1UDLA

The solution structure of the fifth sh3 domain of intersectin 2 (kiaa1256)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
98
structure length
98
Chain Sequence
GSSGSSGQKGWFPASHVKLLGPSSERATPAFHPVCQVIAMYDYAANNEDELSFSKGQLINVMNKDDPDWWQGEINGVTGLFPSNYVKMTTDSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords intersectin 2
publication title The solution structure of the fifth SH3 domain of intersectin 2 (KIAA1256)
rcsb
source organism Homo sapiens
total genus 6
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1udlA00
4J9FA 2O31A 4ZNXA 2KGTA 3QWYA 1VYVA 2KE9A 1NYFA 1YN8A 2HCKA 3EHRA 4J9GA 4Z88A 1JQQA 4JJCA 1U3OA 1PKSA 1I07A 1UJ0A 1JO8A 4Y92A 2FEIA 4WCIA 2B86A 1AWWA 1AD5A 1WFWA 3M0SA 2ED0A 3SEMA 4IIMA 3O5ZA 2EQIA 2J6FA 3VS4A 1GFCA 3ZL7C 4RTVA 1UJYA 3UATA 2EGAA 1BU1A 1QKWA 3TSWA 1CKAA 1NG2A 1V1CA 2EYYA 4OMNA 4RTTA 1SSHA 4FSSA 5HCKA 5IH2A 1WYXA 2HSPA 2PTKA 2IIMA 1WX6A 3I5RA 4F17A 2DL8A 1NM7A 3REAB 1ARKA 4F16A 2DRMA 1CKBA 1H8KA 1X2QA 1K76A 5IHNA 4Z89A 2DLPA 2DL7A 2DL5A 2JMCA 2C0IA 2A37A 2EGEA 1VA7A 1Y57A 2DMOA 4HVVA 2CT3A 2CT4A 2K79A 2O2OA 3KFVA 1FMKA 1KFZA 1G83A 2YT6A 2D8HA 2CSQA 3EG1A 4J9IA 1AVZC 2ED1A 1UHFA 1M3AA 2KYMA 1KJWA 1RLPC 2GGRA 1NLPC 1E6HA 2EKHA 2YUQA 2LJ3A 3VS7A 2HDAA 1HJDA 2FRWA 1I1JA 3TVTA 2LMJA 2DILA 2DJQA 1GCQA 2ROTA 1UFFA 2DNUA 2M51A 3EGUA 2BTTA 1X43A 2K9GA 2O9VA 4GLMA 1BBZA 2RNAA 2J7IA 5I22A 1WXTA 1SRLA 2HBWA 2KXDA 4RTZA 2KRMA 5ECAA 1TUDA 1T3LA 3CQTA 2FO0A 3H41A 4J9DA 1WA7A 2KRSA 2SEMA 1UGVA 3FJ5A 2KEAA 2LQNA 3VRZA 2DE0X 1SHFA 2CDTA 4LN2A 5IXFA 1ZLMA 1E6GA 2EBPA 2KYBA 2RN8A 3VS1A 2EYXA 4JJBA 4OMLA 2LJ1A 1QLYA 3VS0A 1IO6A 2JMAA 1AZGB 1NYGA 4HXJA 2AKLA 2F2XA 1HD3A 1GBRA 2YUOA 1ZUUA 2MOXA 4K11A 4RTXA 1UECA 4JPBW 2GTJA 1PRMC 2OJ2A 2YUNA 1T3SA 2GTOA 2LCSA 5FW9A 3JV3A 1UHCA 1X27A 3VS2A 2LZ6B 3THKA 4OMOA 1BK2A 1UG1A 3R6NA 2AKKA 2KRNA 2F2WA 1X6GA 3ULRB 1VYTA 3C0CA 1A0NB 3A98A 2JT4A 4J9HA 2X3XD 4LUDA 2BZYA 1SEMA 1I0CA 1GL5A 1JXMA 1ABOA 1SPKA 3M0QA 3UA6A 1E7OA 2SRCA 2OI3A 2YUPA 1M8MA 2LJ0A 2J06A 1CSKA 3I9QA 1WDXA 1XOVA 2RMOA 2YSQA 1MUZA 4KRTA 1QWEA 3NHNA 4CC7A 2L0AA 4J9CA 3M0TA 2JM8A 2PZ1A 4JZ4A 4AG1C 1B07A 2J6KA 2LP5A 2RQUA 2OAWA 1G2BA 3PVQA 1MV3A 5IHKA 1PNJA 2JW4A 2EYZA 3EG2A 1UUEA 1EFNA 1RUWA 2VWFA 3PVLA 2L3SA 2DF6A 2DYBA 2G6FX 1T0JA 1WLPB 3NMZC 4R0KA 2AZSA 1M27C 2KR3A 2EPDA 4QT7A 4RTWA 1K4US 1OPKA 2RQVA 4X1VA 1U5SA 1K9AA 2DRKA 1Y0MA 2AK5A 3UF4A 2K2MA 2DX1A 2RPNA 1ABQA 2JXBA 1AOJA 2RQRA 3M0RA 2KT1A 2E5KA 3VS5A 1AEYA 1ZBJA 3H0IA 1FYNA 4HCKA 2W0ZA 2DL4A 1LCKA 1W6XA 1PKTA 3REBB 2BZ8A 4LUEA 1Z9QA 1SHGA 1NEBA 4CC2A 2ROLA 3EHQA 1UDLA 4E6RA 4ESRA 4Z8AA 2KXCA 1YP5A 4AFUC 1GFDA 4DEXA 3M0UA 4OMQA 4JJDA 1OOTA 5EC7A 4GBQA 4DEYA 3NPFA 3U23A 3QWXX 2PNIA 1K1ZA 1WXUA 4CC3A 1J3TA 4IIOA 1YWPA 1WIEA 1SRMA 5I11A 4ORZA 2VVKA 2DBKA 1UTIA 4D8DA 1K0XA 2D0NA 1KSWA 1AZEA 1W1FA 2V1QA 1ZX6A 2I0NA 2KBTA 2ENMA 2QDLA 2F2VA 1QWFA 1MV0B 3VRYA 2O88A 1NEGA 2CREA 2JS2A 2BZXA 1GCQC 1PHTA 5GJVB 1S1NA 2K7AA 1JXOA 3UA7A 3TSZA 1W70A 4OMPA 1RLQC 1QKXA 4OMMA 5FWCA 1JEGA 2FG0A 2O9SA 2EW3A 2RQWA 1YWOA 2RQTA 5IHIA 1JU5C 5FWBA 2MCNA 3VS6A 2FPFA 2MIOA 1UE9A 4RUGA 1H92A 4AG2C 1H3HA 3LH5A 2EGCA 2X3WD 1QCFA 4JZ3A 3EG3A 2NUZA 2JS0A 4D8KA 2FRYA 1OPLA 2K6DA 2C0OA 2DM1A 2GNCA 3I35A 2CH4W 2L3PA 2DL3A 1GBQA 3IQLA 4RTUA 2EVRA 3EG0A 1TUCA 2JM9A 1AWXA 2JTEA 2KROA 1X2KA 3H0HA 4RTYA 2A36A 1KIKA 2HEQA 1X69A 2K3BA 3PE0A 2L2PA 1M3CA 1OEBA 1M30A 1OV3A 3H0FA 4HVWA 1BB9A 3RBBB 2VKNA 4F14A 3M0PA 1PRLC 2J05A 4AFZC 1GRIA 1ZUKA 4CC4B 1Z9ZA 2CUDA 2P4RA 2A08A 2FPEA 2CSIA 2V1RA 5GJWB 2L3QA 2RF0A 4AFSC 2NWMA 3I5SA 2EYWA 2KNBB 3SHWA 1YNZA 2C0TA 3VS3A 1NLOC 2GQIA 5IXBA 1AWOA 1AWJA 2LQWA 2DVJA 1U06A 1WI7A 1B3QA 2ABLA 4HVUA 1HSQA 2FPDA 4J9EA 4EIKA 1GCPA 4J9BA 1M3BA 1YCSB 2DBMA 5L23A 2GBQA 1PWTA 2CUBA 3RNJA 1VYUA 2W10A 2KT8A 4LNPA 4AFQC 2XMFA 4M4ZA 2D8JA 2H8HA 2M0YA 1N5ZA 2A28A 2DA9A 2AZVA 1WXBA 1T0HA 4A63B 3GBQA 4LE9A 1TG0A 2J6OA 2LNHB 1K0SA 2D1XA 3NGPA 2ECZA 1ZSGA 2LX7A 1RI9A 2CH4A 1ZUYA 2YDLA 2ESWA 1X6BA
chains in the Genus database with same CATH superfamily
3SD4A 5CR2A 4OB1B 3EHRA 2YRDA 4J9GA 3ASKA 4XTXA 1MGQA 2ZZDA 1U3OA 2LNVA 4EPCA 3MJXA 1YHQA 1AD5A 2E5QA 1WFWA 2DTOA 5GMKl 3CBMA 3KBGA 3O5ZA 4RKUE 1VQOQ 1QVFA 3QDRB 4Y28E 3CCET 4RTVA 4VUBA 2DXUA 2RHXA 4QVZA 1NJIU 1CKAA 1MMDA 2X51A 3P8BB 3M5AA 1ZBXA 1QW1A 3G6ET 2F5TX 4F17A 4E7IA 1NM7A 1M1KC 1PSEA 2QA4Q 1K73R 1KQSS 5FRNA 3TREA 2DLPA 2D9TA 2P4TA 2RJEA 2QASA 2KI7A 4FIBA 2A37A 2GFAA 2DMOA 4M7AA 2E6NA 2RHIA 1FMKA 2YT6A 3CC4Q 1B34B 1AVZC 2MYSA 2NUPA 3C95A 1M3AA 1OYXA 4PNOA 4C5GA 1JBMA 2EKHA 3VS7A 2HDAA 4F04B 4OF1A 4MZTA 3CMET 1R0CB 3QG1A 1I1JA 1EX4A 1WHGA 2DJQA 2M1HA 1M1KU 2YXYA 2DNUA 5LJ3e 1X43A 1YI2T 5GMKi 4GLMA 5I22A 2HBWA 4EDUA 4RTZA 3OMCA 4RG2A 3SB2A 3CCMQ 1QVFS 1MNEA 2OTLT 4PJMA 2V26A 1WGSA 4J9DA 1WA7A 2SEMA 3MP6A 4BY6C 2EQUA 2AT1B 2LQNA 3VRZA 3P8HA 1UGQB 1ZLMA 2PVGB 1E6GA 2EBPA 2KYBA 4M77F 3VS1A 4JJBA 4OMLA 1W2BP 3G1JA 3QKJA 5CCAA 2JMAA 2YLBA 4GLKA 2DXTA 1VQMT 2F2XA 2MOXA 4K11A 3A8LB 4ZGDB 4RCBA 1YJ9T 2HNIA 1PG5B 3GNGA 4DOWA 1UHCA 4AT1B 2KMTA 3HFOA 2LZ6B 3JB9J 1D09B 2DIGA 4BD3A 3AHUA 1G5VA 1QVGS 2P0KA 1UG1A 2ZPBB 2WSEE 3GF5A 1YITA 3C0CA 3CCEQ 3A98A 1C1AA 5GAMg 3E1SA 4PFZA 1NBEB 1YCYA 4LUDA 2BZYA 1SEMA 1IHVA 1I0CA 1BI2A 1SPKA 1ABOA 3M0QA 3UA6A 1E7OA 5GAOp 2OI3A 1VQLQ 2LJ0A 4L6V5 3JCMb 2QEXA 2E3IA 1RL2A 2LTOA 1XOVA 5GAN7 4KRTA 2GQVA 3NHNA 2Y4XA 4CC7A 3CBPA 5HY6A 4AG1C 2J6KA 3DB3A 3CXCA 4XTUA 2OTJA 2LCLA 2RK1A 3C94A 3L2RA 3X24B 4XQ3A 1UUEA 3M58A 4NL3A 5CQXA 3J80E 1BIAA 2JVVA 2G6FX 4IUQA 5CKDA 3NMZC 1VUBA 1PD1A 4FT4A 1XQHA 1Q95G 2DIQA 1PC0A 1K9AA 3UF4A 1I8FA 2K2MA 3QBYA 4MZPA 3S6WA 3EG9B 3OYEA 1OU9A 2ZCFB 2CKKA 2E5KA 5D7UA 2COZA 2OAUA 4FSXA 3GPLA 1VQ5T 1AEYA 3S3MA 4HT9A 1D0ZA 2W0ZA 3EG9A 2DL4A 3OS1A 3M54A 1LCKA 1W6XA 4ZTJA 3JCMg 3DKMA 2LT1A 3AT1B 3SWNB 2OTLQ 3EFOB 4BDZA 4PJLA 5GAN6 3PT9A 1QMCA 3T9NA 4C92F 3SWNA 2KXCA 3EFOA 1JJ2P 2IG0A 1VQNT 2K2VA 3H6ZA 2QAZA 2JUFA 3HHTB 3U23A 5D6XA 2CZ7B 3EH2A 4EMKA 4JS5A 1WXUA 1Q7YR 1VQOA 2BIVA 2FZKB 1J3TA 3A5ZB 1JB0E 4C5EA 5I11A 3CXCS 3JRZA 1TSFA 2XD0A 4BI3A 2XU8A 4M77C 5GAN3 1M8VA 