2J6FA

N-terminal sh3 domain of cms (cd2ap human homolog) bound to cbl-b peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords CD2-ASSOCIATED PROTEIN
publication title Atypical Polyproline Recognition by the Cms N- Terminal SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j6fA00
3R6NA 1K0XA 1WYXA 2DRMA 2KRNA 2XMFA 1Y57A 2DMOA 2YUQA 2X3XD 1QWFA 2EGEA 3M0UA 2DILA 5IXBA 3M0TA 4AG2C 3VS0A 2J6KA 4ESRA 1CKBA 1GCQC 2VWFA 3EHQA 4D8DA 2JS2A 1UHFA 2DYBA 2KRMA 4F14A 4JJDA 1WA7A 4Z8AA 1HSQA 3H0FA 4OMOA 5FW9A 1I0CA 1E7OA 2A36A 2VKNA 3A98A 3VS6A 2M51A 1K4US 3VS4A 3H0HA 1UFFA 1PNJA 1A0NB 2ENMA 1T3SA 3REAB 1X43A 1WLPB 1RLPC 1UG1A 2K3BA 3NHNA 2EYZA 4AFSC 2ROLA 1WX6A 3REBB 1GBRA 2RMOA 4J9EA 4ZNXA 1H92A 1W6XA 1JO8A 2ED1A 3JV3A 4OMMA 1MUZA 4QT7A 2CT4A 4J9DA 2BZXA 5IH2A 2EGAA 3NGPA 1W70A 2HDAA 2LZ6B 2YUPA 2V1QA 2CSQA 2FRWA 4F16A 2I0NA 3TSWA 2RNAA 3QWYA 3C0CA 2MIOA 1GCPA 1ZUKA 2YSQA 1WXBA 1M8MA 2L0AA 2DBKA 2O2OA 2NWMA 3EHRA 3VS1A 5GJVB 1YP5A 5GJWB 4HCKA 3VRYA 1E6GA 3RNJA 2X3WD 2ABLA 5EC7A 2HEQA 1UE9A 1ZSGA 1M3BA 1CKAA 1ZLMA 2DVJA 2CUBA 2V1RA 4HVUA 1K76A 4JJCA 1ABQA 3VS3A 2O88A 4RTYA 2C0OA 2RQUA 5FWCA 3SEMA 2DM1A 2M0YA 2W0ZA 2F2VA 2JS0A 5I11A 2O31A 2ESWA 4K11A 3PVLA 1U5SA 2KT1A 1Z9QA 2ROTA 4OMNA 1VYTA 3RBBB 1SRLA 1B07A 1AZEA 4RTUA 1AZGB 4JZ3A 2JXBA 1SHFA 1N5ZA 1ZUUA 4KRTA 2KYMA 2KT8A 3NMZC 4LUDA 1UTIA 1PHTA 2PNIA 4FSSA 1T3LA 2AKKA 2D1XA 3ULRB 1VYUA 1SRMA 2CUDA 2GQIA 3M0QA 4IIOA 2J6FA 1FMKA 1UECA 4RUGA 4J9BA 2EYYA 1OPLA 1QKXA 4OMLA 1NLOC 1IO6A 2DBMA 2DL7A 2DL3A 2KR3A 2EKHA 2PZ1A 2D8HA 2KYBA 3IQLA 3UATA 1QWEA 2L3PA 1WXTA 2KE9A 2FRYA 3NPFA 1TUCA 1TG0A 2LJ3A 1SPKA 2BZYA 2RQWA 2CSIA 2J05A 2DE0X 2W10A 3CQTA 2D8JA 2OJ2A 1KSWA 1E6HA 2YUOA 1H8KA 2J6OA 1NEGA 3H41A 3EG3A 4DEXA 1NEBA 1VA7A 2HSPA 1M30A 3TSZA 2AZSA 1U3OA 4J9HA 3VS7A 4AG1C 2C0TA 4CC2A 2JMAA 1V1CA 1SHGA 2LJ0A 1UDLA 2DRKA 2RF0A 4HVVA 4LUEA 3VS5A 2AZVA 3U23A 1YCSB 2AKLA 1ABOA 1TUDA 1VYVA 2ED0A 1QCFA 3UA7A 1X69A 1OOTA 4ORZA 3PVQA 2SRCA 5IXFA 2HCKA 2F2WA 4WCIA 4JPBW 5IHIA 2CT3A 3UA6A 1XOVA 4E6RA 2FO0A 2GNCA 1B3QA 1M3CA 2C0IA 1YWOA 2LQWA 2DA9A 1BBZA 3VS2A 1X6GA 4EIKA 3EG0A 4RTTA 2LJ1A 3GBQA 1YNZA 1AOJA 2RQTA 1JU5C 2DNUA 2LX7A 5L23A 5HCKA 1X2QA 1NM7A 1PKTA 3KFVA 2LNHB 1X27A 4J9GA 3VRZA 1RI9A 2KGTA 1H3HA 4RTXA 1UJ0A 1WXUA 3O5ZA 2GTJA 1T0HA 2FPFA 1J3TA 2DF6A 2GGRA 1GBQA 2MCNA 2RQRA 4GLMA 4HVWA 2GTOA 2JM8A 1G83A 2KEAA 2DX1A 2DJQA 2GBQA 1X6BA 2K2MA 3THKA 1WDXA 2F2XA 1BB9A 1X2KA 4RTZA 1GFDA 1UHCA 3M0RA 3I35A 1AVZC 1GRIA 2PTKA 2L3QA 1CSKA 1G2BA 1I1JA 2JMCA 3SHWA 2A08A 2QDLA 1WFWA 1WIEA 2JTEA 3TVTA 1MV3A 4D8KA 1MV0B 4AFZC 1NYGA 1SEMA 2DL5A 2DLPA 4JJBA 2FEIA 1Y0MA 1FYNA 1GFCA 1AWOA 2JT4A 4M4ZA 2CREA 2D0NA 2KROA 2O9SA 3M0PA 1PRMC 3FJ5A 2KRSA 1RUWA 1UUEA 1QLYA 4J9FA 1U06A 1ZUYA 4AFQC 4Z89A 2FPEA 1NYFA 4HXJA 5IHNA 2OAWA 3H0IA 1W1FA 1JXOA 4DEYA 1EFNA 2EYWA 1K0SA 4GBQA 2K7AA 2YDLA 2IIMA 1KFZA 3ZL7C 1SSHA 3M0SA 4A63B 1KIKA 4R0KA 2KXCA 4OMPA 1JQQA 2KBTA 1OV3A 2RPNA 2K9GA 2CH4W 1UJYA 1JXMA 1AEYA 3PE0A 2CH4A 2EGCA 2G6FX 2ECZA 2O9VA 2LQNA 1HJDA 1ARKA 1HD3A 2A28A 3I5RA 3EG1A 4LNPA 4J9CA 1GL5A 4IIMA 2A37A 1RLQC 2EPDA 2FPDA 2K79A 4Z88A 1Z9ZA 2FG0A 2OI3A 4Y92A 1M27C 2KXDA 4F17A 3LH5A 2YUNA 2JW4A 1LCKA 3EG2A 4OMQA 2SEMA 2BZ8A 2BTTA 1M3AA 1PKSA 1T0JA 2E5KA 1OPKA 5IHKA 2DL8A 4CC7A 1ZX6A 1QKWA 2H8HA 1AD5A 2LP5A 2YT6A 2EW3A 4RTWA 5ECAA 3QWXX 5FWBA 2HBWA 1KJWA 2EQIA 2P4RA 4AFUC 1OEBA 2KNBB 2DL4A 2J7IA 3I5SA 2RN8A 2EVRA 2RQVA 1PWTA 1BK2A 4CC3A 2AK5A 1AWWA 1K1ZA 1PRLC 2EYXA 3EGUA 3UF4A 4CC4B 2CDTA 1NG2A 2VVKA 4JZ4A 1S1NA 1UGVA 5I22A 1YN8A 4LN2A 2L3SA 2NUZA 3I9QA 2LCSA 2J06A 2MOXA 4LE9A 1JEGA 1K9AA 2K6DA 2EBPA 1I07A 4RTVA 1GCQA 1AWJA 1WI7A 1ZBJA 2JM9A 1BU1A 1AWXA 1YWPA 2B86A 2L2PA 2LMJA 4X1VA 1NLPC 4J9IA
chains in the Genus database with same CATH superfamily
2X4JA 1VIEA 2X4XA 1WYXA 3MP6A 2DRMA 2KRNA 5LJ3j 2DMOA 2YUQA 1ZSZB 2DILA 2R5MA 3CCSQ 3VV0A 2JS2A 3JCMQ 2AIRB 3INZA 4F14A 4E7KA 2P4TA 4J7IA 2OTJQ 4FM4B 5KYYB 3H0FA 3X28B 3LWIA 2L89A 4N4IA 1I0CA 2BUDA 1E7OA 4RCCA 5A0LA 4OP0A 1YJNA 1UB4A 1TOVA 4C92G 2ZPHB 3GF5A 2MF2A 2ENMA 4M7AD 4X9CA 1RLPC 1UG1A 2K3BA 4AFSC 2ROLA 4KH1B 3L2UA 3SD4A 2RMOA 3QYGB 4J9EA 2YRDA 1IB8A 2YLCA 4PNOA 3O8VA 4ZGEB 2XDPA 4B9WA 1VQOQ 4OMMA 4M75F 1MUZA 1BYMA 4QT7A 2RJFA 2QDYB 2CT4A 1ZHIA 4E7IA 2QTVA 1WGSA 2BZXA 3BY7A 5I21A 4XTYA 2HDAA 3ER0A 2YUPA 2V1QA 4B9XA 1EX4A 2E65A 3VUZA 2CSQA 2F69A 3EGDB 2QA4Q 4C92A 4ME7A 3M4YA 2EQUA 3A8OB 4KGZB 3PMTA 2MIOA 3JSCA 2YLBA 1D0XA 1YJWQ 4M77F 2DBKA 2COYA 3EHRA 3VU3C 3CCJT 1PSFA 1UGQB 4IURA 5GAOm 3EFOB 3MO8A 1K76A 1WHLA 2GCXA 4GY5A 2HZYA 1B7TA 2C0OA 2RQUA 5CQXA 4X9DA 3CC4T 2DZCA 3PVLA 1M1KR 4F7UG 1U1SA 1U5SA 4OMNA 1VYTA 2FZCB 3RBBB 2CP6A 1C6VX 1WHGA 3LGLA 4PJNA 5GAMf 1AZEA 2DTOA 4JZ3A 1D0ZA 1SHFA 1QVPA 2O4XB 4KRTA 3J7AF 3QPHA 3NMZC 4LUDA 1UTIA 1X6OA 1VQPT 3AT1B 1T3LA 1XTDA 1R0BG 2AKKA 4BB7A 2K2VA 3CCET 1QVFS 3J81E 1TWBA 4IIOA 4JRPA 5LJ5f 1KQSS 3C12A 1RAFB 2K5FA 1YIJA 1WHMA 4OB2B 3SB2A 2JN0A 1FMKA 2E1HA 3CMEA 4E7LA 1OPLA 1N9RA 5GANf 2V8JA 1IO6A 2DL7A 1YHQA 4J6WA 1QWEA 2L3PA 2FRYA 1TG0A 4EMKB 1NPPA 1BIBA 5KYWB 1RAGB 3OYHA 2RA2A 3VJPA 5GAN4 3CC4Q 2OJ2A 1NJIR 1NEGA 4DBHA 1YJ9Q 2X4WA 3CCRT 5A2QE 4OF1A 2OAUA 3JB9G 2LRQA 3TSZA 3CC2T 3MJXA 4O6JA 5GANe 3META 5FLXE 1UDLA 1VQPQ 3PFSA 1D0YA 4GLKA 2AZVA 2AKLA 1VYVA 2ED0A 2YRVA 3OMGA 1Q81C 2DD4A 2P0KA 4ORZA 4BE2A 4PFZA 2SRCA 1GXIE 2DFUA 3UT1A 1VQ8Q 5LJ3f 4WCIA 1Q86R 1YITA 5A0DA 2KMTA 1NPRA 1YI2A 3HL8A 1YWOA 4F7UE 1X6GA 4JRQA 5D6WA 1N6AA 2RI3A 3G6ET 3A1PA 2DNUA 2ZPGB 4IUPA 3CMAA 3OS1A 1ZSZC 1D3BB 4KGXB 3TCJA 3FDRA 3JCMX 2VUBA 3BDUA 2OTLT 1M1GA 3CC2Q 1MMGA 1WXUA 2GTJA 2JTMA 1T0HA 2PU9B 2FPFA 4FCYA 3OS5A 4C0FA 4BI3A 1QQJA 2DEUA 2K5IA 4XU2A 3CD6A 3EH1A 2MAMA 4KUIA 4M7DC 2FYKA 2KEAA 3FJPA 5CQYA 2DJQA 1G5VA 2DYIA 4OB0B 1OZ3A 4BE1A 1WQWA 3CPFA 4IUQA 3HKSA 3ASKA 2CZ6B 4OVAA 2ZPBB 2MWOA 1CSKA 2QQ9A 1G2BA 3MEUA 3HHTB 4JLGA 5CK9A 1YJNT 2QDLA 2D6FA 1WFWA 1WIEA 4XAXB 3TVTA 2R5AA 1MV0B 3UDCA 5GAMh 1ZA1B 2FEIA 3EH2A 1AWOA 1VQ5T 4MDWA 4Y91A 3FJ5A 1RUWA 2FL7A 1VQ6T 5LJ5h 2DZ9A 4AFQC 4FT2A 2FPEA 1JJ2S 1QCNA 