5LJ3e

Structure of the core of the yeast spliceosome immediately after branching
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
83
structure length
75
Chain Sequence
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSKGTPLGKILLKGDNITLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
total genus 9
structure length 75
sequence length 83
chains with identical sequence p
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj3e00
3V8JA 3M4GA 4M7DE 1BIBA 3JCMh 4M75B 4C92F 4C8QB 4M7DC 4PJOA 4RCBA 5LJ3g 5GANg 5GMKl 2E10A 5GAN2 2EAYA 3EFRA 4F7UF 3VU3C 5GAOn 3AHUA 1WQWA 4NL3A 5GAMg 4M7AE 5GAOq 3SWNC 3PGGA 4M77B 1KQ2A 4M7AC 2Y90A 4M7DD 5LJ5h 3INZA 3HSBA 4C92B 3FJPA 4M78G 4J5YA 4X9CA 4XU3A 4M75A 3JCMW 4N0AA 2CGHA 4XU2A 5LJ5j 3V7CA 4C8QA 2E64A 4A54A 5GMKi 3JCMX 5I21A 3QSUA 4XU1A 3BY7A 3JB9I 4PJOG 3JB9J 3EFSA 4M7DF 3RESA 4J6XA 3JB9F 1I4K1 1JRIA 4HT8A 3RERA 3L2ZA 1JBMA 2DKGA 3JCMf 4M77A 1M8VA 4EMKC 4XTVA 5DY9A 3V7SA 2EJGA 2VXFA 2VC8A 4M7AF 2VXEA 2FB7A 4M75G 4XTZA 1WNLA 4JRKA 4HT9A 4QVDA 4C8QG 4M7DB 2DTIA 4M78E 3JCMJ 3BFMA 2I2LA 5LJ3e 5GANe 5LJ5f 1BIAA 4M78C 2DXTA 5GAN8 1B34B 1I8FA 4NOYA 5GAMe 3JCMd 4PJOE 3SWNB 4M77G 5GAN4 1WPYA 2RA2A 3BW1A 4PJOC 1U1SA 3BDUA 3JB9D 3JCMP 1HXDA 2HNIA 4JLIA 4XU0A 3FB9A 4WF2A 2DZCA 4F7UB 2DJZA 1H641 4J6WA 5LJ5d 2DEQA 1B34A 4M75E 3JCMb 3HFOA 4M7AD 1I5LA 3JB9H 4C8QE 4PJOD 1U1TA 3JCMg 4M78F 4N0AC 3RKYA 2DVEA 3RUXA 4C8QC 2DTHA 2RD1A 3JCMc 4C92A 4EMKB 5GAOm 4JRIA 4MMKA 4PJOF 4OP0A 4M77E 5GMKh 5GMKe 4X9DA 4F7UA 2RM4A 2DTOA 1N9RA 3SB2A 5GAN6 1HK9A 4M77C 5GMKj 2JN0A 1X01A 2QTXA 5LJ3h 5LJ5g 5GANh 4V2SA 5GAOr 5GAN7 2YLBA 5LJ3j 2E41A 4QVCA 5GAMh 3QO3A 4XQ3A 5GAOl 5GANj 5CAIA 4M7AB 1D3BB 1LOJA 5GAMj 4RCCA 4C92G 2DXUA 5GAOp 4C8QF 1M5Q1 1Y96B 3V8KA 4PNOA 4M78D 3V7RA 4M7DA 1LNXA 4J6YA 2RB6A 4F7UG 5GMKm 1TH7A 4A53A 3V8LA 4JUVA 4M77F 2ZGWA 1YCYA 1N9SA 4M75C 4XTWA 3QUIA 2YLCA 3SWNA 1D3BA 4XTUA 3JCMe 4M7AA 4XTXA 2YHTA 4DQ2A 1Y96A 3QHSA 5LJ3f 2EJ9A 2DZ9A 2E1HA 2E65A 5GANf 3HFNA 3L1AA 5GAN3 2K57A 5GAMf 4HA8A 4EMHA 4M7DG 4C92E 1MGQA 4M75D 3RKWA 3JCMV 4EMGA 5GAN5 3JB9G 4C8QD 5LJ5e 3RKXA 2FYKA 4C92C 1LJOA 4M78B 4F7UE 3GIBA 1WQ7A 4EMKA 4NL2A 4XTYA 1I81A 4M7AG 4M75F 3RIRA 4PJOB 5LJ3d 4M77D 1KQ1A 5GANd 3JCMQ 2EJFA 2EWNA 4C92D 5GAMd 4Y91A 4MMLA 3FIFA 4M78A
chains in the Genus database with same CATH superfamily
3QJ6A 1YWOA 3MEWA 2QTVA 2M0YA 4KRTA 1VQ8T 1YI2T 4OF1A 4C92B 5HCKA 3OYIA 2QEXA 2KVQG 2QA4Q 1NYGA 1W2BS 2YSQA 3LW5E 1UEBA 3M56A 3VV0A 4FYXB 3CBMA 3HL8A 1FWZA 1IGQA 3BFMA 3EAEA 2VWFA 2DD4A 3QXEB 1OPLA 2EQUA 3J81E 3PVQA 1TU0B 3CCUQ 4C0DC 2LJ3A 1KQSP 1G3WA 1RUWA 1SSHA 2D8HA 2ROTA 3JSCA 2FRWA 2YXYA 4CC2A 3JB9H 2EYZA 1W1FA 2RJFA 1KC8R 3EFOA 1RACB 5GMKe 2RO0A 1K9MR 1KK7A 2XMFA 4JS5A 2QGFB 1M30A 4DOVA 1GL5A 4JJCA 3M54A 1RAAB 1M1GA 1WIEA 1ZSGA 2O4XB 3OS0A 3EG1A 1ZSZB 2JJ9A 1V29B 1VQMQ 2CZ7B 1S72T 3EH2A 3QHSA 1D0XA 1BI1A 3HPWA 2RHZA 2DL7A 1OU9A 1WA7A 2RQWA 1G3YA 1BBZA 1C0MA 4FSXA 3VS2A 1XQHA 2HCKA 1M1KU 3ZEHA 1W2BP 1IO6A 1PCXA 1R8OB 1NPRA 2QK0A 1WJSA 3OYGA 2MWOA 1YJNT 3M58A 5IHKA 3M0PA 2EVRA 2CH4A 3G71A 1ABQA 2ECZA 3MEUA 2Y90A 2EKOA 1U3OA 4N0AA 2JW4A 2L3RA 2OTJT 3JB9J 1I4K1 4BDYA 1WHGA 2DNUA 4OMPA 5DY9A 4CI0C 1XOVA 4M7AF 3QDFA 4JJBA 2KRNA 4ZNXA 1UJYA 3ME9A 4PJOE 3RNJA 3U23A 2KRMA 1PD1A 3CCVA 1Q7YC 1G8XA 2CP7A 4J6WA 2KMTA 2SEMA 2OTLA 3VKIA 4AFZC 4ZN1A 2K3BA 4C92A 3WXMB 4BI3A 3OYFA 1PWTA 2M1HA 4M77E 5GMKh 1QVFP 4LDUA 1N9RA 2P0PA 4OMFB 3SB2A 1X01A 2XK0A 4PJNA 5J3BA 1KQSA 1UUEA 1X6GA 3CPWS 3CC7Q 3O8VA 5GJWB 1ZA1B 4E7LA 2COZA 3G4ST 4PFPA 1WDXA 4XTWA 1BU1A 5A0DA 2L3PA 2E70A 1NJIU 4BE1A 2OJ2A 2F5TX 5GAMf 2M16A 4PLLA 4VUBA 2CKKA 3CD6Q 4M7AG 3CXCA 1VQKQ 3EG9B 5EC7A 3CCLT 3OQ5A 1GBRA 3KXTA 1YITA 1IXDA 1S1NA 3OMCA 2A28A 3HTRA 4KGXB 4L5GA 4C8QB 2CP5A 4E47A 4F7UF 4RKUE 1WQWA 4M7AC 5LJ5h 3CC4T 2DK3A 2DO3A 3OS1A 2RPNA 2LX9A 3RESA 3M0UA 1HSQA 3L2ZA 2DKGA 3C95A 1NJIC 2DAQA 2QEXQ 3QYHB 1EZZB 2COWA 4JRKA 2EKHA 3TSWA 1CKAA 2A0FB 4LDVA 2MMPA 2XU8A 3KBGA 3OYBA 1VQ5A 2GQVA 1MMDA 3E9GA 2GFAA 2K3YA 5LJ5d 1SG5A 2CP3A 2E6ZA 2E5KA 4J9EA 3OYNA 3CCRA 2K7AA 3LWIA 4NS5A 1HK9A 4HKEA 1TTHB 1B7TA 2GNCA 4J9HA 4GLKA 1LOJA 4JRPA 2V8JA 4P5NA 1YI2A 1K0XA 1H3HA 1M5Q1 4ZGDB 1IB8A 2BZYA 4F7UG 2EPDA 1M2VB 2ZPIB 4ESRA 2YRVA 3AT1B 1UG1A 2KK4A 1K0SA 1YJWA 2DZ9A 3DKMA 1C6VX 1M3AA 3C4SA 1Q82R 4HA8A 3VS6A 1D1CA 1MGQA 2LP5A 3EG3A 2C06A 2F2WA 4BDZA 1VQNT 1WQ7A 2DBKA 4M77D 2EWNA 2L89A 2Y4YA 4BI8B 1X27A 1FMKA 1ZX6A 3CCJA 3CC2T 4HCBA 1WLPB 2KAFA 4DA4A 4RCBA 2DRKA 1K76A 1X2QA 1PC0A 2CH4W 2PU9B 4J83A 4EPCA 3EHRA 3L2VA 4LUDA 4N4GA 1NE8A 1B07A 4QT7A 4R55A 3G71Q 2VGMA 4OVAA 1T0JA 1SPKA 3RERA 1SRMA 1M8VA 1B3QA 2MK5A 5FU6C 4IUQA 1MNDA 3PIPA 3QPHA 4M75G 4XTZA 3P8DA 1H92A 2QA4A 2LMJA 3SDZA 1S72A 4PJMA 1X69A 4X1VA 2EIFA 1WHMA 4M4ZA 4J9BA 3KFVA 1QVGS 1HD3A 3MP8A 3EG0A 3CCQA 2RD1A 4BACA 2LTOA 4MMKA 1NG2A 2OTLQ 4OB2B 3G6ET 3CCUA 1WGSA 4LXCA 1VQ6T 2X4XA 5LJ3h 3CMAQ 2DL8A 2LVMA 3LGLA 1Z9ZA 4LDWA 3OSSC 2A3LA 2O31A 3THKA 1VQLQ 1MV3A 1M90U 2JS2A 1HJDA 3OYYA 1JXOA 4PFZA 3S3OA 4C0FA 3J80E 1ACMB 2HKQB 3EGXB 3OY9A 3CBPA 1KC8C 4KUDK 2LNVA 4QQ6A 1X2KA 3PNWC 2ZCFB 4OGEA 1CSKA 3OMGA 5KE3A 3OYJA 1BK2A 1K9MC 1VQ7T 1T3SA 4BB7A 1AWXA 1QCFA 3HRSA 3M59A 5LJ3d 2KXDA 1VQMA 2KDSA 2EJFA 2OAUA 1YHQQ 1SF9A 3PT9A 3V8JA 1BIBA 1E7OA 1VQPA 2GQIA 3A8GB 4F16A 2JVVA 4MZMA 1YITQ 4BUGA 2ROLA 1D1AA 3HSBA 3I9QA 2HSEB 5FROA 1NLPC 1MMNA 2EYWA 1VQOT 4HCKA 2DJQA 2D1XA 3I56T 2LC4A 4B9XA 4JS4A 1NZ9A 2VASA 1OX8A 3M4YA 2HKNA 1K9AA 3ULRB 5LJ5f 2XI9A 5GAN8 1GXIE 7AT1B 4J9DA 2RA2A 3EFOB 4QKUA 1VQ4A 3CEYA 3NTHA 3P8HA 3HP9A 4AG2C 2DF6A 1WYXA 5CKFA 4JRQA 1B34A 2WACA 1NLOC 4RTUA 3GP8A 1KD1C 1VQ5Q 4M78F 3JCMc 4EMKB 1ZBXA 4OB1B 3VS7A 3VJPA 1F1BB 1VA7A 2DL5A 3L2RA 2RQTA 3CMET 2DETA 4RCCA 1VIEA 2P0KA 5HK3A 1QKWA 3DLMA 2F2XA 1VQ8Q 1VQ9T 3O5ZA 1YI2Q 3X24B 3CC7A 4R0KA 5J39A 2A36A 1WHKA 3EGUA 2DBMA 4QVZA 1QP2A 2CT3A 2LJ1A 1WFWA 4II1A 4AT1B 2LQWA 1YJWQ 2P84A 1KQ1A 1Y57A 1IREB 3JCMQ 4Y91A 2WSEE 4N4HA 3FIFA 2O2OA 3JCMh 4CC7A 1WJRA 4PJOA 4UC4A 3H0HA 3VS3A 4DBHA 5GAN2 5KCOA 2DXBA 4BY6C 4M7AE 3SWNC 1SKUB 1K4US 3S3MA 3HRUA 1KQ2A 2JM8A 3CCJQ 3OS2A 1ZHIA 3FJPA 4M78G 4DBFA 3MHXA 1ZBJA 3ASKA 4Z8AA 3QYGB 1AZEA 4XU1A 1E6HA 3RMSA 1V76A 3JB9F 1QKXA 4M77A 4IUTA 1JB0E 5DM7R 2VXEA 2SRCA 2KT8A 2DTIA 1IRXA 2FG0A 1TOVA 4M78C 4HVUA 3JCMd 4DBQA 2PUOB 2HNIA 2EGEA 1VQNA 2JM9A 3OYKA 1S72Q 3FDRA 4C5GA 3FLGA 3HHTB 1I5LA 2FPFA 4WTOB 2EGAA 1QP3A 2DD5A 1BB9A 3OW2S 3NTIA 3CC2A 4KGZB 2QQ9A 5GAN6 2JN0A 2ED1A 1TXQA 4QQGA 1OV3A 3CCQQ 4ORZA 3OYCA 1RLPC 3UPUA 2BZ8A 4ZGEB 1Q82U 2HEQA 4PNOA 5KYUA 4C0DB 2RMOA 1UGSB 4OMLA 3I5RA 1RABB 3CCET 5CO7A 2X9HA 4O5VA 2F2VA 1D3BA 3UA6A 2GTJA 3QWXX 3BDLA 3NPFA 5LJ3f 3L1AA 