2J6FA

N-terminal sh3 domain of cms (cd2ap human homolog) bound to cbl-b peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-ASSOCIATED PROTEIN
publication title Atypical Polyproline Recognition by the Cms N- Terminal SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j6fA00
3UF4A 1OEBA 4J9DA 2DRMA 1UFFA 1UE9A 5IHKA 1NEGA 2DL8A 2FRWA 2O2OA 3U23A 4F16A 2O9SA 1QWEA 2DMOA 2J6OA 4Z88A 2EW3A 1SHFA 1X2KA 1PHTA 1N5ZA 2CT3A 2L2PA 5GJWB 1PKTA 1YWOA 2F2WA 2L3PA 2KGTA 2GNCA 3EG1A 4ZNXA 2DF6A 3SEMA 2C0TA 2LX7A 1TUDA 1UTIA 3H0IA 1WDXA 2KT1A 5IHNA 2FPFA 1TG0A 2W0ZA 2FPDA 4D8DA 4OMNA 2LJ1A 2CT4A 1NLOC 1JEGA 2JM9A 4AFQC 1G2BA 2DJQA 2CSQA 2JMCA 5EC7A 5FWBA 1NEBA 4J9GA 4AG2C 2B86A 4Z89A 2DILA 2GTJA 1MUZA 1LCKA 2JS0A 5HCKA 1PWTA 2RQVA 2HEQA 3NMZC 2MOXA 3EHQA 1W70A 1K9AA 1GBRA 2KRNA 5IH2A 1KFZA 2CDTA 1GCPA 3THKA 3VS1A 3RNJA 1K0XA 2DA9A 4M4ZA 2K2MA 4JJCA 1E6GA 1M3BA 3GBQA 1KJWA 2SRCA 1UUEA 2HSPA 1NYFA 2AKKA 1E6HA 1YNZA 1K1ZA 3I9QA 3UA6A 4Y92A 2K7AA 2RF0A 1W6XA 4JJBA 1BK2A 2J06A 1J3TA 1VYUA 2OJ2A 1JXMA 2MCNA 4AFSC 1NM7A 3I5SA 1UJ0A 4CC3A 2BZYA 4RTTA 2A28A 4F17A 2J6KA 3H0HA 3VS6A 2YUOA 3LH5A 1ARKA 2PZ1A 4J9CA 1S1NA 3VS4A 1UGVA 4RTXA 4Z8AA 2J7IA 3M0SA 5FW9A 2CUBA 1ZUUA 2D8HA 2KROA 1BU1A 2BTTA 4ORZA 1CKAA 2IIMA 2YT6A 2PNIA 3M0TA 3NPFA 1AWOA 2JTEA 1OOTA 2ED1A 2YSQA 4CC2A 1ZUYA 2CREA 4LE9A 2RQWA 1RLQC 1Y0MA 1U06A 3QWYA 2AZVA 2O31A 3EG3A 1NG2A 4HVVA 2K79A 4X1VA 1AZEA 1M3CA 2HCKA 2E5KA 2EGAA 1PNJA 1ZBJA 4CC4B 4K11A 2DRKA 2LJ0A 4DEXA 1V1CA 1VYVA 4FSSA 1AZGB 2KR3A 2ENMA 2RQRA 1I07A 3TVTA 5IXFA 2RMOA 2ECZA 1I0CA 1RI9A 2DM1A 2RQUA 2FPEA 1AWJA 2D1XA 4JZ4A 1AWXA 4RUGA 2JS2A 2ED0A 3VS7A 2CUDA 4WCIA 2V1RA 2VWFA 1WI7A 1ZX6A 2JM8A 4QT7A 3I35A 1YN8A 1ZUKA 2K3BA 1SEMA 1OV3A 1M8MA 4IIOA 4RTUA 2EBPA 2GBQA 1VYTA 1T3SA 2NUZA 1H3HA 2F2XA 2FO0A 3TSWA 1AOJA 1IO6A 2DLPA 3VS2A 4R0KA 5I11A 2BZ8A 2LJ3A 1UHCA 5FWCA 2M51A 1Z9ZA 1X69A 2O9VA 3EGUA 4OMLA 2LNHB 1NLPC 4HVWA 2X3XD 4AG1C 1JXOA 3VRZA 4RTVA 1UECA 1SRMA 2OI3A 3M0RA 3UA7A 1GL5A 1QCFA 1HD3A 2VVKA 1WIEA 2CH4W 1W1FA 1Y57A 3IQLA 1X6BA 1KSWA 1QKWA 2KRMA 5ECAA 3R6NA 1SRLA 1B3QA 1PKSA 2VKNA 1H92A 3VS5A 1MV0B 3NHNA 1E7OA 1PRMC 3EHRA 4LUDA 3JV3A 1AWWA 4AFUC 2EQIA 3PVQA 3TSZA 1JQQA 1T3LA 1U3OA 2DVJA 1K0SA 2A08A 2A37A 4AFZC 3PE0A 1M3AA 2EYXA 2FG0A 1CSKA 3REAB 1WX6A 4DEYA 3ULRB 1UG1A 3PVLA 4J9BA 2DX1A 3FJ5A 1M27C 4LUEA 2W10A 1WLPB 1HJDA 2YUNA 2CH4A 2KBTA 4JJDA 1GBQA 2G6FX 2JT4A 2ROLA 1RUWA 2BZXA 4F14A 2X3WD 2MIOA 1G83A 1WXBA 2EYZA 1GCQC 4RTYA 2RQTA 2GTOA 3ZL7C 1SHGA 2L3QA 1B07A 4LN2A 1A0NB 2DL7A 1U5SA 2LCSA 2RPNA 1SPKA 1WXTA 2XMFA 1PRLC 2DBMA 1BB9A 1I1JA 3VS0A 3H41A 2ESWA 1GFDA 1QWFA 2I0NA 2SEMA 2LMJA 4A63B 2AK5A 5IXBA 2AKLA 2DBKA 1M30A 4CC7A 1KIKA 1YP5A 3M0UA 2JW4A 4JPBW 1QKXA 2KXDA 4D8KA 1T0JA 2HBWA 3A98A 1EFNA 3KFVA 1GRIA 3NGPA 2JMAA 2M0YA 3I5RA 2YUPA 1MV3A 1UJYA 2V1QA 2KYMA 2LQNA 3RBBB 1BBZA 5I22A 4GLMA 3M0QA 1T0HA 4OMOA 2K6DA 2YUQA 2RN8A 2D0NA 3REBB 2HDAA 2DL4A 2JXBA 1NYGA 2KEAA 2OAWA 5IHIA 1Z9QA 2P4RA 2KT8A 3UATA 1SSHA 1X43A 1YWPA 1WA7A 2O88A 2H8HA 2EKHA 2J6FA 2D8JA 2YDLA 2EVRA 1GFCA 1X6GA 1AEYA 1K76A 1TUCA 1JO8A 2J05A 1CKBA 2GQIA 2NWMA 4RTWA 4ESRA 3EG0A 2EGCA 4JZ3A 2QDLA 1YCSB 1AD5A 1WXUA 2ROTA 3SHWA 2GGRA 3CQTA 4OMPA 4HCKA 4J9HA 3H0FA 2EYWA 1OPKA 2KNBB 2LQWA 4RTZA 1H8KA 2KE9A 5GJVB 1UHFA 2DL5A 2DYBA 4J9IA 4J9EA 3VRYA 3O5ZA 3QWXX 2EPDA 1X27A 2LP5A 4KRTA 1OPLA 4IIMA 1ABOA 2DNUA 4EIKA 2A36A 3VS3A 3EG2A 4LNPA 2AZSA 2PTKA 1QLYA 2ABLA 1RLPC 1ZLMA 4J9FA 4HXJA 2L0AA 4OMQA 2KYBA 2K9GA 2C0OA 1FMKA 4E6RA 4OMMA 1XOVA 2KXCA 1K4US 2L3SA 2LZ6B 1AVZC 2C0IA 5L23A 2EYYA 1GCQA 1WFWA 2DL3A 1HSQA 2CSIA 2KRSA 1VA7A 1FYNA 2RNAA 1ZSGA 1ABQA 1UDLA 2FEIA 1JU5C 1WYXA 2FRYA 3C0CA 4HVUA 3M0PA 4GBQA 2F2VA 1X2QA 2EGEA 2DE0X
chains in the Genus database with same CATH superfamily
4PFPA 3VKIA 3UF4A 5GAN4 4XTZA 4EPCA 4F7UF 4NOYA 1VQNT 5IHKA 5J3BA 3ER0A 2DXCA 4N0AA 4GY5A 2BE7D 5GAMf 5GMKh 4F16A 3OYGA 1VQLQ 1QWEA 2DMOA 2X9HA 5LJ5h 4Z88A 1PHTA 4ZN1A 2XIDA 2RD1A 3CPWP 1R0CB 1PKTA 1VQMQ 5GANf 2FHDA 4ZNXA 2VGNA 3E9FA 3GOXA 2YRDA 3SEMA 1UTIA 3G71A 3OBWA 2FPFA 4YTLA 2L8DA 2LJ1A 4M7AE 4QQDA 2CT4A 4A4HA 1JEGA 4M7AD 2CZ6B 4X9DA 5KYYA 1NEBA 2X51A 3OMGA 2XHCA 4NL3A 4C92A 1LCKA 4M77F 3NTHA 2JS0A 3RIRA 1BI3A 3TEEA 5CKEA 5LJ3f 1IGQA 4DQ2A 3OYCA 4M78E 2EQJA 2KRNA 2XICA 4M78D 2A0FB 2CDTA 4EDUA 5KYYB 1GCPA 2K3YA 4LDVA 4LDUA 2DA9A 1O9SA 3LH0A 4KGVB 4JJCA 4QQ6A 3GBQA 2QAZA 4CRIA 1KJWA 4OMFB 2KQWA 1UUEA 4JJNK 1BCOA 2BKDN 5GMKe 1YIJQ 4A4FA 1YNZA 3M56A 1QCOA 3CCQQ 2A7YA 1VQ6Q 4Y92A 2K7AA 4E7KA 1OYXA 2K3XA 1W6XA 5C0MA 3H9NA 3MCAB 4JJBA 3HFNA 3FRNA 1J3TA 2MCNA 3GNFB 2E70A 3H6ZA 3G4SA 1KQ1A 2CP5A 1UJ0A 4CC3A 1IGUA 4RTTA 2A28A 2J6KA 2K5LA 1OZ2A 2YUOA 3HRSA 2DZCA 1ARKA 4R56A 1VUBA 4J9CA 4C8QC 1RI0A 1OZ3A 1QMCA 1UGVA 4RTXA 1YJWT 1MNEA 5GAMd 1M1KC 4JLGA 1ZUUA 5I21A 1BU1A 3JB9F 2LC4A 4BB7A 3OW2A 3NPFA 1AWOA 4MZMA 3QUIA 3M55A 5GANd 5J26A 2E6NA 1QVFP 7AT1B 3QWYA 4C5IA 1N9RA 2AZVA 5IN1A 3EG3A 3OA6A 3QXEB 1YHQQ 5LJ3h 1Q7YC 1VQNA 2YRVA 4CC4B 4MZPA 4DEXA 2KR3A 2RQRA 1VQ4A 4QKUA 4M75E 5IXFA 2RMOA 2ECZA 4M75D 3CMAA 1RI9A 4JS4A 3RMQA 2QGFB 5GAOr 2WSCE 2ED0A 4IUUA 2V1RA 4ZN3A 1O75A 1WI7A 2FZKB 4FL6A 3OYHA 1KQSP 5GAMe 4QT7A 2ZPFB 2OAUA 1SEMA 1OV3A 5FRNA 4IIOA 2QA4T 2EBPA 2GBQA 4J5YA 3OYYA 3RESA 1H3HA 1MNDA 1Q86C 2F69A 4R0KA 3VS2A 2BZ8A 1OQKA 5FWCA 1K8AU 3NTIA 3E19A 2FB7A 2O9VA 2QQSA 4LD9K 1SSFA 4N4IA 1NLPC 1Q86R 1JXOA 3LWIA 3VRZA 2COZA 4ZTJA 1UECA 3A8LB 2R57A 1GL5A 3DLMA 1G5VA 4N4GA 1K8AR 4M7DE 1WIEA 4M7DD 5ECAA 3IQLA 2M16A 3R6NA 1SRLA 2DTOA 5LJ3e 1B3QA 1M5Q1 4QQGA 2GQVA 4HA8A 1VQKT 5GMKi 3CCUA 3VS5A 2NLUA 3A8GB 3QIIA 5GAOn 3CD6T 3NHNA 4RCBA 3EHRA 3S6WA 4UC4A 1SKUB 2CS7A 2CP6A 4AFUC 5FU7C 2EWNA 4ZGJB 5CQXA 2ZPGB 3CCRT 2FG0A 3CCLA 2RJDA 3PVLA 1X01A 3FJ5A 4PFOA 1BCMA 4Y28E 2OX7A 5HY6A 3VYGA 3OW2S 2CP3A 4L5GA 2ROLA 1KQ2A 4F14A 4F7UE 4PKCC 5GAN8 3A5ZB 2MIOA 4BUGA 4ZGDB 2QI2A 1GCQC 2FVUA 4J6YA 4RTYA 1RAGB 3MP1A 2LVMA 4QW2A 1A0NB 2AHJB 4OGEA 1I81A 1YJWQ 2LCSA 3V8LA 2XMFA 3JCMW 3JB9I 3BFMA 1QWFA 1YI2A 1HXDA 3QKJA 4A63B 2QGGA 2DK3A 2AKLA 3RKWA 3SDZA 1KIKA 