4BUGA 4DEYA 2K7AA 3BW1A 4A4GA 3A5ZB 5GMKh 1X01A 1SSHA 1N9SA 4C5EA 4M78G 1N8RC 1W2BS 1IZ6A 4R0KA 2KXCA 1KC8R 1AHJB 2RM4A 2IVWA 3PNWC 1K8AU 1KK7A 4FW1A 2XD0A 1YJNQ 2K9GA 2YXYA 2IPOB 1JXMA 4B6MA 2VYTA 2O9VA 1VQLA 2LQNA 1HD3A 4V2SA 3PTAA 2F5KA 1OX8A 3G71A 1GL5A 4JRIA 1WZOA 1MMNA 4Z88A 4J8OA 3RDVA 5DY9A 4FU6A 1M5Q1 1JBMA 4LDYA 6AT1B 1M27C 5FROA 1PD1A 2Z0WA 3LH5A 2JW4A 2MPXC 2QAZA 3EG2A 2O01E 4OMQA 2SEMA 2BZ8A 3OBWA 1N8RU 3JB9H 1QVFA 1D1BA 1M3AA 4M78A 1WQ7A 5GMKi 1OPKA 2DD5A 2ATCB 3P8BB 1KQSA 5LJ3h 1ZX6A 2DKGA 4M7DF 2DXTA 1O9SA 2H8HA 3JCMP 2EW3A 2JZ2A 3G4SA 3CBPA 3X24B 3QWXX 3CCMT 1YIJT 3CCUT 2HAXA 1OEBA 1RAHB 3MP8A 3QIIA 4PJOB 5IAYA 2NYSA 1YHQT 1BK2A 3EGDA 3CCQA 1K1ZA 5CVIA 4CC4B 2CDTA 2VVKA 4JZ4A 4D6WA 1S1NA 5I22A 2CS7A 3V8KA 3WXMB 2LCSA 2EWNA 3CC7A 2K6DA 4NL2A 1VQMA 2EBPA 2QXFA 1RAAB 1I4K1 1GCQA 2L3RA 1Q86U 3QJYA 2K3YA 2VASA 2A3LA 2ZZDA 4RKUE 5HK3A 1BU1A 1AWXA 2B86A 1NLPC 2RI2A 2QTXA 5KE3A 2VC8A 5AT1B 3R6NA 4J7FA 2K3XA 3UPUA 2DO3A 3RR6A 3CPWS 3HP9A 4Z02A 5IN1A 3CCVT 4PLLA 1ZBXA 1M90C 1QVFP 2VV5A 1YIJQ 1Y57A 3PIPA 2RJDA 1RI0A 2O4XA 2X3XD 3CMEQ 3URGA 3M0UA 1KQSP 3M0TA 4ZTJA 1YI2T 1YHQQ 3EHQA 3BDLA 3S3NA 4JJDA 3RKWA 3NTKA 4LDWA 3GPLA 4PLIA 2WSCE 2A36A 2VKNA 3P8DA 2XKOC 3OSVA 3OYIA 3GOXA 3TU4K 3VS4A 4LDXA 1UFFA 1A0NB 3HRTA 3REAB 2EYZA 4R56A 3E9GA 4EMKA 1WX6A 3REBB 2XICA 2VXFA 1W6XA 2ZGWA 3CBOA 3FRNA 3CD6T 3LYIA 1SG5A 3OYGA 2GFUA 4J9DA 2HQXA 3KBGA 2KQWA 4LD9K 1LJOA 2LZ6B 3ZBDA 3D7SB 1YITQ 1YI2Q 1C0MA 4F16A 3M4GA 5DM7R 2RNAA 3C0CA 3OYAA 5HKCA 3OS2A 2L0AA 3VS1A 3A8LB 3M56A 2CP7A 1YCYA 2HEQA 3CMAQ 3JCMf 2V1RA 3CCST 4JJCA 1U8RA 1ABQA 3HSBA 1JJ2A 2X51A 4DBFA 3SEMA 4C0DC 4CI0C 2W0ZA 1FMVA 3PIOA 2JS0A 2RD1A 4C92C 4K11A 2KT1A 3CD6Q 1SRLA 4RTUA 3TQ7P 3V7SA 1N27A 5GAN3 1PHTA 4LDVA 1P92A 3SFMA 4RG2A 2D1XA 1MHNA 1SF9A 2CUDA 2GQIA 2OX7A 4EPCA 2R57A 3WVDB 2V26A 1VQOT 2FZKB 3OW2S 1VQNA 1R0CB 3H6ZA 4BY6B 3C94A 5FU7C 1QKXA 4KUDK 2RI5A 2IG0A 4II1A 3G71T 2DBMA 4CRIA 2XIDA 1FMWA 2EFIA 2RK1A 2VGNA 4PJLA 5KCHA 2QA4T 1Q81R 2M9UA 3NPFA 1KHCA 2X4YA 4P5NA 4FIBA 3DB4A 2RQWA 2CSIA 2J05A 1Q95G 2W10A 3CQTA 1YJWT 1E6HA 1H8KA 1FWZA 4E7SA 3CXCA 1VA7A 4M78B 1M30A 2D0QB 5GMKm 4E47A 3HPWA 1OYXA 1WJQA 3VS7A 2C0TA 4CC2A 2JMAA 1V1CA 1KQ2A 3SWNB 1BKBA 3T9NA 4KH0B 4HT8A 3G7ZA 4HVVA 4M77G 4Y28E 4N4GA 3I55A 4AT1B 1TUDA 4LD6A 4C0GA 1QCFA 3UA7A 2RHUA 3AHUA 1W2BP 4M75A 3PVQA 1UGSB 2E3IA 4F04B 4JPBW 4FYWB 5IHIA 3OYMA 1VQLQ 2CT3A 1BCMA 2AHJB 2FO0A 3X26B 3G71Q 1B3QA 2C0IA 2LQWA 4EIKA 3EG0A 4RTTA 1Q82C 1UEBA 1FX7A 3GBQA 4E2FB 1YNZA 1AOJA 1JU5C 2LX7A 4EMGA 3RESA 3VUBA 2LNHB 1X27A 3VRZA 4C92F 4M77A 2EQMA 3CPWA 1IHWA 1H3HA 1B34B 3RMQA 4PJOG 2HBPA 3O5ZA 3G4SQ 2DF6A 2GGRA 2E41A 1GBQA 1QW1A 4HVWA 3RUXA 4Q5WA 1VQ7A 1YJ9T 1K8AR 5KYNA 2K4YA 2GBQA 2VB6A 1X6BA 2K2MA 1WDXA 1OQKA 1X2KA 3CCQQ 2X9HA 1GFDA 5A0GA 3M0RA 3JCMh 1IGUA 2PTKA 4C92E 4HCBA 1H641 5D6XA 3OS0A 3CC7Q 3OYKA 1OZ2A 3VYHB 1VQMQ 4PJOA 1NYGA 1SEMA 1VQ8T 1Y7XA 2QASA 1N8RR 1ZQ1A 1HYOA 3CCLA 3MEAA 3OYBA 2M02A 3H9NA 1UGPB 3V7RA 3Q1JA 1QLYA 3E9FA 4J9FA 2MMPA 2E6ZA 3EAEA 3P8HA 4HXJA 3M57A 4F7UF 2OAWA 2XDDA 2QQBA 1W1FA 1EFNA 4GBQA 2YDLA 4ATOA 2EKOA 4C92D 3M0SA 1YFNA 2KAFA 2HQHA 3MP1A 5GAOl 4KULA 5DLOA 2BE9B 2COWA 2EJGA 3H8ZA 1Y07A 4MDXA 3PE0A 2LDMA 1AT1B 4ZN1A 2CP3A 4PJOE 3QO3A 8AT1B 3EG1A 4J9CA 5GAMg 5KYXA 2A37A 2EPDA 1IGQA 1VQ9A 4Y92A 5LJ5d 2YUNA 4ZGDB 5GAN2 3RIRA 9ATCB 5GAN8 2BTTA 5LJ5g 1PKSA 2E64A 5CR2A 3OYNA 3OW2A 3QXEB 5IHKA 2DL8A 2M1HA 1Q81U 4CC7A 1QKWA 3JB9F 2RO0A 1AD5A 2YT6A 2A0FB 4KBMB 4FYVB 4HKEA 3VYGA 1KJWA 2P0QA 1S72A 4PJOD 3L2RA 3JB9I 4PJJA 3EGXB 1PWTA 3EGUA 3G1JA 4M78C 1M90R 1Y96B 1M8VA 1NG2A 2K57A 1YN8A 2EQJA 4LN2A 4XU1A 3ZEHA 2NUZA 3I9QA 2RHXA 2ZCFB 5FU6B 1MMAA 3DLMA 4LE9A 1K9AA 1I07A 1WI7A 2JM9A 5LJ3d 1VIFA 2HD0A 2ZPFB 2E6NA 2EYQA 4E7JA 2LMJA 3M59A 5LJ3g 4MMLA 2H3JA 4RCBA 5CO7A 2RJCA 1K0XA 1VQNQ 5CAIA 3MPUB 5GAOn 5GAN6 2EGEA 1RADB 3OW2P 3V8LA 4AG2C 4M75B 1TUGB 3VS0A 2J6KA 1GCQC 5GANh 3OBYA 4ZGJB 2PUOB 3QZ9B 1JB0E 3MEWA 1HXDA 4N0AA 4QQGA 4X34A 1G3YA 1WA7A 3JB9D 1HSQA 4KGVB 2QEXA 2QQRA 1WNLA 3VS6A 1K4US 2YRCA 3H0HA 2DXCA 4C8QG 1T3SA 1X43A 3NFCA 3I56A 2FB7A 4ANJA 3NHNA 4M77B 1EZZB 4JLIA 3OQ5A 4FSXA 4IUVA 4ZNXA 1JO8A 2ED1A 2ZAEA 5GAN7 3V7CA 5EG2A 2JVVA 5C6SA 5IH2A 2EGAA 3QZ5B 3L42A 2WSEE 2QQSA 3SWNA 4BI8B 3KXTA 2DTHA 3C95A 1IRXA 2I0NA 3TSWA 2EIFA 4C8QA 3QWYA 4M7DA 4NL3A 2LQKA 1ZA2B 3CXCS 4EMKC 2Y90A 4BDZA 2BIVA 2YSQA 2O2OA 2D9TA 2DXBA 5GJVB 3CMET 1YP5A 3VRYA 1E6GA 4C5IA 5EC7A 1UE9A 1ZSGA 4A4EA 3F70A 3LH0A 2CUBA 1PSEA 2O88A 4RTYA 2DM1A 2R58A 5I11A 1PCXA 2O31A 1RAEB 3GNFB 2KDSA 4JJNK 1NZ9A 1Z9QA 2ROTA 2MI6A 5KE2A 1VQ7Q 4XTXA 2JXBA 2V8IA 1ZUUA 4QVZA 4DQ2A 1OU9A 2KYMA 2KT8A 3M54A 1B34A 4M78E 3FIFA 1QVGS 2PVOB 3BE3A 3JCMV 4FSSA 1U1TA 1OI1A 3OMCA 4DBRA 4A53A 3ULRB 1VYUA 3M0QA 3E1SA 4QQDA 1C1AA 2J6FA 3RERA 3CCJA 3NTHA 4J9BA 1Q7YC 3M53A 1FXXA 3EFSA 3VKIA 1YITT 4OMLA 2EKHA 2DL3A 3RKXA 2PZ1A 2KYBA 3IQLA 3CCLQ 2QYZA 2XI9A 5KYXB 1VQ9T 2LJ3A 5J26A 4DA4A 1DJ7B 2DE0X 2D8JA 3M55A 2CP2A 2I2LA 4M78D 1VQ4A 2J6OA 1WHHA 2DTIA 4DEXA 3CMAT 2HSEB 2HSPA 2AZSA 5D6YA 1M90U 4AG1C 2DIQA 3HFNA 2PUKB 3LGFA 4HT9A 3RMSA 1V76A 2DRKA 3CCEA 3L2QA 2RF0A 3C4SA 1S72T 1SKUB 4M7AG 4A4KA 1YCSB 1ABOA 5GAN5 5HY6A 5IXFA 5KYUA 3N5BB 1XNIA 3EG9A 4VUBA 3UA6A 1XOVA 2EAYA 4J5YA 4E6RA 1G8XA 1M3CA 2E5QA 2DA9A 1BBZA 3QYHB 3FLGA 3VS2A 3M5AA 2NLUA 5CKHA 1VQ9Q 4KT0E 3BFMA 1M2OA 4PL6A 3WVEB 3LWHA 2LTOA 1LPLA 5GAOq 1IHVA 1X2QA 2QK0A 2VXEA 1NM7A 1V29B 1PKTA 4FT4A 4J9GA 3LX7A 4HCZA 3CCRA 2DJZA 4M7AA 4BI4A 2KGTA 2XU8A 4RTXA 4M75C 2E4HA 4FW2A 2EQKA 4UC4A 2HNIA 2MCNA 3UWNA 5C0MA 1S72Q 4GLMA 5GMKj 2GTOA 1VOMA 1G83A 1BIAA 2DX1A 2PVGB 4XTVA 1BI0A 3THKA 2HMAA 3MHXA 1BB9A 4QKUA 4O5VA 3RKYA 3ZFJA 2DETA 1AVZC 1I5LA 4M77C 5CCAA 1HK9A 1PD0A 1I1JA 2CP0A 4C5GA 3OB9A 2QEXT 2A08A 2L5QA 3G6EA 3QUIA 3CBMA 2JTEA 3EGXA 3JCMJ 2DL5A 1VQLT 3M9QA 1OX9A 3OYFA 4RMOA 1GFCA 1Y96A 2DIGA 2JT4A 4IUUA 3V8JA 3OYCA 4M4ZA 2OTLA 2CREA 2D0NA 2KROA 2O9SA 2JNGA 2DK3A 4WF2A 2KRSA 4M75G 1LNXA 2E12A 1ACMB 1UUEA 3OYDA 1ZUYA 4Z89A 2VGMA 5IHNA 2Y4YA 2C06A 3H0IA 1KD1C 2EYWA 1K0SA 