;  3UF4 A;  2RQW A;  2DRM A;  2DL7 A;  3I9Q A;  3UA6 A;  4OMP A;  1T3L A;  1VA7 A;  5IHI A;  1VYV A;  4RTZ A;  1CKB A;  1QWF A;  1WLP B;  3FJ5 A;  2C0T A;  1BK2 A;  2X3W D;  1T3S A;  4OMQ A;  2YT6 A;  3PVQ A;  3SEM A;  4WCI A;  2L0A A;  3VS0 A;  1I07 A;  1WX6 A;  1EFN A;  1OPL A;  2EW3 A;  2LJ1 A;  2MIO A;  2DX1 A;  4AFZ C;  1JEG A;  3VS6 A;  1CSK A;  2EKH A;  1ABO A;  1NYG A;  2KYM A;  1CKA A;  1W1F A;  2RN8 A;  4M4Z A;  3EG3 A;  2CH4 A;  1AZE A;  3VS1 A;  1YCS B;  3ULR B;  1GCQ A;  4FSS A;  2J6F A;  1MV3 A;  1G2B A;  1BU1 A;  1GCP A;  2BZY A;  1HJD A;  1YN8 A;  1Y57 A;  4ORZ A;  5FWC A;  2KE9 A;  1PWT A;  2KRM A;  1UUE A;  2K2M A;  4HCK A;  2EYW A;  1RUW A;  2O2O A;  2EBP A;  2HEQ A;  2ROL A;  3QWX X;  3KFV A;  2FRY A;  1RLQ C;  2OAW A;  4Z89 A;  2A37 A;  2M0Y A;  1UTI A;  4ZNX A;  2KT8 A;  1B3Q A;  2AKK A;  4LN2 A;  1GBQ A;  1WI7 A;  5IHN A;  1OPK A;  2CT3 A;  1KSW A;  4AFU C;  2C0O A;  1UHC A;  1X2Q A;  1BBZ A;  2L3Q A;  2CUD A;  3I5S A;  5IHK A;  2QDL A;  1H8K A;  2L2P A;  1FYN A;  1M3B A;  1JXO A;  2DJQ A;  1M8M A;  2YUN A;  3I35 A;  2KYB A;  1M27 C;  1ZX6 A;  1H3H A;  1MV0 B;  3PE0 A;  3VRY A;  3EG0 A;  1ZUK A;  1QLY A;  2LQN A;  4K11 A;  2K9G A;  2EGA A;  4D8K A;  1QKX A;  1ARK A;  1KIK A;  2RPN A;  3TSZ A;  1A0N B;  4HVV A;  1SRM A;  3VS7 A;  1H92 A;  1KFZ A;  2F2V A;  2DL8 A;  1JO8 A;  2SEM A;  2G6F X;  1WYX A;  1UFF A;  2LMJ A;  1LCK A;  1JQQ A;  2LNH B;  2KT1 A;  2DBM A;  2JMA A;  3RBB B;  1UG1 A;  3VS4 A;  2O88 A;  2DRK A;  3M0S A;  2YSQ A;  1GFC A;  1V1C A;  4J9E A;  2EVR A;  2DL5 A;  1K1Z A;  2LQW A;  1SSH A;  2M51 A;  2NWM A;  2J6O A;  1YP5 A;  2BZ8 A;  3H41 A;  4JJC A;  3H0I A;  1T0J A;  1UJY A;  1TUD A;  4JJD A;  2OJ2 A;  1W70 A;  4F16 A;  2J05 A;  1MUZ A;  2VKN A;  3O5Z A;  4ESR A;  2DNU A;  3GBQ A;  4LUD A;  2EYX A;  1FMK A;  2GTO A;  4JPB W;  2DYB A;  1K0X A;  1K76 A;  2OI3 A;  2DL4 A;  2JW4 A;  2KRN A;  4AFS C;  3EG1 A;  3NHN A;  2DF6 A;  5I11 A;  4Y92 A;  1K0S A;  1XOV A;  4RTX A;  1M3A A;  1TUC A;  4OMO A;  4J9H A;  2YDL A;  1HSQ A;  2NUZ A;  2MOX A;  1WXT A;  3M0Q A;  1S1N A;  4DEX A;  1QKW A;  1VYU A;  3M0T A;  1NEG A;  2YUO A;  2O9V A;  1ZLM A;  2IIM A;  3I5R A;  3VRZ A;  1SHF A;  1OV3 A;  1PKT A;  2X3X D;  3EHR A;  2HSP A;  1GRI A;  4F14 A;  2LZ6 B;  2ECZ A;  2GGR A;  2CUB A;  1AWW A;  3CQT A;  2KNB B;  3EHQ A;  1GFD A;  2JM9 A;  1OEB A;  2FPF A;  2DL3 A;  2F2W A;  2K7A A;  2KRO A;  1PRL C;  1NLP C;  2RQV A;  2CH4 W;  3VS2 A;  2FRW A;  3TVT A;  5IXB A;  4J9B A;  2RNA A;  2LJ3 A;  2JS0 A;  4RUG A;  2EYY A;  4CC3 A;  1Y0M A;  1X43 A;  2L3P A;  1AOJ A;  1AWX A;  4IIM A;  3REA B;  2RQR A;  2FPD A;  4HVU A;  1M30 A;  2W10 A;  1T0H A;  4AG2 C;  2YUQ A;  2D8J A;  1ZUU A;  4AFQ C;  1NEB A;  2W0Z A;  1QWE A;  2BTT A;  1YWO A;  2V1R A;  1K4U S;  1YNZ A;  1GL5 A;  5L23 A;  1QCF A;  2H8H A;  1E6G A;  4OMN A;  2D8H A;  2CDT A;  2JM8 A;  3R6N A;  2I0N A;  4LUE A;  3H0F A;  2KGT A;  2KEA A;  2EPD A;  2LCS A;  1I0C A;  1IO6 A;  1WXB A;  1AWJ A;  1NG2 A;  1SRL A;  4D8D A;  3EGU A;  1X27 A;  5HCK A;  2CSQ A;  1YWP A;  4JZ3 A;  2CT4 A;  1AEY A;  1UE9 A;  4Z8A A;  2JXB A;  1JU5 C;  4GLM A;  2FO0 A;  1AD5 A;  1KJW A;  4J9C A;  2HDA A;  4J9D A;  2B86 A;  2E5K A;  1BB9 A;  2J7I A;  2KXD A;  2EQI A;  1B07 A;  3H0H A;  1WA7 A;  2ED0 A;  5GJW B;  2DA9 A;  4GBQ A;  3PVL A;  2SRC A;  1X6B A;  1NYF A;  4R0K A;  2CSI A;  3QWY A;  2A36 A;  5FWB A;  2PNI A;  2PTK A;  2HBW A;  2JMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...