5CVIA 3CCST 2WSFE 4N0AC 3GLXA 3M54A 1QKXA 4FIBA 2HQEA 1T0JA 2HBWA 4P5NA 2LRQA 4X9CA 1GRIA 2M0YA 3KUFA 3JB9H 4E7LA 2V1QA 3I55Q 3FC3A 2LNVA 3RBBB 1R8OB 5I22A 4M77E 4XK8E 4HT9A 4M77D 4PJMA 3X25B 1PCXA 1N8RU 1KQSA 5GAN2 2QEXA 3H8ZA 5A2QE 2FL7A 2E64A 1SSHA 1YWPA 1G3TA 4BI4A 2H8HA 2KDSA 1RADB 2JOYA 4DA4A 4JDSA 1GFCA 3LGLA 3CPFA 2RJEA 5GMKj 1X6GA 1N8RR 4DBQA 3A8HB 3MO8A 4C92C 1YBYA 2NWMA 4RTWA 2E65A 3CCET 5HK3A 2QQ9A 1AD5A 1WXUA 3CQTA 3HTRA 4HCKA 4RTZA 3MP8A 3FJPA 1H8KA 3QBYA 4J8OA 3O5ZA 4A4EA 3QJ6A 1X27A 4O6JA 3OYKA 1OPLA 3M58A 3UDCA 5A0DA 2F1LA 1UGRB 3EG2A 4LNPA 2PTKA 1QLYA 2ABLA 3E9GA 1G8XA 4HXJA 6AT1B 4OMMA 1VQKA 1Y96A 2HL3A 2MMPA 2KXCA 2L3SA 3X26B 2DL3A 4C8QB 3JB9D 2KRSA 3CD6Q 4ZTFA 4TVRA 1FYNA 2RNAA 1C1AA 1VQOA 1PM3A 3RERA 1FWZA 3C4SA 1WYXA 3C0CA 3M0PA 4E47A 1X2QA 2DO3A 2EGEA 3CCRQ 1LPLA 3MHXA 5FU6C 1VIFA 2M02A 4ME7A 3J81E 1OEBA 2MK5A 4E7JA 1NEGA 1QVGS 2FRWA 3HSBA 1AT1B 2RM4A 2RB6A 2RH2A 3CCMA 5HK0A 4C5GA 1UGQB 1I5LA 2K57A 3X24B 5GJWB 5GAMj 4J83A 1WZOA 2KGTA 2GNCA 4IUPA 5CKDA 2WSEE 2LX7A 3GPLA 1WDXA 3JCMh 5IHNA 1BKBA 4D8DA 3P8HA 5GANj 3UT1A 3CCSA 2HL5C 1M1FA 3O8VA 4C8QG 2JM9A 4AFQC 2JMCA 1H3ZA 5EC7A 3QJYA 2COYA 1RAEB 1WNLA 1WGSA 4J9GA 5CKFA 3A8MB 4Z89A 2QQRA 2GTJA 2P84A 3G7ZA 1MUZA 2YXYA 4Y91A 3CEYA 3ME9A 4MDWA 3M57A 4C0GA 4PJOA 3S3MA 2CZ7B 2MOXA 3CCVA 2R58A 3FIFA 3CCQT 1W70A 4FW2A 1GBRA 3URGA 5IH2A 4JRQA 3DKMA 2R5AA 2HAXA 3VS1A 3RNJA 1K0XA 2E3IA 4QVDA 2P4TA 1BI0A 1M3BA 1I8FA 3QYHB 4PJOB 3CCJT 2JTFA 1VQ5T 1WHLA 2X35A 1TOVA 1YJNQ 1E6HA 1U1SA 4OP0A 5CCAA 4E7IA 1KD1U 3CCEQ 4C8QF 2DZ9A 2YLBA 2CGHA 1KD1C 4NS5A 2J06A 2P0QA 3GF5A 3MJXA 1VYUA 3OYAA 3OYFA 2OJ2A 4AFSC 4PLLA 4M78C 3WXMB 3JCMe 1FX7A 3H0HA 1LVKA 5FU7B 3VS6A 1KD1R 2B8AA 2PZ1A 3OW2P 3ZFJA 3HRUA 2QXFA 4IUQA 1S1NA 3VS4A 4ATOA 2J7IA 2XKOC 5FW9A 2CUBA 4ORZA 3CBPA 2YT6A 3M0TA 3LWHA 2JTEA 4N4HA 1VQLA 2ED1A 4XTXA 4PJOG 4LE9A 2PVOB 4Z02A 1Y0MA 4MMKA 1VQMA 2DYIA 2O31A 1RL2A 2NYSA 4XTWA 4X1VA 1AZEA 1M3CA 1WHMA 2E5KA 2EGAA 1ZBJA 1V1CA 2VXFA 1I07A 1VQ8Q 3OBYA 2DM1A 2FPEA 2D1XA 3M4GA 3MEWA 4RUGA 3BE3A 2CUDA 1RAHB 1ZX6A 3VYHB 1ZUKA 1OI1A 3QZ5B 2LTOA 1T3SA 2NUZA 5LJ5g 1AOJA 1XJWB 3JCMQ 4ELZC 5I11A 1UHCA 3EFSA 2M51A 3VJPA 3LW5E 3QDFA 1X69A 3L2QA 3L42A 2LNHB 3LLRA 3P8BB 2RHYA 4C92B 4HVWA 2KY9A 2Z0WA 4AG1C 1YIJA 4RTVA 3Q1JA 1SRMA 4OVAA 1VQ6A 3M0RA 4FYXB 5KYXA 1LNXA 4R55A 2CH4W 1W1FA 1Y57A 1X6BA 3L1AA 4JRIA 3L2VA 5CR2A 2HMAA 4VUBA 1PKSA 5CKHA 2Y4XA 2VKNA 1RABB 5GAMh 4OB1B 1E7OA 4DBHA 2PUOB 2L5QA 3CCJQ 1VQ5Q 3JV3A 4FT2A 5KYXB 1AWWA 5GANh 3P8DA 2EQIA 3CC4A 3TSZA 1JQQA 1NE8A 2EQKA 2LDMA 2A37A 2K5FA 4RKUE 5M9OA 1M3AA 3REAB 3RKYA 3SB2A 2D6FA 2FYKA 2YUNA 1BI2A 4JJDA 2Y4YA 2G6FX 2JT4A 1TXQA 5DM7R 3EGXA 4C92G 2XU8A 1OULA 2EYZA 2QG9B 3JRZA 3OYJA 3MP6A 1PD0A 2GTOA 4JRKA 1QVGP 1YHQA 5FU6B 1B07A 4LN2A 3S3NA 2DL7A 2RPNA 1MHNA 3OS2A 3CC7Q 2XI9A 3INZA 2DBMA 3I55T 4JS5A 3VS0A 4JUVA 3OSSC 4X34A 3EAEA 4PL6A 4ANJA 5I2SA 3OYDA 1P92A 3V7SA 2AK5A 5CO7A 2E4HA 1Y71A 3FB9A 4CC7A 4XU0A 2RHUA 3A98A 1EFNA 3NGPA 2E3HA 3L2WA 3META 2XDPA 1D3BA 2DJZA 5AT1B 4C92F 4EMKA 1DJ7B 8ATCB 2DD4A 3E1SA 2HDAA 3OYMA 1NYGA 1EZZB 5CKBA 2KEAA 5GANe 4LDXA 1F1BB 2KT8A 1X43A 2EIFA 1YJ9Q 4M7AA 2O88A 3PMTA 2X4XA 1D3BB 2J6FA 4J6WA 1K8AC 3OY9A 1AEYA 1TUCA 2J05A 1CKBA 5FLXE 3HFOA 4ESRA 2EGCA 4JZ3A 2QDLA 4PJOC 3SHWA 2L3RA 2GGRA 2MYSA 3C12A 2EYWA 1OPKA 2HSEB 4BACA 2NUTA 3TREA 2FZGB 4M7AB 1UHFA 4M78A 2DL5A 4J9EA 3VRYA 2EFIA 3CMET 5J39A 2I2LA 5A0LA 2DEUA 3OMCA 1UGPB 2HNIA 2X4JA 3CXCA 1ZA2B 1UB4A 3VS3A 2AZSA 2K4YA 3BW1A 1YCYA 1ZLMA 3T9NA 4OMQA 2KYBA 1FMKA 4M78B 1D0ZA 3RMSA 1K4US 1K73U 2LZ6B 2C0IA 5GAOq 2DTHA 5L23A 2HKNA 1HSQA 1X75C 4JLIA 3EFRA 4J7IA 3OB9A 3J7AF 1VQ9Q 1ZSGA 2FEIA 1JU5C 1YJWA 4FU6A 1YITQ 4GBQA 2KVQG 3M4YA 2DE0X 1K73R 1MMAA 2QQBA 4M7AG 1UFFA 1UE9A 2DL8A 5KYNA 1WJRA 1N6AA 1QVGA 2CP7A 2O9SA 1WQ7A 1S72T 2EW3A 2FZCB 4XTYA 1N5ZA 2CT3A 3V8KA 1BI1A 3I56T 3X20B 3M9QA 4C0DC 3I55A 1YWOA 1TU0B 2ZPEB 1D1BA 2F2WA 2L3PA 3EG1A 1V29B 2C0TA 2A3LA 1TUDA 5IAYA 4M78G 2KT1A 4A54A 2W0ZA 4JRPA 1ZHIA 2FPDA 2K2VA 2LCCA 4C5EA 2MAMA 1RAAB 3CBOA 1G2BA 5FWBA 1MMGA 4WTOB 1N8RC 1NJIU 5I2MA 1KK7A 2B86A 2DILA 4M75A 1OU9A 1OX9A 1TTHB 1Q81U 1QP3A 2QA4A 5HCKA 4AMCA 5GAOm 2ZPHB 2RQVA 2HEQA 3L2ZA 1YJNT 1K9AA 3OYIA 1NJIR 3CC2T 2DXTA 3SWNC 3THKA 3G1JA 4PK4A 3J80E 4M75B 1Q81R 1M2VA 4M4ZA 4E2FB 2OTJT 5KE2A 1C6VX 2DTIA 2SRCA 2OTLQ 1RACB 3CXCS 3I9QA 1XQHA 2HQXA 3G6ET 2E41A 1AHJB 1BK2A 1M2VB 2V8KA 1WJSA 1JXMA 1D09B 2RO0A 4M7DA 1ZQ1A 1JRIA 1D0YA 3I5SA 3CD6A 1SG5A 2BZYA 3CMEQ 3OQ5A 1FMVA 2PQWA 4F17A 2XDBA 3A1PA 2K5IA 2XK0A 3HPWA 3E2UA 3CCRA 2DERA 4Z8AA 5CK9A 3HL8A 3OS5A 2D8HA 2KROA 2BTTA 4M7DB 1Y96B 5D7UA 4M75G 2GFUA 2PNIA 4IUVA 4BD3A 1M9SA 2M1HA 3FDRA 1OOTA 2H3EB 1ZUYA 2CREA 2IPOB 1VQ8T 3ZEHA 3OS0A 1QVPA 1VOMA 1U06A 4PJLA 2E10A 1W2BS 4F7UA 3A8OB 2JZ2A 2K79A 2HCKA 1VQ7Q 2HQHA 4FW1A 3G71T 2KK4A 5KCHA 2ENMA 5KCOA 3EH2A 4KH0B 4KUDK 3TVTA 2RI3A 2JVVA 1S72Q 2HD0A 2IG0A 2RQUA 2VGMA 1AWJA 4JZ4A 4OB3B 1AWXA 3I56Q 3VS7A 4WCIA 5GAN7 4RMOA 1K9MU 1PD1A 3TQ7P 4FYWB 3I35A 1G3SA 4BE1A 2K3BA 2ZPIB 1M8MA 1ZSZC 4RTUA 4KGXB 4M7DG 4XU2A 1RAFB 2F2XA 2FO0A 2D9TA 2P0PA 1IO6A 2E1HA 4MMLA 4EMKC 2LJ3A 4DBFA 4M77A 4IURA 1H641 2DXUA 1K9MR 1IZ6A 1B34A 3EGUA 5LJ5f 2RA2A 3RKXA 2EJGA 1M2OA 1Q82U 1IXDA 4B9XA 3JCMg 5CQYA 4M7AC 1I5OB 1YJNA 4D6WA 4BDZA 1KC8U 3CCEA 2AIRB 3CCVQ 2LQKA 5CAIA 1QCFA 1HD3A 1V76A 1C0MA 2VVKA 4M77B 3CC2Q 1KSWA 1QKWA 1G3WA 2YWWA 1JJ2S 1Q82R 4O5VA 2QK0A 1M90U 2CKKA 2BE9B 1KC8R 2OTJQ 3G4ST 1KHIA 1VQPQ 2JNGA 2CZ0B 1PRMC 4LUDA 3JB9J 4DOWA 2DFUA 3QHSA 3PVQA 1U3OA 3G6EQ 2EAYA 3PE0A 3CC7T 4Q5WA 4J9BA 2DX1A 3N5BB 4L6V5 3GNGA 1M90R 5DLQE 1HJDA 4F04B 5A0GA 1GBQA 4RG2A 1RUWA 2F5TX 4HT8A 1G83A 4C0FA 4B9WA 4KT0E 2L3QA 2PVDB 1NBEB 1U5SA 4XU1A 2Y90A 4LD6A 1WXTA 4M77G 1PRLC 1PSEA 1BB9A 4L59A 4FSXA 1GFDA 2I0NA 2SEMA 3JCMJ 1PC0A 1FMWA 1VQ8A 2MWPA 5IXBA 1VQ4T 3KBGA 2DBKA 4OF1A 1M30A 4C0DB 1YP5A 3S3OA 2JW4A 3CMAT 1TUGB 4ELYC 2RHZA 3F70A 3KFVA 1IHVA 1WPYA 3I5RA 2YUPA 1MV3A 1YJ9T 3BDLA 2KYMA 4XQ3A 1Y07A 1ACMB 1BBZA 1YFNA 4WF2A 4XU3A 4FCYA 1T0HA 1BYMA 2YUQA 3FLGA 5LJ5d 