1QP3A 3JCMd 4PJOC 1RL2A 4BE0A 1KFZA 1JJ2P 5IT9E 2B8AA 3JCMg 3FC3A 1WJSA 4EMHA 3G4ST 2QG9B 4C8QB 4OMPA 3JAME 4M7DB 2QEXQ 2KBTA 1OV3A 2E10A 3PGGA 1AEYA 4XQ3A 3SDZA 1X75C 1BI3A 2EGCA 1TXQA 2ECZA 1HJDA 1RAIB 1ARKA 2A28A 3I5RA 4LNPA 3CCQT 3I56Q 4OB1B 1M1FA 5J39A 1VQ5A 1OULA 1KD1U 1RLQC 3E2UA 2FG0A 2COZA 2OI3A 2RB6A 1QVGA 4F17A 1VQ6A 1VQKA 3CC7T 5CKEA 4QVCA 1VQMT 1TSFA 2JJ9A 1T0JA 3HFOA 2EJFA 4C0ZA 3HTRA 4PFPA 1I81A 3TREA 3S3OA 2LP5A 2HL3A 4RTWA 3QDFA 4MZTA 2HBWA 1M2VB 4QW2A 2DEQA 2P4RA 2NUPA 1Q82U 4AFUC 1TS9A 4FL6A 2KNBB 5CKFA 3CXCP 3E19A 2J7IA 3I5SA 7AT1B 2EVRA 3QBYA 4CC3A 4M75E 2HKNA 1M4ZA 3OYJA 3OY9A 3ME9A 1MNEA 4N4HA 3QSUA 1MGQA 5GMKl 2J06A 4A4HA 2DERA 5GAOr 3OYEA 1VQ4T 2QQAA 2HL5C 1ZBJA 2NUTA 4FYYB 1YWPA 1WHJA 4L5GA 1K9MC 2M16A 4X1VA 1K73C 1QCOA 4M77E 4J9IA 4OGCA 1QVGP 1PC0A 4PJOF 3HRUA 1H3ZA 3A8MB 5CKBA 2RJEA 3CCMA 2XMFA 3CCUA 4M75D 3QDRB 1QWFA 3CCJQ 5FRNA 5IXBA 3S3MA 5GAMe 1RABB 3CPWP 4F7UA 5KYUB 4ESRA 1CKBA 2VWFA 4D8DA 3EG9B 1OU8A 1UHFA 2GFAA 1TTHB 1D1AA 8ATCB 4PJMA 1TH7A 3GIBA 2DYBA 2KRMA 4XTUA 1K9MU 4Z8AA 4ZTFA 1K73U 2ZPEB 4OMOA 4L59A 5FW9A 2F5TX 5LJ5e 3X25B 3A98A 2M51A 2AT1B 1VQ4Q 1PNJA 3GNGA 4M77D 5GAMd 1WLPB 4HCCA 1I8FA 4E7HA 5GMKe 4QQ6A 4M7AB 2DAQA 1KQ1A 4JUVA 1GBRA 2LCLA 1H92A 3CCEQ 3DB3A 4OGEA 2RHZA 1D09B 3JV3A 2QI2A 3CCVA 2FVUA 4OB3B 4N0AC 2GF7A 1WHKA 3NGPA 1W70A 4BY6C 5KH6A 5GANd 3MCAB 2WSFE 3L2ZA 5KCOA 2FRWA 5J3BA 2QGFB 5GANg 3LLRA 1I5OB 1VQNT 1GCPA 1ZUKA 3FEOA 1WXBA 1M8MA 2NWMA 1MMDA 5GJWB 3L2VA 4HCKA 4ZN3A 3OSSC 3RNJA 2X3WD 2ABLA 1M3BA 3CCRQ 1TU0B 2BE7D 1CKAA 1ZLMA 2DVJA 4DOVA 5LJ3e 4HVUA 1WPYA 5GAOp 3VS3A 4BD3A 5FWCA 3DLLA 2M0YA 1Q7YR 3MEVA 4ELZC 3QJ6A 2F2VA 3SWNC 4PK4A 2ESWA 2E3HA 4LXCA 4LDUA 4C8QC 1B07A 3JCMc 1R77A 1AZGB 2P84A 4NOYA 2LX9A 1N5ZA 2XHCA 4EDUA 2YHTA 5CIUA 2V8KA 4HA8A 2PNIA 3CEYA 2GQVA 1SRMA 2LNVA 3I55T 2XDBA 4J6XA 2LVMA 3OYLA 1IXDA 5HK0A 3G6EQ 1R8OB 1WJRA 1UECA 4RUGA 2EYYA 1NLOC 2KR3A 3CCSA 2D8HA 3JCMW 1M1KC 3UATA 2OTLQ 1WXTA 3EFRA 2KE9A 1TUCA 1K8AC 3A8HB 5M9OA 2OTJA 1SPKA 2BZYA 1VQKT 1YBYA 1BCOA 2RHYA 4OMFB 4XU0A 1KSWA 2YUOA 2CYZB 5L8RE 3H41A 3EG3A 1G3TA 1NEBA 4M7DG 4FYXB 4JS5A 1U3OA 4J9HA 4C0DB 2LC4A 1SHGA 2DXUA 2F1LA 2CGHA 2LJ0A 2P0PA 1G3SA 4C92B 1M1KU 2KY9A 4LUEA 1VQOA 3VS5A 3I55Q 3U23A 5LL6S 1ZSZA 4BDYA 2HKQB 1QP2A 1X69A 1OOTA 2LQ8A 1VQ7T 1SSFA 2HCKA 4NS5A 2NUPB 2F2WA 2JTFA 3JRZA 3QHSA 2GNCA 2QA4A 3L2WA 4ELYC 1VQ5Q 1NJIC 4JRKA 5KYYA 2PVDB 2KI7A 2LJ1A 4TVRA 1KG1A 1BI2A 4R55A 1VQ6Q 2M0OA 4M78F 1VQKQ 2RQTA 1RACB 1YJWA 2EJ9A 5FU7B 5L23A 5HCKA 5I2SA 2RHIA 3HRSA 3PMIA 3QKJA 3KFVA 2XK0A 1RI9A 1UGRB 4C8QF 2NUTB 4WTOB 3NTIA 3CCLT 1UJ0A 3MKDA 1J3TA 1EIFA 1Q86C 1NJIU 2RQRA 1PM3A 1JRIA 2JM8A 1XJWB 3M58A 2JOYA 3GLXA 2F2XA 2HQEA 3DKMA 4RTZA 1UHCA 2X35A 3I35A 1GRIA 4F7UB 2L8DA 4M7AC 2L3QA 4YTLA 1M2VA 1IREB 1KD1R 2JMCA 4C8QE 3SHWA 4IKFA 4M7DE 2FHDA 1MV3A 1NE8A 3QG1A 4PFOA 4JDSA 4D8KA 4AFZC 2DLPA 3FB9A 3EFOA 2E70A 2JUFA 4JJBA 3LW5E 4BACA 1Y0MA 1FYNA 1PG5B 3M0PA 3X20B 1PRMC 2LT1A 1O75A 2WACA 1U06A 4L6V5 3CC4A 3CCMQ 2CZ7B 1NYFA 3CCUQ 1NBEB 1YJ9A 1Q82R 1LVKA 1JXOA 4E7ZA 2RH2A 2CKKA 2QGGA 3J80E 2RK2A 2IIMA 3ZL7C 1Q7YU 2ZPIB 1VQPA 4C8QD 4M7DD 1QMCA 4A63B 1KIKA 2DVEA 1JQQA 4XTWA 5FU6C 2RPNA 2CH4W 1M9SA 1UJYA 5I2MA 2LT4A 1G3WA 2CH4A 1VQ8A 2G6FX 4A54A 2LCCA 3JB9J 2CP5A 5KYWA 4IIMA 3PT9A 4C5HA 1BI1A 2FPDA 2K79A 1Z9ZA 5DLQE 2KXDA 3KUFA 1LCKA 4XTZA 5GAMj 3CCVQ 3S6WA 2K5LA 2E5KA 2XG8D 5D7UA 5CKDA 2BKDN 2MWPA 1VUBA 2A7YA 1KC8C 3GP8A 3OYYA 1MNDA 5AYFA 3CC2A 4DOWA 5LJ5j 3JCMb 4MZPA 4RG8A 1W4SA 5ECAA 5FWBA 3L1AA 5FRMA 2DPPB 1XQHA 4JS4A 1K9MR 2EQIA 1KHIA 1K73R 4AMCA 4M7AF 2CZ0B 5GANj 4IUTA 2DL4A 3OA6A 2KVQG 2PQWA 1D1CA 2RN8A 2RQVA 2MYSA 2AK5A 1AWWA 3R6OA 1PRLC 2EYXA 3UF4A 2H3EB 1UGVA 2OTJT 4MZMA 2MK5A 1KC8U 4PKCC 1Y71A 2L3SA 3A8GB 2KSSA 2MOXA 4XU3A 1JEGA 2KK4A 4MMKA 2FZGB 1F1BB 4RTVA 2Y4XA 4DBQA 1AWJA 1D3BA 1W2BA 1LOJA 4J83A 2YWWA 4QVDA 3I56T 2G3RA 4J6YA 2CZ1B 4XK8E 3JCMe 2L2PA 4A4FA 3TEEA 4M7AE
chains in the Genus database with same CATH topology
3R6NA 1K0XA 1WYXA 2DRMA 2KRNA 2XMFA 1Y57A 2DMOA 2YUQA 2X3XD 1QWFA 2EGEA 3M0UA 2DILA 5IXBA 3M0TA 4AG2C 3VS0A 2J6KA 4ESRA 1CKBA 1GCQC 2VWFA 3EHQA 4D8DA 2JS2A 1UHFA 2DYBA 2KRMA 4F14A 4JJDA 1WA7A 4Z8AA 1HSQA 3H0FA 4OMOA 5FW9A 1I0CA 1E7OA 2A36A 2VKNA 3A98A 3VS6A 2M51A 1K4US 3VS4A 3H0HA 1UFFA 1PNJA 1A0NB 2ENMA 1T3SA 3REAB 1X43A 1WLPB 1RLPC 1UG1A 2K3BA 3NHNA 2EYZA 4AFSC 2ROLA 1WX6A 3REBB 1GBRA 2RMOA 4J9EA 4ZNXA 1H92A 1W6XA 1JO8A 2ED1A 3JV3A 4OMMA 1MUZA 4QT7A 2CT4A 4J9DA 2BZXA 5IH2A 2EGAA 3NGPA 1W70A 2HDAA 2LZ6B 2YUPA 2V1QA 2CSQA 2FRWA 4F16A 2I0NA 3TSWA 2RNAA 3QWYA 3C0CA 2MIOA 1GCPA 1ZUKA 2YSQA 1WXBA 1M8MA 2L0AA 2DBKA 2O2OA 2NWMA 3EHRA 3VS1A 5GJVB 1YP5A 5GJWB 4HCKA 3VRYA 1E6GA 3RNJA 2X3WD 2ABLA 5EC7A 2HEQA 1UE9A 1ZSGA 1M3BA 1CKAA 1ZLMA 2DVJA 2CUBA 2V1RA 4HVUA 1K76A 4JJCA 1ABQA 3VS3A 2O88A 4RTYA 2C0OA 2RQUA 5FWCA 3SEMA 2DM1A 2M0YA 2W0ZA 2F2VA 2JS0A 5I11A 2O31A 2ESWA 4K11A 3PVLA 1U5SA 2KT1A 1Z9QA 2ROTA 4OMNA 1VYTA 3RBBB 1SRLA 1B07A 1AZEA 4RTUA 1AZGB 4JZ3A 2JXBA 1SHFA 1N5ZA 1ZUUA 4KRTA 2KYMA 2KT8A 3NMZC 4LUDA 1UTIA 1PHTA 2PNIA 4FSSA 1T3LA 2AKKA 2D1XA 3ULRB 1VYUA 1SRMA 2CUDA 2GQIA 3M0QA 4IIOA 2J6FA 1FMKA 1UECA 4RUGA 4J9BA 2EYYA 1OPLA 1QKXA 4OMLA 1NLOC 1IO6A 2DBMA 2DL7A 2DL3A 2KR3A 2EKHA 2PZ1A 2D8HA 2KYBA 3IQLA 3UATA 1QWEA 2L3PA 1WXTA 2KE9A 2FRYA 3NPFA 1TUCA 1TG0A 2LJ3A 1SPKA 2BZYA 2RQWA 2CSIA 2J05A 2DE0X 2W10A 3CQTA 2D8JA 2OJ2A 1KSWA 1E6HA 2YUOA 1H8KA 2J6OA 1NEGA 3H41A 3EG3A 4DEXA 1NEBA 1VA7A 2HSPA 1M30A 3TSZA 2AZSA 1U3OA 4J9HA 3VS7A 4AG1C 2C0TA 4CC2A 2JMAA 1V1CA 1SHGA 2LJ0A 1UDLA 2DRKA 2RF0A 4HVVA 4LUEA 3VS5A 2AZVA 3U23A 1YCSB 2AKLA 1ABOA 1TUDA 1VYVA 2ED0A 1QCFA 3UA7A 1X69A 1OOTA 4ORZA 3PVQA 2SRCA 5IXFA 2HCKA 2F2WA 4WCIA 4JPBW 5IHIA 2CT3A 3UA6A 1XOVA 4E6RA 2FO0A 2GNCA 1B3QA 1M3CA 2C0IA 1YWOA 2LQWA 2DA9A 1BBZA 3VS2A 1X6GA 4EIKA 3EG0A 4RTTA 2LJ1A 3GBQA 1YNZA 1AOJA 2RQTA 1JU5C 2DNUA 2LX7A 5L23A 5HCKA 1X2QA 1NM7A 1PKTA 3KFVA 2LNHB 1X27A 4J9GA 3VRZA 1RI9A 2KGTA 1H3HA 4RTXA 1UJ0A 1WXUA 3O5ZA 2GTJA 1T0HA 2FPFA 1J3TA 2DF6A 2GGRA 1GBQA 2MCNA 2RQRA 4GLMA 