2J6FA

N-terminal sh3 domain of cms (cd2ap human homolog) bound to cbl-b peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
b'VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-ASSOCIATED PROTEIN
publication title Atypical Polyproline Recognition by the Cms N- Terminal SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j6fA00
1YWOA 1SHGA 1K4US 2KRSA 1XOVA 2G6FX 1UJ0A 2RMOA 2C0TA 5IHNA 4F17A 1SEMA 2J06A 3PVLA 4HXJA 2SRCA 2BZ8A 2M0YA 2KXDA 2DL3A 2DA9A 1ZUKA 3M0TA 4LN2A 2K9GA 1I1JA 2OAWA 2LX7A 4J9DA 2K3BA 2KGTA 2ROLA 1T0JA 1JXOA 1T0HA 4KRTA 3VS0A 4K11A 1AOJA 4RTTA 4RUGA 2PTKA 1VA7A 2KXCA 3RNJA 3SEMA 1MUZA 2JM9A 3FJ5A 1ZUUA 2BZYA 3H0IA 2CSIA 1KJWA 1JU5C 4RTYA 4LUDA 3PE0A 2GNCA 2ENMA 1H8KA 2EKHA 5IHIA 3M0RA 2O88A 1IO6A 5HCKA 4F16A 1X6BA 5IXBA 1TG0A 2LP5A 2PZ1A 1CKAA 4HVWA 1HSQA 1AWXA 2KRNA 2BZXA 2DF6A 4AFZC 2W0ZA 3H0FA 4GBQA 2ABLA 2RQTA 1GFDA 1WLPB 2JS0A 2W10A 2CT3A 2EPDA 5IHKA 1WA7A 2JS2A 2CUDA 1GCQA 2EBPA 1GRIA 4J9BA 4CC7A 2ESWA 2JT4A 3ULRB 1OV3A 1AD5A 2GTJA 2DL8A 1NM7A 1GBQA 2KE9A 2RF0A 2DL7A 4CC3A 1OPLA 1SPKA 2DBKA 4A63B 1QWFA 2DRKA 2J05A 4LE9A 4RTVA 2JM8A 3NGPA 4J9IA 2GTOA 1WYXA 2DL4A 2LMJA 5I22A 2DLPA 1X27A 1YP5A 2E5KA 5FWBA 2CT4A 2ED1A 1ARKA 1KIKA 2FRYA 2JXBA 1RLQC 1K1ZA 2K79A 1YNZA 2K6DA 2EQIA 2KYBA 1FYNA 4OMLA 1KFZA 1PWTA 3PVQA 1U5SA 4AG2C 2D0NA 2MOXA 2YUQA 1VYVA 1UDLA 3VS5A 1E6HA 1U06A 1UG1A 1ZX6A 5EC7A 2LZ6B 1PRLC 3SHWA 2JMCA 1GCPA 2L3SA 1Z9ZA 2JMAA 3H41A 1ABQA 2GQIA 2L0AA 2X3WD 1GCQC 1MV3A 2AKLA 2YUPA 2FRWA 1K76A 3CQTA 2KYMA 2RPNA 2LQNA 1NYFA 2KROA 2F2XA 3ZL7C 1OEBA 2C0IA 1T3SA 1PRMC 2J6FA 1X43A 2X3XD 2VWFA 1PHTA 4X1VA 3R6NA 1UFFA 2DYBA 1UGVA 1WXUA 2A28A 3LH5A 4DEXA 5I11A 1QWEA 2FPDA 2XMFA 2RQUA 2CREA 4OMMA 4RTWA 1U3OA 3I35A 1QKWA 1JQQA 2RN8A 5ECAA 4CC4B 2NWMA 4QT7A 1VYUA 1AWOA 5IXFA 2J7IA 3QWYA 4Z88A 3REBB 1S1NA 1EFNA 3VS2A 2CSQA 2LNHB 1T3LA 2AZVA 1UJYA 4AG1C 3M0QA 4Z8AA 1QCFA 3VS4A 1RLPC 1W1FA 2HCKA 1BK2A 2EVRA 5FW9A 4F14A 1Y0MA 2DJQA 1X69A 2KT1A 2L3PA 2SEMA 2MCNA 1WXTA 1K0XA 3NHNA 2OJ2A 2YSQA 1YN8A 4RTUA 1A0NB 2KRMA 1TUCA 4M4ZA 2FO0A 4AFUC 2F2WA 1V1CA 1UE9A 2A36A 2DE0X 2EYWA 4IIOA 4J9FA 1AEYA 2GGRA 3A98A 1SSHA 2D8JA 1I07A 3EG3A 3VRZA 1B3QA 3I5SA 2DILA 1PKTA 2QDLA 1UHFA 2CH4A 2KT8A 2DMOA 1ABOA 2LCSA 1LCKA 1PKSA 2O2OA 1NG2A 1WI7A 3REAB 1J3TA 4Z89A 1ZUYA 1M27C 3EG2A 4FSSA 1YWPA 2CDTA 2YDLA 2VVKA 3VS7A 1G83A 4OMPA 1NLOC 2RNAA 5IH2A 2YT6A 1H3HA 1GL5A 4JPBW 1I0CA 2GBQA 1K9AA 4D8KA 2EGCA 1SRMA 3M0UA 1Y57A 1AWJA 1JXMA 1NEBA 2ROTA 1ZSGA 1UHCA 2B86A 3I9QA 2O9VA 3QWXX 1AVZC 2RQWA 2PNIA 1M30A 2ECZA 2RQVA 2KNBB 3EHRA 2CH4W 4LUEA 4D8DA 1OPKA 1W70A 1X2KA 2AZSA 2DL5A 5FWCA 1X6GA 1E6GA 2V1QA 2V1RA 1NEGA 2J6KA 1H92A 3UATA 2DBMA 1NYGA 2FEIA 1HD3A 1QLYA 2C0OA 1GFCA 2A08A 4J9CA 2D1XA 2AKKA 2A37A 2L2PA 2NUZA 2VKNA 1WIEA 1ZBJA 2KBTA 4E6RA 1CSKA 2JW4A 4J9HA 1GBRA 4HCKA 4HVUA 4JJBA 3TVTA 2LQWA 2RQRA 1SRLA 3U23A 1G2BA 2DX1A 1M8MA 1TUDA 4OMQA 2EYXA 1RUWA 2EW3A 3THKA 1YCSB 1ZLMA 4JJCA 2L3QA 2HSPA 1W6XA 4JJDA 2AK5A 1WXBA 3EG1A 3GBQA 4AFSC 1JEGA 1KSWA 3TSWA 1K0SA 2EYYA 1FMKA 1E7OA 1UTIA 1UECA 2HDAA 4AFQC 3H0HA 2DVJA 2IIMA 4ZNXA 1AWWA 1VYTA 4LNPA 3M0SA 2EYZA 3IQLA 2YUOA 2MIOA 4ESRA 2I0NA 3O5ZA 3KFVA 3VS1A 3NPFA 2LJ1A 1BBZA 1NLPC 2KR3A 4WCIA 1MV0B 4Y92A 2FPFA 2H8HA 1HJDA 2K2MA 5GJWB 4DEYA 4JZ4A 1AZGB 2DM1A 2LJ3A 4RTXA 2D8HA 2HBWA 1WDXA 1M3BA 4GLMA 2K7AA 2HEQA 2ED0A 3C0CA 3VRYA 1CKBA 2O31A 4J9GA 2KEAA 2FPEA 2LJ0A 3UF4A 3UA7A 5L23A 1Z9QA 3M0PA 5GJVB 1QKXA 1AZEA 3VS6A 1RI9A 1UUEA 1JO8A 1M3AA 1OOTA 4EIKA 1M3CA 1PNJA 3EGUA 2O9SA 4ORZA 2FG0A 4RTZA 2DNUA 2J6OA 2F2VA 1N5ZA 4J9EA 2BTTA 2P4RA 2M51A 3UA6A 4OMOA 2JTEA 2EGEA 2OI3A 1WX6A 4CC2A 1WFWA 4HVVA 3NMZC 1B07A 1X2QA 2DRMA 3RBBB 1BU1A 3EHQA 4OMNA 1SHFA 3VS3A 2YUNA 1BB9A 3TSZA 2CUBA 4JZ3A 4R0KA 3JV3A 4IIMA 3I5RA 2EGAA 3EG0A
chains in the Genus database with same CATH superfamily
2PU9B 1LOJA 1YWOA 1SHGA 2KRSA 3MPUB 1QVGA 2JZ2A 1UJ0A 2HKNA 5IHNA 3E2UA 3PVLA 2RK2A 3VKIA 3M0TA 4LN2A 3JCMf 3QDFA 4JDSA 4MZMA 1I81A 3RUXA 3AT1B 2ROLA 1V76A 4ZTJA 2F5TX 4EPCA 1VA7A 3TCJA 3SEMA 5LJ5g 1MUZA 4NL2A 5CAIA 2BZYA 1BIAA 3G71Q 3M55A 3VYHB 4ELYC 3H8ZA 1BCOA 5IHIA 5LJ3j 4XTZA 4F16A 1TG0A 1ZBXA 1VQPT 4KGVB 1YJ9T 4BD3A 3OYKA 1SSFA 1HSQA 4OB1B 1AWXA 1EX4A 1M1FA 3PIPA 2FHDA 4M78E 4AFZC 1G8XA 1QP2A 3MCAB 2CP6A 1VQKQ 1GFDA 2JS0A 2CT3A 4KT0E 1WA7A 3JB9I 3M4GA 1GCQA 2JT4A 2EKOA 2GTJA 3QBYA 2X4YA 2DL8A 1XQHA 1SPKA 5FU7B 4XTUA 4E7SA 3CCQA 1X01A 1K73R 4PLLA 3QKJA 1WYXA 2DL4A 3T9NA 3JCMQ 3CCJQ 3CC7T 4ZGDB 4ZN1A 1QVFS 1X27A 1VQ9Q 5FWBA 4HCCA 1ARKA 2K6DA 2DK3A 3FC3A 2EQIA 2XDBA 1RABB 1D3BA 4M7AG 4FW2A 2M16A 4M75F 1NBEB 2K5IA 3SFMA 5I21A 1VQ4Q 2CKKA 1BCMA 1ZX6A 5HY6A 1VQ5A 4BB7A 4ANJA 2V8IA 5GAMj 3CPWA 2LC4A 2L3SA 5DLQE 1Z9ZA 1YI2Q 1D1BA 3CMEQ 1GCQC 1MV3A 1VOMA 2XIDA 1K76A 3CQTA 3P8DA 1IREB 4DQ2A 2KROA 2L89A 3MP8A 1KQSS 1BKBA 1SKUB 4Q5WA 1OEBA 2K3XA 1T3SA 1KD1C 5GAN4 2I2LA 1PRMC 2CZ7B 3R6NA 4AT1B 1UGVA 1QVFP 4N4GA 2QAZA 3INZA 1M2VA 1U3OA 5KYWB 1QVGS 5ECAA 1K8AC 4CC4B 3FDRA 1VYUA 5GAOl 5GAOm 1AWOA 2EQJA 3AHUA 4M75D 1EFNA 2CSQA 1T3LA 1UJYA 4DA4A 3M0QA 1SF9A 4FSXA 1RLPC 4C5EA 5KE3A 3CCUA 2EVRA 4FYWB 2PVDB 5FW9A 4F14A 1X69A 2KT1A 2L3PA 4L5GA 1K0XA 2LT1A 2OJ2A 2YSQA 2DTOA 5KYNA 1OI1A 2NUPA 1TUCA 1JB0E 3CCQT 4M4ZA 3FB9A 4IUTA 4AFUC 2DYIA 1TWBA 3ZFJA 4MZTA 3BW1A 1UE9A 2DE0X 2EYWA 1DJ7B 2D8JA 1WHGA 4C8QG 3I56A 3EFOB 1B3QA 3I5SA 2DILA 4KH0B 1KQSP 2CH4A 3GOXA 3CCRA 4FIBA 1WQ7A 2KT8A 3G6EA 3EGDB 1ABOA 3OYDA 2NYSA 3REAB 4FYYB 4Z89A 3C12A 3G4SA 1HK9A 1KG1A 3HRTA 3NTHA 2O01E 2RNAA 4JS5A 4XTXA 5GAOq 3VJPA 5LJ5e 1K9AA 4QQ6A 1W2BA 1QVGP 1AWJA 1JXMA 1NEBA 2ROTA 4L59A 1UHCA 3VU3C 2L3RA 4M7AC 1G3SA 1VQ5T 2B86A 2RQWA 4FU6A 1O9SA 2ECZA 1QW1A 2NUTA 3EHRA 5GAN5 2E6NA 4JS4A 1X6GA 1X6OA 1WHKA 3JCMV 1UGSB 3UATA 1NYGA 1HD3A 1UEBA 2KMTA 3RKXA 2AKKA 2BKDN 3OYIA 5D6YA 1IXDA 2QEXQ 3GF5A 2D9TA 3OS1A 3QXEB 3CC2Q 2MWPA 5KH6A 1YJWQ 2JN0A 3JCMX 1OX8A 2DX1A 1ZSZA 2MK5A 1M8MA 1M9SA 1TUDA 5J3BA 3WVDB 3OYJA 2EYXA 1VQNQ 3CPWS 5CIUA 1XJWB 3CBOA 2HKQB 1ZLMA 1VQ7Q 2HSPA 3QYHB 4A4EA 4C92G 2ZPGB 2AK5A 2OTLA 5GMKe 3HFNA 3OYBA 3GBQA 1M2OA 