3HKSA

Crystal structure of eukaryotic translation initiation factor eif-5a2 from arabidopsis thaliana
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
144
structure length
144
Chain Sequence
SKTYPQSAGNIRKGGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTAKKLEDIVPSSHNCDVPHVNRVDYQLIDITEDGFVSLLTDSGGTKDDLKLPTDDGLTAQMRLGFDEGKDIVVSVMSSMGEEQICAVKEVGGGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 5A-2
publication title Crystal structure of Arabidopsis translation initiation factor eIF-5A2
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Translation, rna binding protein
total genus 31
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hksA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hksA02
5ELOA 2QA4A 5C0XJ 1EUJA 1TWGH 1VQ9T 2YV5A 4FDBA 4DAYB 1CKNB 5C44G 4LF5L 1IYJB 1KIXA 4IFDJ 3PO3H 4A93G 2NVQH 3F1ZA 3RN2A 4HIMA 1TWHH 1WI5A 2JA6G 3TQYA 1OXUA 4DV0L 3CPWS 4A3MH 3MXNB 1N36L 2IG0A 1YIJA 5DLQE 4LF9Q 1A63A 1SROA 1VQ4A 5BR8Q 1EOVA 4X65Q 2CCZA 4A3GH 1XMOL 4RG1A 4QGUA 1HJPA 2NVXH 1YJWA 5FLXc 4Y7NH 4DV2Q 3W1BA 4NXMQ 2Q2HA 3H15A 3NELA 3CD6T 2CKKA 2NZHA 1AH9A 4DR1L 3AYHB 3JAMc 4JI7L 1XNIA 1CKOA 4GOPB 1Z9FA 2ZTCA 1NBWA 5IT9c 5M5WH 2OTLT 3G6ET 1E24A 4BBSH 4A3LH 4A3MG 4X64Q 3CCUA 1W2BS 3ERSX 4O0AA 2ZM6Q 2R93H 4JI4Q 2JJQA 3NBHB 4A3GG 1I94Q 4DR4Q 2IY5B 4B3SQ 1JJ2A 1NY4A 1SN8A 2ALYB 1H95A 4JI5Q 2NVTH 4MZ9A 4YCVA 4JI6L 5EAYA 4LF7Q 4NPSA 3I55T 4POGA 4JG2A 2UUAQ 1BBWA 3KBGA 3OTOQ 3EIVA 3CCQA 1I94L 3M4QA 2B29A 3CP0A 4GOPC 1K73C 1LTLA 3KLWA 4A3LG 3BZKA 1PYBA 5IWAQ 1J5EQ 3HOUH 1E22A 2E5LL 1SRUA 4J15A 3S24A 2R93G 3T1YL 2PNHA 3CC4T 1TWCH 1G51A 1VQ5T 2OQKA 4LF4Q 3PUVA 4LFAQ 2OWOA 4IPDA 1HZAA 2UUCQ 1E1TA 2DUDA 2VQEQ 1QVFS 4OONA 1AE2A 2D62A 5C4JH 3S1RH 3LGFA 2KCMA 1YI2T 4DV6Q 4JBKA 4DR7Q 1QVGA 1ASZA 