4LDVA 4DQ2A 2V1QA 3RMQA 2I0NA 1MMGA 3VKIA 4CI0C 3L2ZA 3CCVT 3LX7A 1V29B 2BZXA 2DZCA 2VGMA 8AT1B 5GAOm 3MEUA 5CKFA 5GJVB 3M55A 1YFNA 1W70A 4OB3B 1QCNA 1JEGA 4M77D 5C0MA 3CCRA 1YWOA 2RQTA 2XDPA 1JU5C 2FPFA 3OB9A 1VQ7A 2XK0A 3LH5A 2X3WD 4E7HA 2NUZA 2JS0A 1IRXA 2GNCA 3I35A 2CH4W 3GOXA 3JAME 4M77E 4JLGA 2JM9A 3UDCA 2HBPA 5CVIA 1KHIA 1X69A 4HVWA 4Y91A 4M78A 3FB9A 1BB9A 4ELYC 3M0PA 1PRLC 1RAIB 2K3YA 2EQJA 5GANe 5AT1B 1NE8A 2P4RA 2FPEA 3CCMA 1VQ9A 2NWMA 3SHWA 1LJOA 3M4YA 3G71T 1BI0A 4F7UF 2GQIA 2NUTA 1AWOA 3J81E 4AMCA 5CK9A 2DVJA 3A8HB 1VQ5Q 3E2UA 4QQGA 1HSQA 4PJOD 3CMAT 2CUBA 1N6AA 1KD1R 4ME7A 2QDYB 1XTDA 3G4SA 2KT8A 1ZSZB 5KYYB 4M7AF 4LNPA 2RK2A 3JSCA 1F1BB 2D8JA 2L8DA 2EQMA 4HT8A 1VQPQ 5FU6C 3OYMA 2HL5C 4DBQA 1ZSZA 2DA9A 3NTHA 5KYYA 5I2MA 1VQNQ 4PJOE 5LJ5f 2WACA 3GBQA 4LE9A 4E7LA 4WTOB 2J6OA 4BUGA 1RADB 1OU8A 2D1XA 3NGPA 2CGHA 4DBFA 2B8AA 4J9FA 4C92C 4IURA 4PJOB 1VYVA 2HCKA 4M7DF 2V8KA 2YRVA 3OA6A 1JQQA 3WVEB 4JJCA 1K73C 1K8AR 1PKSA 1VQLA 4KGVB 3CCVQ 1UJ0A 1JO8A 4FYVB 2FEIA 2B86A 3CPFA 3CCLA 5KYNA 3SEMA 3BFMA 3VS4A 2J6FA 3JB9H 3A8GB 4M77G 1IGUA 1GFCA 2XI9A 3ZL7C 4C0ZA 3JB9F 3UATA 1QKWA 2DD4A 3TSWA 2ZPFB 4OMFB 3QXEB 2EYYA 4OMNA 2CP3A 1QP2A 4FSSA 2K5FA 3L42A 2FYKA 4L5GA 4ZGEB 2PTKA 1VQ4A 3VYHB 1CKBA 1H8KA 4JRIA 1KQSP 3KUFA 4O6JA 2QGGA 2HAXA 1YIJT 2V8IA 2C0IA 1VQ6Q 1K73U 2EGEA 4XTZA 3V7SA 1VA7A 4YTLA 2DKGA 2CT3A 4C8QD 2K79A 5LJ3d 4ATOA 2XDDA 4MMKA 3ZFJA 4LDXA 4J9IA 5GAOr 2ED1A 3PFSA 5GAN4 3OYCA 2KYMA 4EMHA 1RLPC 2GGRA 5A0GA 1D1AA 1EIFA 1NLPC 3X20B 3LGLA 2G3RA 2CZ0B 3CC2T 3NFCA 3CD6A 4J83A 3G71Q 1S72A 4C8QE 3QZ5B 1YJWT 1VQ7T 2FRWA 3DLLA 1TS9A 2V8JA 4OGCA 3TVTA 1Q82R 4RCCA 1GCQA 3JCMV 1NPPA 3OW2A 1VQ8T 3MEAA 2X4XA 3VUBA 1KQ1A 4PJOG 4M75F 2BTTA 1UGRB 2HQXA 1PSFA 3CMAQ 2M9UA 2RNAA 4C8QB 3JB9I 2E65A 2PUKB 1WXTA 5KE3A 2KRMA 5A2QE 1QVFP 2QK0A 3TCJA 2FO0A 2LCCA 1TXQA 2P84A 2KRSA 3H9NA 4PK4A 1UGVA 2DE0X 3CCSA 3JCMd 2RN8A 3M57A 4C0FA 1UGPB 1NYGA 2X9HA 5LJ3h 4M7AC 4XU3A 2CP0A 1UECA 2QI2A 2LCSA 1HYOA 2RHUA 2HMAA 1M9SA 2ZPEB 1VIFA 2KSSA 4OMOA 5A0DA 1QVGP 3OYFA 4IUVA 2AKKA 2HKQB 2KRNA 4F7UE 3MCAB 1DJ7B 1X6GA 3ULRB 3CCJT 4O5VA 4A53A 4M7DC 2JT4A 3JCMJ 1U1TA 2OX7A 3INZA 1VQKA 2X3XD 2PVDB 2QTXA 4BI8B 2WSCE 4WF2A 1IGQA 3HL8A 3OW2S 1GL5A 1D0YA 4GY5A 2JOYA 2SRCA 2YUPA 4RG8A 3I55A 3I9QA 1M90R 5IAYA 2R5MA 2RMOA 4C0GA 1RACB 1SF9A 3P8DA 1BI3A 1YIJQ 4B9WA 4J9CA 2PU9B 4C8QG 4M7DD 3JCMh 2EYQA 2F5KA 2HSEB 1I5OB 2LP5A 3CCUA 2FZGB 2RQUA 2OAWA 5FU7C 4KULA 3PVQA 1PNJA 2JW4A 2EYZA 2M0OA 3S3NA 1B34A 3PVLA 4A54A 2DETA 5GAMe 5HKCA 1I5LA 4OB0B 2NLUA 1ZA2B 1TU0B 4M7DE 2KR3A 1RAHB 1SSFA 3CC2Q 4UC4A 1PD0A 2RQVA 1YJWQ 4FW1A 4X1VA 4II1A 2XKOC 1Y0MA 2DX1A 1VQ8Q 3URGA 2JXBA 1QVPA 1AOJA 5J26A 4QQ6A 5D6YA 1BKBA 3M0RA 1Q7YC 1H3ZA 4HKEA 1ZBJA 2F1LA 3H0IA 1FYNA 4HCKA 2P0QA 1YJNA 4JLIA 1PKTA 4BB7A 4KGXB 2DK3A 5CKEA 4JDSA 6AT1B 3CCQA 3EHQA 1IB8A 4J6YA 1UB4A 2LDMA 4E6RA 2LQ8A 4M75C 4M78F 1YP5A 3RKYA 2DYIA 3I56A 2I2LA 5EC7A 4DEYA 3DB4A 3OYDA 1BCMA 4F7UG 4ANJA 1ZHIA 1K1ZA 4BDYA 3CC7T 2QXFA 4IIOA 1QQJA 1YWPA 1SRMA 2L89A 4A4KA 1Q7YU 2VXFA 3GIBA 4ORZA 2JNGA 1BYMA 4E7JA 2DBKA 1UTIA 1Y96B 3JCMe 1AZEA 1ZX6A 2KBTA 2QDLA 2A0FB 2FVUA 2RA2A 1X6OA 2RI5A 3OYYA 4QVCA 3CCJQ 2K7AA 1JXOA 2CZ1B 1Y07A 2JN0A 3HPWA 4M75E 4OMPA 1RLQC 1G3YA 1QKXA 3G6EQ 4OMMA 3OYKA 3QYGB 2O9SA 4N0AC 2MCNA 4BY6B 2MIOA 5GANd 1H92A 2EGCA 5CAIA 3EG3A 4M7DG 2C0OA 2EAYA 2CP7A 5HK3A 2DL3A 2K3XA 3OYGA 4ZN1A 1W2BA 2DTIA 3EG0A 1M2VB 2DZ9A 3QIIA 1YHQT 3SWNC 1AWXA 3H0HA 2A36A 1KIKA 3MEVA 2E10A 1M2VA 2L2PA 2X4JA 1M3CA 1OV3A 5L8RE 1KD1C 1Q81R 5LJ3f 4F14A 1TUGB 2E4HA 4EMKC 3CMEQ 5LJ3j 1Z9ZA 3MP1A 2CUDA 1IREB 2V1RA 5GJWB 2L3QA 2RF0A 1XNIA 3ME9A 2EYWA 1V76A 2C0TA 3BY7A 4KH0B 4J7FA 3VS3A 1NLOC 1YI2Q 3VU3C 2LQWA 4FT2A 4P5NA 1WI7A 1N9RA 3V8LA 2ABLA 2YLCA 4J9EA 4J9BA 3OYNA 5L23A 2GBQA 3D7SB 1Q86R 2DAQA 3CEYA 1K8AC 5C6SA 4OGEA 2W10A 5GANh 1KD1U 5DY9A 2RB6A 4M4ZA 2M0YA 3META 2PQWA 4MDXA 3V7RA 1VQMQ 2HQEA 1N9SA 1YJ9Q 1K0SA 2QQSA 1SG5A 3CC7Q 2RD1A 1ZUYA 2ESWA 3OBWA 4M75G 2O31A 4ZNXA 3NTKA 2KE9A 4CRIA 1YN8A 4M78C 3OYLA 1OI1A 3A8MB 2XHCA 1U8RA 1M1FA 4FYXB 3L2QA 2QA4A 3BDUA 4RMOA 4Y92A 3C12A 4WCIA 1K8AU 1AWWA 4N4HA 1WHKA 1HXDA 4PLLA 2EQIA 3FLGA 1G3WA 4JJNK 1QCOA 3CC4A 1EZZB 2EGAA 5KYUB 1BU1A 1MHNA 3M56A 3QUIA 1NG2A 1V1CA 4RTTA 1PM3A 5KYUA 2HSPA 1KHCA 3QO3A 2DL8A 3REAB 4F16A 5KCHA 1JJ2A 1Q82C 2X4WA 4Z89A 3V8KA 3OYBA 4PL6A 2DO3A 1YHQQ 2JMCA 5FLXE 3RUXA 1WHHA 3CBOA 4PKCC 1RAEB 2CT4A 3KFVA 1YITT 4KH1B 2D8HA 3EG1A 4M77B 1MMAA 3LWIA 1UHFA 5GMKm 3UWNA 1KJWA 3OYJA 2VC8A 4M77A 1E6HA 1KC8R 1TWBA 1VOMA 2XIDA 2X4YA 3HSBA 2LJ3A 2QEXT 4Z02A 3HRUA 2DILA 2ATCB 2ZGWA 1B7TA 2RI2A 2ROTA 1UFFA 1Q82U 5GAN2 2K9GA 2OTJT 2COYA 1UGSB 1WQ7A 4HCBA 1WHJA 2J7IA 2KXDA 4IUTA 5ECAA 3KXTA 2ZAEA 2EFIA 3EGDB 1TOVA 5LJ5g 3MO8A 1WZOA 2JZ2A 2VUBA 2HD0A 2X35A 4LXCA 4C0DC 4JUVA 3OYAA 3FJ5A 1X75C 3EGDA 1SHFA 4LN2A 5IXFA 3QJYA 2EYXA 1TH7A 1QLYA 2MAMA 3CCEA 1IO6A 1AZGB 1JJ2S 2QYZA 4HXJA 1HD3A 1GBRA 2YUOA 1ZUUA 3OS5A 2OJ2A 4PJOA 2D0QB 1ACMB 1M90C 3BE3A 2KY9A 4HCZA 5FW9A 1X27A 3EFSA 3VS2A 2E70A 1WQWA 3OMGA 3FDRA 1WJQA 3THKA 1BK2A 1WPYA 2E64A 3PNWC 2RJCA 4A4FA 3R6NA 2BUDA 4C92D 3PTAA 2F2WA 3E9FA 5A0LA 2WSFE 4XU1A 1JRIA 4J6XA 1C0MA 1VQOT 7AT1B 3QHSA 5GAMd 3L2WA 1JXMA 4X9DA 2XDBA 4FW2A 5FU6B 1M8MA 2H3EB 4OB2B 2QG9B 2Y4YA 2KVQG 4C92E 1CSKA 3CMEA 5GANf 1WDXA 4KT0E 3HKSA 3LLRA 4KBMB 4LD6A 5GANj 1M90U 2L5QA 3L2UA 3M0TA 2JM8A 2PZ1A 2VXEA 4JZ4A 1B07A 3TEEA 3UPUA 4LDWA 4PLIA 3O8VA 4C92B 1YITQ 1G2BA 2AHJB 1MV3A 5IHKA 4XAXB 5IT9E 3EG2A 2BE9B 2L3SA 2DF6A 2PUOB 3CCRT 2O4XB 2OTLA 1WLPB 4R0KA 2AZSA 2EPDA 4QT7A 3MP8A 4RTWA 2QEXQ 3TQ7P 1IXDA 4BACA 5D6WA 1K4US 1OPKA 1U5SA 2DRKA 4TVRA 5CIUA 2AK5A 2COWA 2RPNA 4MZMA 4DA4A 1AT1B 2KT1A 1VQMA 1FX7A 3VS5A 2A3LA 4HA8A 1BCOA 3CPWA 4C8QA 4A4EA 3R6OA 4LUEA 3M59A 1Z9QA 1SHGA 4ZTFA 1NEBA 5GAOl 5GAMh 2VYTA 4CC2A 4Q5WA 2ROLA 2K5LA 4PJJA 1UDLA 2DVEA 5FRMA 1VIEA 4Z8AA 3CCMT 1VQ9T 5KH6A 4AFUC 4DEXA 4OMQA 1OOTA 1OQKA 2VASA 4GBQA 4J6WA 1W4SA 2PNIA 5DLQE 9ATCB 5AYFA 4CC3A 4FCYA 3HP9A 2MWOA 4B9XA 3Q1JA 5J3BA 2VVKA 2YHTA 3MPUB 2KQWA 1K0XA 1KSWA 4XK8E 1W1FA 3G4ST 2F2VA 