2J6FA

N-terminal sh3 domain of cms (cd2ap human homolog) bound to cbl-b peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-ASSOCIATED PROTEIN
publication title Atypical Polyproline Recognition by the Cms N- Terminal SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j6fA00
4IIMA 3VS1A 2CUBA 3NMZC 3JV3A 2KGTA 2PTKA 4CC4B 3PE0A 1NYGA 3VS6A 1UHCA 4Z88A 1TUCA 2L0AA 4AFQC 1WXTA 1B07A 1QKXA 4CC7A 4OMNA 5GJWB 1M8MA 4AFZC 1GCQA 1ABQA 1I07A 3VS0A 1CSKA 1OPLA 1Y57A 1J3TA 1UJYA 1JXMA 2JW4A 1AZGB 4DEYA 1JEGA 1WA7A 2LZ6B 3QWYA 4AFSC 2L3SA 2AZSA 3VS7A 1A0NB 1GCPA 3U23A 2AKKA 2YSQA 3M0SA 2A37A 1G2BA 4A63B 3VS2A 1I0CA 2LQNA 1K0SA 1AWWA 1AD5A 4DEXA 1UFFA 1UHFA 2FRYA 1U06A 2LJ3A 2LP5A 1HJDA 1H92A 2F2VA 2YDLA 2J06A 1ARKA 2EYYA 2HEQA 4J9HA 4KRTA 2JTEA 2K3BA 2HDAA 3VS5A 3I9QA 3H0HA 4LN2A 2DBKA 3M0RA 4OMMA 1OEBA 2BTTA 2KYMA 1GCQC 2DE0X 4HCKA 2YT6A 1I1JA 2IIMA 1NM7A 2GTJA 2GBQA 4GLMA 1IO6A 1HSQA 1PHTA 1JO8A 1W1FA 4EIKA 2DF6A 2V1QA 2F2WA 4RTZA 2EW3A 1NYFA 2EYXA 3H41A 4OMLA 4LUDA 2D8JA 2ECZA 2YUQA 4LNPA 1X43A 2GTOA 3M0TA 3EG3A 4QT7A 2AKLA 1U5SA 3EG0A 2NWMA 2EVRA 1WDXA 2HCKA 2RF0A 2K9GA 3C0CA 3SEMA 1X6BA 2BZ8A 1YP5A 1H8KA 4JJCA 1MV3A 2JM8A 1YN8A 3LH5A 2I0NA 2DRKA 2EKHA 1EFNA 5I22A 1T0HA 4E6RA 4D8DA 1AZEA 2E5KA 2CT4A 1ZUKA 1M3AA 2O9VA 2D8HA 1HD3A 3M0PA 1UUEA 3I5RA 1PRMC 1U3OA 2RN8A 5GJVB 2KYBA 2QDLA 3NPFA 4R0KA 3TSWA 4J9EA 2K6DA 2A36A 3NGPA 4OMQA 4J9BA 2DX1A 3RNJA 1T3SA 2CH4W 2DBMA 4RTUA 1GFDA 2KRMA 2JMCA 4M4ZA 2K2MA 4CC3A 2K79A 2V1RA 2JS2A 2DMOA 1CKBA 1RUWA 2KNBB 1CKAA 3A98A 4OMPA 4X1VA 4IIOA 1X2QA 3SHWA 2O9SA 2HSPA 3VRZA 2D0NA 2J7IA 3IQLA 1YCSB 4RTVA 1ZUUA 2K7AA 1QCFA 3REBB 2DRMA 2ED1A 1AWJA 4J9IA 2P4RA 2C0IA 4J9GA 2KROA 4RTXA 2LNHB 1V1CA 5I11A 1SHGA 2MCNA 1TG0A 1E6GA 2O31A 1W70A 1M27C 2F2XA 3UA6A 4Y92A 2KRSA 1QLYA 2LX7A 3UA7A 4HVUA 1T3LA 2GNCA 1YWPA 3I5SA 2JS0A 3ULRB 4F16A 1NLPC 1Z9ZA 2B86A 2KR3A 3PVQA 1E6HA 3ZL7C 1X27A 2DL8A 5FWBA 2DYBA 1MUZA 2RQTA 2LJ1A 3EG1A 2YUPA 2A28A 4CC2A 1AWXA 1WI7A 2EQIA 1MV0B 1UTIA 1WX6A 1WXBA 1ZLMA 2JT4A 1WYXA 1RLPC 2VVKA 3M0UA 1YNZA 4JZ4A 3THKA 2RPNA 3CQTA 2OI3A 2SEMA 1BB9A 1WLPB 4RUGA 5IHNA 4JPBW 2CSIA 2EGEA 1LCKA 2DA9A 1ZUYA 3KFVA 4HVWA 1PNJA 4OMOA 1M3CA 2HBWA 2FRWA 2FPFA 4RTWA 2LCSA 2SRCA 3EG2A 1GBRA 2L3PA 2MIOA 5HCKA 1AWOA 1UG1A 1KFZA 1BK2A 3I35A 5L23A 1NEGA 1UJ0A 2ENMA 1JQQA 1WIEA 2C0OA 1ZSGA 2KBTA 1WFWA 2DILA 1SSHA 4F14A 2X3XD 3UF4A 1TUDA 2OAWA 2JM9A 1OOTA 4RTTA 4AG2C 5FW9A 1GFCA 2DL3A 2KRNA 2FG0A 2ESWA 1FYNA 2H8HA 2DL5A 2KXDA 1K1ZA 2ED0A 2DL7A 3QWXX 1KJWA 4D8KA 2XMFA 4HVVA 2ABLA 4JZ3A 1UECA 2OJ2A 2AZVA 2DL4A 3REAB 1S1NA 2PZ1A 4ESRA 1K4US 3RBBB 2KXCA 2J6FA 4WCIA 1NLOC 4HXJA 2RQWA 2JMAA 1GRIA 4RTYA 1VYVA 3TVTA 1Y0MA 2EYZA 4Z89A 1XOVA 2DLPA 1B3QA 5ECAA 2A08A 1GL5A 2L2PA 2DNUA 5IHIA 1PWTA 1ZX6A 3H0IA 1KSWA 2D1XA 2J05A 2LQWA 4JJBA 1N5ZA 1UE9A 1WXUA 1BBZA 4LE9A 1G83A 1Z9QA 2KT8A 2FPDA 1H3HA 1VYTA 1K0XA 2J6OA 2AK5A 2EBPA 4FSSA 1VA7A 1NG2A 1X6GA 2EPDA 3VRYA 2M51A 2VWFA 2W0ZA 3EHQA 2YUOA 2CUDA 1VYUA 3O5ZA 3UATA 5EC7A 3EHRA 1ZBJA 1NEBA 2GQIA 2KE9A 1W6XA 1UDLA 1M3BA 1M30A 3EGUA 2RQVA 1GBQA 4AG1C 2LMJA 2FO0A 1AEYA 2FEIA 2RMOA 1K9AA 2CREA 2CDTA 2X3WD 3VS3A 1FMKA 3TSZA 2W10A 2CSQA 2MOXA 1UGVA 2VKNA 2CH4A 2L3QA 3R6NA 4F17A 4LUEA 2KT1A 5IHKA 1JU5C 1QWEA 4J9CA 3GBQA 1JXOA 1ABOA 2DJQA 1RLQC 2ROLA 1SRMA 2DM1A 2RNAA 1RI9A 2C0TA 2RQRA 5IH2A 1BU1A 1SHFA 1SPKA 1X2KA 2JXBA 1OPKA 2YUNA 2O88A 2RQUA 3VS4A 5IXBA 1QKWA 3M0QA 4AFUC 1KIKA 3FJ5A 2LJ0A 2CT3A 2EGCA 1PRLC 5IXFA 2EYWA 1QWFA 2M0YA 2GGRA 1SEMA 1T0JA 2FPEA 2NUZA 1X69A 2DVJA 4ORZA 2PNIA 2G6FX 2J6KA 1E7OA 2BZYA 1K76A 1AOJA 2ROTA 3H0FA 4Z8AA 1AVZC 2KEAA 3NHNA 4JJDA 5FWCA 4ZNXA 4GBQA 3PVLA 1OV3A 4J9DA 1SRLA 1YWOA 4K11A 2BZXA 2O2OA 2EGAA 4J9FA 1PKSA 1PKTA
chains in the Genus database with same CATH superfamily
3JV3A 5CKFA 2ZPHB 4CC4B 3V7CA 2ZAEA 1NYGA 3JRZA 5CAIA 3CCEA 3M4GA 5GANf 2L0AA 1Q7YC 3G6ET 2CP5A 3MHXA 3RMSA 5LJ5f 2RHYA 1QMCA 1QKXA 3TREA 3CD6A 1ABQA 3EGXA 1D0YA 2K3XA 3VJPA 1J3TA 1UJYA 1YJNQ 2OTLA 1N6AA 4M7DC 3QWYA 1BI3A 2DERA 1PSFA 2QQSA 3U23A 3FDRA 3VS2A 1I0CA 1K0SA 4DEXA 1UHFA 2FRYA 2LJ3A 2LP5A 1HJDA 3JAME 2DTOA 1X75C 3QDRB 2EYYA 2HEQA 5CKDA 3JCMg 3VS5A 3I9QA 2AIRB 3H0HA 2RJEA 4LN2A 4PJOG 4OMMA 1H3ZA 4JLGA 2KYMA 1YJNA 4ZN1A 1I1JA 2DJZA 2LCCA 4JS4A 4PJOB 3JB9G 3FC3A 1NM7A 5GAN4 2GBQA 4PFPA 1JO8A 1GXIE 3DLMA 5KYNA 3ER0A 1WNLA 3CXCS 3UWNA 1N27A 2D9TA 2V8KA 2MWOA 4LUDA 4QVDA 3CPFA 2YUQA 4E7JA 4AMCA 3QJYA 1U5SA 3FJPA 3ASKA 4E7HA 2DK3A 1WHKA 2RF0A 3BY7A 2K9GA 2KMTA 4OB3B 5L8RE 2QDYB 1YHQA 1YP5A 1H8KA 2RO0A 2EKHA 2HKQB 2OTJT 3QPHA 3FRNA 2E5KA 2CT4A 3OYGA 1M3AA 4F7UG 3M0PA 1UUEA 3I5RA 3LX7A 1N8RR 4R0KA 4M78F 3DB4A 5FU7B 4J9EA 3P8HA 2K6DA 4HCBA 5FRMA 3SD4A 3KXTA 3RNJA 3CCJT 3TU4K 2XKOC 3INZA 3QHSA 2LTOA 5IN1A 2VC8A 4C8QF 4CC3A 2K79A 2M0OA 4XTYA 4ZTFA 5GAN8 3CC4T 3L1AA 4C92A 2JS2A 2DMOA 3M58A 1SG5A 3MP6A 2LVMA 2LC4A 4FT4A 2O9SA 4ME7A 2F69A 4RTVA 1OU8A 1QCFA 2X9HA 1FX7A 1TU0B 3JSCA 1AWJA 3LH0A 5GAOn 2C0IA 4J9GA 3CCRT 3QBYA 1VQ5T 2R5MA 1V1CA 4ZGJB 3QSUA 1W2BS 5GANh 3CCUA 4EPCA 1E6GA 4ELYC 2FZKB 3NTKA 5LJ5h 4V2SA 4E7LA 4XTWA 2KRSA 4EMKA 1NBEB 5C0MA 4M77F 3SWNA 1JBMA 3OYAA 1MNEA 4M75G 1KC8U 3RMQA 4HVUA 3AT1B 2Y90A 3I5SA 3ULRB 3WVEB 2KR3A 2C06A 1PCXA 1X27A 2DL8A 3L2UA 1WGSA 2DYBA 2RQTA 3L2RA 2NUTB 1YJWQ 2A28A 2QYZA 5D7UA 3G71Q 2CYZB 3F70A 1IB8A 1WXBA 3BDUA 4EMKC 3OYDA 3QXEB 4MMKA 2VVKA 3M0UA 1B34B 3THKA 2RPNA 2QEXT 2OI3A 1JJ2S 4JPBW 1IHVA 1LCKA 3OSSC 1LVKA 4BI8B 1ZUYA 3EFOB 4BI3A 5IAYA 1PNJA 1Y07A 1M3CA 1KQSS 2DIQA 2DD4A 2FRWA 2A3LA 3HL8A 4M7AD 2E6ZA 4RTWA 1YJWA 1S72Q 3EG2A 1GBRA 1M9SA 4PJLA 2QASA 1NPRA 2VYTA 3G71A 1UG1A 1KFZA 2P0KA 3I35A 5L23A 1Q81R 2DEUA 4MMLA 1UJ0A 1MNDA 2HSEB 5DY9A 4M78B 1EZZB 1WIEA 4EDUA 1ZSGA 1WFWA 3A5ZB 1SSHA 3PNWC 3TQ7P 2X3XD 3CCQQ 3MP1A 4FL6A 2YLBA 2OAWA 3RR6A 2LX9A 4PJMA 2K5FA 5GAOr 2ESWA 4C8QB 1FYNA 3J80E 2ED0A 2DL7A 2KI7A 5KYYA 2FYKA 3QWXX 1KJWA 4C5HA 1S72A 1RAFB 4A4GA 1VQ9Q 3VUZA 3PMIA 4HVVA 1VQLT 1K8AR 3OS2A 2LQ8A 5GMKj 3ME9A 2PZ1A 4ESRA 1K4US 3RBBB 2KXCA 4M7DD 2GQVA 2HBPA 3CCQA 1KD1U 1N8RC 4HXJA 3HP9A 4J5YA 