2GQIA

Solution structure of the sh3 domain of human ras gtpase-activating protein 1
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
71
structure length
71
Chain Sequence
GSSGSSGRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras GTPase-activating protein 1
publication title Solution structure of the SH3 domain of human Ras GTPase-activating protein 1
rcsb
source organism Homo sapiens
total genus 5
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2gqiA00
5HCKA 1ARKA 1YWPA 2GNCA 4LN2A 5EC7A 1AOJA 1OV3A 1YP5A 2JTEA 3UATA 2ECZA 4LUEA 2E5KA 5IHIA 2JM8A 3IQLA 1T3SA 2KXDA 1QWEA 4ESRA 3EG1A 1Z9QA 1QCFA 5IXFA 3FJ5A 4OMOA 1WDXA 3RNJA 1UJYA 2FO0A 2LJ1A 2LX7A 2AZVA 1E6GA 1BU1A 1QLYA 2DL7A 3ZL7C 1K76A 2RN8A 4JPBW 3M0UA 2DA9A 2KRMA 3TSWA 3H41A 3REAB 4A63B 2RMOA 2KRSA 1GFDA 2RPNA 2YUOA 2L3PA 3REBB 2AZSA 4RTTA 1J3TA 5I22A 1VYVA 2EBPA 3GBQA 1JEGA 1PRMC 2YUQA 4Z88A 2B86A 4KRTA 2IIMA 2K6DA 2AKLA 3TSZA 4CC7A 1JU5C 5IHNA 3VS2A 2SEMA 1NM7A 2CT3A 1H92A 4HVVA 1K1ZA 1M3CA 1NLOC 4Y92A 3M0PA 4OMLA 1FMKA 4IIMA 1CKBA 2JW4A 3H0HA 1UHFA 4OMMA 2FPEA 1UTIA 2CSIA 2K7AA 1H8KA 2EGEA 1KIKA 2GQIA 1W70A 1W6XA 4JJBA 2F2VA 4X1VA 1YCSB 2EVRA 2RQUA 1VA7A 2CUBA 2J06A 1SHGA 2L2PA 2EW3A 3NPFA 3VS6A 2D8JA 2DE0X 3H0IA 2A36A 2RNAA 4GBQA 1S1NA 4J9FA 1M27C 1T0JA 2C0IA 1RLQC 2ROLA 2GTJA 2AK5A 4AFUC 1E6HA 2YUNA 2M51A 1UDLA 4J9IA 2JT4A 1SRMA 1X69A 1U3OA 2F2WA 4AFZC 2DBKA 2A37A 1UJ0A 1V1CA 3QWYA 2KNBB 5IXBA 2GTOA 1ZX6A 2O9VA 2DL4A 2D1XA 2L0AA 4DEYA 5ECAA 2JS2A 3QWXX 1U06A 1X43A 1LCKA 4ORZA 1CSKA 1H3HA 1GCPA 1BBZA 2PTKA 4CC4B 2J05A 1OPKA 1NEGA 5IH2A 1RLPC 1YWOA 2L3QA 4LUDA 2G6FX 2KT8A 4K11A 1AWXA 1TG0A 2KR3A 1K9AA 3PE0A 2DLPA 1UGVA 1ZUUA 2J6FA 1KFZA 1G83A 1ABQA 1WFWA 1AVZC 2RQTA 1G2BA 4JZ4A 1B07A 2MOXA 2LZ6B 2VKNA 1EFNA 4AG2C 2CREA 3JV3A 2CUDA 4J9GA 1UG1A 4J9CA 2YUPA 2HEQA 4J9HA 1M30A 1MUZA 4AG1C 4JJDA 2LJ3A 2JS0A 2LQWA 2OAWA 1T3LA 1TUDA 3EHRA 2HSPA 1QKXA 4R0KA 2DYBA 3VS4A 4RTXA 3EHQA 1QKWA 1OOTA 1GBQA 1RUWA 3VS0A 1M8MA 1PNJA 2FPDA 5GJVB 1MV3A 1B3QA 4HCKA 2BZ8A 2FRYA 1NG2A 2A28A 1OEBA 2BZYA 4E6RA 2H8HA 2MCNA 2JXBA 1PRLC 2O9SA 3VS3A 3SHWA 2ESWA 3ULRB 1W1FA 2YSQA 2FRWA 2KYBA 2YT6A 2M0YA 2K9GA 2EPDA 1WXTA 2CT4A 3I9QA 4F16A 1HD3A 1ZSGA 2K79A 2W0ZA 1M3BA 4EIKA 4ZNXA 2DNUA 2PZ1A 1HJDA 2DILA 2EGCA 2RF0A 3I35A 4RTWA 4F17A 4RTVA 3VS7A 1ZUKA 2BTTA 4HVUA 4F14A 2NUZA 2KXCA 1WLPB 5FW9A 1WYXA 2D0NA 2KGTA 2PNIA 2KT1A 2KYMA 1QWFA 4RTZA 4QT7A 4WCIA 1X6GA 2EYWA 3I5SA 1VYUA 3M0SA 3LH5A 1M3AA 1N5ZA 2HCKA 2JMAA 1ZBJA 1X27A 5IHKA 2SRCA 2RQVA 1GBRA 1WX6A 1Y57A 2RQWA 2K2MA 1GCQC 2DBMA 3VS1A 1WXBA 1PKTA 1BK2A 2HBWA 2KBTA 2KROA 5I11A 1UUEA 2KRNA 4CC3A 1AWWA 2P4RA 3UA7A 4LE9A 3M0QA 2FEIA 1T0HA 2XMFA 4FSSA 1JXOA 3UF4A 3R6NA 1WXUA 2DVJA 2C0TA 4JZ3A 1ABOA 2K3BA 1Z9ZA 2W10A 3RBBB 2LJ0A 5FWCA 3TVTA 1MV0B 2O31A 2EKHA 2DM1A 2J6OA 4OMPA 2ED0A 1KSWA 2AKKA 4DEXA 2DX1A 2EQIA 3EG0A 3EGUA 5L23A 1NEBA 2ENMA 2V1RA 2KE9A 2QDLA 1K4US 4RUGA 3M0TA 2LQNA 4D8KA 2LP5A 1NYFA 1I07A 2ED1A 2JMCA 4HVWA 4J9BA 2FG0A 2LNHB 1WIEA 1AEYA 2KEAA 2HDAA 4AFQC 1GCQA 2RQRA 1UE9A 4JJCA 4Z89A 4GLMA 2O88A 2J7IA 2VWFA 3PVQA 2DRKA 4IIOA 1ZUYA 1X2QA 3EG3A 1SPKA 1WA7A 2GGRA 2MIOA 1A0NB 2DJQA 1PHTA 3NGPA 1K0XA 2CH4W 1YNZA 4CC2A 1GL5A 1Y0MA 1SHFA 2EYZA 2OI3A 1SSHA 3O5ZA 3CQTA 1JXMA 3VS5A 1NLPC 3THKA 1I0CA 2ABLA 1BB9A 3M0RA 1NYGA 1U5SA 2DL5A 1PKSA 5FWBA 2C0OA 2J6KA 1WI7A 2V1QA 3C0CA 1PWTA 2CDTA 3VRZA 2LCSA 1VYTA 1UECA 1OPLA 2DF6A 1GRIA 2F2XA 2ROTA 2DMOA 3I5RA 4OMNA 1SEMA 4D8DA 1CKAA 4M4ZA 1JO8A 2DL8A 4J9DA 4RTYA 2CH4A 2YDLA 2X3XD 3VRYA 4J9EA 3PVLA 2D8HA 3SEMA 3UA6A 1AWOA 2EYXA 1YN8A 5GJWB 2EGAA 1HSQA 2GBQA 2O2OA 4LNPA 1XOVA 2BZXA 2JM9A 3U23A 4AFSC 1RI9A 1UHCA 4OMQA 1FYNA 2FPFA 2X3WD 1X6BA 1AZGB 1SRLA 2L3SA 4HXJA 2DL3A 2A08A 1K0SA 3NHNA 2DRMA 1AWJA 1I1JA 1E7OA 1ZLMA 3EG2A 3NMZC 1X2KA 2LMJA 2OJ2A 4Z8AA 1JQQA 2NWMA 3A98A 1TUCA 1KJWA 1UFFA 2CSQA 2EYYA 2I0NA 3KFVA 4RTUA 1GFCA 2VVKA 3H0FA 1AD5A 1IO6A 1AZEA
chains in the Genus database with same CATH superfamily
3QDRB 2CP2A 5HCKA 1ARKA 3G71T 1YWPA 3M53A 2GNCA 1WJRA 4LN2A 5GMKh 1BKBA 1OV3A 1YP5A 2DAQA 2ECZA 1PSEA 2V8IA 1K9MC 5KE2A 1QWEA 4ESRA 3EG1A 1QCFA 1X01A 5IXFA 1WDXA 3RNJA 3CCJT 2FO0A 4BE2A 1E6GA 2MWOA 4E7LA 1BU1A 2HQHA 2LC4A 5A2QE 3V8KA 2FZGB 2DL7A 3FDRA 5HKCA 3OW2S 2VXFA 4JPBW 2FL7A 3G6EA 2K5IA 1KC8U 4C92C 2DXBA 4BY6C 3TSWA 3HFNA 2DIQA 3H41A 3REAB 2YUOA 1UEBA 1W4SA 4ZN1A 3REBB 2PQWA 1JJ2S 3GBQA 4FM4B 3CCJQ 1PRMC 3D7SB 2K6DA 2AKLA 3TSZA 4P5NA 3J81E 1VQ4T 1VQ9A 1D0ZA 3VS2A 2HNIA 5D7UA 3OS1A 3G4SA 1NM7A 4HVVA 2RHUA 3CCEA 1OQKA 4OMLA 3S6WA 4EDUA 5KYUA 4O6JA 1IHVA 3H0HA 1UHFA 1UTIA 1G5VA 5CKFA 1KIKA 4LDUA 4JJBA 2EJFA 4FU6A 1BI2A 2EVRA 1VA7A 4JJNK 2CUBA 4CI0C 1SHGA 1V76A 4KUDK 2EW3A 1UGRB 3MP6A 1K8AU 2FYKA 2A36A 1XJWB 4GBQA 4J9FA 5KYXA 1B7TA 1D0XA 2DO3A 3M57A 1MNEA 2ROLA 2GTJA 4E2FB 1Q86C 4FYVB 1E6HA 1M9SA 3OYBA 2NUPB 3QPHA 4FSXA 2FZKB 4M77G 2F2WA 2DBKA 1UJ0A 2CZ1B 2KNBB 2BUDA 2KMTA 3OY9A 4C8QA 2DPPB 1SF9A 2DL4A 1WHJA 4R56A 1WNLA 3MP1A 5C6SA 3QYGB 1ZSZB 1NE8A 3TEEA 1OPKA 5IH2A 1OI1A 4HKEA 1N8RC 3MHXA 2H3EB 2LT4A 2CP6A 1GXIE 5GAMh 1AWXA 3E2UA 3OYGA 1K9AA 2DLPA 1RAEB 1VQ5A 1YI2A 1VQLT 1ABQA 4Q5WA 2LX9A 1G3TA 1D1BA 2LZ6B 2VKNA 5CKEA 1EFNA 4AG2C 2CREA 3JV3A 4A4EA 4QQDA 2DZ9A 4J9CA 5GANh 4J9HA 5FRNA 1M30A 2JTFA 4EMKA 1MUZA 4XTZA 2JS0A 2LQWA 3CMAA 1WZOA 1B34B 2RM4A 2HKQB 1T3LA 4LD6A 2DYBA 4OB0B 4ANJA 3CCRA 4ZTJA 2RB6A 2E6ZA 2OAUA 3V7RA 2EQMA 3EFOB 5GMKi 5GAMd 3CPWA 4MZTA 4B9WA 2R58A 2FPDA 1XTDA 5GJVB 1MV3A 3N5BB 3GNGA 2ZPFB 2L89A 4BB7A 1G3SA 1Q7YR 3JCMb 1OEBA 3EAEA 3BW1A 2H8HA 2RH2A 1YJ9T 2JXBA 2V8KA 4Y91A 1QQJA 2ESWA 3ULRB 1W1FA 2YHTA 2VUBA 1VQOQ 3CCMA 1ZA2B 1V29B 2RA2A 1WXTA 4F16A 5KYNA 4M7AD 4C5HA 2K79A 4EMHA 5GAOl 1JBMA 1YJNQ 2W0ZA 4C92F 4O5VA 4EIKA 4BE1A 2EIFA 1TWBA 2RF0A 3CC2A 1YJ9Q 4HVUA 1MNDA 2HBPA 3JCMf 3OYIA 2KXCA 1WLPB 3JCMc 2D6FA 3QJ6A 3LH0A 2MI6A 4B9XA 2D0NA 2QQBA 4PL6A 3CMET 4M75B 2KGTA 2PNIA 2KT1A 2KYMA 1MHNA 3MP8A 4QT7A 2XG8D 3CCLT 5HK0A 3LYIA 1VUBA 3WVEB 4PJNA 4M78E 9ATCB 1IREB 2RQWA 3CMEQ 3QG1A 3VS1A 3CCJA 2KBTA 4KH1B 3M4YA 3GF5A 2M9UA 1AWWA 2P4RA 3H9NA 3CCLQ 