5LJ3e

Structure of the core of the yeast spliceosome immediately after branching
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
83
structure length
75
Chain Sequence
b'MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSKGTPLGKILLKGDNITLITS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 9
structure length 75
sequence length 83
chains with identical sequence p
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj3e00
2K57A 4JRKA 3L2ZA 5LJ3d 5GAN2 5GAOq 3JCMW 3QSUA 3EFSA 4MMLA 5GMKj 3RERA 4M7DG 3JCMc 2EJFA 4PJOG 2EAYA 3AHUA 4M7DD 3QO3A 1B34A 4M77F 1D3BB 5DY9A 1KQ1A 4HT9A 1M5Q1 5LJ5g 3JB9F 4J6XA 4DQ2A 4EMKB 1KQ2A 3JCMg 3JCMQ 4M77G 1JRIA 5LJ5f 3GIBA 4EMKA 2YLBA 4EMHA 3PGGA 5LJ3h 5GMKh 5LJ5d 4XTXA 4XTUA 4M7DA 4X9DA 5GAMg 3JCMd 3RKWA 3V8JA 4M7DC 3EFRA 4PJOA 2RA2A 4J6YA 4XU2A 2Y90A 5GAMf 4C8QB 4HT8A 4PJOC 4C8QD 4F7UG 5GAN4 4M7AF 4J6WA 5GAMd 4C8QA 1I8FA 3V7CA 5GMKi 3JCMJ 1MGQA 4M75A 4C92F 3BW1A 2DTIA 1LJOA 1B34B 4M75C 4C92E 5LJ3j 5GAOl 3VU3C 3RUXA 1I4K1 2QTXA 4RCBA 4M7DB 4PNOA 4X9CA 1Y96B 4N0AA 2ZGWA 3FB9A 4XTVA 3FJPA 4N0AC 1X01A 4EMGA 2DEQA 1Y96A 4F7UA 5LJ5e 4M78A 4XU3A 2DVEA 4M78C 2CGHA 3JCMf 3JCMe 3JB9G 3QHSA 5GAOp 2DXTA 2E1HA 4RCCA 1HK9A 2DZ9A 1U1TA 3RIRA 4PJOB 4PJOD 5GMKl 3SWNA 5LJ5j 4A54A 3SWNC 1BIBA 5GAMe 1LOJA 2DZCA 5GANg 2VC8A 4HA8A 5GAN8 3BDUA 5GAOm 4M77B 2VXFA 2JN0A 2E10A 4M75B 1BIAA 5GANe 5GANf 4M75D 4NL3A 2VXEA 4JUVA 1H641 5GAMj 4A53A 4M77A 3RESA 5GAOr 2RM4A 4M7AG 4M77C 4C8QE 5GANd 3V8LA 4XTWA 5LJ5h 4M75E 3BY7A 4XU0A 3JCMh 4C92G 1TH7A 4QVDA 2DTHA 3L1AA 1HXDA 4F7UB 5CAIA 3QUIA 4M78B 5GMKm 4M78D 5GAN5 3V7RA 5GAMh 2YHTA 4XTZA 4XQ3A 4XTYA 3SWNB 2EJGA 4C8QC 3JCMV 2DJZA 3HFOA 4M78E 4OP0A 2HNIA 5GANh 5GAN7 4M7AA 5I21A 4M7AC 1U1SA 1WPYA 1LNXA 4M7DF 2EWNA 3SB2A 2FB7A 4C92A 4M7DE 2E41A 4JRIA 4C92C 3HSBA 4PJOE 1WNLA 3JCMP 4M77D 1M8VA 2DTOA 1N9RA 3JB9D 3JCMb 3JB9J 2DKGA 4WF2A 4JLIA 4C8QF 3JCMX 2E64A 3BFMA 4QVCA 3V7SA 4M75F 4NOYA 4M77E 5GANj 1I5LA 3INZA 4C8QG 1D3BA 1YCYA 2DXUA 4M75G 1WQ7A 4Y91A 2YLCA 4XU1A 3M4GA 3HFNA 3RKXA 4EMKC 1I81A 3JB9H 2I2LA 5GAOn 4V2SA 2RB6A 1N9SA 4MMKA 4M7AB 3V8KA 4F7UF 5GAN6 4M7AD 4M78F 4F7UE 4NL2A 1JBMA 5LJ3g 4J5YA 2E65A 4C92B 3FIFA 4C92D 1WQWA 5GMKe 4M78G 5LJ3f 5LJ3e 2FYKA 5GAN3 3JB9I 4M7AE 2RD1A 3RKYA 4PJOF 2EJ9A
chains in the Genus database with same CATH superfamily
5FLXE 3PTAA 2YSQA 2Y4YA 3QO3A 1D3BB 2QK0A 1M5Q1 3NTHA 4J7IA 3CCQT 1VQ9A 4PFPA 3R6NA 1JQQA 5GMKh 3OA6A 4ESRA 3PNWC 3E1SA 4F7UG 5KYYB 1WHLA 3I56Q 1X6OA 5I2MA 3CXCA 4AG1C 3LWHA 3CCVA 2QYZA 1GCQC 1WIEA 2F2XA 2KVQG 4QQGA 1JO8A 3VYHB 4UC4A 3L42A 4Z88A 1G83A 1RABB 5D6YA 4YTLA 2HAXA 1VQ6Q 4OB2B 3RIRA 2KBTA 1ZUKA 2KAFA 1M3CA 3A8GB 4F16A 2DL7A 5GANf 4C0DC 2IIMA 3CCSQ 1QCFA 5HK0A 5CAIA 4OMPA 4LUEA 2KSSA 4M78B 2DM1A 3CC4A 1BU1A 4LD6A 3ZFJA 1YJWA 3SWNB 1Q95G 2L5QA 2O9SA 5KYUA 2MPXC 3G6EQ 1UFFA 4DEXA 1FYNA 3OMGA 4MDXA 1WNLA 2RQRA 4KT0E 1N27A 3INZA 3MEVA 1VQ7A 2D0NA 3M4GA 4M7AB 2RHZA 2EYQA 4C92D 1T3SA 3EHQA 2IVWA 5GAN3 2HD0A 4AFQC 4HXJA 5GAN2 2FZCB 3CC2A 3HTRA 1NEGA 4BY6B 2EYZA 4ZGEB 4J6XA 3JCMg 1PHTA 1IGQA 2K79A 1RAAB 3SEMA 2LCLA 2XICA 4DBQA 1IXDA 1HSQA 2BZYA 3G4ST 1G5VA 1PSFA 2AZVA 3PVQA 4HVVA 2ZGWA 3GNFB 3OSSC 2A3LA 1ZA2B 2KT8A 1M1GA 4KRTA 3NTKA 2DVEA 4M78C 4M7DD 5FRNA 4A54A 2QQSA 1LVKA 3SWNC 2RJDA 1LOJA 3DB3A 2LP5A 1BIAA 2COZA 4NL3A 4FYXB 1RACB 4OGEA 1YP5A 3V8LA 2EVRA 3EHRA 1TOVA 2RMOA 5KE2A 3QUIA 1M90R 4O6JA 1UGVA 2AKKA 2LNHB 2KROA 2HQXA 2LJ0A 1IB8A 2A7YA 2KY9A 1IHVA 1NYGA 5I21A 4M7AC 1VQLQ 3OS2A 3CXCP 5AT1B 2DD5A 1NE8A 3JCMb 3C94A 2XMFA 1YJ9Q 3QJYA 1M1KR 2LVMA 1NJIC 1VQ4Q 2V26A 1WQ7A 5GAOn 3VUZA 3NPFA 2BUDA 2OAWA 1YHQQ 3MJXA 2O88A 1AVZC 1H8KA 3E19A 2DLPA 2O4XA 3RBBB 2FYKA 4JRPA 2K5LA 4OVAA 4BI4A 4FYVB 3L2ZA 3UF4A 2LZ6B 2LNVA 4PLLA 2GNCA 4A4KA 2E12A 5KYNA 3JB9F 4EMKB 1TTHB 2CT3A 4KBMB 3CCEA 3X20B 2P84A 3UT1A 5CKDA 2RA2A 1YJNQ 1M9SA 3KFVA 3CC7T 4C5HA 1WXUA 1M2OA 2O9VA 1MNEA 4OMFB 1K8AU 3CD6T 1AEYA 2DL4A 2XD0A 1BI1A 3FJPA 4FIBA 1W4SA 3OYBA 5A0GA 1HYOA 2VYTA 5GAOp 3VUBA 4JJNK 4PJOD 4KGVB 2AIRB 4JZ4A 1ZA1B 4KULA 2A28A 3OYFA 2DZCA 4E47A 5GANg 3I55T 2EKHA 5GANe 2QA4A 1WXTA 2O01E 2D8HA 1RAGB 4F14A 4M7AG 5CVIA 1ZLMA 5LJ5h 2M51A 1Q86U 3D7SB 3L1AA 3M56A 2CS7A 1UHCA 2JT4A 1NEBA 4JDSA 4AFZC 5A2QE 1QW1A 1OU8A 3HHTB 4RKUE 3SFMA 1Q81U 2FB7A 2L3SA 1KSWA 6AT1B 2QEXT 1YITA 1KG1A 1NBEB 1LCKA 2OTJT 2QXFA 2M16A 4MZTA 2AHJB 4EMKC 3LX7A 1Y7XA 1JBMA 4J9GA 3CCQA 3FIFA 2DF6A 1YNZA 3SD4A 2XHCA 2FVUA 3EFOB 2RD1A 3VS6A 4GLMA 2KI7A 1VUBA 2LC4A 3EH2A 2E4HA 1T0HA 3C4SA 1VQNQ 2X4JA 4KUIA 3SDZA 3VS7A 3M59A 2EQUA 5LJ5f 4ZTFA 2VVKA 3EG2A 3HP9A 4A4GA 3GIBA 4EMKA 2XU8A 1Z9QA 1PNJA 2G6FX 4LNPA 1PG5B 1YI2Q 2J6KA 2X4YA 2SEMA 3CCRT 2XK0A 1GFCA 3M9QA 3JCMJ 1RAEB 3BW1A 1I0CA 3M58A 1KD1R 1GRIA 4LDWA 4AMCA 2ATCB 2D9TA 4EIKA 1KJWA 1P92A 2EGEA 3WXMB 4VUBA 3H8ZA 8AT1B 2VGMA 3OS5A 3J81E 2NUPA 2CSIA 4C5EA 3C95A 3C0CA 4L5GA 5GAN8 4RTXA 4M75B 3OYAA 2YUOA 3RESA 4M77C 2D0QB 1RLPC 4DOVA 4R56A 1N8RR 2FRYA 2M0OA 2CP3A 1M3BA 4F17A 1AWJA 2J6FA 4RUGA 2ROTA 1OULA 1VQ5Q 1HD3A 1PKSA 2R5AA 3M57A 2PUOB 1S72Q 4NS5A 1LNXA 1VA7A 1B3QA 1K0SA 2DAQA 2X35A 3JCMP 1FWZA 1AT1B 2CYZB 2DTOA 1PRLC 4C8QF 3JCMX 2JJ9A 3KUFA 1W6XA 1VQMQ 2YDLA 1I5LA 2DRMA 1Y71A 2KE9A 4RTYA 2W0ZA 3DLLA 4KH1B 1E6HA 4IUPA 4MMKA 1M4ZA 1RI0A 3A1PA 1AOJA 1VQOT 2EQMA 3M5AA 5LJ3d 3EFSA 2CKKA 3EFOA 3TSZA 1GXIE 1VYTA 3ZL7C 5KCHA 1B34A 2MK5A 3G4SA 1KQ1A 4HT9A 1SHFA 5CKBA 1W2BS 2KDSA 4CI0C 2NUTB 3A98A 2ECZA 2RQVA 2VKNA 3RMSA 4L6V5 2A0FB 2X3XD 4J7FA 4E7JA 1WXBA 1TUCA 5FRMA 3G71Q 4KGZB 5GAMd 3V7CA 2D1XA 3UA6A 4C92F 4C92E 4M75C 1AZEA 4PNOA 1Y07A 2JOYA 1X69A 4N0AC 1RAFB 5IXBA 5KCOA 2BKDN 2CP0A 2FPDA 2WACA 2F69A 2EYXA 3JCMf 2KRNA 1K76A 2GTOA 5GAMe 2GGRA 2VC8A 2PU9B 2M0YA 2OAUA 2ZPHB 3HRSA 2A36A 2E5QA 4ATOA 2FO0A 3CQTA 3OW2S 1NPRA 1X75C 2BIVA 3EGXA 4IKFA 4M78E 3X25B 1OI1A 5CCAA 3MEUA 2OTLT 3M0PA 4M7DF 2EWNA 1MHNA 3SB2A 1FMKA 4M7DE 2E41A 2YRVA 1IRXA 3VS5A 1Q86C 1HJDA 1VQLT 3OB9A 4C0FA 4RTTA 4OF1A 4R55A 3KXTA 3OSVA 1F1BB 4HVWA 1UDLA 5A0DA 1Q81C 2EGCA 4X34A 3JSCA 3NFCA 5KYUB 1VQ8A 4IUVA 1VQ9Q 1NJIU 3UWNA 5IHNA 3MEAA 4M7AE 2F2WA 5KYWA 4BE1A 3RKYA 1QVFS 3S3MA 2K57A 5GAOq 1K73R 2EJFA 2KYBA 1VOMA 1Y0MA 3CCVQ 5LJ5g 1UJ0A 2R5MA 3A8HB 3META 2AZSA 2EYWA 3CD6A 1YCSB 4X9DA 4Y92A 3OS1A 4Y28E 4C8QB 3P8HA 1K1ZA 2JUFA 1GCPA 2JMAA 2JTEA 2DO3A 4LDUA 4PFZA 5GAN4 3CMAT 2CUBA 1XOVA 4E6RA 1WJSA 3VRYA 4RCBA 1MV0B 1KC8R 3I55A 3DLMA 2O31A 3QIIA 1RUWA 2YRCA 2DILA 1Z9ZA 4LUDA 4R0KA 2MF2A 2COWA 1JXMA 3CC4Q 4PLIA 2M02A 2EFIA 1BBZA 1YJWQ 3BDUA 2GCXA 1WJQA 3EAEA 1SHGA 5DLQE 2O2OA 1M90C 4CRIA 2QEXA 5GAN5 4DA4A 2OTJA 1FXXA 3HFOA 4LE9A 4LDYA 3L2WA 1X27A 3OBWA 2VV5A 5AYFA 1VYVA 1U1SA 1G3YA 3I5RA 