4C92G 2DD5A 2JS2A 4M7AD 1WHLA 2DEUA 1PHTA 1IHWA 1R8OB 3BDLA 4IKFA 1Q81C 2KDSA 2GF7A 1KK7A 4F7UB 5FWCA 3VJPA 3N5BB 4N4GA 1D1BA 2RQWA 5IHIA 5FWBA 3A8OB 2CP6A 4EMGA 4F7UA 4M7AE 1H3HA 2DFUA 4JZ3A 4BE0A 3CPWS 4HCCA 2FRYA 1OPLA 3G7ZA 2K6DA 2DM1A 1OZ2A 3OS0A 1VQLT 3PMTA 5CO7A 1RAFB 2EVRA 4E7ZA 1G3TA 1TUCA 3RESA 2JTEA 3CCLT 4M7AB 1VQ5A 4RTYA 2DPPB 2K3BA 2VGNA 4XU0A 3H0FA 1WNLA 1M30A 1Q86C 2MF2A 2NUPB 2HQHA 2VKNA 5KYWB 3CCRQ 3JB9D 2RHZA 4AFZC 1Q81U 1VQ7Q 5KYWA 3M9QA 4BI4A 1VQ4T 1QVGA 1VQPA 1K9MR 1YNZA 5DM7R 1OULA 1VQNA 2D6FA 4M7DB 5IXBA 2RJFA 2ZPIB 4NS5A 2FL7A 3RDVA 1U06A 4M7DA 1M4ZA 5KYXB 1B3QA 2QQRA 3HRTA 1MNDA 2FPDA 2HKNA 3GNFB 2R57A 1YCSB 2QQ9A 4J7IA 5KYXA 4KUDK 1TTHB 3RKWA 1AHJB 1Q86U 1FMWA 3CCVA 4AFQC 2XMFA 1VQ9Q 2H8HA 1N8RR 2EQKA 3VV0A 3QZ9B 3CD6T 2A28A 1S72T 5FU7B 1OX9A 3S3OA 4A63B 2M16A 4OP0A 4FU6A 5LJ5d 2ECZA 3CXCP 3UT1A 3PIOA 3QPHA 5IN1A 3V7CA 4X34A 1H641 1FWZA 4M75D 2KGTA 3QWYA 1NYFA 4NL2A 2E41A 4Z88A 2E12A 1Y96A 3E19A 2CP2A 4M7AG 3G4SQ 1I07A 1LPLA 3EGXB 2LX9A 4E7SA 3CCST 1VQ6A 3M0SA 2ED0A 4J5YA 5GAOq 3HRSA 4IIMA 1RAGB 1O9SA 4KUIA 3EGXA 3PGGA 1NJIR 5CKBA 1UJYA 1M2OA 3F70A 4J8OA 2JTFA 2MMPA 4C5HA 3RIRA 2R58A 8ATCB 1SSHA 1KC8C 2O01E 5HCKA 2VB6A 1WYXA 4M75B 5IH2A 2IIMA 1WX6A 3I5RA 5GAMf 3GP8A 1ZA1B 1ARKA 5DLOA 2DRMA 3G71A 1X2QA 2DEQA 4M75A 3GLXA 1K76A 5IHNA 5GAMj 2LRQA 4A4GA 2DL7A 1WJSA 3FIFA 2DL5A 5LJ3g 3LWHA 3CCLQ 1Y7XA 1KG1A 3ZBDA 4PJOF 1Y57A 4HVVA 4IUUA 5LJ5h 3FC3A 2O2OA 1KFZA 1U1SA 1G83A 3CMAA 4JRPA 2CSQA 2ZPGB 3JB9G 1UEBA 4PFOA 2FHDA 2P0PA 1QP3A 1VQKT 2H3JA 4QQDA 2VV5A 4XTYA 2YUQA 2MPXC 1VQ4Q 1NZ9A 3I55T 2BE7D 1HJDA 1KC8U 1M1KR 2LMJA 3OBYA 3EFRA 4LD9K 5KE2A 1FXXA 2F69A 5GAN5 3M4GA 2M51A 4ZGJB 1D1CA 3EGUA 1XJWB 3CCUT 4JS4A 2O9VA 1BBZA 2QGFB 4N0AA 1SRLA 4QKUA 1TUDA 1IZ6A 1T3LA 3CQTA 1BIBA 2EKOA 3H41A 4IUPA 2KEAA 3QDFA 3OQ5A 2CDTA 1LVKA 4XTVA 3JCMf 3CD6Q 1S72Q 3OY9A 4PFPA 3V8JA 3LGFA 4R56A 2LJ1A 3X25B 1VQPT 4BE2A 1W2BS 3VS0A 1PCXA 2QQAA 3LYIA 4EMKB 1P92A 5J39A 2HZYA 2RHYA 1G8XA 5KCOA 2AKLA 3ZEHA 3JCMX 4RTXA 1YJNT 5GMKh 4JPBW 1BI1A 2GTJA 1PRMC 2YUNA 2R5AA 1T3SA 2GTOA 4A4HA 2ZPHB 2AIRB 3SDZA 1RAAB 3CCQT 5LJ5e 1YIJA 1D0XA 3CCSQ 3EAEA 4C8QF 2RJDA 3I56T 3NTIA 4M78D 4X9CA 2XG8D 1VYTA 3JCMQ 1A0NB 1WJRA 4FYYB 4J9HA 4B6MA 1OZ3A 1R0BG 3X26B 3JCMW 3OSSC 3RMSA 3TU4K 2J06A 3CC2A 4M78E 1YJWA 2RO0A 2K4YA 2YSQA 1MUZA 1QWEA 3QSUA 2L0AA 1VQ8A 1ZSZC 4DBRA 3WXMB 3RR6A 2RI3A 3OYHA 5LL6S 4FM4B 3L2VA 1VQ6T 4M78B 4R55A 2KAFA 3RKXA 1EFNA 1RUWA 2VWFA 2EJFA 3SFMA 1VQKQ 1SKUB 2DYBA 5CKHA 1T0JA 4BE1A 1RABB 1M27C 1I4K1 1RI0A 2DTHA 3MKDA 2K5IA 3C4SA 3OSVA 3I55Q 2KK4A 2QTVA 4PJOC 2CP5A 1M5Q1 1NPRA 1KQ2A 3WVDB 3OS2A 4PJNA 4D6WA 2NUTB 5GAOn 1ABQA 5GMKe 3QYHB 2RQRA 3CCUQ 4MMLA 2MWPA 2YRCA 2E1HA 3EH1A 4ZN3A 3REBB 1R77A 2RM4A 2BZ8A 3H8ZA 2K57A 3E9GA 2LC4A 5HK0A 3DLMA 2LQKA 4ESRA 3HFNA 2EIFA 2LT4A 1O75A 3QJ6A 1OX8A 1GFDA 3M0UA 4JJDA 3CCJA 2XICA 2GFUA 3NPFA 2JJ9A 4QVDA 3QWXX 3FEOA 3G6EA 4KGZB 1YJNQ 5LJ5j 1MMNA 2IPOB 1WIEA 2MI6A 2HL3A 4D8DA 2D0NA 2EWNA 3MEWA 3CCQQ 2EJ9A 3LH0A 2ENMA 1QWFA 3J7AF 1MV0B 3VRYA 3MHXA 2O88A 1NEGA 4M78G 2CREA 5GAN8 1LOJA 3I56Q 1GCQC 2CZ6B 3LW5E 1HK9A 3BW1A 1S1NA 2FZCB 3UA7A 3OW2P 2IVWA 3TSZA 2M02A 1X01A 3M53A 2L3RA 5GANg 2FG0A 4E2FB 2EW3A 4L59A 4C0DB 3FJPA 3VS6A 1UE9A 3ER0A 4RUGA 5EG2A 4C8QC 4AG2C 1K9MC 3CPWP 1C6VX 1QCFA 2C06A 3L1AA 5I21A 4XTWA 4D8KA 2QA4T 2Z0WA 2L3PA 3A1PA 1GBQA 3IQLA 1YI2A 4RTUA 3PIPA 1WHMA 2BKDN 2Y90A 2KROA 2JTMA 1X2KA 2PVOB 2CYZB 2E3HA 2DXCA 2HEQA 4C92A 4FL6A 3JCMP 3PE0A 2YWWA 1OEBA 2A7YA 3VUZA 3CC4T 3HTRA 2DERA 3RBBB 4V2SA 1ZQ1A 2NYSA 2J05A 1D3BB 4JRKA 1GRIA 1ZUKA 4CC4B 4MDWA 2O4XA 4C5IA 5GMKj 2A08A 1N8RC 1FMVA 2CSIA 1N27A 1D3BA 4N4IA 4AFSC 2LVMA 4E47A 3I5SA 2KNBB 1Y71A 2E6ZA 2EJGA 5I2SA 3JCMc 2OTJQ 1K9MU 4QW2A 1AWJA 1YJ9A 2GCXA 1G3SA 3CC7A 4HVUA 4DBHA 4LDUA 4DOVA 2DJZA 1YBYA 3X28B 2MK5A 4EIKA 1GCPA 1M3BA 3VYGA 2DBMA 1I81A 1PWTA 4FYWB 5M9OA 3RERA 5FROA 1KQSA 2DXBA 3RNJA 1M1GA 1VYUA 3PMIA 4NOYA 1LNXA 3OYIA 4ELZC 2CS7A 1N5ZA 4JRQA 2AZVA 1WXBA 1T0HA 1N8RU 4LDYA 4OVAA 1NJIC 1TG0A 2QQBA 2RH2A 2LNHB 3FRNA 2FB7A 1ZSGA 4XU2A 4E7KA 1GXIE 2LX7A 1RI9A 2CH4A 3JV3A 2YDLA 5CQYA 1X6BA
chains in the Genus database with same CATH topology
4J9FA 2O31A 4ZNXA 2KGTA 3QWYA 1VYVA 2KE9A 1NYFA 1YN8A 2HCKA 3EHRA 4J9GA 4Z88A 1JQQA 4JJCA 1U3OA 1PKSA 1I07A 1UJ0A 1JO8A 4Y92A 2FEIA 4WCIA 2B86A 1AWWA 1AD5A 1WFWA 3M0SA 2ED0A 3SEMA 4IIMA 3O5ZA 2EQIA 2J6FA 3VS4A 1GFCA 3ZL7C 4RTVA 1UJYA 3UATA 2EGAA 1BU1A 1QKWA 3TSWA 1CKAA 1NG2A 1V1CA 2EYYA 4OMNA 4RTTA 1SSHA 4FSSA 5HCKA 5IH2A 1WYXA 2HSPA 2PTKA 2IIMA 1WX6A 3I5RA 4F17A 2DL8A 1NM7A 3REAB 1ARKA 4F16A 2DRMA 1CKBA 1H8KA 1X2QA 1K76A 5IHNA 4Z89A 2DLPA 2DL7A 2DL5A 2JMCA 2C0IA 2A37A 2EGEA 1VA7A 1Y57A 2DMOA 4HVVA 2CT3A 2CT4A 2K79A 2O2OA 3KFVA 1FMKA 1KFZA 1G83A 2YT6A 2D8HA 2CSQA 3EG1A 4J9IA 1AVZC 2ED1A 1UHFA 1M3AA 2KYMA 1KJWA 1RLPC 2GGRA 1NLPC 1E6HA 2EKHA 2YUQA 2LJ3A 3VS7A 2HDAA 1HJDA 2FRWA 1I1JA 3TVTA 2LMJA 2DILA 2DJQA 1GCQA 2ROTA 1UFFA 2DNUA 2M51A 3EGUA 2BTTA 1X43A 2K9GA 2O9VA 4GLMA 1BBZA 2RNAA 2J7IA 5I22A 1WXTA 1SRLA 2HBWA 2KXDA 4RTZA 2KRMA 5ECAA 1TUDA 1T3LA 3CQTA 2FO0A 3H41A 4J9DA 1WA7A 2KRSA 2SEMA 1UGVA 3FJ5A 2KEAA 2LQNA 3VRZA 2DE0X 1SHFA 2CDTA 4LN2A 5IXFA 1ZLMA 1E6GA 2EBPA 2KYBA 2RN8A 3VS1A 2EYXA 4JJBA 4OMLA 2LJ1A 1QLYA 3VS0A 1IO6A 2JMAA 1AZGB 1NYGA 4HXJA 2AKLA 2F2XA 1HD3A 1GBRA 2YUOA 1ZUUA 2MOXA 4K11A 4RTXA 1UECA 4JPBW 2GTJA 1PRMC 2OJ2A 2YUNA 1T3SA 2GTOA 2LCSA 5FW9A 3JV3A 1UHCA 1X27A 3VS2A 2LZ6B 3THKA 4OMOA 1BK2A 1UG1A 3R6NA 2AKKA 2KRNA 2F2WA 1X6GA 3ULRB 1VYTA 3C0CA 1A0NB 3A98A 2JT4A 4J9HA 2X3XD 4LUDA 2BZYA 1SEMA 1I0CA 1GL5A 1JXMA 1ABOA 1SPKA 3M0QA 3UA6A 1E7OA 2SRCA 2OI3A 2YUPA 1M8MA 2LJ0A 2J06A 1CSKA 3I9QA 1WDXA 1XOVA 2RMOA 2YSQA 1MUZA 4KRTA 1QWEA 3NHNA 4CC7A 2L0AA 4J9CA 3M0TA 2JM8A 2PZ1A 4JZ4A 4AG1C 1B07A 2J6KA 2LP5A 2RQUA 2OAWA 1G2BA 3PVQA 1MV3A 5IHKA 1PNJA 2JW4A 2EYZA 3EG2A 1UUEA 1EFNA 1RUWA 2VWFA 3PVLA 2L3SA 2DF6A 2DYBA 2G6FX 1T0JA 1WLPB 3NMZC 4R0KA 2AZSA 1M27C 2KR3A 2EPDA 4QT7A 4RTWA 1K4US 1OPKA 2RQVA 4X1VA 1U5SA 1K9AA 2DRKA 1Y0MA 2AK5A 3UF4A 2K2MA 2DX1A 2RPNA 1ABQA 2JXBA 1AOJA 2RQRA 