2JZ2A 3M0QA 2E3IA 4MZPA 2FEIA 2QDYB 4FSSA 3R6NA 1MMGA 3GNFB 4PJOC 3I56T 2DTHA 3AT1B 1Z9ZA 2CYZB 2W10A 2X9HA 3ZFJA 4R55A 4E7IA 5FWCA 3TVTA 2O31A 2EKHA 4KBMB 1AHJB 1S72T 4DEXA 2QYZA 4F7UE 1D09B 4PFPA 4C92E 2KE9A 1QVFS 1LVKA 3HRTA 3EGDA 3I56Q 1IGQA 4A4KA 2LP5A 1DJ7B 2E41A 2PUOB 1IZ6A 2ZGWA 3SB2A 1K8AC 2HDAA 3P8HA 4FYYB 2RQRA 2P0KA 1UE9A 5GAN4 2O88A 2ATCB 3EG3A 5FU6C 2RD1A 1SPKA 1UGQB 5KYUB 1A0NB 1RADB 2EQJA 4C5EA 4DQ2A 4DBQA 2WSFE 1XQHA 3OYJA 1RAGB 5GANg 1YNZA 1OU9A 3G6ET 1GL5A 1SHFA 3O5ZA 3JB9D 1W2BS 3CEYA 1I0CA 4BI8B 2ABLA 4QVZA 1BB9A 2E65A 4HCBA 3JAME 1YJWA 5FWBA 2C0OA 1ACMB 2V1QA 2LT1A 2VV5A 3KXTA 5FRMA 5KYXB 2OX7A 2RI5A 3VRZA 5EG2A 3ASKA 2DETA 1VQ9T 2MK5A 4M77A 4XTWA 4XQ3A 3NTKA 3G4ST 2DF6A 4M7DE 4PJOG 2VXEA 2RHXA 2VC8A 4NL2A 2P0QA 4JLIA 3CCET 3RDVA 1C1AA 2RJCA 4M4ZA 4J9DA 2IVWA 3JCMW 4J9EA 8AT1B 1O9SA 4C8QB 1LNXA 1WHLA 2KVQG 1YBYA 2RJFA 1YIJQ 3G4SQ 5A0LA 4PJJA 1VQNT 3LGLA 5GAN2 1UHCA 2QASA 1D3BA 1KD1R 2X3WD 3SDZA 1X6BA 1VIEA 4HXJA 2EQUA 2GFUA 3LX7A 1ZLMA 2OJ2A 4Z8AA 3TCJA 5GAN5 3OA6A 1VQNQ 3QZ9B 4RTUA 1VQOA 4J6WA 2QQSA 3BDLA 3MJXA 4D6WA 4M7DD 2HSEB 4KH0B 1YJNA 4NOYA 5GAOr 3X26B 5EC7A 1AOJA 1N6AA 2M02A 4LUEA 4C0FA 2JM8A 2DIGA 3IQLA 2KXDA 3FJ5A 1UJYA 3VJPA 2LX7A 5LJ3j 1WHGA 2P0PA 2CKKA 1K76A 1M2VA 3CBOA 4ZN3A 3CCQA 2EYQA 2MF2A 3M0UA 2KRMA 2JTMA 4A63B 1GFDA 2KRSA 1VQ5T 1YI2T 2ZPHB 4PJOF 4PLLA 4A4FA 3OYKA 1I81A 2L3PA 3AHUA 3NTIA 3RUXA 4OF1A 4E7JA 4KRTA 4C0DB 2MAMA 1JJ2A 1RI0A 3L2ZA 4CC7A 1JU5C 3JCMh 4N4GA 1C0MA 2SEMA 3CMEA 1QVGA 1U8RA 1K1ZA 1M3CA 3CD6Q 4PJLA 3CMAT 1VQ5Q 2V26A 3EG9A 4IIMA 3CCRT 1PG5B 2CSIA 5I2SA 3UT1A 2GQIA 1W70A 1WHKA 4X1VA 2XU8A 2FZCB 4OB2B 3SWNB 1EIFA 1HK9A 3A1PA 2E70A 4A4GA 4ZTFA 3F70A 5HK3A 3CMAQ 3VS6A 2RNAA 4JUVA 3CBMA 3M9QA 3HL8A 3VUBA 2OTJQ 4BACA 3JB9H 1N9SA 1T0JA 1RLQC 1D1AA 3JCMd 2QEXQ 2LNVA 4MZMA 2AK5A 2DTOA 4M75D 3V7SA 2YUNA 2M51A 4J9IA 4XU2A 4OP0A 4TVRA 3I55T 1G8XA 2D9TA 3FIFA 4VUBA 1M4ZA 3CC2T 2QGFB 3ZEHA 2QA4Q 2LQKA 2MYSA 2KDSA 1ZX6A 3QHSA 2L0AA 2IG0A 3J80E 1U06A 4M78C 1LCKA 1H3HA 4FCYA 2F5TX 2PTKA 1NEGA 3M54A 1RLPC 3EFRA 1YWOA 3I55Q 2L3QA 4LUDA 5LJ5e 3QSUA 1H3ZA 1KQSS 3OMCA 4EMGA 4XTXA 2KR3A 3PE0A 1ZUUA 1KFZA 1G83A 1M1GA 7AT1B 1WFWA 3EGDB 1AVZC 2RQTA 4QKUA 1M8VA 3L2UA 1OULA 5LL6S 5GAOq 2KY9A 2YUPA 2X4XA 1KK7A 3VKIA 3RKXA 1TUDA 2EKOA 2FHDA 4J6YA 5J39A 4L59A 4RTXA 3EHQA 1RUWA 2QI2A 2O4XA 3VS0A 1M8MA 4AT1B 3OMGA 1PNJA 1YIJA 1B3QA 2K5FA 4DA4A 2FRYA 1NG2A 2X4YA 2A28A 3R6OA 4E6RA 5GAOn 2MCNA 1PRLC 2O9SA 5LJ3e 1R0BG 2YT6A 4XK8E 2M0YA 2K9GA 3JCMQ 3TU4K 1VQMA 1M1KR 4PJOA 3I9QA 2XICA 1ZSGA 4M78G 3OQ5A 2JVVA 4M77B 3MCAB 1VQNA 1M3BA 2DNUA 4KULA 3G1JA 3UWNA 1FXXA 3JRZA 1P92A 2VASA 4F17A 3GLXA 4RTVA 3PT9A 3VS7A 1NJIR 2DEUA 4F14A 4BY6B 3JCMg 2WACA 3Q1JA 5IAYA 3M58A 3HSBA 1FWZA 4E47A 4XTUA 4M7DC 4BI4A 1R8OB 3V7CA 1EZZB 5AYFA 2GCXA 5LJ5h 3HHTB 3C95A 4DBFA 1WGSA 2EYWA 3L1AA 4BUGA 1YJWT 1D3BB 3HPWA 5CKHA 1YCYA 3M0SA 4C8QD 1RAAB 1M3AA 3C4SA 3H8ZA 1X27A 4F7UG 5IHKA 2SRCA 5GAN8 4C92G 4E7SA 2DERA 2R5AA 3P8BB 2DBMA 2JUFA 3MPUB 1JRIA 2K4YA 2Z0WA 1Q7YU 2KROA 2EJGA 1ZQ1A 4HCCA 2R57A 2QAZA 1YJWQ 2HL5C 4LE9A 1TH7A 1T0HA 3CD6A 1JXOA 3C12A 3HKSA 2K3YA 3UF4A 1PCXA 2Y90A 3OYHA 2DVJA 2C0TA 4M7AE 1ABOA 1UGPB 3JB9I 2JOYA 3RBBB 1M90R 2DM1A 1VQPQ 4PFZA 2ED0A 3OS2A 1KSWA 1M2VB 2DX1A 3EG0A 2KAFA 5L23A 2V1RA 2QDLA 4RG8A 1K4US 4M78F 1Q82R 3CPFA 3LWHA 4LD9K 3OB9A 1M1FA 4D8KA 2OTJA 5LJ3h 2QEXA 1VQOT 4MDXA 4RG2A 2FG0A 2YXYA 1WIEA 1SKUB 5GAN7 1GCQA 2XHCA 4UC4A 3KUFA 3OYEA 1F1BB 1WPYA 1YJNT 4HT9A 4PK4A 4GLMA 1BIAA 1QCNA 3MKDA 5L8RE 3PVQA 2DRKA 3NTHA 4IIOA 2OTLQ 1X2QA 2E12A 1RAHB 2MWPA 2QA4A 1RACB 1WA7A 4M75C 5HY6A 2MIOA 3EG9B 5GANd 1TSFA 4II1A 3EFSA 2K3XA 4N0AC 3KBGA 2CP3A 2PU9B 3HP9A 5FLXE 1Y0MA 2EYZA 4F7UF 2LDMA 3CCQT 1VQ6A 1SSHA 3CQTA 1JXMA 2RO0A 3VS5A 3I55A 1TXQA 3M0RA 1ZA1B 1W2BA 2DL5A 1PKSA 4JRPA 3M59A 1WI7A 2M16A 3C0CA 3SWNA 4IURA 4OVAA 3RKYA 4KUIA 2ZPIB 2K2VA 4JDSA 3PMIA 3CCQQ 1GRIA 2F2XA 2ROTA 3E9FA 1M1KC 2K5LA 1M2OA 2X3XD 3OS0A 1YN8A 1HSQA 2GBQA 4JLGA 4LNPA 2JM9A 1VQKQ 1RI9A 4OMQA 2XDPA 5CCAA 1Y96A 2FPFA 2FB7A 2XIDA 4ATOA 2A08A 1AWJA 1PSFA 3NMZC 1X2KA 2AT1B 3OYLA 4JS5A 2CZ0B 1JQQA 2XD0A 4V2SA 4M7DF 5LJ5g 3A8HB 3PNWC 3X20B 5KYWA 4IUUA 1GFCA 3H0FA 1IO6A 2CP5A 2QQAA 5GAOm 3M5AA 3M4GA 2RHZA 3CPWP 2JTEA 1I4K1 3UATA 2GQVA 2RJDA 5KCHA 3QYHB 1T3SA 1MMAA 4XTYA 4RCCA 3CCSQ 2LJ1A 2AZVA 5IN1A 5M9OA 1Q81R 5AT1B 2O4XB 4X34A 1ZBXA 1K73R 3X25B 2VYTA 2RMOA 2M1HA 2RPNA 4NL3A 4RTTA 1J3TA 5I22A 1VYVA 2EBPA 5IT9E 4Z88A 2B86A 3HRUA 1KD1U 4M78A 4QW2A 4PJOB 2F1LA 4X9DA 4MDWA 2CT3A 4BDZA 1BI3A 1NLOC 3CXCA 2X4JA 1QP3A 4Y92A 2ZPEB 5LJ3g 2FPEA 2K7AA 1NPRA 5CAIA 3VUZA 4FIBA 3V8JA 1FMWA 1Q7YC 2F2VA 1YCSB 4M77D 1YIJT 2L2PA 5D6YA 2CGHA 3PIPA 3NPFA 4L6V5 2D8JA 2DE0X 3H0IA 1BYMA 4DBHA 3VU3C 5LJ5j 1VQPA 4M75F 5GMKl 1S1NA 4F7UA 1M27C 1IB8A 4C92A 3PTAA 1VQMT 4FT2A 3DB4A 1C6VX 2DTIA 5FU6B 1UDLA 3SFMA 2JJ9A 2LQ8A 4EMKC 2ZCFB 2NLUA 1SRMA 2ZPBB 4HT8A 4AFZC 1WQWA 2A37A 3QWYA 5CR2A 2RK2A 5IXBA 2O9VA 2D1XA 1OZ3A 2I2LA 4DEYA 3H6ZA 2IPOB 3INZA 4QQGA 1VQMQ 1G3YA 3HTRA 1RAIB 1U1TA 2OTLA 1TOVA 1CSKA 4ORZA 1GCPA 1BBZA 4QQ6A 5LJ5f 3EH1A 2VGNA 1K9MR 4AMCA 2BIVA 2A3LA 2COYA 2HMAA 4K11A 2E5QA 1KQSA 8ATCB 1UGVA 2ZZDA 4NS5A 1G2BA 4M7AC 2NYSA 1B07A 2MOXA 4ZGJB 1LOJA 1JB0E 3OW2A 3ER0A 3CD6T 3EHRA 2HSPA 1WHHA 4FW2A 4M75E 4LDVA 3VS4A 4L5GA 1H641 1I8FA 4ELZC 1GBQA 1OU8A 5FU7C 3ME9A 1R0CB 1VQKA 1VQ7Q 4HCKA 2BZ8A 5GMKe 2BZYA 3QZ5B 5LJ3f 4JS4A 3L2QA 2QTXA 3T9NA 2OTJT 2B8AA 2YSQA 3A5ZB 2KYBA 3A8LB 2QEXT 1BI1A 2EPDA 3M55A 3JSCA 1I5OB 3DKMA 1U1SA 1QVPA 1Y71A 2E4HA 2A7YA 1HJDA 2KSSA 3META 2AIRB 5CK9A 3J7AF 2XDDA 1Q86R 3OYYA 3VYGA 2QA4T 2DXTA 3QXEB 2EWNA 1X6OA 2HKNA 3CCVA 1NBEB 3C94A 2HZYA 3OSVA 4KGZB 3EGXA 1LJOA 3BDUA 5FW9A 3CCSA 1VQ6T 4RKUE 2DXCA 4J7IA 4M7AG 4FW1A 4RTZA 1QCOA 4RMOA 3BFMA 2DK3A 2GFAA 1Y96B 4PFOA 1VYUA 3QKJA 3E1SA 1OYXA 1N5ZA 3A8OB 1N8RR 4XU3A 4E7KA 2EFIA 3HRSA 1GBRA 1WX6A 3PFSA 4CRIA 3CBPA 1VQ6Q 5J3BA 2HBWA 2PVOB 4N0AA 2KRNA 5KYWB 4BE0A 1M1KU 5CVIA 2XMFA 2F69A 2YLCA 1KD1C 1WXUA 2PUKB 3OW2P 4C5IA 1NZ9A 4KGXB 2K3BA 3CCUA 4PNOA 4QVCA 2X35A 1N9RA 2X51A 3L2WA 