1UDLA

The solution structure of the fifth sh3 domain of intersectin 2 (kiaa1256)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
98
structure length
98
Chain Sequence
GSSGSSGQKGWFPASHVKLLGPSSERATPAFHPVCQVIAMYDYAANNEDELSFSKGQLINVMNKDDPDWWQGEINGVTGLFPSNYVKMTTDSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the fifth SH3 domain of intersectin 2 (KIAA1256)
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords intersectin 2
total genus 6
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1udlA00
2EBPA 2OJ2A 3M0PA 4ZNXA 1RUWA 1E6GA 1JU5C 4R0KA 2XMFA 1PKSA 3VS4A 3THKA 1X2KA 1QKXA 2LMJA 1PKTA 2NWMA 2W10A 1ZX6A 2BZXA 3VS2A 1GCQA 1TUDA 3VS0A 1YP5A 1BB9A 3C0CA 1RI9A 3H0FA 2CSIA 3QWXX 2DBKA 2IIMA 5L23A 2KGTA 1J3TA 3TSWA 1MV0B 4D8KA 4A63B 1W70A 2GTOA 1W1FA 1JEGA 5IH2A 1E7OA 2M0YA 2JMAA 1UDLA 2K9GA 1B07A 1AVZC 2KR3A 2DL8A 1UGVA 3M0QA 2RQUA 2H8HA 4J9DA 4LUEA 1K1ZA 2EYWA 2O9VA 2K6DA 1G83A 2LNHB 4OMLA 4OMQA 1GFDA 1T0JA 2SRCA 3H0IA 3RNJA 2RQTA 2I0NA 2GBQA 4ORZA 1AOJA 2V1RA 4J9CA 1T3LA 2D8JA 2KXCA 1Z9ZA 3CQTA 1W6XA 3I35A 3GBQA 4Z89A 1NEBA 1SHGA 2EPDA 2L0AA 4J9FA 1FMKA 4RTWA 2L3SA 3RBBB 2RN8A 4J9IA 1AWJA 3REAB 2LCSA 2X3XD 4FSSA 3PVQA 2DMOA 4JJCA 2YUPA 2V1QA 2NUZA 4AFQC 1B3QA 1AZEA 3UF4A 1IO6A 1X6GA 2YUNA 2DJQA 3NMZC 2CREA 4D8DA 2A08A 1GRIA 2EQIA 4F14A 2KT8A 3U23A 2O88A 1ZLMA 2J6FA 3REBB 1AD5A 2LP5A 1WLPB 3FJ5A 2CT3A 2J05A 2X3WD 4KRTA 4X1VA 1UECA 2HBWA 2HSPA 1KFZA 4OMPA 4RTZA 1BBZA 2DF6A 2DYBA 2RQVA 1K9AA 1PWTA 5ECAA 1RLPC 1U5SA 3SEMA 4RTYA 1NEGA 1WXTA 2EGEA 2DL5A 3I9QA 2JTEA 1QCFA 2CT4A 2ED1A 3R6NA 1X43A 2KRNA 5I11A 1A0NB 1GBRA 1VYUA 2A36A 4RTVA 1GCPA 4J9EA 4F16A 2FPDA 2D0NA 5FWCA 1N5ZA 1SHFA 1U06A 1UHCA 2FEIA 2EYXA 1UFFA 4QT7A 3LH5A 3PVLA 5GJVB 1HJDA 4Z8AA 1ZUYA 4AG2C 2MIOA 3I5RA 4F17A 4M4ZA 1QKWA 5IXBA 3VS3A 4RTUA 4OMNA 1NM7A 2O2OA 4Y92A 2LQNA 1NLPC 3UATA 2O9SA 3ULRB 3M0TA 4JJDA 1YNZA 4E6RA 1ABQA 1V1CA 3VS7A 4J9BA 1KIKA 1AEYA 2YUQA 3IQLA 2EVRA 3EHRA 4DEYA 2PTKA 4EIKA 2C0IA 2D8HA 4HCKA 1QLYA 5I22A 2FRWA 2ED0A 2ROLA 4CC3A 2K7AA 1K0SA 2KROA 2CUBA 2BZ8A 1SEMA 5EC7A 2J06A 2KEAA 2YT6A 2JS2A 1YCSB 2F2XA 3PE0A 4JPBW 4JJBA 2HCKA 3H41A 1WYXA 5IHKA 2D1XA 1WFWA 2GNCA 2VWFA 4Z88A 2LJ3A 4J9GA 1CSKA 1BU1A 2KXDA 2RF0A 1JQQA 2JT4A 4IIMA 4ESRA 1M8MA 1ZBJA 1WI7A 1VYTA 2FO0A 2LQWA 2BTTA 1PRLC 3EG3A 1GFCA 2DL4A 3M0RA 5HCKA 1H92A 2GQIA 1SSHA 1KJWA 2PZ1A 1ZUKA 1ZSGA 1H3HA 2DL3A 1Y0MA 3VRZA 1M3CA 2LX7A 2DILA 4GLMA 3TSZA 1T0HA 2OAWA 3EG1A 2CH4W 4OMMA 5GJWB 2MCNA 4WCIA 1CKBA 1YWOA 4CC4B 1QWFA 2KYBA 4LN2A 2B86A 4CC2A 1M3BA 3VS6A 4DEXA 1MV3A 1VA7A 2G6FX 3NPFA 1UHFA 1EFNA 3UA7A 5IHNA 1BK2A 2ENMA 5FW9A 1GL5A 2KT1A 2RPNA 2DM1A 2DVJA 1OPKA 2W0ZA 2KE9A 5IXFA 1PHTA 1UG1A 2EYZA 1SPKA 1OEBA 4JZ3A 2VKNA 3A98A 1K0XA 1I1JA 2KRSA 1M30A 1ZUUA 2CDTA 2BZYA 1WIEA 3M0SA 2AKKA 1YWPA 2CSQA 3O5ZA 2EGCA 1X6BA 1GCQC 3JV3A 2KRMA 1NYFA 1JXOA 2L3QA 2LJ0A 2AKLA 3VS5A 4OMOA 1X69A 1HD3A 3EG0A 1AWWA 2LJ1A 1JXMA 3TVTA 2J6KA 3KFVA 1AWOA 2M51A 2JS0A 1NYGA 2F2VA 4LE9A 3SHWA 2C0OA 3EGUA 5FWBA 2JM9A 2DE0X 1UJYA 1WXUA 2YSQA 2DLPA 1K76A 2ABLA 2KYMA 3UA6A 1OOTA 2DRKA 2O31A 1WX6A 1PRMC 1LCKA 1UE9A 2ROTA 2QDLA 1VYVA 3VRYA 1X27A 4GBQA 1OPLA 2DL7A 1ARKA 2ESWA 2LZ6B 2F2WA 4JZ4A 4HVWA 4RTTA 2J6OA 2RQRA 3QWYA 1M27C 2DRMA 2DNUA 2L2PA 1RLQC 2HEQA 1E6HA 1JO8A 1Y57A 1TG0A 3NGPA 2ECZA 2AK5A 2AZVA 2K2MA 2MOXA 2OI3A 1G2BA 1AWXA 2YDLA 4AFSC 4AG1C 1OV3A 2FPFA 2AZSA 1UUEA 2A28A 1XOVA 2CUDA 1WXBA 2CH4A 4AFUC 1SRMA 2KBTA 2JM8A 1S1NA 1NG2A 4HXJA 4HVVA 1KSWA 2YUOA 2GGRA 2FG0A 2EKHA 2EGAA 4LNPA 2FRYA 4J9HA 1K4US 1I0CA 1ABOA 2J7IA 2PNIA 1UTIA 2JMCA 1SRLA 2FPEA 3EHQA 4K11A 2GTJA 1AZGB 2HDAA 4RUGA 1H8KA 3ZL7C 1HSQA 2JXBA 2L3PA 2P4RA 4RTXA 3I5SA 2JW4A 2RQWA 1M3AA 1I07A 2K3BA 3VS1A 2C0TA 1U3OA 2VVKA 4AFZC 2DBMA 2E5KA 4LUDA 2RNAA 1WA7A 1QWEA 2EW3A 1X2QA 1MUZA 5IHIA 1PNJA 1GBQA 1FYNA 4IIOA 2DA9A 1WDXA 1NLOC 1UJ0A 1Z9QA 1T3SA 1CKAA 3NHNA 1YN8A 3H0HA 4HVUA 2EYYA 2KNBB 3M0UA 2K79A 2SEMA 4CC7A 2RMOA 1TUCA 3EG2A 2DX1A 2A37A
chains in the Genus database with same CATH superfamily
2EBPA 2R57A 3M56A 1EX4A 4LD6A 3M0PA 3AT1B 4ANJA 1JU5C 4FM4B 3SWNB 1PKSA 3VS4A 3CCVT 3BFMA 1QKXA 1D1AA 2NWMA 1TWBA 3CCQT 2YLBA 1AT1B 5I2SA 1GCQA 3OYYA 3MP1A 3OYDA 4CRIA 1M2VB 2BUDA 1YP5A 4IKFA 4B9XA 2CSIA 2NUTB 2DBKA 2IIMA 3CCJA 3TSWA 4LXCA 2DVEA 2R58A 4B9WA 4EDUA 2M0YA 2MWOA 3SWNA 2LQKA 1UDLA 3CMAQ 3CPWS 4X9DA 3EFRA 3UWNA 1NPRA 4J9DA 3OW2A 1K1ZA 1WGSA 3PT9A 1GFDA 4OMQA 1QQJA 3S3NA 3H0IA 1BI3A 3M55A 2VXFA 2VGMA 1B34B 2V1RA 5AT1B 3CMEA 4OB0B 1T3LA 1Z9ZA 3CQTA 1Q86U 3I35A 4JRPA 5GAOq 1NEBA 2L0AA 4XTYA 2PU9B 3MCAB 2X4XA 1RADB 2L3SA 3A5ZB 4J9IA 1AWJA 2DZ9A 3REAB 4A54A 3CCSA 5GAN5 4E7HA 1N27A 1I81A 2DMOA 4OGCA 1WHLA 2E3IA 1IZ6A 1JB0E 4AFQC 1Y96B 1B3QA 4PKCC 1AZEA 3UF4A 2YUNA 7AT1B 2DJQA 4D8DA 1QMCA 3FEOA 1JRIA 1GRIA 3O8VA 4F14A 3E1SA 5GAOn 3RKXA 3A1PA 3KBGA 3REBB 4PJOA 5GANg 4KRTA 3A8MB 3RKWA 4X1VA 1KFZA 2DERA 4RTZA 2DF6A 3RKYA 1M1FA 1PWTA 1RLPC 2P0KA 4RTYA 1SF9A 1VIEA 4OF1A 5KYUB 2DD5A 2DL5A 3INZA 1KC8C 2Y90A 2CT4A 1VQ6Q 1IREB 1YITQ 2KRNA 5I11A 4XTVA 2A36A 1LOJA 3P8BB 4J9EA 5FWCA 2EYXA 1UFFA 2X9HA 3UT1A 4ZTJA 3CMET 3CCMQ 2KK4A 4C5EA 3L1AA 1QKWA 5IXBA 3EG9A 4FYYB 4PJOD 2P0PA 2DXUA 1O9SA 1NLPC 3M0TA 4JJDA 4E6RA 1ABQA 2G3RA 5FLXE 4A4GA 2DTIA 1K73C 1YIJT 3CC2T 3L2WA 3BW1A 2K3XA 4XU3A 4LDWA 3X26B 3LYIA 2D8HA 2CGHA 4HCKA 1QLYA 4HKEA 1YJ9A 2ED0A 4BI4A 1K0SA 2KROA 2CUBA 4PK4A 5FROA 2BZ8A 1SEMA 5EC7A 4L59A 4RG2A 2JS2A 1YCSB 2XG8D 2F2XA 4JRQA 4C5GA 4C92A 1YJNT 4RMOA 3JB9F 5KCHA 2XKOC 4PLIA 2D1XA 3HL8A 2H3JA 2GNCA 2VWFA 1CSKA 1BU1A 2LNVA 1JQQA 1M8MA 2E65A 1LJOA 1I5OB 2QA4T 1FMVA 3QO3A 3CCEQ 2RHXA 3EG3A 2C06A 1GFCA 1H92A 1KQSA 1VQKT 3CXCA 2RJFA 1BI1A 5DM7R 1ZSZC 2PZ1A 1ZSGA 4LDXA 1WHKA 3CCLQ 4E7IA 1M3CA 3TSZA 2M16A 4XK8E 3EG1A 4OMMA 1VQ6T 1CKBA 2DEUA 4HCZA 4M7DB 4C8QC 3EGDB 3CC4Q 1M2OA 2LT1A 3TEEA 4HA8A 1VA7A 1WPYA 1QVPA 3LGFA 5KYYA 1OULA 3UA7A 2YXYA 5GANh 3I56A 4ZGEB 5FW9A 1JJ2S 2DVJA 1OPKA 2KE9A 5IXFA 1MNDA 2XDDA 4M78E 3RMSA 4JZ3A 1OEBA 5CQYA 2GF7A 3A98A 4PJLA 2KRSA 1M30A 1ZUUA 1YITA 4E7JA 5GMKj 2BZYA 1X6BA 1GCQC 2RO0A 1XJWB 1PD1A 2KRMA 1G3YA 