2J6FA

N-terminal sh3 domain of cms (cd2ap human homolog) bound to cbl-b peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical Polyproline Recognition by the Cms N- Terminal SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords CD2-ASSOCIATED PROTEIN
total genus 13
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j6fA00
1A0NB 3I35A 1KSWA 3M0TA 2LQNA 2DL3A 2HSPA 1K4US 3TSWA 2A08A 2H8HA 1YNZA 2D0NA 2LP5A 1KIKA 1YCSB 2FG0A 1BU1A 1W70A 3H0HA 1UDLA 3PE0A 1PRMC 2EYWA 3QWXX 2K7AA 4ESRA 4F17A 3SEMA 1M3BA 2FO0A 1QKWA 2CUDA 1UG1A 2SEMA 1M3CA 2JM9A 1GRIA 2IIMA 2DNUA 2DYBA 2W10A 2F2VA 2MOXA 4OMQA 3VS0A 3M0PA 1AWXA 1YWPA 3NPFA 4HVVA 2KXDA 4LE9A 5I11A 1Y57A 3PVLA 4AG2C 5IH2A 3VRYA 2O88A 3NMZC 2DJQA 4RTZA 1I07A 4GBQA 4QT7A 2JM8A 1TUCA 2CREA 1H3HA 3R6NA 2FRWA 1EFNA 1ZX6A 1K9AA 5IXBA 2GGRA 2RPNA 2C0OA 4ORZA 1HD3A 1AVZC 4X1VA 4OMPA 2J6FA 1NG2A 1E6GA 2E5KA 1E6HA 2OJ2A 4Z88A 2EW3A 2KGTA 2DBMA 2YUPA 1KFZA 2AZSA 1GCQC 2DVJA 4JZ4A 2I0NA 1NM7A 1YWOA 1WLPB 2DRKA 2BZXA 2EPDA 3VRZA 1B07A 2ABLA 3QWYA 2DL7A 4R0KA 4AFSC 2JS0A 3NGPA 1WX6A 1AWJA 4JJDA 2NWMA 2BTTA 2KT8A 4J9EA 3I5RA 2A28A 1X69A 1ZUYA 3ZL7C 2D8JA 1OEBA 2EYYA 5GJVB 2GBQA 3H41A 4GLMA 2EKHA 1N5ZA 2FPDA 2K3BA 1X6GA 3I9QA 1UGVA 5GJWB 2LJ3A 1UHFA 2RF0A 3O5ZA 2ED1A 1K1ZA 1ABQA 3THKA 2BZYA 2CSIA 1JXMA 2AZVA 2FPFA 1VA7A 2KXCA 3EG0A 2ECZA 1T3SA 4RTUA 1QLYA 3RBBB 3IQLA 1X27A 1GCQA 2CT3A 1W1FA 2KRNA 2DL8A 3TSZA 2HEQA 4CC4B 1S1NA 2PTKA 2L3QA 2VKNA 4J9CA 2RQRA 1FYNA 1V1CA 2CH4W 2O31A 2DL4A 1YP5A 1MV0B 2EGEA 2V1RA 3UA7A 4F16A 2JTEA 2D1XA 2JW4A 2KR3A 1PWTA 2O9SA 3JV3A 3EHRA 1U06A 4LNPA 2CDTA 1CKBA 2FPEA 2XMFA 2KEAA 4DEYA 4RTYA 2OAWA 2K9GA 2DX1A 4LUEA 1AD5A 3UATA 2RN8A 4HXJA 1VYUA 2DILA 3EG1A 3PVQA 1GL5A 4F14A 4D8KA 4J9HA 4D8DA 2C0IA 1AWWA 1WXBA 1UECA 4IIMA 3FJ5A 1Z9ZA 2C0TA 4OMMA 2GQIA 1LCKA 4J9GA 1I1JA 1OPKA 1UE9A 4RTVA 1WA7A 1UJYA 1ZBJA 2EBPA 1X2QA 5IXFA 1UTIA 2LMJA 2JMCA 1X2KA 3M0SA 4KRTA 3VS3A 2DRMA 1NEBA 1WXTA 1JO8A 1RLPC 2ED0A 1GBQA 3VS4A 4RTWA 1BB9A 2KNBB 3NHNA 1OPLA 4J9BA 2ROLA 2KE9A 2O2OA 4IIOA 2AK5A 2GTJA 4HVWA 2LZ6B 4E6RA 3VS1A 2DL5A 2RQTA 1Y0MA 2PZ1A 2K79A 2L3SA 2G6FX 1K0XA 1NLPC 2F2XA 4J9FA 1MV3A 2JS2A 1SSHA 1PRLC 1UFFA 2J05A 5ECAA 1GBRA 3ULRB 4ZNXA 1B3QA 2MIOA 1AWOA 1PKTA 2EYZA 2EYXA 1TUDA 1BBZA 2VVKA 2EGCA 1WDXA 2RMOA 2LJ1A 2B86A 2KYBA 3GBQA 3A98A 2DE0X 2GNCA 1I0CA 1ARKA 5L23A 4JZ3A 4J9IA 2SRCA 2YDLA 3EG2A 1SRLA 3KFVA 3UF4A 4AG1C 1OOTA 2JT4A 1HJDA 1QCFA 1H92A 2CUBA 4M4ZA 4JJBA 2YSQA 3I5SA 1XOVA 1AZGB 2K6DA 4FSSA 1W6XA 1SEMA 4LUDA 1PNJA 1VYTA 4AFZC 2L0AA 3LH5A 1CKAA 2AKKA 3H0FA 1JU5C 3M0RA 2KROA 2EQIA 2L3PA 2YUNA 4J9DA 2JMAA 2CSQA 1YN8A 1WI7A 2OI3A 2RNAA 3CQTA 1J3TA 2DF6A 1T3LA 2P4RA 3U23A 4CC2A 2DA9A 2MCNA 1WXUA 2L2PA 1K76A 1H8KA 1VYVA 1UJ0A 3UA6A 5FWCA 4HCKA 1ZSGA 1K0SA 1CSKA 2J6KA 1T0HA 2KT1A 1SHGA 2DM1A 1G2BA 1X43A 4AFUC 1WIEA 5EC7A 2A37A 1ZUKA 2LJ0A 1GCPA 3EHQA 2HBWA 4Z89A 2K2MA 2HCKA 2A36A 5IHIA 2DBKA 1UUEA 1PKSA 1U5SA 4DEXA 3TVTA 1E7OA 5I22A 2D8HA 2HDAA 2RQVA 2YT6A 2ESWA 1HSQA 2LCSA 1SHFA 2J06A 1BK2A 2KRSA 3M0QA 1G83A 2BZ8A 3EGUA 1NEGA 1GFDA 4AFQC 2LNHB 4JPBW 4LN2A 1JQQA 2VWFA 2FEIA 4JJCA 4CC7A 2J6OA 1GFCA 1AEYA 3EG3A 2JXBA 2KBTA 4OMLA 3REAB 1OV3A 2ROTA 3H0IA 5IHNA 3SHWA 2O9VA 1PHTA 2M0YA 5FWBA 1JXOA 4CC3A 1IO6A 1ABOA 3C0CA 1U3OA 1X6BA 2RQUA 3VS2A 1QKXA 1M8MA 1RLQC 5FW9A 1SPKA 4K11A 1ZUUA 4WCIA 1FMKA 4RTXA 2F2WA 1M3AA 2KYMA 1ZLMA 2DLPA 2V1QA 4RUGA 4Z8AA 1AZEA 2FRYA 1M27C 2LX7A 1AOJA 3RNJA 1TG0A 4A63B 2KRMA 1NLOC 2CT4A 2YUQA 2X3XD 1QWEA 1RI9A 1M30A 2X3WD 1NYFA 2DMOA 2PNIA 2QDLA 1NYGA 2EGAA 1WFWA 1JEGA 2J7IA 1Z9QA 2GTOA 2NUZA 2ENMA 2AKLA 1T0JA 4EIKA 5IHKA 1SRMA 2LQWA 1RUWA 3VS5A 2CH4A 1UHCA 1WYXA 5HCKA 2YUOA 3REBB 4OMOA 4RTTA 1MUZA 4Y92A 3M0UA 1QWFA 4HVUA 3VS6A 1KJWA 2EVRA 4OMNA 2M51A 2RQWA 3VS7A 2W0ZA
chains in the Genus database with same CATH superfamily
1QMCA 3G1JA 4FL6A 1KSWA 3M0TA 2RB6A 2EKOA 2Y4YA 1K4US 1M2VB 2A08A 2COWA 2LP5A 1BU1A 1W70A 3H0HA 3FDRA 1PRMC 2EYWA 3QWXX 2K7AA 4C92E 4ESRA 3SEMA 1M3BA 1MMDA 2FO0A 1QKWA 3JCMc 1UG1A 3CCJT 3CC2T 3EGDB 3OYMA 1D09B 3WXMB 5GANf 5LJ5d 2DYBA 3VS0A 1Y07A 3TU4K 1YWPA 3NPFA 1TH7A 3EFOA 4BD3A 5IH2A 2O88A 1WHGA 2EJFA 5KE2A 5CCAA 1M5Q1 7AT1B 2P84A 2LT1A 4QT7A 1H3HA 4M7DE 4AMCA 4A4FA 5D6YA 3V8KA 4XTUA 3MCAB 2C0OA 1WJQA 3AHUA 4X1VA 2AT1B 2CYZB 4ZGEB 2P0PA 2OJ2A 5GAMe 4E7JA 3AT1B 2QA4Q 1WNLA 3CMET 1NM7A 1WLPB 2DRKA 2BZXA 2DAQA 1C0MA 2RA2A 4J6WA 3QZ9B 3L2VA 2BTTA 4Y28E 3I5RA 3CCSA 2L5QA 1RACB 1VQMA 2VUBA 4JLIA 2GBQA 4JRQA 4M77F 3PFSA 2FHDA 2LJ3A 3O5ZA 4M7DA 3M56A 2DIGA 1JXMA 1VA7A 4RTUA 1KHCA 3H6ZA 2NUPA 3EG0A 4JLGA 3VYGA 2CT3A 4M7AE 3C12A 2KAFA 3CCEQ 2DL8A 4DOVA 2HEQA 3F70A 3G71T 2A3LA 2QQRA 2RQRA 1SSFA 4M75F 4MMLA 3S3NA 9ATCB 1KQSP 2DL4A 2LCCA 1WJSA 2WSCE 2KR3A 1PWTA 3JV3A 2QEXQ 4J5YA 3P8HA 1DJ7B 2OTLT 5AT1B 2RN8A 3LX7A 4HXJA 3JRZA 3PVQA 1IGUA 2DXBA 1N8RR 4D8KA 2Z0WA 1QVGP 4PJOA 2YRDA 1K8AR 1AWWA 3LGFA 4IIMA 1WJRA 5GMKj 4PL6A 1FMWA 5KYWB 4XU1A 1M90U 2XHCA 1EIFA 2GQIA 1YJ9Q 4M78G 4J9GA 2G3RA 3EFSA 4PFPA 4B6MA 2M9UA 1UJYA 1EX4A 3BW1A 1MNDA 2DVEA 5IXFA 4ZN3A 3M0SA 4KRTA 4M75D 1JO8A 1RLPC 2ED0A 2GFUA 5KYWA 2NYSA 3VS4A 4RTWA 3D7SB 3NHNA 2A0FB 5I2MA 5GAN3 4J9BA 2O2OA 1Q86C 2GTJA 3JB9D 4C8QF 2X4WA 4JRKA 1YIJT 1LVKA 2F5TX 2RQTA 1M1GA 3CCQQ 2E12A 1H3ZA 3ZFJA 3CCMT 1UFFA 4C5GA 1GBRA 3GIBA 1B3QA 4J7FA 1YJ9A 1YJNT 1KD1U 3OYKA 1BI3A 2EYZA 1TUDA 3EG9B 2VVKA 2LJ1A 4DBFA 2R5AA 1PD0A 4XTVA 1VQ5T 4C5HA 3JCMW 5L23A 1B34B 3EFRA 3CXCP 2RHYA 2V26A 3ASKA 4X9DA 2CUBA 4ZTJA 4XK8E 1Q86U 5GAN2 4X9CA 4FSSA 2QEXT 1VYTA 2AHJB 4LDWA 1Q81R 2IG0A 3NFCA 3GOXA 1Q95G 3CC2Q 1KC8U 1OU8A 2AKKA 3H9NA 1UEBA 1RAHB 2CP5A 4JRPA 2YUNA 4EMKB 1BIBA 2CSQA 4KGZB 4Y91A 1YN8A 1Q81U 2K4YA 2LQKA 5GAN5 3CC7A 3OB9A 1J3TA 4OB0B 4KH1B 5LJ3d 2DA9A 5A2QE 1K76A 4A4HA 3UA6A 1ZSGA 1OI1A 1GXIE 1T0HA 1M8VA 2DM1A 4J83A 2ZGWA 5EC7A 3JCMQ 2A37A 5GAOp 2LJ0A 4RKUE 1UGPB 1TXQA 2A36A 2R57A 3CC4Q 3TQ7P 2DBKA 1UUEA 2QA4T 4FSXA 4J6XA 3CCMA 4DEXA 2FL7A 3HPWA 2D6FA 2OTJT 4BI3A 2D8HA 4LXCA 3UPUA 1KG1A 1HSQA 3VUBA 5CIUA 2BIVA 4C92F 1K9MU 1I5OB 1GFDA 4MZMA 3OYHA 1RAIB 4LN2A 