3G71Q 2G3RA 2D0NA 3REBB 3TU4K 2DL4A 4PJOF 3SWNA 4EMGA 5IHIA 3EFOA 5DLOA 3UATA 3FEOA 3LX7A 1WA7A 2M9UA 2RHIA 5GMKm 2D8JA 1TSFA 1N9SA 4II1A 4M75C 1K76A 3DB4A 1JO8A 3OSVA 2GQIA 4FT4A 2LT4A 3EG0A 2HKQB 3CCQA 1IB8A 3SWNB 2LX9A 4A53A 1TS9A 3EFOB 4OMPA 2YLCA 4J9HA 2E5QA 2KNBB 2VV5A 4LDYA 3CXCP 2IVWA 3JB9G 4DOVA 2QYZA 3QWXX 3CCUT 3CCJA 1VQ5A 4KRTA 3PGGA 1NPRA 4J6XA 4A4GA 4IIMA 4FYYB 1Q95G 1VQ9T 1ABOA 4LXCA 5LJ5e 4EIKA 1IRXA 4PLIA 2EQUA 3HP9A 1YITT 4BE0A 2VB6A 3MEAA 3QO3A 4J9FA 4E7HA 3PIPA 2PVGB 2K9GA 4E6RA 3CCLT 1XOVA 2C06A 3AHUA 3EGDA 2YHTA 1AVZC 1HYOA 2RJFA 4OB0B 2NUPA 4QVCA 3G4SQ 1D1AA 2CSIA 4M7DC 3OYEA 3VU3C 1M1KU 2DXBA 1ABQA 1UDLA 2LCLA 2MPXC 3GP8A 2DKGA 4HVUA 2F2VA 3CC4Q 3CC7A 3OYNA 4BE2A 5GAMg 2EJFA 3PIOA 5IT9E 3EGDB 4J9DA 2DRMA 3SFMA 2NUPB 3OYBA 1VIEA 2O2OA 1W2BP 3U23A 3EGXB 1YI2T 1M1KR 1TWBA 1LOJA 4HCBA 1OU8A 2KMTA 3EH1A 2J6OA 5GANg 2JN0A 2O4XA 1SHFA 3QDRB 1X2KA 1ZBXA 1Q7YU 2L2PA 3JCMV 3R6OA 1OX8A 2EYQA 4IKFA 1ZSZA 4XAXB 4PFZA 2DF6A 5L8RE 2V8JA 3WVDB 1UGSB 2VC8A 3H0IA 1VQNQ 1TG0A 1QP2A 3CPWA 4OMNA 3HKSA 1Q7YR 1VQ4Q 1NLOC 5GAN6 2O4XB 2DJQA 2CSQA 5LJ3d 3CMAQ 2QEXT 4AG2C 2AT1B 1YJ9A 2RI5A 5LJ3g 1ZSZB 3JAME 3C95A 1WHHA 3JCMc 3GIBA 4HCZA 3HRTA 4CI0C 1PWTA 3M59A 4BI3A 1Q86U 2OTLT 4PJJA 4EMKB 3OYLA 3NMZC 3EHQA 1M4ZA 1KFZA 4A4KA 2QQAA 5D6YA 1EX4A 2CYZB 3PTAA 4C8QE 3MEVA 1M8VA 4C8QD 2O01E 2K2MA 4M77C 4BI8B 1E6GA 4MZTA 1XTDA 4AT1B 3V7RA 1D1CA 3MPUB 2DETA 2EKOA 2COWA 4C0ZA 2HSPA 1NYFA 1JJ2P 2AKKA 2GF7A 3KXTA 4KBMB 1K1ZA 2MF2A 2V8IA 3UA6A 2RF0A 2DIGA 1EIFA 3LGFA 5DY9A 2KSSA 2NUTB 3L2UA 2RK2A 4BY6B 1G3YA 1NM7A 5EG2A 2ZZDA 5D6XA 3LYIA 4EMHA 3CCUQ 1VQ9A 3LH5A 1K73C 1NPPA 3CBMA 1YITA 1VQOT 2HBPA 2PUKB 2M0OA 5GAOl 1QCNA 5CIUA 3M0SA 4XTUA 1VQ7T 3CCLQ 1CKAA 3QPHA 1U1TA 2IIMA 2LT1A 2YSQA 2RK1A 4CC2A 3M53A 2MI6A 3CCMT 2ZCFB 4HCCA 2RQWA 3V7CA 2QASA 1RLQC 4B6MA 5KE3A 2DD5A 1LJOA 1NG2A 4HVVA 1W2BA 2DEQA 3MKDA 1WHKA 1PNJA 5HKCA 1QVFA 4K11A 1PG5B 2DRKA 2LJ0A 1VYVA 4FSSA 1AZGB 3CPWS 2X4YA 1JBMA 4PJNA 1YI2Q 1GXIE 1I0CA 3MEUA 4PJOE 3PT9A 2JS2A 4KULA 4PJOD 2MWOA 3HHTB 2VWFA 1ZA1B 3V8JA 2JM8A 1IHWA 4E7ZA 1YN8A 1NJIC 1QQJA 3TCJA 4M7AF 1VYTA 1MGQA 1WQWA 1Q81C 3CCVT 3TSWA 2DLPA 2YRCA 1UEBA 3AT1B 2QDYB 1Z9ZA 2QEXQ 2LQ8A 3OS1A 2ZAEA 4OMLA 2X3XD 3RDVA 3SD4A 1NZ9A 2X4WA 3UPUA 2OTLA 2QA4Q 1VQPT 4RG8A 2R5MA 4M78F 1KHCA 2OI3A 5LJ5j 3L2RA 4KGZB 3UA7A 3QYGB 3JCMf 3JCMb 1B7TA 3NTKA 1HK9A 2KRMA 2KAFA 4HKEA 1XNIA 4J7FA 5FROA 2CP0A 4PNOA 1JJ2A 1H92A 1JB0E 3CMEA 1MV0B 4BDYA 4C8QA 5GAN5 2L89A 3RUXA 3PFSA 2ATCB 4ZGEB 1K0SA 1T3LA 2DVJA 2CZ1B 2A08A 4AFZC 2DIQA 1PSFA 2EYXA 1CSKA 1RAIB 4E7SA 1WX6A 4DEYA 3ULRB 1UG1A 1M27C 4LUEA 4KUIA 2W10A 1WLPB 1VQKQ 2CH4A 2KBTA 3VV0A 2BZXA 1VQLT 2X3WD 3ASKA 3QG1A 2RHXA 2GFAA 1I4K1 1SF9A 1WHGA 1WXBA 2EQMA 2RQTA 4LDWA 1VQOQ 3ZL7C 3D7SB 4MDXA 1SHGA 1VQMT 2ZGWA 1BIAA 1SPKA 1VQ7A 2DPPB 2EJ9A 1I1JA 3H41A 1QVFS 2ESWA 4RCCA 1R77A 2PU9B 4OGCA 4XTVA 4GLKA 5D6WA 2LMJA 1S72A 2RJCA 4C92E 3M0UA 3CCMQ 4JPBW 4FYVB 2VXEA 2XD0A 2KXDA 4C92D 3I56A 4D8KA 1QW1A 2JMAA 3JCMP 4F7UB 1UJYA 1Y7XA 3X28B 2ZPBB 3EG9A 1WHJA 2LQNA 5GAOp 4M75F 2DAQA 4DBRA 4GLMA 3M0QA 4OMOA 1K9MC 2K6DA 2RN8A 3RR6A 2JXBA 1KQSS 2OAWA 4FM4B 3NFCA 3CCSQ 1Z9QA 3VUZA 2BIVA 2H3JA 2P4RA 2VUBA 1N27A 2KI7A 3PMIA 2WACA 4IUTA 2QTXA 3EG9B 2EKHA 1IREB 3JCMd 2VASA 2YDLA 3DLLA 5KYUA 2EVRA 4KH1B 2VYTA 2XDDA 2RI2A 2P0KA 1R0BG 1YIJT 2JTMA 3UWNA 2E12A 2JJ9A 2CP2A 2D0QB 4NL2A 1Q82C 1YCSB 3JSCA 3BDUA 1VQ6T 2ROTA 3CC2A 9ATCB 2XG8D 5LJ3j 1KC8C 3PNWC 1KG1A 1W4SA 3H0FA 2LQWA 8AT1B 1B34B 2KE9A 5GJVB 3DB3A 1MMDA 2DYBA 2OTJA 4J9IA 3C94A 2HZYA 5KYUB 4F7UG 1VQPA 2EPDA 1M1GA 2LP5A 2BUDA 4M7DF 3QZ9B 2QTVA 4BY6C 5KYWA 3WVEB 3JCMX 1M90C 1FXXA 2DNUA 3G6EA 2A36A 1X6OA 1TH7A 1D0XA 1U8RA 5AYFA 3CC4T 4C5HA 1WJQA 1RLPC 5KH6A 2L0AA 2C0OA 2GCXA 4V2SA 2F5KA 3VUBA 2EYYA 4OB2B 1BIBA 1GCQA 5C6SA 1WFWA 5FRMA 1VA7A 5KYWB 5GAN3 4QVZA 2DVEA 3BY7A 5GMKl 2E6ZA 2FRYA 3ZBDA 2JUFA 1MMNA 1YHQT 2V26A 5LL6S 3QSUA 3M5AA
chains in the Genus database with same CATH topology
3UF4A 1OEBA 4J9DA 2DRMA 1UFFA 1UE9A 5IHKA 1NEGA 2DL8A 2FRWA 2O2OA 3U23A 4F16A 2O9SA 1QWEA 2DMOA 2J6OA 4Z88A 2EW3A 1SHFA 1X2KA 1PHTA 1N5ZA 2CT3A 2L2PA 5GJWB 1PKTA 1YWOA 2F2WA 2L3PA 2KGTA 2GNCA 3EG1A 4ZNXA 2DF6A 3SEMA 2C0TA 2LX7A 1TUDA 1UTIA 3H0IA 1WDXA 2KT1A 5IHNA 2FPFA 1TG0A 2W0ZA 2FPDA 4D8DA 4OMNA 2LJ1A 2CT4A 1NLOC 1JEGA 2JM9A 4AFQC 1G2BA 2DJQA 2CSQA 2JMCA 5EC7A 5FWBA 1NEBA 4J9GA 4AG2C 2B86A 4Z89A 2DILA 2GTJA 1MUZA 1LCKA 2JS0A 5HCKA 1PWTA 2RQVA 2HEQA 3NMZC 2MOXA 3EHQA 1W70A 1K9AA 1GBRA 2KRNA 5IH2A 1KFZA 2CDTA 1GCPA 3THKA 3VS1A 3RNJA 1K0XA 2DA9A 4M4ZA 2K2MA 4JJCA 1E6GA 1M3BA 3GBQA 1KJWA 2SRCA 1UUEA 2HSPA 1NYFA 2AKKA 1E6HA 1YNZA 1K1ZA 3I9QA 3UA6A 4Y92A 2K7AA 2RF0A 1W6XA 4JJBA 1BK2A 2J06A 1J3TA 1VYUA 2OJ2A 1JXMA 2MCNA 4AFSC 1NM7A 3I5SA 1UJ0A 4CC3A 2BZYA 4RTTA 2A28A 4F17A 2J6KA 3H0HA 3VS6A 2YUOA 3LH5A 1ARKA 2PZ1A 4J9CA 1S1NA 3VS4A 1UGVA 4RTXA 4Z8AA 2J7IA 3M0SA 5FW9A 2CUBA 1ZUUA 2D8HA 2KROA 1BU1A 2BTTA 4ORZA 1CKAA 2IIMA 2YT6A 2PNIA 3M0TA 3NPFA 1AWOA 2JTEA 1OOTA 2ED1A 2YSQA 4CC2A 1ZUYA 2CREA 4LE9A 2RQWA 1RLQC 1Y0MA 1U06A 3QWYA 2AZVA 2O31A 3EG3A 1NG2A 4HVVA 2K79A 4X1VA 1AZEA 1M3CA 2HCKA 2E5KA 2EGAA 1PNJA 1ZBJA 4CC4B 4K11A 2DRKA 2LJ0A 4DEXA 1V1CA 1VYVA 4FSSA 1AZGB 2KR3A 2ENMA 2RQRA 1I07A 3TVTA 5IXFA 2RMOA 2ECZA 1I0CA 1RI9A 2DM1A 2RQUA 2FPEA 1AWJA 2D1XA 4JZ4A 1AWXA 4RUGA 2JS2A 2ED0A 3VS7A 2CUDA 4WCIA 2V1RA 2VWFA 1WI7A 1ZX6A 2JM8A 4QT7A 3I35A 1YN8A 1ZUKA 2K3BA 1SEMA 1OV3A 1M8MA 4IIOA 4RTUA 2EBPA 2GBQA 1VYTA 1T3SA 2NUZA 1H3HA 2F2XA 2FO0A 3TSWA 1AOJA 1IO6A 2DLPA 3VS2A 4R0KA 5I11A 2BZ8A 2LJ3A 1UHCA 5FWCA 2M51A 1Z9ZA 1X69A 2O9VA 3EGUA 4OMLA 2LNHB 1NLPC 4HVWA 2X3XD 4AG1C 1JXOA 3VRZA 4RTVA 1UECA 1SRMA 2OI3A 3M0RA 3UA7A 1GL5A 1QCFA 1HD3A 2VVKA 1WIEA 2CH4W 1W1FA 1Y57A 3IQLA 1X6BA 1KSWA 1QKWA 2KRMA 5ECAA 3R6NA 1SRLA 1B3QA 1PKSA 2VKNA 1H92A 3VS5A 1MV0B 3NHNA 1E7OA 1PRMC 3EHRA 4LUDA 3JV3A 1AWWA 4AFUC 2EQIA 3PVQA 3TSZA 1JQQA 1T3LA 1U3OA 2DVJA 1K0SA 2A08A 2A37A 4AFZC 3PE0A 1M3AA 2EYXA 2FG0A 1CSKA 3REAB 1WX6A 4DEYA 3ULRB 1UG1A 3PVLA 4J9BA 2DX1A 3FJ5A 1M27C 4LUEA 