3HKSA

Crystal structure of eukaryotic translation initiation factor eif-5a2 from arabidopsis thaliana
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
144
structure length
144
Chain Sequence
SKTYPQSAGNIRKGGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTAKKLEDIVPSSHNCDVPHVNRVDYQLIDITEDGFVSLLTDSGGTKDDLKLPTDDGLTAQMRLGFDEGKDIVVSVMSSMGEEQICAVKEVGGGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Arabidopsis translation initiation factor eIF-5A2
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Translation, rna binding protein
molecule keywords Eukaryotic translation initiation factor 5A-2
total genus 31
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hksA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hksA02
5GQOA 3L0OA 1VQLT 1A62A 5LMNW 1VQIA 1XJVA 1YJWA 2A19A 2LVMA 2OWOA 4OWWB 1KD1U 3A74A 4KHZA 4JI2L 2ATWA 2BH2A 4DR7L 4A93G 1S3OA 4ME3A 2VZAA 3CAMA 5HY6A 3MEFA 3J7ZC 4NXNQ 4RG1A 1X55A 1Y1WG 1I3QH 4BBSG 4PMWA 1G6PA 2ZTDA 3H0GH 1QZGA 4IO9A 4BY7G 1L1OA 4JI7Q 1IYJB 2B63G 4QQDA 5FLMH 1U0LA 4LF7L 3KFUA 4DV2Q 1HNWL 2CFMA 1K73U 4JI7L 2N8NA 3U4VA 4LFCQ 3DLLA 4GKJL 1WOCA 3H3VH 1K73C 1SMXA 4DV4L 4DUYQ 1B8AA 4DR4Q 4P72A 4A3KH 4DK3C 1N36L 3CCQT 2JUFA 4GOPB 4GNXB 4POFA 5J26A 4X66Q 1LYLA 5LMUQ 2HHHL 2BH8A 1FJGQ 2QGQA 3K80C 3PCOB 5IT9c 1YJNT 3I56T 1Q81U 2N78A 1TXYA 4X66L 2E70A 4DR6Q 3RLFA 4QQBX 2QEXT 2JVVA 3K0XA 4IJLA 1JJ2A 3KJPA 4JBMA 1Y14B 1NJIU 3J7A5 2K5NA 4YY3Q 2OQ0A 1AE3A 3ERSX 3TREA 4LUZA 4A3GH 2V1CC 1UE1A 3CCUT 4BA1I 1G291 4LFBL 3CMAT 4OWTB 2RF4A 5C0XG 1Q86U 2N49A 1GM5A 2HT1A 2NVYH 2OTLA 1JJ2S 1YI2A 1YEZA 3K7AH 4R4CA 4UPAA 2VW9A 1Q82U 3PO2H 4BA2I 4YTLA 1CSQA 1Q12A 4YWKA 3KF6B 1E3PA 1HR0L 3KJOA 3OW2A 3GTJH 4YHHL 4IPCA 3I4MG 5FLXc 4GN5A 2IG0A 1PH8A 2XHCA 1C7YA 1YI2T 5GAGC 1C0AA 2ZJPA 3I4OA 1Q1EA 3CC7T 1JE5A 4H02A 2PQAB 3CP0A 4GNXA 1NBWA 5C0XJ 1VQOT 3MXNB 1V43A 3CXCS 1XMQL 1P8LA 5IT9E 5IYBH 4CRIA 3BU2A 3F2DA 4DV1L 5IP7G 1J5EQ 1YVCA 1XMOQ 3LGJA 2Z6KC 1NMGA 2LCLA 1PH5A 3CMEA 2ID0A 3FKIH 2NN6G 4DPGA 2E6ZA 4KLKA 3WWVA 3ZJYC 1N36Q 1WCMG 1N34L 1L2FA 1VQPA 1V1QA 1P16A 1S72T 3CCMT 2EXDA 1KC8C 3TS2A 1AE2A 2F3IA 4P71A 4DR2Q 3A5ZB 1IL2A 1VQNA 1X65A 5ELOA 2E5LL 4O2DA 4ZN3A 2PQAA 3CCSA 3S1NH 2UXBL 2WP8J 3BJUA 1UE6A 4A93H 1M1KU 3ULJA 1VQ8T 1GKHA 1BBWA 4LF6L 3KLWA 1PFSA 2F52A 3T1HL 4A3IG 1ASYA 4IPHA 3M3YH 5HGQA 3F2BA 4LUVA 5JJKA 4NXNL 1OTCA 1SROA 1EFWA 3T1YL 3HOUH 3OW2S 3M85A 3A0JA 2Z0SA 2KDSA 2AMCB 1UE7A 4DV6Q 4HIKA 4JI3Q 1QVFA 2MI6A 1D8LA 2OQKA 4JC0A 4NPSA 4R1JA 1CUKA 3K81C 3KDFB 1VCIA 4JBWA 3UDFA 4AYBG 4AQYQ 1HR0Q 1X56A 4HJ7A 3J81E 3E9HA 4A3JG 2R7DA 4DAMA 4XTCS 3CPFA 5AJ3L 2ES2A 1A0IA 4BBSH 1WJJA 3I56A 4C3IH 4JV5L 2NZHA 4L5SA 2JA7H 3GTGH 2UXCQ 3I7FA 5JJIA 4DR5L 2KBNA 1N33Q 3PF5A 1S72A 5IP9H 1TWFH 3NELA 4PZ8A 2HQLA 4FDBA 5LMNQ 2H5XA 1VQ8A 1K83H 2VUMG 1IXRA 1KL9A 1Z9FA 4X62Q 3CCLA 4DKAC 2KVQG 1HJPA 1YJNA 1VQMA 4LF4Q 1CKOA 2CWPA 1JB7A 2IHEA 1M90C 1QUQA 2EQSA 3TQYA 5C44G 2JQOA 2ZJRA 4B3RQ 4BBRG 4X65Q 1YJ9T 3G71A 3J7AF 4DK6C 4YCWA 4A3MG 1FJGL 3JAMi 3OTOQ 3E0EA 4GS3A 2NN6I 4A3LH 4A3IH 1HZCA 1QVGS 4PZ6A 4AYBE 4DV5Q 2RHSB 2UXDL 5GADC 3HOWG 4IOAA 2DUDA 1IZ6A 2VUMH 4DV4Q 3G4ST 1KIXA 1YITT 4MTNA 4LF6Q 1W2BS 4OX9L 4A3BG 2JNGA 2JA9A 1HZBA 2RHQB 2GVAA 1K0RA 1EQQA 3DM3A 4TVRA 2JJQA 4LF5Q 1IBKL 2WB1G 1J6QA 3HOXH 2VQFQ 3GTPH 3CC2A 3AFQA 2JA6G 5A2QE 2F4VL 4B3ML 3S2DH 3HOZH 1IBKQ 1HNWQ 2K52A 4IPDA 2VQFL 3CCLT 4UP7A 1Q82C 5GROA 4P74A 4YHHQ 4GLAC 3PO2G 1HNZQ 4WJ3M 3KOJA 3I55A 3CCRT 1EIFA 3J80E 4PZ7A 4TVAB 5IWAL 5IYCG 4DR1L 1KHIA 2R7ZG 1VQOA 4A3FG 3G71T 1Q1BA 3K7UC 3CCEA 1J5EL 4JV5Q 1M1GA 3J80c 3VDYA 1VQNT 3HOUG 4IFDJ 2I5MX 2R92G 2HIXA 4DNIA 1KXLA 1K8AC 1CKNB 1VQ4T 2ZJQA 4QL5A 3OTOL 4B3TL 3I55T 2YTVA 4A3EH 3HKZG 3D31A 2JA7G 5C44H 4EQ5A 5GAEC 4B3TQ 3F8TA 4A75A 2JK8A 1VQ5T 2KCMA 1HNXQ 3ER0A 4MZ9A 2VY3A 2GVBA 2UUAL 1EWIA 4R4QA 1T9HA 2L3RA 1C9OA 1QVGA 2YV5A 4OONA 2UUCQ 2NZOA 1SFOH 3CQZH 3GD7A 5DM7R 1N8RC 1KQSA 3HOVH 4A3GG 4DV2L 2CKZB 3HKSA 1HNZL 4GNXC 2R6GA 3PUZA 3CCRA 4JI6Q 3PGZA 1YZ6A 3IRBA 1QZHA 2YYZA 5JEAG 4DV0L 5IY0A 3JAME 3OYYA 3G4SA 1X3FA 3CCVA 4JI1L 4JI6L 3RLNA 1X9NA 1XNQQ 4OO1I 4Y7NH 2MQHA 1DGSA 1XNQL 2WAQG 1RL2A 4R4OA 3PO3G 1HZAA 3W1BA 5M3FH 2JA5G 1PH9A 3UDIA 1X3EA 3M4OH 4ALPA 1VQLA 1CKMA 1Z47A 2K5VA 4HJ5A 4DV1Q 2I0QA 2NVTH 3B6YA 1XMQQ 2I5HA 3ULLA 4R4IA 4AH6A 1WCMH 3D0FA 3E9IA 2QEXA 1CKNA 1O7IA 1VQ5A 1SE8A 2ASBA 3SGIA 3LGFA 1GO3E 4KHPQ 5C4JH 4HIMA 4AQYL 4JBKA 5DLQE 1VS0A 2GN5A 4GKJQ 2Q2IA 3CF5A 4DR1Q 2IX1A 1FVIA 2Y0SG 3S17H 4JYAQ 1I5FA 2G3RA 2MWOA 1K9MU 4GKKL 4LF4L 4KI0A 2E5LQ 4B3RL 2FXQA 2JA6H 1X6OA 1UE5A 4JI4Q 3PIOA 2R93H 4A4IA 1YITA 1QVFS 4HIDA 2QA4A 4OXPA 3GO5A 5LMNL 3PF4A 4NB3A 3F2CA 1Q7YC 1VQDA 3S15H 4DV5L 3DB3A 1PYBA 1W3SA 4LFAL 2E2IH 2UXCL 5FLXE 1L1OB 1GVPA 3PV0A 1M90U 1PYSB 3HKZE 3NBHB 5M5XH 4DR3L 4X64Q 1U5KA 3PO3H 1KQSS 4X65L 4A3CH 3UDXA 1IBMQ 4X34A 4A3MH 3HOYG 3KBGA 2HIVA 3CD6T 4APVA 1EOVA 2ZTCA 4JI3L 2E2JH 1I50H 3G6ET 1L1OC 1NE3A 4PG3A 1IBML 1IBLQ 4X62L 4A3DG 2MWPA 4JI1Q 1E1TA 1VQBA 1XMOL 1H95A 1VQHA 3GTOH 3RN5A 5FLMG 4DUZQ 5IYDH 2Z6KA 1E1OA 2UU9L 3W1GA 3PUWA 