4ELYC 2VWFA 1YHQT 1GFCA 1AEYA 3CPFA 4N0AA 2JXBA 2L8DA 1N8RC 3REAB 1OV3A 4KBMB 3H0IA 2XIDA 4Z02A 1QP3A 3CEYA 3OSVA 3SHWA 1K73C 4TVRA 2M0YA 2DKGA 1JXOA 3CCLQ 1D3BA 3C0CA 4WF2A 3JB9H 3HHTB 2LC4A 3A8HB 3JCMb 3CC7Q 5C0MA 2RHZA 4WCIA 2JNGA 4RTXA 1M4ZA 5GMKi 1VQ6A 2K5IA 4E7LA 2V1QA 2XICA 1M90R 2FRYA 1M27C 3L2QA 1Y96B 3SWNC 1MNEA 1V76A 3RNJA 2KRMA 1VQ7A 3CD6A 4M78D 2ZPGB 4PJMA 4MZPA 2EJ9A 3RUXA 4M75A 1NYFA 2NUPB 4M7AG 5LJ5f 2QDLA 3RDVA 3QYHB 3OBWA 1JEGA 5FLXE 4O6JA 5CKBA 4M75C 4RCBA 5GAOq 2AKLA 4EIKA 3M55A 4UC4A 3EG9A 2WSFE 2YUOA 3FLGA 1D3BB 4RTTA 3META 2X4YA 2D9TA 2JJ9A 4OMNA 1VQMQ 4PJOB 1S72A 2BKDN 2LQNA 1VQ6T 2DEUA 2D0NA 1YCSB 4WTOB 2FG0A 4QQDA 3PE0A 1QW1A 3OMGA 2ZPEB 1VQOQ 5DLQE 2CUDA 1XTDA 5D6XA 1M3CA 2JM9A 2W10A 4JS4A 4C8QA 4HVVA 4LE9A 1Y57A 4JDSA 2JTMA 1NJIC 2DJQA 3MHXA 1UGSB 1IB8A 3ZEHA 4RTZA 3CMAT 1I07A 4PLIA 2JM8A 1TUCA 1G5VA 1PCXA 4M78F 2FRWA 1EFNA 4PJLA 2RHUA 4MDWA 3JCMf 2GFAA 1VQ5Q 2RPNA 3SB2A 4DBQA 3CCST 1HD3A 3JSCA 4QVDA 1TWBA 1AVZC 4OMPA 1WHLA 1E6GA 1OX9A 4RG2A 4RG8A 4FT2A 3V7SA 2KGTA 5GAOn 2DBMA 1KFZA 3JCMX 1GCQC 4GLKA 1G3YA 3N5BB 4PJJA 2COZA 5LJ3f 3VRZA 1B07A 3QWYA 2DL7A 3CXCA 4R0KA 5GAMd 2JS0A 1VQPA 3I55A 4C8QE 2QK0A 1X69A 4MDXA 5FRNA 1OEBA 2EYYA 5GJVB 5DLOA 1FXXA 2EKHA 3JCMe 5KYXB 2FPDA 2F69A 3I9QA 1MMAA 5GJWB 4OP0A 5CKFA 2ED1A 3SWNB 1Q81C 3E9GA 2FPFA 1U1SA 2KXCA 2ECZA 3URGA 2XK0A 4BY6B 3RBBB 4FYYB 1VQ4Q 2QQAA 3M4YA 1GCQA 4PFZA 1VQ8A 1HK9A 2L89A 3OBYA 2L3QA 2P0KA 4HCZA 2H3EB 3CCVQ 1BCOA 3OS0A 1V1CA 2JZ2A 2CH4W 5GMKm 1VQLA 2DERA 2O31A 2ZZDA 3BY7A 3OYIA 3VKIA 1W2BP 4V2SA 2EGEA 4F16A 2O9SA 4FYVB 1KQSS 4LNPA 2CDTA 2KEAA 4RTYA 2K9GA 4PJOC 1JB0E 3C94A 4NOYA 3CCJA 2E70A 1VYUA 3RMSA 5LJ5g 4QVCA 5J26A 1Q7YU 1GL5A 2MWOA 1YHQQ 4LD9K 4M7AC 1WXBA 5HK0A 3M54A 1QVGA 3P8DA 2HQHA 4OF1A 4OMMA 1LCKA 4PNOA 4HCBA 2YLCA 3CCSQ 4RTVA 4XU3A 3GF5A 2XDDA 1ZBJA 2KI7A 3EGXA 1RADB 3OYDA 2E3HA 1NEBA 4LDXA 4X34A 5GANg 3M58A 1BB9A 2KNBB 1OPLA 4IIOA 2QTXA 2LQ8A 4A54A 3QDRB 2E6NA 2HL5C 4HVWA 4E6RA 2CZ6B 5KYUA 1LJOA 1M2VA 4N4IA 3G4SA 1Y0MA 1Y96A 2K79A 2L3SA 5HY6A 2F2XA 3EH1A 1VQ8T 1VQ7Q 3CD6Q 1X75C 4KUIA 1SSHA 2H3JA 1M90C 5ECAA 1SF9A 5CO7A 1D1AA 1H641 3WVDB 1PKTA 3L2ZA 3UT1A 2EYXA 2EGCA 5J3BA 1VQLT 1G3TA 1VQKT 3CC4T 3CMEA 1AHJB 2EJGA 3SD4A 2KYBA 3OYJA 2DE0X 2DO3A 2QI2A 1I0CA 1TOVA 1BKBA 4R56A 4OMFB 4J9IA 1MMNA 3KFVA 2RK2A 1OOTA 3BDUA 4HCCA 1HJDA 5IT9E 1QCFA 4DBRA 4JJBA 5CKDA 3I5SA 4BY6C 2QTVA 1XOVA 3OW2P 3X25B 1SEMA 4AFZC 1NE8A 2WACA 2XDBA 4N4HA 5J39A 5CR2A 1W2BS 2VGMA 2M1HA 4M75B 2PUOB 3A8GB 3HRSA 1OU9A 1JU5C 1B34A 3I55Q 3HP9A 5GAOr 5M9OA 4A53A 2DYIA 2KROA 2L3PA 3I56A 3CCLT 5FRMA 1WPYA 2EWNA 4M77G 4F04B 1KD1R 1YITA 3OW2A 3JCMh 2CP3A 1WI7A 2OI3A 1PG5B 2RNAA 1KHIA 1T3LA 4CC2A 3U23A 1N9RA 1WXUA 1N8RU 1H8KA 1VYVA 2XD0A 1UJ0A 3JCMJ 3CC4A 1K0SA 1CSKA 2XU8A 2J6KA 2QG9B 4AFUC 3TCJA 2QXFA 5KYYB 2E10A 2QDYB 1OZ2A 2ATCB 2HBWA 1W4SA 2K2MA 4Z89A 3CCVA 4OB3B 4LD6A 1YBYA 1ZHIA 5GMKh 1U5SA 4KT0E 2ZCFB 1E7OA 5I22A 2RJFA 2HDAA 1S72Q 2RQVA 2YT6A 3ZBDA 5GANh 1JBMA 2ESWA 5GMKl 1U8RA 2LCSA 2OX7A 5CVIA 1XNIA 4YTLA 2RD1A 1BK2A 2KRSA 2VB6A 4HKEA 2LTOA 2RI2A 3RKWA 1M1FA 4F7UG 1G8XA 4C5IA 1NJIU 2E5QA 1YJWA 1NEGA 1VQ8Q 4JPBW 1JQQA 2DK3A 2FEIA 3EFOB 5L8RE 3C95A 2J6OA 2M02A 3EG3A 2MAMA 3HL8A 3CPWP 2ROTA 3FC3A 2FYKA 5GAN8 1K9MR 1PHTA 5FWBA 1K73R 4CC3A 1YJ9T 3CMEQ 2LRQA 1IO6A 3VYHB 2BUDA 3PMIA 3VS2A 1VQ6Q 1VQ7T 3CD6T 1QKXA 4XAXB 1RLQC 1YITQ 1AT1B 1PD1A 5FW9A 3CCUQ 1RL2A 2YHTA 1ZUUA 4C0ZA 2P0QA 2KYMA 3CCVT 4OB1B 4A4EA 1AZEA 1WQWA 5GAN4 3HFNA 3L2WA 1QVFA 2RHIA 4A63B 2X51A 2B8AA 2CT4A 2YUQA 2X3XD 1QWEA 4LDUA 5GMKe 1RI9A 5GAMj 3CCQT 4ATOA 2KVQG 1VQ5A 3NTIA 1W2BA 2DMOA 3WVEB 4M7AB 5KYUB 1WFWA 1TS9A 5I2SA 1D1BA 1SKUB 3A8OB 2J7IA 4C0GA 3JCMg 3EAEA 4KGXB 1RUWA 2HKQB 4KULA 3CCRT 3VJPA 4HVUA 3VS6A 3NTKA 2DFUA 1KJWA 4M7AD 4PJOF 3X20B 4M77B 3CCET 8ATCB 1WHMA 4IUUA 4F7UE 1A0NB 3I35A 3G6EQ 4E7IA 1N6AA 2PVGB 1S72T 2RM4A 5DY9A 2H8HA 1YNZA 4M7AF 3MKDA 1NJIR 1KIKA 2FVUA 1OULA 1ZA1B 4F17A 5D7UA 4IUVA 2DTOA 2IIMA 1NBEB 2F2VA 5GAN6 4J7IA 1VUBA 1ZSZC 1YI2T 2KXDA 2FZKB 4CI0C 2YXYA 1ZQ1A 3SWNA 3DKMA 3RMQA 1JRIA 2L3RA 3VRYA 3NMZC 1N27A 1K9MC 3X24B 4BDYA 2DD5A 2LX9A 1VQLQ 4M75G 2CREA 2E3IA 1VQKQ 2PUKB 2V8KA 2E1HA 3OSSC 3QHSA 1K9AA 5IXBA 2GGRA 4D6WA 1YIJQ 3G71A 3DLMA 1NG2A 2XKOC 4Z88A 1UB4A 1R77A 1SG5A 3X26B 2EW3A 4BI8B 1VQPQ 1I8FA 5KYNA 5GAOl 5KYYA 2EIFA 4FT4A 3M5AA 3JAME 1X01A 2QGGA 2GF7A 4O5VA 1IHWA 1NPPA 2IPOB 1MHNA 3NGPA 4JJDA 5GAMf 2NWMA 2KT8A 3I55T 4J9EA 3OYAA 4C92G 1ZUYA 4ME7A 2HQEA 2D8JA 5HKCA 1QVGS 3H41A 4IUQA 4EMKC 4GLMA 1VQOT 4L6V5 1UGVA 4MMKA 1C1AA 1UHFA 3CCMQ 3GP8A 1K1ZA 1ABQA 2BZYA 2OAUA 2CSIA 5FU6B 2AZVA 1O9SA 2DEQA 1KC8C 2GQVA 2E64A 3M59A 4J6YA 2QAZA 3IQLA 3MJXA 4EPCA 4AT1B 3OQ5A 2O01E 1VIFA 1TU0B 4EMHA 1W1FA 2D0QB 2KRNA 3TSZA 3L2RA 4OGCA 1JJ2S 3MEVA 5GAOm 2ZPBB 1S1NA 2VKNA 4J9CA 5GAMg 3QIIA 1M1KR 2JN0A 3BE3A 3OYGA 1YP5A 5HK3A 1MV0B 3UA7A 2X35A 3EHRA 1U06A 1Q82U 1VQNA 1CKBA 2FPEA 3CPWS 4ZGDB 4DEYA 2K5LA 2OAWA 2DTIA 2A7YA 2DX1A 2RI3A 4LUEA 1AD5A 2K3YA 2LCLA 3L1AA 1BYMA 1Y71A 2CP7A 2DILA 2KSSA 4CRIA 2CP6A 4XQ3A 1YJNA 3JCMV 2VYTA 3QJYA 4ZN1A 2C0TA 2GCXA 2YLBA 5C6SA 5I21A 1I1JA 1OPKA 2YRCA 1UE9A 1WGSA 3EGDA 2EBPA 3CXCS 3PGGA 4II1A 2V8IA 3QXEB 2DXUA 3FB9A 3CCUT 1UTIA 2LMJA 2JMCA 3VS3A 1YJWQ 1WXTA 4VUBA 3RIRA 1VQ4A 1PM3A 2KE9A 4M77A 2RK1A 2HD0A 5FU7B 5KYXA 3DB3A 2M0OA 1X6OA 3CBPA 3QBYA 2JUFA 2R58A 4XTWA 3VU3C 2DL5A 3OYEA 4IURA 1TSFA 2G6FX 4QVZA 1NLPC 2HNIA 1VQPT 4J9FA 3KBGA 2CZ0B 4ZNXA 3CC7T 2EAYA 1MGQA 5CQXA 4HT9A 2PVDB 2VASA 3EH2A 4XTXA 1AWOA 1BBZA 1UGRB 2EQKA 4BE2A 1WDXA 2CP2A 4RCCA 4B9WA 2FZCB 2RMOA 2PVOB 2B86A 3CBOA 1IREB 2GNCA 4QW2A 5LJ5h 2DZ9A 1ARKA 1VIEA 4M77C 3OS5A 4M7DC 2SRCA 2YDLA 3KUFA 4AG1C 2JT4A 3E19A 5CK9A 1IRXA 4M77E 1H92A 4M4ZA 4M7DG 4E2FB 3RKYA 2EQMA 2YSQA 1I5LA 1U1TA 2HMAA 3LGLA 2EQJA 2K6DA 1RAFB 4N0AC 4LUDA 4M78E 2L0AA 2VGNA 1CKAA 3GLXA 3MP6A 3H0FA 1Y7XA 2OTLQ 2DD4A 2RJEA 2NUTA 4PKCC 1YI2Q 2EQIA 4F7UF 3LWIA 3V7RA 2V8JA 4J9DA 3CCUA 3LH0A 2JMAA 3V7CA 2DXTA 3CQTA 1TTHB 2DXCA 3JB9G 3E1SA 2DF6A 2O4XB 3E9FA 3VV0A 3BDLA 2MCNA 2L2PA 4HCKA 