2BKDN 2MMPA 3TVTA 2HQHA 2EYZA 4LDWA 5LJ3j 3FB9A 1HXDA 2A08A 1K73R 5GAMg 2QQRA 2WACA 2P0QA 2MAMA 1IZ6A 8ATCB 1VQ9A 1PWTA 3CCST 4M77B 1VQ6T 1QVPA 2V8JA 2IG0A 4E2FB 3E9GA 2LQWA 4BI4A 4LE9A 3CC2T 2PUKB 1Z9QA 4XTVA 3JCMP 9ATCB 2JVVA 1H3HA 2RK2A 2RD1A 3DB3A 1X6GA 1BCMA 1TXQA 3GP8A 3BFMA 1NJIR 1PC0A 5GAN2 5CCAA 5CIUA 2YUOA 3M4YA 5CO7A 3A8GB 3O5ZA 3UATA 5GANe 5EC7A 3SB2A 3G6EQ 1ZQ1A 2O4XB 2KE9A 1UDLA 5I2SA 3C12A 5KYWB 4E7IA 1GBQA 2QTVA 2FO0A 5LJ3d 1K9MR 1WQWA 2E64A 2CREA 4C5IA 3VS3A 1YFNA 3FLGA 1U1TA 3TSZA 4BY6B 4IUQA 2CSQA 2VKNA 5IHKA 2KT1A 5J26A 4J9CA 2E3IA 1V29B 5GAOm 3VYHB 1JXOA 2EIFA 2XICA 1SRMA 1OZ2A 2RNAA 3A1PA 3SFMA 3G6EA 4KH1B 4XTUA 1G3SA 5J3BA 3MJXA 3LWHA 2YUNA 4MZMA 4BB7A 4LD9K 5IXBA 5A0GA 4AFUC 2CZ0B 1KIKA 2LNVA 2AHJB 1PRLC 2EYWA 1QWFA 3JCMQ 4IKFA 2JTMA 5CQYA 3X25B 3O8VA 1X69A 4X34A 1IGUA 5KYUA 1R8OB 4FSXA 3VUBA 2PNIA 2G6FX 5FROA 4QW2A 4Z8AA 2DIGA 4QQ6A 3QZ5B 1AVZC 3NHNA 2RHIA 2X4JA 2Z0WA 4KULA 4ZNXA 1OV3A 3HRTA 1D3BB 1UGQB 1PKSA 1MMDA 2E70A 2KGTA 4C92E 3PE0A 4B9WA 1UHCA 4Z88A 1M2OA 3GNGA 3UDCA 1VQKT 4KUDK 1B07A 3BW1A 4C92D 1Y7XA 2OTJQ 5FU6B 4C5EA 4N0AA 4XQ3A 2CGHA 4M7AG 4AT1B 1Q86R 2E3HA 2EQUA 2KSSA 4XU1A 4ZTJA 3JCMb 1JEGA 1WA7A 2LZ6B 3VYGA 4FYYB 3R6OA 3JB9J 2G3RA 1A0NB 1K8AC 4KGZB 5CK9A 3MO8A 2YSQA 3M0SA 2A37A 2VUBA 4A63B 1M1KU 2DO3A 2LQNA 3FEOA 3MEVA 3ZBDA 1TSFA 1AWWA 3CCJQ 4FIBA 1UFFA 2LQKA 4FYVB 1QW1A 4C0DB 1TOVA 5GMKl 3OA6A 1H92A 2YDLA 4DBHA 3JCMX 2J06A 2HMAA 1NPPA 4EMGA 3CC4Q 3CBMA 2JTEA 5GANj 3RERA 2OTJA 3MPUB 2DBKA 3M0RA 2HAXA 2ZPIB 4O5VA 4N0AC 1TUGB 2MK5A 2NLUA 5LJ5j 2H3JA 1K73C 3OW2A 4MDXA 2YT6A 5HK3A 5KE3A 1WHJA 2NUPB 2ZPFB 2GTJA 1N9RA 4GLMA 4M7DG 2DF6A 2JZ2A 2F2WA 3CCRQ 2KVQG 3CCJA 1NYFA 3JB9F 1WPYA 3OMGA 2VXFA 2VASA 1N9SA 1Q7YU 3X26B 2OX7A 2QA4T 2D8JA 3CC4A 3CXCP 2KDSA 2ZPGB 2GTOA 3M0TA 1NJIC 2HCKA 2CP7A 1RI0A 2RK1A 2WSEE 4FT2A 4N4GA 3SEMA 2BZ8A 3Q1JA 1M1KC 2JM8A 1YN8A 2CZ6B 2DRKA 2JJ9A 5KYXA 3HFOA 3CCRA 1R0BG 1VQ8T 1AZEA 4B9XA 5LJ5d 1ZUKA 3V7RA 3CCLT 2O9VA 2D8HA 1HD3A 1VQ5A 2X51A 1ZHIA 1Q82R 4BDZA 1U3OA 4A4EA 2QDLA 1D1AA 1UB4A 1RAAB 2A36A 4F7UF 4A4KA 1IXDA 4OMQA 2DX1A 2V8IA 2DPPB 2CP6A 2DAQA 2JMCA 4M4ZA 2A0FB 1R77A 5GAMf 2CZ1B 3OBWA 3QUIA 1BKBA 4PLIA 1CKAA 3A98A 3QIIA 3QDFA 3LGFA 1X2QA 4QVCA 3SHWA 1FMVA 1O9SA 2HSPA 1LJOA 4PJNA 3MEAA 4Y28E 4DOVA 2DRMA 4J9IA 4D6WA 3OYIA 2HQEA 2QEXA 2BUDA 1TG0A 1ZA2B 1W70A 3I55T 3M57A 2F2XA 2PUOB 4Y92A 1W2BP 4CRIA 2XD0A 4M78E 3QG1A 3UA7A 5M9OA 1YWPA 3CXCA 1RL2A 3ZEHA 1VQLQ 3EH2A 4E7SA 4F16A 1Z9ZA 2B86A 3PVQA 1E6HA 3CCVT 4M75F 5GAN6 1YHQQ 4C8QE 1C6VX 4C5GA 2YUPA 1G5VA 1AWXA 1IRXA 1SF9A 3HHTB 5FRNA 2K4YA 5GAN3 3MCAB 5J39A 1WX6A 1ZLMA 2JT4A 2QK0A 1WYXA 3JCMe 2EJFA 3CCMT 2HL3A 4JZ4A 3RKXA 5D6WA 3CCSQ 2R57A 3CQTA 2SEMA 1BB9A 1WLPB 5IHNA 4BE2A 1VQLA 2DFUA 2EQMA 2CSIA 2EGEA 3HFNA 2DA9A 1MMNA 2M9UA 4HVWA 4DBFA 4J6XA 1QVFA 1HK9A 1LNXA 1YBYA 2E4HA 2HBWA 3CC2Q 3GLXA 2FPFA 4J7IA 5D6YA 2QQAA 1QVGS 3RKYA 2DXTA 4M77E 2L5QA 3RKWA 4E47A 1NEGA 3QZ9B 4IUPA 2ENMA 1JQQA 2DILA 3M55A 2CS7A 1VQ4T 1QVFS 4F7UB 1TUDA 3CCSA 4FM4B 3T9NA 1X01A 4PJOA 2KRNA 4R56A 3L42A 2I2LA 3PGGA 1K1ZA 3CC2A 2XK0A 3CPWS 3CCUQ 2FB7A 1X6OA 2RI5A 2XMFA 4HCZA 2ABLA 1VUBA 1UECA 2DKGA 4GLKA 4JZ3A 1MMGA 1W2BA 2YLCA 4DQ2A 3A8LB 2B8AA 3E1SA 3EAEA 3GF5A 7AT1B 2DXBA 5LJ3g 3E19A 1NLOC 1UGRB 3MKDA 1VYVA 3OYMA 5EG2A 1BI2A 1D1CA 3QJ6A 2DLPA 1BI0A 1B3QA 2VB6A 5GAMh 4JJNK 1C0MA 4C92C 1ZX6A 1KSWA 4N4HA 3L2WA 3EG9B 1PG5B 1WXUA 1BBZA 1G83A 2KT8A 4M75B 4QQGA 2EBPA 2EYQA 1VA7A 4MZTA 1IHWA 4ANJA 2GF7A 3OYNA 1KD1R 1JJ2A 2P84A 4UC4A 2W0ZA 2F1LA 2XI9A 1KQSA 1ZSZB 2L89A 3NFCA 1BYMA 1YJ9T 3EHRA 3C95A 4VUBA 1NEBA 1JB0E 3P8DA 3ZFJA 2ZCFB 1VQKQ 1M2VB 1VQNT 2RQVA 3J81E 3SWNC 2Y4XA 1AEYA 2RMOA 1M90R 3CMAT 1FMKA 2L3QA 4A4HA 4F17A 1N8RU 1OYXA 1QWEA 3X24B 2KAFA 2CP2A 2X35A 2ROLA 3G4ST 2DM1A 2L3RA 2X4YA 2FZCB 3CC7T 2RQRA 1KG1A 4F04B 2D0QB 4DOWA 2JXBA 1VQKA 1OPKA 4KBMB 2RQUA 5DLQE 3FJ5A 2LJ0A 6AT1B 2EGCA 3M9QA 5IXFA 2LRQA 2M0YA 3N5BB 2E65A 2A7YA 4ORZA 2NUTA 2EQKA 1SKUB 1K76A 1YIJT 2ROTA 4OB1B 1I8FA 2PVDB 3H0FA 3OBYA 4HA8A 3H9NA 4JLIA 5GAOq 1QCOA 2IVWA 4JJDA 5FWCA 3QYGB 4GBQA 4J9DA 2QA4Q 1I5OB 1SRLA 3M59A 1B34A 1G3YA 2BZXA 2EGAA 4J9FA 1PKTA 2FZGB 4DBRA 3VS1A 2CUBA 3NMZC 3M54A 2PTKA 1B7TA 3EFOA 3VS6A 1O75A 1TUCA 1WXTA 1IREB 2YHTA 4OP0A 4CC7A 4OMNA 5GJWB 3JCMf 2DEQA 1M8MA 4AFZC 1GCQA 1I07A 1CSKA 3CCLQ 2JW4A 4WTOB 1AZGB 4M78A 4OF1A 4AFSC 2L3SA 1D0ZA 2AZSA 3SDZA 2QA4A 2QAZA 2COYA 3VS7A 1VQ7T 2O01E 4M7AF 5DLOA 3M53A 3H6ZA 4KH0B 1RAHB 3C94A 1AD5A 4C8QA 1U06A 2F2VA 1RACB 2XU8A 1ARKA 5LJ5g 4KRTA 2K3BA 5GAMe 2RJFA 1OEBA 1VQOT 1VQ8A 3RIRA 3CCLA 1GCQC 2DE0X 4HCKA 4M78C 3CMET 1IO6A 1HSQA 3CBPA 4EIKA 2JNGA 2X4XA 3OS0A 2EW3A 3PT9A 2EYXA 4KGVB 1RAGB 4J7FA 4C8QC 2BE7D 1U1SA 4M7DF 2ECZA 4LNPA 1X43A 4QT7A 2AKLA 3OW2P 3META 4M77A 2BIVA 2EVRA 1I5LA 3OYYA 3KBGA 2FL7A 1WHHA 4JJCA 1MV3A 4KT0E 3LH5A 1K8AU 5DM7R 4QQDA 2JUFA 1EFNA 4HKEA 5I22A 1T0HA 3LYIA 4D8DA 2NYSA 1M90C 1JRIA 2MWPA 1PRMC 1BIBA 2RN8A 2KYBA 5GJVB 3NPFA 2MPXC 3TSWA 2O4XA 4II1A 4XAXB 4J6WA 1XTDA 3NGPA 4M77C 5KYWA 1K73U 4PJOE 5IT9E 3S6WA 1T3SA 2P0PA 2COZA 1QQJA 3CCMQ 2CH4W 1Q81C 1GFDA 2YRVA 2K2MA 4PJOD 4IUUA 3CCVA 1WJSA 5KCOA 3UPUA 4JRKA 3WVDB 2KNBB 1KHCA 4IUVA 4DBQA 2KY9A 3A8HB 3VRZA 3RDVA 4MZPA 3IQLA 1ZUUA 2DZ9A 3REBB 2XDPA 1NJIU 2P4RA 4XTZA 4M7AB 1LOJA 3CCMA 1VQ4Q 3RESA 4JUVA 2WSFE 3X20B 4BY6C 5I11A 1SHGA 3BE3A 2O31A 3HTRA 4NL3A 2RHXA 1IGQA 3OMCA 3UA6A 1QLYA 3JCMh 2CKKA 2RB6A 1R0CB 4PNOA 3M56A 1YITT 1T3LA 2HD0A 1KQ1A 3BDLA 4F7UE 4LDXA 1NLPC 1Y96B 2DXUA 3ZL7C 1D3BA 3QO3A 3HRSA 1VQ4A 2LJ1A 5GAN5 1WHLA 4A54A 2PU9B 1VQ5Q 1MV0B 4JRQA 4M7DB 4C0ZA 3OYBA 4XU3A 1RLPC 4XU0A 4MDWA 4ATOA 2F5TX 2DETA 2DYIA 4OMOA 1WJRA 2E10A 2COWA 5AYFA 4C92F 1D09B 3MEUA 4PFOA 5GANd 4FCYA 2SRCA 1K9MC 5CVIA 5HCKA 3EGXB 1BK2A 2EKOA 2MF2A 3JB9I 4HT8A 2P4TA 2ZGWA 3PIOA 5FU6C 1ZBXA 3GOXA 5CKBA 1YJ9Q 2JM9A 4M75E 1OOTA 4HT9A 2PVOB 3NTIA 2NUPA 1QVFP 4AG2C 1VQNQ 1GFCA 2ATCB 4R55A 4Z02A 1OX8A 2QEXQ 2H8HA 2KXDA 2EQJA 4RCCA 5LL6S 3CMAQ 2GFAA 4ZGDB 3S3MA 4D8KA 3I56T 4C0DC 2E1HA 2OJ2A 4NL2A 3G4SQ 2AZVA 2VV5A 1S1NA 