2W10A 1WLPB 1HJDA 2YUNA 2CH4A 2KBTA 4JJDA 1GBQA 2G6FX 2JT4A 2ROLA 1RUWA 2BZXA 4F14A 2X3WD 2MIOA 1G83A 1WXBA 2EYZA 1GCQC 4RTYA 2RQTA 2GTOA 3ZL7C 1SHGA 2L3QA 1B07A 4LN2A 1A0NB 2DL7A 1U5SA 2LCSA 2RPNA 1SPKA 1WXTA 2XMFA 1PRLC 2DBMA 1BB9A 1I1JA 3VS0A 3H41A 2ESWA 1GFDA 1QWFA 2I0NA 2SEMA 2LMJA 4A63B 2AK5A 5IXBA 2AKLA 2DBKA 1M30A 4CC7A 1KIKA 1YP5A 3M0UA 2JW4A 4JPBW 1QKXA 2KXDA 4D8KA 1T0JA 2HBWA 3A98A 1EFNA 3KFVA 1GRIA 3NGPA 2JMAA 2M0YA 3I5RA 2YUPA 1MV3A 1UJYA 2V1QA 2KYMA 2LQNA 3RBBB 1BBZA 5I22A 4GLMA 3M0QA 1T0HA 4OMOA 2K6DA 2YUQA 2RN8A 2D0NA 3REBB 2HDAA 2DL4A 2JXBA 1NYGA 2KEAA 2OAWA 5IHIA 1Z9QA 2P4RA 2KT8A 3UATA 1SSHA 1X43A 1YWPA 1WA7A 2O88A 2H8HA 2EKHA 2J6FA 2D8JA 2YDLA 2EVRA 1GFCA 1X6GA 1AEYA 1K76A 1TUCA 1JO8A 2J05A 1CKBA 2GQIA 2NWMA 4RTWA 4ESRA 3EG0A 2EGCA 4JZ3A 2QDLA 1YCSB 1AD5A 1WXUA 2ROTA 3SHWA 2GGRA 3CQTA 4OMPA 4HCKA 4J9HA 3H0FA 2EYWA 1OPKA 2KNBB 2LQWA 4RTZA 1H8KA 2KE9A 5GJVB 1UHFA 2DL5A 2DYBA 4J9IA 4J9EA 3VRYA 3O5ZA 3QWXX 2EPDA 1X27A 2LP5A 4KRTA 1OPLA 4IIMA 1ABOA 2DNUA 4EIKA 2A36A 3VS3A 3EG2A 4LNPA 2AZSA 2PTKA 1QLYA 2ABLA 1RLPC 1ZLMA 4J9FA 4HXJA 2L0AA 4OMQA 2KYBA 2K9GA 2C0OA 1FMKA 4E6RA 4OMMA 1XOVA 2KXCA 1K4US 2L3SA 2LZ6B 1AVZC 2C0IA 5L23A 2EYYA 1GCQA 1WFWA 2DL3A 1HSQA 2CSIA 2KRSA 1VA7A 1FYNA 2RNAA 1ZSGA 1ABQA 1UDLA 2FEIA 1JU5C 1WYXA 2FRYA 3C0CA 4HVUA 3M0PA 4GBQA 2F2VA 1X2QA 2EGEA 2DE0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UF4 A;  1OEB A;  4J9D A;  2DRM A;  1UFF A;  1UE9 A;  5IHK A;  1NEG A;  2DL8 A;  2FRW A;  2O2O A;  3U23 A;  4F16 A;  2O9S A;  1QWE A;  2DMO A;  2J6O A;  4Z88 A;  2EW3 A;  1SHF A;  1X2K A;  1PHT A;  1N5Z A;  2CT3 A;  2L2P A;  5GJW B;  1PKT A;  1YWO A;  2F2W A;  2L3P A;  2KGT A;  2GNC A;  3EG1 A;  4ZNX A;  2DF6 A;  3SEM A;  2C0T A;  2LX7 A;  1TUD A;  1UTI A;  3H0I A;  1WDX A;  2KT1 A;  5IHN A;  2FPF A;  1TG0 A;  2W0Z A;  2FPD A;  4D8D A;  4OMN A;  2LJ1 A;  2CT4 A;  1NLO C;  1JEG A;  2JM9 A;  4AFQ C;  1G2B A;  2DJQ A;  2CSQ A;  2JMC A;  5EC7 A;  5FWB A;  1NEB A;  4J9G A;  4AG2 C;  2B86 A;  4Z89 A;  2DIL A;  2GTJ A;  1MUZ A;  1LCK A;  2JS0 A;  5HCK A;  1PWT A;  2RQV A;  2HEQ A;  3NMZ C;  2MOX A;  3EHQ A;  1W70 A;  1K9A A;  1GBR A;  2KRN A;  5IH2 A;  1KFZ A;  2CDT A;  1GCP A;  3THK A;  3VS1 A;  3RNJ A;  1K0X A;  2DA9 A;  4M4Z A;  2K2M A;  4JJC A;  1E6G A;  1M3B A;  3GBQ A;  1KJW A;  2SRC A;  1UUE A;  2HSP A;  1NYF A;  2AKK A;  1E6H A;  1YNZ A;  1K1Z A;  3I9Q A;  3UA6 A;  4Y92 A;  2K7A A;  2RF0 A;  1W6X A;  4JJB A;  1BK2 A;  2J06 A;  1J3T A;  1VYU A;  2OJ2 A;  1JXM A;  2MCN A;  4AFS C;  1NM7 A;  3I5S A;  1UJ0 A;  4CC3 A;  2BZY A;  4RTT A;  2A28 A;  4F17 A;  2J6K A;  3H0H A;  3VS6 A;  2YUO A;  3LH5 A;  1ARK A;  2PZ1 A;  4J9C A;  1S1N A;  3VS4 A;  1UGV A;  4RTX A;  4Z8A A;  2J7I A;  3M0S A;  5FW9 A;  2CUB A;  1ZUU A;  2D8H A;  2KRO A;  1BU1 A;  2BTT A;  4ORZ A;  1CKA A;  2IIM A;  2YT6 A;  2PNI A;  3M0T A;  3NPF A;  1AWO A;  2JTE A;  1OOT A;  2ED1 A;  2YSQ A;  4CC2 A;  1ZUY A;  2CRE A;  4LE9 A;  2RQW A;  1RLQ C;  1Y0M A;  1U06 A;  3QWY A;  2AZV A;  2O31 A;  3EG3 A;  1NG2 A;  4HVV A;  2K79 A;  4X1V A;  1AZE A;  1M3C A;  2HCK A;  2E5K A;  2EGA A;  1PNJ A;  1ZBJ A;  4CC4 B;  4K11 A;  2DRK A;  2LJ0 A;  4DEX A;  1V1C A;  1VYV A;  4FSS A;  1AZG B;  2KR3 A;  2ENM A;  2RQR A;  1I07 A;  3TVT A;  5IXF A;  2RMO A;  2ECZ A;  1I0C A;  1RI9 A;  2DM1 A;  2RQU A;  2FPE A;  1AWJ A;  2D1X A;  4JZ4 A;  1AWX A;  4RUG A;  2JS2 A;  2ED0 A;  3VS7 A;  2CUD A;  4WCI A;  2V1R A;  2VWF A;  1WI7 A;  1ZX6 A;  2JM8 A;  4QT7 A;  3I35 A;  1YN8 A;  1ZUK A;  2K3B A;  1SEM A;  1OV3 A;  1M8M A;  4IIO A;  4RTU A;  2EBP A;  2GBQ A;  1VYT A;  1T3S A;  2NUZ A;  1H3H A;  2F2X A;  2FO0 A;  3TSW A;  1AOJ A;  1IO6 A;  2DLP A;  3VS2 A;  4R0K A;  5I11 A;  2BZ8 A;  2LJ3 A;  1UHC A;  5FWC A;  2M51 A;  1Z9Z A;  1X69 A;  2O9V A;  3EGU A;  4OML A;  2LNH B;  1NLP C;  4HVW A;  2X3X D;  4AG1 C;  1JXO A;  3VRZ A;  4RTV A;  1UEC A;  1SRM A;  2OI3 A;  3M0R A;  3UA7 A;  1GL5 A;  1QCF A;  1HD3 A;  2VVK A;  1WIE A;  2CH4 W;  1W1F A;  1Y57 A;  3IQL A;  1X6B A;  1KSW A;  1QKW A;  2KRM A;  5ECA A;  3R6N A;  1SRL A;  1B3Q A;  1PKS A;  2VKN A;  1H92 A;  3VS5 A;  1MV0 B;  3NHN A;  1E7O A;  1PRM C;  3EHR A;  4LUD A;  3JV3 A;  1AWW A;  4AFU C;  2EQI A;  3PVQ A;  3TSZ A;  1JQQ A;  1T3L A;  1U3O A;  2DVJ A;  1K0S A;  2A08 A;  2A37 A;  4AFZ C;  3PE0 A;  1M3A A;  2EYX A;  2FG0 A;  1CSK A;  3REA B;  1WX6 A;  4DEY A;  3ULR B;  1UG1 A;  3PVL A;  4J9B A;  2DX1 A;  3FJ5 A;  1M27 C;  4LUE A;  2W10 A;  1WLP B;  1HJD A;  2YUN A;  2CH4 A;  2KBT A;  4JJD A;  1GBQ A;  2G6F X;  2JT4 A;  2ROL A;  1RUW A;  2BZX A;  4F14 A;  2X3W D;  2MIO A;  1G83 A;  1WXB A;  2EYZ A;  1GCQ C;  4RTY A;  2RQT A;  2GTO A;  3ZL7 C;  1SHG A;  2L3Q A;  1B07 A;  4LN2 A;  1A0N B;  2DL7 A;  1U5S A;  2LCS A;  2RPN A;  1SPK A;  1WXT A;  2XMF A;  1PRL C;  2DBM A;  1BB9 A;  1I1J A;  3VS0 A;  3H41 A;  2ESW A;  1GFD A;  1QWF A;  2I0N A;  2SEM A;  2LMJ A;  4A63 B;  2AK5 A;  5IXB A;  2AKL A;  2DBK A;  1M30 A;  4CC7 A;  1KIK A;  1YP5 A;  3M0U A;  2JW4 A;  4JPB W;  1QKX A;  2KXD A;  4D8K A;  1T0J A;  2HBW A;  3A98 A;  1EFN A;  3KFV A;  1GRI A;  3NGP A;  2JMA A;  2M0Y A;  3I5R A;  2YUP A;  1MV3 A;  1UJY A;  2V1Q A;  2KYM A;  2LQN A;  3RBB B;  1BBZ A;  5I22 A;  4GLM A;  3M0Q A;  1T0H A;  4OMO A;  2K6D A;  2YUQ A;  2RN8 A;  2D0N A;  3REB B;  2HDA A;  2DL4 A;  2JXB A;  1NYG A;  2KEA A;  2OAW A;  5IHI A;  1Z9Q A;  2P4R A;  2KT8 A;  3UAT A;  1SSH A;  1X43 A;  1YWP A;  1WA7 A;  2O88 A;  2H8H A;  2EKH A;  2J6F A;  2D8J A;  2YDL A;  2EVR A;  1GFC A;  1X6G A;  1AEY A;  1K76 A;  1TUC A;  1JO8 A;  2J05 A;  1CKB A;  2GQI A;  2NWM A;  4RTW A;  4ESR A;  3EG0 A;  2EGC A;  4JZ3 A;  2QDL A;  1YCS B;  1AD5 A;  1WXU A;  2ROT A;  3SHW A;  2GGR A;  3CQT A;  4OMP A;  4HCK A;  4J9H A;  3H0F A;  2EYW A;  1OPK A;  2KNB B;  2LQW A;  4RTZ A;  1H8K A;  2KE9 A;  5GJV B;  1UHF A;  2DL5 A;  2DYB A;  4J9I A;  4J9E A;  3VRY A;  3O5Z A;  3QWX X;  2EPD A;  1X27 A;  2LP5 A;  4KRT A;  1OPL A;  4IIM A;  1ABO A;  2DNU A;  4EIK A;  2A36 A;  3VS3 A;  3EG2 A;  4LNP A;  2AZS A;  2PTK A;  1QLY A;  2ABL A;  1RLP C;  1ZLM A;  4J9F A;  4HXJ A;  2L0A A;  4OMQ A;  2KYB A;  2K9G A;  2C0O A;  1FMK A;  4E6R A;  4OMM A;  1XOV A;  2KXC A;  1K4U S;  2L3S A;  2LZ6 B;  1AVZ C;  2C0I A;  5L23 A;  2EYY A;  1GCQ A;  1WFW A;  2DL3 A;  1HSQ A;  2CSI A;  2KRS A;  1VA7 A;  1FYN A;  2RNA A;  1ZSG A;  1ABQ A;  1UDL A;  2FEI A;  1JU5 C;  1WYX A;  2FRY A;  3C0C A;  4HVU A;  3M0P A;  4GBQ A;  2F2V A;  1X2Q A;  2EGE A;  2DE0 X; 