3O8VA 2KT1A 2MI6A 1WIEA 2HAXA 4OGEA 4M77D 1ZUKA 3MEAA 4FYWB 1GCPA 3EHQA 2HCKA 4PJOG 5IHIA 1VOMA 3EGXB 3JCMP 1Q7YC 2C06A 1ZSZB 4M78A 4NL2A 1PKSA 4F7UB 1QVFS 3CC2A 4PJOD 3CBMA 1LNXA 1IHVA 1SHFA 4FM4B 2KY9A 4BI4A 3LW5E 4R55A 4M78C 3OYNA 3BFMA 3CMAQ 2RJCA 4E7KA 1IZ6A 3M0QA 4IUTA 2BZ8A 3EGUA 4AFQC 4L5GA 2QASA 5EG2A 3OYFA 1VQ9Q 1LPLA 3FRNA 4JJCA 2VXEA 1YJNQ 2KK4A 2DPPB 2K2VA 4QQGA 2RHXA 2MPXC 4NS5A 3JB9J 4ANJA 1OX8A 1ZBXA 4N4GA 1ABOA 2P4TA 3MP8A 1U3OA 2RQUA 3SDZA 3QPHA 1G3WA 1M8MA 2XDPA 4XTYA 2X4XA 1PSFA 1SPKA 4K11A 5LJ3e 3CCJQ 3PIOA 4LDVA 3OYCA 1FMKA 2F2WA 2DZCA 1M3AA 1ZLMA 4RUGA 2ZAEA 4C8QD 4DQ2A 3OW2S 1K73U 1AOJA 1IGQA 5FU6C 2E4HA 2EYQA 3Q1JA 1TG0A 2X9HA 3PT9A 4KGVB 5CKHA 3QZ5B 3J81E 2DTHA 3CCQA 2PQWA 3MO8A 3UWNA 1BI0A 3A8LB 2PNIA 4BACA 2EGAA 3I56T 3G4ST 2GTOA 5IAYA 1Q82C 2VV5A 2NUZA 5FROA 2ENMA 1T0JA 2RO0A 2Y4XA 1SRMA 1VQ9A 2E41A 3OYYA 3REBB 1MUZA 1QWFA 3GNFB 2COYA 2RI5A 2KDSA 2LDMA 3HRUA 4C5EA 5KE3A 2W0ZA 4C92A 3RKXA 1YFNA 1VQKA 5KH6A 4BDZA 2DL3A 2HSPA 2YRVA 3CCLA 3TSWA 5FU7C 1YITT 1UDLA 4F7UA 2WSEE 2OTLA 3HRTA 3ME9A 2SEMA 1RAGB 2F5KA 5LJ5j 5A0LA 1QCOA 1GRIA 2XI9A 3INZA 2DNUA 2MOXA 4OMQA 3M0PA 1YCYA 5LJ3j 1FMVA 1AWXA 3QG1A 3GPLA 5D6WA 2I2LA 2K5FA 5I11A 2HSEB 3PVLA 4AG2C 5LJ5e 3QDFA 3A8MB 4GBQA 5AYFA 3R6NA 4DA4A 3TREA 4FU6A 4C92C 1ZX6A 3MEUA 1M1KC 3S3MA 3PMTA 1KC8R 4ORZA 2R5MA 3QO3A 2QEXA 3PTAA 2J6FA 3DB4A 4M7DB 2E5KA 2O4XA 1E6HA 3FIFA 1ACMB 3LLRA 2MWPA 3MP1A 4OVAA 2JOYA 3L2UA 2YUPA 4OB2B 2AZSA 3JCMd 4JZ4A 2DVJA 2I0NA 1UGQB 3CCRQ 1YWOA 2ZPHB 1XJWB 1RAAB 2EPDA 1M2OA 3FEOA 2ABLA 3X28B 3MEWA 4RMOA 4AFSC 4NL3A 1WX6A 1AWJA 2YWWA 4DOWA 1KD1C 1K8AU 2BE7D 2JVVA 4PJNA 2A28A 2DIQA 3ZL7C 3E2UA 2MMPA 4BB7A 2QQ9A 3H8ZA 1N5ZA 2K3BA 4M7DD 1M9SA 1X6GA 4M7DF 3M57A 4Q5WA 2RF0A 3LWHA 3THKA 4JJNK 4P5NA 4M7AA 1T3SA 1QLYA 1OQKA 1WQ7A 1BIAA 4C92D 2QGFB 1OZ3A 1X27A 2DETA 1VQNT 4L59A 2OTJA 1HYOA 5CAIA 2VXFA 2LVMA 1C6VX 1N9SA 1VQMT 4CC4B 3G4SQ 2F1LA 4B9XA 2PTKA 1QVPA 3HKSA 4E7ZA 1PC0A 2E6ZA 1FYNA 1KQSA 2V1RA 3J80E 2JTEA 2D1XA 2JW4A 3L42A 3OYLA 2RJDA 1WHJA 2NUTB 5LL6S 1ZSZA 4M78B 3VUZA 4IKFA 2XMFA 4PJOE 5LJ3g 4FW2A 5GAN7 3UATA 5A0GA 2QA4A 4FYXB 5A0DA 1XQHA 2X4JA 4XU0A 4E7SA 3EG1A 4F14A 3LYIA 2CP0A 4J9HA 4BE1A 4D8DA 2C0IA 3OY9A 1UECA 3MPUB 1TUGB 3FJ5A 1Z9ZA 4PK4A 4C8QG 4XTZA 3UDCA 1ZA2B 1RAEB 1WA7A 3QYGB 2MK5A 3QJ6A 2QQSA 1X2QA 3PNWC 1D1CA 2FB7A 1WHKA 2RH2A 2EQUA 1X2KA 2DRMA 2CS7A 3G6ET 1O75A 2HKNA 1GBQA 3V8LA 4C92B 3CCRA 1Q86R 1RI0A 2ROLA 2K57A 3J7AF 2AK5A 4E47A 2LZ6B 3G71Q 4C8QB 3VS1A 1R0BG 2PZ1A 1FWZA 5IN1A 2DJZA 1I4K1 4LDYA 1YHQA 3NTHA 1K0XA 2E65A 4JRIA 3HTRA 5GAMh 1MV3A 3RERA 4FW1A 3R6OA 2JS2A 2NLUA 1PSEA 1R8OB 1PRLC 2J05A 4BUGA 2BE9B 3ULRB 3OA6A 3I56Q 2MIOA 2CZ1B 3OS2A 1VQOA 1WZOA 1YIJA 2ZPIB 1VQNQ 3TEEA 4QQ6A 2EFIA 3S6WA 3S3OA 3GBQA 3A98A 2OTJQ 2KQWA 5GANd 4E7HA 4JZ3A 5CKEA 4C0DC 1QP2A 2MF2A 4PFOA 3EG2A 1SRLA 4FIBA 3UF4A 2K3XA 3M53A 3OYBA 1P92A 1NZ9A 3A5ZB 1G3SA 2PU9B 1IXDA 2VC8A 3G6EA 4HT8A 1AZGB 3GNGA 1W6XA 1PNJA 1NPRA 1D0ZA 3QUIA 2LNVA 3LH5A 3C4SA 1YJWT 2JTFA 1KQ2A 2HZYA 2CKKA 2HBPA 4C0FA 6AT1B 1D0XA 5LJ3h 3M0RA 3QSUA 1B7TA 1LOJA 4HA8A 1BI2A 3RR6A 5KCHA 1Q7YR 1MMGA 3DLLA 1KK7A 5KCOA 2P4RA 4ZTFA 5FWCA 1SHGA 1G2BA 1X43A 5DM7R 4MZTA 5GANj 4FCYA 2IVWA 3ER0A 3M9QA 4EMGA 1JJ2A 3TVTA 3FJPA 2MYSA 1M1KU 3OMCA 1EZZB 3JB9I 4JUVA 1F1BB 2J06A 2LT4A 1G83A 4EDUA 2QYZA 4J8OA 2Y90A 1Q82R 3HSBA 2LNHB 1FX7A 3HFOA 2HQXA 2CGHA 4CC7A 3CMAA 8AT1B 4KH0B 2KBTA 1V29B 4ELZC 4EMKA 4OMLA 3QKJA 1OYXA 4C8QC 2ZPFB 5IHNA 2O9VA 1QCNA 1BI1A 3PIPA 1VQ4T 1R0CB 1X6BA 1HXDA 3CCEA 3KXTA 1QVFP 3SFMA 4PLLA 5CQYA 2DLPA 2KMTA 4IUPA 3RESA 4Z8AA 4ZGJB 3A1PA 1QQJA 2LX7A 4QKUA 3V8JA 4M75E 1JJ2P 3M4GA 4GY5A 4C0DB 4BE0A 1K8AC 1NLOC 1YI2A 4A4KA 1BCMA 4DBHA 1M30A 2X3WD 1WHHA 2XG8D 2CZ7B 2AIRB 1NYGA 3CPWA 2HL3A 1Z9QA 4JS5A 2FZGB 3G7ZA 3P8BB 1D0YA 5IHKA 2LQWA 1RABB 3VS5A 2CH4A 1UHCA 1WYXA 1VQ9T 2M16A 2QQBA 5HCKA 4XU2A 4KUDK 5GANe 3OS1A 3JB9F 4OMOA 4Y92A 1KQ1A 3M0UA 4A4GA 2EVRA 3T9NA 2M51A 2RQWA 3VS7A 1I81A
chains in the Genus database with same CATH topology
1A0NB 3I35A 1KSWA 3M0TA 2LQNA 2DL3A 2HSPA 1K4US 3TSWA 2A08A 2H8HA 1YNZA 2D0NA 2LP5A 1KIKA 1YCSB 2FG0A 1BU1A 1W70A 3H0HA 1UDLA 3PE0A 1PRMC 2EYWA 3QWXX 2K7AA 4ESRA 4F17A 3SEMA 1M3BA 2FO0A 1QKWA 2CUDA 1UG1A 2SEMA 1M3CA 2JM9A 1GRIA 2IIMA 2DNUA 2DYBA 2W10A 2F2VA 2MOXA 4OMQA 3VS0A 3M0PA 1AWXA 1YWPA 3NPFA 4HVVA 2KXDA 4LE9A 5I11A 1Y57A 3PVLA 4AG2C 5IH2A 3VRYA 2O88A 3NMZC 2DJQA 4RTZA 1I07A 4GBQA 4QT7A 2JM8A 1TUCA 2CREA 1H3HA 3R6NA 2FRWA 1EFNA 1ZX6A 1K9AA 5IXBA 2GGRA 2RPNA 2C0OA 4ORZA 1HD3A 1AVZC 4X1VA 4OMPA 2J6FA 1NG2A 1E6GA 2E5KA 1E6HA 2OJ2A 4Z88A 2EW3A 2KGTA 2DBMA 2YUPA 1KFZA 2AZSA 1GCQC 2DVJA 4JZ4A 2I0NA 1NM7A 1YWOA 1WLPB 2DRKA 2BZXA 2EPDA 3VRZA 1B07A 2ABLA 3QWYA 2DL7A 4R0KA 4AFSC 2JS0A 3NGPA 1WX6A 1AWJA 4JJDA 2NWMA 2BTTA 2KT8A 4J9EA 3I5RA 2A28A 1X69A 1ZUYA 3ZL7C 2D8JA 1OEBA 2EYYA 5GJVB 2GBQA 3H41A 4GLMA 2EKHA 1N5ZA 2FPDA 2K3BA 1X6GA 3I9QA 1UGVA 5GJWB 2LJ3A 1UHFA 2RF0A 3O5ZA 2ED1A 1K1ZA 1ABQA 3THKA 2BZYA 2CSIA 1JXMA 2AZVA 2FPFA 1VA7A 2KXCA 3EG0A 2ECZA 1T3SA 4RTUA 1QLYA 3RBBB 3IQLA 1X27A 1GCQA 2CT3A 1W1FA 2KRNA 2DL8A 3TSZA 2HEQA 4CC4B 1S1NA 2PTKA 2L3QA 2VKNA 4J9CA 2RQRA 1FYNA 1V1CA 2CH4W 2O31A 2DL4A 1YP5A 1MV0B 2EGEA 2V1RA 3UA7A 4F16A 2JTEA 2D1XA 2JW4A 2KR3A 1PWTA 2O9SA 3JV3A 3EHRA 1U06A 4LNPA 2CDTA 1CKBA 2FPEA 2XMFA 2KEAA 4DEYA 4RTYA 2OAWA 2K9GA 2DX1A 4LUEA 1AD5A 3UATA 2RN8A 4HXJA 1VYUA 2DILA 3EG1A 3PVQA 1GL5A 4F14A 4D8KA 4J9HA 4D8DA 2C0IA 1AWWA 1WXBA 1UECA 4IIMA 3FJ5A 1Z9ZA 2C0TA 4OMMA 2GQIA 1LCKA 4J9GA 1I1JA 1OPKA 1UE9A 4RTVA 1WA7A 1UJYA 1ZBJA 2EBPA 1X2QA 5IXFA 1UTIA 2LMJA 2JMCA 1X2KA 3M0SA 4KRTA 3VS3A 2DRMA 1NEBA 1WXTA 1JO8A 1RLPC 2ED0A 1GBQA 3VS4A 4RTWA 1BB9A 2KNBB 3NHNA 1OPLA 4J9BA 2ROLA 2KE9A 2O2OA 4IIOA 2AK5A 2GTJA 4HVWA 2LZ6B 4E6RA 3VS1A 2DL5A 2RQTA 1Y0MA 2PZ1A 2K79A 2L3SA 2G6FX 1K0XA 1NLPC 2F2XA 4J9FA 1MV3A 2JS2A 1SSHA 1PRLC 1UFFA 2J05A 5ECAA 1GBRA 3ULRB 4ZNXA 1B3QA 2MIOA 1AWOA 1PKTA 2EYZA 2EYXA 1TUDA 1BBZA 2VVKA 2EGCA 1WDXA 2RMOA 2LJ1A 2B86A 2KYBA 3GBQA 3A98A 2DE0X 2GNCA 1I0CA 1ARKA 5L23A 4JZ3A 4J9IA 