2Q2UA 1EQRA 4ZN1A 3GTQH 4X6AH 5M5WH 4DR4L 1TWCH 3P8BB 1YBYA 2R7FA 3Q8DA 3KF8B 1NZ9A 1VQEA 4OO1G 4TQUS 4LF8L 2KENA 4B3SL 5EAYA 3CCQA 4LW1A 4DR7Q 1VQCA 1R9TH 1OXSC 1PH3A 1WFQA 4QY7A 4IFDI 1Y1VG 4JYAL 5LL6S 3HOVG 4BY1G 3CCJA 1XNIA 1LTLA 4EX5A 2A8VA 2R93G 1PVOA 3JAMc 1K8GA 4YWLA 1SLJA 3W5OA 5C3EG 1VQPT 3PIPA 3CC7A 3KYHC 1SRUA 1N32L 1K8AU 2VQEL 1FL0A 3LGLA 1X3GA 3K8AA 1X54A 3RZOH 1N32Q 1VQ7A 2MO0A 3BZKA 2CCZA 1WI5A 2QA4T 3UE0A 3CCST 2UXBQ 4HJ9A 1B70B 1TWAH 3AEVA 3T1HQ 4DUYL 3ICEA 3U58A 3I2ZA 5H1SE 4L5QA 1KAWA 1MJEA 2K50A 2OTJA 3HFZB 4DV0Q 2B3GA 3UDGA 2IT1A 3CCUA 5E7NA 1XPOA 1FGUA 4LF5L 2D0PA 1TWHH 4IOCA 2R92H 2JA5H 4DV7L 3CC4T 1XNRL 4J15A 4A3FH 2C35B 1VQKA 1LM0A 2BA1A 1YHQT 1XPRA 5K36G 4RMFA 4B3SQ 2MFIA 1I94Q 2UUBQ 2N3SA 3M4QA 3S1QH 1YJWT 2A1AA 3CW2C 1S40A 1SSFA 4DUZL 1I94L 2D0OA 4JG2A 3HOZG 2UUAQ 2MO1A 1V9PA 3DB4A 3JC66 3CC2T 3G48A 1KRTA 4BBRH 1JJCB 3TEHB 5IYBG 2IY5B 1VQGA 3CMAA 1YHBA 4A3CG 1VQ9T 4K0KL 1B7YB 4JI5L 1HH2P 5FJ8H 4GN4B 4L5RC 3J80i 1KD1C 4GLVB 3PUXA 3PUVA 4HJAA 4NXML 2BA0A 2E8GA 4GN3B 2ZM6L 4GOPC 4XIGS 5JJLA 5ELNA 2CWAA 1PV4A 1JMCA 4MNOA 3A5UA 3I4NG 5BR8Q 3T1YQ 4LFAQ 5M3FG 2XTIA 3RR5A 2UUCL 1XTDA 1XNRQ 2KCTA 4JOIA 4P75A 4DV7Q 4QIWE 4A3JH 3H3VI 1PA6A 3GDEA 4B3MQ 2PMZE 3GTLH 2PI2A 5M3MH 1E24A 1VQ6T 4JI4L 1BVSA 1SR3A 3AYHB 4LF7Q 2F4VQ 1GD7A 1VQ7T 1VQAA 4JOIC 3CPWA 1Q46A 3S2HH 2IHFA 2LXKA 2VNUD 1VQ4A 3CD6A 3AQQA 3RNUA 1JJGA 1OXTA 3CCMA 4JI5Q 3UE1A 1N34Q 2E2HH 4LF9Q 3S1MH 4K0KQ 1Q81C 1ASZA 3STBD 3H0GG 2UU9Q 3H15A 2WAQE 3I4NH 1VQMT 3LH0A 1Y1WH 4JI0L 3CPWS 1L0WA 4A76A 3CCJT 2KHIA 2LXJA 1NJIC 2DO3A 4LFCL 3ULPA 5IYCH 1QVCA 1NPRA 1E7ZA 4A3LG 1UWVA 4O0AA 4L5TA 3CCET 1EYGA 1PH4A 1K9MC 1VQ9A 1OXVA 2JOYA 2HHHQ 1TWGH 1Q8KA 1NPPA 3CCVT 1QUQB 1YNXA 2WFWA 5J3BA 4UP9A 4JI8L 5C4XG 2XGTA 1A63A 2VS1A 4LF8Q 1EIYB 4JI8Q 2LQ8A 2K14A 1VQ6A 1NY4A 3TRZA 2RCNA 2YTYA 3HOXG 1Q7YU 5AJ3Q 4A3EG 4YY3L 3RZDH 3HOWH 4DV3Q 4C3JH 5M5YH 1HNXL 1HR0W 3STBC 5FJ8G 4LF9L 4JCVE 1OXUA 2I5LX 1MIUA 3KF6A 1PH6A 4DR6L 2PNHA 3L2PA 1VQJA 1I6HH 4DV6L 3FKIG 1UEBA 1IBLL 1K3RA 1JT8A 4JI0Q 2R7ZH 1SN8A 1A8VA 5JEAJ 1EUJA 3HOYH 1PH2A 1YHAA 4WJ4A 4JBJA 2ZTEA 4KHPL 2D62A 2DGYA 1E22A 2L15A 4P73A 2AWNA 1PH1A 2CQOA 3EBEA 3L7ZC 4QGUA 2ZM6Q 4LWCA 5M3MG 1VQKT 4OWXB 3J81i 1XPUA 1AH9A 2JA8G 1YJ9A 5IWAQ 1YIJT 4YCUA 3F1ZA 1KC8U 2WB1E 5LMUL 3GTMH 4LFBQ 2LSSA 3KDFA 1NTGA 4BXXG 1Q86C 1Y1VH 3S1RH 2IX0A 1OXXK 4UP8A 4GOPA 1N8RU 3NEMA 4HJ8A 3S14H 3FHWA 2KHJA 4A3BH 3CXCA 1MKHA 3NENA 4DR2L 4UY8C 3U50C 3S16H 4DAYB 1CSPA 4IPGA 3EN2A 4OX9Q 4R4TA 2K75A 5C4XH 3G6EA 2JE6I 4LUOA 3J81c 2VQEQ 4C2MH 4IFDG 2OTJT 4HIOA 4DR3Q 3AFPA 2Y0SE 4BXXH 3U4ZA 1KRSA 5IE8A 2NVQH 2AKWB 3RN2A 4BY1H 2UXDQ 2K5HA 1PHJA 4LNQA 4YCVA 4A3DH 4NXMQ 3PSIA 4GLXA 5IYDG 2AWOA 1BKBA 2VL6A 4JI2Q 5IP7H 1BBUA 4Y52H 2OTLT 4C3HH 3M9BA 2AHOB 3J81j 1PH7A 4BY7H 1G51A 1D7QA 5GAHC 5IP9G 2Q2HA 3M7NA 2EIFA 4DV3L 2B29A 2OCEA 4QJFA 1WYDA 3GTKH 5IAYA 2JEBI 3RLOA 1VQFA 2MNAA 4X64L 3EIVA 3TS0A 1MJCA 2YU9H 2PI2E 1HZ9A 4A3KG 2UUBL 3I4MH 2CKKA 4DR5Q 1N33L 2K4KA 1W2BA 1LUZA 3S24A 2YTXA 2Q2TA 3M4PA 4POGA 2NVXH 1M1KC 2JA8H 2JEAI 1N9WA 1RIPA 5BR8L 2ALYB 3FP9A 4AIMA 5C0XI 4GKKQ 4YWMA 2B63H 3CC4A 4IJHA 3BZCA 4RG2A 1YIJA 1YHQA 5C3EH 3PUYA 1NMFA 3CMET
chains in the Genus database with same CATH superfamily
2FINB 1VQLT 4CGYB 2A19A 2W0ZA 4IQZA 1LJOA 2JA7B 2LQKA 1JOOA 2FRWA 4OP0A 4P5NA 4BY7B 2VXEA 5HY6A 4NXNQ 2K5QA 4R0KA 2HMAA 2XRQD 2LMJA 1X01A 3VYTA 1X55A 5LJ5j 3UF4A 4CC7A 4PMWA 2L89A 2NYZD 4K2KA 3QZ9B 3HS0C 3S15B 4IO9A 4C3HG 3SHLA 4M75F 1IYJB 5GMKj 4QQDA 3U9OA 2PVGB 2DJFC 2J7ZA 4DV2Q 4L6V5 1C4QA 3KFUA 1GHKA 2N8NA 3TN2A 3OPOA 4EQPA 4GKJL 1PTOF 1WOCA 1XWEA 2Y0SB 3H3VH 1SMXA 2VV5A 4DR4Q 2AKKA 4GLKA 4QQGA 2DRMA 1HTPA 4QB4A 3LX7A 1JRIA 2FPDA 2X6LA 1TH7A 1X75C 3VYHB 3EGDB 2BH8A 5C6SA 2QGQA 5LJ5d 1WA7A 1YJNT 2DN8A 1QG7A 2A37A 2BE7D 1QP3A 4FXKC 4NMZA 2EZVA 1WCMB 3P1HA 1X2KA 5EG2A 2QEXT 1PTOC 4K5XA 1H8KA 3OYGA 2NVTB 5A0DA 1RAGB 2JJ9A 4LD6A 4A4GA 4V2SA 5D6WA 4ZTFA 1Y14B 2IX3A 1ILPA 1SMYD 1AE3A 4M77C 1D3BA 2QTXA 1EWCA 3DUZA 4BA1I 1PRTB 1NBEB 3S2DB 4C3IB 2AHJB 4OWTB 2HNIA 1EWHA 5C0XG 2D8JA 3GTPB 2RCFA 4M7AC 5HGTA 4BA2I 4UPAA 2VW9A 4M77B 1PFNA 3MFGA 1CSQA 1Q12A 2QXFA 3E9GA 4C8QG 4N4IA 4ZKCB 3HOWB 3NMZC 1E3PA 1HQMC 3L2ZA 4CKEA 1HR0L 5EBCA 2FRYA 4WTOB 1HJDA 1EZ8A 1HXDA 2GFUA 4K11A 1K8MA 4IPCA 4KD4A 4R56A 3G6EQ 5KGUA 2KT8A 5GAGC 4U673 1STBA 2LQWA 2NWMA 2KR3A 3I4OA 2ZJPA 4KY7A 1X69A 1Q7YR 2EQUA 1AEXA 5C0XJ 1ABOA 2DTHA 4DF7A 1BCPD 2K9GA 1FYNA 4JJDA 4N4HA 2Z9HA 2HDAA 3A7LA 5IYBH 3BU2A 4LXCA 4BE2A 3TSSA 1IRXA 4RTWA 4MDXA 1YVCA 1KK7A 2LCLA 2IL8A 3FMCA 4E7LA 2E6ZA 1N36Q 1CA5A 4R55A 2A3LA 1P16A 1V1QA 4MHEA 4CDEC 3CCMT 1KC8C 3D4WA 3VS4A 4XYOA 3A5ZB 4NOYA 1VQNA 1X65A 1BI0A 5ELOA 1PMRA 1STNA 1WHKA 2PQAA 3RERA 1CT1D 1VQ4Q 5I9PA 1SKUB 1M1KU 3H94A 1ZXTA 1VQ8T 3R8BA 1BBWA 1N5ZA 4WJWA 4RWSC 1WFWA 1Q82R 4LUVA 3G7ZA 1OULA 5HGQA 3F2BA 1SROA 1LACA 1NEBA 1Y8NB 1WHGA 1EFWA 3QIAA 2RDGA 4EGVA 3HOUH 1IYVA 1WGSA 3X25B 4UC4A 1GJXA 2AMCB 2K32A 4BS9A 2X35A 4K8IA 4HIKA 2PPBC 2BE9B 4PJNA 1I4HA 1TUGB 4NPSA 3KDFB 4JBWA 4AYBG 5IIFA 4HJ7A 4UY8C 