3QIIA 1KSWA 3CCUT 4XK8E 3TSWA 3M59A 1K0SA 1RAHB 3PGGA 2EFIA 1K73C 2CGHA 4AFQC 2MF2A 4PJJA 4ZNXA 1AWWA 2D6FA 3DLMA 2WACA 2I0NA 3VS1A 3NPFA 2LJ1A 3RR6A 1MV0B 2H8HA 2K2VA 1HJDA 2E65A 2K2MA 1BI1A 1AZGB 2LJ3A 4RTXA 4N4HA 1G3YA 5GAMd 1R0CB 3G6ET 2GFUA 3OYMA 4C8QC 3G4ST 2LJ0A 1ZHIA 5GJVB 1QKXA 2H3EB 2M0OA 1AZEA 4XAXB 1QMCA 5GANd 2YXYA 1PNJA 4N4IA 3WVEB 2FG0A 4RTZA 2RJCA 3CD6Q 1ZSZC 1N5ZA 3CPWP 5GMKl 1WGSA 3CCMQ 3L2WA 2M51A 2JTEA 2JJ9A 5L8RE 1KC8C 1S72A 3X24B 3CCST 1WX6A 1M1KU 4HVVA 2QEXA 1M8VA 1B07A 3QYGB 3CCEQ 3RBBB 5GMKh 3GPLA 4E7KA 1VQMA 2NLUA 4OMNA 2QI2A 2KK4A 3NFCA 3MHXA 2XHCA 2CUBA 2PVGB 3DLLA 1VQOA 1UGRB 4IIMA 1H3ZA 3L2ZA 3M54A 2O4XA 4M7DG 1TUGB 4CI0C 3OSSC 4QQDA 2G6FX 1RL2A 1SEMA 1W2BS 2J06A 4HXJA 2R5AA 2SRCA 2EQUA 2M0YA 3V7CA 4ZGJB 2Y90A 2LCLA 5CR2A 1ACMB 1I1JA 1B7TA 2GCXA 1WHLA 3S3NA 1OULA 5CKDA 1T0JA 3JB9H 3L2QA 1T0HA 2EIFA 2GFAA 3CCLQ 1M90C 1K9MC 1AOJA 1RAFB 1VUBA 2JTFA 2KXCA 2C06A 3NTIA 3JCMP 1KJWA 2R57A 1JU5C 4LUDA 4XTVA 2RHXA 4M75B 1YIJT 4GY5A 2PVOB 5J39A 4C92C 2DAQA 2YRDA 4NS5A 1WQWA 1X6BA 3HFOA 1RADB 3RKWA 3CMAT 1CKAA 4HVWA 1OZ2A 1B34A 3QSUA 1WJQA 1PD1A 5GAMf 2DTIA 2DF6A 2IVWA 2QQAA 3MJXA 4C0DC 4DBFA 5A0DA 1YBYA 2FZKB 2W10A 4O6JA 2EPDA 2ATCB 4M7DA 3OW2A 2CUDA 3CD6A 1GRIA 5GANf 3ULRB 3A8HB 3QZ9B 4JJNK 4CRIA 1NM7A 4PLIA 4OGEA 2HSEB 1WHHA 2RF0A 2DL7A 4E47A 5KYUB 2VASA 4IUQA 2DBKA 4EDUA 1W2BP 1C6VX 2XKOC 2HAXA 1Q81U 1Y96B 4LE9A 2JM8A 3C95A 2CYZB 4J9IA 4PJOF 3CC4Q 1S72T 3UDCA 3M57A 2VYTA 2P0QA 3FIFA 1RLQC 1K1ZA 2K79A 4N0AC 4JUVA 2EYQA 2KY9A 2YWWA 4E7IA 4F7UF 1FYNA 5LJ3h 3UWNA 1KQSA 4OMLA 1VQLA 5CKFA 3PVQA 5FROA 4RKUE 2DZCA 2D0NA 1VQOT 5CKHA 2JNGA 1Q86U 4BUGA 3LWIA 1U06A 5EC7A 2HBPA 1O75A 1Q7YC 5CCAA 3CCLA 3PMIA 2FZGB 2EJFA 1D1CA 2JMCA 2Y4XA 3UPUA 1IHWA 1MGQA 2JMAA 1GXIE 1NPPA 4M7DC 3UT1A 2DXCA 2X3WD 2AKLA 4PFPA 4C0ZA 2XI9A 1K73U 1YHQT 5CQYA 2LQNA 4M7AF 3RIRA 1MMGA 2RI5A 3ZL7C 1WZOA 1YFNA 2K57A 2HQEA 2DJZA 4OP0A 5C0MA 2X3XD 2VWFA 1PHTA 1WXUA 3LH5A 4DEXA 4WF2A 4X34A 2FPDA 2XMFA 4OMMA 1QKWA 2KSSA 4E7LA 1JQQA 1OYXA 5HK0A 5CKEA 3JCMJ 2NWMA 4QT7A 3M5AA 2J7IA 3QWYA 3RMSA 4Z88A 3REBB 4HCBA 1JBMA 1N6AA 2DPPB 3VS2A 4RCCA 2LNHB 3FEOA 5FLXE 2A0FB 2AZVA 4II1A 2ZPBB 5D6XA 4PJOG 2WSCE 4AG1C 2ZZDA 2DEUA 4ZTFA 2QTVA 2JTMA 1W1FA 3PNWC 2QQBA 4HT9A 2RHIA 4LXCA 1Y0MA 4F7UG 2SEMA 3NHNA 3TU4K 4C5HA 2KRMA 4BY6B 3RDVA 3JCMe 5LJ5d 4IIOA 1AEYA 2GGRA 3DB3A 2RHZA 5HK3A 2RI2A 3EG3A 2QYZA 3CCVQ 1B34B 2L8DA 1VQ8A 3H6ZA 1W4SA 2DMOA 4M78G 2EJGA 3VUBA 4OB2B 2LCSA 1PKSA 1WI7A 2E70A 3EG9A 3SDZA 3WXMB 1ZUYA 3EG2A 5I2MA 4J7FA 2YDLA 3PTAA 5KYYB 4OMPA 2QA4T 4LDXA 3OW2S 2YT6A 4M77F 1GL5A 2QQSA 1I0CA 4FW1A 2P4TA 1HYOA 2EGCA 4MDXA 1Y57A 5A2QE 4IKFA 1BI2A 5DM7R 1RAIB 2O9VA 2MYSA 4PJOA 4JLGA 4C8QF 3OS2A 1NJIU 1M30A 2RQVA 4LUEA 1IGUA 4D8DA 1W70A 2AZSA 2DL5A 4C0GA 4F7UA 1SG5A 2J6KA 6AT1B 3G71A 2FEIA 3JCMc 2KAFA 2D1XA 4Y91A 2E3IA 5GANj 4KULA 1XNIA 1KC8R 2RI3A 2VKNA 3CBMA 2OTJQ 4J9HA 1GBRA 1IZ6A 4HCKA 1ZQ1A 3JCMh 1YJNQ 1VQKA 1PD0A 1VIFA 3LH0A 1RUWA 4M7AA 4J6XA 3THKA 2B8AA 5GAN7 1YCSB 3OW2P 4JJCA 3V8LA 4V2SA 1TH7A 4XTYA 2F1LA 2MI6A 2V26A 4M75E 3JCMb 3HP9A 3M58A 2EYYA 5FRMA 4EMKC 1FMKA 2FB7A 3LLRA 1UECA 4PJOC 5LJ5f 3CCJA 2HDAA 4ELZC 1K9MR 1M90R 2IIMA 3QDRB 1VQ9A 4M77G 2DFUA 1Q82C 1U1SA 1KHCA 4ESRA 2AIRB 2VB6A 3O5ZA 4HA8A 3RKYA 1BBZA 4EMGA 4WCIA 2EAYA 4B6MA 3PT9A 4C92F 2HBWA 1WDXA 1M3BA 1VQ8T 4GLMA 4BACA 2HEQA 2ED0A 2V8JA 2RH2A 2O31A 4J9GA 5LJ3g 1VQ4A 2FPEA 1I5OB 5KE2A 1RI0A 4XU2A 3UA7A 5L23A 3M0PA 2DZ9A 2ZGWA 3VS6A 3ME9A 4M78C 1M3AA 1OOTA 4JLIA 4EIKA 2LT4A 3EGUA 5GAOn 1YIJQ 3SWNA 1VQ6Q 1YI2A 2HD0A 2HZYA 1RAAB 3CMEA 3ZBDA 5M9OA 2DXTA 3CMAQ 3O8VA 1OU9A 3UA6A 2QXFA 4B9WA 8ATCB 3OS5A 2KDSA 3NMZC 2E64A 2K4YA 2QG9B 1X2QA 2XD0A 2ZPIB 4OB3B 3LYIA 2P0KA 4LDUA 4FT4A 2YRCA 2VGMA 5CVIA 3VS3A 5A0LA 1JJ2A 5GAN3 4JRIA 4PJNA 4M77A 1PG5B 2RB6A 3HL8A 2E1HA 2ZPFB 1YITQ 3I5RA 2EGAA 2COWA 4NOYA 1G3TA 4ATOA 1D3BB 4A54A 5A0GA 4JRPA 4C8QA 2RMOA 3I55Q 4ME7A 4BDYA 2BZ8A 2L5QA 2KXDA 2DA9A 1EIFA 2WSFE 4XU0A 1PM3A 4J9DA 2K3BA 2QQRA 1Q7YR 1JXOA 4JRKA 2BUDA 3VS0A 4K11A 2PTKA 3RNJA 2JM9A 3FJ5A 1ZUUA 3H0IA 2YRVA 2CSIA 2HQHA 4R55A 1KK7A 3SWNC 3PE0A 4M7DF 2ENMA 4QVDA 2E10A 1H8KA 2K3YA 3S6WA 4HT8A 2CP3A 2EKHA 3OYEA 3M0RA 3CCJT 2O88A 3GLXA 3OYYA 1C0MA 5IXBA 4QQGA 2RHUA 4PFOA 4LD6A 3PFSA 3RERA 5D7UA 3EAEA 5DLOA 2QK0A 2R58A 4DBRA 4EMHA 2W0ZA 2ABLA 4M77C 1R0BG 2XK0A 1QVPA 1WLPB 3I56T 3LGFA 5IHKA 1M2VB 1YHQQ 2EBPA 4J9BA 4M7AB 3CCRT 2ESWA 2MPXC 3OSVA 1AD5A 2RHYA 1KQ1A 1VQ4T 1GBQA 2KE9A 1UGQB 1OPLA 1RACB 5IAYA 2JUFA 2YLCA 3OBWA 4A63B 1QCNA 2ZAEA 1QWFA 2J05A 3N5BB 1YI2T 3CMET 2GTOA 2LMJA 4HKEA 3Q1JA 2DLPA 5GMKm 3LGLA 4C92A 1VQPQ 2NUPB 1D1AA 1YITA 2ED1A 5AYFA 1YJ9Q 3LW5E 2GQVA 4M7DD 2A3LA 1KD1U 2KVQG 3MEWA 1BYMA 4E7ZA 3EH2A 2LQKA 3R6OA 1PWTA 1U5SA 4AG2C 3CC2A 7AT1B 1BI3A 2MOXA 3HHTB 3GIBA 3DKMA 1YJWA 2X9HA 3OYFA 5LJ5j 1UDLA 3EH1A 3QO3A 3VS5A 1K8AU 1E6HA 5EG2A 3JCMg 1VQNA 2CZ6B 2LZ6B 4QVZA 2DO3A 5IN1A 1GCPA 1VQ7A 3H41A 1ABQA 2GQIA 2L0AA 3M9QA 2P0PA 3E1SA 5CKBA 3CC7Q 4QW2A 1D0ZA 4BE1A 4MMKA 5AT1B 2CP0A 2RM4A 2NUTB 4LD9K 2E12A 3BFMA 2BIVA 2C0IA 1JJ2S 2QA4Q 2OTLT 1AHJB 4N0AA 1X43A 2DD4A 1WNLA 5LJ3e 2RJFA 3OBYA 3OYHA 1UFFA 2OX7A 2WSEE 4KH1B 3JB9G 4TVRA 1QWEA 1YCYA 3HPWA 4JRQA 2DIQA 3GNFB 1QQJA 4OB0B 2RQUA 5FU6C 4C8QB 2CP5A 2RN8A 3QJ6A 4YTLA 3V8JA 2XICA 2QGGA 5IXFA 1S1NA 1FX7A 1BI0A 3EGXA 4NL3A 3JRZA 2EQKA 3HRSA 1ZSZB 2QTXA 1MMAA 5GAOr 5GMKj 2AHJB 1UB4A 2RD1A 1TSFA 3KUFA 3L2VA 2DJQA 2DD5A 3CCMA 1M1GA 1HXDA 3X26B 3MP1A 1YN8A 1A0NB 2VUBA 1MNDA 1OX9A 3P8BB 3EFSA 1PSFA 1LVKA 4RG2A 1V1CA 3KXTA 4OMFB 3CCEA 2A36A 3LWHA 1LPLA 3VRZA 3HKSA 2QDLA 4LDYA 2XDPA 1Q82R 2YLBA 3FLGA 2O2OA 1JJ2P 1NG2A 4FM4B 3JCMW 4FSSA 1M27C 2MMPA 1YWPA 2CDTA 2X4WA 4J6YA 2QEXT 2VVKA 4OVAA 1RAEB 3VS7A 1VQMT 1NLOC 3J81E 1H3HA 1Y7XA 4JPBW 3CC2T 1FMVA 4D8KA 1YJWT 1M5Q1 3CC7A 1ZSGA 3EFRA 5GAMe 3I9QA 3L2UA 4FL6A 4PNOA 1VQNT 1WPYA 3QWXX 4MDWA 3S3OA 2XG8D 2QASA 1IB8A 2PNIA 3CCQQ 1N9SA 2CH4W 5FU7C 1VQ7T 1X2KA 4GLKA 4M78F 2M02A 2KQWA 5FWCA 4OF1A 3TREA 4A4HA 2DBMA 2C0OA 4C92B 1ZA1B 2NUZA 4A4GA 2E3HA 1WIEA 2KBTA 4E6RA 1CSKA 