5LJ3e

Structure of the core of the yeast spliceosome immediately after branching
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
83
structure length
75
Chain Sequence
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSKGTPLGKILLKGDNITLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 9
structure length 75
sequence length 83
chains with identical sequence p
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj3e00
4M7AC 1LOJA 4PNOA 1Y96B 4JLIA 4M7DE 3SB2A 4C92C 3JCMJ 5GMKi 4C8QC 4PJOD 5GAMe 5DY9A 3JCMW 3JCMP 4DQ2A 3SWNC 2E1HA 3PGGA 4HA8A 5LJ5d 4M7AA 1BIAA 5LJ5h 4M78C 3JCMd 1I4K1 3JCMh 4MMKA 4M75C 4C92A 3RESA 4C8QA 4V2SA 1B34A 4X9DA 5LJ3d 4A54A 5LJ3h 4OP0A 1YCYA 4XQ3A 4XTUA 4J6YA 3M4GA 3SWNA 4F7UG 4M7AD 2DJZA 3HFNA 4M78A 5GMKj 3QSUA 5GANh 5GAN3 4M77G 2EJGA 4M77F 4M75A 4C8QD 2Y90A 5CAIA 4HT8A 2E64A 4QVDA 1MGQA 4XU2A 4EMHA 3V8LA 1I5LA 2RD1A 4F7UE 4M78D 1D3BB 4M7DC 3BFMA 4EMGA 4JRKA 4M75D 4XTZA 5GAOp 3JB9H 5LJ5j 2EWNA 2DXUA 5GAOm 2FYKA 1HXDA 2E10A 3BW1A 4XU0A 5GAOl 3JB9D 4PJOF 3JCMV 5LJ3j 4M7DA 2YHTA 3V8KA 4EMKB 2VXFA 4F7UB 5GAN7 3BY7A 3FB9A 1WPYA 2JN0A 4M77B 3JB9I 2DTHA 1BIBA 4M7DD 2QTXA 2EAYA 1WQWA 3BDUA 3RIRA 2RB6A 5LJ5f 5GANd 1D3BA 2DZCA 3RKYA 4JRIA 3JCMf 3L1AA 5GAN2 5GAOr 4M7AF 4C92G 5GMKe 2VC8A 1N9RA 2YLCA 4RCBA 4C92F 1Y96A 4WF2A 1U1SA 3VU3C 4C8QF 4XTYA 5LJ3f 3RKWA 5LJ5g 2EJFA 4NL2A 3L2ZA 3EFRA 3JCMg 4J6WA 5GAN5 4RCCA 4M78F 4NL3A 4PJOB 3QO3A 4M77E 5GAN8 4F7UA 4M75F 5LJ3g 1LNXA 2HNIA 3V7CA 3JCMQ 1HK9A 5LJ5e 2DEQA 5GAMd 5GAMh 3GIBA 4PJOG 3JCMe 1JBMA 1WQ7A 4MMLA 1M5Q1 2DTIA 1I8FA 1I81A 4XTWA 1X01A 2VXEA 3JB9F 5LJ3e 3FIFA 4N0AC 4XU3A 5GMKm 5GANj 4XU1A 3EFSA 4C92B 5GAOn 4PJOE 4X9CA 1H641 1B34B 4M7DF 4M7AG 3QHSA 1LJOA 3SWNB 3V8JA 5GMKh 3JCMb 4EMKC 2E41A 3JCMX 4QVCA 4C8QG 2YLBA 4M75B 4Y91A 4NOYA 2DKGA 2DTOA 3QUIA 4M77C 5GAMj 2DXTA 3AHUA 4M78G 5GANf 4M7AE 3INZA 1N9SA 2RM4A 3V7SA 4M75G 4EMKA 5GAOq 2CGHA 5I21A 4C92E 1KQ1A 4C8QE 3JCMc 2DZ9A 4M77A 4XTXA 2DVEA 5GANg 3JB9J 3RUXA 2FB7A 2I2LA 4M78E 3JB9G 4XTVA 1U1TA 3HSBA 1M8VA 1TH7A 4M75E 3FJPA 4M7DB 4J5YA 4F7UF 4M7AB 4PJOC 4A53A 4M77D 5GAMf 3RERA 5GAN4 1JRIA 4C92D 5GANe 5GAN6 5GMKl 2EJ9A 3HFOA 3V7RA 4C8QB 1WNLA 1KQ2A 4HT9A 4M7DG 2RA2A 4JUVA 2K57A 4N0AA 5GAMg 4PJOA 2E65A 4M78B 2ZGWA 4J6XA 3RKXA
chains in the Genus database with same CATH superfamily
1D0YA 5A0GA 2L89A 2RJCA 1UDLA 4C8QC 4CI0C 2DYBA 1BKBA 1VYVA 4QT7A 1G3YA 1Z9QA 3L2UA 4HCCA 1D0ZA 4OP0A 2EYYA 4RG8A 4J6YA 3I55A 2AK5A 4JZ3A 2RI3A 3CCUT 3OA6A 2YWWA 4J7IA 1ABOA 4FYYB 2PNIA 4XTZA 1W6XA 1NE8A 5GAOm 1WXUA 2FYKA 3BW1A 2DXBA 3UPUA 1VQ8T 4GLKA 1UG1A 3V8KA 2RHXA 4JS5A 3RBBB 4M7DD 1MHNA 2V1QA 4OF1A 4E2FB 2DZCA 2H8HA 3HKSA 2HAXA 5J3BA 1C0MA 1BI0A 1VQ9Q 3TSZA 3GIBA 1QWFA 2LDMA 4PJOG 2M51A 1AWOA 2WSCE 1ZBJA 1GCQC 4AFQC 1JJ2S 2B8AA 1C1AA 2JZ2A 3GLXA 3VUZA 5GMKh 3FEOA 1RAGB 1RACB 1ZSGA 1YFNA 2DKGA 3GNFB 1YITA 1IHVA 4LDXA 4IUUA 1R0CB 2FRYA 3EAEA 2ZPBB 1IZ6A 1MMGA 2GFUA 3NTKA 4M78E 1YJWT 5GJWB 3QPHA 4E7IA 1JU5C 2YXYA 2GQVA 2EJ9A 2EGEA 3M0QA 3MP6A 1KC8R 4DBFA 1A0NB 1UJYA 4OB1B 5KYYA 2C0TA 1PD1A 3CC4T 3OYEA 1N8RC 2MIOA 2OTLQ 2JVVA 4B9WA 4JZ4A 2FEIA 3NHNA 2EYXA 3JCMW 1VQPQ 2QI2A 4FW2A 2EKHA 3L2RA 3PGGA 1PG5B 3OYKA 1Q95G 5KYXA 4QW2A 3RESA 3SEMA 3VRYA 2AZVA 1BI2A 3QZ9B 5LJ3h 1LPLA 5GMKj 3QSUA 1B07A 1GRIA 2E6ZA 3ZBDA 4C8QD 5CAIA 4ELYC 4BE1A 3U23A 2CP0A 2XDBA 2P4RA 3G7ZA 2JM8A 2DBMA 2DL5A 4E7LA 5C6SA 2RI5A 3QDFA 4Y28E 4X34A 2R5AA 4J8OA 2DE0X 1GCPA 4F7UB 2MF2A 3PNWC 2WSFE 1RUWA 3TEEA 2EPDA 3BDUA 4JJNK 2VC8A 3ZFJA 2QDLA 1PSEA 4X1VA 4QQGA 5KYYB 2KR3A 4FYXB 3G71A 3OS2A 2ENMA 4RTZA 3NTIA 2YRDA 5KYUA 4N0AC 3CCJT 4O6JA 3G4SA 2LQ8A 4JPBW 1CSKA 2J05A 3CCMA 2L5QA 3QHSA 3CMEA 1X2QA 4C5EA 4EDUA 5CKDA 2DETA 1VQNQ 2J6OA 1M90U 2KY9A 3DB3A 1YNZA 1NJIU 2KT8A 1KD1C 3N5BB 4M77A 4TVRA 1OX8A 2CZ1B 4DEYA 5FROA 2HBPA 3A5ZB 3C4SA 3UT1A 5GAMf 1K9MC 1UGQB 4C92D 5GANe 2MWPA 4M7DG 2LNHB 3E9GA 4PFOA 4PJOA 4DOWA 1MMDA 3PMIA 4RG2A 3H0HA 5FU7B 2PVDB 3UWNA 5HK3A 3OYAA 3G6EA 1PWTA 1QVGP 1KQSP 4AMCA 1IRXA 1VYUA 4X9DA 3TVTA 1YI2Q 4JJCA 4N4GA 2LC4A 2J06A 5KYUB 4QVDA 4AT1B 2YRCA 4JJDA 3CMAQ 1OU9A 3EG0A 1VQLQ 1QLYA 4JRKA 4E6RA 4OMQA 4FSXA 2P84A 3P8BB 2VV5A 5I2SA 2VUBA 3UF4A 3VUBA 3FB9A 2BE7D 2COZA 1YJNT 4M77B 2V8KA 3MEVA 5GAN3 1D3BA 5GAOr 1VQKA 3ASKA 2EJFA 4ZN1A 2DILA 3L2ZA 4BACA 2AT1B 2KYMA 2ESWA 2V8IA 3EGXB 4PJOB 3H0IA 3CCUQ 3D7SB 3V7CA 1MMAA 2FRWA 3CCQT 2JT4A 1ZSZC 5A0DA 2RHIA 1V29B 2CZ0B 3MJXA 2K9GA 1VQ8Q 2B86A 1R77A 1YJ9A 4C8QG 2XDPA 1Y57A 2VKNA 3ME9A 4PFZA 4Y91A 5DM7R 5GAMj 2F2VA 3VRZA 1K4US 2DL4A 2JOYA 1TOVA 1BK2A 1KQ1A 3I9QA 1NBEB 2YRVA 2OTJT 2H3JA 5CR2A 1D0XA 2CP7A 5I2MA 1JXOA 3RMSA 3CPWS 4BDYA 3VYGA 4OB2B 1AZEA 1D1BA 3FC3A 1VQOT 2KROA 1NLPC 4J9BA 4M7AC 4LUEA 3M5AA 2HQXA 2E5KA 2CSIA 2A37A 2DD4A 1YWOA 2COWA 4RTUA 3JCMd 1QVPA 1Z9ZA 2O88A 3M59A 3C12A 4M4ZA 3CCST 3SWNA 2BZ8A 3OYBA 4M77F 1WI7A 4IIMA 3JAME 3CCVT 1M1FA 4EMHA 1YJWQ 2RD1A 1QKWA 4DOVA 2X4XA 1OQKA 1CKAA 2ZPFB 1Q86U 3JB9H 4VUBA 4PJOF 4M7DA 3CC4Q 1K0XA 1E6HA 2DL8A 3O5ZA 2O01E 4J7FA 3RNJA 2Y4XA 4F04B 3FDRA 3GF5A 3UDCA 1T0JA 3EG1A 3PTAA 3A8MB 1M1KC 2LRQA 4C92G 1S72T 3VU3C 3META 3VS4A 3ER0A 1SRMA 4RCCA 1AOJA 1BCOA 2MI6A 4XK8E 4LD9K 1OEBA 1LNXA 4PJLA 2PVOB 3OYDA 2QYZA 1QVFA 3OYFA 5IAYA 3OYHA 2XK0A 5LJ3e 1M2VA 3AT1B 2P0QA 1T3SA 1N8RR 2KRMA 2XKOC 2EIFA 4X9CA 4CC4B 4EPCA 9ATCB 1D1AA 3NPFA 3SWNB 4PLIA 1HYOA 1IGUA 2HKQB 2XD0A 2YLBA 2WACA 3HTRA 5FW9A 3EG2A 1UHCA 2JS2A 4FW1A 1MUZA 1VQ6A 3SD4A 2CH4A 4EMKA 1R0BG 4QQ6A 1XTDA 2FL7A 1NJIC 2EQMA 4K11A 1YHQT 2LQKA 2IVWA 3JV3A 4IUVA 2KK4A 4M7DB 2I0NA 3DKMA 5I11A 5CVIA 2E65A 3CCJQ 4M78B 4C0GA 3NGPA 1D09B 3ZL7C 1T0HA 2PVGB 4Z02A 4KH0B 1PRLC 1OZ2A 5FRMA 5LJ5h 2M0YA 3QZ5B 2HMAA 4R0KA 4C8QA 1ZQ1A 2K6DA 4LXCA 4CC2A 4M7AD 4LUDA 5L8RE 1K73R 2NUTA 3CC2T 1QVGA 3HRTA 4HT8A 5HCKA 2LQWA 3GNGA 1KQSA 2LNVA 4J9DA 5GAOp 4YTLA 2QA4T 1Q82C 5CO7A 1QP2A 2KXDA 2E3IA 2WSEE 3R6NA 3OW2P 5FWCA 4AFUC 4EMKB 4D8KA 2E12A 2KNBB 2DIQA 1BIBA 2FZCB 3CBMA 2QDYB 2D9TA 4C0DB 1KD1R 1AZGB 3JCMg 4M77E 3JCMQ 1JXMA 2QASA 2ZAEA 3EFSA 2RQUA 4PJOE 1SEMA 1UTIA 2K5LA 4M7DF 1GCQA 1Q7YU 2NUTB 2BTTA 2QXFA 1YJNQ 5KCHA 1AD5A 3M4YA 4JRQA 4OMOA 2ECZA 4HVVA 1VQ7A 2OAWA 4B9XA 4RTXA 2CP3A 2A7YA 1G83A 3LWIA 2FB7A 2GGRA 1VQ5T 1FXXA 1TH7A 2MPXC 1WXBA 1JRIA 2CSQA 3CC7T 3CCQQ 3I5SA 2O9VA 2OI3A 3HP9A 1M2OA 1Y0MA 3CCET 1K8AU 2LMJA 3CCRA 3JCMP 5FU6C 2QEXT 1VYTA 1BIAA 1U5SA 3MPUB 3OSSC 4FT4A 1AT1B 1U8RA 3KBGA 2EQUA 4V2SA 4BI4A 2BZYA 3GOXA 5IN1A 4FSSA 2CP2A 2ROTA 2OTJQ 3M0RA 3L2VA 2DIGA 4IIOA 2JJ9A 5KCOA 3M55A 4E7SA 4LD6A 4ZN3A 1Q86C 2QG9B 3VJPA 1VQOQ 4FL6A 3JB9D 2DYIA 4DA4A 1TUDA 2O2OA 2DTHA 2O31A 2ZPGB 2CKKA 1VQMT 3OYYA 1N5ZA 2E6NA 1OOTA 1IXDA 4HCBA 3M57A 