3REAB 2V26A 2KK4A 3EFRA 3CC7Q 3MP8A 3DKMA 2WSCE 1I4K1 1YJ9A 2DVEA 4XTXA 4XU2A 3VU3C 2RQWA 2PVGB 4ZGEB 1VQNA 3M5AA 2YWWA 1Y0MA 2M16A 5ECAA 2RA2A 3CMAA 3OYEA 1GL5A 2L2PA 2DNUA 5IHIA 3H0IA 3S3NA 1YIJQ 4L6V5 2IPOB 3G4SA 3OYHA 1W4SA 2EJ9A 4JJBA 1N5ZA 1UE9A 3CC7A 3JB9H 4M78D 2FPDA 1K0XA 5D6XA 1Q86C 5GMKi 1NG2A 4C0GA 3OYLA 2K2VA 2EPDA 3VRYA 1EIFA 2VWFA 3EHQA 3LLRA 4C8QD 2CP3A 1NZ9A 3PFSA 1ZBJA 5HY6A 5A0DA 1XJWB 1M30A 3EGUA 1YIJA 1M5Q1 1RAEB 3OS5A 4AG1C 1QVGA 4C92G 3V8JA 2FEIA 1VQ6Q 2CDTA 1Q82U 4OGEA 3LW5E 2DTHA 3VKIA 1KC8R 4OMFB 4PFZA 2MOXA 1QCNA 1U8RA 2CH4A 4C92B 1JU5C 1VQ7Q 3JCMc 2E5QA 1JJ2P 2EWNA 1VOMA 2K5IA 2DZCA 2YXYA 3L2ZA 4J83A 2DJQA 5CKEA 5C6SA 4BDYA 3E9FA 1VQMT 1KQSP 4IURA 1KQ2A 2C0TA 2LT4A 4OB0B 5IH2A 1SHFA 3CPWA 1M1GA 3OYFA 1QKWA 4M77D 2QXFA 3M0QA 3AHUA 1VQOQ 3OYJA 1VQ6A 4FW1A 2D6FA 3HSBA 1TWBA 2E6NA 1T0JA 3CMEQ 2NUZA 2GFUA 2DVJA 1VQ7A 1WJQA 2DXCA 4HCCA 2J6KA 2BZYA 4Y91A 4EMKB 1BI1A 3SWNB 4Q5WA 3QYHB 1XNIA 4TVRA 1VQPT 3L2VA 3KUFA 4LDYA 2KEAA 2K57A 1BCOA 1FMWA 4JRIA 3PVLA 4K11A 2VGMA 1M4ZA 1Q82C 2O2OA 1P92A 1VQOA 3G7ZA 2MI6A 4IIMA 4NS5A 1WHGA 3L2QA 1TH7A 4B6MA 3OQ5A 4PJOC 3CMEA 4AFQC 1KHIA 1RAIB 1UGPB 2K3YA 5GMKe 3VS0A 1OPLA 1Y57A 4FYWB 1WHMA 3PMTA 1JXMA 4DEYA 4ELZC 4LD6A 3VV0A 2XG8D 1GCPA 4F7UA 1M8VA 2RI2A 2AKKA 1G2BA 5LJ3e 2YRCA 1YI2T 3A8MB 4LXCA 2HZYA 2AT1B 4RG2A 1Q95G 4J9HA 3LWIA 2HDAA 3JCMJ 3GNFB 4NOYA 3PTAA 1MGQA 2JTFA 2ZPEB 2BTTA 2X4WA 3G1JA 3JCMW 3CCET 2IIMA 5FU7C 2RHUA 1PHTA 1W1FA 5KYYB 2V1QA 4RTZA 1VIEA 1BIAA 3CD6T 2H3EB 2RM4A 2OAUA 3H41A 2OTLT 3FIFA 2HQXA 2E41A 4OMLA 2RI3A 3OYKA 4WF2A 3EG3A 3WXMB 3EG0A 2NWMA 3A8OB 1WDXA 5I21A 3EG9A 4M7AE 1OU9A 3C0CA 1YITQ 1X6BA 1OI1A 2PQWA 4EMHA 2I0NA 2EJGA 2QG9B 4M75A 2HL5C 2QGFB 4M78G 2LT1A 4E6RA 5I2MA 1KC8C 1YJNT 3JCMd 1PM3A 1ZSZA 4JS5A 3V8KA 4YTLA 2RJDA 4C8QG 1Y71A 1M2VA 4QVZA 4QKUA 3CBOA 3URGA 4J9BA 2JOYA 1YITA 3D7SB 2DBMA 1NE8A 2HKNA 3HKSA 4RTUA 2KRMA 1SSFA 2V1RA 4M75C 1CKBA 1RUWA 1H641 4PJJA 1ZA1B 2QTXA 4L5GA 4ZN3A 4L59A 4N4IA 2XHCA 4M7DE 2CP0A 4OMPA 4X1VA 4IIOA 4A53A 1V76A 2D0NA 2J7IA 1DJ7B 1YHQT 1OZ3A 1VQ8Q 1YCSB 2FHDA 2K7AA 1ZSZC 1MHNA 4RCBA 2ED1A 1G3WA 3OS1A 2KROA 1EX4A 4RTXA 1D0XA 2LNHB 4E7KA 4M77G 4FYXB 2MCNA 5A2QE 5GANg 3S3OA 3OYCA 4C0FA 1M27C 4JDSA 5GAOl 4PK4A 2LX7A 1M90U 1KK7A 5GAOp 4RKUE 2VGNA 1FXXA 2GNCA 3I56Q 2JS0A 4KUIA 1VIFA 3TCJA 2CZ7B 1PD1A 2K5LA 3JCMV 2MYSA 5KCHA 5KE2A 2BE9B 5FWBA 4BE1A 2ZZDA 1WQ7A 4J6YA 1MUZA 5KYUB 4LDVA 2R5AA 3EG1A 1Q81U 2RHZA 4CC2A 1AT1B 1WI7A 2EQIA 1RADB 1UTIA 3CEYA 1M1KR 3RUXA 5LJ5e 3EH1A 1OULA 1KD1C 1YNZA 3UT1A 3I55Q 3I56A 4GY5A 3P8BB 4RUGA 2QQ9A 3CCUT 3KFVA 2LCLA 1F1BB 1D1BA 3V8LA 1FWZA 2F5KA 1QP3A 3CCVQ 1TTHB 2LCSA 4FU6A 2L3PA 2MIOA 1QP2A 3X28B 1AWOA 4JRPA 3OY9A 3HRUA 2QI2A 2C0OA 8AT1B 4X9CA 2KBTA 4F14A 1AHJB 1PSEA 3UF4A 3I55A 2XIDA 2GCXA 1UEBA 4OB2B 5LJ3f 1LPLA 1Q7YR 4RTTA 2XDBA 5FW9A 2DL3A 1UGSB 2FG0A 3C4SA 2DL5A 4O6JA 1RABB 4P5NA 4DA4A 4LDUA 1OX9A 1I81A 5CQXA 2Y4YA 5HK0A 4X9DA 1HYOA 5AT1B 3JB9D 3EFSA 1VQMQ 2DL4A 4OGCA 2J6FA 2QGGA 4WCIA 1YJWT 4RG8A 2JMAA 1GRIA 5KH6A 4RTYA 4PKCC 5HKCA 3G71T 4XK8E 4Z89A 4PLLA 1XOVA 2JN0A 1YCYA 4CI0C 4BD3A 1K9MU 5GAMj 2D1XA 2J05A 1VQMA 3TEEA 1VQPQ 3NTHA 1VYTA 2J6OA 2AK5A 2EFIA 1S72T 3H8ZA 4FSSA 1TS9A 4OVAA 5KYXB 5GAN7 5FLXE 1MMAA 3LGLA 2M51A 3OB9A 4A4FA 3GPLA 2CUDA 1ACMB 2R58A 1VYUA 2XDDA 3CCQT 2E12A 4BE0A 1OQKA 2GQIA 1W6XA 1M3BA 2EAYA 2VXEA 2LMJA 5CR2A 4PJOF 1VQPA 1K9AA 3EGDB 2X3WD 3DLLA 3E2UA 4M7AA 2RJCA 4KGXB 2ZPBB 3HPWA 2W10A 1UGVA 2RH2A 3R6NA 4LUEA 3OSVA 5GMKm 1VQ9T 5CKHA 3GBQA 3GIBA 5GAMd 1ABOA 1RLQC 3OW2S 1YI2Q 4E7ZA 1RI9A 1C1AA 1BU1A 3MEWA 1SPKA 1X2KA 2YRDA 2M1HA 1QVGP 4PL6A 3V7SA 4J8OA 2O88A 3VS4A 1G3TA 1M1FA 2FVUA 2CT3A 1Y96A 4FW2A 2KQWA 3QKJA 4RMOA 3PIPA 1PD0A 1G8XA 4BUGA 2GGRA 5A0LA 1SEMA 3CCEQ 4M7AC 2FPEA 1Q86U 4M75D 3J7AF 4BACA 1E7OA 2DD5A 1WZOA 4IUTA 1AOJA 5GMKh 1YI2A 2L8DA 3CD6Q 2LDMA 2HNIA 1XQHA 4M7DA 2OTLQ 3CPWP 1YWOA 2QQBA 2M02A 5LJ3h 3EGDA 2DTIA
chains in the Genus database with same CATH topology
4IIMA 3VS1A 2CUBA 3NMZC 3JV3A 2KGTA 2PTKA 4CC4B 3PE0A 1NYGA 3VS6A 1UHCA 4Z88A 1TUCA 2L0AA 4AFQC 1WXTA 1B07A 1QKXA 4CC7A 4OMNA 5GJWB 1M8MA 4AFZC 1GCQA 1ABQA 1I07A 3VS0A 1CSKA 1OPLA 1Y57A 1J3TA 1UJYA 1JXMA 2JW4A 1AZGB 4DEYA 1JEGA 1WA7A 2LZ6B 3QWYA 4AFSC 2L3SA 2AZSA 3VS7A 1A0NB 1GCPA 3U23A 2AKKA 2YSQA 3M0SA 2A37A 1G2BA 4A63B 3VS2A 1I0CA 2LQNA 1K0SA 1AWWA 1AD5A 4DEXA 1UFFA 1UHFA 2FRYA 1U06A 2LJ3A 2LP5A 1HJDA 1H92A 2F2VA 2YDLA 2J06A 1ARKA 2EYYA 2HEQA 4J9HA 4KRTA 2JTEA 2K3BA 2HDAA 3VS5A 3I9QA 3H0HA 4LN2A 2DBKA 3M0RA 4OMMA 1OEBA 2BTTA 2KYMA 1GCQC 2DE0X 4HCKA 2YT6A 1I1JA 2IIMA 1NM7A 2GTJA 2GBQA 4GLMA 1IO6A 1HSQA 1PHTA 1JO8A 1W1FA 4EIKA 2DF6A 2V1QA 2F2WA 4RTZA 2EW3A 1NYFA 2EYXA 3H41A 4OMLA 4LUDA 2D8JA 2ECZA 2YUQA 4LNPA 1X43A 2GTOA 3M0TA 3EG3A 4QT7A 2AKLA 1U5SA 3EG0A 2NWMA 2EVRA 1WDXA 2HCKA 2RF0A 2K9GA 3C0CA 3SEMA 1X6BA 2BZ8A 1YP5A 1H8KA 4JJCA 1MV3A 2JM8A 1YN8A 3LH5A 2I0NA 2DRKA 2EKHA 1EFNA 5I22A 1T0HA 4E6RA 4D8DA 1AZEA 2E5KA 2CT4A 1ZUKA 1M3AA 2O9VA 2D8HA 1HD3A 3M0PA 1UUEA 3I5RA 1PRMC 1U3OA 2RN8A 5GJVB 2KYBA 2QDLA 3NPFA 4R0KA 3TSWA 4J9EA 2K6DA 2A36A 3NGPA 4OMQA 4J9BA 2DX1A 3RNJA 1T3SA 2CH4W 2DBMA 4RTUA 1GFDA 2KRMA 2JMCA 4M4ZA 2K2MA 4CC3A 2K79A 2V1RA 2JS2A 2DMOA 1CKBA 1RUWA 2KNBB 1CKAA 3A98A 4OMPA 4X1VA 4IIOA 1X2QA 3SHWA 2O9SA 2HSPA 3VRZA 2D0NA 2J7IA 3IQLA 1YCSB 4RTVA 1ZUUA 2K7AA 1QCFA 3REBB 2DRMA 2ED1A 1AWJA 4J9IA 2P4RA 2C0IA 4J9GA 2KROA 4RTXA 2LNHB 1V1CA 5I11A 1SHGA 2MCNA 1TG0A 1E6GA 2O31A 1W70A 1M27C 2F2XA 3UA6A 4Y92A 2KRSA 1QLYA 2LX7A 3UA7A 4HVUA 1T3LA 2GNCA 1YWPA 3I5SA 2JS0A 3ULRB 4F16A 1NLPC 1Z9ZA 2B86A 2KR3A 3PVQA 1E6HA 3ZL7C 1X27A 2DL8A 5FWBA 2DYBA 1MUZA 2RQTA 2LJ1A 3EG1A 2YUPA 2A28A 4CC2A 1AWXA 1WI7A 2EQIA 1MV0B 1UTIA 1WX6A 1WXBA 1ZLMA 2JT4A 1WYXA 1RLPC 2VVKA 3M0UA 1YNZA 4JZ4A 3THKA 2RPNA 3CQTA 2OI3A 2SEMA 1BB9A 1WLPB 4RUGA 5IHNA 4JPBW 2CSIA 2EGEA 1LCKA 2DA9A 1ZUYA 3KFVA 4HVWA 1PNJA 4OMOA 1M3CA 2HBWA 2FRWA 2FPFA 4RTWA 2LCSA 2SRCA 3EG2A 1GBRA 2L3PA 2MIOA 5HCKA 1AWOA 1UG1A 1KFZA 1BK2A 3I35A 5L23A 1NEGA 1UJ0A 2ENMA 1JQQA 1WIEA 2C0OA 1ZSGA 2KBTA 