1CKBA 2CZ6B 1O75A 4PJOE 2X4WA 1KIKA 1E7OA 1D1BA 1XNIA 3V7SA 1BKBA 3H6ZA 3CC2Q 4QT7A 2DPPB 3JB9H 1VQPT 1WFWA 3X26B 3MP8A 2EIFA 3CCLT 2QGFB 2G3RA 5CKFA 3JV3A 1K8AR 2L8DA 3JB9I 4C8QC 2OX7A 3OYGA 1Q7YU 2EAYA 5CQXA 3T9NA 1X43A 3UATA 2V8JA 2ZAEA 5IHIA 3CCRA 1SEMA 4F04B 2RPNA 4EMHA 4XTUA 3JCMd 5FWBA 1WYXA 2O4XB 4E7HA 4GBQA 1XJWB 2PZ1A 1V29B 4C8QA 1I8FA 1VQKT 5KH6A 2XG8D 3RMQA 1LJOA 1RLQC 5GAOl 1VIEA 4X1VA 2RK2A 1W2BA 1UHFA 4JS5A 2L2PA 1RAHB 1BCOA 1U8RA 3JCMe 2P0PA 2ED0A 1T3LA 3LH0A 1NLPC 4MDWA 4JJCA 5GMKl 2RJEA 2SRCA 3OYHA 4BB7A 1UJYA 3MP1A 2YUNA 2E3HA 1TUGB 2LT1A 4A53A 2K4YA 1SSFA 4BACA 2MIOA 2E5KA 1QKXA 2NUZA 1X6BA 1Q82U 2EW3A 3QXEB 4M78D 3L2VA 2IPOB 3BDLA 4M4ZA 4XTZA 1OU9A 9ATCB 2CH4W 4J9IA 4C92A 1M27C 2C0TA 2ZCFB 2E70A 2RJCA 2DX1A 2MI6A 1VQOA 3OW2A 4M77E 4RG2A 3OYDA 4C8QG 1PC0A 1QCNA 1NYFA 1I81A 3CEYA 2JM9A 4V2SA 2A08A 1N9SA 4M7AD 1K9MR 1U5SA 2DJQA 2XDDA 4Z8AA 3CCEQ 1ZUUA 4FW1A 2HEQA 4HCKA 2DEUA 3JCMQ 3VKIA 1N6AA 4BY6C 2KEAA 1BCMA 3EGDA 5LJ3h 1AWXA 2Y4XA 4M7DA 1UGPB 4J6YA 1RADB 1QVFA 1IREB 5CK9A 3ULRB 2MCNA 1D0YA 2J05A 3FDRA 1R77A 1VIFA 1TU0B 4MZPA 5J26A 2WSFE 5LJ3j 2JZ2A 4A63B 4IUTA 3JAME 2QA4Q 1K9AA 4FM4B 3FJ5A 4A4EA 3ZBDA 4RCCA 3FEOA 1FMVA 4J9FA 1KHIA 3HRUA 5GAOm 1K4US 2E10A 2VASA 5FWCA 5GAMj 3CMET 5GANd 3TREA 2OTLA 4Z89A 1JU5C 4M75E 1TH7A 1YITQ 4BDYA 4OMQA 5GMKm 3P8DA 1VQLA 5DLOA 2NUPB 3H9NA 3VJPA 2H3EB 4OB0B 5ECAA 3CCMT 2GBQA 3PFSA 3EG1A 5CIUA 1ZBJA 1WHJA 4A4HA 2HKQB 3CCQQ 1C0MA 2DKGA 4FL6A 1W2BP 2DXBA 3LYIA 3VS4A 4JLGA 3CCUA 2JS2A 4GLKA 2GTJA 2QQ9A 4F7UF 2DBKA 1SRMA 4F7UE 2DNUA 3R6OA 5GMKe 1WHKA 1VQ9T 1V76A 3CBPA 2BE9B 3PE0A 4JRKA 1WDXA 2LT4A 3EG9A 2E6NA 2MMPA 3VYGA 1D09B 2X4XA 4OMLA 2GFUA 3RNJA 5GJWB 1ZUYA 2L3QA 5EG2A 3CMAA 4RMOA 5CKEA 3OYYA 2CP7A 3CCJT 2EKOA 4Q5WA 4PJOA 1MV3A 1U06A 1Q7YC 2F1LA 5L8RE 4FCYA 2PVGB 4RTZA 2HBWA 4DBRA 5GMKi 4E7IA 3OW2P 1B34B 1YIJT 2QQBA 3JRZA 4J83A 4PJMA 1Y96B 4XTVA 2AKLA 2KYMA 2LX9A 2DEQA 2CT4A 1R0BG 1QCOA 1UGQB 4FYYB 4EDUA 4JJDA 2DL8A 3OYMA 4ZNXA 2GQIA 2JN0A 4CC4B 1MMDA 2DYIA 4BE2A 3I56T 3A8OB 3LLRA 4PJLA 1T0JA 1W70A 2A37A 4ZN1A 1NJIR 4KUDK 2QDYB 1RAIB 4XTYA 1M90U 1PSEA 1QVFP 3S6WA 3CBOA 2DK3A 2HDAA 2YUQA 1VQ6T 1J3TA 4JRIA 3OYNA 1VQPA 1Q82C 1AZGB 4M77D 4N4IA 3CCLA 5IN1A 2CP5A 4J8OA 1ARKA 2ZPEB 3M53A 3BFMA 2RNAA 3ME9A 3I35A 2RK1A 2RHIA 2CSQA 3TCJA 5C0MA 2DXUA 3CCST 1JEGA 3VS1A 2RJFA 3EGXB 3RKXA 1M1KU 1D0XA 2DIQA 3G4SQ 2LCCA 1EFNA 2L3RA 3QYGB 1K73C 3OBYA 3HSBA 3QSUA 3G6ET 2RF0A 3VS0A 1O9SA 1TWBA 2YWWA 1OV3A 2V1QA 5LL6S 1VQKA 5GJVB 3TVTA 2ED1A 2LQ8A 1NLOC 4FT4A 5HCKA 3OYEA 1SF9A 5M9OA 5KYWB 3REBB 1CSKA 3QDRB 2K5FA 2LJ1A 5EC7A 1KC8C 3E2UA 2QTXA 1QWFA 2YXYA 4RTUA 2CZ7B 1Y96A 2JS0A 4QW2A 1QLYA 2FZGB 1WLPB 2CDTA 2DXTA 3ASKA 1AD5A 1FMWA 1Y57A 2FPFA 1BYMA 4M75D 1U3OA 2KNBB 3UDCA 2GQVA 3J80E 2DMOA 1HXDA 1VYUA 2X9HA 2C06A 2CZ1B 3CPWS 3JCMV 2HNIA 2YT6A 2RHUA 3A8LB 2V1RA 1I5OB 3M54A 1FX7A 1VQ8Q 2KQWA 1IO6A 2K3BA 2RN8A 4KH0B 4JLIA 3M4YA 1CKAA 2R58A 1M2VA 2C0OA 3AT1B 2KT1A 3J7AF 4J9HA 2DE0X 5A0LA 3M0RA 4C5GA 2RB6A 3V8KA 2HBPA 4M78F 2OI3A 1R8OB 1UUEA 5KYXA 2KXDA 3CD6Q 2BZXA 4AFUC 2CP6A 2MAMA 1ZSZB 4LD9K 1OPLA 3CCET 3RERA 1ZSGA 3JCMc 4CC7A 4FSSA 2HSEB 4ZTJA 3AHUA 2K7AA 1WJRA 1UGRB 2MYSA 2V8IA 4LDXA 1YJ9T 5LJ5d 3I55Q 1PWTA 1VQ4T 3I5SA 4M7AF 2D6FA 1NPPA 4PK4A 1IGUA 1BI2A 1YHQT 2ROLA 2KGTA 3ER0A 3H0FA 1ZBXA 5FU7B 3O8VA 4X9CA 4XAXB 3CC7A 4LN2A 5DM7R 1KD1U 2R57A 1IHWA 4F7UA 1WHMA 5LJ5e 4XU3A 3M0TA 3CMEA 3JB9G 2E1HA 2JTMA 2QEXQ 2GF7A 4IURA 5IT9E 4C0DB 1BK2A 1BIBA 3OQ5A 1UECA 2FRWA 3FC3A 5J39A 2OTJQ 3ZEHA 1B07A 3GBQA 1YJNT 2ZPGB 3IQLA 2AT1B 2RM4A 4MZMA 1OZ2A 3S3OA 1UG1A 3OY9A 3CCMA 1GBQA 2LRQA 3M55A 1SKUB 4D6WA 3FRNA 4D8DA 2DRKA 2VWFA 2WSCE 3M0QA 4XQ3A 1G3TA 2HCKA 2EJGA 2ZPFB 2DJZA 4BDZA 1TUDA 5GANh 1KHCA 4ELZC 4TVRA 2EPDA 1WI7A 3GLXA 4DBFA 5IAYA 7AT1B 3JB9J 1C6VX 1ZSZC 2P0QA 5GANj 4PFOA 3URGA 2KXCA 3MCAB 1TS9A 3HFNA 1K9MC 3QKJA 3CCRQ 2YRDA 4NL2A 1WHGA 1X6GA 4C92B 2E65A 1VQ7Q 3QZ5B 4FT2A 3A5ZB 3HL8A 4PJOF 1NM7A 1WGSA 3CCJA 3EG0A 1H3HA 3RDVA 5GMKj 2L3PA 1ZSZA 2FEIA 4O5VA 4HCCA 1M1KC 1GL5A 4PJNA 4LDVA 5FU7C 3QWXX 5I22A 4FW2A 3WVDB 1JRIA 3E9GA 2X51A 3Q1JA 1YIJA 1MMGA 2NYSA 4XTXA 5FW9A 2K9GA 4HCZA 4C8QD 1UTIA 2DXCA 1JXOA 3NGPA 4BI8B 1GCQA 4J9DA 2LJ3A 3GF5A 3VU3C 3S3NA 1GBRA 3EGDB 1VQNT 4M7DB 3QWYA 3I56A 2FPEA 2ESWA 4AFSC 2H3JA 3REAB 1QP2A 3MP6A 1OYXA 2KK4A 1KQSS 1D1AA 2VXFA 1YFNA 2BE7D 4DOWA 1M30A 2VXEA 4JUVA 1YI2T 2K3YA 1Q86R 5HY6A 1YN8A 5GAOr 2LMJA 1AHJB 5FROA 4PKCC 1VQ6A 4HVUA 2RI2A 1JJ2S 4DEYA 1VQOQ 4IUUA 1UE9A 4JZ3A 1Q81R 2JMCA 3PMIA 3GNGA 2OJ2A 1OZ3A 4RTWA 3CCSA 2ZPIB 1ACMB 1OQKA 1MMNA 1QWEA 4C92C 1QQJA 5CQYA 4ANJA 1TXQA 2L89A 2MOXA 2ZZDA 2XDBA 1SSHA 4WTOB 2F5TX 4Z02A 2XI9A 1D3BA 3CPWA 4Y91A 4C5IA 3G6EA 1ABOA 2J06A 2NLUA 2EQKA 3MEWA 4J9BA 4D8KA 2Z0WA 3DKMA 2DETA 1WQWA 2GFAA 1NG2A 4RTVA 2DL3A 1VQ5T 2EJ9A 4C0GA 5KYYA 2HL3A 3NMZC 4ZN3A 3JCMW 1S72T 2LQKA 1MMAA 3PIPA 2PQWA 4M77F 1K73U 1IZ6A 1SRLA 3UA7A 1VQMT 3G7ZA 3U23A 4E7LA 2JVVA 3BE3A 3V8JA 4M7DC 1QVGS 4XU2A 4HT8A 1PD1A 4P5NA 4N4GA 2LTOA 1XQHA 2W10A 3EG9B 2P0KA 2DIGA 4E2FB 2LCSA 1I4K1 3KBGA 4JPBW 3EG3A 3OS0A 4ELYC 2OTLQ 4M78A 1KC8U 3OYCA 3M0SA 1OPKA 4PJOB 2RI3A 2RHXA 3SWNA 3MKDA 4OGCA 3PVLA 3WVEB 1G3SA 1KD1C 4N4HA 2VGNA 1TG0A 1LPLA 2JM8A 3G71T 4XTWA 1QP3A 4C92G 2HSPA 2XDPA 2JXBA 4OMNA 3L2RA 3PT9A 1BI3A 2CP2A 2YHTA 5GAMh 1OEBA 2JTFA 3CCUQ 4OP0A 4M7AA 2FG0A 2KMTA 3VS3A 1X2KA 2L0AA 8ATCB 1M8VA 2HL5C 2FZKB 2KR3A 1ZQ1A 1N8RC 2E64A 2QAZA 1VQ8T 2CUDA 1I1JA 4QVCA 4M75F 4NOYA 5I11A 3NHNA 2EGAA 1YCYA 1AWOA 1NZ9A 3H0HA 1RI9A 2ENMA 3MO8A 3DB4A 3LW5E 2DFUA 5HKCA 3CMAQ 4EPCA 5IHKA 4J5YA 5IXFA 1JB0E 4PL6A 2K3XA 2CH4A 3HPWA 4M78G 5LJ3f 3OYIA 1YJ9A 1D1CA 2IG0A 2DERA 3HKSA 1VQ4A 4M7DG 3MPUB 3QBYA 4C0ZA 2NWMA 2HMAA 1YHQA 3TU4K 2HQHA 2YLBA 3LGFA 1N5ZA 1YWPA 2K6DA 2QI2A 3EFRA 2M9UA 5GAMf 3P8BB 4OB3B 4PJOC 2JNGA 2E3IA 2RH2A 1PD0A 1C1AA 4ME7A 2RHYA 1WX6A 1BB9A 4XK8E 2DTIA 2QASA 3QJ6A 1PRMC 4RG8A 3RUXA 3CPWP 2QGGA 1X01A 2LQWA 4EMGA 4ORZA 1YJNA 1X2QA 1DJ7B 2D8JA 3QHSA 2DVJA 3CCVT 2DZ9A 3QG1A 5LJ5j 2B86A 1ABQA 1TSFA 4M77B 2KRMA 2RI5A 1H641 2F2VA 3MHXA 4HCBA 3LH5A 4PJJA 3GPLA 4OMMA 4AG2C 2E6ZA 1VQPQ 4XU0A 3THKA 3CCLQ 2P4RA 2KRSA 1M3AA 4WCIA 1V1CA 3N5BB 5C6SA 1KQSA 2LQNA 5FU6B 3C12A 3LGLA 3GOXA 1QKWA 3CC4T 4LXCA 4WF2A 5I2SA 1YJWT 3TQ7P 4QQ6A 1JJ2A 2WSEE 4IIMA 4B9WA 1GFDA 4XU1A 5KE3A 3PIOA 5GAN6 1QVPA 1VQKQ 4IUQA 3QPHA 3GP8A 2EYYA 4AT1B 2LDMA 2PTKA 1K9MU 5CO7A 2EQIA 1VQ7T 3EGUA 3CXCS 1M2VB 4JS4A 4PJOG 1G8XA 4HKEA 4FU6A 2C0IA 1EX4A 2ABLA 5HK3A 4DQ2A 3X24B 4IIOA 3TEEA 2J7IA 4FYWB 2HQEA 2RQUA 3PGGA 2DA9A 4E7SA 5KYXB 2HKNA 3CC2T 2QG9B 4KGXB 2K2VA 1A0NB 3A8MB 2COYA 3CPFA 1VQNA 3VS2A 4J6WA 4E7KA 2J6OA 2EQJA 2RO0A 