3GBQA 3RKWA 3JB9G 4L59A 1JO8A 2LX7A 4F14A 1YP5A 4F7UE 2KE9A 4EMKA 5IH2A 2J7IA 2KXCA 3TVTA 2IPOB 4MDWA 1TWBA 4IIOA 1JXMA 4MMLA 2FZGB 3QJYA 3VUZA 3GNFB 4KT0E 2K5FA 5GJVB 5GMKl 2E10A 4K11A 3EFRA 1M3CA 1PNJA 1Q82C 4X34A 4M7DD 1VQ6A 1M90R 1N8RU 1JEGA 1VQPQ 1TS9A 2NLUA 3JB9I 4M7DF 1ZSZC 5I22A 4HCZA 2QASA 1Y71A 4LE9A 1UDLA 4J9FA 5FW9A 3GLXA 5GANe 1AHJB 1GCQA 3OYMA 3G4SQ 2DMOA 2R57A 3M9QA 4RTTA 2FEIA 2DZCA 1PD0A 4M7AD 4M75E 3A8HB 2RHXA 2K2VA 1JJ2S 3QDRB 3UDCA 1VQ4Q 3L2UA 2JZ2A 2D9TA 3JV3A 3PMIA 3X25B 4HVWA 2M51A 3MEAA 1TUDA 3JAME 5GANj 1M1KC 4E6RA 4C8QF 1UHCA 2ZPGB 4YTLA 3V8LA 4JUVA 1ZQ1A 3CMAA 2YRDA 1YCYA 2BIVA 2P0QA 4XTUA 2C0IA 2EYQA 1KSWA 4M7DG 3M0QA 1VQLA 2OAWA 2J6OA 3RKXA 2WSCE 2BE9B 2L5QA 3IQLA 2DX1A 3FEOA 2JT4A 1K73R 1YIJA 3NFCA 4FM4B 3WVEB 1I0CA 4XAXB 2PVOB 5D6YA 2JOYA 2LT1A 1H8KA 1WX6A 2V1QA 4M7DC 2QGGA 5GANg 1P92A 2JMAA 2DA9A 2BTTA 2JTMA 2M0OA 5KE2A 2QG9B 1YHQA 3PIOA 3QZ5B 2E12A 5KYXB 3NGPA 2A08A 2IIMA 4J9GA 2VUBA 1QW1A 2XDBA 3EFSA 4HT8A 3JCMf 1FXXA 2FB7A 4JLGA 3OBWA 4C8QG 3JCMJ 2JXBA 2XD0A 1AVZC 1YJ9A 2V8KA 1FMWA 4FYWB 2DYIA 3CCSA 1W2BA 2PZ1A 3LH5A 1NM7A 2KROA 4ATOA 4WF2A 2BZXA 1QMCA 2RF0A 2NUZA 2YUPA 2D0QB 4A4KA 4C8QC 1VQNQ 1RAIB 4KUIA 3I5SA 4FW1A 2MAMA 1LPLA 2D8JA 2KQWA 2ZPBB 4JZ4A 3H6ZA 2MI6A 4J9IA 3H41A 1Y07A 3CPWP 3CC2Q 1T0HA 3TREA 2RHUA 4A4EA 4RUGA 4A63B 4LNPA 4QW2A 1N9SA 2YLCA 2DLPA 1W6XA 1Q86U 3M0SA 1UGRB 1UJ0A 3NMZC 2ESWA 5IXFA 4EMHA 4M75D 4EMGA 1D09B 5GAN5 3GNGA 4HCCA 2OX7A 1OEBA 1VQ8A 3DLLA 4M75F 3I55T 1XTDA 2CP2A 2A7YA 1U8RA 1WZOA 2Z0WA 4Z88A 1QVFA 5FRNA 3FJ5A 3E1SA 2XDPA 5HY6A 1IGUA 3M4GA 4CC4B 1VQKT 4N4IA 3E2UA 4PJLA 2EAYA 2CDTA 2KSSA 1M1FA 4XU2A 3A8MB 2CREA 2YDLA 1JRIA 5FWBA 3G6EQ 5AT1B 2B8AA 4J8OA 1VQ6Q 4E7HA 3V7SA 4BI4A 5AYFA 1X75C 2PTKA 4GY5A 3TSZA 2HD0A 2AZVA 2CP0A 4M78E 2QEXT 2GBQA 2DXTA 1B34B 3N5BB 4A4FA 1YNZA 5CKDA 4FYYB 2MCNA 1QLYA 2J6FA 3UATA 3UF4A 3JCMb 2VYTA 2E3IA 1RAEB 1N27A 1XJWB 5FU6B 1AT1B 5GAOm 5KYXA 4FL6A 1KHIA 2P4TA 1N8RR 2ZPFB 3OYEA 2LZ6B 4HVVA 2K79A 4V2SA 2B86A 1GRIA 5CAIA 1BKBA 2AT1B 2KT1A 3A1PA 8AT1B 4B9WA 1LNXA 2GTOA 2NUPB 2PUKB 1OU8A 1KG1A 4M75C 1G2BA 3VRZA 4M7AA 3CQTA 2X3WD 1VIFA 5IAYA 3T9NA 2E65A 3Q1JA 1YJNA 2K57A 3CPWA 3META 1N6AA 3NHNA 1OOTA 2M02A 3GF5A 4GBQA 3I56Q 4PJOB 1SHFA 4PKCC 2OTJA 4OMMA 5DLQE 1TG0A 2CZ0B 3F70A 1YIJQ 1VUBA 5FU7B 2RK2A 1OZ3A 1OYXA 4ZGJB 2A37A 3NTKA 4NL3A 4PLIA 4JJDA 3BE3A 3OYHA 2YT6A 1T3LA 4M77B 3L2WA 1ZUKA 4X9CA 2ABLA 1MMAA 3JCMX 3OA6A 5I21A 5CK9A 4CRIA 1J3TA 2LJ0A 2DL4A 4DBRA 4OB0B 1VYUA 1O9SA 1GFDA 4HT9A 1UB4A 1E6GA 1BIAA 1YFNA 4AMCA 3MKDA 5GAMe 2HAXA 4ZTJA 1AWWA 2JS0A 3A5ZB 5D6WA 4F04B 2ZPHB 1HXDA 1M90C 4JLIA 1D0ZA 3PE0A 1QWFA 4PFOA 3SFMA 2DJZA 1QVGP 4JDSA 1YJ9Q 1WXBA 3PVLA 2XG8D 5CKHA 1U1TA 2E6NA 2OI3A 1TUCA 2J05A 3CCSQ 1QVPA 3H8ZA 4AG1C 3G4SA 2PVDB 1FYNA 1GFCA 1OULA 4OP0A 2L8DA 4X9DA 1VYTA 4F7UA 5KYUB 2DTOA 5KYWA 4BE2A 1EX4A 2I0NA 1LCKA 3SD4A 1YN8A 2K2MA 3CCVT 5GAOr 4BE0A 5GAOl 5CKBA 3J7AF 2OTLT 2MOXA 3A98A 4FYVB 1D3BB 5GAMj 2XHCA 5GAOp 3ER0A 4Y28E 4B6MA 4M78D 3UA7A 4J6YA 4E7SA 4E2FB 4DEXA 6AT1B 3CCMT 4A53A 1K8AR 4LD6A 1K73U 3EHQA 3ZL7C 9ATCB 5IN1A 2ZGWA 1GCPA 1OX9A 1WXTA 2LQNA 1UHFA 2GF7A 2RI3A 3RMQA 3FC3A 3CCLA 1PKTA 2RNAA 1WJQA 1VOMA 2E1HA 1VYVA 2E3HA 5GAN3 2R5AA 1M3BA 2E5QA 2FYKA 1D0YA 1Z9QA 4XTYA 4JJNK 2ENMA 2YUQA 4OMQA 2FPDA 2DL3A 3CC4A 1MUZA 4C92D 1U06A 1JU5C 1R0CB 1UE9A 4Z89A 3MJXA 2HSPA 4JZ3A 4FT2A 4M7DE 4C92F 3DB3A 3OS5A 1QCNA 2L0AA 2VKNA 3R6OA 4FSSA 2NUPA 4AFUC 3H0FA 5GAMg 3PGGA 3OBYA 4PK4A 3JCMW 3X28B 4M75A 5GMKi 4A54A 1K73C 2RHYA 4FCYA 3HKSA 1Q86R 2RQVA 4XK8E 2KY9A 1W4SA 3PFSA 4HXJA 4DOWA 4QVDA 3VYGA 2HL3A 5A0GA 5ECAA 1WHJA 4BY6B 2F69A 2DERA 2L3QA 5M9OA 2JTEA 3SWNB 5L8RE 3BDUA 2EQIA 3JB9D 3CCEQ 1KQSS 4IUVA 2DEQA 1WXUA 4F17A 4C8QE 3EGDA 4N0AC 3RKYA 2BE7D 3VRYA 2EYXA 2VGNA 1MMGA 1YBYA 4RTZA 4D8DA 1VQ5T 2RM4A 2NYSA 1V1CA 5IT9E 1MHNA 2QTXA 3A8LB 2R58A 1QVGA 5A0LA 2C0OA 2E41A 2HBWA 2EQMA 4C92G 4WCIA 3RBBB 4D8KA 3CCRT 1PSEA 3CXCS 1KFZA 1G83A 4XTXA 4IURA 5C6SA 4ZN3A 2QQSA 1XNIA 3LLRA 4C92C 5FLXE 3GIBA 4MZTA 4NL2A 5KCHA 3EH1A 4OB3B 1YJNQ 2HL5C 2MF2A 4FIBA 4E7JA 1YJWT 3TCJA 1I1JA 3X26B 2Y4XA 3ZFJA 3S6WA 2F5KA 3FRNA 2R5MA 2OTJQ 2LCSA 2X4JA 2KEAA 4XU3A 2ED0A 3M57A 2CGHA 2X35A 3V7CA 3M5AA 1AWJA 3QSUA 2M9UA 1NEBA 3CCJT 3C0CA 3TQ7P 2RI2A 5KYYA 4Y92A 2VVKA 1JBMA 2DXCA 2O88A 2AIRB 4BD3A 2VC8A 1EIFA 2CP6A 4E7IA 1I07A 2KNBB 3RR6A 4A4GA 4IIMA 1AOJA 2AK5A 3DB4A 3G6EA 1M4ZA 2HQHA 5GAN4 2CZ1B 3BW1A 1M8MA 4XU0A 2FRYA 3FB9A 2PNIA 2RHIA 1TSFA 3MPUB 2EW3A 4GLMA 2G6FX 3CXCP 2P4RA 2QA4T 2LQ8A 4CC3A 3REBB 1QVFS 5C0MA 3OW2P 5A2QE 1PM3A 1R0BG 5I2SA 2FZCB 5GMKj 2BUDA 3S3NA 2D6FA 4O6JA 1TUGB 1BI0A 3I35A 3QWYA 2W10A 5KH6A 1M27C 1FMVA 1VQ7A 2K5IA 1IHWA 3CCQT 1TH7A 1Q7YU 4RTXA 3VUBA 3L42A 1YWPA 3SWNA 2CZ6B 4C5HA 3QUIA 3CCUT 2QQRA 2DM1A 4OMNA 2QYZA 1PRLC 1Y96A 1UTIA 2K3XA 1SSFA 1N8RC 2AHJB 4C8QD 5LJ5e 2DFUA 2KRSA 3CCLQ 2HQEA 3VS5A 2KI7A 1PHTA 1PKSA 1KD1R 2QQBA 2PVGB 1PRMC 1AWOA 4M78A 1I5OB 4RTWA 4C5IA 2RQUA 2NUTA 1G3SA 2DRMA 1VQOA 2J06A 3CC4Q 2X4YA 3LYIA 2V1RA 3I56A 4EDUA 4KH0B 1VQMT 3P8BB 2QAZA 3R6NA 1Q81R 3C12A 4J5YA 5LJ5j 1X6OA 2E64A 3OB9A 5HK0A 3BY7A 2FL7A 2KYBA 1RLQC 1VQPT 4MDXA 3RDVA 1QCOA 3CCMA 5FRMA 4J7FA 2DYBA 3OYDA 4M7DB 2K5LA 1UGQB 2GGRA 3CPFA 1EFNA 4A4HA 1I8FA 1BI3A 1ZUUA 3EG2A 3E19A 3TU4K 2O9VA 3JCMP 1M2OA 2IG0A 4J7IA 1RAFB 2YUNA 3ZBDA 4IUUA 4C5EA 1RAHB 1H641 3CMEA 3GPLA 3D7SB 2CUDA 1A0NB 3HFOA 2X51A 5CCAA 1UGPB 1H3ZA 4ELYC 1JJ2P 1GBQA 3QBYA 1K8AU 1VQ9A 5I11A 3SEMA 1SHGA 3I55Q 3REAB 5LJ5g 1NYFA 2XICA 5GANh 1VQ4T 3OYLA 2E4HA 4M7AB 2DXUA 3V8KA 1O75A 2W0ZA 3C94A 4PL6A 2JMCA 3OW2A 4KGVB 1JQQA 2RN8A 4L6V5 1UGVA 4E7ZA 2EYYA 2V8IA 3URGA 2FVUA 2H3EB 2YHTA 2O4XA 1R77A 4LUEA 2L3SA 2COYA 3JCMV 2G3RA 1ZSZA 1RAGB 3CBOA 4OMOA 4QQDA 3G7ZA 5GANd 4LN2A 3LH0A 1MV0B 1OPKA 2DEUA 3VYHB 1K8AC 4ANJA 3CC7T 1OZ2A 2F1LA 2CYZB 4LD9K 2K9GA 5DLOA 1D1BA 2KR3A 4FW2A 2RK1A 3KUFA 5HKCA 2JTFA 1CKBA 3M53A 1ARKA 3H9NA 3CD6T 1BYMA 2C0TA 2WSFE 1WNLA 5LJ3e 2X4WA 3E9FA 2EQJA 2EBPA 2KBTA 4ME7A 1WPYA 2DVJA 2KGTA 1ZUYA 3QG1A 2LT4A 4F7UB 4C0ZA 4EIKA 5KYWB 4Q5WA 4PJOD 1Q86C 3RUXA 2BKDN 1LVKA 4FU6A 4PJOF 3CCEA 3HRTA 5FWCA 5IXBA 2H3JA 1RI9A 2YLBA 5LJ3j 4XQ3A 4RG2A 3X20B 4Z02A 3QZ9B 2CT4A 2CSIA 3M55A 2LQKA 1JJ2A 4M7DA 2K6DA 4M77F 5IHNA 4DQ2A 1VQ7Q 1M9SA 3GOXA 4RTYA 4C0GA 4C92E 2QQAA 2FPEA 3VS1A 2X3XD 3QIIA 1KHCA 2CUBA 4KBMB 5CIUA 2MYSA 1NPPA 2CSQA 4J9CA 2YRCA 1PG5B 4M75B 1MNEA 2RH2A 5LJ3g 5GAOn 3EG9A 3VU3C 1KC8U 3AHUA 1M1KR 1W70A 1G3TA 5GAOq 1NEGA 2HZYA 5I2MA 2RJEA 3PTAA 2FZKB 1Q7YR 2L2PA 3SHWA 4C8QA 1VQOQ 1K9MU 3LWHA 3LX7A 2H8HA 1C1AA 4PJOG 4J6XA 3PMTA 2MPXC 3H0IA 2XKOC 3G1JA 4AFSC 4DEYA 2GCXA 4XTVA 3CCVQ 4KH1B 5CVIA 