4TQUS 4ALPA 4JI1Q 4A3FG 1P8LA 1BBUA 4UPAA 3M85A 4JI2L 4IPCA 1VQOT 1YHQT 1N32Q 1M90C 2UUBL 4JYAL 1VQHA 4P75A 1ASYA 1Q7YC 1B7YB 1X3FA 5C4XH 4GLAC 2JA5G 1YITA 3G4ST 1VQIA 2NVYH 3HKZG 4YTLA 5FJ8H 4DV5L 1RL2A 3CMAT 2D0OA 4DAMA 4HIDA 4IO9A 1S3OA 3EN2A 4DR6L 4LW1A 1A8VA 4XTCS 2QA4T 1W3SA 4YHHL 3KDFA 4DR5L 2PQAB 3K81C 2MWOA 1UWVA 4MTNA 4LUZA 1N9WA 1Q46A 1EQRA 1WFQA 2B3GA 2N8NA 2AHOB 1KC8C 3MEFA 4AQYQ 1J6QA 3GTMH 4L5TA 5M3MH 2VQFL 1EYGA 1L0WA 4LF5Q 1VQ8A 5JJLA 3CF5A 4A3JH 4O2DA 4BY1H 3CC7A 5J3BA 3PUWA 4YY3L 1CKMA 4DV3L 4DPGA 1N33Q 4A3IH 2K52A 3CCSA 2N78A 1SFOH 1IL2A 1K83H 3I56A 2YTYA 4BXXH 4DV0Q 2HIVA 2PI2A 4JOIC 3G71A 2JA8H 3I4OA 1N36Q 4P72A 1IBKQ 1E1OA 1BKBA 1M1KU 2F52A 2KBNA 1XMOQ 1G291 1NTGA 2KHJA 2ZTDA 5GAHC 1X9NA 3HOVH 2Z6KA 2VUMH 2PMZE 3UDGA 3I55A 2HQLA 4EQ5A 4TVRA 5M3MG 2HT1A 4BY7H 1IXRA 2NN6G 1M1GA 4AH6A 4A3JG 3S14H 4QQBX 4EX5A 3CXCA 1PH5A 2HHHL 1YJ9A 4PZ7A 1GM5A 4JI7Q 1JB7A 3S16H 1Q82C 3CCUT 1K9MC 1XNRL 4BXXG 2K5NA 3CCLT 4B3TL 1OXVA 2CWAA 2LVMA 4DUZL 3CCET 1PH8A 2ASBA 3PGZA 1IBLL 3L2PA 2F3IA 2B63G 1TXYA 2Y0SG 4QQDA 4LFBQ 2UXCL 2K50A 2BH2A 4GKKL 2AKWB 1CUKA 1KAWA 1L1OA 1HNXL 2Q2UA 2VUMG 4A75A 2XGTA 4A3EH 3CCQT 4C2MH 2MO1A 4JI6Q 1GVPA 4KHZA 5HY6A 1VQOA 4L5RC 1JMCA 4BY7G 4GN4B 4OXPA 2EIFA 1NMGA 1Q81C 3PV0A 3SGIA 1VQLA 1XMQL 3ICEA 3TS2A 3RNUA 4GKJL 1Y1WG 2MNAA 5IYBH 4WJ4A 4NB3A 2AWOA 4L5QA 2ZJPA 1EIYB 4X66Q 2E5LQ 1M90U 4DR2L 3T1YQ 4JV5Q 5JJKA 3S1NH 2YU9H 1V9PA 3BJUA 4DKAC 2NN6I 2K4KA 3RLOA 1PH4A 2R92G 4TVAB 4HJAA 4A3EG 3S17H 5AJ3L 2WAQG 3U4ZA 5IP7H 2JQOA 1Q86C 3I4NH 1AE3A 3H3VH 2R7ZG 4GS3A 4P71A 1QZHA 3L7ZC 3AFPA 1YNXA 1YITT 3PCOB 4BBRH 1I50H 5LMUQ 1SE8A 2UUBQ 4B3ML 4GNXA 4JYAQ 4IPHA 5IP9H 2VNUD 1V1QA 3H0GH 5IYBG 2R7DA 1MIUA 1EIFA 4LFCL 1N34L 3KF6A 1B8AA 5JEAJ 4DR6Q 4P74A 4YHHQ 3GTQH 3PO3G 2PI2E 2MQHA 