4HVWA 2GTOA 2JM8A 1G83A 2KEAA 2DX1A 2DJQA 2GBQA 1X6BA 2K2MA 3THKA 1WDXA 2F2XA 1BB9A 1X2KA 4RTZA 1GFDA 1UHCA 3M0RA 3I35A 1AVZC 1GRIA 2PTKA 2L3QA 1CSKA 1G2BA 1I1JA 2JMCA 3SHWA 2A08A 2QDLA 1WFWA 1WIEA 2JTEA 3TVTA 1MV3A 4D8KA 1MV0B 4AFZC 1NYGA 1SEMA 2DL5A 2DLPA 4JJBA 2FEIA 1Y0MA 1FYNA 1GFCA 1AWOA 2JT4A 4M4ZA 2CREA 2D0NA 2KROA 2O9SA 3M0PA 1PRMC 3FJ5A 2KRSA 1RUWA 1UUEA 1QLYA 4J9FA 1U06A 1ZUYA 4AFQC 4Z89A 2FPEA 1NYFA 4HXJA 5IHNA 2OAWA 3H0IA 1W1FA 1JXOA 4DEYA 1EFNA 2EYWA 1K0SA 4GBQA 2K7AA 2YDLA 2IIMA 1KFZA 3ZL7C 1SSHA 3M0SA 4A63B 1KIKA 4R0KA 2KXCA 4OMPA 1JQQA 2KBTA 1OV3A 2RPNA 2K9GA 2CH4W 1UJYA 1JXMA 1AEYA 3PE0A 2CH4A 2EGCA 2G6FX 2ECZA 2O9VA 2LQNA 1HJDA 1ARKA 1HD3A 2A28A 3I5RA 3EG1A 4LNPA 4J9CA 1GL5A 4IIMA 2A37A 1RLQC 2EPDA 2FPDA 2K79A 4Z88A 1Z9ZA 2FG0A 2OI3A 4Y92A 1M27C 2KXDA 4F17A 3LH5A 2YUNA 2JW4A 1LCKA 3EG2A 4OMQA 2SEMA 2BZ8A 2BTTA 1M3AA 1PKSA 1T0JA 2E5KA 1OPKA 5IHKA 2DL8A 4CC7A 1ZX6A 1QKWA 2H8HA 1AD5A 2LP5A 2YT6A 2EW3A 4RTWA 5ECAA 3QWXX 5FWBA 2HBWA 1KJWA 2EQIA 2P4RA 4AFUC 1OEBA 2KNBB 2DL4A 2J7IA 3I5SA 2RN8A 2EVRA 2RQVA 1PWTA 1BK2A 4CC3A 2AK5A 1AWWA 1K1ZA 1PRLC 2EYXA 3EGUA 3UF4A 4CC4B 2CDTA 1NG2A 2VVKA 4JZ4A 1S1NA 1UGVA 5I22A 1YN8A 4LN2A 2L3SA 2NUZA 3I9QA 2LCSA 2J06A 2MOXA 4LE9A 1JEGA 1K9AA 2K6DA 2EBPA 1I07A 4RTVA 1GCQA 1AWJA 1WI7A 1ZBJA 2JM9A 1BU1A 1AWXA 1YWPA 2B86A 2L2PA 2LMJA 4X1VA 1NLPC 4J9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6N A;  1K0X A;  1WYX A;  2DRM A;  2KRN A;  2XMF A;  1Y57 A;  2DMO A;  2YUQ A;  2X3X D;  1QWF A;  2EGE A;  3M0U A;  2DIL A;  5IXB A;  3M0T A;  4AG2 C;  3VS0 A;  2J6K A;  4ESR A;  1CKB A;  1GCQ C;  2VWF A;  3EHQ A;  4D8D A;  2JS2 A;  1UHF A;  2DYB A;  2KRM A;  4F14 A;  4JJD A;  1WA7 A;  4Z8A A;  1HSQ A;  3H0F A;  4OMO A;  5FW9 A;  1I0C A;  1E7O A;  2A36 A;  2VKN A;  3A98 A;  3VS6 A;  2M51 A;  1K4U S;  3VS4 A;  3H0H A;  1UFF A;  1PNJ A;  1A0N B;  2ENM A;  1T3S A;  3REA B;  1X43 A;  1WLP B;  1RLP C;  1UG1 A;  2K3B A;  3NHN A;  2EYZ A;  4AFS C;  2ROL A;  1WX6 A;  3REB B;  1GBR A;  2RMO A;  4J9E A;  4ZNX A;  1H92 A;  1W6X A;  1JO8 A;  2ED1 A;  3JV3 A;  4OMM A;  1MUZ A;  4QT7 A;  2CT4 A;  4J9D A;  2BZX A;  5IH2 A;  2EGA A;  3NGP A;  1W70 A;  2HDA A;  2LZ6 B;  2YUP A;  2V1Q A;  2CSQ A;  2FRW A;  4F16 A;  2I0N A;  3TSW A;  2RNA A;  3QWY A;  3C0C A;  2MIO A;  1GCP A;  1ZUK A;  2YSQ A;  1WXB A;  1M8M A;  2L0A A;  2DBK A;  2O2O A;  2NWM A;  3EHR A;  3VS1 A;  5GJV B;  1YP5 A;  5GJW B;  4HCK A;  3VRY A;  1E6G A;  3RNJ A;  2X3W D;  2ABL A;  5EC7 A;  2HEQ A;  1UE9 A;  1ZSG A;  1M3B A;  1CKA A;  1ZLM A;  2DVJ A;  2CUB A;  2V1R A;  4HVU A;  1K76 A;  4JJC A;  1ABQ A;  3VS3 A;  2O88 A;  4RTY A;  2C0O A;  2RQU A;  5FWC A;  3SEM A;  2DM1 A;  2M0Y A;  2W0Z A;  2F2V A;  2JS0 A;  5I11 A;  2O31 A;  2ESW A;  4K11 A;  3PVL A;  1U5S A;  2KT1 A;  1Z9Q A;  2ROT A;  4OMN A;  1VYT A;  3RBB B;  1SRL A;  1B07 A;  1AZE A;  4RTU A;  1AZG B;  4JZ3 A;  2JXB A;  1SHF A;  1N5Z A;  1ZUU A;  4KRT A;  2KYM A;  2KT8 A;  3NMZ C;  4LUD A;  1UTI A;  1PHT A;  2PNI A;  4FSS A;  1T3L A;  2AKK A;  2D1X A;  3ULR B;  1VYU A;  1SRM A;  2CUD A;  2GQI A;  3M0Q A;  4IIO A;  2J6F A;  1FMK A;  1UEC A;  4RUG A;  4J9B A;  2EYY A;  1OPL A;  1QKX A;  4OML A;  1NLO C;  1IO6 A;  2DBM A;  2DL7 A;  2DL3 A;  2KR3 A;  2EKH A;  2PZ1 A;  2D8H A;  2KYB A;  3IQL A;  3UAT A;  1QWE A;  2L3P A;  1WXT A;  2KE9 A;  2FRY A;  3NPF A;  1TUC A;  1TG0 A;  2LJ3 A;  1SPK A;  2BZY A;  2RQW A;  2CSI A;  2J05 A;  2DE0 X;  2W10 A;  3CQT A;  2D8J A;  2OJ2 A;  1KSW A;  1E6H A;  2YUO A;  1H8K A;  2J6O A;  1NEG A;  3H41 A;  3EG3 A;  4DEX A;  1NEB A;  1VA7 A;  2HSP A;  1M30 A;  3TSZ A;  2AZS A;  1U3O A;  4J9H A;  3VS7 A;  4AG1 C;  2C0T A;  4CC2 A;  2JMA A;  1V1C A;  1SHG A;  2LJ0 A;  1UDL A;  2DRK A;  2RF0 A;  4HVV A;  4LUE A;  3VS5 A;  2AZV A;  3U23 A;  1YCS B;  2AKL A;  1ABO A;  1TUD A;  1VYV A;  2ED0 A;  1QCF A;  3UA7 A;  1X69 A;  1OOT A;  4ORZ A;  3PVQ A;  2SRC A;  5IXF A;  2HCK A;  2F2W A;  4WCI A;  4JPB W;  5IHI A;  2CT3 A;  3UA6 A;  1XOV A;  4E6R A;  2FO0 A;  2GNC A;  1B3Q A;  1M3C A;  2C0I A;  1YWO A;  2LQW A;  2DA9 A;  1BBZ A;  3VS2 A;  1X6G A;  4EIK A;  3EG0 A;  4RTT A;  2LJ1 A;  3GBQ A;  1YNZ A;  1AOJ A;  2RQT A;  1JU5 C;  2DNU A;  2LX7 A;  5L23 A;  5HCK A;  1X2Q A;  1NM7 A;  1PKT A;  3KFV A;  2LNH B;  1X27 A;  4J9G A;  3VRZ A;  1RI9 A;  2KGT A;  1H3H A;  4RTX A;  1UJ0 A;  1WXU A;  3O5Z A;  2GTJ A;  1T0H A;  2FPF A;  1J3T A;  2DF6 A;  2GGR A;  1GBQ A;  2MCN A;  2RQR A;  4GLM A;  4HVW A;  2GTO A;  2JM8 A;  1G83 A;  2KEA A;  2DX1 A;  2DJQ A;  2GBQ A;  1X6B A;  2K2M A;  3THK A;  1WDX A;  2F2X A;  1BB9 A;  1X2K A;  4RTZ A;  1GFD A;  1UHC A;  3M0R A;  3I35 A;  1AVZ C;  1GRI A;  2PTK A;  2L3Q A;  1CSK A;  1G2B A;  1I1J A;  2JMC A;  3SHW A;  2A08 A;  2QDL A;  1WFW A;  1WIE A;  2JTE A;  3TVT A;  1MV3 A;  4D8K A;  1MV0 B;  4AFZ C;  1NYG A;  1SEM A;  2DL5 A;  2DLP A;  4JJB A;  2FEI A;  1Y0M A;  1FYN A;  1GFC A;  1AWO A;  2JT4 A;  4M4Z A;  2CRE A;  2D0N A;  2KRO A;  2O9S A;  3M0P A;  1PRM C;  3FJ5 A;  2KRS A;  1RUW A;  1UUE A;  1QLY A;  4J9F A;  1U06 A;  1ZUY A;  4AFQ C;  4Z89 A;  2FPE A;  1NYF A;  4HXJ A;  5IHN A;  2OAW A;  3H0I A;  1W1F A;  1JXO A;  4DEY A;  1EFN A;  2EYW A;  1K0S A;  4GBQ A;  2K7A A;  2YDL A;  2IIM A;  1KFZ A;  3ZL7 C;  1SSH A;  3M0S A;  4A63 B;  1KIK A;  4R0K A;  2KXC A;  4OMP A;  1JQQ A;  2KBT A;  1OV3 A;  2RPN A;  2K9G A;  2CH4 W;  1UJY A;  1JXM A;  1AEY A;  3PE0 A;  2CH4 A;  2EGC A;  2G6F X;  2ECZ A;  2O9V A;  2LQN A;  1HJD A;  1ARK A;  1HD3 A;  2A28 A;  3I5R A;  3EG1 A;  4LNP A;  4J9C A;  1GL5 A;  4IIM A;  2A37 A;  1RLQ C;  2EPD A;  2FPD A;  2K79 A;  4Z88 A;  1Z9Z A;  2FG0 A;  2OI3 A;  4Y92 A;  1M27 C;  2KXD A;  4F17 A;  3LH5 A;  2YUN A;  2JW4 A;  1LCK A;  3EG2 A;  4OMQ A;  2SEM A;  2BZ8 A;  2BTT A;  1M3A A;  1PKS A;  1T0J A;  2E5K A;  1OPK A;  5IHK A;  2DL8 A;  4CC7 A;  1ZX6 A;  1QKW A;  2H8H A;  1AD5 A;  2LP5 A;  2YT6 A;  2EW3 A;  4RTW A;  5ECA A;  3QWX X;  5FWB A;  2HBW A;  1KJW A;  2EQI A;  2P4R A;  4AFU C;  1OEB A;  2KNB B;  2DL4 A;  2J7I A;  3I5S A;  2RN8 A;  2EVR A;  2RQV A;  1PWT A;  1BK2 A;  4CC3 A;  2AK5 A;  1AWW A;  1K1Z A;  1PRL C;  2EYX A;  3EGU A;  3UF4 A;  4CC4 B;  2CDT A;  1NG2 A;  2VVK A;  4JZ4 A;  1S1N A;  1UGV A;  5I22 A;  1YN8 A;  4LN2 A;  2L3S A;  2NUZ A;  3I9Q A;  2LCS A;  2J06 A;  2MOX A;  4LE9 A;  1JEG A;  1K9A A;  2K6D A;  2EBP A;  1I07 A;  4RTV A;  1GCQ A;  1AWJ A;  1WI7 A;  1ZBJ A;  2JM9 A;  1BU1 A;  1AWX A;  1YWP A;  2B86 A;  2L2P A;  2LMJ A;  4X1V A;  1NLP C;  4J9I A; 