5KYWA 1V29B 2D0QB 2V8KA 4HVUA 2FL7A 4C0DB 2RQRA 4PJOD 4ZGEB 4WTOB 2LQ8A 5LL6S 4PJOE 1JRIA 1MMNA 2O4XB 1VQ5Q 2EW3A 1Q81R 4AMCA 2LRQA 2L3QA 4F7UE 1W6XA 2HMAA 1D09B 1WXBA 3V7RA 4AFSC 4J7IA 1JEGA 2JOYA 2EWNA 4J6WA 1LJOA 3CD6T 1EZZB 1TXQA 1E7OA 1UTIA 3OYAA 3CCMT 5GAMh 3H0HA 3EFOA 4M78D 1KC8U 4HCZA 3PMTA 1WJRA 1VYTA 1R8OB 3M0SA 2QGFB 2EYZA 1OZ3A 2YUOA 4RG8A 3CC4A 3EGDA 2MIOA 1N9RA 3CXCP 2QQ9A 5CQXA 3CCET 5GANh 4B9XA 4M7AD 3OA6A 4KGXB 5GJWB 1N8RR 2LTOA 2XU8A 1Q86R 4M7AE 3QG1A 4E7JA 4J8OA 3BY7A 3EGXB 2YHTA 1Y07A 1RI9A 1UUEA 1JO8A 1VQLT 9ATCB 3NTKA 4M7DB 1M3CA 2RO0A 8AT1B 1U8RA 3HRUA 3CCUQ 1NZ9A 4PJMA 2DNUA 2F2VA 2P84A 1OQKA 1WJSA 4EMKA 1M90U 4OMOA 1K9MU 5GAOp 3CCLT 2OI3A 3DB4A 4A4FA 3C4SA 4CC2A 2M9UA 2RA2A 2DRMA 2ZCFB 3I56Q 1SHFA 1BB9A 1I4K1 2VXFA 3CCRQ 4R0KA 3G6EQ 4IUUA 4PJLA 3G4SQ 3EG0A 3QUIA 1K4US 1NPRA 4VUBA 1XOVA 4C0FA 4IUPA 2F69A 2C0TA 4F04B 3V8KA 4F17A 1QCOA 4DBHA 3ASKA 4M78A 2DL3A 3BE3A 3RMQA 2DXBA 1ZUKA 2K9GA 1F1BB 3X25B 2OAWA 2LX7A 2KGTA 4UC4A 4Z02A 3TEEA 3M56A 1G5VA 2X4JA 2M1HA 3OYCA 4KRTA 1Y71A 1TS9A 4RTTA 4RUGA 3VYGA 3CCSQ 4BE0A 4M77D 2IG0A 3V7SA 1M1KC 5IT9E 3ZEHA 4M77E 2MAMA 4RTYA 4LDWA 2GNCA 4QVCA 4XTWA 3OMGA 4C5GA 2RK1A 3MEUA 1IO6A 4C8QD 5HCKA 3MO8A 3CBPA 2LP5A 3CCVA 2DERA 3G1JA 4J83A 2PZ1A 3OMCA 4C8QE 3CC4T 2CZ0B 2KRNA 5I2SA 1TTHB 2BZXA 3HTRA 3F70A 2Z0WA 2H3JA 5GAN8 3H0FA 4GBQA 1KQ2A 2RQTA 2BE7D 1R77A 1IHVA 3HSBA 2JS2A 4L6V5 1OU8A 4CC7A 1OV3A 1NJIR 4PL6A 1Q7YU 4CC3A 4M75G 2OTLQ 3A1PA 3BDLA 2DRKA 2LNVA 4RTVA 3NGPA 5CO7A 4DOVA 3E19A 5I22A 2Y4YA 2ZPEB 4LDVA 4X9CA 1YP5A 2E5KA 3D7SB 2CT4A 2HQXA 1KIKA 2FRYA 2JXBA 1YNZA 1WHJA 5KYXA 3PIOA 3JAME 2OTJA 2KYBA 1PC0A 2GF7A 4E7HA 4E2FB 1YJNA 1KFZA 3M4YA 4DOWA 3G71T 3A8MB 2YUQA 1VYVA 3EG9B 1WHMA 3LX7A 1I8FA 1UG1A 4PFZA 1PRLC 2X4XA 3SHWA 5DY9A 3CCSA 5LJ3d 2PUOB 1ZA2B 3QHSA 1Q81C 4C92D 1U1TA 1D0XA 3L2RA 4KUIA 2YUPA 5CK9A 1VQKT 2FRWA 4EMKB 1BIBA 4FYXB 2KYMA 4C92E 4PJOB 4M75A 2RPNA 4KBMB 3E9FA 1NYFA 2VXEA 2RJDA 1S72Q 2DIGA 1NE8A 4RMOA 4OGCA 2F2XA 4BE2A 2LX9A 2QDYB 4F7UB 1VQMQ 2RJEA 2J6FA 4IURA 4X1VA 4XU1A 3SB2A 2CS7A 2DYBA 5GAMg 2A28A 2X35A 4D6WA 3OYNA 5I11A 1N27A 1VQOQ 3CCVT 2ZPHB 1TU0B 2CREA 4RTWA 1N8RC 3I35A 3OQ5A 4KGZB 1VQ9T 1Q86C 1IRXA 2EJ9A 5GANg 3J7AF 4M78B 5KYUA 2FYKA 1TOVA 1XTDA 5LJ5h 3BDUA 1IGQA 2VGNA 3META 4Z8AA 1QCFA 3VS4A 1YIJA 3FJPA 1Y96A 1MNEA 2HCKA 1BK2A 1VQ6A 3FRNA 5HKCA 2HNIA 3OY9A 3CMAA 3MP6A 4KUDK 3KBGA 3A8OB 2MCNA 1WXTA 3JB9F 4R56A 4RTUA 2FO0A 3VUZA 2F2WA 4MZPA 5FRNA 3JB9J 4J9FA 3A98A 1SSHA 4BI8B 4M75C 1I07A 2OAUA 2CZ1B 4FCYA 3S3MA 1UGPB 1PKTA 2PUKB 1UHFA 3CXCA 3ER0A 2JVVA 3L42A 3SD4A 3A5ZB 2XDDA 2F5KA 1LCKA 2E6ZA 2DVEA 2OTJT 1J3TA 5KCOA 1KHIA 1I5LA 4BDZA 1G83A 1YJNT 4C5IA 3I55A 5IH2A 4M7DE 2PQWA 2MWOA 4XU3A 3VV0A 2GBQA 2CP7A 3M0UA 1SRMA 5LJ3f 2AT1B 5KCHA 1AVZC 5C6SA 2KNBB 2HL3A 1OPKA 1G3WA 1Q95G 3JSCA 3SWNB 1E6GA 2DEQA 2V1QA 2E41A 2V1RA 1NEGA 2LDMA 1H92A 1PSEA 1QLYA 1P92A 1GFCA 3C94A 2A08A 4J9CA 3URGA 3JB9D 2A37A 2L2PA 5GAN2 2FZCB 3MEAA 5KYXB 1ZBJA 3OYGA 3QJYA 1X75C 4ZN3A 1H641 2JW4A 1Q82U 3QPHA 3OS0A 2R5MA 4JJBA 1QP3A 3TVTA 1VQLQ 4QKUA 2LQWA 4M77B 1SRLA 3U23A 1VIEA 1MMDA 1G2BA 3X28B 5GAN6 4P5NA 1YHQA 1MHNA 4OMQA 2G3RA 1LNXA 2EQMA 2DKGA 4IUVA 2LCCA 2DXUA 1AT1B 1NJIC 2BE9B 3JCMd 3TQ7P 2FVUA 4JJDA 1FMWA 3EG1A 4J5YA 2VV5A 4XQ3A 1VQ6T 3GNGA 1PCXA 2K5FA 2DVJA 2DTHA 2K5LA 4O5VA 1KD1R 1VQPA 4LNPA 5GMKi 3IQLA 2LVMA 3A8LB 1M1KR 1YJ9A 1QVFA 4MMLA 4PK4A 3OYLA 3KFVA 3X20B 3GP8A 2VC8A 1NLPC 3RESA 4A4KA 2KR3A 4Y92A 2FPFA 5KYYA 4DEYA 1C1AA 4JZ4A 2DM1A 2D8HA 1RAGB 3A8GB 1K8AR 2K7AA 1YITT 3C0CA 3VRYA 1CKBA 2X51A 2KEAA 2HL5C 4A53A 3CEYA 1M4ZA 3UF4A 2COZA 1Z9QA 3L1AA 2E5QA 3OB9A 1FWZA 3I55T 2KI7A 5D6WA 2O9SA 4ORZA 2CP2A 2J6OA 3CPFA 4J9EA 2BTTA 2P4RA 2A7YA 4FYVB 1FXXA 4PKCC 2COYA 1D0YA 2EGEA 3P8HA 3G7ZA 4BI4A 3MEVA 2IPOB 1WFWA 4BY6C 4X9DA 4DBQA 2QA4A 1BU1A 2E4HA 3EHQA 3QZ5B 5GANe 3MKDA 3CXCS 2YUNA 3TSZA 3M53A 3H9NA 1VQ8Q 5J26A 4JZ3A 4BI3A 1N8RU 3JV3A 2DETA 3J80E 5FU6B 4FT2A 4RCBA 3E9GA 4Y28E
chains in the Genus database with same CATH topology
1YWOA 1SHGA 1K4US 2KRSA 1XOVA 2G6FX 1UJ0A 2RMOA 2C0TA 5IHNA 4F17A 1SEMA 2J06A 3PVLA 4HXJA 2SRCA 2BZ8A 2M0YA 2KXDA 2DL3A 2DA9A 1ZUKA 3M0TA 4LN2A 2K9GA 1I1JA 2OAWA 2LX7A 4J9DA 2K3BA 2KGTA 2ROLA 1T0JA 1JXOA 1T0HA 4KRTA 3VS0A 4K11A 1AOJA 4RTTA 4RUGA 2PTKA 1VA7A 2KXCA 3RNJA 3SEMA 1MUZA 2JM9A 3FJ5A 1ZUUA 2BZYA 3H0IA 2CSIA 1KJWA 1JU5C 4RTYA 4LUDA 3PE0A 2GNCA 2ENMA 1H8KA 2EKHA 5IHIA 3M0RA 2O88A 1IO6A 5HCKA 4F16A 1X6BA 5IXBA 1TG0A 2LP5A 2PZ1A 1CKAA 4HVWA 1HSQA 1AWXA 2KRNA 2BZXA 2DF6A 4AFZC 2W0ZA 3H0FA 4GBQA 2ABLA 2RQTA 1GFDA 1WLPB 2JS0A 2W10A 2CT3A 2EPDA 5IHKA 1WA7A 2JS2A 2CUDA 1GCQA 2EBPA 1GRIA 4J9BA 4CC7A 2ESWA 2JT4A 3ULRB 1OV3A 1AD5A 2GTJA 2DL8A 1NM7A 1GBQA 2KE9A 2RF0A 2DL7A 4CC3A 1OPLA 1SPKA 2DBKA 4A63B 1QWFA 2DRKA 2J05A 4LE9A 4RTVA 2JM8A 3NGPA 4J9IA 2GTOA 1WYXA 2DL4A 2LMJA 5I22A 2DLPA 1X27A 1YP5A 2E5KA 5FWBA 2CT4A 2ED1A 1ARKA 1KIKA 2FRYA 2JXBA 1RLQC 1K1ZA 2K79A 1YNZA 2K6DA 2EQIA 2KYBA 1FYNA 4OMLA 1KFZA 1PWTA 3PVQA 1U5SA 4AG2C 2D0NA 2MOXA 2YUQA 1VYVA 1UDLA 3VS5A 1E6HA 1U06A 1UG1A 1ZX6A 5EC7A 2LZ6B 1PRLC 3SHWA 2JMCA 1GCPA 2L3SA 1Z9ZA 2JMAA 3H41A 1ABQA 2GQIA 2L0AA 2X3WD 1GCQC 1MV3A 2AKLA 2YUPA 2FRWA 1K76A 3CQTA 2KYMA 2RPNA 2LQNA 1NYFA 2KROA 2F2XA 3ZL7C 1OEBA 2C0IA 1T3SA 1PRMC 2J6FA 1X43A 2X3XD 2VWFA 1PHTA 4X1VA 3R6NA 1UFFA 2DYBA 1UGVA 1WXUA 2A28A 3LH5A 4DEXA 5I11A 1QWEA 2FPDA 2XMFA 2RQUA 2CREA 4OMMA 4RTWA 1U3OA 3I35A 1QKWA 1JQQA 2RN8A 5ECAA 4CC4B 2NWMA 4QT7A 1VYUA 1AWOA 5IXFA 2J7IA 3QWYA 4Z88A 3REBB 1S1NA 1EFNA 3VS2A 2CSQA 2LNHB 1T3LA 2AZVA 1UJYA 4AG1C 3M0QA 4Z8AA 1QCFA 3VS4A 1RLPC 1W1FA 2HCKA 1BK2A 2EVRA 5FW9A 4F14A 1Y0MA 2DJQA 1X69A 2KT1A 2L3PA 2SEMA 2MCNA 1WXTA 1K0XA 3NHNA 2OJ2A 2YSQA 1YN8A 4RTUA 1A0NB 2KRMA 1TUCA 4M4ZA 2FO0A 4AFUC 2F2WA 1V1CA 1UE9A 2A36A 2DE0X 2EYWA 4IIOA 4J9FA 1AEYA 2GGRA 3A98A 1SSHA 2D8JA 1I07A 3EG3A 3VRZA 1B3QA 3I5SA 2DILA 1PKTA 2QDLA 1UHFA 2CH4A 2KT8A 2DMOA 1ABOA 2LCSA 1LCKA 1PKSA 2O2OA 1NG2A 1WI7A 3REAB 1J3TA 4Z89A 1ZUYA 1M27C 3EG2A 4FSSA 1YWPA 2CDTA 2YDLA 2VVKA 3VS7A 1G83A 4OMPA 1NLOC 