1UDLA

The solution structure of the fifth sh3 domain of intersectin 2 (kiaa1256)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
98
structure length
98
Chain Sequence
GSSGSSGQKGWFPASHVKLLGPSSERATPAFHPVCQVIAMYDYAANNEDELSFSKGQLINVMNKDDPDWWQGEINGVTGLFPSNYVKMTTDSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords intersectin 2
publication title The solution structure of the fifth SH3 domain of intersectin 2 (KIAA1256)
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 6
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1udlA00
1Z9QA 2KNBB 1MUZA 4IIOA 2AKKA 2DNUA 2EYYA 3VS5A 1QCFA 2MCNA 1ABOA 2C0OA 1KSWA 2L3PA 1RLPC 2JM9A 2GNCA 4KRTA 1VA7A 4J9CA 3NHNA 1AWWA 2RMOA 1K0SA 1TUCA 1RI9A 1WFWA 1KJWA 1NM7A 2A36A 4AG2C 1SRLA 1ZUKA 2YUQA 1AZEA 2CUBA 2D8JA 1NYFA 1JXMA 4JJDA 5IXFA 1ZBJA 1ZX6A 1UUEA 1J3TA 2KBTA 2DRKA 2PZ1A 1ZSGA 2RN8A 2KT1A 3VS2A 1M3AA 2V1QA 1UG1A 2LZ6B 1E6GA 4AFQC 2K79A 4LUDA 1AVZC 2DYBA 3SHWA 1ARKA 5I22A 4RTTA 2P4RA 1X27A 2A28A 2JT4A 2DF6A 3NMZC 1BK2A 3H0HA 1IO6A 1E7OA 1RLQC 3EG3A 3UATA 1OOTA 2GTJA 2FG0A 2KROA 4M4ZA 1OPKA 1WIEA 2RF0A 2A08A 1Y57A 4WCIA 1H8KA 4J9IA 2HBWA 2DL7A 3VS0A 2JMCA 1JQQA 4JJBA 1E6HA 4LUEA 1YP5A 2C0TA 2F2VA 2JM8A 4J9FA 2CUDA 1GCQA 1Z9ZA 3NGPA 1LCKA 2K9GA 4OMLA 4Y92A 1AWJA 4OMQA 1WXTA 2NWMA 4CC3A 2YDLA 4K11A 2FPEA 1CKBA 2EYWA 1SPKA 1H3HA 2VVKA 2O88A 2C0IA 1NEGA 1X6BA 2B86A 2DL5A 1K1ZA 2KR3A 2JS2A 1KFZA 2W10A 2XMFA 3EG0A 2BZYA 1GCQC 3EHQA 4EIKA 4D8KA 1HSQA 1SEMA 1K9AA 1EFNA 2RQVA 2KXCA 2DL8A 2JMAA 1UHFA 2DVJA 4X1VA 3REAB 1SHFA 2I0NA 1OV3A 5IH2A 1MV0B 1K0XA 2KGTA 2KRNA 3O5ZA 2YUOA 1UECA 2L3QA 1GL5A 3M0UA 3H0IA 2O31A 2KT8A 2DE0X 2QDLA 3C0CA 1T0JA 2O9SA 2JXBA 1SRMA 1NYGA 2L0AA 2YSQA 2EGAA 1SSHA 4HVUA 2EYXA 2O2OA 2KEAA 4CC4B 2LMJA 2RPNA 1N5ZA 2KRMA 1GFCA 1M3CA 2FO0A 2EPDA 2SRCA 1ZLMA 5I11A 1G83A 2MIOA 1WXUA 4JZ3A 2KE9A 3VS4A 4CC7A 3ZL7C 2DLPA 1TUDA 2DBKA 2M0YA 4DEYA 4Z88A 2AK5A 2MOXA 3TSZA 3PVQA 2GBQA 1UFFA 1X43A 1GBRA 2X3WD 2DJQA 2OAWA 4J9BA 2VWFA 4AFZC 2NUZA 1UE9A 2ED1A 2LNHB 1U3OA 4JJCA 1T0HA 2L3SA 4J9DA 2GGRA 1X6GA 4J9GA 2ABLA 3R6NA 1S1NA 4HVWA 1WXBA 5GJVB 2E5KA 3VS3A 1YCSB 1A0NB 4OMMA 1GFDA 3M0SA 5FWCA 2PTKA 2BTTA 2ED0A 1HJDA 1K4US 1FMKA 5FWBA 2ROLA 1PKTA 2K7AA 3A98A 1AEYA 2CT4A 1WI7A 3FJ5A 2EGEA 3M0RA 3IQLA 2CH4A 3RNJA 3VRZA 2CREA 3M0TA 2RNAA 2DMOA 3REBB 4ZNXA 2ESWA 3LH5A 2CH4W 1OEBA 4ESRA 1B3QA 3GBQA 4OMPA 5IXBA 2LCSA 1NLOC 2JW4A 1QKWA 2V1RA 1UJYA 4CC2A 2AZSA 2CDTA 2EGCA 1QWEA 3SEMA 3UA6A 3VS6A 1BB9A 2KXDA 5IHNA 3VS7A 1M27C 2X3XD 5EC7A 1PKSA 1U5SA 4OMOA 4FSSA 1KIKA 2A37A 2J06A 3I9QA 1PRLC 3UA7A 1M3BA 1YWOA 2J6FA 3VRYA 3H41A 1GBQA 1M8MA 1W6XA 4J9HA 1AWXA 1ZUUA 2FPFA 1I1JA 2YT6A 2YUNA 2LP5A 4Z8AA 1JU5C 2CSIA 1VYUA 2GTOA 1AWOA 1YN8A 5HCKA 1JO8A 1QLYA 1GCPA 2FPDA 1YWPA 1SHGA 1XOVA 2H8HA 3U23A 1W1FA 4F14A 3QWXX 1I0CA 2FRWA 1T3LA 4RTXA 4OMNA 4RTZA 2GQIA 3QWYA 2J05A 4LN2A 1FYNA 1QWFA 2F2WA 5ECAA 1YNZA 2ENMA 1JXOA 4JZ4A 2OI3A 1HD3A 1X69A 3ULRB 4J9EA 1X2QA 2DX1A 2JS0A 2FRYA 3VS1A 3I5RA 1UTIA 1NG2A 1U06A 1UGVA 3M0QA 3PE0A 4GLMA 1AOJA 3PVLA 3TSWA 2O9VA 1B07A 1VYTA 2DRMA 3UF4A 2HCKA 4AG1C 2J6KA 3M0PA 3JV3A 1ABQA 2YUPA 4F17A 4DEXA 2ECZA 1OPLA 3EG1A 2DA9A 2HSPA 2EBPA 2EYZA 5IHKA 4QT7A 2G6FX 4IIMA 4E6RA 1UHCA 4R0KA 4RTWA 1PWTA 1H92A 2RQTA 1K76A 2L2PA 2VKNA 1BU1A 2F2XA 2KYMA 2KYBA 5GJWB 1V1CA 1X2KA 1M30A 1JEGA 1ZUYA 4JPBW 4LNPA 2EKHA 1MV3A 2K6DA 2K3BA 4A63B 2LX7A 4HXJA 2AKLA 2JTEA 1WA7A 1PHTA 3THKA 1RUWA 1I07A 1NLPC 5IHIA 3CQTA 2RQUA 2SEMA 3TVTA 2EVRA 4AFUC 2LQWA 4ORZA 3I5SA 2W0ZA 4AFSC 4F16A 3EG2A 3H0FA 1CSKA 2DILA 5L23A 1WDXA 3KFVA 3RBBB 2AZVA 1WLPB 4D8DA 2BZ8A 1Y0MA 2D8HA 2CT3A 2RQWA 1VYVA 2HEQA 1TG0A 1G2BA 2OJ2A 4LE9A 1GRIA 3EHRA 4HVVA 2KRSA 2DBMA 2LJ0A 2IIMA 4RUGA 2HDAA 2J7IA 1UDLA 3I35A 2D1XA 3NPFA 1PRMC 2J6OA 2CSQA 2DL3A 4RTVA 2DL4A 1UJ0A 1AZGB 2D0NA 2K2MA 2ROTA 3EGUA 2LQNA 1AD5A 4HCKA 1CKAA 2PNIA 2LJ1A 2LJ3A 1QKXA 2FEIA 2EW3A 2DM1A 1WYXA 2M51A 4Z89A 4RTUA 1WX6A 1PNJA 1NEBA 1T3SA 2RQRA 5FW9A 2EQIA 4GBQA 4RTYA 1BBZA 2BZXA 1W70A
chains in the Genus database with same CATH superfamily
1Z9QA 3C12A 1MUZA 4RCBA 1JJ2S 2AKKA 3CPFA 3NTKA 8ATCB 3I56Q 1NJIC 1WHMA 1YI2T 1RLPC 4J9CA 1K8AU 1M90C 2RMOA 5KYUA 1O75A 1TUCA 1RI9A 1QVFP 1KJWA 2A36A 3OMCA 5LJ3j 2YUQA 4E7KA 2ZPBB 2CUBA 4Q5WA 1JXMA 1ZBJA 3JB9H 1ZX6A 5LJ3f 3X20B 3CXCP 3CXCA 1ZHIA 2RN8A 4M78A 3BFMA 3CBPA 5IT9E 3VS2A 4BDZA 2V1QA 1NBEB 4C92D 4LUDA 2QEXQ 5KYYA 9ATCB 2JT4A 2FL7A 1YBYA 4PJMA 1KQSA 1MMAA 1H3ZA 1WQ7A 2BKDN 3EG3A 1ZSZC 3UATA 1OOTA 2GTJA 2ZPEB 5GMKe 1BYMA 1OPKA 3UWNA 4ZTFA 4A4EA 3A5ZB 4J5YA 1VQ5Q 2HBWA 1YJ9Q 2JMCA 1JQQA 2C0TA 5KYWB 3DB4A 4C5IA 1K9MC 4V2SA 1U8RA 2HQHA 2KI7A 2NWMA 4M7DE 1I5OB 1SPKA 2EIFA 2VVKA 3A8HB 1M8VA 3CCET 2KR3A 1D1AA 1AHJB 1TWBA 1KFZA 2CZ6B 1VQ9A 3X28B 1YJNQ 5LJ5f 1QW1A 1NPRA 3EHQA 4PJOG 4EIKA 1SEMA 1NZ9A 2RQVA 3L2RA 2DL8A 2VYTA 1SHFA 3VJPA 2I0NA 1OV3A 2HQXA 3CMAQ 1K0XA 3V7SA 1FXXA 4M7AG 2KRNA 3ER0A 5HY6A 3OB9A 3H0IA 1SG5A 2O31A 3PMIA 1VQOA 3QXEB 5LJ3g 4F04B 1RACB 1Q81U 4KBMB 4IKFA 1SRMA 1NYGA 5LJ5e 1QQJA 1SF9A 4RCCA 4QKUA 4PJNA 2O2OA 4C8QF 1IREB 2IPOB 3SWNC 2YRCA 4CC4B 4EPCA 1VQNQ 2LMJA 1EZZB 1Y71A 3JB9I 3LYIA 1VQMA 5FU6C 1D0YA 3JCMP 1G3YA 1ZLMA 3CC2A 5DM7R 2EQJA 1WXUA 4PFOA 2DLPA 1VQLT 1I5LA 4BE1A 2H3JA 1R0BG 2QASA 4BACA 2JTMA 3G6ET 2M0YA 5GANj 1UGPB 4JJNK 3CCRT 3CC7Q 2AK5A 3URGA 1GBRA 5GANf 4FYYB 2NYSA 4AFZC 2NUZA 1UE9A 2ED1A 3CD6Q 4MDWA 1U3OA 1UEBA 2QA4Q 2WSEE 4R56A 1YHQA 5GMKh 3H9NA 1M1FA 3RMSA 5D6YA 4ANJA 2QDYB 3VUBA 3M0SA 5FWCA 2PTKA 1TXQA 2CP6A 4M75C 3S3OA 2NUPB 2K7AA 1AEYA 4XQ3A 4C5EA 1G3WA 3TREA 1Q81C 3FJ5A 5CVIA 1Q86R 5A2QE 4C8QE 2C06A 3P8BB 2RNAA 4A53A 3I56A 1VQ4T 3CCUT 4ZNXA 2ESWA 2E65A 1N6AA 2CH4W 2KQWA 1EIFA 1KQSS 1X6OA 4C5GA 2NLUA 1B3QA 3L2WA 3HL8A 1MGQA 2COZA 5IXBA 2JW4A 4QVZA 4UC4A 1QKWA 3UDCA 1YITQ 3INZA 3OYYA 3RR6A 3SEMA 3VS6A 3VS7A 3CPWS 2DXCA 1M27C 4JLIA 5EC7A 1U5SA 2QEXA 4FIBA 5LJ5h 1KIKA 1PRLC 4KH0B 4PK4A 3CCVT 2J6FA 3H41A 3MEWA 5GANg 5GAOl 1ZUUA 4FYWB 3OYHA 1K73U 2FPFA 2HSEB 4J6YA 3CCEQ 2YT6A 4ME7A 2CSIA 3RUXA 1VQ5A 1YJ9A 1D0XA 2LCCA 4JRPA 5GAN3 1BCOA 3G4SQ 1JO8A 3PFSA 1SHGA 2DIGA 