#chains in the Genus database with same CATH topology
 4PFP A;  3VKI A;  3UF4 A;  5GAN 4;  4XTZ A;  4EPC A;  4F7U F;  4NOY A;  1VQN T;  5IHK A;  5J3B A;  3ER0 A;  2DXC A;  4N0A A;  4GY5 A;  2BE7 D;  5GAM f;  5GMK h;  4F16 A;  3OYG A;  1VQL Q;  1QWE A;  2DMO A;  2X9H A;  5LJ5 h;  4Z88 A;  1PHT A;  4ZN1 A;  2XID A;  2RD1 A;  3CPW P;  1R0C B;  1PKT A;  1VQM Q;  5GAN f;  2FHD A;  4ZNX A;  2VGN A;  3E9F A;  3GOX A;  2YRD A;  3SEM A;  1UTI A;  3G71 A;  3OBW A;  2FPF A;  4YTL A;  2L8D A;  2LJ1 A;  4M7A E;  4QQD A;  2CT4 A;  4A4H A;  1JEG A;  4M7A D;  2CZ6 B;  4X9D A;  5KYY A;  1NEB A;  2X51 A;  3OMG A;  2XHC A;  4NL3 A;  4C92 A;  1LCK A;  4M77 F;  3NTH A;  2JS0 A;  3RIR A;  1BI3 A;  3TEE A;  5CKE A;  5LJ3 f;  1IGQ A;  4DQ2 A;  3OYC A;  4M78 E;  2EQJ A;  2KRN A;  2XIC A;  4M78 D;  2A0F B;  2CDT A;  4EDU A;  5KYY B;  1GCP A;  2K3Y A;  4LDV A;  4LDU A;  2DA9 A;  1O9S A;  3LH0 A;  4KGV B;  4JJC A;  4QQ6 A;  3GBQ A;  2QAZ A;  4CRI A;  1KJW A;  4OMF B;  2KQW A;  1UUE A;  4JJN K;  1BCO A;  2BKD N;  5GMK e;  1YIJ Q;  4A4F A;  1YNZ A;  3M56 A;  1QCO A;  3CCQ Q;  2A7Y A;  1VQ6 Q;  4Y92 A;  2K7A A;  4E7K A;  1OYX A;  2K3X A;  1W6X A;  5C0M A;  3H9N A;  3MCA B;  4JJB A;  3HFN A;  3FRN A;  1J3T A;  2MCN A;  3GNF B;  2E70 A;  3H6Z A;  3G4S A;  1KQ1 A;  2CP5 A;  1UJ0 A;  4CC3 A;  1IGU A;  4RTT A;  2A28 A;  2J6K A;  2K5L A;  1OZ2 A;  2YUO A;  3HRS A;  2DZC A;  1ARK A;  4R56 A;  1VUB A;  4J9C A;  4C8Q C;  1RI0 A;  1OZ3 A;  1QMC A;  1UGV A;  4RTX A;  1YJW T;  1MNE A;  5GAM d;  1M1K C;  4JLG A;  1ZUU A;  5I21 A;  1BU1 A;  3JB9 F;  2LC4 A;  4BB7 A;  3OW2 A;  3NPF A;  1AWO A;  4MZM A;  3QUI A;  3M55 A;  5GAN d;  5J26 A;  2E6N A;  1QVF P;  7AT1 B;  3QWY A;  4C5I A;  1N9R A;  2AZV A;  5IN1 A;  3EG3 A;  3OA6 A;  3QXE B;  1YHQ Q;  5LJ3 h;  1Q7Y C;  1VQN A;  2YRV A;  4CC4 B;  4MZP A;  4DEX A;  2KR3 A;  2RQR A;  1VQ4 A;  4QKU A;  4M75 E;  5IXF A;  2RMO A;  2ECZ A;  4M75 D;  3CMA A;  1RI9 A;  4JS4 A;  3RMQ A;  2QGF B;  5GAO r;  2WSC E;  2ED0 A;  4IUU A;  2V1R A;  4ZN3 A;  1O75 A;  1WI7 A;  2FZK B;  4FL6 A;  3OYH A;  1KQS P;  5GAM e;  4QT7 A;  2ZPF B;  2OAU A;  1SEM A;  1OV3 A;  5FRN A;  4IIO A;  2QA4 T;  2EBP A;  2GBQ A;  4J5Y A;  3OYY A;  3RES A;  1H3H A;  1MND A;  1Q86 C;  2F69 A;  4R0K A;  3VS2 A;  2BZ8 A;  1OQK A;  5FWC A;  1K8A U;  3NTI A;  3E19 A;  2FB7 A;  2O9V A;  2QQS A;  4LD9 K;  1SSF A;  4N4I A;  1NLP C;  1Q86 R;  1JXO A;  3LWI A;  3VRZ A;  2COZ A;  4ZTJ A;  1UEC A;  3A8L B;  2R57 A;  1GL5 A;  3DLM A;  1G5V A;  4N4G A;  1K8A R;  4M7D E;  1WIE A;  4M7D D;  5ECA A;  3IQL A;  2M16 A;  3R6N A;  1SRL A;  2DTO A;  5LJ3 e;  1B3Q A;  1M5Q 1;  4QQG A;  2GQV A;  4HA8 A;  1VQK T;  5GMK i;  3CCU A;  3VS5 A;  2NLU A;  3A8G B;  3QII A;  5GAO n;  3CD6 T;  3NHN A;  4RCB A;  3EHR A;  3S6W A;  4UC4 A;  1SKU B;  2CS7 A;  2CP6 A;  4AFU C;  5FU7 C;  2EWN A;  4ZGJ B;  5CQX A;  2ZPG B;  3CCR T;  2FG0 A;  3CCL A;  2RJD A;  3PVL A;  1X01 A;  3FJ5 A;  4PFO A;  1BCM A;  4Y28 E;  2OX7 A;  5HY6 A;  3VYG A;  3OW2 S;  2CP3 A;  4L5G A;  2ROL A;  1KQ2 A;  4F14 A;  4F7U E;  4PKC C;  5GAN 8;  3A5Z B;  2MIO A;  4BUG A;  4ZGD B;  2QI2 A;  1GCQ C;  2FVU A;  4J6Y A;  4RTY A;  1RAG B;  3MP1 A;  2LVM A;  4QW2 A;  1A0N B;  2AHJ B;  4OGE A;  1I81 A;  1YJW Q;  2LCS A;  3V8L A;  2XMF A;  3JCM W;  3JB9 I;  3BFM A;  1QWF A;  1YI2 A;  1HXD A;  3QKJ A;  4A63 B;  2QGG A;  2DK3 A;  2AKL A;  3RKW A;  3SDZ A;  1KIK A;  5CVI A;  3CCS T;  2WSF E;  4N0A C;  3GLX A;  3M54 A;  1QKX A;  4FIB A;  2HQE A;  1T0J A;  2HBW A;  4P5N A;  2LRQ A;  4X9C A;  1GRI A;  2M0Y A;  3KUF A;  3JB9 H;  4E7L A;  2V1Q A;  3I55 Q;  3FC3 A;  2LNV A;  3RBB B;  1R8O B;  5I22 A;  4M77 E;  4XK8 E;  4HT9 A;  4M77 D;  4PJM A;  3X25 B;  1PCX A;  1N8R U;  1KQS A;  5GAN 2;  2QEX A;  3H8Z A;  5A2Q E;  2FL7 A;  2E64 A;  1SSH A;  1YWP A;  1G3T A;  4BI4 A;  2H8H A;  2KDS A;  1RAD B;  2JOY A;  4DA4 A;  4JDS A;  1GFC A;  3LGL A;  3CPF A;  2RJE A;  5GMK j;  1X6G A;  1N8R R;  4DBQ A;  3A8H B;  3MO8 A;  4C92 C;  1YBY A;  2NWM A;  4RTW A;  2E65 A;  3CCE T;  5HK3 A;  2QQ9 A;  1AD5 A;  1WXU A;  3CQT A;  3HTR A;  4HCK A;  4RTZ A;  3MP8 A;  3FJP A;  1H8K A;  3QBY A;  4J8O A;  3O5Z A;  4A4E A;  3QJ6 A;  1X27 A;  4O6J A;  3OYK A;  1OPL A;  3M58 A;  3UDC A;  5A0D A;  2F1L A;  1UGR B;  3EG2 A;  4LNP A;  2PTK A;  1QLY A;  2ABL A;  3E9G A;  1G8X A;  4HXJ A;  6AT1 B;  4OMM A;  1VQK A;  1Y96 A;  2HL3 A;  2MMP A;  2KXC A;  2L3S A;  3X26 B;  2DL3 A;  4C8Q B;  3JB9 D;  2KRS A;  3CD6 Q;  4ZTF A;  4TVR A;  1FYN A;  2RNA A;  1C1A A;  1VQO A;  1PM3 A;  3RER A;  1FWZ A;  3C4S A;  1WYX A;  3C0C A;  3M0P A;  4E47 A;  1X2Q A;  2DO3 A;  2EGE A;  3CCR Q;  1LPL A;  3MHX A;  5FU6 C;  1VIF A;  2M02 A;  4ME7 A;  3J81 E;  1OEB A;  2MK5 A;  4E7J A;  1NEG A;  1QVG S;  2FRW A;  3HSB A;  1AT1 B;  2RM4 A;  2RB6 A;  2RH2 A;  3CCM A;  5HK0 A;  4C5G A;  1UGQ B;  1I5L A;  2K57 A;  3X24 B;  5GJW B;  5GAM j;  4J83 A;  1WZO A;  2KGT A;  2GNC A;  4IUP A;  5CKD A;  2WSE E;  2LX7 A;  3GPL A;  1WDX A;  3JCM h;  5IHN A;  1BKB A;  4D8D A;  3P8H A;  5GAN j;  3UT1 A;  3CCS A;  2HL5 C;  1M1F A;  3O8V A;  4C8Q G;  2JM9 A;  4AFQ C;  2JMC A;  1H3Z A;  5EC7 A;  3QJY A;  2COY A;  1RAE B;  1WNL A;  1WGS A;  4J9G A;  5CKF A;  3A8M B;  4Z89 A;  2QQR A;  2GTJ A;  2P84 A;  3G7Z A;  1MUZ A;  2YXY A;  4Y91 A;  3CEY A;  3ME9 A;  4MDW A;  3M57 A;  4C0G A;  4PJO A;  3S3M A;  2CZ7 B;  2MOX A;  3CCV A;  2R58 A;  3FIF A;  3CCQ T;  1W70 A;  4FW2 A;  1GBR A;  3URG A;  5IH2 A;  4JRQ A;  