3FB9A 1PKTA 1YI2A 3VV0A 3OYJA 2HZYA 1I07A 1QVGA 2MWOA 5IH2A 1B7TA 1HK9A 2X3WD 4A4FA 2DBMA 1XTDA 2P4TA 3O5ZA 1MUZA 4ZGDB 4BUGA 3VRZA 5FU6C 3HRTA 2AK5A 4M77A 2V8KA 5L23A 2LX7A 4C8QE 2YUPA 1AWWA 3OMCA 3JCMh 4QVDA 1G2BA 4F7UB 3V7RA 4B6MA 1YBYA 1WZOA 5GAN7 1WPYA 4GY5A 4BD3A 1PM3A 2ZPBB 4FSXA 3TSWA 3LWIA 1N9RA 3JB9D 2VB6A 1OX9A 1E6GA 4K11A 1YWOA 4DBHA 3M0UA 1PCXA 1VQ5A 2VUBA 2CREA 2EBPA 1S72A 2XIDA 1BI0A 4CC2A 4OB1B 3NTIA 2XKOC 3OYKA 2DD4A 5LJ3g 5LJ3e 1VQMA 1Q7YR 2K5IA 4JJBA 2PVDB 1OX8A 4MMLA 2DL5A 3QZ9B 5D6XA 4BI3A 5CR2A 5DY9A 1W1FA 4QQDA 1MNDA 1KQ2A 1RL2A 3QDFA 4CC3A 4M77G 2B8AA 1QMCA 2QTVA 3CC7Q 1KQSP 1M1FA 5GAMg 3RKWA 1K8AC 1ZHIA 2Y90A 3CMEQ 3OYLA 2K2MA 4L59A 2BZ8A 2F5KA 1M8MA 1MGQA 4M75A 1G3WA 1UGSB 2JW4A 3CBMA 5J3BA 1JJ2P 2I0NA 1H92A 2PNIA 4N0AA 2BTTA 5D7UA 4J9CA 4J9EA 3CCMQ 2CGHA 3G71A 1U1TA 2M1HA 4JRQA 4HA8A 1KFZA 1Q82R 1EZZB 3F70A 2DYBA 4ZGJB 1UB4A 3E9FA 2CZ0B 3BY7A 2RQTA 4E7ZA 2DTHA 2QQAA 4B9XA 3L2QA 2PUKB 3X28B 3UPUA 3I9QA 2QA4T 1SPKA 1WHHA 3G1JA 2QQRA 3PMTA 1OOTA 2PVOB 3QYHB 3CCUT 2H8HA 1SG5A 2QDLA 1EIFA 1S1NA 1D0ZA 2FHDA 1KK7A 1ZX6A 3SHWA 1WA7A 4OMOA 2FL7A 5CKHA 3EH1A 3H41A 3CCJQ 4II1A 1H3ZA 4M75G 2YLCA 1QVGP 3RR6A 1K0XA 3H0IA 2RQWA 3L2UA 1N8RU 1R0CB 2I2LA 3FLGA 1YITT 2NUTA 4QVZA 2MWPA 5D6WA 1YIJQ 1UEBA 4QKUA 4BE0A
chains in the Genus database with same CATH topology
4C0GA 5FLXE 4JRKA 3PTAA 5LJ3d 4ZN3A 3JCMW 2LT4A 3EFSA 2LQKA 1S72T 2CKKA 3PIPA 2E6NA 2MMPA 2Y4YA 3VYGA 2X4XA 1GXIE 2PQWA 3QO3A 5KCHA 1B34A 2GFUA 4M77F 1D3BB 3G4SA 1K73U 1KQ1A 4HT9A 1M5Q1 3NTHA 4J7IA 5EG2A 3CMAA 3CCQT 1IZ6A 1VQ9A 4RMOA 5CKEA 5CKBA 1W2BS 3OYYA 2KDSA 1VQMT 3G7ZA 4E7LA 5GMKh 3CCJT 2JVVA 4CI0C 2EKOA 3RMSA 4L6V5 3V8JA 3OA6A 4Q5WA 4M7DC 4J7FA 1QVGS 4PJOA 4XU2A 4HT8A 1Q7YC 4E7JA 3PNWC 3E1SA 4F7UG 5FRMA 5L8RE 2PVGB 4N4GA 4P5NA 1X6OA 5GAMd 2LTOA 5I2MA 3CXCA 1XQHA 3V7CA 3LWHA 3CCVA 5GMKi 4C92F 4QQGA 4E7IA 2KVQG 4C92E 1B34B 2P0KA 4M75C 1YIJT 2DIGA 2QQBA 3JRZA 1I4K1 4J83A 4UC4A 3VYHB 4PNOA 3KBGA 1Y96B 3L42A 4XTVA 1Y07A 2JOYA 3OS0A 2LX9A 4N0AC 4ELYC 5KCOA 2BKDN 2DEQA 2WACA 2F69A 5D6YA 4M78A 4YTLA 1KC8U 3OYCA 1UGQB 3JCMf 2HAXA 4OB2B 3RIRA 4PJOB 4EDUA 2RI3A 2RHXA 2KAFA 3SWNA 4OGCA 3A8GB 3OYMA 5GAMe 2VC8A 2PU9B 3WVEB 2JN0A 1G3SA 5GANf 2OAUA 2ZPHB 3HRSA 4C0DC 1KD1C 4N4HA 2VGNA 4BE2A 2E5QA 3G71T 5HK0A 4ATOA 4XTWA 3I56T 1QP3A 3A8OB 4C92G 5CAIA 2XDPA 3LLRA 2KSSA 3OW2S 4M78B 4ZN1A 1NPRA 3L2RA 3CC4A 1X75C 3PT9A 1BI3A 2QDYB 2BIVA 4KUDK 4LD6A 5GAMh 2YHTA 3ZFJA 2JTFA 1YJWA 4XTYA 3SWNB 1M90U 4IKFA 1PSEA 2L5QA 4M78E 4OP0A 3X25B 3S6WA 4M7AA 1OI1A 5CCAA 3MEUA 3CBOA 2OTLT 2DK3A 4M7DF 2EWNA 1MHNA 3SB2A 2KMTA 1VQ6T 4M7DE 2E41A 2YRVA 4JRIA 3OMGA 4MDXA 3OYNA 1WNLA 1VQPA 1Q82C 1Q86C 4M77D 1VQLT 1M8VA 4N4IA 4KT0E 3OB9A 5IN1A 3CCLA 4J8OA 1ZQ1A 2ZPEB 3M53A 4C0FA 2E64A 3BFMA 1N8RC 1VQ8T 4QVCA 3ME9A 4M75F 4NOYA 2RK1A 4OF1A 2RHIA 1N27A 3INZA 4R55A 3MEVA 3OSVA 3KXTA 3TCJA 1YCYA 5C0MA 2DXUA 1NZ9A 1VQ7A 3CCST 2RJFA 3M4GA 5A0DA 3RKXA 1M1KU 1Q81C 2DIQA 2LCCA 3DB4A 3JSCA 3LW5E 3MO8A 3NFCA 4X34A 4M7AB 1VQ8A 5HKCA 2RHZA 4EPCA 4IUVA 2L3RA 1NJIU 4J5YA 3UWNA 3QYGB 1JB0E 2EYQA 4C92D 4PL6A 2K3XA 3HPWA 4M78G 5LJ3f 3OYIA 2IVWA 3MEAA 5GAN3 2HD0A 3OBYA 4BE1A 1YJ9A 1K73C 3HSBA 3RKYA 1QVFS 3S3MA 2K57A 2IG0A 5GAN2 5GAOq 3QSUA 3G6ET 3CC2A 3HKSA 1VQ4A 4M7DG 1O9SA 2EJFA 4BY6B 4ZGEB 5LJ5g 4J6XA 5LL6S 3QBYA 4C0ZA 3JCMg 1VQKA 2R5MA 1YHQA 3A8HB 3META 3TU4K 2LCLA 2YLBA 3LGFA 3CD6A 2XICA 2LQ8A 4X9DA 4FT4A 3OS1A 2QI2A 3OYEA 3EFRA 2M9UA 4Y28E 5GAMf 3P8BB 4OB3B 4C8QB 2JNGA 2RH2A 3P8HA 2JUFA 5M9OA 3G4ST 4PJOC 1G5VA 3QDRB 5GAN4 2DO3A 4LDUA 2K5FA 3CMAT 1PSFA 1XOVA 4ME7A 2RHYA 1WJSA 4XK8E 2DTIA 1KC8C 3QJ6A 4RG8A 2QTXA 4RCBA 3RUXA 2ZGWA 3GNFB 3I55A 3OSSC 1X01A 2CZ7B 2A3LA 3DLMA 4EMGA 1Y96A 4QW2A 1YJNA 1M1GA 3QIIA 1DJ7B 3NTKA 2DVEA 4M78C 4M7DD 3QHSA 3CCVT 2DXTA 2DZ9A 3ASKA 5FRNA 3QG1A 2MF2A 5LJ5j 4A54A 2QQSA 4PLIA 3SWNC 2EFIA 1LOJA 2RJDA 3DB3A 3BDUA 4M77B 2RI5A 1BYMA 1BIAA 2GCXA 4NL3A 4M75D 1WJQA 1H641 3EAEA 4OGEA 3MHXA 4HCBA 3V8LA 5DLQE 3UDCA 2GQVA 3GPLA 3J80E 1M90C 2E6ZA 4XU0A 4CRIA 1HXDA 2QEXA 5KE2A 3QUIA 4O6JA 3M5AA 2C06A 2CZ1B 5GAN5 3CPWS 2HQXA 2A7YA 4DA4A 2OTJA 1FXXA 3JCMV 3HFOA 4LDYA 2KY9A 2HNIA 3N5BB 5C6SA 5LJ5f 3L2WA 5I21A 3OBWA 2VV5A 5AYFA 2RHUA 3A8LB 1KQSA 1U1SA 4M7AC 5FU6B 1G3YA 3C12A 3LGLA 3OS2A 3M54A 1FX7A 2CZ6B 2KQWA 1O75A 4PJOE 2DD5A 2X4WA 3GOXA 3CC4T 1NE8A 3JCMb 3C94A 4WF2A 4JLIA 3M4YA 1XNIA 5I2SA 2R58A 1YJWT 3V7SA 1BKBA 3QJYA 4QQ6A 2WSEE 3H6ZA 1JJ2A 3J7AF 4B9WA 2LVMA 1NJIC 1WQ7A 4XU1A 5KE3A 2DPPB 3JB9H 5A0LA 1VQPT 5GAOn 3X26B 3PIOA 4C5GA 2RB6A 3VUZA 3MP8A 3V8KA 5GAN6 2EIFA 2HBPA 3CCLT 1QVPA 2BUDA 4M78F 4IUQA 1R8OB 2G3RA 3QPHA 5CKFA 3GP8A 3E19A 2O4XA 2LDMA 1K9MU 2FYKA 4JRPA 2K5LA 2L8DA 5CO7A 3JB9I 2MAMA 4OVAA 4BI4A 4C8QC 1VQ7T 4LD9K 3L2ZA 3OYGA 3CCET 3RERA 3CXCS 3JCMc 4JS4A 4ZTJA 4PJOG 2EAYA 1Q7YU 3AHUA 4HKEA 2LNVA 5CQXA 3T9NA 4FU6A 4PLLA 1WJRA 4A4KA 1UGRB 5HK3A 2E12A 2V8JA 3CCRA 3JB9F 4DQ2A 4EMKB 2V8IA 3X24B 3TEEA 4KBMB 4LDXA 1YJ9T 2HQEA 3CCEA 4EMHA 3PGGA 5LJ5d 4XTUA 3CC2T 1VQ4T 3X20B 3JCMd 3UT1A 2O4XB 2RA2A 5CKDA 4E7HA 2K2VA 1M9SA 3A8MB 3CC7T 4C5HA 3CPFA 1VQNA 4M7AF 2D6FA 1NPPA 1V29B 4J6WA 4E7KA 4C8QA 1I8FA 1VQKT 1BI2A 5KH6A 1YHQT 2XG8D 3RMQA 4OMFB 1LJOA 1K8AU 3CD6T 3ER0A 1ZBXA 5FU7B 5GAOl 1VIEA 3O8VA 2RK2A 2EQJA 1BI1A 2RO0A 4X9CA 4XAXB 3CC7A 3FB9A 1W2BA 2XD0A 3FJPA 4JS5A 4FIBA 1W4SA 5DM7R 1KD1U 2R57A 3OYBA 5A0GA 4F7UA 1YI2A 3VV0A 5LJ5e 4XU3A 1U8RA 3OYJA 3JCMe 3CMEA 3JB9G 2P0PA 2VYTA 1QVGA 5GAOp 2MWOA 2E1HA 1HK9A 2JTMA 3LH0A 3VUBA 4A4FA 4MDWA 2GF7A 1XTDA 2P4TA 2RJEA 4IURA 5GMKl 4JJNK 4PJOD 3OYHA 4BB7A 5IT9E 4C0DB 4ZGDB 1BIBA 4KULA 3OQ5A 2DZCA 4BUGA 4E47A 3OYFA 5GANg 3FC3A 3MP1A 5J39A 3I55T 3ZEHA 5GANe 5FU6C 3HRTA 2QA4A 2O01E 1YJNT 2ZPGB 4A53A 2LT1A 4M77A 2V8KA 2K4YA 1SSFA 2RM4A 4MZMA 5CVIA 4C8QE 4BACA 1OZ2A 4M7AG 4M7AE 3OMCA 3S3OA 5LJ5h 3OY9A 3CCMA 3M55A 2LRQA 3JCMh 1Q86U 4QVDA 1Q82U 3L1AA 4F7UB 4D6WA 3M56A 3QXEB 2CS7A 3FRNA 4M78D 3L2VA 2WSCE 3BDLA 3V7RA 4XTZA 4XQ3A 1G3TA 2EJGA 2ZPFB 4JDSA 1YBYA 2DJZA 4BDZA 5GANh 5GAN7 5A2QE 1QW1A 4ZTFA 1KHCA 4ELZC 4TVRA 1WPYA 3HHTB 4RKUE 3SFMA 1Q81U 2FB7A 4GY5A 4C92A 4BD3A 2ZCFB 2QEXT 2ZPBB 4FSXA 3LWIA 2E70A 3GLXA 5IAYA 1N9RA 1YITA 3JB9D 3JB9J 2RJCA 1KG1A 2MI6A 2P0QA 3OW2A 1VQOA 2OTJT 2QXFA 4M77E 4RG2A 5GANj 3OYDA 2M16A 3URGA 4C8QG 1VQ5A 4MZTA 2VUBA 2AHJB 1VQ5T 3MCAB 3HFNA 1S72A 1K9MC 2XIDA 1I81A 1BI0A 3CEYA 4EMKC 3LX7A 3QKJA 4V2SA 1Y7XA 1N9SA 4OB1B 4M7AD 3NTIA 2XKOC 4NL2A 3OYKA 1JBMA 2DD4A 5LJ3g 4C92B 2E65A 2XDDA 3CCQA 3FIFA 5LJ3e 3SD4A 2XHCA 3QZ5B 4FT2A 2K5IA 1VQMA 2FVUA 3A5ZB 2RD1A 3HL8A 4PJOF 1VUBA 2LC4A 1WGSA 3CCJA 2PVDB 4MMLA 5GMKj 4O5VA 3C4SA 4HCCA 1M1KC 2X4JA 3QZ9B 5D6XA 