3U23A 1W1FA 3QWXX 4ZTJA 4RTZA 4NOYA 5CR2A 4M7DC 3QWYA 4OMFB 4PJOF 1FYNA 3RMQA 2F2WA 4C92B 1YNZA 2ENMA 2IG0A 1HD3A 1OYXA 2E41A 2JS0A 4EMKA 2BIVA 2FRYA 3VS1A 5GAN6 1AT1B 2LNVA 1NG2A 1U06A 4M7AF 1YJNA 1AOJA 1Q7YC 2O9VA 4X34A 1VYTA 4EMKB 3UF4A 1ABQA 1BI2A 4DEXA 2ECZA 4AMCA 3EG1A 1QP3A 3GNGA 3CMAA 4FT4A 3PIPA 1UHCA 4R0KA 1PM3A 4AT1B 1XQHA 4DOVA 4IUUA 3EGXA 1VQLQ 2VGNA 4L59A 2F2XA 1RAFB 1QP2A 3L2VA 3G6EQ 1XJWB 3CCRQ 1M30A 2ZPIB 2JTFA 2K3BA 3OYEA 4M78D 3OS2A 3MO8A 1M1GA 2YXYA 1QVPA 1KC8R 1VQNA 4HKEA 2V8KA 3QDFA 3QSUA 5IHIA 2HL3A 4B6MA 1OU8A 2LQWA 2RK1A 5GAN7 3HHTB 4M77A 1WDXA 1VQ7Q 2ZCFB 2AZVA 3NTIA 1Y0MA 5HK3A 2DERA 2XDPA 4EMGA 3CC7A 4PJOE 4C0FA 1TG0A 1YFNA 3EHRA 4LDXA 5I2MA 2KRSA 3CD6A 2DBMA 4GLKA 2IIMA 3M59A 5KCOA 2QA4A 3V8KA 4M7AE 1KQ2A 1KC8U 1JJ2P 2JUFA 2QK0A 2HZYA 2CSQA 2PUOB 2DL4A 1AZGB 1VQ4Q 3CCUQ 2ROTA 2K2MA 3EGUA 3PT9A 4C5HA 2HKQB 3BW1A 2RJCA 4HCKA 1D1BA 3QDRB 3L2QA 2E5QA 2DK3A 1VQKT 3QJ6A 1RADB 1MNDA 3EGDA 6AT1B 2P0QA 2QTVA 1WYXA 3QO3A 2M51A 1PNJA 2MWPA 1T3SA 2X4WA 4XTXA 4C8QC 1BBZA 2BZXA 3TEEA 3A8OB 3OYJA 2EKOA 1M1KR 2DNUA 3VS5A 3PGGA 1M2VB 3JB9J 2PQWA 1KQ1A 3CCVQ 1V76A 1KSWA 4QQDA 2L3PA 2CZ0B 2MMPA 3EH1A 4MMLA 3NHNA 1AWWA 1K0SA 1KHIA 2E10A 3QJYA 1Q82R 1X75C 1Y7XA 5FRNA 2JNGA 1SRLA 3JCMW 1NYFA 1YITA 4XTUA 1UUEA 2DYIA 1J3TA 1ZSGA 2WACA 2E3HA 2KT1A 2EJFA 1V29B 1E6GA 2K79A 3N5BB 2L3RA 1ZA2B 2HQEA 3RIRA 3OYMA 1M1KU 1NJIR 1X27A 2A28A 2ZZDA 2M9UA 2DF6A 2DTOA 2EJGA 3CCEA 1UGSB 2OAUA 2QQBA 3LWIA 1VUBA 2RF0A 2A08A 2LRQA 3MHXA 2QI2A 4J9IA 4FCYA 3G4SA 1N8RR 1E6HA 5IN1A 4JRIA 1C6VX 4ATOA 2JM8A 3NGPA 4F7UA 2I2LA 4OMLA 4Y92A 2MI6A 3WVEB 4BY6B 4JLGA 4A4FA 1UB4A 1YJWQ 1IGQA 1RAEB 3HRUA 1PC0A 4RKUE 3X26B 4N0AA 1MHNA 3CCMT 2DL5A 2CZ1B 2JS2A 3OYIA 3TQ7P 2XMFA 3EG0A 1GCQC 4OGCA 4L5GA 2DJZA 3DKMA 1IZ6A 3EG9A 2JMAA 1UHFA 2DVJA 4X1VA 1N8RU 1K9MR 3LWHA 2MYSA 2DD5A 1MV0B 2ZAEA 1VQLA 2PVGB 3EG9B 8AT1B 4KGXB 3HSBA 3G6EA 3CC7T 3CCRA 2KT8A 1NPPA 2DE0X 4C0DC 1SKUB 4C92G 2A3LA 4ZGJB 2L0AA 5GAMd 2EGAA 3CD6T 2EYXA 4J7FA 2KEAA 2FZGB 2RPNA 2XK0A 4E2FB 1N5ZA 3S6WA 1M3CA 4YTLA 2FO0A 2RI5A 5C0MA 1VQ8T 1G83A 4MZTA 2MIOA 3SFMA 4JZ3A 1VQ7A 1QVGS 3VV0A 4A54A 1TUDA 4L6V5 1VQ6Q 1VQKQ 4PJOC 1ZA1B 5KYUB 4WF2A 3M4GA 5FU7C 1BI0A 2X3WD 3V7RA 3E19A 3JCMV 1RAHB 2P84A 4M75A 2F69A 4M7AC 2L3SA 1MNEA 4M78B 1LJOA 3HRTA 4KT0E 1VQ4A 3CCUA 1WXBA 4IUQA 3VS3A 1VOMA 1KQSP 1RAAB 1YCSB 4NS5A 2P0KA 3C94A 5KYYB 1A0NB 5LJ3e 1IHVA 4O5VA 2E4HA 4DOWA 3CEYA 1HJDA 2KY9A 1YITT 1K4US 4JRQA 1FMKA 5FWBA 4HT9A 3S3MA 1X01A 2BE7D 4PNOA 3CPWP 5LJ3d 3CPWA 1HXDA 3IQLA 3VRZA 1ZBXA 2E64A 4DBRA 3CCVA 3REBB 3QZ9B 4BI3A 1OEBA 2EQUA 1K8AC 1BCMA 4ESRA 2LCSA 2RHIA 1OX9A 1OU9A 1UJYA 3BDUA 5GAMh 4FM4B 2DXTA 3MKDA 4CC2A 3G4ST 2AZSA 5KYXA 2XU8A 4M77D 5IHNA 3CCJT 1IRXA 2QQAA 2X3XD 1SSFA 4OMOA 5KYXB 2COWA 2Y4XA 2RD1A 2B8AA 4FT2A 5J26A 3I55T 3JCMf 1M3BA 3O8VA 2XD0A 2MF2A 4OGEA 1W6XA 4J9HA 1AWXA 3META 4M7DA 3CCMQ 1I1JA 4BUGA 1I4K1 1JU5C 3MPUB 1N9RA 5J3BA 3KBGA 4ELZC 3OYGA 5FROA 5LJ5d 1YN8A 5HCKA 5GAN8 4XAXB 2FPDA 1YWPA 1KK7A 3JCMe 4E7ZA 4RTXA 2HAXA 2F1LA 3VYHB 4P5NA 1YJWA 2J05A 2QGGA 4PLIA 2PVDB 2DO3A 4JZ4A 1X69A 3UT1A 3X24B 3M4YA 4KH1B 1MMGA 3H6ZA 5DY9A 3TSWA 2JJ9A 1B07A 1TSFA 2RO0A 3A8MB 4J8OA 5LJ3h 4C92F 4E47A 3JV3A 2YUPA 1P92A 2DA9A 2MAMA 1VQ8Q 3RERA 2EBPA 3RESA 1VQ7T 5IHKA 3PTAA 1H92A 2RQTA 5GANe 1K76A 1WGSA 4LDWA 2E1HA 2ZGWA 1V1CA 5GJWB 1M9SA 2K6DA 2QG9B 2H3EB 4HXJA 1IXDA 2QYZA 5GANd 1RUWA 3GF5A 3LX7A 4JS4A 1IGUA 2DEQA 2K3XA 2RQUA 2SEMA 2EVRA 4AFUC 3OSSC 3JCMg 2W0ZA 2X35A 3EG2A 3H0FA 2M0OA 2HL5C 3OYDA 4OB1B 3JAME 3L2UA 2XIDA 1BIBA 2AT1B 4MZMA 5CK9A 3M54A 3GLXA 1VQ6A 1VQKA 4HA8A 1OX8A 2CT3A 1G2BA 2OJ2A 4LE9A 3PMTA 1TOVA 4HVVA 1Q86U 2KK4A 1G3SA 3FEOA 2K4YA 4RUGA 7AT1B 2J7IA 2LT1A 3KXTA 2J6OA 2DL3A 5KE2A 1UJ0A 1BI1A 4C92E 2OTLT 2D0NA 2R5AA 1ZQ1A 2JOYA 4C8QA 2D0QB 3ASKA 2EJ9A 5GMKm 4DBHA 1WHJA 1AD5A 3FRNA 2LJ1A 1MMDA 2RHZA 3E9FA 1TH7A 2CYZB 2FEIA 4PJLA 4JS5A 3AHUA 4J6WA 2DM1A 1BI3A 1WX6A 2DFUA 4OB0B 1NEBA 1BKBA 2CP3A 5FW9A 3CCJQ 4PL6A 4GBQA 4DBFA 1DJ7B 1W70A 2LX9A 2KNBB 4M78G 3TCJA 4WTOB 2DEUA 5GAOm 2EYYA 4Z02A 3CCQT 3I55Q 4PLLA 5LL6S 2GFAA 2MCNA 1ABOA 5CAIA 2ATCB 1VA7A 4QQ6A 4BD3A 2X4YA 2QTXA 1WQWA 3CC4T 1RI0A 3MEUA 4D6WA 5IXFA 3P8HA 3D7SB 1I81A 4DA4A 2DRKA 2PZ1A 3AT1B 5GANh 2X51A 4N4IA 1WHGA 3LGLA 3OYFA 1M3AA 1UG1A 2LZ6B 4OF1A 2V8JA 2RM4A 4ZGEB 1YJWT 1MMNA 2DYBA 4XU1A 2EQMA 1D3BA 4RTTA 3UPUA 2L8DA 4DQ2A 3EFSA 1BK2A 3EGXB 3HFNA 1IO6A 1E7OA 3M9QA 3CCMA 4M75D 4ELYC 3ZEHA 1D1CA 1D3BB 2LT4A 3QYGB 1K73C 1QMCA 2KROA 3FIFA 3M58A 2YLBA 1LPLA 4QVCA 1VQPT 3M53A 4JJBA 2LDMA 2RJEA 4LUEA 4OP0A 2F2VA 1GXIE 2OTJQ 4Y91A 4J9FA 3WXMB 3G1JA 1GCQA 1Z9ZA 3RDVA 4RMOA 4LDUA 5GAOp 2K9GA 1PD0A 1WXTA 3PNWC 4OMQA 2E6NA 2JZ2A 2YDLA 4CC3A 4K11A 2FPEA 4M77B 1XTDA 4XTYA 5D6XA 4OB2B 3QUIA 2CP0A 3OW2A 4MDXA 4RG8A 3QHSA 4EDUA 2O88A 3LGFA 3OQ5A 1IB8A 1OI1A 2R57A 2B86A 3E1SA 4N4HA 3F70A 2MWOA 3KUFA 2PVOB 5GAN5 2W10A 2DZ9A 2BZYA 3CCST 4D8KA 4FSXA 2RHXA 4LD9K 2KXCA 1VQ8A 1WHKA 2K3YA 1QVGP 1QVGA 5CKFA 5FLXE 2DXUA 1VQ6T 1UECA 2A0FB 1GL5A 3M0UA 4J83A 3C0CA 1T0JA 1HK9A 2YSQA 2K5IA 2D9TA 1XNIA 3E9GA 1YIJQ 4X9DA 1SSHA 4HVUA 1OQKA 3EGDB 4PJOA 3GOXA 1RAGB 3OS0A 2CS7A 2XICA 1U1SA 3JRZA 4XTWA 2L5QA 1GFCA 1O9SA 2QQSA 1HYOA 2OTLQ 4M7AA 1FMWA 5CKDA 5I11A 4M7DD 2EWNA 2KE9A 1R77A 2VC8A 2X4JA 3VS4A 4CC7A 2VV5A 1KD1R 2DBKA 2K5FA 4DEYA 1ZSZA 2DVEA 1UFFA 1X43A 2OAWA 2VWFA 2LNHB 5CIUA 2R58A 5AT1B 1S72T 1ZSZB 4JJCA 4J9DA 5KH6A 1KC8C 2L89A 2ABLA 1FX7A 3J80E 3R6NA 4FU6A 5CO7A 1S1NA 4C92C 5GJVB 3CCLT 3CCQQ 1PD1A 2XDBA 4KUIA 3FLGA 2K57A 1M90R 4OMMA 2FHDA 2LQKA 1FMVA 2CGHA 1Q82U 2BTTA 4M78F 4OB3B 4EMKC 3CC4Q 2COYA 2P4TA 3GIBA 2ED0A 4CRIA 2ROLA 1PKTA 2Z0WA 2EYQA 3A98A 4QVDA 3DLMA 2RK2A 5FRMA 3CCJA 2EGEA 3M0RA 1G5VA 2HMAA 2RB6A 2CH4A 2CREA 2QQ9A 2WSCE 1OULA 3NFCA 3I55A 1UGRB 4LDVA 4F7UB 2DMOA 5GMKi 1NJIU 2XHCA 3LH5A 4PFPA 3JCMQ 1N27A 1M90U 4NL2A 2NUTA 2R5MA 4OVAA 5GAMj 2RH2A 4MZPA 2V1RA 5HK0A 1VQPQ 2CDTA 1W2BS 3SWNA 1QWEA 2E6ZA 1BB9A 4II1A 1PSFA 1N9SA 1RAIB 3OS5A 4BE0A 1W4SA 1PKSA 2FZKB 3SWNB 2RA2A 2J06A 3OW2S 1M1KC 5FU6B 4BE2A 2JVVA 4KGZB 3VRYA 3ZBDA 3LLRA 1K8AR 