3DKM A;  2R5A A;  2HAX A;  3VS1 A;  3RNJ A;  1K0X A;  2E3I A;  4QVD A;  2P4T A;  1BI0 A;  1M3B A;  1I8F A;  3QYH B;  4PJO B;  3CCJ T;  2JTF A;  1VQ5 T;  1WHL A;  2X35 A;  1TOV A;  1YJN Q;  1E6H A;  1U1S A;  4OP0 A;  5CCA A;  4E7I A;  1KD1 U;  3CCE Q;  4C8Q F;  2DZ9 A;  2YLB A;  2CGH A;  1KD1 C;  4NS5 A;  2J06 A;  2P0Q A;  3GF5 A;  3MJX A;  1VYU A;  3OYA A;  3OYF A;  2OJ2 A;  4AFS C;  4PLL A;  4M78 C;  3WXM B;  3JCM e;  1FX7 A;  3H0H A;  1LVK A;  5FU7 B;  3VS6 A;  1KD1 R;  2B8A A;  2PZ1 A;  3OW2 P;  3ZFJ A;  3HRU A;  2QXF A;  4IUQ A;  1S1N A;  3VS4 A;  4ATO A;  2J7I A;  2XKO C;  5FW9 A;  2CUB A;  4ORZ A;  3CBP A;  2YT6 A;  3M0T A;  3LWH A;  2JTE A;  4N4H A;  1VQL A;  2ED1 A;  4XTX A;  4PJO G;  4LE9 A;  2PVO B;  4Z02 A;  1Y0M A;  4MMK A;  1VQM A;  2DYI A;  2O31 A;  1RL2 A;  2NYS A;  4XTW A;  4X1V A;  1AZE A;  1M3C A;  1WHM A;  2E5K A;  2EGA A;  1ZBJ A;  1V1C A;  2VXF A;  1I07 A;  1VQ8 Q;  3OBY A;  2DM1 A;  2FPE A;  2D1X A;  3M4G A;  3MEW A;  4RUG A;  3BE3 A;  2CUD A;  1RAH B;  1ZX6 A;  3VYH B;  1ZUK A;  1OI1 A;  3QZ5 B;  2LTO A;  1T3S A;  2NUZ A;  5LJ5 g;  1AOJ A;  1XJW B;  3JCM Q;  4ELZ C;  5I11 A;  1UHC A;  3EFS A;  2M51 A;  3VJP A;  3LW5 E;  3QDF A;  1X69 A;  3L2Q A;  3L42 A;  2LNH B;  3LLR A;  3P8B B;  2RHY A;  4C92 B;  4HVW A;  2KY9 A;  2Z0W A;  4AG1 C;  1YIJ A;  4RTV A;  3Q1J A;  1SRM A;  4OVA A;  1VQ6 A;  3M0R A;  4FYX B;  5KYX A;  1LNX A;  4R55 A;  2CH4 W;  1W1F A;  1Y57 A;  1X6B A;  3L1A A;  4JRI A;  3L2V A;  5CR2 A;  2HMA A;  4VUB A;  1PKS A;  5CKH A;  2Y4X A;  2VKN A;  1RAB B;  5GAM h;  4OB1 B;  1E7O A;  4DBH A;  2PUO B;  2L5Q A;  3CCJ Q;  1VQ5 Q;  3JV3 A;  4FT2 A;  5KYX B;  1AWW A;  5GAN h;  3P8D A;  2EQI A;  3CC4 A;  3TSZ A;  1JQQ A;  1NE8 A;  2EQK A;  2LDM A;  2A37 A;  2K5F A;  4RKU E;  5M9O A;  1M3A A;  3REA B;  3RKY A;  3SB2 A;  2D6F A;  2FYK A;  2YUN A;  1BI2 A;  4JJD A;  2Y4Y A;  2G6F X;  2JT4 A;  1TXQ A;  5DM7 R;  3EGX A;  4C92 G;  2XU8 A;  1OUL A;  2EYZ A;  2QG9 B;  3JRZ A;  3OYJ A;  3MP6 A;  1PD0 A;  2GTO A;  4JRK A;  1QVG P;  1YHQ A;  5FU6 B;  1B07 A;  4LN2 A;  3S3N A;  2DL7 A;  2RPN A;  1MHN A;  3OS2 A;  3CC7 Q;  2XI9 A;  3INZ A;  2DBM A;  3I55 T;  4JS5 A;  3VS0 A;  4JUV A;  3OSS C;  4X34 A;  3EAE A;  4PL6 A;  4ANJ A;  5I2S A;  3OYD A;  1P92 A;  3V7S A;  2AK5 A;  5CO7 A;  2E4H A;  1Y71 A;  3FB9 A;  4CC7 A;  4XU0 A;  2RHU A;  3A98 A;  1EFN A;  3NGP A;  2E3H A;  3L2W A;  3MET A;  2XDP A;  1D3B A;  2DJZ A;  5AT1 B;  4C92 F;  4EMK A;  1DJ7 B;  8ATC B;  2DD4 A;  3E1S A;  2HDA A;  3OYM A;  1NYG A;  1EZZ B;  5CKB A;  2KEA A;  5GAN e;  4LDX A;  1F1B B;  2KT8 A;  1X43 A;  2EIF A;  1YJ9 Q;  4M7A A;  2O88 A;  3PMT A;  2X4X A;  1D3B B;  2J6F A;  4J6W A;  1K8A C;  3OY9 A;  1AEY A;  1TUC A;  2J05 A;  1CKB A;  5FLX E;  3HFO A;  4ESR A;  2EGC A;  4JZ3 A;  2QDL A;  4PJO C;  3SHW A;  2L3R A;  2GGR A;  2MYS A;  3C12 A;  2EYW A;  1OPK A;  2HSE B;  4BAC A;  2NUT A;  3TRE A;  2FZG B;  4M7A B;  1UHF A;  4M78 A;  2DL5 A;  4J9E A;  3VRY A;  2EFI A;  3CME T;  5J39 A;  2I2L A;  5A0L A;  2DEU A;  3OMC A;  1UGP B;  2HNI A;  2X4J A;  3CXC A;  1ZA2 B;  1UB4 A;  3VS3 A;  2AZS A;  2K4Y A;  3BW1 A;  1YCY A;  1ZLM A;  3T9N A;  4OMQ A;  2KYB A;  1FMK A;  4M78 B;  1D0Z A;  3RMS A;  1K4U S;  1K73 U;  2LZ6 B;  2C0I A;  5GAO q;  2DTH A;  5L23 A;  2HKN A;  1HSQ A;  1X75 C;  4JLI A;  3EFR A;  4J7I A;  3OB9 A;  3J7A F;  1VQ9 Q;  1ZSG A;  2FEI A;  1JU5 C;  1YJW A;  4FU6 A;  1YIT Q;  4GBQ A;  2KVQ G;  3M4Y A;  2DE0 X;  1K73 R;  1MMA A;  2QQB A;  4M7A G;  1UFF A;  1UE9 A;  2DL8 A;  5KYN A;  1WJR A;  1N6A A;  1QVG A;  2CP7 A;  2O9S A;  1WQ7 A;  1S72 T;  2EW3 A;  2FZC B;  4XTY A;  1N5Z A;  2CT3 A;  3V8K A;  1BI1 A;  3I56 T;  3X20 B;  3M9Q A;  4C0D C;  3I55 A;  1YWO A;  1TU0 B;  2ZPE B;  1D1B A;  2F2W A;  2L3P A;  3EG1 A;  1V29 B;  2C0T A;  2A3L A;  1TUD A;  5IAY A;  4M78 G;  2KT1 A;  4A54 A;  2W0Z A;  4JRP A;  1ZHI A;  2FPD A;  2K2V A;  2LCC A;  4C5E A;  2MAM A;  1RAA B;  3CBO A;  1G2B A;  5FWB A;  1MMG A;  4WTO B;  1N8R C;  1NJI U;  5I2M A;  1KK7 A;  2B86 A;  2DIL A;  4M75 A;  1OU9 A;  1OX9 A;  1TTH B;  1Q81 U;  1QP3 A;  2QA4 A;  5HCK A;  4AMC A;  5GAO m;  2ZPH B;  2RQV A;  2HEQ A;  3L2Z A;  1YJN T;  1K9A A;  3OYI A;  1NJI R;  3CC2 T;  2DXT A;  3SWN C;  3THK A;  3G1J A;  4PK4 A;  3J80 E;  4M75 B;  1Q81 R;  1M2V A;  4M4Z A;  4E2F B;  2OTJ T;  5KE2 A;  1C6V X;  2DTI A;  2SRC A;  2OTL Q;  1RAC B;  3CXC S;  3I9Q A;  1XQH A;  2HQX A;  3G6E T;  2E41 A;  1AHJ B;  1BK2 A;  1M2V B;  2V8K A;  1WJS A;  1JXM A;  1D09 B;  2RO0 A;  4M7D A;  1ZQ1 A;  1JRI A;  1D0Y A;  3I5S A;  3CD6 A;  1SG5 A;  2BZY A;  3CME Q;  3OQ5 A;  1FMV A;  2PQW A;  4F17 A;  2XDB A;  3A1P A;  2K5I A;  2XK0 A;  3HPW A;  3E2U A;  3CCR A;  2DER A;  4Z8A A;  5CK9 A;  3HL8 A;  3OS5 A;  2D8H A;  2KRO A;  2BTT A;  4M7D B;  1Y96 B;  5D7U A;  4M75 G;  2GFU A;  2PNI A;  4IUV A;  4BD3 A;  1M9S A;  2M1H A;  3FDR A;  1OOT A;  2H3E B;  1ZUY A;  2CRE A;  2IPO B;  1VQ8 T;  3ZEH A;  3OS0 A;  1QVP A;  1VOM A;  1U06 A;  4PJL A;  2E10 A;  1W2B S;  4F7U A;  3A8O B;  2JZ2 A;  2K79 A;  2HCK A;  1VQ7 Q;  2HQH A;  4FW1 A;  3G71 T;  2KK4 A;  5KCH A;  2ENM A;  5KCO A;  3EH2 A;  4KH0 B;  4KUD K;  3TVT A;  2RI3 A;  2JVV A;  1S72 Q;  2HD0 A;  2IG0 A;  2RQU A;  2VGM A;  1AWJ A;  4JZ4 A;  4OB3 B;  1AWX A;  3I56 Q;  3VS7 A;  4WCI A;  5GAN 7;  4RMO A;  1K9M U;  1PD1 A;  3TQ7 P;  4FYW B;  3I35 A;  1G3S A;  4BE1 A;  2K3B A;  2ZPI B;  1M8M A;  1ZSZ C;  4RTU A;  4KGX B;  4M7D G;  4XU2 A;  1RAF B;  2F2X A;  2FO0 A;  2D9T A;  2P0P A;  1IO6 A;  2E1H A;  4MML A;  4EMK C;  2LJ3 A;  4DBF A;  4M77 A;  4IUR A;  1H64 1;  2DXU A;  1K9M R;  1IZ6 A;  1B34 A;  3EGU A;  5LJ5 f;  2RA2 A;  3RKX A;  2EJG A;  1M2O A;  1Q82 U;  1IXD A;  4B9X A;  3JCM g;  5CQY A;  4M7A C;  1I5O B;  1YJN A;  4D6W A;  4BDZ A;  1KC8 U;  3CCE A;  2AIR B;  3CCV Q;  2LQK A;  5CAI A;  1QCF A;  1HD3 A;  1V76 A;  1C0M A;  2VVK A;  4M77 B;  3CC2 Q;  1KSW A;  1QKW A;  1G3W A;  2YWW A;  1JJ2 S;  1Q82 R;  4O5V A;  2QK0 A;  1M90 U;  