2CP6A 2F5TX 2L3QA 2AKLA 3VS5A 1X69A 1HD3A 3EG0A 2L3RA 2LJ1A 1JXMA 1VQMA 1BCOA 1LNXA 4Z02A 2KAFA 2M51A 4M77B 2F2VA 3VJPA 4M7AE 4NL3A 2O01E 2DE0X 2YSQA 2DLPA 2RH2A 2ZPBB 2MWPA 1K76A 2QYZA 2ZPEB 1UE9A 2QDLA 3CXCS 3VRYA 3EGXA 1X27A 4ME7A 2DL7A 4M78F 4JZ4A 3X20B 4DBRA 3MJXA 2J6OA 1Q81R 2ZZDA 3QWYA 1WQWA 2DNUA 5LJ3d 2HEQA 3LH0A 1E6HA 1JO8A 1VQLT 4DBHA 1VQPQ 3QSUA 3LGLA 3CCRQ 3CMAA 1G2BA 1H641 2LCCA 3CPWA 2DTHA 1NJIU 1YI2A 2E70A 4AFSC 3MEUA 1YBYA 3E9GA 4J83A 4RCBA 2AZSA 1UUEA 2MMPA 4BE2A 1Q86C 1JJ2P 1WZOA 3OYCA 2FZKB 3VUZA 4AFUC 4M7AF 2FVUA 1VQ7A 1VQ8A 2DXBA 4M78A 2JM8A 4JS4A 1NG2A 3VYHB 1VQ9A 3V7CA 3OYEA 2GGRA 2FG0A 3JCMf 3OYAA 2EGAA 3GIBA 2FRYA 5KE2A 2J7IA 3MEAA 2JUFA 1EZZB 3EHQA 4ELYC 1TUGB 4RUGA 3BDLA 1HSQA 2JXBA 5GMKh 4C0DC 1OQKA 5HK0A 1YI2Q 2QQRA 3QKJA 3BDUA 1M3AA 1ZSZB 1I07A 2K3BA 4M75E 2COYA 2QEXQ 3DB4A 3S3MA 2DTOA 4C92D 1OX9A 1ZA2B 4FCYA 3CCQQ 5GANj 1PNJA 5LJ5j 3CCUA 1WDXA 4F7UA 5GAMh 1Z9QA 3NHNA 1YN8A 3H0HA 4BB7A 2K79A 4RG8A 3ER0A 2DX1A 3TU4K 4MDXA 2JVVA 1BI2A 2KMTA 1ZSZA 4ZNXA 3BY7A 5FRNA 1RUWA 4YTLA 4AMCA 1LVKA 3CCLA 4R0KA 1RAEB 1U1SA 4OVAA 1X2KA 2LMJA 4JS5A 2W10A 4PLLA 1ZHIA 2BZXA 2VV5A 4ZN3A 5LJ3j 1O75A 1VQLQ 4C5IA 1RI9A 4EMKC 3VV0A 1JJ2A 5CQXA 1MV0B 1QVGP 5LL6S 2CZ1B 4KGVB 2GTOA 1W1FA 5IH2A 4FYWB 1E7OA 1TU0B 4Q5WA 5GMKl 2LQ8A 2DEQA 3QDRB 2K5LA 2IPOB 1M90C 1UGVA 4FL6A 5GAMj 2RQUA 2H8HA 4LUEA 1S72T 2O9VA 1G8XA 1T0JA 2SRCA 5KYXA 2I0NA 3CCET 2XU8A 2GBQA 2NUTA 1Y96A 1AOJA 1WQ7A 3JAME 2O4XB 3JCMJ 4J9CA 4LDYA 3A8OB 5I21A 2D8JA 3CEYA 1VIFA 3GBQA 4XU1A 2M1HA 5FRMA 2EJ9A 4Z89A 3RIRA 4KBMB 1QW1A 2QQAA 4J9FA 1K9MR 4NOYA 3NTKA 3OBYA 4RTWA 2CZ0B 3EAEA 5GAMf 1K8AR 3C94A 9ATCB 4QKUA 2NUZA 1IO6A 1YFNA 2OTLT 3E19A 1VQ5Q 3NMZC 4GY5A 2QQBA 3MKDA 2EQIA 4IUVA 2O88A 2YLCA 1ZLMA 2LVMA 1RABB 1AD5A 5GAN4 2LP5A 1G3SA 2CT3A 2J05A 1UECA 2HBWA 2RJEA 2K2VA 1BBZA 2DYBA 1D3BA 2KQWA 3EH1A 3SEMA 2E10A 1WXTA 1VQNA 2A3LA 2EGEA 1YJ9T 4DBQA 1KQ1A 3I9QA 2JTEA 2COZA 3R6NA 2E4HA 4HCCA 1A0NB 1GBRA 1VYUA 2NYSA 4WF2A 1GCPA 2RJDA 4F16A 2D0NA 1I5LA 4RKUE 3MO8A 1UHCA 1W4SA 4QT7A 3PVLA 1IHWA 3V8JA 4II1A 2H3EB 1F1BB 1ZUYA 4BDZA 4M4ZA 2IVWA 4LDVA 3JCMP 1UGQB 1M1GA 1OX8A 2O2OA 2RK1A 5KYUA 1YJNQ 3JCMg 4FT4A 2O9SA 2NUPA 2ZPFB 1QVFP 1KIKA 1QVFA 1H3ZA 3IQLA 1QVGA 4PJMA 1K9MU 3EHRA 3PNWC 3NFCA 4EIKA 1PSFA 2MF2A 2C0IA 2KSSA 5LJ5g 3X28B 4JRKA 3GP8A 4BE0A 3G4ST 1VQPT 2J06A 2KEAA 2YT6A 1M1KU 3GLXA 2QEXT 2EQUA 3MP6A 3OY9A 2HCKA 1WJSA 5IHKA 3CC4T 2LDMA 1WFWA 4Z88A 4J9GA 1TS9A 3PMTA 4VUBA 3OYFA 2XD0A 1G3WA 4IIMA 2JT4A 1VQOA 3HHTB 1MMAA 1WI7A 4A53A 1M4ZA 3NTHA 1VQMQ 3CBOA 3TREA 4MMLA 1OYXA 4JLGA 4XQ3A 5HCKA 8AT1B 8ATCB 3ASKA 1VQLA 2HQHA 1KJWA 4IURA 2DL3A 3M5AA 2M02A 2B8AA 4GLMA 3H9NA 2DILA 1VQ6A 1T0HA 1IB8A 3OS1A 2VASA 4CC4B 2HKQB 4J6XA 3EFSA 1VQ8Q 2RI3A 2MPXC 5C6SA 4CC2A 3EFOA 4DEXA 1RAFB 2G6FX 3NPFA 3CCMA 3CPWP 5IHNA 3L2QA 5GMKi 4A4KA 3LW5E 5GAOp 1KD1U 3G6ET 2VGNA 2KT1A 3CCVA 3QIIA 2DM1A 2QDYB 4A4HA 3LWHA 3DKMA 5EG2A 1VQNQ 1Y7XA 2EQMA 3MP8A 2EQKA 2M9UA 4PFOA 1I1JA 2CDTA 3OYJA 4QQDA 3G6EA 1TXQA 3EGDA 5A0GA 1WIEA 3M0SA 1YWPA 3CCJT 3EFOB 3H8ZA 2HL5C 3O5ZA 2EGCA 5KYYB 5C0MA 2WACA 2COWA 5CO7A 1M90U 3GOXA 4O5VA 3OYIA 4IUQA 1VQ9Q 1OU8A 1UEBA 4M75F 4M77C 4F04B 1NYGA 4L6V5 3T9NA 1KC8U 2RJCA 4PNOA 1TH7A 2CP3A 4R56A 1UJYA 3RERA 4QQGA 5FU6B 2JTFA 2Y4XA 2KYMA 1OOTA 2DRKA 2O31A 5IAYA 1X01A 4BI3A 1ARKA 2ESWA 2X4YA 2ZAEA 2V26A 4HVWA 2CZ6B 1P92A 4M77A 1K9MC 2PUOB 1V76A 2JZ2A 1R77A 1KG1A 2R5MA 1RLQC 4M7DE 1Y57A 4KGZB 2PQWA 1YHQT 5FU7B 1YI2T 2YDLA 1N8RR 1KD1R 3M9QA 3CCSQ 4AG1C 1OV3A 4KT0E 1RAHB 1XOVA 2CUDA 3CXCP 5GAN2 3OW2S 1PSEA 2JNGA 3JB9G 2HKNA 1C6VX 1IXDA 2YHTA 3M59A 1SRMA 2L8DA 1V29B 4M7AG 3G7ZA 4M78D 2BE9B 3HRTA 4HXJA 4ATOA 3VKIA 2YUOA 2F1LA 3GNFB 2EKHA 4LNPA 4FSXA 4F7UB 1K4US 2YRVA 2FPEA 4K11A 3OQ5A 2HDAA 3Q1JA 4N4GA 2P4RA 2DXCA 4TVRA 2MYSA 3I5SA 1VOMA 2R5AA 1XTDA 4OMFB 2AIRB 2C0TA 1M8VA 3FLGA 1YJWA 3M57A 4IUPA 4M7DF 2BIVA 1VQ5A 5CVIA 2EW3A 4EMHA 1AHJB 1MUZA 5A0LA 4P5NA 2MAMA 1PCXA 5I2MA 2E1HA 3C12A 4PJOF 2DA9A 1KK7A 4LDUA 5LJ3e 2QA4A 1UJ0A 5DY9A 4HVUA 2EYYA 1UGSB 4KGXB 3M0UA 4O6JA 2QG9B 3G71T 2OTJQ 2QQ9A 3PTAA 4DOWA 1NBEB 2RHZA 3OSSC 5AYFA 4AT1B 5CAIA 3CCUQ 3JSCA 3HFNA 1PKTA 1YCYA 2E12A 4XAXB 3RR6A 1BI0A 3LX7A 5CKEA 2K5IA 1RACB 4FIBA 5HK3A 3C0CA 3WVEB 2F5KA 3HTRA 3QWXX 5GANd 2KI7A 1B34A 2DJZA 1M90R 2X4JA 1XQHA 4D8KA 3D7SB 1VQKQ 1JEGA 2JTMA 4M78C 3HRSA 3GPLA 4QVZA 3OS5A 2OTLA 2JMAA 5KYWB 1BIAA 3OYLA 1AVZC 1KC8R 2DL8A 5A2QE 1W2BS 2CP5A 5LJ5e 3QHSA 5GANe 4R55A 3NTIA 5KE3A 2WSCE 5GMKm 1PD0A 2K6DA 1G83A 2LNHB 4OMLA 3WVDB 3I55A 3KUFA 2CKKA 3ME9A 1K73U 4M75B 1MNEA 5CIUA 1X6OA 2L5QA 2FL7A 1N9SA 5DLQE 2P4TA 2QEXA 5KYWA 1SHGA 2EPDA 4FU6A 4JJNK 4E7KA 1YJNA 4XU0A 5IN1A 4J7FA 4C8QA 4N4IA 4XTUA 4KH1B 2LT4A 4DQ2A 1D3BB 2VB6A 1NE8A 3RBBB 2D6FA 1G3TA 2LCSA 4DA4A 2X3XD 4EMKB 2QK0A 5KYXB 2OAUA 2XI9A 1VQOT 4JJCA 1N8RU 2QAZA 4Y91A 1X6GA 4BUGA 1X75C 3OB9A 4ZTFA 3FC3A 5GAN7 3PIOA 3U23A 3EH2A 2K4YA 1WLPB 3FJ5A 3CCMT 2EAYA 2CS7A 2HSPA 2JJ9A 4M77D 1PG5B 2RQVA 3LWIA 1BIBA 5GAOl 3CCUT 3R6OA 3EG9B 5KYNA 2DXTA 3CCJQ 4EMKA 1NEGA 3C95A 3V7RA 5LJ5h 4FW1A 3JB9J 1IHVA 1QCFA 1UB4A 2P84A 3L2RA 2Z0WA 2E3HA 4A4EA 3JCMe 3OMCA 3RMQA 4M77G 2FPDA 3HFOA 2DK3A 2RHUA 4J6WA 2L89A 5IT9E 3LH5A 3JCMh 3G4SQ 4MMKA 4PL6A 2CP7A 3L2UA 5GJVB 4E7SA 5GAOr 4AG2C 2MIOA 1ZA1B 3DLMA 2KVQG 4OMNA 1D0XA 1YITT 2Y4YA 3CBPA 3UATA 3UDCA 1Q86R 1YNZA 1Q82U 1V1CA 1Q81U 4M7DD 3N5BB 4J9BA 1AEYA 2EVRA 4DEYA 2DETA 2PTKA 2AHJB 3META 1W2BA 1N8RC 1VQMT 2FRWA 3JCMX 4BACA 4C0GA 3G4SA 2K7AA 2QGFB 1VQPA 4HT8A 4LD9K 3HRUA 5GMKe 4DBFA 6AT1B 1YHQQ 4N0AA 1KQSS 1IGUA 3CC7A 4WTOB 1BYMA 3CC2Q 2NUPB 4BE1A 3PIPA 1QVGS 4J6YA 3CCLT 5CK9A 3OYKA 1VQ8T 4BDYA 1ZQ1A 3FB9A 2EWNA 4ESRA 1ZBJA 2EYQA 2LQWA 1VQ4A 4RCCA 2BTTA 1PRLC 5HY6A 3X25B 2VYTA 2E6ZA 4E7LA 3QG1A 3M0RA 3G6EQ 3MHXA 2HD0A 2GQIA 4X9CA 4IUUA 4NS5A 1SSHA 4N0AC 1YHQA 3J80E 3QDFA 2KDSA 4FYXB 1H3HA 3VRZA 4PFZA 2LX7A 2KY9A 1Q95G 1K8AC 1MGQA 2K57A 5GJWB 2MCNA 3QJYA 3RESA 1QWFA 4OB2B 3ZFJA 2EKOA 4MZTA 4LN2A 2B86A 1M3BA 3VS6A 1MV3A 1VQ4T 3OYGA 2CP0A 2E6NA 2MK5A 1BK2A 2ENMA 4N4HA 1NJIR 2RPNA 1MMDA 4HCBA 2PVGB 4JRIA 