4IKFA 2QI2A 2LDMA 2LNHB 2JNGA 3MO8A 2I2LA 2NWMA 4NOYA 5EG2A 3VS4A 3CCMQ 4M77G 3EGDB 2AKLA 1SEMA 4PJOC 1U1SA 2QXFA 4PJJA 1FX7A 2JUFA 1KIKA 2YUOA 5D7UA 3A8OB 2LCCA 5CQXA 1UECA 2DE0X 2DVEA 5FU7C 2DILA 2DTHA 3G71T 4TVRA 4JRIA 1RI0A 2XIDA 3CMEQ 2KYMA 4M77C 3UT1A 2EFIA 5GAN7 4QVCA 3QO3A 3M0RA 4LDXA 4RTVA 5J26A 5L23A 1VQ9Q 1QWEA 5CKEA 3V7RA 1X43A 2RB6A 1AEYA 3LGFA 2DIQA 3OSVA 1ZA2B 2HDAA 5IHIA 3JCMe 2ATCB 2QDYB 1WHHA 5CR2A 1KD1U 2EJ9A 2O9SA 2EQKA 4MZPA 5GANf 2ZPEB 5LL6S 2EGCA 3WVDB 1N5ZA 3MP1A 4AFQC 1M2VA 1IZ6A 2ZZDA 3UWNA 4D6WA 1I81A 1Y0MA 3RIRA 1BI2A 2FHDA 3CMAT 4FT4A 5D6XA 2XDDA 1NJIR 1OI1A 1Q81U 5CQYA 1Y7XA 2MWPA 3TEEA 2VB6A 3L2QA 1VQLT 3MP6A 4OGCA 1YIJT 5KYYB 1YCSB 3INZA 3M0TA 1SRLA 2ZAEA 4R56A 1RL2A 2HBPA 3QKJA 3OYAA 4EMKC 1X6BA 2EJGA 1OQKA 2VXFA 1ZLMA 4IUPA 3MEVA 4ELZC 4ZTFA 1YHQT 1G5VA 2DIGA 4RG8A 1WHLA 1AZGB 3VS0A 5KYNA 3CCRQ 4JPBW 2V26A 8ATCB 1DJ7B 2VV5A 1PSFA 1Q81C 1YITT 2HMAA 1KJWA 2O01E 2DPPB 1QQJA 2AZSA 2IVWA 3JCMg 1IHVA 1K1ZA 2AKKA 2LCLA 4KULA 1ABOA 1YJ9T 2K4YA 2GFUA 2J6KA 3CCST 1UFFA 1HYOA 2MIOA 2YWWA 5GAMh 1RADB 2QDLA 2HQXA 2D0NA 1Y96B 2PQWA 1GCQC 5GMKm 3I55A 2RQRA 4LDYA 1BCOA 2RJDA 2CS7A 1Q95G 3CD6A 2RI5A 3HFNA 1VQKA 1WI7A 3JRZA 4RMOA 1AD5A 1U5SA 1LJOA 4M78B 3EGXA 2FO0A 2RJCA 4E7KA 2NUTB 2LRQA 1BCMA 5GAMd 1NBEB 3MCAB
chains in the Genus database with same CATH topology
3V8JA 3M4GA 1VQKT 3QJ6A 4N4IA 1BIBA 4C5IA 1VQPA 1G3SA 3MEWA 1VQOA 2X4YA 3A8GB 3LYIA 2EAYA 3I56A 1VQ8T 4EDUA 2JVVA 4MZMA 2KSSA 1VQMT 1YI2T 4BUGA 4OF1A 3P8BB 4C92B 3OYIA 2QEXA 1M1FA 3C12A 2KVQG 4J5YA 3HSBA 4XU2A 5FROA 5LJ5j 1X6OA 2E64A 3OB9A 3A8MB 5HK0A 3BY7A 2FL7A 1W2BS 1JRIA 3LW5E 1VQPT 4MDXA 1K9MU 2B8AA 1UEBA 4J8OA 1VQOT 4E7HA 3V7SA 3M56A 3CCMA 4BI4A 5AYFA 3VV0A 1X75C 3I56T 3CBMA 4J7FA 4GY5A 5FRMA 3HL8A 2HD0A 2LC4A 4M7DD 4B9XA 4JS4A 3OYDA 1FWZA 1NZ9A 4M7DB 4M78E 2K5LA 1UGQB 3BFMA 2QEXT 3M4YA 5LJ5f 3CPFA 2DXTA 2XI9A 1B34B 1I8FA 3EAEA 1BI3A 3N5BB 4A4HA 5GAN8 4A4FA 1GXIE 2DD4A 5CKDA 3E19A 3QXEB 2RA2A 3TU4K 2EQUA 3J81E 3JCMP 1VQ4A 2IG0A 3CEYA 3NTHA 3P8HA 4J7IA 3HP9A 4C0DC 3ZBDA 4IUUA 4C5EA 1H641 1G3WA 5CKFA 4JRQA 3CMEA 3GPLA 3JCMb 1B34A 2WACA 2VYTA 3HFOA 5CCAA 1UGPB 3JSCA 3JB9H 3GP8A 1KD1C 1H3ZA 4M78F 1N27A 2RJFA 4ELYC 5FU6B 3JCMc 4EMKB 3QBYA 5GAOm 4FL6A 1KHIA 2P4TA 1K8AU 1VQ9A 5GMKe 1ZBXA 2ZPFB 2RO0A 4OB1B 3OYEA 3VJPA 5LJ5g 5GANh 2XICA 1VQ4T 4V2SA 3OYLA 4JS5A 4DOVA 5CAIA 1BKBA 3L2RA 3M54A 4M7AB 3CMET 4RCCA 2DXUA 1M1GA 1VIEA 2P0KA 3V8KA 1O75A 2O4XB 5HK3A 3C94A 4B9WA 1LNXA 4PL6A 3OW2A 3DLMA 3OS0A 2PUKB 1VQ9T 1KG1A 4L6V5 4M75C 1V29B 4M7AA 3URGA 2V8IA 2FVUA 2CZ7B 1VIFA 3X24B 2YHTA 1S72T 3QHSA 2O4XA 5IAYA 1BI1A 3HPWA 2E65A 3T9NA 2RHZA 3CC7A 3Q1JA 1YJNA 2K57A 5J39A 3CPWA 3JCMV 3META 2G3RA 4QVZA 1QP2A 1N6AA 3CBOA 4QQDA 1G3YA 4II1A 4FSXA 3G7ZA 3GF5A 1XQHA 4PJOB 1M1KU 1KQ1A 5GANd 3CC2A 1IREB 3JCMQ 3ZEHA 3LH0A 4PKCC 4Y91A 1R8OB 2WSEE 1NPRA 4N4HA 3FIFA 3VYHB 1K8AC 2OTJA 3CC7T 1OZ2A 5DLQE 1WJSA 3OYGA 2CZ0B 2MWOA 3F70A 2CYZB 1YJNT 4LD9K 3JCMh 1VUBA 1WJRA 3M58A 5FU7B 2RK2A 4UC4A 4PJOA 1OZ3A 3G71A 1OYXA 5GAN2 4ZGJB 5KCOA 2DXBA 3NTKA 4BY6C 4NL3A 4M7AE 4PLIA 3MEUA 3SWNC 3OYHA 3S3MA 3HRUA 4M77B 5DLOA 3L2WA 2Y90A 2EKOA 1KQ2A 3OS2A 2RK1A 1ZHIA 3FJPA 4M78G 4X9CA 4N0AA 3MHXA 3ASKA 3JCMX 3KUFA 3QYGB 3OA6A 2L3RA 5I21A 5HKCA 2OTJT 4XU1A 3JB9J 3RMSA 5CK9A 2JTFA 3JB9F 1I4K1 4BDYA 3M53A 4CRIA 4M77A 4IUTA 1JB0E 5DY9A 3CD6T 4CI0C 4OB0B 5DM7R 1XOVA 1BYMA 1O9SA 2VXEA 4M7AF 2WSFE 1WNLA 4HT9A 1UB4A 2DTIA 5LJ3e 1BIAA 2X4WA 3E9FA 4M78C 2EQJA 5GAMe 3JCMd 3ME9A 4ZTJA 2PUOB 2HAXA 4PJOE 4ME7A 3A5ZB 1WPYA 5D6WA 2ZPHB 1HXDA 2HNIA 4JLIA 3CCVA 1M90C 1Q7YC 3QG1A 1VQNA 2LT4A 3OYKA 3SFMA 4F7UB 3FDRA 2DJZA 4J6WA 2KMTA 4C0ZA 4C5GA 2OTLA 3FLGA 4JDSA 4Q5WA 3HHTB 2XG8D 1I5LA 5CKHA 3VKIA 4PJOD 1U1TA 2E6NA 4ZN1A 1Q86C 1QP3A 2DD5A 3RUXA 1QVPA 3OW2S 3H8ZA 4C92A 3WXMB 2BKDN 4BI3A 3G4SA 2PVDB 4FU6A 3OYFA 1N8RC 2M1HA 3NTIA 4M77E 4OP0A 4PJOF 2L8DA 4LDUA 4X9DA 4F7UA 5GMKh 2DTOA 3HRTA 1N9RA 2QQ9A 2P0PA 4OMFB 3SB2A 5GAN6 2JN0A 1X01A 2XK0A 2H3JA 3SD4A 3CCVT 5GAOr 4BE0A 1KQSA 2YLBA 5J3BA 5LJ3j 5GAOl 4QQGA 4XQ3A 5CKBA 3CPWS 4RG2A 3OYCA 3X20B 3UPUA 4Z02A 2OTLT 3J7AF 1D3BB 3QZ9B 2XHCA 5GAMj 3O8VA 4ZGEB 1Q82U 5GAOp 3ER0A 3M55A 4Y28E 2LQKA 1JJ2A 4PNOA 4M78D 4M7DA 4J6YA 4C0DB 4E7LA 3CCMT 4A53A 1UGSB 4LD6A 3G4ST 1K73U 4M77F 5IN1A 3CCET 5CO7A 2ZGWA 4XTWA 4O5VA 3CCLA 3RMQA 1D3BA 2GF7A 3FC3A 2RI3A 5A0DA 3BDLA 2E70A 4DQ2A 1NJIU 1WJQA 5LJ3f 4BE1A 2E1HA 4M78A 1M9SA 3L1AA 2F5TX 3GOXA 5GAN3 5GAMf 4C0GA 4C92E 2R5AA 2QQAA 2E5QA 3RKWA 3JB9G 2M16A 4L59A 2FYKA 4F7UE 4PLLA 4VUBA 2CKKA 4EMKA 4XTYA 4JJNK 4M7AG 3QIIA 3CXCA 3CC4A 4C92D 4MDWA 3CCLT 1KHCA 3OQ5A 4MMLA 4KBMB 3KXTA 5CIUA 1YITA 3QJYA 4FT2A 3VUZA 1NPPA 3OMCA 4M7DE 4C92F 4M75B 3DB3A 4L5GA 4C8QB 3GNFB 3OS5A 2RH2A 4KT0E 2K5FA 4E47A 5LJ3g 5GMKl 2E10A 5GAOn 4F7UF 3EFRA 3R6OA 4RKUE 3VU3C 1KC8U 3AHUA 1WQWA 5GAMg 1G3TA 5GAOq 1Q82C 3PGGA 5I2MA 4M7AC 2RJEA 4X34A 5LJ5h 3PTAA 3OBYA 3CC4T 2DK3A 1N8RU 3JCMW 3X28B 1VQ6A 4M75A 4C8QA 5GMKi 4A54A 2DO3A 3OS1A 3LX7A 2NLUA 3LWHA 2RHYA 2LX9A 1K73C 3JB9I 4PJOG 3CCEA 4M7DF 3RESA 4J6XA 3PMTA 3HKSA 2XKOC 3L2ZA 2DKGA 3C95A 4HCZA 1NJIC 4XK8E 2DAQA 2GCXA 2KY9A 3QYHB 4XTVA 1W4SA 3PFSA 5CVIA 4IKFA 1Y71A 2QI2A 2LDMA 4DOWA 4JRKA 4QVDA 3VYGA 4LDVA 2JNGA 5A0GA 3MO8A 2I2LA 3GLXA 2MMPA 1AHJB 5GANe 2XU8A 4BY6B 4NOYA 2F69A 3KBGA 5M9OA 5EG2A 3OYMA 3OYBA 3SWNB 1VQ5A 2GQVA 4M77G 5L8RE 4PJOC 1U1SA 3BDUA 3JB9D 2QXFA 2R57A 1FX7A 3M9QA 1KQSS 2JUFA 3E9GA 2GFAA 3A8OB 2DZCA 2K3YA 2LCCA 5CQXA 4IUVA 5LJ5d 2DEQA 4M75E 4M7AD 3A8HB 2RHXA 2K2VA 1JJ2S 4C8QE 2E6ZA 4N0AC 3RKYA 2DVEA 5FU7C 3QDRB 2DTHA 3UDCA 3G71T 3OYNA 4TVRA 3CCRA 3L2UA 2JZ2A 4JRIA 2D9TA 1RI0A 1YBYA 2VGNA 2XIDA 1VQ5T 2RM4A 3PMIA 3LWIA 4NS5A 3X25B 1HK9A 4M77C 1MHNA 3MEAA 2QTXA 3A8LB 2R58A 4HKEA 3UT1A 5IT9E 2EFIA 5GAN7 4BE2A 5A0LA 1QVGA 2E41A 4QVCA 3JAME 3QO3A 5GANj 4GLKA 1M1KC 2EQMA 4LDXA 1LOJA 4JRPA 2V8JA 5J26A 4P5NA 4C92G 1YI2A 4C8QF 1M5Q1 4ZGDB 3V7RA 5CKEA 2RB6A 2ZPGB 4F7UG 3CCRT 1PSEA 4YTLA 3CXCS 3V8LA 4JUVA 1ZQ1A 3LGFA 2DIQA 3OSVA 3CMAA 2ZPIB 1YCYA 3JCMe 2BIVA 2YRVA 2KK4A 2P0QA 4XTUA 2QDYB 4XTXA 5CR2A 4IURA 1KD1U 5C6SA 1YJWA 2EJ9A 2DZ9A 2EQKA 3DKMA 4MZPA 4ZN3A 5GANf 2ZPEB 3C4SA 2EYQA 5LL6S 4HA8A 3WVDB 4M7DG 1MGQA 2QQSA 3MP1A 1VQLA 1XNIA 3LLRA 2C06A 1IZ6A 3RKXA 2WSCE 4C92C 4BDZA 1VQNT 2ZZDA 2L5QA 5FLXE 3GIBA 1WQ7A 3FEOA 4MZTA 3UWNA 1YIJA 4NL2A 4D6WA 1I81A 3NFCA 4FM4B 3WVEB 4OB3B 3RIRA 5KCHA 1BI2A 2FHDA 4XAXB 4M77D 3CMAT 2MF2A 2PVOB 5D6YA 2EWNA 4FT4A 5D6XA 2JOYA 2XDDA 2L89A 1OI1A 2LT1A 2Y4YA 4FIBA 4BI8B 1Q81U 4E7JA 1YJWT 5CQYA 3TCJA 3CCJA 1Y7XA 3CC2T 3X26B 2MWPA 2KAFA 3TEEA 4DA4A 4HCBA 2Y4XA 3ZFJA 3L2QA 3S6WA 1VQLT 4M7DC 3MP6A 4RCBA 2F5KA 