5GJVB

Structure of the mammalian voltage-gated calcium channel cav1.1 complex at near atomic resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
100
structure length
100
Chain Sequence
b'QGPHMALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVEGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1S
publication title Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
total genus 24
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2016-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5gjvB00
2CSQA 1H92A 1SHGA 3KFVA 1UECA 1IO6A 2RQRA 4ORZA 3I5SA 2DBKA 1UJ0A 2DBMA 4JPBW 1SRMA 1BK2A 2X3XD 5ECAA 2LP5A 2GGRA 4AFUC 2BZXA 1WA7A 2JXBA 1JXOA 2V1QA 2KEAA 1ZSGA 1K1ZA 1SSHA 1K0SA 2K79A 5I22A 1RUWA 4J9FA 1NLPC 1V1CA 1K4US 2DMOA 3VS7A 1AOJA 2LZ6B 3QWYA 4J9HA 5FWBA 1KSWA 1NYFA 2MCNA 1I07A 1M3BA 1RI9A 1NM7A 1UDLA 2CUBA 1UTIA 4J9DA 1Y0MA 2BZ8A 2K6DA 3UA7A 2KT8A 1WI7A 2JS0A 2LNHB 2KE9A 2EKHA 2NUZA 4RUGA 2EYXA 2EPDA 1AZEA 1ZX6A 2K9GA 1T0JA 4KRTA 2LQNA 2A36A 4HVVA 3C0CA 1WLPB 2CUDA 2DRKA 4WCIA 2CH4A 2LJ3A 4RTYA 5FWCA 4AFZC 3O5ZA 2VWFA 2DILA 4QT7A 1M3CA 1YP5A 4A63B 2HDAA 4OMNA 1YWOA 2RQUA 1T3SA 2HSPA 1S1NA 2H8HA 2RQTA 3M0UA 2DJQA 1UHCA 3ULRB 1PRLC 2A37A 3EHRA 1G2BA 4RTUA 3U23A 3RBBB 4JZ3A 4AG2C 3I9QA 2L3SA 4ESRA 1KJWA 4DEYA 2HCKA 5IXFA 2ROTA 4FSSA 2JTEA 2JMAA 1MV3A 2L2PA 1BU1A 2YUQA 2GTJA 1RLPC 2J06A 1ABQA 1M27C 2RN8A 2AZVA 3SEMA 2QDLA 4OMOA 2YUPA 2GQIA 3NMZC 2D1XA 2KBTA 3PVQA 4AG1C 1A0NB 2DL3A 1WXBA 3H0FA 3VS4A 1GBRA 2A28A 1GCPA 2W10A 2K2MA 2RNAA 5HCKA 1QWEA 2YUNA 3NGPA 1OV3A 3VS0A 4IIMA 1WXUA 1BB9A 2CREA 3EG3A 4JJBA 4HVUA 2DM1A 1UUEA 1CSKA 2LCSA 1X6GA 1T3LA 2YDLA 1GBQA 2F2XA 1HSQA 2VVKA 4CC7A 2YT6A 2KGTA 2DE0X 1M30A 4CC4B 2VKNA 1VYVA 2RF0A 4X1VA 2O9SA 1K9AA 5IHIA 1GRIA 4RTTA 4LE9A 2EGAA 1AWWA 2FPFA 1QKXA 2J7IA 2SRCA 1U06A 3PE0A 3TSWA 2J05A 1FMKA 2JMCA 1UGVA 3EG2A 2BZYA 2FPDA 2KROA 4J9IA 1SPKA 2DRMA 2OI3A 2P4RA 1EFNA 2DYBA 2JM8A 4RTWA 2ESWA 1X69A 1I0CA 4J9EA 1YNZA 3EG0A 4J9GA 4M4ZA 4OMQA 1JO8A 1MV0B 2EGEA 2C0OA 1AWXA 4HXJA 2B86A 1ARKA 2I0NA 1AZGB 5L23A 3EG1A 4OMLA 1AD5A 1X27A 3H41A 3PVLA 1PKSA 2KRNA 2DLPA 4OMPA 4Z88A 2RPNA 2RMOA 4J9BA 2AKKA 2C0TA 2ED0A 3H0HA 2DF6A 2KXCA 2LX7A 1UHFA 1SHFA 2OAWA 1WDXA 2O2OA 1WYXA 1AEYA 4OMMA 2DL7A 1PNJA 1YN8A 2KRSA 1ZUYA 2EYWA 3M0QA 1M8MA 3VS1A 1WX6A 4D8KA 4DEXA 2O31A 2YUOA 4JZ4A 3UATA 1YCSB 3H0IA 3M0TA 2PNIA 1UG1A 2DL8A 2RQWA 2ED1A 2PZ1A 3UA6A 2RQVA 4Z89A 5EC7A 1CKAA 2L0AA 4AFSC 2HBWA 2HEQA 2EBPA 2EYZA 3A98A 2MOXA 1ZLMA 2CT4A 4GBQA 2E5KA 3UF4A 4CC3A 5GJVB 3CQTA 2EQIA 1LCKA 2PTKA 4F14A 4Y92A 1Z9ZA 2JW4A 1UJYA 2MIOA 3REAB 1YWPA 2C0IA 1AWOA 2DA9A 5FW9A 1OOTA 2KR3A 4LNPA 1WIEA 1U3OA 2FEIA 3TSZA 2XMFA 2SEMA 2V1RA 5GJWB 3ZL7C 1GCQA 1KFZA 1GFDA 1JU5C 1GFCA 1ZBJA 2CH4W 3M0SA 3VS3A 2GBQA 2KYMA 1E7OA 3QWXX 2IIMA 1U5SA 4RTVA 1NG2A 1QCFA 2F2WA 1HJDA 4LN2A 1OPLA 4LUEA 3THKA 5IXBA 4GLMA 1AVZC 2DNUA 1NEGA 2DL4A 1VYTA 1ZUKA 1Z9QA 1B3QA 1ZUUA 4HCKA 2D8JA 1OPKA 1H8KA 4K11A 4IIOA 2ABLA 2A08A 1PHTA 1NEBA 1WFWA 1XOVA 2D0NA 3VRZA 2BTTA 4RTZA 3EGUA 2CDTA 2LJ1A 3R6NA 1TG0A 2NWMA 4LUDA 1Y57A 3M0RA 2DL5A 1OEBA 1JXMA 2AZSA 2DX1A 1UFFA 2CSIA 1HD3A 3GBQA 4AFQC 1M3AA 1T0HA 2JS2A 1JEGA 2GNCA 2FRWA 1RLQC 1E6HA 1X43A 1KIKA 1X6BA 2FPEA 4R0KA 4CC2A 1NLOC 1K76A 2J6OA 3EHQA 1SEMA 2F2VA 2KXDA 1UE9A 1J3TA 1QLYA 3SHWA 1CKBA 3I5RA 3NPFA 2CT3A 1QKWA 2D8HA 3M0PA 1GCQC 1NYGA 4HVWA 2G6FX 1X2QA 3NHNA 4J9CA 2ENMA 1VYUA 1SRLA 4JJDA 2J6KA 5I11A 2LMJA 2M0YA 1W6XA 4RTXA 1VA7A 2LQWA 2K3BA 2KNBB 2AK5A 3FJ5A 2X3WD 3VRYA 3VS2A 3LH5A 1MUZA 1TUCA 2GTOA 2KT1A 2KYBA 4F17A 2W0ZA 2EW3A 3VS6A 2DVJA 1K0XA 2JM9A 2OJ2A 2J6FA 4D8DA 2O9VA 1TUDA 1W70A 2KRMA 3I35A 3IQLA 2FO0A 3JV3A 1QWFA 4JJCA 2FRYA 5IH2A 1BBZA 1B07A 4Z8AA 3RNJA 2M51A 4ZNXA 1E6GA 1ABOA 2EGCA 2L3PA 1X2KA 5IHNA 2JT4A 4E6RA 2YSQA 4F16A 2K7AA 2EYYA 2FG0A 1GL5A 1PWTA 2AKLA 2LJ0A 1PKTA 4EIKA 2ROLA 2ECZA 1JQQA 2L3QA 1G83A 1I1JA 1W1FA 2EVRA 2O88A 3VS5A 1H3HA 3REBB 5IHKA 1FYNA 1PRMC 1N5ZA 1AWJA 1WXTA 3TVTA
chains in the Genus database with same CATH superfamily
1VQNQ 4LDXA 3BDLA 3SDZA 2EJFA 2XHCA 1G5VA 3JB9G 2DERA 4XTVA 5DLOA 2QGGA 2FL7A 4JPBW 1SG5A 2QTVA 1X01A 4C5EA 3L2ZA 5ECAA 1NPRA 1M4ZA 4E7LA 1QVFA 2A7YA 2XDBA 1WNLA 2DD5A 2YRDA 1ZSGA 5D6XA 4A4KA 1SSHA 5GAOn 2VV5A 4C92G 4EMKC 2MWPA 1RUWA 5DY9A 1VQPQ 2KVQG 2CP0A 2OAUA 4PJLA 1B34B 1VQLA 1K4US 1N8RC 1EX4A 4E7JA 3I56Q 1NYFA 3QDRB 1I07A 4HCBA 2QEXT 5CKHA 2X51A 1UDLA 3VYGA 1Y0MA 2JNGA 2K6DA 4E7SA 3WXMB 2QXFA 2IVWA 2EKHA 4PFZA 4AMCA 2OTLQ 1VIEA 2RH2A 3R6OA 3QO3A 1VQ5T 2VXEA 1Y96A 2DRKA 2QQSA 4WCIA 1JJ2A 5GAOp 2LJ3A 4RTYA 4C8QE 5FWCA 2AHJB 2DIQA 5I21A 1I4K1 4C8QA 2DILA 2PVDB 4BY6C 5GAMf 1C6VX 1WHMA 3MJXA 1YWOA 1VQ7T 2DJQA 5CVIA 4FIBA 4BDZA 3NTKA 3ULRB 2RHXA 4TVRA 4HCZA 3S3MA 1YFNA 3EHRA 1RAIB 3RR6A 5LL6S 4E2FB 4KGZB 3ZBDA 2LCCA 3U23A 4M7AG 3FIFA 3I9QA 2L3SA 1TXQA 1IREB 1R0BG 2JTEA 1BU1A 2XK0A 1RLPC 2J06A 4OGEA 4PJJA 5GAN3 2RN8A 1VQOT 1W2BP 4XU2A 4C5IA 4OMOA 1D1AA 2D1XA 5KYYA 4PJOB 2R5MA 4AG1C 3M59A 4E7KA 3H0FA 3EGDA 1EZZB 3CPWA 2P84A 4JRIA 4PLLA 1HYOA 3CCSQ 3V7CA 4RG2A 3OW2P 2YUNA 1OV3A 1WXUA 3CCET 2WACA 2DYIA 4IUVA 4HVUA 3PT9A 2FZKB 3X28B 4B6MA 2K5IA 1UGPB 4XTYA 1C0MA 1CSKA 3EAEA 2LCSA 4FM4B 5GAMh 1BI2A 1KC8R 4CC7A 2YT6A 2KGTA 1K9MR 2MF2A 3A8OB 2RF0A 1JRIA 2AT1B 2KI7A 3G4ST 2K5LA 1BI3A 3CC2T 5GMKh 1I5LA 3MCAB 5IHIA 3E1SA 1RAGB 1QQJA 3LWHA 2PQWA 1AWWA 3QDFA 2FPFA 4OP0A 1QKXA 1NZ9A 2SRCA 4BI4A 4ZTJA 4M77B 3JRZA 3CC7Q 1OQKA 3OB9A 1K8AC 2P0QA 2JM8A 2RI2A 2ZPBB 2ESWA 1YNZA 3EG0A 4J9GA 4M4ZA 3G6EQ 1MV0B 4HXJA 1YI2A 1QVGA 2HKNA 4A54A 1YITA 3JCMf 1RI0A 1NBEB 1AD5A 1X27A 3RKWA 4C92F 2MPXC 5FU7C 3PVLA 4QVDA 1VQ6Q 4J9BA 3RDVA 3EFRA 1KQSS 2DF6A 1VQKQ 3JB9H 1UHFA 2RJFA 4EDUA 1ZQ1A 2DL7A 4QVZA 5I2SA 5HK0A 1YN8A 5LJ3f 2LT1A 3M0QA 3PNWC 1QCNA 4DEXA 1B34A 3MHXA 4ZTFA 1K73R 3H0IA 4EPCA 3OA6A 2PNIA 3OQ5A 3OYJA 5GAN7 2FVUA 3JCMQ 2V8JA 4JDSA 2RJCA 4AFSC 2L0AA 3EH1A 2HBWA 3DLMA 3CMET 1Y71A 4MZMA 1IHWA 1HK9A 2EIFA 4DBHA 5HKCA 4C8QD 1Q82R 4M78B 4F14A 3OYDA 2DIGA 1UJYA 3REAB 1AWOA 4L6V5 4M7AF 3VKIA 5FW9A 1KD1U 3CXCP 1WIEA 5D6YA 1VQLQ 1N6AA 1F1BB 2F1LA 2XMFA 3N5BB 