2RNAA 5IH2A 2YT6A 1H3HA 1GL5A 4JPBW 1I0CA 2GBQA 1K9AA 4D8KA 2EGCA 1SRMA 3M0UA 1Y57A 1AWJA 1JXMA 1NEBA 2ROTA 1ZSGA 1UHCA 2B86A 3I9QA 2O9VA 3QWXX 1AVZC 2RQWA 2PNIA 1M30A 2ECZA 2RQVA 2KNBB 3EHRA 2CH4W 4LUEA 4D8DA 1OPKA 1W70A 1X2KA 2AZSA 2DL5A 5FWCA 1X6GA 1E6GA 2V1QA 2V1RA 1NEGA 2J6KA 1H92A 3UATA 2DBMA 1NYGA 2FEIA 1HD3A 1QLYA 2C0OA 1GFCA 2A08A 4J9CA 2D1XA 2AKKA 2A37A 2L2PA 2NUZA 2VKNA 1WIEA 1ZBJA 2KBTA 4E6RA 1CSKA 2JW4A 4J9HA 1GBRA 4HCKA 4HVUA 4JJBA 3TVTA 2LQWA 2RQRA 1SRLA 3U23A 1G2BA 2DX1A 1M8MA 1TUDA 4OMQA 2EYXA 1RUWA 2EW3A 3THKA 1YCSB 1ZLMA 4JJCA 2L3QA 2HSPA 1W6XA 4JJDA 2AK5A 1WXBA 3EG1A 3GBQA 4AFSC 1JEGA 1KSWA 3TSWA 1K0SA 2EYYA 1FMKA 1E7OA 1UTIA 1UECA 2HDAA 4AFQC 3H0HA 2DVJA 2IIMA 4ZNXA 1AWWA 1VYTA 4LNPA 3M0SA 2EYZA 3IQLA 2YUOA 2MIOA 4ESRA 2I0NA 3O5ZA 3KFVA 3VS1A 3NPFA 2LJ1A 1BBZA 1NLPC 2KR3A 4WCIA 1MV0B 4Y92A 2FPFA 2H8HA 1HJDA 2K2MA 5GJWB 4DEYA 4JZ4A 1AZGB 2DM1A 2LJ3A 4RTXA 2D8HA 2HBWA 1WDXA 1M3BA 4GLMA 2K7AA 2HEQA 2ED0A 3C0CA 3VRYA 1CKBA 2O31A 4J9GA 2KEAA 2FPEA 2LJ0A 3UF4A 3UA7A 5L23A 1Z9QA 3M0PA 5GJVB 1QKXA 1AZEA 3VS6A 1RI9A 1UUEA 1JO8A 1M3AA 1OOTA 4EIKA 1M3CA 1PNJA 3EGUA 2O9SA 4ORZA 2FG0A 4RTZA 2DNUA 2J6OA 2F2VA 1N5ZA 4J9EA 2BTTA 2P4RA 2M51A 3UA6A 4OMOA 2JTEA 2EGEA 2OI3A 1WX6A 4CC2A 1WFWA 4HVVA 3NMZC 1B07A 1X2QA 2DRMA 3RBBB 1BU1A 3EHQA 4OMNA 1SHFA 3VS3A 2YUNA 1BB9A 3TSZA 2CUBA 4JZ3A 4R0KA 3JV3A 4IIMA 3I5RA 2EGAA 3EG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YWO A;  1SHG A;  1K4U S;  2KRS A;  1XOV A;  2G6F X;  1UJ0 A;  2RMO A;  2C0T A;  5IHN A;  4F17 A;  1SEM A;  2J06 A;  3PVL A;  4HXJ A;  2SRC A;  2BZ8 A;  2M0Y A;  2KXD A;  2DL3 A;  2DA9 A;  1ZUK A;  3M0T A;  4LN2 A;  2K9G A;  1I1J A;  2OAW A;  2LX7 A;  4J9D A;  2K3B A;  2KGT A;  2ROL A;  1T0J A;  1JXO A;  1T0H A;  4KRT A;  3VS0 A;  4K11 A;  1AOJ A;  4RTT A;  4RUG A;  2PTK A;  1VA7 A;  2KXC A;  3RNJ A;  3SEM A;  1MUZ A;  2JM9 A;  3FJ5 A;  1ZUU A;  2BZY A;  3H0I A;  2CSI A;  1KJW A;  1JU5 C;  4RTY A;  4LUD A;  3PE0 A;  2GNC A;  2ENM A;  1H8K A;  2EKH A;  5IHI A;  3M0R A;  2O88 A;  1IO6 A;  5HCK A;  4F16 A;  1X6B A;  5IXB A;  1TG0 A;  2LP5 A;  2PZ1 A;  1CKA A;  4HVW A;  1HSQ A;  1AWX A;  2KRN A;  2BZX A;  2DF6 A;  4AFZ C;  2W0Z A;  3H0F A;  4GBQ A;  2ABL A;  2RQT A;  1GFD A;  1WLP B;  2JS0 A;  2W10 A;  2CT3 A;  2EPD A;  5IHK A;  1WA7 A;  2JS2 A;  2CUD A;  1GCQ A;  2EBP A;  1GRI A;  4J9B A;  4CC7 A;  2ESW A;  2JT4 A;  3ULR B;  1OV3 A;  1AD5 A;  2GTJ A;  2DL8 A;  1NM7 A;  1GBQ A;  2KE9 A;  2RF0 A;  2DL7 A;  4CC3 A;  1OPL A;  1SPK A;  2DBK A;  4A63 B;  1QWF A;  2DRK A;  2J05 A;  4LE9 A;  4RTV A;  2JM8 A;  3NGP A;  4J9I A;  2GTO A;  1WYX A;  2DL4 A;  2LMJ A;  5I22 A;  2DLP A;  1X27 A;  1YP5 A;  2E5K A;  5FWB A;  2CT4 A;  2ED1 A;  1ARK A;  1KIK A;  2FRY A;  2JXB A;  1RLQ C;  1K1Z A;  2K79 A;  1YNZ A;  2K6D A;  2EQI A;  2KYB A;  1FYN A;  4OML A;  1KFZ A;  1PWT A;  3PVQ A;  1U5S A;  4AG2 C;  2D0N A;  2MOX A;  2YUQ A;  1VYV A;  1UDL A;  3VS5 A;  1E6H A;  1U06 A;  1UG1 A;  1ZX6 A;  5EC7 A;  2LZ6 B;  1PRL C;  3SHW A;  2JMC A;  1GCP A;  2L3S A;  1Z9Z A;  2JMA A;  3H41 A;  1ABQ A;  2GQI A;  2L0A A;  2X3W D;  1GCQ C;  1MV3 A;  2AKL A;  2YUP A;  2FRW A;  1K76 A;  3CQT A;  2KYM A;  2RPN A;  2LQN A;  1NYF A;  2KRO A;  2F2X A;  3ZL7 C;  1OEB A;  2C0I A;  1T3S A;  1PRM C;  2J6F A;  1X43 A;  2X3X D;  2VWF A;  1PHT A;  4X1V A;  3R6N A;  1UFF A;  2DYB A;  1UGV A;  1WXU A;  2A28 A;  3LH5 A;  4DEX A;  5I11 A;  1QWE A;  2FPD A;  2XMF A;  2RQU A;  2CRE A;  4OMM A;  4RTW A;  1U3O A;  3I35 A;  1QKW A;  1JQQ A;  2RN8 A;  5ECA A;  4CC4 B;  2NWM A;  4QT7 A;  1VYU A;  1AWO A;  5IXF A;  2J7I A;  3QWY A;  4Z88 A;  3REB B;  1S1N A;  1EFN A;  3VS2 A;  2CSQ A;  2LNH B;  1T3L A;  2AZV A;  1UJY A;  4AG1 C;  3M0Q A;  4Z8A A;  1QCF A;  3VS4 A;  1RLP C;  1W1F A;  2HCK A;  1BK2 A;  2EVR A;  5FW9 A;  4F14 A;  1Y0M A;  2DJQ A;  1X69 A;  2KT1 A;  2L3P A;  2SEM A;  2MCN A;  1WXT A;  1K0X A;  3NHN A;  2OJ2 A;  2YSQ A;  1YN8 A;  4RTU A;  1A0N B;  2KRM A;  1TUC A;  4M4Z A;  2FO0 A;  4AFU C;  2F2W A;  1V1C A;  1UE9 A;  2A36 A;  2DE0 X;  2EYW A;  4IIO A;  4J9F A;  1AEY A;  2GGR A;  3A98 A;  1SSH A;  2D8J A;  1I07 A;  3EG3 A;  3VRZ A;  1B3Q A;  3I5S A;  2DIL A;  1PKT A;  2QDL A;  1UHF A;  2CH4 A;  2KT8 A;  2DMO A;  1ABO A;  2LCS A;  1LCK A;  1PKS A;  2O2O A;  1NG2 A;  1WI7 A;  3REA B;  1J3T A;  4Z89 A;  1ZUY A;  1M27 C;  3EG2 A;  4FSS A;  1YWP A;  2CDT A;  2YDL A;  2VVK A;  3VS7 A;  1G83 A;  4OMP A;  1NLO C;  2RNA A;  5IH2 A;  2YT6 A;  1H3H A;  1GL5 A;  4JPB W;  1I0C A;  2GBQ A;  1K9A A;  4D8K A;  2EGC A;  1SRM A;  3M0U A;  1Y57 A;  1AWJ A;  1JXM A;  1NEB A;  2ROT A;  1ZSG A;  1UHC A;  2B86 A;  3I9Q A;  2O9V A;  3QWX X;  1AVZ C;  2RQW A;  2PNI A;  1M30 A;  2ECZ A;  2RQV A;  2KNB B;  3EHR A;  2CH4 W;  4LUE A;  4D8D A;  1OPK A;  1W70 A;  1X2K A;  2AZS A;  2DL5 A;  5FWC A;  1X6G A;  1E6G A;  2V1Q A;  2V1R A;  1NEG A;  2J6K A;  1H92 A;  3UAT A;  2DBM A;  1NYG A;  2FEI A;  1HD3 A;  1QLY A;  2C0O A;  1GFC A;  2A08 A;  4J9C A;  2D1X A;  2AKK A;  2A37 A;  2L2P A;  2NUZ A;  2VKN A;  1WIE A;  1ZBJ A;  2KBT A;  4E6R A;  1CSK A;  2JW4 A;  4J9H A;  1GBR A;  4HCK A;  4HVU A;  4JJB A;  3TVT A;  2LQW A;  2RQR A;  1SRL A;  3U23 A;  1G2B A;  2DX1 A;  1M8M A;  1TUD A;  4OMQ A;  2EYX A;  1RUW A;  2EW3 A;  3THK A;  1YCS B;  1ZLM A;  4JJC A;  2L3Q A;  2HSP A;  1W6X A;  4JJD A;  2AK5 A;  1WXB A;  3EG1 A;  3GBQ A;  4AFS C;  1JEG A;  1KSW A;  3TSW A;  1K0S A;  2EYY A;  1FMK A;  1E7O A;  1UTI A;  1UEC A;  2HDA A;  4AFQ C;  3H0H A;  2DVJ A;  2IIM A;  4ZNX A;  1AWW A;  1VYT A;  4LNP A;  3M0S A;  2EYZ A;  3IQL A;  2YUO A;  2MIO A;  4ESR A;  2I0N A;  3O5Z A;  3KFV A;  3VS1 A;  3NPF A;  2LJ1 A;  1BBZ A;  1NLP C;  2KR3 A;  4WCI A;  1MV0 B;  4Y92 A;  2FPF A;  2H8H A;  1HJD A;  2K2M A;  5GJW B;  4DEY A;  4JZ4 A;  1AZG B;  2DM1 A;  2LJ3 A;  4RTX A;  2D8H A;  2HBW A;  1WDX A;  1M3B A;  4GLM A;  2K7A A;  2HEQ A;  2ED0 A;  3C0C A;  3VRY A;  1CKB A;  2O31 A;  4J9G A;  2KEA A;  2FPE A;  2LJ0 A;  3UF4 A;  3UA7 A;  5L23 A;  1Z9Q A;  3M0P A;  5GJV B;  1QKX A;  1AZE A;  3VS6 A;  1RI9 A;  1UUE A;  1JO8 A;  1M3A A;  1OOT A;  4EIK A;  1M3C A;  1PNJ A;  3EGU A;  2O9S A;  4ORZ A;  2FG0 A;  4RTZ A;  2DNU A;  2J6O A;  2F2V A;  1N5Z A;  4J9E A;  2BTT A;  2P4R A;  2M51 A;  3UA6 A;  4OMO A;  2JTE A;  2EGE A;  2OI3 A;  1WX6 A;  4CC2 A;  1WFW A;  4HVV A;  3NMZ C;  1B07 A;  1X2Q A;  2DRM A;  3RBB B;  1BU1 A;  3EHQ A;  4OMN A;  1SHF A;  3VS3 A;  2YUN A;  1BB9 A;  3TSZ A;  2CUB A;  4JZ3 A;  4R0K A;  3JV3 A;  4IIM A;  3I5R A;  2EGA A;  3EG0 A; 