2CKK A;  2BE9 B;  1KC8 R;  2OTJ Q;  3G4S T;  1KHI A;  1VQP Q;  2JNG A;  2CZ0 B;  1PRM C;  4LUD A;  3JB9 J;  4DOW A;  2DFU A;  3QHS A;  3PVQ A;  1U3O A;  3G6E Q;  2EAY A;  3PE0 A;  3CC7 T;  4Q5W A;  4J9B A;  2DX1 A;  3N5B B;  4L6V 5;  3GNG A;  1M90 R;  5DLQ E;  1HJD A;  4F04 B;  5A0G A;  1GBQ A;  4RG2 A;  1RUW A;  2F5T X;  4HT8 A;  1G83 A;  4C0F A;  4B9W A;  4KT0 E;  2L3Q A;  2PVD B;  1NBE B;  1U5S A;  4XU1 A;  2Y90 A;  4LD6 A;  1WXT A;  4M77 G;  1PRL C;  1PSE A;  1BB9 A;  4L59 A;  4FSX A;  1GFD A;  2I0N A;  2SEM A;  3JCM J;  1PC0 A;  1FMW A;  1VQ8 A;  2MWP A;  5IXB A;  1VQ4 T;  3KBG A;  2DBK A;  4OF1 A;  1M30 A;  4C0D B;  1YP5 A;  3S3O A;  2JW4 A;  3CMA T;  1TUG B;  4ELY C;  2RHZ A;  3F70 A;  3KFV A;  1IHV A;  1WPY A;  3I5R A;  2YUP A;  1MV3 A;  1YJ9 T;  3BDL A;  2KYM A;  4XQ3 A;  1Y07 A;  1ACM B;  1BBZ A;  1YFN A;  4WF2 A;  4XU3 A;  4FCY A;  1T0H A;  1BYM A;  2YUQ A;  3FLG A;  5LJ5 d;  3G71 Q;  2G3R A;  2D0N A;  3REB B;  3TU4 K;  2DL4 A;  4PJO F;  3SWN A;  4EMG A;  5IHI A;  3EFO A;  5DLO A;  3UAT A;  3FEO A;  3LX7 A;  1WA7 A;  2M9U A;  2RHI A;  5GMK m;  2D8J A;  1TSF A;  1N9S A;  4II1 A;  4M75 C;  1K76 A;  3DB4 A;  1JO8 A;  3OSV A;  2GQI A;  4FT4 A;  2LT4 A;  3EG0 A;  2HKQ B;  3CCQ A;  1IB8 A;  3SWN B;  2LX9 A;  4A53 A;  1TS9 A;  3EFO B;  4OMP A;  2YLC A;  4J9H A;  2E5Q A;  2KNB B;  2VV5 A;  4LDY A;  3CXC P;  2IVW A;  3JB9 G;  4DOV A;  2QYZ A;  3QWX X;  3CCU T;  3CCJ A;  1VQ5 A;  4KRT A;  3PGG A;  1NPR A;  4J6X A;  4A4G A;  4IIM A;  4FYY B;  1Q95 G;  1VQ9 T;  1ABO A;  4LXC A;  5LJ5 e;  4EIK A;  1IRX A;  4PLI A;  2EQU A;  3HP9 A;  1YIT T;  4BE0 A;  2VB6 A;  3MEA A;  3QO3 A;  4J9F A;  4E7H A;  3PIP A;  2PVG B;  2K9G A;  4E6R A;  3CCL T;  1XOV A;  2C06 A;  3AHU A;  3EGD A;  2YHT A;  1AVZ C;  1HYO A;  2RJF A;  4OB0 B;  2NUP A;  4QVC A;  3G4S Q;  1D1A A;  2CSI A;  4M7D C;  3OYE A;  3VU3 C;  1M1K U;  2DXB A;  1ABQ A;  1UDL A;  2LCL A;  2MPX C;  3GP8 A;  2DKG A;  4HVU A;  2F2V A;  3CC4 Q;  3CC7 A;  3OYN A;  4BE2 A;  5GAM g;  2EJF A;  3PIO A;  5IT9 E;  3EGD B;  4J9D A;  2DRM A;  3SFM A;  2NUP B;  3OYB A;  1VIE A;  2O2O A;  1W2B P;  3U23 A;  3EGX B;  1YI2 T;  1M1K R;  1TWB A;  1LOJ A;  4HCB A;  1OU8 A;  2KMT A;  3EH1 A;  2J6O A;  5GAN g;  2JN0 A;  2O4X A;  1SHF A;  3QDR B;  1X2K A;  1ZBX A;  1Q7Y U;  2L2P A;  3JCM V;  3R6O A;  1OX8 A;  2EYQ A;  4IKF A;  1ZSZ A;  4XAX B;  4PFZ A;  2DF6 A;  5L8R E;  2V8J A;  3WVD B;  1UGS B;  2VC8 A;  3H0I A;  1VQN Q;  1TG0 A;  1QP2 A;  3CPW A;  4OMN A;  3HKS A;  1Q7Y R;  1VQ4 Q;  1NLO C;  5GAN 6;  2O4X B;  2DJQ A;  2CSQ A;  5LJ3 d;  3CMA Q;  2QEX T;  4AG2 C;  2AT1 B;  1YJ9 A;  2RI5 A;  5LJ3 g;  1ZSZ B;  3JAM E;  3C95 A;  1WHH A;  3JCM c;  3GIB A;  4HCZ A;  3HRT A;  4CI0 C;  1PWT A;  3M59 A;  4BI3 A;  1Q86 U;  2OTL T;  4PJJ A;  4EMK B;  3OYL A;  3NMZ C;  3EHQ A;  1M4Z A;  1KFZ A;  4A4K A;  2QQA A;  5D6Y A;  1EX4 A;  2CYZ B;  3PTA A;  4C8Q E;  3MEV A;  1M8V A;  4C8Q D;  2O01 E;  2K2M A;  4M77 C;  4BI8 B;  1E6G A;  4MZT A;  1XTD A;  4AT1 B;  3V7R A;  1D1C A;  3MPU B;  2DET A;  2EKO A;  2COW A;  4C0Z A;  2HSP A;  1NYF A;  1JJ2 P;  2AKK A;  2GF7 A;  3KXT A;  4KBM B;  1K1Z A;  2MF2 A;  2V8I A;  3UA6 A;  2RF0 A;  2DIG A;  1EIF A;  3LGF A;  5DY9 A;  2KSS A;  2NUT B;  3L2U A;  2RK2 A;  4BY6 B;  1G3Y A;  1NM7 A;  5EG2 A;  2ZZD A;  5D6X A;  3LYI A;  4EMH A;  3CCU Q;  1VQ9 A;  3LH5 A;  1K73 C;  1NPP A;  3CBM A;  1YIT A;  1VQO T;  2HBP A;  2PUK B;  2M0O A;  5GAO l;  1QCN A;  5CIU A;  3M0S A;  4XTU A;  1VQ7 T;  3CCL Q;  1CKA A;  3QPH A;  1U1T A;  2IIM A;  2LT1 A;  2YSQ A;  2RK1 A;  4CC2 A;  3M53 A;  2MI6 A;  3CCM T;  2ZCF B;  4HCC A;  2RQW A;  3V7C A;  2QAS A;  1RLQ C;  4B6M A;  5KE3 A;  2DD5 A;  1LJO A;  1NG2 A;  4HVV A;  1W2B A;  2DEQ A;  3MKD A;  1WHK A;  1PNJ A;  5HKC A;  1QVF A;  4K11 A;  1PG5 B;  2DRK A;  2LJ0 A;  1VYV A;  4FSS A;  1AZG B;  3CPW S;  2X4Y A;  1JBM A;  4PJN A;  1YI2 Q;  1GXI E;  1I0C A;  3MEU A;  4PJO E;  3PT9 A;  2JS2 A;  4KUL A;  4PJO D;  2MWO A;  3HHT B;  2VWF A;  1ZA1 B;  3V8J A;  2JM8 A;  1IHW A;  4E7Z A;  1YN8 A;  1NJI C;  1QQJ A;  3TCJ A;  4M7A F;  1VYT A;  1MGQ A;  1WQW A;  1Q81 C;  3CCV T;  3TSW A;  2DLP A;  2YRC A;  1UEB A;  3AT1 B;  2QDY B;  1Z9Z A;  2QEX Q;  2LQ8 A;  3OS1 A;  2ZAE A;  4OML A;  2X3X D;  3RDV A;  3SD4 A;  1NZ9 A;  2X4W A;  3UPU A;  2OTL A;  2QA4 Q;  1VQP T;  4RG8 A;  2R5M A;  4M78 F;  1KHC A;  2OI3 A;  5LJ5 j;  3L2R A;  4KGZ B;  3UA7 A;  3QYG B;  3JCM f;  3JCM b;  1B7T A;  3NTK A;  1HK9 A;  2KRM A;  2KAF A;  4HKE A;  1XNI A;  4J7F A;  5FRO A;  2CP0 A;  4PNO A;  1JJ2 A;  1H92 A;  1JB0 E;  3CME A;  1MV0 B;  4BDY A;  4C8Q A;  5GAN 5;  2L89 A;  3RUX A;  3PFS A;  2ATC B;  4ZGE B;  1K0S A;  1T3L A;  2DVJ A;  2CZ1 B;  2A08 A;  4AFZ C;  2DIQ A;  1PSF A;  2EYX A;  1CSK A;  1RAI B;  4E7S A;  1WX6 A;  4DEY A;  3ULR B;  1UG1 A;  1M27 C;  4LUE A;  4KUI A;  2W10 A;  1WLP B;  1VQK Q;  2CH4 A;  2KBT A;  3VV0 A;  2BZX A;  1VQL T;  2X3W D;  3ASK A;  3QG1 A;  2RHX A;  2GFA A;  1I4K 1;  1SF9 A;  1WHG A;  1WXB A;  2EQM A;  2RQT A;  4LDW A;  1VQO Q;  3ZL7 C;  3D7S B;  4MDX A;  1SHG A;  1VQM T;  2ZGW A;  1BIA A;  1SPK A;  1VQ7 A;  2DPP B;  2EJ9 A;  1I1J A;  3H41 A;  1QVF S;  2ESW A;  4RCC A;  1R77 A;  2PU9 B;  4OGC A;  4XTV A;  4GLK A;  5D6W A;  2LMJ A;  1S72 A;  2RJC A;  4C92 E;  3M0U A;  3CCM Q;  4JPB W;  4FYV B;  2VXE A;  2XD0 A;  2KXD A;  4C92 D;  3I56 A;  4D8K A;  1QW1 A;  2JMA A;  3JCM P;  4F7U B;  1UJY A;  1Y7X A;  3X28 B;  2ZPB B;  3EG9 A;  1WHJ A;  2LQN A;  5GAO p;  4M75 F;  2DAQ A;  4DBR A;  4GLM A;  3M0Q A;  4OMO A;  1K9M C;  2K6D A;  2RN8 A;  3RR6 A;  2JXB A;  1KQS S;  2OAW A;  4FM4 B;  3NFC A;  3CCS Q;  1Z9Q A;  3VUZ A;  2BIV A;  2H3J A;  2P4R A;  2VUB A;  1N27 A;  2KI7 A;  3PMI A;  2WAC A;  4IUT A;  2QTX A;  3EG9 B;  2EKH A;  1IRE B;  3JCM d;  2VAS A;  2YDL A;  3DLL A;  5KYU A;  2EVR A;  4KH1 B;  2VYT A;  2XDD A;  2RI2 A;  2P0K A;  1R0B G;  1YIJ T;  2JTM A;  3UWN A;  2E12 A;  2JJ9 A;  2CP2 A;  2D0Q B;  4NL2 A;  1Q82 C;  1YCS B;  3JSC A;  3BDU A;  1VQ6 T;  2ROT A;  3CC2 A;  9ATC B;  2XG8 D;  5LJ3 j;  1KC8 C;  3PNW C;  1KG1 A;  1W4S A;  3H0F A;  2LQW A;  8AT1 B;  1B34 B;  2KE9 A;  5GJV B;  3DB3 A;  1MMD A;  2DYB A;  2OTJ A;  4J9I A;  3C94 A;  2HZY A;  5KYU B;  4F7U G;  1VQP A;  2EPD A;  1M1G A;  2LP5 A;  2BUD A;  4M7D F;  3QZ9 B;  2QTV A;  4BY6 C;  5KYW A;  3WVE B;  3JCM X;  1M90 C;  1FXX A;  2DNU A;  3G6E A;  2A36 A;  1X6O A;  1TH7 A;  1D0X A;  1U8R A;  5AYF A;  3CC4 T;  4C5H A;  1WJQ A;  1RLP C;  5KH6 A;  2L0A A;  2C0O A;  2GCX A;  4V2S A;  2F5K A;  3VUB A;  2EYY A;  4OB2 B;  1BIB A;  1GCQ A;  5C6S A;  1WFW A;  5FRM A;  1VA7 A;  5KYW B;  5GAN 3;  4QVZ A;  2DVE A;  3BY7 A;  5GMK l;  2E6Z A;  2FRY A;  3ZBD A;  2JUF A;  1MMN A;  1YHQ T;  2V26 A;  5LL6 S;  3QSU A;  3M5A A; 