3JCMc 2A3LA 4F7UE 4FSXA 1YHQT 4F7UA 1GCQA 2E10A 1KFZA 2PUKB 4XU1A 3RMSA 1S72A 3ME9A 3QXEB 5GMKi 3MPUB 4E47A 2FZCB 2COWA 3QWXX 2IIMA 4RTVA 3F70A 1NG2A 4JLIA 1QVPA 1VQNT 1YJ9A 5AT1B 1D1BA 4A53A 3THKA 3V8KA 3SWNA 5IXBA 1WQWA 5D6WA 4M7DG 5CAIA 4R56A 4PJOE 1VQMA 4JS4A 1ZUKA 4EMKB 2RO0A 1WFWA 2RHIA 3LGLA 3EH2A 4RTZA 2LJ1A 1KQ2A 5GAOr 3M0RA 3V7SA 3BW1A 1TU0B 3H6ZA 2NLUA 1VQPT 1OU9A 2CSIA 1HD3A 2QYZA 2R58A 3GBQA 2O4XA 3M58A 2GNCA 4M75E 1X43A 3NTHA 4M75A 2DZ9A 3MEWA 2FPEA 3OMGA 2L89A 4CC2A 2J6OA 1UE9A 4RKUE 5J39A 4R55A 1JB0E 1QLYA 4J6WA 1RABB 3NPFA 2VB6A 5CKDA 1K9MC 1GCQC 4HVWA 3NHNA 2OTLT 1WQ7A 3JCMP 4BY6B 4JJDA 1W6XA 3M53A 2LQWA 6AT1B 1YJNQ 2X3WD 4DBQA 5HK3A 2DTOA 4VUBA 3SWNC 2EW3A 4M77E 1K0XA 2OJ2A 2D0QB 2JTFA 3PIOA 2DETA 4M77A 2RI5A 3JCMd 3RKXA 2BE7D 3IQLA 4UC4A 3CCUA 2EFIA 1VQ8A 1D3BA 1UGQB 4Z8AA 1ABOA 3BE3A 1SF9A 4B9WA 2QA4A 3QKJA 1N8RU 2YSQA 5LJ5f 3ER0A 4FYYB 3CCRA 3CBPA 2FG0A 3KXTA 1NPPA 2JJ9A 3HFNA 5LJ3d 2LVMA 1Q95G 1PKTA 1JQQA 1MNEA 4M75C 1G83A 1YBYA 1I1JA 4PKCC 1H3HA 2YWWA 1Y96B 4C5GA 1Q81U 1WXTA 3TVTA 2BIVA 4A4GA 3KFVA 1OX9A 3CCST 1IO6A 1OZ2A 2HD0A 3MKDA 4ORZA 4DOVA 3I5SA 2DBKA 2XIDA 2DBMA 2RHZA 4B9XA 2FB7A 3P8DA 2ZGWA 2GGRA 4AFUC 1QCOA 2OX7A 1JBMA 2RI3A 4WTOB 1WA7A 2JXBA 5A0GA 1K73C 2KEAA 1YI2Q 1ZBXA 2KY9A 1Q7YR 3BDUA 1RAEB 1YITQ 2KSSA 4IUPA 5CKFA 3HRUA 1IXDA 3HHTB 4J9FA 2YRVA 4FT2A 1M2VA 2DMOA 1I5OB 3VS7A 5A0LA 5GAMe 1UGRB 2PU9B 2R5AA 1KQSA 1M3BA 3QSUA 4OB3B 4OMFB 5KYYB 4M78E 2JVVA 2EYQA 2HL5C 4J9DA 3X20B 3OYEA 3AHUA 3EGDB 4M78A 4D6WA 3E9GA 3OYGA 1Q82C 2KE9A 2NUZA 4RUGA 1BI1A 3H8ZA 3CC7T 4HVVA 3C0CA 1WLPB 1PD1A 2ZPIB 2HNIA 4AFZC 4M7DF 2VWFA 1M3CA 2BE9B 1YP5A 2HDAA 1FWZA 1YIJA 1T3SA 2HSPA 1S1NA 2H8HA 4FU6A 5FU7B 3G6ET 1QP3A 3OYYA 2A37A 5GMKm 4RTUA 1TH7A 2XU8A 5GAMg 3E19A 2QQ9A 2VGNA 4DEYA 5J3BA 3VU3C 1VQ6T 4FSSA 4LDWA 5CCAA 1HXDA 1MV3A 2JMAA 1VQKT 4ANJA 4LDYA 2MAMA 1KK7A 1M27C 2E70A 4C0FA 2X4XA 2QG9B 1S72Q 2CP6A 4M75D 5GMKl 4C0ZA 1QW1A 5GAN2 1PSFA 2LDMA 2LQ8A 5HCKA 1QWEA 4AT1B 4OB0B 1YJ9Q 3QG1A 1BB9A 5KYXA 3L1AA 8AT1B 4LXCA 3CC4Q 4M7AA 5CR2A 4C92C 1M1KR 4L59A 1QVGP 1IB8A 1M90U 3OYAA 1KQ1A 2F2XA 3G1JA 4KH0B 1Q86U 2VVKA 4N4IA 1VQ4A 4PFPA 5LJ5d 2DE0X 4JJNK 4M77D 4X1VA 1OULA 1VQLT 4RTTA 4LE9A 2MK5A 2EGAA 2Z0WA 1Y07A 2NUPA 4PLIA 2COYA 3A5ZB 2DJZA 3JCMe 3TSWA 1FMKA 2JMCA 5GANd 1D0XA 4QVCA 2BZYA 2COZA 2KROA 3INZA 4GLKA 4JRPA 2DYBA 4RTWA 4PJOF 4M7AC 5LJ3e 4KBMB 3QBYA 2KQWA 1JO8A 2CZ7B 2DVEA 3PMIA 2HAXA 3A8LB 3P8BB 3CCUQ 1VQ8Q 3E2UA 2I0NA 2QEXA 2CZ6B 4BI3A 4N0AA 1OYXA 4DBRA 4Z88A 2QA4Q 2EAYA 2RPNA 2AKKA 4F7UB 2ED0A 3H0HA 3CCRQ 1W2BS 1P92A 1QMCA 3QZ9B 4RCCA 2VYTA 5A0DA 2DTHA 1BI0A 3T9NA 3JCMg 1C1AA 2O2OA 1PSEA 3CCVA 4OMMA 1BYMA 2V26A 3JB9J 4FL6A 1Q7YC 4KGVB 1WX6A 2DXCA 4D8KA 3HKSA 1XNIA 2YUOA 3OW2S 3WVEB 2C06A 3OYMA 3SWNB 2K4YA 3JB9D 1YCSB 3M0TA 4M78D 1XJWB 1VQ7A 3UPUA 2RK1A 1YJNT 2RQWA 2PZ1A 5LJ3g 2RQVA 2HMAA 5EC7A 3OMCA 1O75A 2HEQA 2EBPA 3A98A 1M5Q1 2MOXA 2QQAA 1ZLMA 2K57A 4WF2A 3PFSA 3UF4A 1I8FA 1AT1B 2VGMA 5A2QE 4ATOA 2O4XB 2MIOA 1VQOA 1R0CB 2HQHA 4N0AC 5CKEA 4M75B 2KR3A 1U3OA 2FEIA 3MEVA 2X4WA 2L5QA 3OY9A 3CCQQ 2ZZDA 2KDSA 2V1RA 1BKBA 1GFCA 1ZBJA 3M0SA 1DJ7B 3CCLQ 3CMAA 2KYMA 4BE1A 1U5SA 3D7SB 2F2WA 4LN2A 5FLXE 1OPLA 3EFOA 4NL2A 2LCLA 2DNUA 4KULA 1NEGA 1D3BB 1ZUUA 3G4SA 4C8QG 1YIJQ 3VRZA 1TTHB 4M7AD 3EGUA 1YI2T 1TG0A 1UB4A 3OYNA 2NUTA 2E6NA 1YITT 1OEBA 1JXMA 2DX1A 3QYGB 1VQ9T 1UFFA 2FYKA 1YJWA 2LQKA 4AFQC 2X4JA 1M1KC 5GAOm 1JEGA 1E6HA 3HRTA 4R0KA 3Q1JA 1KHCA 2XICA 4DQ2A 2KXDA 1MNDA 4MZPA 3AT1B 2ZPEB 1VIFA 3M0PA 1WHHA 2EQKA 2XKOC 1ZA2B 3G71A 1X2QA 2L3RA 1UEBA 3EFSA 4J5YA 2ENMA 1VYUA 4V2SA 2ZPFB 5LJ5e 2J6KA 3LLRA 4FYWB 4X34A 2K3BA 4RG8A 2DTIA 4PNOA 2KT1A 2KYBA 3OS0A 3PIPA 4BE0A 3VS6A 1RAAB 2JM9A 4LD6A 4D8DA 1TUDA 5GAMd 5FROA 1K73U 1FMVA 1M2VB 1BCOA 3RNJA 1LOJA 2M51A 1VQ4Q 5GANe 1E6GA 2L3PA 3WVDB 2CP7A 5IHNA 2HKQB 2CP3A 3M56A 3DLLA 1KQSP 2K7AA 2VASA 3CPFA 4QQGA 3CBOA 1N9RA 2ECZA 3VUZA 3HFOA 2DO3A 2LRQA 3VUBA 4MMLA 2EVRA 2GF7A 5LJ5g 4M7DC 3GPLA 3ZEHA 1S72T 4C92B 3CCMT 5GANj 2CSQA 3I55T 1SHGA 4ELYC 1H92A 2ZPGB 1KD1R 3ZFJA 1WJQA 2RHYA 2CS7A 5CIUA 1YJ9T 1OI1A 2HL3A 5GAN5 3CC4T 1BK2A 2X3XD 3OYLA 1M8VA 3FC3A 4XQ3A 4IKFA 4J6YA 5CQXA 5GANg 2V1QA 2HQXA 4XAXB 4ELZC 3EG9A 4XTWA 3HSBA 2QEXQ 2DPPB 1D0ZA 1WHGA 2K79A 3PTAA 1YHQA 1V1CA 1BIBA 2KK4A 3J7AF 2DEQA 4GY5A 1KSWA 3M57A 2MCNA 1NE8A 1W2BA 1RI9A 2HZYA 1NM7A 3X26B 5FRNA 2CUBA 1TS9A 3O8VA 3CCVQ 2P0KA 1V76A 4BDYA 1WI7A 2PVOB 3V8LA 5KYWA 3I56T 2EPDA 3OW2A 5KYXB 1KC8C 5CKBA 3UWNA 1ZX6A 4M7AB 1T0JA 4KRTA 5L8RE 3QZ5B 1VQ7Q 3CCJA 4HCCA 2FHDA 2CH4A 1WHJA 4FYVB 2F69A 3O5ZA 4QT7A 3VJPA 4DBFA 4OMNA 2RQUA 3H9NA 1VQPA 2E12A 3OBYA 2RQTA 4QKUA 2CZ1B 4C8QF 1UHCA 3EGXA 1QVFP 1PRLC 3CCUT 4KGXB 1VQ8T 1MMGA 2V8KA 3C95A 2M0OA 2ZCFB 4JZ3A 1VQOQ 4NS5A 2NUPB 2HCKA 1SSFA 5IXFA 1VUBA 3CCRT 5KYUA 2B8AA 2L2PA 2Y4YA 2AIRB 1M1GA 4BD3A 2OTJA 4J7IA 2DAQA 4X9CA 2YUPA 1RAHB 3NMZC 4LD9K 2K3YA 3PVQA 2DL3A 2LT4A 5IAYA 1WXBA 1M2OA 3CMAQ 3OYCA 3VS4A 1QP2A 2A28A 1N8RR 1GCPA 2W10A 2HQEA 3FDRA 2K2MA 2RNAA 3JCMX 3NGPA 3KBGA 2RA2A 5KCHA 2DKGA 2MI6A 2RJDA 3S3NA 3CD6A 1JJ2P 4OVAA 3CBMA 4JS5A 1AHJB 1T3LA 3G4SQ 1I81A 2MYSA 2WSCE 1GBQA 4PJOG 2MMPA 1Q81R 2XD0A 4ZGDB 4XTUA 3HL8A 4CC4B 2WSEE 2VKNA 2E1HA 4XU0A 4BB7A 2RM4A 1WPYA 1V29B 1YJWQ 2O9SA 4PL6A 1GRIA 4C0DC 3CCQT 2A0FB 1ZSZA 1Q7YU 2D9TA 3SB2A 2J7IA 1U06A 2J05A 4JLGA 2VXFA 3CCLT 1UGVA 3EG2A 3G71Q 2FPDA 5C6SA 1SPKA 2CZ0B 4PK4A 5GAN6 2DRMA 3CPWP 3P8HA 2P4RA 4CRIA 1D09B 5GMKe 4RCBA 1B7TA 3KUFA 4J9EA 2GFUA 4C92E 3GF5A 2HBPA 2EGEA 1YIJT 1EIFA 3META 4C92A 2QQBA 5GAMj 1AWXA 2B86A 1IHVA 1ARKA 1H3ZA 1M9SA 4M77G 1MHNA 1KD1C 1AZGB 3EG1A 4OMLA 1TOVA 3CXCA 1RAFB 1PKSA 2DLPA 4OMPA 1OZ3A 4JUVA 2C0TA 3OYKA 5GMKj 2KXCA 4MDWA 2LX7A 3JCMb 3TREA 4P5NA 4IUTA 2OAWA 4MDXA 1ZSZC 1ZUYA 2KRSA 3LX7A 1X6OA 1M8MA 3L2UA 3M55A 4KT0E 4NL3A 1FXXA 4X9DA 1U1TA 2O31A 3EFOB 4OGCA 3UATA 3QJ6A 3RIRA 1NJIR 3G6EA 5GAOq 1G3SA 2E3IA 4LDUA 3UA6A 5CK9A 1SKUB 1K8AU 3M54A 2E3HA 2JTMA 3FRNA 2X35A 2X9HA 2VC8A 2D6FA 2YLBA 2CT4A 2NUTB 3MP6A 1MMDA 4GBQA 2E6ZA 1WGSA 3UDCA 4M7AE 4J6XA 1RADB 1Y7XA 1MMNA 5GJVB 3QHSA 1WJSA 