4LD6A 3HPWA 4FW2A 4MMKA 2ZPFB 4RG2A 2YUNA 1VYUA 3G71T 2GTOA 5L8RE 4M78E 2RI3A 3CCSQ 3JCMJ 1C1AA 4C8QD 1QLYA 3M5AA 2OTJA 1B34A 1K9MU 2FB7A 4F14A 1I0CA 1T3LA 4QW2A 3OY9A 5GAOq 4LN2A 1QWFA 5ECAA 2HKNA 1JXOA 2EQKA 2KMTA 2OI3A 3ULRB 4J9EA 1X2QA 1M2OA 3SD4A 5GAOr 3BE3A 1C0MA 1Q95G 3I5RA 1QVFA 1UGVA 3M0QA 2DRMA 2DTIA 2VGMA 5GMKj 4M75B 4F17A 3OMGA 1N8RC 2EAYA 3OBYA 2EYZA 2LVMA 3CMET 2L2PA 4M77G 2KYMA 2DIQA 5GAMg 4ZGDB 2CKKA 4JPBW 4LNPA 2EKHA 1MV3A 1YIJA 4FYVB 4A63B 2JTEA 1WA7A 2O4XA 2E70A 1PHTA 1S72Q 2M1HA 3JCMb 1I07A 1NLPC 5KYWA 1H641 3CQTA 1OZ2A 2VB6A 3OSVA 4ORZA 2O4XB 3J7AF 3CCLQ 1LVKA 2OTLA 4AFSC 4F16A 1YCYA 4DBQA 3C95A 1NE8A 2DILA 5KYNA 3RBBB 4A4KA 1WLPB 4BI4A 3FB9A 3H8ZA 3T9NA 1VYVA 2HEQA 1GRIA 1Q81R 4X9CA 3OYCA 1U1TA 3V8JA 2D6FA 3MP1A 2LJ0A 5LJ5j 1M4ZA 2EFIA 4BY6C 1UDLA 5KCHA 3NPFA 4B9XA 1PRMC 2HBPA 4RTVA 3CCQA 3OYLA 3CBMA 4ZN3A 1TTHB 2LQNA 3OBWA 2DD4A 5GAN2 4QQGA 4N0AC 3CC4A 2AIRB 2IVWA 4XU3A 2VASA 2GCXA 4M7DB 1G3TA 2ZPHB 3EAEA 4KUDK 1B7TA 2EW3A 1Y07A 4E7JA 4Z89A 2QGFB 3CBOA 3QG1A 2RHYA 5J39A 2HNIA 3JSCA 2M16A 2RQRA 3EFOA 4BB7A 2EQIA 5A0GA 3HTRA 3BDLA 4IIOA 3ZFJA 3EFOB 3RKWA 1RL2A 2LTOA 1QCFA 3OS1A 2C0OA 3VYGA 2JM9A 2GNCA 4KRTA 5M9OA 1QCNA 1PG5B 3JCMd 3M55A 4PJOD 2LC4A 3OYBA 1WFWA 3LW5E 2K5LA 1NM7A 4AG2C 3WVDB 1ZUKA 3G71Q 1AZEA 2DPPB 2D8JA 4JJDA 2E12A 1VQPA 2V26A 2KBTA 4M7AD 2OTJT 4PJJA 2M02A 2CP2A 2V8IA 4JUVA 3PIOA 4AFQC 1AVZC 3SHWA 1ARKA 5I22A 2P4RA 3HFOA 5EG2A 4F7UG 4J7IA 3NMZC 2FVUA 2XKOC 3H0HA 1YI2Q 4BDYA 1F1BB 1RLQC 1LNXA 2NUPA 3MP8A 5C6SA 2FG0A 2RHUA 1Q7YR 1QVFS 4M4ZA 4M78C 2F5KA 2OX7A 3SB2A 3MJXA 1WIEA 4WCIA 1Y57A 5LJ5g 1H8KA 3TU4K 3CCSA 1BIAA 2DL7A 3VS0A 1WNLA 3CXCS 1YP5A 3HRSA 1IHWA 2KVQG 2VXFA 1TU0B 3C4SA 1KG1A 4LDYA 2CUDA 3P8DA 5D7UA 4E7IA 1LCKA 2ZPGB 1AWJA 1R0CB 2DAQA 1CKBA 2EYWA 4J6XA 3CMEQ 2O01E 5I21A 3S3NA 1H3HA 1YIJT 2C0IA 1NEGA 2YWWA 1X6BA 3OYNA 1K73R 1K1ZA 2JN0A 1Q7YU 1FWZA 4M77F 4ZN1A 5GMKl 1K9AA 1EFNA 5D6WA 1EX4A 3DLLA 3JCMc 3REAB 1WJSA 3DB3A 3A8GB 5IH2A 1RABB 2GF7A 4NL3A 4C8QB 2KGTA 2KSSA 3O5ZA 2AHJB 2YUOA 2L3QA 3EH2A 3A1PA 5CCAA 3JCMh 5GAOn 2QDLA 3V7CA 2O9SA 3GP8A 2JXBA 5CKHA 5A0LA 2YHTA 1S72A 1WHLA 3JB9G 2QQRA 2YRDA 5CKEA 1VQ9T 2DKGA 4M75G 2KRMA 3CCLA 4N4GA 2EPDA 2SRCA 1Y96A 4IUTA 2RJFA 1D09B 5KE3A 1D0ZA 2F5TX 1VIEA 4A4GA 4C92A 3ZL7C 1JBMA 1Y96B 4JRKA 3FDRA 3QKJA 4Z88A 1VQOT 1PSEA 2MOXA 3TSZA 3PVQA 2GBQA 4BI8B 4XK8E 2Y90A 2DJQA 4J9BA 1Q86C 1T0HA 1R8OB 3M57A 2GGRA 1X6GA 4J9GA 2DZCA 4M77E 1VQMT 4HVWA 2G3RA 3JB9D 1KHCA 2E5KA 3MCAB 3CC2T 1GFDA 4FYXB 2BUDA 2K2VA 2GFUA 1W2BP 1W2BA 2BE9B 2CT4A 3HP9A 2LQ8A 5CQYA 1WI7A 3RNJA 3GPLA 3M0TA 4E7SA 3QYHB 3OW2P 1WHHA 4TVRA 1YHQT 1OZ3A 4A4HA 5DLOA 3VUZA 2QAZA 2LCLA 3MEVA 3VU3C 3GBQA 4OMPA 3RKXA 3G71A 1NLOC 4XTZA 4M7DG 4PFZA 4F7UF 3HKSA 4C0DB 2EGCA 3FC3A 3Q1JA 3UA6A 4LXCA 2KXDA 4CI0C 3QBYA 1QCOA 4XTVA 2PUKB 4FSSA 3MP6A 1JJ2A 2A37A 3I9QA 4VUBA 2X4XA 3UA7A 2WSFE 3I56T 4C0ZA 4XU2A 1YWOA 1GBQA 1YI2A 2FZCB 1M8MA 3SDZA 1WJQA 2LP5A 4Z8AA 4HCBA 1AWOA 2X9HA 2GQVA 4PJOB 3ME9A 1JB0E 2A7YA 4HCCA 3QIIA 2DETA 4C0GA 1GCPA 2XI9A 4IUVA 1XOVA 2H8HA 5FU7B 4Y28E 1M2VA 2CP5A 2FRWA 2KAFA 4OMNA 4M7AB 2QEXT 1LOJA 2GQIA 3CMEA 1ACMB 4R55A 2DX1A 2PU9B 1PCXA 3MEAA 1UTIA 3PE0A 1M5Q1 4GLMA 3BY7A 3PVLA 3R6OA 1VQ9Q 4HCZA 1VQ5T 3OYAA 1YJ9T 2HCKA 1JRIA 4KULA 4AG1C 2J6KA 4F7UE 3M0PA 3J81E 3OYKA 1OPLA 2DXBA 2XDDA 2HSPA 4QT7A 1WPYA 2G6FX 3JB9F 4IIMA 4E6RA 4RTWA 1PWTA 2RJDA 2E3IA 1KD1U 1VIFA 4M75F 2VKNA 1BU1A 5I2SA 2KYBA 3QZ5B 3FJPA 1X2KA 1VQOQ 3GNFB 5HKCA 1ZUYA 1JEGA 4EMHA 3NTHA 3E2UA 2YRVA 2MPXC 2CP7A 2LX7A 3V8LA 2AKLA 3EFRA 3THKA 3VKIA 5IAYA 4PKCC 3L2ZA 2XG8D 1YJNT 2YLCA 3L1AA 4IURA 3TVTA 3LH0A 2QXFA 3G7ZA 1VQMQ 3I5SA 4HT8A 3OA6A 1CSKA 3CC2Q 5L23A 3KFVA 3CMAT 2VUBA 4KGVB 3RKYA 4FW1A 4C8QG 4D8DA 3QPHA 2BZ8A 2HD0A 2D8HA 4E7LA 2Y4YA 3JCMX 2RQWA 5GAMf 2P0PA 4IUPA 2NUTB 2FYKA 5A0DA 4XU0A 5GAN4 4JDSA 4E7HA 3A8LB 1I8FA 1TS9A 5AYFA 4B9WA 5DLQE 1UGQB 1VQNT 2CZ7B 1WZOA 2HDAA 2KDSA 4M77C 3I35A 2D1XA 2VXEA 1YHQQ 5CQXA 1G8XA 3L42A 2MK5A 2DTHA 4FL6A 1WJRA 5GAMe 4GY5A 1CKAA 2PNIA 3M56A 1Q82C 2LJ3A 1QKXA 4M75E 1KD1C 1TUGB 2RI2A 5CKBA 4RTUA 3X25B 4RTYA 2QA4T 1HSQA 1B34B 4M7DF 4O6JA
chains in the Genus database with same CATH topology
1Z9QA 2KNBB 1MUZA 4IIOA 2AKKA 2DNUA 2EYYA 3VS5A 1QCFA 2MCNA 1ABOA 2C0OA 1KSWA 2L3PA 1RLPC 2JM9A 2GNCA 4KRTA 1VA7A 4J9CA 3NHNA 1AWWA 2RMOA 1K0SA 1TUCA 1RI9A 1WFWA 1KJWA 1NM7A 2A36A 4AG2C 1SRLA 1ZUKA 2YUQA 1AZEA 2CUBA 2D8JA 1NYFA 1JXMA 4JJDA 5IXFA 1ZBJA 1ZX6A 1UUEA 1J3TA 2KBTA 2DRKA 2PZ1A 1ZSGA 2RN8A 2KT1A 3VS2A 1M3AA 2V1QA 1UG1A 2LZ6B 1E6GA 4AFQC 2K79A 4LUDA 1AVZC 2DYBA 3SHWA 1ARKA 5I22A 4RTTA 2P4RA 1X27A 2A28A 2JT4A 2DF6A 3NMZC 1BK2A 3H0HA 1IO6A 1E7OA 1RLQC 3EG3A 3UATA 1OOTA 2GTJA 2FG0A 2KROA 4M4ZA 1OPKA 1WIEA 2RF0A 2A08A 1Y57A 4WCIA 1H8KA 4J9IA 2HBWA 2DL7A 3VS0A 2JMCA 1JQQA 4JJBA 1E6HA 4LUEA 1YP5A 2C0TA 2F2VA 2JM8A 4J9FA 2CUDA 1GCQA 1Z9ZA 3NGPA 1LCKA 2K9GA 4OMLA 4Y92A 1AWJA 4OMQA 1WXTA 2NWMA 4CC3A 2YDLA 4K11A 2FPEA 1CKBA 2EYWA 1SPKA 1H3HA 2VVKA 2O88A 2C0IA 1NEGA 1X6BA 2B86A 2DL5A 1K1ZA 2KR3A 2JS2A 1KFZA 2W10A 2XMFA 3EG0A 2BZYA 1GCQC 3EHQA 4EIKA 4D8KA 1HSQA 1SEMA 1K9AA 1EFNA 2RQVA 2KXCA 2DL8A 2JMAA 1UHFA 2DVJA 4X1VA 3REAB 1SHFA 2I0NA 1OV3A 5IH2A 1MV0B 1K0XA 2KGTA 2KRNA 3O5ZA 2YUOA 1UECA 2L3QA 1GL5A 3M0UA 3H0IA 2O31A 2KT8A 2DE0X 2QDLA 3C0CA 1T0JA 2O9SA 2JXBA 1SRMA 1NYGA 2L0AA 2YSQA 2EGAA 1SSHA 4HVUA 2EYXA 2O2OA 2KEAA 4CC4B 2LMJA 2RPNA 1N5ZA 2KRMA 1GFCA 1M3CA 2FO0A 2EPDA 2SRCA 1ZLMA 5I11A 1G83A 2MIOA 1WXUA 4JZ3A 2KE9A 3VS4A 4CC7A 3ZL7C 2DLPA 1TUDA 2DBKA 2M0YA 4DEYA 4Z88A 2AK5A 2MOXA 3TSZA 3PVQA 2GBQA 1UFFA 1X43A 1GBRA 2X3WD 2DJQA 2OAWA 4J9BA 2VWFA 4AFZC 2NUZA 1UE9A 2ED1A 2LNHB 1U3OA 4JJCA 1T0HA 2L3SA 4J9DA 2GGRA 1X6GA 4J9GA 2ABLA 3R6NA 1S1NA 4HVWA 1WXBA 5GJVB 2E5KA 3VS3A 1YCSB 1A0NB 4OMMA 1GFDA 3M0SA 5FWCA 2PTKA 2BTTA 2ED0A 1HJDA 1K4US 1FMKA 5FWBA 2ROLA 1PKTA 2K7AA 3A98A 1AEYA 2CT4A 1WI7A 3FJ5A 2EGEA 3M0RA 3IQLA 2CH4A 3RNJA 3VRZA 2CREA 3M0TA 2RNAA 2DMOA 3REBB 4ZNXA 2ESWA 3LH5A 2CH4W 1OEBA 4ESRA 1B3QA 3GBQA 4OMPA 5IXBA 2LCSA 1NLOC 2JW4A 1QKWA 2V1RA 1UJYA 4CC2A 2AZSA 2CDTA 2EGCA 