1MGQA 5AJ3L 3TP5A 4M7AF 2NZHA 4L5SA 1AN8A 5T1IA 5IGDA 3X20B 3WOEA 4K6LA 3A8HB 5JJIA 4HCZA 1EYAA 1V8QA 2KBNA 2RJFA 3PF5A 5IP9H 3OYAA 5GAMh 1TWFH 1VQPQ 3VS6A 1XTCD 2HQLA 2GQIA 2KECA 2PUOB 3QPHA 4M77D 3SFMA 1QB5D 2VUMG 1IXRA 1KL9A 3CC4Q 1LO5D 2R57A 3R93A 5GAOl 2YLBA 1S5CD 2LKVA 3S1QB 3EH2A 1AWJA 4DU9A 1QUQA 3CRLC 4OHJA 3TQYA 3BS1A 4LDXA 2GCXA 2K5IA 4CKBA 3TZUA 4OELB 4R8NA 3JAMi 1YNNC 3E0EA 3OTOQ 1HZCA 1QVGS 1CI3M 4PZ6A 1TS9A 2A6HD 3CKIB 5GADC 3HOWG 2VUMH 1E7OA 2PW5A 1Y8PB 1KIXA 4BWGB 1PD0A 4BB7A 1W2BS 4OX9L 5CVIA 1EQQA 3DM3A 1YI2Q 4TVRA 4Z02A 4LF5Q 2IIMA 3VYUA 2EGCA 1J6QA 2VQFQ 4ESRA 3AFQA 4M77F 3TP8A 4FT4A 4B3ML 1IBKQ 2VQFL 4IPDA 4C2MB 2RK1A 1Q82C 2VYTA 5CAIA 2JXMB 1M8MA 2ZPBB 3I55A 1X3QA 4CHTB 5IWAL 1R9TB 2O2LD 3M57A 4A3FG 1DM0B 2ZXOA 3J80c 2GTJA 3TU4K 1VQNT 3EQLC 3HOUG 4O42A 2YUOA 4MIUA 3EG9B 1UEAB 2I5MX 3T16A 4DNIA 1SNQA 2FHTA 1CKNB 2M0OA 1EU4A 3VR2A 2HDLA 3R6OA 3I55T 4A3EH 3K5MA 2VB6A 3FPUB 4VUBA 3OYMA 3A8KE 1NLOC 4X9DA 2EQKA 1GUSA 2KCMA 1HNXQ 5GMKh 2UUAL 1NCVA 5ELDA 3BVZA 1T9HA 3KLSA 1SSHA 5ELBA 4M7AD 1TVXA 4Q5VA 1JWSD 4OONA 5J1ZA 3OMCA 1JQQA 4FYXB 1SFOH 4A3GG 1EIHA 3H0GB 1I4XA 2FMCA 3HOVH 2ZXRA 2EJFA 4KMUC 1OO9B 2E1HA 2K5WA 3PGZA 4K8JA 1AZEA 2BDNA 1W70A 3CQZB 5JEAG 3HOYH 3T4AC 5I22A 4JI6L 1X9NA 4TRDA 4OO1I 2EGEA 3PO3G 4GBQA 1T0JA 1N8RR 1TY2A 3TCJA 1PH9A 1RCVD 1QMCA 3MPUB 1X3EA 1CKMA 1EQTA 4ALPA 5GANe 1NYGA 1TG0A 4M7AA 3ULLA 1BCPF 1KQSP 3G71Q 2KMTA 1CKNA 3SGIA 2L9HA 1D6EC 2RQUA 5C4JH 4HIMA 1QCFA 4DR1Q 2K33A 3NWTA 2NVXB 3I4MB 4PLIA 2CP2A 4HKEA 2IVWA 4ATOA 3MXUA 1WIEA 1S72Q 1UE5A 4JI4Q 2R93H 1MUZA 1BIAA 1I4QA 1F77A 4C3JG 3PMFA 4HIDA 2BOSA 5LMNL 2JN4A 1SNMA 3OSSC 3HPWA 2MUYA 2OT2A 2F69A 4LFAL 2E2IH 3L2RA 3M4YA 2EY1A 4FYVB 1PYSB 2FO0A 2E2IB 1FNUA 1M2VB 4OEMB 1QCOA 4A3CH 2VVKA 4X34A 3HOYG 1DYQA 4R9WA 4A4KA 1PSEA 2E2JH 3S2HH 2ZTCA 5FO9B 4ZGJB 3TSZA 3OQ5A 1UFFA 5FRMA 3JRZA 5D7UA 4JW0A 1XYIA 2JA6B 5HURA 1TS2A 2MOXA 5CV7A 4HT8A 4DUZQ 2UU9L 3PUWA 4U68A 2G6FX 4M77G 2D0QB 1BI3A 4HT9A 2NLUA 4DBRA 3GNGA 2HUGA 2R7FA 2X6GA 3Q8DA 1D09B 4GY5A 4HCSA 3QR8A 3JB9G 1D5ZC 3H09A 5L23A 1IO6A 4B9XA 3PMIA 2M1HA 1J3TA 4LW1A 2LJ0A 3KUFA 1VQCA 4HAEA 2H3JA 2KXDA 3A7AB 4M78A 1WFQA 3I55Q 2F2VA 4F87A 1SDFA 2HKNA 4BY1G 4KV6A 2R93G 2B2WC 3FIFA 1O7ZA 4DGZA 5GMKl 5CKFA 5T1GA 5IGCA 5C3EG 3KYHC 3PIPA 2O2OA 4EMGA 2NUTB 1SRUA 2VQEL 2QDLA 3IAYA 2EYLA 2ZT9C 1NR2A 1WI5A 4X9CA 2L55A 2D5DA 5AFWA 1WXUA 3PVQA 2Q8RE 1HA5A 3U58A 1HA6A 5H1SE 4L5QA 4G7ZC 2K50A 3KFVA 2OTJA 2F5TX 4Z88A 3G1JA 5E7NA 2EWNA 2D0PA 3N52A 2B2VC 1E2VA 3PNWC 2QGGA 4J15A 2PVOB 1VQKA 1NR4A 4I7ZC 1AEYA 4A93B 1PTOH 2F0LA 4Z9CB 1MMGA 3E2UA 4JPBW 3FC3A 3OY9A 1KDCA 2N3SA 2DXUA 2F2XA 3M4QA 3S1RB 1GXDC 3S1QH 4J9BA 4J5YA 3UT1A 4DUZL 1KLUD 2AUKA 3CC2T 4EMKA 3SWNA 3TEHB 2IY5B 1MMDA 1VQGA 4M7DG 1BXTA 3T51B 3I4NB 2RK2A 5M9OA 3DKMA 2WB1B 4JRPA 2BZ8A 1F9PA 2E3IA 5M5WB 2RJEA 5KYIA 2ROTA 5ELNA 1S5BD 1VDZA 2VC8A 1ONLA 3D6WA 3EFSA 1U8RA 3BVMA 2XN9C 5BR8Q 1JB0E 4OMPA 3LH5A 3T1YQ 1HFNA 4JZ4A 2KQWA 1LTGD 1Q90A 1XNRQ 1T5EA 3MEUA 1PRMC 4DEXA 3H3VI 4CI0C 1PA6A 4JLGA 3GTLH 2PMZE 2EYXA 2BTTA 3A8LB 1E24A 5LJ3j 2XI9A 1BVSA 2F4VQ 1AP0A 1Y0MA 1IW7C 1GD7A 1VQ7T 4LUDA 2A69C 3EROA 1TWGB 1BBXC 4JOIC 3I35A 2OTLQ 1WHHA 4CDDC 4QQ6A 4M7AB 3CD6A 1JJGA 4BE0A 2KBTA 3URGA 2O9SA 3V7CA 2B2TC 2EY2A 2L4NA 3OIPA 5CV6A 3H0GG 1YJWQ 5GAMf 1B2TA 1Y1WH 4A4EA 3Q24A 1WVLA 4A76A 2EKOA 2LXJA 3A1PA 5A0GA 3QJYA 4DK1A 4IIMA 3EFOB 3DXJC 5IYCH 1BQQT 1BCPB 2M9VA 1NPRA 2DBMA 1NJIR 4NW2A 5DAUA 1JU5C 4S3SA 4BI8B 3RBBB 2IPKD 4ZK9B 1NE8A 1PH4A 1VQ9A 1U1TA 1SYGA 1Q8KA 5EQ0A 4C0GA 3U9SA 2LT4A 4ZQ3A 2YSQA 2R92B 1A63A 5GAMd 1EIYB 2CZ7B 4JI8Q 2YRDA 2LQ8A 5D3IB 3GOXA 1M4VA 1NY4A 1EY9A 3JCMX 3R2IA 4LUEA 2AIRB 3DEPA 3HOWH 1ZSZB 3VRYA 5M5YH 1HNXL 4F14A 1GBQA 3A56A 4JCVE 4UHVA 3MA2B 2EQJA 3QSUA 1VQJA 2PNHA 4M7DA 3FKIG 1UEBA 2GTOA 3QBYA 1JT8A 4JI0Q 1SN8A 1A15A 1GCQC 4KJOA 5JEAH 1TSFA 2DEQA 2D62A 2L15A 2AWNA 2NUPB 1PH1A 1U9RA 3NWSA 1MV3A 4MZMA 1Q86R 3QDFA 1LT4D 3L7ZC 3QOLA 4LWCA 4QIWB 2ZM6Q 4E7ZA 3G6JB 1KSWA 3PIO3 1LPLA 1KD1R 3S1RH 2IX0A 4QKUA 2RHYA 5FU6B 1N8RU 1OXXK 4UP8A 3S14H 3GIBA 2Z4IA 1NEGA 4XYQA 2NUPA 3U50C 4DAYB 1CSPA 3RMSA 2YRCA 5GJWB 4AFQC 2KT1A 3INZA 2MGSA 2LX7A 3FVQA 3RMQA 3EN2A 3VR6A 4OX9Q 4OMFB 1UUPA 2RN8A 3G6EA 4LUOA 3J81c 4C2MH 4QVZA 3MCAB 4DR3Q 2Y0SE 1WLPB 1IW7D 3D4RA 2ASBA 3RN2A 4BY1H 3A98A 4YCVA 2V1RA 1C0MA 3LYIA 5I2MA 2A5HA 1BKBA 4RAUC 3MEWA 4Y52H 2MYSA 2L0CA 2HQXA 4BY7H 2VGNA 5LJ5e 1T0HA 1K9MR 1G51A 3PQIA 5CV8A 5GAHC 1TT2A 2BDOA 2JYOA 1A3VA 2RF0A 1WYDA 3J80L 3GTKH 3WXMB 4BUGA 1R4PB 1VQFA 4X64L 2MNAA 1M1FA 1O7YA 1JQYD 4A3KG 3ZBDA 1U5SA 4ZNXA 4MZPA 4DBQA 3VS3A 2XMFA 3MP1A 1H9MA 2JA8H 3M4PA 2XRSD 4A3BB 3REAB 1RIPA 5BR8L 3S14B 2KY9A 5JVH3 2F3VA 4YWMA 4XQJA 3CC4A 3CBPA 4C92A 4IJHA 1HRJA 1XQHA 1YHQA 3X3MA 5GQOA 3L0OA 4PNOA 5FLXL 2LVMA 4OWWB 3A74A 2V1QA 2ATWA 2BH2A 3VS0A 3OA6A 2WINB 2R7ZB 3OYNA 3QB3A 2VZAA 2F3WA 5D65A 2EYPA 2B8FA 3MEFA 4C3HB 3J7ZC 4WF2A 2Q8TA 2X9HA 1I3QH 4KT0E 2ZTDA 1QZGA 1B9NA 5M3MB 2BZXA 3W3AA 1WTOA 1L1OA 2B63G 4A3JB 4C0FA 1U0LA 3I9QA 5LJ3g 1PRTD 1VA7A 3CBOA 1WTHA 1K73U 3NTIA 1TS3A 