3M0RA 2KT1A 2E5KA 3VS5A 1AEYA 1ZBJA 3H0IA 1FYNA 4HCKA 2W0ZA 2DL4A 1LCKA 1W6XA 1PKTA 3REBB 2BZ8A 4LUEA 1Z9QA 1SHGA 1NEBA 4CC2A 2ROLA 3EHQA 1UDLA 4E6RA 4ESRA 4Z8AA 2KXCA 1YP5A 4AFUC 1GFDA 4DEXA 3M0UA 4OMQA 4JJDA 1OOTA 5EC7A 4GBQA 4DEYA 3NPFA 3U23A 3QWXX 2PNIA 1K1ZA 1WXUA 4CC3A 1J3TA 4IIOA 1YWPA 1WIEA 1SRMA 5I11A 4ORZA 2VVKA 2DBKA 1UTIA 4D8DA 1K0XA 2D0NA 1KSWA 1AZEA 1W1FA 2V1QA 1ZX6A 2I0NA 2KBTA 2ENMA 2QDLA 2F2VA 1QWFA 1MV0B 3VRYA 2O88A 1NEGA 2CREA 2JS2A 2BZXA 1GCQC 1PHTA 5GJVB 1S1NA 2K7AA 1JXOA 3UA7A 3TSZA 1W70A 4OMPA 1RLQC 1QKXA 4OMMA 5FWCA 1JEGA 2FG0A 2O9SA 2EW3A 2RQWA 1YWOA 2RQTA 5IHIA 1JU5C 5FWBA 2MCNA 3VS6A 2FPFA 2MIOA 1UE9A 4RUGA 1H92A 4AG2C 1H3HA 3LH5A 2EGCA 2X3WD 1QCFA 4JZ3A 3EG3A 2NUZA 2JS0A 4D8KA 2FRYA 1OPLA 2K6DA 2C0OA 2DM1A 2GNCA 3I35A 2CH4W 2L3PA 2DL3A 1GBQA 3IQLA 4RTUA 2EVRA 3EG0A 1TUCA 2JM9A 1AWXA 2JTEA 2KROA 1X2KA 3H0HA 4RTYA 2A36A 1KIKA 2HEQA 1X69A 2K3BA 3PE0A 2L2PA 1M3CA 1OEBA 1M30A 1OV3A 3H0FA 4HVWA 1BB9A 3RBBB 2VKNA 4F14A 3M0PA 1PRLC 2J05A 4AFZC 1GRIA 1ZUKA 4CC4B 1Z9ZA 2CUDA 2P4RA 2A08A 2FPEA 2CSIA 2V1RA 5GJWB 2L3QA 2RF0A 4AFSC 2NWMA 3I5SA 2EYWA 2KNBB 3SHWA 1YNZA 2C0TA 3VS3A 1NLOC 2GQIA 5IXBA 1AWOA 1AWJA 2LQWA 2DVJA 1U06A 1WI7A 1B3QA 2ABLA 4HVUA 1HSQA 2FPDA 4J9EA 4EIKA 1GCPA 4J9BA 1M3BA 1YCSB 2DBMA 5L23A 2GBQA 1PWTA 2CUBA 3RNJA 1VYUA 2W10A 2KT8A 4LNPA 4AFQC 2XMFA 4M4ZA 2D8JA 2H8HA 2M0YA 1N5ZA 2A28A 2DA9A 2AZVA 1WXBA 1T0HA 4A63B 3GBQA 4LE9A 1TG0A 2J6OA 2LNHB 1K0SA 2D1XA 3NGPA 2ECZA 1ZSGA 2LX7A 1RI9A 2CH4A 1ZUYA 2YDLA 2ESWA 1X6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9F A;  2O31 A;  4ZNX A;  2KGT A;  3QWY A;  1VYV A;  2KE9 A;  1NYF A;  1YN8 A;  2HCK A;  3EHR A;  4J9G A;  4Z88 A;  1JQQ A;  4JJC A;  1U3O A;  1PKS A;  1I07 A;  1UJ0 A;  1JO8 A;  4Y92 A;  2FEI A;  4WCI A;  2B86 A;  1AWW A;  1AD5 A;  1WFW A;  3M0S A;  2ED0 A;  3SEM A;  4IIM A;  3O5Z A;  2EQI A;  2J6F A;  3VS4 A;  1GFC A;  3ZL7 C;  4RTV A;  1UJY A;  3UAT A;  2EGA A;  1BU1 A;  1QKW A;  3TSW A;  1CKA A;  1NG2 A;  1V1C A;  2EYY A;  4OMN A;  4RTT A;  1SSH A;  4FSS A;  5HCK A;  5IH2 A;  1WYX A;  2HSP A;  2PTK A;  2IIM A;  1WX6 A;  3I5R A;  4F17 A;  2DL8 A;  1NM7 A;  3REA B;  1ARK A;  4F16 A;  2DRM A;  1CKB A;  1H8K A;  1X2Q A;  1K76 A;  5IHN A;  4Z89 A;  2DLP A;  2DL7 A;  2DL5 A;  2JMC A;  2C0I A;  2A37 A;  2EGE A;  1VA7 A;  1Y57 A;  2DMO A;  4HVV A;  2CT3 A;  2CT4 A;  2K79 A;  2O2O A;  3KFV A;  1FMK A;  1KFZ A;  1G83 A;  2YT6 A;  2D8H A;  2CSQ A;  3EG1 A;  4J9I A;  1AVZ C;  2ED1 A;  1UHF A;  1M3A A;  2KYM A;  1KJW A;  1RLP C;  2GGR A;  1NLP C;  1E6H A;  2EKH A;  2YUQ A;  2LJ3 A;  3VS7 A;  2HDA A;  1HJD A;  2FRW A;  1I1J A;  3TVT A;  2LMJ A;  2DIL A;  2DJQ A;  1GCQ A;  2ROT A;  1UFF A;  2DNU A;  2M51 A;  3EGU A;  2BTT A;  1X43 A;  2K9G A;  2O9V A;  4GLM A;  1BBZ A;  2RNA A;  2J7I A;  5I22 A;  1WXT A;  1SRL A;  2HBW A;  2KXD A;  4RTZ A;  2KRM A;  5ECA A;  1TUD A;  1T3L A;  3CQT A;  2FO0 A;  3H41 A;  4J9D A;  1WA7 A;  2KRS A;  2SEM A;  1UGV A;  3FJ5 A;  2KEA A;  2LQN A;  3VRZ A;  2DE0 X;  1SHF A;  2CDT A;  4LN2 A;  5IXF A;  1ZLM A;  1E6G A;  2EBP A;  2KYB A;  2RN8 A;  3VS1 A;  2EYX A;  4JJB A;  4OML A;  2LJ1 A;  1QLY A;  3VS0 A;  1IO6 A;  2JMA A;  1AZG B;  1NYG A;  4HXJ A;  2AKL A;  2F2X A;  1HD3 A;  1GBR A;  2YUO A;  1ZUU A;  2MOX A;  4K11 A;  4RTX A;  1UEC A;  4JPB W;  2GTJ A;  1PRM C;  2OJ2 A;  2YUN A;  1T3S A;  2GTO A;  2LCS A;  5FW9 A;  3JV3 A;  1UHC A;  1X27 A;  3VS2 A;  2LZ6 B;  3THK A;  4OMO A;  1BK2 A;  1UG1 A;  3R6N A;  2AKK A;  2KRN A;  2F2W A;  1X6G A;  3ULR B;  1VYT A;  3C0C A;  1A0N B;  3A98 A;  2JT4 A;  4J9H A;  2X3X D;  4LUD A;  2BZY A;  1SEM A;  1I0C A;  1GL5 A;  1JXM A;  1ABO A;  1SPK A;  3M0Q A;  3UA6 A;  1E7O A;  2SRC A;  2OI3 A;  2YUP A;  1M8M A;  2LJ0 A;  2J06 A;  1CSK A;  3I9Q A;  1WDX A;  1XOV A;  2RMO A;  2YSQ A;  1MUZ A;  4KRT A;  1QWE A;  3NHN A;  4CC7 A;  2L0A A;  4J9C A;  3M0T A;  2JM8 A;  2PZ1 A;  4JZ4 A;  4AG1 C;  1B07 A;  2J6K A;  2LP5 A;  2RQU A;  2OAW A;  1G2B A;  3PVQ A;  1MV3 A;  5IHK A;  1PNJ A;  2JW4 A;  2EYZ A;  3EG2 A;  1UUE A;  1EFN A;  1RUW A;  2VWF A;  3PVL A;  2L3S A;  2DF6 A;  2DYB A;  2G6F X;  1T0J A;  1WLP B;  3NMZ C;  4R0K A;  2AZS A;  1M27 C;  2KR3 A;  2EPD A;  4QT7 A;  4RTW A;  1K4U S;  1OPK A;  2RQV A;  4X1V A;  1U5S A;  1K9A A;  2DRK A;  1Y0M A;  2AK5 A;  3UF4 A;  2K2M A;  2DX1 A;  2RPN A;  1ABQ A;  2JXB A;  1AOJ A;  2RQR A;  3M0R A;  2KT1 A;  2E5K A;  3VS5 A;  1AEY A;  1ZBJ A;  3H0I A;  1FYN A;  4HCK A;  2W0Z A;  2DL4 A;  1LCK A;  1W6X A;  1PKT A;  3REB B;  2BZ8 A;  4LUE A;  1Z9Q A;  1SHG A;  1NEB A;  4CC2 A;  2ROL A;  3EHQ A;  1UDL A;  4E6R A;  4ESR A;  4Z8A A;  2KXC A;  1YP5 A;  4AFU C;  1GFD A;  4DEX A;  3M0U A;  4OMQ A;  4JJD A;  1OOT A;  5EC7 A;  4GBQ A;  4DEY A;  3NPF A;  3U23 A;  3QWX X;  2PNI A;  1K1Z A;  1WXU A;  4CC3 A;  1J3T A;  4IIO A;  1YWP A;  1WIE A;  1SRM A;  5I11 A;  4ORZ A;  2VVK A;  2DBK A;  1UTI A;  4D8D A;  1K0X A;  2D0N A;  1KSW A;  1AZE A;  1W1F A;  2V1Q A;  1ZX6 A;  2I0N A;  2KBT A;  2ENM A;  2QDL A;  2F2V A;  1QWF A;  1MV0 B;  3VRY A;  2O88 A;  1NEG A;  2CRE A;  2JS2 A;  2BZX A;  1GCQ C;  1PHT A;  5GJV B;  1S1N A;  2K7A A;  1JXO A;  3UA7 A;  3TSZ A;  1W70 A;  4OMP A;  1RLQ C;  1QKX A;  4OMM A;  5FWC A;  1JEG A;  2FG0 A;  2O9S A;  2EW3 A;  2RQW A;  1YWO A;  2RQT A;  5IHI A;  1JU5 C;  5FWB A;  2MCN A;  3VS6 A;  2FPF A;  2MIO A;  1UE9 A;  4RUG A;  1H92 A;  4AG2 C;  1H3H A;  3LH5 A;  2EGC A;  2X3W D;  1QCF A;  4JZ3 A;  3EG3 A;  2NUZ A;  2JS0 A;  4D8K A;  2FRY A;  1OPL A;  2K6D A;  2C0O A;  2DM1 A;  2GNC A;  3I35 A;  2CH4 W;  2L3P A;  2DL3 A;  1GBQ A;  3IQL A;  4RTU A;  2EVR A;  3EG0 A;  1TUC A;  2JM9 A;  1AWX A;  2JTE A;  2KRO A;  1X2K A;  3H0H A;  4RTY A;  2A36 A;  1KIK A;  2HEQ A;  1X69 A;  2K3B A;  3PE0 A;  2L2P A;  1M3C A;  1OEB A;  1M30 A;  1OV3 A;  3H0F A;  4HVW A;  1BB9 A;  3RBB B;  2VKN A;  4F14 A;  3M0P A;  1PRL C;  2J05 A;  4AFZ C;  1GRI A;  1ZUK A;  4CC4 B;  1Z9Z A;  2CUD A;  2P4R A;  2A08 A;  2FPE A;  2CSI A;  2V1R A;  5GJW B;  2L3Q A;  2RF0 A;  4AFS C;  2NWM A;  3I5S A;  2EYW A;  2KNB B;  3SHW A;  1YNZ A;  2C0T A;  3VS3 A;  1NLO C;  2GQI A;  5IXB A;  1AWO A;  1AWJ A;  2LQW A;  2DVJ A;  1U06 A;  1WI7 A;  1B3Q A;  2ABL A;  4HVU A;  1HSQ A;  2FPD A;  4J9E A;  4EIK A;  1GCP A;  4J9B A;  1M3B A;  1YCS B;  2DBM A;  5L23 A;  2GBQ A;  1PWT A;  2CUB A;  3RNJ A;  1VYU A;  2W10 A;  2KT8 A;  4LNP A;  4AFQ C;  2XMF A;  4M4Z A;  2D8J A;  2H8H A;  2M0Y A;  1N5Z A;  2A28 A;  2DA9 A;  2AZV A;  1WXB A;  1T0H A;  4A63 B;  3GBQ A;  4LE9 A;  1TG0 A;  2J6O A;  2LNH B;  1K0S A;  2D1X A;  3NGP A;  2ECZ A;  1ZSG A;  2LX7 A;  1RI9 A;  2CH4 A;  1ZUY A;  2YDL A;  2ESW A;  1X6B A; 