#chains in the Genus database with same CATH topology
 2PU9 B;  1LOJ A;  1YWO A;  1SHG A;  2KRS A;  3MPU B;  1QVG A;  2JZ2 A;  1UJ0 A;  2HKN A;  5IHN A;  3E2U A;  3PVL A;  2RK2 A;  3VKI A;  3M0T A;  4LN2 A;  3JCM f;  3QDF A;  4JDS A;  4MZM A;  1I81 A;  3RUX A;  3AT1 B;  2ROL A;  1V76 A;  4ZTJ A;  2F5T X;  4EPC A;  1VA7 A;  3TCJ A;  3SEM A;  5LJ5 g;  1MUZ A;  4NL2 A;  5CAI A;  2BZY A;  1BIA A;  3G71 Q;  3M55 A;  3VYH B;  4ELY C;  3H8Z A;  1BCO A;  5IHI A;  5LJ3 j;  4XTZ A;  4F16 A;  1TG0 A;  1ZBX A;  1VQP T;  4KGV B;  1YJ9 T;  4BD3 A;  3OYK A;  1SSF A;  1HSQ A;  4OB1 B;  1AWX A;  1EX4 A;  1M1F A;  3PIP A;  2FHD A;  4M78 E;  4AFZ C;  1G8X A;  1QP2 A;  3MCA B;  2CP6 A;  1VQK Q;  1GFD A;  2JS0 A;  2CT3 A;  4KT0 E;  1WA7 A;  3JB9 I;  3M4G A;  1GCQ A;  2JT4 A;  2EKO A;  2GTJ A;  3QBY A;  2X4Y A;  2DL8 A;  1XQH A;  1SPK A;  5FU7 B;  4XTU A;  4E7S A;  3CCQ A;  1X01 A;  1K73 R;  4PLL A;  3QKJ A;  1WYX A;  2DL4 A;  3T9N A;  3JCM Q;  3CCJ Q;  3CC7 T;  4ZGD B;  4ZN1 A;  1QVF S;  1X27 A;  1VQ9 Q;  5FWB A;  4HCC A;  1ARK A;  2K6D A;  2DK3 A;  3FC3 A;  2EQI A;  2XDB A;  1RAB B;  1D3B A;  4M7A G;  4FW2 A;  2M16 A;  4M75 F;  1NBE B;  2K5I A;  3SFM A;  5I21 A;  1VQ4 Q;  2CKK A;  1BCM A;  1ZX6 A;  5HY6 A;  1VQ5 A;  4BB7 A;  4ANJ A;  2V8I A;  5GAM j;  3CPW A;  2LC4 A;  2L3S A;  5DLQ E;  1Z9Z A;  1YI2 Q;  1D1B A;  3CME Q;  1GCQ C;  1MV3 A;  1VOM A;  2XID A;  1K76 A;  3CQT A;  3P8D A;  1IRE B;  4DQ2 A;  2KRO A;  2L89 A;  3MP8 A;  1KQS S;  1BKB A;  1SKU B;  4Q5W A;  1OEB A;  2K3X A;  1T3S A;  1KD1 C;  5GAN 4;  2I2L A;  1PRM C;  2CZ7 B;  3R6N A;  4AT1 B;  1UGV A;  1QVF P;  4N4G A;  2QAZ A;  3INZ A;  1M2V A;  1U3O A;  5KYW B;  1QVG S;  5ECA A;  1K8A C;  4CC4 B;  3FDR A;  1VYU A;  5GAO l;  5GAO m;  1AWO A;  2EQJ A;  3AHU A;  4M75 D;  1EFN A;  2CSQ A;  1T3L A;  1UJY A;  4DA4 A;  3M0Q A;  1SF9 A;  4FSX A;  1RLP C;  4C5E A;  5KE3 A;  3CCU A;  2EVR A;  4FYW B;  2PVD B;  5FW9 A;  4F14 A;  1X69 A;  2KT1 A;  2L3P A;  4L5G A;  1K0X A;  2LT1 A;  2OJ2 A;  2YSQ A;  2DTO A;  5KYN A;  1OI1 A;  2NUP A;  1TUC A;  1JB0 E;  3CCQ T;  4M4Z A;  3FB9 A;  4IUT A;  4AFU C;  2DYI A;  1TWB A;  3ZFJ A;  4MZT A;  3BW1 A;  1UE9 A;  2DE0 X;  2EYW A;  1DJ7 B;  2D8J A;  1WHG A;  4C8Q G;  3I56 A;  3EFO B;  1B3Q A;  3I5S A;  2DIL A;  4KH0 B;  1KQS P;  2CH4 A;  3GOX A;  3CCR A;  4FIB A;  1WQ7 A;  2KT8 A;  3G6E A;  3EGD B;  1ABO A;  3OYD A;  2NYS A;  3REA B;  4FYY B;  4Z89 A;  3C12 A;  3G4S A;  1HK9 A;  1KG1 A;  3HRT A;  3NTH A;  2O01 E;  2RNA A;  4JS5 A;  4XTX A;  5GAO q;  3VJP A;  5LJ5 e;  1K9A A;  4QQ6 A;  1W2B A;  1QVG P;  1AWJ A;  1JXM A;  1NEB A;  2ROT A;  4L59 A;  1UHC A;  3VU3 C;  2L3R A;  4M7A C;  1G3S A;  1VQ5 T;  2B86 A;  2RQW A;  4FU6 A;  1O9S A;  2ECZ A;  1QW1 A;  2NUT A;  3EHR A;  5GAN 5;  2E6N A;  4JS4 A;  1X6G A;  1X6O A;  1WHK A;  3JCM V;  1UGS B;  3UAT A;  1NYG A;  1HD3 A;  1UEB A;  2KMT A;  3RKX A;  2AKK A;  2BKD N;  3OYI A;  5D6Y A;  1IXD A;  2QEX Q;  3GF5 A;  2D9T A;  3OS1 A;  3QXE B;  3CC2 Q;  2MWP A;  5KH6 A;  1YJW Q;  2JN0 A;  3JCM X;  1OX8 A;  2DX1 A;  1ZSZ A;  2MK5 A;  1M8M A;  1M9S A;  1TUD A;  5J3B A;  3WVD B;  3OYJ A;  2EYX A;  1VQN Q;  3CPW S;  5CIU A;  1XJW B;  3CBO A;  2HKQ B;  1ZLM A;  1VQ7 Q;  2HSP A;  3QYH B;  4A4E A;  4C92 G;  2ZPG B;  2AK5 A;  2OTL A;  5GMK e;  3HFN A;  3OYB A;  3GBQ A;  1M2O A;  3QII A;  1KSW A;  3CCU T;  4XK8 E;  3TSW A;  3M59 A;  1K0S A;  1RAH B;  3PGG A;  2EFI A;  1K73 C;  2CGH A;  4AFQ C;  2MF2 A;  4PJJ A;  4ZNX A;  1AWW A;  2D6F A;  3DLM A;  2WAC A;  2I0N A;  3VS1 A;  3NPF A;  2LJ1 A;  3RR6 A;  1MV0 B;  2H8H A;  2K2V A;  1HJD A;  2E65 A;  2K2M A;  1BI1 A;  1AZG B;  2LJ3 A;  4RTX A;  4N4H A;  1G3Y A;  5GAM d;  1R0C B;  3G6E T;  2GFU A;  3OYM A;  4C8Q C;  3G4S T;  2LJ0 A;  1ZHI A;  5GJV B;  1QKX A;  2H3E B;  2M0O A;  1AZE A;  4XAX B;  1QMC A;  5GAN d;  2YXY A;  1PNJ A;  4N4I A;  3WVE B;  2FG0 A;  4RTZ A;  2RJC A;  3CD6 Q;  1ZSZ C;  1N5Z A;  3CPW P;  5GMK l;  1WGS A;  3CCM Q;  3L2W A;  2M51 A;  2JTE A;  2JJ9 A;  5L8R E;  1KC8 C;  1S72 A;  3X24 B;  3CCS T;  1WX6 A;  1M1K U;  4HVV A;  2QEX A;  1M8V A;  1B07 A;  3QYG B;  3CCE Q;  3RBB B;  5GMK h;  3GPL A;  4E7K A;  1VQM A;  2NLU A;  4OMN A;  2QI2 A;  2KK4 A;  3NFC A;  3MHX A;  2XHC A;  2CUB A;  2PVG B;  3DLL A;  1VQO A;  1UGR B;  4IIM A;  1H3Z A;  3L2Z A;  3M54 A;  2O4X A;  4M7D G;  1TUG B;  4CI0 C;  3OSS C;  4QQD A;  2G6F X;  1RL2 A;  1SEM A;  1W2B S;  2J06 A;  4HXJ A;  2R5A A;  2SRC A;  2EQU A;  2M0Y A;  3V7C A;  4ZGJ B;  2Y90 A;  2LCL A;  5CR2 A;  1ACM B;  1I1J A;  1B7T A;  2GCX A;  1WHL A;  3S3N A;  1OUL A;  5CKD A;  1T0J A;  3JB9 H;  3L2Q A;  1T0H A;  2EIF A;  2GFA A;  3CCL Q;  1M90 C;  1K9M C;  1AOJ A;  1RAF B;  1VUB A;  2JTF A;  2KXC A;  2C06 A;  3NTI A;  3JCM P;  1KJW A;  2R57 A;  1JU5 C;  4LUD A;  4XTV A;  2RHX A;  4M75 B;  1YIJ T;  4GY5 A;  2PVO B;  5J39 A;  4C92 C;  2DAQ A;  2YRD A;  4NS5 A;  1WQW A;  1X6B A;  3HFO A;  1RAD B;  3RKW A;  3CMA T;  1CKA A;  4HVW A;  1OZ2 A;  1B34 A;  3QSU A;  1WJQ A;  1PD1 A;  5GAM f;  2DTI A;  2DF6 A;  2IVW A;  2QQA A;  3MJX A;  4C0D C;  4DBF A;  5A0D A;  1YBY A;  2FZK B;  2W10 A;  4O6J A;  2EPD A;  2ATC B;  4M7D A;  3OW2 A;  2CUD A;  3CD6 A;  1GRI A;  5GAN f;  3ULR B;  3A8H B;  3QZ9 B;  4JJN K;  4CRI A;  1NM7 A;  4PLI A;  4OGE A;  2HSE B;  1WHH A;  2RF0 A;  2DL7 A;  4E47 A;  5KYU B;  2VAS A;  4IUQ A;  2DBK A;  4EDU A;  1W2B P;  1C6V X;  2XKO C;  2HAX A;  1Q81 U;  1Y96 B;  4LE9 A;  2JM8 