1M9SA 4M7AC 3G71Q 2OTJT 1NZ9A 1PHTA 1UG1A 1Q82C 3MEVA 2FB7A 3L2VA 4PJOC 1I4K1 1VQ7Q 3OYMA 3CC7T 5GAMe 3OYHA 3VU3C 1WJQA 2AKKA 3QYGB 5CKDA 1NPPA 2K3YA 3H6ZA 2K5FA 5GAN8 2PUKB 2CZ7B 2HSEB 1WHHA 2DKGA 3KFVA 4LE9A 1D0ZA 3SHWA 3GF5A 3VYGA 3G71A 3EGUA 4M77F 1KQ2A 1FWZA 3CCEA 1WXUA 1KD1C 1WNLA 1NJIC 3AHUA 2QXFA 4F7UE 2ABLA 3UA6A 4X34A 1VQOQ 1LCKA 3CCST 1QP2A 1VYVA 3DB3A 2V8JA 2RD1A 1C1AA 4GBQA 5CKFA 5LJ5d 2EIFA 2GCXA 1U8RA 2LZ6B 1OI1A 3HKSA 4M78B 2RQRA 1Q82R 3CC4A 1QVFS 1M27C 1IGQA 1OZ2A 5J3BA 1OU9A 4J5YA 4C8QF 2QQSA 3NGPA 2ECZA 2AK5A 2AZVA 2MOXA 2VUBA 3OS0A 2OI3A 1YJWQ 4C92C 3I55Q 3EGXB 2A28A 1MMNA 1YIJQ 4MZMA 1WXBA 1GXIE 3DLLA 1Q7YC 2CH4A 2WSEE 1VUBA 4M77E 1WHJA 2IG0A 4ZGDB 2HL3A 2EFIA 4HVVA 3PMIA 1RAGB 3OS2A 3SWNC 2BKDN 4PJNA 3M4GA 4FT2A 5A0DA 1M1KC 1RAIB 1SG5A 4J9HA 1I0CA 3CC7Q 3OYBA 1G5VA 2GTJA 3JB9D 1H8KA 3ZL7C 4MDWA 2LTOA 2JW4A 2P0QA 2QTXA 4OB3B 1HYOA 3VS1A 3CC2A 1U3OA 1B7TA 2DBMA 2E5KA 2RNAA 1WA7A 1Q7YU 5CKBA 1X2QA 3WXMB 4M7DG 3JCMd 5IHIA 2V8KA 1GBQA 4M7DC 2ZPIB 1FYNA 2X4WA 2ZPHB 3ZBDA 1RI0A 1T3SA 1CKAA 2DFUA 5J39A 2XDPA 4FYVB 4CC7A 3OYNA 2YRDA 4IUTA 2RMOA 1C0MA 3EG2A 2A37A 3E2UA 2RM4A 2GFAA 2OJ2A 2F69A 2XIDA 1M5Q1 1E6GA 2XMFA 2XK0A 4M75C 3THKA 3SD4A 1Y07A 1FMWA 4V2SA 2AT1B 1ZX6A 4C8QE 3QPHA 2JOYA 3VS2A 4QQ6A 1TUDA 3VS0A 1BB9A 3QUIA 1S72Q 4C92G 3H0FA 3SFMA 3VUBA 5GAN3 5L23A 2O4XA 2KGTA 1J3TA 4A63B 1W70A 2LC4A 3I56T 2EJGA 3QZ9B 2K9GA 4PJOE 2PVDB 1B07A 2FYKA 3QBYA 2KR3A 4BY6B 2HAXA 3LLRA 3M0QA 1HXDA 3JCMW 2EYWA 3S3OA 4OB1B 3RNJA 2RQTA 5HKCA 4ORZA 4MZPA 1MMGA 4L5GA 1Q7YR 2KXCA 1TOVA 4OP0A 1W6XA 4JUVA 3UPUA 3A8HB 2QGGA 1D1BA 2V8IA 4FW2A 1FMKA 2HZYA 3CMAT 1BKBA 3CCRA 5D6WA 5DLOA 4KUIA 4C8QD 2RN8A 2DO3A 4Y28E 1D0YA 2DYIA 4FSSA 3L42A 3PVQA 2RHYA 2FZGB 5LJ3g 3A8GB 1VQ4Q 2E5QA 2YUPA 2V1QA 5KH6A 4GLKA 3RUXA 2YWWA 3TQ7P 3KXTA 1KHIA 2CREA 4CI0C 3SDZA 1LPLA 2A08A 4M75A 1VQ9T 1N9RA 2KT8A 3FIFA 1Q81C 1U1TA 4J8OA 3J7AF 2RA2A 2J6FA 5FU7C 4XTZA 2X3WD 4C8QB 4OMPA 1K9AA 4F7UG 1WHMA 5ECAA 1U5SA 2YRCA 4NL2A 2DAQA 3TCJA 2ED1A 3OW2P 2CYZB 3JB9H 5D6YA 5CR2A 1X43A 3M53A 2X51A 3G1JA 4HT9A 4RTVA 2GFUA 1WHGA 3S6WA 1N5ZA 1SHFA 1U06A 2FEIA 4PJOB 3F70A 5FU6C 4E2FB 1HJDA 2ZGWA 4Z8AA 3SB2A 4F17A 3I5RA 4ZGJB 3CCQA 3VS3A 1YJ9Q 4RTUA 1FX7A 2LX9A 4UC4A 1NM7A 2I2LA 4Y92A 3JCMc 2LQNA 4C92B 3ULRB 4EMGA 1FXXA 3VS7A 3CCVQ 2YUQA 4JLIA 3JRZA 1DJ7B 5I22A 2D9TA 2ROLA 2VC8A 4CC3A 1HK9A 1WJRA 2PVOB 4B6MA 3CMEQ 4EPCA 1QCOA 4QVCA 3QYHB 4KH0B 1YJWT 3PE0A 3J81E 4JPBW 4JJBA 3QXEB 3H41A 1WYXA 3MPUB 4M78G 2BE7D 4M7AB 2LJ3A 2XDBA 1SKUB 3FRNA 2KXDA 4BI8B 2RF0A 4M7DA 2M0OA 1S72A 1VYTA 1ZBXA 2FO0A 2LCLA 3HP9A 2DD4A 2RB6A 1D1CA 3CD6Q 2QI2A 2DL4A 1Y71A 2HMAA 3CPFA 4QVDA 5CCAA 1RL2A 1VQ7T 2MI6A 1ZUKA 4A4FA 1Y0MA 3URGA 3L2ZA 4PFPA 2OAWA 5D7UA 2CH4W 5LJ5f 4M7AA 5GAOm 5GANf 4WCIA 1YWOA 1VQNT 1I8FA 2DPPB 4XU2A 2KYBA 2DIQA 4C8QG 1TTHB 1UHFA 3P8DA 3QJ6A 1EFNA 2QA4Q 3P8HA 5KCOA 3E9FA 3RDVA 2D0QB 4C92E 1K8AU 1GL5A 2RI2A 2OTJA 2W0ZA 3HPWA 3QZ5B 4KUDK 1R0CB 2EYZA 1QCNA 2FHDA 1SPKA 2VKNA 2QASA 1K0XA 1KHCA 5L8RE 4PJOG 5LJ3h 4XTXA 2CSQA 4DOVA 4BY6C 3JV3A 1NYFA 1VQ5T 1JXOA 1UGPB 2LJ0A 4OMOA 4ELZC 4C0FA 1AWWA 3TVTA 2J6KA 1BCMA 2HBPA 1AWOA 2JS0A 1VQKA 2WSFE 2FZCB 3OA6A 1XNIA 3FJPA 2C0OA 1YIJA 3JCMV 1QP3A 5FWBA 2JM9A 2HQEA 3JCMQ 3I55T 4C5HA 3I56Q 4XTWA 3JB9I 1WX6A 1PRMC 2ROTA 4M75D 3M54A 1RAAB 5D6XA 2ZCFB 1OPLA 1K73R 1SSFA 5M9OA 3GNGA 2F2WA 3CD6T 2CP2A 1PM3A 4M75G 5GAMd 4RTTA 1UGRB 5LJ3f 3MEWA 2VXEA 3HSBA 2XHCA 1N6AA 2XICA 2DRMA 3PFSA 2L2PA 2JN0A 1R8OB 1TG0A 2LRQA 2RK2A 4E7ZA 2HQXA 2K2MA 3A8LB 1AWXA 3JCMb 2FPFA 4C0ZA 2E64A 4C92F 1PC0A 1KQSP 4JDSA 3OBWA 3BE3A 1D09B 1M1KR 2EJFA 4J7IA 4OGEA 3OMGA 2ATCB 2E41A 2KBTA 2QTVA 2DIGA 3CD6A 2A0FB 3FDRA 3CBMA 4KULA 3C4SA 1R0BG 1S1NA 1MHNA 1KSWA 4ZN1A 4F7UF 3X24B 3OSVA 1ACMB 2OX7A 4QW2A 3V7SA 3PGGA 5GAMg 1ABOA 2PNIA 4D6WA 1UTIA 2JMCA 1SRLA 3M58A 1AZGB 1IRXA 2DZCA 2L3PA 4RTXA 1OZ3A 2GQVA 4E47A 2HNIA 3CCRT 4C0DB 2RQWA 3ZEHA 5GAN6 2EQJA 1TSFA 1EIFA 2VVKA 4AFZC 4LUDA 2OTLQ 5CKHA 1QWEA 1JBMA 4M7AD 2X35A 1W2BP 2ZPGB 4IIOA 5J26A 3V8LA 1NLOC 2A7YA 2RI5A 1M2VA 2KNBB 3V8KA 2SEMA 3M4YA 4PJJA 2NLUA 4BD3A 1TUCA 2RHIA
chains in the Genus database with same CATH topology
2EBPA 2OJ2A 3M0PA 4ZNXA 1RUWA 1E6GA 1JU5C 4R0KA 2XMFA 1PKSA 3VS4A 3THKA 1X2KA 1QKXA 2LMJA 1PKTA 2NWMA 2W10A 1ZX6A 2BZXA 3VS2A 1GCQA 1TUDA 3VS0A 1YP5A 1BB9A 3C0CA 1RI9A 3H0FA 2CSIA 3QWXX 2DBKA 2IIMA 5L23A 2KGTA 1J3TA 3TSWA 1MV0B 4D8KA 4A63B 1W70A 2GTOA 1W1FA 1JEGA 5IH2A 1E7OA 2M0YA 2JMAA 1UDLA 2K9GA 1B07A 1AVZC 2KR3A 2DL8A 1UGVA 3M0QA 2RQUA 2H8HA 4J9DA 4LUEA 1K1ZA 2EYWA 2O9VA 2K6DA 1G83A 2LNHB 4OMLA 4OMQA 1GFDA 1T0JA 2SRCA 3H0IA 3RNJA 2RQTA 2I0NA 2GBQA 4ORZA 1AOJA 2V1RA 4J9CA 1T3LA 2D8JA 2KXCA 1Z9ZA 3CQTA 1W6XA 3I35A 3GBQA 4Z89A 1NEBA 1SHGA 2EPDA 2L0AA 4J9FA 1FMKA 4RTWA 2L3SA 3RBBB 2RN8A 4J9IA 1AWJA 3REAB 2LCSA 2X3XD 4FSSA 3PVQA 2DMOA 4JJCA 2YUPA 2V1QA 2NUZA 4AFQC 1B3QA 1AZEA 3UF4A 1IO6A 1X6GA 2YUNA 2DJQA 3NMZC 2CREA 4D8DA 2A08A 1GRIA 2EQIA 4F14A 2KT8A 3U23A 2O88A 1ZLMA 2J6FA 3REBB 1AD5A 2LP5A 1WLPB 3FJ5A 2CT3A 2J05A 2X3WD 4KRTA 4X1VA 1UECA 2HBWA 2HSPA 1KFZA 4OMPA 4RTZA 1BBZA 2DF6A 2DYBA 2RQVA 1K9AA 1PWTA 5ECAA 1RLPC 1U5SA 3SEMA 4RTYA 1NEGA 1WXTA 2EGEA 2DL5A 3I9QA 2JTEA 1QCFA 2CT4A 2ED1A 3R6NA 1X43A 2KRNA 5I11A 1A0NB 1GBRA 1VYUA 2A36A 4RTVA 1GCPA 4J9EA 4F16A 2FPDA 2D0NA 5FWCA 1N5ZA 1SHFA 1U06A 1UHCA 2FEIA 2EYXA 1UFFA 4QT7A 3LH5A 3PVLA 5GJVB 1HJDA 4Z8AA 1ZUYA 4AG2C 2MIOA 3I5RA 4F17A 4M4ZA 1QKWA 5IXBA 3VS3A 4RTUA 4OMNA 1NM7A 2O2OA 4Y92A 2LQNA 1NLPC 3UATA 2O9SA 3ULRB 3M0TA 4JJDA 1YNZA 4E6RA 1ABQA 1V1CA 3VS7A 4J9BA 1KIKA 1AEYA 2YUQA 3IQLA 2EVRA 3EHRA 4DEYA 2PTKA 4EIKA 2C0IA 2D8HA 4HCKA 1QLYA 5I22A 2FRWA 2ED0A 2ROLA 4CC3A 2K7AA 1K0SA 2KROA 2CUBA 2BZ8A 1SEMA 5EC7A 2J06A 2KEAA 2YT6A 2JS2A 1YCSB 2F2XA 3PE0A 4JPBW 4JJBA 2HCKA 3H41A 1WYXA 5IHKA 2D1XA 1WFWA 2GNCA 2VWFA 4Z88A 2LJ3A 4J9GA 1CSKA 1BU1A 2KXDA 2RF0A 1JQQA 2JT4A 4IIMA 4ESRA 1M8MA 1ZBJA 1WI7A 1VYTA 2FO0A 2LQWA 2BTTA 1PRLC 3EG3A 1GFCA 2DL4A 3M0RA 5HCKA 1H92A 2GQIA 1SSHA 1KJWA 2PZ1A 1ZUKA 1ZSGA 1H3HA 2DL3A 1Y0MA 3VRZA 1M3CA 2LX7A 2DILA 4GLMA 3TSZA 1T0HA 