2SRCA 2YDLA 3EG2A 1SRLA 3KFVA 3UF4A 4AG1C 1OOTA 2JT4A 1HJDA 1QCFA 1H92A 2CUBA 4M4ZA 4JJBA 2YSQA 3I5SA 1XOVA 1AZGB 2K6DA 4FSSA 1W6XA 1SEMA 4LUDA 1PNJA 1VYTA 4AFZC 2L0AA 3LH5A 1CKAA 2AKKA 3H0FA 1JU5C 3M0RA 2KROA 2EQIA 2L3PA 2YUNA 4J9DA 2JMAA 2CSQA 1YN8A 1WI7A 2OI3A 2RNAA 3CQTA 1J3TA 2DF6A 1T3LA 2P4RA 3U23A 4CC2A 2DA9A 2MCNA 1WXUA 2L2PA 1K76A 1H8KA 1VYVA 1UJ0A 3UA6A 5FWCA 4HCKA 1ZSGA 1K0SA 1CSKA 2J6KA 1T0HA 2KT1A 1SHGA 2DM1A 1G2BA 1X43A 4AFUC 1WIEA 5EC7A 2A37A 1ZUKA 2LJ0A 1GCPA 3EHQA 2HBWA 4Z89A 2K2MA 2HCKA 2A36A 5IHIA 2DBKA 1UUEA 1PKSA 1U5SA 4DEXA 3TVTA 1E7OA 5I22A 2D8HA 2HDAA 2RQVA 2YT6A 2ESWA 1HSQA 2LCSA 1SHFA 2J06A 1BK2A 2KRSA 3M0QA 1G83A 2BZ8A 3EGUA 1NEGA 1GFDA 4AFQC 2LNHB 4JPBW 4LN2A 1JQQA 2VWFA 2FEIA 4JJCA 4CC7A 2J6OA 1GFCA 1AEYA 3EG3A 2JXBA 2KBTA 4OMLA 3REAB 1OV3A 2ROTA 3H0IA 5IHNA 3SHWA 2O9VA 1PHTA 2M0YA 5FWBA 1JXOA 4CC3A 1IO6A 1ABOA 3C0CA 1U3OA 1X6BA 2RQUA 3VS2A 1QKXA 1M8MA 1RLQC 5FW9A 1SPKA 4K11A 1ZUUA 4WCIA 1FMKA 4RTXA 2F2WA 1M3AA 2KYMA 1ZLMA 2DLPA 2V1QA 4RUGA 4Z8AA 1AZEA 2FRYA 1M27C 2LX7A 1AOJA 3RNJA 1TG0A 4A63B 2KRMA 1NLOC 2CT4A 2YUQA 2X3XD 1QWEA 1RI9A 1M30A 2X3WD 1NYFA 2DMOA 2PNIA 2QDLA 1NYGA 2EGAA 1WFWA 1JEGA 2J7IA 1Z9QA 2GTOA 2NUZA 2ENMA 2AKLA 1T0JA 4EIKA 5IHKA 1SRMA 2LQWA 1RUWA 3VS5A 2CH4A 1UHCA 1WYXA 5HCKA 2YUOA 3REBB 4OMOA 4RTTA 1MUZA 4Y92A 3M0UA 1QWFA 4HVUA 3VS6A 1KJWA 2EVRA 4OMNA 2M51A 2RQWA 3VS7A 2W0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0N B;  3I35 A;  1KSW A;  3M0T A;  2LQN A;  2DL3 A;  2HSP A;  1K4U S;  3TSW A;  2A08 A;  2H8H A;  1YNZ A;  2D0N A;  2LP5 A;  1KIK A;  1YCS B;  2FG0 A;  1BU1 A;  1W70 A;  3H0H A;  1UDL A;  3PE0 A;  1PRM C;  2EYW A;  3QWX X;  2K7A A;  4ESR A;  4F17 A;  3SEM A;  1M3B A;  2FO0 A;  1QKW A;  2CUD A;  1UG1 A;  2SEM A;  1M3C A;  2JM9 A;  1GRI A;  2IIM A;  2DNU A;  2DYB A;  2W10 A;  2F2V A;  2MOX A;  4OMQ A;  3VS0 A;  3M0P A;  1AWX A;  1YWP A;  3NPF A;  4HVV A;  2KXD A;  4LE9 A;  5I11 A;  1Y57 A;  3PVL A;  4AG2 C;  5IH2 A;  3VRY A;  2O88 A;  3NMZ C;  2DJQ A;  4RTZ A;  1I07 A;  4GBQ A;  4QT7 A;  2JM8 A;  1TUC A;  2CRE A;  1H3H A;  3R6N A;  2FRW A;  1EFN A;  1ZX6 A;  1K9A A;  5IXB A;  2GGR A;  2RPN A;  2C0O A;  4ORZ A;  1HD3 A;  1AVZ C;  4X1V A;  4OMP A;  2J6F A;  1NG2 A;  1E6G A;  2E5K A;  1E6H A;  2OJ2 A;  4Z88 A;  2EW3 A;  2KGT A;  2DBM A;  2YUP A;  1KFZ A;  2AZS A;  1GCQ C;  2DVJ A;  4JZ4 A;  2I0N A;  1NM7 A;  1YWO A;  1WLP B;  2DRK A;  2BZX A;  2EPD A;  3VRZ A;  1B07 A;  2ABL A;  3QWY A;  2DL7 A;  4R0K A;  4AFS C;  2JS0 A;  3NGP A;  1WX6 A;  1AWJ A;  4JJD A;  2NWM A;  2BTT A;  2KT8 A;  4J9E A;  3I5R A;  2A28 A;  1X69 A;  1ZUY A;  3ZL7 C;  2D8J A;  1OEB A;  2EYY A;  5GJV B;  2GBQ A;  3H41 A;  4GLM A;  2EKH A;  1N5Z A;  2FPD A;  2K3B A;  1X6G A;  3I9Q A;  1UGV A;  5GJW B;  2LJ3 A;  1UHF A;  2RF0 A;  3O5Z A;  2ED1 A;  1K1Z A;  1ABQ A;  3THK A;  2BZY A;  2CSI A;  1JXM A;  2AZV A;  2FPF A;  1VA7 A;  2KXC A;  3EG0 A;  2ECZ A;  1T3S A;  4RTU A;  1QLY A;  3RBB B;  3IQL A;  1X27 A;  1GCQ A;  2CT3 A;  1W1F A;  2KRN A;  2DL8 A;  3TSZ A;  2HEQ A;  4CC4 B;  1S1N A;  2PTK A;  2L3Q A;  2VKN A;  4J9C A;  2RQR A;  1FYN A;  1V1C A;  2CH4 W;  2O31 A;  2DL4 A;  1YP5 A;  1MV0 B;  2EGE A;  2V1R A;  3UA7 A;  4F16 A;  2JTE A;  2D1X A;  2JW4 A;  2KR3 A;  1PWT A;  2O9S A;  3JV3 A;  3EHR A;  1U06 A;  4LNP A;  2CDT A;  1CKB A;  2FPE A;  2XMF A;  2KEA A;  4DEY A;  4RTY A;  2OAW A;  2K9G A;  2DX1 A;  4LUE A;  1AD5 A;  3UAT A;  2RN8 A;  4HXJ A;  1VYU A;  2DIL A;  3EG1 A;  3PVQ A;  1GL5 A;  4F14 A;  4D8K A;  4J9H A;  4D8D A;  2C0I A;  1AWW A;  1WXB A;  1UEC A;  4IIM A;  3FJ5 A;  1Z9Z A;  2C0T A;  4OMM A;  2GQI A;  1LCK A;  4J9G A;  1I1J A;  1OPK A;  1UE9 A;  4RTV A;  1WA7 A;  1UJY A;  1ZBJ A;  2EBP A;  1X2Q A;  5IXF A;  1UTI A;  2LMJ A;  2JMC A;  1X2K A;  3M0S A;  4KRT A;  3VS3 A;  2DRM A;  1NEB A;  1WXT A;  1JO8 A;  1RLP C;  2ED0 A;  1GBQ A;  3VS4 A;  4RTW A;  1BB9 A;  2KNB B;  3NHN A;  1OPL A;  4J9B A;  2ROL A;  2KE9 A;  2O2O A;  4IIO A;  2AK5 A;  2GTJ A;  4HVW A;  2LZ6 B;  4E6R A;  3VS1 A;  2DL5 A;  2RQT A;  1Y0M A;  2PZ1 A;  2K79 A;  2L3S A;  2G6F X;  1K0X A;  1NLP C;  2F2X A;  4J9F A;  1MV3 A;  2JS2 A;  1SSH A;  1PRL C;  1UFF A;  2J05 A;  5ECA A;  1GBR A;  3ULR B;  4ZNX A;  1B3Q A;  2MIO A;  1AWO A;  1PKT A;  2EYZ A;  2EYX A;  1TUD A;  1BBZ A;  2VVK A;  2EGC A;  1WDX A;  2RMO A;  2LJ1 A;  2B86 A;  2KYB A;  3GBQ A;  3A98 A;  2DE0 X;  2GNC A;  1I0C A;  1ARK A;  5L23 A;  4JZ3 A;  4J9I A;  2SRC A;  2YDL A;  3EG2 A;  1SRL A;  3KFV A;  3UF4 A;  4AG1 C;  1OOT A;  2JT4 A;  1HJD A;  1QCF A;  1H92 A;  2CUB A;  4M4Z A;  4JJB A;  2YSQ A;  3I5S A;  1XOV A;  1AZG B;  2K6D A;  4FSS A;  1W6X A;  1SEM A;  4LUD A;  1PNJ A;  1VYT A;  4AFZ C;  2L0A A;  3LH5 A;  1CKA A;  2AKK A;  3H0F A;  1JU5 C;  3M0R A;  2KRO A;  2EQI A;  2L3P A;  2YUN A;  4J9D A;  2JMA A;  2CSQ A;  1YN8 A;  1WI7 A;  2OI3 A;  2RNA A;  3CQT A;  1J3T A;  2DF6 A;  1T3L A;  2P4R A;  3U23 A;  4CC2 A;  2DA9 A;  2MCN A;  1WXU A;  2L2P A;  1K76 A;  1H8K A;  1VYV A;  1UJ0 A;  3UA6 A;  5FWC A;  4HCK A;  1ZSG A;  1K0S A;  1CSK A;  2J6K A;  1T0H A;  2KT1 A;  1SHG A;  2DM1 A;  1G2B A;  1X43 A;  4AFU C;  1WIE A;  5EC7 A;  2A37 A;  1ZUK A;  2LJ0 A;  1GCP A;  3EHQ A;  2HBW A;  4Z89 A;  2K2M A;  2HCK A;  2A36 A;  5IHI A;  2DBK A;  1UUE A;  1PKS A;  1U5S A;  4DEX A;  3TVT A;  1E7O A;  5I22 A;  2D8H A;  2HDA A;  2RQV A;  2YT6 A;  2ESW A;  1HSQ A;  2LCS A;  1SHF A;  2J06 A;  1BK2 A;  2KRS A;  3M0Q A;  1G83 A;  2BZ8 A;  3EGU A;  1NEG A;  1GFD A;  4AFQ C;  2LNH B;  4JPB W;  4LN2 A;  1JQQ A;  2VWF A;  2FEI A;  4JJC A;  4CC7 A;  2J6O A;  1GFC A;  1AEY A;  3EG3 A;  2JXB A;  2KBT A;  4OML A;  3REA B;  1OV3 A;  2ROT A;  3H0I A;  5IHN A;  3SHW A;  2O9V A;  1PHT A;  2M0Y A;  5FWB A;  1JXO A;  4CC3 A;  1IO6 A;  1ABO A;  3C0C A;  1U3O A;  1X6B A;  2RQU A;  3VS2 A;  1QKX A;  1M8M A;  1RLQ C;  5FW9 A;  1SPK A;  4K11 A;  1ZUU A;  4WCI A;  1FMK A;  4RTX A;  2F2W A;  1M3A A;  2KYM A;  1ZLM A;  2DLP A;  2V1Q A;  4RUG A;  4Z8A A;  1AZE A;  2FRY A;  1M27 C;  2LX7 A;  1AOJ A;  3RNJ A;  1TG0 A;  4A63 B;  2KRM A;  1NLO C;  2CT4 A;  2YUQ A;  2X3X D;  1QWE A;  1RI9 A;  1M30 A;  2X3W D;  1NYF A;  2DMO A;  2PNI A;  2QDL A;  1NYG A;  2EGA A;  1WFW A;  1JEG A;  2J7I A;  1Z9Q A;  2GTO A;  2NUZ A;  2ENM A;  2AKL A;  1T0J A;  4EIK A;  5IHK A;  1SRM A;  2LQW A;  1RUW A;  3VS5 A;  2CH4 A;  1UHC A;  1WYX A;  5HCK A;  2YUO A;  3REB B;  4OMO A;  4RTT A;  1MUZ A;  4Y92 A;  3M0U A;  1QWF A;  4HVU A;  3VS6 A;  1KJW A;  2EVR A;  4OMN A;  2M51 A;  2RQW A;  3VS7 A;  2W0Z A; 