2PTKA 3S6WA 1VQMQ 2QK0A 1VQ4T 2C0IA 2DA9A 1YHQQ 1OOTA 2DZCA 2E65A 4LNPA 1U1SA 4M7DB 2HSEB 5KE3A 4OB2B 2SEMA 3V8JA 5IT9E 5GJWB 2FZGB 4PFOA 4HA8A 3ZL7C 1M90R 2BUDA 2CH4W 4PJMA 1Q86R 4M78G 3OYIA 4F7UF 3QUIA 5KCOA 1QCFA 5DM7R 4J83A 2F5KA 4E7HA 2KAFA 3CCJQ 2XDDA 4GLMA 4OB1B 1AVZC 5D7UA 1VYTA 5KH6A 2K3XA 1OPKA 1H8KA 1LVKA 4IIOA 2ABLA 2A08A 1PHTA 1NEBA 4BI8B 1XOVA 2D0NA 4N4GA 1OX8A 2CDTA 1XTDA 2NWMA 4MMKA 1Y57A 2DL5A 2AZSA 2PVGB 3S3OA 3M9QA 3LYIA 2JS2A 1T0HA 3L2RA 4O6JA 2M1HA 5FRMA 1RLQC 1KIKA 2DK3A 3BY7A 1IRXA 3RMQA 3HPWA 1X6BA 1K76A 1SEMA 2Y4XA 4CI0C 3CCVT 1Q81C 4C5HA 3I5RA 4QW2A 2OTJQ 2CT3A 2IG0A 4M75F 2QGFB 2G6FX 2H3EB 1R77A 1VQ5A 4J9CA 5LJ3j 2QI2A 1SRLA 4XTXA 4A4EA 2LMJA 2M0YA 4RTXA 4OF1A 1R8OB 4LDVA 3MEAA 2ZPHB 3VRYA 4E7IA 1TUCA 3GLXA 3CD6Q 2DVJA 2YHTA 3EG9B 1RL2A 2O01E 2O9VA 4HT9A 3UT1A 2JN0A 3JV3A 1IZ6A 1QWFA 2FRYA 2EQUA 4M77F 4ZNXA 4ZGEB 3G7ZA 2EGCA 2QASA 1X2KA 2ZAEA 2JT4A 2XI9A 4F16A 4C92D 4F04B 1GL5A 3JAME 3OSSC 1W4SA 2AKLA 2LJ0A 3FEOA 4EIKA 5KYWB 3JB9I 4ME7A 4KH1B 1TWBA 1YJNA 2O88A 5IHKA 1YCYA 1KC8U 4O5VA 3GNFB 2JUFA 2JOYA 1N5ZA 1AWJA 3CMAT 5FU6C 1TUGB 1K9MU 4C8QC 3GIBA 1UECA 3CCEA 2RQRA 5AYFA 1UJ0A 2CP2A 5KYNA 3RUXA 1SRMA 4IUUA 3EGXB 2EKOA 4BACA 2LP5A 4Y28E 2KMTA 2DXBA 1MMAA 2GQVA 2BZXA 3OBWA 1G8XA 1JXOA 2LC4A 2LTOA 3TEEA 1NJIC 1K1ZA 4C0DB 4A4FA 1K0SA 4BUGA 3HTRA 5I22A 5KYUB 4A4HA 3CC2A 1NLPC 1MGQA 1AOJA 2LZ6B 3QWYA 4J9HA 5FWBA 1YJWT 1IGQA 4RMOA 3J80E 2M16A 2X4YA 3FLGA 3L2WA 2VUBA 3CEYA 4EMHA 2EWNA 1UTIA 2BZ8A 2LX9A 3UA7A 3ASKA 2KT8A 2JS0A 4QQDA 2LNHB 3JCMJ 2DEUA 3JB9F 2EYXA 3VV0A 4M78F 4M7DE 3G71T 1AZEA 3A8HB 2K9GA 4M7DA 2DD4A 2LQNA 2A36A 3C94A 4J7FA 3FB9A 2CUDA 2DFUA 1M90C 2EQJA 4A63B 2CKKA 1VQ9A 1Q86C 3M0UA 2R57A 1G3TA 5GAOl 2XDPA 2DXTA 3GNGA 7AT1B 4ZN1A 4Y91A 2QTXA 3SD4A 1N27A 1G2BA 1X75C 3RBBB 4AG2C 4ESRA 1ZSZB 3JCMW 4BE2A 1KJWA 4HT8A 3FJPA 5CO7A 2ROTA 2GCXA 3CXCS 1OU8A 2YUQA 5LJ5j 2GTJA 3OS5A 4L5GA 1ABQA 1UGSB 2AZVA 3SEMA 2QDLA 1PCXA 2GQIA 4E7ZA 2EJ9A 1XQHA 2KBTA 3L42A 2RJEA 1A0NB 2RK2A 1Q82U 3RKYA 1GBRA 2RHUA 4Q5WA 3DB3A 3RESA 1KHIA 3VS0A 4IIMA 2CREA 1D0YA 5IN1A 3EG3A 4JJBA 1FX7A 3LW5E 5C0MA 3CMEA 2DM1A 1UUEA 1LJOA 4PJNA 2QQRA 1X6GA 3JCMh 2YDLA 1GXIE 2YRCA 1O9SA 2XG8D 1HSQA 3MP8A 4JRQA 1M30A 2NYSA 1VQMT 1KG1A 3QJYA 1VYVA 3L2QA 4NOYA 3PGGA 1K9AA 3M4YA 4N4HA 2RD1A 4C0GA 3CCMA 5LJ3h 3I55A 1BIAA 3TQ7P 2P0PA 2H3JA 1VOMA 4II1A 4IURA 3OS1A 2EQMA 3PE0A 5I2MA 5GAN8 2YXYA 1WJRA 3MP1A 3CC4A 2G3RA 1VQNA 2DXUA 1VQ5Q 5CQYA 2P4TA 4J9IA 4PJOA 1H641 2OI3A 3CCJT 1EFNA 2E4HA 1PD0A 4FW2A 1X69A 1I0CA 1QVFS 4OMQA 1WHKA 3X24B 3L2VA 2C0OA 3SFMA 8ATCB 5L23A 3H41A 2KRNA 4EMGA 1TSFA 2RMOA 3M4GA 2E5QA 3I56A 3QYHB 3DB4A 4KUIA 1SHFA 1WDXA 1WYXA 1AEYA 1PNJA 2QA4T 2M9UA 2EYWA 4DOWA 2OTJT 3VS1A 3OYBA 2OTLA 2QDYB 4JZ4A 1BCMA 4XTZA 1UG1A 2DL8A 1JJ2S 4PJOC 2ED1A 3CCEQ 4J8OA 2GFAA 4F7UG 4Z89A 1CKAA 3OYFA 1G3YA 3OS2A 3E9FA 4M7DD 1WZOA 2EYZA 3CD6T 4Z02A 4FT4A 2E5KA 4CC3A 3BFMA 1M1FA 3CQTA 2EQIA 1LCKA 4ZGJB 1ZA1B 3A1PA 4Y92A 1Z9ZA 2JW4A 1WHLA 1YWPA 3M5AA 3MEUA 3LGFA 4JRKA 9ATCB 3CC2Q 2Y90A 3TSZA 1IGUA 3DKMA 1LNXA 5FU6B 4C8QB 1GFDA 1JU5C 4QQ6A 5GANf 5GAN4 3VS3A 3QPHA 2GBQA 2YLCA 4KUDK 1E7OA 3CPWS 3CCSA 1D1CA 3PMTA 1HJDA 3JSCA 4M75G 2RB6A 3A8GB 4LUEA 2MWOA 4M77C 3OYHA 3GP8A 2E64A 2M02A 2DL4A 2K2VA 3X25B 2ATCB 1Z9QA 1B3QA 4HCKA 2D8JA 2I2LA 2WSFE 1VQ9Q 3QIIA 4K11A 3TCJA 1PM3A 2BTTA 3J81E 3R6NA 4LUDA 5J26A 3CCQA 5LJ5h 5HY6A 1ZHIA 5KE2A 2LNVA 5EG2A 1M3AA 3V7RA 3NFCA 3A8MB 1RACB 2PUOB 2L8DA 3CCLA 2FRWA 2BKDN 1G3WA 5DLQE 1NLOC 3EHQA 2F2VA 1J3TA 3SHWA 1CKBA 2CGHA 4YTLA 1QKWA 2D8HA 1NYGA 3GOXA 1LPLA 3VYHB 3CC7A 5GANh 3LH0A 4DA4A 5I11A 1VA7A 2KNBB 2AK5A 3FJ5A 3VS2A 3LH5A 1MUZA 2GTOA 2IPOB 4F17A 3MO8A 2W0ZA 3CMEQ 4PJOD 2QAZA 3TU4K 2J6FA 4FYXB 4ZN3A 1W70A 2KRMA 3I35A 4MZTA 2FO0A 1NJIU 1QVGS 4JJCA 5IH2A 1BBZA 1B07A 4XK8E 4EMKA 1PC0A 5M9OA 3C12A 1ACMB 4E6RA 4IUQA 1VQ6A 2CP5A 3HRSA 2EYYA 4XU3A 1VQKA 1PWTA 1K8AR 4M78C 3URGA 3LWIA 4HKEA 1PG5B 2EJGA 1FMWA 2ROLA 3CCMQ 3OSVA 1M1KU 2L3QA 3RERA 3I55Q 2V8IA 2F5TX 1N9SA 2CYZB 2E41A 1W1FA 3JCMV 3VS5A 2JZ2A 4FCYA 3REBB 3HP9A 3NTIA 1FYNA 1PRMC 3C4SA 2K5FA 1U8RA 4FW1A
chains in the Genus database with same CATH topology
2CSQA 1H92A 1SHGA 3KFVA 1UECA 1IO6A 2RQRA 4ORZA 3I5SA 2DBKA 1UJ0A 2DBMA 4JPBW 1SRMA 1BK2A 2X3XD 5ECAA 2LP5A 2GGRA 4AFUC 2BZXA 1WA7A 2JXBA 1JXOA 2V1QA 2KEAA 1ZSGA 1K1ZA 1SSHA 1K0SA 2K79A 5I22A 1RUWA 4J9FA 1NLPC 1V1CA 1K4US 2DMOA 3VS7A 1AOJA 2LZ6B 3QWYA 4J9HA 5FWBA 1KSWA 1NYFA 2MCNA 1I07A 1M3BA 1RI9A 1NM7A 1UDLA 2CUBA 1UTIA 4J9DA 1Y0MA 2BZ8A 2K6DA 3UA7A 2KT8A 1WI7A 2JS0A 2LNHB 2KE9A 2EKHA 2NUZA 4RUGA 2EYXA 2EPDA 1AZEA 1ZX6A 2K9GA 1T0JA 4KRTA 2LQNA 2A36A 4HVVA 3C0CA 1WLPB 2CUDA 2DRKA 4WCIA 2CH4A 2LJ3A 4RTYA 5FWCA 4AFZC 3O5ZA 2VWFA 2DILA 4QT7A 1M3CA 1YP5A 4A63B 2HDAA 4OMNA 1YWOA 2RQUA 1T3SA 2HSPA 1S1NA 2H8HA 2RQTA 3M0UA 2DJQA 1UHCA 3ULRB 1PRLC 2A37A 3EHRA 1G2BA 4RTUA 3U23A 3RBBB 4JZ3A 4AG2C 3I9QA 2L3SA 4ESRA 1KJWA 4DEYA 2HCKA 5IXFA 2ROTA 4FSSA 2JTEA 2JMAA 1MV3A 2L2PA 1BU1A 2YUQA 2GTJA 1RLPC 2J06A 1ABQA 1M27C 2RN8A 2AZVA 3SEMA 2QDLA 4OMOA 2YUPA 2GQIA 3NMZC 2D1XA 2KBTA 3PVQA 4AG1C 1A0NB 2DL3A 1WXBA 3H0FA 3VS4A 1GBRA 2A28A 1GCPA 2W10A 2K2MA 2RNAA 5HCKA 1QWEA 2YUNA 3NGPA 1OV3A 3VS0A 4IIMA 1WXUA 1BB9A 2CREA 3EG3A 4JJBA 4HVUA 2DM1A 1UUEA 1CSKA 2LCSA 1X6GA 1T3LA 2YDLA 1GBQA 2F2XA 1HSQA 2VVKA 4CC7A 2YT6A 2KGTA 2DE0X 1M30A 4CC4B 2VKNA 1VYVA 2RF0A 4X1VA 2O9SA 1K9AA 5IHIA 1GRIA 4RTTA 4LE9A 2EGAA 1AWWA 2FPFA 1QKXA 2J7IA 2SRCA 1U06A 3PE0A 3TSWA 2J05A 1FMKA 2JMCA 1UGVA 3EG2A 2BZYA 2FPDA 2KROA 4J9IA 1SPKA 2DRMA 2OI3A 2P4RA 1EFNA 2DYBA 2JM8A 4RTWA 2ESWA 1X69A 1I0CA 4J9EA 1YNZA 3EG0A 4J9GA 4M4ZA 4OMQA 1JO8A 1MV0B 2EGEA 2C0OA 1AWXA 4HXJA 2B86A 1ARKA 2I0NA 1AZGB 5L23A 3EG1A 4OMLA 1AD5A 1X27A 3H41A 3PVLA 1PKSA 2KRNA 2DLPA 4OMPA 4Z88A 2RPNA 2RMOA 4J9BA 2AKKA 2C0TA 2ED0A 3H0HA 2DF6A 2KXCA 2LX7A 1UHFA 1SHFA 2OAWA 1WDXA 2O2OA 1WYXA 1AEYA 4OMMA 2DL7A 1PNJA 1YN8A 2KRSA 1ZUYA 2EYWA 3M0QA 1M8MA 3VS1A 1WX6A 4D8KA 4DEXA 2O31A 2YUOA 4JZ4A 3UATA 1YCSB 3H0IA 3M0TA 2PNIA 1UG1A 2DL8A 2RQWA 2ED1A 2PZ1A 3UA6A 2RQVA 4Z89A 5EC7A 1CKAA 