5GANg 4OGCA 1P92A 3FRNA 1YIJT 2R5MA 2JTMA 2M0OA 5KE2A 2X4JA 2PU9B 4EPCA 4J83A 3L2VA 1YHQA 3INZA 3PIOA 4N4GA 3QZ5B 1NE8A 4XU3A 2E12A 3M57A 2CGHA 2X35A 3V7CA 4R55A 3M5AA 2VGMA 3QSUA 2VUBA 1RL2A 4OVAA 4R56A 2HBPA 1QW1A 3QKJA 2M9UA 2XDBA 3EFSA 3OYAA 3CCJT 4HT8A 2RI2A 3RERA 1JBMA 2DXCA 3JCMf 1FXXA 4BD3A 1M8VA 5FU6C 4EMKC 2EJGA 4IUQA 2VXFA 2VC8A 3PIPA 1EIFA 2FB7A 3QPHA 4IUPA 4JLGA 4M75G 3MEVA 3OBWA 3P8DA 4XTZA 4ELZC 4C8QG 4E7IA 4ZTFA 1YHQT 1G5VA 3JCMJ 4A4GA 2QA4A 2DIGA 3SDZA 4RG8A 1S72A 2XD0A 1YJ9A 2EIFA 3DB4A 3G6EA 1M4ZA 5GAN4 2V8KA 3CCSA 1W2BA 2CZ1B 3BW1A 1DJ7B 2VV5A 4XU0A 1PSFA 1Q81C 1QVGS 3FB9A 2RHIA 4ATOA 4WF2A 1YITT 2O01E 2DPPB 2D0QB 2IVWA 3JCMg 4A4KA 3MP8A 4C8QC 2QA4T 2LQ8A 2RD1A 3CCQA 2LCLA 4BACA 1QVFS 2LTOA 4KULA 5C0MA 4MMKA 1YJ9T 5A2QE 4KUIA 2K4YA 4OB2B 3G6ET 2GFUA 3CCUA 1WGSA 5I2SA 3CCST 5GMKj 1VQ6T 2MAMA 2X4XA 2BUDA 5LJ3h 2LVMA 3S3NA 2D6FA 2KQWA 2ZPBB 3LGLA 4LDWA 4O6JA 5GAMh 3OSSC 1BI0A 3H6ZA 2MI6A 2A3LA 5KH6A 2HQXA 1Y07A 1Y96B 3TREA 2RHUA 1VQ7A 2K5IA 2PQWA 4A4EA 1M90U 3CCQT 5GMKm 1TH7A 1Q7YU 3OYYA 3I55A 3S3OA 4LDYA 3VUBA 4C0FA 3L42A 4QW2A 3SWNA 2RJDA 1N9SA 2CZ6B 4C5HA 3QUIA 2YLCA 2QQRA 3J80E 3OY9A 2CS7A 3CCUT 3CBPA 1Q86U 1KC8C 1Y96A 4KUDK 1UGRB 2LNVA 3CD6A 2RI5A 3HFNA 4QQ6A 3PNWC 1VQKA 3JRZA 2ZCFB 4OGEA 3OMGA 2K3XA 1SSFA 4EMHA 4M75D 4EMGA 5KE3A 4RMOA 5GAN5 3OYJA 2AHJB 4C8QD 3GNGA 5LJ5e 4HCCA 1K9MC 1LJOA 4M78B 1VQ7T 2RJCA 4BB7A 1VQ8A 3DLLA 2HQEA 4E7KA 3HRSA 3M59A 4M75F 3I55T 5LJ3d 1VQMA 1XTDA 2KDSA 2A7YA 1U8RA 2EJFA 2LRQA 2QQBA 2OAUA 2PVGB 5GAMd 1QVFA 5FRNA 3MCAB 3E1SA 2XDPA 3PT9A 5HY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8J A;  3M4G A;  4M7D E;  1BIB A;  3JCM h;  4M75 B;  4C92 F;  4C8Q B;  4M7D C;  4PJO A;  4RCB A;  5LJ3 g;  5GAN g;  5GMK l;  2E10 A;  5GAN 2;  2EAY A;  3EFR A;  4F7U F;  3VU3 C;  5GAO n;  3AHU A;  1WQW A;  4NL3 A;  5GAM g;  4M7A E;  5GAO q;  3SWN C;  3PGG A;  4M77 B;  1KQ2 A;  4M7A C;  2Y90 A;  4M7D D;  5LJ5 h;  3INZ A;  3HSB A;  4C92 B;  3FJP A;  4M78 G;  4J5Y A;  4X9C A;  4XU3 A;  4M75 A;  3JCM W;  4N0A A;  2CGH A;  4XU2 A;  5LJ5 j;  3V7C A;  4C8Q A;  2E64 A;  4A54 A;  5GMK i;  3JCM X;  5I21 A;  3QSU A;  4XU1 A;  3BY7 A;  3JB9 I;  4PJO G;  3JB9 J;  3EFS A;  4M7D F;  3RES A;  4J6X A;  3JB9 F;  1I4K 1;  1JRI A;  4HT8 A;  3RER A;  3L2Z A;  1JBM A;  2DKG A;  3JCM f;  4M77 A;  1M8V A;  4EMK C;  4XTV A;  5DY9 A;  3V7S A;  2EJG A;  2VXF A;  2VC8 A;  4M7A F;  2VXE A;  2FB7 A;  4M75 G;  4XTZ A;  1WNL A;  4JRK A;  4HT9 A;  4QVD A;  4C8Q G;  4M7D B;  2DTI A;  4M78 E;  3JCM J;  3BFM A;  2I2L A;  5LJ3 e;  5GAN e;  5LJ5 f;  1BIA A;  4M78 C;  2DXT A;  5GAN 8;  1B34 B;  1I8F A;  4NOY A;  5GAM e;  3JCM d;  4PJO E;  3SWN B;  4M77 G;  5GAN 4;  1WPY A;  2RA2 A;  3BW1 A;  4PJO C;  1U1S A;  3BDU A;  3JB9 D;  3JCM P;  1HXD A;  2HNI A;  4JLI A;  4XU0 A;  3FB9 A;  4WF2 A;  2DZC A;  4F7U B;  2DJZ A;  1H64 1;  4J6W A;  5LJ5 d;  2DEQ A;  1B34 A;  4M75 E;  3JCM b;  3HFO A;  4M7A D;  1I5L A;  3JB9 H;  4C8Q E;  4PJO D;  1U1T A;  3JCM g;  4M78 F;  4N0A C;  3RKY A;  2DVE A;  3RUX A;  4C8Q C;  2DTH A;  2RD1 A;  3JCM c;  4C92 A;  4EMK B;  5GAO m;  4JRI A;  4MMK A;  4PJO F;  4OP0 A;  4M77 E;  5GMK h;  5GMK e;  4X9D A;  4F7U A;  2RM4 A;  2DTO A;  1N9R A;  3SB2 A;  5GAN 6;  1HK9 A;  4M77 C;  5GMK j;  2JN0 A;  1X01 A;  2QTX A;  5LJ3 h;  5LJ5 g;  5GAN h;  4V2S A;  5GAO r;  5GAN 7;  2YLB A;  5LJ3 j;  2E41 A;  4QVC A;  5GAM h;  3QO3 A;  4XQ3 A;  5GAO l;  5GAN j;  5CAI A;  4M7A B;  1D3B B;  1LOJ A;  5GAM j;  4RCC A;  4C92 G;  2DXU A;  5GAO p;  4C8Q F;  1M5Q 1;  1Y96 B;  3V8K A;  4PNO A;  4M78 D;  3V7R A;  4M7D A;  1LNX A;  4J6Y A;  2RB6 A;  4F7U G;  5GMK m;  1TH7 A;  4A53 A;  3V8L A;  4JUV A;  4M77 F;  2ZGW A;  1YCY A;  1N9S A;  4M75 C;  4XTW A;  3QUI A;  2YLC A;  3SWN A;  1D3B A;  4XTU A;  3JCM e;  4M7A A;  4XTX A;  2YHT A;  4DQ2 A;  1Y96 A;  3QHS A;  5LJ3 f;  2EJ9 A;  2DZ9 A;  2E1H A;  2E65 A;  5GAN f;  3HFN A;  3L1A A;  5GAN 3;  2K57 A;  5GAM f;  4HA8 A;  4EMH A;  4M7D G;  4C92 E;  1MGQ A;  4M75 D;  3RKW A;  3JCM V;  4EMG A;  5GAN 5;  3JB9 G;  4C8Q D;  5LJ5 e;  3RKX A;  2FYK A;  4C92 C;  1LJO A;  4M78 B;  4F7U E;  3GIB A;  1WQ7 A;  4EMK A;  4NL2 A;  4XTY A;  1I81 A;  4M7A G;  4M75 F;  3RIR A;  4PJO B;  5LJ3 d;  4M77 D;  1KQ1 A;  5GAN d;  3JCM Q;  2EJF A;  2EWN A;  4C92 D;  5GAM d;  4Y91 A;  4MML A;  3FIF A;  4M78 A; 
#chains in the Genus database with same CATH topology
 3QJ6 A;  1YWO A;  3MEW A;  2QTV A;  2M0Y A;  4KRT A;  1VQ8 T;  1YI2 T;  4OF1 A;  4C92 B;  5HCK A;  3OYI A;  2QEX A;  2KVQ G;  2QA4 Q;  1NYG A;  1W2B S;  2YSQ A;  3LW5 E;  1UEB A;  3M56 A;  3VV0 A;  4FYX B;  3CBM A;  3HL8 A;  1FWZ A;  1IGQ A;  3BFM A;  3EAE A;  2VWF A;  2DD4 A;  3QXE B;  1OPL A;  2EQU A;  3J81 E;  3PVQ A;  1TU0 B;  3CCU Q;  4C0D C;  2LJ3 A;  1KQS P;  1G3W A;  1RUW A;  1SSH A;  2D8H A;  2ROT A;  3JSC A;  2FRW A;  2YXY A;  4CC2 A;  3JB9 H;  2EYZ A;  1W1F A;  2RJF A;  1KC8 R;  3EFO A;  1RAC B;  5GMK e;  2RO0 A;  1K9M R;  1KK7 A;  2XMF A;  4JS5 A;  2QGF B;  1M30 A;  4DOV A;  1GL5 A;  4JJC A;  3M54 A;  1RAA B;  1M1G A;  1WIE A;  1ZSG A;  2O4X B;  3OS0 A;  3EG1 A;  1ZSZ B;  2JJ9 A;  1V29 B;  1VQM Q;  2CZ7 B;  1S72 T;  3EH2 A;  3QHS A;  1D0X A;  1BI1 A;  3HPW A;  2RHZ A;  2DL7 A;  1OU9 A;  1WA7 A;  2RQW A;  1G3Y A;  1BBZ A;  1C0M A;  4FSX A;  3VS2 A;  1XQH A;  2HCK A;  1M1K U;  3ZEH A;  1W2B P;  1IO6 A;  1PCX A;  1R8O B;  1NPR A;  2QK0 A;  1WJS A;  3OYG A;  2MWO A;  1YJN T;  3M58 A;  5IHK A;  3M0P A;  2EVR A;  2CH4 A;  3G71 A;  1ABQ A;  2ECZ A;  3MEU A;  2Y90 A;  2EKO A;  1U3O A;  4N0A A;  2JW4 A;  2L3R A;  2OTJ T;  3JB9 J;  1I4K 1;  4BDY A;  1WHG A;  2DNU A;  4OMP A;  5DY9 A;  4CI0 C;  1XOV A;  4M7A F;  3QDF A;  4JJB A;  2KRN A;  4ZNX A;  1UJY A;  3ME9 A;  4PJO E;  3RNJ A;  3U23 A;  2KRM A;  1PD1 A;  3CCV A;  1Q7Y C;  1G8X A;  2CP7 A;  4J6W A;  2KMT A;  2SEM A;  2OTL A;  3VKI A;  4AFZ C;  4ZN1 A;  2K3B A;  4C92 A;  3WXM B;  4BI3 A;  3OYF A;  1PWT A;  2M1H A;  4M77 E;  5GMK h;  1QVF P;  4LDU A;  1N9R A;  2P0P A;  4OMF B;  3SB2 A;  1X01 A;  2XK0 A;  4PJN A;  5J3B A;  1KQS A;  1UUE A;  1X6G A;  3CPW S;  3CC7 Q;  3O8V A;  5GJW B;  1ZA1 B;  4E7L A;  2COZ A;  3G4S T;  4PFP A;  1WDX A;  4XTW A;  1BU1 A;  5A0D A;  2L3P A;  2E70 A;  1NJI U;  4BE1 A;  2OJ2 A;  2F5T X;  5GAM f;  2M16 A;  4PLL A;  4VUB A;  2CKK A;  3CD6 Q;  4M7A G;  3CXC A;  1VQK Q;  3EG9 B;  5EC7 A;  3CCL T;  3OQ5 A;  1GBR A;  3KXT A;  1YIT A;  1IXD A;  1S1N A;  3OMC A;  2A28 A;  3HTR A;  4KGX B;  4L5G A;  4C8Q B;  2CP5 A;  4E47 A;  4F7U F;  4RKU E;  1WQW A;  4M7A C;  5LJ5 h;  3CC4 T;  2DK3 A;  2DO3 A;  