1QWEA 3SEMA 3UA6A 3VS6A 1BB9A 2KXDA 5IHNA 3VS7A 1M27C 2X3XD 5EC7A 1PKSA 1U5SA 4OMOA 4FSSA 1KIKA 2A37A 2J06A 3I9QA 1PRLC 3UA7A 1M3BA 1YWOA 2J6FA 3VRYA 3H41A 1GBQA 1M8MA 1W6XA 4J9HA 1AWXA 1ZUUA 2FPFA 1I1JA 2YT6A 2YUNA 2LP5A 4Z8AA 1JU5C 2CSIA 1VYUA 2GTOA 1AWOA 1YN8A 5HCKA 1JO8A 1QLYA 1GCPA 2FPDA 1YWPA 1SHGA 1XOVA 2H8HA 3U23A 1W1FA 4F14A 3QWXX 1I0CA 2FRWA 1T3LA 4RTXA 4OMNA 4RTZA 2GQIA 3QWYA 2J05A 4LN2A 1FYNA 1QWFA 2F2WA 5ECAA 1YNZA 2ENMA 1JXOA 4JZ4A 2OI3A 1HD3A 1X69A 3ULRB 4J9EA 1X2QA 2DX1A 2JS0A 2FRYA 3VS1A 3I5RA 1UTIA 1NG2A 1U06A 1UGVA 3M0QA 3PE0A 4GLMA 1AOJA 3PVLA 3TSWA 2O9VA 1B07A 1VYTA 2DRMA 3UF4A 2HCKA 4AG1C 2J6KA 3M0PA 3JV3A 1ABQA 2YUPA 4F17A 4DEXA 2ECZA 1OPLA 3EG1A 2DA9A 2HSPA 2EBPA 2EYZA 5IHKA 4QT7A 2G6FX 4IIMA 4E6RA 1UHCA 4R0KA 4RTWA 1PWTA 1H92A 2RQTA 1K76A 2L2PA 2VKNA 1BU1A 2F2XA 2KYMA 2KYBA 5GJWB 1V1CA 1X2KA 1M30A 1JEGA 1ZUYA 4JPBW 4LNPA 2EKHA 1MV3A 2K6DA 2K3BA 4A63B 2LX7A 4HXJA 2AKLA 2JTEA 1WA7A 1PHTA 3THKA 1RUWA 1I07A 1NLPC 5IHIA 3CQTA 2RQUA 2SEMA 3TVTA 2EVRA 4AFUC 2LQWA 4ORZA 3I5SA 2W0ZA 4AFSC 4F16A 3EG2A 3H0FA 1CSKA 2DILA 5L23A 1WDXA 3KFVA 3RBBB 2AZVA 1WLPB 4D8DA 2BZ8A 1Y0MA 2D8HA 2CT3A 2RQWA 1VYVA 2HEQA 1TG0A 1G2BA 2OJ2A 4LE9A 1GRIA 3EHRA 4HVVA 2KRSA 2DBMA 2LJ0A 2IIMA 4RUGA 2HDAA 2J7IA 1UDLA 3I35A 2D1XA 3NPFA 1PRMC 2J6OA 2CSQA 2DL3A 4RTVA 2DL4A 1UJ0A 1AZGB 2D0NA 2K2MA 2ROTA 3EGUA 2LQNA 1AD5A 4HCKA 1CKAA 2PNIA 2LJ1A 2LJ3A 1QKXA 2FEIA 2EW3A 2DM1A 1WYXA 2M51A 4Z89A 4RTUA 1WX6A 1PNJA 1NEBA 1T3SA 2RQRA 5FW9A 2EQIA 4GBQA 4RTYA 1BBZA 2BZXA 1W70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9Q A;  2KNB B;  1MUZ A;  4IIO A;  2AKK A;  2DNU A;  2EYY A;  3VS5 A;  1QCF A;  2MCN A;  1ABO A;  2C0O A;  1KSW A;  2L3P A;  1RLP C;  2JM9 A;  2GNC A;  4KRT A;  1VA7 A;  4J9C A;  3NHN A;  1AWW A;  2RMO A;  1K0S A;  1TUC A;  1RI9 A;  1WFW A;  1KJW A;  1NM7 A;  2A36 A;  4AG2 C;  1SRL A;  1ZUK A;  2YUQ A;  1AZE A;  2CUB A;  2D8J A;  1NYF A;  1JXM A;  4JJD A;  5IXF A;  1ZBJ A;  1ZX6 A;  1UUE A;  1J3T A;  2KBT A;  2DRK A;  2PZ1 A;  1ZSG A;  2RN8 A;  2KT1 A;  3VS2 A;  1M3A A;  2V1Q A;  1UG1 A;  2LZ6 B;  1E6G A;  4AFQ C;  2K79 A;  4LUD A;  1AVZ C;  2DYB A;  3SHW A;  1ARK A;  5I22 A;  4RTT A;  2P4R A;  1X27 A;  2A28 A;  2JT4 A;  2DF6 A;  3NMZ C;  1BK2 A;  3H0H A;  1IO6 A;  1E7O A;  1RLQ C;  3EG3 A;  3UAT A;  1OOT A;  2GTJ A;  2FG0 A;  2KRO A;  4M4Z A;  1OPK A;  1WIE A;  2RF0 A;  2A08 A;  1Y57 A;  4WCI A;  1H8K A;  4J9I A;  2HBW A;  2DL7 A;  3VS0 A;  2JMC A;  1JQQ A;  4JJB A;  1E6H A;  4LUE A;  1YP5 A;  2C0T A;  2F2V A;  2JM8 A;  4J9F A;  2CUD A;  1GCQ A;  1Z9Z A;  3NGP A;  1LCK A;  2K9G A;  4OML A;  4Y92 A;  1AWJ A;  4OMQ A;  1WXT A;  2NWM A;  4CC3 A;  2YDL A;  4K11 A;  2FPE A;  1CKB A;  2EYW A;  1SPK A;  1H3H A;  2VVK A;  2O88 A;  2C0I A;  1NEG A;  1X6B A;  2B86 A;  2DL5 A;  1K1Z A;  2KR3 A;  2JS2 A;  1KFZ A;  2W10 A;  2XMF A;  3EG0 A;  2BZY A;  1GCQ C;  3EHQ A;  4EIK A;  4D8K A;  1HSQ A;  1SEM A;  1K9A A;  1EFN A;  2RQV A;  2KXC A;  2DL8 A;  2JMA A;  1UHF A;  2DVJ A;  4X1V A;  3REA B;  1SHF A;  2I0N A;  1OV3 A;  5IH2 A;  1MV0 B;  1K0X A;  2KGT A;  2KRN A;  3O5Z A;  2YUO A;  1UEC A;  2L3Q A;  1GL5 A;  3M0U A;  3H0I A;  2O31 A;  2KT8 A;  2DE0 X;  2QDL A;  3C0C A;  1T0J A;  2O9S A;  2JXB A;  1SRM A;  1NYG A;  2L0A A;  2YSQ A;  2EGA A;  1SSH A;  4HVU A;  2EYX A;  2O2O A;  2KEA A;  4CC4 B;  2LMJ A;  2RPN A;  1N5Z A;  2KRM A;  1GFC A;  1M3C A;  2FO0 A;  2EPD A;  2SRC A;  1ZLM A;  5I11 A;  1G83 A;  2MIO A;  1WXU A;  4JZ3 A;  2KE9 A;  3VS4 A;  4CC7 A;  3ZL7 C;  2DLP A;  1TUD A;  2DBK A;  2M0Y A;  4DEY A;  4Z88 A;  2AK5 A;  2MOX A;  3TSZ A;  3PVQ A;  2GBQ A;  1UFF A;  1X43 A;  1GBR A;  2X3W D;  2DJQ A;  2OAW A;  4J9B A;  2VWF A;  4AFZ C;  2NUZ A;  1UE9 A;  2ED1 A;  2LNH B;  1U3O A;  4JJC A;  1T0H A;  2L3S A;  4J9D A;  2GGR A;  1X6G A;  4J9G A;  2ABL A;  3R6N A;  1S1N A;  4HVW A;  1WXB A;  5GJV B;  2E5K A;  3VS3 A;  1YCS B;  1A0N B;  4OMM A;  1GFD A;  3M0S A;  5FWC A;  2PTK A;  2BTT A;  2ED0 A;  1HJD A;  1K4U S;  1FMK A;  5FWB A;  2ROL A;  1PKT A;  2K7A A;  3A98 A;  1AEY A;  2CT4 A;  1WI7 A;  3FJ5 A;  2EGE A;  3M0R A;  3IQL A;  2CH4 A;  3RNJ A;  3VRZ A;  2CRE A;  3M0T A;  2RNA A;  2DMO A;  3REB B;  4ZNX A;  2ESW A;  3LH5 A;  2CH4 W;  1OEB A;  4ESR A;  1B3Q A;  3GBQ A;  4OMP A;  5IXB A;  2LCS A;  1NLO C;  2JW4 A;  1QKW A;  2V1R A;  1UJY A;  4CC2 A;  2AZS A;  2CDT A;  2EGC A;  1QWE A;  3SEM A;  3UA6 A;  3VS6 A;  1BB9 A;  2KXD A;  5IHN A;  3VS7 A;  1M27 C;  2X3X D;  5EC7 A;  1PKS A;  1U5S A;  4OMO A;  4FSS A;  1KIK A;  2A37 A;  2J06 A;  3I9Q A;  1PRL C;  3UA7 A;  1M3B A;  1YWO A;  2J6F A;  3VRY A;  3H41 A;  1GBQ A;  1M8M A;  1W6X A;  4J9H A;  1AWX A;  1ZUU A;  2FPF A;  1I1J A;  2YT6 A;  2YUN A;  2LP5 A;  4Z8A A;  1JU5 C;  2CSI A;  1VYU A;  2GTO A;  1AWO A;  1YN8 A;  5HCK A;  1JO8 A;  1QLY A;  1GCP A;  2FPD A;  1YWP A;  1SHG A;  1XOV A;  2H8H A;  3U23 A;  1W1F A;  4F14 A;  3QWX X;  1I0C A;  2FRW A;  1T3L A;  4RTX A;  4OMN A;  4RTZ A;  2GQI A;  3QWY A;  2J05 A;  4LN2 A;  1FYN A;  1QWF A;  2F2W A;  5ECA A;  1YNZ A;  2ENM A;  1JXO A;  4JZ4 A;  2OI3 A;  1HD3 A;  1X69 A;  3ULR B;  4J9E A;  1X2Q A;  2DX1 A;  2JS0 A;  2FRY A;  3VS1 A;  3I5R A;  1UTI A;  1NG2 A;  1U06 A;  1UGV A;  3M0Q A;  3PE0 A;  4GLM A;  1AOJ A;  3PVL A;  3TSW A;  2O9V A;  1B07 A;  1VYT A;  2DRM A;  3UF4 A;  2HCK A;  4AG1 C;  2J6K A;  3M0P A;  3JV3 A;  1ABQ A;  2YUP A;  4F17 A;  4DEX A;  2ECZ A;  1OPL A;  3EG1 A;  2DA9 A;  2HSP A;  2EBP A;  2EYZ A;  5IHK A;  4QT7 A;  2G6F X;  4IIM A;  4E6R A;  1UHC A;  4R0K A;  4RTW A;  1PWT A;  1H92 A;  2RQT A;  1K76 A;  2L2P A;  2VKN A;  1BU1 A;  2F2X A;  2KYM A;  2KYB A;  5GJW B;  1V1C A;  1X2K A;  1M30 A;  1JEG A;  1ZUY A;  4JPB W;  4LNP A;  2EKH A;  1MV3 A;  2K6D A;  2K3B A;  4A63 B;  2LX7 A;  4HXJ A;  2AKL A;  2JTE A;  1WA7 A;  1PHT A;  3THK A;  1RUW A;  1I07 A;  1NLP C;  5IHI A;  3CQT A;  2RQU A;  2SEM A;  3TVT A;  2EVR A;  4AFU C;  2LQW A;  4ORZ A;  3I5S A;  2W0Z A;  4AFS C;  4F16 A;  3EG2 A;  3H0F A;  1CSK A;  2DIL A;  5L23 A;  1WDX A;  3KFV A;  3RBB B;  2AZV A;  1WLP B;  4D8D A;  2BZ8 A;  1Y0M A;  2D8H A;  2CT3 A;  2RQW A;  1VYV A;  2HEQ A;  1TG0 A;  1G2B A;  2OJ2 A;  4LE9 A;  1GRI A;  3EHR A;  4HVV A;  2KRS A;  2DBM A;  2LJ0 A;  2IIM A;  4RUG A;  2HDA A;  2J7I A;  1UDL A;  3I35 A;  2D1X A;  3NPF A;  1PRM C;  2J6O A;  2CSQ A;  2DL3 A;  4RTV A;  2DL4 A;  1UJ0 A;  1AZG B;  2D0N A;  2K2M A;  2ROT A;  3EGU A;  2LQN A;  1AD5 A;  4HCK A;  1CKA A;  2PNI A;  2LJ1 A;  2LJ3 A;  1QKX A;  2FEI A;  2EW3 A;  2DM1 A;  1WYX A;  2M51 A;  4Z89 A;  4RTU A;  1WX6 A;  1PNJ A;  1NEB A;  1T3S A;  2RQR A;  5FW9 A;  2EQI A;  4GBQ A;  4RTY A;  1BBZ A;  2BZX A;  1W70 A; 