#chains in the Genus database with same CATH topology
 3SD4 A;  5CR2 A;  4OB1 B;  3EHR A;  2YRD A;  4J9G A;  3ASK A;  4XTX A;  1MGQ A;  2ZZD A;  1U3O A;  2LNV A;  4EPC A;  3MJX A;  1YHQ A;  1AD5 A;  2E5Q A;  1WFW A;  2DTO A;  5GMK l;  3CBM A;  3KBG A;  3O5Z A;  4RKU E;  1VQO Q;  1QVF A;  3QDR B;  4Y28 E;  3CCE T;  4RTV A;  4VUB A;  2DXU A;  2RHX A;  4QVZ A;  1NJI U;  1CKA A;  1MMD A;  2X51 A;  3P8B B;  3M5A A;  1ZBX A;  1QW1 A;  3G6E T;  2F5T X;  4F17 A;  4E7I A;  1NM7 A;  1M1K C;  1PSE A;  2QA4 Q;  1K73 R;  1KQS S;  5FRN A;  3TRE A;  2DLP A;  2D9T A;  2P4T A;  2RJE A;  2QAS A;  2KI7 A;  4FIB A;  2A37 A;  2GFA A;  2DMO A;  4M7A A;  2E6N A;  2RHI A;  1FMK A;  2YT6 A;  3CC4 Q;  1B34 B;  1AVZ C;  2MYS A;  2NUP A;  3C95 A;  1M3A A;  1OYX A;  4PNO A;  4C5G A;  1JBM A;  2EKH A;  3VS7 A;  2HDA A;  4F04 B;  4OF1 A;  4MZT A;  3CME T;  1R0C B;  3QG1 A;  1I1J A;  1EX4 A;  1WHG A;  2DJQ A;  2M1H A;  1M1K U;  2YXY A;  2DNU A;  5LJ3 e;  1X43 A;  1YI2 T;  5GMK i;  4GLM A;  5I22 A;  2HBW A;  4EDU A;  4RTZ A;  3OMC A;  4RG2 A;  3SB2 A;  3CCM Q;  1QVF S;  1MNE A;  2OTL T;  4PJM A;  2V26 A;  1WGS A;  4J9D A;  1WA7 A;  2SEM A;  3MP6 A;  4BY6 C;  2EQU A;  2AT1 B;  2LQN A;  3VRZ A;  3P8H A;  1UGQ B;  1ZLM A;  2PVG B;  1E6G A;  2EBP A;  2KYB A;  4M77 F;  3VS1 A;  4JJB A;  4OML A;  1W2B P;  3G1J A;  3QKJ A;  5CCA A;  2JMA A;  2YLB A;  4GLK A;  2DXT A;  1VQM T;  2F2X A;  2MOX A;  4K11 A;  3A8L B;  4ZGD B;  4RCB A;  1YJ9 T;  2HNI A;  1PG5 B;  3GNG A;  4DOW A;  1UHC A;  4AT1 B;  2KMT A;  3HFO A;  2LZ6 B;  3JB9 J;  1D09 B;  2DIG A;  4BD3 A;  3AHU A;  1G5V A;  1QVG S;  2P0K A;  1UG1 A;  2ZPB B;  2WSE E;  3GF5 A;  1YIT A;  3C0C A;  3CCE Q;  3A98 A;  1C1A A;  5GAM g;  3E1S A;  4PFZ A;  1NBE B;  1YCY A;  4LUD A;  2BZY A;  1SEM A;  1IHV A;  1I0C A;  1BI2 A;  1SPK A;  1ABO A;  3M0Q A;  3UA6 A;  1E7O A;  5GAO p;  2OI3 A;  1VQL Q;  2LJ0 A;  4L6V 5;  3JCM b;  2QEX A;  2E3I A;  1RL2 A;  2LTO A;  1XOV A;  5GAN 7;  4KRT A;  2GQV A;  3NHN A;  2Y4X A;  4CC7 A;  3CBP A;  5HY6 A;  4AG1 C;  2J6K A;  3DB3 A;  3CXC A;  4XTU A;  2OTJ A;  2LCL A;  2RK1 A;  3C94 A;  3L2R A;  3X24 B;  4XQ3 A;  1UUE A;  3M58 A;  4NL3 A;  5CQX A;  3J80 E;  1BIA A;  2JVV A;  2G6F X;  4IUQ A;  5CKD A;  3NMZ C;  1VUB A;  1PD1 A;  4FT4 A;  1XQH A;  1Q95 G;  2DIQ A;  1PC0 A;  1K9A A;  3UF4 A;  1I8F A;  2K2M A;  3QBY A;  4MZP A;  3S6W A;  3EG9 B;  3OYE A;  1OU9 A;  2ZCF B;  2CKK A;  2E5K A;  5D7U A;  2COZ A;  2OAU A;  4FSX A;  3GPL A;  1VQ5 T;  1AEY A;  3S3M A;  4HT9 A;  1D0Z A;  2W0Z A;  3EG9 A;  2DL4 A;  3OS1 A;  3M54 A;  1LCK A;  1W6X A;  4ZTJ A;  3JCM g;  3DKM A;  2LT1 A;  3AT1 B;  3SWN B;  2OTL Q;  3EFO B;  4BDZ A;  4PJL A;  5GAN 6;  3PT9 A;  1QMC A;  3T9N A;  4C92 F;  3SWN A;  2KXC A;  3EFO A;  1JJ2 P;  2IG0 A;  1VQN T;  2K2V A;  3H6Z A;  2QAZ A;  2JUF A;  3HHT B;  3U23 A;  5D6X A;  2CZ7 B;  3EH2 A;  4EMK A;  4JS5 A;  1WXU A;  1Q7Y R;  1VQO A;  2BIV A;  2FZK B;  1J3T A;  3A5Z B;  1JB0 E;  4C5E A;  5I11 A;  3CXC S;  3JRZ A;  1TSF A;  2XD0 A;  4BI3 A;  2XU8 A;  4M77 C;  5GAN 3;  1M8V A;  4LDV A;  4DQ2 A;  2V1Q A;  3RMQ A;  2I0N A;  1MMG A;  3VKI A;  4CI0 C;  3L2Z A;  3CCV T;  3LX7 A;  1V29 B;  2BZX A;  2DZC A;  2VGM A;  8AT1 B;  5GAO m;  3MEU A;  5CKF A;  5GJV B;  3M55 A;  1YFN A;  1W70 A;  4OB3 B;  1QCN A;  1JEG A;  4M77 D;  5C0M A;  3CCR A;  1YWO A;  2RQT A;  2XDP A;  1JU5 C;  2FPF A;  3OB9 A;  1VQ7 A;  2XK0 A;  3LH5 A;  2X3W D;  4E7H A;  2NUZ A;  2JS0 A;  1IRX A;  2GNC A;  3I35 A;  2CH4 W;  3GOX A;  3JAM E;  4M77 E;  4JLG A;  2JM9 A;  3UDC A;  2HBP A;  5CVI A;  1KHI A;  1X69 A;  4HVW A;  4Y91 A;  4M78 A;  3FB9 A;  1BB9 A;  4ELY C;  3M0P A;  1PRL C;  1RAI B;  2K3Y A;  2EQJ A;  5GAN e;  5AT1 B;  1NE8 A;  2P4R A;  2FPE A;  3CCM A;  1VQ9 A;  2NWM A;  3SHW A;  1LJO A;  3M4Y A;  3G71 T;  1BI0 A;  4F7U F;  2GQI A;  2NUT A;  1AWO A;  3J81 E;  4AMC A;  5CK9 A;  2DVJ A;  3A8H B;  1VQ5 Q;  3E2U A;  4QQG A;  1HSQ A;  4PJO D;  3CMA T;  2CUB A;  1N6A A;  1KD1 R;  4ME7 A;  2QDY B;  1XTD A;  3G4S A;  2KT8 A;  1ZSZ B;  5KYY B;  4M7A F;  4LNP A;  2RK2 A;  3JSC A;  1F1B B;  2D8J A;  2L8D A;  2EQM A;  4HT8 A;  1VQP Q;  5FU6 C;  3OYM A;  2HL5 C;  4DBQ A;  1ZSZ A;  2DA9 A;  3NTH A;  5KYY A;  5I2M A;  1VQN Q;  4PJO E;  5LJ5 f;  2WAC A;  3GBQ A;  4LE9 A;  4E7L A;  4WTO B;  2J6O A;  4BUG A;  1RAD B;  1OU8 A;  2D1X A;  3NGP A;  2CGH A;  4DBF A;  2B8A A;  4J9F A;  4C92 C;  4IUR A;  4PJO B;  1VYV A;  2HCK A;  4M7D F;  2V8K A;  2YRV A;  3OA6 A;  1JQQ A;  3WVE B;  4JJC A;  1K73 C;  1K8A R;  1PKS A;  1VQL A;  4KGV B;  3CCV Q;  1UJ0 A;  1JO8 A;  4FYV B;  2FEI A;  2B86 A;  3CPF A;  3CCL A;  5KYN A;  3SEM A;  3BFM A;  3VS4 A;  2J6F A;  3JB9 H;  3A8G B;  4M77 G;  1IGU A;  1GFC A;  2XI9 A;  3ZL7 C;  4C0Z A;  3JB9 F;  3UAT A;  1QKW A;  2DD4 A;  3TSW A;  2ZPF B;  4OMF B;  3QXE B;  2EYY A;  4OMN A;  2CP3 A;  1QP2 A;  4FSS A;  2K5F A;  3L42 A;  2FYK A;  4L5G A;  4ZGE B;  2PTK A;  1VQ4 A;  3VYH B;  1CKB A;  1H8K A;  4JRI A;  1KQS P;  3KUF A;  4O6J A;  2QGG A;  2HAX A;  1YIJ T;  2V8I A;  2C0I A;  1VQ6 Q;  1K73 U;  2EGE A;  4XTZ A;  3V7S A;  1VA7 A;  4YTL A;  2DKG A;  2CT3 A;  4C8Q D;  2K79 A;  5LJ3 d;  4ATO A;  2XDD A;  4MMK A;  3ZFJ A;  4LDX A;  4J9I A;  5GAO r;  2ED1 A;  3PFS A;  5GAN 4;  3OYC A;  2KYM A;  4EMH A;  1RLP C;  2GGR A;  5A0G A;  1D1A A;  1EIF A;  1NLP C;  3X20 B;  3LGL A;  2G3R A;  2CZ0 B;  