1WFWA 2DILA 1SSHA 4F14A 2X3XD 3UF4A 1TUDA 2OAWA 2JM9A 1OOTA 4RTTA 4AG2C 5FW9A 1GFCA 2DL3A 2KRNA 2FG0A 2ESWA 1FYNA 2H8HA 2DL5A 2KXDA 1K1ZA 2ED0A 2DL7A 3QWXX 1KJWA 4D8KA 2XMFA 4HVVA 2ABLA 4JZ3A 1UECA 2OJ2A 2AZVA 2DL4A 3REAB 1S1NA 2PZ1A 4ESRA 1K4US 3RBBB 2KXCA 2J6FA 4WCIA 1NLOC 4HXJA 2RQWA 2JMAA 1GRIA 4RTYA 1VYVA 3TVTA 1Y0MA 2EYZA 4Z89A 1XOVA 2DLPA 1B3QA 5ECAA 2A08A 1GL5A 2L2PA 2DNUA 5IHIA 1PWTA 1ZX6A 3H0IA 1KSWA 2D1XA 2J05A 2LQWA 4JJBA 1N5ZA 1UE9A 1WXUA 1BBZA 4LE9A 1G83A 1Z9QA 2KT8A 2FPDA 1H3HA 1VYTA 1K0XA 2J6OA 2AK5A 2EBPA 4FSSA 1VA7A 1NG2A 1X6GA 2EPDA 3VRYA 2M51A 2VWFA 2W0ZA 3EHQA 2YUOA 2CUDA 1VYUA 3O5ZA 3UATA 5EC7A 3EHRA 1ZBJA 1NEBA 2GQIA 2KE9A 1W6XA 1UDLA 1M3BA 1M30A 3EGUA 2RQVA 1GBQA 4AG1C 2LMJA 2FO0A 1AEYA 2FEIA 2RMOA 1K9AA 2CREA 2CDTA 2X3WD 3VS3A 1FMKA 3TSZA 2W10A 2CSQA 2MOXA 1UGVA 2VKNA 2CH4A 2L3QA 3R6NA 4F17A 4LUEA 2KT1A 5IHKA 1JU5C 1QWEA 4J9CA 3GBQA 1JXOA 1ABOA 2DJQA 1RLQC 2ROLA 1SRMA 2DM1A 2RNAA 1RI9A 2C0TA 2RQRA 5IH2A 1BU1A 1SHFA 1SPKA 1X2KA 2JXBA 1OPKA 2YUNA 2O88A 2RQUA 3VS4A 5IXBA 1QKWA 3M0QA 4AFUC 1KIKA 3FJ5A 2LJ0A 2CT3A 2EGCA 1PRLC 5IXFA 2EYWA 1QWFA 2M0YA 2GGRA 1SEMA 1T0JA 2FPEA 2NUZA 1X69A 2DVJA 4ORZA 2PNIA 2G6FX 2J6KA 1E7OA 2BZYA 1K76A 1AOJA 2ROTA 3H0FA 4Z8AA 1AVZC 2KEAA 3NHNA 4JJDA 5FWCA 4ZNXA 4GBQA 3PVLA 1OV3A 4J9DA 1SRLA 1YWOA 4K11A 2BZXA 2O2OA 2EGAA 4J9FA 1PKSA 1PKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIM A;  3VS1 A;  2CUB A;  3NMZ C;  3JV3 A;  2KGT A;  2PTK A;  4CC4 B;  3PE0 A;  1NYG A;  3VS6 A;  1UHC A;  4Z88 A;  1TUC A;  2L0A A;  4AFQ C;  1WXT A;  1B07 A;  1QKX A;  4CC7 A;  4OMN A;  5GJW B;  1M8M A;  4AFZ C;  1GCQ A;  1ABQ A;  1I07 A;  3VS0 A;  1CSK A;  1OPL A;  1Y57 A;  1J3T A;  1UJY A;  1JXM A;  2JW4 A;  1AZG B;  4DEY A;  1JEG A;  1WA7 A;  2LZ6 B;  3QWY A;  4AFS C;  2L3S A;  2AZS A;  3VS7 A;  1A0N B;  1GCP A;  3U23 A;  2AKK A;  2YSQ A;  3M0S A;  2A37 A;  1G2B A;  4A63 B;  3VS2 A;  1I0C A;  2LQN A;  1K0S A;  1AWW A;  1AD5 A;  4DEX A;  1UFF A;  1UHF A;  2FRY A;  1U06 A;  2LJ3 A;  2LP5 A;  1HJD A;  1H92 A;  2F2V A;  2YDL A;  2J06 A;  1ARK A;  2EYY A;  2HEQ A;  4J9H A;  4KRT A;  2JTE A;  2K3B A;  2HDA A;  3VS5 A;  3I9Q A;  3H0H A;  4LN2 A;  2DBK A;  3M0R A;  4OMM A;  1OEB A;  2BTT A;  2KYM A;  1GCQ C;  2DE0 X;  4HCK A;  2YT6 A;  1I1J A;  2IIM A;  1NM7 A;  2GTJ A;  2GBQ A;  4GLM A;  1IO6 A;  1HSQ A;  1PHT A;  1JO8 A;  1W1F A;  4EIK A;  2DF6 A;  2V1Q A;  2F2W A;  4RTZ A;  2EW3 A;  1NYF A;  2EYX A;  3H41 A;  4OML A;  4LUD A;  2D8J A;  2ECZ A;  2YUQ A;  4LNP A;  1X43 A;  2GTO A;  3M0T A;  3EG3 A;  4QT7 A;  2AKL A;  1U5S A;  3EG0 A;  2NWM A;  2EVR A;  1WDX A;  2HCK A;  2RF0 A;  2K9G A;  3C0C A;  3SEM A;  1X6B A;  2BZ8 A;  1YP5 A;  1H8K A;  4JJC A;  1MV3 A;  2JM8 A;  1YN8 A;  3LH5 A;  2I0N A;  2DRK A;  2EKH A;  1EFN A;  5I22 A;  1T0H A;  4E6R A;  4D8D A;  1AZE A;  2E5K A;  2CT4 A;  1ZUK A;  1M3A A;  2O9V A;  2D8H A;  1HD3 A;  3M0P A;  1UUE A;  3I5R A;  1PRM C;  1U3O A;  2RN8 A;  5GJV B;  2KYB A;  2QDL A;  3NPF A;  4R0K A;  3TSW A;  4J9E A;  2K6D A;  2A36 A;  3NGP A;  4OMQ A;  4J9B A;  2DX1 A;  3RNJ A;  1T3S A;  2CH4 W;  2DBM A;  4RTU A;  1GFD A;  2KRM A;  2JMC A;  4M4Z A;  2K2M A;  4CC3 A;  2K79 A;  2V1R A;  2JS2 A;  2DMO A;  1CKB A;  1RUW A;  2KNB B;  1CKA A;  3A98 A;  4OMP A;  4X1V A;  4IIO A;  1X2Q A;  3SHW A;  2O9S A;  2HSP A;  3VRZ A;  2D0N A;  2J7I A;  3IQL A;  1YCS B;  4RTV A;  1ZUU A;  2K7A A;  1QCF A;  3REB B;  2DRM A;  2ED1 A;  1AWJ A;  4J9I A;  2P4R A;  2C0I A;  4J9G A;  2KRO A;  4RTX A;  2LNH B;  1V1C A;  5I11 A;  1SHG A;  2MCN A;  1TG0 A;  1E6G A;  2O31 A;  1W70 A;  1M27 C;  2F2X A;  3UA6 A;  4Y92 A;  2KRS A;  1QLY A;  2LX7 A;  3UA7 A;  4HVU A;  1T3L A;  2GNC A;  1YWP A;  3I5S A;  2JS0 A;  3ULR B;  4F16 A;  1NLP C;  1Z9Z A;  2B86 A;  2KR3 A;  3PVQ A;  1E6H A;  3ZL7 C;  1X27 A;  2DL8 A;  5FWB A;  2DYB A;  1MUZ A;  2RQT A;  2LJ1 A;  3EG1 A;  2YUP A;  2A28 A;  4CC2 A;  1AWX A;  1WI7 A;  2EQI A;  1MV0 B;  1UTI A;  1WX6 A;  1WXB A;  1ZLM A;  2JT4 A;  1WYX A;  1RLP C;  2VVK A;  3M0U A;  1YNZ A;  4JZ4 A;  3THK A;  2RPN A;  3CQT A;  2OI3 A;  2SEM A;  1BB9 A;  1WLP B;  4RUG A;  5IHN A;  4JPB W;  2CSI A;  2EGE A;  1LCK A;  2DA9 A;  1ZUY A;  3KFV A;  4HVW A;  1PNJ A;  4OMO A;  1M3C A;  2HBW A;  2FRW A;  2FPF A;  4RTW A;  2LCS A;  2SRC A;  3EG2 A;  1GBR A;  2L3P A;  2MIO A;  5HCK A;  1AWO A;  1UG1 A;  1KFZ A;  1BK2 A;  3I35 A;  5L23 A;  1NEG A;  1UJ0 A;  2ENM A;  1JQQ A;  1WIE A;  2C0O A;  1ZSG A;  2KBT A;  1WFW A;  2DIL A;  1SSH A;  4F14 A;  2X3X D;  3UF4 A;  1TUD A;  2OAW A;  2JM9 A;  1OOT A;  4RTT A;  4AG2 C;  5FW9 A;  1GFC A;  2DL3 A;  2KRN A;  2FG0 A;  2ESW A;  1FYN A;  2H8H A;  2DL5 A;  2KXD A;  1K1Z A;  2ED0 A;  2DL7 A;  3QWX X;  1KJW A;  4D8K A;  2XMF A;  4HVV A;  2ABL A;  4JZ3 A;  1UEC A;  2OJ2 A;  2AZV A;  2DL4 A;  3REA B;  1S1N A;  2PZ1 A;  4ESR A;  1K4U S;  3RBB B;  2KXC A;  2J6F A;  4WCI A;  1NLO C;  4HXJ A;  2RQW A;  2JMA A;  1GRI A;  4RTY A;  1VYV A;  3TVT A;  1Y0M A;  2EYZ A;  4Z89 A;  1XOV A;  2DLP A;  1B3Q A;  5ECA A;  2A08 A;  1GL5 A;  2L2P A;  2DNU A;  5IHI A;  1PWT A;  1ZX6 A;  3H0I A;  1KSW A;  2D1X A;  2J05 A;  2LQW A;  4JJB A;  1N5Z A;  1UE9 A;  1WXU A;  1BBZ A;  4LE9 A;  1G83 A;  1Z9Q A;  2KT8 A;  2FPD A;  1H3H A;  1VYT A;  1K0X A;  2J6O A;  2AK5 A;  2EBP A;  4FSS A;  1VA7 A;  1NG2 A;  1X6G A;  2EPD A;  3VRY A;  2M51 A;  2VWF A;  2W0Z A;  3EHQ A;  2YUO A;  2CUD A;  1VYU A;  3O5Z A;  3UAT A;  5EC7 A;  3EHR A;  1ZBJ A;  1NEB A;  2GQI A;  2KE9 A;  1W6X A;  1UDL A;  1M3B A;  1M30 A;  3EGU A;  2RQV A;  1GBQ A;  4AG1 C;  2LMJ A;  2FO0 A;  1AEY A;  2FEI A;  2RMO A;  1K9A A;  2CRE A;  2CDT A;  2X3W D;  3VS3 A;  1FMK A;  3TSZ A;  2W10 A;  2CSQ A;  2MOX A;  1UGV A;  2VKN A;  2CH4 A;  2L3Q A;  3R6N A;  4F17 A;  4LUE A;  2KT1 A;  5IHK A;  1JU5 C;  1QWE A;  4J9C A;  3GBQ A;  1JXO A;  1ABO A;  2DJQ A;  1RLQ C;  2ROL A;  1SRM A;  2DM1 A;  2RNA A;  1RI9 A;  2C0T A;  2RQR A;  5IH2 A;  1BU1 A;  1SHF A;  1SPK A;  1X2K A;  2JXB A;  1OPK A;  2YUN A;  2O88 A;  2RQU A;  3VS4 A;  5IXB A;  1QKW A;  3M0Q A;  4AFU C;  1KIK A;  3FJ5 A;  2LJ0 A;  2CT3 A;  2EGC A;  1PRL C;  5IXF A;  2EYW A;  1QWF A;  2M0Y A;  2GGR A;  1SEM A;  1T0J A;  2FPE A;  2NUZ A;  1X69 A;  2DVJ A;  4ORZ A;  2PNI A;  2G6F X;  2J6K A;  1E7O A;  2BZY A;  1K76 A;  1AOJ A;  2ROT A;  3H0F A;  4Z8A A;  1AVZ C;  2KEA A;  3NHN A;  4JJD A;  5FWC A;  4ZNX A;  4GBQ A;  3PVL A;  1OV3 A;  4J9D A;  1SRL A;  1YWO A;  4K11 A;  2BZX A;  2O2O A;  2EGA A;  4J9F A;  1PKS A;  1PKT A; 