A;  3C95 A;  2CYZ B;  4J9I A;  4PJO F;  3CC4 Q;  1S72 T;  3UDC A;  3M57 A;  2VYT A;  2P0Q A;  3FIF A;  1RLQ C;  1K1Z A;  2K79 A;  4N0A C;  4JUV A;  2EYQ A;  2KY9 A;  2YWW A;  4E7I A;  4F7U F;  1FYN A;  5LJ3 h;  3UWN A;  1KQS A;  4OML A;  1VQL A;  5CKF A;  3PVQ A;  5FRO A;  4RKU E;  2DZC A;  2D0N A;  1VQO T;  5CKH A;  2JNG A;  1Q86 U;  4BUG A;  3LWI A;  1U06 A;  5EC7 A;  2HBP A;  1O75 A;  1Q7Y C;  5CCA A;  3CCL A;  3PMI A;  2FZG B;  2EJF A;  1D1C A;  2JMC A;  2Y4X A;  3UPU A;  1IHW A;  1MGQ A;  2JMA A;  1GXI E;  1NPP A;  4M7D C;  3UT1 A;  2DXC A;  2X3W D;  2AKL A;  4PFP A;  4C0Z A;  2XI9 A;  1K73 U;  1YHQ T;  5CQY A;  2LQN A;  4M7A F;  3RIR A;  1MMG A;  2RI5 A;  3ZL7 C;  1WZO A;  1YFN A;  2K57 A;  2HQE A;  2DJZ A;  4OP0 A;  5C0M A;  2X3X D;  2VWF A;  1PHT A;  1WXU A;  3LH5 A;  4DEX A;  4WF2 A;  4X34 A;  2FPD A;  2XMF A;  4OMM A;  1QKW A;  2KSS A;  4E7L A;  1JQQ A;  1OYX A;  5HK0 A;  5CKE A;  3JCM J;  2NWM A;  4QT7 A;  3M5A A;  2J7I A;  3QWY A;  3RMS A;  4Z88 A;  3REB B;  4HCB A;  1JBM A;  1N6A A;  2DPP B;  3VS2 A;  4RCC A;  2LNH B;  3FEO A;  5FLX E;  2A0F B;  2AZV A;  4II1 A;  2ZPB B;  5D6X A;  4PJO G;  2WSC E;  4AG1 C;  2ZZD A;  2DEU A;  4ZTF A;  2QTV A;  2JTM A;  1W1F A;  3PNW C;  2QQB A;  4HT9 A;  2RHI A;  4LXC A;  1Y0M A;  4F7U G;  2SEM A;  3NHN A;  3TU4 K;  4C5H A;  2KRM A;  4BY6 B;  3RDV A;  3JCM e;  5LJ5 d;  4IIO A;  1AEY A;  2GGR A;  3DB3 A;  2RHZ A;  5HK3 A;  2RI2 A;  3EG3 A;  2QYZ A;  3CCV Q;  1B34 B;  2L8D A;  1VQ8 A;  3H6Z A;  1W4S A;  2DMO A;  4M78 G;  2EJG A;  3VUB A;  4OB2 B;  2LCS A;  1PKS A;  1WI7 A;  2E70 A;  3EG9 A;  3SDZ A;  3WXM B;  1ZUY A;  3EG2 A;  5I2M A;  4J7F A;  2YDL A;  3PTA A;  5KYY B;  4OMP A;  2QA4 T;  4LDX A;  3OW2 S;  2YT6 A;  4M77 F;  1GL5 A;  2QQS A;  1I0C A;  4FW1 A;  2P4T A;  1HYO A;  2EGC A;  4MDX A;  1Y57 A;  5A2Q E;  4IKF A;  1BI2 A;  5DM7 R;  1RAI B;  2O9V A;  2MYS A;  4PJO A;  4JLG A;  4C8Q F;  3OS2 A;  1NJI U;  1M30 A;  2RQV A;  4LUE A;  1IGU A;  4D8D A;  1W70 A;  2AZS A;  2DL5 A;  4C0G A;  4F7U A;  1SG5 A;  2J6K A;  6AT1 B;  3G71 A;  2FEI A;  3JCM c;  2KAF A;  2D1X A;  4Y91 A;  2E3I A;  5GAN j;  4KUL A;  1XNI A;  1KC8 R;  2RI3 A;  2VKN A;  3CBM A;  2OTJ Q;  4J9H A;  1GBR A;  1IZ6 A;  4HCK A;  1ZQ1 A;  3JCM h;  1YJN Q;  1VQK A;  1PD0 A;  1VIF A;  3LH0 A;  1RUW A;  4M7A A;  4J6X A;  3THK A;  2B8A A;  5GAN 7;  1YCS B;  3OW2 P;  4JJC A;  3V8L A;  4V2S A;  1TH7 A;  4XTY A;  2F1L A;  2MI6 A;  2V26 A;  4M75 E;  3JCM b;  3HP9 A;  3M58 A;  2EYY A;  5FRM A;  4EMK C;  1FMK A;  2FB7 A;  3LLR A;  1UEC A;  4PJO C;  5LJ5 f;  3CCJ A;  2HDA A;  4ELZ C;  1K9M R;  1M90 R;  2IIM A;  3QDR B;  1VQ9 A;  4M77 G;  2DFU A;  1Q82 C;  1U1S A;  1KHC A;  4ESR A;  2AIR B;  2VB6 A;  3O5Z A;  4HA8 A;  3RKY A;  1BBZ A;  4EMG A;  4WCI A;  2EAY A;  4B6M A;  3PT9 A;  4C92 F;  2HBW A;  1WDX A;  1M3B A;  1VQ8 T;  4GLM A;  4BAC A;  2HEQ A;  2ED0 A;  2V8J A;  2RH2 A;  2O31 A;  4J9G A;  5LJ3 g;  1VQ4 A;  2FPE A;  1I5O B;  5KE2 A;  1RI0 A;  4XU2 A;  3UA7 A;  5L23 A;  3M0P A;  2DZ9 A;  2ZGW A;  3VS6 A;  3ME9 A;  4M78 C;  1M3A A;  1OOT A;  4JLI A;  4EIK A;  2LT4 A;  3EGU A;  5GAO n;  1YIJ Q;  3SWN A;  1VQ6 Q;  1YI2 A;  2HD0 A;  2HZY A;  1RAA B;  3CME A;  3ZBD A;  5M9O A;  2DXT A;  3CMA Q;  3O8V A;  1OU9 A;  3UA6 A;  2QXF A;  4B9W A;  8ATC B;  3OS5 A;  2KDS A;  3NMZ C;  2E64 A;  2K4Y A;  2QG9 B;  1X2Q A;  2XD0 A;  2ZPI B;  4OB3 B;  3LYI A;  2P0K A;  4LDU A;  4FT4 A;  2YRC A;  2VGM A;  5CVI A;  3VS3 A;  5A0L A;  1JJ2 A;  5GAN 3;  4JRI A;  4PJN A;  4M77 A;  1PG5 B;  2RB6 A;  3HL8 A;  2E1H A;  2ZPF B;  1YIT Q;  3I5R A;  2EGA A;  2COW A;  4NOY A;  1G3T A;  4ATO A;  1D3B B;  4A54 A;  5A0G A;  4JRP A;  4C8Q A;  2RMO A;  3I55 Q;  4ME7 A;  4BDY A;  2BZ8 A;  2L5Q A;  2KXD A;  2DA9 A;  1EIF A;  2WSF E;  4XU0 A;  1PM3 A;  4J9D A;  2K3B A;  2QQR A;  1Q7Y R;  1JXO A;  4JRK A;  2BUD A;  3VS0 A;  4K11 A;  2PTK A;  3RNJ A;  2JM9 A;  3FJ5 A;  1ZUU A;  3H0I A;  2YRV A;  2CSI A;  2HQH A;  4R55 A;  1KK7 A;  3SWN C;  3PE0 A;  4M7D F;  2ENM A;  4QVD A;  2E10 A;  1H8K A;  2K3Y A;  3S6W A;  4HT8 A;  2CP3 A;  2EKH A;  3OYE A;  3M0R A;  3CCJ T;  2O88 A;  3GLX A;  3OYY A;  1C0M A;  5IXB A;  4QQG A;  2RHU A;  4PFO A;  4LD6 A;  3PFS A;  3RER A;  5D7U A;  3EAE A;  5DLO A;  2QK0 A;  2R58 A;  4DBR A;  4EMH A;  2W0Z A;  2ABL A;  4M77 C;  1R0B G;  2XK0 A;  1QVP A;  1WLP B;  3I56 T;  3LGF A;  5IHK A;  1M2V B;  1YHQ Q;  2EBP A;  4J9B A;  4M7A B;  3CCR T;  2ESW A;  2MPX C;  3OSV A;  1AD5 A;  2RHY A;  1KQ1 A;  1VQ4 T;  1GBQ A;  2KE9 A;  1UGQ B;  1OPL A;  1RAC B;  5IAY A;  2JUF A;  2YLC A;  3OBW A;  4A63 B;  1QCN A;  2ZAE A;  1QWF A;  2J05 A;  3N5B B;  1YI2 T;  3CME T;  2GTO A;  2LMJ A;  4HKE A;  3Q1J A;  2DLP A;  5GMK m;  3LGL A;  4C92 A;  1VQP Q;  2NUP B;  1D1A A;  1YIT A;  2ED1 A;  5AYF A;  1YJ9 Q;  3LW5 E;  2GQV A;  4M7D D;  2A3L A;  1KD1 U;  2KVQ G;  3MEW A;  1BYM A;  4E7Z A;  3EH2 A;  2LQK A;  3R6O A;  1PWT A;  1U5S A;  4AG2 C;  3CC2 A;  7AT1 B;  1BI3 A;  2MOX A;  3HHT B;  3GIB A;  3DKM A;  1YJW A;  2X9H A;  3OYF A;  5LJ5 j;  1UDL A;  3EH1 A;  3QO3 A;  3VS5 A;  1K8A U;  1E6H A;  5EG2 A;  3JCM g;  1VQN A;  2CZ6 B;  2LZ6 B;  4QVZ A;  2DO3 A;  5IN1 A;  1GCP A;  1VQ7 A;  3H41 A;  1ABQ A;  2GQI A;  2L0A A;  3M9Q A;  2P0P A;  3E1S A;  5CKB A;  3CC7 Q;  4QW2 A;  1D0Z A;  4BE1 A;  4MMK A;  5AT1 B;  2CP0 A;  2RM4 A;  2NUT B;  4LD9 K;  2E12 A;  3BFM A;  2BIV A;  2C0I A;  1JJ2 S;  2QA4 Q;  2OTL T;  1AHJ B;  4N0A A;  1X43 A;  2DD4 A;  1WNL A;  5LJ3 e;  2RJF A;  3OBY A;  3OYH A;  1UFF A;  2OX7 A;  2WSE E;  4KH1 B;  3JB9 G;  4TVR A;  1QWE A;  1YCY A;  3HPW A;  4JRQ A;  2DIQ A;  3GNF B;  1QQJ A;  4OB0 B;  2RQU A;  5FU6 C;  4C8Q B;  2CP5 A;  2RN8 A;  3QJ6 A;  4YTL A;  3V8J A;  2XIC A;  2QGG A;  5IXF A;  1S1N A;  1FX7 A;  1BI0 A;  3EGX A;  4NL3 A;  3JRZ A;  2EQK A;  3HRS A;  1ZSZ B;  2QTX A;  1MMA A;  5GAO r;  5GMK j;  2AHJ B;  1UB4 A;  2RD1 A;  1TSF A;  3KUF A;  3L2V A;  2DJQ A;  2DD5 A;  3CCM A;  1M1G A;  1HXD A;  3X26 B;  3MP1 A;  