4KUIA 3SDZA 4BI3A 5CR2A 5DY9A 3M59A 4LDVA 5FU7C 4QQDA 1KQ2A 1RL2A 3JCMQ 2EQUA 4M77G 1JRIA 3E9GA 1N6AA 2B8AA 3HP9A 3VKIA 3WVDB 3Q1JA 4A4GA 2XU8A 4BY6C 4EMKA 1YIJA 3GIBA 5LJ3h 1M1FA 4XTXA 2Y4XA 4M7DA 5GAMg 3RKWA 4HCZA 1UGPB 1ZHIA 1K8AC 4J6YA 2Y90A 1QVFA 2X4YA 4C8QD 2DXCA 1IREB 3OYLA 3CCRT 2XK0A 4BI8B 4L59A 5CK9A 2F5KA 3M9QA 3JCMJ 1MGQA 4M75A 1VIFA 3BW1A 3FDRA 1G3WA 1UGSB 3M58A 3CBMA 4MZPA 5J26A 5J3BA 2WSFE 4LDWA 5LJ3j 3GF5A 3VU3C 2JZ2A 3S3NA 4N0AA 4IUTA 3JAME 4FM4B 2D9TA 1P92A 3WXMB 4A4EA 1VQNT 4VUBA 3H8ZA 3ZBDA 4M7DB 2CGHA 3G71A 2VGMA 4RCCA 3I56A 3OS5A 1U1TA 3J81E 3FEOA 2M1HA 4JRQA 2H3JA 4C5EA 1QP2A 1KHIA 3C95A 3HRUA 1OYXA 3MP6A 2KK4A 4L5GA 5GAOm 5GAN8 4HA8A 1KQSS 2VXFA 2E10A 4M75B 3OYAA 4DOWA 2VXEA 4JUVA 1YI2T 5GAMj 2K3YA 5HY6A 3RESA 5GAOr 4M77C 5GANd 3CMET 2D0QB 3TREA 1AHJB 2OTLA 3F70A 5FROA 4PKCC 4DOVA 4M75E 4ZGJB 1UB4A 4R56A 3E9FA 2CZ0B 3BY7A 1VQ6A 1TH7A 2DTHA 4BDYA 2M0OA 5GMKm 2QQAA 2RI2A 4B9XA 3P8DA 3L2QA 2PUKB 3X28B 1JJ2S 1VQLA 3UPUA 4IUUA 5DLOA 2QA4T 3VJPA 3PMIA 4OB0B 2R5AA 3M57A 2QQRA 3GNGA 2PUOB 3PMTA 1OZ3A 1LNXA 4NS5A 2PVOB 3QYHB 3CCMT 3CCUT 3PFSA 5CIUA 2ZPIB 3CCSA 4A4HA 2DAQA 2X35A 4C92C 1EIFA 3JCMP 1FWZA 2CYZB 2DTOA 5CQYA 2FHDA 2DKGA 4FL6A 4C8QF 3JCMX 2L89A 2ZZDA 3KUFA 2XDBA 2DXBA 2FL7A 5CKHA 3LYIA 1I5LA 4JLGA 3CCUA 2F5TX 4Z02A 4II1A 2XI9A 1D3BA 1Y71A 4GLKA 3CPWA 4Y91A 4M75G 4C5IA 1H3ZA 2YLCA 2QQ9A 3G6EA 3DLLA 2NLUA 3L2UA 2EQKA 2I2LA 1N8RU 3MEWA 4IUPA 3FLGA 4MMKA 1YITT 1M4ZA 4F7UF 1RI0A 4F7UE 4QVZA 3DKMA 2MWPA 1VQOT 5D6WA 3R6OA 1WQWA 2EQMA 1UEBA 2GFAA 5GMKe 1VQ9T 4BE0A 3CBPA 2EJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K57 A;  4JRK A;  3L2Z A;  5LJ3 d;  5GAN 2;  5GAO q;  3JCM W;  3QSU A;  3EFS A;  4MML A;  5GMK j;  3RER A;  4M7D G;  3JCM c;  2EJF A;  4PJO G;  2EAY A;  3AHU A;  4M7D D;  3QO3 A;  1B34 A;  4M77 F;  1D3B B;  5DY9 A;  1KQ1 A;  4HT9 A;  1M5Q 1;  5LJ5 g;  3JB9 F;  4J6X A;  4DQ2 A;  4EMK B;  1KQ2 A;  3JCM g;  3JCM Q;  4M77 G;  1JRI A;  5LJ5 f;  3GIB A;  4EMK A;  2YLB A;  4EMH A;  3PGG A;  5LJ3 h;  5GMK h;  5LJ5 d;  4XTX A;  4XTU A;  4M7D A;  4X9D A;  5GAM g;  3JCM d;  3RKW A;  3V8J A;  4M7D C;  3EFR A;  4PJO A;  2RA2 A;  4J6Y A;  4XU2 A;  2Y90 A;  5GAM f;  4C8Q B;  4HT8 A;  4PJO C;  4C8Q D;  4F7U G;  5GAN 4;  4M7A F;  4J6W A;  5GAM d;  4C8Q A;  1I8F A;  3V7C A;  5GMK i;  3JCM J;  1MGQ A;  4M75 A;  4C92 F;  3BW1 A;  2DTI A;  1LJO A;  1B34 B;  4M75 C;  4C92 E;  5LJ3 j;  5GAO l;  3VU3 C;  3RUX A;  1I4K 1;  2QTX A;  4RCB A;  4M7D B;  4PNO A;  4X9C A;  1Y96 B;  4N0A A;  2ZGW A;  3FB9 A;  4XTV A;  3FJP A;  4N0A C;  1X01 A;  4EMG A;  2DEQ A;  1Y96 A;  4F7U A;  5LJ5 e;  4M78 A;  4XU3 A;  2DVE A;  4M78 C;  2CGH A;  3JCM f;  3JCM e;  3JB9 G;  3QHS A;  5GAO p;  2DXT A;  2E1H A;  4RCC A;  1HK9 A;  2DZ9 A;  1U1T A;  3RIR A;  4PJO B;  4PJO D;  5GMK l;  3SWN A;  5LJ5 j;  4A54 A;  3SWN C;  1BIB A;  5GAM e;  1LOJ A;  2DZC A;  5GAN g;  2VC8 A;  4HA8 A;  5GAN 8;  3BDU A;  5GAO m;  4M77 B;  2VXF A;  2JN0 A;  2E10 A;  4M75 B;  1BIA A;  5GAN e;  5GAN f;  4M75 D;  4NL3 A;  2VXE A;  4JUV A;  1H64 1;  5GAM j;  4A53 A;  4M77 A;  3RES A;  5GAO r;  2RM4 A;  4M7A G;  4M77 C;  4C8Q E;  5GAN d;  3V8L A;  4XTW A;  5LJ5 h;  4M75 E;  3BY7 A;  4XU0 A;  3JCM h;  4C92 G;  1TH7 A;  4QVD A;  2DTH A;  3L1A A;  1HXD A;  4F7U B;  5CAI A;  3QUI A;  4M78 B;  5GMK m;  4M78 D;  5GAN 5;  3V7R A;  5GAM h;  2YHT A;  4XTZ A;  4XQ3 A;  4XTY A;  3SWN B;  2EJG A;  4C8Q C;  3JCM V;  2DJZ A;  3HFO A;  4M78 E;  4OP0 A;  2HNI A;  5GAN h;  5GAN 7;  4M7A A;  5I21 A;  4M7A C;  1U1S A;  1WPY A;  1LNX A;  4M7D F;  2EWN A;  3SB2 A;  2FB7 A;  4C92 A;  4M7D E;  2E41 A;  4JRI A;  4C92 C;  3HSB A;  4PJO E;  1WNL A;  3JCM P;  4M77 D;  1M8V A;  2DTO A;  1N9R A;  3JB9 D;  3JCM b;  3JB9 J;  2DKG A;  4WF2 A;  4JLI A;  4C8Q F;  3JCM X;  2E64 A;  3BFM A;  4QVC A;  3V7S A;  4M75 F;  4NOY A;  4M77 E;  5GAN j;  1I5L A;  3INZ A;  4C8Q G;  1D3B A;  1YCY A;  2DXU A;  4M75 G;  1WQ7 A;  4Y91 A;  2YLC A;  4XU1 A;  3M4G A;  3HFN A;  3RKX A;  4EMK C;  1I81 A;  3JB9 H;  2I2L A;  5GAO n;  4V2S A;  2RB6 A;  1N9S A;  4MMK A;  4M7A B;  3V8K A;  4F7U F;  5GAN 6;  4M7A D;  4M78 F;  4F7U E;  4NL2 A;  1JBM A;  5LJ3 g;  4J5Y A;  2E65 A;  4C92 B;  3FIF A;  4C92 D;  1WQW A;  5GMK e;  4M78 G;  5LJ3 f;  5LJ3 e;  2FYK A;  5GAN 3;  3JB9 I;  4M7A E;  2RD1 A;  3RKY A;  4PJO F;  2EJ9 A; 
#chains in the Genus database with same CATH topology
 5FLX E;  3PTA A;  2YSQ A;  2Y4Y A;  3QO3 A;  1D3B B;  2QK0 A;  1M5Q 1;  3NTH A;  4J7I A;  3CCQ T;  1VQ9 A;  4PFP A;  3R6N A;  1JQQ A;  5GMK h;  3OA6 A;  4ESR A;  3PNW C;  3E1S A;  4F7U G;  5KYY B;  1WHL A;  3I56 Q;  1X6O A;  5I2M A;  3CXC A;  4AG1 C;  3LWH A;  3CCV A;  2QYZ A;  1GCQ C;  1WIE A;  2F2X A;  2KVQ G;  4QQG A;  1JO8 A;  3VYH B;  4UC4 A;  3L42 A;  4Z88 A;  1G83 A;  1RAB B;  5D6Y A;  4YTL A;  2HAX A;  1VQ6 Q;  4OB2 B;  3RIR A;  2KBT A;  1ZUK A;  2KAF A;  1M3C A;  3A8G B;  4F16 A;  2DL7 A;  5GAN f;  4C0D C;  2IIM A;  3CCS Q;  1QCF A;  5HK0 A;  5CAI A;  4OMP A;  4LUE A;  2KSS A;  4M78 B;  2DM1 A;  3CC4 A;  1BU1 A;  4LD6 A;  3ZFJ A;  1YJW A;  3SWN B;  1Q95 G;  2L5Q A;  2O9S A;  5KYU A;  2MPX C;  3G6E Q;  1UFF A;  4DEX A;  1FYN A;  3OMG A;  4MDX A;  1WNL A;  2RQR A;  4KT0 E;  1N27 A;  3INZ A;  3MEV A;  1VQ7 A;  2D0N A;  3M4G A;  4M7A B;  2RHZ A;  2EYQ A;  4C92 D;  1T3S A;  3EHQ A;  2IVW A;  5GAN 3;  2HD0 A;  4AFQ C;  4HXJ A;  5GAN 2;  2FZC B;  3CC2 A;  3HTR A;  1NEG A;  4BY6 B;  2EYZ A;  4ZGE B;  4J6X A;  3JCM g;  1PHT A;  1IGQ A;  2K79 A;  1RAA B;  3SEM A;  2LCL A;  2XIC A;  4DBQ A;  1IXD A;  1HSQ A;  2BZY A;  3G4S T;  1G5V A;  1PSF A;  2AZV A;  3PVQ A;  4HVV A;  2ZGW A;  3GNF B;  3OSS C;  2A3L A;  1ZA2 B;  2KT8 A;  1M1G A;  4KRT A;  3NTK A;  2DVE A;  4M78 C;  4M7D D;  5FRN A;  4A54 A;  2QQS A;  1LVK A;  3SWN C;  2RJD A;  1LOJ A;  3DB3 A;  2LP5 A;  1BIA A;  2COZ A;  4NL3 A;  4FYX B;  1RAC B;  4OGE A;  1YP5 A;  3V8L A;  2EVR A;  3EHR A;  1TOV A;  2RMO A;  5KE2 A;  3QUI A;  1M90 R;  4O6J A;  1UGV A;  2AKK A;  2LNH B;  2KRO A;  2HQX A;  2LJ0 A;  1IB8 A;  2A7Y A;  2KY9 A;  1IHV A;  1NYG A;  5I21 A;  4M7A C;  1VQL Q;  3OS2 A;  3CXC P;  5AT1 B;  2DD5 A;  1NE8 A;  3JCM b;  3C94 A;  2XMF A;  1YJ9 Q;  3QJY A;  1M1K R;  2LVM A;  1NJI C;  1VQ4 Q;  2V26 A;  1WQ7 A;  5GAO n;  3VUZ A;  3NPF A;  2BUD A;  2OAW A;  1YHQ Q;  3MJX A;  2O88 A;  1AVZ C;  1H8K A;  3E19 A;  2DLP A;  2O4X A;  3RBB B;  2FYK A;  4JRP A;  2K5L A;  4OVA A;  4BI4 A;  4FYV B;  3L2Z A;  3UF4 A;  2LZ6 B;  2LNV A;  4PLL A;  2GNC A;  4A4K A;  2E12 A;  5KYN A;  3JB9 F;  4EMK B;  1TTH B;  2CT3 A;  4KBM B;  3CCE A;  3X20 