#chains in the Genus database with same CATH topology
 3JV3 A;  5CKF A;  2ZPH B;  4CC4 B;  3V7C A;  2ZAE A;  1NYG A;  3JRZ A;  5CAI A;  3CCE A;  3M4G A;  5GAN f;  2L0A A;  1Q7Y C;  3G6E T;  2CP5 A;  3MHX A;  3RMS A;  5LJ5 f;  2RHY A;  1QMC A;  1QKX A;  3TRE A;  3CD6 A;  1ABQ A;  3EGX A;  1D0Y A;  2K3X A;  3VJP A;  1J3T A;  1UJY A;  1YJN Q;  2OTL A;  1N6A A;  4M7D C;  3QWY A;  1BI3 A;  2DER A;  1PSF A;  2QQS A;  3U23 A;  3FDR A;  3VS2 A;  1I0C A;  1K0S A;  4DEX A;  1UHF A;  2FRY A;  2LJ3 A;  2LP5 A;  1HJD A;  3JAM E;  2DTO A;  1X75 C;  3QDR B;  2EYY A;  2HEQ A;  5CKD A;  3JCM g;  3VS5 A;  3I9Q A;  2AIR B;  3H0H A;  2RJE A;  4LN2 A;  4PJO G;  4OMM A;  1H3Z A;  4JLG A;  2KYM A;  1YJN A;  4ZN1 A;  1I1J A;  2DJZ A;  2LCC A;  4JS4 A;  4PJO B;  3JB9 G;  3FC3 A;  1NM7 A;  5GAN 4;  2GBQ A;  4PFP A;  1JO8 A;  1GXI E;  3DLM A;  5KYN A;  3ER0 A;  1WNL A;  3CXC S;  3UWN A;  1N27 A;  2D9T A;  2V8K A;  2MWO A;  4LUD A;  4QVD A;  3CPF A;  2YUQ A;  4E7J A;  4AMC A;  3QJY A;  1U5S A;  3FJP A;  3ASK A;  4E7H A;  2DK3 A;  1WHK A;  2RF0 A;  3BY7 A;  2K9G A;  2KMT A;  4OB3 B;  5L8R E;  2QDY B;  1YHQ A;  1YP5 A;  1H8K A;  2RO0 A;  2EKH A;  2HKQ B;  2OTJ T;  3QPH A;  3FRN A;  2E5K A;  2CT4 A;  3OYG A;  1M3A A;  4F7U G;  3M0P A;  1UUE A;  3I5R A;  3LX7 A;  1N8R R;  4R0K A;  4M78 F;  3DB4 A;  5FU7 B;  4J9E A;  3P8H A;  2K6D A;  4HCB A;  5FRM A;  3SD4 A;  3KXT A;  3RNJ A;  3CCJ T;  3TU4 K;  2XKO C;  3INZ A;  3QHS A;  2LTO A;  5IN1 A;  2VC8 A;  4C8Q F;  4CC3 A;  2K79 A;  2M0O A;  4XTY A;  4ZTF A;  5GAN 8;  3CC4 T;  3L1A A;  4C92 A;  2JS2 A;  2DMO A;  3M58 A;  1SG5 A;  3MP6 A;  2LVM A;  2LC4 A;  4FT4 A;  2O9S A;  4ME7 A;  2F69 A;  4RTV A;  1OU8 A;  1QCF A;  2X9H A;  1FX7 A;  1TU0 B;  3JSC A;  1AWJ A;  3LH0 A;  5GAO n;  2C0I A;  4J9G A;  3CCR T;  3QBY A;  1VQ5 T;  2R5M A;  1V1C A;  4ZGJ B;  3QSU A;  1W2B S;  5GAN h;  3CCU A;  4EPC A;  1E6G A;  4ELY C;  2FZK B;  3NTK A;  5LJ5 h;  4V2S A;  4E7L A;  4XTW A;  2KRS A;  4EMK A;  1NBE B;  5C0M A;  4M77 F;  3SWN A;  1JBM A;  3OYA A;  1MNE A;  4M75 G;  1KC8 U;  3RMQ A;  4HVU A;  3AT1 B;  2Y90 A;  3I5S A;  3ULR B;  3WVE B;  2KR3 A;  2C06 A;  1PCX A;  1X27 A;  2DL8 A;  3L2U A;  1WGS A;  2DYB A;  2RQT A;  3L2R A;  2NUT B;  1YJW Q;  2A28 A;  2QYZ A;  5D7U A;  3G71 Q;  2CYZ B;  3F70 A;  1IB8 A;  1WXB A;  3BDU A;  4EMK C;  3OYD A;  3QXE B;  4MMK A;  2VVK A;  3M0U A;  1B34 B;  3THK A;  2RPN A;  2QEX T;  2OI3 A;  1JJ2 S;  4JPB W;  1IHV A;  1LCK A;  3OSS C;  1LVK A;  4BI8 B;  1ZUY A;  3EFO B;  4BI3 A;  5IAY A;  1PNJ A;  1Y07 A;  1M3C A;  1KQS S;  2DIQ A;  2DD4 A;  2FRW A;  2A3L A;  3HL8 A;  4M7A D;  2E6Z A;  4RTW A;  1YJW A;  1S72 Q;  3EG2 A;  1GBR A;  1M9S A;  4PJL A;  2QAS A;  1NPR A;  2VYT A;  3G71 A;  1UG1 A;  1KFZ A;  2P0K A;  3I35 A;  5L23 A;  1Q81 R;  2DEU A;  4MML A;  1UJ0 A;  1MND A;  2HSE B;  5DY9 A;  4M78 B;  1EZZ B;  1WIE A;  4EDU A;  1ZSG A;  1WFW A;  3A5Z B;  1SSH A;  3PNW C;  3TQ7 P;  2X3X D;  3CCQ Q;  3MP1 A;  4FL6 A;  2YLB A;  2OAW A;  3RR6 A;  2LX9 A;  4PJM A;  2K5F A;  5GAO r;  2ESW A;  4C8Q B;  1FYN A;  3J80 E;  2ED0 A;  2DL7 A;  2KI7 A;  5KYY A;  2FYK A;  3QWX X;  1KJW A;  4C5H A;  1S72 A;  1RAF B;  4A4G A;  1VQ9 Q;  3VUZ A;  3PMI A;  4HVV A;  1VQL T;  1K8A R;  3OS2 A;  2LQ8 A;  5GMK j;  3ME9 A;  2PZ1 A;  4ESR A;  1K4U S;  3RBB B;  2KXC A;  4M7D D;  2GQV A;  2HBP A;  3CCQ A;  1KD1 U;  1N8R C;  4HXJ A;  3HP9 A;  4J5Y A;  2BKD N;  2MMP A;  3TVT A;  2HQH A;  2EYZ A;  4LDW A;  5LJ3 j;  3FB9 A;  1HXD A;  2A08 A;  1K73 R;  5GAM g;  2QQR A;  2WAC A;  2P0Q A;  2MAM A;  1IZ6 A;  8ATC B;  1VQ9 A;  1PWT A;  3CCS T;  4M77 B;  1VQ6 T;  1QVP A;  2V8J A;  2IG0 A;  4E2F B;  3E9G A;  2LQW A;  4BI4 A;  4LE9 A;  3CC2 T;  2PUK B;  1Z9Q A;  4XTV A;  3JCM P;  9ATC B;  2JVV A;  1H3H A;  2RK2 A;  2RD1 A;  3DB3 A;  1X6G A;  1BCM A;  1TXQ A;  3GP8 A;  3BFM A;  1NJI R;  1PC0 A;  5GAN 2;  5CCA A;  5CIU A;  2YUO A;  3M4Y A;  5CO7 A;  3A8G B;  3O5Z A;  3UAT A;  5GAN e;  5EC7 A;  3SB2 A;  3G6E Q;  1ZQ1 A;  2O4X B;  2KE9 A;  1UDL A;  5I2S A;  3C12 A;  5KYW B;  4E7I A;  1GBQ A;  2QTV A;  2FO0 A;  5LJ3 d;  1K9M R;  1WQW A;  2E64 A;  2CRE A;  4C5I A;  3VS3 A;  1YFN A;  3FLG A;  1U1T A;  3TSZ A;  4BY6 B;  4IUQ A;  2CSQ A;  2VKN A;  5IHK A;  2KT1 A;  5J26 A;  4J9C A;  2E3I A;  1V29 B;  5GAO m;  3VYH B;  1JXO A;  2EIF A;  2XIC A;  1SRM A;  1OZ2 A;  2RNA A;  3A1P A;  3SFM A;  3G6E A;  4KH1 B;  4XTU A;  1G3S A;  5J3B A;  3MJX A;  3LWH A;  2YUN A;  4MZM A;  4BB7 A;  4LD9 K;  5IXB A;  5A0G A;  4AFU C;  2CZ0 B;  1KIK A;  2LNV A;  2AHJ B;  1PRL C;  2EYW A;  1QWF A;  3JCM Q;  4IKF A;  2JTM A;  5CQY A;  3X25 B;  3O8V A;  1X69 A;  4X34 A;  1IGU A;  5KYU A;  1R8O B;  4FSX A;  3VUB A;  2PNI A;  2G6F X;  5FRO A;  4QW2 A;  4Z8A A;  2DIG A;  4QQ6 A;  3QZ5 B;  1AVZ C;  3NHN A;  2RHI A;  2X4J A;  2Z0W A;  4KUL A;  4ZNX A;  1OV3 A;  3HRT A;  1D3B B;  1UGQ B;  1PKS A;  1MMD A;  2E70 A;  2KGT A;  4C92 E;  3PE0 A;  4B9W A;  1UHC A;  4Z88 A;  1M2O A;  3GNG A;  3UDC A;  1VQK T;  4KUD K;  1B07 A;  3BW1 A;  4C92 D;  1Y7X A;  2OTJ Q;  5FU6 B;  4C5E A;  4N0A A;  4XQ3 A;  2CGH A;  4M7A G;  4AT1 B;  1Q86 R;  2E3H A;  2EQU A;  2KSS A;  4XU1 A;  4ZTJ A;  3JCM b;  1JEG A;  1WA7 A;  2LZ6 B;  3VYG A;  4FYY B;  3R6O A;  3JB9 J;  2G3R A;  1A0N B;  1K8A C;  4KGZ B;  5CK9 A;  3MO8 A;  2YSQ A;  3M0S A;  2A37 A;  2VUB A;  4A63 B;  1M1K U;  2DO3 A;  2LQN A;  3FEO A;  3MEV A;  3ZBD A;  1TSF A;  1AWW A;  3CCJ Q;  4FIB A;  1UFF A;  2LQK A;  4FYV B;  