2L0AA 4AFSC 2HBWA 2HEQA 2EBPA 2EYZA 3A98A 2MOXA 1ZLMA 2CT4A 4GBQA 2E5KA 3UF4A 4CC3A 5GJVB 3CQTA 2EQIA 1LCKA 2PTKA 4F14A 4Y92A 1Z9ZA 2JW4A 1UJYA 2MIOA 3REAB 1YWPA 2C0IA 1AWOA 2DA9A 5FW9A 1OOTA 2KR3A 4LNPA 1WIEA 1U3OA 2FEIA 3TSZA 2XMFA 2SEMA 2V1RA 5GJWB 3ZL7C 1GCQA 1KFZA 1GFDA 1JU5C 1GFCA 1ZBJA 2CH4W 3M0SA 3VS3A 2GBQA 2KYMA 1E7OA 3QWXX 2IIMA 1U5SA 4RTVA 1NG2A 1QCFA 2F2WA 1HJDA 4LN2A 1OPLA 4LUEA 3THKA 5IXBA 4GLMA 1AVZC 2DNUA 1NEGA 2DL4A 1VYTA 1ZUKA 1Z9QA 1B3QA 1ZUUA 4HCKA 2D8JA 1OPKA 1H8KA 4K11A 4IIOA 2ABLA 2A08A 1PHTA 1NEBA 1WFWA 1XOVA 2D0NA 3VRZA 2BTTA 4RTZA 3EGUA 2CDTA 2LJ1A 3R6NA 1TG0A 2NWMA 4LUDA 1Y57A 3M0RA 2DL5A 1OEBA 1JXMA 2AZSA 2DX1A 1UFFA 2CSIA 1HD3A 3GBQA 4AFQC 1M3AA 1T0HA 2JS2A 1JEGA 2GNCA 2FRWA 1RLQC 1E6HA 1X43A 1KIKA 1X6BA 2FPEA 4R0KA 4CC2A 1NLOC 1K76A 2J6OA 3EHQA 1SEMA 2F2VA 2KXDA 1UE9A 1J3TA 1QLYA 3SHWA 1CKBA 3I5RA 3NPFA 2CT3A 1QKWA 2D8HA 3M0PA 1GCQC 1NYGA 4HVWA 2G6FX 1X2QA 3NHNA 4J9CA 2ENMA 1VYUA 1SRLA 4JJDA 2J6KA 5I11A 2LMJA 2M0YA 1W6XA 4RTXA 1VA7A 2LQWA 2K3BA 2KNBB 2AK5A 3FJ5A 2X3WD 3VRYA 3VS2A 3LH5A 1MUZA 1TUCA 2GTOA 2KT1A 2KYBA 4F17A 2W0ZA 2EW3A 3VS6A 2DVJA 1K0XA 2JM9A 2OJ2A 2J6FA 4D8DA 2O9VA 1TUDA 1W70A 2KRMA 3I35A 3IQLA 2FO0A 3JV3A 1QWFA 4JJCA 2FRYA 5IH2A 1BBZA 1B07A 4Z8AA 3RNJA 2M51A 4ZNXA 1E6GA 1ABOA 2EGCA 2L3PA 1X2KA 5IHNA 2JT4A 4E6RA 2YSQA 4F16A 2K7AA 2EYYA 2FG0A 1GL5A 1PWTA 2AKLA 2LJ0A 1PKTA 4EIKA 2ROLA 2ECZA 1JQQA 2L3QA 1G83A 1I1JA 1W1FA 2EVRA 2O88A 3VS5A 1H3HA 3REBB 5IHKA 1FYNA 1PRMC 1N5ZA 1AWJA 1WXTA 3TVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSQ A;  1H92 A;  1SHG A;  3KFV A;  1UEC A;  1IO6 A;  2RQR A;  4ORZ A;  3I5S A;  2DBK A;  1UJ0 A;  2DBM A;  4JPB W;  1SRM A;  1BK2 A;  2X3X D;  5ECA A;  2LP5 A;  2GGR A;  4AFU C;  2BZX A;  1WA7 A;  2JXB A;  1JXO A;  2V1Q A;  2KEA A;  1ZSG A;  1K1Z A;  1SSH A;  1K0S A;  2K79 A;  5I22 A;  1RUW A;  4J9F A;  1NLP C;  1V1C A;  1K4U S;  2DMO A;  3VS7 A;  1AOJ A;  2LZ6 B;  3QWY A;  4J9H A;  5FWB A;  1KSW A;  1NYF A;  2MCN A;  1I07 A;  1M3B A;  1RI9 A;  1NM7 A;  1UDL A;  2CUB A;  1UTI A;  4J9D A;  1Y0M A;  2BZ8 A;  2K6D A;  3UA7 A;  2KT8 A;  1WI7 A;  2JS0 A;  2LNH B;  2KE9 A;  2EKH A;  2NUZ A;  4RUG A;  2EYX A;  2EPD A;  1AZE A;  1ZX6 A;  2K9G A;  1T0J A;  4KRT A;  2LQN A;  2A36 A;  4HVV A;  3C0C A;  1WLP B;  2CUD A;  2DRK A;  4WCI A;  2CH4 A;  2LJ3 A;  4RTY A;  5FWC A;  4AFZ C;  3O5Z A;  2VWF A;  2DIL A;  4QT7 A;  1M3C A;  1YP5 A;  4A63 B;  2HDA A;  4OMN A;  1YWO A;  2RQU A;  1T3S A;  2HSP A;  1S1N A;  2H8H A;  2RQT A;  3M0U A;  2DJQ A;  1UHC A;  3ULR B;  1PRL C;  2A37 A;  3EHR A;  1G2B A;  4RTU A;  3U23 A;  3RBB B;  4JZ3 A;  4AG2 C;  3I9Q A;  2L3S A;  4ESR A;  1KJW A;  4DEY A;  2HCK A;  5IXF A;  2ROT A;  4FSS A;  2JTE A;  2JMA A;  1MV3 A;  2L2P A;  1BU1 A;  2YUQ A;  2GTJ A;  1RLP C;  2J06 A;  1ABQ A;  1M27 C;  2RN8 A;  2AZV A;  3SEM A;  2QDL A;  4OMO A;  2YUP A;  2GQI A;  3NMZ C;  2D1X A;  2KBT A;  3PVQ A;  4AG1 C;  1A0N B;  2DL3 A;  1WXB A;  3H0F A;  3VS4 A;  1GBR A;  2A28 A;  1GCP A;  2W10 A;  2K2M A;  2RNA A;  5HCK A;  1QWE A;  2YUN A;  3NGP A;  1OV3 A;  3VS0 A;  4IIM A;  1WXU A;  1BB9 A;  2CRE A;  3EG3 A;  4JJB A;  4HVU A;  2DM1 A;  1UUE A;  1CSK A;  2LCS A;  1X6G A;  1T3L A;  2YDL A;  1GBQ A;  2F2X A;  1HSQ A;  2VVK A;  4CC7 A;  2YT6 A;  2KGT A;  2DE0 X;  1M30 A;  4CC4 B;  2VKN A;  1VYV A;  2RF0 A;  4X1V A;  2O9S A;  1K9A A;  5IHI A;  1GRI A;  4RTT A;  4LE9 A;  2EGA A;  1AWW A;  2FPF A;  1QKX A;  2J7I A;  2SRC A;  1U06 A;  3PE0 A;  3TSW A;  2J05 A;  1FMK A;  2JMC A;  1UGV A;  3EG2 A;  2BZY A;  2FPD A;  2KRO A;  4J9I A;  1SPK A;  2DRM A;  2OI3 A;  2P4R A;  1EFN A;  2DYB A;  2JM8 A;  4RTW A;  2ESW A;  1X69 A;  1I0C A;  4J9E A;  1YNZ A;  3EG0 A;  4J9G A;  4M4Z A;  4OMQ A;  1JO8 A;  1MV0 B;  2EGE A;  2C0O A;  1AWX A;  4HXJ A;  2B86 A;  1ARK A;  2I0N A;  1AZG B;  5L23 A;  3EG1 A;  4OML A;  1AD5 A;  1X27 A;  3H41 A;  3PVL A;  1PKS A;  2KRN A;  2DLP A;  4OMP A;  4Z88 A;  2RPN A;  2RMO A;  4J9B A;  2AKK A;  2C0T A;  2ED0 A;  3H0H A;  2DF6 A;  2KXC A;  2LX7 A;  1UHF A;  1SHF A;  2OAW A;  1WDX A;  2O2O A;  1WYX A;  1AEY A;  4OMM A;  2DL7 A;  1PNJ A;  1YN8 A;  2KRS A;  1ZUY A;  2EYW A;  3M0Q A;  1M8M A;  3VS1 A;  1WX6 A;  4D8K A;  4DEX A;  2O31 A;  2YUO A;  4JZ4 A;  3UAT A;  1YCS B;  3H0I A;  3M0T A;  2PNI A;  1UG1 A;  2DL8 A;  2RQW A;  2ED1 A;  2PZ1 A;  3UA6 A;  2RQV A;  4Z89 A;  5EC7 A;  1CKA A;  2L0A A;  4AFS C;  2HBW A;  2HEQ A;  2EBP A;  2EYZ A;  3A98 A;  2MOX A;  1ZLM A;  2CT4 A;  4GBQ A;  2E5K A;  3UF4 A;  4CC3 A;  5GJV B;  3CQT A;  2EQI A;  1LCK A;  2PTK A;  4F14 A;  4Y92 A;  1Z9Z A;  2JW4 A;  1UJY A;  2MIO A;  3REA B;  1YWP A;  2C0I A;  1AWO A;  2DA9 A;  5FW9 A;  1OOT A;  2KR3 A;  4LNP A;  1WIE A;  1U3O A;  2FEI A;  3TSZ A;  2XMF A;  2SEM A;  2V1R A;  5GJW B;  3ZL7 C;  1GCQ A;  1KFZ A;  1GFD A;  1JU5 C;  1GFC A;  1ZBJ A;  2CH4 W;  3M0S A;  3VS3 A;  2GBQ A;  2KYM A;  1E7O A;  3QWX X;  2IIM A;  1U5S A;  4RTV A;  1NG2 A;  1QCF A;  2F2W A;  1HJD A;  4LN2 A;  1OPL A;  4LUE A;  3THK A;  5IXB A;  4GLM A;  1AVZ C;  2DNU A;  1NEG A;  2DL4 A;  1VYT A;  1ZUK A;  1Z9Q A;  1B3Q A;  1ZUU A;  4HCK A;  2D8J A;  1OPK A;  1H8K A;  4K11 A;  4IIO A;  2ABL A;  2A08 A;  1PHT A;  1NEB A;  1WFW A;  1XOV A;  2D0N A;  3VRZ A;  2BTT A;  4RTZ A;  3EGU A;  2CDT A;  2LJ1 A;  3R6N A;  1TG0 A;  2NWM A;  4LUD A;  1Y57 A;  3M0R A;  2DL5 A;  1OEB A;  1JXM A;  2AZS A;  2DX1 A;  1UFF A;  2CSI A;  1HD3 A;  3GBQ A;  4AFQ C;  1M3A A;  1T0H A;  2JS2 A;  1JEG A;  2GNC A;  2FRW A;  1RLQ C;  1E6H A;  1X43 A;  1KIK A;  1X6B A;  2FPE A;  4R0K A;  4CC2 A;  1NLO C;  1K76 A;  2J6O A;  3EHQ A;  1SEM A;  2F2V A;  2KXD A;  1UE9 A;  1J3T A;  1QLY A;  3SHW A;  1CKB A;  3I5R A;  3NPF A;  2CT3 A;  1QKW A;  2D8H A;  3M0P A;  1GCQ C;  1NYG A;  4HVW A;  2G6F X;  1X2Q A;  3NHN A;  4J9C A;  2ENM A;  1VYU A;  1SRL A;  4JJD A;  2J6K A;  5I11 A;  2LMJ A;  2M0Y A;  1W6X A;  4RTX A;  1VA7 A;  2LQW A;  2K3B A;  2KNB B;  2AK5 A;  3FJ5 A;  2X3W D;  3VRY A;  3VS2 A;  3LH5 A;  1MUZ A;  1TUC A;  2GTO A;  2KT1 A;  2KYB A;  4F17 A;  2W0Z A;  2EW3 A;  3VS6 A;  2DVJ A;  1K0X A;  2JM9 A;  2OJ2 A;  2J6F A;  4D8D A;  2O9V A;  1TUD A;  1W70 A;  2KRM A;  3I35 A;  3IQL A;  2FO0 A;  3JV3 A;  1QWF A;  4JJC A;  2FRY A;  5IH2 A;  1BBZ A;  1B07 A;  4Z8A A;  3RNJ A;  2M51 A;  4ZNX A;  1E6G A;  1ABO A;  2EGC A;  2L3P A;  1X2K A;  5IHN A;  2JT4 A;  4E6R A;  2YSQ A;  4F16 A;  2K7A A;  2EYY A;  2FG0 A;  1GL5 A;  1PWT A;  2AKL A;  2LJ0 A;  1PKT A;  4EIK A;  2ROL A;  2ECZ A;  1JQQ A;  2L3Q A;  1G83 A;  1I1J A;  1W1F A;  2EVR A;  2O88 A;  3VS5 A;  1H3H A;  3REB B;  5IHK A;  1FYN A;  1PRM C;  1N5Z A;  1AWJ A;  1WXT A;  3TVT A; 