1YN8 A;  1A0N B;  2VUB A;  1MND A;  1OX9 A;  3P8B B;  3EFS A;  1PSF A;  1LVK A;  4RG2 A;  1V1C A;  3KXT A;  4OMF B;  3CCE A;  2A36 A;  3LWH A;  1LPL A;  3VRZ A;  3HKS A;  2QDL A;  4LDY A;  2XDP A;  1Q82 R;  2YLB A;  3FLG A;  2O2O A;  1JJ2 P;  1NG2 A;  4FM4 B;  3JCM W;  4FSS A;  1M27 C;  2MMP A;  1YWP A;  2CDT A;  2X4W A;  4J6Y A;  2QEX T;  2VVK A;  4OVA A;  1RAE B;  3VS7 A;  1VQM T;  1NLO C;  3J81 E;  1H3H A;  1Y7X A;  4JPB W;  3CC2 T;  1FMV A;  4D8K A;  1YJW T;  1M5Q 1;  3CC7 A;  1ZSG A;  3EFR A;  5GAM e;  3I9Q A;  3L2U A;  4FL6 A;  4PNO A;  1VQN T;  1WPY A;  3QWX X;  4MDW A;  3S3O A;  2XG8 D;  2QAS A;  1IB8 A;  2PNI A;  3CCQ Q;  1N9S A;  2CH4 W;  5FU7 C;  1VQ7 T;  1X2K A;  4GLK A;  4M78 F;  2M02 A;  2KQW A;  5FWC A;  4OF1 A;  3TRE A;  4A4H A;  2DBM A;  2C0O A;  4C92 B;  1ZA1 B;  2NUZ A;  4A4G A;  2E3H A;  1WIE A;  2KBT A;  4E6R A;  1CSK A;  5KYW A;  1V29 B;  2D0Q B;  2V8K A;  4HVU A;  2FL7 A;  4C0D B;  2RQR A;  4PJO D;  4ZGE B;  4WTO B;  2LQ8 A;  5LL6 S;  4PJO E;  1JRI A;  1MMN A;  2O4X B;  1VQ5 Q;  2EW3 A;  1Q81 R;  4AMC A;  2LRQ A;  2L3Q A;  4F7U E;  1W6X A;  2HMA A;  1D09 B;  1WXB A;  3V7R A;  4AFS C;  4J7I A;  1JEG A;  2JOY A;  2EWN A;  4J6W A;  1LJO A;  3CD6 T;  1EZZ B;  1TXQ A;  1E7O A;  1UTI A;  3OYA A;  3CCM T;  5GAM h;  3H0H A;  3EFO A;  4M78 D;  1KC8 U;  4HCZ A;  3PMT A;  1WJR A;  1VYT A;  1R8O B;  3M0S A;  2QGF B;  2EYZ A;  1OZ3 A;  2YUO A;  4RG8 A;  3CC4 A;  3EGD A;  2MIO A;  1N9R A;  3CXC P;  2QQ9 A;  5CQX A;  3CCE T;  5GAN h;  4B9X A;  4M7A D;  3OA6 A;  4KGX B;  5GJW B;  1N8R R;  2LTO A;  2XU8 A;  1Q86 R;  4M7A E;  3QG1 A;  4E7J A;  4J8O A;  3BY7 A;  3EGX B;  2YHT A;  1Y07 A;  1RI9 A;  1UUE A;  1JO8 A;  1VQL T;  9ATC B;  3NTK A;  4M7D B;  1M3C A;  2RO0 A;  8AT1 B;  1U8R A;  3HRU A;  3CCU Q;  1NZ9 A;  4PJM A;  2DNU A;  2F2V A;  2P84 A;  1OQK A;  1WJS A;  4EMK A;  1M90 U;  4OMO A;  1K9M U;  5GAO p;  3CCL T;  2OI3 A;  3DB4 A;  4A4F A;  3C4S A;  4CC2 A;  2M9U A;  2RA2 A;  2DRM A;  2ZCF B;  3I56 Q;  1SHF A;  1BB9 A;  1I4K 1;  2VXF A;  3CCR Q;  4R0K A;  3G6E Q;  4IUU A;  4PJL A;  3G4S Q;  3EG0 A;  3QUI A;  1K4U S;  1NPR A;  4VUB A;  1XOV A;  4C0F A;  4IUP A;  2F69 A;  2C0T A;  4F04 B;  3V8K A;  4F17 A;  1QCO A;  4DBH A;  3ASK A;  4M78 A;  2DL3 A;  3BE3 A;  3RMQ A;  2DXB A;  1ZUK A;  2K9G A;  1F1B B;  3X25 B;  2OAW A;  2LX7 A;  2KGT A;  4UC4 A;  4Z02 A;  3TEE A;  3M56 A;  1G5V A;  2X4J A;  2M1H A;  3OYC A;  4KRT A;  1Y71 A;  1TS9 A;  4RTT A;  4RUG A;  3VYG A;  3CCS Q;  4BE0 A;  4M77 D;  2IG0 A;  3V7S A;  1M1K C;  5IT9 E;  3ZEH A;  4M77 E;  2MAM A;  4RTY A;  4LDW A;  2GNC A;  4QVC A;  4XTW A;  3OMG A;  4C5G A;  2RK1 A;  3MEU A;  1IO6 A;  4C8Q D;  5HCK A;  3MO8 A;  3CBP A;  2LP5 A;  3CCV A;  2DER A;  3G1J A;  4J83 A;  2PZ1 A;  3OMC A;  4C8Q E;  3CC4 T;  2CZ0 B;  2KRN A;  5I2S A;  1TTH B;  2BZX A;  3HTR A;  3F70 A;  2Z0W A;  2H3J A;  5GAN 8;  3H0F A;  4GBQ A;  1KQ2 A;  2RQT A;  2BE7 D;  1R77 A;  1IHV A;  3HSB A;  2JS2 A;  4L6V 5;  1OU8 A;  4CC7 A;  1OV3 A;  1NJI R;  4PL6 A;  1Q7Y U;  4CC3 A;  4M75 G;  2OTL Q;  3A1P A;  3BDL A;  2DRK A;  2LNV A;  4RTV A;  3NGP A;  5CO7 A;  4DOV A;  3E19 A;  5I22 A;  2Y4Y A;  2ZPE B;  4LDV A;  4X9C A;  1YP5 A;  2E5K A;  3D7S B;  2CT4 A;  2HQX A;  1KIK A;  2FRY A;  2JXB A;  1YNZ A;  1WHJ A;  5KYX A;  3PIO A;  3JAM E;  2OTJ A;  2KYB A;  1PC0 A;  2GF7 A;  4E7H A;  4E2F B;  1YJN A;  1KFZ A;  3M4Y A;  4DOW A;  3G71 T;  3A8M B;  2YUQ A;  1VYV A;  3EG9 B;  1WHM A;  3LX7 A;  1I8F A;  1UG1 A;  4PFZ A;  1PRL C;  2X4X A;  3SHW A;  5DY9 A;  3CCS A;  5LJ3 d;  2PUO B;  1ZA2 B;  3QHS A;  1Q81 C;  4C92 D;  1U1T A;  1D0X A;  3L2R A;  4KUI A;  2YUP A;  5CK9 A;  1VQK T;  2FRW A;  4EMK B;  1BIB A;  4FYX B;  2KYM A;  4C92 E;  4PJO B;  4M75 A;  2RPN A;  4KBM B;  3E9F A;  1NYF A;  2VXE A;  2RJD A;  1S72 Q;  2DIG A;  1NE8 A;  4RMO A;  4OGC A;  2F2X A;  4BE2 A;  2LX9 A;  2QDY B;  4F7U B;  1VQM Q;  2RJE A;  2J6F A;  4IUR A;  4X1V A;  4XU1 A;  3SB2 A;  2CS7 A;  2DYB A;  5GAM g;  2A28 A;  2X35 A;  4D6W A;  3OYN A;  5I11 A;  1N27 A;  1VQO Q;  3CCV T;  2ZPH B;  1TU0 B;  2CRE A;  4RTW A;  1N8R C;  3I35 A;  3OQ5 A;  4KGZ B;  1VQ9 T;  1Q86 C;  1IRX A;  2EJ9 A;  5GAN g;  3J7A F;  4M78 B;  5KYU A;  2FYK A;  1TOV A;  1XTD A;  5LJ5 h;  3BDU A;  1IGQ A;  2VGN A;  3MET A;  4Z8A A;  1QCF A;  3VS4 A;  1YIJ A;  3FJP A;  1Y96 A;  1MNE A;  2HCK A;  1BK2 A;  1VQ6 A;  3FRN A;  5HKC A;  2HNI A;  3OY9 A;  3CMA A;  3MP6 A;  4KUD K;  3KBG A;  3A8O B;  2MCN A;  1WXT A;  3JB9 F;  4R56 A;  4RTU A;  2FO0 A;  3VUZ A;  2F2W A;  4MZP A;  5FRN A;  3JB9 J;  4J9F A;  3A98 A;  1SSH A;  4BI8 B;  4M75 C;  1I07 A;  2OAU A;  2CZ1 B;  4FCY A;  3S3M A;  1UGP B;  1PKT A;  2PUK B;  1UHF A;  3CXC A;  3ER0 A;  2JVV A;  3L42 A;  3SD4 A;  3A5Z B;  2XDD A;  2F5K A;  1LCK A;  2E6Z A;  2DVE A;  2OTJ T;  1J3T A;  5KCO A;  1KHI A;  1I5L A;  4BDZ A;  1G83 A;  1YJN T;  4C5I A;  3I55 A;  5IH2 A;  4M7D E;  2PQW A;  2MWO A;  4XU3 A;  3VV0 A;  2GBQ A;  2CP7 A;  3M0U A;  1SRM A;  5LJ3 f;  2AT1 B;  5KCH A;  1AVZ C;  5C6S A;  2KNB B;  2HL3 A;  1OPK A;  1G3W A;  1Q95 G;  3JSC A;  3SWN B;  1E6G A;  2DEQ A;  2V1Q A;  2E41 A;  2V1R A;  1NEG A;  2LDM A;  1H92 A;  1PSE A;  1QLY A;  1P92 A;  1GFC A;  3C94 A;  2A08 A;  4J9C A;  3URG A;  3JB9 D;  2A37 A;  2L2P A;  5GAN 2;  2FZC B;  3MEA A;  5KYX B;  1ZBJ A;  3OYG A;  3QJY A;  1X75 C;  4ZN3 A;  1H64 1;  2JW4 A;  1Q82 U;  3QPH A;  3OS0 A;  2R5M A;  4JJB A;  1QP3 A;  3TVT A;  1VQL Q;  4QKU A;  2LQW A;  4M77 B;  1SRL A;  3U23 A;  1VIE A;  1MMD A;  1G2B A;  3X28 B;  5GAN 6;  4P5N A;  1YHQ A;  1MHN A;  4OMQ A;  2G3R A;  1LNX A;  2EQM A;  2DKG A;  4IUV A;  2LCC A;  2DXU A;  1AT1 B;  1NJI C;  2BE9 B;  3JCM d;  3TQ7 P;  2FVU A;  4JJD A;  1FMW A;  3EG1 A;  4J5Y A;  2VV5 A;  4XQ3 A;  1VQ6 T;  3GNG A;  1PCX A;  2K5F A;  2DVJ A;  2DTH A;  2K5L A;  4O5V A;  1KD1 R;  1VQP A;  4LNP A;  5GMK i;  3IQL A;  2LVM A;  3A8L B;  1M1K R;  1YJ9 A;  1QVF A;  4MML A;  4PK4 A;  3OYL A;  3KFV A;  3X20 B;  3GP8 A;  2VC8 A;  1NLP C;  3RES A;  4A4K A;  2KR3 A;  4Y92 A;  2FPF A;  5KYY A;  4DEY A;  1C1A A;  4JZ4 A;  2DM1 A;  2D8H A;  1RAG B;  3A8G B;  1K8A R;  2K7A A;  1YIT T;  3C0C A;  3VRY A;  1CKB A;  2X51 A;  2KEA A;  2HL5 C;  4A53 A;  3CEY A;  1M4Z A;  3UF4 A;  2COZ A;  1Z9Q A;  3L1A A;  2E5Q A;  3OB9 A;  1FWZ A;  3I55 T;  2KI7 A;  5D6W A;  2O9S A;  4ORZ A;  2CP2 A;  2J6O A;  3CPF A;  4J9E A;  2BTT A;  2P4R A;  2A7Y A;  4FYV B;  1FXX A;  4PKC C;  2COY A;  1D0Y A;  2EGE A;  3P8H A;  3G7Z A;  4BI4 A;  3MEV A;  2IPO B;  1WFW A;  4BY6 C;  4X9D A;  4DBQ A;  2QA4 A;  1BU1 A;  2E4H A;  3EHQ A;  3QZ5 B;  5GAN e;  3MKD A;  3CXC S;  2YUN A;  3TSZ A;  3M53 A;  3H9N A;  1VQ8 Q;  5J26 A;  4JZ3 A;  4BI3 A;  1N8R U;  3JV3 A;  2DET A;  3J80 E;  5FU6 B;  4FT2 A;  4RCB A;  3E9G A;  4Y28 E; 