1QW1 A;  4C0D B;  1TOV A;  5GMK l;  3OA6 A;  1H92 A;  2YDL A;  4DBH A;  3JCM X;  2J06 A;  2HMA A;  1NPP A;  4EMG A;  3CC4 Q;  3CBM A;  2JTE A;  5GAN j;  3RER A;  2OTJ A;  3MPU B;  2DBK A;  3M0R A;  2HAX A;  2ZPI B;  4O5V A;  4N0A C;  1TUG B;  2MK5 A;  2NLU A;  5LJ5 j;  2H3J A;  1K73 C;  3OW2 A;  4MDX A;  2YT6 A;  5HK3 A;  5KE3 A;  1WHJ A;  2NUP B;  2ZPF B;  2GTJ A;  1N9R A;  4GLM A;  4M7D G;  2DF6 A;  2JZ2 A;  2F2W A;  3CCR Q;  2KVQ G;  3CCJ A;  1NYF A;  3JB9 F;  1WPY A;  3OMG A;  2VXF A;  2VAS A;  1N9S A;  1Q7Y U;  3X26 B;  2OX7 A;  2QA4 T;  2D8J A;  3CC4 A;  3CXC P;  2KDS A;  2ZPG B;  2GTO A;  3M0T A;  1NJI C;  2HCK A;  2CP7 A;  1RI0 A;  2RK1 A;  2WSE E;  4FT2 A;  4N4G A;  3SEM A;  2BZ8 A;  3Q1J A;  1M1K C;  2JM8 A;  1YN8 A;  2CZ6 B;  2DRK A;  2JJ9 A;  5KYX A;  3HFO A;  3CCR A;  1R0B G;  1VQ8 T;  1AZE A;  4B9X A;  5LJ5 d;  1ZUK A;  3V7R A;  3CCL T;  2O9V A;  2D8H A;  1HD3 A;  1VQ5 A;  2X51 A;  1ZHI A;  1Q82 R;  4BDZ A;  1U3O A;  4A4E A;  2QDL A;  1D1A A;  1UB4 A;  1RAA B;  2A36 A;  4F7U F;  4A4K A;  1IXD A;  4OMQ A;  2DX1 A;  2V8I A;  2DPP B;  2CP6 A;  2DAQ A;  2JMC A;  4M4Z A;  2A0F B;  1R77 A;  5GAM f;  2CZ1 B;  3OBW A;  3QUI A;  1BKB A;  4PLI A;  1CKA A;  3A98 A;  3QII A;  3QDF A;  3LGF A;  1X2Q A;  4QVC A;  3SHW A;  1FMV A;  1O9S A;  2HSP A;  1LJO A;  4PJN A;  3MEA A;  4Y28 E;  4DOV A;  2DRM A;  4J9I A;  4D6W A;  3OYI A;  2HQE A;  2QEX A;  2BUD A;  1TG0 A;  1ZA2 B;  1W70 A;  3I55 T;  3M57 A;  2F2X A;  2PUO B;  4Y92 A;  1W2B P;  4CRI A;  2XD0 A;  4M78 E;  3QG1 A;  3UA7 A;  5M9O A;  1YWP A;  3CXC A;  1RL2 A;  3ZEH A;  1VQL Q;  3EH2 A;  4E7S A;  4F16 A;  1Z9Z A;  2B86 A;  3PVQ A;  1E6H A;  3CCV T;  4M75 F;  5GAN 6;  1YHQ Q;  4C8Q E;  1C6V X;  4C5G A;  2YUP A;  1G5V A;  1AWX A;  1IRX A;  1SF9 A;  3HHT B;  5FRN A;  2K4Y A;  5GAN 3;  3MCA B;  5J39 A;  1WX6 A;  1ZLM A;  2JT4 A;  2QK0 A;  1WYX A;  3JCM e;  2EJF A;  3CCM T;  2HL3 A;  4JZ4 A;  3RKX A;  5D6W A;  3CCS Q;  2R57 A;  3CQT A;  2SEM A;  1BB9 A;  1WLP B;  5IHN A;  4BE2 A;  1VQL A;  2DFU A;  2EQM A;  2CSI A;  2EGE A;  3HFN A;  2DA9 A;  1MMN A;  2M9U A;  4HVW A;  4DBF A;  4J6X A;  1QVF A;  1HK9 A;  1LNX A;  1YBY A;  2E4H A;  2HBW A;  3CC2 Q;  3GLX A;  2FPF A;  4J7I A;  5D6Y A;  2QQA A;  1QVG S;  3RKY A;  2DXT A;  4M77 E;  2L5Q A;  3RKW A;  4E47 A;  1NEG A;  3QZ9 B;  4IUP A;  2ENM A;  1JQQ A;  2DIL A;  3M55 A;  2CS7 A;  1VQ4 T;  1QVF S;  4F7U B;  1TUD A;  3CCS A;  4FM4 B;  3T9N A;  1X01 A;  4PJO A;  2KRN A;  4R56 A;  3L42 A;  2I2L A;  3PGG A;  1K1Z A;  3CC2 A;  2XK0 A;  3CPW S;  3CCU Q;  2FB7 A;  1X6O A;  2RI5 A;  2XMF A;  4HCZ A;  2ABL A;  1VUB A;  1UEC A;  2DKG A;  4GLK A;  4JZ3 A;  1MMG A;  1W2B A;  2YLC A;  4DQ2 A;  3A8L B;  2B8A A;  3E1S A;  3EAE A;  3GF5 A;  7AT1 B;  2DXB A;  5LJ3 g;  3E19 A;  1NLO C;  1UGR B;  3MKD A;  1VYV A;  3OYM A;  5EG2 A;  1BI2 A;  1D1C A;  3QJ6 A;  2DLP A;  1BI0 A;  1B3Q A;  2VB6 A;  5GAM h;  4JJN K;  1C0M A;  4C92 C;  1ZX6 A;  1KSW A;  4N4H A;  3L2W A;  3EG9 B;  1PG5 B;  1WXU A;  1BBZ A;  1G83 A;  2KT8 A;  4M75 B;  4QQG A;  2EBP A;  2EYQ A;  1VA7 A;  4MZT A;  1IHW A;  4ANJ A;  2GF7 A;  3OYN A;  1KD1 R;  1JJ2 A;  2P84 A;  4UC4 A;  2W0Z A;  2F1L A;  2XI9 A;  1KQS A;  1ZSZ B;  2L89 A;  3NFC A;  1BYM A;  1YJ9 T;  3EHR A;  3C95 A;  4VUB A;  1NEB A;  1JB0 E;  3P8D A;  3ZFJ A;  2ZCF B;  1VQK Q;  1M2V B;  1VQN T;  2RQV A;  3J81 E;  3SWN C;  2Y4X A;  1AEY A;  2RMO A;  1M90 R;  3CMA T;  1FMK A;  2L3Q A;  4A4H A;  4F17 A;  1N8R U;  1OYX A;  1QWE A;  3X24 B;  2KAF A;  2CP2 A;  2X35 A;  2ROL A;  3G4S T;  2DM1 A;  2L3R A;  2X4Y A;  2FZC B;  3CC7 T;  2RQR A;  1KG1 A;  4F04 B;  2D0Q B;  4DOW A;  2JXB A;  1VQK A;  1OPK A;  4KBM B;  2RQU A;  5DLQ E;  3FJ5 A;  2LJ0 A;  6AT1 B;  2EGC A;  3M9Q A;  5IXF A;  2LRQ A;  2M0Y A;  3N5B B;  2E65 A;  2A7Y A;  4ORZ A;  2NUT A;  2EQK A;  1SKU B;  1K76 A;  1YIJ T;  2ROT A;  4OB1 B;  1I8F A;  2PVD B;  3H0F A;  3OBY A;  4HA8 A;  3H9N A;  4JLI A;  5GAO q;  1QCO A;  2IVW A;  4JJD A;  5FWC A;  3QYG B;  4GBQ A;  4J9D A;  2QA4 Q;  1I5O B;  1SRL A;  3M59 A;  1B34 A;  1G3Y A;  2BZX A;  2EGA A;  4J9F A;  1PKT A;  2FZG B;  4DBR A;  3VS1 A;  2CUB A;  3NMZ C;  3M54 A;  2PTK A;  1B7T A;  3EFO A;  3VS6 A;  1O75 A;  1TUC A;  1WXT A;  1IRE B;  2YHT A;  4OP0 A;  4CC7 A;  4OMN A;  5GJW B;  3JCM f;  2DEQ A;  1M8M A;  4AFZ C;  1GCQ A;  1I07 A;  1CSK A;  3CCL Q;  2JW4 A;  4WTO B;  1AZG B;  4M78 A;  4OF1 A;  4AFS C;  2L3S A;  1D0Z A;  2AZS A;  3SDZ A;  2QA4 A;  2QAZ A;  2COY A;  3VS7 A;  1VQ7 T;  2O01 E;  4M7A F;  5DLO A;  3M53 A;  3H6Z A;  4KH0 B;  1RAH B;  3C94 A;  1AD5 A;  4C8Q A;  1U06 A;  2F2V A;  1RAC B;  2XU8 A;  1ARK A;  5LJ5 g;  4KRT A;  2K3B A;  5GAM e;  2RJF A;  1OEB A;  1VQO T;  1VQ8 A;  3RIR A;  3CCL A;  1GCQ C;  2DE0 X;  4HCK A;  4M78 C;  3CME T;  1IO6 A;  1HSQ A;  3CBP A;  4EIK A;  2JNG A;  2X4X A;  3OS0 A;  2EW3 A;  3PT9 A;  2EYX A;  4KGV B;  1RAG B;  4J7F A;  4C8Q C;  2BE7 D;  1U1S A;  4M7D F;  2ECZ A;  4LNP A;  1X43 A;  4QT7 A;  2AKL A;  3OW2 P;  3MET A;  4M77 A;  2BIV A;  2EVR A;  1I5L A;  3OYY A;  3KBG A;  2FL7 A;  1WHH A;  4JJC A;  1MV3 A;  4KT0 E;  3LH5 A;  1K8A U;  5DM7 R;  4QQD A;  2JUF A;  1EFN A;  4HKE A;  5I22 A;  1T0H A;  3LYI A;  4D8D A;  2NYS A;  1M90 C;  1JRI A;  2MWP A;  1PRM C;  1BIB A;  2RN8 A;  2KYB A;  5GJV B;  3NPF A;  2MPX C;  3TSW A;  2O4X A;  4II1 A;  4XAX B;  4J6W A;  1XTD A;  3NGP A;  4M77 C;  5KYW A;  1K73 U;  4PJO E;  5IT9 E;  3S6W A;  1T3S A;  2P0P A;  2COZ A;  1QQJ A;  3CCM Q;  2CH4 W;  1Q81 C;  1GFD A;  2YRV A;  2K2M A;  4PJO D;  4IUU A;  3CCV A;  1WJS A;  5KCO A;  3UPU A;  4JRK A;  3WVD B;  2KNB B;  1KHC A;  4IUV A;  4DBQ A;  2KY9 A;  3A8H B;  3VRZ A;  3RDV A;  4MZP A;  3IQL A;  1ZUU A;  2DZ9 A;  3REB B;  2XDP A;  1NJI U;  2P4R A;  4XTZ A;  4M7A B;  1LOJ A;  3CCM A;  1VQ4 Q;  3RES A;  4JUV A;  2WSF E;  3X20 B;  4BY6 C;  5I11 A;  1SHG A;  3BE3 A;  2O31 A;  3HTR A;  4NL3 A;  2RHX A;  1IGQ A;  3OMC A;  3UA6 A;  1QLY A;  3JCM h;  2CKK A;  2RB6 A;  1R0C B;  