3OS1 A;  2RPN A;  2LX9 A;  3RES A;  3M0U A;  1HSQ A;  3L2Z A;  2DKG A;  3C95 A;  1NJI C;  2DAQ A;  2QEX Q;  3QYH B;  1EZZ B;  2COW A;  4JRK A;  2EKH A;  3TSW A;  1CKA A;  2A0F B;  4LDV A;  2MMP A;  2XU8 A;  3KBG A;  3OYB A;  1VQ5 A;  2GQV A;  1MMD A;  3E9G A;  2GFA A;  2K3Y A;  5LJ5 d;  1SG5 A;  2CP3 A;  2E6Z A;  2E5K A;  4J9E A;  3OYN A;  3CCR A;  2K7A A;  3LWI A;  4NS5 A;  1HK9 A;  4HKE A;  1TTH B;  1B7T A;  2GNC A;  4J9H A;  4GLK A;  1LOJ A;  4JRP A;  2V8J A;  4P5N A;  1YI2 A;  1K0X A;  1H3H A;  1M5Q 1;  4ZGD B;  1IB8 A;  2BZY A;  4F7U G;  2EPD A;  1M2V B;  2ZPI B;  4ESR A;  2YRV A;  3AT1 B;  1UG1 A;  2KK4 A;  1K0S A;  1YJW A;  2DZ9 A;  3DKM A;  1C6V X;  1M3A A;  3C4S A;  1Q82 R;  4HA8 A;  3VS6 A;  1D1C A;  1MGQ A;  2LP5 A;  3EG3 A;  2C06 A;  2F2W A;  4BDZ A;  1VQN T;  1WQ7 A;  2DBK A;  4M77 D;  2EWN A;  2L89 A;  2Y4Y A;  4BI8 B;  1X27 A;  1FMK A;  1ZX6 A;  3CCJ A;  3CC2 T;  4HCB A;  1WLP B;  2KAF A;  4DA4 A;  4RCB A;  2DRK A;  1K76 A;  1X2Q A;  1PC0 A;  2CH4 W;  2PU9 B;  4J83 A;  4EPC A;  3EHR A;  3L2V A;  4LUD A;  4N4G A;  1NE8 A;  1B07 A;  4QT7 A;  4R55 A;  3G71 Q;  2VGM A;  4OVA A;  1T0J A;  1SPK A;  3RER A;  1SRM A;  1M8V A;  1B3Q A;  2MK5 A;  5FU6 C;  4IUQ A;  1MND A;  3PIP A;  3QPH A;  4M75 G;  4XTZ A;  3P8D A;  1H92 A;  2QA4 A;  2LMJ A;  3SDZ A;  1S72 A;  4PJM A;  1X69 A;  4X1V A;  2EIF A;  1WHM A;  4M4Z A;  4J9B A;  3KFV A;  1QVG S;  1HD3 A;  3MP8 A;  3EG0 A;  3CCQ A;  2RD1 A;  4BAC A;  2LTO A;  4MMK A;  1NG2 A;  2OTL Q;  4OB2 B;  3G6E T;  3CCU A;  1WGS A;  4LXC A;  1VQ6 T;  2X4X A;  5LJ3 h;  3CMA Q;  2DL8 A;  2LVM A;  3LGL A;  1Z9Z A;  4LDW A;  3OSS C;  2A3L A;  2O31 A;  3THK A;  1VQL Q;  1MV3 A;  1M90 U;  2JS2 A;  1HJD A;  3OYY A;  1JXO A;  4PFZ A;  3S3O A;  4C0F A;  3J80 E;  1ACM B;  2HKQ B;  3EGX B;  3OY9 A;  3CBP A;  1KC8 C;  4KUD K;  2LNV A;  4QQ6 A;  1X2K A;  3PNW C;  2ZCF B;  4OGE A;  1CSK A;  3OMG A;  5KE3 A;  3OYJ A;  1BK2 A;  1K9M C;  1VQ7 T;  1T3S A;  4BB7 A;  1AWX A;  1QCF A;  3HRS A;  3M59 A;  5LJ3 d;  2KXD A;  1VQM A;  2KDS A;  2EJF A;  2OAU A;  1YHQ Q;  1SF9 A;  3PT9 A;  3V8J A;  1BIB A;  1E7O A;  1VQP A;  2GQI A;  3A8G B;  4F16 A;  2JVV A;  4MZM A;  1YIT Q;  4BUG A;  2ROL A;  1D1A A;  3HSB A;  3I9Q A;  2HSE B;  5FRO A;  1NLP C;  1MMN A;  2EYW A;  1VQO T;  4HCK A;  2DJQ A;  2D1X A;  3I56 T;  2LC4 A;  4B9X A;  4JS4 A;  1NZ9 A;  2VAS A;  1OX8 A;  3M4Y A;  2HKN A;  1K9A A;  3ULR B;  5LJ5 f;  2XI9 A;  5GAN 8;  1GXI E;  7AT1 B;  4J9D A;  2RA2 A;  3EFO B;  4QKU A;  1VQ4 A;  3CEY A;  3NTH A;  3P8H A;  3HP9 A;  4AG2 C;  2DF6 A;  1WYX A;  5CKF A;  4JRQ A;  1B34 A;  2WAC A;  1NLO C;  4RTU A;  3GP8 A;  1KD1 C;  1VQ5 Q;  4M78 F;  3JCM c;  4EMK B;  1ZBX A;  4OB1 B;  3VS7 A;  3VJP A;  1F1B B;  1VA7 A;  2DL5 A;  3L2R A;  2RQT A;  3CME T;  2DET A;  4RCC A;  1VIE A;  2P0K A;  5HK3 A;  1QKW A;  3DLM A;  2F2X A;  1VQ8 Q;  1VQ9 T;  3O5Z A;  1YI2 Q;  3X24 B;  3CC7 A;  4R0K A;  5J39 A;  2A36 A;  1WHK A;  3EGU A;  2DBM A;  4QVZ A;  1QP2 A;  2CT3 A;  2LJ1 A;  1WFW A;  4II1 A;  4AT1 B;  2LQW A;  1YJW Q;  2P84 A;  1KQ1 A;  1Y57 A;  1IRE B;  3JCM Q;  4Y91 A;  2WSE E;  4N4H A;  3FIF A;  2O2O A;  3JCM h;  4CC7 A;  1WJR A;  4PJO A;  4UC4 A;  3H0H A;  3VS3 A;  4DBH A;  5GAN 2;  5KCO A;  2DXB A;  4BY6 C;  4M7A E;  3SWN C;  1SKU B;  1K4U S;  3S3M A;  3HRU A;  1KQ2 A;  2JM8 A;  3CCJ Q;  3OS2 A;  1ZHI A;  3FJP A;  4M78 G;  4DBF A;  3MHX A;  1ZBJ A;  3ASK A;  4Z8A A;  3QYG B;  1AZE A;  4XU1 A;  1E6H A;  3RMS A;  1V76 A;  3JB9 F;  1QKX A;  4M77 A;  4IUT A;  1JB0 E;  5DM7 R;  2VXE A;  2SRC A;  2KT8 A;  2DTI A;  1IRX A;  2FG0 A;  1TOV A;  4M78 C;  4HVU A;  3JCM d;  4DBQ A;  2PUO B;  2HNI A;  2EGE A;  1VQN A;  2JM9 A;  3OYK A;  1S72 Q;  3FDR A;  4C5G A;  3FLG A;  3HHT B;  1I5L A;  2FPF A;  4WTO B;  2EGA A;  1QP3 A;  2DD5 A;  1BB9 A;  3OW2 S;  3NTI A;  3CC2 A;  4KGZ B;  2QQ9 A;  5GAN 6;  2JN0 A;  2ED1 A;  1TXQ A;  4QQG A;  1OV3 A;  3CCQ Q;  4ORZ A;  3OYC A;  1RLP C;  3UPU A;  2BZ8 A;  4ZGE B;  1Q82 U;  2HEQ A;  4PNO A;  5KYU A;  4C0D B;  2RMO A;  1UGS B;  4OML A;  3I5R A;  1RAB B;  3CCE T;  5CO7 A;  2X9H A;  4O5V A;  2F2V A;  1D3B A;  3UA6 A;  2GTJ A;  3QWX X;  3BDL A;  3NPF A;  5LJ3 f;  3L1A A;  3GBQ A;  3RKW A;  3JB9 G;  4L59 A;  1JO8 A;  2LX7 A;  4F14 A;  1YP5 A;  4F7U E;  2KE9 A;  4EMK A;  5IH2 A;  2J7I A;  2KXC A;  3TVT A;  2IPO B;  4MDW A;  1TWB A;  4IIO A;  1JXM A;  4MML A;  2FZG B;  3QJY A;  3VUZ A;  3GNF B;  4KT0 E;  2K5F A;  5GJV B;  5GMK l;  2E10 A;  4K11 A;  3EFR A;  1M3C A;  1PNJ A;  1Q82 C;  4X34 A;  4M7D D;  1VQ6 A;  1M90 R;  1N8R U;  1JEG A;  1VQP Q;  1TS9 A;  2NLU A;  3JB9 I;  4M7D F;  1ZSZ C;  5I22 A;  4HCZ A;  2QAS A;  1Y71 A;  4LE9 A;  1UDL A;  4J9F A;  5FW9 A;  3GLX A;  5GAN e;  1AHJ B;  1GCQ A;  3OYM A;  3G4S Q;  2DMO A;  2R57 A;  3M9Q A;  4RTT A;  2FEI A;  2DZC A;  1PD0 A;  4M7A D;  4M75 E;  3A8H B;  2RHX A;  2K2V A;  1JJ2 S;  3QDR B;  3UDC A;  1VQ4 Q;  3L2U A;  2JZ2 A;  2D9T A;  3JV3 A;  3PMI A;  3X25 B;  4HVW A;  2M51 A;  3MEA A;  1TUD A;  3JAM E;  5GAN j;  1M1K C;  4E6R A;  4C8Q F;  1UHC A;  2ZPG B;  4YTL A;  3V8L A;  4JUV A;  1ZQ1 A;  3CMA A;  2YRD A;  1YCY A;  2BIV A;  2P0Q A;  4XTU A;  2C0I A;  2EYQ A;  1KSW A;  4M7D G;  3M0Q A;  1VQL A;  2OAW A;  2J6O A;  3RKX A;  2WSC E;  2BE9 B;  2L5Q A;  3IQL A;  2DX1 A;  3FEO A;  2JT4 A;  1K73 R;  1YIJ A;  3NFC A;  4FM4 B;  3WVE B;  1I0C A;  4XAX B;  2PVO B;  5D6Y A;  2JOY A;  2LT1 A;  1H8K A;  1WX6 A;  2V1Q A;  4M7D C;  2QGG A;  5GAN g;  1P92 A;  2JMA A;  2DA9 A;  2BTT A;  2JTM A;  2M0O A;  5KE2 A;  2QG9 B;  1YHQ A;  3PIO A;  3QZ5 B;  2E12 A;  5KYX B;  3NGP A;  2A08 A;  2IIM A;  4J9G A;  2VUB A;  1QW1 A;  2XDB A;  3EFS A;  4HT8 A;  3JCM f;  1FXX A;  2FB7 A;  4JLG A;  3OBW A;  4C8Q G;  3JCM J;  2JXB A;  2XD0 A;  1AVZ C;  1YJ9 A;  2V8K A;  1FMW A;  4FYW B;  2DYI A;  3CCS A;  1W2B A;  2PZ1 A;  3LH5 A;  1NM7 A;  2KRO A;  4ATO A;  4WF2 A;  2BZX A;  1QMC A;  2RF0 A;  2NUZ A;  2YUP A;  2D0Q B;  4A4K A;  4C8Q C;  1VQN Q;  1RAI B;  4KUI A;  3I5S A;  4FW1 A;  2MAM A;  1LPL A;  2D8J A;  2KQW A;  2ZPB B;  4JZ4 A;  3H6Z A;  2MI6 A;  4J9I A;  3H41 A;  1Y07 A;  3CPW P;  3CC2 Q;  1T0H A;  3TRE A;  2RHU A;  4A4E A;  4RUG A;  4A63 B;  4LNP A;  4QW2 A;  1N9S A;  2YLC A;  2DLP A;  1W6X A;  1Q86 U;  3M0S A;  1UGR B;  1UJ0 A;  3NMZ C;  2ESW A;  5IXF A;  4EMH A;  4M75 D;  4EMG A;  1D09 B;  5GAN 5;  3GNG A;  4HCC A;  2OX7 A;  1OEB A;  1VQ8 A;  3DLL A;  4M75 F;  3I55 T;  1XTD A;  2CP2 A;  2A7Y A;  1U8R A;  1WZO A;  2Z0W A;  4Z88 A;  1QVF A;  5FRN A;  3FJ5 A;  3E1S A;  2XDP A;  5HY6 A;  1IGU A;  3M4G A;  4CC4 B;  