#chains in the Genus database with same CATH topology
 1VQN Q;  4LDX A;  3BDL A;  3SDZ A;  2EJF A;  2XHC A;  1G5V A;  3JB9 G;  2DER A;  4XTV A;  5DLO A;  2QGG A;  2FL7 A;  4JPB W;  1SG5 A;  2QTV A;  1X01 A;  4C5E A;  3L2Z A;  5ECA A;  1NPR A;  1M4Z A;  4E7L A;  1QVF A;  2A7Y A;  2XDB A;  1WNL A;  2DD5 A;  2YRD A;  1ZSG A;  5D6X A;  4A4K A;  1SSH A;  5GAO n;  2VV5 A;  4C92 G;  4EMK C;  2MWP A;  1RUW A;  5DY9 A;  1VQP Q;  2KVQ G;  2CP0 A;  2OAU A;  4PJL A;  1B34 B;  1VQL A;  1K4U S;  1N8R C;  1EX4 A;  4E7J A;  3I56 Q;  1NYF A;  3QDR B;  1I07 A;  4HCB A;  2QEX T;  5CKH A;  2X51 A;  1UDL A;  3VYG A;  1Y0M A;  2JNG A;  2K6D A;  4E7S A;  3WXM B;  2QXF A;  2IVW A;  2EKH A;  4PFZ A;  4AMC A;  2OTL Q;  1VIE A;  2RH2 A;  3R6O A;  3QO3 A;  1VQ5 T;  2VXE A;  1Y96 A;  2DRK A;  2QQS A;  4WCI A;  1JJ2 A;  5GAO p;  2LJ3 A;  4RTY A;  4C8Q E;  5FWC A;  2AHJ B;  2DIQ A;  5I21 A;  1I4K 1;  4C8Q A;  2DIL A;  2PVD B;  4BY6 C;  5GAM f;  1C6V X;  1WHM A;  3MJX A;  1YWO A;  1VQ7 T;  2DJQ A;  5CVI A;  4FIB A;  4BDZ A;  3NTK A;  3ULR B;  2RHX A;  4TVR A;  4HCZ A;  3S3M A;  1YFN A;  3EHR A;  1RAI B;  3RR6 A;  5LL6 S;  4E2F B;  4KGZ B;  3ZBD A;  2LCC A;  3U23 A;  4M7A G;  3FIF A;  3I9Q A;  2L3S A;  1TXQ A;  1IRE B;  1R0B G;  2JTE A;  1BU1 A;  2XK0 A;  1RLP C;  2J06 A;  4OGE A;  4PJJ A;  5GAN 3;  2RN8 A;  1VQO T;  1W2B P;  4XU2 A;  4C5I A;  4OMO A;  1D1A A;  2D1X A;  5KYY A;  4PJO B;  2R5M A;  4AG1 C;  3M59 A;  4E7K A;  3H0F A;  3EGD A;  1EZZ B;  3CPW A;  2P84 A;  4JRI A;  4PLL A;  1HYO A;  3CCS Q;  3V7C A;  4RG2 A;  3OW2 P;  2YUN A;  1OV3 A;  1WXU A;  3CCE T;  2WAC A;  2DYI A;  4IUV A;  4HVU A;  3PT9 A;  2FZK B;  3X28 B;  4B6M A;  2K5I A;  1UGP B;  4XTY A;  1C0M A;  1CSK A;  3EAE A;  2LCS A;  4FM4 B;  5GAM h;  1BI2 A;  1KC8 R;  4CC7 A;  2YT6 A;  2KGT A;  1K9M R;  2MF2 A;  3A8O B;  2RF0 A;  1JRI A;  2AT1 B;  2KI7 A;  3G4S T;  2K5L A;  1BI3 A;  3CC2 T;  5GMK h;  1I5L A;  3MCA B;  5IHI A;  3E1S A;  1RAG B;  1QQJ A;  3LWH A;  2PQW A;  1AWW A;  3QDF A;  2FPF A;  4OP0 A;  1QKX A;  1NZ9 A;  2SRC A;  4BI4 A;  4ZTJ A;  4M77 B;  3JRZ A;  3CC7 Q;  1OQK A;  3OB9 A;  1K8A C;  2P0Q A;  2JM8 A;  2RI2 A;  2ZPB B;  2ESW A;  1YNZ A;  3EG0 A;  4J9G A;  4M4Z A;  3G6E Q;  1MV0 B;  4HXJ A;  1YI2 A;  1QVG A;  2HKN A;  4A54 A;  1YIT A;  3JCM f;  1RI0 A;  1NBE B;  1AD5 A;  1X27 A;  3RKW A;  4C92 F;  2MPX C;  5FU7 C;  3PVL A;  4QVD A;  1VQ6 Q;  4J9B A;  3RDV A;  3EFR A;  1KQS S;  2DF6 A;  1VQK Q;  3JB9 H;  1UHF A;  2RJF A;  4EDU A;  1ZQ1 A;  2DL7 A;  4QVZ A;  5I2S A;  5HK0 A;  1YN8 A;  5LJ3 f;  2LT1 A;  3M0Q A;  3PNW C;  1QCN A;  4DEX A;  1B34 A;  3MHX A;  4ZTF A;  1K73 R;  3H0I A;  4EPC A;  3OA6 A;  2PNI A;  3OQ5 A;  3OYJ A;  5GAN 7;  2FVU A;  3JCM Q;  2V8J A;  4JDS A;  2RJC A;  4AFS C;  2L0A A;  3EH1 A;  2HBW A;  3DLM A;  3CME T;  1Y71 A;  4MZM A;  1IHW A;  1HK9 A;  2EIF A;  4DBH A;  5HKC A;  4C8Q D;  1Q82 R;  4M78 B;  4F14 A;  3OYD A;  2DIG A;  1UJY A;  3REA B;  1AWO A;  4L6V 5;  4M7A F;  3VKI A;  5FW9 A;  1KD1 U;  3CXC P;  1WIE A;  5D6Y A;  1VQL Q;  1N6A A;  1F1B B;  2F1L A;  2XMF A;  3N5B B;  3JCM c;  2A3L A;  4F7U E;  4FSX A;  1YHQ T;  4F7U A;  1GCQ A;  2E10 A;  1KFZ A;  2PUK B;  4XU1 A;  3RMS A;  1S72 A;  3ME9 A;  3QXE B;  5GMK i;  3MPU B;  4E47 A;  2FZC B;  2COW A;  3QWX X;  2IIM A;  4RTV A;  3F70 A;  1NG2 A;  4JLI A;  1QVP A;  1VQN T;  1YJ9 A;  5AT1 B;  1D1B A;  4A53 A;  3THK A;  3V8K A;  3SWN A;  5IXB A;  1WQW A;  5D6W A;  4M7D G;  5CAI A;  4R56 A;  4PJO E;  1VQM A;  4JS4 A;  1ZUK A;  4EMK B;  2RO0 A;  1WFW A;  2RHI A;  3LGL A;  3EH2 A;  4RTZ A;  2LJ1 A;  1KQ2 A;  5GAO r;  3M0R A;  3V7S A;  3BW1 A;  1TU0 B;  3H6Z A;  2NLU A;  1VQP T;  1OU9 A;  2CSI A;  1HD3 A;  2QYZ A;  2R58 A;  3GBQ A;  2O4X A;  3M58 A;  2GNC A;  4M75 E;  1X43 A;  3NTH A;  4M75 A;  2DZ9 A;  3MEW A;  2FPE A;  3OMG A;  2L89 A;  4CC2 A;  2J6O A;  1UE9 A;  4RKU E;  5J39 A;  4R55 A;  1JB0 E;  1QLY A;  4J6W A;  1RAB B;  3NPF A;  2VB6 A;  5CKD A;  1K9M C;  1GCQ C;  4HVW A;  3NHN A;  2OTL T;  1WQ7 A;  3JCM P;  4BY6 B;  4JJD A;  1W6X A;  3M53 A;  2LQW A;  6AT1 B;  1YJN Q;  2X3W D;  4DBQ A;  5HK3 A;  2DTO A;  4VUB A;  3SWN C;  2EW3 A;  4M77 E;  1K0X A;  2OJ2 A;  2D0Q B;  2JTF A;  3PIO A;  2DET A;  4M77 A;  2RI5 A;  3JCM d;  3RKX A;  2BE7 D;  3IQL A;  4UC4 A;  3CCU A;  2EFI A;  1VQ8 A;  1D3B A;  1UGQ B;  4Z8A A;  1ABO A;  3BE3 A;  1SF9 A;  4B9W A;  2QA4 A;  3QKJ A;  1N8R U;  2YSQ A;  5LJ5 f;  3ER0 A;  4FYY B;  3CCR A;  3CBP A;  2FG0 A;  3KXT A;  1NPP A;  2JJ9 A;  3HFN A;  5LJ3 d;  2LVM A;  1Q95 G;  1PKT A;  1JQQ A;  1MNE A;  4M75 C;  1G83 A;  1YBY A;  1I1J A;  4PKC C;  1H3H A;  2YWW A;  1Y96 B;  4C5G A;  1Q81 U;  1WXT A;  3TVT A;  2BIV A;  4A4G A;  3KFV A;  1OX9 A;  3CCS T;  1IO6 A;  1OZ2 A;  2HD0 A;  3MKD A;  4ORZ A;  4DOV A;  3I5S A;  2DBK A;  2XID A;  2DBM A;  2RHZ A;  4B9X A;  2FB7 A;  3P8D A;  2ZGW A;  2GGR A;  4AFU C;  1QCO A;  2OX7 A;  1JBM A;  2RI3 A;  4WTO B;  1WA7 A;  2JXB A;  5A0G A;  1K73 C;  2KEA A;  1YI2 Q;  1ZBX A;  2KY9 A;  1Q7Y R;  3BDU A;  1RAE B;  1YIT Q;  2KSS A;  4IUP A;  5CKF A;  3HRU A;  1IXD A;  3HHT B;  4J9F A;  2YRV A;  4FT2 A;  1M2V A;  2DMO A;  1I5O B;  3VS7 A;  5A0L A;  5GAM e;  1UGR B;  2PU9 B;  2R5A A;  1KQS A;  1M3B A;  3QSU A;  4OB3 B;  4OMF B;  5KYY B;  4M78 E;  2JVV A;  2EYQ A;  2HL5 C;  4J9D A;  3X20 B;  3OYE A;  3AHU A;  3EGD B;  4M78 A;  4D6W A;  3E9G A;  