2OAWA 3EG1A 2CH4W 4OMMA 5GJWB 2MCNA 4WCIA 1CKBA 1YWOA 4CC4B 1QWFA 2KYBA 4LN2A 2B86A 4CC2A 1M3BA 3VS6A 4DEXA 1MV3A 1VA7A 2G6FX 3NPFA 1UHFA 1EFNA 3UA7A 5IHNA 1BK2A 2ENMA 5FW9A 1GL5A 2KT1A 2RPNA 2DM1A 2DVJA 1OPKA 2W0ZA 2KE9A 5IXFA 1PHTA 1UG1A 2EYZA 1SPKA 1OEBA 4JZ3A 2VKNA 3A98A 1K0XA 1I1JA 2KRSA 1M30A 1ZUUA 2CDTA 2BZYA 1WIEA 3M0SA 2AKKA 1YWPA 2CSQA 3O5ZA 2EGCA 1X6BA 1GCQC 3JV3A 2KRMA 1NYFA 1JXOA 2L3QA 2LJ0A 2AKLA 3VS5A 4OMOA 1X69A 1HD3A 3EG0A 1AWWA 2LJ1A 1JXMA 3TVTA 2J6KA 3KFVA 1AWOA 2M51A 2JS0A 1NYGA 2F2VA 4LE9A 3SHWA 2C0OA 3EGUA 5FWBA 2JM9A 2DE0X 1UJYA 1WXUA 2YSQA 2DLPA 1K76A 2ABLA 2KYMA 3UA6A 1OOTA 2DRKA 2O31A 1WX6A 1PRMC 1LCKA 1UE9A 2ROTA 2QDLA 1VYVA 3VRYA 1X27A 4GBQA 1OPLA 2DL7A 1ARKA 2ESWA 2LZ6B 2F2WA 4JZ4A 4HVWA 4RTTA 2J6OA 2RQRA 3QWYA 1M27C 2DRMA 2DNUA 2L2PA 1RLQC 2HEQA 1E6HA 1JO8A 1Y57A 1TG0A 3NGPA 2ECZA 2AK5A 2AZVA 2K2MA 2MOXA 2OI3A 1G2BA 1AWXA 2YDLA 4AFSC 4AG1C 1OV3A 2FPFA 2AZSA 1UUEA 2A28A 1XOVA 2CUDA 1WXBA 2CH4A 4AFUC 1SRMA 2KBTA 2JM8A 1S1NA 1NG2A 4HXJA 4HVVA 1KSWA 2YUOA 2GGRA 2FG0A 2EKHA 2EGAA 4LNPA 2FRYA 4J9HA 1K4US 1I0CA 1ABOA 2J7IA 2PNIA 1UTIA 2JMCA 1SRLA 2FPEA 3EHQA 4K11A 2GTJA 1AZGB 2HDAA 4RUGA 1H8KA 3ZL7C 1HSQA 2JXBA 2L3PA 2P4RA 4RTXA 3I5SA 2JW4A 2RQWA 1M3AA 1I07A 2K3BA 3VS1A 2C0TA 1U3OA 2VVKA 4AFZC 2DBMA 2E5KA 4LUDA 2RNAA 1WA7A 1QWEA 2EW3A 1X2QA 1MUZA 5IHIA 1PNJA 1GBQA 1FYNA 4IIOA 2DA9A 1WDXA 1NLOC 1UJ0A 1Z9QA 1T3SA 1CKAA 3NHNA 1YN8A 3H0HA 4HVUA 2EYYA 2KNBB 3M0UA 2K79A 2SEMA 4CC7A 2RMOA 1TUCA 3EG2A 2DX1A 2A37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBP A;  2OJ2 A;  3M0P A;  4ZNX A;  1RUW A;  1E6G A;  1JU5 C;  4R0K A;  2XMF A;  1PKS A;  3VS4 A;  3THK A;  1X2K A;  1QKX A;  2LMJ A;  1PKT A;  2NWM A;  2W10 A;  1ZX6 A;  2BZX A;  3VS2 A;  1GCQ A;  1TUD A;  3VS0 A;  1YP5 A;  1BB9 A;  3C0C A;  1RI9 A;  3H0F A;  2CSI A;  3QWX X;  2DBK A;  2IIM A;  5L23 A;  2KGT A;  1J3T A;  3TSW A;  1MV0 B;  4D8K A;  4A63 B;  1W70 A;  2GTO A;  1W1F A;  1JEG A;  5IH2 A;  1E7O A;  2M0Y A;  2JMA A;  1UDL A;  2K9G A;  1B07 A;  1AVZ C;  2KR3 A;  2DL8 A;  1UGV A;  3M0Q A;  2RQU A;  2H8H A;  4J9D A;  4LUE A;  1K1Z A;  2EYW A;  2O9V A;  2K6D A;  1G83 A;  2LNH B;  4OML A;  4OMQ A;  1GFD A;  1T0J A;  2SRC A;  3H0I A;  3RNJ A;  2RQT A;  2I0N A;  2GBQ A;  4ORZ A;  1AOJ A;  2V1R A;  4J9C A;  1T3L A;  2D8J A;  2KXC A;  1Z9Z A;  3CQT A;  1W6X A;  3I35 A;  3GBQ A;  4Z89 A;  1NEB A;  1SHG A;  2EPD A;  2L0A A;  4J9F A;  1FMK A;  4RTW A;  2L3S A;  3RBB B;  2RN8 A;  4J9I A;  1AWJ A;  3REA B;  2LCS A;  2X3X D;  4FSS A;  3PVQ A;  2DMO A;  4JJC A;  2YUP A;  2V1Q A;  2NUZ A;  4AFQ C;  1B3Q A;  1AZE A;  3UF4 A;  1IO6 A;  1X6G A;  2YUN A;  2DJQ A;  3NMZ C;  2CRE A;  4D8D A;  2A08 A;  1GRI A;  2EQI A;  4F14 A;  2KT8 A;  3U23 A;  2O88 A;  1ZLM A;  2J6F A;  3REB B;  1AD5 A;  2LP5 A;  1WLP B;  3FJ5 A;  2CT3 A;  2J05 A;  2X3W D;  4KRT A;  4X1V A;  1UEC A;  2HBW A;  2HSP A;  1KFZ A;  4OMP A;  4RTZ A;  1BBZ A;  2DF6 A;  2DYB A;  2RQV A;  1K9A A;  1PWT A;  5ECA A;  1RLP C;  1U5S A;  3SEM A;  4RTY A;  1NEG A;  1WXT A;  2EGE A;  2DL5 A;  3I9Q A;  2JTE A;  1QCF A;  2CT4 A;  2ED1 A;  3R6N A;  1X43 A;  2KRN A;  5I11 A;  1A0N B;  1GBR A;  1VYU A;  2A36 A;  4RTV A;  1GCP A;  4J9E A;  4F16 A;  2FPD A;  2D0N A;  5FWC A;  1N5Z A;  1SHF A;  1U06 A;  1UHC A;  2FEI A;  2EYX A;  1UFF A;  4QT7 A;  3LH5 A;  3PVL A;  5GJV B;  1HJD A;  4Z8A A;  1ZUY A;  4AG2 C;  2MIO A;  3I5R A;  4F17 A;  4M4Z A;  1QKW A;  5IXB A;  3VS3 A;  4RTU A;  4OMN A;  1NM7 A;  2O2O A;  4Y92 A;  2LQN A;  1NLP C;  3UAT A;  2O9S A;  3ULR B;  3M0T A;  4JJD A;  1YNZ A;  4E6R A;  1ABQ A;  1V1C A;  3VS7 A;  4J9B A;  1KIK A;  1AEY A;  2YUQ A;  3IQL A;  2EVR A;  3EHR A;  4DEY A;  2PTK A;  4EIK A;  2C0I A;  2D8H A;  4HCK A;  1QLY A;  5I22 A;  2FRW A;  2ED0 A;  2ROL A;  4CC3 A;  2K7A A;  1K0S A;  2KRO A;  2CUB A;  2BZ8 A;  1SEM A;  5EC7 A;  2J06 A;  2KEA A;  2YT6 A;  2JS2 A;  1YCS B;  2F2X A;  3PE0 A;  4JPB W;  4JJB A;  2HCK A;  3H41 A;  1WYX A;  5IHK A;  2D1X A;  1WFW A;  2GNC A;  2VWF A;  4Z88 A;  2LJ3 A;  4J9G A;  1CSK A;  1BU1 A;  2KXD A;  2RF0 A;  1JQQ A;  2JT4 A;  4IIM A;  4ESR A;  1M8M A;  1ZBJ A;  1WI7 A;  1VYT A;  2FO0 A;  2LQW A;  2BTT A;  1PRL C;  3EG3 A;  1GFC A;  2DL4 A;  3M0R A;  5HCK A;  1H92 A;  2GQI A;  1SSH A;  1KJW A;  2PZ1 A;  1ZUK A;  1ZSG A;  1H3H A;  2DL3 A;  1Y0M A;  3VRZ A;  1M3C A;  2LX7 A;  2DIL A;  4GLM A;  3TSZ A;  1T0H A;  2OAW A;  3EG1 A;  2CH4 W;  4OMM A;  5GJW B;  2MCN A;  4WCI A;  1CKB A;  1YWO A;  4CC4 B;  1QWF A;  2KYB A;  4LN2 A;  2B86 A;  4CC2 A;  1M3B A;  3VS6 A;  4DEX A;  1MV3 A;  1VA7 A;  2G6F X;  3NPF A;  1UHF A;  1EFN A;  3UA7 A;  5IHN A;  1BK2 A;  2ENM A;  5FW9 A;  1GL5 A;  2KT1 A;  2RPN A;  2DM1 A;  2DVJ A;  1OPK A;  2W0Z A;  2KE9 A;  5IXF A;  1PHT A;  1UG1 A;  2EYZ A;  1SPK A;  1OEB A;  4JZ3 A;  2VKN A;  3A98 A;  1K0X A;  1I1J A;  2KRS A;  1M30 A;  1ZUU A;  2CDT A;  2BZY A;  1WIE A;  3M0S A;  2AKK A;  1YWP A;  2CSQ A;  3O5Z A;  2EGC A;  1X6B A;  1GCQ C;  3JV3 A;  2KRM A;  1NYF A;  1JXO A;  2L3Q A;  2LJ0 A;  2AKL A;  3VS5 A;  4OMO A;  1X69 A;  1HD3 A;  3EG0 A;  1AWW A;  2LJ1 A;  1JXM A;  3TVT A;  2J6K A;  3KFV A;  1AWO A;  2M51 A;  2JS0 A;  1NYG A;  2F2V A;  4LE9 A;  3SHW A;  2C0O A;  3EGU A;  5FWB A;  2JM9 A;  2DE0 X;  1UJY A;  1WXU A;  2YSQ A;  2DLP A;  1K76 A;  2ABL A;  2KYM A;  3UA6 A;  1OOT A;  2DRK A;  2O31 A;  1WX6 A;  1PRM C;  1LCK A;  1UE9 A;  2ROT A;  2QDL A;  1VYV A;  3VRY A;  1X27 A;  4GBQ A;  1OPL A;  2DL7 A;  1ARK A;  2ESW A;  2LZ6 B;  2F2W A;  4JZ4 A;  4HVW A;  4RTT A;  2J6O A;  2RQR A;  3QWY A;  1M27 C;  2DRM A;  2DNU A;  2L2P A;  1RLQ C;  2HEQ A;  1E6H A;  1JO8 A;  1Y57 A;  1TG0 A;  3NGP A;  2ECZ A;  2AK5 A;  2AZV A;  2K2M A;  2MOX A;  2OI3 A;  1G2B A;  1AWX A;  2YDL A;  4AFS C;  4AG1 C;  1OV3 A;  2FPF A;  2AZS A;  1UUE A;  2A28 A;  1XOV A;  2CUD A;  1WXB A;  2CH4 A;  4AFU C;  1SRM A;  2KBT A;  2JM8 A;  1S1N A;  1NG2 A;  4HXJ A;  4HVV A;  1KSW A;  2YUO A;  2GGR A;  2FG0 A;  2EKH A;  2EGA A;  4LNP A;  2FRY A;  4J9H A;  1K4U S;  1I0C A;  1ABO A;  2J7I A;  2PNI A;  1UTI A;  2JMC A;  1SRL A;  2FPE A;  3EHQ A;  4K11 A;  2GTJ A;  1AZG B;  2HDA A;  4RUG A;  1H8K A;  3ZL7 C;  1HSQ A;  2JXB A;  2L3P A;  2P4R A;  4RTX A;  3I5S A;  2JW4 A;  2RQW A;  1M3A A;  1I07 A;  2K3B A;  3VS1 A;  2C0T A;  1U3O A;  2VVK A;  4AFZ C;  2DBM A;  2E5K A;  4LUD A;  2RNA A;  1WA7 A;  1QWE A;  2EW3 A;  1X2Q A;  1MUZ A;  5IHI A;  1PNJ A;  1GBQ A;  1FYN A;  4IIO A;  2DA9 A;  1WDX A;  1NLO C;  1UJ0 A;  1Z9Q A;  1T3S A;  1CKA A;  3NHN A;  1YN8 A;  3H0H A;  4HVU A;  2EYY A;  2KNB B;  3M0U A;  2K79 A;  2SEM A;  4CC7 A;  2RMO A;  1TUC A;  3EG2 A;  2DX1 A;  2A37 A; 