4LF6Q 3HKZE 1VQ8T 2I5HA 5IAYA 1TWFH 2WFWA 3CC7T 4X34A 5IP7G 3KJPA 3KDFB 4YCUA 1VQJA 2LXKA 2VQFQ 1JE5A 4P73A 2UXDL 3CCST 4JBWA 3I56T 4BBRG 4LNQA 1NE3A 4UY8C 3CCLA 4YY3Q 3G71T 4AYBG 3DB3A 5IP9G 3CCEA 4GN5A 4DV3Q 2JEBI 3ULJA 2E2HH 4OWXB 1Q1EA 2WP8J 3HOWH 4DK3C 4KLKA 3GO5A 5IYDH 1JJGA 3F2DA 2KVQG 1Q82U 2L15A 4R4OA 1K9MU 3GTOH 4B3RL 3S2HH 1FJGL 3A0JA 4QY7A 5GADC 3DM3A 2LXJA 1PH7A 2IX0A 4OX9Q 2K14A 4LF8L 3LGLA 1JT8A 4BBSG 1YHBA 4BA2I 1Q8KA 1YJ9T 1P16A 4YWKA 3A5UA 1L2FA 5C0XG 4HJ9A 4K0KL 5K36G 1N8RU 1VCIA 1Y14B 4NXNQ 4ZN1A 3HKSA 2KCTA 2ZJQA 1QVCA 3AQQA 3L0OA 4IFDG 4A4IA 3HOWG 1KHIA 1XNRQ 3HOYH 2G3RA 2OQ0A 4DUZQ 3KYHC 1T9HA 2CWPA 3ZJYC 4X62L 1Q81U 1VQAA 3IRBA 5M3FH 4JI3Q 3H3VI 1KL9A 2UXCQ 1YJNA 2E2JH 2WB1G 4GKKQ 4JC0A 2KDSA 3J81E 4JBMA 1VQGA 3FP9A 4UP8A 3S2DH 1X54A 3STBC 1EQQA 3HOUG 1VQLT 2Y0SE 2MI6A 1L1OB 3J7AF 1D7QA 1CSPA 4A3KH 2MFIA 1MJCA 2H5XA 1V43A 2Z6KC 5LMNL 1HNWQ 1XMQQ 1UE1A 4BA1I 3GTGH 1U5KA 2R6GA 3J7ZC 1GD7A 4OO1G 5JJIA 2LCLA 2JUFA 2OTJA 3GTLH 3T1HL 2E2IH 2KENA 4GN3B 4H02A 2E6ZA 3JAME 1NJIC 3CAMA 4DR2Q 2BA1A 3RZDH 1IBML 2JA9A 4R4CA 1PV4A 5C0XI 3TEHB 3PO2H 4QJFA 2JEAI 1LUZA 2BA0A 3HOXH 1K3RA 3K8AA 5LL6S 1LM0A 1IZ6A 2KHIA 3K7AH 4X65L 5BR8L 5C4XG 5FJ8G 4IFDI 3OW2A 1L1OC 4B3MQ 1PA6A 2DGYA 3F2CA 3J81j 3U58A 2WAQE 4GLVB 1QUQA 3UE0A 3PF4A 2MWPA 2C35B 4X6AH 1X6OA 3CCVA 4LFCQ 5M5YH 4DV7L 1X3EA 5LMNW 4GNXB 2GN5A 3TS0A 1HZBA 4A3CH 2BH8A 2E8GA 4L5SA 4BY1G 3UDFA 4X64L 5FLMH 3F2BA 3HOXG 4DV4L 3KF6B 3CC2A 4DK6C 4JI8L 5C3EH 5J26A 2JK8A 4A3IG 2UXBL 1GO3E 4A3DH 3CCMT 2HIXA 4PZ6A 3K80C 1KXLA 4OO1I 1C0AA 1YBYA 1HZ9A 4B3SL 2JA8G 4KHPL 3U4VA 2UXDQ 1VQPA 1KD1C 1QVGS 1EWIA 3TRZA 4DR3L 3FKIH 1K73U 3CPWA 1FVIA 4LF7L 1S72A 1LYLA 3HOVG 3OTOL 1WOCA 1O7IA 4PZ8A 2UU9L 4HJ7A 3RZOH 1D8LA 1U0LA 3HOZH 3S1QH 5GAEC 4C3JH 3J81i 3PIPA 