1VQK T;  4N4I A;  3E2U A;  4PJL A;  2EAY A;  2CDT A;  2KSS A;  1M1F A;  4XU2 A;  3A8M B;  2CRE A;  2YDL A;  1JRI A;  5FWB A;  3G6E Q;  5AT1 B;  2B8A A;  4J8O A;  1VQ6 Q;  4E7H A;  3V7S A;  4BI4 A;  5AYF A;  1X75 C;  2PTK A;  4GY5 A;  3TSZ A;  2HD0 A;  2AZV A;  2CP0 A;  4M78 E;  2QEX T;  2GBQ A;  2DXT A;  1B34 B;  3N5B B;  4A4F A;  1YNZ A;  5CKD A;  4FYY B;  2MCN A;  1QLY A;  2J6F A;  3UAT A;  3UF4 A;  3JCM b;  2VYT A;  2E3I A;  1RAE B;  1N27 A;  1XJW B;  5FU6 B;  1AT1 B;  5GAO m;  5KYX A;  4FL6 A;  1KHI A;  2P4T A;  1N8R R;  2ZPF B;  3OYE A;  2LZ6 B;  4HVV A;  2K79 A;  4V2S A;  2B86 A;  1GRI A;  5CAI A;  1BKB A;  2AT1 B;  2KT1 A;  3A1P A;  8AT1 B;  4B9W A;  1LNX A;  2GTO A;  2NUP B;  2PUK B;  1OU8 A;  1KG1 A;  4M75 C;  1G2B A;  3VRZ A;  4M7A A;  3CQT A;  2X3W D;  1VIF A;  5IAY A;  3T9N A;  2E65 A;  3Q1J A;  1YJN A;  2K57 A;  3CPW A;  3MET A;  1N6A A;  3NHN A;  1OOT A;  2M02 A;  3GF5 A;  4GBQ A;  3I56 Q;  4PJO B;  1SHF A;  4PKC C;  2OTJ A;  4OMM A;  5DLQ E;  1TG0 A;  2CZ0 B;  3F70 A;  1YIJ Q;  1VUB A;  5FU7 B;  2RK2 A;  1OZ3 A;  1OYX A;  4ZGJ B;  2A37 A;  3NTK A;  4NL3 A;  4PLI A;  4JJD A;  3BE3 A;  3OYH A;  2YT6 A;  1T3L A;  4M77 B;  3L2W A;  1ZUK A;  4X9C A;  2ABL A;  1MMA A;  3JCM X;  3OA6 A;  5I21 A;  5CK9 A;  4CRI A;  1J3T A;  2LJ0 A;  2DL4 A;  4DBR A;  4OB0 B;  1VYU A;  1O9S A;  1GFD A;  4HT9 A;  1UB4 A;  1E6G A;  1BIA A;  1YFN A;  4AMC A;  3MKD A;  5GAM e;  2HAX A;  4ZTJ A;  1AWW A;  2JS0 A;  3A5Z B;  5D6W A;  4F04 B;  2ZPH B;  1HXD A;  1M90 C;  4JLI A;  1D0Z A;  3PE0 A;  1QWF A;  4PFO A;  3SFM A;  2DJZ A;  1QVG P;  4JDS A;  1YJ9 Q;  1WXB A;  3PVL A;  2XG8 D;  5CKH A;  1U1T A;  2E6N A;  2OI3 A;  1TUC A;  2J05 A;  3CCS Q;  1QVP A;  3H8Z A;  4AG1 C;  3G4S A;  2PVD B;  1FYN A;  1GFC A;  1OUL A;  4OP0 A;  2L8D A;  4X9D A;  1VYT A;  4F7U A;  5KYU B;  2DTO A;  5KYW A;  4BE2 A;  1EX4 A;  2I0N A;  1LCK A;  3SD4 A;  1YN8 A;  2K2M A;  3CCV T;  5GAO r;  4BE0 A;  5GAO l;  5CKB A;  3J7A F;  2OTL T;  2MOX A;  3A98 A;  4FYV B;  1D3B B;  5GAM j;  2XHC A;  5GAO p;  3ER0 A;  4Y28 E;  4B6M A;  4M78 D;  3UA7 A;  4J6Y A;  4E7S A;  4E2F B;  4DEX A;  6AT1 B;  3CCM T;  4A53 A;  1K8A R;  4LD6 A;  1K73 U;  3EHQ A;  3ZL7 C;  9ATC B;  5IN1 A;  2ZGW A;  1GCP A;  1OX9 A;  1WXT A;  2LQN A;  1UHF A;  2GF7 A;  2RI3 A;  3RMQ A;  3FC3 A;  3CCL A;  1PKT A;  2RNA A;  1WJQ A;  1VOM A;  2E1H A;  1VYV A;  2E3H A;  5GAN 3;  2R5A A;  1M3B A;  2E5Q A;  2FYK A;  1D0Y A;  1Z9Q A;  4XTY A;  4JJN K;  2ENM A;  2YUQ A;  4OMQ A;  2FPD A;  2DL3 A;  3CC4 A;  1MUZ A;  4C92 D;  1U06 A;  1JU5 C;  1R0C B;  1UE9 A;  4Z89 A;  3MJX A;  2HSP A;  4JZ3 A;  4FT2 A;  4M7D E;  4C92 F;  3DB3 A;  3OS5 A;  1QCN A;  2L0A A;  2VKN A;  3R6O A;  4FSS A;  2NUP A;  4AFU C;  3H0F A;  5GAM g;  3PGG A;  3OBY A;  4PK4 A;  3JCM W;  3X28 B;  4M75 A;  5GMK i;  4A54 A;  1K73 C;  2RHY A;  4FCY A;  3HKS A;  1Q86 R;  2RQV A;  4XK8 E;  2KY9 A;  1W4S A;  3PFS A;  4HXJ A;  4DOW A;  4QVD A;  3VYG A;  2HL3 A;  5A0G A;  5ECA A;  1WHJ A;  4BY6 B;  2F69 A;  2DER A;  2L3Q A;  5M9O A;  2JTE A;  3SWN B;  5L8R E;  3BDU A;  2EQI A;  3JB9 D;  3CCE Q;  1KQS S;  4IUV A;  2DEQ A;  1WXU A;  4F17 A;  4C8Q E;  3EGD A;  4N0A C;  3RKY A;  2BE7 D;  3VRY A;  2EYX A;  2VGN A;  1MMG A;  1YBY A;  4RTZ A;  4D8D A;  1VQ5 T;  2RM4 A;  2NYS A;  1V1C A;  5IT9 E;  1MHN A;  2QTX A;  3A8L B;  2R58 A;  1QVG A;  5A0L A;  2C0O A;  2E41 A;  2HBW A;  2EQM A;  4C92 G;  4WCI A;  3RBB B;  4D8K A;  3CCR T;  1PSE A;  3CXC S;  1KFZ A;  1G83 A;  4XTX A;  4IUR A;  5C6S A;  4ZN3 A;  2QQS A;  1XNI A;  3LLR A;  4C92 C;  5FLX E;  3GIB A;  4MZT A;  4NL2 A;  5KCH A;  3EH1 A;  4OB3 B;  1YJN Q;  2HL5 C;  2MF2 A;  4FIB A;  4E7J A;  1YJW T;  3TCJ A;  1I1J A;  3X26 B;  2Y4X A;  3ZFJ A;  3S6W A;  2F5K A;  3FRN A;  2R5M A;  2OTJ Q;  2LCS A;  2X4J A;  2KEA A;  4XU3 A;  2ED0 A;  3M57 A;  2CGH A;  2X35 A;  3V7C A;  3M5A A;  1AWJ A;  3QSU A;  2M9U A;  1NEB A;  3CCJ T;  3C0C A;  3TQ7 P;  2RI2 A;  5KYY A;  4Y92 A;  2VVK A;  1JBM A;  2DXC A;  2O88 A;  2AIR B;  4BD3 A;  2VC8 A;  1EIF A;  2CP6 A;  4E7I A;  1I07 A;  2KNB B;  3RR6 A;  4A4G A;  4IIM A;  1AOJ A;  2AK5 A;  3DB4 A;  3G6E A;  1M4Z A;  2HQH A;  5GAN 4;  2CZ1 B;  3BW1 A;  1M8M A;  4XU0 A;  2FRY A;  3FB9 A;  2PNI A;  2RHI A;  1TSF A;  3MPU B;  2EW3 A;  4GLM A;  2G6F X;  3CXC P;  2P4R A;  2QA4 T;  2LQ8 A;  4CC3 A;  3REB B;  1QVF S;  5C0M A;  3OW2 P;  5A2Q E;  1PM3 A;  1R0B G;  5I2S A;  2FZC B;  5GMK j;  2BUD A;  3S3N A;  2D6F A;  4O6J A;  1TUG B;  1BI0 A;  3I35 A;  3QWY A;  2W10 A;  5KH6 A;  1M27 C;  1FMV A;  1VQ7 A;  2K5I A;  1IHW A;  3CCQ T;  1TH7 A;  1Q7Y U;  4RTX A;  3VUB A;  3L42 A;  1YWP A;  3SWN A;  2CZ6 B;  4C5H A;  3QUI A;  3CCU T;  2QQR A;  2DM1 A;  4OMN A;  2QYZ A;  1PRL C;  1Y96 A;  1UTI A;  2K3X A;  1SSF A;  1N8R C;  2AHJ B;  4C8Q D;  5LJ5 e;  2DFU A;  2KRS A;  3CCL Q;  2HQE A;  3VS5 A;  2KI7 A;  1PHT A;  1PKS A;  1KD1 R;  2QQB A;  2PVG B;  1PRM C;  1AWO A;  4M78 A;  1I5O B;  4RTW A;  4C5I A;  2RQU A;  2NUT A;  1G3S A;  2DRM A;  1VQO A;  2J06 A;  3CC4 Q;  2X4Y A;  3LYI A;  2V1R A;  3I56 A;  4EDU A;  4KH0 B;  1VQM T;  3P8B B;  2QAZ A;  3R6N A;  1Q81 R;  3C12 A;  4J5Y A;  5LJ5 j;  1X6O A;  2E64 A;  3OB9 A;  5HK0 A;  3BY7 A;  2FL7 A;  2KYB A;  1RLQ C;  1VQP T;  4MDX A;  3RDV A;  1QCO A;  3CCM A;  5FRM A;  4J7F A;  2DYB A;  3OYD A;  4M7D B;  2K5L A;  1UGQ B;  2GGR A;  3CPF A;  1EFN A;  4A4H A;  1I8F A;  1BI3 A;  1ZUU A;  3EG2 A;  3E19 A;  3TU4 K;  2O9V A;  3JCM P;  1M2O A;  2IG0 A;  4J7I A;  1RAF B;  2YUN A;  3ZBD A;  4IUU A;  4C5E A;  1RAH B;  1H64 1;  3CME A;  3GPL A;  3D7S B;  2CUD A;  1A0N B;  3HFO A;  2X51 A;  5CCA A;  1UGP B;  1H3Z A;  4ELY C;  1JJ2 P;  1GBQ A;  3QBY A;  1K8A U;  1VQ9 A;  5I11 A;  3SEM A;  1SHG A;  3I55 Q;  3REA B;  5LJ5 g;  1NYF A;  2XIC A;  5GAN h;  1VQ4 T;  3OYL A;  2E4H A;  4M7A B;  2DXU A;  3V8K A;  1O75 A;  2W0Z A;  3C94 A;  4PL6 A;  2JMC A;  3OW2 A;  4KGV B;  1JQQ A;  2RN8 A;  4L6V 5;  1UGV A;  4E7Z A;  2EYY A;  2V8I A;  3URG A;  2FVU A;  2H3E B;  2YHT A;  2O4X A;  1R77 A;  4LUE A;  2L3S A;  2COY A;  3JCM V;  2G3R A;  1ZSZ A;  1RAG B;  3CBO A;  4OMO A;  4QQD A;  3G7Z A;  5GAN d;  4LN2 A;  3LH0 A;  1MV0 B;  1OPK A;  2DEU A;  3VYH B;  1K8A C;  4ANJ A;  3CC7 T;  1OZ2 A;  2F1L A;  2CYZ B;  4LD9 K;  2K9G A;  5DLO A;  1D1B A;  2KR3 A;  4FW2 A;  2RK1 A;  3KUF A;  5HKC A;  2JTF A;  1CKB A;  3M53 A;  1ARK A;  3H9N A;  3CD6 T;  1BYM A;  2C0T A;  2WSF E;  1WNL A;  5LJ3 e;  2X4W A;  3E9F A;  2EQJ A;  2EBP A;  2KBT A;  4ME7 A;  1WPY A;  2DVJ A;  2KGT A;  1ZUY A;  3QG1 A;  2LT4 A;  4F7U B;  4C0Z A;  4EIK