2P84A 2J6OA 4OMPA 2BKDN 1BI0A 2AKKA 1LPLA 4FT4A 1NJIU 2EQIA 1JJ2P 3MEWA 1NEBA 3OYNA 4DOWA 3QO3A 4WTOB 3CC7Q 2RI2A 2COZA 1RAFB 1QVGP 2KI7A 3M0TA 2LQNA 4M77C 2KK4A 2DYIA 3RKWA 2EQKA 2ED1A 4B6MA 1VQ8Q 4HVWA 4C5GA 3FJPA 4J9BA 3S3MA 3RIRA 2PVDB 1AEYA 2KEAA 4AFQC 4XAXB 4M78B 1TS9A 3G71Q 2RHYA 5GAMe 1O75A 2E3HA 4JJCA 4C8QE 3MEVA 2NUTA 2J7IA 1TU0B 4M7AF 2DFUA 1UGSB 1KG1A 2K57A 1PHTA 1K0XA 4C0GA 4LDWA 2LTOA 4PJOD 2CH4W 1QVGS 3FRNA 2ZAEA 5GANe 4CC2A 2OI3A 5FROA 1OZ2A 4A54A 2RI3A 3OBYA 3RMSA 3THKA 4LXCA 2A0FB 5GAN3 1ZSZC 3P8DA 1YHQT 2CP0A 4F7UB 1QMCA 2MMPA 4C92B 1M90U 1IHWA 1VQ4Q 1VYTA 4XTVA 3GPLA 2HL3A 3I5RA 4N4HA 4OMNA 1Q82U 1SEMA 4D8DA 1CKAA 3JB9G 1YHQQ 2DL8A 2HD0A 2YDLA 3TREA 5D6XA 1KC8R 4IUTA 3PVLA 3UA6A 1AWOA 2AHJB 2EYXA 4A4HA 1WJSA 2O2OA 3PGGA 2BZXA 3U23A 4J5YA 3LLRA 1OX9A 2WSCE 3A8MB 1FYNA 4J8OA 1VQPT 1SRLA 3GOXA 1VQ7A 3G7ZA 2EAYA 2V8JA 3VYHB 1BCOA 3OSSC 4A53A 4WF2A 5KCOA 2NWMA 3A98A 3GIBA 2L5QA 5LJ5d 1YITA 2EYYA 2I0NA 2Y4XA 3SD4A 5KYYA 2QTVA 4JRQA 4M7DB 1MMDA 5CQXA 2KQWA 2E5KA 5IHIA 5A0GA 2OTLT 1QVFA 1K8AR 4FYXB 1Z9QA 4OMOA 4KT0E 1QLYA 4RCBA 3ZL7C 2RN8A 2DVEA 4DOVA 2XKOC 1WQ7A 2DA9A 3QJYA 2DEQA 1N27A 4M7DG 1VQLQ 1TTHB 3JCMJ 2AZSA 1PD0A 1JEGA 1QP2A 3X24B 2YUQA 5I2MA 2IIMA 2ZPGB 3JB9F 3A8GB 4KGVB 5IHNA 1UB4A 4J7FA 1I5LA 4BI3A 1H92A 1AT1B 3M0PA 5CKDA 5LJ3d 1FMKA 3TQ7P 1PM3A 4M77F 1CKBA 2JW4A 2LVMA 4OMMA 3ZBDA 1IXDA 1HXDA 1H8KA 4FL6A 2EGEA 4PJMA 4LDYA 1W6XA 3CC4A 4JRKA 5CO7A 2BE7D 2RQUA 5DY9A 4M7AA 2J06A 3EGXB 1VQKT 3QDFA 1VOMA 4YTLA 4OGCA 3S3OA 1D0YA 2QG9B 1WHMA 2M0OA 2LCLA 2F5KA 4IUPA 2C0IA 1Q81U 3MO8A 2HQXA 2YWWA 5I21A 4AFUC 2HQEA 3OYFA 3CC7A 1K73U 1Q95G 2JT4A 4GLKA 1NJIC 2E10A 2DJZA 1XNIA 1X69A 1U3OA 1VQ8A 1V1CA 4ZGDB 4J83A 1EX4A 2VB6A 3G71A 2GTOA 1WJQA 1X75C 3CCVT 5ECAA 2JS2A 3QWXX 3QBYA 2RK1A 1X43A 4GY5A 3JB9J 2XK0A 4CC4B 4PKCC 2J05A 1MMNA 3CCST 1KC8C 4M75G 2LCCA 2BE9B 4DBRA 1QVFP 5DLOA 1KQ1A 3UPUA 2G6FX 2KT8A 4HA8A 3BY7A 1QW1A 1TG0A 2GF7A 2DZCA 3CCVQ 5GMKj 2COWA 1RL2A 1R77A 2J6FA 4BD3A 4C0ZA 4M77E 5KE3A 3FB9A 4JZ4A 3DB3A 2CUDA 4J9GA 1RABB 1VQ4A 3JCMV 2E64A 1FX7A 3V8LA 1UG1A 4IUQA 2HEQA 4AG1C 4JJDA 2LJ3A 1G3WA 4QVDA 2OAWA 2NUTB 4JRIA 4X9CA 1M90C 4IUVA 1QKXA 4R0KA 1YHQA 3CCUT 1QKWA 1OOTA 3CPWS 3OYAA 4M78D 3RMQA 1W2BP 4OB3B 3BE3A 1Q82C 1S72Q 5GAMg 2YRCA 3UDCA 4Y28E 4HCZA 4C8QC 1PD1A 5KH6A 3NFCA 2E1HA 3L42A 1NPPA 4E7ZA 1FMVA 3CCUQ 1TUGB 3VS3A 3SHWA 1BCMA 1KHCA 2FRWA 2QXFA 1K9MU 2WSEE 2RJEA 4F04B 2CT4A 4IKFA 1HD3A 1SSFA 4ZNXA 2PZ1A 4E7HA 2DILA 5GAOp 3JCMX 2EGCA 5CQYA 3I35A 4RTWA 3E9GA 1ZUKA 4C92D 3O8VA 2BTTA 2NUZA 3JCMe 1IRXA 1WYXA 3G6EQ 3L2RA 1YFNA 1QWFA 3RESA 6AT1B 2QQ9A 4WCIA 1X6GA 2DKGA 1BIBA 3I5SA 3OS5A 4MMLA 3LH5A 3JCMP 4Z02A 2JMAA 2HCKA 1ZBJA 2MPXC 2NUPA 3URGA 1VQLA 2DD5A 2RQVA 1VQ9Q 1Y57A 2K2MA 1GCQC 2H3JA 1WXBA 1PKTA 1SG5A 2QQRA 1BK2A 2VGMA 5I11A 3CCEQ 1UUEA 3DLLA 3M56A 4CC3A 1Y7XA 3UA7A 4C0DC 5GAMj 5CKBA 2YRDA 5CIUA 5KYYB 4C8QG 1ZSZA 4JZ3A 3X28B 4ME7A 3RERA 2LJ0A 4OGEA 2D0QB 1Y07A 1MV0B 1Q86U 2CZ7B 1ZHIA 5GAN6 4ZGEB 2YRVA 4ELYC 1M5Q1 1VQ7T 4M7DA 5GANj 3EGUA 2ENMA 2XI9A 4XU1A 4EMKB 3SWNC 4RUGA 4BDYA 4EPCA 3FC3A 1YJ9A 5GMKm 3OYCA 1YITT 5DM7R 3CXCP 2CP7A 1NYFA 1I07A 3OBWA 3LWIA 1VIFA 2JMCA 3GP8A 3QIIA 3PIOA 2JNGA 5GAMf 2LNHB 5C0MA 2X4WA 4FYWB 3MEAA 2LRQA 5DLQE 1N8RU 4Z89A 1B34A 3WVDB 1PC0A 3E19A 1Q81C 1KQ2A 2VWFA 4J6XA 1ZUYA 3LW5E 1MGQA 2GGRA 3EFOA 4OMFB 1YITQ 5D6WA 1K73C 2DJQA 2EJ9A 3S3NA 3NGPA 5GANf 2QK0A 2XDBA 2CZ6B 2L8DA 3CXCS 4LDXA 4M7AB 1NLPC 1YI2Q 1NYGA 1U5SA 4N4IA 3CCLA 2J6KA 2CS7A 1PWTA 2O01E 2R5MA 3HFOA 2L3RA 2CDTA 3FEOA 2LCSA 1UECA 1OPLA 4MMKA 2E6NA 5J26A 5A0DA 4C8QF 2DMOA 1KHIA 3OYDA 1HYOA 5FU7B 2JN0A 4XU0A 3EH2A 3CCRQ 1JO8A 4RTYA 2CH4A 2Y4YA 3RR6A 3VRYA 3OYMA 2D8HA 3SEMA 4OB1B 2QGGA 3CCMT 3CC4T 5GJWB 2EGAA 4M75A 3VV0A 1XOVA 4PLIA 3I56A 1KQSP 4AFSC 2HAXA 3LGFA 3WXMB 3QUIA 1OX8A 2DXUA 2YLBA 3FLGA 1S72A 1AZGB 2L3SA 2RHIA 2DL3A 3PMTA 1K0SA 1IGUA 3NHNA 2DRMA 2P4TA 1I1JA 3L2VA 1E7OA 3CCMQ 3EG2A 3CC4Q 2FVUA 2DD4A 4PJOE 3CC7T 2LMJA 2G3RA 1D1CA 1TUCA 1KJWA 1UFFA 3DLMA 2CSQA 2C06A 2PVGB 3KFVA 3MEUA 1VQ8T 2VVKA 1AD5A 1AZEA 3CC2Q
chains in the Genus database with same CATH topology
5HCKA 1ARKA 1YWPA 2GNCA 4LN2A 5EC7A 1AOJA 1OV3A 1YP5A 2JTEA 3UATA 2ECZA 4LUEA 2E5KA 5IHIA 2JM8A 3IQLA 1T3SA 2KXDA 1QWEA 4ESRA 3EG1A 1Z9QA 1QCFA 5IXFA 3FJ5A 4OMOA 1WDXA 3RNJA 1UJYA 2FO0A 2LJ1A 2LX7A 2AZVA 1E6GA 1BU1A 1QLYA 2DL7A 3ZL7C 1K76A 2RN8A 4JPBW 3M0UA 2DA9A 2KRMA 3TSWA 3H41A 3REAB 4A63B 2RMOA 2KRSA 1GFDA 2RPNA 2YUOA 2L3PA 3REBB 2AZSA 4RTTA 1J3TA 5I22A 1VYVA 2EBPA 3GBQA 1JEGA 1PRMC 2YUQA 4Z88A 2B86A 4KRTA 2IIMA 2K6DA 2AKLA 3TSZA 4CC7A 1JU5C 5IHNA 3VS2A 2SEMA 1NM7A 2CT3A 1H92A 4HVVA 1K1ZA 1M3CA 1NLOC 4Y92A 3M0PA 4OMLA 1FMKA 4IIMA 1CKBA 2JW4A 3H0HA 1UHFA 4OMMA 2FPEA 1UTIA 2CSIA 2K7AA 1H8KA 2EGEA 1KIKA 2GQIA 1W70A 1W6XA 4JJBA 2F2VA 4X1VA 1YCSB 2EVRA 2RQUA 1VA7A 2CUBA 2J06A 1SHGA 2L2PA 2EW3A 3NPFA 3VS6A 2D8JA 2DE0X 3H0IA 2A36A 2RNAA 4GBQA 1S1NA 4J9FA 1M27C 1T0JA 2C0IA 1RLQC 2ROLA 2GTJA 2AK5A 4AFUC 1E6HA 2YUNA 2M51A 1UDLA 4J9IA 2JT4A 1SRMA 1X69A 1U3OA 2F2WA 4AFZC 2DBKA 2A37A 1UJ0A 1V1CA 3QWYA 2KNBB 5IXBA 2GTOA 1ZX6A 2O9VA 2DL4A 2D1XA 2L0AA 4DEYA 5ECAA 2JS2A 3QWXX 1U06A 1X43A 1LCKA 4ORZA 1CSKA 1H3HA 1GCPA 1BBZA 2PTKA 4CC4B 2J05A 1OPKA 1NEGA 5IH2A 1RLPC 1YWOA 2L3QA 4LUDA 2G6FX 2KT8A 4K11A 1AWXA 1TG0A 2KR3A 1K9AA 3PE0A 2DLPA 1UGVA 1ZUUA 2J6FA 1KFZA 1G83A 1ABQA 1WFWA 1AVZC 2RQTA 1G2BA 4JZ4A 1B07A 2MOXA 2LZ6B 2VKNA 1EFNA 4AG2C 2CREA 3JV3A 2CUDA 4J9GA 1UG1A 4J9CA 2YUPA 2HEQA 4J9HA 1M30A 1MUZA 4AG1C 4JJDA 2LJ3A 2JS0A 2LQWA 2OAWA 1T3LA 1TUDA 3EHRA 2HSPA 1QKXA 4R0KA 2DYBA 3VS4A 4RTXA 3EHQA 1QKWA 1OOTA 1GBQA 1RUWA 3VS0A 1M8MA 1PNJA 2FPDA 5GJVB 1MV3A 1B3QA 4HCKA 2BZ8A 2FRYA 1NG2A 2A28A 1OEBA 2BZYA 4E6RA 2H8HA 2MCNA 2JXBA 1PRLC 2O9SA 3VS3A 3SHWA 2ESWA 3ULRB 1W1FA 2YSQA 2FRWA 2KYBA 2YT6A 2M0YA 2K9GA 2EPDA 1WXTA 2CT4A 3I9QA 4F16A 1HD3A 1ZSGA 2K79A 2W0ZA 1M3BA 4EIKA 4ZNXA 2DNUA 2PZ1A 1HJDA 2DILA 2EGCA 2RF0A 3I35A 4RTWA 4F17A 4RTVA 3VS7A 1ZUKA 2BTTA 4HVUA 4F14A 2NUZA 2KXCA 1WLPB 5FW9A 1WYXA 2D0NA 2KGTA 2PNIA 2KT1A 2KYMA 1QWFA 4RTZA 4QT7A 