4A3CG 4POFA 4GNXC 1VQFA 4B3RQ 1FJGQ 4AYBE 1VQNA 4QL5A 4LUVA 1KRSA 2N3SA 4DNIA 1X55A 3A74A 2R7FA 5FLMG 4LF8Q 1PH1A 2YTVA 4HIKA 4WJ3M 1BVSA 1YVCA 4MNOA 4LFAL 2I5MX 5GQOA 2UUCL 2NZOA 3PUYA 3FKIG 4YCWA 1Q7YU 1PH9A 1XPUA 3PF5A 1X65A 3AFQA 4KI0A 1W2BA 2CQOA 3NENA 4R4QA 4XIGS 3J7A5 1YJNT 4A93H 1YZ6A 3P8BB 2IX1A 1N32L 4CRIA 3LGJA 4X62Q 1XNQL 3ER0A 3M3YH 3CCJT 3RLNA 5H1SE 2JA6H 2GVBA 3CMEA 1Q12A 4HJ8A 2E70A 2JVVA 1KC8U 1NJIU 1X56A 3M4PA 5IY0A 5A2QE 2Q2IA 4DV5Q 4AIMA 4DV1L 4OWTB 3E9IA 3PIOA 1XJVA 1PVOA 2QEXA 1SSFA 2ZJRA 1RIPA 2A8VA 2WB1E 2OTJT 3CXCS 1GKHA 2RF4A 1VQDA 3WWVA 5LMNQ 4AQYL 4APVA 4DR5Q 1KRTA 3HFZB 3GDEA 3T1HQ 3LH0A 3I4NG 4YWMA 1N33L 2A1AA 3U50C 2K75A 1IBMQ 1PYSB 1WYDA 3J81c 3CCMA 1XTDA 1QVFA 4IOCA 1VQ6A 1IBKL 1KQSS 1PH3A 2R7ZH 2GVAA 3H0GG 1UEBA 4R4IA 4C3IH 1HNZL 4R4TA 3GTKH 5HGQA 3RR5A 2I0QA 2ID0A 2XHCA 1B70B 2RHSB 2LQ8A 3CCVT 3PUZA 1K8AC 2MO0A 1PH2A 1KD1U 1VQKA 3J80E 3TREA 4DV7Q 4Y52H 3D31A 1M1KC 3CC2T 1UE6A 3W1GA 1I6HH 1QUQB 2Z0SA 4IPGA 2HHHQ 4DV4Q 2EXDA 1PH6A 4IJHA 1HR0L 1FGUA 4JI8Q 1VQEA 1YEZA 1VQPT 1NPPA 3K0XA 4UP9A 1VQMA 1NMFA 3F8TA 3UDIA 4LFBL 2UXBQ 4PG3A 4B3TQ 4RMFA 5DM7R 1UE5A 4JI0L 5IYDG 3AEVA 4KHPQ 1S72T 1IBLQ 1PFSA 3FHWA 3PSIA 3S1MH 1VQCA 4DR3Q 1E7ZA 3M4OH 3CCRA 2OCEA 4HJ5A 3RN5A 3W5OA 2F4VL 2JE6I 3OYYA 1CSQA 4PMWA 1HNXQ 4A3FH 2FXQA 3CCJA 1VQNT 1S40A 4GLXA 2UU9Q 1VQ7A 1Y1VH 2CFMA 2CKZB 1SR3A 1XPOA 1CKNA 4DUYL 3KJOA 1OXSC 2XTIA 2JA5H 5M5XH 5JEAG 1DGSA 3D0FA 3Q8DA 1HZCA 4A3BH 1PHJA 4X66L 4JV5L 4R1JA 5GAGC 4GKJQ 1OXTA 5FLXE 1VS0A 1Q86U 3CQZH 3PUXA 1OXXK 4ME3A 3ULPA 3HOYG 1VQ9A 4DR1Q 3I4MH 3RLFA 3CW2C 1VQBA 1HR0W 5M3FG 3VDYA 5IYCH 3A5ZB 5IT9E 5ELNA 1I5FA 2JNGA 1WJJA 1TWAH 2RCNA 1JJ2S 2LSSA 1Y1VG 5AJ3Q 5LMUL 4LF9L 4IOAA 3CMET 2JA7H 1XNQQ 3JC66 2VS1A 4A3KG 4A3BG 2IHFA 3BU2A 4QIWE 4DV2L 4NXML 