A;  5KYW B;  4Q5W A;  4PJO D;  1Q86 C;  3RUX A;  2BKD N;  1LVK A;  4FU6 A;  4PJO F;  3CCE A;  3HRT A;  5FWC A;  5IXB A;  2H3J A;  1RI9 A;  2YLB A;  5LJ3 j;  4XQ3 A;  4RG2 A;  3X20 B;  4Z02 A;  3QZ9 B;  2CT4 A;  2CSI A;  3M55 A;  2LQK A;  1JJ2 A;  4M7D A;  2K6D A;  4M77 F;  5IHN A;  4DQ2 A;  1VQ7 Q;  1M9S A;  3GOX A;  4RTY A;  4C0G A;  4C92 E;  2QQA A;  2FPE A;  3VS1 A;  2X3X D;  3QII A;  1KHC A;  2CUB A;  4KBM B;  5CIU A;  2MYS A;  1NPP A;  2CSQ A;  4J9C A;  2YRC A;  1PG5 B;  4M75 B;  1MNE A;  2RH2 A;  5LJ3 g;  5GAO n;  3EG9 A;  3VU3 C;  1KC8 U;  3AHU A;  1M1K R;  1W70 A;  1G3T A;  5GAO q;  1NEG A;  2HZY A;  5I2M A;  2RJE A;  3PTA A;  2FZK B;  1Q7Y R;  2L2P A;  3SHW A;  4C8Q A;  1VQO Q;  1K9M U;  3LWH A;  3LX7 A;  2H8H A;  1C1A A;  4PJO G;  4J6X A;  3PMT A;  2MPX C;  3H0I A;  2XKO C;  3G1J A;  4AFS C;  4DEY A;  2GCX A;  4XTV A;  3CCV Q;  4KH1 B;  5CVI A;  4IKF A;  2QI2 A;  2LDM A;  2LNH B;  2JNG A;  3MO8 A;  2I2L A;  2NWM A;  4NOY A;  5EG2 A;  3VS4 A;  3CCM Q;  4M77 G;  3EGD B;  2AKL A;  1SEM A;  4PJO C;  1U1S A;  2QXF A;  4PJJ A;  1FX7 A;  2JUF A;  1KIK A;  2YUO A;  5D7U A;  3A8O B;  2LCC A;  5CQX A;  1UEC A;  2DE0 X;  2DVE A;  5FU7 C;  2DIL A;  2DTH A;  3G71 T;  4TVR A;  4JRI A;  1RI0 A;  2XID A;  3CME Q;  2KYM A;  4M77 C;  3UT1 A;  2EFI A;  5GAN 7;  4QVC A;  3QO3 A;  3M0R A;  4LDX A;  4RTV A;  5J26 A;  5L23 A;  1VQ9 Q;  1QWE A;  5CKE A;  3V7R A;  1X43 A;  2RB6 A;  1AEY A;  3LGF A;  2DIQ A;  3OSV A;  1ZA2 B;  2HDA A;  5IHI A;  3JCM e;  2ATC B;  2QDY B;  1WHH A;  5CR2 A;  1KD1 U;  2EJ9 A;  2O9S A;  2EQK A;  4MZP A;  5GAN f;  2ZPE B;  5LL6 S;  2EGC A;  3WVD B;  1N5Z A;  3MP1 A;  4AFQ C;  1M2V A;  1IZ6 A;  2ZZD A;  3UWN A;  4D6W A;  1I81 A;  1Y0M A;  3RIR A;  1BI2 A;  2FHD A;  3CMA T;  4FT4 A;  5D6X A;  2XDD A;  1NJI R;  1OI1 A;  1Q81 U;  5CQY A;  1Y7X A;  2MWP A;  3TEE A;  2VB6 A;  3L2Q A;  1VQL T;  3MP6 A;  4OGC A;  1YIJ T;  5KYY B;  1YCS B;  3INZ A;  3M0T A;  1SRL A;  2ZAE A;  4R56 A;  1RL2 A;  2HBP A;  3QKJ A;  3OYA A;  4EMK C;  1X6B A;  2EJG A;  1OQK A;  2VXF A;  1ZLM A;  4IUP A;  3MEV A;  4ELZ C;  4ZTF A;  1YHQ T;  1G5V A;  2DIG A;  4RG8 A;  1WHL A;  1AZG B;  3VS0 A;  5KYN A;  3CCR Q;  4JPB W;  2V26 A;  8ATC B;  1DJ7 B;  2VV5 A;  1PSF A;  1Q81 C;  1YIT T;  2HMA A;  1KJW A;  2O01 E;  2DPP B;  1QQJ A;  2AZS A;  2IVW A;  3JCM g;  1IHV A;  1K1Z A;  2AKK A;  2LCL A;  4KUL A;  1ABO A;  1YJ9 T;  2K4Y A;  2GFU A;  2J6K A;  3CCS T;  1UFF A;  1HYO A;  2MIO A;  2YWW A;  5GAM h;  1RAD B;  2QDL A;  2HQX A;  2D0N A;  1Y96 B;  2PQW A;  1GCQ C;  5GMK m;  3I55 A;  2RQR A;  4LDY A;  1BCO A;  2RJD A;  2CS7 A;  1Q95 G;  3CD6 A;  2RI5 A;  3HFN A;  1VQK A;  1WI7 A;  3JRZ A;  4RMO A;  1AD5 A;  1U5S A;  1LJO A;  4M78 B;  3EGX A;  2FO0 A;  2RJC A;  4E7K A;  2NUT B;  2LRQ A;  1BCM A;  5GAM d;  1NBE B;  3MCA B; 
#chains in the Genus database with same CATH homology
 3V8J A;  3M4G A;  1VQK T;  3QJ6 A;  4N4I A;  1BIB A;  4C5I A;  1VQP A;  1G3S A;  3MEW A;  1VQO A;  2X4Y A;  3A8G B;  3LYI A;  2EAY A;  3I56 A;  1VQ8 T;  4EDU A;  2JVV A;  4MZM A;  2KSS A;  1VQM T;  1YI2 T;  4BUG A;  4OF1 A;  3P8B B;  4C92 B;  3OYI A;  2QEX A;  1M1F A;  3C12 A;  2KVQ G;  4J5Y A;  3HSB A;  4XU2 A;  5FRO A;  5LJ5 j;  1X6O A;  2E64 A;  3OB9 A;  3A8M B;  5HK0 A;  3BY7 A;  2FL7 A;  1W2B S;  1JRI A;  3LW5 E;  1VQP T;  4MDX A;  1K9M U;  2B8A A;  1UEB A;  4J8O A;  1VQO T;  4E7H A;  3V7S A;  3M56 A;  3CCM A;  4BI4 A;  5AYF A;  3VV0 A;  1X75 C;  3I56 T;  3CBM A;  4J7F A;  4GY5 A;  5FRM A;  3HL8 A;  2HD0 A;  2LC4 A;  4M7D D;  4B9X A;  4JS4 A;  3OYD A;  1FWZ A;  1NZ9 A;  4M7D B;  4M78 E;  2K5L A;  1UGQ B;  3BFM A;  2QEX T;  3M4Y A;  5LJ5 f;  3CPF A;  2DXT A;  2XI9 A;  1B34 B;  1I8F A;  3EAE A;  1BI3 A;  3N5B B;  4A4H A;  5GAN 8;  4A4F A;  1GXI E;  2DD4 A;  5CKD A;  3E19 A;  3QXE B;  2RA2 A;  3TU4 K;  2EQU A;  3J81 E;  3JCM P;  1VQ4 A;  2IG0 A;  3CEY A;  3NTH A;  3P8H A;  4J7I A;  3HP9 A;  4C0D C;  3ZBD A;  4IUU A;  4C5E A;  1H64 1;  1G3W A;  5CKF A;  4JRQ A;  3CME A;  3GPL A;  3JCM b;  1B34 A;  2WAC A;  2VYT A;  3HFO A;  5CCA A;  1UGP B;  3JSC A;  3JB9 H;  3GP8 A;  1KD1 C;  1H3Z A;  4M78 F;  1N27 A;  2RJF A;  4ELY C;  5FU6 B;  3JCM c;  4EMK B;  3QBY A;  5GAO m;  4FL6 A;  1KHI A;  2P4T A;  1K8A U;  1VQ9 A;  5GMK e;  1ZBX A;  2ZPF B;  2RO0 A;  4OB1 B;  3OYE A;  3VJP A;  5LJ5 g;  5GAN h;  2XIC A;  1VQ4 T;  4V2S A;  3OYL A;  4JS5 A;  4DOV A;  5CAI A;  1BKB A;  3L2R A;  3M54 A;  4M7A B;  3CME T;  4RCC A;  2DXU A;  1M1G A;  1VIE A;  2P0K A;  3V8K A;  1O75 A;  2O4X B;  5HK3 A;  3C94 A;  4B9W A;  1LNX A;  4PL6 A;  3OW2 A;  3DLM A;  3OS0 A;  2PUK B;  1VQ9 T;  1KG1 A;  4L6V 5;  4M75 C;  1V29 B;  4M7A A;  3URG A;  2V8I A;  2FVU A;  2CZ7 B;  1VIF A;  3X24 B;  2YHT A;  1S72 T;  3QHS A;  2O4X A;  5IAY A;  1BI1 A;  3HPW A;  2E65 A;  3T9N A;  2RHZ A;  3CC7 A;  3Q1J A;  1YJN A;  2K57 A;  5J39 A;  3CPW A;  3JCM V;  3MET A;  2G3R A;  4QVZ A;  1QP2 A;  1N6A A;  3CBO A;  4QQD A;  1G3Y A;  4II1 A;  4FSX A;  3G7Z A;  3GF5 A;  1XQH A;  4PJO B;  1M1K U;  1KQ1 A;  5GAN d;  3CC2 A;  1IRE B;  3JCM Q;  3ZEH A;  3LH0 A;  4PKC C;  4Y91 A;  1R8O B;  2WSE E;  1NPR A;  4N4H A;  3FIF A;  3VYH B;  1K8A C;  2OTJ A;  3CC7 T;  1OZ2 A;  5DLQ E;  1WJS A;  3OYG A;  2CZ0 B;  2MWO A;  3F70 A;  2CYZ B;  1YJN T;  4LD9 K;  3JCM h;  1VUB A;  1WJR A;  3M58 A;  5FU7 B;  2RK2 A;  4UC4 A;  4PJO A;  1OZ3 A;  3G71 A;  1OYX A;  5GAN 2;  4ZGJ B;  5KCO A;  2DXB A;  3NTK A;  4BY6 C;  4NL3 A;  4M7A E;  4PLI A;  3MEU A;  3SWN C;  3OYH A;  3S3M A;  3HRU A;  4M77 B;  5DLO A;  3L2W A;  2Y90 A;  2EKO A;  1KQ2 A;  3OS2 A;  2RK1 A;  1ZHI A;  3FJP A;  4M78 G;  4X9C A;  4N0A A;  3MHX A;  3ASK A;  3JCM X;  3KUF A;  3QYG B;  3OA6 A;  2L3R A;  5I21 A;  5HKC A;  2OTJ T;  4XU1 A;  3JB9 J;  3RMS A;  5CK9 A;  2JTF A;  3JB9 F;  1I4K 1;  4BDY A;  3M53 A;  4CRI A;  4M77 A;  4IUT A;  1JB0 E;  5DY9 A;  3CD6 T;  4CI0 C;  4OB0 B;  5DM7 R;  1XOV A;  1BYM A;  1O9S A;  2VXE A;  4M7A F;  2WSF E;  1WNL A;  4HT9 A;  1UB4 A;  2DTI A;  5LJ3 e;  1BIA A;  2X4W A;  3E9F A;  4M78 C;  2EQJ A;  5GAM e;  3JCM d;  3ME9 A;  4ZTJ A;  2PUO B;  2HAX A;  4PJO E;  4ME7 A;  3A5Z B;  1WPY A;  5D6W A;  2ZPH B;  1HXD A;  2HNI A;  4JLI A;  3CCV A;  1M90 C;  1Q7Y C;  3QG1 A;  1VQN A;  2LT4 A;  3OYK A;  3SFM A;  4F7U B;  3FDR A;  2DJZ A;  4J6W A;  2KMT A;  4C0Z A;  4C5G A;  2OTL A;  3FLG A;  4JDS A;  4Q5W A;  3HHT B;  2XG8 D;  1I5L A;  5CKH A;  3VKI A;  4PJO D;  1U1T A;  2E6N A;  4ZN1 A;  1Q86 C;  1QP3 A;  2DD5 A;  3RUX A;  1QVP A;  3OW2 S;  3H8Z A;  4C92 A;  3WXM B;  2BKD N;  4BI3 A;  3G4S A;  2PVD B;  