4PNO A;  3M56 A;  1YIT T;  1T3L A;  2HD0 A;  1KQ1 A;  3BDL A;  4F7U E;  4LDX A;  1NLP C;  1Y96 B;  2DXU A;  3ZL7 C;  1D3B A;  3QO3 A;  3HRS A;  1VQ4 A;  2LJ1 A;  5GAN 5;  1WHL A;  4A54 A;  2PU9 B;  1VQ5 Q;  1MV0 B;  4JRQ A;  4M7D B;  4C0Z A;  3OYB A;  4XU3 A;  1RLP C;  4XU0 A;  4MDW A;  4ATO A;  2F5T X;  2DET A;  2DYI A;  4OMO A;  1WJR A;  2E10 A;  2COW A;  5AYF A;  4C92 F;  1D09 B;  3MEU A;  4PFO A;  5GAN d;  4FCY A;  2SRC A;  1K9M C;  5CVI A;  5HCK A;  3EGX B;  1BK2 A;  2EKO A;  2MF2 A;  3JB9 I;  4HT8 A;  2P4T A;  2ZGW A;  3PIO A;  5FU6 C;  1ZBX A;  3GOX A;  5CKB A;  1YJ9 Q;  2JM9 A;  4M75 E;  1OOT A;  4HT9 A;  2PVO B;  3NTI A;  2NUP A;  1QVF P;  4AG2 C;  1VQN Q;  1GFC A;  2ATC B;  4R55 A;  4Z02 A;  1OX8 A;  2QEX Q;  2H8H A;  2KXD A;  2EQJ A;  4RCC A;  5LL6 S;  3CMA Q;  2GFA A;  4ZGD B;  3S3M A;  4D8K A;  3I56 T;  4C0D C;  2E1H A;  2OJ2 A;  4NL2 A;  3G4S Q;  2AZV A;  2VV5 A;  1S1N A;  3REA B;  2V26 A;  2KK4 A;  3EFR A;  3CC7 Q;  3MP8 A;  3DKM A;  2WSC E;  1I4K 1;  1YJ9 A;  2DVE A;  4XTX A;  4XU2 A;  3VU3 C;  2RQW A;  2PVG B;  4ZGE B;  1VQN A;  3M5A A;  2YWW A;  1Y0M A;  2M16 A;  5ECA A;  2RA2 A;  3CMA A;  3OYE A;  1GL5 A;  2L2P A;  2DNU A;  5IHI A;  3H0I A;  3S3N A;  1YIJ Q;  4L6V 5;  2IPO B;  3G4S A;  3OYH A;  1W4S A;  2EJ9 A;  4JJB A;  1N5Z A;  1UE9 A;  3CC7 A;  3JB9 H;  4M78 D;  2FPD A;  1K0X A;  5D6X A;  1Q86 C;  5GMK i;  1NG2 A;  4C0G A;  3OYL A;  2K2V A;  2EPD A;  3VRY A;  1EIF A;  2VWF A;  3EHQ A;  3LLR A;  4C8Q D;  2CP3 A;  1NZ9 A;  3PFS A;  1ZBJ A;  5HY6 A;  5A0D A;  1XJW B;  1M30 A;  3EGU A;  1YIJ A;  1M5Q 1;  1RAE B;  3OS5 A;  4AG1 C;  1QVG A;  4C92 G;  3V8J A;  2FEI A;  1VQ6 Q;  2CDT A;  1Q82 U;  4OGE A;  3LW5 E;  2DTH A;  3VKI A;  1KC8 R;  4OMF B;  4PFZ A;  2MOX A;  1QCN A;  1U8R A;  2CH4 A;  4C92 B;  1JU5 C;  1VQ7 Q;  3JCM c;  2E5Q A;  1JJ2 P;  2EWN A;  1VOM A;  2K5I A;  2DZC A;  2YXY A;  3L2Z A;  4J83 A;  2DJQ A;  5CKE A;  5C6S A;  4BDY A;  3E9F A;  1VQM T;  1KQS P;  4IUR A;  1KQ2 A;  2C0T A;  2LT4 A;  4OB0 B;  5IH2 A;  1SHF A;  3CPW A;  1M1G A;  3OYF A;  1QKW A;  4M77 D;  2QXF A;  3M0Q A;  3AHU A;  1VQO Q;  3OYJ A;  1VQ6 A;  4FW1 A;  2D6F A;  3HSB A;  1TWB A;  2E6N A;  1T0J A;  3CME Q;  2NUZ A;  2GFU A;  2DVJ A;  1VQ7 A;  1WJQ A;  2DXC A;  4HCC A;  2J6K A;  2BZY A;  4Y91 A;  4EMK B;  1BI1 A;  3SWN B;  4Q5W A;  3QYH B;  1XNI A;  4TVR A;  1VQP T;  3L2V A;  3KUF A;  4LDY A;  2KEA A;  2K57 A;  1BCO A;  1FMW A;  4JRI A;  3PVL A;  4K11 A;  2VGM A;  1M4Z A;  1Q82 C;  2O2O A;  1P92 A;  1VQO A;  3G7Z A;  2MI6 A;  4IIM A;  4NS5 A;  1WHG A;  3L2Q A;  1TH7 A;  4B6M A;  3OQ5 A;  4PJO C;  3CME A;  4AFQ C;  1KHI A;  1RAI B;  1UGP B;  2K3Y A;  5GMK e;  3VS0 A;  1OPL A;  1Y57 A;  4FYW B;  1WHM A;  3PMT A;  1JXM A;  4DEY A;  4ELZ C;  4LD6 A;  3VV0 A;  2XG8 D;  1GCP A;  4F7U A;  1M8V A;  2RI2 A;  2AKK A;  1G2B A;  5LJ3 e;  2YRC A;  1YI2 T;  3A8M B;  4LXC A;  2HZY A;  2AT1 B;  4RG2 A;  1Q95 G;  4J9H A;  3LWI A;  2HDA A;  3JCM J;  3GNF B;  4NOY A;  3PTA A;  1MGQ A;  2JTF A;  2ZPE B;  2BTT A;  2X4W A;  3G1J A;  3JCM W;  3CCE T;  2IIM A;  5FU7 C;  2RHU A;  1PHT A;  1W1F A;  5KYY B;  2V1Q A;  4RTZ A;  1VIE A;  1BIA A;  3CD6 T;  2H3E B;  2RM4 A;  2OAU A;  3H41 A;  2OTL T;  3FIF A;  2HQX A;  2E41 A;  4OML A;  2RI3 A;  3OYK A;  4WF2 A;  3EG3 A;  3WXM B;  3EG0 A;  2NWM A;  3A8O B;  1WDX A;  5I21 A;  3EG9 A;  4M7A E;  1OU9 A;  3C0C A;  1YIT Q;  1X6B A;  1OI1 A;  2PQW A;  4EMH A;  2I0N A;  2EJG A;  2QG9 B;  4M75 A;  2HL5 C;  2QGF B;  4M78 G;  2LT1 A;  4E6R A;  5I2M A;  1KC8 C;  1YJN T;  3JCM d;  1PM3 A;  1ZSZ A;  4JS5 A;  3V8K A;  4YTL A;  2RJD A;  4C8Q G;  1Y71 A;  1M2V A;  4QVZ A;  4QKU A;  3CBO A;  3URG A;  4J9B A;  2JOY A;  1YIT A;  3D7S B;  2DBM A;  1NE8 A;  2HKN A;  3HKS A;  4RTU A;  2KRM A;  1SSF A;  2V1R A;  4M75 C;  1CKB A;  1RUW A;  1H64 1;  4PJJ A;  1ZA1 B;  2QTX A;  4L5G A;  4ZN3 A;  4L59 A;  4N4I A;  2XHC A;  4M7D E;  2CP0 A;  4OMP A;  4X1V A;  4IIO A;  4A53 A;  1V76 A;  2D0N A;  2J7I A;  1DJ7 B;  1YHQ T;  1OZ3 A;  1VQ8 Q;  1YCS B;  2FHD A;  2K7A A;  1ZSZ C;  1MHN A;  4RCB A;  2ED1 A;  1G3W A;  3OS1 A;  2KRO A;  1EX4 A;  4RTX A;  1D0X A;  2LNH B;  4E7K A;  4M77 G;  4FYX B;  2MCN A;  5A2Q E;  5GAN g;  3S3O A;  3OYC A;  4C0F A;  1M27 C;  4JDS A;  5GAO l;  4PK4 A;  2LX7 A;  1M90 U;  1KK7 A;  5GAO p;  4RKU E;  2VGN A;  1FXX A;  2GNC A;  3I56 Q;  2JS0 A;  4KUI A;  1VIF A;  3TCJ A;  2CZ7 B;  1PD1 A;  2K5L A;  3JCM V;  2MYS A;  5KCH A;  5KE2 A;  2BE9 B;  5FWB A;  4BE1 A;  2ZZD A;  1WQ7 A;  4J6Y A;  1MUZ A;  5KYU B;  4LDV A;  2R5A A;  3EG1 A;  1Q81 U;  2RHZ A;  4CC2 A;  1AT1 B;  1WI7 A;  2EQI A;  1RAD B;  1UTI A;  3CEY A;  1M1K R;  3RUX A;  5LJ5 e;  3EH1 A;  1OUL A;  1KD1 C;  1YNZ A;  3UT1 A;  3I55 Q;  3I56 A;  4GY5 A;  3P8B B;  4RUG A;  2QQ9 A;  3CCU T;  3KFV A;  2LCL A;  1F1B B;  1D1B A;  3V8L A;  1FWZ A;  2F5K A;  1QP3 A;  3CCV Q;  1TTH B;  2LCS A;  4FU6 A;  2L3P A;  2MIO A;  1QP2 A;  3X28 B;  1AWO A;  4JRP A;  3OY9 A;  3HRU A;  2QI2 A;  2C0O A;  8AT1 B;  4X9C A;  2KBT A;  4F14 A;  1AHJ B;  1PSE A;  3UF4 A;  3I55 A;  2XID A;  2GCX A;  1UEB A;  4OB2 B;  5LJ3 f;  1LPL A;  1Q7Y R;  4RTT A;  2XDB A;  5FW9 A;  2DL3 A;  1UGS B;  2FG0 A;  3C4S A;  2DL5 A;  4O6J A;  1RAB B;  4P5N A;  4DA4 A;  4LDU A;  1OX9 A;  1I81 A;  5CQX A;  2Y4Y A;  5HK0 A;  4X9D A;  1HYO A;  5AT1 B;  3JB9 D;  3EFS A;  1VQM Q;  2DL4 A;  4OGC A;  2J6F A;  2QGG A;  4WCI A;  1YJW T;  4RG8 A;  2JMA A;  1GRI A;  5KH6 A;  4RTY A;  4PKC C;  5HKC A;  3G71 T;  4XK8 E;  4Z89 A;  4PLL A;  1XOV A;  2JN0 A;  1YCY A;  4CI0 C;  4BD3 A;  1K9M U;  5GAM j;  2D1X A;  2J05 A;  1VQM A;  3TEE A;  1VQP Q;  3NTH A;  1VYT A;  2J6O A;  2AK5 A;  2EFI A;  1S72 T;  3H8Z A;  4FSS A;  1TS9 A;  4OVA A;  5KYX B;  5GAN 7;  5FLX E;  1MMA A;  3LGL A;  2M51 A;  3OB9 A;  4A4F A;  3GPL A;  2CUD A;  1ACM B;  2R58 A;  1VYU A;  2XDD A;  3CCQ T;  2E12 A;  4BE0 A;  1OQK A;  2GQI A;  1W6X A;  1M3B A;  2EAY A;  2VXE A;  2LMJ A;  5CR2 A;  4PJO F;  1VQP A;  1K9A A;  3EGD B;  2X3W D;  3DLL A;  3E2U A;  4M7A A;  2RJC A;  4KGX B;  2ZPB B;  3HPW A;  2W10 A;  1UGV A;  2RH2 A;  3R6N A;  4LUE A;  3OSV A;  5GMK m;  1VQ9 T;  5CKH A;  3GBQ A;  3GIB A;  5GAM d;  1ABO A;  1RLQ C;  3OW2 S;  1YI2 Q;  4E7Z A;  1RI9 A;  1C1A A;  1BU1 A;  3MEW A;  1SPK A;  1X2K A;  2YRD A;  2M1H A;  1QVG P;  4PL6 A;  3V7S A;  4J8O A;  2O88 A;  3VS4 A;  1G3T A;  1M1F A;  2FVU A;  2CT3 A;  1Y96 A;  4FW2 A;  2KQW A;  3QKJ A;  4RMO A;  3PIP A;  1PD0 A;  1G8X A;  4BUG A;  2GGR A;  5A0L A;  1SEM A;  3CCE Q;  4M7A C;  2FPE A;  1Q86 U;  4M75 D;  3J7A F;  4BAC A;  1E7O A;  2DD5 A;  1WZO A;  4IUT A;  1AOJ A;  5GMK h;  1YI2 A;  2L8D A;  3CD6 Q;  2LDM A;  2HNI A;  1XQH A;  4M7D A;  2OTL Q;  3CPW P;  1YWO A;  2QQB A;  2M02 A;  5LJ3 h;  3EGD A;  2DTI A; 