#chains in the Genus database with same CATH topology
 1Z9Q A;  3C12 A;  1MUZ A;  4RCB A;  1JJ2 S;  2AKK A;  3CPF A;  3NTK A;  8ATC B;  3I56 Q;  1NJI C;  1WHM A;  1YI2 T;  1RLP C;  4J9C A;  1K8A U;  1M90 C;  2RMO A;  5KYU A;  1O75 A;  1TUC A;  1RI9 A;  1QVF P;  1KJW A;  2A36 A;  3OMC A;  5LJ3 j;  2YUQ A;  4E7K A;  2ZPB B;  2CUB A;  4Q5W A;  1JXM A;  1ZBJ A;  3JB9 H;  1ZX6 A;  5LJ3 f;  3X20 B;  3CXC P;  3CXC A;  1ZHI A;  2RN8 A;  4M78 A;  3BFM A;  3CBP A;  5IT9 E;  3VS2 A;  4BDZ A;  2V1Q A;  1NBE B;  4C92 D;  4LUD A;  2QEX Q;  5KYY A;  9ATC B;  2JT4 A;  2FL7 A;  1YBY A;  4PJM A;  1KQS A;  1MMA A;  1H3Z A;  1WQ7 A;  2BKD N;  3EG3 A;  1ZSZ C;  3UAT A;  1OOT A;  2GTJ A;  2ZPE B;  5GMK e;  1BYM A;  1OPK A;  3UWN A;  4ZTF A;  4A4E A;  3A5Z B;  4J5Y A;  1VQ5 Q;  2HBW A;  1YJ9 Q;  2JMC A;  1JQQ A;  2C0T A;  5KYW B;  3DB4 A;  4C5I A;  1K9M C;  4V2S A;  1U8R A;  2HQH A;  2KI7 A;  2NWM A;  4M7D E;  1I5O B;  1SPK A;  2EIF A;  2VVK A;  3A8H B;  1M8V A;  3CCE T;  2KR3 A;  1D1A A;  1AHJ B;  1TWB A;  1KFZ A;  2CZ6 B;  1VQ9 A;  3X28 B;  1YJN Q;  5LJ5 f;  1QW1 A;  1NPR A;  3EHQ A;  4PJO G;  4EIK A;  1SEM A;  1NZ9 A;  2RQV A;  3L2R A;  2DL8 A;  2VYT A;  1SHF A;  3VJP A;  2I0N A;  1OV3 A;  2HQX A;  3CMA Q;  1K0X A;  3V7S A;  1FXX A;  4M7A G;  2KRN A;  3ER0 A;  5HY6 A;  3OB9 A;  3H0I A;  1SG5 A;  2O31 A;  3PMI A;  1VQO A;  3QXE B;  5LJ3 g;  4F04 B;  1RAC B;  1Q81 U;  4KBM B;  4IKF A;  1SRM A;  1NYG A;  5LJ5 e;  1QQJ A;  1SF9 A;  4RCC A;  4QKU A;  4PJN A;  2O2O A;  4C8Q F;  1IRE B;  2IPO B;  3SWN C;  2YRC A;  4CC4 B;  4EPC A;  1VQN Q;  2LMJ A;  1EZZ B;  1Y71 A;  3JB9 I;  3LYI A;  1VQM A;  5FU6 C;  1D0Y A;  3JCM P;  1G3Y A;  1ZLM A;  3CC2 A;  5DM7 R;  2EQJ A;  1WXU A;  4PFO A;  2DLP A;  1VQL T;  1I5L A;  4BE1 A;  2H3J A;  1R0B G;  2QAS A;  4BAC A;  2JTM A;  3G6E T;  2M0Y A;  5GAN j;  1UGP B;  4JJN K;  3CCR T;  3CC7 Q;  2AK5 A;  3URG A;  1GBR A;  5GAN f;  4FYY B;  2NYS A;  4AFZ C;  2NUZ A;  1UE9 A;  2ED1 A;  3CD6 Q;  4MDW A;  1U3O A;  1UEB A;  2QA4 Q;  2WSE E;  4R56 A;  1YHQ A;  5GMK h;  3H9N A;  1M1F A;  3RMS A;  5D6Y A;  4ANJ A;  2QDY B;  3VUB A;  3M0S A;  5FWC A;  2PTK A;  1TXQ A;  2CP6 A;  4M75 C;  3S3O A;  2NUP B;  2K7A A;  1AEY A;  4XQ3 A;  4C5E A;  1G3W A;  3TRE A;  1Q81 C;  3FJ5 A;  5CVI A;  1Q86 R;  5A2Q E;  4C8Q E;  2C06 A;  3P8B B;  2RNA A;  4A53 A;  3I56 A;  1VQ4 T;  3CCU T;  4ZNX A;  2ESW A;  2E65 A;  1N6A A;  2CH4 W;  2KQW A;  1EIF A;  1KQS S;  1X6O A;  4C5G A;  2NLU A;  1B3Q A;  3L2W A;  3HL8 A;  1MGQ A;  2COZ A;  5IXB A;  2JW4 A;  4QVZ A;  4UC4 A;  1QKW A;  3UDC A;  1YIT Q;  3INZ A;  3OYY A;  3RR6 A;  3SEM A;  3VS6 A;  3VS7 A;  3CPW S;  2DXC A;  1M27 C;  4JLI A;  5EC7 A;  1U5S A;  2QEX A;  4FIB A;  5LJ5 h;  1KIK A;  1PRL C;  4KH0 B;  4PK4 A;  3CCV T;  2J6F A;  3H41 A;  3MEW A;  5GAN g;  5GAO l;  1ZUU A;  4FYW B;  3OYH A;  1K73 U;  2FPF A;  2HSE B;  4J6Y A;  3CCE Q;  2YT6 A;  4ME7 A;  2CSI A;  3RUX A;  1VQ5 A;  1YJ9 A;  1D0X A;  2LCC A;  4JRP A;  5GAN 3;  1BCO A;  3G4S Q;  1JO8 A;  3PFS A;  1SHG A;  2DIG A;  3U23 A;  1W1F A;  3QWX X;  4ZTJ A;  4RTZ A;  4NOY A;  5CR2 A;  4M7D C;  3QWY A;  4OMF B;  4PJO F;  1FYN A;  3RMQ A;  2F2W A;  4C92 B;  1YNZ A;  2ENM A;  2IG0 A;  1HD3 A;  1OYX A;  2E41 A;  2JS0 A;  4EMK A;  2BIV A;  2FRY A;  3VS1 A;  5GAN 6;  1AT1 B;  2LNV A;  1NG2 A;  1U06 A;  4M7A F;  1YJN A;  1AOJ A;  1Q7Y C;  2O9V A;  4X34 A;  1VYT A;  4EMK B;  3UF4 A;  1ABQ A;  1BI2 A;  4DEX A;  2ECZ A;  4AMC A;  3EG1 A;  1QP3 A;  3GNG A;  3CMA A;  4FT4 A;  3PIP A;  1UHC A;  4R0K A;  1PM3 A;  4AT1 B;  1XQH A;  4DOV A;  4IUU A;  3EGX A;  1VQL Q;  2VGN A;  4L59 A;  2F2X A;  1RAF B;  1QP2 A;  3L2V A;  3G6E Q;  1XJW B;  3CCR Q;  1M30 A;  2ZPI B;  2JTF A;  2K3B A;  3OYE A;  4M78 D;  3OS2 A;  3MO8 A;  1M1G A;  2YXY A;  1QVP A;  1KC8 R;  1VQN A;  4HKE A;  2V8K A;  3QDF A;  3QSU A;  5IHI A;  2HL3 A;  4B6M A;  1OU8 A;  2LQW A;  2RK1 A;  5GAN 7;  3HHT B;  4M77 A;  1WDX A;  1VQ7 Q;  2ZCF B;  2AZV A;  3NTI A;  1Y0M A;  5HK3 A;  2DER A;  2XDP A;  4EMG A;  3CC7 A;  4PJO E;  4C0F A;  1TG0 A;  1YFN A;  3EHR A;  4LDX A;  5I2M A;  2KRS A;  3CD6 A;  2DBM A;  4GLK A;  2IIM A;  3M59 A;  5KCO A;  2QA4 A;  3V8K A;  4M7A E;  1KQ2 A;  1KC8 U;  1JJ2 P;  2JUF A;  2QK0 A;  2HZY A;  2CSQ A;  2PUO B;  2DL4 A;  1AZG B;  1VQ4 Q;  3CCU Q;  2ROT A;  2K2M A;  3EGU A;  3PT9 A;  4C5H A;  2HKQ B;  3BW1 A;  2RJC A;  4HCK A;  1D1B A;  3QDR B;  3L2Q A;  2E5Q A;  2DK3 A;  1VQK T;  3QJ6 A;  1RAD B;  1MND A;  3EGD A;  6AT1 B;  2P0Q A;  2QTV A;  1WYX A;  3QO3 A;  2M51 A;  1PNJ A;  2MWP A;  1T3S A;  2X4W A;  4XTX A;  4C8Q C;  1BBZ A;  2BZX A;  3TEE A;  3A8O B;  3OYJ A;  2EKO A;  1M1K R;  2DNU A;  3VS5 A;  3PGG A;  1M2V B;  3JB9 J;  2PQW A;  1KQ1 A;  3CCV Q;  1V76 A;  1KSW A;  4QQD A;  2L3P A;  2CZ0 B;  2MMP A;  3EH1 A;  4MML A;  3NHN A;  1AWW A;  1K0S A;  1KHI A;  2E10 A;  3QJY A;  1Q82 R;  1X75 C;  1Y7X A;  5FRN A;  2JNG A;  1SRL A;  3JCM W;  1NYF A;  1YIT A;  4XTU A;  1UUE A;  2DYI A;  1J3T A;  1ZSG A;  2WAC A;  2E3H A;  2KT1 A;  2EJF A;  1V29 B;  1E6G A;  2K79 A;  3N5B B;  2L3R A;  1ZA2 B;  2HQE A;  3RIR A;  3OYM A;  1M1K U;  1NJI R;  1X27 A;  2A28 A;  2ZZD A;  2M9U A;  2DF6 A;  2DTO A;  2EJG A;  3CCE A;  1UGS B;  2OAU A;  2QQB A;  3LWI A;  1VUB A;  2RF0 A;  2A08 A;  2LRQ A;  3MHX A;  2QI2 A;  4J9I A;  4FCY A;  3G4S A;  1N8R R;  1E6H A;  5IN1 A;  4JRI A;  