4WCIA 1X6GA 2EYWA 3I5SA 1VYUA 3M0SA 3LH5A 1M3AA 1N5ZA 2HCKA 2JMAA 1ZBJA 1X27A 5IHKA 2SRCA 2RQVA 1GBRA 1WX6A 1Y57A 2RQWA 2K2MA 1GCQC 2DBMA 3VS1A 1WXBA 1PKTA 1BK2A 2HBWA 2KBTA 2KROA 5I11A 1UUEA 2KRNA 4CC3A 1AWWA 2P4RA 3UA7A 4LE9A 3M0QA 2FEIA 1T0HA 2XMFA 4FSSA 1JXOA 3UF4A 3R6NA 1WXUA 2DVJA 2C0TA 4JZ3A 1ABOA 2K3BA 1Z9ZA 2W10A 3RBBB 2LJ0A 5FWCA 3TVTA 1MV0B 2O31A 2EKHA 2DM1A 2J6OA 4OMPA 2ED0A 1KSWA 2AKKA 4DEXA 2DX1A 2EQIA 3EG0A 3EGUA 5L23A 1NEBA 2ENMA 2V1RA 2KE9A 2QDLA 1K4US 4RUGA 3M0TA 2LQNA 4D8KA 2LP5A 1NYFA 1I07A 2ED1A 2JMCA 4HVWA 4J9BA 2FG0A 2LNHB 1WIEA 1AEYA 2KEAA 2HDAA 4AFQC 1GCQA 2RQRA 1UE9A 4JJCA 4Z89A 4GLMA 2O88A 2J7IA 2VWFA 3PVQA 2DRKA 4IIOA 1ZUYA 1X2QA 3EG3A 1SPKA 1WA7A 2GGRA 2MIOA 1A0NB 2DJQA 1PHTA 3NGPA 1K0XA 2CH4W 1YNZA 4CC2A 1GL5A 1Y0MA 1SHFA 2EYZA 2OI3A 1SSHA 3O5ZA 3CQTA 1JXMA 3VS5A 1NLPC 3THKA 1I0CA 2ABLA 1BB9A 3M0RA 1NYGA 1U5SA 2DL5A 1PKSA 5FWBA 2C0OA 2J6KA 1WI7A 2V1QA 3C0CA 1PWTA 2CDTA 3VRZA 2LCSA 1VYTA 1UECA 1OPLA 2DF6A 1GRIA 2F2XA 2ROTA 2DMOA 3I5RA 4OMNA 1SEMA 4D8DA 1CKAA 4M4ZA 1JO8A 2DL8A 4J9DA 4RTYA 2CH4A 2YDLA 2X3XD 3VRYA 4J9EA 3PVLA 2D8HA 3SEMA 3UA6A 1AWOA 2EYXA 1YN8A 5GJWB 2EGAA 1HSQA 2GBQA 2O2OA 4LNPA 1XOVA 2BZXA 2JM9A 3U23A 4AFSC 1RI9A 1UHCA 4OMQA 1FYNA 2FPFA 2X3WD 1X6BA 1AZGB 1SRLA 2L3SA 4HXJA 2DL3A 2A08A 1K0SA 3NHNA 2DRMA 1AWJA 1I1JA 1E7OA 1ZLMA 3EG2A 3NMZC 1X2KA 2LMJA 2OJ2A 4Z8AA 1JQQA 2NWMA 3A98A 1TUCA 1KJWA 1UFFA 2CSQA 2EYYA 2I0NA 3KFVA 4RTUA 1GFCA 2VVKA 3H0FA 1AD5A 1IO6A 1AZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HCK A;  1ARK A;  1YWP A;  2GNC A;  4LN2 A;  5EC7 A;  1AOJ A;  1OV3 A;  1YP5 A;  2JTE A;  3UAT A;  2ECZ A;  4LUE A;  2E5K A;  5IHI A;  2JM8 A;  3IQL A;  1T3S A;  2KXD A;  1QWE A;  4ESR A;  3EG1 A;  1Z9Q A;  1QCF A;  5IXF A;  3FJ5 A;  4OMO A;  1WDX A;  3RNJ A;  1UJY A;  2FO0 A;  2LJ1 A;  2LX7 A;  2AZV A;  1E6G A;  1BU1 A;  1QLY A;  2DL7 A;  3ZL7 C;  1K76 A;  2RN8 A;  4JPB W;  3M0U A;  2DA9 A;  2KRM A;  3TSW A;  3H41 A;  3REA B;  4A63 B;  2RMO A;  2KRS A;  1GFD A;  2RPN A;  2YUO A;  2L3P A;  3REB B;  2AZS A;  4RTT A;  1J3T A;  5I22 A;  1VYV A;  2EBP A;  3GBQ A;  1JEG A;  1PRM C;  2YUQ A;  4Z88 A;  2B86 A;  4KRT A;  2IIM A;  2K6D A;  2AKL A;  3TSZ A;  4CC7 A;  1JU5 C;  5IHN A;  3VS2 A;  2SEM A;  1NM7 A;  2CT3 A;  1H92 A;  4HVV A;  1K1Z A;  1M3C A;  1NLO C;  4Y92 A;  3M0P A;  4OML A;  1FMK A;  4IIM A;  1CKB A;  2JW4 A;  3H0H A;  1UHF A;  4OMM A;  2FPE A;  1UTI A;  2CSI A;  2K7A A;  1H8K A;  2EGE A;  1KIK A;  2GQI A;  1W70 A;  1W6X A;  4JJB A;  2F2V A;  4X1V A;  1YCS B;  2EVR A;  2RQU A;  1VA7 A;  2CUB A;  2J06 A;  1SHG A;  2L2P A;  2EW3 A;  3NPF A;  3VS6 A;  2D8J A;  2DE0 X;  3H0I A;  2A36 A;  2RNA A;  4GBQ A;  1S1N A;  4J9F A;  1M27 C;  1T0J A;  2C0I A;  1RLQ C;  2ROL A;  2GTJ A;  2AK5 A;  4AFU C;  1E6H A;  2YUN A;  2M51 A;  1UDL A;  4J9I A;  2JT4 A;  1SRM A;  1X69 A;  1U3O A;  2F2W A;  4AFZ C;  2DBK A;  2A37 A;  1UJ0 A;  1V1C A;  3QWY A;  2KNB B;  5IXB A;  2GTO A;  1ZX6 A;  2O9V A;  2DL4 A;  2D1X A;  2L0A A;  4DEY A;  5ECA A;  2JS2 A;  3QWX X;  1U06 A;  1X43 A;  1LCK A;  4ORZ A;  1CSK A;  1H3H A;  1GCP A;  1BBZ A;  2PTK A;  4CC4 B;  2J05 A;  1OPK A;  1NEG A;  5IH2 A;  1RLP C;  1YWO A;  2L3Q A;  4LUD A;  2G6F X;  2KT8 A;  4K11 A;  1AWX A;  1TG0 A;  2KR3 A;  1K9A A;  3PE0 A;  2DLP A;  1UGV A;  1ZUU A;  2J6F A;  1KFZ A;  1G83 A;  1ABQ A;  1WFW A;  1AVZ C;  2RQT A;  1G2B A;  4JZ4 A;  1B07 A;  2MOX A;  2LZ6 B;  2VKN A;  1EFN A;  4AG2 C;  2CRE A;  3JV3 A;  2CUD A;  4J9G A;  1UG1 A;  4J9C A;  2YUP A;  2HEQ A;  4J9H A;  1M30 A;  1MUZ A;  4AG1 C;  4JJD A;  2LJ3 A;  2JS0 A;  2LQW A;  2OAW A;  1T3L A;  1TUD A;  3EHR A;  2HSP A;  1QKX A;  4R0K A;  2DYB A;  3VS4 A;  4RTX A;  3EHQ A;  1QKW A;  1OOT A;  1GBQ A;  1RUW A;  3VS0 A;  1M8M A;  1PNJ A;  2FPD A;  5GJV B;  1MV3 A;  1B3Q A;  4HCK A;  2BZ8 A;  2FRY A;  1NG2 A;  2A28 A;  1OEB A;  2BZY A;  4E6R A;  2H8H A;  2MCN A;  2JXB A;  1PRL C;  2O9S A;  3VS3 A;  3SHW A;  2ESW A;  3ULR B;  1W1F A;  2YSQ A;  2FRW A;  2KYB A;  2YT6 A;  2M0Y A;  2K9G A;  2EPD A;  1WXT A;  2CT4 A;  3I9Q A;  4F16 A;  1HD3 A;  1ZSG A;  2K79 A;  2W0Z A;  1M3B A;  4EIK A;  4ZNX A;  2DNU A;  2PZ1 A;  1HJD A;  2DIL A;  2EGC A;  2RF0 A;  3I35 A;  4RTW A;  4F17 A;  4RTV A;  3VS7 A;  1ZUK A;  2BTT A;  4HVU A;  4F14 A;  2NUZ A;  2KXC A;  1WLP B;  5FW9 A;  1WYX A;  2D0N A;  2KGT A;  2PNI A;  2KT1 A;  2KYM A;  1QWF A;  4RTZ A;  4QT7 A;  4WCI A;  1X6G A;  2EYW A;  3I5S A;  1VYU A;  3M0S A;  3LH5 A;  1M3A A;  1N5Z A;  2HCK A;  2JMA A;  1ZBJ A;  1X27 A;  5IHK A;  2SRC A;  2RQV A;  1GBR A;  1WX6 A;  1Y57 A;  2RQW A;  2K2M A;  1GCQ C;  2DBM A;  3VS1 A;  1WXB A;  1PKT A;  1BK2 A;  2HBW A;  2KBT A;  2KRO A;  5I11 A;  1UUE A;  2KRN A;  4CC3 A;  1AWW A;  2P4R A;  3UA7 A;  4LE9 A;  3M0Q A;  2FEI A;  1T0H A;  2XMF A;  4FSS A;  1JXO A;  3UF4 A;  3R6N A;  1WXU A;  2DVJ A;  2C0T A;  4JZ3 A;  1ABO A;  2K3B A;  1Z9Z A;  2W10 A;  3RBB B;  2LJ0 A;  5FWC A;  3TVT A;  1MV0 B;  2O31 A;  2EKH A;  2DM1 A;  2J6O A;  4OMP A;  2ED0 A;  1KSW A;  2AKK A;  4DEX A;  2DX1 A;  2EQI A;  3EG0 A;  3EGU A;  5L23 A;  1NEB A;  2ENM A;  2V1R A;  2KE9 A;  2QDL A;  1K4U S;  4RUG A;  3M0T A;  2LQN A;  4D8K A;  2LP5 A;  1NYF A;  1I07 A;  2ED1 A;  2JMC A;  4HVW A;  4J9B A;  2FG0 A;  2LNH B;  1WIE A;  1AEY A;  2KEA A;  2HDA A;  4AFQ C;  1GCQ A;  2RQR A;  1UE9 A;  4JJC A;  4Z89 A;  4GLM A;  2O88 A;  2J7I A;  2VWF A;  3PVQ A;  2DRK A;  4IIO A;  1ZUY A;  1X2Q A;  3EG3 A;  1SPK A;  1WA7 A;  2GGR A;  2MIO A;  1A0N B;  2DJQ A;  1PHT A;  3NGP A;  1K0X A;  2CH4 W;  1YNZ A;  4CC2 A;  1GL5 A;  1Y0M A;  1SHF A;  2EYZ A;  2OI3 A;  1SSH A;  3O5Z A;  3CQT A;  1JXM A;  3VS5 A;  1NLP C;  3THK A;  1I0C A;  2ABL A;  1BB9 A;  3M0R A;  1NYG A;  1U5S A;  2DL5 A;  1PKS A;  5FWB A;  2C0O A;  2J6K A;  1WI7 A;  2V1Q A;  3C0C A;  1PWT A;  2CDT A;  3VRZ A;  2LCS A;  1VYT A;  1UEC A;  1OPL A;  2DF6 A;  1GRI A;  2F2X A;  2ROT A;  2DMO A;  3I5R A;  4OMN A;  1SEM A;  4D8D A;  1CKA A;  4M4Z A;  1JO8 A;  2DL8 A;  4J9D A;  4RTY A;  2CH4 A;  2YDL A;  2X3X D;  3VRY A;  4J9E A;  3PVL A;  2D8H A;  3SEM A;  3UA6 A;  1AWO A;  2EYX A;  1YN8 A;  5GJW B;  2EGA A;  1HSQ A;  2GBQ A;  2O2O A;  4LNP A;  1XOV A;  2BZX A;  2JM9 A;  3U23 A;  4AFS C;  1RI9 A;  1UHC A;  4OMQ A;  1FYN A;  2FPF A;  2X3W D;  1X6B A;  1AZG B;  1SRL A;  2L3S A;  4HXJ A;  2DL3 A;  2A08 A;  1K0S A;  3NHN A;  2DRM A;  1AWJ A;  1I1J A;  1E7O A;  1ZLM A;  3EG2 A;  3NMZ C;  1X2K A;  2LMJ A;  2OJ2 A;  4Z8A A;  1JQQ A;  2NWM A;  3A98 A;  1TUC A;  1KJW A;  1UFF A;  2CSQ A;  2EYY A;  2I0N A;  3KFV A;  4RTU A;  1GFC A;  2VVK A;  3H0F A;  1AD5 A;  1IO6 A;  1AZE A; 