4P5NA 1K1ZA 4C8QF 2PQWA 3CCSQ 5IHKA 2GTOA 3HPWA 1AHJB 1SRLA 2IIMA 5IHIA 3S3MA 3HL8A 3CCVQ 2F1LA 3BE3A 2RQTA 5HKCA 2VYTA 4OGCA 3J7AF 1PRMC 5GAOn 2AKLA 3OBYA 4M7AG 3JRZA 1H8KA 1F1BB 2CZ7B 4QVZA 4IUQA 5GAOq 1S72Q 3NTHA 4FYVB 4PJMA 3I56A 3CCLA 2HBWA 2JMCA 3HSBA 1M8VA 1NYGA 3FJPA 1PHTA 2KVQG 3TU4K 5GAN4 2KRNA 5GAN6 3I55T 1YIJA 2KYBA 2CYZB 1GXIE 1X69A 2FO0A 1EX4A 2J7IA 4JLIA 4M7DE 2R58A 4C92C 3FRNA 2J6KA 5AYFA 1ACMB 4L59A 1I4K1 1M1KR 2CZ6B 2PTKA 4XTUA 2M16A 1ARKA 1W2BA 1Q81U 1ZA2B 1YHQQ 2K3BA 3M0PA 1VQ4A 1B3QA 2LVMA 3TREA 4EMGA 1AWJA 2PUOB 3MHXA 2NUPA 2NLUA 2MMPA 3MO8A 2XDDA 1TTHB 1RAFB 4PFPA 2E4HA 5CKEA 1MV3A 2XIDA 3S3OA 3EFOA 2RF0A 5GANd 3RKYA 3JCMf 4WF2A 3CD6A 3VV0A 3X20B 4LNPA 3LW5E 1NJIR 2DO3A 4R55A 3E2UA 3CC2Q 3CBPA 3Q1JA 1YITT 2RK1A 1QQJA 4OGEA 5LJ5e 1QVFS 2RN8A 2VXEA 2QA4Q 1X43A 2NYSA 1ZSZA 3CEYA 2MOXA 2VGNA 2ZPHB 2DTOA 1OPKA 2KGTA 1K73C 1VUBA 2DERA 3VS5A 2HKNA 3P8HA 4OB3B 1WFWA 2C06A 5CQYA 4C8QE 2CP6A 4BD3A 1NPRA 2NUPB 1B7TA 2AZSA 3JB9G 1RI0A 2PUKB 4RTWA 3RERA 3SFMA 3E19A 5KYXB 1BBZA 1WNLA 4C5GA 1Q82R 2K2MA 1KIKA 3EFOB 2FPDA 2R57A 2ZGWA 1QCOA 2QQBA 2PU9B 2LCSA 2W0ZA 2EQKA 4M7AA 2KDSA 1X27A 3EH1A 4MMKA 2K5IA 4AFZC 2RNAA 1TG0A 5J26A 1HJDA 3P8DA 1QVGS 1VQ5Q 1KQSS 3VKIA 3OBWA 2FHDA 3CC7Q 4XU0A 2KXCA 3ZEHA 3G71T 3CCEQ 2VXFA 2COYA 4D6WA 2SEMA 3G4ST 2KSSA 4FCYA 2H3EB 2QEXQ 1KG1A 4QQDA 3CCMT 2DK3A 2RJFA 2YUQA 2QGGA 5GMKi 1WHMA 3THKA 3CMET 3EFRA 2O9SA 1Y07A 5GAMh 4C0FA 4KGXB 1M5Q1 4A4EA 3VS7A 3QIIA 4MZMA 2E5QA 2HSEB 3NMZC 2V8JA 5LL6S 5EG2A 1N27A 3EGDA 5KYWA 1NEGA 1Y7XA 4BY6C 4OVAA 3DLMA 4ELZC 1VQMQ 1ZUKA 7AT1B 2RM4A 2K4YA 2RJDA 5I21A 1W4SA 2EQIA 3G6ET 2CP5A 4AFSC 1TU0B 5GANg 1RLPC 1I07A 2I2LA 5A0LA 4XTVA 1U1TA 2GF7A 3C94A 1ZUUA 3LLRA 3PMTA 4JDSA 4J9EA 4A4HA 2EW3A 1OV3A 1Y71A 2EYZA 2CUBA 4HT9A 2RA2A 1Q86R 1G3TA 4ZGJB 2HZYA 1VIFA 1WHHA 4MZTA 3H0FA 1UEBA 4HA8A 2LZ6B 1SPKA 2LJ0A 2LT1A 1B34A 2EGAA 5LJ3d 4MDXA 4A54A 3WXMB 3DLLA 2DJZA 4BI8B 1SG5A 1HSQA 2DRMA 1I5LA 1VQKT 2KAFA 1WIEA 5KYWB 1D3BB 2DLPA 2DRKA 1I1JA 1KHIA 4Z88A 3I55Q 1NPPA 1PKTA 1HD3A 2YHTA 8ATCB 1BB9A 4D8DA 4OMPA 3JB9I 2CH4W 2DAQA 1ZX6A 3PFSA 4LN2A 1VQ9A 2QK0A 4M7AF 4JRIA 3GPLA 1TSFA 4ZNXA 2BZXA 3A8GB 5GMKe 4RCBA 3L42A 1X2KA 1Y96A 1U1SA 1YJ9T 2FZGB 2VWFA 4J9IA 3L2QA 1EFNA 3QO3A 1GBQA 2MWOA 3QKJA 4IUTA 2K7AA 5EC7A 1PSFA 2J6FA 1WLPB 1NZ9A 4XU3A 1ABQA 2JMAA 4F16A 3F70A 4RTTA 1BCMA 2CT4A 1M27C 5DLOA 2LCLA 1B34B 2E3HA 2RQWA 1LJOA 1PNJA 2L8DA 4QKUA 3KUFA 4PJNA 4NOYA 4HCKA 4ANJA 5C0MA 2GNCA 4KUDK 3V7SA 2BUDA 2DXCA 2AKKA 1KHCA 3X25B 5FWBA 2FVUA 4RTVA 1YITQ 5CCAA 2OTLA 3TQ7P 2X4WA 1GL5A 2LJ1A 4ZTFA 2ZPEB 2C0IA 1VQPA 1WJRA 1OPLA 2LT4A 2JUFA 2HSPA 2RJEA 4PNOA 2DM1A 1LVKA 1Y96B 2AHJB 1M90C 1I0CA 1UGSB 2HQHA 2A3LA 1QW1A 1XQHA 1RLQC 5HY6A 4M75C 3UATA 1X75C 3QJYA 1G5VA 4XQ3A 1OZ3A 1W2BS 4BI3A 1VOMA 2E64A 1NYFA 4II1A 3WVEB 3OB9A 1KSWA 4LDVA 4LDWA 4WTOB 5GAOl 4DBHA 3REBB 2VB6A 1PC0A 4PKCC 3LWHA 3OYMA 2HDAA 2JN0A 4KBMB 2Y4YA 4KUIA 2A36A 5FLXE 1Q7YR 2G3RA 4A4GA 4J9FA 1G3WA 2D8HA 1M2VB 2HEQA 1UHFA 3QDRB 1OU8A 2L0AA 1SSFA 1VQ6T 5LJ3g 1UE9A 1X6BA 1JBMA 2DTIA 3JB9F 1X01A 3I5RA 1VQNA 2NUZA 2K79A 4F14A 2F2WA 4XU1A 2A08A 1FX7A 2K5FA 3CQTA 4OMLA 2F69A 3G71Q 1N8RU 3DB4A 3EG9A 5FU6B 1K8AR 2DVJA 4C0ZA 5IT9E 3G4SQ 3QUIA 3OYNA 1M4ZA 4M7AE 5GANf 4KT0E 3CCMQ 2YUNA 3CMEQ 4ZTJA 3A8OB 3JB9J 2VVKA 2FPFA 4PL6A 1G8XA 1BYMA 2JS0A 4C8QB 3CXCP 2JM9A 1M3CA 5M9OA 2K57A 3MEUA 3MEWA 1WHKA 2ED0A 2ED1A 5D6YA 3SB2A 2LQNA 1YI2A 4HCZA 1AWWA 5GAMe 5CIUA 4M78C 4RTYA 4C92A 3CMAA 4HVUA 2EVRA 1VQLA 1EIFA 4F7UG 3G6EQ 4GBQA 1MNEA 1PCXA 2X4JA 3ULRB 5GANh 4A4KA 2EJGA 4BE2A 3PVQA 2L3SA 4HXJA 3EG9B 4M75D 2X3XD 3OYCA 2V1RA 2O4XA 2M0OA 2BKDN 4OMFB 5GAN7 1IB8A 2IPOB 1QMCA 2QAZA 3VS3A 2QTXA 2EAYA 3CCUA 4AG1C 1N9RA 1WDXA 2YUPA 1N6AA 1KD1U 2SRCA 2GCXA 2XICA 3KXTA 1VQ8A 1HK9A 1VQ7T 1ZA1B 4MDWA 4C0DC 1M8MA 1VQKQ 2RQVA 1I81A 1K9MU 3KFVA 2KI7A 2DF6A 5GANj 1RABB 5FRNA 1JB0E 4C92B 2P0KA 4L5GA 2X9HA 1ZLMA 1S1NA 4NS5A 2RK2A 1N9SA 3CCRT 2CGHA 4O5VA 1YJ9Q 1OI1A 2O4XB 3TSWA 3A8LB 4XTXA 3MP1A 2P4TA 4DBQA 2DNUA 1TUGB 1Q81R 4JJBA 4IUPA 3LH5A 4OMNA 1TXQA 1IHWA 2CT3A 3OSVA 2D0QB 4N0AA 3BDLA 2DXUA 3RKXA 1BI3A 1YCSB 2RHZA 3E9FA 2CS7A 3VS6A 5LJ5d 1MV0B 2ROLA 1YJWA 2DEUA 4N4IA 3X24B 1C6VX 5ECAA 3M9QA 3SDZA 1SSHA 4L6V5 4M77G 2OX7A 3CC4A 2RI2A 4N4HA 4M78D 3BFMA 1TUCA 3QWXX 5CKFA 4A63B 3QXEB 5I22A 5IH2A 1AVZC 1QP3A 3M53A 1H3ZA 4CC3A 2JNGA 2DFUA 2RB6A 2BE9B 5D6WA 1GBRA 2XMFA 2LTOA 4C92F 4XTYA 5LJ3f 1NM7A 4NL2A 3C0CA 5GAN5 2NWMA 4PK4A 2Z0WA 1JJ2P 2DBKA 4F7UA 2XU8A 1IGQA 8AT1B 3VS1A 3QJ6A 2K2VA 3I56T 4XTWA 2KMTA 3CCLT 3EG3A 3FIFA 3NFCA 1SF9A 3MP8A 3RR6A 1H641 4JS4A 3OW2A 1YIJT 1M90R 3JCMX 2GQIA 2EYWA 1T3LA 1WGSA 4M75G 4J9GA 1AWXA 2DL7A 3T9NA 4KH1B 4BDZA 3CCJA 3M58A 1VQ6Q 4A53A 2RO0A 2EYQA 4GY5A 2YSQA 2LCCA 2A28A 1WHGA 2ZCFB 3OYIA 1V76A 1VQ4T 1Q7YC 1FMKA 1E7OA 4RKUE 1WJSA 1LCKA 3OY9A 3J81E 2JTEA 2M1HA 5DY9A 3OQ5A 4DQ2A 3CXCA 2OJ2A 5AT1B 2ATCB 3JCMh 1KJWA 1RAIB 4WCIA 4IURA 1R8OB 1M1KU 3I35A 3HFNA 3MEAA 3H41A 1QVFP 1YN8A 4LDUA 4XU2A 3OYGA 3RDVA 3CD6T 2MYSA 1KC8U 1FMVA 2KQWA 2YT6A 3X28B 2X4YA 2KEAA 1K8AC 4B6MA 5LJ3j 3VS0A 1QCFA 1M9SA 4BY6B 3QBYA 2FZKB 1JEGA 1NLOC 1WX6A 5KE3A 3RIRA 3LH0A 2GFAA 3M0SA 4ZGDB 3PIOA 1WHLA 3A8HB 2YLCA 3MCAB 1RADB 4FIBA 3RKWA 5L23A 2L2PA 1UB4A 5LJ5g 3SHWA 1ZSZB 2JTFA 1OX9A 2D6FA 2EFIA 2HNIA 3QYGB 2DEQA 1M3AA 5KE2A 1PD0A 1YJNA 2V26A 2LX7A 2CDTA 3EGXA 3H8ZA 4J83A 2GBQA 4JLGA 3V8JA 2E41A 3JCMb 4J9HA 1OYXA 3QWYA 3AHUA 4M78G 2D1XA 4C92E 2P0PA 3CCQA 2W10A 4RMOA 2E70A 5DLQE 1WZOA 2DVEA 1RAAB 1CKBA 4J9CA 4F7UF 4M7AB 1RI9A 4E7ZA 1VQ7Q 5GMKl 2KBTA 3HFOA 1P92A 1WHJA 2DL3A 3URGA 4C5IA 1Q82U 2ZZDA 1LOJA 1WJQA 1YWPA 2RH2A 3OMGA 2KRSA 2QTVA 3C95A 3R6OA 4ME7A 2OTJA 2E1HA 1PKSA 1H92A 1W70A 3CCRQ 1YCYA 1X6GA 4LE9A 2F2XA 4M75A 1VQOA 4E7KA 2XHCA 3O8VA 4BB7A 1IREB 3S3NA 5CQXA 1NEBA 4ZGEB 2EWNA 3LGLA 2E10A 1UFFA 1XOVA 3EHRA 3GP8A 3OYLA 2RHUA 4KULA 1TWBA 3CCSA 5FU7C 1PM3A 2DMOA 1XJWB 3FJ5A 2L3RA 1ZHIA 2DPPB 3CCVA 4OMMA 1Q81C 2RQRA 1QKXA 3EGDB 4J6WA 3TCJA 4NL3A 1RL2A 3QG1A 1ZUYA 4LDYA 2MCNA 4KGVB 1BI1A 1SKUB 3VYHB 4MZPA 1WQ7A 1MMNA 1UJ0A 1I8FA 2LJ3A 1TS9A 2DA9A 3QYHB 2GTJA 2FG0A 1JJ2A 3IQLA 2JTMA 1SHFA 1UUEA 4A4FA 1S72A 1K0SA 3OMCA 2KE9A 4M75B 3PIPA 3OYJA 4M77C 2DXTA 1GFDA 3CPWP 4JRPA 1W1FA 4HKEA 2OAUA 2HL3A 2DZ9A 5CKBA 2RPNA 3RUXA 1NG2A 2JXBA 4IKFA 2G6FX 2AIRB 4PJOC 1G2BA 1BU1A 3PVLA 4OB0B 3V7RA 1KQ2A 1KFZA 3I56Q 3CCLQ 1UECA 1K76A 5IXBA 5J39A 3HRSA 1U06A 3JCMJ 2A0FB 2DX1A 1YIJQ 4KGZB 4Y92A 1YHQA 1ZBXA 4FU6A 4E7HA 5CK9A 3G1JA 1GFCA 4FYWB 1O75A 3M4GA 2QQRA 4M78A 4Z8AA 3EGUA 2C0OA 2Y90A 1WYXA 2ZPIB 1VQ9T 2F5KA 2IG0A 1MGQA 1YBYA 4F7UE 1FYNA 3VS2A 2L3PA 3J80E 3FLGA 3X26B 2MAMA 3LYIA 1KC8C 