#chains in the Genus database with same CATH topology
 2X4J A;  1VIE A;  2X4X A;  1WYX A;  3MP6 A;  2DRM A;  2KRN A;  5LJ3 j;  2DMO A;  2YUQ A;  1ZSZ B;  2DIL A;  2R5M A;  3CCS Q;  3VV0 A;  2JS2 A;  3JCM Q;  2AIR B;  3INZ A;  4F14 A;  4E7K A;  2P4T A;  4J7I A;  2OTJ Q;  4FM4 B;  5KYY B;  3H0F A;  3X28 B;  3LWI A;  2L89 A;  4N4I A;  1I0C A;  2BUD A;  1E7O A;  4RCC A;  5A0L A;  4OP0 A;  1YJN A;  1UB4 A;  1TOV A;  4C92 G;  2ZPH B;  3GF5 A;  2MF2 A;  2ENM A;  4M7A D;  4X9C A;  1RLP C;  1UG1 A;  2K3B A;  4AFS C;  2ROL A;  4KH1 B;  3L2U A;  3SD4 A;  2RMO A;  3QYG B;  4J9E A;  2YRD A;  1IB8 A;  2YLC A;  4PNO A;  3O8V A;  4ZGE B;  2XDP A;  4B9W A;  1VQO Q;  4OMM A;  4M75 F;  1MUZ A;  1BYM A;  4QT7 A;  2RJF A;  2QDY B;  2CT4 A;  1ZHI A;  4E7I A;  2QTV A;  1WGS A;  2BZX A;  3BY7 A;  5I21 A;  4XTY A;  2HDA A;  3ER0 A;  2YUP A;  2V1Q A;  4B9X A;  1EX4 A;  2E65 A;  3VUZ A;  2CSQ A;  2F69 A;  3EGD B;  2QA4 Q;  4C92 A;  4ME7 A;  3M4Y A;  2EQU A;  3A8O B;  4KGZ B;  3PMT A;  2MIO A;  3JSC A;  2YLB A;  1D0X A;  1YJW Q;  4M77 F;  2DBK A;  2COY A;  3EHR A;  3VU3 C;  3CCJ T;  1PSF A;  1UGQ B;  4IUR A;  5GAO m;  3EFO B;  3MO8 A;  1K76 A;  1WHL A;  2GCX A;  4GY5 A;  2HZY A;  1B7T A;  2C0O A;  2RQU A;  5CQX A;  4X9D A;  3CC4 T;  2DZC A;  3PVL A;  1M1K R;  4F7U G;  1U1S A;  1U5S A;  4OMN A;  1VYT A;  2FZC B;  3RBB B;  2CP6 A;  1C6V X;  1WHG A;  3LGL A;  4PJN A;  5GAM f;  1AZE A;  2DTO A;  4JZ3 A;  1D0Z A;  1SHF A;  1QVP A;  2O4X B;  4KRT A;  3J7A F;  3QPH A;  3NMZ C;  4LUD A;  1UTI A;  1X6O A;  1VQP T;  3AT1 B;  1T3L A;  1XTD A;  1R0B G;  2AKK A;  4BB7 A;  2K2V A;  3CCE T;  1QVF S;  3J81 E;  1TWB A;  4IIO A;  4JRP A;  5LJ5 f;  1KQS S;  3C12 A;  1RAF B;  2K5F A;  1YIJ A;  1WHM A;  4OB2 B;  3SB2 A;  2JN0 A;  1FMK A;  2E1H A;  3CME A;  4E7L A;  1OPL A;  1N9R A;  5GAN f;  2V8J A;  1IO6 A;  2DL7 A;  1YHQ A;  4J6W A;  1QWE A;  2L3P A;  2FRY A;  1TG0 A;  4EMK B;  1NPP A;  1BIB A;  5KYW B;  1RAG B;  3OYH A;  2RA2 A;  3VJP A;  5GAN 4;  3CC4 Q;  2OJ2 A;  1NJI R;  1NEG A;  4DBH A;  1YJ9 Q;  2X4W A;  3CCR T;  5A2Q E;  4OF1 A;  2OAU A;  3JB9 G;  2LRQ A;  3TSZ A;  3CC2 T;  3MJX A;  4O6J A;  5GAN e;  3MET A;  5FLX E;  1UDL A;  1VQP Q;  3PFS A;  1D0Y A;  4GLK A;  2AZV A;  2AKL A;  1VYV A;  2ED0 A;  2YRV A;  3OMG A;  1Q81 C;  2DD4 A;  2P0K A;  4ORZ A;  4BE2 A;  4PFZ A;  2SRC A;  1GXI E;  2DFU A;  3UT1 A;  1VQ8 Q;  5LJ3 f;  4WCI A;  1Q86 R;  1YIT A;  5A0D A;  2KMT A;  1NPR A;  1YI2 A;  3HL8 A;  1YWO A;  4F7U E;  1X6G A;  4JRQ A;  5D6W A;  1N6A A;  2RI3 A;  3G6E T;  3A1P A;  2DNU A;  2ZPG B;  4IUP A;  3CMA A;  3OS1 A;  1ZSZ C;  1D3B B;  4KGX B;  3TCJ A;  3FDR A;  3JCM X;  2VUB A;  3BDU A;  2OTL T;  1M1G A;  3CC2 Q;  1MMG A;  1WXU A;  2GTJ A;  2JTM A;  1T0H A;  2PU9 B;  2FPF A;  4FCY A;  3OS5 A;  4C0F A;  4BI3 A;  1QQJ A;  2DEU A;  2K5I A;  4XU2 A;  3CD6 A;  3EH1 A;  2MAM A;  4KUI A;  4M7D C;  2FYK A;  2KEA A;  3FJP A;  5CQY A;  2DJQ A;  1G5V A;  2DYI A;  4OB0 B;  1OZ3 A;  4BE1 A;  1WQW A;  3CPF A;  4IUQ A;  3HKS A;  3ASK A;  2CZ6 B;  4OVA A;  2ZPB B;  2MWO A;  1CSK A;  2QQ9 A;  1G2B A;  3MEU A;  3HHT B;  4JLG A;  5CK9 A;  1YJN T;  2QDL A;  2D6F A;  1WFW A;  1WIE A;  4XAX B;  3TVT A;  2R5A A;  1MV0 B;  3UDC A;  5GAM h;  1ZA1 B;  2FEI A;  3EH2 A;  1AWO A;  1VQ5 T;  4MDW A;  4Y91 A;  3FJ5 A;  1RUW A;  2FL7 A;  1VQ6 T;  5LJ5 h;  2DZ9 A;  4AFQ C;  4FT2 A;  2FPE A;  1JJ2 S;  1QCN A;  4BUG A;  4DEY A;  2K7A A;  3BW1 A;  4A4G A;  3A5Z B;  5GMK h;  1X01 A;  1SSH A;  1N9S A;  4C5E A;  4M78 G;  1N8R C;  1W2B S;  1IZ6 A;  4R0K A;  2KXC A;  1KC8 R;  1AHJ B;  2RM4 A;  2IVW A;  3PNW C;  1K8A U;  1KK7 A;  4FW1 A;  2XD0 A;  1YJN Q;  2K9G A;  2YXY A;  2IPO B;  1JXM A;  4B6M A;  2VYT A;  2O9V A;  1VQL A;  2LQN A;  1HD3 A;  4V2S A;  3PTA A;  2F5K A;  1OX8 A;  3G71 A;  1GL5 A;  4JRI A;  1WZO A;  1MMN A;  4Z88 A;  4J8O A;  3RDV A;  5DY9 A;  4FU6 A;  1M5Q 1;  1JBM A;  4LDY A;  6AT1 B;  1M27 C;  5FRO A;  1PD1 A;  2Z0W A;  3LH5 A;  2JW4 A;  2MPX C;  2QAZ A;  3EG2 A;  2O01 E;  4OMQ A;  2SEM A;  2BZ8 A;  3OBW A;  1N8R U;  3JB9 H;  1QVF A;  1D1B A;  1M3A A;  4M78 A;  1WQ7 A;  5GMK i;  1OPK A;  2DD5 A;  2ATC B;  3P8B B;  1KQS A;  5LJ3 h;  1ZX6 A;  2DKG A;  4M7D F;  2DXT A;  1O9S A;  2H8H A;  3JCM P;  2EW3 A;  2JZ2 A;  3G4S A;  3CBP A;  3X24 B;  3QWX X;  3CCM T;  1YIJ T;  3CCU T;  2HAX A;  1OEB A;  1RAH B;  3MP8 A;  3QII A;  4PJO B;  5IAY A;  2NYS A;  1YHQ T;  1BK2 A;  3EGD A;  3CCQ A;  1K1Z A;  5CVI A;  4CC4 B;  2CDT A;  2VVK A;  4JZ4 A;  4D6W A;  1S1N A;  5I22 A;  2CS7 A;  3V8K A;  3WXM B;  2LCS A;  2EWN A;  3CC7 A;  2K6D A;  4NL2 A;  1VQM A;  2EBP A;  2QXF A;  1RAA B;  1I4K 1;  1GCQ A;  2L3R A;  1Q86 U;  3QJY A;  2K3Y A;  2VAS A;  2A3L A;  2ZZD A;  4RKU E;  5HK3 A;  1BU1 A;  1AWX A;  2B86 A;  1NLP C;  2RI2 A;  2QTX A;  5KE3 A;  2VC8 A;  5AT1 B;  3R6N A;  4J7F A;  2K3X A;  3UPU A;  2DO3 A;  3RR6 A;  3CPW S;  3HP9 A;  4Z02 A;  5IN1 A;  3CCV T;  4PLL A;  1ZBX A;  1M90 C;  1QVF P;  2VV5 A;  1YIJ Q;  1Y57 A;  3PIP A;  2RJD A;  1RI0 A;  2O4X A;  2X3X D;  3CME Q;  3URG A;  3M0U A;  1KQS P;  3M0T A;  4ZTJ A;  1YI2 T;  1YHQ Q;  3EHQ A;  3BDL A;  3S3N A;  4JJD A;  3RKW A;  3NTK A;  4LDW A;  3GPL A;  4PLI A;  2WSC E;  2A36 A;  2VKN A;  3P8D A;  2XKO C;  3OSV A;  3OYI A;  3GOX A;  3TU4 K;  3VS4 A;  4LDX A;  1UFF A;  1A0N B;  3HRT A;  3REA B;  2EYZ A;  4R56 A;  3E9G A;  4EMK A;  1WX6 A;  3REB B;  2XIC A;  2VXF A;  1W6X A;  2ZGW A;  3CBO A;  3FRN A;  3CD6 T;  3LYI A;  1SG5 