3CC2 T;  3NFC A;  3CD6 A;  4J83 A;  3G71 Q;  1S72 A;  4C8Q E;  3QZ5 B;  1YJW T;  1VQ7 T;  2FRW A;  3DLL A;  1TS9 A;  2V8J A;  4OGC A;  3TVT A;  1Q82 R;  4RCC A;  1GCQ A;  3JCM V;  1NPP A;  3OW2 A;  1VQ8 T;  3MEA A;  2X4X A;  3VUB A;  1KQ1 A;  4PJO G;  4M75 F;  2BTT A;  1UGR B;  2HQX A;  1PSF A;  3CMA Q;  2M9U A;  2RNA A;  4C8Q B;  3JB9 I;  2E65 A;  2PUK B;  1WXT A;  5KE3 A;  2KRM A;  5A2Q E;  1QVF P;  2QK0 A;  3TCJ A;  2FO0 A;  2LCC A;  1TXQ A;  2P84 A;  2KRS A;  3H9N A;  4PK4 A;  1UGV A;  2DE0 X;  3CCS A;  3JCM d;  2RN8 A;  3M57 A;  4C0F A;  1UGP B;  1NYG A;  2X9H A;  5LJ3 h;  4M7A C;  4XU3 A;  2CP0 A;  1UEC A;  2QI2 A;  2LCS A;  1HYO A;  2RHU A;  2HMA A;  1M9S A;  2ZPE B;  1VIF A;  2KSS A;  4OMO A;  5A0D A;  1QVG P;  3OYF A;  4IUV A;  2AKK A;  2HKQ B;  2KRN A;  4F7U E;  3MCA B;  1DJ7 B;  1X6G A;  3ULR B;  3CCJ T;  4O5V A;  4A53 A;  4M7D C;  2JT4 A;  3JCM J;  1U1T A;  2OX7 A;  3INZ A;  1VQK A;  2X3X D;  2PVD B;  2QTX A;  4BI8 B;  2WSC E;  4WF2 A;  1IGQ A;  3HL8 A;  3OW2 S;  1GL5 A;  1D0Y A;  4GY5 A;  2JOY A;  2SRC A;  2YUP A;  4RG8 A;  3I55 A;  3I9Q A;  1M90 R;  5IAY A;  2R5M A;  2RMO A;  4C0G A;  1RAC B;  1SF9 A;  3P8D A;  1BI3 A;  1YIJ Q;  4B9W A;  4J9C A;  2PU9 B;  4C8Q G;  4M7D D;  3JCM h;  2EYQ A;  2F5K A;  2HSE B;  1I5O B;  2LP5 A;  3CCU A;  2FZG B;  2RQU A;  2OAW A;  5FU7 C;  4KUL A;  3PVQ A;  1PNJ A;  2JW4 A;  2EYZ A;  2M0O A;  3S3N A;  1B34 A;  3PVL A;  4A54 A;  2DET A;  5GAM e;  5HKC A;  1I5L A;  4OB0 B;  2NLU A;  1ZA2 B;  1TU0 B;  4M7D E;  2KR3 A;  1RAH B;  1SSF A;  3CC2 Q;  4UC4 A;  1PD0 A;  2RQV A;  1YJW Q;  4FW1 A;  4X1V A;  4II1 A;  2XKO C;  1Y0M A;  2DX1 A;  1VQ8 Q;  3URG A;  2JXB A;  1QVP A;  1AOJ A;  5J26 A;  4QQ6 A;  5D6Y A;  1BKB A;  3M0R A;  1Q7Y C;  1H3Z A;  4HKE A;  1ZBJ A;  2F1L A;  3H0I A;  1FYN A;  4HCK A;  2P0Q A;  1YJN A;  4JLI A;  1PKT A;  4BB7 A;  4KGX B;  2DK3 A;  5CKE A;  4JDS A;  6AT1 B;  3CCQ A;  3EHQ A;  1IB8 A;  4J6Y A;  1UB4 A;  2LDM A;  4E6R A;  2LQ8 A;  4M75 C;  4M78 F;  1YP5 A;  3RKY A;  2DYI A;  3I56 A;  2I2L A;  5EC7 A;  4DEY A;  3DB4 A;  3OYD A;  1BCM A;  4F7U G;  4ANJ A;  1ZHI A;  1K1Z A;  4BDY A;  3CC7 T;  2QXF A;  4IIO A;  1QQJ A;  1YWP A;  1SRM A;  2L89 A;  4A4K A;  1Q7Y U;  2VXF A;  3GIB A;  4ORZ A;  2JNG A;  1BYM A;  4E7J A;  2DBK A;  1UTI A;  1Y96 B;  3JCM e;  1AZE A;  1ZX6 A;  2KBT A;  2QDL A;  2A0F B;  2FVU A;  2RA2 A;  1X6O A;  2RI5 A;  3OYY A;  4QVC A;  3CCJ Q;  2K7A A;  1JXO A;  2CZ1 B;  1Y07 A;  2JN0 A;  3HPW A;  4M75 E;  4OMP A;  1RLQ C;  1G3Y A;  1QKX A;  3G6E Q;  4OMM A;  3OYK A;  3QYG B;  2O9S A;  4N0A C;  2MCN A;  4BY6 B;  2MIO A;  5GAN d;  1H92 A;  2EGC A;  5CAI A;  3EG3 A;  4M7D G;  2C0O A;  2EAY A;  2CP7 A;  5HK3 A;  2DL3 A;  2K3X A;  3OYG A;  4ZN1 A;  1W2B A;  2DTI A;  3EG0 A;  1M2V B;  2DZ9 A;  3QII A;  1YHQ T;  3SWN C;  1AWX A;  3H0H A;  2A36 A;  1KIK A;  3MEV A;  2E10 A;  1M2V A;  2L2P A;  2X4J A;  1M3C A;  1OV3 A;  5L8R E;  1KD1 C;  1Q81 R;  5LJ3 f;  4F14 A;  1TUG B;  2E4H A;  4EMK C;  3CME Q;  5LJ3 j;  1Z9Z A;  3MP1 A;  2CUD A;  1IRE B;  2V1R A;  5GJW B;  2L3Q A;  2RF0 A;  1XNI A;  3ME9 A;  2EYW A;  1V76 A;  2C0T A;  3BY7 A;  4KH0 B;  4J7F A;  3VS3 A;  1NLO C;  1YI2 Q;  3VU3 C;  2LQW A;  4FT2 A;  4P5N A;  1WI7 A;  1N9R A;  3V8L A;  2ABL A;  2YLC A;  4J9E A;  4J9B A;  3OYN A;  5L23 A;  2GBQ A;  3D7S B;  1Q86 R;  2DAQ A;  3CEY A;  1K8A C;  5C6S A;  4OGE A;  2W10 A;  5GAN h;  1KD1 U;  5DY9 A;  2RB6 A;  4M4Z A;  2M0Y A;  3MET A;  2PQW A;  4MDX A;  3V7R A;  1VQM Q;  2HQE A;  1N9S A;  1YJ9 Q;  1K0S A;  2QQS A;  1SG5 A;  3CC7 Q;  2RD1 A;  1ZUY A;  2ESW A;  3OBW A;  4M75 G;  2O31 A;  4ZNX A;  3NTK A;  2KE9 A;  4CRI A;  1YN8 A;  4M78 C;  3OYL A;  1OI1 A;  3A8M B;  2XHC A;  1U8R A;  1M1F A;  4FYX B;  3L2Q A;  2QA4 A;  3BDU A;  4RMO A;  4Y92 A;  3C12 A;  4WCI A;  1K8A U;  1AWW A;  4N4H A;  1WHK A;  1HXD A;  4PLL A;  2EQI A;  3FLG A;  1G3W A;  4JJN K;  1QCO A;  3CC4 A;  1EZZ B;  2EGA A;  5KYU B;  1BU1 A;  1MHN A;  3M56 A;  3QUI A;  1NG2 A;  1V1C A;  4RTT A;  1PM3 A;  5KYU A;  2HSP A;  1KHC A;  3QO3 A;  2DL8 A;  3REA B;  4F16 A;  5KCH A;  1JJ2 A;  1Q82 C;  2X4W A;  4Z89 A;  3V8K A;  3OYB A;  4PL6 A;  2DO3 A;  1YHQ Q;  2JMC A;  5FLX E;  3RUX A;  1WHH A;  3CBO A;  4PKC C;  1RAE B;  2CT4 A;  3KFV A;  1YIT T;  4KH1 B;  2D8H A;  3EG1 A;  4M77 B;  1MMA A;  3LWI A;  1UHF A;  5GMK m;  3UWN A;  1KJW A;  3OYJ A;  2VC8 A;  4M77 A;  1E6H A;  1KC8 R;  1TWB A;  1VOM A;  2XID A;  2X4Y A;  3HSB A;  2LJ3 A;  2QEX T;  4Z02 A;  3HRU A;  2DIL A;  2ATC B;  2ZGW A;  1B7T A;  2RI2 A;  2ROT A;  1UFF A;  1Q82 U;  5GAN 2;  2K9G A;  2OTJ T;  2COY A;  1UGS B;  1WQ7 A;  4HCB A;  1WHJ A;  2J7I A;  2KXD A;  4IUT A;  5ECA A;  3KXT A;  2ZAE A;  2EFI A;  3EGD B;  1TOV A;  5LJ5 g;  3MO8 A;  1WZO A;  2JZ2 A;  2VUB A;  2HD0 A;  2X35 A;  4LXC A;  4C0D C;  4JUV A;  3OYA A;  3FJ5 A;  1X75 C;  3EGD A;  1SHF A;  4LN2 A;  5IXF A;  3QJY A;  2EYX A;  1TH7 A;  1QLY A;  2MAM A;  3CCE A;  1IO6 A;  1AZG B;  1JJ2 S;  2QYZ A;  4HXJ A;  1HD3 A;  1GBR A;  2YUO A;  1ZUU A;  3OS5 A;  2OJ2 A;  4PJO A;  2D0Q B;  1ACM B;  1M90 C;  3BE3 A;  2KY9 A;  4HCZ A;  5FW9 A;  1X27 A;  3EFS A;  3VS2 A;  2E70 A;  1WQW A;  3OMG A;  3FDR A;  1WJQ A;  3THK A;  1BK2 A;  1WPY A;  2E64 A;  3PNW C;  2RJC A;  4A4F A;  3R6N A;  2BUD A;  4C92 D;  3PTA A;  2F2W A;  3E9F A;  5A0L A;  2WSF E;  4XU1 A;  1JRI A;  4J6X A;  1C0M A;  1VQO T;  7AT1 B;  3QHS A;  5GAM d;  3L2W A;  1JXM A;  4X9D A;  2XDB A;  4FW2 A;  5FU6 B;  1M8M A;  2H3E B;  4OB2 B;  2QG9 B;  2Y4Y A;  2KVQ G;  4C92 E;  1CSK A;  3CME A;  5GAN f;  1WDX A;  4KT0 E;  3HKS A;  3LLR A;  4KBM B;  4LD6 A;  5GAN j;  1M90 U;  2L5Q A;  3L2U A;  3M0T A;  2JM8 A;  2PZ1 A;  2VXE A;  4JZ4 A;  1B07 A;  3TEE A;  3UPU A;  4LDW A;  4PLI A;  3O8V A;  4C92 B;  1YIT Q;  1G2B A;  2AHJ B;  1MV3 A;  5IHK A;  4XAX B;  5IT9 E;  3EG2 A;  2BE9 B;  2L3S A;  2DF6 A;  2PUO B;  3CCR T;  2O4X B;  2OTL A;  1WLP B;  4R0K A;  2AZS A;  2EPD A;  4QT7 A;  3MP8 A;  4RTW A;  2QEX Q;  3TQ7 P;  1IXD A;  4BAC A;  5D6W