1RAEB 2EKOA 4RUGA 1U3OA 3HHTB 1YP5A 2DJQA 1VQ4Q 3BY7A 2CUDA 4E47A 2X3WD 2X51A 1OULA 3CPFA 3CC2A 1WQWA 5LJ5f 4C5HA 3L1AA 1VA7A 4E7JA 5KYNA 5CKHA 4XAXB 2VGMA 2R5MA 3UA6A 2BIVA 2QA4A 5GAN8 4M75F 2HQEA 5GAMd 4PJJA 1M1GA 5IHNA 3JCMe 3CD6Q 4MMLA 2LP5A 5GMKm 1X6OA 2OTLT 5D7UA 2HD0A 2YUOA 3OW2S 1VQPT 2PZ1A 4QVCA 2XI9A 4PLLA 1H3HA 3PE0A 3EHQA 2EQJA 3RMQA 5A2QE 1WXTA 3OS1A 1W2BP 1I5OB 3M0UA 2QQAA 2L3QA 3LGFA 1UGRB 3MKDA 3A1PA 1FMWA 6AT1B 4DEXA 2HCKA 3JSCA 3M56A 2DD5A 1QCNA 4J5YA 4ESRA 4M77D 2MK5A 4BE0A 2QGFB 4ATOA 4FT2A 1V1CA 3GBQA 3OS0A 2F5TX 4JUVA 2ABLA 1UGPB 3H9NA 2FPEA 4PJOD 5HK0A 1EZZB 2JW4A 3CXCS 3SWNC 3OS5A 2RMOA 1J3TA 4FM4B 1VQ5A 3WVDB 2RHYA 3CC7A 4CC7A 2M02A 3L2WA 2KT1A 3CBOA 4CRIA 5GJVB 3V8LA 1D1CA 3CCEA 1RAHB 2HL5C 4M7DC 2LX9A 2K3XA 5LJ5j 1K9AA 1HXDA 2QEXA 1K9MR 2XG8D 1WA7A 3H6ZA 3JCMV 2X35A 2EBPA 4AG2C 1M30A 2CREA 1IO6A 1WPYA 4DBRA 1VQNT 2D8JA 1E6GA 2D0NA 5GAN2 1M3BA 4UC4A 4Z89A 4HVWA 3S6WA 1K73U 1AEYA 3A98A 1QWEA 2K3YA 3E1SA 4M78F 4ORZA 5IXFA 4F17A 5KH6A 4KRTA 4GLMA 1FWZA 1VQMA 3UA7A 4Q5WA 3M54A 4R56A 4BUGA 4EMKC 1O9SA 1DJ7B 1KK7A 3INZA 3M0TA 5D6XA 1YI2T 3PT9A 3REAB 3LX7A 2YDLA 1MNDA 2QQ9A 3JCMc 2VASA 1JO8A 3EH2A 2QQSA 1UGVA 1JQQA 4EIKA 2EGCA 4M75E 3CMAT 1VQLT 3CPWA 1SHGA 3HRUA 1XNIA 1VIEA 2M9UA 5GAMg 1G3SA 4J6XA
chains in the Genus database with same CATH topology
1VIFA 5A0GA 1Q7YC 2L89A 2RJCA 4MZTA 4RKUE 1WJSA 4C8QC 3OY9A 4CI0C 3J81E 2PVGB 1BKBA 2M1HA 5DY9A 3OQ5A 1UEBA 4Z02A 4DQ2A 3CXCA 4HA8A 1OZ2A 1G3YA 5FRMA 5LJ5h 3QZ5B 3JCMh 3L2UA 4C8QA 1ZQ1A 4IURA 1R8OB 1B34A 2LT1A 5LJ3d 4HCCA 4MDXA 4A54A 4OP0A 3WXMB 4RG8A 1M1KU 4J6YA 3DLLA 4M7AD 3I55A 5L8RE 2DJZA 3HFNA 3MEAA 4BI8B 3CC2T 1QVGA 3HRTA 4HT8A 2RI3A 3CCUT 4LDUA 3GNGA 4XU2A 1I5LA 1KQSA 3OYGA 1VQKT 2KAFA 2LNVA 3OA6A 3CD6T 4J7IA 1D3BB 5GAOp 1KC8U 4XTZA 4YTLA 2KQWA 1KHIA 3X28B 1NE8A 5GAOm 2QA4T 1Q82C 2FYKA 1NPPA 2X4YA 1QP2A 3BW1A 2DXBA 5CO7A 1K8AC 2WSEE 3UPUA 1VQ8T 5LJ3j 4GLKA 2YHTA 1M9SA 3V8KA 4BY6B 4EMKB 2E12A 2RHXA 4JS5A 2DIQA 3QBYA 3JB9I 1BIBA 3CBMA 2DAQA 4M7DD 3PFSA 2QDYB 1MHNA 4OF1A 5KE3A 3RIRA 3LH0A 2GFAA 4ZGDB 1VQ9A 2DZCA 3PIOA 3A8HB 2D9TA 4JRIA 3GPLA 4M7AF 3A8GB 5GMKe 3HKSA 2YLCA 4RCBA 3MCAB 3L42A 1Y96A 4C0DB 1U1SA 1YJ9T 4FIBA 3RKWA 5LJ5g 1UB4A 2HAXA 3L2QA 5J3BA 2JTFA 3JCMg 1BI0A 3QO3A 4M77E 2D6FA 2MWOA 2EFIA 3QKJA 2HNIA 3QYGB 4IUTA 3JCMQ 3GIBA 2DEQA 2LDMA 4PJOG 1PSFA 2WSCE 1NZ9A 5KE2A 1YJNA 4XU3A 3EFSA 1JJ2S 3F70A 2B8AA 5DLOA 4PJOE 2LCLA 1B34B 2K5LA 2JZ2A 4M7DF 3GLXA 1LJOA 4J83A 3H8ZA 4JLGA 3V8JA 3FEOA 3VUZA 2E41A 5GMKh 3JCMb 2L8DA 1Q7YU 2OTJA 2QXFA 3KUFA 1OYXA 5KCHA 3GNFB 2DKGA 3M4YA 4NOYA 1YITA 4JRQA 5C0MA 4M78G 4LDXA 4IUUA 3AHUA 4KUDK 3V7SA 1VQ7A 3EAEA 2BUDA 2DXCA 4C92E 2ZPBB 4B9XA 2P0PA 3CCQA 4RMOA 1IZ6A 2A7YA 1KHCA 2E70A 5DLQE 2DVEA 2GFUA 3NTKA 3X25B 3LWIA 2FB7A 2FVUA 4M78E 1YJWT 1VQ5T 1FXXA 1TH7A 3QPHA 5CCAA 4E7IA 2OTLA 4F7UF 4M7AB 2X4WA 1JRIA 5GMKl 4ZTFA 3CC7T 2GQVA 2EJ9A 2ZPEB 3HFOA 1P92A 1VQPA 1WJRA 2LT4A 2JUFA 3MP6A 2RJEA 3HP9A 4OB1B 3URGA 4C5IA 3CC4T 1Q82U 3OYEA 1N8RC 2ZZDA 3CCET 1LOJA 1WJQA 2JVVA 2RH2A 4PNOA 1K8AU 1Y96B 3OMGA 4B9WA 3CCRA 2AHJB 3C95A 1M90C 3JCMW 3R6OA 1UGSB 2QI2A 4ME7A 5FU6C 2QEXT 3JCMP 2E1HA 3PGGA 3L2RA 2A3LA 1BIAA 1QW1A 3OSSC 4FT4A 3OYKA 1U8RA 1XQHA 5HY6A 4M75C 4QW2A 1X75C 3KBGA 3QJYA 2EQUA 3RESA 4V2SA 4BI4A 1G5VA 3QZ9B 1BI2A 5LJ3h 1YCYA 4XQ3A 3GOXA 5IN1A 5GMKj 3QSUA 1OZ3A 1W2BS 2E6ZA 3ZBDA 4M75A 4C8QD 4BI3A 4ELYC 5CAIA 4BE1A 1VQOA 2E64A 3L2VA 2XDBA 4II1A 2DIGA 2XHCA 3O8VA 4E7KA 3G7ZA 3WVEB 3OB9A 1IREB 4BB7A 5KCOA 3M55A 4E7LA 5C6SA 3S3NA 2RI5A 5CQXA 4LDVA 4ZGEB 2EWNA 3LGLA 4LDWA 4LD6A 4ZN3A 2E10A 1Q86C 3VJPA 4Y28E 1XOVA 4X34A 2R5AA 5GAOl 3GP8A 4FL6A 4J8OA 3OYLA 3JB9D 2RHUA 1M1KC 4KULA 4PKCC 4DA4A 3LWHA 4F7UB 3OYMA 2MF2A 3PNWC 3CCSA 2WSFE 5FU7C 2JN0A 4KBMB 2Y4YA 2DTHA 3TEEA 2ZPGB 2CKKA 4KUIA 1VQMT 5FLXE 3OYYA 2G3RA 2L3RA 2E6NA 3BDUA 4JJNK 1ZHIA 4A4GA 1G3WA 2DPPB 3CCVA 4HCBA 3M57A 2VC8A 4P5NA 4C8QF 3ZFJA 1Q81C 2PQWA 1PSEA 3QDRB 3HPWA 4J6WA 1AHJB 3TCJA 1SSFA 4QQGA 1RL2A 4NL3A 3QG1A 4LDYA 3S3MA 5LJ3g 1VQ6T 3HL8A 1BI1A 3G71A 3VYHB 3OS2A 1JBMA 1WQ7A 4MZPA 2DTIA 3NTIA 1I8FA 3JB9F 5HKCA 1X01A 3QYHB 1VQNA 4N0AC 2VYTA 3CCJT 4O6JA 4OGCA 2LQ8A 3G4SA 4XU1A 1JJ2A 1FX7A 2JTMA 2K5FA 3J7AF 5GAOn 3CCMA 3OBYA 4A4FA 2F69A 4M7AG 3JRZA 2L5QA 3QHSA 3DB4A 3CMEA 5FU6B 1S72A 1N8RU 4C0ZA 3OMCA 4C5EA 4EDUA 5IT9E 5CKDA 2CZ7B 4M75B 3PIPA 3OYJA 1M90U 3QUIA 4M77C 4QVZA 2DXTA 1M4ZA 2KY9A 4IUQA 3DB3A 5GANf 3OYNA 4KT0E 4M7AE 4JRPA 1NJIU 5GAOq 4HKEA 2OAUA 1KD1C 3NTHA 2DZ9A 5CKBA 3N5BB 4M77A 3I56A 4ZTJA 3A8OB 4TVRA 3JB9J 3RUXA 2CZ1B 1VQ4T 3CCLA 4PL6A 5FROA 2HBPA 3A5ZB 4IKFA 3HSBA 1M8VA 3FJPA 3C4SA 2KVQG 3UT1A 4PJOC 3TU4K 5GAMf 1K9MC 5GAN4 1UGQB 1BYMA 4C92D 5GANe 5GAN6 2MWPA 3I55T 4OB0B 3V7RA 4C8QB 4M7DG 3E9GA 1YIJA 1KQ2A 5M9OA 2CYZB 1GXIE 2K57A 3MEUA 3MEWA 4DOWA 4PJOA 3PMIA 4RG2A 5J39A 3HRSA 5FU7B 4JLIA 5D6YA 4M7DE 2PVDB 2R58A 3SB2A 3UWNA 4C92C 3JCMJ 1YI2A 5HK3A 4HCZA 3OYAA 3G6EA 5GAMe 5CIUA 3FRNA 1YHQA 4M78C 5AYFA 4L59A 1ZBXA 1I4K1 4FU6A 4C92A 3CMAA 4E7HA 5CK9A 2CZ6B 4X9DA 1VQLA 1EIFA 1O75A 4XTUA 4F7UG 2M16A 3M4GA 2QQRA 4M78A 1W2BA 1Q81U 2X4JA 4N4GA 5GANh 2LC4A 2EJGA 4A4KA 4BE2A 2Y90A 2ZPIB 1VQ9T 2F5KA 2IG0A 1MGQA 4QVDA 1YBYA 1VQ4A 4F7UE 2LVMA 3TREA 4JRKA 4M75D 2PUOB 4EMGA 3OYCA 3MHXA 2O4XA 3J80E 3FLGA 3X26B 2MAMA 3LYIA 1KC8C 4FSXA 2NLUA 2EKOA 2MMPA 3MO8A 2XDDA 3P8BB 3HHTB 2M0OA 2VV5A 2BKDN 5I2SA 2VUBA 3VUBA 4OMFB 5CKEA 5GAN7 3BY7A 3FB9A 4E47A 2XIDA 3S3OA 1YJNT 4M77B 3CPFA 2V8KA 3CC2A 2QTXA 2EAYA 1WQWA 3MEVA 5LJ5f 5GAN3 5GANd 4C5HA 1D3BA 3RKYA 5GAOr 3CCUA 3JCMf 3L1AA 1VQKA 1N9RA 4WF2A 3ASKA 3CD6A 3VV0A 4E7JA 3X20B 5CKHA 3LW5E 2VGMA 2R5MA 2EJFA 4XAXB 2DO3A 2BIVA 1N6AA 3L2ZA 4ZN1A 2V8IA 4R55A 4BACA 3CBPA 3Q1JA 2QA4A 1YITT 1KD1U 2RK1A 4PJOB 2GCXA 2XICA 5GAN8 4M75F 3KXTA 2HQEA 1VQ8A 4M78B 4OGEA 3V7CA 1HK9A 5LJ5e 5GAMd 1M1GA 4MDWA 4C0DC 1VQ7T 3JCMe 3CCQT 4MMLA 1QVFS 5A0DA 1I81A 2RHIA 1K9MU 2VXEA 5GANj 5GMKm 1X6OA 1V29B 2CZ0B 2OTLT 5FRNA 1JB0E 4C92B 2P0KA 4L5GA 2HD0A 3CEYA 1YJ9A 3OW2S 1VQPT 4QVCA 2VGNA 2XDPA 2XI9A 2ZPHB 4C8QG 4PLLA 3ME9A 5DM7R 4Y91A 4NS5A 2DTOA 3RMQA 2EQJA 5GAMj 5A2QE 1K73C 1VUBA 2RK2A 3P8HA 1N9SA 4OB3B 3OS1A 3CCRT 2JOYA 2CGHA 4O5VA 1KQ1A 2C06A 5CQYA 4C8QE 2QQAA 1OI1A 2YRVA 2O4XB 3LGFA 2OTJT 1UGRB 4BD3A 3A8LB 4XTXA 3MP1A 1NPRA 2H3JA 2P4TA 5CR2A 3JB9G 3JSCA 3M56A 2DD5A 5I2MA 1RI0A 4IUPA 3RMSA 4J5YA 2PUKB 4M77D 3CPWS 3SFMA 4BDYA 4BE0A 3RERA 3VYGA 4ATOA 3E19A 4OB2B 1WNLA 4FT2A 4C5GA 3FC3A 3OS0A 3OSVA 2D0QB 2F5TX 4JUVA 4N0AA 1VQOT 3BDLA 2DXUA 2R57A 1UGPB 2ZGWA 3RKXA 1BI3A 4M7AC 2QQBA 3M5AA 2RHZA 4PJOD 3E9FA 5HK0A 2HQXA 2PU9B 2CS7A 3CXCS 3SWNC 2DD4A 5LJ5d 2EQKA 4M7AA 2KDSA 3OS5A 