#chains in the Genus database with same CATH topology
 1QMC A;  3G1J A;  4FL6 A;  1KSW A;  3M0T A;  2RB6 A;  2EKO A;  2Y4Y A;  1K4U S;  1M2V B;  2A08 A;  2COW A;  2LP5 A;  1BU1 A;  1W70 A;  3H0H A;  3FDR A;  1PRM C;  2EYW A;  3QWX X;  2K7A A;  4C92 E;  4ESR A;  3SEM A;  1M3B A;  1MMD A;  2FO0 A;  1QKW A;  3JCM c;  1UG1 A;  3CCJ T;  3CC2 T;  3EGD B;  3OYM A;  1D09 B;  3WXM B;  5GAN f;  5LJ5 d;  2DYB A;  3VS0 A;  1Y07 A;  3TU4 K;  1YWP A;  3NPF A;  1TH7 A;  3EFO A;  4BD3 A;  5IH2 A;  2O88 A;  1WHG A;  2EJF A;  5KE2 A;  5CCA A;  1M5Q 1;  7AT1 B;  2P84 A;  2LT1 A;  4QT7 A;  1H3H A;  4M7D E;  4AMC A;  4A4F A;  5D6Y A;  3V8K A;  4XTU A;  3MCA B;  2C0O A;  1WJQ A;  3AHU A;  4X1V A;  2AT1 B;  2CYZ B;  4ZGE B;  2P0P A;  2OJ2 A;  5GAM e;  4E7J A;  3AT1 B;  2QA4 Q;  1WNL A;  3CME T;  1NM7 A;  1WLP B;  2DRK A;  2BZX A;  2DAQ A;  1C0M A;  2RA2 A;  4J6W A;  3QZ9 B;  3L2V A;  2BTT A;  4Y28 E;  3I5R A;  3CCS A;  2L5Q A;  1RAC B;  1VQM A;  2VUB A;  4JLI A;  2GBQ A;  4JRQ A;  4M77 F;  3PFS A;  2FHD A;  2LJ3 A;  3O5Z A;  4M7D A;  3M56 A;  2DIG A;  1JXM A;  1VA7 A;  4RTU A;  1KHC A;  3H6Z A;  2NUP A;  3EG0 A;  4JLG A;  3VYG A;  2CT3 A;  4M7A E;  3C12 A;  2KAF A;  3CCE Q;  2DL8 A;  4DOV A;  2HEQ A;  3F70 A;  3G71 T;  2A3L A;  2QQR A;  2RQR A;  1SSF A;  4M75 F;  4MML A;  3S3N A;  9ATC B;  1KQS P;  2DL4 A;  2LCC A;  1WJS A;  2WSC E;  2KR3 A;  1PWT A;  3JV3 A;  2QEX Q;  4J5Y A;  3P8H A;  1DJ7 B;  2OTL T;  5AT1 B;  2RN8 A;  3LX7 A;  4HXJ A;  3JRZ A;  3PVQ A;  1IGU A;  2DXB A;  1N8R R;  4D8K A;  2Z0W A;  1QVG P;  4PJO A;  2YRD A;  1K8A R;  1AWW A;  3LGF A;  4IIM A;  1WJR A;  5GMK j;  4PL6 A;  1FMW A;  5KYW B;  4XU1 A;  1M90 U;  2XHC A;  1EIF A;  2GQI A;  1YJ9 Q;  4M78 G;  4J9G A;  2G3R A;  3EFS A;  4PFP A;  4B6M A;  2M9U A;  1UJY A;  1EX4 A;  3BW1 A;  1MND A;  2DVE A;  5IXF A;  4ZN3 A;  3M0S A;  4KRT A;  4M75 D;  1JO8 A;  1RLP C;  2ED0 A;  2GFU A;  5KYW A;  2NYS A;  3VS4 A;  4RTW A;  3D7S B;  3NHN A;  2A0F B;  5I2M A;  5GAN 3;  4J9B A;  2O2O A;  1Q86 C;  2GTJ A;  3JB9 D;  4C8Q F;  2X4W A;  4JRK A;  1YIJ T;  1LVK A;  2F5T X;  2RQT A;  1M1G A;  3CCQ Q;  2E12 A;  1H3Z A;  3ZFJ A;  3CCM T;  1UFF A;  4C5G A;  1GBR A;  3GIB A;  1B3Q A;  4J7F A;  1YJ9 A;  1YJN T;  1KD1 U;  3OYK A;  1BI3 A;  2EYZ A;  1TUD A;  3EG9 B;  2VVK A;  2LJ1 A;  4DBF A;  2R5A A;  1PD0 A;  4XTV A;  1VQ5 T;  4C5H A;  3JCM W;  5L23 A;  1B34 B;  3EFR A;  3CXC P;  2RHY A;  2V26 A;  3ASK A;  4X9D A;  2CUB A;  4ZTJ A;  4XK8 E;  1Q86 U;  5GAN 2;  4X9C A;  4FSS A;  2QEX T;  1VYT A;  2AHJ B;  4LDW A;  1Q81 R;  2IG0 A;  3NFC A;  3GOX A;  1Q95 G;  3CC2 Q;  1KC8 U;  1OU8 A;  2AKK A;  3H9N A;  1UEB A;  1RAH B;  2CP5 A;  4JRP A;  2YUN A;  4EMK B;  1BIB A;  2CSQ A;  4KGZ B;  4Y91 A;  1YN8 A;  1Q81 U;  2K4Y A;  2LQK A;  5GAN 5;  3CC7 A;  3OB9 A;  1J3T A;  4OB0 B;  4KH1 B;  5LJ3 d;  2DA9 A;  5A2Q E;  1K76 A;  4A4H A;  3UA6 A;  1ZSG A;  1OI1 A;  1GXI E;  1T0H A;  1M8V A;  2DM1 A;  4J83 A;  2ZGW A;  5EC7 A;  3JCM Q;  2A37 A;  5GAO p;  2LJ0 A;  4RKU E;  1UGP B;  1TXQ A;  2A36 A;  2R57 A;  3CC4 Q;  3TQ7 P;  2DBK A;  1UUE A;  2QA4 T;  4FSX A;  4J6X A;  3CCM A;  4DEX A;  2FL7 A;  3HPW A;  2D6F A;  2OTJ T;  4BI3 A;  2D8H A;  4LXC A;  3UPU A;  1KG1 A;  1HSQ A;  3VUB A;  5CIU A;  2BIV A;  4C92 F;  1K9M U;  1I5O B;  1GFD A;  4MZM A;  3OYH A;  1RAI B;  4LN2 A;  4ELY C;  2VWF A;  1YHQ T;  1GFC A;  1AEY A;  3CPF A;  4N0A A;  2JXB A;  2L8D A;  1N8R C;  3REA B;  1OV3 A;  4KBM B;  3H0I A;  2XID A;  4Z02 A;  1QP3 A;  3CEY A;  3OSV A;  3SHW A;  1K73 C;  4TVR A;  2M0Y A;  2DKG A;  1JXO A;  3CCL Q;  1D3B A;  3C0C A;  4WF2 A;  3JB9 H;  3HHT B;  2LC4 A;  3A8H B;  3JCM b;  3CC7 Q;  5C0M A;  2RHZ A;  4WCI A;  2JNG A;  4RTX A;  1M4Z A;  5GMK i;  1VQ6 A;  2K5I A;  4E7L A;  2V1Q A;  2XIC A;  1M90 R;  2FRY A;  1M27 C;  3L2Q A;  1Y96 B;  3SWN C;  1MNE A;  1V76 A;  3RNJ A;  2KRM A;  1VQ7 A;  3CD6 A;  4M78 D;  2ZPG B;  4PJM A;  4MZP A;  2EJ9 A;  3RUX A;  4M75 A;  1NYF A;  2NUP B;  4M7A G;  5LJ5 f;  2QDL A;  3RDV A;  3QYH B;  3OBW A;  1JEG A;  5FLX E;  4O6J A;  5CKB A;  4M75 C;  4RCB A;  5GAO q;  2AKL A;  4EIK A;  3M55 A;  4UC4 A;  3EG9 A;  2WSF E;  2YUO A;  3FLG A;  1D3B B;  4RTT A;  3MET A;  2X4Y A;  2D9T A;  2JJ9 A;  4OMN A;  1VQM Q;  4PJO B;  1S72 A;  2BKD N;  2LQN A;  1VQ6 T;  2DEU A;  2D0N A;  1YCS B;  4WTO B;  2FG0 A;  4QQD A;  3PE0 A;  1QW1 A;  3OMG A;  2ZPE B;  1VQO Q;  5DLQ E;  2CUD A;  1XTD A;  5D6X A;  1M3C A;  2JM9 A;  2W10 A;  4JS4 A;  4C8Q A;  4HVV A;  4LE9 A;  1Y57 A;  4JDS A;  2JTM A;  1NJI C;  2DJQ A;  3MHX A;  1UGS B;  1IB8 A;  3ZEH A;  4RTZ A;  3CMA T;  1I07 A;  4PLI A;  2JM8 A;  1TUC A;  1G5V A;  1PCX A;  4M78 F;  2FRW A;  1EFN A;  4PJL A;  2RHU A;  4MDW A;  3JCM f;  2GFA A;  1VQ5 Q;  2RPN A;  3SB2 A;  4DBQ A;  3CCS T;  1HD3 A;  3JSC A;  4QVD A;  1TWB A;  1AVZ C;  4OMP A;  1WHL A;  1E6G A;  1OX9 A;  4RG2 A;  4RG8 A;  4FT2 A;  3V7S A;  2KGT A;  5GAO n;  2DBM A;  1KFZ A;  3JCM X;  1GCQ C;  4GLK A;  1G3Y A;  3N5B B;  4PJJ A;  2COZ A;  5LJ3 f;  3VRZ A;  1B07 A;  3QWY A;  2DL7 A;  3CXC A;  4R0K A;  5GAM d;  2JS0 A;  1VQP A;  3I55 A;  4C8Q E;  2QK0 A;  1X69 A;  4MDX A;  5FRN A;  1OEB A;  2EYY A;  5GJV B;  5DLO A;  1FXX A;  2EKH A;  3JCM e;  5KYX B;  2FPD A;  2F69 A;  3I9Q A;  1MMA A;  5GJW B;  4OP0 A;  5CKF A;  2ED1 A;  3SWN B;  1Q81 C;  3E9G A;  2FPF A;  1U1S A;  2KXC A;  2ECZ A;  3URG A;  2XK0 A;  4BY6 B;  3RBB B;  4FYY B;  1VQ4 Q;  2QQA A;  3M4Y A;  1GCQ A;  4PFZ A;  1VQ8 A;  1HK9 A;  2L89 A;  3OBY A;  2L3Q A;  2P0K A;  4HCZ A;  2H3E B;  3CCV Q;  1BCO A;  3OS0 A;  1V1C A;  2JZ2 A;  2CH4 W;  5GMK m;  1VQL A;  2DER A;  2O31 A;  2ZZD A;  3BY7 A;  3OYI A;  3VKI A;  1W2B P;  4V2S A;  2EGE A;  4F16 A;  2O9S A;  4FYV B;  1KQS S;  4LNP A;  2CDT A;  2KEA A;  4RTY A;  2K9G A;  4PJO C;  1JB0 E;  3C94 A;  4NOY A;  3CCJ A;  2E70 A;  1VYU A;  3RMS A;  5LJ5 g;  4QVC A;  5J26 A;  1Q7Y U;  1GL5 A;  2MWO A;  1YHQ Q;  4LD9 K;  4M7A C;  1WXB A;  5HK0 A;  3M54 A;  1QVG A;  3P8D A;  2HQH A;  4OF1 A;  4OMM A;  1LCK A;  4PNO A;  4HCB A;  2YLC A;  3CCS Q;  4RTV A;  4XU3 A;  3GF5 A;  2XDD A;  1ZBJ A;  2KI7 A;  3EGX A;  1RAD B;  3OYD A;  2E3H A;  1NEB A;  4LDX A;  4X34 A;  5GAN g;  3M58 A;  1BB9 A;  2KNB B;  1OPL A;  4IIO A;  2QTX A;  2LQ8 A;  4A54 A;  3QDR B;  2E6N A;  2HL5 C;  4HVW A;  4E6R A;  2CZ6 B;  5KYU A;  1LJO A;  1M2V A;  4N4I A;  3G4S A;  1Y0M A;  1Y96 A;  2K79 A;  2L3S A;  5HY6 A;  2F2X A;  3EH1 A;  1VQ8 T;  1VQ7 Q;  3CD6 Q;  1X75 C;  4KUI A;  1SSH A;  2H3J A;  1M90 C;  5ECA A;  1SF9 A;  5CO7 A;  1D1A A;  1H64 1;  3WVD B;  1PKT A;  3L2Z A;  3UT1 A;  2EYX A;  2EGC A;  5J3B A;  1VQL T;  1G3T A;  1VQK T;  3CC4 T;  3CME A;  1AHJ B;  2EJG A;  3SD4 A;  2KYB A;  3OYJ A;  2DE0 X;  2DO3 A;  2QI2 A;  1I0C A;  1TOV A;  1BKB A;  4R56 A;  4OMF B;  4J9I A;  1MMN A;  3KFV A;  2RK2 A;  1OOT A;  3BDU A;  4HCC A;  1HJD A;  5IT9 E;  1QCF A;  4DBR A;  4JJB A;  5CKD A;  3I5S A;  4BY6 C;  2QTV A;  1XOV A;  3OW2 P;  3X25 B;  1SEM A;  4AFZ C;  1NE8 A;  2WAC A;  2XDB A;  4N4H A;  5J39 A;  5CR2 A;  1W2B S;  2VGM A;  2M1H A;  4M75 B;  2PUO B;  3A8G B;  3HRS A;  1OU9 A;  1JU5 C;  1B34 A;  3I55 Q;  3HP9 A;  5GAO r;  5M9O A;  4A53 A;  2DYI A;  2KRO A;  2L3P A;  3I56 A;  3CCL T;  5FRM A;  1WPY A;  2EWN A;  4M77 G;  4F04 B;  1KD1 R;  1YIT A;  3OW2 A;  3JCM h;  2CP3 A;  1WI7 A;  2OI3 A;  1PG5 B;  2RNA A;  1KHI A;  1T3L A;  4CC2 A;  3U23 A;  1N9R A;  1WXU A;  1N8R U;  1H8K A;  1VYV A;  2XD0 A;  1UJ0 A;  3JCM J;  3CC4 A;  1K0S A;  1CSK A;  2XU8 A;  2J6K A;  2QG9 B;  4AFU C;  3TCJ A;  2QXF A;  5KYY B;  2E10 A;  2QDY B;  1OZ2 A;  2ATC B;  2HBW A;  1W4S A;  2K2M A;  4Z89 A;  3CCV A;  4OB3 B;  4LD6 A;  1YBY A;  1ZHI A;  5GMK h;  1U5S A;  4KT0 E;  2ZCF B;  1E7O A;  5I22 A;  2RJF A;  2HDA A;  1S72 Q;  2RQV A;  2YT6 A;  3ZBD A;  5GAN h;  1JBM A;  2ESW A;  5GMK l;  1U8R A;  2LCS A;  2OX7 A;  5CVI A;  1XNI A;  4YTL A;  2RD1 A;  1BK2 A;  2KRS A;  2VB6 A;  4HKE A;  2LTO A;  2RI2 A;  3RKW A;  1M1F A;  4F7U G;  1G8X A;  4C5I A;  1NJI U;  2E5Q A;  1YJW A;  1NEG A;  1VQ8 Q;  4JPB W;  1JQQ A;  2DK3 A;  2FEI A;  3EFO B;  5L8R E;  3C95 A;  2J6O A;  2M02 A;  3EG3 A;  2MAM A;  3HL8 A;  3CPW P;  2ROT A;  3FC3 A;  2FYK A;  5GAN 8;  1K9M R;  1PHT A;  5FWB A;  1K73 R;  4CC3 A;  1YJ9 T;  3CME Q;  2LRQ A;  1IO6 A;  3VYH B;  2BUD A;  3PMI A;  3VS2 A;  1VQ6 Q;  1VQ7 T;  3CD6 T;  1QKX A;  4XAX B;  1RLQ C;  1YIT Q;  1AT1 B;  1PD1 A;  5FW9 A;  3CCU Q;  1RL2 A;  2YHT A;  1ZUU A;  4C0Z A;  2P0Q A;  2KYM A;  3CCV T;  4OB1 B;  4A4E A;  1AZE A;  1WQW A;  5GAN 4;  3HFN A;  3L2W A;  1QVF A;  2RHI A;  4A63 B;  2X51 A;  2B8A A;  2CT4 A;  2YUQ A;  2X3X D;  1QWE A;  4LDU A;  5GMK e;  1RI9 A;  5GAM j;  3CCQ T;  4ATO A;  2KVQ G;  1VQ5 A;  3NTI A;  1W2B A;  2DMO A;  3WVE B;  4M7A B;  5KYU B;  1WFW A;  1TS9 A;  5I2S A;  1D1B A;  1SKU B;  3A8O B;  2J7I A;  4C0G A;  3JCM g;  3EAE A;  4KGX B;  1RUW A;  2HKQ B;  4KUL A;  3CCR T;  3VJP A;  4HVU A;  3VS6 A;  3NTK A;  2DFU A;  1KJW A;  4M7A D;  4PJO F;  3X20 B;  4M77 B;  3CCE T;  8ATC B;  1WHM A;  4IUU A;  4F7U E;  1A0N B;  3I35 A;  3G6E Q;  4E7I A;  1N6A A;  2PVG B;  1S72 T;  2RM4 A;  5DY9 A;  2H8H A;  1YNZ A;  4M7A F;  3MKD A;  1NJI R;  1KIK A;  2FVU A;  1OUL A;  1ZA1 B;  4F17 A;  5D7U A;  4IUV A;  2DTO A;  2IIM A;  1NBE B;  2F2V A;  5GAN 6;  4J7I A;  1VUB A;  1ZSZ C;  1YI2 T;  2KXD A;  2FZK B;  4CI0 C;  2YXY A;  1ZQ1 A;  3SWN A;  3DKM A;  3RMQ A;  1JRI A;  2L3R A;  3VRY A;  3NMZ C;  1N27 A;  1K9M C;  3X24 B;  4BDY A;  2DD5 A;  2LX9 A;  1VQL Q;  4M75 G;  2CRE A;  2E3I A;  1VQK Q;  2PUK B;  2V8K A;  2E1H A;  3OSS C;  3QHS A;  1K9A A;  5IXB A;  2GGR A;  4D6W A;  1YIJ Q;  3G71 A;  3DLM A;  1NG2 A;  2XKO C;  4Z88 A;  1UB4 A;  1R77 A;  1SG5 A;  3X26 B;  2EW3 A;  4BI8 B;  1VQP Q;  1I8F A;  5KYN A;  5GAO l;  5KYY A;  2EIF A;  4FT4 A;  3M5A A;  3JAM E;  1X01 A;  2QGG A;  2GF7 A;  4O5V A;  1IHW A;  1NPP A;  2IPO B;  1MHN A;  3NGP A;  4JJD A;  5GAM f;  2NWM A;  2KT8 A;  3I55 T;  4J9E A;  3OYA A;  4C92 G;  1ZUY A;  4ME7 A;  2HQE A;  2D8J A;  5HKC A;  1QVG S;  3H41 A;  4IUQ A;  4EMK C;  4GLM A;  1VQO T;  4L6V 5;  1UGV A;  4MMK A;  1C1A A;  1UHF A;  3CCM Q;  3GP8 A;  1K1Z A;  1ABQ A;  2BZY A;  2OAU A;  2CSI A;  5FU6 B;  2AZV A;  1O9S A;  2DEQ A;  1KC8 C;  2GQV A;  2E64 A;  3M59 A;  4J6Y A;  2QAZ A;  3IQL A;  3MJX A;  4EPC A;  4AT1 B;  3OQ5 A;  2O01 E;  1VIF A;  1TU0 B;  4EMH A;  1W1F A;  2D0Q B;  2KRN A;  3TSZ A;  3L2R A;  4OGC A;  1JJ2 S;  3MEV A;  5GAO m;  2ZPB B;  1S1N A;  2VKN A;  4J9C A;  5GAM g;  3QII A;  1M1K R;  2JN0 A;  3BE3 A;  3OYG A;  1YP5 A;  5HK3 A;  1MV0 B;  3UA7 A;  2X35 A;  3EHR A;  1U06 A;  1Q82 U;  1VQN A;  1CKB A;  2FPE A;  3CPW S;  4ZGD B;  4DEY A;  2K5L A;  2OAW A;  2DTI A;  2A7Y A;  2DX1 A;  2RI3 A;  4LUE A;  1AD5 A;  2K3Y A;  2LCL A;  3L1A A;  1BYM A;  1Y71 A;  2CP7 A;  2DIL A;  2KSS A;  4CRI A;  2CP6 A;  4XQ3 A;  1YJN A;  3JCM V;  2VYT A;  3QJY A;  4ZN1 A;  2C0T A;  2GCX A;  2YLB A;  5C6S A;  5I21 A;  1I1J A;  1OPK A;  2YRC A;  1UE9 A;  1WGS A;  3EGD A;  2EBP A;  3CXC S;  3PGG A;  4II1 A;  2V8I A;  3QXE B;  2DXU A;  3FB9 A;  3CCU T;  1UTI A;  2LMJ A;  2JMC A;  3VS3 A;  1YJW Q;  1WXT A;  4VUB A;  3RIR A;  1VQ4 A;  1PM3 A;  2KE9 A;  4M77 A;  2RK1 A;  2HD0 A;  5FU7 B;  5KYX A;  3DB3 A;  2M0O A;  1X6O A;  3CBP A;  3QBY A;  2JUF A;  2R58 A;  4XTW A;  3VU3 C;  2DL5 A;  3OYE A;  4IUR A;  1TSF A;  2G6F X;  4QVZ A;  1NLP C;  2HNI A;  1VQP T;  4J9F A;  3KBG A;  2CZ0 B;  4ZNX A;  3CC7 T;  2EAY