5GJVB 1K73C 2JSOA 3SWNC 5DM63 1WHJA 1CKBA 5C3EB 4DUYQ 1UHCA 4P72A 2LQNA 4E7KA 4DK3C 3GPLA 3O13A 4PJOF 4GNXB 5J26A 4X66Q 2RJDA 2DY7A 4H13C 2EYFA 2ZPHB 4D6WA 1DJRD 1W2BP 3I56T 1Q81U 4X66L 2K5LA 1TXYA 5BN4A 4DR6Q 5KNDA 1ZHIA 2B8GA 2P5ZX 2H3EB 3JCMP 3CCEQ 4ULLA 2JVVA 1NSNS 1AD5A 1G3WA 2AT1B 3EVQA 3HHTB 3J7A5 2K5NA 3TVTA 3OYEA 2LMCB 3ERSX 1LTSD 4A3GH 2V1CC 2F2WA 2KHSA 3CCUT 1BOSA 1EY4A 1PFMA 3I56Q 2K7VA 2RSNA 2RQVA 1G291 3I72A 4RCNA 1CM9A 2HZYA 4LFBL 3HOXB 2HT1A 5FK9C 1ZYRD 2NVYH 3EHQA 1JJ2S 2OTLA 4RH6A 4OMNA 3JCMc 2SNMA 2GFAA 2K5DA 2BZYA 1AZPA 5JVG3 3MXPA 4YWKA 1SFOB 2CZ1B 1ENFA 4HMIA 3VR4A 3KJOA 1QVPA 1PFBA 1RADB 3MC0B 1I4PA 4GN5A 2IG0A 2E65A 2XHCA 4KH1B 2F0KA 4M78C 4QT7A 3VR3A 1C0AA 2LS01 2LCSA 2F0MA 5C5LA 3AT1B 3CP0A 1NBWA 5E1FA 4GNXA 4HVWA 1V43A 1SPKA 3I5SA 3CXCS 3FJPA 1P8LA 1XMQL 4CRIA 2DF6A 3E0JA 4I7AA 1MMNA 2BE5C 4J8OA 1WXBA 5LJ3d 4PJJA 2CQAA 4DPGA 2KA7A 2NN6G 4KLKA 3CU7A 3ZEHA 1WCMG 5CK9A 1SG5A 2F3IA 4DR2Q 3L1AA 4C8QA 1WZOA 1W1FA 2LC4A 4OL7A 1B7TA 4WORA 3SK4A 3M54A 3OS0A 4ZN3A 2E5LL 2QKIC 5IXBA 2EJGC 2YRVA 1PTOB 2WP8J 3CC2Q 1AW7A 3ULJA 1GKHA 2F0DA 2PW7A 3KLWA 3OSOA 4A3IG 3D4DA 5CYUA 1ASYA 2KK4A 4M75B 4IPHA 4H7BA 3M3YH 5ELEA 3RMHA 5JJKA 3VR5A 1PRTC 3L3OC 3IQLA 5EPKA 1KTKA 4CJ2C 8AT1B 3A0JA 2DLPA 2KDSA 2Z6BA 4PL6A 1VQ7Q 3ITPA 4YHHL 3LNNA 1Z9QA 3K57A 1CUKA 3K81C 4AQYQ 2RI2A 1RUWA 3SB2A 1VF5C 4M75A 3J81E 2EDGA 4DAMA 2ES2A 4XTCS 5GAMj 1QCNA 1A0IA 1WJJA 2AUJD 2L8DA 5C4ZA 1HUMA 2JA7H 1ZLMA 1WTVA 3AB9A 1CKAA 4DN4M 2KI7A 2DYBA 2HAXA 2O4XA 4IUQA 2J7IA 4C92F 3MTSA 4J9CA 4C56C 1Z9FA 4XQNA 3RUXA 4RTZA 2FZCB 5FROA 4D8KA 1HJPA 4FF2A 1ZSGA 1CKOA 1HPCA 4RTVA 2E5KA 2BUDA 2JQOA 2A6ED 1TTHB 3ONAB 4DK6C 1U3OA 1UTIA 2ESWA 2QAZA 4A3KB 2EJFC 1FJGL 2RHXA 3M58A 4A3IH 3M4OB 4JVZA 4AYBE 4C1NI 2UXDL 2YXYA 5CV5A 2Y4YA 1QWEA 1A3TA 2HBPA 3H9NA 1IZ6A 1PHTA 1S1NA 1YITT 1D5MC 3O8VA 3JB9D 3H3VC 4LF6Q 2JNGA 2FPFA 2RHQB 2GVAA 2DIQA 1X27A 1SXTA 2B8AA 2MHVA 1WPYA 1I1JA 3VJPA 1BCOA 3CC2A 2FFKB 4J83A 3JCMV 2OX7A 4OMOA 1K28A 3HOZH 5GAOn 4L6TB 3OYIA 4UP7A 5GROA 4P74A 3RKXA 5C4XB 1MSHA 4PMBA 3BYYB 1N27A 1VOMA 1MHWC 5IYCG 1HD3A 2EPBA 4PQXA 1JE4A 1VQOA 4KKTA 5K36H 3G71T 3OYCA 1Q1BA 3M0UA 3CCEA 4F8MA 4JV5Q 4C5HA 1BUVT 3VS7A 4JJNK 2N88A 4ILWA 2B63B 2R92G 2HIXA 1FXXA 2KCCA 4C8QD 3F70A 2NYSA 1B07A 1PG5B 1IL8A 4QL5A 4ZAIA 4KRTA 3HP9A 5HCKA 3SEBA 4AG2C 2DA9A 2J0TD 3D31A 3HKZG 5BN3A 4EQ5A 4TSSA 5GAEC 2X4YA 4F7UE 5C5MA 2KVMA 4A75A 3TEEA 1E2ZA 2XIDA 2DERA 1EZ6A 4FL6A 3LWEA 3TDQA 2GVBA 2O5IC 5LJ3f 1PDQA 4FF1A 2FJ2A 4AFSC 4LDYA 2YV5A 3PMTA 2QQRA 3M59A 5DM7R 1BO0A 3CQZH 3GD7A 3MWYW 4DV2L 2F0EA 2R6GA 4F17A 2F0TA 2RDHA 2B2UA 1QZHA 2YWWA 2P0PA 3RZDB 2DXBA 3OYYA 3G4SA 1X3FA 4M78E 4KGXB 2EY6A 2MQHA 1AT1B 1YWPA 1WDXA 2X3XD 1RL2A 1VQ6Q 3OWEB 4R4OA 1HZAA 5M3FH 1KQ2A 2JA5G 2V8IA 1MGSA 5C3WA 3C0CA 5GANg 1E6GA 1VQLA 2K5VA 4DV1Q 4DOVA 3B6YA 4HN7A 1XMQQ 1A6XA 1KC8R 4R4IA 1WCMH 3D0FA 1EY8A 1CHPD 1TQOA 4FSXA 2QEXA 1O7IA 1SE8A 2N55A 1PSFA 5KCOA 3HFNA 3LGFA 1SJED 1U4LA 4A3EB 3C46A 4V190 3NBHA 4QVCA 2GN5A 4GKJQ 2IX1A 1G3TA 1FVIA 1I5FA 4Y28E 1B4OA 5KIXA 3GTMB 3JAML 2XSCA 4XQ3A 3GTOB 4KI0A 1GL5A 3GTKB 4XTWA 5EKLA 1YITA 1QVFS 2EYJA 5LJ5f 1PNJA 1F2MA 3GO5A 2QQ9A 4J9EA 4L59A 1DJ7B 4E47A 2C0TA 1KFZA 3FEWX 2H8HA 3F2CA 3PF4A 3S15H 3HOYB 1PYBA 4EPCA 2MK5A 1W3SA 4HEDA 5FLXE 3OS1A 1KIKA 1GVPA 1M90U 5M5XH 3K6OA 3WDNA 2ZPEB 1LTTD 2SDFA 5KYXB 4AT1B 4NDXA 4XXEA 1WQWA 3S3MA 1UNSA 2FYKA 2K6AA 2Z4HA 4X65L 4OIJA 3LLRA 4APVA 3E1SA 4BBSG 2YUQA 1NE3A 3G6ET 1M8AA 1IBLQ 4A3DG 1KHCA 4K5WA 2WV6D 2LZ6B 4KUIA 1D1AA 1VQBA 2HQEA 4CC3A 2LTOA 1VQHA 2PMZB 2PO4A 3I91A 3RN5A 2DX1A 2DVEA 3QWXX 4RTYA 3GTQH 2HQHA 4X6AH 5EGTA 2DL4A 2DKGA 1KJWA 4DR4L 4DAYA 1TWCH 4A3IB 1NZ9A 5GMKe 4L5GA 4YIJA 4EIKA 1I81A 2A74C 2KENA 3J7YW 5EAYA 1SNCA 1GRIA 1EY0A 1R9TH 4QY7A 5IHNA 1LT5D 1DONA 2G5DA 1JO8A 4HVVA 3MXNA 4YWLA 2NBFA 1SLJA 2KEEA 4RGTA 1W6KA 5BN5A 2DILA 3CC7A 1FR3A 1N32L 5KYYB 1BB9A 1FL0A 4BY6B 4JRQA 2X69A 2RHIA 2MAMA 4A3DB 1N32Q 1VQ7A 1WHLA 4CJ1B 1WJRA 2KYMA 2QA4T 4BDZA 3VA5A 4NL3A 4HJ9A 3T1HQ 3SDZA 4M77A 4DUYL 2A7YA 4OMLA 4M7DF 2VUMB 1KAWA 5E4WC 3HFZB 4ZYSA 2DD4A 2V8KA 1FGUA 3GV6A 1TWHH 2DEUA 3NQTA 3CC4T 3KK7A 1VQ9Q 5K36G 1LM0A 2QCPX 5CORA 1XPRA 4M78G 4B3SQ 4EDUA 1XXGA 1I94Q 1X2QA 5DY9A 5DNFA 1TU2B 2NN6H 2UUBQ 1VQMQ 1YJWT 2K3YA 1I94L 1BCPC 2UUAQ 2FPEA 3E19A 4OB3B 3DB4A 2XD0A 1W6XA 2SEBD 1KRTA 4BBRH 4JZ3A 1Y7XA 2WACA 4K0KL 1VQ9T 4R8IA 4JI5L 2HD0A 1AZGB 2P0QA 1HH2P 1SYDA 2M0YA 1CZGA 3PUXA 3JB9J 2ZM6L 4GN3B 4GOPC 3WVEB 3LWIA 2CSQA 1AVZC 2ZAEA 3QJ6A 4ZGEB 4XIGS 2JT4A 2DTOA 2XICA 2RJCA 4JLIA 4XTVA 2XTIA 2OJ2A 3C1FA 4JK1C 3D3RA 2LCCA 2RHZA 3JCMd 1JB3A 4XTZA 2F5KA 2F0GA 2KCTA 4J6WA 1VIFA 4DV7Q 4A3JH 2ZGWA 1ET6A 3VV0A 4B3MQ 2CH4A 2DZCA 1VQ6T 1SR3A 4PV1C 3FEOA 4DA2A 2AQ3B 4B6MA 1C6VX 2QG9B 1VQAA 2DL7A 3CPWA 4FYWB 2XG8D 5GAOm 1Q46A 2LXKA 1B3QA 1EIGA 2C9OA 1JXOA 4DK0A 1ZEQX 2VNUD 4JUVA 4BY6C 1VQ4A 1H9RA 4HSVA 1OXTA 4JI5Q 1QE6A 3UE1A 3K58A 3HL8A 2E2HH 1D0YA 3E5SA 4FP5D 1OEBA 2L1BA 1M1KR 4JI0L 3CPWS 1G8XA 2CHBD 3QZ5B 3CCJT 2KHIA 3I90A 3SVMA 2XWJB 2KEAA 1Y1WB 2DO3A 4LFCL 1PC0A 2O9VA 3OMGA 