3JCMd 1QVPA 4FM4B 1YJWA 1VQ5A 4MMKA 4N4IA 3M59A 3X24B 3C12A 3CCST 2K5IA 3SWNA 3M9QA 3SDZA 3WVDB 2RHYA 3CC7A 5J26A 3P8DA 4L6V5 1QVGS 4M77G 3L2WA 3OYBA 4M77F 3CBOA 4CRIA 3JAME 3CCVT 1M1FA 4EMHA 3V8LA 2RI2A 4N4HA 1KQSS 3CC4A 2RD1A 3CCEA 3VKIA 4DOVA 4M78D 2X4XA 3OBWA 3BFMA 2LX9A 4M7DC 1Q86U 2ZPFB 2K3XA 2FHDA 5CKFA 5LJ5j 3QXEB 3JB9H 1HXDA 4XU0A 2QEXA 2XG8D 4VUBA 1QP3A 3H6ZA 4PJOF 3JCMV 3ZEHA 3M53A 4M7DA 2X35A 3G71T 1H3ZA 2VXFA 2O01E 4J7FA 4D6WA 2Y4XA 1WPYA 2JNGA 1VQNT 3FDRA 3GF5A 3UDCA 3G4ST 2KSSA 1KG1A 2RB6A 4QQDA 3CCMT 5GAN2 5D6WA 3PTAA 2DK3A 2RJFA 3A8MB 2LRQA 2LTOA 4UC4A 4C92G 3S6WA 5GMKi 3CMET 4C92F 1S72T 1K73U 3VU3C 3META 4XTYA 5LJ3f 3ER0A 4NL2A 3EFRA 5GAN5 4RCCA 2K3YA 3E1SA 4M78F 2MI6A 4XK8E 4F7UA 4LD9K 1LNXA 2XU8A 1Y07A 2PVOB 5GAMh 4C0FA 3OYDA 1QVFA 3OYFA 1M5Q1 3QJ6A 4A4EA 5KH6A 2K2VA 5IAYA 3OYHA 2XK0A 3QIIA 4MZMA 4XTWA 3I56T 2KMTA 5LJ3e 3CCLT 3FIFA 2E5QA 1FWZA 1VQMA 2P0QA 3NFCA 4Q5WA 2XKOC 2EIFA 3MP8A 2V8JA 1H641 3M54A 1N27A 4X9CA 5EG2A 5LL6S 4EPCA 4R56A 4JS4A 3SWNB 3OW2A 1YIJT 4BUGA 1Y7XA 4PLIA 4BY6C 4EMKC 3JCMX 2XD0A 4OVAA 1O9SA 2WACA 2YLBA 3DLMA 4ELZC 1DJ7B 1VQ6A 1WGSA 3SD4A 3INZA 2RM4A 5D6XA 4M75G 4EMKA 2K4YA 2RJDA 3PT9A 1W4SA 5I21A 3G6ET 1YI2T 3LX7A 4QQ6A 1XTDA 2QQ9A 2FL7A 3JCMc 1NJIC 3T9NA 2EQMA 4BDZA 5GANg 1YHQT 2LQKA 2IVWA 2QQSA 2I2LA 3CCJA 5A0LA 4XTVA 1U1TA 3M58A 2GF7A 2KK4A 4IUVA 3C94A 4M75E 3CMAT 4M7DB 3LLRA 1VQLT 4A53A 2RO0A 3PMTA 4JDSA 4A4HA 3CPWA 2EYQA 3HRUA 1Y71A 1XNIA 4GY5A 2LCCA 1VIEA 3DKMA 4HT9A 5CVIA 2RA2A 1G3TA 2M9UA 4ZGJB 5GAMg 2ZCFB 3OYIA 2E65A 1G3SA 4C0GA 4J6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A C;  1LOJ A;  4PNO A;  1Y96 B;  4JLI A;  4M7D E;  3SB2 A;  4C92 C;  3JCM J;  5GMK i;  4C8Q C;  4PJO D;  5GAM e;  5DY9 A;  3JCM W;  3JCM P;  4DQ2 A;  3SWN C;  2E1H A;  3PGG A;  4HA8 A;  5LJ5 d;  4M7A A;  1BIA A;  5LJ5 h;  4M78 C;  3JCM d;  1I4K 1;  3JCM h;  4MMK A;  4M75 C;  4C92 A;  3RES A;  4C8Q A;  4V2S A;  1B34 A;  4X9D A;  5LJ3 d;  4A54 A;  5LJ3 h;  4OP0 A;  1YCY A;  4XQ3 A;  4XTU A;  4J6Y A;  3M4G A;  3SWN A;  4F7U G;  4M7A D;  2DJZ A;  3HFN A;  4M78 A;  5GMK j;  3QSU A;  5GAN h;  5GAN 3;  4M77 G;  2EJG A;  4M77 F;  4M75 A;  4C8Q D;  2Y90 A;  5CAI A;  4HT8 A;  2E64 A;  4QVD A;  1MGQ A;  4XU2 A;  4EMH A;  3V8L A;  1I5L A;  2RD1 A;  4F7U E;  4M78 D;  1D3B B;  4M7D C;  3BFM A;  4EMG A;  4JRK A;  4M75 D;  4XTZ A;  5GAO p;  3JB9 H;  5LJ5 j;  2EWN A;  2DXU A;  5GAO m;  2FYK A;  1HXD A;  2E10 A;  3BW1 A;  4XU0 A;  5GAO l;  3JB9 D;  4PJO F;  3JCM V;  5LJ3 j;  4M7D A;  2YHT A;  3V8K A;  4EMK B;  2VXF A;  4F7U B;  5GAN 7;  3BY7 A;  3FB9 A;  1WPY A;  2JN0 A;  4M77 B;  3JB9 I;  2DTH A;  1BIB A;  4M7D D;  2QTX A;  2EAY A;  1WQW A;  3BDU A;  3RIR A;  2RB6 A;  5LJ5 f;  5GAN d;  1D3B A;  2DZC A;  3RKY A;  4JRI A;  3JCM f;  3L1A A;  5GAN 2;  5GAO r;  4M7A F;  4C92 G;  5GMK e;  2VC8 A;  1N9R A;  2YLC A;  4RCB A;  4C92 F;  1Y96 A;  4WF2 A;  1U1S A;  3VU3 C;  4C8Q F;  4XTY A;  5LJ3 f;  3RKW A;  5LJ5 g;  2EJF A;  4NL2 A;  3L2Z A;  3EFR A;  3JCM g;  4J6W A;  5GAN 5;  4RCC A;  4M78 F;  4NL3 A;  4PJO B;  3QO3 A;  4M77 E;  5GAN 8;  4F7U A;  4M75 F;  5LJ3 g;  1LNX A;  2HNI A;  3V7C A;  3JCM Q;  1HK9 A;  5LJ5 e;  2DEQ A;  5GAM d;  5GAM h;  3GIB A;  4PJO G;  3JCM e;  1JBM A;  1WQ7 A;  4MML A;  1M5Q 1;  2DTI A;  1I8F A;  1I81 A;  4XTW A;  1X01 A;  2VXE A;  3JB9 F;  5LJ3 e;  3FIF A;  4N0A C;  4XU3 A;  5GMK m;  5GAN j;  4XU1 A;  3EFS A;  4C92 B;  5GAO n;  4PJO E;  4X9C A;  1H64 1;  1B34 B;  4M7D F;  4M7A G;  3QHS A;  1LJO A;  3SWN B;  3V8J A;  5GMK h;  3JCM b;  4EMK C;  2E41 A;  3JCM X;  4QVC A;  4C8Q G;  2YLB A;  4M75 B;  4Y91 A;  4NOY A;  2DKG A;  2DTO A;  3QUI A;  4M77 C;  5GAM j;  2DXT A;  3AHU A;  4M78 G;  5GAN f;  4M7A E;  3INZ A;  1N9S A;  2RM4 A;  3V7S A;  4M75 G;  4EMK A;  5GAO q;  2CGH A;  5I21 A;  4C92 E;  1KQ1 A;  4C8Q E;  3JCM c;  2DZ9 A;  4M77 A;  4XTX A;  2DVE A;  5GAN g;  3JB9 J;  3RUX A;  2FB7 A;  2I2L A;  4M78 E;  3JB9 G;  4XTV A;  1U1T A;  3HSB A;  1M8V A;  1TH7 A;  4M75 E;  3FJP A;  4M7D B;  4J5Y A;  4F7U F;  4M7A B;  4PJO C;  4A53 A;  4M77 D;  5GAM f;  3RER A;  5GAN 4;  1JRI A;  4C92 D;  5GAN e;  5GAN 6;  5GMK l;  2EJ9 A;  3HFO A;  3V7R A;  4C8Q B;  1WNL A;  1KQ2 A;  4HT9 A;  4M7D G;  2RA2 A;  4JUV A;  2K57 A;  4N0A A;  5GAM g;  4PJO A;  2E65 A;  4M78 B;  2ZGW A;  4J6X A;  3RKX A; 
#chains in the Genus database with same CATH topology
 1D0Y A;  5A0G A;  2L89 A;  2RJC A;  1UDL A;  4C8Q C;  4CI0 C;  2DYB A;  1BKB A;  1VYV A;  4QT7 A;  1G3Y A;  1Z9Q A;  3L2U A;  4HCC A;  1D0Z A;  4OP0 A;  2EYY A;  4RG8 A;  4J6Y A;  3I55 A;  2AK5 A;  4JZ3 A;  2RI3 A;  3CCU T;  3OA6 A;  2YWW A;  4J7I A;  1ABO A;  4FYY B;  2PNI A;  4XTZ A;  1W6X A;  1NE8 A;  5GAO m;  1WXU A;  2FYK A;  3BW1 A;  2DXB A;  3UPU A;  1VQ8 T;  4GLK A;  1UG1 A;  3V8K A;  2RHX A;  4JS5 A;  3RBB B;  4M7D D;  1MHN A;  2V1Q A;  4OF1 A;  4E2F B;  2DZC A;  2H8H A;  3HKS A;  2HAX A;  5J3B A;  1C0M A;  1BI0 A;  1VQ9 Q;  3TSZ A;  3GIB A;  1QWF A;  2LDM A;  4PJO G;  2M51 A;  1AWO A;  2WSC E;  1ZBJ A;  1GCQ C;  4AFQ C;  1JJ2 S;  2B8A A;  1C1A A;  2JZ2 A;  3GLX A;  3VUZ A;  5GMK h;  3FEO A;  1RAG B;  1RAC B;  1ZSG A;  1YFN A;  2DKG A;  3GNF B;  1YIT A;  1IHV A;  4LDX A;  4IUU A;  1R0C B;  2FRY A;  3EAE A;  2ZPB B;  1IZ6 A;  1MMG A;  2GFU A;  3NTK A;  4M78 E;  1YJW T;  5GJW B;  3QPH A;  4E7I A;  1JU5 C;  2YXY A;  2GQV A;  2EJ9 A;  2EGE A;  3M0Q A;  3MP6 A;  1KC8 R;  4DBF A;  1A0N B;  1UJY A;  4OB1 B;  5KYY A;  2C0T A;  1PD1 A;  3CC4 T;  3OYE A;  1N8R C;  2MIO A;  2OTL Q;  2JVV A;  4B9W A;  4JZ4 A;  2FEI A;  3NHN A;  2EYX A;  3JCM W;  1VQP Q;  2QI2 A;  4FW2 A;  2EKH A;  3L2R A;  3PGG A;  1PG5 B;  3OYK A;  1Q95 G;  5KYX A;  4QW2 A;  3RES A;  3SEM A;  3VRY A;  2AZV A;  1BI2 A;  3QZ9 B;  5LJ3 h;  1LPL A;  5GMK j;  3QSU A;  1B07 A;  1GRI A;  2E6Z A;  3ZBD A;  4C8Q D;  5CAI A;  4ELY C;  4BE1 A;  3U23 A;  2CP0 A;  2XDB A;  2P4R A;  3G7Z A;  2JM8 A;  2DBM A;  2DL5 A;  4E7L A;  5C6S A;  2RI5 A;  3QDF A;  4Y28 E;  4X34 A;  2R5A A;  4J8O A;  2DE0 X;  1GCP A;  4F7U B;  2MF2 A;  3PNW C;  2WSF E;  1RUW A;  3TEE A;  2EPD A;  3BDU A;  4JJN K;  2VC8 A;  3ZFJ A;  2QDL A;  1PSE A;  4X1V A;  4QQG A;  5KYY B;  2KR3 A;  4FYX B;  3G71 A;  3OS2 A;  2ENM A;  4RTZ A;  3NTI A;  2YRD A;  5KYU A;  4N0A C;  3CCJ T;  4O6J A;  3G4S A;  2LQ8 A;  4JPB W;  1CSK A;  2J05 A;  3CCM A;  2L5Q A;  3QHS A;  3CME A;  1X2Q A;  4C5E A;  4EDU A;  5CKD A;  2DET A;  1VQN Q;  2J6O A;  1M90 U;  2KY9 A;  3DB3 A;  1YNZ A;  1NJI U;  2KT8 A;  1KD1 C;  3N5B B;  4M77 A;  4TVR A;  1OX8 A;  2CZ1 B;  4DEY A;  5FRO A;  2HBP A;  3A5Z B;  3C4S A;  3UT1 A;  5GAM f;  1K9M C;  1UGQ B;  4C92 D;  5GAN e;  2MWP A;  4M7D G;  2LNH B;  3E9G A;  4PFO A;  4PJO A;  4DOW A;  1MMD A;  3PMI A;  4RG2 A;  3H0H A;  5FU7 B;  2PVD B;  3UWN A;  5HK3 A;  3OYA A;  3G6E A;  1PWT A;  1QVG P;  1KQS P;  4AMC A;  1IRX A;  1VYU A;  4X9D A;  3TVT A;  1YI2 Q;  4JJC A;  4N4G A;  2LC4 A;  2J06 A;  5KYU B;  4QVD A;  4AT1 B;  2YRC A;  4JJD A;  3CMA Q;  1OU9 A;  3EG0 A;  1VQL Q;  1QLY A;  4JRK A;  4E6R A;  4OMQ A;  4FSX A;  2P84 A;  3P8B B;  2VV5 A;  5I2S A;  2VUB A;  3UF4 A;  3VUB A;  3FB9 A;  2BE7 D;  2COZ A;  1YJN T;  4M77 B;  2V8K A;  3MEV A;  5GAN 3;  1D3B A;  5GAO r;  1VQK A;  3ASK A;  2EJF A;  4ZN1 A;  2DIL A;  3L2Z A;  4BAC A;  2AT1 B;  2KYM A;  2ESW A;  2V8I A;  3EGX B;  4PJO B;  3H0I A;  3CCU Q;  3D7S B;  3V7C A;  1MMA A;  2FRW A;  3CCQ T;  2JT4 A;  1ZSZ C;  5A0D A;  2RHI A;  1V29 B;  2CZ0 B;  3MJX A;  2K9G A;  1VQ8 Q;  2B86 A;  1R77 A;  1YJ9 A;  4C8Q G;  2XDP A;  1Y57 A;  2VKN A;  3ME9 A;  4PFZ A;  4Y91 A;  5DM7 R;  5GAM j;  2F2V A;  3VRZ A;  1K4U S;  2DL4 A;  2JOY A;  1TOV A;  1BK2 A;  1KQ1 A;  3I9Q A;  1NBE B;  2YRV A;  2OTJ T;  2H3J A;  5CR2 A;  1D0X A;  2CP7 A;  5I2M A;  1JXO A;  3RMS A;  3CPW S;  4BDY A;  3VYG A;  4OB2 B;  1AZE A;  1D1B A;  3FC3 A;  1VQO T;  2KRO A;  1NLP C;  4J9B A;  4M7A C;  4LUE A;  3M5A A;  2HQX A;  2E5K A;  2CSI A;  2A37 A;  2DD4 A;  1YWO A;  2COW A;  4RTU A;  3JCM d;  1QVP A;  1Z9Z A;  2O88 A;  3M59 A;  3C12 A;  4M4Z A;  3CCS T;  3SWN A;  2BZ8 A;  3OYB A;  4M77 F;  1WI7 A;  4IIM A;  3JAM E;  3CCV T;  1M1F A;  4EMH A;  1YJW Q;  2RD1 A;  1QKW A;  4DOV A;  2X4X A;  1OQK A;  1CKA A;  2ZPF B;  1Q86 U;  3JB9 H;  4VUB A;  4PJO F;  4M7D A;  3CC4 Q;  1K0X A;  1E6H A;  2DL8 A;  3O5Z A;  2O01 E;  4J7F A;  3RNJ A;  2Y4X A;  4F04 B;  3FDR A;  3GF5 A;  3UDC A;  1T0J A;  3EG1 A;  3PTA A;  3A8M B;  1M1K C;  2LRQ A;  4C92 G;  1S72 T;  3VU3 C;  3MET A;  3VS4 A;  3ER0 A;  1SRM A;  4RCC A;  1AOJ A;  1BCO A;  2MI6 A;  4XK8 E;  4LD9 K;  1OEB A;  1LNX A;  4PJL A;  2PVO B;  3OYD A;  2QYZ A;  1QVF A;  3OYF A;  5IAY A;  3OYH A;  2XK0 A;  5LJ3 e;  1M2V A;  3AT1 B;  2P0Q A;  1T3S A;  1N8R R;  2KRM A;  2XKO C;  2EIF A;  4X9C A;  4CC4 B;  4EPC A;  9ATC B;  1D1A A;  3NPF A;  3SWN B;  4PLI A;  1HYO A;  1IGU A;  2HKQ B;  2XD0 A;  2YLB A;  2WAC A;  3HTR A;  5FW9 A;  3EG2 A;  1UHC A;  2JS2 A;  4FW1 A;  1MUZ A;  1VQ6 A;  3SD4 A;  2CH4 A;  4EMK A;  1R0B G;  4QQ6 A;  1XTD A;  2FL7 A;  1NJI C;  2EQM A;  4K11 A;  1YHQ T;  2LQK A;  2IVW A;  3JV3 A;  4IUV A;  2KK4 A;  4M7D B;  2I0N A;  3DKM A;  5I11 A;  5CVI A;  2E65 A;  3CCJ Q;  4M78 B;  4C0G A;  3NGP A;  1D09 B;  3ZL7 C;  1T0H A;  2PVG B;  4Z02 A;  4KH0 B;  1PRL C;  1OZ2 A;  5FRM A;  5LJ5 h;  2M0Y A;  3QZ5 B;  2HMA A;  4R0K A;  4C8Q A;  1ZQ1 A;  2K6D A;  4LXC A;  4CC2 A;  4M7A D;  4LUD A;  5L8R E;  1K73 R;  2NUT A;  3CC2 T;  1QVG A;  3HRT A;  4HT8 A;  5HCK A;  2LQW A;  3GNG A;  1KQS A;  2LNV A;  4J9D A;  5GAO p;  4YTL A;  2QA4 T;  1Q82 C;  5CO7 A;  1QP2 A;  2KXD A;  2E3I A;  2WSE E;  3R6N A;  3OW2 P;  5FWC A;  4AFU C;  4EMK B;  4D8K A;  2E12 A;  2KNB B;  2DIQ A;  1BIB A;  2FZC B;  3CBM A;  2QDY B;  2D9T A;  4C0D B;  1KD1 R;  1AZG B;  3JCM g;  4M77 E;  3JCM Q;  1JXM A;  2QAS A;  2ZAE A;  3EFS A;  2RQU A;  4PJO E;  1SEM A;  1UTI A;  2K5L A;  4M7D F;  1GCQ A;  1Q7Y U;  2NUT B;  2BTT A;  2QXF A;  1YJN Q;  5KCH A;  1AD5 A;  3M4Y A;  4JRQ A;  4OMO A;  2ECZ A;  4HVV A;  1VQ7 A;  2OAW A;  4B9X A;  4RTX A;  2CP3 A;  2A7Y A;  1G83 A;  3LWI A;  2FB7 A;  2GGR A;  1VQ5 T;  1FXX A;  1TH7 A;  2MPX C;  1WXB A;  1JRI A;  2CSQ A;  3CC7 T;  3CCQ Q;  3I5S A;  2O9V A;  2OI3 A;  3HP9 A;  1M2O A;  1Y0M A;  3CCE T;  1K8A U;  2LMJ A;  3CCR A;  3JCM P;  5FU6 C;  2QEX T;  1VYT A;  1BIA A;  1U5S A;  3MPU B;  3OSS C;  4FT4 A;  1AT1 B;  1U8R A;  3KBG A;  2EQU A;  4V2S A;  4BI4 A;  2BZY A;  3GOX A;  5IN1 A;  4FSS A;  2CP2 A;  2ROT A;  2OTJ Q;  3M0R A;  3L2V A;  2DIG A;  4IIO A;  2JJ9 A;  5KCO A;  3M55 A;  4E7S A;  4LD6 A;  4ZN3 A;  1Q86 C;  2QG9 B;  3VJP A;  1VQO Q;  4FL6 A;  3JB9 D;  2DYI A;  4DA4 A;  1TUD A;  2O2O A;  2DTH A;  2O31 A;  2ZPG B;  2CKK A;  1VQM T;  3OYY A;  1N5Z A;  2E6N A;  1OOT A;  1IXD A;  4HCB A;  3M57 A;  4P5N A;  1K1Z A;  4C8Q F;  2PQW A;  3CCS Q;  5IHK A;  2GTO A;  3HPW A;  1AHJ B;  1SRL A;  2IIM A;  5IHI A;  3S3M A;  3HL8 A;  3CCV Q;  2F1L A;  3BE3 A;  2RQT A;  5HKC A;  2VYT A;  4OGC A;  3J7A F;  1PRM C;  5GAO n;  2AKL A;  3OBY A;  4M7A G;  3JRZ A;  1H8K A;  1F1B B;  2CZ7 B;  4QVZ A;  4IUQ A;  5GAO q;  1S72 Q;  3NTH A;  4FYV B;  4PJM A;  3I56 A;  3CCL A;  2HBW A;  2JMC A;  3HSB A;  1M8V A;  1NYG A;  3FJP A;  1PHT A;  2KVQ G;  3TU4 K;  5GAN 4;  2KRN A;  5GAN 6;  3I55 T;  1YIJ A;  2KYB A;  2CYZ B;  1GXI E;  1X69 A;  2FO0 A;  1EX4 A;  2J7I A;  4JLI A;  4M7D E;  2R58 A;  4C92 C;  3FRN A;  2J6K A;  5AYF A;  1ACM B;  4L59 A;  1I4K 1;  1M1K R;  2CZ6 B;  2PTK A;  4XTU A;  2M16 A;  1ARK A;  1W2B A;  1Q81 U;  1ZA2 B;  1YHQ Q;  2K3B A;  3M0P A;  1VQ4 A;  1B3Q A;  2LVM A;  3TRE A;  4EMG A;  1AWJ A;  2PUO B;  3MHX A;  2NUP A;  2NLU A;  2MMP A;  3MO8 A;  2XDD A;  1TTH B;  1RAF B;  4PFP A;  2E4H A;  5CKE A;  1MV3 A;  2XID A;  3S3O A;  3EFO A;  2RF0 A;  5GAN d;  3RKY A;  3JCM f;  4WF2 A;  3CD6 A;  3VV0 A;  3X20 B;  4LNP A;  3LW5 E;  1NJI R;  2DO3 A;  4R55 A;  3E2U A;  3CC2 Q;  3CBP A;  3Q1J A;  1YIT T;  2RK1 A;  1QQJ A;  4OGE A;  5LJ5 e;  1QVF S;  2RN8 A;  2VXE A;  2QA4 Q;  1X43 A;  2NYS A;  1ZSZ A;  3CEY A;  2MOX A;  2VGN A;  2ZPH B;  2DTO A;  1OPK A;  2KGT A;  1K73 C;  1VUB A;  2DER A;  3VS5 A;  2HKN A;  3P8H A;  4OB3 B;  1WFW A;  2C06 A;  5CQY A;  4C8Q E;  2CP6 A;  4BD3 A;  1NPR A;  2NUP B;  1B7T A;  2AZS A;  3JB9 G;  1RI0 A;  2PUK B;  4RTW A;  3RER A;  3SFM A;  3E19 A;  5KYX B;  1BBZ A;  1WNL A;  4C5G A;  1Q82 R;  2K2M A;  1KIK A;  3EFO B;  2FPD A;  2R57 A;  2ZGW A;  1QCO A;  2QQB A;  2PU9 B;  2LCS A;  2W0Z A;  2EQK A;  4M7A A;  2KDS A;  1X27 A;  3EH1 A;  4MMK A;  2K5I A;  4AFZ C;  2RNA A;  1TG0 A;  5J26 A;  1HJD A;  3P8D A;  1QVG S;  1VQ5 Q;  1KQS S;  3VKI A;  3OBW A;  2FHD A;  3CC7 Q;  4XU0 A;  2KXC A;  3ZEH A;  3G71 T;  3CCE Q;  2VXF A;  2COY A;  4D6W A;  2SEM A;  3G4S T;  2KSS A;  4FCY A;  2H3E B;  2QEX Q;  1KG1 A;  4QQD A;  3CCM T;  2DK3 A;  2RJF A;  2YUQ A;  2QGG A;  5GMK i;  1WHM A;  3THK A;  3CME T;  3EFR A;  2O9S A;  1Y07 A;  5GAM h;  4C0F A;  4KGX B;  1M5Q 1;  4A4E A;  3VS7 A;  3QII A;  4MZM A;  2E5Q A;  2HSE B;  3NMZ C;  2V8J A;  5LL6 S;  5EG2 A;  1N27 A;  3EGD A;  5KYW A;  1NEG A;  1Y7X A;  4BY6 C;  4OVA A;  3DLM A;  4ELZ C;  1VQM Q;  1ZUK A;  7AT1 B;  2RM4 