B;  2P84 A;  3UT1 A;  5CKD A;  2RA2 A;  1YJN Q;  1M9S A;  3KFV A;  3CC7 T;  4C5H A;  1WXU A;  1M2O A;  2O9V A;  1MNE A;  4OMF B;  1K8A U;  3CD6 T;  1AEY A;  2DL4 A;  2XD0 A;  1BI1 A;  3FJP A;  4FIB A;  1W4S A;  3OYB A;  5A0G A;  1HYO A;  2VYT A;  5GAO p;  3VUB A;  4JJN K;  4PJO D;  4KGV B;  2AIR B;  4JZ4 A;  1ZA1 B;  4KUL A;  2A28 A;  3OYF A;  2DZC A;  4E47 A;  5GAN g;  3I55 T;  2EKH A;  5GAN e;  2QA4 A;  1WXT A;  2O01 E;  2D8H A;  1RAG B;  4F14 A;  4M7A G;  5CVI A;  1ZLM A;  5LJ5 h;  2M51 A;  1Q86 U;  3D7S B;  3L1A A;  3M56 A;  2CS7 A;  1UHC A;  2JT4 A;  1NEB A;  4JDS A;  4AFZ C;  5A2Q E;  1QW1 A;  1OU8 A;  3HHT B;  4RKU E;  3SFM A;  1Q81 U;  2FB7 A;  2L3S A;  1KSW A;  6AT1 B;  2QEX T;  1YIT A;  1KG1 A;  1NBE B;  1LCK A;  2OTJ T;  2QXF A;  2M16 A;  4MZT A;  2AHJ B;  4EMK C;  3LX7 A;  1Y7X A;  1JBM A;  4J9G A;  3CCQ A;  3FIF A;  2DF6 A;  1YNZ A;  3SD4 A;  2XHC A;  2FVU A;  3EFO B;  2RD1 A;  3VS6 A;  4GLM A;  2KI7 A;  1VUB A;  2LC4 A;  3EH2 A;  2E4H A;  1T0H A;  3C4S A;  1VQN Q;  2X4J A;  4KUI A;  3SDZ A;  3VS7 A;  3M59 A;  2EQU A;  5LJ5 f;  4ZTF A;  2VVK A;  3EG2 A;  3HP9 A;  4A4G A;  3GIB A;  4EMK A;  2XU8 A;  1Z9Q A;  1PNJ A;  2G6F X;  4LNP A;  1PG5 B;  1YI2 Q;  2J6K A;  2X4Y A;  2SEM A;  3CCR T;  2XK0 A;  1GFC A;  3M9Q A;  3JCM J;  1RAE B;  3BW1 A;  1I0C A;  3M58 A;  1KD1 R;  1GRI A;  4LDW A;  4AMC A;  2ATC B;  2D9T A;  4EIK A;  1KJW A;  1P92 A;  2EGE A;  3WXM B;  4VUB A;  3H8Z A;  8AT1 B;  2VGM A;  3OS5 A;  3J81 E;  2NUP A;  2CSI A;  4C5E A;  3C95 A;  3C0C A;  4L5G A;  5GAN 8;  4RTX A;  4M75 B;  3OYA A;  2YUO A;  3RES A;  4M77 C;  2D0Q B;  1RLP C;  4DOV A;  4R56 A;  1N8R R;  2FRY A;  2M0O A;  2CP3 A;  1M3B A;  4F17 A;  1AWJ A;  2J6F A;  4RUG A;  2ROT A;  1OUL A;  1VQ5 Q;  1HD3 A;  1PKS A;  2R5A A;  3M57 A;  2PUO B;  1S72 Q;  4NS5 A;  1LNX A;  1VA7 A;  1B3Q A;  1K0S A;  2DAQ A;  2X35 A;  3JCM P;  1FWZ A;  1AT1 B;  2CYZ B;  2DTO A;  1PRL C;  4C8Q F;  3JCM X;  2JJ9 A;  3KUF A;  1W6X A;  1VQM Q;  2YDL A;  1I5L A;  2DRM A;  1Y71 A;  2KE9 A;  4RTY A;  2W0Z A;  3DLL A;  4KH1 B;  1E6H A;  4IUP A;  4MMK A;  1M4Z A;  1RI0 A;  3A1P A;  1AOJ A;  1VQO T;  2EQM A;  3M5A A;  5LJ3 d;  3EFS A;  2CKK A;  3EFO A;  3TSZ A;  1GXI E;  1VYT A;  3ZL7 C;  5KCH A;  1B34 A;  2MK5 A;  3G4S A;  1KQ1 A;  4HT9 A;  1SHF A;  5CKB A;  1W2B S;  2KDS A;  4CI0 C;  2NUT B;  3A98 A;  2ECZ A;  2RQV A;  2VKN A;  3RMS A;  4L6V 5;  2A0F B;  2X3X D;  4J7F A;  4E7J A;  1WXB A;  1TUC A;  5FRM A;  3G71 Q;  4KGZ B;  5GAM d;  3V7C A;  2D1X A;  3UA6 A;  4C92 F;  4C92 E;  4M75 C;  1AZE A;  4PNO A;  1Y07 A;  2JOY A;  1X69 A;  4N0A C;  1RAF B;  5IXB A;  5KCO A;  2BKD N;  2CP0 A;  2FPD A;  2WAC A;  2F69 A;  2EYX A;  3JCM f;  2KRN A;  1K76 A;  2GTO A;  5GAM e;  2GGR A;  2VC8 A;  2PU9 B;  2M0Y A;  2OAU A;  2ZPH B;  3HRS A;  2A36 A;  2E5Q A;  4ATO A;  2FO0 A;  3CQT A;  3OW2 S;  1NPR A;  1X75 C;  2BIV A;  3EGX A;  4IKF A;  4M78 E;  3X25 B;  1OI1 A;  5CCA A;  3MEU A;  2OTL T;  3M0P A;  4M7D F;  2EWN A;  1MHN A;  3SB2 A;  1FMK A;  4M7D E;  2E41 A;  2YRV A;  1IRX A;  3VS5 A;  1Q86 C;  1HJD A;  1VQL T;  3OB9 A;  4C0F A;  4RTT A;  4OF1 A;  4R55 A;  3KXT A;  3OSV A;  1F1B B;  4HVW A;  1UDL A;  5A0D A;  1Q81 C;  2EGC A;  4X34 A;  3JSC A;  3NFC A;  5KYU B;  1VQ8 A;  4IUV A;  1VQ9 Q;  1NJI U;  3UWN A;  5IHN A;  3MEA A;  4M7A E;  2F2W A;  5KYW A;  4BE1 A;  3RKY A;  1QVF S;  3S3M A;  2K57 A;  5GAO q;  1K73 R;  2EJF A;  2KYB A;  1VOM A;  1Y0M A;  3CCV Q;  5LJ5 g;  1UJ0 A;  2R5M A;  3A8H B;  3MET A;  2AZS A;  2EYW A;  3CD6 A;  1YCS B;  4X9D A;  4Y92 A;  3OS1 A;  4Y28 E;  4C8Q B;  3P8H A;  1K1Z A;  2JUF A;  1GCP A;  2JMA A;  2JTE A;  2DO3 A;  4LDU A;  4PFZ A;  5GAN 4;  3CMA T;  2CUB A;  1XOV A;  4E6R A;  1WJS A;  3VRY A;  4RCB A;  1MV0 B;  1KC8 R;  3I55 A;  3DLM A;  2O31 A;  3QII A;  1RUW A;  2YRC A;  2DIL A;  1Z9Z A;  4LUD A;  4R0K A;  2MF2 A;  2COW A;  1JXM A;  3CC4 Q;  4PLI A;  2M02 A;  2EFI A;  1BBZ A;  1YJW Q;  3BDU A;  2GCX A;  1WJQ A;  3EAE A;  1SHG A;  5DLQ E;  2O2O A;  1M90 C;  4CRI A;  2QEX A;  5GAN 5;  4DA4 A;  2OTJ A;  1FXX A;  3HFO A;  4LE9 A;  4LDY A;  3L2W A;  1X27 A;  3OBW A;  2VV5 A;  5AYF A;  1VYV A;  1U1S A;  1G3Y A;  3I5R A;  1CKB A;  2CZ6 B;  1O75 A;  4PJO E;  2X4W A;  1KIK A;  1E7O A;  1D1B A;  1XNI A;  3V7S A;  1BKB A;  3H6Z A;  3CC2 Q;  4QT7 A;  2DPP B;  3JB9 H;  1VQP T;  1WFW A;  3X26 B;  3MP8 A;  2EIF A;  3CCL T;  2QGF B;  2G3R A;  5CKF A;  3JV3 A;  1K8A R;  2L8D A;  3JB9 I;  4C8Q C;  2OX7 A;  3OYG A;  1Q7Y U;  2EAY A;  5CQX A;  3T9N A;  1X43 A;  3UAT A;  2V8J A;  2ZAE A;  5IHI A;  3CCR A;  1SEM A;  4F04 B;  2RPN A;  4EMH A;  4XTU A;  3JCM d;  5FWB A;  1WYX A;  2O4X B;  4E7H A;  4GBQ A;  1XJW B;  2PZ1 A;  1V29 B;  4C8Q A;  1I8F A;  1VQK T;  5KH6 A;  2XG8 D;  3RMQ A;  1LJO A;  1RLQ C;  5GAO l;  1VIE A;  4X1V A;  2RK2 A;  1W2B A;  1UHF A;  4JS5 A;  2L2P A;  1RAH B;  1BCO A;  1U8R A;  3JCM e;  2P0P A;  2ED0 A;  1T3L A;  3LH0 A;  1NLP C;  4MDW A;  4JJC A;  5GMK l;  2RJE A;  2SRC A;  3OYH A;  4BB7 A;  1UJY A;  3MP1 A;  2YUN A;  2E3H A;  1TUG B;  2LT1 A;  4A53 A;  2K4Y A;  1SSF A;  4BAC A;  2MIO A;  2E5K A;  1QKX A;  2NUZ A;  1X6B A;  1Q82 U;  2EW3 A;  3QXE B;  4M78 D;  3L2V A;  2IPO B;  3BDL A;  4M4Z A;  4XTZ A;  1OU9 A;  9ATC B;  2CH4 W;  4J9I A;  4C92 A;  1M27 C;  2C0T A;  2ZCF B;  2E70 A;  2RJC A;  2DX1 A;  2MI6 A;  1VQO A;  3OW2 A;  4M77 E;  4RG2 A;  3OYD A;  4C8Q G;  1PC0 A;  1QCN A;  1NYF A;  1I81 A;  3CEY A;  2JM9 A;  4V2S A;  2A08 A;  1N9S A;  4M7A D;  1K9M R;  1U5S A;  2DJQ A;  2XDD A;  4Z8A A;  3CCE Q;  1ZUU A;  4FW1 A;  2HEQ A;  4HCK A;  2DEU A;  3JCM Q;  3VKI A;  1N6A A;  4BY6 C;  2KEA A;  1BCM A;  3EGD A;  5LJ3 h;  1AWX A;  2Y4X A;  4M7D A;  1UGP B;  4J6Y A;  1RAD B;  1QVF A;  1IRE B;  5CK9 A;  3ULR B;  2MCN A;  1D0Y A;  2J05 A;  3FDR A;  1R77 A;  1VIF A;  1TU0 B;  4MZP A;  5J26 A;  2WSF E;  5LJ3 j;  2JZ2 A;  4A63 B;  4IUT A;  3JAM E;  2QA4 Q;  1K9A A;  4FM4 B;  3FJ5 A;  4A4E A;  3ZBD A;  4RCC A;  3FEO A;  1FMV A;  4J9F A;  1KHI A;  3HRU A;  5GAO m;  1K4U S;  2E10 A;  2VAS A;  5FWC A;  5GAM j;  3CME T;  5GAN d;  3TRE A;  2OTL A;  4Z89 A;  1JU5 C;  4M75 E;  1TH7 A;  1YIT Q;  4BDY A;  4OMQ A;  5GMK m;  3P8D A;  1VQL A;  5DLO A;  2NUP B;  3H9N A;  3VJP A;  2H3E B;  4OB0 B;  5ECA A;  3CCM T;  2GBQ A;  3PFS A;  3EG1 A;  5CIU A;  1ZBJ A;  1WHJ A;  4A4H A;  2HKQ B;  3CCQ Q;  1C0M A;  2DKG A;  4FL6 A;  1W2B P;  2DXB A;  3LYI A;  3VS4 A;  4JLG A;  3CCU A;  2JS2 A;  4GLK A;  2GTJ A;  2QQ9 A;  4F7U F;  2DBK A;  1SRM A;  4F7U E;  2DNU A;  3R6O A;  5GMK e;  1WHK A;  1VQ9 T;  1V76 A;  