3OYG A;  1Q82 C;  2KE9 A;  2NUZ A;  4RUG A;  1BI1 A;  3H8Z A;  3CC7 T;  4HVV A;  3C0C A;  1WLP B;  1PD1 A;  2ZPI B;  2HNI A;  4AFZ C;  4M7D F;  2VWF A;  1M3C A;  2BE9 B;  1YP5 A;  2HDA A;  1FWZ A;  1YIJ A;  1T3S A;  2HSP A;  1S1N A;  2H8H A;  4FU6 A;  5FU7 B;  3G6E T;  1QP3 A;  3OYY A;  2A37 A;  5GMK m;  4RTU A;  1TH7 A;  2XU8 A;  5GAM g;  3E19 A;  2QQ9 A;  2VGN A;  4DEY A;  5J3B A;  3VU3 C;  1VQ6 T;  4FSS A;  4LDW A;  5CCA A;  1HXD A;  1MV3 A;  2JMA A;  1VQK T;  4ANJ A;  4LDY A;  2MAM A;  1KK7 A;  1M27 C;  2E70 A;  4C0F A;  2X4X A;  2QG9 B;  1S72 Q;  2CP6 A;  4M75 D;  5GMK l;  4C0Z A;  1QW1 A;  5GAN 2;  1PSF A;  2LDM A;  2LQ8 A;  5HCK A;  1QWE A;  4AT1 B;  4OB0 B;  1YJ9 Q;  3QG1 A;  1BB9 A;  5KYX A;  3L1A A;  8AT1 B;  4LXC A;  3CC4 Q;  4M7A A;  5CR2 A;  4C92 C;  1M1K R;  4L59 A;  1QVG P;  1IB8 A;  1M90 U;  3OYA A;  1KQ1 A;  2F2X A;  3G1J A;  4KH0 B;  1Q86 U;  2VVK A;  4N4I A;  1VQ4 A;  4PFP A;  5LJ5 d;  2DE0 X;  4JJN K;  4M77 D;  4X1V A;  1OUL A;  1VQL T;  4RTT A;  4LE9 A;  2MK5 A;  2EGA A;  2Z0W A;  1Y07 A;  2NUP A;  4PLI A;  2COY A;  3A5Z B;  2DJZ A;  3JCM e;  3TSW A;  1FMK A;  2JMC A;  5GAN d;  1D0X A;  4QVC A;  2BZY A;  2COZ A;  2KRO A;  3INZ A;  4GLK A;  4JRP A;  2DYB A;  4RTW A;  4PJO F;  4M7A C;  5LJ3 e;  4KBM B;  3QBY A;  2KQW A;  1JO8 A;  2CZ7 B;  2DVE A;  3PMI A;  2HAX A;  3A8L B;  3P8B B;  3CCU Q;  1VQ8 Q;  3E2U A;  2I0N A;  2QEX A;  2CZ6 B;  4BI3 A;  4N0A A;  1OYX A;  4DBR A;  4Z88 A;  2QA4 Q;  2EAY A;  2RPN A;  2AKK A;  4F7U B;  2ED0 A;  3H0H A;  3CCR Q;  1W2B S;  1P92 A;  1QMC A;  3QZ9 B;  4RCC A;  2VYT A;  5A0D A;  2DTH A;  1BI0 A;  3T9N A;  3JCM g;  1C1A A;  2O2O A;  1PSE A;  3CCV A;  4OMM A;  1BYM A;  2V26 A;  3JB9 J;  4FL6 A;  1Q7Y C;  4KGV B;  1WX6 A;  2DXC A;  4D8K A;  3HKS A;  1XNI A;  2YUO A;  3OW2 S;  3WVE B;  2C06 A;  3OYM A;  3SWN B;  2K4Y A;  3JB9 D;  1YCS B;  3M0T A;  4M78 D;  1XJW B;  1VQ7 A;  3UPU A;  2RK1 A;  1YJN T;  2RQW A;  2PZ1 A;  5LJ3 g;  2RQV A;  2HMA A;  5EC7 A;  3OMC A;  1O75 A;  2HEQ A;  2EBP A;  3A98 A;  1M5Q 1;  2MOX A;  2QQA A;  1ZLM A;  2K57 A;  4WF2 A;  3PFS A;  3UF4 A;  1I8F A;  1AT1 B;  2VGM A;  5A2Q E;  4ATO A;  2O4X B;  2MIO A;  1VQO A;  1R0C B;  2HQH A;  4N0A C;  5CKE A;  4M75 B;  2KR3 A;  1U3O A;  2FEI A;  3MEV A;  2X4W A;  2L5Q A;  3OY9 A;  3CCQ Q;  2ZZD A;  2KDS A;  2V1R A;  1BKB A;  1GFC A;  1ZBJ A;  3M0S A;  1DJ7 B;  3CCL Q;  3CMA A;  2KYM A;  4BE1 A;  1U5S A;  3D7S B;  2F2W A;  4LN2 A;  5FLX E;  1OPL A;  3EFO A;  4NL2 A;  2LCL A;  2DNU A;  4KUL A;  1NEG A;  1D3B B;  1ZUU A;  3G4S A;  4C8Q G;  1YIJ Q;  3VRZ A;  1TTH B;  4M7A D;  3EGU A;  1YI2 T;  1TG0 A;  1UB4 A;  3OYN A;  2NUT A;  2E6N A;  1YIT T;  1OEB A;  1JXM A;  2DX1 A;  3QYG B;  1VQ9 T;  1UFF A;  2FYK A;  1YJW A;  2LQK A;  4AFQ C;  2X4J A;  1M1K C;  5GAO m;  1JEG A;  1E6H A;  3HRT A;  4R0K A;  3Q1J A;  1KHC A;  2XIC A;  4DQ2 A;  2KXD A;  1MND A;  4MZP A;  3AT1 B;  2ZPE B;  1VIF A;  3M0P A;  1WHH A;  2EQK A;  2XKO C;  1ZA2 B;  3G71 A;  1X2Q A;  2L3R A;  1UEB A;  3EFS A;  4J5Y A;  2ENM A;  1VYU A;  4V2S A;  2ZPF B;  5LJ5 e;  2J6K A;  3LLR A;  4FYW B;  4X34 A;  2K3B A;  4RG8 A;  2DTI A;  4PNO A;  2KT1 A;  2KYB A;  3OS0 A;  3PIP A;  4BE0 A;  3VS6 A;  1RAA B;  2JM9 A;  4LD6 A;  4D8D A;  1TUD A;  5GAM d;  5FRO A;  1K73 U;  1FMV A;  1M2V B;  1BCO A;  3RNJ A;  1LOJ A;  2M51 A;  1VQ4 Q;  5GAN e;  1E6G A;  2L3P A;  3WVD B;  2CP7 A;  5IHN A;  2HKQ B;  2CP3 A;  3M56 A;  3DLL A;  1KQS P;  2K7A A;  2VAS A;  3CPF A;  4QQG A;  3CBO A;  1N9R A;  2ECZ A;  3VUZ A;  3HFO A;  2DO3 A;  2LRQ A;  3VUB A;  4MML A;  2EVR A;  2GF7 A;  5LJ5 g;  4M7D C;  3GPL A;  3ZEH A;  1S72 T;  4C92 B;  3CCM T;  5GAN j;  2CSQ A;  3I55 T;  1SHG A;  4ELY C;  1H92 A;  2ZPG B;  1KD1 R;  3ZFJ A;  1WJQ A;  2RHY A;  2CS7 A;  5CIU A;  1YJ9 T;  1OI1 A;  2HL3 A;  5GAN 5;  3CC4 T;  1BK2 A;  2X3X D;  3OYL A;  1M8V A;  3FC3 A;  4XQ3 A;  4IKF A;  4J6Y A;  5CQX A;  5GAN g;  2V1Q A;  2HQX A;  4XAX B;  4ELZ C;  3EG9 A;  4XTW A;  3HSB A;  2QEX Q;  2DPP B;  1D0Z A;  1WHG A;  2K79 A;  3PTA A;  1YHQ A;  1V1C A;  1BIB A;  2KK4 A;  3J7A F;  2DEQ A;  4GY5 A;  1KSW A;  3M57 A;  2MCN A;  1NE8 A;  1W2B A;  1RI9 A;  2HZY A;  1NM7 A;  3X26 B;  5FRN A;  2CUB A;  1TS9 A;  3O8V A;  3CCV Q;  2P0K A;  1V76 A;  4BDY A;  1WI7 A;  2PVO B;  3V8L A;  5KYW A;  3I56 T;  2EPD A;  3OW2 A;  5KYX B;  1KC8 C;  5CKB A;  3UWN A;  1ZX6 A;  4M7A B;  1T0J A;  4KRT A;  5L8R E;  3QZ5 B;  1VQ7 Q;  3CCJ A;  4HCC A;  2FHD A;  2CH4 A;  1WHJ A;  4FYV B;  2F69 A;  3O5Z A;  4QT7 A;  3VJP A;  4DBF A;  4OMN A;  2RQU A;  3H9N A;  1VQP A;  2E12 A;  3OBY A;  2RQT A;  4QKU A;  2CZ1 B;  4C8Q F;  1UHC A;  3EGX A;  1QVF P;  1PRL C;  3CCU T;  4KGX B;  1VQ8 T;  1MMG A;  2V8K A;  3C95 A;  2M0O A;  2ZCF B;  4JZ3 A;  1VQO Q;  4NS5 A;  2NUP B;  2HCK A;  1SSF A;  5IXF A;  1VUB A;  3CCR T;  5KYU A;  2B8A A;  2L2P A;  2Y4Y A;  2AIR B;  1M1G A;  4BD3 A;  2OTJ A;  4J7I A;  2DAQ A;  4X9C A;  2YUP A;  1RAH B;  3NMZ C;  4LD9 K;  2K3Y A;  3PVQ A;  2DL3 A;  2LT4 A;  5IAY A;  1WXB A;  1M2O A;  3CMA Q;  3OYC A;  3VS4 A;  1QP2 A;  2A28 A;  1N8R R;  1GCP A;  2W10 A;  2HQE A;  3FDR A;  2K2M A;  2RNA A;  3JCM X;  3NGP A;  3KBG A;  2RA2 A;  5KCH A;  2DKG A;  2MI6 A;  2RJD A;  3S3N A;  3CD6 A;  1JJ2 P;  4OVA A;  3CBM A;  4JS5 A;  1AHJ B;  1T3L A;  3G4S Q;  1I81 A;  2MYS A;  2WSC E;  1GBQ A;  4PJO G;  2MMP A;  1Q81 R;  2XD0 A;  4ZGD B;  4XTU A;  3HL8 A;  4CC4 B;  2WSE E;  2VKN A;  2E1H A;  4XU0 A;  4BB7 A;  2RM4 A;  1WPY A;  1V29 B;  1YJW Q;  2O9S A;  4PL6 A;  1GRI A;  4C0D C;  3CCQ T;  2A0F B;  1ZSZ A;  1Q7Y U;  2D9T A;  3SB2 A;  2J7I A;  1U06 A;  2J05 A;  4JLG A;  2VXF A;  3CCL T;  1UGV A;  3EG2 A;  3G71 Q;  2FPD A;  5C6S A;  1SPK A;  2CZ0 B;  4PK4 A;  5GAN 6;  2DRM A;  3CPW P;  3P8H A;  2P4R A;  4CRI A;  1D09 B;  5GMK e;  4RCB A;  1B7T A;  3KUF A;  4J9E A;  2GFU A;  4C92 E;  3GF5 A;  2HBP A;  2EGE A;  1YIJ T;  1EIF A;  3MET A;  4C92 A;  2QQB A;  5GAM j;  1AWX A;  2B86 A;  1IHV A;  1ARK A;  1H3Z A;  1M9S A;  4M77 G;  1MHN A;  1KD1 