4LUOA 4GOPA 3DB4A 2I5LX 2QEXT 3B6YA 2Q2TA 4LF6L 2VL6A 3EBEA 3I4MG 4DV1Q 1N34Q 1MKHA 4YWLA 3CD6A 3PO2G 3J80i 5IYCG 4A76A 2V1CC 1E3PA 2K5HA 3UDXA 2VY3A 1C7YA 2L3RA 1NZ9A 3KOJA 1X3GA 3NEMA 2ZM6L 3E9HA 2ES2A 1K8GA 2OTLA 3G6EA 4JI4L 1JJCB 3I2ZA 1A62A 3ULLA 2K5VA 3STBD 1VQ6T 1K0RA 2QGQA 1YIJT 3CPFA 2JA7G 4DR4L 2YYZA 1FL0A 3BZCA 3GD7A 3DLLA 1VQ4T 1K8AU 2A19A 4JI5L 1A0IA 3GTPH 1I3QH 1Q1BA 5E7NA 2B63H 1YJWT 1HNZQ 2UUAL 4OX9L 4OWWB 2D0PA 1VQKT 1C9OA 1WCMH 1UE7A 2N49A 2RHQB 5IWAL 3M7NA 4RG2A 1J5EL 2EQSA 4NXNL 3G48A 1Z47A 5C3EG 1MJEA 2ATWA 3K7UC 5IE8A 4A3DG 2VW9A 1NPRA 1QZGA 4K0KQ 2JOYA 2IT1A 2ZTEA 4UP7A 5GROA 4HIOA 1Y1WH 1R9TH 1VQMT 3CC4A 4LF4L 1OTCA 3KFUA 2AMCB 1G6PA 1VQ5A 2VQEL 2VZAA 4JI2Q 1HR0Q 4JI3L 3KF8B 3JAMi 1HH2P 4DV6L 5C44H 4JOIA 4JI1L 1N8RC 3CCRT 3I7FA 4C3HH 4LWCA 1KQSA 1EFWA 4JI0Q 4JCVE 3HOZG 1SMXA 1YI2A 2R92H 4IJLA 3E0EA 4DR7L 1WCMG 3OW2S 3UE1A 1SLJA 2YTXA 1VQ7T 1YHQA 2F4VQ 2IHEA 4ZN3A 3J80c 2DO3A 2PQAA 3S15H 3M9BA 1HNWL 2AWNA 3G4SA 4JBJA 3GTJH 1XPRA 3CMAA 4DUYQ 1YHAA
chains in the Genus database with same CATH superfamily
4BD3A 3H0FA 2NUZA 1GCQA 1LLRD 1STAA 2IWHA 4DNTB 2EYYA 2B86A 2K3YA 3NTKA 3RMQA 4ANJA 2YUNA 3MP8A 4IUVA 1EZ8A 1CKNB 2F5TX 5FO9B 3I90A 4ZRZA 1KIXA 4IFDJ 3I35A 2O4XB 3VU3C 1ZSZC 4DEXA 3NWTA 2HCCA 4HIMA 1JQYD 1C4QA 2Z0WA 1OXUA 3TQYA 4M75A 1H9MA 3MXNB 3SWNA 3MTSA 4K2LA 1RAEB 1MMNA 1YCYA 1S5BD 1LCKA 2CCZA 5A2QL 1DOKA 1M27C 1AWWA 4QGUA 1HJPA 2NVXH 1YJWA 1Q82R 2XN9C 5DEHA 1T0JA 5GMKm 1V8QA 2K28A 2Q2HA 3TSSA 3WOFA 3H15A 3NELA 2CKKA 1G83A 2NZHA 1HJDA 1K8OA 3CMEQ 1YP5A 2DTOA 1STYA 2BE5D 1XNIA 4H13C 4N9TA 3JAMc 1I6HB 1EFNA 1NBWA 4O1NA 4ULLA 4BBSH 4EMHA 5M9OA 1Y7XA 1ZSZA 1CZWA 1ARKA 4O0AA 1WX6A 2EQUA 4C92E 2ZM6Q 4JI4Q 1PTOH 2AKKA 2QTXA 3FLGA 3VYGA 5LJ3e 5M3FB 2ZAEA 4L63B 4B3SQ 1UUEA 1B34A 