#chains in the Genus database with same CATH homology
 3UF4 A;  1OEB A;  4J9D A;  2DRM A;  1UFF A;  1UE9 A;  5IHK A;  1NEG A;  2DL8 A;  2FRW A;  2O2O A;  3U23 A;  4F16 A;  2O9S A;  1QWE A;  2DMO A;  2J6O A;  4Z88 A;  2EW3 A;  1SHF A;  1X2K A;  1PHT A;  1N5Z A;  2CT3 A;  2L2P A;  5GJW B;  1PKT A;  1YWO A;  2F2W A;  2L3P A;  2KGT A;  2GNC A;  3EG1 A;  4ZNX A;  2DF6 A;  3SEM A;  2C0T A;  2LX7 A;  1TUD A;  1UTI A;  3H0I A;  1WDX A;  2KT1 A;  5IHN A;  2FPF A;  1TG0 A;  2W0Z A;  2FPD A;  4D8D A;  4OMN A;  2LJ1 A;  2CT4 A;  1NLO C;  1JEG A;  2JM9 A;  4AFQ C;  1G2B A;  2DJQ A;  2CSQ A;  2JMC A;  5EC7 A;  5FWB A;  1NEB A;  4J9G A;  4AG2 C;  2B86 A;  4Z89 A;  2DIL A;  2GTJ A;  1MUZ A;  1LCK A;  2JS0 A;  5HCK A;  1PWT A;  2RQV A;  2HEQ A;  3NMZ C;  2MOX A;  3EHQ A;  1W70 A;  1K9A A;  1GBR A;  2KRN A;  5IH2 A;  1KFZ A;  2CDT A;  1GCP A;  3THK A;  3VS1 A;  3RNJ A;  1K0X A;  2DA9 A;  4M4Z A;  2K2M A;  4JJC A;  1E6G A;  1M3B A;  3GBQ A;  1KJW A;  2SRC A;  1UUE A;  2HSP A;  1NYF A;  2AKK A;  1E6H A;  1YNZ A;  1K1Z A;  3I9Q A;  3UA6 A;  4Y92 A;  2K7A A;  2RF0 A;  1W6X A;  4JJB A;  1BK2 A;  2J06 A;  1J3T A;  1VYU A;  2OJ2 A;  1JXM A;  2MCN A;  4AFS C;  1NM7 A;  3I5S A;  1UJ0 A;  4CC3 A;  2BZY A;  4RTT A;  2A28 A;  4F17 A;  2J6K A;  3H0H A;  3VS6 A;  2YUO A;  3LH5 A;  1ARK A;  2PZ1 A;  4J9C A;  1S1N A;  3VS4 A;  1UGV A;  4RTX A;  4Z8A A;  2J7I A;  3M0S A;  5FW9 A;  2CUB A;  1ZUU A;  2D8H A;  2KRO A;  1BU1 A;  2BTT A;  4ORZ A;  1CKA A;  2IIM A;  2YT6 A;  2PNI A;  3M0T A;  3NPF A;  1AWO A;  2JTE A;  1OOT A;  2ED1 A;  2YSQ A;  4CC2 A;  1ZUY A;  2CRE A;  4LE9 A;  2RQW A;  1RLQ C;  1Y0M A;  1U06 A;  3QWY A;  2AZV A;  2O31 A;  3EG3 A;  1NG2 A;  4HVV A;  2K79 A;  4X1V A;  1AZE A;  1M3C A;  2HCK A;  2E5K A;  2EGA A;  1PNJ A;  1ZBJ A;  4CC4 B;  4K11 A;  2DRK A;  2LJ0 A;  4DEX A;  1V1C A;  1VYV A;  4FSS A;  1AZG B;  2KR3 A;  2ENM A;  2RQR A;  1I07 A;  3TVT A;  5IXF A;  2RMO A;  2ECZ A;  1I0C A;  1RI9 A;  2DM1 A;  2RQU A;  2FPE A;  1AWJ A;  2D1X A;  4JZ4 A;  1AWX A;  4RUG A;  2JS2 A;  2ED0 A;  3VS7 A;  2CUD A;  4WCI A;  2V1R A;  2VWF A;  1WI7 A;  1ZX6 A;  2JM8 A;  4QT7 A;  3I35 A;  1YN8 A;  1ZUK A;  2K3B A;  1SEM A;  1OV3 A;  1M8M A;  4IIO A;  4RTU A;  2EBP A;  2GBQ A;  1VYT A;  1T3S A;  2NUZ A;  1H3H A;  2F2X A;  2FO0 A;  3TSW A;  1AOJ A;  1IO6 A;  2DLP A;  3VS2 A;  4R0K A;  5I11 A;  2BZ8 A;  2LJ3 A;  1UHC A;  5FWC A;  2M51 A;  1Z9Z A;  1X69 A;  2O9V A;  3EGU A;  4OML A;  2LNH B;  1NLP C;  4HVW A;  2X3X D;  4AG1 C;  1JXO A;  3VRZ A;  4RTV A;  1UEC A;  1SRM A;  2OI3 A;  3M0R A;  3UA7 A;  1GL5 A;  1QCF A;  1HD3 A;  2VVK A;  1WIE A;  2CH4 W;  1W1F A;  1Y57 A;  3IQL A;  1X6B A;  1KSW A;  1QKW A;  2KRM A;  5ECA A;  3R6N A;  1SRL A;  1B3Q A;  1PKS A;  2VKN A;  1H92 A;  3VS5 A;  1MV0 B;  3NHN A;  1E7O A;  1PRM C;  3EHR A;  4LUD A;  3JV3 A;  1AWW A;  4AFU C;  2EQI A;  3PVQ A;  3TSZ A;  1JQQ A;  1T3L A;  1U3O A;  2DVJ A;  1K0S A;  2A08 A;  2A37 A;  4AFZ C;  3PE0 A;  1M3A A;  2EYX A;  2FG0 A;  1CSK A;  3REA B;  1WX6 A;  4DEY A;  3ULR B;  1UG1 A;  3PVL A;  4J9B A;  2DX1 A;  3FJ5 A;  1M27 C;  4LUE A;  2W10 A;  1WLP B;  1HJD A;  2YUN A;  2CH4 A;  2KBT A;  4JJD A;  1GBQ A;  2G6F X;  2JT4 A;  2ROL A;  1RUW A;  2BZX A;  4F14 A;  2X3W D;  2MIO A;  1G83 A;  1WXB A;  2EYZ A;  1GCQ C;  4RTY A;  2RQT A;  2GTO A;  3ZL7 C;  1SHG A;  2L3Q A;  1B07 A;  4LN2 A;  1A0N B;  2DL7 A;  1U5S A;  2LCS A;  2RPN A;  1SPK A;  1WXT A;  2XMF A;  1PRL C;  2DBM A;  1BB9 A;  1I1J A;  3VS0 A;  3H41 A;  2ESW A;  1GFD A;  1QWF A;  2I0N A;  2SEM A;  2LMJ A;  4A63 B;  2AK5 A;  5IXB A;  2AKL A;  2DBK A;  1M30 A;  4CC7 A;  1KIK A;  1YP5 A;  3M0U A;  2JW4 A;  4JPB W;  1QKX A;  2KXD A;  4D8K A;  1T0J A;  2HBW A;  3A98 A;  1EFN A;  3KFV A;  1GRI A;  3NGP A;  2JMA A;  2M0Y A;  3I5R A;  2YUP A;  1MV3 A;  1UJY A;  2V1Q A;  2KYM A;  2LQN A;  3RBB B;  1BBZ A;  5I22 A;  4GLM A;  3M0Q A;  1T0H A;  4OMO A;  2K6D A;  2YUQ A;  2RN8 A;  2D0N A;  3REB B;  2HDA A;  2DL4 A;  2JXB A;  1NYG A;  2KEA A;  2OAW A;  5IHI A;  1Z9Q A;  2P4R A;  2KT8 A;  3UAT A;  1SSH A;  1X43 A;  1YWP A;  1WA7 A;  2O88 A;  2H8H A;  2EKH A;  2J6F A;  2D8J A;  2YDL A;  2EVR A;  1GFC A;  1X6G A;  1AEY A;  1K76 A;  1TUC A;  1JO8 A;  2J05 A;  1CKB A;  2GQI A;  2NWM A;  4RTW A;  4ESR A;  3EG0 A;  2EGC A;  4JZ3 A;  2QDL A;  1YCS B;  1AD5 A;  1WXU A;  2ROT A;  3SHW A;  2GGR A;  3CQT A;  4OMP A;  4HCK A;  4J9H A;  3H0F A;  2EYW A;  1OPK A;  2KNB B;  2LQW A;  4RTZ A;  1H8K A;  2KE9 A;  5GJV B;  1UHF A;  2DL5 A;  2DYB A;  4J9I A;  4J9E A;  3VRY A;  3O5Z A;  3QWX X;  2EPD A;  1X27 A;  2LP5 A;  4KRT A;  1OPL A;  4IIM A;  1ABO A;  2DNU A;  4EIK A;  2A36 A;  3VS3 A;  3EG2 A;  4LNP A;  2AZS A;  2PTK A;  1QLY A;  2ABL A;  1RLP C;  1ZLM A;  4J9F A;  4HXJ A;  2L0A A;  4OMQ A;  2KYB A;  2K9G A;  2C0O A;  1FMK A;  4E6R A;  4OMM A;  1XOV A;  2KXC A;  1K4U S;  2L3S A;  2LZ6 B;  1AVZ C;  2C0I A;  5L23 A;  2EYY A;  1GCQ A;  1WFW A;  2DL3 A;  1HSQ A;  2CSI A;  2KRS A;  1VA7 A;  1FYN A;  2RNA A;  1ZSG A;  1ABQ A;  1UDL A;  2FEI A;  1JU5 C;  1WYX A;  2FRY A;  3C0C A;  4HVU A;  3M0P A;  4GBQ A;  2F2V A;  1X2Q A;  2EGE A;  2DE0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...