#chains in the Genus database with same CATH topology
 2EBP A;  2R57 A;  3M56 A;  1EX4 A;  4LD6 A;  3M0P A;  3AT1 B;  4ANJ A;  1JU5 C;  4FM4 B;  3SWN B;  1PKS A;  3VS4 A;  3CCV T;  3BFM A;  1QKX A;  1D1A A;  2NWM A;  1TWB A;  3CCQ T;  2YLB A;  1AT1 B;  5I2S A;  1GCQ A;  3OYY A;  3MP1 A;  3OYD A;  4CRI A;  1M2V B;  2BUD A;  1YP5 A;  4IKF A;  4B9X A;  2CSI A;  2NUT B;  2DBK A;  2IIM A;  3CCJ A;  3TSW A;  4LXC A;  2DVE A;  2R58 A;  4B9W A;  4EDU A;  2M0Y A;  2MWO A;  3SWN A;  2LQK A;  1UDL A;  3CMA Q;  3CPW S;  4X9D A;  3EFR A;  3UWN A;  1NPR A;  4J9D A;  3OW2 A;  1K1Z A;  1WGS A;  3PT9 A;  1GFD A;  4OMQ A;  1QQJ A;  3S3N A;  3H0I A;  1BI3 A;  3M55 A;  2VXF A;  2VGM A;  1B34 B;  2V1R A;  5AT1 B;  3CME A;  4OB0 B;  1T3L A;  1Z9Z A;  3CQT A;  1Q86 U;  3I35 A;  4JRP A;  5GAO q;  1NEB A;  2L0A A;  4XTY A;  2PU9 B;  3MCA B;  2X4X A;  1RAD B;  2L3S A;  3A5Z B;  4J9I A;  1AWJ A;  2DZ9 A;  3REA B;  4A54 A;  3CCS A;  5GAN 5;  4E7H A;  1N27 A;  1I81 A;  2DMO A;  4OGC A;  1WHL A;  2E3I A;  1IZ6 A;  1JB0 E;  4AFQ C;  1Y96 B;  1B3Q A;  4PKC C;  1AZE A;  3UF4 A;  2YUN A;  7AT1 B;  2DJQ A;  4D8D A;  1QMC A;  3FEO A;  1JRI A;  1GRI A;  3O8V A;  4F14 A;  3E1S A;  5GAO n;  3RKX A;  3A1P A;  3KBG A;  3REB B;  4PJO A;  5GAN g;  4KRT A;  3A8M B;  3RKW A;  4X1V A;  1KFZ A;  2DER A;  4RTZ A;  2DF6 A;  3RKY A;  1M1F A;  1PWT A;  1RLP C;  2P0K A;  4RTY A;  1SF9 A;  1VIE A;  4OF1 A;  5KYU B;  2DD5 A;  2DL5 A;  3INZ A;  1KC8 C;  2Y90 A;  2CT4 A;  1VQ6 Q;  1IRE B;  1YIT Q;  2KRN A;  5I11 A;  4XTV A;  2A36 A;  1LOJ A;  3P8B B;  4J9E A;  5FWC A;  2EYX A;  1UFF A;  2X9H A;  3UT1 A;  4ZTJ A;  3CME T;  3CCM Q;  2KK4 A;  4C5E A;  3L1A A;  1QKW A;  5IXB A;  3EG9 A;  4FYY B;  4PJO D;  2P0P A;  2DXU A;  1O9S A;  1NLP C;  3M0T A;  4JJD A;  4E6R A;  1ABQ A;  2G3R A;  5FLX E;  4A4G A;  2DTI A;  1K73 C;  1YIJ T;  3CC2 T;  3L2W A;  3BW1 A;  2K3X A;  4XU3 A;  4LDW A;  3X26 B;  3LYI A;  2D8H A;  2CGH A;  4HCK A;  1QLY A;  4HKE A;  1YJ9 A;  2ED0 A;  4BI4 A;  1K0S A;  2KRO A;  2CUB A;  4PK4 A;  5FRO A;  2BZ8 A;  1SEM A;  5EC7 A;  4L59 A;  4RG2 A;  2JS2 A;  1YCS B;  2XG8 D;  2F2X A;  4JRQ A;  4C5G A;  4C92 A;  1YJN T;  4RMO A;  3JB9 F;  5KCH A;  2XKO C;  4PLI A;  2D1X A;  3HL8 A;  2H3J A;  2GNC A;  2VWF A;  1CSK A;  1BU1 A;  2LNV A;  1JQQ A;  1M8M A;  2E65 A;  1LJO A;  1I5O B;  2QA4 T;  1FMV A;  3QO3 A;  3CCE Q;  2RHX A;  3EG3 A;  2C06 A;  1GFC A;  1H92 A;  1KQS A;  1VQK T;  3CXC A;  2RJF A;  1BI1 A;  5DM7 R;  1ZSZ C;  2PZ1 A;  1ZSG A;  4LDX A;  1WHK A;  3CCL Q;  4E7I A;  1M3C A;  3TSZ A;  2M16 A;  4XK8 E;  3EG1 A;  4OMM A;  1VQ6 T;  1CKB A;  2DEU A;  4HCZ A;  4M7D B;  4C8Q C;  3EGD B;  3CC4 Q;  1M2O A;  2LT1 A;  3TEE A;  4HA8 A;  1VA7 A;  1WPY A;  1QVP A;  3LGF A;  5KYY A;  1OUL A;  3UA7 A;  2YXY A;  5GAN h;  3I56 A;  4ZGE B;  5FW9 A;  1JJ2 S;  2DVJ A;  1OPK A;  2KE9 A;  5IXF A;  1MND A;  2XDD A;  4M78 E;  3RMS A;  4JZ3 A;  1OEB A;  5CQY A;  2GF7 A;  3A98 A;  4PJL A;  2KRS A;  1M30 A;  1ZUU A;  1YIT A;  4E7J A;  5GMK j;  2BZY A;  1X6B A;  1GCQ C;  2RO0 A;  1XJW B;  1PD1 A;  2KRM A;  1G3Y A;  2CP6 A;  2F5T X;  2L3Q A;  2AKL A;  3VS5 A;  1X69 A;  1HD3 A;  3EG0 A;  2L3R A;  2LJ1 A;  1JXM A;  1VQM A;  1BCO A;  1LNX A;  4Z02 A;  2KAF A;  2M51 A;  4M77 B;  2F2V A;  3VJP A;  4M7A E;  4NL3 A;  2O01 E;  2DE0 X;  2YSQ A;  2DLP A;  2RH2 A;  2ZPB B;  2MWP A;  1K76 A;  2QYZ A;  2ZPE B;  1UE9 A;  2QDL A;  3CXC S;  3VRY A;  3EGX A;  1X27 A;  4ME7 A;  2DL7 A;  4M78 F;  4JZ4 A;  3X20 B;  4DBR A;  3MJX A;  2J6O A;  1Q81 R;  2ZZD A;  3QWY A;  1WQW A;  2DNU A;  5LJ3 d;  2HEQ A;  3LH0 A;  1E6H A;  1JO8 A;  1VQL T;  4DBH A;  1VQP Q;  3QSU A;  3LGL A;  3CCR Q;  3CMA A;  1G2B A;  1H64 1;  2LCC A;  3CPW A;  2DTH A;  1NJI U;  1YI2 A;  2E70 A;  4AFS C;  3MEU A;  1YBY A;  3E9G A;  4J83 A;  4RCB A;  2AZS A;  1UUE A;  2MMP A;  4BE2 A;  1Q86 C;  1JJ2 P;  1WZO A;  3OYC A;  2FZK B;  3VUZ A;  4AFU C;  4M7A F;  2FVU A;  1VQ7 A;  1VQ8 A;  2DXB A;  4M78 A;  2JM8 A;  4JS4 A;  1NG2 A;  3VYH B;  1VQ9 A;  3V7C A;  3OYE A;  2GGR A;  2FG0 A;  3JCM f;  3OYA A;  2EGA A;  3GIB A;  2FRY A;  5KE2 A;  2J7I A;  3MEA A;  2JUF A;  1EZZ B;  3EHQ A;  4ELY C;  1TUG B;  4RUG A;  3BDL A;  1HSQ A;  2JXB A;  5GMK h;  4C0D C;  1OQK A;  5HK0 A;  1YI2 Q;  2QQR A;  3QKJ A;  3BDU A;  1M3A A;  1ZSZ B;  1I07 A;  2K3B A;  4M75 E;  2COY A;  2QEX Q;  3DB4 A;  3S3M A;  2DTO A;  4C92 D;  1OX9 A;  1ZA2 B;  4FCY A;  3CCQ Q;  5GAN j;  1PNJ A;  5LJ5 j;  3CCU A;  1WDX A;  4F7U A;  5GAM h;  1Z9Q A;  3NHN A;  1YN8 A;  3H0H A;  4BB7 A;  2K79 A;  4RG8 A;  3ER0 A;  2DX1 A;  3TU4 K;  4MDX A;  2JVV A;  1BI2 A;  2KMT A;  1ZSZ A;  4ZNX A;  3BY7 A;  5FRN A;  1RUW A;  4YTL A;  4AMC A;  1LVK A;  3CCL A;  4R0K A;  1RAE B;  1U1S A;  4OVA A;  1X2K A;  2LMJ A;  4JS5 A;  2W10 A;  4PLL A;  1ZHI A;  2BZX A;  2VV5 A;  4ZN3 A;  5LJ3 j;  1O75 A;  1VQL Q;  4C5I A;  1RI9 A;  4EMK C;  3VV0 A;  1JJ2 A;  5CQX A;  1MV0 B;  1QVG P;  5LL6 S;  2CZ1 B;  4KGV B;  2GTO A;  1W1F A;  5IH2 A;  4FYW B;  1E7O A;  1TU0 B;  4Q5W A;  5GMK l;  2LQ8 A;  2DEQ A;  3QDR B;  2K5L A;  2IPO B;  1M90 C;  1UGV A;  4FL6 A;  5GAM j;  2RQU A;  2H8H A;  4LUE A;  1S72 T;  2O9V A;  1G8X A;  1T0J A;  2SRC A;  5KYX A;  2I0N A;  3CCE T;  2XU8 A;  2GBQ A;  2NUT A;  1Y96 A;  1AOJ A;  1WQ7 A;  3JAM E;  2O4X B;  3JCM J;  4J9C A;  4LDY A;  3A8O B;  5I21 A;  2D8J A;  3CEY A;  1VIF A;  3GBQ A;  4XU1 