A;  1MGQ A;  5CQX A;  4HT9 A;  2PVD B;  2VAS A;  3EH2 A;  4XTX A;  1AWO A;  1BBZ A;  1UGR B;  2EQK A;  4BE2 A;  1WDX A;  2CP2 A;  4RCC A;  4B9W A;  2FZC B;  2RMO A;  2PVO B;  2B86 A;  3CBO A;  1IRE B;  2GNC A;  4QW2 A;  5LJ5 h;  2DZ9 A;  1ARK A;  1VIE A;  4M77 C;  3OS5 A;  4M7D C;  2SRC A;  2YDL A;  3KUF A;  4AG1 C;  2JT4 A;  3E19 A;  5CK9 A;  1IRX A;  4M77 E;  1H92 A;  4M4Z A;  4M7D G;  4E2F B;  3RKY A;  2EQM A;  2YSQ A;  1I5L A;  1U1T A;  2HMA A;  3LGL A;  2EQJ A;  2K6D A;  1RAF B;  4N0A C;  4LUD A;  4M78 E;  2L0A A;  2VGN A;  1CKA A;  3GLX A;  3MP6 A;  3H0F A;  1Y7X A;  2OTL Q;  2DD4 A;  2RJE A;  2NUT A;  4PKC C;  1YI2 Q;  2EQI A;  4F7U F;  3LWI A;  3V7R A;  2V8J A;  4J9D A;  3CCU A;  3LH0 A;  2JMA A;  3V7C A;  2DXT A;  3CQT A;  1TTH B;  2DXC A;  3JB9 G;  3E1S A;  2DF6 A;  2O4X B;  3E9F A;  3VV0 A;  3BDL A;  2MCN A;  2L2P A;  4HCK A;  3O8V A;  2KT1 A;  2MI6 A;  1WIE A;  2HAX A;  4OGE A;  4M77 D;  1ZUK A;  3MEA A;  4FYW B;  1GCP A;  3EHQ A;  2HCK A;  4PJO G;  5IHI A;  1VOM A;  3EGX B;  3JCM P;  1Q7Y C;  2C06 A;  1ZSZ B;  4M78 A;  4NL2 A;  1PKS A;  4F7U B;  1QVF S;  3CC2 A;  4PJO D;  3CBM A;  1LNX A;  1IHV A;  1SHF A;  4FM4 B;  2KY9 A;  4BI4 A;  3LW5 E;  4R55 A;  4M78 C;  3OYN A;  3BFM A;  3CMA Q;  2RJC A;  4E7K A;  1IZ6 A;  3M0Q A;  4IUT A;  2BZ8 A;  3EGU A;  4AFQ C;  4L5G A;  2QAS A;  5EG2 A;  3OYF A;  1VQ9 Q;  1LPL A;  3FRN A;  4JJC A;  2VXE A;  1YJN Q;  2KK4 A;  2DPP B;  2K2V A;  4QQG A;  2RHX A;  2MPX C;  4NS5 A;  3JB9 J;  4ANJ A;  1OX8 A;  1ZBX A;  4N4G A;  1ABO A;  2P4T A;  3MP8 A;  1U3O A;  2RQU A;  3SDZ A;  3QPH A;  1G3W A;  1M8M A;  2XDP A;  4XTY A;  2X4X A;  1PSF A;  1SPK A;  4K11 A;  5LJ3 e;  3CCJ Q;  3PIO A;  4LDV A;  3OYC A;  1FMK A;  2F2W A;  2DZC A;  1M3A A;  1ZLM A;  4RUG A;  2ZAE A;  4C8Q D;  4DQ2 A;  3OW2 S;  1K73 U;  1AOJ A;  1IGQ A;  5FU6 C;  2E4H A;  2EYQ A;  3Q1J A;  1TG0 A;  2X9H A;  3PT9 A;  4KGV B;  5CKH A;  3QZ5 B;  3J81 E;  2DTH A;  3CCQ A;  2PQW A;  3MO8 A;  3UWN A;  1BI0 A;  3A8L B;  2PNI A;  4BAC A;  2EGA A;  3I56 T;  3G4S T;  2GTO A;  5IAY A;  1Q82 C;  2VV5 A;  2NUZ A;  5FRO A;  2ENM A;  1T0J A;  2RO0 A;  2Y4X A;  1SRM A;  1VQ9 A;  2E41 A;  3OYY A;  3REB B;  1MUZ A;  1QWF A;  3GNF B;  2COY A;  2RI5 A;  2KDS A;  2LDM A;  3HRU A;  4C5E A;  5KE3 A;  2W0Z A;  4C92 A;  3RKX A;  1YFN A;  1VQK A;  5KH6 A;  4BDZ A;  2DL3 A;  2HSP A;  2YRV A;  3CCL A;  3TSW A;  5FU7 C;  1YIT T;  1UDL A;  4F7U A;  2WSE E;  2OTL A;  3HRT A;  3ME9 A;  2SEM A;  1RAG B;  2F5K A;  5LJ5 j;  5A0L A;  1QCO A;  1GRI A;  2XI9 A;  3INZ A;  2DNU A;  2MOX A;  4OMQ A;  3M0P A;  1YCY A;  5LJ3 j;  1FMV A;  1AWX A;  3QG1 A;  3GPL A;  5D6W A;  2I2L A;  2K5F A;  5I11 A;  2HSE B;  3PVL A;  4AG2 C;  5LJ5 e;  3QDF A;  3A8M B;  4GBQ A;  5AYF A;  3R6N A;  4DA4 A;  3TRE A;  4FU6 A;  4C92 C;  1ZX6 A;  3MEU A;  1M1K C;  3S3M A;  3PMT A;  1KC8 R;  4ORZ A;  2R5M A;  3QO3 A;  2QEX A;  3PTA A;  2J6F A;  3DB4 A;  4M7D B;  2E5K A;  2O4X A;  1E6H A;  3FIF A;  1ACM B;  3LLR A;  2MWP A;  3MP1 A;  4OVA A;  2JOY A;  3L2U A;  2YUP A;  4OB2 B;  2AZS A;  3JCM d;  4JZ4 A;  2DVJ A;  2I0N A;  1UGQ B;  3CCR Q;  1YWO A;  2ZPH B;  1XJW B;  1RAA B;  2EPD A;  1M2O A;  3FEO A;  2ABL A;  3X28 B;  3MEW A;  4RMO A;  4AFS C;  4NL3 A;  1WX6 A;  1AWJ A;  2YWW A;  4DOW A;  1KD1 C;  1K8A U;  2BE7 D;  2JVV A;  4PJN A;  2A28 A;  2DIQ A;  3ZL7 C;  3E2U A;  2MMP A;  4BB7 A;  2QQ9 A;  3H8Z A;  1N5Z A;  2K3B A;  4M7D D;  1M9S A;  1X6G A;  4M7D F;  3M57 A;  4Q5W A;  2RF0 A;  3LWH A;  3THK A;  4JJN K;  4P5N A;  4M7A A;  1T3S A;  1QLY A;  1OQK A;  1WQ7 A;  1BIA A;  4C92 D;  2QGF B;  1OZ3 A;  1X27 A;  2DET A;  1VQN T;  4L59 A;  2OTJ A;  1HYO A;  5CAI A;  2VXF A;  2LVM A;  1C6V X;  1N9S A;  1VQM T;  4CC4 B;  3G4S Q;  2F1L A;  4B9X A;  2PTK A;  1QVP A;  3HKS A;  4E7Z A;  1PC0 A;  2E6Z A;  1FYN A;  1KQS A;  2V1R A;  3J80 E;  2JTE A;  2D1X A;  2JW4 A;  3L42 A;  3OYL A;  2RJD A;  1WHJ A;  2NUT B;  5LL6 S;  1ZSZ A;  4M78 B;  3VUZ A;  4IKF A;  2XMF A;  4PJO E;  5LJ3 g;  4FW2 A;  5GAN 7;  3UAT A;  5A0G A;  2QA4 A;  4FYX B;  5A0D A;  1XQH A;  2X4J A;  4XU0 A;  4E7S A;  3EG1 A;  4F14 A;  3LYI A;  2CP0 A;  4J9H A;  4BE1 A;  4D8D A;  2C0I A;  3OY9 A;  1UEC A;  3MPU B;  1TUG B;  3FJ5 A;  1Z9Z A;  4PK4 A;  4C8Q G;  4XTZ A;  3UDC A;  1ZA2 B;  1RAE B;  1WA7 A;  3QYG B;  2MK5 A;  3QJ6 A;  2QQS A;  1X2Q A;  3PNW C;  1D1C A;  2FB7 A;  1WHK A;  2RH2 A;  2EQU A;  1X2K A;  2DRM A;  2CS7 A;  3G6E T;  1O75 A;  2HKN A;  1GBQ A;  3V8L A;  4C92 B;  3CCR A;  1Q86 R;  1RI0 A;  2ROL A;  2K57 A;  3J7A F;  2AK5 A;  4E47 A;  2LZ6 B;  3G71 Q;  4C8Q B;  3VS1 A;  1R0B G;  2PZ1 A;  1FWZ A;  5IN1 A;  2DJZ A;  1I4K 1;  4LDY A;  1YHQ A;  3NTH A;  1K0X A;  2E65 A;  4JRI A;  3HTR A;  5GAM h;  1MV3 A;  3RER A;  4FW1 A;  3R6O A;  2JS2 A;  2NLU A;  1PSE A;  1R8O B;  1PRL C;  2J05 A;  4BUG A;  2BE9 B;  3ULR B;  3OA6 A;  3I56 Q;  2MIO A;  2CZ1 B;  3OS2 A;  1VQO A;  1WZO A;  1YIJ A;  2ZPI B;  1VQN Q;  3TEE A;  4QQ6 A;  2EFI A;  3S6W A;  3S3O A;  3GBQ A;  3A98 A;  2OTJ Q;  2KQW A;  5GAN d;  4E7H A;  4JZ3 A;  5CKE A;  4C0D C;  1QP2 A;  2MF2 A;  4PFO A;  3EG2 A;  1SRL A;  4FIB A;  3UF4 A;  2K3X A;  3M53 A;  3OYB A;  1P92 A;  1NZ9 A;  3A5Z B;  1G3S A;  2PU9 B;  1IXD A;  2VC8 A;  3G6E A;  4HT8 A;  1AZG B;  3GNG A;  1W6X A;  1PNJ A;  1NPR A;  1D0Z A;  3QUI A;  2LNV A;  3LH5 A;  3C4S A;  1YJW T;  2JTF A;  1KQ2 A;  2HZY A;  2CKK A;  2HBP A;  4C0F A;  6AT1 B;  1D0X A;  5LJ3 h;  3M0R A;  3QSU A;  1B7T A;  1LOJ A;  4HA8 A;  1BI2 A;  3RR6 A;  5KCH A;  1Q7Y R;  1MMG A;  3DLL A;  1KK7 A;  5KCO A;  2P4R A;  4ZTF A;  5FWC A;  1SHG A;  1G2B A;  1X43 A;  5DM7 R;  4MZT A;  5GAN j;  4FCY A;  2IVW A;  3ER0 A;  3M9Q A;  4EMG A;  1JJ2 A;  3TVT A;  3FJP A;  2MYS A;  1M1K U;  3OMC A;  1EZZ B;  3JB9 I;  4JUV A;  1F1B B;  2J06 A;  2LT4 A;  1G83 A;  4EDU A;  2QYZ A;  4J8O A;  2Y90 A;  1Q82 R;  3HSB A;  2LNH B;  1FX7 A;  3HFO A;  2HQX A;  2CGH A;  4CC7 A;  3CMA A;  8AT1 B;  4KH0 B;  2KBT A;  1V29 B;  4ELZ C;  4EMK A;  4OML A;  3QKJ A;  1OYX A;  4C8Q C;  2ZPF B;  5IHN A;  2O9V A;  1QCN A;  1BI1 A;  3PIP A;  1VQ4 T;  1R0C B;  1X6B A;  1HXD A;  3CCE A;  3KXT A;  1QVF P;  3SFM A;  4PLL A;  5CQY A;  2DLP A;  2KMT A;  4IUP A;  3RES A;  4Z8A A;  4ZGJ B;  3A1P A;  1QQJ A;  2LX7 A;  4QKU A;  3V8J A;  4M75 E;  1JJ2 P;  3M4G A;  4GY5 A;  4C0D B;  4BE0 A;  1K8A C;  1NLO C;  1YI2 A;  4A4K A;  1BCM A;  4DBH A;  1M30 A;  2X3W D;  1WHH A;  2XG8 D;  2CZ7 B;  2AIR B;  1NYG A;  3CPW A;  2HL3 A;  1Z9Q A;  4JS5 A;  2FZG B;  3G7Z A;  3P8B B;  1D0Y A;  5IHK A;  2LQW A;  1RAB B;  3VS5 A;  2CH4 A;  1UHC A;  1WYX A;  1VQ9 T;  2M16 A;  2QQB A;  5HCK A;  4XU2 A;  4KUD K;  5GAN e;  3OS1 A;  3JB9 F;  4OMO A;  4Y92 A;  1KQ1 A;  3M0U A;  4A4G A;  2EVR A;  3T9N A;  2M51 A;  2RQW A;  3VS7 A;  1I81 A; 