5A2QL 1E7ZA 1NG2A 3UI2A 5JJZA 1UWVA 1NYFA 2JA8B 2QDBA 2X51A 3GTQB 1RLPC 3M5AA 3URYA 1UGPB 2JOYA 3QHSA 2HHHQ 1TWGH 1YNXA 1QUQB 2WFWA 3R2TA 1Q81R 1TWHB 5J3BA 3W5OA 5C4XG 2MP1A 4LF8Q 2OTJQ 1F2LA 1OI1A 2DD5A 5KYXA 3DM1A 4C5EA 2CZ6B 3TRZA 1YNND 4Y7NB 1EY7A 2RCNA 1PM3A 3M9QA 3CCVQ 1Q7YU 2C06A 3HOXG 2A6HC 5M5XB 2I5LX 4BY1B 2A36A 2PTKA 1IBLL 3HRUA 4FU6A 3V7SA 2R7ZH 2HD3A 1A8VA 5JEAJ 2F1LA 1EUJA 1M4ZA 5IH2A 4QUFA 1FD7D 2QI2A 4JBJA 2ZTEA 1IXDA 4FXDA 1AOJA 3MO8A 2DETA 4P73A 4RG8A 1H9SB 2CQOA 2PNIA 2K5FA 2LFNA 5M3MG 1HHVA 4OWXB 5LL6X 3J81i 2JA8G 1RABB 3F1ZA 1Z9ZA 1ESFA 3TP7A 2LSSA 3KDFA 5IN1A 4BXXG 1EX4A 1ZSZA 2X4XA 4BE1A 3H6ZA 1Y1VH 1EU3A 2BKDN 5JPMC 3FHWA 4A3BH 1QOHA 3S16H 4PNYA 4IPGA 1OU8A 1YCSB 1SEMA 2MMPA 4DOWA 4R4TA 4XT1B 2E6NA 4J7IA 3V8LA 1L0XB 5GAMg 4FF3A 3UDCA 1W6JA 3HZXA 4G57A 1VIEA 3H0IA 4K14A 4CDFC 4BXXH 1Q8IA 1TUDA 3U4ZA 1KRSA 2Q8IB 3JCMb 5C4HA 1IREB 2K79A 5GANj 1R8OB 4LNQA 1G2TA 1SRLA 2B2YC 3K5OA 2VKNA 4ORZA 3PSIA 4KD3A 4E7IA 4E6IA 2VL6A 4JI2Q 1M2VA 1WTPA 2OTLT 3SWNB 1MMAA 2V8JA 2V26A 2Q2HA 2EIFA 1M5Q1 3FRNA 1FNVA 2H1EA 2OCEA 1UGVA 4QJFA 2R93B 4F04B 2JEBI 3RLOA 2JW4A 4XU1A 3EIVA 1YNJC 2YU9H 2RVLA 1HZ9A 2SRCA 4DR5Q 1N33L 2ABLA 1UUEA 2HL5C 2KXCA 5GMKm 3S24A 2AK5A 3EAEA 4XDXA 4K2LA 2JXBA 4IIOA 2NTTA 3FP9A 2MCNA 5C0XI 3OYLA 4PKCC 3NP8A 4GKKQ 3M4GA 2B63H 3CCLQ 1X6BA 4PFOA 1E0BA 3LWUA 1K83B 4II1A 1NMFA 1A62A 3QWYA 3V7RA 4DAVA 1XJVA 2ZPFB 2HEQA 2RMOA 4N0AA 1KD1U 1U4MA 4KHZA 1F2ZA 2NTSA 4O1NA 3JCMe 3GTGB 4DR7L 4A93G 2E12A 2PQEA 1VMPA 4RG1A 3BDUA 4M4ZA 2CGHA 3J81L 3WVDB 1G6PA 3H0GH 4EMHA 3HOVB 4KKSA 5GAN5 3IFDA 1HTLD 5CCAA 5EPJA 2EYHA 3CBMA 3FDTA 4JI7Q 1WHMA 1JOKA 5FLMH 4LF7L 4X3TA 1X3PA 1ZYRC 2Y90A 3TP6A 3REBB 4JI7L 4PFZA 3GLXA 4IN3A 3U4VA 3DLLA 4DQ2A 3M0PA 2L5QA 1B8AA 1LLRD 1S5FD 1N36L 3CCQT 2JUFA 1AZQA 4POFA 1RTNA 3JB9H 4N8FA 3OBWA 3DWAA 5LMUQ 3MXGA 2HHHL 3M56A 5EPLA 5KYUA 3PCOB 3BYTB 3MFYA 3BE3A 1T3SA 3P7JA 2RDFA 3RLFA 2KYBA 2KRNA 2MPXC 4QQBX 1JC7A 3EG0A 3P20A 4IJLA 4C8QE 1GUWA 3CRKC 3CMEQ 1NJIU 3FKIB 1YNZA 1RF2D 2D1XA 2OQ0A 4J9FA 3TREA 4LUZA 1UGRB 5L37A 3H91A 4HSPA 4V0BA 2RQWA 4IUUA 2EJMA 3HOZB 4BBSB 1UJYA 3CMAT 1B1ZA 1VQKQ 2PNRC 4OGCA 2N49A 1GM5A 2D9UA 1X32A 4MN3A 1H3HA 3K7AH 3PO2H 1N9SA 4ZTJA 2CW0D 3CEYA 2QTVA 4YTLA 4DAPA 2FVUA 2ZPGB 3VS5A 3MEVA 1K0SA 3NPFA 3HRTA 1FNWA 5LJ5g 3A55A 1M9SA 2EQMA 2FB7A 3GTJH 1QVFP 8ATCB 1AWOA 1ICWA 3OOCA 3VUZA 2RO0A 2D6FA 1PH8A 1Y8OB 3BVGA 2ZCFB 1GOZA 1ZUUA 3MKDA 2B2UC 2KQ3A 3RD4A 3CC7T 2LP5A 4IKFA 2M51A 1V76A 1A2TA 3MXNB 5G3LF 3EGXB 4PJOA 1JICA 5IP7G 4LDWA 1TIID 1XMOQ 1EYCA 3LGJA 4RKBA 4F7UB 2Z6KC 1HFGA 1PH5A 2ID0A 4DFAA 4PFPA 1SYFA 1N34L 1L2FA 1VQPA 4RFBA 1OX8A 1RAFB 4K6DA 1V1PB 3TS2A 4P71A 3SK5A 3KUPA 1IL2A 3NTHA 1EZZB 3S1NH 3QYGB 1UE6A 4FYYB 3BJUA 4A93H 5CKEA 2JTFA 1ENCA 2IPOB 3T1HL 5GAN3 1PFSA 3FPPA 1CSKA 3L2VA 1T5XD 1RLQC 3MP8A 4N9TA 1DOKA 1OTCA 1N6AA 3T1YL 2E2JB 3OW2S 3GTJB 1Y96B 1YCYA 4HCKA 2TSSA 4LMQD 2SEMA 4FF4A 4DV6Q 4XTXA 2K2VA 2OQKA 4JC0A 1VCIA 1GUNA 3UDFA 1XNQQ 2EGAA 1X56A 4A3JG 3E9HA 1HR0Q 1EQVA 1RHPA 4BBSH 1HUNA 3GF5A 3I56A 1N9RA 5GAN2 2MPMA 3JV3A 1YNJD 1QVGP 2J6KA 3AU7A 1EEFD 2UXCQ 1DZ1A 1YITQ 3I7FA 2DJGC 1CHQD 3BY7A 2EYYA 3FRPB 3NELA 1G3SA 4CKCA 3QDRB 1RDPD 1IB8A 4ZCKA 2ROLA 3A54A 4DXFA 3CCLA 4DKAC 1M2OA 2DMOA 3L2UA 3P8HA 1YJNA 4LF4Q 4JRKA 1K73R 4HVUA 2IHEA 1M90C 4JDSA 2EQSA 1JB7A 4FO2A 5FO7B 2ZJRA 1EEID 3S1MB 2PUKB 1YJ9T 3G71A 4YCWA 4LNPA 4A3LH 4GS3A 1U1SA 2AZSA 4L8JA 4M75G 2RHSB 2OF1A 2I2LA 3G4ST 4PJOG 3HRZC 4JS5A 2HSEB 2F4IA 2O4XB 4MTNA 1ARKA 3GBQA 5CGKA 4A3BG 2JA9A 1HZBA 1K0RA 3C3LA 3RZOB 1I3QB 5I11A 4Z8AA 1R0BG 4RCCA 1R0CB 3HOXH 3GTPH 1X43A 5CKDA 2GA4B 3S2DH 1HNWQ 2DBKA 2K4YA 3OYKA 1DD2A 2D2CC 4AG1C 1VQNQ 1PXUA 1STHA 3CCJQ 1HNZQ 1CK1A 3KOJA 4PZ7A 3CCRT 1EIFA 2B86A 3J80E 4F7UG 3UPUA 1ICFB 1GHJA 1KHIA 1PZJD 5C3XA 4ODGA 4RTUA 2MF2A 2R7ZG 4M78B 3VDYA 1NUCA 4G4KA 5HK3A 4IFDH 3MHXA 3L2QA 1PZID 2HCCA 4KN7C 1K8AC 1KXLA 2ZJQA 4J7FA 2IWHA 2YLCA 3OTOL 3FJ5A 1ET9A 5C4JB 4B3TL 2KCNA 2JA7G 3OYHA 4B3TQ 1MHNA 3H0HA 5I2YA 1E2WA 2JK8A 4M78D 1KNAA 4CC4B 3ER0A 4MZ9A 2VUBA 4RGOS 2VY3A 5DEHA 4CBVA 3TZDA 2CDTA 1I50B 3R3OA 2F1MA 3RUZA 1Y69U 2L3RA 1JWUD 1C9OA 5AYFA 2Z8LA 3P75A 5IGBA 4KTAA 1QVGA 4IALA 4PJOC 2MJ8A 2UUCQ 4KH0B 1N8RC 1KQSA 1A0NB 2CKZB 4OF1A 2BE5D 3OBYA 2COWA 3HEJA 4GNXC 3IRBA 3TMEA 3EGDA 1LTRD 3CC7Q 2YYZA 4F16A 3V2TA 4JI1L 5KEEA 3CCVA 4FYDA 1B50A 1F9QA 1XNQL 1IHZA 2WAQG 4IUNA 4RCOA 1M90R 1BI2A 1B53A 3GNFB 5CBAE 1Z47A 4HJ5A 3M4OH 5EC7A 4LE9A 2M2LA 3X3NA 2I0QA 3S6WA 2NVTH 3FB9A 3S17B 1YIJQ 4FW1A 4A4FA 5G3LD 4AH6A 3E9IA 1NM7A 3H6MA 1VQ5A 4H44C 1C48A 5KE2A 5CC4A 1RJTA 5DLQE 1VS0A 2KJXA 3CXCP 2Q2IA 3CF5A 2ED0A 3VA7A 2G3RA 5GAMe 5ELFA 2PVDB 2XVSA 4LF4L 3OB9A 1V1OA 2E5LQ 4B3RL 2FXQA 1GXIE 4TKOB 3A8GB 3NUCA 5KYNA 4ME7A 3VU3C 4A4HA 1SE4A 4A4IA 2QA4A 4OXPA 5K5PA 1SE2A 1OZ2A 5EKKA 5CR2A 1WQ7A 2J6OA 3DB3A 1OOTA 2FZKB 2GBQA 3PTAA 2UXCL 3PV0A 2VB3X 3NBHB 3E3XA 4DR3L 5M5YB 2F0NA 1KNEA 1U5KA 1Q3LA 1CA6A 1KQSS 4M77E 4RHRA 2C0IA 3C94A 3UDXA 2DL3A 3OYBA 1IBMQ 2HIVA 4HCCA 2MIOA 3CD6T 1LTID 2RA2A 4C5IA 1EOVA 5IYDH 3ERQA 4XAXB 3M0RA 