A;  1K4U S;  1OPK A;  1U5S A;  2DRK A;  4TVR A;  5CIU A;  2AK5 A;  2COW A;  2RPN A;  4MZM A;  4DA4 A;  1AT1 B;  2KT1 A;  1VQM A;  1FX7 A;  3VS5 A;  2A3L A;  4HA8 A;  1BCO A;  3CPW A;  4C8Q A;  4A4E A;  3R6O A;  4LUE A;  3M59 A;  1Z9Q A;  1SHG A;  4ZTF A;  1NEB A;  5GAO l;  5GAM h;  2VYT A;  4CC2 A;  4Q5W A;  2ROL A;  2K5L A;  4PJJ A;  1UDL A;  2DVE A;  5FRM A;  1VIE A;  4Z8A A;  3CCM T;  1VQ9 T;  5KH6 A;  4AFU C;  4DEX A;  4OMQ A;  1OOT A;  1OQK A;  2VAS A;  4GBQ A;  4J6W A;  1W4S A;  2PNI A;  5DLQ E;  9ATC B;  5AYF A;  4CC3 A;  4FCY A;  3HP9 A;  2MWO A;  4B9X A;  3Q1J A;  5J3B A;  2VVK A;  2YHT A;  3MPU B;  2KQW A;  1K0X A;  1KSW A;  4XK8 E;  1W1F A;  3G4S T;  2F2V A;  4C92 G;  2DD5 A;  2JS2 A;  4M7A D;  1WHL A;  2DEU A;  1PHT A;  1IHW A;  1R8O B;  3BDL A;  4IKF A;  1Q81 C;  2KDS A;  2GF7 A;  1KK7 A;  4F7U B;  5FWC A;  3VJP A;  3N5B B;  4N4G A;  1D1B A;  2RQW A;  5IHI A;  5FWB A;  3A8O B;  2CP6 A;  4EMG A;  4F7U A;  4M7A E;  1H3H A;  2DFU A;  4JZ3 A;  4BE0 A;  3CPW S;  4HCC A;  2FRY A;  1OPL A;  3G7Z A;  2K6D A;  2DM1 A;  1OZ2 A;  3OS0 A;  1VQL T;  3PMT A;  5CO7 A;  1RAF B;  2EVR A;  4E7Z A;  1G3T A;  1TUC A;  3RES A;  2JTE A;  3CCL T;  4M7A B;  1VQ5 A;  4RTY A;  2DPP B;  2K3B A;  2VGN A;  4XU0 A;  3H0F A;  1WNL A;  1M30 A;  1Q86 C;  2MF2 A;  2NUP B;  2HQH A;  2VKN A;  5KYW B;  3CCR Q;  3JB9 D;  2RHZ A;  4AFZ C;  1Q81 U;  1VQ7 Q;  5KYW A;  3M9Q A;  4BI4 A;  1VQ4 T;  1QVG A;  1VQP A;  1K9M R;  1YNZ A;  5DM7 R;  1OUL A;  1VQN A;  2D6F A;  4M7D B;  5IXB A;  2RJF A;  2ZPI B;  4NS5 A;  2FL7 A;  3RDV A;  1U06 A;  4M7D A;  1M4Z A;  5KYX B;  1B3Q A;  2QQR A;  3HRT A;  1MND A;  2FPD A;  2HKN A;  3GNF B;  2R57 A;  1YCS B;  2QQ9 A;  4J7I A;  5KYX A;  4KUD K;  1TTH B;  3RKW A;  1AHJ B;  1Q86 U;  1FMW A;  3CCV A;  4AFQ C;  2XMF A;  1VQ9 Q;  2H8H A;  1N8R R;  2EQK A;  3VV0 A;  3QZ9 B;  3CD6 T;  2A28 A;  1S72 T;  5FU7 B;  1OX9 A;  3S3O A;  4A63 B;  2M16 A;  4OP0 A;  4FU6 A;  5LJ5 d;  2ECZ A;  3CXC P;  3UT1 A;  3PIO A;  3QPH A;  5IN1 A;  3V7C A;  4X34 A;  1H64 1;  1FWZ A;  4M75 D;  2KGT A;  3QWY A;  1NYF A;  4NL2 A;  2E41 A;  4Z88 A;  2E12 A;  1Y96 A;  3E19 A;  2CP2 A;  4M7A G;  3G4S Q;  1I07 A;  1LPL A;  3EGX B;  2LX9 A;  4E7S A;  3CCS T;  1VQ6 A;  3M0S A;  2ED0 A;  4J5Y A;  5GAO q;  3HRS A;  4IIM A;  1RAG B;  1O9S A;  4KUI A;  3EGX A;  3PGG A;  1NJI R;  5CKB A;  1UJY A;  1M2O A;  3F70 A;  4J8O A;  2JTF A;  2MMP A;  4C5H A;  3RIR A;  2R58 A;  8ATC B;  1SSH A;  1KC8 C;  2O01 E;  5HCK A;  2VB6 A;  1WYX A;  4M75 B;  5IH2 A;  2IIM A;  1WX6 A;  3I5R A;  5GAM f;  3GP8 A;  1ZA1 B;  1ARK A;  5DLO A;  2DRM A;  3G71 A;  1X2Q A;  2DEQ A;  4M75 A;  3GLX A;  1K76 A;  5IHN A;  5GAM j;  2LRQ A;  4A4G A;  2DL7 A;  1WJS A;  3FIF A;  2DL5 A;  5LJ3 g;  3LWH A;  3CCL Q;  1Y7X A;  1KG1 A;  3ZBD A;  4PJO F;  1Y57 A;  4HVV A;  4IUU A;  5LJ5 h;  3FC3 A;  2O2O A;  1KFZ A;  1U1S A;  1G83 A;  3CMA A;  4JRP A;  2CSQ A;  2ZPG B;  3JB9 G;  1UEB A;  4PFO A;  2FHD A;  2P0P A;  1QP3 A;  1VQK T;  2H3J A;  4QQD A;  2VV5 A;  4XTY A;  2YUQ A;  2MPX C;  1VQ4 Q;  1NZ9 A;  3I55 T;  2BE7 D;  1HJD A;  1KC8 U;  1M1K R;  2LMJ A;  3OBY A;  3EFR A;  4LD9 K;  5KE2 A;  1FXX A;  2F69 A;  5GAN 5;  3M4G A;  2M51 A;  4ZGJ B;  1D1C A;  3EGU A;  1XJW B;  3CCU T;  4JS4 A;  2O9V A;  1BBZ A;  2QGF B;  4N0A A;  1SRL A;  4QKU A;  1TUD A;  1IZ6 A;  1T3L A;  3CQT A;  1BIB A;  2EKO A;  3H41 A;  4IUP A;  2KEA A;  3QDF A;  3OQ5 A;  2CDT A;  1LVK A;  4XTV A;  3JCM f;  3CD6 Q;  1S72 Q;  3OY9 A;  4PFP A;  3V8J A;  3LGF A;  4R56 A;  2LJ1 A;  3X25 B;  1VQP T;  4BE2 A;  1W2B S;  3VS0 A;  1PCX A;  2QQA A;  3LYI A;  4EMK B;  1P92 A;  5J39 A;  2HZY A;  2RHY A;  1G8X A;  5KCO A;  2AKL A;  3ZEH A;  3JCM X;  4RTX A;  1YJN T;  5GMK h;  4JPB W;  1BI1 A;  2GTJ A;  1PRM C;  2YUN A;  2R5A A;  1T3S A;  2GTO A;  4A4H A;  2ZPH B;  2AIR B;  3SDZ A;  1RAA B;  3CCQ T;  5LJ5 e;  1YIJ A;  1D0X A;  3CCS Q;  3EAE A;  4C8Q F;  2RJD A;  3I56 T;  3NTI A;  4M78 D;  4X9C A;  2XG8 D;  1VYT A;  3JCM Q;  1A0N B;  1WJR A;  4FYY B;  4J9H A;  4B6M A;  1OZ3 A;  1R0B G;  3X26 B;  3JCM W;  3OSS C;  3RMS A;  3TU4 K;  2J06 A;  3CC2 A;  4M78 E;  1YJW A;  2RO0 A;  2K4Y A;  2YSQ A;  1MUZ A;  1QWE A;  3QSU A;  2L0A A;  1VQ8 A;  1ZSZ C;  4DBR A;  3WXM B;  3RR6 A;  2RI3 A;  3OYH A;  5LL6 S;  4FM4 B;  3L2V A;  1VQ6 T;  4M78 B;  4R55 A;  2KAF A;  3RKX A;  1EFN A;  1RUW A;  2VWF A;  2EJF A;  3SFM A;  1VQK Q;  1SKU B;  2DYB A;  5CKH A;  1T0J A;  4BE1 A;  1RAB B;  1M27 C;  1I4K 1;  1RI0 A;  2DTH A;  3MKD A;  2K5I A;  3C4S A;  3OSV A;  3I55 Q;  2KK4 A;  2QTV A;  4PJO C;  2CP5 A;  1M5Q 1;  1NPR A;  1KQ2 A;  3WVD B;  3OS2 A;  4PJN A;  4D6W A;  2NUT B;  5GAO n;  1ABQ A;  5GMK e;  3QYH B;  2RQR A;  3CCU Q;  4MML A;  2MWP A;  2YRC A;  2E1H A;  3EH1 A;  4ZN3 A;  3REB B;  1R77 A;  2RM4 A;  2BZ8 A;  3H8Z A;  2K57 A;  3E9G A;  2LC4 A;  5HK0 A;  3DLM A;  2LQK A;  4ESR A;  3HFN A;  2EIF A;  2LT4 A;  1O75 A;  3QJ6 A;  1OX8 A;  1GFD A;  3M0U A;  4JJD A;  3CCJ A;  2XIC A;  2GFU A;  3NPF A;  2JJ9 A;  4QVD A;  3QWX X;  3FEO A;  3G6E A;  4KGZ B;  1YJN Q;  5LJ5 j;  1MMN A;  2IPO B;  1WIE A;  2MI6 A;  2HL3 A;  4D8D A;  2D0N A;  2EWN A;  3MEW A;  3CCQ Q;  2EJ9 A;  3LH0 A;  2ENM A;  1QWF A;  3J7A F;  1MV0 B;  3VRY A;  3MHX A;  2O88 A;  1NEG A;  4M78 G;  2CRE A;  5GAN 8;  1LOJ A;  3I56 Q;  1GCQ C;  2CZ6 B;  3LW5 E;  1HK9 A;  3BW1 A;  1S1N A;  2FZC B;  3UA7 A;  3OW2 P;  2IVW A;  3TSZ A;  2M02 A;  1X01 A;  3M53 A;  2L3R A;  5GAN g;  2FG0 A;  4E2F B;  2EW3 A;  4L59 A;  4C0D B;  3FJP A;  3VS6 A;  1UE9 A;  3ER0 A;  4RUG A;  5EG2 A;  4C8Q C;  4AG2 C;  1K9M C;  3CPW P;  1C6V X;  1QCF A;  2C06 A;  3L1A A;  5I21 A;  4XTW A;  4D8K A;  2QA4 T;  2Z0W A;  2L3P A;  3A1P A;  1GBQ A;  3IQL A;  1YI2 A;  4RTU A;  3PIP A;  1WHM A;  2BKD N;  2Y90 A;  2KRO A;  2JTM A;  1X2K A;  2PVO B;  2CYZ B;  2E3H A;  2DXC A;  2HEQ A;  4C92 A;  4FL6 A;  3JCM P;  3PE0 A;  2YWW A;  1OEB A;  2A7Y A;  3VUZ A;  3CC4 T;  3HTR A;  2DER A;  3RBB B;  4V2S A;  1ZQ1 A;  2NYS A;  2J05 A;  1D3B B;  4JRK A;  1GRI A;  1ZUK A;  4CC4 B;  4MDW A;  2O4X A;  4C5I A;  5GMK j;  2A08 A;  1N8R C;  1FMV A;  2CSI A;  1N27 A;  1D3B A;  4N4I A;  4AFS C;  2LVM A;  4E47 A;  3I5S A;  2KNB B;  1Y71 A;  2E6Z A;  2EJG A;  5I2S A;  3JCM c;  2OTJ Q;  1K9M U;  4QW2 A;  1AWJ A;  1YJ9 A;  2GCX A;  1G3S A;  3CC7 A;  4HVU A;  4DBH A;  4LDU A;  4DOV A;  2DJZ A;  1YBY A;  3X28 B;  2MK5 A;  4EIK A;  1GCP A;  1M3B A;  3VYG A;  2DBM A;  1I81 A;  1PWT A;  4FYW B;  5M9O A;  3RER A;  5FRO A;  1KQS A;  2DXB A;  3RNJ A;  1M1G A;  1VYU A;  3PMI A;  4NOY A;  1LNX A;  3OYI A;  4ELZ C;  2CS7 A;  1N5Z A;  4JRQ A;  2AZV A;  1WXB A;  1T0H A;  1N8R U;  4LDY A;  4OVA A;  1NJI C;  1TG0 A;  2QQB A;  2RH2 A;  2LNH B;  3FRN A;  2FB7 A;  1ZSG A;  4XU2 A;  4E7K A;  1GXI E;  2LX7 A;  1RI9 A;  2CH4 A;  3JV3 A;  2YDL A;  5CQY A;  1X6B A; 