A;  3OYG A;  2GFU A;  4J9D A;  2HQX A;  3KBG A;  2KQW A;  4LD9 K;  1LJO A;  2LZ6 B;  3ZBD A;  3D7S B;  1YIT Q;  1YI2 Q;  1C0M A;  4F16 A;  3M4G A;  5DM7 R;  2RNA A;  3C0C A;  3OYA A;  5HKC A;  3OS2 A;  2L0A A;  3VS1 A;  3A8L B;  3M56 A;  2CP7 A;  1YCY A;  2HEQ A;  3CMA Q;  3JCM f;  2V1R A;  3CCS T;  4JJC A;  1U8R A;  1ABQ A;  3HSB A;  1JJ2 A;  2X51 A;  4DBF A;  3SEM A;  4C0D C;  4CI0 C;  2W0Z A;  1FMV A;  3PIO A;  2JS0 A;  2RD1 A;  4C92 C;  4K11 A;  2KT1 A;  3CD6 Q;  1SRL A;  4RTU A;  3TQ7 P;  3V7S A;  1N27 A;  5GAN 3;  1PHT A;  4LDV A;  1P92 A;  3SFM A;  4RG2 A;  2D1X A;  1MHN A;  1SF9 A;  2CUD A;  2GQI A;  2OX7 A;  4EPC A;  2R57 A;  3WVD B;  2V26 A;  1VQO T;  2FZK B;  3OW2 S;  1VQN A;  1R0C B;  3H6Z A;  4BY6 B;  3C94 A;  5FU7 C;  1QKX A;  4KUD K;  2RI5 A;  2IG0 A;  4II1 A;  3G71 T;  2DBM A;  4CRI A;  2XID A;  1FMW A;  2EFI A;  2RK1 A;  2VGN A;  4PJL A;  5KCH A;  2QA4 T;  1Q81 R;  2M9U A;  3NPF A;  1KHC A;  2X4Y A;  4P5N A;  4FIB A;  3DB4 A;  2RQW A;  2CSI A;  2J05 A;  1Q95 G;  2W10 A;  3CQT A;  1YJW T;  1E6H A;  1H8K A;  1FWZ A;  4E7S A;  3CXC A;  1VA7 A;  4M78 B;  1M30 A;  2D0Q B;  5GMK m;  4E47 A;  3HPW A;  1OYX A;  1WJQ A;  3VS7 A;  2C0T A;  4CC2 A;  2JMA A;  1V1C A;  1KQ2 A;  3SWN B;  1BKB A;  3T9N A;  4KH0 B;  4HT8 A;  3G7Z A;  4HVV A;  4M77 G;  4Y28 E;  4N4G A;  3I55 A;  4AT1 B;  1TUD A;  4LD6 A;  4C0G A;  1QCF A;  3UA7 A;  2RHU A;  3AHU A;  1W2B P;  4M75 A;  3PVQ A;  1UGS B;  2E3I A;  4F04 B;  4JPB W;  4FYW B;  5IHI A;  3OYM A;  1VQL Q;  2CT3 A;  1BCM A;  2AHJ B;  2FO0 A;  3X26 B;  3G71 Q;  1B3Q A;  2C0I A;  2LQW A;  4EIK A;  3EG0 A;  4RTT A;  1Q82 C;  1UEB A;  1FX7 A;  3GBQ A;  4E2F B;  1YNZ A;  1AOJ A;  1JU5 C;  2LX7 A;  4EMG A;  3RES A;  3VUB A;  2LNH B;  1X27 A;  3VRZ A;  4C92 F;  4M77 A;  2EQM A;  3CPW A;  1IHW A;  1H3H A;  1B34 B;  3RMQ A;  4PJO G;  2HBP A;  3O5Z A;  3G4S Q;  2DF6 A;  2GGR A;  2E41 A;  1GBQ A;  1QW1 A;  4HVW A;  3RUX A;  4Q5W A;  1VQ7 A;  1YJ9 T;  1K8A R;  5KYN A;  2K4Y A;  2GBQ A;  2VB6 A;  1X6B A;  2K2M A;  1WDX A;  1OQK A;  1X2K A;  3CCQ Q;  2X9H A;  1GFD A;  5A0G A;  3M0R A;  3JCM h;  1IGU A;  2PTK A;  4C92 E;  4HCB A;  1H64 1;  5D6X A;  3OS0 A;  3CC7 Q;  3OYK A;  1OZ2 A;  3VYH B;  1VQM Q;  4PJO A;  1NYG A;  1SEM A;  1VQ8 T;  1Y7X A;  2QAS A;  1N8R R;  1ZQ1 A;  1HYO A;  3CCL A;  3MEA A;  3OYB A;  2M02 A;  3H9N A;  1UGP B;  3V7R A;  3Q1J A;  1QLY A;  3E9F A;  4J9F A;  2MMP A;  2E6Z A;  3EAE A;  3P8H A;  4HXJ A;  3M57 A;  4F7U F;  2OAW A;  2XDD A;  2QQB A;  1W1F A;  1EFN A;  4GBQ A;  2YDL A;  4ATO A;  2EKO A;  4C92 D;  3M0S A;  1YFN A;  2KAF A;  2HQH A;  3MP1 A;  5GAO l;  4KUL A;  5DLO A;  2BE9 B;  2COW A;  2EJG A;  3H8Z A;  1Y07 A;  4MDX A;  3PE0 A;  2LDM A;  1AT1 B;  4ZN1 A;  2CP3 A;  4PJO E;  3QO3 A;  8AT1 B;  3EG1 A;  4J9C A;  5GAM g;  5KYX A;  2A37 A;  2EPD A;  1IGQ A;  1VQ9 A;  4Y92 A;  5LJ5 d;  2YUN A;  4ZGD B;  5GAN 2;  3RIR A;  9ATC B;  5GAN 8;  2BTT A;  5LJ5 g;  1PKS A;  2E64 A;  5CR2 A;  3OYN A;  3OW2 A;  3QXE B;  5IHK A;  2DL8 A;  2M1H A;  1Q81 U;  4CC7 A;  1QKW A;  3JB9 F;  2RO0 A;  1AD5 A;  2YT6 A;  2A0F B;  4KBM B;  4FYV B;  4HKE A;  3VYG A;  1KJW A;  2P0Q A;  1S72 A;  4PJO D;  3L2R A;  3JB9 I;  4PJJ A;  3EGX B;  1PWT A;  3EGU A;  3G1J A;  4M78 C;  1M90 R;  1Y96 B;  1M8V A;  1NG2 A;  2K57 A;  1YN8 A;  2EQJ A;  4LN2 A;  4XU1 A;  3ZEH A;  2NUZ A;  3I9Q A;  2RHX A;  2ZCF B;  5FU6 B;  1MMA A;  3DLM A;  4LE9 A;  1K9A A;  1I07 A;  1WI7 A;  2JM9 A;  5LJ3 d;  1VIF A;  2HD0 A;  2ZPF B;  2E6N A;  2EYQ A;  4E7J A;  2LMJ A;  3M59 A;  5LJ3 g;  4MML A;  2H3J A;  4RCB A;  5CO7 A;  2RJC A;  1K0X A;  1VQN Q;  5CAI A;  3MPU B;  5GAO n;  5GAN 6;  2EGE A;  1RAD B;  3OW2 P;  3V8L A;  4AG2 C;  4M75 B;  1TUG B;  3VS0 A;  2J6K A;  1GCQ C;  5GAN h;  3OBY A;  4ZGJ B;  2PUO B;  3QZ9 B;  1JB0 E;  3MEW A;  1HXD A;  4N0A A;  4QQG A;  4X34 A;  1G3Y A;  1WA7 A;  3JB9 D;  1HSQ A;  4KGV B;  2QEX A;  2QQR A;  1WNL A;  3VS6 A;  1K4U S;  2YRC A;  3H0H A;  2DXC A;  4C8Q G;  1T3S A;  1X43 A;  3NFC A;  3I56 A;  2FB7 A;  4ANJ A;  3NHN A;  4M77 B;  1EZZ B;  4JLI A;  3OQ5 A;  4FSX A;  4IUV A;  4ZNX A;  1JO8 A;  2ED1 A;  2ZAE A;  5GAN 7;  3V7C A;  5EG2 A;  2JVV A;  5C6S A;  5IH2 A;  2EGA A;  3QZ5 B;  3L42 A;  2WSE E;  2QQS A;  3SWN A;  4BI8 B;  3KXT A;  2DTH A;  3C95 A;  1IRX A;  2I0N A;  3TSW A;  2EIF A;  4C8Q A;  3QWY A;  4M7D A;  4NL3 A;  2LQK A;  1ZA2 B;  3CXC S;  4EMK C;  2Y90 A;  4BDZ A;  2BIV A;  2YSQ A;  2O2O A;  2D9T A;  2DXB A;  5GJV B;  3CME T;  1YP5 A;  3VRY A;  1E6G A;  4C5I A;  5EC7 A;  1UE9 A;  1ZSG A;  4A4E A;  3F70 A;  3LH0 A;  2CUB A;  1PSE A;  2O88 A;  4RTY A;  2DM1 A;  2R58 A;  5I11 A;  1PCX A;  2O31 A;  1RAE B;  3GNF B;  2KDS A;  4JJN K;  1NZ9 A;  1Z9Q A;  2ROT A;  2MI6 A;  5KE2 A;  1VQ7 Q;  4XTX A;  2JXB A;  2V8I A;  1ZUU A;  4QVZ A;  4DQ2 A;  1OU9 A;  2KYM A;  2KT8 A;  3M54 A;  1B34 A;  4M78 E;  3FIF A;  1QVG S;  2PVO B;  3BE3 A;  3JCM V;  4FSS A;  1U1T A;  1OI1 A;  3OMC A;  4DBR A;  4A53 A;  3ULR B;  1VYU A;  3M0Q A;  3E1S A;  4QQD A;  1C1A A;  2J6F A;  3RER A;  3CCJ A;  3NTH A;  4J9B A;  1Q7Y C;  3M53 A;  1FXX A;  3EFS A;  3VKI A;  1YIT T;  4OML A;  2EKH A;  2DL3 A;  3RKX A;  2PZ1 A;  2KYB A;  3IQL A;  3CCL Q;  2QYZ A;  2XI9 A;  5KYX B;  1VQ9 T;  2LJ3 A;  5J26 A;  4DA4 A;  1DJ7 B;  2DE0 X;  2D8J A;  3M55 A;  2CP2 A;  2I2L A;  4M78 D;  1VQ4 A;  2J6O A;  1WHH A;  2DTI A;  4DEX A;  3CMA T;  2HSE B;  2HSP A;  2AZS A;  5D6Y A;  1M90 U;  4AG1 C;  2DIQ A;  3HFN A;  2PUK B;  3LGF A;  4HT9 A;  3RMS A;  1V76 A;  2DRK A;  3CCE A;  3L2Q A;  2RF0 A;  3C4S A;  1S72 T;  1SKU B;  4M7A G;  4A4K A;  1YCS B;  1ABO A;  5GAN 5;  5HY6 A;  5IXF A;  5KYU A;  3N5B B;  1XNI A;  3EG9 A;  4VUB A;  3UA6 A;  1XOV A;  2EAY A;  4J5Y A;  4E6R A;  1G8X A;  1M3C A;  2E5Q A;  2DA9 A;  1BBZ A;  3QYH B;  3FLG A;  3VS2 A;  3M5A A;  2NLU A;  5CKH A;  1VQ9 Q;  4KT0 E;  3BFM A;  1M2O A;  4PL6 A;  3WVE B;  3LWH A;  2LTO A;  1LPL A;  5GAO q;  1IHV A;  1X2Q A;  2QK0 A;  2VXE A;  1NM7 A;  1V29 