#chains in the Genus database with same CATH homology
 1A0N B;  3I35 A;  1KSW A;  3M0T A;  2LQN A;  2DL3 A;  2HSP A;  1K4U S;  3TSW A;  2A08 A;  2H8H A;  1YNZ A;  2D0N A;  2LP5 A;  1KIK A;  1YCS B;  2FG0 A;  1BU1 A;  1W70 A;  3H0H A;  1UDL A;  3PE0 A;  1PRM C;  2EYW A;  3QWX X;  2K7A A;  4ESR A;  4F17 A;  3SEM A;  1M3B A;  2FO0 A;  1QKW A;  2CUD A;  1UG1 A;  2SEM A;  1M3C A;  2JM9 A;  1GRI A;  2IIM A;  2DNU A;  2DYB A;  2W10 A;  2F2V A;  2MOX A;  4OMQ A;  3VS0 A;  3M0P A;  1AWX A;  1YWP A;  3NPF A;  4HVV A;  2KXD A;  4LE9 A;  5I11 A;  1Y57 A;  3PVL A;  4AG2 C;  5IH2 A;  3VRY A;  2O88 A;  3NMZ C;  2DJQ A;  4RTZ A;  1I07 A;  4GBQ A;  4QT7 A;  2JM8 A;  1TUC A;  2CRE A;  1H3H A;  3R6N A;  2FRW A;  1EFN A;  1ZX6 A;  1K9A A;  5IXB A;  2GGR A;  2RPN A;  2C0O A;  4ORZ A;  1HD3 A;  1AVZ C;  4X1V A;  4OMP A;  2J6F A;  1NG2 A;  1E6G A;  2E5K A;  1E6H A;  2OJ2 A;  4Z88 A;  2EW3 A;  2KGT A;  2DBM A;  2YUP A;  1KFZ A;  2AZS A;  1GCQ C;  2DVJ A;  4JZ4 A;  2I0N A;  1NM7 A;  1YWO A;  1WLP B;  2DRK A;  2BZX A;  2EPD A;  3VRZ A;  1B07 A;  2ABL A;  3QWY A;  2DL7 A;  4R0K A;  4AFS C;  2JS0 A;  3NGP A;  1WX6 A;  1AWJ A;  4JJD A;  2NWM A;  2BTT A;  2KT8 A;  4J9E A;  3I5R A;  2A28 A;  1X69 A;  1ZUY A;  3ZL7 C;  2D8J A;  1OEB A;  2EYY A;  5GJV B;  2GBQ A;  3H41 A;  4GLM A;  2EKH A;  1N5Z A;  2FPD A;  2K3B A;  1X6G A;  3I9Q A;  1UGV A;  5GJW B;  2LJ3 A;  1UHF A;  2RF0 A;  3O5Z A;  2ED1 A;  1K1Z A;  1ABQ A;  3THK A;  2BZY A;  2CSI A;  1JXM A;  2AZV A;  2FPF A;  1VA7 A;  2KXC A;  3EG0 A;  2ECZ A;  1T3S A;  4RTU A;  1QLY A;  3RBB B;  3IQL A;  1X27 A;  1GCQ A;  2CT3 A;  1W1F A;  2KRN A;  2DL8 A;  3TSZ A;  2HEQ A;  4CC4 B;  1S1N A;  2PTK A;  2L3Q A;  2VKN A;  4J9C A;  2RQR A;  1FYN A;  1V1C A;  2CH4 W;  2O31 A;  2DL4 A;  1YP5 A;  1MV0 B;  2EGE A;  2V1R A;  3UA7 A;  4F16 A;  2JTE A;  2D1X A;  2JW4 A;  2KR3 A;  1PWT A;  2O9S A;  3JV3 A;  3EHR A;  1U06 A;  4LNP A;  2CDT A;  1CKB A;  2FPE A;  2XMF A;  2KEA A;  4DEY A;  4RTY A;  2OAW A;  2K9G A;  2DX1 A;  4LUE A;  1AD5 A;  3UAT A;  2RN8 A;  4HXJ A;  1VYU A;  2DIL A;  3EG1 A;  3PVQ A;  1GL5 A;  4F14 A;  4D8K A;  4J9H A;  4D8D A;  2C0I A;  1AWW A;  1WXB A;  1UEC A;  4IIM A;  3FJ5 A;  1Z9Z A;  2C0T A;  4OMM A;  2GQI A;  1LCK A;  4J9G A;  1I1J A;  1OPK A;  1UE9 A;  4RTV A;  1WA7 A;  1UJY A;  1ZBJ A;  2EBP A;  1X2Q A;  5IXF A;  1UTI A;  2LMJ A;  2JMC A;  1X2K A;  3M0S A;  4KRT A;  3VS3 A;  2DRM A;  1NEB A;  1WXT A;  1JO8 A;  1RLP C;  2ED0 A;  1GBQ A;  3VS4 A;  4RTW A;  1BB9 A;  2KNB B;  3NHN A;  1OPL A;  4J9B A;  2ROL A;  2KE9 A;  2O2O A;  4IIO A;  2AK5 A;  2GTJ A;  4HVW A;  2LZ6 B;  4E6R A;  3VS1 A;  2DL5 A;  2RQT A;  1Y0M A;  2PZ1 A;  2K79 A;  2L3S A;  2G6F X;  1K0X A;  1NLP C;  2F2X A;  4J9F A;  1MV3 A;  2JS2 A;  1SSH A;  1PRL C;  1UFF A;  2J05 A;  5ECA A;  1GBR A;  3ULR B;  4ZNX A;  1B3Q A;  2MIO A;  1AWO A;  1PKT A;  2EYZ A;  2EYX A;  1TUD A;  1BBZ A;  2VVK A;  2EGC A;  1WDX A;  2RMO A;  2LJ1 A;  2B86 A;  2KYB A;  3GBQ A;  3A98 A;  2DE0 X;  2GNC A;  1I0C A;  1ARK A;  5L23 A;  4JZ3 A;  4J9I A;  2SRC A;  2YDL A;  3EG2 A;  1SRL A;  3KFV A;  3UF4 A;  4AG1 C;  1OOT A;  2JT4 A;  1HJD A;  1QCF A;  1H92 A;  2CUB A;  4M4Z A;  4JJB A;  2YSQ A;  3I5S A;  1XOV A;  1AZG B;  2K6D A;  4FSS A;  1W6X A;  1SEM A;  4LUD A;  1PNJ A;  1VYT A;  4AFZ C;  2L0A A;  3LH5 A;  1CKA A;  2AKK A;  3H0F A;  1JU5 C;  3M0R A;  2KRO A;  2EQI A;  2L3P A;  2YUN A;  4J9D A;  2JMA A;  2CSQ A;  1YN8 A;  1WI7 A;  2OI3 A;  2RNA A;  3CQT A;  1J3T A;  2DF6 A;  1T3L A;  2P4R A;  3U23 A;  4CC2 A;  2DA9 A;  2MCN A;  1WXU A;  2L2P A;  1K76 A;  1H8K A;  1VYV A;  1UJ0 A;  3UA6 A;  5FWC A;  4HCK A;  1ZSG A;  1K0S A;  1CSK A;  2J6K A;  1T0H A;  2KT1 A;  1SHG A;  2DM1 A;  1G2B A;  1X43 A;  4AFU C;  1WIE A;  5EC7 A;  2A37 A;  1ZUK A;  2LJ0 A;  1GCP A;  3EHQ A;  2HBW A;  4Z89 A;  2K2M A;  2HCK A;  2A36 A;  5IHI A;  2DBK A;  1UUE A;  1PKS A;  1U5S A;  4DEX A;  3TVT A;  1E7O A;  5I22 A;  2D8H A;  2HDA A;  2RQV A;  2YT6 A;  2ESW A;  1HSQ A;  2LCS A;  1SHF A;  2J06 A;  1BK2 A;  2KRS A;  3M0Q A;  1G83 A;  2BZ8 A;  3EGU A;  1NEG A;  1GFD A;  4AFQ C;  2LNH B;  4JPB W;  4LN2 A;  1JQQ A;  2VWF A;  2FEI A;  4JJC A;  4CC7 A;  2J6O A;  1GFC A;  1AEY A;  3EG3 A;  2JXB A;  2KBT A;  4OML A;  3REA B;  1OV3 A;  2ROT A;  3H0I A;  5IHN A;  3SHW A;  2O9V A;  1PHT A;  2M0Y A;  5FWB A;  1JXO A;  4CC3 A;  1IO6 A;  1ABO A;  3C0C A;  1U3O A;  1X6B A;  2RQU A;  3VS2 A;  1QKX A;  1M8M A;  1RLQ C;  5FW9 A;  1SPK A;  4K11 A;  1ZUU A;  4WCI A;  1FMK A;  4RTX A;  2F2W A;  1M3A A;  2KYM A;  1ZLM A;  2DLP A;  2V1Q A;  4RUG A;  4Z8A A;  1AZE A;  2FRY A;  1M27 C;  2LX7 A;  1AOJ A;  3RNJ A;  1TG0 A;  4A63 B;  2KRM A;  1NLO C;  2CT4 A;  2YUQ A;  2X3X D;  1QWE A;  1RI9 A;  1M30 A;  2X3W D;  1NYF A;  2DMO A;  2PNI A;  2QDL A;  1NYG A;  2EGA A;  1WFW A;  1JEG A;  2J7I A;  1Z9Q A;  2GTO A;  2NUZ A;  2ENM A;  2AKL A;  1T0J A;  4EIK A;  5IHK A;  1SRM A;  2LQW A;  1RUW A;  3VS5 A;  2CH4 A;  1UHC A;  1WYX A;  5HCK A;  2YUO A;  3REB B;  4OMO A;  4RTT A;  1MUZ A;  4Y92 A;  3M0U A;  1QWF A;  4HVU A;  3VS6 A;  1KJW A;  2EVR A;  4OMN A;  2M51 A;  2RQW A;  3VS7 A;  2W0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...