A;  2M1H A;  5FRM A;  2EJ9 A;  4Z89 A;  3RIR A;  4KBM B;  1QW1 A;  2QQA A;  4J9F A;  1K9M R;  4NOY A;  3NTK A;  3OBY A;  4RTW A;  2CZ0 B;  3EAE A;  5GAM f;  1K8A R;  3C94 A;  9ATC B;  4QKU A;  2NUZ A;  1IO6 A;  1YFN A;  2OTL T;  3E19 A;  1VQ5 Q;  3NMZ C;  4GY5 A;  2QQB A;  3MKD A;  2EQI A;  4IUV A;  2O88 A;  2YLC A;  1ZLM A;  2LVM A;  1RAB B;  1AD5 A;  5GAN 4;  2LP5 A;  1G3S A;  2CT3 A;  2J05 A;  1UEC A;  2HBW A;  2RJE A;  2K2V A;  1BBZ A;  2DYB A;  1D3B A;  2KQW A;  3EH1 A;  3SEM A;  2E10 A;  1WXT A;  1VQN A;  2A3L A;  2EGE A;  1YJ9 T;  4DBQ A;  1KQ1 A;  3I9Q A;  2JTE A;  2COZ A;  3R6N A;  2E4H A;  4HCC A;  1A0N B;  1GBR A;  1VYU A;  2NYS A;  4WF2 A;  1GCP A;  2RJD A;  4F16 A;  2D0N A;  1I5L A;  4RKU E;  3MO8 A;  1UHC A;  1W4S A;  4QT7 A;  3PVL A;  1IHW A;  3V8J A;  4II1 A;  2H3E B;  1F1B B;  1ZUY A;  4BDZ A;  4M4Z A;  2IVW A;  4LDV A;  3JCM P;  1UGQ B;  1M1G A;  1OX8 A;  2O2O A;  2RK1 A;  5KYU A;  1YJN Q;  3JCM g;  4FT4 A;  2O9S A;  2NUP A;  2ZPF B;  1QVF P;  1KIK A;  1QVF A;  1H3Z A;  3IQL A;  1QVG A;  4PJM A;  1K9M U;  3EHR A;  3PNW C;  3NFC A;  4EIK A;  1PSF A;  2MF2 A;  2C0I A;  2KSS A;  5LJ5 g;  3X28 B;  4JRK A;  3GP8 A;  4BE0 A;  3G4S T;  1VQP T;  2J06 A;  2KEA A;  2YT6 A;  1M1K U;  3GLX A;  2QEX T;  2EQU A;  3MP6 A;  3OY9 A;  2HCK A;  1WJS A;  5IHK A;  3CC4 T;  2LDM A;  1WFW A;  4Z88 A;  4J9G A;  1TS9 A;  3PMT A;  4VUB A;  3OYF A;  2XD0 A;  1G3W A;  4IIM A;  2JT4 A;  1VQO A;  3HHT B;  1MMA A;  1WI7 A;  4A53 A;  1M4Z A;  3NTH A;  1VQM Q;  3CBO A;  3TRE A;  4MML A;  1OYX A;  4JLG A;  4XQ3 A;  5HCK A;  8AT1 B;  8ATC B;  3ASK A;  1VQL A;  2HQH A;  1KJW A;  4IUR A;  2DL3 A;  3M5A A;  2M02 A;  2B8A A;  4GLM A;  3H9N A;  2DIL A;  1VQ6 A;  1T0H A;  1IB8 A;  3OS1 A;  2VAS A;  4CC4 B;  2HKQ B;  4J6X A;  3EFS A;  1VQ8 Q;  2RI3 A;  2MPX C;  5C6S A;  4CC2 A;  3EFO A;  4DEX A;  1RAF B;  2G6F X;  3NPF A;  3CCM A;  3CPW P;  5IHN A;  3L2Q A;  5GMK i;  4A4K A;  3LW5 E;  5GAO p;  1KD1 U;  3G6E T;  2VGN A;  2KT1 A;  3CCV A;  3QII A;  2DM1 A;  2QDY B;  4A4H A;  3LWH A;  3DKM A;  5EG2 A;  1VQN Q;  1Y7X A;  2EQM A;  3MP8 A;  2EQK A;  2M9U A;  4PFO A;  1I1J A;  2CDT A;  3OYJ A;  4QQD A;  3G6E A;  1TXQ A;  3EGD A;  5A0G A;  1WIE A;  3M0S A;  1YWP A;  3CCJ T;  3EFO B;  3H8Z A;  2HL5 C;  3O5Z A;  2EGC A;  5KYY B;  5C0M A;  2WAC A;  2COW A;  5CO7 A;  1M90 U;  3GOX A;  4O5V A;  3OYI A;  4IUQ A;  1VQ9 Q;  1OU8 A;  1UEB A;  4M75 F;  4M77 C;  4F04 B;  1NYG A;  4L6V 5;  3T9N A;  1KC8 U;  2RJC A;  4PNO A;  1TH7 A;  2CP3 A;  4R56 A;  1UJY A;  3RER A;  4QQG A;  5FU6 B;  2JTF A;  2Y4X A;  2KYM A;  1OOT A;  2DRK A;  2O31 A;  5IAY A;  1X01 A;  4BI3 A;  1ARK A;  2ESW A;  2X4Y A;  2ZAE A;  2V26 A;  4HVW A;  2CZ6 B;  1P92 A;  4M77 A;  1K9M C;  2PUO B;  1V76 A;  2JZ2 A;  1R77 A;  1KG1 A;  2R5M A;  1RLQ C;  4M7D E;  1Y57 A;  4KGZ B;  2PQW A;  1YHQ T;  5FU7 B;  1YI2 T;  2YDL A;  1N8R R;  1KD1 R;  3M9Q A;  3CCS Q;  4AG1 C;  1OV3 A;  4KT0 E;  1RAH B;  1XOV A;  2CUD A;  3CXC P;  5GAN 2;  3OW2 S;  1PSE A;  2JNG A;  3JB9 G;  2HKN A;  1C6V X;  1IXD A;  2YHT A;  3M59 A;  1SRM A;  2L8D A;  1V29 B;  4M7A G;  3G7Z A;  4M78 D;  2BE9 B;  3HRT A;  4HXJ A;  4ATO A;  3VKI A;  2YUO A;  2F1L A;  3GNF B;  2EKH A;  4LNP A;  4FSX A;  4F7U B;  1K4U S;  2YRV A;  2FPE A;  4K11 A;  3OQ5 A;  2HDA A;  3Q1J A;  4N4G A;  2P4R A;  2DXC A;  4TVR A;  2MYS A;  3I5S A;  1VOM A;  2R5A A;  1XTD A;  4OMF B;  2AIR B;  2C0T A;  1M8V A;  3FLG A;  1YJW A;  3M57 A;  4IUP A;  4M7D F;  2BIV A;  1VQ5 A;  5CVI A;  2EW3 A;  4EMH A;  1AHJ B;  1MUZ A;  5A0L A;  4P5N A;  2MAM A;  1PCX A;  5I2M A;  2E1H A;  3C12 A;  4PJO F;  2DA9 A;  1KK7 A;  4LDU A;  5LJ3 e;  2QA4 A;  1UJ0 A;  5DY9 A;  4HVU A;  2EYY A;  1UGS B;  4KGX B;  3M0U A;  4O6J A;  2QG9 B;  3G71 T;  2OTJ Q;  2QQ9 A;  3PTA A;  4DOW A;  1NBE B;  2RHZ A;  3OSS C;  5AYF A;  4AT1 B;  5CAI A;  3CCU Q;  3JSC A;  3HFN A;  1PKT A;  1YCY A;  2E12 A;  4XAX B;  3RR6 A;  1BI0 A;  3LX7 A;  5CKE A;  2K5I A;  1RAC B;  4FIB A;  5HK3 A;  3C0C A;  3WVE B;  2F5K A;  3HTR A;  3QWX X;  5GAN d;  2KI7 A;  1B34 A;  2DJZ A;  1M90 R;  2X4J A;  1XQH A;  4D8K A;  3D7S B;  1VQK Q;  1JEG A;  2JTM A;  4M78 C;  3HRS A;  3GPL A;  4QVZ A;  3OS5 A;  2OTL A;  2JMA A;  5KYW B;  1BIA A;  3OYL A;  1AVZ C;  1KC8 R;  2DL8 A;  5A2Q E;  1W2B S;  2CP5 A;  5LJ5 e;  3QHS A;  5GAN e;  4R55 A;  3NTI A;  5KE3 A;  2WSC E;  5GMK m;  1PD0 A;  2K6D A;  1G83 A;  2LNH B;  4OML A;  3WVD B;  3I55 A;  3KUF A;  2CKK A;  3ME9 A;  1K73 U;  4M75 B;  1MNE A;  5CIU A;  1X6O A;  2L5Q A;  2FL7 A;  1N9S A;  5DLQ E;  2P4T A;  2QEX A;  5KYW A;  1SHG A;  2EPD A;  4FU6 A;  4JJN K;  4E7K A;  1YJN A;  4XU0 A;  5IN1 A;  4J7F A;  4C8Q A;  4N4I A;  4XTU A;  4KH1 B;  2LT4 A;  4DQ2 A;  1D3B B;  2VB6 A;  1NE8 A;  3RBB B;  2D6F A;  1G3T A;  2LCS A;  4DA4 A;  2X3X D;  4EMK B;  2QK0 A;  5KYX B;  2OAU A;  2XI9 A;  1VQO T;  4JJC A;  1N8R U;  2QAZ A;  4Y91 A;  1X6G A;  4BUG A;  1X75 C;  3OB9 A;  4ZTF A;  3FC3 A;  5GAN 7;  3PIO A;  3U23 A;  3EH2 A;  2K4Y A;  1WLP B;  3FJ5 A;  3CCM T;  2EAY A;  2CS7 A;  2HSP A;  2JJ9 A;  4M77 D;  1PG5 B;  2RQV A;  3LWI A;  1BIB A;  5GAO l;  3CCU T;  3R6O A;  3EG9 B;  5KYN A;  2DXT A;  3CCJ Q;  4EMK A;  1NEG A;  3C95 A;  3V7R A;  5LJ5 h;  4FW1 A;  3JB9 J;  1IHV A;  1QCF A;  1UB4 A;  2P84 A;  3L2R A;  2Z0W A;  2E3H A;  4A4E A;  3JCM e;  3OMC A;  3RMQ A;  4M77 G;  2FPD A;  3HFO A;  2DK3 A;  2RHU A;  4J6W A;  2L89 A;  5IT9 E;  3LH5 A;  3JCM h;  3G4S Q;  4MMK A;  4PL6 A;  2CP7 A;  3L2U A;  5GJV B;  4E7S A;  5GAO r;  4AG2 C;  2MIO A;  1ZA1 B;  3DLM A;  2KVQ G;  4OMN A;  1D0X A;  1YIT T;  2Y4Y A;  3CBP A;  3UAT A;  3UDC A;  1Q86 R;  1YNZ A;  1Q82 U;  1V1C A;  1Q81 U;  4M7D D;  3N5B B;  4J9B A;  1AEY A;  2EVR A;  4DEY A;  2DET A;  2PTK A;  2AHJ B;  3MET A;  1W2B A;  1N8R C;  1VQM T;  2FRW A;  3JCM X;  4BAC A;  4C0G A;  3G4S A;  2K7A A;  2QGF B;  1VQP A;  4HT8 A;  4LD9 K;  3HRU A;  5GMK e;  4DBF A;  6AT1 B;  1YHQ Q;  4N0A A;  1KQS S;  1IGU A;  3CC7 A;  4WTO B;  1BYM A;  3CC2 Q;  2NUP B;  4BE1 