4RTTA 4PG3A 2JTMA 2VWFA 1M3BA 3QKJA 2GQVA 2MWPA 1XX8A 2AQ1B 2G9DA 4KK7A 2RKSA 4JI1Q 1XMOL 5C0XH 1PKTA 1I4GA 3GTOH 2ZZDA 4M75D 2ICEC 5FLMG 1PYWD 2Q2UA 2JS0A 3PVLA 4E7JA 2DIGA 2DVJA 3EFOA 1EQRA 4X3SA 3W1GA 3ZYYX 1BNZA 1LOJA 3A8OB 3P8BB 1PTOD 3ND8A 2A08A 1K0XA 3KF8B 1VQEA 4NS5A 2F0FA 1F1BB 4MMLA 4TQUS 4OO1G 4B3SL 4IUVA 4NP5A 4DR7Q 1WTWA 2I46A 1VQLQ 1OXSC 2ATCB 1PH3A 3EGUA 4JYAL 1J9OA 1I07A 5LL6S 2F0WA 4HR7B 3CCJA 1XNIA 3V8KA 1LTLA 1WD1A 4M75E 3HOVG 1O75A 4NL2A 3JAMc 2F0PA 1K8GA 3HP3A 2AQ2B 3VS2A 3NGPA 1I0CA 1VQPT 1X3GA 3K8AA 1TOVA 1DCZA 1EY6A 3RZOH 2DNUA 1QNKA 1XJWB 2MO0A 3LX0A 4Y92A 2CCZA 1SE3A 4J9IA 4PJLA 3UE0A 1B70B 1TWAH 3AEVA 4QF4A 1H641 4X3KA 5IGEA 1MJEA 3CPWP 3UDGA 4DV0Q 2B3GA 4ZUJA 2IT1A 4AFUC 2R92H 2CUBA 3OS2A 4IOCA 4G7HC 4DV7L 5EKIA 2B2YA 1KDAA 2NVYB 3EG2A 5LJ3e 4A3FH 1OYXA 2BA1A 4HA8A 4IUPA 1IKLA 4RMFA 2MFIA 1FGBD 2COZA 2F0VA 2XK0A 1ZA1B 3GP8A 5CKBA 2A1AA 1S40A 2H4OA 2JMAA 2FL7A 3EH1A 5FU7C 4PMCA 3HOZG 2MO1A 1V9PA 2DL8A 2QK0A 1TXQA 2X4WA 4E6RA 3JC66 5IYBG 3NXWA 2KROA 4A3CG 2LDMA 1B7YB 2KEDA 3EA6A 4GN4B 5FJ8H 1JWMD 4HTHA 2EFIA 4PLLA 4L5RC 1ZA2B 5CIUA 5CR3A 3PUVA 1RODA 3T56B 4NXML 2F0JA 3QO2A 5KRUA 3CCMQ 2X3WD 5JAVA 1D1IA 1VUBA 1PV4A 4B9WA 1JMCA 5KNCA 1LNXA 1B34A 2R5AA 3JB9I 4DEYA 5DLOA 2PZTA 4LFAQ 5M3FG 2CP0A 1AWWA 3SK6A 2J05A 4UAIA 3RR5A 1XTDA 5I21A 1Q95G 3JCMh 1QKXA 3D6CA 1H3ZA 2P4TA 4N0AC 5C0MA 1OU9A 2PI2A 3JSCA 4M7DC 1H9KA 2IJ0A 3HG9A 3AYHB 5M3MH 4JI4L 2ECZA 4DNTB 2RH2A 2CS7A 2W10A 3OYJA 3M0QA 1TWBA 1D0ZA 2JZ2A 2BIVA 3VUBA 1BYMA 4J1MA 2KE9A 2IHFA 4M1UB 1KG1A 1D1KA 2NB0A 2O31A 4O6JA 3RNUA 1NLPC 3CCSQ 2CP3A 2R58A 4ELYC 3SHWA 3S1MH 1N34Q 4GZYC 1ACMB 1SNDA 4ID6A 1YJNQ 1Q81C 1RTOA 1ASZA 1PD1A 1WX6A 1OZ3A 3H15A 3I4NH 3META 2DYIA 2K7AA 5LJ5h 2WIIB 3C2PA 4J9HA 1L0WA 1RAIB 1RI9A 1RAHB 1PKSA 4OB0B 5CV9A 1SAPA 3ULPA 2DK3A 4B08A 5KCHA 2CVRA 1ZX6A 1TWCB 3KLSX 4HMJA 2FEIA 4MTKA 1JJ2P 4C1NK 3THKA 2EYZA 1EYGA 2COYA 4FSSA 4C0DC 1PRTF 3JB9F 5C44H 5FU7B 2YUPA 4UP9A 3MEHA 2XGTA 2KSSA 3EHRA 1D1BA 4M7AE 5GAOr 2R61A 2KNBB 4Q5WA 2B2TA 4J8QA 2LJ1A 1SYBA 3RZDH 4A3EG 4YY3L 4DV3Q 2NUTA 1M3AA 4F7UF 3STBC 5FJ8G 4LF9L 4A63B 3KF6A 2RQTA 1STEA 2K04A 3OYFA 3RESA 4E2FB 1K3BC 2XWBB 4DR6L 3BDCA 5I2SA 1K3RA 3EFRA 4H0LC 3OIQA 3D8GA 3G7LA 1ZSZC 1D2BA 1PH2A 4WJ4A 1UGQB 1UB4A 2DGYA 3MHBA 1E22A 4ZLTF 4LDVA 1D5XC 4JS4A 4Z89A 3EBEA 4QGUA 1GFCA 5D6XA 1XPUA 1VQKT 2F03A 1AH9A 5LJ3h 5IWAQ 4CJ0B 1YIJT 4YCUA 1U4RA 2M9UA 3LWHA 2M16A 2WB1E 5LMUL 2BCOA 3GTMH 4LFBQ 1NTGA 4P2CB 3N6RA 2KRSA 5GAN7 4M78F 4OB1B 4GOPA 1I6VC 3NEMA 4HJ8A 2P84A 2E74C 2DM1A 4Y91A 2CP5A 3CXCA 1MKHA 4DR2L 4A3FB 2CP6A 1ILQA 3VYSA 2D9TA 2HSPA 1HSQA 2PCFB 5IT9L 2QQAA 2EXZA 2K75A 1LABA 2E41A 5C4XH 4XT3B 2JE6I 5M3FB 2E64A 2VQEQ 3S2HB 1HXYD 4FM4B 3CHBD 3UA6A 3AFPA 2O5JC 1SRMA 2AKLA 4KBMB 2JP1A 2OXPA 5IE8A 2NVQH 1I6HB 2UXDQ 1OPLA 4HXJA 4KJNA 2YT6A 1PHJA 2HKQB 4GLXA 1EOTA 2A73B 1K1ZA 2B2VA 5IYDG 1BBUA 4J6HA 3VS1A 3J81j 1PH7A 2QASA 2K6DA 1SF9A 5IP9G 1A3UA 5I4DA 4C0ZA 1LCKA 2RNAA 1P92A 2B29A 2PU9B 3M53A 1QCBD 2RB6A 5GMKi 4A54A 3TS0A 2E4HA 1D3BB 1MJCA 3MVVA 4ELZC 2VXFA 5IOCA 1PLFA 3I4MH 2CKKA 2K3XA 1W2BA 2PZWA 2JEAI 3EG9A 4BD3A 5GAN6 2Q2TA 1M1KC 4POGA 1N9WA 2ALYB 3JCMJ 2A68D 1EY5A 3TQ7P 1VF7A 3BZCA 4RG2A 5C3EH 3CMET 2CYZB 5LMNW 1W4SA 2GNCA 6AT1B 1WI7A 7AT1B 1VQIA 1FMKA 3NHHA 1B34B 3A8IE 3A8MB 3H8ZA 1YJWA 3SE0A 2OWOA 2WSCE 5F2DA 4JI2L 1KABA 3NTKA 1PRLC 1I5LA 4KULA 1S3OA 4ME3A 2ENMA 1JBMA 1LVKA 3CAMA 2GF7A 2K01A 1KAAA 3HGBA 1Y1WG 1F2YA 1JORA 2ED1A 2YUNA 1V29B 3WOFA 4DNRB 2EYWA 3DWPA 3QYHB 1O7LA 4AYBB 3UWNA 3GTLB 1FMVA 2EBPA 5FWCA 4E7SA 1CFMA 1BK2A 2NUCA 4BY7G 3I73A 1HNWL 2CFMA 4LFCQ 3KBXA 2EYMA 4RMOA 5A0LA 1SMYC 1UDLA 1U4PA 3VRZA 5GAN8 1STYA 2CW0C 2VXWA 3BG3A 3D7SB 4DV4L 5LHY1 5JPNC 4AMCA 4A3KH 4GOPB 3OW7A 1H92A 1LYLA 1FJGQ 1TUCA 2O88A 4LK1C 3K80C 4C0DB 5COYA 2CSIA 4M7DE 3KXTA 5D14A 5IT9c 2N78A 2LJ3A 1VQ5Q 3I70A 2E70A 1BF4A 5IXFA 4OMQA 2RQRA 1I4RA 3K0XA 2HCKA 2VASA 1JJ2A 1GUTA 5I6YA 3KJPA 4JBMA 4RTXA 4OO1H 3HSBA 3E6ZX 4YY3Q 2DPPB 3ASKA 1SBBB 1UE1A 2G9HD 1DOMA 3U23A 2SNSA 1SHFA 1D1CA 3M0SA 3C4SA 5AT1B 1Q86U 2RF4A 1EFID 3CCRQ 1YI2A 1YEZA 4R4CA 2RM4A 4I65A 1Q82U 3IL8A 3CCUQ 1UGSB 3FDRA 3OYDA 1UAPA 2EVBA 3KF6B 2DAQA 1RAAB 1OQKA 2DNEA 3OW2A 3I4MG 3UA7A 3GP7A 1IGUA 5A35A 5FLXc 3P8DA 4X1VA 1YI2T 2F0SA 1C7YA 1FWZA 2EW3A 2RQXA 2K05A 1CTMA 1G83A 1Q1EA 1JE5A 2DY8A 4H02A 2PQAB 5KYLA 3V05A 1VQOT 1R77A 5NUCA 1QP2A 2A68C 2CZ0B 4DA4A 5IT9E 2K2MA 4DV1L 3F2DA 4DXGA 1J5EQ 5I9OA 5ELCA 2B39A 1Z7TA 3DHQA 1NMGA 1M3CA 1K9AA 3CMEA 3RNJA 3FKIH 5GANh 2EKHA 3WWVA 2DXTA 1Y71A 2K28A 3ZJYC 4ABNA 5KNBA 1TWFB 1S72T 2EXDA 5JOBA 1AE2A 4J6YA 1G2BA 3J7AV 4O2DA 2E2HB 2RD1A 1TKWB 1D0XA 3QO3A 3CCSA 3BZDB 2UXBL 1T3LA 2WSFE 1M30A 2HL3A 4LF6L 1JEGA 4J9DA 2F52A 4BI4A 4M7DB 3PGGA 4K5VA 4NXNL 2FG0A 1YN8A 1WYXA 1TR5A 4HCEA 3M85A 1OPKA 2OAWA 1R4QB 2Z0SA 1AWXA 4QMGA 4A3MB 4ME5A 2JTEA 3M0TA 1WTRA 1QKWA 1UE7A 2D8HA 4JI3Q 1QVFA 2MI6A 1D8LA 3EJIA 4ANJA 4KKUA 4R1JA 2L3SA 3PO3B 1K76A 3OSVA 4OB2B 5E3FA 1S4ZA 1B9MA 1JR0D 2C5CA 2R7DA 3N5BB 3CPFA 4HCBA 4C3IH 4JV5L 1AHJB 3GTGH 2RI5A 5I2XA 1GBRA 3ULRB 