2N88A 2GQIA 1I1JA 3OYLA 1Q81R 1JJ2A 3WVDB 4C0FA 2ALYB 2KEDA 3MA2B 4MZ9A 5JAVA 4JG2A 1TH7A 3KBGA 1Y8NB 3EIVA 3X3NA 4GLMA 4M78G 1CFMA 2L12A 2RNAA 1ML0D 1K73C 2DD4A 3KLWA 3SB2A 3FC3A 3VR5A 5E3FA 3C1FA 4HN7A 2E5LL 1OPKA 2XDBA 2P5ZX 1Q86R 2O2OA 1LT6D 1TWCH 1G51A 1X69A 1RTOA 3LWHA 1VQ5T 1BXTA 2OQKA 3RZDB 1K76A 1HZAA 2RQTA 2DUDA 1QVFS 5GMKi 1AE2A 4JBKA 2ROTA 3OYMA 4J1MA 4ALPA 4A3FG 1P8LA 2XICA 2JM8A 4MMKA 1YHQT 2X6LA 4OHJA 3M58A 3R6OA 1E0BA 2B2VA 4J6WA 1VQMQ 1B7YB 3VRZA 5C4XH 3NBIA 5FJ8H 4HIDA 3FIFA 4IO9A 5FLXL 4J9DA 4DR6L 3FPUB 4XQJA 1W3SA 3HS0C 3L2ZA 1E2WA 2QASA 2W0ZA 4YHHL 3KDFA 2C0TA 3W2DA 4J5YA 4M77D 2MWOA 3CCJQ 4LUZA 4I7ZC 2B3GA 1WFQA 2EYFA 1KC8C 3TDQA 1SXTA 1K1ZA 1BBXC 1BF4A 4L5GA 1EYGA 2XWBB 2DAQA 1M2VA 2F0UA 2WSCE 2D9UA 5HGTA 2F3VA 1CKMA 3QBYA 3OS5A 4DPGA 4DV3L 1N33Q 3CCSA 3VUBA 4KV6A 2XK0A 3EH1A 1U4RA 3Q24A 1Z9ZA 1X3QA 3QO3A 2PPBC 4QIWB 3I4OA 1PKSA 2NLUA 1SRLA 3TZUA 1M1KU 3S1QB 1TR5A 1WCMB 1J8IA 1OI1A 3HOVH 2Z6KA 4C92A 2PMZE 2SNMA 2RHIA 3UDGA 3I55A 4EMKA 2O9SA 2KECA 2LKVA 2Q8RE 4LJZC 1HHVA 4AH6A 3D4DA 4QQBX 2RJFA 2HHHL 3NGPA 4DAYB 4PZ7A 1H3ZA 3V8JA 1EYDA 1GCPA 1VIFA 1VDZA 2B2UC 2K5NA 4KGXB 1CQVA 4PJJA 3CCET 3Q6SA 1WYXA 4DUZL 4F17A 1HFNA 1IBLL 3PFSA 1SNCA 2GA4B 1IKMA 2B63G 2K5IA 3BY7A 1PCXA 1OZ2A 1JXOA 4KULA 3HHTB 3S15B 3SHWA 2GF7A 2A74C 2VYTA 5HY6A 4K5VA 4N8FA 5KYYA 4RFBA 4J83A 2EIFA 1NJIR 1NMGA 2DKGA 4DU9A 3HP3A 1XMQL 2NVTB 2QTVA 2X35A 5IYBH 3M7GA 1EIYB 1GXDC 4DR2L 4A53A 5EPLA 3QJYA 3BDLA 2K01A 3S1NH 4FT2A 1VQNQ 2K2MA 2PQWA 5LJ5j 1PH4A 5JPNC 2QF7A 4ME7A 1UECA 3EQLC 1CHQD 3GIBA 3R2IA 1MBYA 1QZHA 5EQ0A 2DL4A 1O78A 3SK5A 3EGDB 5KYXA 4PJOG 4AFSC 2KMTA 2HBWA 1IYUA 4ZK9B 5BN5A 4V190 4JYAQ 1V1QA 3H0GH 5IYBG 2R7DA 4M77E 5FKAC 3JCMg 4BUGA 2GFAA 4H0LC 2VXWA 3WOEA 1GUGA 4F14A 1IGUA 2M00A 3CRLC 3PO3G 3SEMA 