1C6V X;  4ATO A;  2JM8 A;  3NGP A;  4F7U A;  2I2L A;  4OML A;  4Y92 A;  2MI6 A;  3WVE B;  4BY6 B;  4JLG A;  4A4F A;  1UB4 A;  1YJW Q;  1IGQ A;  1RAE B;  3HRU A;  1PC0 A;  4RKU E;  3X26 B;  4N0A A;  1MHN A;  3CCM T;  2DL5 A;  2CZ1 B;  2JS2 A;  3OYI A;  3TQ7 P;  2XMF A;  3EG0 A;  1GCQ C;  4OGC A;  4L5G A;  2DJZ A;  3DKM A;  1IZ6 A;  3EG9 A;  2JMA A;  1UHF A;  2DVJ A;  4X1V A;  1N8R U;  1K9M R;  3LWH A;  2MYS A;  2DD5 A;  1MV0 B;  2ZAE A;  1VQL A;  2PVG B;  3EG9 B;  8AT1 B;  4KGX B;  3HSB A;  3G6E A;  3CC7 T;  3CCR A;  2KT8 A;  1NPP A;  2DE0 X;  4C0D C;  1SKU B;  4C92 G;  2A3L A;  4ZGJ B;  2L0A A;  5GAM d;  2EGA A;  3CD6 T;  2EYX A;  4J7F A;  2KEA A;  2FZG B;  2RPN A;  2XK0 A;  4E2F B;  1N5Z A;  3S6W A;  1M3C A;  4YTL A;  2FO0 A;  2RI5 A;  5C0M A;  1VQ8 T;  1G83 A;  4MZT A;  2MIO A;  3SFM A;  4JZ3 A;  1VQ7 A;  1QVG S;  3VV0 A;  4A54 A;  1TUD A;  4L6V 5;  1VQ6 Q;  1VQK Q;  4PJO C;  1ZA1 B;  5KYU B;  4WF2 A;  3M4G A;  5FU7 C;  1BI0 A;  2X3W D;  3V7R A;  3E19 A;  3JCM V;  1RAH B;  2P84 A;  4M75 A;  2F69 A;  4M7A C;  2L3S A;  1MNE A;  4M78 B;  1LJO A;  3HRT A;  4KT0 E;  1VQ4 A;  3CCU A;  1WXB A;  4IUQ A;  3VS3 A;  1VOM A;  1KQS P;  1RAA B;  1YCS B;  4NS5 A;  2P0K A;  3C94 A;  5KYY B;  1A0N B;  5LJ3 e;  1IHV A;  4O5V A;  2E4H A;  4DOW A;  3CEY A;  1HJD A;  2KY9 A;  1YIT T;  1K4U S;  4JRQ A;  1FMK A;  5FWB A;  4HT9 A;  3S3M A;  1X01 A;  2BE7 D;  4PNO A;  3CPW P;  5LJ3 d;  3CPW A;  1HXD A;  3IQL A;  3VRZ A;  1ZBX A;  2E64 A;  4DBR A;  3CCV A;  3REB B;  3QZ9 B;  4BI3 A;  1OEB A;  2EQU A;  1K8A C;  1BCM A;  4ESR A;  2LCS A;  2RHI A;  1OX9 A;  1OU9 A;  1UJY A;  3BDU A;  5GAM h;  4FM4 B;  2DXT A;  3MKD A;  4CC2 A;  3G4S T;  2AZS A;  5KYX A;  2XU8 A;  4M77 D;  5IHN A;  3CCJ T;  1IRX A;  2QQA A;  2X3X D;  1SSF A;  4OMO A;  5KYX B;  2COW A;  2Y4X A;  2RD1 A;  2B8A A;  4FT2 A;  5J26 A;  3I55 T;  3JCM f;  1M3B A;  3O8V A;  2XD0 A;  2MF2 A;  4OGE A;  1W6X A;  4J9H A;  1AWX A;  3MET A;  4M7D A;  3CCM Q;  1I1J A;  4BUG A;  1I4K 1;  1JU5 C;  3MPU B;  1N9R A;  5J3B A;  3KBG A;  4ELZ C;  3OYG A;  5FRO A;  5LJ5 d;  1YN8 A;  5HCK A;  5GAN 8;  4XAX B;  2FPD A;  1YWP A;  1KK7 A;  3JCM e;  4E7Z A;  4RTX A;  2HAX A;  2F1L A;  3VYH B;  4P5N A;  1YJW A;  2J05 A;  2QGG A;  4PLI A;  2PVD B;  2DO3 A;  4JZ4 A;  1X69 A;  3UT1 A;  3X24 B;  3M4Y A;  4KH1 B;  1MMG A;  3H6Z A;  5DY9 A;  3TSW A;  2JJ9 A;  1B07 A;  1TSF A;  2RO0 A;  3A8M B;  4J8O A;  5LJ3 h;  4C92 F;  4E47 A;  3JV3 A;  2YUP A;  1P92 A;  2DA9 A;  2MAM A;  1VQ8 Q;  3RER A;  2EBP A;  3RES A;  1VQ7 T;  5IHK A;  3PTA A;  1H92 A;  2RQT A;  5GAN e;  1K76 A;  1WGS A;  4LDW A;  2E1H A;  2ZGW A;  1V1C A;  5GJW B;  1M9S A;  2K6D A;  2QG9 B;  2H3E B;  4HXJ A;  1IXD A;  2QYZ A;  5GAN d;  1RUW A;  3GF5 A;  3LX7 A;  4JS4 A;  1IGU A;  2DEQ A;  2K3X A;  2RQU A;  2SEM A;  2EVR A;  4AFU C;  3OSS C;  3JCM g;  2W0Z A;  2X35 A;  3EG2 A;  3H0F A;  2M0O A;  2HL5 C;  3OYD A;  4OB1 B;  3JAM E;  3L2U A;  2XID A;  1BIB A;  2AT1 B;  4MZM A;  5CK9 A;  3M54 A;  3GLX A;  1VQ6 A;  1VQK A;  4HA8 A;  1OX8 A;  2CT3 A;  1G2B A;  2OJ2 A;  4LE9 A;  3PMT A;  1TOV A;  4HVV A;  1Q86 U;  2KK4 A;  1G3S A;  3FEO A;  2K4Y A;  4RUG A;  7AT1 B;  2J7I A;  2LT1 A;  3KXT A;  2J6O A;  2DL3 A;  5KE2 A;  1UJ0 A;  1BI1 A;  4C92 E;  2OTL T;  2D0N A;  2R5A A;  1ZQ1 A;  2JOY A;  4C8Q A;  2D0Q B;  3ASK A;  2EJ9 A;  5GMK m;  4DBH A;  1WHJ A;  1AD5 A;  3FRN A;  2LJ1 A;  1MMD A;  2RHZ A;  3E9F A;  1TH7 A;  2CYZ B;  2FEI A;  4PJL A;  4JS5 A;  3AHU A;  4J6W A;  2DM1 A;  1BI3 A;  1WX6 A;  2DFU A;  4OB0 B;  1NEB A;  1BKB A;  2CP3 A;  5FW9 A;  3CCJ Q;  4PL6 A;  4GBQ A;  4DBF A;  1DJ7 B;  1W70 A;  2LX9 A;  2KNB B;  4M78 G;  3TCJ A;  4WTO B;  2DEU A;  5GAO m;  2EYY A;  4Z02 A;  3CCQ T;  3I55 Q;  4PLL A;  5LL6 S;  2GFA A;  2MCN A;  1ABO A;  5CAI A;  2ATC B;  1VA7 A;  4QQ6 A;  4BD3 A;  2X4Y A;  2QTX A;  1WQW A;  3CC4 T;  1RI0 A;  3MEU A;  4D6W A;  5IXF A;  3P8H A;  3D7S B;  1I81 A;  4DA4 A;  2DRK A;  2PZ1 A;  3AT1 B;  5GAN h;  2X51 A;  4N4I A;  1WHG A;  3LGL A;  3OYF A;  1M3A A;  1UG1 A;  2LZ6 B;  4OF1 A;  2V8J A;  2RM4 A;  4ZGE B;  1YJW T;  1MMN A;  2DYB A;  4XU1 A;  2EQM A;  1D3B A;  4RTT A;  3UPU A;  2L8D A;  4DQ2 A;  3EFS A;  1BK2 A;  3EGX B;  3HFN A;  1IO6 A;  1E7O A;  3M9Q A;  3CCM A;  4M75 D;  4ELY C;  3ZEH A;  1D1C A;  1D3B B;  2LT4 A;  3QYG B;  1K73 C;  1QMC A;  2KRO A;  3FIF A;  3M58 A;  2YLB A;  1LPL A;  4QVC A;  1VQP T;  3M53 A;  4JJB A;  2LDM A;  2RJE A;  4LUE A;  4OP0 A;  2F2V A;  1GXI E;  2OTJ Q;  4Y91 A;  4J9F A;  3WXM B;  3G1J A;  1GCQ A;  1Z9Z A;  3RDV A;  4RMO A;  4LDU A;  5GAO p;  2K9G A;  1PD0 A;  1WXT A;  3PNW C;  4OMQ A;  2E6N A;  2JZ2 A;  2YDL A;  4CC3 A;  4K11 A;  2FPE A;  4M77 B;  1XTD A;  4XTY A;  5D6X A;  4OB2 B;  3QUI A;  2CP0 A;  3OW2 A;  4MDX A;  4RG8 A;  3QHS A;  4EDU A;  2O88 A;  3LGF A;  3OQ5 A;  1IB8 A;  1OI1 A;  2R57 A;  2B86 A;  3E1S A;  4N4H A;  3F70 A;  2MWO A;  3KUF A;  2PVO B;  5GAN 5;  2W10 A;  2DZ9 A;  2BZY A;  3CCS T;  4D8K A;  4FSX A;  2RHX A;  4LD9 K;  2KXC A;  1VQ8 A;  1WHK A;  2K3Y A;  1QVG P;  1QVG A;  5CKF A;  5FLX E;  2DXU A;  1VQ6 T;  1UEC A;  2A0F B;  1GL5 A;  3M0U A;  4J83 A;  3C0C A;  1T0J A;  1HK9 A;  2YSQ A;  2K5I A;  2D9T A;  1XNI A;  3E9G A;  1YIJ Q;  4X9D A;  1SSH A;  4HVU A;  1OQK A;  3EGD B;  4PJO A;  3GOX A;  1RAG B;  3OS0 A;  2CS7 A;  2XIC A;  1U1S A;  3JRZ A;  4XTW A;  2L5Q A;  1GFC A;  1O9S A;  2QQS A;  1HYO A;  2OTL Q;  4M7A A;  1FMW A;  5CKD A;  5I11 A;  4M7D D;  2EWN A;  2KE9 A;  1R77 A;  2VC8 A;  2X4J A;  3VS4 A;  4CC7 A;  2VV5 A;  1KD1 R;  2DBK A;  2K5F A;  4DEY A;  1ZSZ A;  2DVE A;  1UFF A;  1X43 A;  2OAW A;  2VWF A;  2LNH B;  5CIU A;  2R58 A;  5AT1 B;  1S72 T;  1ZSZ B;  4JJC A;  4J9D A;  5KH6 A;  1KC8 C;  2L89 A;  2ABL A;  1FX7 A;  3J80 E;  3R6N A;  4FU6 A;  5CO7 A;  1S1N A;  4C92 C;  5GJV B;  3CCL T;  3CCQ Q;  1PD1 A;  2XDB A;  4KUI A;  3FLG A;  2K57 A;  1M90 R;  4OMM A;  2FHD A;  2LQK A;  1FMV A;  2CGH A;  1Q82 U;  2BTT A;  4M78 F;  4OB3 B;  4EMK C;  3CC4 Q;  2COY A;  2P4T A;  3GIB