2I07B 2NWGA 4ZGDB 4DR5L 4F88A 1EYDA 1N33Q 1K8OA 1S72A 1K8AR 2JM8A 1VQ8Q 2VGMA 1STAA 4PZ8A 4FDBA 1K4US 5LMNQ 1YHQQ 4WFN3 2H5XA 1VQ8A 1K83H 4X62Q 2KVQG 2RSOA 1VQMA 3NSWA 2CWPA 3DEOA 4B3RQ 1BIBA 3OW2P 1Y07A 4ZRZA 5CMDA 3CD6Q 5C44G 4BBRG 4X65Q 3DLMA 1U06A 3J7AF 2CT3A 4O5VA 2LY7A 3S3OA 1CQFA 2E2DC 4A3MG 3X28B 2NN6I 2CH4W 2A6EC 1PWTA 4N8X1 4DV5Q 1DOLA 1SEBD 4RGMA 3RR6A 3AHUA 2UUCL 2DUDA 3BDLA 4IZ8A 4DV4Q 1LTBD 1TWAB 2K57A 4IUTA 5GANd 1SNOA 4PK4A 4DBFA 4JJCA 3JCMW 4XU0A 5I6WA 2JJQA 3MAQA 1IBKL 2WB1G 2P0KA 1G91A 1TS5A 5A2QE 2F4VL 2JA6G 1F9SA 3RDVA 4FCYA 2K52A 3CCLT 2QA4Q 1KQ1A 4KY6A 4YHHQ 1E6HA 1HYOA 4XU2A 2HCIA 5FWBA 3BDOA 1IGQA 4GLAC 3PO2G 4WJ3M 4X3UA 4IOAA 4TVAB 5IGFA 4DR1L 1MNEA 1B3AA 3PE0A 3K7UC 1Y96A 4BBRB 1J5EL 1M1GA 4OIKA 1VQ4T 2YHTA 1STGA 3T53B 3QXEB 2YTVA 2DRKA 4C5GA 4EVOA 4C8QC 4ZUIA 2CUDA 2Z0WA 2ICIA 3O5ZA 5CBEE 4M7AG 3F8TA 3H0FA 1ML0D 2L2PA 4LN2A 4OMMA 1VQ5T 1WTQA 1VYTA 2L0AA 5ISRA 5IHKA 5GANf 4IFDJ 1EL0A 1F9RA 1EWIA 2R3ZA 4C8QB 4R4QA 3AMUA 1BI1A 2XU8A 1L0YB 2JM9A 1RI0A 2F0UA 4GLMA 2NZOA 1JOQA 3SXHA 1NAPA 4RHSA 2LNHB 2WAQB 3HKSA 1HNZL 3K7AB 3OS5A 4F7UA 3CCRA 1SYCA 3PUZA 2EY5A 4JI6Q 1YZ6A 3PO2B 1RD9D 2F0IA 5D3DA 4DV0L 5IY0A 3JAME 2L5TA 4MDWA 5CQYA 3SR1A 2QGFB 2CP7A 1GFDA 2JN0A 2KUMA 3Q1JA 3RLNA 1DGSA 4DBHA 1SYEA 1LTAD 5J22A 4Y7NH 4RKUE 3W1BA 1UECA 3SD4A 3UDIA 1WNLA 2DJQA 3FLGA 2D0NA 2QILA 1UHFA 2K3BA 1WXTA 5FRNA 2I5HA 2KGTA 1C8CA 2L3QA 1VYUA 2DFUA 5EJWA 1WD0A 1UG1A 1YFNA 1GO3E 1TS4A 4KHPQ 3M55A 1DXMA 4AQYL 4JBKA 1ZKOA 2A0FB 2A69D 2JMCA 2ZXPA 3IKJA 2Y0SG 3IFTA 4JYAQ 1ZQ1A 2F0HA 4M75C 1IKMA 2MWOA 1K9MU 2OAUA 2JS2A 4GKKL 3K5NA 2JA6H 1X6OA 2E10A 1VMCA 4RA8A 3PIOA 3RKYA 1RACB 2DZ9A 3F2UA 4NB3A 5IODA 1Q7YC 1FYCA 2Y4XA 3G4SQ 1VQDA 4FVMA 4WCIA 3ME9A 2LT1A 5FU6C 4KUDK 4DV5L 1WTXA 3JCMQ 2EYQA 1L1OB 2XIWA 3HKZE 3PO3H 3V8JA 1Z6HA 4C3JB 4X64Q 1SHGA 2F0QA 2EJGA 4J6XA 5GAOq 4A3MH 2OEOA 3KBGA 2QDYB 4IURA 4JI3L 3HOUB 1I50H 1L1OC 3C1EA 1IBML 2FMMA 4X62L 4LF7Q 1A2UA 1FX7A 2NUZA 3NPPA 2QQBA 4XU3A 1E1TA 3ND9A 1H95A 1UJ0A 3ZFJA 3H41A 4XK8E 2ENBA 5KE3A 2Z6KA 5IHIA 5KH6A 3QG1A 1E1OA 4RCBA 1FMWA 4ZN1A 2Z1CA 5M5WH 2HBWA 2K1BA 2KOLA 3GQBA 1YBYA 3L42A 5FKAC 4KGZB 5L8RE 2WSEE 1G6ZA 4LF8L 1O9SA 4XQQA 4A53A 3MP6A 2RHUA 3CCQA 1YJ9Q 4OVAA 1J8IA 1IHWA 2YU9B 1H9JA 2XDPA 3JCMg 3QUIA 4MZTA 4C92C 2HDMA 1Y1VG 4IFDI 1QW1A 2WKDA 4EX5A 5E4XA 1PVOA 2A8VA 3NBIA 3I3CA 2O01E 3S9WA 1GUGA 1JXMA 2KRMA 3NE5B 1HQRD 1SSOA 1KLGD 4RKLA 4RGNA 4UDUC 3OWFA 1G2SA 1K8AU 3LGLA 4FIBA 2TMPA 2ZPIB 1X54A 2QYZA 4EQNA 3KF8A 2CT4A 2DJZA 3BZKA 3MZ5A 4PJOE 2EQIA 3CCST 1WJSA 4NKLA 3X26B 2UXBQ 4EMKB 2EPDA 1G5VA 3ICEA 2L3PA 3PFSA 3I2ZA 3K5LA 2QQSA 1WJQA 1XPOA 1EFNA 3X24B 5FW9A 3QOJA 1ESRA 3CCUA 1H9SA 4E7HA 1IYUA 4LF5L 3EG1A 4OGEA 1KDBA 1S5ED 2JA5H 3W2DA 1XNRL 3MJXA 2RI3A 2C35B 1IHVA 3S16B 3E9FA 2LNVA 1YHQT 4WRDA 2PZ1A 5KYWA 3QWNA 4ZKBB 1GCPA 2LRQA 2K03A 1G3YA 2EOTA 4F7XA 1Y1VB 2FHDA 3CW2C 1SSFA 5J39A 2D0OA 4JG2A 3BFMA 2QF7A 4PJOD 3G48A 2EYOA 1JJCB 4QVDA 1VQOQ 2RA4A 1YHBA 3CMAA 3C12A 3I5RA 4G7OC 1B44D 2XDDA 3TBIB 3J80i 5KYWB 1KD1C 5CV4A 4GLVB 4HJAA 2E76C 2BA0A 2E8GA 1YP5A 4M8AA 5JJLA 2XNAC 4FW2A 1RAEB 2CWAA 3DMUA 1NNXA 3I4NG 4MNOA 3A5UA 2J4XA 2JA5B 2OI3A 4CC2A 4LDUA 2E5QA 3A8JE 1I4K1 1QQJA 4LAAA 1OV3A 1MI2A 5CO7A 1ZUKA 4FT2A 3RKWA 1TY0A 2IW3A 4C92B 4P75A 4QIWE 1YWOA 3GDEA 1S5DD 3QIIA 2A28A 3DWQA 3Q22A 3VYGA 2VB2X 5C44B 4QCLA 3Q23A 4FNFA 2J6FA 3AQQA 3HFOA 3S1NB 3CCMA 4LF9Q 4KY5A 4K0KQ 4PJMA 9ATCB 3K0YA 3I4LA 3STBD 2WAQE 2UU9Q 1VQMT 2WKCA 3S3NA 3LH0A 4C3IG 3PT9A 2DE0X 3CMAQ 1RKNA 4KHVA 2AZVA 1CZWA 3MEAA 3L2WA 1NJIC 1TU0B 2R5MA 3NQIA 4M7DD 2PZUA 3ZL7C 4AFZC 4KGVB 2EVRA 1MSGA 1QVCA 1O80A 2SOBA 3R6NA 2J06A 4XTUA 4A3LG 4O0AA 4L5TA 4XTYA 5KYUB 2QEXQ 3CCET 3SK8A 4BACA 2EJ9A 1K9MC 1OXVA 1NPPA 1ZUYA 3UATA 3CCVT 4JI8L 3M7GA 3NHNA 1SNPA 2VS1A 2E3HA 5CKHA 3GV3A 1GUOA 1AFPA 3NK9A 3T9NA 1ABQA 1C1AA 3LW5E 1HK9A 1VQ6A 1MBYA 1V1PA 2K14A 1Y57A 2YTYA 3OHXC 2PQWA 4L63B 1ZBXA 2LX9A 4BDYA 1ENAA 5HK0A 4CDCC 5AJ3Q 3M3YB 4C3JH 2FZGB 5KYYA 1HR0W 3BW1A 1OXUA 4C92E 1MIUA 4N9PA 4RUGA 5FOBB 1PH6A 3RIRA 5D6YA 3L2PA 1I6HH 2NVQB 1SJHD 4DV6L 4FXGC 1OX9A 4JRIA 3Q0AA 1YHAA 4A3GB 1G8ZD 1BR9A 3JCMf 2QW7A 2RBMA 4KHPL 3L9AX 4JJBA 2YDLA 3EG3A 2DL5A 1II3A 3SEMA 1LV9A 5ECAA 2EAYA 3CCQQ 1YJ9A 3TSWA 1KC8U 1QWFA 4BI3A 1M27C 2EE1A 1CQVA 1GCQA 1Q86C 3VYRA 5CQXA 3HTRA 5HKCA 1MNDA 2KHJA 2DNCA 4EQOA 3V96A 5TSSA 4C92D 3K59A 3NENA 2XKOC 1UE9A 1I8FA 4C8QF 1PCXA 4EMKC 1JCKB 2GGRA 1QILA 5GAOp 1QWYA 5GAN4 3CQTA 2QEJC 4LJZC 4Q0FA 3VKIA 1BBZA 5EBDA 4QW2A 2OTJT 3HKZB 3KLRA 4HIOA 4IFDG 2L12A 1VYVA 2DTIA 4C92G 3EFXD 4LD9K 1ZBJA 2AKWB 2K5HA 4A3DH 4NXMQ 1MD2D 2AWOA 1XOVA 1HCZA 1QNUA 5FO8B 3NFCA 5IP7H 3HRSA 1X6GA 3M9BA 3EGXA 2AHOB 5DM73 4PJOB 2F0OA 3I8ZA 4C3HH 1D7QA 2KAFA 4KN4C 3M7NA 4DV3L 2V4DA 2DXCA 4N4GA 1V1CA 5IAYA 1QLYA 2XDBA 1M8VA 3PIP3 2C0OA 2L11A 1MV0B 1LT3D 3T13A 2CREA 1BDOA 1I5OB 2PI2E 2UUBL 1O78A 4D8DA 1QJOA 2M02A 2K4KA 1LUZA 2YTXA 2RPNA 2NVXH 4OGQC 1PZKD 4J9GA 5C6AA 2NZ1D 2P4RA 2X4JA 4QUCA 1LT6D 2I0NA 2B2WA 4AIMA 1BU1A 2M00A 2PYKA 3C95A 1BCMA 5IGGA 1YIJA 4JOIA 2E75C 3Q6SA 3PUYA 3S17H 4MMKA