#chains in the Genus database with same CATH homology
 4J9F A;  2O31 A;  4ZNX A;  2KGT A;  3QWY A;  1VYV A;  2KE9 A;  1NYF A;  1YN8 A;  2HCK A;  3EHR A;  4J9G A;  4Z88 A;  1JQQ A;  4JJC A;  1U3O A;  1PKS A;  1I07 A;  1UJ0 A;  1JO8 A;  4Y92 A;  2FEI A;  4WCI A;  2B86 A;  1AWW A;  1AD5 A;  1WFW A;  3M0S A;  2ED0 A;  3SEM A;  4IIM A;  3O5Z A;  2EQI A;  2J6F A;  3VS4 A;  1GFC A;  3ZL7 C;  4RTV A;  1UJY A;  3UAT A;  2EGA A;  1BU1 A;  1QKW A;  3TSW A;  1CKA A;  1NG2 A;  1V1C A;  2EYY A;  4OMN A;  4RTT A;  1SSH A;  4FSS A;  5HCK A;  5IH2 A;  1WYX A;  2HSP A;  2PTK A;  2IIM A;  1WX6 A;  3I5R A;  4F17 A;  2DL8 A;  1NM7 A;  3REA B;  1ARK A;  4F16 A;  2DRM A;  1CKB A;  1H8K A;  1X2Q A;  1K76 A;  5IHN A;  4Z89 A;  2DLP A;  2DL7 A;  2DL5 A;  2JMC A;  2C0I A;  2A37 A;  2EGE A;  1VA7 A;  1Y57 A;  2DMO A;  4HVV A;  2CT3 A;  2CT4 A;  2K79 A;  2O2O A;  3KFV A;  1FMK A;  1KFZ A;  1G83 A;  2YT6 A;  2D8H A;  2CSQ A;  3EG1 A;  4J9I A;  1AVZ C;  2ED1 A;  1UHF A;  1M3A A;  2KYM A;  1KJW A;  1RLP C;  2GGR A;  1NLP C;  1E6H A;  2EKH A;  2YUQ A;  2LJ3 A;  3VS7 A;  2HDA A;  1HJD A;  2FRW A;  1I1J A;  3TVT A;  2LMJ A;  2DIL A;  2DJQ A;  1GCQ A;  2ROT A;  1UFF A;  2DNU A;  2M51 A;  3EGU A;  2BTT A;  1X43 A;  2K9G A;  2O9V A;  4GLM A;  1BBZ A;  2RNA A;  2J7I A;  5I22 A;  1WXT A;  1SRL A;  2HBW A;  2KXD A;  4RTZ A;  2KRM A;  5ECA A;  1TUD A;  1T3L A;  3CQT A;  2FO0 A;  3H41 A;  4J9D A;  1WA7 A;  2KRS A;  2SEM A;  1UGV A;  3FJ5 A;  2KEA A;  2LQN A;  3VRZ A;  2DE0 X;  1SHF A;  2CDT A;  4LN2 A;  5IXF A;  1ZLM A;  1E6G A;  2EBP A;  2KYB A;  2RN8 A;  3VS1 A;  2EYX A;  4JJB A;  4OML A;  2LJ1 A;  1QLY A;  3VS0 A;  1IO6 A;  2JMA A;  1AZG B;  1NYG A;  4HXJ A;  2AKL A;  2F2X A;  1HD3 A;  1GBR A;  2YUO A;  1ZUU A;  2MOX A;  4K11 A;  4RTX A;  1UEC A;  4JPB W;  2GTJ A;  1PRM C;  2OJ2 A;  2YUN A;  1T3S A;  2GTO A;  2LCS A;  5FW9 A;  3JV3 A;  1UHC A;  1X27 A;  3VS2 A;  2LZ6 B;  3THK A;  4OMO A;  1BK2 A;  1UG1 A;  3R6N A;  2AKK A;  2KRN A;  2F2W A;  1X6G A;  3ULR B;  1VYT A;  3C0C A;  1A0N B;  3A98 A;  2JT4 A;  4J9H A;  2X3X D;  4LUD A;  2BZY A;  1SEM A;  1I0C A;  1GL5 A;  1JXM A;  1ABO A;  1SPK A;  3M0Q A;  3UA6 A;  1E7O A;  2SRC A;  2OI3 A;  2YUP A;  1M8M A;  2LJ0 A;  2J06 A;  1CSK A;  3I9Q A;  1WDX A;  1XOV A;  2RMO A;  2YSQ A;  1MUZ A;  4KRT A;  1QWE A;  3NHN A;  4CC7 A;  2L0A A;  4J9C A;  3M0T A;  2JM8 A;  2PZ1 A;  4JZ4 A;  4AG1 C;  1B07 A;  2J6K A;  2LP5 A;  2RQU A;  2OAW A;  1G2B A;  3PVQ A;  1MV3 A;  5IHK A;  1PNJ A;  2JW4 A;  2EYZ A;  3EG2 A;  1UUE A;  1EFN A;  1RUW A;  2VWF A;  3PVL A;  2L3S A;  2DF6 A;  2DYB A;  2G6F X;  1T0J A;  1WLP B;  3NMZ C;  4R0K A;  2AZS A;  1M27 C;  2KR3 A;  2EPD A;  4QT7 A;  4RTW A;  1K4U S;  1OPK A;  2RQV A;  4X1V A;  1U5S A;  1K9A A;  2DRK A;  1Y0M A;  2AK5 A;  3UF4 A;  2K2M A;  2DX1 A;  2RPN A;  1ABQ A;  2JXB A;  1AOJ A;  2RQR A;  3M0R A;  2KT1 A;  2E5K A;  3VS5 A;  1AEY A;  1ZBJ A;  3H0I A;  1FYN A;  4HCK A;  2W0Z A;  2DL4 A;  1LCK A;  1W6X A;  1PKT A;  3REB B;  2BZ8 A;  4LUE A;  1Z9Q A;  1SHG A;  1NEB A;  4CC2 A;  2ROL A;  3EHQ A;  1UDL A;  4E6R A;  4ESR A;  4Z8A A;  2KXC A;  1YP5 A;  4AFU C;  1GFD A;  4DEX A;  3M0U A;  4OMQ A;  4JJD A;  1OOT A;  5EC7 A;  4GBQ A;  4DEY A;  3NPF A;  3U23 A;  3QWX X;  2PNI A;  1K1Z A;  1WXU A;  4CC3 A;  1J3T A;  4IIO A;  1YWP A;  1WIE A;  1SRM A;  5I11 A;  4ORZ A;  2VVK A;  2DBK A;  1UTI A;  4D8D A;  1K0X A;  2D0N A;  1KSW A;  1AZE A;  1W1F A;  2V1Q A;  1ZX6 A;  2I0N A;  2KBT A;  2ENM A;  2QDL A;  2F2V A;  1QWF A;  1MV0 B;  3VRY A;  2O88 A;  1NEG A;  2CRE A;  2JS2 A;  2BZX A;  1GCQ C;  1PHT A;  5GJV B;  1S1N A;  2K7A A;  1JXO A;  3UA7 A;  3TSZ A;  1W70 A;  4OMP A;  1RLQ C;  1QKX A;  4OMM A;  5FWC A;  1JEG A;  2FG0 A;  2O9S A;  2EW3 A;  2RQW A;  1YWO A;  2RQT A;  5IHI A;  1JU5 C;  5FWB A;  2MCN A;  3VS6 A;  2FPF A;  2MIO A;  1UE9 A;  4RUG A;  1H92 A;  4AG2 C;  1H3H A;  3LH5 A;  2EGC A;  2X3W D;  1QCF A;  4JZ3 A;  3EG3 A;  2NUZ A;  2JS0 A;  4D8K A;  2FRY A;  1OPL A;  2K6D A;  2C0O A;  2DM1 A;  2GNC A;  3I35 A;  2CH4 W;  2L3P A;  2DL3 A;  1GBQ A;  3IQL A;  4RTU A;  2EVR A;  3EG0 A;  1TUC A;  2JM9 A;  1AWX A;  2JTE A;  2KRO A;  1X2K A;  3H0H A;  4RTY A;  2A36 A;  1KIK A;  2HEQ A;  1X69 A;  2K3B A;  3PE0 A;  2L2P A;  1M3C A;  1OEB A;  1M30 A;  1OV3 A;  3H0F A;  4HVW A;  1BB9 A;  3RBB B;  2VKN A;  4F14 A;  3M0P A;  1PRL C;  2J05 A;  4AFZ C;  1GRI A;  1ZUK A;  4CC4 B;  1Z9Z A;  2CUD A;  2P4R A;  2A08 A;  2FPE A;  2CSI A;  2V1R A;  5GJW B;  2L3Q A;  2RF0 A;  4AFS C;  2NWM A;  3I5S A;  2EYW A;  2KNB B;  3SHW A;  1YNZ A;  2C0T A;  3VS3 A;  1NLO C;  2GQI A;  5IXB A;  1AWO A;  1AWJ A;  2LQW A;  2DVJ A;  1U06 A;  1WI7 A;  1B3Q A;  2ABL A;  4HVU A;  1HSQ A;  2FPD A;  4J9E A;  4EIK A;  1GCP A;  4J9B A;  1M3B A;  1YCS B;  2DBM A;  5L23 A;  2GBQ A;  1PWT A;  2CUB A;  3RNJ A;  1VYU A;  2W10 A;  2KT8 A;  4LNP A;  4AFQ C;  2XMF A;  4M4Z A;  2D8J A;  2H8H A;  2M0Y A;  1N5Z A;  2A28 A;  2DA9 A;  2AZV A;  1WXB A;  1T0H A;  4A63 B;  3GBQ A;  4LE9 A;  1TG0 A;  2J6O A;  2LNH B;  1K0S A;  2D1X A;  3NGP A;  2ECZ A;  1ZSG A;  2LX7 A;  1RI9 A;  2CH4 A;  1ZUY A;  2YDL A;  2ESW A;  1X6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...