A;  2ED0 A;  4CRI A;  2ROL A;  1PKT A;  2Z0W A;  2EYQ A;  3A98 A;  4QVD A;  3DLM A;  2RK2 A;  5FRM A;  3CCJ A;  2EGE A;  3M0R A;  1G5V A;  2HMA A;  2RB6 A;  2CH4 A;  2CRE A;  2QQ9 A;  2WSC E;  1OUL A;  3NFC A;  3I55 A;  1UGR B;  4LDV A;  4F7U B;  2DMO A;  5GMK i;  1NJI U;  2XHC A;  3LH5 A;  4PFP A;  3JCM Q;  1N27 A;  1M90 U;  4NL2 A;  2NUT A;  2R5M A;  4OVA A;  5GAM j;  2RH2 A;  4MZP A;  2V1R A;  5HK0 A;  1VQP Q;  2CDT A;  1W2B S;  3SWN A;  1QWE A;  2E6Z A;  1BB9 A;  4II1 A;  1PSF A;  1N9S A;  1RAI B;  3OS5 A;  4BE0 A;  1W4S A;  1PKS A;  2FZK B;  3SWN B;  2RA2 A;  2J06 A;  3OW2 S;  1M1K C;  5FU6 B;  4BE2 A;  2JVV A;  4KGZ B;  3VRY A;  3ZBD A;  3LLR A;  1K8A R;  4LD6 A;  3HPW A;  4FW2 A;  4MMK A;  2ZPF B;  4RG2 A;  2YUN A;  1VYU A;  3G71 T;  2GTO A;  5L8R E;  4M78 E;  2RI3 A;  3CCS Q;  3JCM J;  1C1A A;  4C8Q D;  1QLY A;  3M5A A;  2OTJ A;  1B34 A;  1K9M U;  2FB7 A;  4F14 A;  1I0C A;  1T3L A;  4QW2 A;  3OY9 A;  5GAO q;  4LN2 A;  1QWF A;  5ECA A;  2HKN A;  1JXO A;  2EQK A;  2KMT A;  2OI3 A;  3ULR B;  4J9E A;  1X2Q A;  1M2O A;  3SD4 A;  5GAO r;  3BE3 A;  1C0M A;  1Q95 G;  3I5R A;  1QVF A;  1UGV A;  3M0Q A;  2DRM A;  2DTI A;  2VGM A;  5GMK j;  4M75 B;  4F17 A;  3OMG A;  1N8R C;  2EAY A;  3OBY A;  2EYZ A;  2LVM A;  3CME T;  2L2P A;  4M77 G;  2KYM A;  2DIQ A;  5GAM g;  4ZGD B;  2CKK A;  4JPB W;  4LNP A;  2EKH A;  1MV3 A;  1YIJ A;  4FYV B;  4A63 B;  2JTE A;  1WA7 A;  2O4X A;  2E70 A;  1PHT A;  1S72 Q;  2M1H A;  3JCM b;  1I07 A;  1NLP C;  5KYW A;  1H64 1;  3CQT A;  1OZ2 A;  2VB6 A;  3OSV A;  4ORZ A;  2O4X B;  3J7A F;  3CCL Q;  1LVK A;  2OTL A;  4AFS C;  4F16 A;  1YCY A;  4DBQ A;  3C95 A;  1NE8 A;  2DIL A;  5KYN A;  3RBB B;  4A4K A;  1WLP B;  4BI4 A;  3FB9 A;  3H8Z A;  3T9N A;  1VYV A;  2HEQ A;  1GRI A;  1Q81 R;  4X9C A;  3OYC A;  1U1T A;  3V8J A;  2D6F A;  3MP1 A;  2LJ0 A;  5LJ5 j;  1M4Z A;  2EFI A;  4BY6 C;  1UDL A;  5KCH A;  3NPF A;  4B9X A;  1PRM C;  2HBP A;  4RTV A;  3CCQ A;  3OYL A;  3CBM A;  4ZN3 A;  1TTH B;  2LQN A;  3OBW A;  2DD4 A;  5GAN 2;  4QQG A;  4N0A C;  3CC4 A;  2AIR B;  2IVW A;  4XU3 A;  2VAS A;  2GCX A;  4M7D B;  1G3T A;  2ZPH B;  3EAE A;  4KUD K;  1B7T A;  2EW3 A;  1Y07 A;  4E7J A;  4Z89 A;  2QGF B;  3CBO A;  3QG1 A;  2RHY A;  5J39 A;  2HNI A;  3JSC A;  2M16 A;  2RQR A;  3EFO A;  4BB7 A;  2EQI A;  5A0G A;  3HTR A;  3BDL A;  4IIO A;  3ZFJ A;  3EFO B;  3RKW A;  1RL2 A;  2LTO A;  1QCF A;  3OS1 A;  2C0O A;  3VYG A;  2JM9 A;  2GNC A;  4KRT A;  5M9O A;  1QCN A;  1PG5 B;  3JCM d;  3M55 A;  4PJO D;  2LC4 A;  3OYB A;  1WFW A;  3LW5 E;  2K5L A;  1NM7 A;  4AG2 C;  3WVD B;  1ZUK A;  3G71 Q;  1AZE A;  2DPP B;  2D8J A;  4JJD A;  2E12 A;  1VQP A;  2V26 A;  2KBT A;  4M7A D;  2OTJ T;  4PJJ A;  2M02 A;  2CP2 A;  2V8I A;  4JUV A;  3PIO A;  4AFQ C;  1AVZ C;  3SHW A;  1ARK A;  5I22 A;  2P4R A;  3HFO A;  5EG2 A;  4F7U G;  4J7I A;  3NMZ C;  2FVU A;  2XKO C;  3H0H A;  1YI2 Q;  4BDY A;  1F1B B;  1RLQ C;  1LNX A;  2NUP A;  3MP8 A;  5C6S A;  2FG0 A;  2RHU A;  1Q7Y R;  1QVF S;  4M4Z A;  4M78 C;  2F5K A;  2OX7 A;  3SB2 A;  3MJX A;  1WIE A;  4WCI A;  1Y57 A;  5LJ5 g;  1H8K A;  3TU4 K;  3CCS A;  1BIA A;  2DL7 A;  3VS0 A;  1WNL A;  3CXC S;  1YP5 A;  3HRS A;  1IHW A;  2KVQ G;  2VXF A;  1TU0 B;  3C4S A;  1KG1 A;  4LDY A;  2CUD A;  3P8D A;  5D7U A;  4E7I A;  1LCK A;  2ZPG B;  1AWJ A;  1R0C B;  2DAQ A;  1CKB A;  2EYW A;  4J6X A;  3CME Q;  2O01 E;  5I21 A;  3S3N A;  1H3H A;  1YIJ T;  2C0I A;  1NEG A;  2YWW A;  1X6B A;  3OYN A;  1K73 R;  1K1Z A;  2JN0 A;  1Q7Y U;  1FWZ A;  4M77 F;  4ZN1 A;  5GMK l;  1K9A A;  1EFN A;  5D6W A;  1EX4 A;  3DLL A;  3JCM c;  3REA B;  1WJS A;  3DB3 A;  3A8G B;  5IH2 A;  1RAB B;  2GF7 A;  4NL3 A;  4C8Q B;  2KGT A;  2KSS A;  3O5Z A;  2AHJ B;  2YUO A;  2L3Q A;  3EH2 A;  3A1P A;  5CCA A;  3JCM h;  5GAO n;  2QDL A;  3V7C A;  2O9S A;  3GP8 A;  2JXB A;  5CKH A;  5A0L A;  2YHT A;  1S72 A;  1WHL A;  3JB9 G;  2QQR A;  2YRD A;  5CKE A;  1VQ9 T;  2DKG A;  4M75 G;  2KRM A;  3CCL A;  4N4G A;  2EPD A;  2SRC A;  1Y96 A;  4IUT A;  2RJF A;  1D09 B;  5KE3 A;  1D0Z A;  2F5T X;  1VIE A;  4A4G A;  4C92 A;  3ZL7 C;  1JBM A;  1Y96 B;  4JRK A;  3FDR A;  3QKJ A;  4Z88 A;  1VQO T;  1PSE A;  2MOX A;  3TSZ A;  3PVQ A;  2GBQ A;  4BI8 B;  4XK8 E;  2Y90 A;  2DJQ A;  4J9B A;  1Q86 C;  1T0H A;  1R8O B;  3M57 A;  2GGR A;  1X6G A;  4J9G A;  2DZC A;  4M77 E;  1VQM T;  4HVW A;  2G3R A;  3JB9 D;  1KHC A;  2E5K A;  3MCA B;  3CC2 T;  1GFD A;  4FYX B;  2BUD A;  2K2V A;  2GFU A;  1W2B P;  1W2B A;  2BE9 B;  2CT4 A;  3HP9 A;  2LQ8 A;  5CQY A;  1WI7 A;  3RNJ A;  3GPL A;  3M0T A;  4E7S A;  3QYH B;  3OW2 P;  1WHH A;  4TVR A;  1YHQ T;  1OZ3 A;  4A4H A;  5DLO A;  3VUZ A;  2QAZ A;  2LCL A;  3MEV A;  3VU3 C;  3GBQ A;  4OMP A;  3RKX A;  3G71 A;  1NLO C;  4XTZ A;  4M7D G;  4PFZ A;  4F7U F;  3HKS A;  4C0D B;  2EGC A;  3FC3 A;  3Q1J A;  3UA6 A;  4LXC A;  2KXD A;  4CI0 C;  3QBY A;  1QCO A;  4XTV A;  2PUK B;  4FSS A;  3MP6 A;  1JJ2 A;  2A37 A;  3I9Q A;  4VUB A;  2X4X A;  3UA7 A;  2WSF E;  3I56 T;  4C0Z A;  4XU2 A;  1YWO A;  1GBQ A;  1YI2 A;  2FZC B;  1M8M A;  3SDZ A;  1WJQ A;  2LP5 A;  4Z8A A;  4HCB A;  1AWO A;  2X9H A;  2GQV A;  4PJO B;  3ME9 A;  1JB0 E;  2A7Y A;  4HCC A;  3QII A;  2DET A;  4C0G A;  1GCP A;  2XI9 A;  4IUV A;  1XOV A;  2H8H A;  5FU7 B;  4Y28 E;  1M2V A;  2CP5 A;  2FRW A;  2KAF A;  4OMN A;  4M7A B;  2QEX T;  1LOJ A;  2GQI A;  3CME A;  1ACM B;  4R55 A;  2DX1 A;  2PU9 B;  1PCX A;  3MEA A;  1UTI A;  3PE0 A;  1M5Q 1;  4GLM A;  3BY7 A;  3PVL A;  3R6O A;  1VQ9 Q;  4HCZ A;  1VQ5 T;  3OYA A;  1YJ9 T;  2HCK A;  1JRI A;  4KUL A;  4AG1 C;  2J6K A;  4F7U E;  3M0P A;  3J81 E;  3OYK A;  1OPL A;  2DXB A;  2XDD A;  2HSP A;  4QT7 A;  1WPY A;  2G6F X;  3JB9 F;  4IIM A;  4E6R A;  4RTW A;  1PWT A;  2RJD A;  2E3I A;  1KD1 U;  1VIF A;  4M75 F;  2VKN A;  1BU1 A;  5I2S A;  2KYB A;  3QZ5 B;  3FJP A;  1X2K A;  1VQO Q;  3GNF B;  5HKC A;  1ZUY A;  1JEG A;  4EMH A;  3NTH A;  3E2U A;  2YRV A;  2MPX C;  2CP7 A;  2LX7 A;  3V8L A;  2AKL A;  3EFR A;  3THK A;  3VKI A;  5IAY A;  4PKC C;  3L2Z A;  2XG8 D;  1YJN T;  2YLC A;  3L1A A;  4IUR A;  3TVT A;  3LH0 A;  2QXF A;  3G7Z A;  1VQM Q;  3I5S A;  4HT8 A;  3OA6 A;  1CSK A;  3CC2 Q;  5L23 A;  3KFV A;  3CMA T;  2VUB A;  4KGV B;  3RKY A;  4FW1 A;  4C8Q G;  4D8D A;  3QPH A;  2BZ8 A;  2HD0 A;  2D8H A;  4E7L A;  2Y4Y A;  3JCM X;  2RQW A;  5GAM f;  2P0P A;  4IUP A;  2NUT B;  2FYK A;  5A0D A;  4XU0 A;  5GAN 4;  4JDS A;  4E7H A;  3A8L B;  1I8F A;  1TS9 A;  5AYF A;  4B9W A;  5DLQ E;  1UGQ B;  1VQN T;  2CZ7 B;  1WZO A;  2HDA A;  2KDS A;  4M77 C;  3I35 A;  2D1X A;  2VXE A;  1YHQ Q;  5CQX A;  1G8X A;  3L42 A;  2MK5 A;  2DTH A;  4FL6 A;  1WJR A;  5GAM e;  4GY5 A;  1CKA A;  2PNI A;  3M56 A;  1Q82 C;  2LJ3 A;  1QKX A;  4M75 E;  1KD1 C;  1TUG B;  2RI2 A;  5CKB A;  4RTU A;  3X25 B;  4RTY A;  2QA4 T;  1HSQ A;  1B34 B;  4M7D F;  4O6J A; 