A;  3PIP A;  1QVG S;  4J6Y A;  3CCL T;  5CK9 A;  3OYK A;  1VQ8 T;  4BDY A;  1ZQ1 A;  3FB9 A;  2EWN A;  4ESR A;  1ZBJ A;  2EYQ A;  2LQW A;  1VQ4 A;  4RCC A;  2BTT A;  1PRL C;  5HY6 A;  3X25 B;  2VYT A;  2E6Z A;  4E7L A;  3QG1 A;  3M0R A;  3G6E Q;  3MHX A;  2HD0 A;  2GQI A;  4X9C A;  4IUU A;  4NS5 A;  1SSH A;  4N0A C;  1YHQ A;  3J80 E;  3QDF A;  2KDS A;  4FYX B;  1H3H A;  3VRZ A;  4PFZ A;  2LX7 A;  2KY9 A;  1Q95 G;  1K8A C;  1MGQ A;  2K57 A;  5GJW B;  2MCN A;  3QJY A;  3RES A;  1QWF A;  4OB2 B;  3ZFJ A;  2EKO A;  4MZT A;  4LN2 A;  2B86 A;  1M3B A;  3VS6 A;  1MV3 A;  1VQ4 T;  3OYG A;  2CP0 A;  2E6N A;  2MK5 A;  1BK2 A;  2ENM A;  4N4H A;  1NJI R;  2RPN A;  1MMD A;  4HCB A;  2PVG B;  4JRI A;  1M9S A;  4M7A C;  3G71 Q;  2OTJ T;  1NZ9 A;  1PHT A;  1UG1 A;  1Q82 C;  3MEV A;  2FB7 A;  3L2V A;  4PJO C;  1I4K 1;  1VQ7 Q;  3OYM A;  3CC7 T;  5GAM e;  3OYH A;  3VU3 C;  1WJQ A;  2AKK A;  3QYG B;  5CKD A;  1NPP A;  2K3Y A;  3H6Z A;  2K5F A;  5GAN 8;  2PUK B;  2CZ7 B;  2HSE B;  1WHH A;  2DKG A;  3KFV A;  4LE9 A;  1D0Z A;  3SHW A;  3GF5 A;  3VYG A;  3G71 A;  3EGU A;  4M77 F;  1KQ2 A;  1FWZ A;  3CCE A;  1WXU A;  1KD1 C;  1WNL A;  1NJI C;  3AHU A;  2QXF A;  4F7U E;  2ABL A;  3UA6 A;  4X34 A;  1VQO Q;  1LCK A;  3CCS T;  1QP2 A;  1VYV A;  3DB3 A;  2V8J A;  2RD1 A;  1C1A A;  4GBQ A;  5CKF A;  5LJ5 d;  2EIF A;  2GCX A;  1U8R A;  2LZ6 B;  1OI1 A;  3HKS A;  4M78 B;  2RQR A;  1Q82 R;  3CC4 A;  1QVF S;  1M27 C;  1IGQ A;  1OZ2 A;  5J3B A;  1OU9 A;  4J5Y A;  4C8Q F;  2QQS A;  3NGP A;  2ECZ A;  2AK5 A;  2AZV A;  2MOX A;  2VUB A;  3OS0 A;  2OI3 A;  1YJW Q;  4C92 C;  3I55 Q;  3EGX B;  2A28 A;  1MMN A;  1YIJ Q;  4MZM A;  1WXB A;  1GXI E;  3DLL A;  1Q7Y C;  2CH4 A;  2WSE E;  1VUB A;  4M77 E;  1WHJ A;  2IG0 A;  4ZGD B;  2HL3 A;  2EFI A;  4HVV A;  3PMI A;  1RAG B;  3OS2 A;  3SWN C;  2BKD N;  4PJN A;  3M4G A;  4FT2 A;  5A0D A;  1M1K C;  1RAI B;  1SG5 A;  4J9H A;  1I0C A;  3CC7 Q;  3OYB A;  1G5V A;  2GTJ A;  3JB9 D;  1H8K A;  3ZL7 C;  4MDW A;  2LTO A;  2JW4 A;  2P0Q A;  2QTX A;  4OB3 B;  1HYO A;  3VS1 A;  3CC2 A;  1U3O A;  1B7T A;  2DBM A;  2E5K A;  2RNA A;  1WA7 A;  1Q7Y U;  5CKB A;  1X2Q A;  3WXM B;  4M7D G;  3JCM d;  5IHI A;  2V8K A;  1GBQ A;  4M7D C;  2ZPI B;  1FYN A;  2X4W A;  2ZPH B;  3ZBD A;  1RI0 A;  1T3S A;  1CKA A;  2DFU A;  5J39 A;  2XDP A;  4FYV B;  4CC7 A;  3OYN A;  2YRD A;  4IUT A;  2RMO A;  1C0M A;  3EG2 A;  2A37 A;  3E2U A;  2RM4 A;  2GFA A;  2OJ2 A;  2F69 A;  2XID A;  1M5Q 1;  1E6G A;  2XMF A;  2XK0 A;  4M75 C;  3THK A;  3SD4 A;  1Y07 A;  1FMW A;  4V2S A;  2AT1 B;  1ZX6 A;  4C8Q E;  3QPH A;  2JOY A;  3VS2 A;  4QQ6 A;  1TUD A;  3VS0 A;  1BB9 A;  3QUI A;  1S72 Q;  4C92 G;  3H0F A;  3SFM A;  3VUB A;  5GAN 3;  5L23 A;  2O4X A;  2KGT A;  1J3T A;  4A63 B;  1W70 A;  2LC4 A;  3I56 T;  2EJG A;  3QZ9 B;  2K9G A;  4PJO E;  2PVD B;  1B07 A;  2FYK A;  3QBY A;  2KR3 A;  4BY6 B;  2HAX A;  3LLR A;  3M0Q A;  1HXD A;  3JCM W;  2EYW A;  3S3O A;  4OB1 B;  3RNJ A;  2RQT A;  5HKC A;  4ORZ A;  4MZP A;  1MMG A;  4L5G A;  1Q7Y R;  2KXC A;  1TOV A;  4OP0 A;  1W6X A;  4JUV A;  3UPU A;  3A8H B;  2QGG A;  1D1B A;  2V8I A;  4FW2 A;  1FMK A;  2HZY A;  3CMA T;  1BKB A;  3CCR A;  5D6W A;  5DLO A;  4KUI A;  4C8Q D;  2RN8 A;  2DO3 A;  4Y28 E;  1D0Y A;  2DYI A;  4FSS A;  3L42 A;  3PVQ A;  2RHY A;  2FZG B;  5LJ3 g;  3A8G B;  1VQ4 Q;  2E5Q A;  2YUP A;  2V1Q A;  5KH6 A;  4GLK A;  3RUX A;  2YWW A;  3TQ7 P;  3KXT A;  1KHI A;  2CRE A;  4CI0 C;  3SDZ A;  1LPL A;  2A08 A;  4M75 A;  1VQ9 T;  1N9R A;  2KT8 A;  3FIF A;  1Q81 C;  1U1T A;  4J8O A;  3J7A F;  2RA2 A;  2J6F A;  5FU7 C;  4XTZ A;  2X3W D;  4C8Q B;  4OMP A;  1K9A A;  4F7U G;  1WHM A;  5ECA A;  1U5S A;  2YRC A;  4NL2 A;  2DAQ A;  3TCJ A;  2ED1 A;  3OW2 P;  2CYZ B;  3JB9 H;  5D6Y A;  5CR2 A;  1X43 A;  3M53 A;  2X51 A;  3G1J A;  4HT9 A;  4RTV A;  2GFU A;  1WHG A;  3S6W A;  1N5Z A;  1SHF A;  1U06 A;  2FEI A;  4PJO B;  3F70 A;  5FU6 C;  4E2F B;  1HJD A;  2ZGW A;  4Z8A A;  3SB2 A;  4F17 A;  3I5R A;  4ZGJ B;  3CCQ A;  3VS3 A;  1YJ9 Q;  4RTU A;  1FX7 A;  2LX9 A;  4UC4 A;  1NM7 A;  2I2L A;  4Y92 A;  3JCM c;  2LQN A;  4C92 B;  3ULR B;  4EMG A;  1FXX A;  3VS7 A;  3CCV Q;  2YUQ A;  4JLI A;  3JRZ A;  1DJ7 B;  5I22 A;  2D9T A;  2ROL A;  2VC8 A;  4CC3 A;  1HK9 A;  1WJR A;  2PVO B;  4B6M A;  3CME Q;  4EPC A;  1QCO A;  4QVC A;  3QYH B;  4KH0 B;  1YJW T;  3PE0 A;  3J81 E;  4JPB W;  4JJB A;  3QXE B;  3H41 A;  1WYX A;  3MPU B;  4M78 G;  2BE7 D;  4M7A B;  2LJ3 A;  2XDB A;  1SKU B;  3FRN A;  2KXD A;  4BI8 B;  2RF0 A;  4M7D A;  2M0O A;  1S72 A;  1VYT A;  1ZBX A;  2FO0 A;  2LCL A;  3HP9 A;  2DD4 A;  2RB6 A;  1D1C A;  3CD6 Q;  2QI2 A;  2DL4 A;  1Y71 A;  2HMA A;  3CPF A;  4QVD A;  5CCA A;  1RL2 A;  1VQ7 T;  2MI6 A;  1ZUK A;  4A4F A;  1Y0M A;  3URG A;  3L2Z A;  4PFP A;  2OAW A;  5D7U A;  2CH4 W;  5LJ5 f;  4M7A A;  5GAO m;  5GAN f;  4WCI A;  1YWO A;  1VQN T;  1I8F A;  2DPP B;  4XU2 A;  2KYB A;  2DIQ A;  4C8Q G;  1TTH B;  1UHF A;  3P8D A;  3QJ6 A;  1EFN A;  2QA4 Q;  3P8H A;  5KCO A;  3E9F A;  3RDV A;  2D0Q B;  4C92 E;  1K8A U;  1GL5 A;  2RI2 A;  2OTJ A;  2W0Z A;  3HPW A;  3QZ5 B;  4KUD K;  1R0C B;  2EYZ A;  1QCN A;  2FHD A;  1SPK A;  2VKN A;  2QAS A;  1K0X A;  1KHC A;  5L8R E;  4PJO G;  5LJ3 h;  4XTX A;  2CSQ A;  4DOV A;  4BY6 C;  3JV3 A;  1NYF A;  1VQ5 T;  1JXO A;  1UGP B;  2LJ0 A;  4OMO A;  4ELZ C;  4C0F A;  1AWW A;  3TVT A;  2J6K A;  1BCM A;  2HBP A;  1AWO A;  2JS0 A;  1VQK A;  2WSF E;  2FZC B;  3OA6 A;  1XNI A;  3FJP A;  2C0O A;  1YIJ A;  3JCM V;  1QP3 A;  5FWB A;  2JM9 A;  2HQE A;  3JCM Q;  3I55 T;  4C5H A;  3I56 Q;  4XTW A;  3JB9 I;  1WX6 A;  1PRM C;  2ROT A;  4M75 D;  3M54 A;  1RAA B;  5D6X A;  2ZCF B;  1OPL A;  1K73 R;  1SSF A;  5M9O A;  3GNG A;  2F2W A;  3CD6 T;  2CP2 A;  1PM3 A;  4M75 G;  5GAM d;  4RTT A;  1UGR B;  5LJ3 f;  3MEW A;  2VXE A;  3HSB A;  2XHC A;  1N6A A;  2XIC A;  2DRM A;  3PFS A;  2L2P A;  2JN0 A;  1R8O B;  1TG0 A;  2LRQ A;  2RK2 A;  4E7Z A;  2HQX A;  2K2M A;  3A8L B;  1AWX A;  3JCM b;  2FPF A;  4C0Z A;  2E64 A;  4C92 F;  1PC0 A;  1KQS P;  4JDS A;  3OBW A;  3BE3 A;  1D09 B;  1M1K R;  2EJF A;  4J7I A;  4OGE A;  3OMG A;  2ATC B;  2E41 A;  2KBT A;  2QTV A;  2DIG A;  3CD6 A;  2A0F B;  3FDR A;  3CBM A;  4KUL A;  3C4S A;  1R0B G;  1S1N A;  1MHN A;  1KSW A;  4ZN1 A;  4F7U F;  3X24 B;  3OSV A;  1ACM B;  2OX7 A;  4QW2 A;  3V7S A;  3PGG A;  5GAM g;  1ABO A;  2PNI A;  4D6W A;  1UTI A;  2JMC A;  1SRL A;  3M58 A;  1AZG B;  1IRX A;  2DZC A;  2L3P A;  4RTX A;  1OZ3 A;  2GQV A;  4E47 A;  2HNI A;  3CCR T;  4C0D B;  2RQW A;  3ZEH A;  5GAN 6;  2EQJ A;  1TSF A;  1EIF A;  2VVK A;  4AFZ C;  4LUD A;  2OTL Q;  5CKH A;  1QWE A;  1JBM A;  4M7A D;  2X35 A;  1W2B P;  2ZPG B;  4IIO A;  5J26 A;  3V8L A;  1NLO C;  2A7Y A;  2RI5 A;  1M2V A;  2KNB B;  3V8K A;  2SEM A;  3M4Y A;  4PJJ A;  2NLU A;  4BD3 A;  1TUC A;  2RHI A; 