#chains in the Genus database with same CATH topology
 3QDR B;  2CP2 A;  5HCK A;  1ARK A;  3G71 T;  1YWP A;  3M53 A;  2GNC A;  1WJR A;  4LN2 A;  5GMK h;  1BKB A;  1OV3 A;  1YP5 A;  2DAQ A;  2ECZ A;  1PSE A;  2V8I A;  1K9M C;  5KE2 A;  1QWE A;  4ESR A;  3EG1 A;  1QCF A;  1X01 A;  5IXF A;  1WDX A;  3RNJ A;  3CCJ T;  2FO0 A;  4BE2 A;  1E6G A;  2MWO A;  4E7L A;  1BU1 A;  2HQH A;  2LC4 A;  5A2Q E;  3V8K A;  2FZG B;  2DL7 A;  3FDR A;  5HKC A;  3OW2 S;  2VXF A;  4JPB W;  2FL7 A;  3G6E A;  2K5I A;  1KC8 U;  4C92 C;  2DXB A;  4BY6 C;  3TSW A;  3HFN A;  2DIQ A;  3H41 A;  3REA B;  2YUO A;  1UEB A;  1W4S A;  4ZN1 A;  3REB B;  2PQW A;  1JJ2 S;  3GBQ A;  4FM4 B;  3CCJ Q;  1PRM C;  3D7S B;  2K6D A;  2AKL A;  3TSZ A;  4P5N A;  3J81 E;  1VQ4 T;  1VQ9 A;  1D0Z A;  3VS2 A;  2HNI A;  5D7U A;  3OS1 A;  3G4S A;  1NM7 A;  4HVV A;  2RHU A;  3CCE A;  1OQK A;  4OML A;  3S6W A;  4EDU A;  5KYU A;  4O6J A;  1IHV A;  3H0H A;  1UHF A;  1UTI A;  1G5V A;  5CKF A;  1KIK A;  4LDU A;  4JJB A;  2EJF A;  4FU6 A;  1BI2 A;  2EVR A;  1VA7 A;  4JJN K;  2CUB A;  4CI0 C;  1SHG A;  1V76 A;  4KUD K;  2EW3 A;  1UGR B;  3MP6 A;  1K8A U;  2FYK A;  2A36 A;  1XJW B;  4GBQ A;  4J9F A;  5KYX A;  1B7T A;  1D0X A;  2DO3 A;  3M57 A;  1MNE A;  2ROL A;  2GTJ A;  4E2F B;  1Q86 C;  4FYV B;  1E6H A;  1M9S A;  3OYB A;  2NUP B;  3QPH A;  4FSX A;  2FZK B;  4M77 G;  2F2W A;  2DBK A;  1UJ0 A;  2CZ1 B;  2KNB B;  2BUD A;  2KMT A;  3OY9 A;  4C8Q A;  2DPP B;  1SF9 A;  2DL4 A;  1WHJ A;  4R56 A;  1WNL A;  3MP1 A;  5C6S A;  3QYG B;  1ZSZ B;  1NE8 A;  3TEE A;  1OPK A;  5IH2 A;  1OI1 A;  4HKE A;  1N8R C;  3MHX A;  2H3E B;  2LT4 A;  2CP6 A;  1GXI E;  5GAM h;  1AWX A;  3E2U A;  3OYG A;  1K9A A;  2DLP A;  1RAE B;  1VQ5 A;  1YI2 A;  1VQL T;  1ABQ A;  4Q5W A;  2LX9 A;  1G3T A;  1D1B A;  2LZ6 B;  2VKN A;  5CKE A;  1EFN A;  4AG2 C;  2CRE A;  3JV3 A;  4A4E A;  4QQD A;  2DZ9 A;  4J9C A;  5GAN h;  4J9H A;  5FRN A;  1M30 A;  2JTF A;  4EMK A;  1MUZ A;  4XTZ A;  2JS0 A;  2LQW A;  3CMA A;  1WZO A;  1B34 B;  2RM4 A;  2HKQ B;  1T3L A;  4LD6 A;  2DYB A;  4OB0 B;  4ANJ A;  3CCR A;  4ZTJ A;  2RB6 A;  2E6Z A;  2OAU A;  3V7R A;  2EQM A;  3EFO B;  5GMK i;  5GAM d;  3CPW A;  4MZT A;  4B9W A;  2R58 A;  2FPD A;  1XTD A;  5GJV B;  1MV3 A;  3N5B B;  3GNG A;  2ZPF B;  2L89 A;  4BB7 A;  1G3S A;  1Q7Y R;  3JCM b;  1OEB A;  3EAE A;  3BW1 A;  2H8H A;  2RH2 A;  1YJ9 T;  2JXB A;  2V8K A;  4Y91 A;  1QQJ A;  2ESW A;  3ULR B;  1W1F A;  2YHT A;  2VUB A;  1VQO Q;  3CCM A;  1ZA2 B;  1V29 B;  2RA2 A;  1WXT A;  4F16 A;  5KYN A;  4M7A D;  4C5H A;  2K79 A;  4EMH A;  5GAO l;  1JBM A;  1YJN Q;  2W0Z A;  4C92 F;  4O5V A;  4EIK A;  4BE1 A;  2EIF A;  1TWB A;  2RF0 A;  3CC2 A;  1YJ9 Q;  4HVU A;  1MND A;  2HBP A;  3JCM f;  3OYI A;  2KXC A;  1WLP B;  3JCM c;  2D6F A;  3QJ6 A;  3LH0 A;  2MI6 A;  4B9X A;  2D0N A;  2QQB A;  4PL6 A;  3CME T;  4M75 B;  2KGT A;  2PNI A;  2KT1 A;  2KYM A;  1MHN A;  3MP8 A;  4QT7 A;  2XG8 D;  3CCL T;  5HK0 A;  3LYI A;  1VUB A;  3WVE B;  4PJN A;  4M78 E;  9ATC B;  1IRE B;  2RQW A;  3CME Q;  3QG1 A;  3VS1 A;  3CCJ A;  2KBT A;  4KH1 B;  3M4Y A;  3GF5 A;  2M9U A;  1AWW A;  2P4R A;  3H9N A;  3CCL Q;  2JZ2 A;  3M0Q A;  2E3I A;  4MZP A;  2FEI A;  2QDY B;  4FSS A;  3R6N A;  1MMG A;  3GNF B;  4PJO C;  3I56 T;  2DTH A;  3AT1 B;  1Z9Z A;  2CYZ B;  2W10 A;  2X9H A;  3ZFJ A;  4R55 A;  4E7I A;  5FWC A;  3TVT A;  2O31 A;  2EKH A;  4KBM B;  1AHJ B;  1S72 T;  4DEX A;  2QYZ A;  4F7U E;  1D09 B;  4PFP A;  4C92 E;  2KE9 A;  1QVF S;  1LVK A;  3HRT A;  3EGD A;  3I56 Q;  1IGQ A;  4A4K A;  2LP5 A;  1DJ7 B;  2E41 A;  2PUO B;  1IZ6 A;  2ZGW A;  3SB2 A;  1K8A C;  2HDA A;  3P8H A;  4FYY B;  2RQR A;  2P0K A;  1UE9 A;  5GAN 4;  2O88 A;  2ATC B;  3EG3 A;  5FU6 C;  2RD1 A;  1SPK A;  1UGQ B;  5KYU B;  1A0N B;  1RAD B;  2EQJ A;  4C5E A;  4DQ2 A;  4DBQ A;  2WSF E;  1XQH A;  3OYJ A;  1RAG B;  5GAN g;  1YNZ A;  1OU9 A;  3G6E T;  1GL5 A;  1SHF A;  3O5Z A;  3JB9 D;  1W2B S;  3CEY A;  1I0C A;  4BI8 B;  2ABL A;  4QVZ A;  1BB9 A;  2E65 A;  4HCB A;  3JAM E;  1YJW A;  5FWB A;  2C0O A;  1ACM B;  2V1Q A;  2LT1 A;  2VV5 A;  3KXT A;  5FRM A;  5KYX B;  2OX7 A;  2RI5 A;  3VRZ A;  5EG2 A;  3ASK A;  2DET A;  1VQ9 T;  2MK5 A;  4M77 A;  4XTW A;  4XQ3 A;  3NTK A;  3G4S T;  2DF6 A;  4M7D E;  4PJO G;  2VXE A;  2RHX A;  2VC8 A;  4NL2 A;  2P0Q A;  4JLI A;  3CCE T;  3RDV A;  1C1A A;  2RJC A;  4M4Z A;  4J9D A;  2IVW A;  3JCM W;  4J9E A;  8AT1 B;  1O9S A;  4C8Q B;  1LNX A;  1WHL A;  2KVQ G;  1YBY A;  2RJF A;  1YIJ Q;  3G4S Q;  5A0L A;  4PJJ A;  1VQN T;  3LGL A;  5GAN 2;  1UHC A;  2QAS A;  1D3B A;  1KD1 R;  2X3W D;  3SDZ A;  1X6B A;  1VIE A;  4HXJ A;  2EQU A;  2GFU A;  3LX7 A;  1ZLM A;  2OJ2 A;  4Z8A A;  3TCJ A;  5GAN 5;  3OA6 A;  1VQN Q;  3QZ9 B;  4RTU A;  1VQO A;  4J6W A;  2QQS A;  3BDL A;  3MJX A;  4D6W A;  4M7D D;  2HSE B;  4KH0 B;  1YJN A;  4NOY A;  5GAO r;  3X26 B;  5EC7 A;  1AOJ A;  1N6A A;  2M02 A;  4LUE A;  4C0F A;  2JM8 A;  2DIG A;  3IQL A;  2KXD A;  3FJ5 A;  1UJY A;  3VJP A;  2LX7 A;  5LJ3 j;  1WHG A;  2P0P A;  2CKK A;  1K76 A;  1M2V A;  3CBO A;  4ZN3 A;  3CCQ A;  2EYQ A;  2MF2 A;  3M0U A;  2KRM A;  2JTM A;  4A63 B;  1GFD A;  2KRS A;  1VQ5 T;  1YI2 T;  2ZPH B;  4PJO F;  4PLL A;  4A4F A;  3OYK A;  1I81 A;  2L3P A;  3AHU A;  3NTI A;  3RUX A;  4OF1 A;  4E7J A;  4KRT A;  4C0D B;  2MAM A;  1JJ2 A;  1RI0 A;  3L2Z A;  4CC7 A;  1JU5 C;  3JCM h;  4N4G A;  1C0M A;  2SEM A;  3CME A;  