3CBP A;  2BE9 B;  3PE0 A;  4JRK A;  1WDX A;  2LT4 A;  3EG9 A;  2E6N A;  2MMP A;  3VYG A;  1D09 B;  2X4X A;  4OML A;  2GFU A;  3RNJ A;  5GJW B;  1ZUY A;  2L3Q A;  5EG2 A;  3CMA A;  4RMO A;  5CKE A;  3OYY A;  2CP7 A;  3CCJ T;  2EKO A;  4Q5W A;  4PJO A;  1MV3 A;  1U06 A;  1Q7Y C;  2F1L A;  5L8R E;  4FCY A;  2PVG B;  4RTZ A;  2HBW A;  4DBR A;  5GMK i;  4E7I A;  3OW2 P;  1B34 B;  1YIJ T;  2QQB A;  3JRZ A;  4J83 A;  4PJM A;  1Y96 B;  4XTV A;  2AKL A;  2KYM A;  2LX9 A;  2DEQ A;  2CT4 A;  1R0B G;  1QCO A;  1UGQ B;  4FYY B;  4EDU A;  4JJD A;  2DL8 A;  3OYM A;  4ZNX A;  2GQI A;  2JN0 A;  4CC4 B;  1MMD A;  2DYI A;  4BE2 A;  3I56 T;  3A8O B;  3LLR A;  4PJL A;  1T0J A;  1W70 A;  2A37 A;  4ZN1 A;  1NJI R;  4KUD K;  2QDY B;  1RAI B;  4XTY A;  1M90 U;  1PSE A;  1QVF P;  3S6W A;  3CBO A;  2DK3 A;  2HDA A;  2YUQ A;  1VQ6 T;  1J3T A;  4JRI A;  3OYN A;  1VQP A;  1Q82 C;  1AZG B;  4M77 D;  4N4I A;  3CCL A;  5IN1 A;  2CP5 A;  4J8O A;  1ARK A;  2ZPE B;  3M53 A;  3BFM A;  2RNA A;  3ME9 A;  3I35 A;  2RK1 A;  2RHI A;  2CSQ A;  3TCJ A;  5C0M A;  2DXU A;  3CCS T;  1JEG A;  3VS1 A;  2RJF A;  3EGX B;  3RKX A;  1M1K U;  1D0X A;  2DIQ A;  3G4S Q;  2LCC A;  1EFN A;  2L3R A;  3QYG B;  1K73 C;  3OBY A;  3HSB A;  3QSU A;  3G6E T;  2RF0 A;  3VS0 A;  1O9S A;  1TWB A;  2YWW A;  1OV3 A;  2V1Q A;  5LL6 S;  1VQK A;  5GJV B;  3TVT A;  2ED1 A;  2LQ8 A;  1NLO C;  4FT4 A;  5HCK A;  3OYE A;  1SF9 A;  5M9O A;  5KYW B;  3REB B;  1CSK A;  3QDR B;  2K5F A;  2LJ1 A;  5EC7 A;  1KC8 C;  3E2U A;  2QTX A;  1QWF A;  2YXY A;  4RTU A;  2CZ7 B;  1Y96 A;  2JS0 A;  4QW2 A;  1QLY A;  2FZG B;  1WLP B;  2CDT A;  2DXT A;  3ASK A;  1AD5 A;  1FMW A;  1Y57 A;  2FPF A;  1BYM A;  4M75 D;  1U3O A;  2KNB B;  3UDC A;  2GQV A;  3J80 E;  2DMO A;  1HXD A;  1VYU A;  2X9H A;  2C06 A;  2CZ1 B;  3CPW S;  3JCM V;  2HNI A;  2YT6 A;  2RHU A;  3A8L B;  2V1R A;  1I5O B;  3M54 A;  1FX7 A;  1VQ8 Q;  2KQW A;  1IO6 A;  2K3B A;  2RN8 A;  4KH0 B;  4JLI A;  3M4Y A;  1CKA A;  2R58 A;  1M2V A;  2C0O A;  3AT1 B;  2KT1 A;  3J7A F;  4J9H A;  2DE0 X;  5A0L A;  3M0R A;  4C5G A;  2RB6 A;  3V8K A;  2HBP A;  4M78 F;  2OI3 A;  1R8O B;  1UUE A;  5KYX A;  2KXD A;  3CD6 Q;  2BZX A;  4AFU C;  2CP6 A;  2MAM A;  1ZSZ B;  4LD9 K;  1OPL A;  3CCE T;  3RER A;  1ZSG A;  3JCM c;  4CC7 A;  4FSS A;  2HSE B;  4ZTJ A;  3AHU A;  2K7A A;  1WJR A;  1UGR B;  2MYS A;  2V8I A;  4LDX A;  1YJ9 T;  5LJ5 d;  3I55 Q;  1PWT A;  1VQ4 T;  3I5S A;  4M7A F;  2D6F A;  1NPP A;  4PK4 A;  1IGU A;  1BI2 A;  1YHQ T;  2ROL A;  2KGT A;  3ER0 A;  3H0F A;  1ZBX A;  5FU7 B;  3O8V A;  4X9C A;  4XAX B;  3CC7 A;  4LN2 A;  5DM7 R;  1KD1 U;  2R57 A;  1IHW A;  4F7U A;  1WHM A;  5LJ5 e;  4XU3 A;  3M0T A;  3CME A;  3JB9 G;  2E1H A;  2JTM A;  2QEX Q;  2GF7 A;  4IUR A;  5IT9 E;  4C0D B;  1BK2 A;  1BIB A;  3OQ5 A;  1UEC A;  2FRW A;  3FC3 A;  5J39 A;  2OTJ Q;  3ZEH A;  1B07 A;  3GBQ A;  1YJN T;  2ZPG B;  3IQL A;  2AT1 B;  2RM4 A;  4MZM A;  1OZ2 A;  3S3O A;  1UG1 A;  3OY9 A;  3CCM A;  1GBQ A;  2LRQ A;  3M55 A;  1SKU B;  4D6W A;  3FRN A;  4D8D A;  2DRK A;  2VWF A;  2WSC E;  3M0Q A;  4XQ3 A;  1G3T A;  2HCK A;  2EJG A;  2ZPF B;  2DJZ A;  4BDZ A;  1TUD A;  5GAN h;  1KHC A;  4ELZ C;  4TVR A;  2EPD A;  1WI7 A;  3GLX A;  4DBF A;  5IAY A;  7AT1 B;  3JB9 J;  1C6V X;  1ZSZ C;  2P0Q A;  5GAN j;  4PFO A;  3URG A;  2KXC A;  3MCA B;  1TS9 A;  3HFN A;  1K9M C;  3QKJ A;  3CCR Q;  2YRD A;  4NL2 A;  1WHG A;  1X6G A;  4C92 B;  2E65 A;  1VQ7 Q;  3QZ5 B;  4FT2 A;  3A5Z B;  3HL8 A;  4PJO F;  1NM7 A;  1WGS A;  3CCJ A;  3EG0 A;  1H3H A;  3RDV A;  5GMK j;  2L3P A;  1ZSZ A;  2FEI A;  4O5V A;  4HCC A;  1M1K C;  1GL5 A;  4PJN A;  4LDV A;  5FU7 C;  3QWX X;  5I22 A;  4FW2 A;  3WVD B;  1JRI A;  3E9G A;  2X51 A;  3Q1J A;  1YIJ A;  1MMG A;  2NYS A;  4XTX A;  5FW9 A;  2K9G A;  4HCZ A;  4C8Q D;  1UTI A;  2DXC A;  1JXO A;  3NGP A;  4BI8 B;  1GCQ A;  4J9D A;  2LJ3 A;  3GF5 A;  3VU3 C;  3S3N A;  1GBR A;  3EGD B;  1VQN T;  4M7D B;  3QWY A;  3I56 A;  2FPE A;  2ESW A;  4AFS C;  2H3J A;  3REA B;  1QP2 A;  3MP6 A;  1OYX A;  2KK4 A;  1KQS S;  1D1A A;  2VXF A;  1YFN A;  2BE7 D;  4DOW A;  1M30 A;  2VXE A;  4JUV A;  1YI2 T;  2K3Y A;  1Q86 R;  5HY6 A;  1YN8 A;  5GAO r;  2LMJ A;  1AHJ B;  5FRO A;  4PKC C;  1VQ6 A;  4HVU A;  2RI2 A;  1JJ2 S;  4DEY A;  1VQO Q;  4IUU A;  1UE9 A;  4JZ3 A;  1Q81 R;  2JMC A;  3PMI A;  3GNG A;  2OJ2 A;  1OZ3 A;  4RTW A;  3CCS A;  2ZPI B;  1ACM B;  1OQK A;  1MMN A;  1QWE A;  4C92 C;  1QQJ A;  5CQY A;  4ANJ A;  1TXQ A;  2L89 A;  2MOX A;  2ZZD A;  2XDB A;  1SSH A;  4WTO B;  2F5T X;  4Z02 A;  2XI9 A;  1D3B A;  3CPW A;  4Y91 A;  4C5I A;  3G6E A;  1ABO A;  2J06 A;  2NLU A;  2EQK A;  3MEW A;  4J9B A;  4D8K A;  2Z0W A;  3DKM A;  2DET A;  1WQW A;  2GFA A;  1NG2 A;  4RTV A;  2DL3 A;  1VQ5 T;  2EJ9 A;  4C0G A;  5KYY A;  2HL3 A;  3NMZ C;  4ZN3 A;  3JCM W;  1S72 T;  2LQK A;  1MMA A;  3PIP A;  2PQW A;  4M77 F;  1K73 U;  1IZ6 A;  1SRL A;  3UA7 A;  1VQM T;  3G7Z A;  3U23 A;  4E7L A;  2JVV A;  3BE3 A;  3V8J A;  4M7D C;  1QVG S;  4XU2 A;  4HT8 A;  1PD1 A;  4P5N A;  4N4G A;  2LTO A;  1XQH A;  2W10 A;  3EG9 B;  2P0K A;  2DIG A;  4E2F B;  2LCS A;  1I4K 1;  3KBG A;  4JPB W;  3EG3 A;  3OS0 A;  4ELY C;  2OTL Q;  4M78 A;  1KC8 U;  3OYC A;  3M0S A;  1OPK A;  4PJO B;  2RI3 A;  2RHX A;  3SWN A;  3MKD A;  4OGC A;  3PVL A;  3WVE B;  1G3S A;  1KD1 C;  4N4H A;  2VGN A;  1TG0 A;  1LPL A;  2JM8 A;  3G71 T;  4XTW A;  1QP3 A;  4C92 G;  2HSP A;  2XDP A;  2JXB A;  4OMN A;  3L2R A;  3PT9 A;  1BI3 A;  2CP2 A;  2YHT A;  5GAM h;  1OEB A;  2JTF A;  3CCU Q;  4OP0 A;  4M7A A;  2FG0 A;  2KMT A;  3VS3 A;  1X2K A;  2L0A A;  8ATC B;  1M8V A;  2HL5 C;  2FZK B;  2KR3 A;  1ZQ1 A;  1N8R C;  2E64 A;  2QAZ A;  1VQ8 T;  2CUD A;  1I1J A;  4QVC A;  4M75 F;  4NOY A;  5I11 A;  3NHN A;  2EGA A;  1YCY A;  1AWO A;  1NZ9 A;  3H0H A;  1RI9 A;  2ENM A;  3MO8 A;  3DB4 A;  3LW5 E;  2DFU A;  5HKC A;  3CMA Q;  4EPC A;  5IHK A;  4J5Y A;  5IXF A;  1JB0 E;  4PL6 A;  2K3X A;  2CH4 A;  3HPW A;  4M78 G;  5LJ3 f;  3OYI A;  1YJ9 A;  1D1C A;  2IG0 A;  2DER A;  3HKS A;  1VQ4 A;  4M7D G;  3MPU B;  3QBY A;  4C0Z A;  2NWM A;  2HMA A;  1YHQ A;  3TU4 K;  2HQH A;  2YLB A;  3LGF A;  1N5Z A;  1YWP A;  2K6D A;  2QI2 A;  3EFR A;  2M9U A;  5GAM f;  3P8B B;  4OB3 B;  4PJO C;  2JNG A;  2E3I A;  2RH2 A;  1PD0 A;  1C1A A;  4ME7 A;  2RHY A;  1WX6 A;  1BB9 A;  4XK8 E;  2DTI A;  2QAS A;  3QJ6 A;  1PRM C;  4RG8 A;  3RUX A;  3CPW P;  2QGG A;  1X01 A;  2LQW A;  4EMG A;  4ORZ A;  1YJN A;  1X2Q A;  1DJ7 B;  2D8J A;  3QHS A;  2DVJ A;  3CCV T;  2DZ9 A;  3QG1 A;  5LJ5 j;  2B86 A;  1ABQ A;  1TSF A;  4M77 B;  2KRM A;  2RI5 