#chains in the Genus database with same CATH homology
 1Z9Q A;  2KNB B;  1MUZ A;  4IIO A;  2AKK A;  2DNU A;  2EYY A;  3VS5 A;  1QCF A;  2MCN A;  1ABO A;  2C0O A;  1KSW A;  2L3P A;  1RLP C;  2JM9 A;  2GNC A;  4KRT A;  1VA7 A;  4J9C A;  3NHN A;  1AWW A;  2RMO A;  1K0S A;  1TUC A;  1RI9 A;  1WFW A;  1KJW A;  1NM7 A;  2A36 A;  4AG2 C;  1SRL A;  1ZUK A;  2YUQ A;  1AZE A;  2CUB A;  2D8J A;  1NYF A;  1JXM A;  4JJD A;  5IXF A;  1ZBJ A;  1ZX6 A;  1UUE A;  1J3T A;  2KBT A;  2DRK A;  2PZ1 A;  1ZSG A;  2RN8 A;  2KT1 A;  3VS2 A;  1M3A A;  2V1Q A;  1UG1 A;  2LZ6 B;  1E6G A;  4AFQ C;  2K79 A;  4LUD A;  1AVZ C;  2DYB A;  3SHW A;  1ARK A;  5I22 A;  4RTT A;  2P4R A;  1X27 A;  2A28 A;  2JT4 A;  2DF6 A;  3NMZ C;  1BK2 A;  3H0H A;  1IO6 A;  1E7O A;  1RLQ C;  3EG3 A;  3UAT A;  1OOT A;  2GTJ A;  2FG0 A;  2KRO A;  4M4Z A;  1OPK A;  1WIE A;  2RF0 A;  2A08 A;  1Y57 A;  4WCI A;  1H8K A;  4J9I A;  2HBW A;  2DL7 A;  3VS0 A;  2JMC A;  1JQQ A;  4JJB A;  1E6H A;  4LUE A;  1YP5 A;  2C0T A;  2F2V A;  2JM8 A;  4J9F A;  2CUD A;  1GCQ A;  1Z9Z A;  3NGP A;  1LCK A;  2K9G A;  4OML A;  4Y92 A;  1AWJ A;  4OMQ A;  1WXT A;  2NWM A;  4CC3 A;  2YDL A;  4K11 A;  2FPE A;  1CKB A;  2EYW A;  1SPK A;  1H3H A;  2VVK A;  2O88 A;  2C0I A;  1NEG A;  1X6B A;  2B86 A;  2DL5 A;  1K1Z A;  2KR3 A;  2JS2 A;  1KFZ A;  2W10 A;  2XMF A;  3EG0 A;  2BZY A;  1GCQ C;  3EHQ A;  4EIK A;  4D8K A;  1HSQ A;  1SEM A;  1K9A A;  1EFN A;  2RQV A;  2KXC A;  2DL8 A;  2JMA A;  1UHF A;  2DVJ A;  4X1V A;  3REA B;  1SHF A;  2I0N A;  1OV3 A;  5IH2 A;  1MV0 B;  1K0X A;  2KGT A;  2KRN A;  3O5Z A;  2YUO A;  1UEC A;  2L3Q A;  1GL5 A;  3M0U A;  3H0I A;  2O31 A;  2KT8 A;  2DE0 X;  2QDL A;  3C0C A;  1T0J A;  2O9S A;  2JXB A;  1SRM A;  1NYG A;  2L0A A;  2YSQ A;  2EGA A;  1SSH A;  4HVU A;  2EYX A;  2O2O A;  2KEA A;  4CC4 B;  2LMJ A;  2RPN A;  1N5Z A;  2KRM A;  1GFC A;  1M3C A;  2FO0 A;  2EPD A;  2SRC A;  1ZLM A;  5I11 A;  1G83 A;  2MIO A;  1WXU A;  4JZ3 A;  2KE9 A;  3VS4 A;  4CC7 A;  3ZL7 C;  2DLP A;  1TUD A;  2DBK A;  2M0Y A;  4DEY A;  4Z88 A;  2AK5 A;  2MOX A;  3TSZ A;  3PVQ A;  2GBQ A;  1UFF A;  1X43 A;  1GBR A;  2X3W D;  2DJQ A;  2OAW A;  4J9B A;  2VWF A;  4AFZ C;  2NUZ A;  1UE9 A;  2ED1 A;  2LNH B;  1U3O A;  4JJC A;  1T0H A;  2L3S A;  4J9D A;  2GGR A;  1X6G A;  4J9G A;  2ABL A;  3R6N A;  1S1N A;  4HVW A;  1WXB A;  5GJV B;  2E5K A;  3VS3 A;  1YCS B;  1A0N B;  4OMM A;  1GFD A;  3M0S A;  5FWC A;  2PTK A;  2BTT A;  2ED0 A;  1HJD A;  1K4U S;  1FMK A;  5FWB A;  2ROL A;  1PKT A;  2K7A A;  3A98 A;  1AEY A;  2CT4 A;  1WI7 A;  3FJ5 A;  2EGE A;  3M0R A;  3IQL A;  2CH4 A;  3RNJ A;  3VRZ A;  2CRE A;  3M0T A;  2RNA A;  2DMO A;  3REB B;  4ZNX A;  2ESW A;  3LH5 A;  2CH4 W;  1OEB A;  4ESR A;  1B3Q A;  3GBQ A;  4OMP A;  5IXB A;  2LCS A;  1NLO C;  2JW4 A;  1QKW A;  2V1R A;  1UJY A;  4CC2 A;  2AZS A;  2CDT A;  2EGC A;  1QWE A;  3SEM A;  3UA6 A;  3VS6 A;  1BB9 A;  2KXD A;  5IHN A;  3VS7 A;  1M27 C;  2X3X D;  5EC7 A;  1PKS A;  1U5S A;  4OMO A;  4FSS A;  1KIK A;  2A37 A;  2J06 A;  3I9Q A;  1PRL C;  3UA7 A;  1M3B A;  1YWO A;  2J6F A;  3VRY A;  3H41 A;  1GBQ A;  1M8M A;  1W6X A;  4J9H A;  1AWX A;  1ZUU A;  2FPF A;  1I1J A;  2YT6 A;  2YUN A;  2LP5 A;  4Z8A A;  1JU5 C;  2CSI A;  1VYU A;  2GTO A;  1AWO A;  1YN8 A;  5HCK A;  1JO8 A;  1QLY A;  1GCP A;  2FPD A;  1YWP A;  1SHG A;  1XOV A;  2H8H A;  3U23 A;  1W1F A;  4F14 A;  3QWX X;  1I0C A;  2FRW A;  1T3L A;  4RTX A;  4OMN A;  4RTZ A;  2GQI A;  3QWY A;  2J05 A;  4LN2 A;  1FYN A;  1QWF A;  2F2W A;  5ECA A;  1YNZ A;  2ENM A;  1JXO A;  4JZ4 A;  2OI3 A;  1HD3 A;  1X69 A;  3ULR B;  4J9E A;  1X2Q A;  2DX1 A;  2JS0 A;  2FRY A;  3VS1 A;  3I5R A;  1UTI A;  1NG2 A;  1U06 A;  1UGV A;  3M0Q A;  3PE0 A;  4GLM A;  1AOJ A;  3PVL A;  3TSW A;  2O9V A;  1B07 A;  1VYT A;  2DRM A;  3UF4 A;  2HCK A;  4AG1 C;  2J6K A;  3M0P A;  3JV3 A;  1ABQ A;  2YUP A;  4F17 A;  4DEX A;  2ECZ A;  1OPL A;  3EG1 A;  2DA9 A;  2HSP A;  2EBP A;  2EYZ A;  5IHK A;  4QT7 A;  2G6F X;  4IIM A;  4E6R A;  1UHC A;  4R0K A;  4RTW A;  1PWT A;  1H92 A;  2RQT A;  1K76 A;  2L2P A;  2VKN A;  1BU1 A;  2F2X A;  2KYM A;  2KYB A;  5GJW B;  1V1C A;  1X2K A;  1M30 A;  1JEG A;  1ZUY A;  4JPB W;  4LNP A;  2EKH A;  1MV3 A;  2K6D A;  2K3B A;  4A63 B;  2LX7 A;  4HXJ A;  2AKL A;  2JTE A;  1WA7 A;  1PHT A;  3THK A;  1RUW A;  1I07 A;  1NLP C;  5IHI A;  3CQT A;  2RQU A;  2SEM A;  3TVT A;  2EVR A;  4AFU C;  2LQW A;  4ORZ A;  3I5S A;  2W0Z A;  4AFS C;  4F16 A;  3EG2 A;  3H0F A;  1CSK A;  2DIL A;  5L23 A;  1WDX A;  3KFV A;  3RBB B;  2AZV A;  1WLP B;  4D8D A;  2BZ8 A;  1Y0M A;  2D8H A;  2CT3 A;  2RQW A;  1VYV A;  2HEQ A;  1TG0 A;  1G2B A;  2OJ2 A;  4LE9 A;  1GRI A;  3EHR A;  4HVV A;  2KRS A;  2DBM A;  2LJ0 A;  2IIM A;  4RUG A;  2HDA A;  2J7I A;  1UDL A;  3I35 A;  2D1X A;  3NPF A;  1PRM C;  2J6O A;  2CSQ A;  2DL3 A;  4RTV A;  2DL4 A;  1UJ0 A;  1AZG B;  2D0N A;  2K2M A;  2ROT A;  3EGU A;  2LQN A;  1AD5 A;  4HCK A;  1CKA A;  2PNI A;  2LJ1 A;  2LJ3 A;  1QKX A;  2FEI A;  2EW3 A;  2DM1 A;  1WYX A;  2M51 A;  4Z89 A;  4RTU A;  1WX6 A;  1PNJ A;  1NEB A;  1T3S A;  2RQR A;  5FW9 A;  2EQI A;  4GBQ A;  4RTY A;  1BBZ A;  2BZX A;  1W70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...