B;  1PKT A;  4FT4 A;  4J9G A;  3LX7 A;  4HCZ A;  3CCR A;  2DJZ A;  4M7A A;  4BI4 A;  2KGT A;  2XU8 A;  4RTX A;  4M75 C;  2E4H A;  4FW2 A;  2EQK A;  4UC4 A;  2HNI A;  2MCN A;  3UWN A;  5C0M A;  1S72 Q;  4GLM A;  5GMK j;  2GTO A;  1VOM A;  1G83 A;  1BIA A;  2DX1 A;  2PVG B;  4XTV A;  1BI0 A;  3THK A;  2HMA A;  3MHX A;  1BB9 A;  4QKU A;  4O5V A;  3RKY A;  3ZFJ A;  2DET A;  1AVZ C;  1I5L A;  4M77 C;  5CCA A;  1HK9 A;  1PD0 A;  1I1J A;  2CP0 A;  4C5G A;  3OB9 A;  2QEX T;  2A08 A;  2L5Q A;  3G6E A;  3QUI A;  3CBM A;  2JTE A;  3EGX A;  3JCM J;  2DL5 A;  1VQL T;  3M9Q A;  1OX9 A;  3OYF A;  4RMO A;  1GFC A;  1Y96 A;  2DIG A;  2JT4 A;  4IUU A;  3V8J A;  3OYC A;  4M4Z A;  2OTL A;  2CRE A;  2D0N A;  2KRO A;  2O9S A;  2JNG A;  2DK3 A;  4WF2 A;  2KRS A;  4M75 G;  1LNX A;  2E12 A;  1ACM B;  1UUE A;  3OYD A;  1ZUY A;  4Z89 A;  2VGM A;  5IHN A;  2Y4Y A;  2C06 A;  3H0I A;  1KD1 C;  2EYW A;  1K0S A;  1QP3 A;  3JCM d;  4PJO C;  1RL2 A;  4BE0 A;  1KFZ A;  1JJ2 P;  5IT9 E;  2B8A A;  3JCM g;  3FC3 A;  1WJS A;  4EMH A;  3G4S T;  2QG9 B;  4C8Q B;  4OMP A;  3JAM E;  4M7D B;  2QEX Q;  2KBT A;  1OV3 A;  2E10 A;  3PGG A;  1AEY A;  4XQ3 A;  3SDZ A;  1X75 C;  1BI3 A;  2EGC A;  1TXQ A;  2ECZ A;  1HJD A;  1RAI B;  1ARK A;  2A28 A;  3I5R A;  4LNP A;  3CCQ T;  3I56 Q;  4OB1 B;  1M1F A;  5J39 A;  1VQ5 A;  1OUL A;  1KD1 U;  1RLQ C;  3E2U A;  2FG0 A;  2COZ A;  2OI3 A;  2RB6 A;  1QVG A;  4F17 A;  1VQ6 A;  1VQK A;  3CC7 T;  5CKE A;  4QVC A;  1VQM T;  1TSF A;  2JJ9 A;  1T0J A;  3HFO A;  2EJF A;  4C0Z A;  3HTR A;  4PFP A;  1I81 A;  3TRE A;  3S3O A;  2LP5 A;  2HL3 A;  4RTW A;  3QDF A;  4MZT A;  2HBW A;  1M2V B;  4QW2 A;  2DEQ A;  2P4R A;  2NUP A;  1Q82 U;  4AFU C;  1TS9 A;  4FL6 A;  2KNB B;  5CKF A;  3CXC P;  3E19 A;  2J7I A;  3I5S A;  7AT1 B;  2EVR A;  3QBY A;  4CC3 A;  4M75 E;  2HKN A;  1M4Z A;  3OYJ A;  3OY9 A;  3ME9 A;  1MNE A;  4N4H A;  3QSU A;  1MGQ A;  5GMK l;  2J06 A;  4A4H A;  2DER A;  5GAO r;  3OYE A;  1VQ4 T;  2QQA A;  2HL5 C;  1ZBJ A;  2NUT A;  4FYY B;  1YWP A;  1WHJ A;  4L5G A;  1K9M C;  2M16 A;  4X1V A;  1K73 C;  1QCO A;  4M77 E;  4J9I A;  4OGC A;  1QVG P;  1PC0 A;  4PJO F;  3HRU A;  1H3Z A;  3A8M B;  5CKB A;  2RJE A;  3CCM A;  2XMF A;  3CCU A;  4M75 D;  3QDR B;  1QWF A;  3CCJ Q;  5FRN A;  5IXB A;  3S3M A;  5GAM e;  1RAB B;  3CPW P;  4F7U A;  5KYU B;  4ESR A;  1CKB A;  2VWF A;  4D8D A;  3EG9 B;  1OU8 A;  1UHF A;  2GFA A;  1TTH B;  1D1A A;  8ATC B;  4PJM A;  1TH7 A;  3GIB A;  2DYB A;  2KRM A;  4XTU A;  1K9M U;  4Z8A A;  4ZTF A;  1K73 U;  2ZPE B;  4OMO A;  4L59 A;  5FW9 A;  2F5T X;  5LJ5 e;  3X25 B;  3A98 A;  2M51 A;  2AT1 B;  1VQ4 Q;  1PNJ A;  3GNG A;  4M77 D;  5GAM d;  1WLP B;  4HCC A;  1I8F A;  4E7H A;  5GMK e;  4QQ6 A;  4M7A B;  2DAQ A;  1KQ1 A;  4JUV A;  1GBR A;  2LCL A;  1H92 A;  3CCE Q;  3DB3 A;  4OGE A;  2RHZ A;  1D09 B;  3JV3 A;  2QI2 A;  3CCV A;  2FVU A;  4OB3 B;  4N0A C;  2GF7 A;  1WHK A;  3NGP A;  1W70 A;  4BY6 C;  5KH6 A;  5GAN d;  3MCA B;  2WSF E;  3L2Z A;  5KCO A;  2FRW A;  5J3B A;  2QGF B;  5GAN g;  3LLR A;  1I5O B;  1VQN T;  1GCP A;  1ZUK A;  3FEO A;  1WXB A;  1M8M A;  2NWM A;  1MMD A;  5GJW B;  3L2V A;  4HCK A;  4ZN3 A;  3OSS C;  3RNJ A;  2X3W D;  2ABL A;  1M3B A;  3CCR Q;  1TU0 B;  2BE7 D;  1CKA A;  1ZLM A;  2DVJ A;  4DOV A;  5LJ3 e;  4HVU A;  1WPY A;  5GAO p;  3VS3 A;  4BD3 A;  5FWC A;  3DLL A;  2M0Y A;  1Q7Y R;  3MEV A;  4ELZ C;  3QJ6 A;  2F2V A;  3SWN C;  4PK4 A;  2ESW A;  2E3H A;  4LXC A;  4LDU A;  4C8Q C;  1B07 A;  3JCM c;  1R77 A;  1AZG B;  2P84 A;  4NOY A;  2LX9 A;  1N5Z A;  2XHC A;  4EDU A;  2YHT A;  5CIU A;  2V8K A;  4HA8 A;  2PNI A;  3CEY A;  2GQV A;  1SRM A;  2LNV A;  3I55 T;  2XDB A;  4J6X A;  2LVM A;  3OYL A;  1IXD A;  5HK0 A;  3G6E Q;  1R8O B;  1WJR A;  1UEC A;  4RUG A;  2EYY A;  1NLO C;  2KR3 A;  3CCS A;  2D8H A;  3JCM W;  1M1K C;  3UAT A;  2OTL Q;  1WXT A;  3EFR A;  2KE9 A;  1TUC A;  1K8A C;  3A8H B;  5M9O A;  2OTJ A;  1SPK A;  2BZY A;  1VQK T;  1YBY A;  1BCO A;  2RHY A;  4OMF B;  4XU0 A;  1KSW A;  2YUO A;  2CYZ B;  5L8R E;  3H41 A;  3EG3 A;  1G3T A;  1NEB A;  4M7D G;  4FYX B;  4JS5 A;  1U3O A;  4J9H A;  4C0D B;  2LC4 A;  1SHG A;  2DXU A;  2F1L A;  2CGH A;  2LJ0 A;  2P0P A;  1G3S A;  4C92 B;  1M1K U;  2KY9 A;  4LUE A;  1VQO A;  3VS5 A;  3I55 Q;  3U23 A;  5LL6 S;  1ZSZ A;  4BDY A;  2HKQ B;  1QP2 A;  1X69 A;  1OOT A;  2LQ8 A;  1VQ7 T;  1SSF A;  2HCK A;  4NS5 A;  2NUP B;  2F2W A;  2JTF A;  3JRZ A;  3QHS A;  2GNC A;  2QA4 A;  3L2W A;  4ELY C;  1VQ5 Q;  1NJI C;  4JRK A;  5KYY A;  2PVD B;  2KI7 A;  2LJ1 A;  4TVR A;  1KG1 A;  1BI2 A;  4R55 A;  1VQ6 Q;  2M0O A;  4M78 F;  1VQK Q;  2RQT A;  1RAC B;  1YJW A;  2EJ9 A;  5FU7 B;  5L23 A;  5HCK A;  5I2S A;  2RHI A;  3HRS A;  3PMI A;  3QKJ A;  3KFV A;  2XK0 A;  1RI9 A;  1UGR B;  4C8Q F;  2NUT B;  4WTO B;  3NTI A;  3CCL T;  1UJ0 A;  3MKD A;  1J3T A;  1EIF A;  1Q86 C;  1NJI U;  2RQR A;  1PM3 A;  1JRI A;  2JM8 A;  1XJW B;  3M58 A;  2JOY A;  3GLX A;  2F2X A;  2HQE A;  3DKM A;  4RTZ A;  1UHC A;  2X35 A;  3I35 A;  1GRI A;  4F7U B;  2L8D A;  4M7A C;  2L3Q A;  4YTL A;  1M2V A;  1IRE B;  1KD1 R;  2JMC A;  4C8Q E;  3SHW A;  4IKF A;  4M7D E;  2FHD A;  1MV3 A;  1NE8 A;  3QG1 A;  4PFO A;  4JDS A;  4D8K A;  4AFZ C;  2DLP A;  3FB9 A;  3EFO A;  2E70 A;  2JUF A;  4JJB A;  3LW5 E;  4BAC A;  1Y0M A;  1FYN A;  1PG5 B;  3M0P A;  3X20 B;  1PRM C;  2LT1 A;  1O75 A;  2WAC A;  1U06 A;  4L6V 5;  3CC4 A;  3CCM Q;  2CZ7 B;  1NYF A;  3CCU Q;  1NBE B;  1YJ9 A;  1Q82 R;  1LVK A;  1JXO A;  4E7Z A;  2RH2 A;  2CKK A;  2QGG A;  3J80 E;  2RK2 A;  2IIM A;  3ZL7 C;  1Q7Y U;  2ZPI B;  1VQP A;  4C8Q D;  4M7D D;  1QMC A;  4A63 B;  1KIK A;  2DVE A;  1JQQ A;  4XTW A;  5FU6 C;  2RPN A;  2CH4 W;  1M9S A;  1UJY A;  5I2M A;  2LT4 A;  1G3W A;  2CH4 A;  1VQ8 A;  2G6F X;  4A54 A;  2LCC A;  3JB9 J;  2CP5 A;  5KYW A;  4IIM A;  3PT9 A;  4C5H A;  1BI1 A;  2FPD A;  2K79 A;  1Z9Z A;  5DLQ E;  2KXD A;  3KUF A;  1LCK A;  4XTZ A;  5GAM j;  3CCV Q;  3S6W A;  2K5L A;  2E5K A;  2XG8 D;  5D7U A;  5CKD A;  2BKD N;  2MWP A;  1VUB A;  2A7Y A;  1KC8 C;  3GP8 A;  3OYY A;  1MND A;  5AYF A;  3CC2 A;  4DOW A;  5LJ5 j;  3JCM b;  4MZP A;  4RG8 A;  1W4S A;  5ECA A;  5FWB A;  3L1A A;  5FRM A;  2DPP B;  1XQH A;  4JS4 A;  1K9M R;  2EQI A;  1KHI A;  1K73 R;  4AMC A;  4M7A F;  2CZ0 B;  5GAN j;  4IUT A;  2DL4 A;  3OA6 A;  2KVQ G;  2PQW A;  1D1C A;  2RN8 A;  2RQV A;  2MYS A;  2AK5 A;  1AWW A;  3R6O A;  1PRL C;  2EYX A;  3UF4 A;  2H3E B;  1UGV A;  2OTJ T;  4MZM A;  2MK5 A;  1KC8 U;  4PKC C;  1Y71 A;  2L3S A;  3A8G B;  2KSS A;  2MOX A;  4XU3 A;  1JEG A;  2KK4 A;  4MMK A;  2FZG B;  1F1B B;  4RTV A;  2Y4X A;  4DBQ A;  1AWJ A;  1D3B A;  1W2B A;  1LOJ A;  4J83 A;  2YWW A;  4QVD A;  3I56 T;  2G3R A;  4J6Y A;  2CZ1 B;  4XK8 E;  3JCM e;  2L2P A;  4A4F A;  3TEE A;  4M7A E; 