1QVG A;  1U8R A;  1K1Z A;  1M3C A;  3CD6 Q;  4PJL A;  3CMA T;  1VQ5 Q;  2V26 A;  3EG9 A;  4IIM A;  3CCR T;  1PG5 B;  2CSI A;  5I2S A;  3UT1 A;  2GQI A;  1W70 A;  1WHK A;  4X1V A;  2XU8 A;  2FZC B;  4OB2 B;  3SWN B;  1EIF A;  1HK9 A;  3A1P A;  2E70 A;  4A4G A;  4ZTF A;  3F70 A;  5HK3 A;  3CMA Q;  3VS6 A;  2RNA A;  4JUV A;  3CBM A;  3M9Q A;  3HL8 A;  3VUB A;  2OTJ Q;  4BAC A;  3JB9 H;  1N9S A;  1T0J A;  1RLQ C;  1D1A A;  3JCM d;  2QEX Q;  2LNV A;  4MZM A;  2AK5 A;  2DTO A;  4M75 D;  3V7S A;  2YUN A;  2M51 A;  4J9I A;  4XU2 A;  4OP0 A;  4TVR A;  3I55 T;  1G8X A;  2D9T A;  3FIF A;  4VUB A;  1M4Z A;  3CC2 T;  2QGF B;  3ZEH A;  2QA4 Q;  2LQK A;  2MYS A;  2KDS A;  1ZX6 A;  3QHS A;  2L0A A;  2IG0 A;  3J80 E;  1U06 A;  4M78 C;  1LCK A;  1H3H A;  4FCY A;  2F5T X;  2PTK A;  1NEG A;  3M54 A;  1RLP C;  3EFR A;  1YWO A;  3I55 Q;  2L3Q A;  4LUD A;  5LJ5 e;  3QSU A;  1H3Z A;  1KQS S;  3OMC A;  4EMG A;  4XTX A;  2KR3 A;  3PE0 A;  1ZUU A;  1KFZ A;  1G83 A;  1M1G A;  7AT1 B;  1WFW A;  3EGD B;  1AVZ C;  2RQT A;  4QKU A;  1M8V A;  3L2U A;  1OUL A;  5LL6 S;  5GAO q;  2KY9 A;  2YUP A;  2X4X A;  1KK7 A;  3VKI A;  3RKX A;  1TUD A;  2EKO A;  2FHD A;  4J6Y A;  5J39 A;  4L59 A;  4RTX A;  3EHQ A;  1RUW A;  2QI2 A;  2O4X A;  3VS0 A;  1M8M A;  4AT1 B;  3OMG A;  1PNJ A;  1YIJ A;  1B3Q A;  2K5F A;  4DA4 A;  2FRY A;  1NG2 A;  2X4Y A;  2A28 A;  3R6O A;  4E6R A;  5GAO n;  2MCN A;  1PRL C;  2O9S A;  5LJ3 e;  1R0B G;  2YT6 A;  4XK8 E;  2M0Y A;  2K9G A;  3JCM Q;  3TU4 K;  1VQM A;  1M1K R;  4PJO A;  3I9Q A;  2XIC A;  1ZSG A;  4M78 G;  3OQ5 A;  2JVV A;  4M77 B;  3MCA B;  1VQN A;  1M3B A;  2DNU A;  4KUL A;  3G1J A;  3UWN A;  1FXX A;  3JRZ A;  1P92 A;  2VAS A;  4F17 A;  3GLX A;  4RTV A;  3PT9 A;  3VS7 A;  1NJI R;  2DEU A;  4F14 A;  4BY6 B;  3JCM g;  2WAC A;  3Q1J A;  5IAY A;  3M58 A;  3HSB A;  1FWZ A;  4E47 A;  4XTU A;  4M7D C;  4BI4 A;  1R8O B;  3V7C A;  1EZZ B;  5AYF A;  2GCX A;  5LJ5 h;  3HHT B;  3C95 A;  4DBF A;  1WGS A;  2EYW A;  3L1A A;  4BUG A;  1YJW T;  1D3B B;  3HPW A;  5CKH A;  1YCY A;  3M0S A;  4C8Q D;  1RAA B;  1M3A A;  3C4S A;  3H8Z A;  1X27 A;  4F7U G;  5IHK A;  2SRC A;  5GAN 8;  4C92 G;  4E7S A;  2DER A;  2R5A A;  3P8B B;  2DBM A;  2JUF A;  3MPU B;  1JRI A;  2K4Y A;  2Z0W A;  1Q7Y U;  2KRO A;  2EJG A;  1ZQ1 A;  4HCC A;  2R57 A;  2QAZ A;  1YJW Q;  2HL5 C;  4LE9 A;  1TH7 A;  1T0H A;  3CD6 A;  1JXO A;  3C12 A;  3HKS A;  2K3Y A;  3UF4 A;  1PCX A;  2Y90 A;  3OYH A;  2DVJ A;  2C0T A;  4M7A E;  1ABO A;  1UGP B;  3JB9 I;  2JOY A;  3RBB B;  1M90 R;  2DM1 A;  1VQP Q;  4PFZ A;  2ED0 A;  3OS2 A;  1KSW A;  1M2V B;  2DX1 A;  3EG0 A;  2KAF A;  5L23 A;  2V1R A;  2QDL A;  4RG8 A;  1K4U S;  4M78 F;  1Q82 R;  3CPF A;  3LWH A;  4LD9 K;  3OB9 A;  1M1F A;  4D8K A;  2OTJ A;  5LJ3 h;  2QEX A;  1VQO T;  4MDX A;  4RG2 A;  2FG0 A;  2YXY A;  1WIE A;  1SKU B;  5GAN 7;  1GCQ A;  2XHC A;  4UC4 A;  3KUF A;  3OYE A;  1F1B B;  1WPY A;  1YJN T;  4HT9 A;  4PK4 A;  4GLM A;  1BIA A;  1QCN A;  3MKD A;  5L8R E;  3PVQ A;  2DRK A;  3NTH A;  4IIO A;  2OTL Q;  1X2Q A;  2E12 A;  1RAH B;  2MWP A;  2QA4 A;  1RAC B;  1WA7 A;  4M75 C;  5HY6 A;  2MIO A;  3EG9 B;  5GAN d;  1TSF A;  4II1 A;  3EFS A;  2K3X A;  4N0A C;  3KBG A;  2CP3 A;  2PU9 B;  3HP9 A;  5FLX E;  1Y0M A;  2EYZ A;  4F7U F;  2LDM A;  3CCQ T;  1VQ6 A;  1SSH A;  3CQT A;  1JXM A;  2RO0 A;  3VS5 A;  3I55 A;  1TXQ A;  3M0R A;  1ZA1 B;  1W2B A;  2DL5 A;  1PKS A;  4JRP A;  3M59 A;  1WI7 A;  2M16 A;  3C0C A;  3SWN A;  4IUR A;  4OVA A;  3RKY A;  4KUI A;  2ZPI B;  2K2V A;  4JDS A;  3PMI A;  3CCQ Q;  1GRI A;  2F2X A;  2ROT A;  3E9F A;  1M1K C;  2K5L A;  1M2O A;  2X3X D;  3OS0 A;  1YN8 A;  1HSQ A;  2GBQ A;  4JLG A;  4LNP A;  2JM9 A;  1VQK Q;  1RI9 A;  4OMQ A;  2XDP A;  5CCA A;  1Y96 A;  2FPF A;  2FB7 A;  2XID A;  4ATO A;  2A08 A;  1AWJ A;  1PSF A;  3NMZ C;  1X2K A;  2AT1 B;  3OYL A;  4JS5 A;  2CZ0 B;  1JQQ A;  2XD0 A;  4V2S A;  4M7D F;  5LJ5 g;  3A8H B;  3PNW C;  3X20 B;  5KYW A;  4IUU A;  1GFC A;  3H0F A;  1IO6 A;  2CP5 A;  2QQA A;  5GAO m;  3M5A A;  3M4G A;  2RHZ A;  3CPW P;  2JTE A;  1I4K 1;  3UAT A;  2GQV A;  2RJD A;  5KCH A;  3QYH B;  1T3S A;  1MMA A;  4XTY A;  4RCC A;  3CCS Q;  2LJ1 A;  2AZV A;  5IN1 A;  5M9O A;  1Q81 R;  5AT1 B;  2O4X B;  4X34 A;  1ZBX A;  1K73 R;  3X25 B;  2VYT A;  2RMO A;  2M1H A;  2RPN A;  4NL3 A;  4RTT A;  1J3T A;  5I22 A;  1VYV A;  2EBP A;  5IT9 E;  4Z88 A;  2B86 A;  3HRU A;  1KD1 U;  4M78 A;  4QW2 A;  4PJO B;  2F1L A;  4X9D A;  4MDW A;  2CT3 A;  4BDZ A;  1BI3 A;  1NLO C;  3CXC A;  2X4J A;  1QP3 A;  4Y92 A;  2ZPE B;  5LJ3 g;  2FPE A;  2K7A A;  1NPR A;  5CAI A;  3VUZ A;  4FIB A;  3V8J A;  1FMW A;  1Q7Y C;  2F2V A;  1YCS B;  4M77 D;  1YIJ T;  2L2P A;  5D6Y A;  2CGH A;  3PIP A;  3NPF A;  4L6V 5;  2D8J A;  2DE0 X;  3H0I A;  1BYM A;  4DBH A;  3VU3 C;  5LJ5 j;  1VQP A;  4M75 F;  5GMK l;  1S1N A;  4F7U A;  1M27 C;  1IB8 A;  4C92 A;  3PTA A;  1VQM T;  4FT2 A;  3DB4 A;  1C6V X;  2DTI A;  5FU6 B;  1UDL A;  3SFM A;  2JJ9 A;  2LQ8 A;  4EMK C;  2ZCF B;  2NLU A;  1SRM A;  2ZPB B;  4HT8 A;  4AFZ C;  1WQW A;  2A37 A;  3QWY A;  5CR2 A;  2RK2 A;  5IXB A;  2O9V A;  2D1X A;  1OZ3 A;  2I2L A;  4DEY A;  3H6Z A;  2IPO B;  3INZ A;  4QQG A;  1VQM Q;  1G3Y A;  3HTR A;  1RAI B;  1U1T A;  2OTL A;  1TOV A;  1CSK A;  4ORZ A;  1GCP A;  1BBZ A;  4QQ6 A;  5LJ5 f;  3EH1 A;  2VGN A;  1K9M R;  4AMC A;  2BIV A;  2A3L A;  2COY A;  2HMA A;  4K11 A;  2E5Q A;  1KQS A;  8ATC B;  1UGV A;  2ZZD A;  4NS5 A;  1G2B A;  4M7A C;  2NYS A;  1B07 A;  2MOX A;  4ZGJ B;  1LOJ A;  1JB0 E;  3OW2 A;  3ER0 A;  3CD6 T;  3EHR A;  2HSP A;  1WHH A;  4FW2 A;  4M75 E;  4LDV A;  3VS4 A;  4L5G A;  1H64 1;  1I8F A;  4ELZ C;  1GBQ A;  1OU8 A;  5FU7 C;  3ME9 A;  1R0C B;  1VQK A;  1VQ7 Q;  4HCK A;  2BZ8 A;  5GMK e;  2BZY A;  3QZ5 B;  5LJ3 f;  4JS4 A;  3L2Q A;  2QTX A;  3T9N A;  2OTJ T;  2B8A A;  2YSQ A;  3A5Z B;  2KYB A;  3A8L B;  2QEX T;  1BI1 A;  2EPD A;  3M55 A;  3JSC A;  1I5O B;  3DKM A;  1U1S A;  1QVP A;  1Y71 A;  2E4H A;  2A7Y A;  1HJD A;  2KSS A;  3MET A;  2AIR