A;  1H64 1;  2F2V A;  3MHX A;  4HCB A;  3LH5 A;  4PJJ A;  3GPL A;  4OMM A;  4AG2 C;  2E6Z A;  1VQP Q;  4XU0 A;  3THK A;  3CCL Q;  2P4R A;  2KRS A;  1M3A A;  4WCI A;  1V1C A;  3N5B B;  5C6S A;  1KQS A;  2LQN A;  5FU6 B;  3C12 A;  3LGL A;  3GOX A;  1QKW A;  3CC4 T;  4LXC A;  4WF2 A;  5I2S A;  1YJW T;  3TQ7 P;  4QQ6 A;  1JJ2 A;  2WSE E;  4IIM A;  4B9W A;  1GFD A;  4XU1 A;  5KE3 A;  3PIO A;  5GAN 6;  1QVP A;  1VQK Q;  4IUQ A;  3QPH A;  3GP8 A;  2EYY A;  4AT1 B;  2LDM A;  2PTK A;  1K9M U;  5CO7 A;  2EQI A;  1VQ7 T;  3EGU A;  3CXC S;  1M2V B;  4JS4 A;  4PJO G;  1G8X A;  4HKE A;  4FU6 A;  2C0I A;  1EX4 A;  2ABL A;  5HK3 A;  4DQ2 A;  3X24 B;  4IIO A;  3TEE A;  2J7I A;  4FYW B;  2HQE A;  2RQU A;  3PGG A;  2DA9 A;  4E7S A;  5KYX B;  2HKN A;  3CC2 T;  2QG9 B;  4KGX B;  2K2V A;  1A0N B;  3A8M B;  2COY A;  3CPF A;  1VQN A;  3VS2 A;  4J6W A;  4E7K A;  2J6O A;  2EQJ A;  2RO0 A;  3FB9 A;  1PKT A;  1YI2 A;  3VV0 A;  3OYJ A;  2HZY A;  1I07 A;  1QVG A;  2MWO A;  5IH2 A;  1B7T A;  1HK9 A;  2X3W D;  4A4F A;  2DBM A;  1XTD A;  2P4T A;  3O5Z A;  1MUZ A;  4ZGD B;  4BUG A;  3VRZ A;  5FU6 C;  3HRT A;  2AK5 A;  4M77 A;  2V8K A;  5L23 A;  2LX7 A;  4C8Q E;  2YUP A;  1AWW A;  3OMC A;  3JCM h;  4QVD A;  1G2B A;  4F7U B;  3V7R A;  4B6M A;  1YBY A;  1WZO A;  5GAN 7;  1WPY A;  4GY5 A;  4BD3 A;  1PM3 A;  2ZPB B;  4FSX A;  3TSW A;  3LWI A;  1N9R A;  3JB9 D;  2VB6 A;  1OX9 A;  1E6G A;  4K11 A;  1YWO A;  4DBH A;  3M0U A;  1PCX A;  1VQ5 A;  2VUB A;  2CRE A;  2EBP A;  1S72 A;  2XID A;  1BI0 A;  4CC2 A;  4OB1 B;  3NTI A;  2XKO C;  3OYK A;  2DD4 A;  5LJ3 g;  5LJ3 e;  1VQM A;  1Q7Y R;  2K5I A;  4JJB A;  2PVD B;  1OX8 A;  4MML A;  2DL5 A;  3QZ9 B;  5D6X A;  4BI3 A;  5CR2 A;  5DY9 A;  1W1F A;  4QQD A;  1MND A;  1KQ2 A;  1RL2 A;  3QDF A;  4CC3 A;  4M77 G;  2B8A A;  1QMC A;  2QTV A;  3CC7 Q;  1KQS P;  1M1F A;  5GAM g;  3RKW A;  1K8A C;  1ZHI A;  2Y90 A;  3CME Q;  3OYL A;  2K2M A;  4L59 A;  2BZ8 A;  2F5K A;  1M8M A;  1MGQ A;  4M75 A;  1G3W A;  1UGS B;  2JW4 A;  3CBM A;  5J3B A;  1JJ2 P;  2I0N A;  1H92 A;  2PNI A;  4N0A A;  2BTT A;  5D7U A;  4J9C A;  4J9E A;  3CCM Q;  2CGH A;  3G71 A;  1U1T A;  2M1H A;  4JRQ A;  4HA8 A;  1KFZ A;  1Q82 R;  1EZZ B;  3F70 A;  2DYB A;  4ZGJ B;  1UB4 A;  3E9F A;  2CZ0 B;  3BY7 A;  2RQT A;  4E7Z A;  2DTH A;  2QQA A;  4B9X A;  3L2Q A;  2PUK B;  3X28 B;  3UPU A;  3I9Q A;  2QA4 T;  1SPK A;  1WHH A;  3G1J A;  2QQR A;  3PMT A;  1OOT A;  2PVO B;  3QYH B;  3CCU T;  2H8H A;  1SG5 A;  2QDL A;  1EIF A;  1S1N A;  1D0Z A;  2FHD A;  1KK7 A;  1ZX6 A;  3SHW A;  1WA7 A;  4OMO A;  2FL7 A;  5CKH A;  3EH1 A;  3H41 A;  3CCJ Q;  4II1 A;  1H3Z A;  4M75 G;  2YLC A;  1QVG P;  3RR6 A;  1K0X A;  3H0I A;  2RQW A;  3L2U A;  1N8R U;  1R0C B;  2I2L A;  3FLG A;  1YIT T;  2NUT A;  4QVZ A;  2MWP A;  5D6W A;  1YIJ Q;  1UEB A;  4QKU A;  4BE0 A; 
#chains in the Genus database with same CATH homology
 4C0G A;  5FLX E;  4JRK A;  3PTA A;  5LJ3 d;  4ZN3 A;  3JCM W;  2LT4 A;  3EFS A;  2LQK A;  1S72 T;  2CKK A;  3PIP A;  2E6N A;  2MMP A;  2Y4Y A;  3VYG A;  2X4X A;  1GXI E;  2PQW A;  3QO3 A;  5KCH A;  1B34 A;  2GFU A;  4M77 F;  1D3B B;  3G4S A;  1K73 U;  1KQ1 A;  4HT9 A;  1M5Q 1;  3NTH A;  4J7I A;  5EG2 A;  3CMA A;  3CCQ T;  1IZ6 A;  1VQ9 A;  4RMO A;  5CKE A;  5CKB A;  1W2B S;  3OYY A;  2KDS A;  1VQM T;  3G7Z A;  4E7L A;  5GMK h;  3CCJ T;  2JVV A;  4CI0 C;  2EKO A;  3RMS A;  4L6V 5;  3V8J A;  3OA6 A;  4Q5W A;  4M7D C;  4J7F A;  1QVG S;  4PJO A;  4XU2 A;  4HT8 A;  1Q7Y C;  4E7J A;  3PNW C;  3E1S A;  4F7U G;  5FRM A;  5L8R E;  2PVG B;  4N4G A;  4P5N A;  1X6O A;  5GAM d;  2LTO A;  5I2M A;  3CXC A;  1XQH A;  3V7C A;  3LWH A;  3CCV A;  5GMK i;  4C92 F;  4QQG A;  4E7I A;  2KVQ G;  4C92 E;  1B34 B;  2P0K A;  4M75 C;  1YIJ T;  2DIG A;  2QQB A;  3JRZ A;  1I4K 1;  4J83 A;  4UC4 A;  3VYH B;  4PNO A;  3KBG A;  1Y96 B;  3L42 A;  4XTV A;  1Y07 A;  2JOY A;  3OS0 A;  2LX9 A;  4N0A C;  4ELY C;  5KCO A;  2BKD N;  2DEQ A;  2WAC A;  2F69 A;  5D6Y A;  4M78 A;  4YTL A;  1KC8 U;  3OYC A;  1UGQ B;  3JCM f;  2HAX A;  4OB2 B;  3RIR A;  4PJO B;  4EDU A;  2RI3 A;  2RHX A;  2KAF A;  3SWN A;  4OGC A;  3A8G B;  3OYM A;  5GAM e;  2VC8 A;  2PU9 B;  3WVE B;  2JN0 A;  1G3S A;  5GAN f;  2OAU A;  2ZPH B;  3HRS A;  4C0D C;  1KD1 C;  4N4H A;  2VGN A;  4BE2 A;  2E5Q A;  3G71 T;  5HK0 A;  4ATO A;  4XTW A;  3I56 T;  1QP3 A;  3A8O B;  4C92 G;  5CAI A;  2XDP A;  3LLR A;  2KSS A;  3OW2 S;  4M78 B;  4ZN1 A;  1NPR A;  3L2R A;  3CC4 A;  1X75 C;  3PT9 A;  1BI3 A;  2QDY B;  2BIV A;  4KUD K;  4LD6 A;  5GAM h;  2YHT A;  3ZFJ A;  2JTF A;  1YJW A;  4XTY A;  3SWN B;  1M90 U;  4IKF A;  1PSE A;  2L5Q A;  4M78 E;  4OP0 A;  3X25 B;  3S6W A;  4M7A A;  1OI1 A;  5CCA A;  3MEU A;  3CBO A;  2OTL T;  2DK3 A;  4M7D F;  2EWN A;  1MHN A;  3SB2 A;  2KMT A;  1VQ6 T;  4M7D E;  2E41 A;  2YRV A;  4JRI A;  3OMG A;  4MDX A;  3OYN A;  1WNL A;  1VQP A;  1Q82 C;  1Q86 C;  4M77 D;  1VQL T;  1M8V A;  4N4I A;  4KT0 E;  3OB9 A;  5IN1 A;  3CCL A;  4J8O A;  1ZQ1 A;  2ZPE B;  3M53 A;  4C0F A;  2E64 A;  3BFM A;  1N8R C;  1VQ8 T;  4QVC A;  3ME9 A;  4M75 F;  4NOY A;  2RK1 A;  4OF1 A;  2RHI A;  1N27 A;  3INZ A;  4R55 A;  3MEV A;  3OSV A;  3KXT A;  3TCJ A;  1YCY A;  5C0M A;  2DXU A;  1NZ9 A;  1VQ7 A;  3CCS T;  2RJF A;  3M4G A;  5A0D A;  3RKX A;  1M1K U;  1Q81 C;  2DIQ A;  2LCC A;  3DB4 A;  3JSC A;  3LW5 E;  3MO8 A;  3NFC A;  4X34 A;  4M7A B;  1VQ8 A;  5HKC A;  2RHZ A;  4EPC A;  4IUV A;  2L3R A;  1NJI U;  4J5Y A;  3UWN A;  3QYG B;  1JB0 E;  2EYQ A;  4C92 D;  4PL6 A;  2K3X A;  3HPW A;  4M78 G;  5LJ3 f;  3OYI A;  2IVW A;  3MEA A;  5GAN 3;  2HD0 A;  3OBY A;  4BE1 A;  1YJ9 A;  1K73 C;  3HSB A;  3RKY A;  1QVF S;  3S3M A;  2K57 A;  2IG0 A;  5GAN 2;  5GAO q;  3QSU A;  3G6E T;  3CC2 A;  3HKS A;  1VQ4 A;  4M7D G;  1O9S A;  2EJF A;  4BY6 B;  4ZGE B;  5LJ5 g;  4J6X A;  5LL6 S;  3QBY A;  4C0Z A;  3JCM g;  1VQK A;  2R5M A;  1YHQ A;  3A8H B;  3MET A;  3TU4 K;  2LCL A;  2YLB A;  3LGF A;  3CD6 A;  2XIC A;  2LQ8 A;  4X9D A;  4FT4 A;  3OS1 A;  2QI2 A;  3OYE A;  3EFR A;  2M9U A;  4Y28 E;  5GAM f;  3P8B B;  4OB3 B;  4C8Q B;  2JNG A;  2RH2 A;  3P8H A;  2JUF A;  5M9O A;  3G4S T;  4PJO C;  1G5V A;  3QDR B;  5GAN 4;  2DO3 A;  4LDU A;  2K5F A;  3CMA T;  1PSF A;  1XOV A;  4ME7 A;  2RHY A;  1WJS A;  4XK8 E;  2DTI A;  1KC8 C;  3QJ6 A;  4RG8 A;  2QTX A;  4RCB A;  3RUX A;  2ZGW A;  3GNF B;  3I55 A;  3OSS C;  1X01 A;  2CZ7 B;  2A3L A;  3DLM A;  4EMG A;  1Y96 A;  4QW2 A;  1YJN A;  1M1G A;  3QII A;  1DJ7 B;  3NTK A;  2DVE A;  4M78 C;  4M7D D;  3QHS A;  3CCV T;  2DXT A;  2DZ9 A;  3ASK A;  5FRN A;  3QG1 A;  2MF2 A;  5LJ5 j;  