#chains in the Genus database with same CATH homology
 2EBP A;  2OJ2 A;  3M0P A;  4ZNX A;  1RUW A;  1E6G A;  1JU5 C;  4R0K A;  2XMF A;  1PKS A;  3VS4 A;  3THK A;  1X2K A;  1QKX A;  2LMJ A;  1PKT A;  2NWM A;  2W10 A;  1ZX6 A;  2BZX A;  3VS2 A;  1GCQ A;  1TUD A;  3VS0 A;  1YP5 A;  1BB9 A;  3C0C A;  1RI9 A;  3H0F A;  2CSI A;  3QWX X;  2DBK A;  2IIM A;  5L23 A;  2KGT A;  1J3T A;  3TSW A;  1MV0 B;  4D8K A;  4A63 B;  1W70 A;  2GTO A;  1W1F A;  1JEG A;  5IH2 A;  1E7O A;  2M0Y A;  2JMA A;  1UDL A;  2K9G A;  1B07 A;  1AVZ C;  2KR3 A;  2DL8 A;  1UGV A;  3M0Q A;  2RQU A;  2H8H A;  4J9D A;  4LUE A;  1K1Z A;  2EYW A;  2O9V A;  2K6D A;  1G83 A;  2LNH B;  4OML A;  4OMQ A;  1GFD A;  1T0J A;  2SRC A;  3H0I A;  3RNJ A;  2RQT A;  2I0N A;  2GBQ A;  4ORZ A;  1AOJ A;  2V1R A;  4J9C A;  1T3L A;  2D8J A;  2KXC A;  1Z9Z A;  3CQT A;  1W6X A;  3I35 A;  3GBQ A;  4Z89 A;  1NEB A;  1SHG A;  2EPD A;  2L0A A;  4J9F A;  1FMK A;  4RTW A;  2L3S A;  3RBB B;  2RN8 A;  4J9I A;  1AWJ A;  3REA B;  2LCS A;  2X3X D;  4FSS A;  3PVQ A;  2DMO A;  4JJC A;  2YUP A;  2V1Q A;  2NUZ A;  4AFQ C;  1B3Q A;  1AZE A;  3UF4 A;  1IO6 A;  1X6G A;  2YUN A;  2DJQ A;  3NMZ C;  2CRE A;  4D8D A;  2A08 A;  1GRI A;  2EQI A;  4F14 A;  2KT8 A;  3U23 A;  2O88 A;  1ZLM A;  2J6F A;  3REB B;  1AD5 A;  2LP5 A;  1WLP B;  3FJ5 A;  2CT3 A;  2J05 A;  2X3W D;  4KRT A;  4X1V A;  1UEC A;  2HBW A;  2HSP A;  1KFZ A;  4OMP A;  4RTZ A;  1BBZ A;  2DF6 A;  2DYB A;  2RQV A;  1K9A A;  1PWT A;  5ECA A;  1RLP C;  1U5S A;  3SEM A;  4RTY A;  1NEG A;  1WXT A;  2EGE A;  2DL5 A;  3I9Q A;  2JTE A;  1QCF A;  2CT4 A;  2ED1 A;  3R6N A;  1X43 A;  2KRN A;  5I11 A;  1A0N B;  1GBR A;  1VYU A;  2A36 A;  4RTV A;  1GCP A;  4J9E A;  4F16 A;  2FPD A;  2D0N A;  5FWC A;  1N5Z A;  1SHF A;  1U06 A;  1UHC A;  2FEI A;  2EYX A;  1UFF A;  4QT7 A;  3LH5 A;  3PVL A;  5GJV B;  1HJD A;  4Z8A A;  1ZUY A;  4AG2 C;  2MIO A;  3I5R A;  4F17 A;  4M4Z A;  1QKW A;  5IXB A;  3VS3 A;  4RTU A;  4OMN A;  1NM7 A;  2O2O A;  4Y92 A;  2LQN A;  1NLP C;  3UAT A;  2O9S A;  3ULR B;  3M0T A;  4JJD A;  1YNZ A;  4E6R A;  1ABQ A;  1V1C A;  3VS7 A;  4J9B A;  1KIK A;  1AEY A;  2YUQ A;  3IQL A;  2EVR A;  3EHR A;  4DEY A;  2PTK A;  4EIK A;  2C0I A;  2D8H A;  4HCK A;  1QLY A;  5I22 A;  2FRW A;  2ED0 A;  2ROL A;  4CC3 A;  2K7A A;  1K0S A;  2KRO A;  2CUB A;  2BZ8 A;  1SEM A;  5EC7 A;  2J06 A;  2KEA A;  2YT6 A;  2JS2 A;  1YCS B;  2F2X A;  3PE0 A;  4JPB W;  4JJB A;  2HCK A;  3H41 A;  1WYX A;  5IHK A;  2D1X A;  1WFW A;  2GNC A;  2VWF A;  4Z88 A;  2LJ3 A;  4J9G A;  1CSK A;  1BU1 A;  2KXD A;  2RF0 A;  1JQQ A;  2JT4 A;  4IIM A;  4ESR A;  1M8M A;  1ZBJ A;  1WI7 A;  1VYT A;  2FO0 A;  2LQW A;  2BTT A;  1PRL C;  3EG3 A;  1GFC A;  2DL4 A;  3M0R A;  5HCK A;  1H92 A;  2GQI A;  1SSH A;  1KJW A;  2PZ1 A;  1ZUK A;  1ZSG A;  1H3H A;  2DL3 A;  1Y0M A;  3VRZ A;  1M3C A;  2LX7 A;  2DIL A;  4GLM A;  3TSZ A;  1T0H A;  2OAW A;  3EG1 A;  2CH4 W;  4OMM A;  5GJW B;  2MCN A;  4WCI A;  1CKB A;  1YWO A;  4CC4 B;  1QWF A;  2KYB A;  4LN2 A;  2B86 A;  4CC2 A;  1M3B A;  3VS6 A;  4DEX A;  1MV3 A;  1VA7 A;  2G6F X;  3NPF A;  1UHF A;  1EFN A;  3UA7 A;  5IHN A;  1BK2 A;  2ENM A;  5FW9 A;  1GL5 A;  2KT1 A;  2RPN A;  2DM1 A;  2DVJ A;  1OPK A;  2W0Z A;  2KE9 A;  5IXF A;  1PHT A;  1UG1 A;  2EYZ A;  1SPK A;  1OEB A;  4JZ3 A;  2VKN A;  3A98 A;  1K0X A;  1I1J A;  2KRS A;  1M30 A;  1ZUU A;  2CDT A;  2BZY A;  1WIE A;  3M0S A;  2AKK A;  1YWP A;  2CSQ A;  3O5Z A;  2EGC A;  1X6B A;  1GCQ C;  3JV3 A;  2KRM A;  1NYF A;  1JXO A;  2L3Q A;  2LJ0 A;  2AKL A;  3VS5 A;  4OMO A;  1X69 A;  1HD3 A;  3EG0 A;  1AWW A;  2LJ1 A;  1JXM A;  3TVT A;  2J6K A;  3KFV A;  1AWO A;  2M51 A;  2JS0 A;  1NYG A;  2F2V A;  4LE9 A;  3SHW A;  2C0O A;  3EGU A;  5FWB A;  2JM9 A;  2DE0 X;  1UJY A;  1WXU A;  2YSQ A;  2DLP A;  1K76 A;  2ABL A;  2KYM A;  3UA6 A;  1OOT A;  2DRK A;  2O31 A;  1WX6 A;  1PRM C;  1LCK A;  1UE9 A;  2ROT A;  2QDL A;  1VYV A;  3VRY A;  1X27 A;  4GBQ A;  1OPL A;  2DL7 A;  1ARK A;  2ESW A;  2LZ6 B;  2F2W A;  4JZ4 A;  4HVW A;  4RTT A;  2J6O A;  2RQR A;  3QWY A;  1M27 C;  2DRM A;  2DNU A;  2L2P A;  1RLQ C;  2HEQ A;  1E6H A;  1JO8 A;  1Y57 A;  1TG0 A;  3NGP A;  2ECZ A;  2AK5 A;  2AZV A;  2K2M A;  2MOX A;  2OI3 A;  1G2B A;  1AWX A;  2YDL A;  4AFS C;  4AG1 C;  1OV3 A;  2FPF A;  2AZS A;  1UUE A;  2A28 A;  1XOV A;  2CUD A;  1WXB A;  2CH4 A;  4AFU C;  1SRM A;  2KBT A;  2JM8 A;  1S1N A;  1NG2 A;  4HXJ A;  4HVV A;  1KSW A;  2YUO A;  2GGR A;  2FG0 A;  2EKH A;  2EGA A;  4LNP A;  2FRY A;  4J9H A;  1K4U S;  1I0C A;  1ABO A;  2J7I A;  2PNI A;  1UTI A;  2JMC A;  1SRL A;  2FPE A;  3EHQ A;  4K11 A;  2GTJ A;  1AZG B;  2HDA A;  4RUG A;  1H8K A;  3ZL7 C;  1HSQ A;  2JXB A;  2L3P A;  2P4R A;  4RTX A;  3I5S A;  2JW4 A;  2RQW A;  1M3A A;  1I07 A;  2K3B A;  3VS1 A;  2C0T A;  1U3O A;  2VVK A;  4AFZ C;  2DBM A;  2E5K A;  4LUD A;  2RNA A;  1WA7 A;  1QWE A;  2EW3 A;  1X2Q A;  1MUZ A;  5IHI A;  1PNJ A;  1GBQ A;  1FYN A;  4IIO A;  2DA9 A;  1WDX A;  1NLO C;  1UJ0 A;  1Z9Q A;  1T3S A;  1CKA A;  3NHN A;  1YN8 A;  3H0H A;  4HVU A;  2EYY A;  2KNB B;  3M0U A;  2K79 A;  2SEM A;  4CC7 A;  2RMO A;  1TUC A;  3EG2 A;  2DX1 A;  2A37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...