#chains in the Genus database with same CATH homology
 1YWO A;  1SHG A;  1K4U S;  2KRS A;  1XOV A;  2G6F X;  1UJ0 A;  2RMO A;  2C0T A;  5IHN A;  4F17 A;  1SEM A;  2J06 A;  3PVL A;  4HXJ A;  2SRC A;  2BZ8 A;  2M0Y A;  2KXD A;  2DL3 A;  2DA9 A;  1ZUK A;  3M0T A;  4LN2 A;  2K9G A;  1I1J A;  2OAW A;  2LX7 A;  4J9D A;  2K3B A;  2KGT A;  2ROL A;  1T0J A;  1JXO A;  1T0H A;  4KRT A;  3VS0 A;  4K11 A;  1AOJ A;  4RTT A;  4RUG A;  2PTK A;  1VA7 A;  2KXC A;  3RNJ A;  3SEM A;  1MUZ A;  2JM9 A;  3FJ5 A;  1ZUU A;  2BZY A;  3H0I A;  2CSI A;  1KJW A;  1JU5 C;  4RTY A;  4LUD A;  3PE0 A;  2GNC A;  2ENM A;  1H8K A;  2EKH A;  5IHI A;  3M0R A;  2O88 A;  1IO6 A;  5HCK A;  4F16 A;  1X6B A;  5IXB A;  1TG0 A;  2LP5 A;  2PZ1 A;  1CKA A;  4HVW A;  1HSQ A;  1AWX A;  2KRN A;  2BZX A;  2DF6 A;  4AFZ C;  2W0Z A;  3H0F A;  4GBQ A;  2ABL A;  2RQT A;  1GFD A;  1WLP B;  2JS0 A;  2W10 A;  2CT3 A;  2EPD A;  5IHK A;  1WA7 A;  2JS2 A;  2CUD A;  1GCQ A;  2EBP A;  1GRI A;  4J9B A;  4CC7 A;  2ESW A;  2JT4 A;  3ULR B;  1OV3 A;  1AD5 A;  2GTJ A;  2DL8 A;  1NM7 A;  1GBQ A;  2KE9 A;  2RF0 A;  2DL7 A;  4CC3 A;  1OPL A;  1SPK A;  2DBK A;  4A63 B;  1QWF A;  2DRK A;  2J05 A;  4LE9 A;  4RTV A;  2JM8 A;  3NGP A;  4J9I A;  2GTO A;  1WYX A;  2DL4 A;  2LMJ A;  5I22 A;  2DLP A;  1X27 A;  1YP5 A;  2E5K A;  5FWB A;  2CT4 A;  2ED1 A;  1ARK A;  1KIK A;  2FRY A;  2JXB A;  1RLQ C;  1K1Z A;  2K79 A;  1YNZ A;  2K6D A;  2EQI A;  2KYB A;  1FYN A;  4OML A;  1KFZ A;  1PWT A;  3PVQ A;  1U5S A;  4AG2 C;  2D0N A;  2MOX A;  2YUQ A;  1VYV A;  1UDL A;  3VS5 A;  1E6H A;  1U06 A;  1UG1 A;  1ZX6 A;  5EC7 A;  2LZ6 B;  1PRL C;  3SHW A;  2JMC A;  1GCP A;  2L3S A;  1Z9Z A;  2JMA A;  3H41 A;  1ABQ A;  2GQI A;  2L0A A;  2X3W D;  1GCQ C;  1MV3 A;  2AKL A;  2YUP A;  2FRW A;  1K76 A;  3CQT A;  2KYM A;  2RPN A;  2LQN A;  1NYF A;  2KRO A;  2F2X A;  3ZL7 C;  1OEB A;  2C0I A;  1T3S A;  1PRM C;  2J6F A;  1X43 A;  2X3X D;  2VWF A;  1PHT A;  4X1V A;  3R6N A;  1UFF A;  2DYB A;  1UGV A;  1WXU A;  2A28 A;  3LH5 A;  4DEX A;  5I11 A;  1QWE A;  2FPD A;  2XMF A;  2RQU A;  2CRE A;  4OMM A;  4RTW A;  1U3O A;  3I35 A;  1QKW A;  1JQQ A;  2RN8 A;  5ECA A;  4CC4 B;  2NWM A;  4QT7 A;  1VYU A;  1AWO A;  5IXF A;  2J7I A;  3QWY A;  4Z88 A;  3REB B;  1S1N A;  1EFN A;  3VS2 A;  2CSQ A;  2LNH B;  1T3L A;  2AZV A;  1UJY A;  4AG1 C;  3M0Q A;  4Z8A A;  1QCF A;  3VS4 A;  1RLP C;  1W1F A;  2HCK A;  1BK2 A;  2EVR A;  5FW9 A;  4F14 A;  1Y0M A;  2DJQ A;  1X69 A;  2KT1 A;  2L3P A;  2SEM A;  2MCN A;  1WXT A;  1K0X A;  3NHN A;  2OJ2 A;  2YSQ A;  1YN8 A;  4RTU A;  1A0N B;  2KRM A;  1TUC A;  4M4Z A;  2FO0 A;  4AFU C;  2F2W A;  1V1C A;  1UE9 A;  2A36 A;  2DE0 X;  2EYW A;  4IIO A;  4J9F A;  1AEY A;  2GGR A;  3A98 A;  1SSH A;  2D8J A;  1I07 A;  3EG3 A;  3VRZ A;  1B3Q A;  3I5S A;  2DIL A;  1PKT A;  2QDL A;  1UHF A;  2CH4 A;  2KT8 A;  2DMO A;  1ABO A;  2LCS A;  1LCK A;  1PKS A;  2O2O A;  1NG2 A;  1WI7 A;  3REA B;  1J3T A;  4Z89 A;  1ZUY A;  1M27 C;  3EG2 A;  4FSS A;  1YWP A;  2CDT A;  2YDL A;  2VVK A;  3VS7 A;  1G83 A;  4OMP A;  1NLO C;  2RNA A;  5IH2 A;  2YT6 A;  1H3H A;  1GL5 A;  4JPB W;  1I0C A;  2GBQ A;  1K9A A;  4D8K A;  2EGC A;  1SRM A;  3M0U A;  1Y57 A;  1AWJ A;  1JXM A;  1NEB A;  2ROT A;  1ZSG A;  1UHC A;  2B86 A;  3I9Q A;  2O9V A;  3QWX X;  1AVZ C;  2RQW A;  2PNI A;  1M30 A;  2ECZ A;  2RQV A;  2KNB B;  3EHR A;  2CH4 W;  4LUE A;  4D8D A;  1OPK A;  1W70 A;  1X2K A;  2AZS A;  2DL5 A;  5FWC A;  1X6G A;  1E6G A;  2V1Q A;  2V1R A;  1NEG A;  2J6K A;  1H92 A;  3UAT A;  2DBM A;  1NYG A;  2FEI A;  1HD3 A;  1QLY A;  2C0O A;  1GFC A;  2A08 A;  4J9C A;  2D1X A;  2AKK A;  2A37 A;  2L2P A;  2NUZ A;  2VKN A;  1WIE A;  1ZBJ A;  2KBT A;  4E6R A;  1CSK A;  2JW4 A;  4J9H A;  1GBR A;  4HCK A;  4HVU A;  4JJB A;  3TVT A;  2LQW A;  2RQR A;  1SRL A;  3U23 A;  1G2B A;  2DX1 A;  1M8M A;  1TUD A;  4OMQ A;  2EYX A;  1RUW A;  2EW3 A;  3THK A;  1YCS B;  1ZLM A;  4JJC A;  2L3Q A;  2HSP A;  1W6X A;  4JJD A;  2AK5 A;  1WXB A;  3EG1 A;  3GBQ A;  4AFS C;  1JEG A;  1KSW A;  3TSW A;  1K0S A;  2EYY A;  1FMK A;  1E7O A;  1UTI A;  1UEC A;  2HDA A;  4AFQ C;  3H0H A;  2DVJ A;  2IIM A;  4ZNX A;  1AWW A;  1VYT A;  4LNP A;  3M0S A;  2EYZ A;  3IQL A;  2YUO A;  2MIO A;  4ESR A;  2I0N A;  3O5Z A;  3KFV A;  3VS1 A;  3NPF A;  2LJ1 A;  1BBZ A;  1NLP C;  2KR3 A;  4WCI A;  1MV0 B;  4Y92 A;  2FPF A;  2H8H A;  1HJD A;  2K2M A;  5GJW B;  4DEY A;  4JZ4 A;  1AZG B;  2DM1 A;  2LJ3 A;  4RTX A;  2D8H A;  2HBW A;  1WDX A;  1M3B A;  4GLM A;  2K7A A;  2HEQ A;  2ED0 A;  3C0C A;  3VRY A;  1CKB A;  2O31 A;  4J9G A;  2KEA A;  2FPE A;  2LJ0 A;  3UF4 A;  3UA7 A;  5L23 A;  1Z9Q A;  3M0P A;  5GJV B;  1QKX A;  1AZE A;  3VS6 A;  1RI9 A;  1UUE A;  1JO8 A;  1M3A A;  1OOT A;  4EIK A;  1M3C A;  1PNJ A;  3EGU A;  2O9S A;  4ORZ A;  2FG0 A;  4RTZ A;  2DNU A;  2J6O A;  2F2V A;  1N5Z A;  4J9E A;  2BTT A;  2P4R A;  2M51 A;  3UA6 A;  4OMO A;  2JTE A;  2EGE A;  2OI3 A;  1WX6 A;  4CC2 A;  1WFW A;  4HVV A;  3NMZ C;  1B07 A;  1X2Q A;  2DRM A;  3RBB B;  1BU1 A;  3EHQ A;  4OMN A;  1SHF A;  3VS3 A;  2YUN A;  1BB9 A;  3TSZ A;  2CUB A;  4JZ3 A;  4R0K A;  3JV3 A;  4IIM A;  3I5R A;  2EGA A;  3EG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...