4A54 A;  2QQS A;  4PLI A;  3SWN C;  2EFI A;  1LOJ A;  2RJD A;  3DB3 A;  3BDU A;  4M77 B;  2RI5 A;  1BYM A;  1BIA A;  2GCX A;  4NL3 A;  4M75 D;  1WJQ A;  1H64 1;  3EAE A;  4OGE A;  3MHX A;  4HCB A;  3V8L A;  5DLQ E;  3UDC A;  2GQV A;  3GPL A;  3J80 E;  1M90 C;  2E6Z A;  4XU0 A;  4CRI A;  1HXD A;  2QEX A;  5KE2 A;  3QUI A;  4O6J A;  3M5A A;  2C06 A;  2CZ1 B;  5GAN 5;  3CPW S;  2HQX A;  2A7Y A;  4DA4 A;  2OTJ A;  1FXX A;  3JCM V;  3HFO A;  4LDY A;  2KY9 A;  2HNI A;  3N5B B;  5C6S A;  5LJ5 f;  3L2W A;  5I21 A;  3OBW A;  2VV5 A;  5AYF A;  2RHU A;  3A8L B;  1KQS A;  1U1S A;  4M7A C;  5FU6 B;  1G3Y A;  3C12 A;  3LGL A;  3OS2 A;  3M54 A;  1FX7 A;  2CZ6 B;  2KQW A;  1O75 A;  4PJO E;  2DD5 A;  2X4W A;  3GOX A;  3CC4 T;  1NE8 A;  3JCM b;  3C94 A;  4WF2 A;  4JLI A;  3M4Y A;  1XNI A;  5I2S A;  2R58 A;  1YJW T;  3V7S A;  1BKB A;  3QJY A;  4QQ6 A;  2WSE E;  3H6Z A;  1JJ2 A;  3J7A F;  4B9W A;  2LVM A;  1NJI C;  1WQ7 A;  4XU1 A;  5KE3 A;  2DPP B;  3JB9 H;  5A0L A;  1VQP T;  5GAO n;  3X26 B;  3PIO A;  4C5G A;  2RB6 A;  3VUZ A;  3MP8 A;  3V8K A;  5GAN 6;  2EIF A;  2HBP A;  3CCL T;  1QVP A;  2BUD A;  4M78 F;  4IUQ A;  1R8O B;  2G3R A;  3QPH A;  5CKF A;  3GP8 A;  3E19 A;  2O4X A;  2LDM A;  1K9M U;  2FYK A;  4JRP A;  2K5L A;  2L8D A;  5CO7 A;  3JB9 I;  2MAM A;  4OVA A;  4BI4 A;  4C8Q C;  1VQ7 T;  4LD9 K;  3L2Z A;  3OYG A;  3CCE T;  3RER A;  3CXC S;  3JCM c;  4JS4 A;  4ZTJ A;  4PJO G;  2EAY A;  1Q7Y U;  3AHU A;  4HKE A;  2LNV A;  5CQX A;  3T9N A;  4FU6 A;  4PLL A;  1WJR A;  4A4K A;  1UGR B;  5HK3 A;  2E12 A;  2V8J A;  3CCR A;  3JB9 F;  4DQ2 A;  4EMK B;  2V8I A;  3X24 B;  3TEE A;  4KBM B;  4LDX A;  1YJ9 T;  2HQE A;  3CCE A;  4EMH A;  3PGG A;  5LJ5 d;  4XTU A;  3CC2 T;  1VQ4 T;  3X20 B;  3JCM d;  3UT1 A;  2O4X B;  2RA2 A;  5CKD A;  4E7H A;  2K2V A;  1M9S A;  3A8M B;  3CC7 T;  4C5H A;  3CPF A;  1VQN A;  4M7A F;  2D6F A;  1NPP A;  1V29 B;  4J6W A;  4E7K A;  4C8Q A;  1I8F A;  1VQK T;  1BI2 A;  5KH6 A;  1YHQ T;  2XG8 D;  3RMQ A;  4OMF B;  1LJO A;  1K8A U;  3CD6 T;  3ER0 A;  1ZBX A;  5FU7 B;  5GAO l;  1VIE A;  3O8V A;  2RK2 A;  2EQJ A;  1BI1 A;  2RO0 A;  4X9C A;  4XAX B;  3CC7 A;  3FB9 A;  1W2B A;  2XD0 A;  3FJP A;  4JS5 A;  4FIB A;  1W4S A;  5DM7 R;  1KD1 U;  2R57 A;  3OYB A;  5A0G A;  4F7U A;  1YI2 A;  3VV0 A;  5LJ5 e;  4XU3 A;  1U8R A;  3OYJ A;  3JCM e;  3CME A;  3JB9 G;  2P0P A;  2VYT A;  1QVG A;  5GAO p;  2MWO A;  2E1H A;  1HK9 A;  2JTM A;  3LH0 A;  3VUB A;  4A4F A;  4MDW A;  2GF7 A;  1XTD A;  2P4T A;  2RJE A;  4IUR A;  5GMK l;  4JJN K;  4PJO D;  3OYH A;  4BB7 A;  5IT9 E;  4C0D B;  4ZGD B;  1BIB A;  4KUL A;  3OQ5 A;  2DZC A;  4BUG A;  4E47 A;  3OYF A;  5GAN g;  3FC3 A;  3MP1 A;  5J39 A;  3I55 T;  3ZEH A;  5GAN e;  5FU6 C;  3HRT A;  2QA4 A;  2O01 E;  1YJN T;  2ZPG B;  4A53 A;  2LT1 A;  4M77 A;  2V8K A;  2K4Y A;  1SSF A;  2RM4 A;  4MZM A;  5CVI A;  4C8Q E;  4BAC A;  1OZ2 A;  4M7A G;  4M7A E;  3OMC A;  3S3O A;  5LJ5 h;  3OY9 A;  3CCM A;  3M55 A;  2LRQ A;  3JCM h;  1Q86 U;  4QVD A;  1Q82 U;  3L1A A;  4F7U B;  4D6W A;  3M56 A;  3QXE B;  2CS7 A;  3FRN A;  4M78 D;  3L2V A;  2WSC E;  3BDL A;  3V7R A;  4XTZ A;  4XQ3 A;  1G3T A;  2EJG A;  2ZPF B;  4JDS A;  1YBY A;  2DJZ A;  4BDZ A;  5GAN h;  5GAN 7;  5A2Q E;  1QW1 A;  4ZTF A;  1KHC A;  4ELZ C;  4TVR A;  1WPY A;  3HHT B;  4RKU E;  3SFM A;  1Q81 U;  2FB7 A;  4GY5 A;  4C92 A;  4BD3 A;  2ZCF B;  2QEX T;  2ZPB B;  4FSX A;  3LWI A;  2E70 A;  3GLX A;  5IAY A;  1N9R A;  1YIT A;  3JB9 D;  3JB9 J;  2RJC A;  1KG1 A;  2MI6 A;  2P0Q A;  3OW2 A;  1VQO A;  2OTJ T;  2QXF A;  4M77 E;  4RG2 A;  5GAN j;  3OYD A;  2M16 A;  3URG A;  4C8Q G;  1VQ5 A;  4MZT A;  2VUB A;  2AHJ B;  1VQ5 T;  3MCA B;  3HFN A;  1S72 A;  1K9M C;  2XID A;  1I81 A;  1BI0 A;  3CEY A;  4EMK C;  3LX7 A;  3QKJ A;  4V2S A;  1Y7X A;  1N9S A;  4OB1 B;  4M7A D;  3NTI A;  2XKO C;  4NL2 A;  3OYK A;  1JBM A;  2DD4 A;  5LJ3 g;  4C92 B;  2E65 A;  2XDD A;  3CCQ A;  3FIF A;  5LJ3 e;  3SD4 A;  2XHC A;  3QZ5 B;  4FT2 A;  2K5I A;  1VQM A;  2FVU A;  3A5Z B;  2RD1 A;  3HL8 A;  4PJO F;  1VUB A;  2LC4 A;  1WGS A;  3CCJ A;  2PVD B;  4MML A;  5GMK j;  4O5V A;  3C4S A;  4HCC A;  1M1K C;  2X4J A;  3QZ9 B;  5D6X A;  4KUI A;  3SDZ A;  4BI3 A;  5CR2 A;  5DY9 A;  3M59 A;  4LDV A;  5FU7 C;  4QQD A;  1KQ2 A;  1RL2 A;  3JCM Q;  2EQU A;  4M77 G;  1JRI A;  3E9G A;  1N6A A;  2B8A A;  3HP9 A;  3VKI A;  3WVD B;  3Q1J A;  4A4G A;  2XU8 A;  4BY6 C;  4EMK A;  1YIJ A;  3GIB A;  5LJ3 h;  1M1F A;  4XTX A;  2Y4X A;  4M7D A;  5GAM g;  3RKW A;  4HCZ A;  1UGP B;  1ZHI A;  1K8A C;  4J6Y A;  2Y90 A;  1QVF A;  2X4Y A;  4C8Q D;  2DXC A;  1IRE B;  3OYL A;  3CCR T;  2XK0 A;  4BI8 B;  4L59 A;  5CK9 A;  2F5K A;  3M9Q A;  3JCM J;  1MGQ A;  4M75 A;  1VIF A;  3BW1 A;  3FDR A;  1G3W A;  1UGS B;  3M58 A;  3CBM A;  4MZP A;  5J26 A;  5J3B A;  2WSF E;  4LDW A;  5LJ3 j;  3GF5 A;  3VU3 C;  2JZ2 A;  3S3N A;  4N0A A;  4IUT A;  3JAM E;  4FM4 B;  2D9T A;  1P92 A;  3WXM B;  4A4E A;  1VQN T;  4VUB A;  3H8Z A;  3ZBD A;  4M7D B;  2CGH A;  3G71 A;  2VGM A;  4RCC A;  3I56 A;  3OS5 A;  1U1T A;  3J81 E;  3FEO A;  2M1H A;  4JRQ A;  2H3J A;  4C5E A;  1QP2 A;  1KHI A;  3C95 A;  3HRU A;  1OYX A;  3MP6 A;  2KK4 A;  4L5G A;  5GAO m;  5GAN 8;  4HA8 A;  1KQS S;  2VXF A;  2E10 A;  4M75 B;  3OYA A;  4DOW A;  2VXE A;  4JUV A;  1YI2 T;  5GAM j;  2K3Y A;  5HY6 A;  3RES A;  5GAO r;  4M77 C;  5GAN d;  3CME T;  2D0Q B;  3TRE A;  1AHJ B;  2OTL A;  3F70 A;  5FRO A;  4PKC C;  4DOV A;  4M75 E;  4ZGJ B;  1UB4 A;  4R56 A;  3E9F A;  2CZ0 B;  3BY7 A;  1VQ6 A;  1TH7 A;  2DTH A;  4BDY A;  2M0O A;  5GMK m;  2QQA A;  2RI2 A;  4B9X A;  3P8D A;  3L2Q A;  2PUK B;  3X28 B;  1JJ2 S;  1VQL A;  3UPU A;  4IUU A;  5DLO A;  2QA4 T;  3VJP A;  3PMI A;  4OB0 B;  2R5A A;  3M57 A;  2QQR A;  3GNG A;  2PUO B;  3PMT A;  1OZ3 A;  1LNX A;  4NS5 A;  2PVO B;  3QYH B;  3CCM T;  3CCU T;  3PFS A;  5CIU A;  2ZPI B;  3CCS A;  4A4H A;  2DAQ A;  2X35 A;  4C92 C;  1EIF A;  3JCM P;  1FWZ A;  2CYZ B;  2DTO A;  5CQY A;  2FHD A;  2DKG A;  4FL6 A;  4C8Q F;  3JCM X;  2L89 A;  2ZZD A;  3KUF A;  2XDB A;  2DXB A;  2FL7 A;  5CKH A;  3LYI A;  1I5L A;  4JLG A;  3CCU A;  2F5T X;  4Z02 A;  4II1 A;  2XI9 A;  1D3B A;  1Y71 A;  4GLK A;  3CPW A;  4Y91 A;  4M75 G;  4C5I A;  1H3Z A;  2YLC A;  2QQ9 A;  3G6E A;  3DLL A;  2NLU A;  3L2U A;  2EQK A;  2I2L A;  1N8R U;  3MEW A;  4IUP A;  3FLG A;  4MMK A;  1YIT T;  1M4Z A;  4F7U F;  1RI0 A;  4F7U E;  4QVZ A;  3DKM A;  2MWP A;  1VQO T;  5D6W A;  3R6O A;  1WQW A;  2EQM A;  1UEB A;  2GFA A;  5GMK e;  1VQ9 T;  4BE0 A;  3CBP A;  2EJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...