5KYWB 2PI2E 2MQHA 4RA8A 4LF6Q 1WHKA 3HKZE 3KJPA 1JQQA 1LVKA 2KROA 5LJ3g 1BDOA 2VQFQ 1GBRA 3CU7A 4PV1C 2QEXQ 2K79A 3CCST 3A55A 2UXDL 4N0AA 4LNQA 1W6XA 3CCLA 1EQVA 4XQ3A 1CI3M 3ULJA 2A3LA 3VYRA 2WP8J 3HOWH 4HSVA 3TBIB 3EHRA 3UPUA 2HD3A 1B1ZA 3U9OA 1BCPB 2OXPA 4R4OA 2ED0A 2KYBA 3S3MA 1Y1VB 2X51A 4RKUE 1VQ6Q 2IX0A 2DJZA 2ENBA 3M4GA 3HKZB 4LF8L 1AWJA 1QW1A 2ZXOA 3ASKA 1P16A 2EY5A 2LS01 1L2FA 4CC2A 3QOLA 2DX1A 1LT3D 1ESRA 3MEUA 1VCIA 4ZN1A 3HKSA 1JWMD 1I5OB 2X4WA 3JCMX 3EFOA 1M5Q1 3HOWG 1KHIA 1SNQA 1XNRQ 3N6RA 2YXYA 4CJ0B 4M77C 3PIO3 1VQAA 5M3FH 3H3VI 2UXCQ 1YJNA 1EY4A 2JA7B 1A2TA 4KT0E 1TUCA 1ZA2B 5J22A 2NVYB 2FVUA 4MHEA 2A73B 4JBMA 4UP8A 1Y0MA 3EAEA 3OYIA 2E75C 1J9OA 1G3YA 3L2UA 5GANe 1WHGA 3M55A 5LMNL 3EG1A 4KUDK 2RA2A 5L23A 4XTYA 1F2ZA 1RAGB 1VMPA 4X3KA 2R6GA 3J7ZC 1GD7A 2B2TA 2DXTA 2PU9B 2J6FA 2OTJA 2M0OA 3TMEA 2GQVA 1HQMC 1BU1A 4K8JA 1ZUUA 2DRKA 2EYHA 5CGKA 3RZDH 2QDLA 2PUOB 4M77A 1STGA 2JEAI 3QKJA 3J7AV 3HOXH 4C0ZA 5LL6S 1PRTF 3GTPB 4X65L 5BR8L 1SNMA 1K8MA 3ND9A 2DRMA 4QKUA 4N8X1 2Z9HA 2ZCFB 3REAB 3NPPA 1PA6A 3V96A 4YIJA 1EY0A 2JZ2A 1J3TA 5KEEA 3PF4A 1L0XB 4M75F 4LDXA 3CCVA 4CKCA 5TSSA 1MD2D 1D09B 4DOWA 4BI4A 4OGQC 1X3EA 2CS7A 2EYJA 1BUVT 3CBOA 2F0FA 2BH8A 2E8GA 3BVMA 5KCOA 4X64L 3HOXG 3BW1A 3SDZA 3KF6B 4JLGA 4JRPA 2DL3A 1SYFA 1UGPB 3H6MA 1KXLA 1TY0A 2JA8G 2XDPA 4NL2A 4KHPL 2A08A 4LUDA 2FPDA 3VYSA 2CW0C 4RTYA 2R92B 4OF1A 2A37A 1II3A 4P2CB 3N52A 1QMCA 1EZZB 5C6SA 4LF7L 1NYFA 2CP5A 4FYWB 1O7IA 3MZ5A 1STNA 2IPKD 4XTWA 3S1QH 5KE3A 1EY5A 2F0GA 3J81i 3A7AB 3FRPB 3I56Q 1CSKA 4B3RQ 1D6EC 4XAXB 2N3SA 2NUTA 4UDUC 2DN8A 2O5IC 4B9WA 4OP0A 4LFAL 3URYA 3SEBA 2I5MX 5GQOA 5IGBA 2UUCL 2NZOA 3C95A 1Q7YU 1PH9A 1YN8A 1T0HA 5IGGA 3I5RA 1X65A 5I4DA 4KI0A 2CQOA 2ECZA 2K6DA 1YJNT 4EVOA 3P8BB 1GHJA 1JU5C 1ZYRD 2DIQA 3LGJA 