C;  1AZG B;  3EG1 A;  4OML A;  1TOV A;  3CXC A;  1RAF B;  1PKS A;  2DLP A;  4OMP A;  1OZ3 A;  4JUV A;  2C0T A;  3OYK A;  5GMK j;  2KXC A;  4MDW A;  2LX7 A;  3JCM b;  3TRE A;  4P5N A;  4IUT A;  2OAW A;  4MDX A;  1ZSZ C;  1ZUY A;  2KRS A;  3LX7 A;  1X6O A;  1M8M A;  3L2U A;  3M55 A;  4KT0 E;  4NL3 A;  1FXX A;  4X9D A;  1U1T A;  2O31 A;  3EFO B;  4OGC A;  3UAT A;  3QJ6 A;  3RIR A;  1NJI R;  3G6E A;  5GAO q;  1G3S A;  2E3I A;  4LDU A;  3UA6 A;  5CK9 A;  1SKU B;  1K8A U;  3M54 A;  2E3H A;  2JTM A;  3FRN A;  2X35 A;  2X9H A;  2VC8 A;  2D6F A;  2YLB A;  2CT4 A;  2NUT B;  3MP6 A;  1MMD A;  4GBQ A;  2E6Z A;  1WGS A;  3UDC A;  4M7A E;  4J6X A;  1RAD B;  1Y7X A;  1MMN A;  5GJV B;  3QHS A;  1WJS A;  2PTK A;  3S6W A;  1VQM Q;  2QK0 A;  1VQ4 T;  2C0I A;  2DA9 A;  1YHQ Q;  1OOT A;  2DZC A;  2E65 A;  4LNP A;  1U1S A;  4M7D B;  2HSE B;  5KE3 A;  4OB2 B;  2SEM A;  3V8J A;  5IT9 E;  5GJW B;  2FZG B;  4PFO A;  4HA8 A;  3ZL7 C;  1M90 R;  2BUD A;  2CH4 W;  4PJM A;  1Q86 R;  4M78 G;  3OYI A;  4F7U F;  3QUI A;  5KCO A;  1QCF A;  5DM7 R;  4J83 A;  2F5K A;  4E7H A;  2KAF A;  3CCJ Q;  2XDD A;  4GLM A;  4OB1 B;  1AVZ C;  5D7U A;  1VYT A;  5KH6 A;  2K3X A;  1OPK A;  1H8K A;  1LVK A;  4IIO A;  2ABL A;  2A08 A;  1PHT A;  1NEB A;  4BI8 B;  1XOV A;  2D0N A;  4N4G A;  1OX8 A;  2CDT A;  1XTD A;  2NWM A;  4MMK A;  1Y57 A;  2DL5 A;  2AZS A;  2PVG B;  3S3O A;  3M9Q A;  3LYI A;  2JS2 A;  1T0H A;  3L2R A;  4O6J A;  2M1H A;  5FRM A;  1RLQ C;  1KIK A;  2DK3 A;  3BY7 A;  1IRX A;  3RMQ A;  3HPW A;  1X6B A;  1K76 A;  1SEM A;  2Y4X A;  4CI0 C;  3CCV T;  1Q81 C;  4C5H A;  3I5R A;  4QW2 A;  2OTJ Q;  2CT3 A;  2IG0 A;  4M75 F;  2QGF B;  2G6F X;  2H3E B;  1R77 A;  1VQ5 A;  4J9C A;  5LJ3 j;  2QI2 A;  1SRL A;  4XTX A;  4A4E A;  2LMJ A;  2M0Y A;  4RTX A;  4OF1 A;  1R8O B;  4LDV A;  3MEA A;  2ZPH B;  3VRY A;  4E7I A;  1TUC A;  3GLX A;  3CD6 Q;  2DVJ A;  2YHT A;  3EG9 B;  1RL2 A;  2O01 E;  2O9V A;  4HT9 A;  3UT1 A;  2JN0 A;  3JV3 A;  1IZ6 A;  1QWF A;  2FRY A;  2EQU A;  4M77 F;  4ZNX A;  4ZGE B;  3G7Z A;  2EGC A;  2QAS A;  1X2K A;  2ZAE A;  2JT4 A;  2XI9 A;  4F16 A;  4C92 D;  4F04 B;  1GL5 A;  3JAM E;  3OSS C;  1W4S A;  2AKL A;  2LJ0 A;  3FEO A;  4EIK A;  5KYW B;  3JB9 I;  4ME7 A;  4KH1 B;  1TWB A;  1YJN A;  2O88 A;  5IHK A;  1YCY A;  1KC8 U;  4O5V A;  3GNF B;  2JUF A;  2JOY A;  1N5Z A;  1AWJ A;  3CMA T;  5FU6 C;  1TUG B;  1K9M U;  4C8Q C;  3GIB A;  1UEC A;  3CCE A;  2RQR A;  5AYF A;  1UJ0 A;  2CP2 A;  5KYN A;  3RUX A;  1SRM A;  4IUU A;  3EGX B;  2EKO A;  4BAC A;  2LP5 A;  4Y28 E;  2KMT A;  2DXB A;  1MMA A;  2GQV A;  2BZX A;  3OBW A;  1G8X A;  1JXO A;  2LC4 A;  2LTO A;  3TEE A;  1NJI C;  1K1Z A;  4C0D B;  4A4F A;  1K0S A;  4BUG A;  3HTR A;  5I22 A;  5KYU B;  4A4H A;  3CC2 A;  1NLP C;  1MGQ A;  1AOJ A;  2LZ6 B;  3QWY A;  4J9H A;  5FWB A;  1YJW T;  1IGQ A;  4RMO A;  3J80 E;  2M16 A;  2X4Y A;  3FLG A;  3L2W A;  2VUB A;  3CEY A;  4EMH A;  2EWN A;  1UTI A;  2BZ8 A;  2LX9 A;  3UA7 A;  3ASK A;  2KT8 A;  2JS0 A;  4QQD A;  2LNH B;  3JCM J;  2DEU A;  3JB9 F;  2EYX A;  3VV0 A;  4M78 F;  4M7D E;  3G71 T;  1AZE A;  3A8H B;  2K9G A;  4M7D A;  2DD4 A;  2LQN A;  2A36 A;  3C94 A;  4J7F A;  3FB9 A;  2CUD A;  2DFU A;  1M90 C;  2EQJ A;  4A63 B;  2CKK A;  1VQ9 A;  1Q86 C;  3M0U A;  2R57 A;  1G3T A;  5GAO l;  2XDP A;  2DXT A;  3GNG A;  7AT1 B;  4ZN1 A;  4Y91 A;  2QTX A;  3SD4 A;  1N27 A;  1G2B A;  1X75 C;  3RBB B;  4AG2 C;  4ESR A;  1ZSZ B;  3JCM W;  4BE2 A;  1KJW A;  4HT8 A;  3FJP A;  5CO7 A;  2ROT A;  2GCX A;  3CXC S;  1OU8 A;  2YUQ A;  5LJ5 j;  2GTJ A;  3OS5 A;  4L5G A;  1ABQ A;  1UGS B;  2AZV A;  3SEM A;  2QDL A;  1PCX A;  2GQI A;  4E7Z A;  2EJ9 A;  1XQH A;  2KBT A;  3L42 A;  2RJE A;  1A0N B;  2RK2 A;  1Q82 U;  3RKY A;  1GBR A;  2RHU A;  4Q5W A;  3DB3 A;  3RES A;  1KHI A;  3VS0 A;  4IIM A;  2CRE A;  1D0Y A;  5IN1 A;  3EG3 A;  4JJB A;  1FX7 A;  3LW5 E;  5C0M A;  3CME A;  2DM1 A;  1UUE A;  1LJO A;  4PJN A;  2QQR A;  1X6G A;  3JCM h;  2YDL A;  1GXI E;  2YRC A;  1O9S A;  2XG8 D;  1HSQ A;  3MP8 A;  4JRQ A;  1M30 A;  2NYS A;  1VQM T;  1KG1 A;  3QJY A;  1VYV A;  3L2Q A;  4NOY A;  3PGG A;  1K9A A;  3M4Y A;  4N4H A;  2RD1 A;  4C0G A;  3CCM A;  5LJ3 h;  3I55 A;  1BIA A;  3TQ7 P;  2P0P A;  2H3J A;  1VOM A;  4II1 A;  4IUR A;  3OS1 A;  2EQM A;  3PE0 A;  5I2M A;  5GAN 8;  2YXY A;  1WJR A;  3MP1 A;  3CC4 A;  2G3R A;  1VQN A;  2DXU A;  1VQ5 Q;  5CQY A;  2P4T A;  4J9I A;  4PJO A;  1H64 1;  2OI3 A;  3CCJ T;  1EFN A;  2E4H A;  1PD0 A;  4FW2 A;  1X69 A;  1I0C A;  1QVF S;  4OMQ A;  1WHK A;  3X24 B;  3L2V A;  2C0O A;  3SFM A;  8ATC B;  5L23 A;  3H41 A;  2KRN A;  4EMG A;  1TSF A;  2RMO A;  3M4G A;  2E5Q A;  3I56 A;  3QYH B;  3DB4 A;  4KUI A;  1SHF A;  1WDX A;  1WYX A;  1AEY A;  1PNJ A;  2QA4 T;  2M9U A;  2EYW A;  4DOW A;  2OTJ T;  3VS1 A;  3OYB A;  2OTL A;  2QDY B;  4JZ4 A;  1BCM A;  4XTZ A;  1UG1 A;  2DL8 A;  1JJ2 S;  4PJO C;  2ED1 A;  3CCE Q;  4J8O A;  2GFA A;  4F7U G;  4Z89 A;  1CKA A;  3OYF A;  1G3Y A;  3OS2 A;  3E9F A;  4M7D D;  1WZO A;  2EYZ A;  3CD6 T;  4Z02 A;  4FT4 A;  2E5K A;  4CC3 A;  3BFM A;  1M1F A;  3CQT A;  2EQI A;  1LCK A;  4ZGJ B;  1ZA1 B;  3A1P A;  4Y92 A;  1Z9Z A;  2JW4 A;  1WHL A;  1YWP A;  3M5A A;  3MEU A;  3LGF A;  4JRK A;  9ATC B;  3CC2 Q;  2Y90 A;  3TSZ A;  1IGU A;  3DKM A;  1LNX A;  5FU6 B;  4C8Q B;  1GFD A;  1JU5 C;  4QQ6 A;  5GAN f;  5GAN 4;  3VS3 A;  3QPH A;  2GBQ A;  2YLC A;  4KUD K;  1E7O A;  3CPW S;  3CCS A;  1D1C A;  3PMT A;  1HJD A;  3JSC A;  4M75 G;  2RB6 A;  3A8G B;  4LUE A;  2MWO A;  4M77 C;  3OYH A;  3GP8 A;  2E64 A;  2M02 A;  2DL4 A;  2K2V A;  3X25 B;  2ATC B;  1Z9Q A;  1B3Q A;  4HCK A;  2D8J A;  2I2L A;  2WSF E;  1VQ9 Q;  3QII A;  4K11 A;  3TCJ A;  1PM3 A;  2BTT A;  3J81 E;  3R6N A;  4LUD A;  5J26 A;  3CCQ A;  5LJ5 h;  5HY6 A;  1ZHI A;  5KE2 A;  2LNV A;  5EG2 A;  1M3A A;  3V7R A;  3NFC A;  3A8M B;  1RAC B;  2PUO B;  2L8D A;  3CCL A;  2FRW A;  2BKD N;  1G3W A;  5DLQ E;  1NLO C;  3EHQ A;  2F2V A;  1J3T A;  3SHW A;  1CKB A;  2CGH A;  4YTL A;  1QKW A;  2D8H A;  1NYG A;  3GOX A;  1LPL A;  3VYH B;  3CC7 A;  5GAN h;  3LH0 A;  4DA4 A;  5I11 A;  1VA7 A;  2KNB B;  2AK5 A;  3FJ5 A;  3VS2 A;  3LH5 A;  1MUZ A;  2GTO A;  2IPO B;  4F17 A;  3MO8 A;  2W0Z A;  3CME Q;  4PJO D;  2QAZ A;  3TU4 K;  2J6F A;  4FYX B;  4ZN3 A;  1W70 A;  2KRM A;  3I35 A;  4MZT A;  2FO0 A;  1NJI U;  1QVG S;  4JJC A;  5IH2 A;  1BBZ A;  1B07 A;  4XK8 E;  4EMK A;  1PC0 A;  5M9O A;  3C12 A;  1ACM B;  4E6R A;  4IUQ A;  1VQ6 A;  2CP5 A;  3HRS A;  2EYY A;  4XU3 A;  1VQK A;  1PWT A;  1K8A R;  4M78 C;  3URG A;  3LWI A;  4HKE A;  1PG5 B;  2EJG A;  1FMW A;  2ROL A;  3CCM Q;  3OSV A;  1M1K U;  2L3Q A;  3RER A;  3I55 Q;  2V8I A;  2F5T X;  1N9S A;  2CYZ B;  2E41 A;  1W1F A;  3JCM V;  3VS5 A;  2JZ2 A;  4FCY A;  3REB B;  3HP9 A;  3NTI A;  1FYN A;  1PRM C;  3C4S A;  2K5F A;  1U8R A;  4FW1 A; 