A;  2K4Y A;  2RJD A;  5I21 A;  1W4S A;  2EQI A;  3G6E T;  2CP5 A;  4AFS C;  1TU0 B;  5GAN g;  1RLP C;  1I07 A;  2I2L A;  5A0L A;  4XTV A;  1U1T A;  2GF7 A;  3C94 A;  1ZUU A;  3LLR A;  3PMT A;  4JDS A;  4J9E A;  4A4H A;  2EW3 A;  1OV3 A;  1Y71 A;  2EYZ A;  2CUB A;  4HT9 A;  2RA2 A;  1Q86 R;  1G3T A;  4ZGJ B;  2HZY A;  1VIF A;  1WHH A;  4MZT A;  3H0F A;  1UEB A;  4HA8 A;  2LZ6 B;  1SPK A;  2LJ0 A;  2LT1 A;  1B34 A;  2EGA A;  5LJ3 d;  4MDX A;  4A54 A;  3WXM B;  3DLL A;  2DJZ A;  4BI8 B;  1SG5 A;  1HSQ A;  2DRM A;  1I5L A;  1VQK T;  2KAF A;  1WIE A;  5KYW B;  1D3B B;  2DLP A;  2DRK A;  1I1J A;  1KHI A;  4Z88 A;  3I55 Q;  1NPP A;  1PKT A;  1HD3 A;  2YHT A;  8ATC B;  1BB9 A;  4D8D A;  4OMP A;  3JB9 I;  2CH4 W;  2DAQ A;  1ZX6 A;  3PFS A;  4LN2 A;  1VQ9 A;  2QK0 A;  4M7A F;  4JRI A;  3GPL A;  1TSF A;  4ZNX A;  2BZX A;  3A8G B;  5GMK e;  4RCB A;  3L42 A;  1X2K A;  1Y96 A;  1U1S A;  1YJ9 T;  2FZG B;  2VWF A;  4J9I A;  3L2Q A;  1EFN A;  3QO3 A;  1GBQ A;  2MWO A;  3QKJ A;  4IUT A;  2K7A A;  5EC7 A;  1PSF A;  2J6F A;  1WLP B;  1NZ9 A;  4XU3 A;  1ABQ A;  2JMA A;  4F16 A;  3F70 A;  4RTT A;  1BCM A;  2CT4 A;  1M27 C;  5DLO A;  2LCL A;  1B34 B;  2E3H A;  2RQW A;  1LJO A;  1PNJ A;  2L8D A;  4QKU A;  3KUF A;  4PJN A;  4NOY A;  4HCK A;  4ANJ A;  5C0M A;  2GNC A;  4KUD K;  3V7S A;  2BUD A;  2DXC A;  2AKK A;  1KHC A;  3X25 B;  5FWB A;  2FVU A;  4RTV A;  1YIT Q;  5CCA A;  2OTL A;  3TQ7 P;  2X4W A;  1GL5 A;  2LJ1 A;  4ZTF A;  2ZPE B;  2C0I A;  1VQP A;  1WJR A;  1OPL A;  2LT4 A;  2JUF A;  2HSP A;  2RJE A;  4PNO A;  2DM1 A;  1LVK A;  1Y96 B;  2AHJ B;  1M90 C;  1I0C A;  1UGS B;  2HQH A;  2A3L A;  1QW1 A;  1XQH A;  1RLQ C;  5HY6 A;  4M75 C;  3UAT A;  1X75 C;  3QJY A;  1G5V A;  4XQ3 A;  1OZ3 A;  1W2B S;  4BI3 A;  1VOM A;  2E64 A;  1NYF A;  4II1 A;  3WVE B;  3OB9 A;  1KSW A;  4LDV A;  4LDW A;  4WTO B;  5GAO l;  4DBH A;  3REB B;  2VB6 A;  1PC0 A;  4PKC C;  3LWH A;  3OYM A;  2HDA A;  2JN0 A;  4KBM B;  2Y4Y A;  4KUI A;  2A36 A;  5FLX E;  1Q7Y R;  2G3R A;  4A4G A;  4J9F A;  1G3W A;  2D8H A;  1M2V B;  2HEQ A;  1UHF A;  3QDR B;  1OU8 A;  2L0A A;  1SSF A;  1VQ6 T;  5LJ3 g;  1UE9 A;  1X6B A;  1JBM A;  2DTI A;  3JB9 F;  1X01 A;  3I5R A;  1VQN A;  2NUZ A;  2K79 A;  4F14 A;  2F2W A;  4XU1 A;  2A08 A;  1FX7 A;  2K5F A;  3CQT A;  4OML A;  2F69 A;  3G71 Q;  1N8R U;  3DB4 A;  3EG9 A;  5FU6 B;  1K8A R;  2DVJ A;  4C0Z A;  5IT9 E;  3G4S Q;  3QUI A;  3OYN A;  1M4Z A;  4M7A E;  5GAN f;  4KT0 E;  3CCM Q;  2YUN A;  3CME Q;  4ZTJ A;  3A8O B;  3JB9 J;  2VVK A;  2FPF A;  4PL6 A;  1G8X A;  1BYM A;  2JS0 A;  4C8Q B;  3CXC P;  2JM9 A;  1M3C A;  5M9O A;  2K57 A;  3MEU A;  3MEW A;  1WHK A;  2ED0 A;  2ED1 A;  5D6Y A;  3SB2 A;  2LQN A;  1YI2 A;  4HCZ A;  1AWW A;  5GAM e;  5CIU A;  4M78 C;  4RTY A;  4C92 A;  3CMA A;  4HVU A;  2EVR A;  1VQL A;  1EIF A;  4F7U G;  3G6E Q;  4GBQ A;  1MNE A;  1PCX A;  2X4J A;  3ULR B;  5GAN h;  4A4K A;  2EJG A;  4BE2 A;  3PVQ A;  2L3S A;  4HXJ A;  3EG9 B;  4M75 D;  2X3X D;  3OYC A;  2V1R A;  2O4X A;  2M0O A;  2BKD N;  4OMF B;  5GAN 7;  1IB8 A;  2IPO B;  1QMC A;  2QAZ A;  3VS3 A;  2QTX A;  2EAY A;  3CCU A;  4AG1 C;  1N9R A;  1WDX A;  2YUP A;  1N6A A;  1KD1 U;  2SRC A;  2GCX A;  2XIC A;  3KXT A;  1VQ8 A;  1HK9 A;  1VQ7 T;  1ZA1 B;  4MDW A;  4C0D C;  1M8M A;  1VQK Q;  2RQV A;  1I81 A;  1K9M U;  3KFV A;  2KI7 A;  2DF6 A;  5GAN j;  1RAB B;  5FRN A;  1JB0 E;  4C92 B;  2P0K A;  4L5G A;  2X9H A;  1ZLM A;  1S1N A;  4NS5 A;  2RK2 A;  1N9S A;  3CCR T;  2CGH A;  4O5V A;  1YJ9 Q;  1OI1 A;  2O4X B;  3TSW A;  3A8L B;  4XTX A;  3MP1 A;  2P4T A;  4DBQ A;  2DNU A;  1TUG B;  1Q81 R;  4JJB A;  4IUP A;  3LH5 A;  4OMN A;  1TXQ A;  1IHW A;  2CT3 A;  3OSV A;  2D0Q B;  4N0A A;  3BDL A;  2DXU A;  3RKX A;  1BI3 A;  1YCS B;  2RHZ A;  3E9F A;  2CS7 A;  3VS6 A;  5LJ5 d;  1MV0 B;  2ROL A;  1YJW A;  2DEU A;  4N4I A;  3X24 B;  1C6V X;  5ECA A;  3M9Q A;  3SDZ A;  1SSH A;  4L6V 5;  4M77 G;  2OX7 A;  3CC4 A;  2RI2 A;  4N4H A;  4M78 D;  3BFM A;  1TUC A;  3QWX X;  5CKF A;  4A63 B;  3QXE B;  5I22 A;  5IH2 A;  1AVZ C;  1QP3 A;  3M53 A;  1H3Z A;  4CC3 A;  2JNG A;  2DFU A;  2RB6 A;  2BE9 B;  5D6W A;  1GBR A;  2XMF A;  2LTO A;  4C92 F;  4XTY A;  5LJ3 f;  1NM7 A;  4NL2 A;  3C0C A;  5GAN 5;  2NWM A;  4PK4 A;  2Z0W A;  1JJ2 P;  2DBK A;  4F7U A;  2XU8 A;  1IGQ A;  8AT1 B;  3VS1 A;  3QJ6 A;  2K2V A;  3I56 T;  4XTW A;  2KMT A;  3CCL T;  3EG3 A;  3FIF A;  3NFC A;  1SF9 A;  3MP8 A;  3RR6 A;  1H64 1;  4JS4 A;  3OW2 A;  1YIJ T;  1M90 R;  3JCM X;  2GQI A;  2EYW A;  1T3L A;  1WGS A;  4M75 G;  4J9G A;  1AWX A;  2DL7 A;  3T9N A;  4KH1 B;  4BDZ A;  3CCJ A;  3M58 A;  1VQ6 Q;  4A53 A;  2RO0 A;  2EYQ A;  4GY5 A;  2YSQ A;  2LCC A;  2A28 A;  1WHG A;  2ZCF B;  3OYI A;  1V76 A;  1VQ4 T;  1Q7Y C;  1FMK A;  1E7O A;  4RKU E;  1WJS A;  1LCK A;  3OY9 A;  3J81 E;  2JTE A;  2M1H A;  5DY9 A;  3OQ5 A;  4DQ2 A;  3CXC A;  2OJ2 A;  5AT1 B;  2ATC B;  3JCM h;  1KJW A;  1RAI B;  4WCI A;  4IUR A;  1R8O B;  1M1K U;  3I35 A;  3HFN A;  3MEA A;  3H41 A;  1QVF P;  1YN8 A;  4LDU A;  4XU2 A;  3OYG A;  3RDV A;  3CD6 T;  2MYS A;  1KC8 U;  1FMV A;  2KQW A;  2YT6 A;  3X28 B;  2X4Y A;  2KEA A;  1K8A C;  4B6M A;  5LJ3 j;  3VS0 A;  1QCF A;  1M9S A;  4BY6 B;  3QBY A;  2FZK B;  1JEG A;  1NLO C;  1WX6 A;  5KE3 A;  3RIR A;  3LH0 A;  2GFA A;  3M0S A;  4ZGD B;  3PIO A;  1WHL A;  3A8H B;  2YLC A;  3MCA B;  1RAD B;  4FIB A;  3RKW A;  5L23 A;  2L2P A;  1UB4 A;  5LJ5 g;  3SHW A;  1ZSZ B;  2JTF A;  1OX9 A;  2D6F A;  2EFI A;  2HNI A;  3QYG B;  2DEQ A;  1M3A A;  5KE2 A;  1PD0 A;  1YJN A;  2V26 A;  2LX7 A;  2CDT A;  3EGX A;  3H8Z A;  4J83 A;  2GBQ A;  4JLG A;  3V8J A;  2E41 A;  3JCM b;  4J9H A;  1OYX A;  3QWY A;  3AHU A;  4M78 G;  2D1X A;  4C92 E;  2P0P A;  3CCQ A;  2W10 A;  4RMO A;  2E70 A;  5DLQ E;  1WZO A;  2DVE A;  1RAA B;  1CKB A;  4J9C A;  4F7U F;  4M7A B;  1RI9 A;  4E7Z A;  1VQ7 Q;  5GMK l;  2KBT A;  3HFO A;  1P92 A;  1WHJ A;  2DL3 A;  3URG A;  4C5I A;  1Q82 U;  2ZZD A;  1LOJ A;  1WJQ A;  1YWP A;  2RH2 A;  3OMG A;  2KRS A;  2QTV A;  3C95 A;  3R6O A;  4ME7 A;  2OTJ A;  2E1H A;  1PKS A;  1H92 A;  1W70 A;  3CCR Q;  1YCY A;  1X6G A;  4LE9 A;  2F2X A;  4M75 A;  1VQO A;  4E7K A;  2XHC A;  3O8V A;  4BB7 A;  1IRE B;  3S3N A;  5CQX A;  1NEB A;  4ZGE B;  2EWN A;  3LGL A;  2E10 A;  1UFF A;  1XOV A;  3EHR A;  3GP8 A;  3OYL A;  2RHU A;  4KUL A;  1TWB A;  3CCS A;  5FU7 C;  1PM3 A;  2DMO A;  1XJW B;  3FJ5 A;  2L3R A;  1ZHI A;  2DPP B;  3CCV A;  4OMM A;  1Q81 C;  2RQR A;  1QKX A;  3EGD B;  4J6W A;  3TCJ A;  4NL3 A;  1RL2 A;  3QG1 A;  1ZUY A;  4LDY A;  2MCN A;  4KGV B;  1BI1 A;  1SKU B;  