#chains in the Genus database with same CATH homology
 4IIM A;  3VS1 A;  2CUB A;  3NMZ C;  3JV3 A;  2KGT A;  2PTK A;  4CC4 B;  3PE0 A;  1NYG A;  3VS6 A;  1UHC A;  4Z88 A;  1TUC A;  2L0A A;  4AFQ C;  1WXT A;  1B07 A;  1QKX A;  4CC7 A;  4OMN A;  5GJW B;  1M8M A;  4AFZ C;  1GCQ A;  1ABQ A;  1I07 A;  3VS0 A;  1CSK A;  1OPL A;  1Y57 A;  1J3T A;  1UJY A;  1JXM A;  2JW4 A;  1AZG B;  4DEY A;  1JEG A;  1WA7 A;  2LZ6 B;  3QWY A;  4AFS C;  2L3S A;  2AZS A;  3VS7 A;  1A0N B;  1GCP A;  3U23 A;  2AKK A;  2YSQ A;  3M0S A;  2A37 A;  1G2B A;  4A63 B;  3VS2 A;  1I0C A;  2LQN A;  1K0S A;  1AWW A;  1AD5 A;  4DEX A;  1UFF A;  1UHF A;  2FRY A;  1U06 A;  2LJ3 A;  2LP5 A;  1HJD A;  1H92 A;  2F2V A;  2YDL A;  2J06 A;  1ARK A;  2EYY A;  2HEQ A;  4J9H A;  4KRT A;  2JTE A;  2K3B A;  2HDA A;  3VS5 A;  3I9Q A;  3H0H A;  4LN2 A;  2DBK A;  3M0R A;  4OMM A;  1OEB A;  2BTT A;  2KYM A;  1GCQ C;  2DE0 X;  4HCK A;  2YT6 A;  1I1J A;  2IIM A;  1NM7 A;  2GTJ A;  2GBQ A;  4GLM A;  1IO6 A;  1HSQ A;  1PHT A;  1JO8 A;  1W1F A;  4EIK A;  2DF6 A;  2V1Q A;  2F2W A;  4RTZ A;  2EW3 A;  1NYF A;  2EYX A;  3H41 A;  4OML A;  4LUD A;  2D8J A;  2ECZ A;  2YUQ A;  4LNP A;  1X43 A;  2GTO A;  3M0T A;  3EG3 A;  4QT7 A;  2AKL A;  1U5S A;  3EG0 A;  2NWM A;  2EVR A;  1WDX A;  2HCK A;  2RF0 A;  2K9G A;  3C0C A;  3SEM A;  1X6B A;  2BZ8 A;  1YP5 A;  1H8K A;  4JJC A;  1MV3 A;  2JM8 A;  1YN8 A;  3LH5 A;  2I0N A;  2DRK A;  2EKH A;  1EFN A;  5I22 A;  1T0H A;  4E6R A;  4D8D A;  1AZE A;  2E5K A;  2CT4 A;  1ZUK A;  1M3A A;  2O9V A;  2D8H A;  1HD3 A;  3M0P A;  1UUE A;  3I5R A;  1PRM C;  1U3O A;  2RN8 A;  5GJV B;  2KYB A;  2QDL A;  3NPF A;  4R0K A;  3TSW A;  4J9E A;  2K6D A;  2A36 A;  3NGP A;  4OMQ A;  4J9B A;  2DX1 A;  3RNJ A;  1T3S A;  2CH4 W;  2DBM A;  4RTU A;  1GFD A;  2KRM A;  2JMC A;  4M4Z A;  2K2M A;  4CC3 A;  2K79 A;  2V1R A;  2JS2 A;  2DMO A;  1CKB A;  1RUW A;  2KNB B;  1CKA A;  3A98 A;  4OMP A;  4X1V A;  4IIO A;  1X2Q A;  3SHW A;  2O9S A;  2HSP A;  3VRZ A;  2D0N A;  2J7I A;  3IQL A;  1YCS B;  4RTV A;  1ZUU A;  2K7A A;  1QCF A;  3REB B;  2DRM A;  2ED1 A;  1AWJ A;  4J9I A;  2P4R A;  2C0I A;  4J9G A;  2KRO A;  4RTX A;  2LNH B;  1V1C A;  5I11 A;  1SHG A;  2MCN A;  1TG0 A;  1E6G A;  2O31 A;  1W70 A;  1M27 C;  2F2X A;  3UA6 A;  4Y92 A;  2KRS A;  1QLY A;  2LX7 A;  3UA7 A;  4HVU A;  1T3L A;  2GNC A;  1YWP A;  3I5S A;  2JS0 A;  3ULR B;  4F16 A;  1NLP C;  1Z9Z A;  2B86 A;  2KR3 A;  3PVQ A;  1E6H A;  3ZL7 C;  1X27 A;  2DL8 A;  5FWB A;  2DYB A;  1MUZ A;  2RQT A;  2LJ1 A;  3EG1 A;  2YUP A;  2A28 A;  4CC2 A;  1AWX A;  1WI7 A;  2EQI A;  1MV0 B;  1UTI A;  1WX6 A;  1WXB A;  1ZLM A;  2JT4 A;  1WYX A;  1RLP C;  2VVK A;  3M0U A;  1YNZ A;  4JZ4 A;  3THK A;  2RPN A;  3CQT A;  2OI3 A;  2SEM A;  1BB9 A;  1WLP B;  4RUG A;  5IHN A;  4JPB W;  2CSI A;  2EGE A;  1LCK A;  2DA9 A;  1ZUY A;  3KFV A;  4HVW A;  1PNJ A;  4OMO A;  1M3C A;  2HBW A;  2FRW A;  2FPF A;  4RTW A;  2LCS A;  2SRC A;  3EG2 A;  1GBR A;  2L3P A;  2MIO A;  5HCK A;  1AWO A;  1UG1 A;  1KFZ A;  1BK2 A;  3I35 A;  5L23 A;  1NEG A;  1UJ0 A;  2ENM A;  1JQQ A;  1WIE A;  2C0O A;  1ZSG A;  2KBT A;  1WFW A;  2DIL A;  1SSH A;  4F14 A;  2X3X D;  3UF4 A;  1TUD A;  2OAW A;  2JM9 A;  1OOT A;  4RTT A;  4AG2 C;  5FW9 A;  1GFC A;  2DL3 A;  2KRN A;  2FG0 A;  2ESW A;  1FYN A;  2H8H A;  2DL5 A;  2KXD A;  1K1Z A;  2ED0 A;  2DL7 A;  3QWX X;  1KJW A;  4D8K A;  2XMF A;  4HVV A;  2ABL A;  4JZ3 A;  1UEC A;  2OJ2 A;  2AZV A;  2DL4 A;  3REA B;  1S1N A;  2PZ1 A;  4ESR A;  1K4U S;  3RBB B;  2KXC A;  2J6F A;  4WCI A;  1NLO C;  4HXJ A;  2RQW A;  2JMA A;  1GRI A;  4RTY A;  1VYV A;  3TVT A;  1Y0M A;  2EYZ A;  4Z89 A;  1XOV A;  2DLP A;  1B3Q A;  5ECA A;  2A08 A;  1GL5 A;  2L2P A;  2DNU A;  5IHI A;  1PWT A;  1ZX6 A;  3H0I A;  1KSW A;  2D1X A;  2J05 A;  2LQW A;  4JJB A;  1N5Z A;  1UE9 A;  1WXU A;  1BBZ A;  4LE9 A;  1G83 A;  1Z9Q A;  2KT8 A;  2FPD A;  1H3H A;  1VYT A;  1K0X A;  2J6O A;  2AK5 A;  2EBP A;  4FSS A;  1VA7 A;  1NG2 A;  1X6G A;  2EPD A;  3VRY A;  2M51 A;  2VWF A;  2W0Z A;  3EHQ A;  2YUO A;  2CUD A;  1VYU A;  3O5Z A;  3UAT A;  5EC7 A;  3EHR A;  1ZBJ A;  1NEB A;  2GQI A;  2KE9 A;  1W6X A;  1UDL A;  1M3B A;  1M30 A;  3EGU A;  2RQV A;  1GBQ A;  4AG1 C;  2LMJ A;  2FO0 A;  1AEY A;  2FEI A;  2RMO A;  1K9A A;  2CRE A;  2CDT A;  2X3W D;  3VS3 A;  1FMK A;  3TSZ A;  2W10 A;  2CSQ A;  2MOX A;  1UGV A;  2VKN A;  2CH4 A;  2L3Q A;  3R6N A;  4F17 A;  4LUE A;  2KT1 A;  5IHK A;  1JU5 C;  1QWE A;  4J9C A;  3GBQ A;  1JXO A;  1ABO A;  2DJQ A;  1RLQ C;  2ROL A;  1SRM A;  2DM1 A;  2RNA A;  1RI9 A;  2C0T A;  2RQR A;  5IH2 A;  1BU1 A;  1SHF A;  1SPK A;  1X2K A;  2JXB A;  1OPK A;  2YUN A;  2O88 A;  2RQU A;  3VS4 A;  5IXB A;  1QKW A;  3M0Q A;  4AFU C;  1KIK A;  3FJ5 A;  2LJ0 A;  2CT3 A;  2EGC A;  1PRL C;  5IXF A;  2EYW A;  1QWF A;  2M0Y A;  2GGR A;  1SEM A;  1T0J A;  2FPE A;  2NUZ A;  1X69 A;  2DVJ A;  4ORZ A;  2PNI A;  2G6F X;  2J6K A;  1E7O A;  2BZY A;  1K76 A;  1AOJ A;  2ROT A;  3H0F A;  4Z8A A;  1AVZ C;  2KEA A;  3NHN A;  4JJD A;  5FWC A;  4ZNX A;  4GBQ A;  3PVL A;  1OV3 A;  4J9D A;  1SRL A;  1YWO A;  4K11 A;  2BZX A;  2O2O A;  2EGA A;  4J9F A;  1PKS A;  1PKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...