B;  5CK9 A;  3J7A F;  2XDD A;  1Q86 R;  3OYY A;  3VYG A;  2QA4 T;  2DXT A;  3QXE B;  2EWN A;  1X6O A;  2HKN A;  3CCV A;  1NBE B;  3C94 A;  2HZY A;  3OSV A;  4KGZ B;  3EGX A;  1LJO A;  3BDU A;  5FW9 A;  3CCS A;  1VQ6 T;  4RKU E;  2DXC A;  4J7I A;  4M7A G;  4FW1 A;  4RTZ A;  1QCO A;  4RMO A;  3BFM A;  2DK3 A;  2GFA A;  1Y96 B;  4PFO A;  1VYU A;  3QKJ A;  3E1S A;  1OYX A;  1N5Z A;  3A8O B;  1N8R R;  4XU3 A;  4E7K A;  2EFI A;  3HRS A;  1GBR A;  1WX6 A;  3PFS A;  4CRI A;  3CBP A;  1VQ6 Q;  5J3B A;  2HBW A;  2PVO B;  4N0A A;  2KRN A;  5KYW B;  4BE0 A;  1M1K U;  5CVI A;  2XMF A;  2F69 A;  2YLC A;  1KD1 C;  1WXU A;  2PUK B;  3OW2 P;  4C5I A;  1NZ9 A;  4KGX B;  2K3B A;  3CCU A;  4PNO A;  4QVC A;  2X35 A;  1N9R A;  2X51 A;  3L2W A;  2P84 A;  2J6O A;  4OMP A;  2BKD N;  1BI0 A;  2AKK A;  1LPL A;  4FT4 A;  1NJI U;  2EQI A;  1JJ2 P;  3MEW A;  1NEB A;  3OYN A;  4DOW A;  3QO3 A;  4WTO B;  3CC7 Q;  2RI2 A;  2COZ A;  1RAF B;  1QVG P;  2KI7 A;  3M0T A;  2LQN A;  4M77 C;  2KK4 A;  2DYI A;  3RKW A;  2EQK A;  2ED1 A;  4B6M A;  1VQ8 Q;  4HVW A;  4C5G A;  3FJP A;  4J9B A;  3S3M A;  3RIR A;  2PVD B;  1AEY A;  2KEA A;  4AFQ C;  4XAX B;  4M78 B;  1TS9 A;  3G71 Q;  2RHY A;  5GAM e;  1O75 A;  2E3H A;  4JJC A;  4C8Q E;  3MEV A;  2NUT A;  2J7I A;  1TU0 B;  4M7A F;  2DFU A;  1UGS B;  1KG1 A;  2K57 A;  1PHT A;  1K0X A;  4C0G A;  4LDW A;  2LTO A;  4PJO D;  2CH4 W;  1QVG S;  3FRN A;  2ZAE A;  5GAN e;  4CC2 A;  2OI3 A;  5FRO A;  1OZ2 A;  4A54 A;  2RI3 A;  3OBY A;  3RMS A;  3THK A;  4LXC A;  2A0F B;  5GAN 3;  1ZSZ C;  3P8D A;  1YHQ T;  2CP0 A;  4F7U B;  1QMC A;  2MMP A;  4C92 B;  1M90 U;  1IHW A;  1VQ4 Q;  1VYT A;  4XTV A;  3GPL A;  2HL3 A;  3I5R A;  4N4H A;  4OMN A;  1Q82 U;  1SEM A;  4D8D A;  1CKA A;  3JB9 G;  1YHQ Q;  2DL8 A;  2HD0 A;  2YDL A;  3TRE A;  5D6X A;  1KC8 R;  4IUT A;  3PVL A;  3UA6 A;  1AWO A;  2AHJ B;  2EYX A;  4A4H A;  1WJS A;  2O2O A;  3PGG A;  2BZX A;  3U23 A;  4J5Y A;  3LLR A;  1OX9 A;  2WSC E;  3A8M B;  1FYN A;  4J8O A;  1VQP T;  1SRL A;  3GOX A;  1VQ7 A;  3G7Z A;  2EAY A;  2V8J A;  3VYH B;  1BCO A;  3OSS C;  4A53 A;  4WF2 A;  5KCO A;  2NWM A;  3A98 A;  3GIB A;  2L5Q A;  5LJ5 d;  1YIT A;  2EYY A;  2I0N A;  2Y4X A;  3SD4 A;  5KYY A;  2QTV A;  4JRQ A;  4M7D B;  1MMD A;  5CQX A;  2KQW A;  2E5K A;  5IHI A;  5A0G A;  2OTL T;  1QVF A;  1K8A R;  4FYX B;  1Z9Q A;  4OMO A;  4KT0 E;  1QLY A;  4RCB A;  3ZL7 C;  2RN8 A;  2DVE A;  4DOV A;  2XKO C;  1WQ7 A;  2DA9 A;  3QJY A;  2DEQ A;  1N27 A;  4M7D G;  1VQL Q;  1TTH B;  3JCM J;  2AZS A;  1PD0 A;  1JEG A;  1QP2 A;  3X24 B;  2YUQ A;  5I2M A;  2IIM A;  2ZPG B;  3JB9 F;  3A8G B;  4KGV B;  5IHN A;  1UB4 A;  4J7F A;  1I5L A;  4BI3 A;  1H92 A;  1AT1 B;  3M0P A;  5CKD A;  5LJ3 d;  1FMK A;  3TQ7 P;  1PM3 A;  4M77 F;  1CKB A;  2JW4 A;  2LVM A;  4OMM A;  3ZBD A;  1IXD A;  1HXD A;  1H8K A;  4FL6 A;  2EGE A;  4PJM A;  4LDY A;  1W6X A;  3CC4 A;  4JRK A;  5CO7 A;  2BE7 D;  2RQU A;  5DY9 A;  4M7A A;  2J06 A;  3EGX B;  1VQK T;  3QDF A;  1VOM A;  4YTL A;  4OGC A;  3S3O A;  1D0Y A;  2QG9 B;  1WHM A;  2M0O A;  2LCL A;  2F5K A;  4IUP A;  2C0I A;  1Q81 U;  3MO8 A;  2HQX A;  2YWW A;  5I21 A;  4AFU C;  2HQE A;  3OYF A;  3CC7 A;  1K73 U;  1Q95 G;  2JT4 A;  4GLK A;  1NJI C;  2E10 A;  2DJZ A;  1XNI A;  1X69 A;  1U3O A;  1VQ8 A;  1V1C A;  4ZGD B;  4J83 A;  1EX4 A;  2VB6 A;  3G71 A;  2GTO A;  1WJQ A;  1X75 C;  3CCV T;  5ECA A;  2JS2 A;  3QWX X;  3QBY A;  2RK1 A;  1X43 A;  4GY5 A;  3JB9 J;  2XK0 A;  4CC4 B;  4PKC C;  2J05 A;  1MMN A;  3CCS T;  1KC8 C;  4M75 G;  2LCC A;  2BE9 B;  4DBR A;  1QVF P;  5DLO A;  1KQ1 A;  3UPU A;  2G6F X;  2KT8 A;  4HA8 A;  3BY7 A;  1QW1 A;  1TG0 A;  2GF7 A;  2DZC A;  3CCV Q;  5GMK j;  2COW A;  1RL2 A;  1R77 A;  2J6F A;  4BD3 A;  4C0Z A;  4M77 E;  5KE3 A;  3FB9 A;  4JZ4 A;  3DB3 A;  2CUD A;  4J9G A;  1RAB B;  1VQ4 A;  3JCM V;  2E64 A;  1FX7 A;  3V8L A;  1UG1 A;  4IUQ A;  2HEQ A;  4AG1 C;  4JJD A;  2LJ3 A;  1G3W A;  4QVD A;  2OAW A;  2NUT B;  4JRI A;  4X9C A;  1M90 C;  4IUV A;  1QKX A;  4R0K A;  1YHQ A;  3CCU T;  1QKW A;  1OOT A;  3CPW S;  3OYA A;  4M78 D;  3RMQ A;  1W2B P;  4OB3 B;  3BE3 A;  1Q82 C;  1S72 Q;  5GAM g;  2YRC A;  3UDC A;  4Y28 E;  4HCZ A;  4C8Q C;  1PD1 A;  5KH6 A;  3NFC A;  2E1H A;  3L42 A;  1NPP A;  4E7Z A;  1FMV A;  3CCU Q;  1TUG B;  3VS3 A;  3SHW A;  1BCM A;  1KHC A;  2FRW A;  2QXF A;  1K9M U;  2WSE E;  2RJE A;  4F04 B;  2CT4 A;  4IKF A;  1HD3 A;  1SSF A;  4ZNX A;  2PZ1 A;  4E7H A;  2DIL A;  5GAO p;  3JCM X;  2EGC A;  5CQY A;  3I35 A;  4RTW A;  3E9G A;  1ZUK A;  4C92 D;  3O8V A;  2BTT A;  2NUZ A;  3JCM e;  1IRX A;  1WYX A;  3G6E Q;  3L2R A;  1YFN A;  1QWF A;  3RES A;  6AT1 B;  2QQ9 A;  4WCI A;  1X6G A;  2DKG A;  1BIB A;  3I5S A;  3OS5 A;  4MML A;  3LH5 A;  3JCM P;  4Z02 A;  2JMA A;  2HCK A;  1ZBJ A;  2MPX C;  2NUP A;  3URG A;  1VQL A;  2DD5 A;  2RQV A;  1VQ9 Q;  1Y57 A;  2K2M A;  1GCQ C;  2H3J A;  1WXB A;  1PKT A;  1SG5 A;  2QQR A;  1BK2 A;  2VGM A;  5I11 A;  3CCE Q;  1UUE A;  3DLL A;  3M56 A;  4CC3 A;  1Y7X A;  3UA7 A;  4C0D C;  5GAM j;  5CKB A;  2YRD A;  5CIU A;  5KYY B;  4C8Q G;  1ZSZ A;  4JZ3 A;  3X28 B;  4ME7 A;  3RER A;  2LJ0 A;  4OGE A;  2D0Q B;  1Y07 A;  1MV0 B;  1Q86 U;  2CZ7 B;  1ZHI A;  5GAN 6;  4ZGE B;  2YRV A;  4ELY C;  1M5Q 1;  1VQ7 T;  4M7D A;  5GAN j;  3EGU A;  2ENM A;  2XI9 A;  4XU1 A;  4EMK B;  3SWN C;  4RUG A;  4BDY A;  4EPC A;  3FC3 A;  1YJ9 A;  5GMK m;  3OYC A;  1YIT T;  5DM7 R;  3CXC P;  2CP7 A;  1NYF A;  1I07 A;  3OBW A;  3LWI A;  1VIF A;  2JMC A;  3GP8 A;  3QII A;  3PIO A;  2JNG A;  5GAM f;  2LNH B;  5C0M A;  2X4W A;  4FYW B;  3MEA A;  2LRQ A;  5DLQ E;  1N8R U;  4Z89 A;  1B34 A;  3WVD B;  1PC0 A;  3E19 A;  1Q81 C;  1KQ2 A;  2VWF A;  4J6X A;  1ZUY A;  3LW5 E;  1MGQ A;  2GGR A;  3EFO A;  4OMF B;  1YIT Q;  5D6W A;  1K73 C;  2DJQ A;  2EJ9 A;  3S3N A;  3NGP A;  5GAN f;  2QK0 A;  2XDB A;  2CZ6 B;  2L8D A;  3CXC S;  4LDX A;  4M7A B;  1NLP C;  1YI2 Q;  1NYG A;  1U5S A;  4N4I A;  3CCL A;  2J6K A;  2CS7 A;  1PWT A;  2O01 E;  2R5M A;  3HFO A;  2L3R A;  2CDT A;  3FEO A;  2LCS A;  1UEC A;  1OPL A;  4MMK A;  2E6N A;  5J26 A;  5A0D A;  4C8Q F;  2DMO A;  1KHI A;  3OYD A;  1HYO A;  5FU7 B;  2JN0 A;  4XU0 A;  3EH2 A;  3CCR Q;  1JO8 A;  4RTY A;  2CH4 A;  2Y4Y A;  3RR6 A;  3VRY A;  3OYM A;  2D8H A;  3SEM A;  4OB1 B;  2QGG A;  3CCM T;  3CC4 T;  5GJW B;  2EGA A;  4M75 A;  3VV0 A;  1XOV A;  4PLI A;  3I56 A;  1KQS P;  4AFS C;  2HAX A;  3LGF A;  3WXM B;  3QUI A;  1OX8 A;  2DXU A;  2YLB A;  3FLG A;  1S72 A;  1AZG B;  2L3S A;  2RHI A;  2DL3 A;  3PMT A;  1K0S A;  1IGU A;  3NHN A;  2DRM A;  2P4T A;  1I1J A;  3L2V A;  1E7O A;  3CCM Q;  3EG2 A;  3CC4 Q;  2FVU A;  2DD4 A;  4PJO E;  3CC7 T;  2LMJ A;  2G3R A;  1D1C A;  1TUC A;  1KJW A;  1UFF A;  3DLM A;  2CSQ A;  2C06 A;  2PVG B;  3KFV A;  3MEU A;  1VQ8 T;  2VVK A;  1AD5 A;  1AZE A;  3CC2 Q; 