3VYH B;  4MZP A;  1WQ7 A;  1MMN A;  1UJ0 A;  1I8F A;  2LJ3 A;  1TS9 A;  2DA9 A;  3QYH B;  2GTJ A;  2FG0 A;  1JJ2 A;  3IQL A;  2JTM A;  1SHF A;  1UUE A;  4A4F A;  1S72 A;  1K0S A;  3OMC A;  2KE9 A;  4M75 B;  3PIP A;  3OYJ A;  4M77 C;  2DXT A;  1GFD A;  3CPW P;  4JRP A;  1W1F A;  4HKE A;  2OAU A;  2HL3 A;  2DZ9 A;  5CKB A;  2RPN A;  3RUX A;  1NG2 A;  2JXB A;  4IKF A;  2G6F X;  2AIR B;  4PJO C;  1G2B A;  1BU1 A;  3PVL A;  4OB0 B;  3V7R A;  1KQ2 A;  1KFZ A;  3I56 Q;  3CCL Q;  1UEC A;  1K76 A;  5IXB A;  5J39 A;  3HRS A;  1U06 A;  3JCM J;  2A0F B;  2DX1 A;  1YIJ Q;  4KGZ B;  4Y92 A;  1YHQ A;  1ZBX A;  4FU6 A;  4E7H A;  5CK9 A;  3G1J A;  1GFC A;  4FYW B;  1O75 A;  3M4G A;  2QQR A;  4M78 A;  4Z8A A;  3EGU A;  2C0O A;  2Y90 A;  1WYX A;  2ZPI B;  1VQ9 T;  2F5K A;  2IG0 A;  1MGQ A;  1YBY A;  4F7U E;  1FYN A;  3VS2 A;  2L3P A;  3J80 E;  3FLG A;  3X26 B;  2MAM A;  3LYI A;  1KC8 C;  1RAE B;  2EKO A;  4RUG A;  1U3O A;  3HHT B;  1YP5 A;  2DJQ A;  1VQ4 Q;  3BY7 A;  2CUD A;  4E47 A;  2X3W D;  2X51 A;  1OUL A;  3CPF A;  3CC2 A;  1WQW A;  5LJ5 f;  4C5H A;  3L1A A;  1VA7 A;  4E7J A;  5KYN A;  5CKH A;  4XAX B;  2VGM A;  2R5M A;  3UA6 A;  2BIV A;  2QA4 A;  5GAN 8;  4M75 F;  2HQE A;  5GAM d;  4PJJ A;  1M1G A;  5IHN A;  3JCM e;  3CD6 Q;  4MML A;  2LP5 A;  5GMK m;  1X6O A;  2OTL T;  5D7U A;  2HD0 A;  2YUO A;  3OW2 S;  1VQP T;  2PZ1 A;  4QVC A;  2XI9 A;  4PLL A;  1H3H A;  3PE0 A;  3EHQ A;  2EQJ A;  3RMQ A;  5A2Q E;  1WXT A;  3OS1 A;  1W2B P;  1I5O B;  3M0U A;  2QQA A;  2L3Q A;  3LGF A;  1UGR B;  3MKD A;  3A1P A;  1FMW A;  6AT1 B;  4DEX A;  2HCK A;  3JSC A;  3M56 A;  2DD5 A;  1QCN A;  4J5Y A;  4ESR A;  4M77 D;  2MK5 A;  4BE0 A;  2QGF B;  4ATO A;  4FT2 A;  1V1C A;  3GBQ A;  3OS0 A;  2F5T X;  4JUV A;  2ABL A;  1UGP B;  3H9N A;  2FPE A;  4PJO D;  5HK0 A;  1EZZ B;  2JW4 A;  3CXC S;  3SWN C;  3OS5 A;  2RMO A;  1J3T A;  4FM4 B;  1VQ5 A;  3WVD B;  2RHY A;  3CC7 A;  4CC7 A;  2M02 A;  3L2W A;  2KT1 A;  3CBO A;  4CRI A;  5GJV B;  3V8L A;  1D1C A;  3CCE A;  1RAH B;  2HL5 C;  4M7D C;  2LX9 A;  2K3X A;  5LJ5 j;  1K9A A;  1HXD A;  2QEX A;  1K9M R;  2XG8 D;  1WA7 A;  3H6Z A;  3JCM V;  2X35 A;  2EBP A;  4AG2 C;  1M30 A;  2CRE A;  1IO6 A;  1WPY A;  4DBR A;  1VQN T;  2D8J A;  1E6G A;  2D0N A;  5GAN 2;  1M3B A;  4UC4 A;  4Z89 A;  4HVW A;  3S6W A;  1K73 U;  1AEY A;  3A98 A;  1QWE A;  2K3Y A;  3E1S A;  4M78 F;  4ORZ A;  5IXF A;  4F17 A;  5KH6 A;  4KRT A;  4GLM A;  1FWZ A;  1VQM A;  3UA7 A;  4Q5W A;  3M54 A;  4R56 A;  4BUG A;  4EMK C;  1O9S A;  1DJ7 B;  1KK7 A;  3INZ A;  3M0T A;  5D6X A;  1YI2 T;  3PT9 A;  3REA B;  3LX7 A;  2YDL A;  1MND A;  2QQ9 A;  3JCM c;  2VAS A;  1JO8 A;  3EH2 A;  2QQS A;  1UGV A;  1JQQ A;  4EIK A;  2EGC A;  4M75 E;  3CMA T;  1VQL T;  3CPW A;  1SHG A;  3HRU A;  1XNI A;  1VIE A;  2M9U A;  5GAM g;  1G3S A;  4J6X A; 
#chains in the Genus database with same CATH homology
 1VIF A;  5A0G A;  1Q7Y C;  2L89 A;  2RJC A;  4MZT A;  4RKU E;  1WJS A;  4C8Q C;  3OY9 A;  4CI0 C;  3J81 E;  2PVG B;  1BKB A;  2M1H A;  5DY9 A;  3OQ5 A;  1UEB A;  4Z02 A;  4DQ2 A;  3CXC A;  4HA8 A;  1OZ2 A;  1G3Y A;  5FRM A;  5LJ5 h;  3QZ5 B;  3JCM h;  3L2U A;  4C8Q A;  1ZQ1 A;  4IUR A;  1R8O B;  1B34 A;  2LT1 A;  5LJ3 d;  4HCC A;  4MDX A;  4A54 A;  4OP0 A;  3WXM B;  4RG8 A;  1M1K U;  4J6Y A;  3DLL A;  4M7A D;  3I55 A;  5L8R E;  2DJZ A;  3HFN A;  3MEA A;  4BI8 B;  3CC2 T;  1QVG A;  3HRT A;  4HT8 A;  2RI3 A;  3CCU T;  4LDU A;  3GNG A;  4XU2 A;  1I5L A;  1KQS A;  3OYG A;  1VQK T;  2KAF A;  2LNV A;  3OA6 A;  3CD6 T;  4J7I A;  1D3B B;  5GAO p;  1KC8 U;  4XTZ A;  4YTL A;  2KQW A;  1KHI A;  3X28 B;  1NE8 A;  5GAO m;  2QA4 T;  1Q82 C;  2FYK A;  1NPP A;  2X4Y A;  1QP2 A;  3BW1 A;  2DXB A;  5CO7 A;  1K8A C;  2WSE E;  3UPU A;  1VQ8 T;  5LJ3 j;  4GLK A;  2YHT A;  1M9S A;  3V8K A;  4BY6 B;  4EMK B;  2E12 A;  2RHX A;  4JS5 A;  2DIQ A;  3QBY A;  3JB9 I;  1BIB A;  3CBM A;  2DAQ A;  4M7D D;  3PFS A;  2QDY B;  1MHN A;  4OF1 A;  5KE3 A;  3RIR A;  3LH0 A;  2GFA A;  4ZGD B;  1VQ9 A;  2DZC A;  3PIO A;  3A8H B;  2D9T A;  4JRI A;  3GPL A;  4M7A F;  3A8G B;  5GMK e;  3HKS A;  2YLC A;  4RCB A;  3MCA B;  3L42 A;  1Y96 A;  4C0D B;  1U1S A;  1YJ9 T;  4FIB A;  3RKW A;  5LJ5 g;  1UB4 A;  2HAX A;  3L2Q A;  5J3B A;  2JTF A;  3JCM g;  1BI0 A;  3QO3 A;  4M77 E;  2D6F A;  2MWO A;  2EFI A;  3QKJ A;  2HNI A;  3QYG B;  4IUT A;  3JCM Q;  3GIB A;  2DEQ A;  2LDM A;  4PJO G;  1PSF A;  2WSC E;  1NZ9 A;  5KE2 A;  1YJN A;  4XU3 A;  3EFS A;  1JJ2 S;  3F70 A;  2B8A A;  5DLO A;  4PJO E;  2LCL A;  1B34 B;  2K5L A;  2JZ2 A;  4M7D F;  3GLX A;  1LJO A;  4J83 A;  3H8Z A;  4JLG A;  3V8J A;  3FEO A;  3VUZ A;  2E41 A;  5GMK h;  3JCM b;  2L8D A;  1Q7Y U;  2OTJ A;  2QXF A;  3KUF A;  1OYX A;  5KCH A;  3GNF B;  2DKG A;  3M4Y A;  4NOY A;  1YIT A;  4JRQ A;  5C0M A;  4M78 G;  4LDX A;  4IUU A;  3AHU A;  4KUD K;  3V7S A;  1VQ7 A;  3EAE A;  2BUD A;  2DXC A;  4C92 E;  2ZPB B;  4B9X A;  2P0P A;  3CCQ A;  4RMO A;  1IZ6 A;  2A7Y A;  1KHC A;  2E70 A;  5DLQ E;  2DVE A;  2GFU A;  3NTK A;  3X25 B;  3LWI A;  2FB7 A;  2FVU A;  4M78 E;  1YJW T;  1VQ5 T;  1FXX A;  1TH7 A;  3QPH A;  5CCA A;  4E7I A;  2OTL A;  4F7U F;  4M7A B;  2X4W A;  1JRI A;  5GMK l;  4ZTF A;  3CC7 T;  2GQV A;  2EJ9 A;  2ZPE B;  3HFO A;  1P92 A;  1VQP A;  1WJR A;  2LT4 A;  2JUF A;  3MP6 A;  2RJE A;  3HP9 A;  4OB1 B;  3URG A;  4C5I A;  3CC4 T;  1Q82 U;  3OYE A;  1N8R C;  2ZZD A;  3CCE T;  1LOJ A;  1WJQ A;  2JVV A;  2RH2 A;  4PNO A;  1K8A U;  1Y96 B;  3OMG A;  4B9W A;  3CCR A;  2AHJ B;  3C95 A;  1M90 C;  3JCM W;  3R6O A;  1UGS B;  2QI2 A;  4ME7 A;  5FU6 C;  2QEX T;  3JCM P;  2E1H A;  3PGG A;  3L2R A;  2A3L A;  1BIA A;  1QW1 A;  3OSS C;  4FT4 A;  3OYK A;  1U8R A;  1XQH A;  5HY6 A;  4M75 C;  4QW2 A;  1X75 C;  3KBG A;  3QJY A;  2EQU A;  3RES A;  4V2S A;  4BI4 A;  1G5V A;  3QZ9 B;  1BI2 A;  5LJ3 h;  1YCY A;  4XQ3 A;  3GOX A;  5IN1 A;  5GMK j;  3QSU A;  1OZ3 A;  1W2B S;  2E6Z A;  3ZBD A;  4M75 A;  4C8Q D;  4BI3 A;  4ELY C;  5CAI A;  4BE1 A;  1VQO A;  2E64 A;  3L2V A;  2XDB A;  4II1 A;  2DIG A;  2XHC A;  3O8V A;  4E7K A;  3G7Z A;  3WVE B;  3OB9 A;  1IRE B;  4BB7 A;  5KCO A;  3M55 A;  4E7L A;  5C6S A;  3S3N A;  2RI5 A;  5CQX A;  4LDV A;  4ZGE B;  2EWN A;  3LGL A;  4LDW A;  4LD6 A;  4ZN3 A;  2E10 A;  1Q86 C;  3VJP A;  4Y28 E;  1XOV A;  4X34 A;  2R5A A;  5GAO l;  3GP8 A;  4FL6 A;  4J8O A;  3OYL A;  3JB9 D;  2RHU A;  1M1K C;  4KUL A;  4PKC C;  4DA4 A;  3LWH A;  4F7U B;  3OYM A;  2MF2 A;  3PNW C;  3CCS A;  2WSF E;  5FU7 C;  2JN0 A;  4KBM B;  2Y4Y A;  2DTH A;  3TEE A;  2ZPG B;  2CKK A;  4KUI A;  1VQM T;  5FLX E;  3OYY A;  