#chains in the Genus database with same CATH homology
 3R6N A;  1K0X A;  1WYX A;  2DRM A;  2KRN A;  2XMF A;  1Y57 A;  2DMO A;  2YUQ A;  2X3X D;  1QWF A;  2EGE A;  3M0U A;  2DIL A;  5IXB A;  3M0T A;  4AG2 C;  3VS0 A;  2J6K A;  4ESR A;  1CKB A;  1GCQ C;  2VWF A;  3EHQ A;  4D8D A;  2JS2 A;  1UHF A;  2DYB A;  2KRM A;  4F14 A;  4JJD A;  1WA7 A;  4Z8A A;  1HSQ A;  3H0F A;  4OMO A;  5FW9 A;  1I0C A;  1E7O A;  2A36 A;  2VKN A;  3A98 A;  3VS6 A;  2M51 A;  1K4U S;  3VS4 A;  3H0H A;  1UFF A;  1PNJ A;  1A0N B;  2ENM A;  1T3S A;  3REA B;  1X43 A;  1WLP B;  1RLP C;  1UG1 A;  2K3B A;  3NHN A;  2EYZ A;  4AFS C;  2ROL A;  1WX6 A;  3REB B;  1GBR A;  2RMO A;  4J9E A;  4ZNX A;  1H92 A;  1W6X A;  1JO8 A;  2ED1 A;  3JV3 A;  4OMM A;  1MUZ A;  4QT7 A;  2CT4 A;  4J9D A;  2BZX A;  5IH2 A;  2EGA A;  3NGP A;  1W70 A;  2HDA A;  2LZ6 B;  2YUP A;  2V1Q A;  2CSQ A;  2FRW A;  4F16 A;  2I0N A;  3TSW A;  2RNA A;  3QWY A;  3C0C A;  2MIO A;  1GCP A;  1ZUK A;  2YSQ A;  1WXB A;  1M8M A;  2L0A A;  2DBK A;  2O2O A;  2NWM A;  3EHR A;  3VS1 A;  5GJV B;  1YP5 A;  5GJW B;  4HCK A;  3VRY A;  1E6G A;  3RNJ A;  2X3W D;  2ABL A;  5EC7 A;  2HEQ A;  1UE9 A;  1ZSG A;  1M3B A;  1CKA A;  1ZLM A;  2DVJ A;  2CUB A;  2V1R A;  4HVU A;  1K76 A;  4JJC A;  1ABQ A;  3VS3 A;  2O88 A;  4RTY A;  2C0O A;  2RQU A;  5FWC A;  3SEM A;  2DM1 A;  2M0Y A;  2W0Z A;  2F2V A;  2JS0 A;  5I11 A;  2O31 A;  2ESW A;  4K11 A;  3PVL A;  1U5S A;  2KT1 A;  1Z9Q A;  2ROT A;  4OMN A;  1VYT A;  3RBB B;  1SRL A;  1B07 A;  1AZE A;  4RTU A;  1AZG B;  4JZ3 A;  2JXB A;  1SHF A;  1N5Z A;  1ZUU A;  4KRT A;  2KYM A;  2KT8 A;  3NMZ C;  4LUD A;  1UTI A;  1PHT A;  2PNI A;  4FSS A;  1T3L A;  2AKK A;  2D1X A;  3ULR B;  1VYU A;  1SRM A;  2CUD A;  2GQI A;  3M0Q A;  4IIO A;  2J6F A;  1FMK A;  1UEC A;  4RUG A;  4J9B A;  2EYY A;  1OPL A;  1QKX A;  4OML A;  1NLO C;  1IO6 A;  2DBM A;  2DL7 A;  2DL3 A;  2KR3 A;  2EKH A;  2PZ1 A;  2D8H A;  2KYB A;  3IQL A;  3UAT A;  1QWE A;  2L3P A;  1WXT A;  2KE9 A;  2FRY A;  3NPF A;  1TUC A;  1TG0 A;  2LJ3 A;  1SPK A;  2BZY A;  2RQW A;  2CSI A;  2J05 A;  2DE0 X;  2W10 A;  3CQT A;  2D8J A;  2OJ2 A;  1KSW A;  1E6H A;  2YUO A;  1H8K A;  2J6O A;  1NEG A;  3H41 A;  3EG3 A;  4DEX A;  1NEB A;  1VA7 A;  2HSP A;  1M30 A;  3TSZ A;  2AZS A;  1U3O A;  4J9H A;  3VS7 A;  4AG1 C;  2C0T A;  4CC2 A;  2JMA A;  1V1C A;  1SHG A;  2LJ0 A;  1UDL A;  2DRK A;  2RF0 A;  4HVV A;  4LUE A;  3VS5 A;  2AZV A;  3U23 A;  1YCS B;  2AKL A;  1ABO A;  1TUD A;  1VYV A;  2ED0 A;  1QCF A;  3UA7 A;  1X69 A;  1OOT A;  4ORZ A;  3PVQ A;  2SRC A;  5IXF A;  2HCK A;  2F2W A;  4WCI A;  4JPB W;  5IHI A;  2CT3 A;  3UA6 A;  1XOV A;  4E6R A;  2FO0 A;  2GNC A;  1B3Q A;  1M3C A;  2C0I A;  1YWO A;  2LQW A;  2DA9 A;  1BBZ A;  3VS2 A;  1X6G A;  4EIK A;  3EG0 A;  4RTT A;  2LJ1 A;  3GBQ A;  1YNZ A;  1AOJ A;  2RQT A;  1JU5 C;  2DNU A;  2LX7 A;  5L23 A;  5HCK A;  1X2Q A;  1NM7 A;  1PKT A;  3KFV A;  2LNH B;  1X27 A;  4J9G A;  3VRZ A;  1RI9 A;  2KGT A;  1H3H A;  4RTX A;  1UJ0 A;  1WXU A;  3O5Z A;  2GTJ A;  1T0H A;  2FPF A;  1J3T A;  2DF6 A;  2GGR A;  1GBQ A;  2MCN A;  2RQR A;  4GLM A;  4HVW A;  2GTO A;  2JM8 A;  1G83 A;  2KEA A;  2DX1 A;  2DJQ A;  2GBQ A;  1X6B A;  2K2M A;  3THK A;  1WDX A;  2F2X A;  1BB9 A;  1X2K A;  4RTZ A;  1GFD A;  1UHC A;  3M0R A;  3I35 A;  1AVZ C;  1GRI A;  2PTK A;  2L3Q A;  1CSK A;  1G2B A;  1I1J A;  2JMC A;  3SHW A;  2A08 A;  2QDL A;  1WFW A;  1WIE A;  2JTE A;  3TVT A;  1MV3 A;  4D8K A;  1MV0 B;  4AFZ C;  1NYG A;  1SEM A;  2DL5 A;  2DLP A;  4JJB A;  2FEI A;  1Y0M A;  1FYN A;  1GFC A;  1AWO A;  2JT4 A;  4M4Z A;  2CRE A;  2D0N A;  2KRO A;  2O9S A;  3M0P A;  1PRM C;  3FJ5 A;  2KRS A;  1RUW A;  1UUE A;  1QLY A;  4J9F A;  1U06 A;  1ZUY A;  4AFQ C;  4Z89 A;  2FPE A;  1NYF A;  4HXJ A;  5IHN A;  2OAW A;  3H0I A;  1W1F A;  1JXO A;  4DEY A;  1EFN A;  2EYW A;  1K0S A;  4GBQ A;  2K7A A;  2YDL A;  2IIM A;  1KFZ A;  3ZL7 C;  1SSH A;  3M0S A;  4A63 B;  1KIK A;  4R0K A;  2KXC A;  4OMP A;  1JQQ A;  2KBT A;  1OV3 A;  2RPN A;  2K9G A;  2CH4 W;  1UJY A;  1JXM A;  1AEY A;  3PE0 A;  2CH4 A;  2EGC A;  2G6F X;  2ECZ A;  2O9V A;  2LQN A;  1HJD A;  1ARK A;  1HD3 A;  2A28 A;  3I5R A;  3EG1 A;  4LNP A;  4J9C A;  1GL5 A;  4IIM A;  2A37 A;  1RLQ C;  2EPD A;  2FPD A;  2K79 A;  4Z88 A;  1Z9Z A;  2FG0 A;  2OI3 A;  4Y92 A;  1M27 C;  2KXD A;  4F17 A;  3LH5 A;  2YUN A;  2JW4 A;  1LCK A;  3EG2 A;  4OMQ A;  2SEM A;  2BZ8 A;  2BTT A;  1M3A A;  1PKS A;  1T0J A;  2E5K A;  1OPK A;  5IHK A;  2DL8 A;  4CC7 A;  1ZX6 A;  1QKW A;  2H8H A;  1AD5 A;  2LP5 A;  2YT6 A;  2EW3 A;  4RTW A;  5ECA A;  3QWX X;  5FWB A;  2HBW A;  1KJW A;  2EQI A;  2P4R A;  4AFU C;  1OEB A;  2KNB B;  2DL4 A;  2J7I A;  3I5S A;  2RN8 A;  2EVR A;  2RQV A;  1PWT A;  1BK2 A;  4CC3 A;  2AK5 A;  1AWW A;  1K1Z A;  1PRL C;  2EYX A;  3EGU A;  3UF4 A;  4CC4 B;  2CDT A;  1NG2 A;  2VVK A;  4JZ4 A;  1S1N A;  1UGV A;  5I22 A;  1YN8 A;  4LN2 A;  2L3S A;  2NUZ A;  3I9Q A;  2LCS A;  2J06 A;  2MOX A;  4LE9 A;  1JEG A;  1K9A A;  2K6D A;  2EBP A;  1I07 A;  4RTV A;  1GCQ A;  1AWJ A;  1WI7 A;  1ZBJ A;  2JM9 A;  1BU1 A;  1AWX A;  1YWP A;  2B86 A;  2L2P A;  2LMJ A;  4X1V A;  1NLP C;  4J9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...