4FU6 A;  3OYF A;  1N8R C;  2M1H A;  3NTI A;  4M77 E;  4OP0 A;  4PJO F;  2L8D A;  4LDU A;  4X9D A;  4F7U A;  5GMK h;  2DTO A;  3HRT A;  1N9R A;  2QQ9 A;  2P0P A;  4OMF B;  3SB2 A;  5GAN 6;  2JN0 A;  1X01 A;  2XK0 A;  2H3J A;  3SD4 A;  3CCV T;  5GAO r;  4BE0 A;  1KQS A;  2YLB A;  5J3B A;  5LJ3 j;  5GAO l;  4QQG A;  4XQ3 A;  5CKB A;  3CPW S;  4RG2 A;  3OYC A;  3X20 B;  3UPU A;  4Z02 A;  2OTL T;  3J7A F;  1D3B B;  3QZ9 B;  2XHC A;  5GAM j;  3O8V A;  4ZGE B;  1Q82 U;  5GAO p;  3ER0 A;  3M55 A;  4Y28 E;  2LQK A;  1JJ2 A;  4PNO A;  4M78 D;  4M7D A;  4J6Y A;  4C0D B;  4E7L A;  3CCM T;  4A53 A;  1UGS B;  4LD6 A;  3G4S T;  1K73 U;  4M77 F;  5IN1 A;  3CCE T;  5CO7 A;  2ZGW A;  4XTW A;  4O5V A;  3CCL A;  3RMQ A;  1D3B A;  2GF7 A;  3FC3 A;  2RI3 A;  5A0D A;  3BDL A;  2E70 A;  4DQ2 A;  1NJI U;  1WJQ A;  5LJ3 f;  4BE1 A;  2E1H A;  4M78 A;  1M9S A;  3L1A A;  2F5T X;  3GOX A;  5GAN 3;  5GAM f;  4C0G A;  4C92 E;  2R5A A;  2QQA A;  2E5Q A;  3RKW A;  3JB9 G;  2M16 A;  4L59 A;  2FYK A;  4F7U E;  4PLL A;  4VUB A;  2CKK A;  4EMK A;  4XTY A;  4JJN K;  4M7A G;  3QII A;  3CXC A;  3CC4 A;  4C92 D;  4MDW A;  3CCL T;  1KHC A;  3OQ5 A;  4MML A;  4KBM B;  3KXT A;  5CIU A;  1YIT A;  3QJY A;  4FT2 A;  3VUZ A;  1NPP A;  3OMC A;  4M7D E;  4C92 F;  4M75 B;  3DB3 A;  4L5G A;  4C8Q B;  3GNF B;  3OS5 A;  2RH2 A;  4KT0 E;  2K5F A;  4E47 A;  5LJ3 g;  5GMK l;  2E10 A;  5GAO n;  4F7U F;  3EFR A;  3R6O A;  4RKU E;  3VU3 C;  1KC8 U;  3AHU A;  1WQW A;  5GAM g;  1G3T A;  5GAO q;  1Q82 C;  3PGG A;  5I2M A;  4M7A C;  2RJE A;  4X34 A;  5LJ5 h;  3PTA A;  3OBY A;  3CC4 T;  2DK3 A;  1N8R U;  3JCM W;  3X28 B;  1VQ6 A;  4M75 A;  4C8Q A;  5GMK i;  4A54 A;  2DO3 A;  3OS1 A;  3LX7 A;  2NLU A;  3LWH A;  2RHY A;  2LX9 A;  1K73 C;  3JB9 I;  4PJO G;  3CCE A;  4M7D F;  3RES A;  4J6X A;  3PMT A;  3HKS A;  2XKO C;  3L2Z A;  2DKG A;  3C95 A;  4HCZ A;  1NJI C;  4XK8 E;  2DAQ A;  2GCX A;  2KY9 A;  3QYH B;  4XTV A;  1W4S A;  3PFS A;  5CVI A;  4IKF A;  1Y71 A;  2QI2 A;  2LDM A;  4DOW A;  4JRK A;  4QVD A;  3VYG A;  4LDV A;  2JNG A;  5A0G A;  3MO8 A;  2I2L A;  3GLX A;  2MMP A;  1AHJ B;  5GAN e;  2XU8 A;  4BY6 B;  4NOY A;  2F69 A;  3KBG A;  5M9O A;  5EG2 A;  3OYM A;  3OYB A;  3SWN B;  1VQ5 A;  2GQV A;  4M77 G;  5L8R E;  4PJO C;  1U1S A;  3BDU A;  3JB9 D;  2QXF A;  2R57 A;  1FX7 A;  3M9Q A;  1KQS S;  2JUF A;  3E9G A;  2GFA A;  3A8O B;  2DZC A;  2K3Y A;  2LCC A;  5CQX A;  4IUV A;  5LJ5 d;  2DEQ A;  4M75 E;  4M7A D;  3A8H B;  2RHX A;  2K2V A;  1JJ2 S;  4C8Q E;  2E6Z A;  4N0A C;  3RKY A;  2DVE A;  5FU7 C;  3QDR B;  2DTH A;  3UDC A;  3G71 T;  3OYN A;  4TVR A;  3CCR A;  3L2U A;  2JZ2 A;  4JRI A;  2D9T A;  1RI0 A;  1YBY A;  2VGN A;  2XID A;  1VQ5 T;  2RM4 A;  3PMI A;  3LWI A;  4NS5 A;  3X25 B;  1HK9 A;  4M77 C;  1MHN A;  3MEA A;  2QTX A;  3A8L B;  2R58 A;  4HKE A;  3UT1 A;  5IT9 E;  2EFI A;  5GAN 7;  4BE2 A;  5A0L A;  1QVG A;  2E41 A;  4QVC A;  3JAM E;  3QO3 A;  5GAN j;  4GLK A;  1M1K C;  2EQM A;  4LDX A;  1LOJ A;  4JRP A;  2V8J A;  5J26 A;  4P5N A;  4C92 G;  1YI2 A;  4C8Q F;  1M5Q 1;  4ZGD B;  3V7R A;  5CKE A;  2RB6 A;  2ZPG B;  4F7U G;  3CCR T;  1PSE A;  4YTL A;  3CXC S;  3V8L A;  4JUV A;  1ZQ1 A;  3LGF A;  2DIQ A;  3OSV A;  3CMA A;  2ZPI B;  1YCY A;  3JCM e;  2BIV A;  2YRV A;  2KK4 A;  2P0Q A;  4XTU A;  2QDY B;  4XTX A;  5CR2 A;  4IUR A;  1KD1 U;  5C6S A;  1YJW A;  2EJ9 A;  2DZ9 A;  2EQK A;  3DKM A;  4MZP A;  4ZN3 A;  5GAN f;  2ZPE B;  3C4S A;  2EYQ A;  5LL6 S;  4HA8 A;  3WVD B;  4M7D G;  1MGQ A;  2QQS A;  3MP1 A;  1VQL A;  1XNI A;  3LLR A;  2C06 A;  1IZ6 A;  3RKX A;  2WSC E;  4C92 C;  4BDZ A;  1VQN T;  2ZZD A;  2L5Q A;  5FLX E;  3GIB A;  1WQ7 A;  3FEO A;  4MZT A;  3UWN A;  1YIJ A;  4NL2 A;  4D6W A;  1I81 A;  3NFC A;  4FM4 B;  3WVE B;  4OB3 B;  3RIR A;  5KCH A;  1BI2 A;  2FHD A;  4XAX B;  4M77 D;  3CMA T;  2MF2 A;  2PVO B;  5D6Y A;  2EWN A;  4FT4 A;  5D6X A;  2JOY A;  2XDD A;  2L89 A;  1OI1 A;  2LT1 A;  2Y4Y A;  4FIB A;  4BI8 B;  1Q81 U;  4E7J A;  1YJW T;  5CQY A;  3TCJ A;  3CCJ A;  1Y7X A;  3CC2 T;  3X26 B;  2MWP A;  2KAF A;  3TEE A;  4DA4 A;  4HCB A;  2Y4X A;  3ZFJ A;  3L2Q A;  3S6W A;  1VQL T;  4M7D C;  3MP6 A;  4RCB A;  2F5K A;  5GAN g;  4OGC A;  1P92 A;  3FRN A;  1YIJ T;  2R5M A;  2JTM A;  2M0O A;  5KE2 A;  2X4J A;  2PU9 B;  4EPC A;  4J83 A;  3L2V A;  1YHQ A;  3INZ A;  3PIO A;  4N4G A;  3QZ5 B;  1NE8 A;  4XU3 A;  2E12 A;  3M57 A;  2CGH A;  2X35 A;  3V7C A;  4R55 A;  3M5A A;  2VGM A;  3QSU A;  2VUB A;  1RL2 A;  4OVA A;  4R56 A;  2HBP A;  1QW1 A;  3QKJ A;  2M9U A;  2XDB A;  3EFS A;  3OYA A;  3CCJ T;  4HT8 A;  2RI2 A;  3RER A;  1JBM A;  2DXC A;  3JCM f;  1FXX A;  4BD3 A;  1M8V A;  5FU6 C;  4EMK C;  2EJG A;  4IUQ A;  2VXF A;  2VC8 A;  3PIP A;  1EIF A;  2FB7 A;  3QPH A;  4IUP A;  4JLG A;  4M75 G;  3MEV A;  3OBW A;  3P8D A;  4XTZ A;  4ELZ C;  4C8Q G;  4E7I A;  4ZTF A;  1YHQ T;  1G5V A;  3JCM J;  4A4G A;  2QA4 A;  2DIG A;  3SDZ A;  4RG8 A;  1S72 A;  2XD0 A;  1YJ9 A;  2EIF A;  3DB4 A;  3G6E A;  1M4Z A;  5GAN 4;  2V8K A;  3CCS A;  1W2B A;  2CZ1 B;  3BW1 A;  1DJ7 B;  2VV5 A;  4XU0 A;  1PSF A;  1Q81 C;  1QVG S;  3FB9 A;  2RHI A;  4ATO A;  4WF2 A;  1YIT T;  2O01 E;  2DPP B;  2D0Q B;  2IVW A;  3JCM g;  4A4K A;  3MP8 A;  4C8Q C;  2QA4 T;  2LQ8 A;  2RD1 A;  3CCQ A;  2LCL A;  4BAC A;  1QVF S;  2LTO A;  4KUL A;  5C0M A;  4MMK A;  1YJ9 T;  5A2Q E;  4KUI A;  2K4Y A;  4OB2 B;  3G6E T;  2GFU A;  3CCU A;  1WGS A;  5I2S A;  3CCS T;  5GMK j;  1VQ6 T;  2MAM A;  2X4X A;  2BUD A;  5LJ3 h;  2LVM A;  3S3N A;  2D6F A;  2KQW A;  2ZPB B;  3LGL A;  4LDW A;  4O6J A;  5GAM h;  3OSS C;  1BI0 A;  3H6Z A;  2MI6 A;  2A3L A;  5KH6 A;  2HQX A;  1Y07 A;  1Y96 B;  3TRE A;  2RHU A;  1VQ7 A;  2K5I A;  2PQW A;  4A4E A;  1M90 U;  3CCQ T;  5GMK m;  1TH7 A;  1Q7Y U;  3OYY A;  3I55 A;  3S3O A;  4LDY A;  3VUB A;  4C0F A;  3L42 A;  4QW2 A;  3SWN A;  2RJD A;  1N9S A;  2CZ6 B;  4C5H A;  3QUI A;  2YLC A;  2QQR A;  3J80 E;  3OY9 A;  2CS7 A;  3CCU T;  3CBP A;  1Q86 U;  1KC8 C;  1Y96 A;  4KUD K;  1UGR B;  2LNV A;  3CD6 A;  2RI5 A;  3HFN A;  4QQ6 A;  3PNW C;  1VQK A;  3JRZ A;  2ZCF B;  4OGE A;  3OMG A;  2K3X A;  1SSF A;  4EMH A;  4M75 D;  4EMG A;  5KE3 A;  4RMO A;  5GAN 5;  3OYJ A;  2AHJ B;  4C8Q D;  3GNG A;  5LJ5 e;  4HCC A;  1K9M C;  1LJO A;  4M78 B;  1VQ7 T;  2RJC A;  4BB7 A;  1VQ8 A;  3DLL A;  2HQE A;  4E7K A;  3HRS A;  3M59 A;  4M75 F;  3I55 T;  5LJ3 d;  1VQM A;  1XTD A;  2KDS A;  2A7Y A;  1U8R A;  2EJF A;  2LRQ A;  2QQB A;  2OAU A;  2PVG B;  5GAM d;  1QVF A;  5FRN A;  3MCA B;  3E1S A;  2XDP A;  3PT9 A;  5HY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...