2G3R A;  2L3R A;  2E6N A;  3BDU A;  4JJN K;  1ZHI A;  4A4G A;  1G3W A;  2DPP B;  3CCV A;  4HCB A;  3M57 A;  2VC8 A;  4P5N A;  4C8Q F;  3ZFJ A;  1Q81 C;  2PQW A;  1PSE A;  3QDR B;  3HPW A;  4J6W A;  1AHJ B;  3TCJ A;  1SSF A;  4QQG A;  1RL2 A;  4NL3 A;  3QG1 A;  4LDY A;  3S3M A;  5LJ3 g;  1VQ6 T;  3HL8 A;  1BI1 A;  3G71 A;  3VYH B;  3OS2 A;  1JBM A;  1WQ7 A;  4MZP A;  2DTI A;  3NTI A;  1I8F A;  3JB9 F;  5HKC A;  1X01 A;  3QYH B;  1VQN A;  4N0A C;  2VYT A;  3CCJ T;  4O6J A;  4OGC A;  2LQ8 A;  3G4S A;  4XU1 A;  1JJ2 A;  1FX7 A;  2JTM A;  2K5F A;  3J7A F;  5GAO n;  3CCM A;  3OBY A;  4A4F A;  2F69 A;  4M7A G;  3JRZ A;  2L5Q A;  3QHS A;  3DB4 A;  3CME A;  5FU6 B;  1S72 A;  1N8R U;  4C0Z A;  3OMC A;  4C5E A;  4EDU A;  5IT9 E;  5CKD A;  2CZ7 B;  4M75 B;  3PIP A;  3OYJ A;  1M90 U;  3QUI A;  4M77 C;  4QVZ A;  2DXT A;  1M4Z A;  2KY9 A;  4IUQ A;  3DB3 A;  5GAN f;  3OYN A;  4KT0 E;  4M7A E;  4JRP A;  1NJI U;  5GAO q;  4HKE A;  2OAU A;  1KD1 C;  3NTH A;  2DZ9 A;  5CKB A;  3N5B B;  4M77 A;  3I56 A;  4ZTJ A;  3A8O B;  4TVR A;  3JB9 J;  3RUX A;  2CZ1 B;  1VQ4 T;  3CCL A;  4PL6 A;  5FRO A;  2HBP A;  3A5Z B;  4IKF A;  3HSB A;  1M8V A;  3FJP A;  3C4S A;  2KVQ G;  3UT1 A;  4PJO C;  3TU4 K;  5GAM f;  1K9M C;  5GAN 4;  1UGQ B;  1BYM A;  4C92 D;  5GAN e;  5GAN 6;  2MWP A;  3I55 T;  4OB0 B;  3V7R A;  4C8Q B;  4M7D G;  3E9G A;  1YIJ A;  1KQ2 A;  5M9O A;  2CYZ B;  1GXI E;  2K57 A;  3MEU A;  3MEW A;  4DOW A;  4PJO A;  3PMI A;  4RG2 A;  5J39 A;  3HRS A;  5FU7 B;  4JLI A;  5D6Y A;  4M7D E;  2PVD B;  2R58 A;  3SB2 A;  3UWN A;  4C92 C;  3JCM J;  1YI2 A;  5HK3 A;  4HCZ A;  3OYA A;  3G6E A;  5GAM e;  5CIU A;  3FRN A;  1YHQ A;  4M78 C;  5AYF A;  4L59 A;  1ZBX A;  1I4K 1;  4FU6 A;  4C92 A;  3CMA A;  4E7H A;  5CK9 A;  2CZ6 B;  4X9D A;  1VQL A;  1EIF A;  1O75 A;  4XTU A;  4F7U G;  2M16 A;  3M4G A;  2QQR A;  4M78 A;  1W2B A;  1Q81 U;  2X4J A;  4N4G A;  5GAN h;  2LC4 A;  2EJG A;  4A4K A;  4BE2 A;  2Y90 A;  2ZPI B;  1VQ9 T;  2F5K A;  2IG0 A;  1MGQ A;  4QVD A;  1YBY A;  1VQ4 A;  4F7U E;  2LVM A;  3TRE A;  4JRK A;  4M75 D;  2PUO B;  4EMG A;  3OYC A;  3MHX A;  2O4X A;  3J80 E;  3FLG A;  3X26 B;  2MAM A;  3LYI A;  1KC8 C;  4FSX A;  2NLU A;  2EKO A;  2MMP A;  3MO8 A;  2XDD A;  3P8B B;  3HHT B;  2M0O A;  2VV5 A;  2BKD N;  5I2S A;  2VUB A;  3VUB A;  4OMF B;  5CKE A;  5GAN 7;  3BY7 A;  3FB9 A;  4E47 A;  2XID A;  3S3O A;  1YJN T;  4M77 B;  3CPF A;  2V8K A;  3CC2 A;  2QTX A;  2EAY A;  1WQW A;  3MEV A;  5LJ5 f;  5GAN 3;  5GAN d;  4C5H A;  1D3B A;  3RKY A;  5GAO r;  3CCU A;  3JCM f;  3L1A A;  1VQK A;  1N9R A;  4WF2 A;  3ASK A;  3CD6 A;  3VV0 A;  4E7J A;  3X20 B;  5CKH A;  3LW5 E;  2VGM A;  2R5M A;  2EJF A;  4XAX B;  2DO3 A;  2BIV A;  1N6A A;  3L2Z A;  4ZN1 A;  2V8I A;  4R55 A;  4BAC A;  3CBP A;  3Q1J A;  2QA4 A;  1YIT T;  1KD1 U;  2RK1 A;  4PJO B;  2GCX A;  2XIC A;  5GAN 8;  4M75 F;  3KXT A;  2HQE A;  1VQ8 A;  4M78 B;  4OGE A;  3V7C A;  1HK9 A;  5LJ5 e;  5GAM d;  1M1G A;  4MDW A;  4C0D C;  1VQ7 T;  3JCM e;  3CCQ T;  4MML A;  1QVF S;  5A0D A;  1I81 A;  2RHI A;  1K9M U;  2VXE A;  5GAN j;  5GMK m;  1X6O A;  1V29 B;  2CZ0 B;  2OTL T;  5FRN A;  1JB0 E;  4C92 B;  2P0K A;  4L5G A;  2HD0 A;  3CEY A;  1YJ9 A;  3OW2 S;  1VQP T;  4QVC A;  2VGN A;  2XDP A;  2XI9 A;  2ZPH B;  4C8Q G;  4PLL A;  3ME9 A;  5DM7 R;  4Y91 A;  4NS5 A;  2DTO A;  3RMQ A;  2EQJ A;  5GAM j;  5A2Q E;  1K73 C;  1VUB A;  2RK2 A;  3P8H A;  1N9S A;  4OB3 B;  3OS1 A;  3CCR T;  2JOY A;  2CGH A;  4O5V A;  1KQ1 A;  2C06 A;  5CQY A;  4C8Q E;  2QQA A;  1OI1 A;  2YRV A;  2O4X B;  3LGF A;  2OTJ T;  1UGR B;  4BD3 A;  3A8L B;  4XTX A;  3MP1 A;  1NPR A;  2H3J A;  2P4T A;  5CR2 A;  3JB9 G;  3JSC A;  3M56 A;  2DD5 A;  5I2M A;  1RI0 A;  4IUP A;  3RMS A;  4J5Y A;  2PUK B;  4M77 D;  3CPW S;  3SFM A;  4BDY A;  4BE0 A;  3RER A;  3VYG A;  4ATO A;  3E19 A;  4OB2 B;  1WNL A;  4FT2 A;  4C5G A;  3FC3 A;  3OS0 A;  3OSV A;  2D0Q B;  2F5T X;  4JUV A;  4N0A A;  1VQO T;  3BDL A;  2DXU A;  2R57 A;  1UGP B;  2ZGW A;  3RKX A;  1BI3 A;  4M7A C;  2QQB A;  3M5A A;  2RHZ A;  4PJO D;  3E9F A;  5HK0 A;  2HQX A;  2PU9 B;  2CS7 A;  3CXC S;  3SWN C;  2DD4 A;  5LJ5 d;  2EQK A;  4M7A A;  2KDS A;  3OS5 A;  3JCM d;  1QVP A;  4FM4 B;  1YJW A;  1VQ5 A;  4MMK A;  4N4I A;  3M59 A;  3X24 B;  3C12 A;  3CCS T;  2K5I A;  3SWN A;  3M9Q A;  3SDZ A;  3WVD B;  2RHY A;  3CC7 A;  5J26 A;  3P8D A;  4L6V 5;  1QVG S;  4M77 G;  3L2W A;  3OYB A;  4M77 F;  3CBO A;  4CRI A;  3JAM E;  3CCV T;  1M1F A;  4EMH A;  3V8L A;  2RI2 A;  4N4H A;  1KQS S;  3CC4 A;  2RD1 A;  3CCE A;  3VKI A;  4DOV A;  4M78 D;  2X4X A;  3OBW A;  3BFM A;  2LX9 A;  4M7D C;  1Q86 U;  2ZPF B;  2K3X A;  2FHD A;  5CKF A;  5LJ5 j;  3QXE B;  3JB9 H;  1HXD A;  4XU0 A;  2QEX A;  2XG8 D;  4VUB A;  1QP3 A;  3H6Z A;  4PJO F;  3JCM V;  3ZEH A;  3M53 A;  4M7D A;  2X35 A;  3G71 T;  1H3Z A;  2VXF A;  2O01 E;  4J7F A;  4D6W A;  2Y4X A;  1WPY A;  2JNG A;  1VQN T;  3FDR A;  3GF5 A;  3UDC A;  3G4S T;  2KSS A;  1KG1 A;  2RB6 A;  4QQD A;  3CCM T;  5GAN 2;  5D6W A;  3PTA A;  2DK3 A;  2RJF A;  3A8M B;  2LRQ A;  2LTO A;  4UC4 A;  4C92 G;  3S6W A;  5GMK i;  3CME T;  4C92 F;  1S72 T;  1K73 U;  3VU3 C;  3MET A;  4XTY A;  5LJ3 f;  3ER0 A;  4NL2 A;  3EFR A;  5GAN 5;  4RCC A;  2K3Y A;  3E1S A;  4M78 F;  2MI6 A;  4XK8 E;  4F7U A;  4LD9 K;  1LNX A;  2XU8 A;  1Y07 A;  2PVO B;  5GAM h;  4C0F A;  3OYD A;  1QVF A;  3OYF A;  1M5Q 1;  3QJ6 A;  4A4E A;  5KH6 A;  2K2V A;  5IAY A;  3OYH A;  2XK0 A;  3QII A;  4MZM A;  4XTW A;  3I56 T;  2KMT A;  5LJ3 e;  3CCL T;  3FIF A;  2E5Q A;  1FWZ A;  1VQM A;  2P0Q A;  3NFC A;  4Q5W A;  2XKO C;  2EIF A;  3MP8 A;  2V8J A;  1H64 1;  3M54 A;  1N27 A;  4X9C A;  5EG2 A;  5LL6 S;  4EPC A;  4R56 A;  4JS4 A;  3SWN B;  3OW2 A;  1YIJ T;  4BUG A;  1Y7X A;  4PLI A;  4BY6 C;  4EMK C;  3JCM X;  2XD0 A;  4OVA A;  1O9S A;  2WAC A;  2YLB A;  3DLM A;  4ELZ C;  1DJ7 B;  1VQ6 A;  1WGS A;  3SD4 A;  3INZ A;  2RM4 A;  5D6X A;  4M75 G;  4EMK A;  2K4Y A;  2RJD A;  3PT9 A;  1W4S A;  5I21 A;  3G6E T;  1YI2 T;  3LX7 A;  4QQ6 A;  1XTD A;  2QQ9 A;  2FL7 A;  3JCM c;  1NJI C;  3T9N A;  2EQM A;  4BDZ A;  5GAN g;  1YHQ T;  2LQK A;  2IVW A;  2QQS A;  2I2L A;  3CCJ A;  5A0L A;  4XTV A;  1U1T A;  3M58 A;  2GF7 A;  2KK4 A;  4IUV A;  3C94 A;  4M75 E;  3CMA T;  4M7D B;  3LLR A;  1VQL T;  4A53 A;  2RO0 A;  3PMT A;  4JDS A;  4A4H A;  3CPW A;  2EYQ A;  3HRU A;  1Y71 A;  1XNI A;  4GY5 A;  2LCC A;  1VIE A;  3DKM A;  4HT9 A;  5CVI A;  2RA2 A;  1G3T A;  2M9U A;  4ZGJ B;  5GAM g;  2ZCF B;  3OYI A;  2E65 A;  1G3S A;  4C0G A;  4J6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...