#chains in the Genus database with same CATH homology
 2CSQ A;  1H92 A;  1SHG A;  3KFV A;  1UEC A;  1IO6 A;  2RQR A;  4ORZ A;  3I5S A;  2DBK A;  1UJ0 A;  2DBM A;  4JPB W;  1SRM A;  1BK2 A;  2X3X D;  5ECA A;  2LP5 A;  2GGR A;  4AFU C;  2BZX A;  1WA7 A;  2JXB A;  1JXO A;  2V1Q A;  2KEA A;  1ZSG A;  1K1Z A;  1SSH A;  1K0S A;  2K79 A;  5I22 A;  1RUW A;  4J9F A;  1NLP C;  1V1C A;  1K4U S;  2DMO A;  3VS7 A;  1AOJ A;  2LZ6 B;  3QWY A;  4J9H A;  5FWB A;  1KSW A;  1NYF A;  2MCN A;  1I07 A;  1M3B A;  1RI9 A;  1NM7 A;  1UDL A;  2CUB A;  1UTI A;  4J9D A;  1Y0M A;  2BZ8 A;  2K6D A;  3UA7 A;  2KT8 A;  1WI7 A;  2JS0 A;  2LNH B;  2KE9 A;  2EKH A;  2NUZ A;  4RUG A;  2EYX A;  2EPD A;  1AZE A;  1ZX6 A;  2K9G A;  1T0J A;  4KRT A;  2LQN A;  2A36 A;  4HVV A;  3C0C A;  1WLP B;  2CUD A;  2DRK A;  4WCI A;  2CH4 A;  2LJ3 A;  4RTY A;  5FWC A;  4AFZ C;  3O5Z A;  2VWF A;  2DIL A;  4QT7 A;  1M3C A;  1YP5 A;  4A63 B;  2HDA A;  4OMN A;  1YWO A;  2RQU A;  1T3S A;  2HSP A;  1S1N A;  2H8H A;  2RQT A;  3M0U A;  2DJQ A;  1UHC A;  3ULR B;  1PRL C;  2A37 A;  3EHR A;  1G2B A;  4RTU A;  3U23 A;  3RBB B;  4JZ3 A;  4AG2 C;  3I9Q A;  2L3S A;  4ESR A;  1KJW A;  4DEY A;  2HCK A;  5IXF A;  2ROT A;  4FSS A;  2JTE A;  2JMA A;  1MV3 A;  2L2P A;  1BU1 A;  2YUQ A;  2GTJ A;  1RLP C;  2J06 A;  1ABQ A;  1M27 C;  2RN8 A;  2AZV A;  3SEM A;  2QDL A;  4OMO A;  2YUP A;  2GQI A;  3NMZ C;  2D1X A;  2KBT A;  3PVQ A;  4AG1 C;  1A0N B;  2DL3 A;  1WXB A;  3H0F A;  3VS4 A;  1GBR A;  2A28 A;  1GCP A;  2W10 A;  2K2M A;  2RNA A;  5HCK A;  1QWE A;  2YUN A;  3NGP A;  1OV3 A;  3VS0 A;  4IIM A;  1WXU A;  1BB9 A;  2CRE A;  3EG3 A;  4JJB A;  4HVU A;  2DM1 A;  1UUE A;  1CSK A;  2LCS A;  1X6G A;  1T3L A;  2YDL A;  1GBQ A;  2F2X A;  1HSQ A;  2VVK A;  4CC7 A;  2YT6 A;  2KGT A;  2DE0 X;  1M30 A;  4CC4 B;  2VKN A;  1VYV A;  2RF0 A;  4X1V A;  2O9S A;  1K9A A;  5IHI A;  1GRI A;  4RTT A;  4LE9 A;  2EGA A;  1AWW A;  2FPF A;  1QKX A;  2J7I A;  2SRC A;  1U06 A;  3PE0 A;  3TSW A;  2J05 A;  1FMK A;  2JMC A;  1UGV A;  3EG2 A;  2BZY A;  2FPD A;  2KRO A;  4J9I A;  1SPK A;  2DRM A;  2OI3 A;  2P4R A;  1EFN A;  2DYB A;  2JM8 A;  4RTW A;  2ESW A;  1X69 A;  1I0C A;  4J9E A;  1YNZ A;  3EG0 A;  4J9G A;  4M4Z A;  4OMQ A;  1JO8 A;  1MV0 B;  2EGE A;  2C0O A;  1AWX A;  4HXJ A;  2B86 A;  1ARK A;  2I0N A;  1AZG B;  5L23 A;  3EG1 A;  4OML A;  1AD5 A;  1X27 A;  3H41 A;  3PVL A;  1PKS A;  2KRN A;  2DLP A;  4OMP A;  4Z88 A;  2RPN A;  2RMO A;  4J9B A;  2AKK A;  2C0T A;  2ED0 A;  3H0H A;  2DF6 A;  2KXC A;  2LX7 A;  1UHF A;  1SHF A;  2OAW A;  1WDX A;  2O2O A;  1WYX A;  1AEY A;  4OMM A;  2DL7 A;  1PNJ A;  1YN8 A;  2KRS A;  1ZUY A;  2EYW A;  3M0Q A;  1M8M A;  3VS1 A;  1WX6 A;  4D8K A;  4DEX A;  2O31 A;  2YUO A;  4JZ4 A;  3UAT A;  1YCS B;  3H0I A;  3M0T A;  2PNI A;  1UG1 A;  2DL8 A;  2RQW A;  2ED1 A;  2PZ1 A;  3UA6 A;  2RQV A;  4Z89 A;  5EC7 A;  1CKA A;  2L0A A;  4AFS C;  2HBW A;  2HEQ A;  2EBP A;  2EYZ A;  3A98 A;  2MOX A;  1ZLM A;  2CT4 A;  4GBQ A;  2E5K A;  3UF4 A;  4CC3 A;  5GJV B;  3CQT A;  2EQI A;  1LCK A;  2PTK A;  4F14 A;  4Y92 A;  1Z9Z A;  2JW4 A;  1UJY A;  2MIO A;  3REA B;  1YWP A;  2C0I A;  1AWO A;  2DA9 A;  5FW9 A;  1OOT A;  2KR3 A;  4LNP A;  1WIE A;  1U3O A;  2FEI A;  3TSZ A;  2XMF A;  2SEM A;  2V1R A;  5GJW B;  3ZL7 C;  1GCQ A;  1KFZ A;  1GFD A;  1JU5 C;  1GFC A;  1ZBJ A;  2CH4 W;  3M0S A;  3VS3 A;  2GBQ A;  2KYM A;  1E7O A;  3QWX X;  2IIM A;  1U5S A;  4RTV A;  1NG2 A;  1QCF A;  2F2W A;  1HJD A;  4LN2 A;  1OPL A;  4LUE A;  3THK A;  5IXB A;  4GLM A;  1AVZ C;  2DNU A;  1NEG A;  2DL4 A;  1VYT A;  1ZUK A;  1Z9Q A;  1B3Q A;  1ZUU A;  4HCK A;  2D8J A;  1OPK A;  1H8K A;  4K11 A;  4IIO A;  2ABL A;  2A08 A;  1PHT A;  1NEB A;  1WFW A;  1XOV A;  2D0N A;  3VRZ A;  2BTT A;  4RTZ A;  3EGU A;  2CDT A;  2LJ1 A;  3R6N A;  1TG0 A;  2NWM A;  4LUD A;  1Y57 A;  3M0R A;  2DL5 A;  1OEB A;  1JXM A;  2AZS A;  2DX1 A;  1UFF A;  2CSI A;  1HD3 A;  3GBQ A;  4AFQ C;  1M3A A;  1T0H A;  2JS2 A;  1JEG A;  2GNC A;  2FRW A;  1RLQ C;  1E6H A;  1X43 A;  1KIK A;  1X6B A;  2FPE A;  4R0K A;  4CC2 A;  1NLO C;  1K76 A;  2J6O A;  3EHQ A;  1SEM A;  2F2V A;  2KXD A;  1UE9 A;  1J3T A;  1QLY A;  3SHW A;  1CKB A;  3I5R A;  3NPF A;  2CT3 A;  1QKW A;  2D8H A;  3M0P A;  1GCQ C;  1NYG A;  4HVW A;  2G6F X;  1X2Q A;  3NHN A;  4J9C A;  2ENM A;  1VYU A;  1SRL A;  4JJD A;  2J6K A;  5I11 A;  2LMJ A;  2M0Y A;  1W6X A;  4RTX A;  1VA7 A;  2LQW A;  2K3B A;  2KNB B;  2AK5 A;  3FJ5 A;  2X3W D;  3VRY A;  3VS2 A;  3LH5 A;  1MUZ A;  1TUC A;  2GTO A;  2KT1 A;  2KYB A;  4F17 A;  2W0Z A;  2EW3 A;  3VS6 A;  2DVJ A;  1K0X A;  2JM9 A;  2OJ2 A;  2J6F A;  4D8D A;  2O9V A;  1TUD A;  1W70 A;  2KRM A;  3I35 A;  3IQL A;  2FO0 A;  3JV3 A;  1QWF A;  4JJC A;  2FRY A;  5IH2 A;  1BBZ A;  1B07 A;  4Z8A A;  3RNJ A;  2M51 A;  4ZNX A;  1E6G A;  1ABO A;  2EGC A;  2L3P A;  1X2K A;  5IHN A;  2JT4 A;  4E6R A;  2YSQ A;  4F16 A;  2K7A A;  2EYY A;  2FG0 A;  1GL5 A;  1PWT A;  2AKL A;  2LJ0 A;  1PKT A;  4EIK A;  2ROL A;  2ECZ A;  1JQQ A;  2L3Q A;  1G83 A;  1I1J A;  1W1F A;  2EVR A;  2O88 A;  3VS5 A;  1H3H A;  3REB B;  5IHK A;  1FYN A;  1PRM C;  1N5Z A;  1AWJ A;  1WXT A;  3TVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...