#chains in the Genus database with same CATH homology
 5HCK A;  1ARK A;  1YWP A;  2GNC A;  4LN2 A;  5EC7 A;  1AOJ A;  1OV3 A;  1YP5 A;  2JTE A;  3UAT A;  2ECZ A;  4LUE A;  2E5K A;  5IHI A;  2JM8 A;  3IQL A;  1T3S A;  2KXD A;  1QWE A;  4ESR A;  3EG1 A;  1Z9Q A;  1QCF A;  5IXF A;  3FJ5 A;  4OMO A;  1WDX A;  3RNJ A;  1UJY A;  2FO0 A;  2LJ1 A;  2LX7 A;  2AZV A;  1E6G A;  1BU1 A;  1QLY A;  2DL7 A;  3ZL7 C;  1K76 A;  2RN8 A;  4JPB W;  3M0U A;  2DA9 A;  2KRM A;  3TSW A;  3H41 A;  3REA B;  4A63 B;  2RMO A;  2KRS A;  1GFD A;  2RPN A;  2YUO A;  2L3P A;  3REB B;  2AZS A;  4RTT A;  1J3T A;  5I22 A;  1VYV A;  2EBP A;  3GBQ A;  1JEG A;  1PRM C;  2YUQ A;  4Z88 A;  2B86 A;  4KRT A;  2IIM A;  2K6D A;  2AKL A;  3TSZ A;  4CC7 A;  1JU5 C;  5IHN A;  3VS2 A;  2SEM A;  1NM7 A;  2CT3 A;  1H92 A;  4HVV A;  1K1Z A;  1M3C A;  1NLO C;  4Y92 A;  3M0P A;  4OML A;  1FMK A;  4IIM A;  1CKB A;  2JW4 A;  3H0H A;  1UHF A;  4OMM A;  2FPE A;  1UTI A;  2CSI A;  2K7A A;  1H8K A;  2EGE A;  1KIK A;  2GQI A;  1W70 A;  1W6X A;  4JJB A;  2F2V A;  4X1V A;  1YCS B;  2EVR A;  2RQU A;  1VA7 A;  2CUB A;  2J06 A;  1SHG A;  2L2P A;  2EW3 A;  3NPF A;  3VS6 A;  2D8J A;  2DE0 X;  3H0I A;  2A36 A;  2RNA A;  4GBQ A;  1S1N A;  4J9F A;  1M27 C;  1T0J A;  2C0I A;  1RLQ C;  2ROL A;  2GTJ A;  2AK5 A;  4AFU C;  1E6H A;  2YUN A;  2M51 A;  1UDL A;  4J9I A;  2JT4 A;  1SRM A;  1X69 A;  1U3O A;  2F2W A;  4AFZ C;  2DBK A;  2A37 A;  1UJ0 A;  1V1C A;  3QWY A;  2KNB B;  5IXB A;  2GTO A;  1ZX6 A;  2O9V A;  2DL4 A;  2D1X A;  2L0A A;  4DEY A;  5ECA A;  2JS2 A;  3QWX X;  1U06 A;  1X43 A;  1LCK A;  4ORZ A;  1CSK A;  1H3H A;  1GCP A;  1BBZ A;  2PTK A;  4CC4 B;  2J05 A;  1OPK A;  1NEG A;  5IH2 A;  1RLP C;  1YWO A;  2L3Q A;  4LUD A;  2G6F X;  2KT8 A;  4K11 A;  1AWX A;  1TG0 A;  2KR3 A;  1K9A A;  3PE0 A;  2DLP A;  1UGV A;  1ZUU A;  2J6F A;  1KFZ A;  1G83 A;  1ABQ A;  1WFW A;  1AVZ C;  2RQT A;  1G2B A;  4JZ4 A;  1B07 A;  2MOX A;  2LZ6 B;  2VKN A;  1EFN A;  4AG2 C;  2CRE A;  3JV3 A;  2CUD A;  4J9G A;  1UG1 A;  4J9C A;  2YUP A;  2HEQ A;  4J9H A;  1M30 A;  1MUZ A;  4AG1 C;  4JJD A;  2LJ3 A;  2JS0 A;  2LQW A;  2OAW A;  1T3L A;  1TUD A;  3EHR A;  2HSP A;  1QKX A;  4R0K A;  2DYB A;  3VS4 A;  4RTX A;  3EHQ A;  1QKW A;  1OOT A;  1GBQ A;  1RUW A;  3VS0 A;  1M8M A;  1PNJ A;  2FPD A;  5GJV B;  1MV3 A;  1B3Q A;  4HCK A;  2BZ8 A;  2FRY A;  1NG2 A;  2A28 A;  1OEB A;  2BZY A;  4E6R A;  2H8H A;  2MCN A;  2JXB A;  1PRL C;  2O9S A;  3VS3 A;  3SHW A;  2ESW A;  3ULR B;  1W1F A;  2YSQ A;  2FRW A;  2KYB A;  2YT6 A;  2M0Y A;  2K9G A;  2EPD A;  1WXT A;  2CT4 A;  3I9Q A;  4F16 A;  1HD3 A;  1ZSG A;  2K79 A;  2W0Z A;  1M3B A;  4EIK A;  4ZNX A;  2DNU A;  2PZ1 A;  1HJD A;  2DIL A;  2EGC A;  2RF0 A;  3I35 A;  4RTW A;  4F17 A;  4RTV A;  3VS7 A;  1ZUK A;  2BTT A;  4HVU A;  4F14 A;  2NUZ A;  2KXC A;  1WLP B;  5FW9 A;  1WYX A;  2D0N A;  2KGT A;  2PNI A;  2KT1 A;  2KYM A;  1QWF A;  4RTZ A;  4QT7 A;  4WCI A;  1X6G A;  2EYW A;  3I5S A;  1VYU A;  3M0S A;  3LH5 A;  1M3A A;  1N5Z A;  2HCK A;  2JMA A;  1ZBJ A;  1X27 A;  5IHK A;  2SRC A;  2RQV A;  1GBR A;  1WX6 A;  1Y57 A;  2RQW A;  2K2M A;  1GCQ C;  2DBM A;  3VS1 A;  1WXB A;  1PKT A;  1BK2 A;  2HBW A;  2KBT A;  2KRO A;  5I11 A;  1UUE A;  2KRN A;  4CC3 A;  1AWW A;  2P4R A;  3UA7 A;  4LE9 A;  3M0Q A;  2FEI A;  1T0H A;  2XMF A;  4FSS A;  1JXO A;  3UF4 A;  3R6N A;  1WXU A;  2DVJ A;  2C0T A;  4JZ3 A;  1ABO A;  2K3B A;  1Z9Z A;  2W10 A;  3RBB B;  2LJ0 A;  5FWC A;  3TVT A;  1MV0 B;  2O31 A;  2EKH A;  2DM1 A;  2J6O A;  4OMP A;  2ED0 A;  1KSW A;  2AKK A;  4DEX A;  2DX1 A;  2EQI A;  3EG0 A;  3EGU A;  5L23 A;  1NEB A;  2ENM A;  2V1R A;  2KE9 A;  2QDL A;  1K4U S;  4RUG A;  3M0T A;  2LQN A;  4D8K A;  2LP5 A;  1NYF A;  1I07 A;  2ED1 A;  2JMC A;  4HVW A;  4J9B A;  2FG0 A;  2LNH B;  1WIE A;  1AEY A;  2KEA A;  2HDA A;  4AFQ C;  1GCQ A;  2RQR A;  1UE9 A;  4JJC A;  4Z89 A;  4GLM A;  2O88 A;  2J7I A;  2VWF A;  3PVQ A;  2DRK A;  4IIO A;  1ZUY A;  1X2Q A;  3EG3 A;  1SPK A;  1WA7 A;  2GGR A;  2MIO A;  1A0N B;  2DJQ A;  1PHT A;  3NGP A;  1K0X A;  2CH4 W;  1YNZ A;  4CC2 A;  1GL5 A;  1Y0M A;  1SHF A;  2EYZ A;  2OI3 A;  1SSH A;  3O5Z A;  3CQT A;  1JXM A;  3VS5 A;  1NLP C;  3THK A;  1I0C A;  2ABL A;  1BB9 A;  3M0R A;  1NYG A;  1U5S A;  2DL5 A;  1PKS A;  5FWB A;  2C0O A;  2J6K A;  1WI7 A;  2V1Q A;  3C0C A;  1PWT A;  2CDT A;  3VRZ A;  2LCS A;  1VYT A;  1UEC A;  1OPL A;  2DF6 A;  1GRI A;  2F2X A;  2ROT A;  2DMO A;  3I5R A;  4OMN A;  1SEM A;  4D8D A;  1CKA A;  4M4Z A;  1JO8 A;  2DL8 A;  4J9D A;  4RTY A;  2CH4 A;  2YDL A;  2X3X D;  3VRY A;  4J9E A;  3PVL A;  2D8H A;  3SEM A;  3UA6 A;  1AWO A;  2EYX A;  1YN8 A;  5GJW B;  2EGA A;  1HSQ A;  2GBQ A;  2O2O A;  4LNP A;  1XOV A;  2BZX A;  2JM9 A;  3U23 A;  4AFS C;  1RI9 A;  1UHC A;  4OMQ A;  1FYN A;  2FPF A;  2X3W D;  1X6B A;  1AZG B;  1SRL A;  2L3S A;  4HXJ A;  2DL3 A;  2A08 A;  1K0S A;  3NHN A;  2DRM A;  1AWJ A;  1I1J A;  1E7O A;  1ZLM A;  3EG2 A;  3NMZ C;  1X2K A;  2LMJ A;  2OJ2 A;  4Z8A A;  1JQQ A;  2NWM A;  3A98 A;  1TUC A;  1KJW A;  1UFF A;  2CSQ A;  2EYY A;  2I0N A;  3KFV A;  4RTU A;  1GFC A;  2VVK A;  3H0F A;  1AD5 A;  1IO6 A;  1AZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...