chains in the Genus database with same CATH topology
1VQLT 2A19A 1LJOA 2LQKA 4OP0A 4P5NA 2VXEA 5HY6A 4NXNQ 1X01A 1X55A 5LJ5j 4PMWA 2L89A 3QZ9B 4IO9A 4M75F 1IYJB 5GMKj 4QQDA 2PVGB 3KFUA 4DV2Q 4L6V5 2N8NA 4GKJL 1WOCA 3H3VH 1SMXA 2VV5A 4DR4Q 4GLKA 4QQGA 3LX7A 1JRIA 1TH7A 1X75C 3VYHB 2BH8A 5C6SA 2QGQA 5LJ5d 1YJNT 1QP3A 5EG2A 2QEXT 3OYGA 5A0DA 4LD6A 4V2SA 1Y14B 4A4GA 5D6WA 4ZTFA 1AE3A 4M77C 1D3BA 2QTXA 4BA1I 2AHJB 4OWTB 2HNIA 5C0XG 4M7AC 4BA2I 4UPAA 2VW9A 4M77B 1CSQA 1Q12A 2QXFA 3E9GA 4C8QG 4N4IA 1E3PA 3L2ZA 1HR0L 1HXDA 2GFUA 4IPCA 4R56A 5GAGC 2ZJPA 3I4OA 2EQUA 5C0XJ 2DTHA 4N4HA 5IYBH 3BU2A 4BE2A 1YVCA 4MDXA 2LCLA 4E7LA 2E6ZA 1N36Q 4R55A 2A3LA 1P16A 1V1QA 3CCMT 1KC8C 3A5ZB 4NOYA 1VQNA 1X65A 1BI0A 5ELOA 2PQAA 3RERA 1M1KU 1VQ8T 1BBWA 5HGQA 3F2BA 4LUVA 3G7ZA 1SROA 1EFWA 3HOUH 1WGSA 3X25B 4UC4A 2AMCB 2X35A 4HIKA 4NPSA 3KDFB 4JBWA 4AYBG 4HJ7A 4UY8C 1MGQA 5AJ3L 4M7AF 2NZHA 4L5SA 3X20B 3A8HB 5JJIA 4HCZA 2KBNA 2RJFA 3PF5A 5IP9H 3OYAA 5GAMh 1TWFH 2HQLA 2PUOB 3QPHA 4M77D 3SFMA 2VUMG 1IXRA 1KL9A 2R57A 5GAOl 2YLBA 1QUQA 3TQYA 4LDXA 2GCXA 2K5IA 3JAMi 3OTOQ 3E0EA 1HZCA 1QVGS 4PZ6A 5GADC 3HOWG 2VUMH 1KIXA 4BB7A 1W2BS 4OX9L 5CVIA 1EQQA 3DM3A 4TVRA 4Z02A 4LF5Q 1J6QA 2VQFQ 3AFQA 4M77F 4FT4A 4B3ML 1IBKQ 2VQFL 4IPDA 2RK1A 1Q82C 2VYTA 5CAIA 2ZPBB 3I55A 5IWAL 3M57A 4A3FG 3J80c 3TU4K 1VQNT 3HOUG 4IFDJ 2I5MX 4DNIA 1CKNB 2M0OA 3R6OA 3I55T 4A3EH 4VUBA 3OYMA 4X9DA 2EQKA 2KCMA 1HNXQ 5GMKh 2UUAL 1T9HA 4M7AD 4OONA 3OMCA 1SFOH 4A3GG 3HOVH 2EJFA 2E1HA 3PGZA 5JEAG 3HOYH 4JI6L 1X9NA 4OO1I 3PO3G 1PH9A 3TCJA 1X3EA 4ALPA 1CKMA 5GANe 4M7AA 3ULLA 2KMTA 1CKNA 3SGIA 5C4JH 4HIMA 4DR1Q 4PLIA 4HKEA 2IVWA 4ATOA 1UE5A 4JI4Q 2R93H 1BIAA 4HIDA 5LMNL 3OSSC 3HPWA 2F69A 4LFAL 2E2IH 3L2RA 3M4YA 1PYSB 4A3CH 4X34A 3HOYG 4A4KA 1PSEA 2E2JH 3S2HH 2ZTCA 4ZGJB 3OQ5A 5FRMA 3JRZA 4HT8A 4DUZQ 2UU9L 3PUWA 4HT9A 4M77G 2D0QB 1BI3A 2NLUA 3Q8DA 2R7FA 3GNGA 4GY5A 3JB9G 4B9XA 3PMIA 2M1HA 4LW1A 3KUFA 1VQCA 2H3JA 4M78A 1WFQA 4BY1G 2R93G 3FIFA 5GMKl 5CKFA 5C3EG 3KYHC 3PIPA 4EMGA 1SRUA 2VQEL 1WI5A 4X9CA 3U58A 5H1SE 4L5QA 2K50A 2OTJA 2F5TX 5E7NA 2EWNA 2D0PA 3PNWC 4J15A 2PVOB 1VQKA 3FC3A 2N3SA 3OY9A 3M4QA 3S1QH 2DXUA 4J5YA 3UT1A 4DUZL 3CC2T 4EMKA 3SWNA 3TEHB 2IY5B 1VQGA 4M7DG 2RK2A 5M9OA 3DKMA 4JRPA 2RJEA 5ELNA 2VC8A 3EFSA 1U8RA 5BR8Q 1JB0E 3T1YQ 2KQWA 1XNRQ 3MEUA 3H3VI 4CI0C 1PA6A 4JLGA 3GTLH 2PMZE 3A8LB 1E24A 5LJ3j 2XI9A 1BVSA 2F4VQ 1GD7A 1VQ7T 4JOIC 4QQ6A 4M7AB 3CD6A 1JJGA 4BE0A 3URGA 3V7CA 3H0GG 5GAMf 1Y1WH 4A4EA 4A76A 2EKOA 2LXJA 5A0GA 3QJYA 5IYCH 1NPRA 4BI8B 1NE8A 1PH4A 1VQ9A 1U1TA 1Q8KA 4C0GA 2LT4A 1A63A 5GAMd 1EIYB 2CZ7B 4JI8Q 2LQ8A 3GOXA 1NY4A 3JCMX 3HOWH 5M5YH 1HNXL 4JCVE 2EQJA 3QSUA 1VQJA 2PNHA 4M7DA 3FKIG 1UEBA 3QBYA 1JT8A 4JI0Q 1SN8A 2DEQA 2D62A 2L15A 2AWNA 1PH1A 3L7ZC 4MZMA 2ZM6Q 4LWCA 3S1RH 2IX0A 1OXXK 2RHYA 5FU6B 1N8RU 4UP8A 3S14H 3GIBA 3U50C 4DAYB 1CSPA 3RMSA 3INZA 3RMQA 3EN2A 4OX9Q 4OMFB 3G6EA 4LUOA 3J81c 4C2MH 4QVZA 3MCAB 4DR3Q 2Y0SE 3RN2A 4BY1H 4YCVA 3LYIA 5I2MA 1BKBA 3MEWA 4Y52H 2HQXA 4BY7H 2VGNA 5LJ5e 1G51A 5GAHC 1WYDA 3GTKH 3WXMB 4BUGA 1VQFA 2MNAA 4X64L 1M1FA 4A3KG 3ZBDA 4MZPA 3MP1A 2JA8H 3M4PA 1RIPA 5BR8L 2KY9A 4YWMA 3CC4A 3CBPA 4C92A 4IJHA 1XQHA 1YHQA 5GQOA 3L0OA 4PNOA 2LVMA 4OWWB 3A74A 2ATWA 2BH2A 3OA6A 3OYNA 2VZAA 3MEFA 3J7ZC 4WF2A 1I3QH 4KT0E 2ZTDA 1QZGA 1L1OA 2B63G 4C0FA 1U0LA 5LJ3g 3CBOA 1K73U 3NTIA 1K73C 3SWNC 4DUYQ 4P72A 4E7KA 4DK3C 3GPLA 4PJOF 4GNXB 5J26A 4X66Q 2RJDA 2ZPHB 4D6WA 3I56T 1Q81U 4X66L 2K5LA 1TXYA 4DR6Q 1ZHIA 3JCMP 2JVVA 1G3WA 3HHTB 3J7A5 2K5NA 3OYEA 3ERSX 4A3GH 2V1CC 3CCUT 1G291 4LFBL 2HT1A 2NVYH 2OTLA 1JJ2S 3JCMc 2GFAA 4YWKA 2CZ1B 3KJOA 1QVPA 4GN5A 2IG0A 2E65A 2XHCA 4M78C 1C0AA 3CP0A 4GNXA 1NBWA 1V43A 3CXCS 1XMQL 3FJPA 1P8LA 4CRIA 4J8OA 5LJ3d 4DPGA 2NN6G 4KLKA 3ZEHA 1WCMG 5CK9A 2F3IA 4DR2Q 3L1AA 4C8QA 2LC4A 3M54A 3OS0A 4ZN3A 2E5LL 2YRVA 2WP8J 3ULJA 1GKHA 3KLWA 4A3IG 1ASYA 2KK4A 4M75B 4IPHA 3M3YH 5JJKA 3A0JA 2KDSA 4PL6A 4YHHL 1CUKA 3K81C 4AQYQ 2RI2A 3SB2A 4M75A 3J81E 2ES2A 4DAMA 4XTCS 5GAMj 1A0IA 1WJJA 2L8DA 2JA7H 2HAXA 2O4XA 4IUQA 4C92F 1Z9FA 3RUXA 5FROA 1HJPA 1CKOA 2BUDA 2JQOA 4DK6C 1FJGL 2RHXA 3M58A 4A3IH 4AYBE 2UXDL 2Y4YA 2HBPA 1IZ6A 1YITT 3O8VA 3JB9D 4LF6Q 2JNGA 2RHQB 2GVAA 2DIQA 2B8AA 1WPYA 3VJPA 3CC2A 4J83A 3JCMV 3HOZH 5GAOn 3OYIA 4UP7A 5GROA 4P74A 3RKXA 1N27A 5IYCG 1VQOA 3G71T 3OYCA 1Q1BA 3CCEA 4JV5Q 4C5HA 4JJNK 2R92G 2HIXA 1FXXA 4C8QD 3F70A 4QL5A 3HP9A 3HKZG 3D31A 4EQ5A 5GAEC 2X4YA 4F7UE 4A75A 3TEEA 2XIDA 4FL6A 2GVBA 5LJ3f 4LDYA 2YV5A 3PMTA 2QQRA 3M59A 5DM7R 3CQZH 3GD7A 4DV2L 2R6GA 1QZHA 2P0PA 2DXBA 3OYYA 3G4SA 1X3FA 4M78E 2MQHA 1RL2A 4R4OA 1HZAA 5M3FH 1KQ2A 2JA5G 2V8IA 5GANg 1VQLA 2K5VA 4DV1Q 4DOVA 3B6YA 1XMQQ 4R4IA 1WCMH 3D0FA 4FSXA 2QEXA 1O7IA 1SE8A 2ASBA 1PSFA 5KCOA 3HFNA 3LGFA 4GKJQ 4QVCA 2GN5A 2IX1A 1G3TA 1FVIA 1I5FA 4Y28E 4XQ3A 4KI0A 4XTWA 1YITA 1QVFS 5LJ5f 3GO5A 2QQ9A 4L59A 4E47A 1DJ7B 3PF4A 3F2CA 3S15H 1PYBA 1W3SA 4EPCA 5FLXE 3OS1A 1GVPA 1M90U 5M5XH 2ZPEB 4X65L 1WQWA 3S3MA 2FYKA 3LLRA 4APVA 3E1SA 4BBSG 1NE3A 3G6ET 1IBLQ 4A3DG 1KHCA 4KUIA 1VQBA 2HQEA 2LTOA 1VQH