4X62Q 4BBRB 1S4ZA 4KD3A 3U9SA 2ICIA 2GVBA 3CMEA 4HJ8A 3M4PA 2XMFA 4J9BA 2Q2IA 4AIMA 4A4FA 4HCZA 1SSFA 1RIPA 2A69C 4DR7L 2OTJT 3FEOA 4F7UE 3CXCS 1YHQQ 4AQYL 2DBMA 3ZEHA 4GY5A 5CK9A 1AWOA 2NTTA 4D8KA 2M2LA 3IFTA 4MIUA 5FRMA 2EQJA 3H3VC 2ESWA 1R4PB 1UGSB 1PLFA 4YWMA 1BIBA 1MUZA 1PSEA 2HSEB 1WYDA 3J81c 4PL6A 1XTDA 5I2MA 1IBKL 1KQSS 3P75A 3MP6A 2QQRA 2GVAA 4FXKC 1M8MA 3TZDA 3REBB 2K5FA 4RKBA 2EJ9A 1C0AA 3NHNA 2I0QA 9ATCB 2ID0A 2XHCA 4V2SA 1FR3A 3CCVT 2LMJA 1BCOA 2LNVA 3X28B 2M51A 1PH2A 4NL3A 3J80E 3OOCA 2LCCA 4GBQA 5DNFA 4Y52H 1KDAA 1EL0A 2JYOA 1N8RR 2Z0SA 4IPGA 5EKKA 2HHHQ 4DV4Q 2M9UA 4MZTA 4C92F 2RQXA 3K0XA 4LFBL 2FZKB 5E1FA 1VQMA 3F8TA 3RUZA 3M57A 3M59A 2EY6A 4JI0L 3AEVA 5IYDG 2E2JB 2DK3A 1IBLQ 1W70A 3FHWA 2V8JA 3A8MB 5HKCA 2ENMA 2OCEA 2AZVA 4HJ5A 3L2QA 3MFYA 1AHJB 5GANg 2FXQA 3CCJA 1S40A 3CCEQ 1Y1VH 1SSOA 2CFMA 2CKZB 1XPOA 1V1PA 3KJOA 2XSCA 3OW7A 1EY9A 4DN4M 2F5KA 2KXCA 3JCMb 2YLBA 4JLIA 1OV3A 2L0AA 1HZCA 1OXTA 4KGVB 1SYGA 1M3AA 4IIOA 1OXXK 3HOYG 2HKQB 5CKHA 1Z9QA 1VQ9A 3MHXA 2AQ3B 4AFQC 4BY1B 2DXBA 2PYKA 1SFOB 4N4HA 4MZPA 3VS6A 3EGUA 3D8GA 1NLPC 2GCXA 5FU7B 4OB2B 4MMLA 1WJJA 4IALA 5ELNA 2DD5A 4IOAA 1Y1VG 2GFUA 2O9VA 4F7UA 3CMET 4WFN3 2JA7H 2VS1A 3UDCA 1IGQA 2IHFA 1U9RA 4GOPA 4RGOS 2I5LX 4NKLA 1WQWA 1A0NB 2LX9A 5GAMf 4C5HA 2E10A 2R57A 2L4NA 3MC0B 1G8ZD 1MKHA 4YWLA 3NBHA 1GUNA 4A76A 1JWUD 3OSVA 3PVQA 2COYA 5GAMh 1K0SA 2L3RA 4QVCA 2EJGC 1NZ9A 3L9AX 4PJLA 1X3GA 3JCMP 2ZM6L 1K8GA 3U23A 3TU4K 4JI4L 5FU7C 3I2ZA 2JA7G 1Y96B 1ICWA 1YIJT 2YYZA 3BZCA 2PUKB 3M53A 3GTPH 2RKSA 2RD1A 2DL5A 3S3NA 4A3EB 3NFCA 2W10A 1S5ED 2V4DA 4C2MB 4C3JB 3VRYA 1RD9D 5D7UA 4OX9L 4EPCA 4B6MA 4F88A 1UDLA 1F9RA 1LTRD 3CCSQ 3H9NA 2EYPA 1UE7A 2HUGA 1Y71A 2N49A 2RHQB 1N9RA 4MDWA 3I70A 5EBCA 3MCAB 5C3EG 1M3CA 3OBWA 1CA6A 2EXZA 3X24B 4KTAA 1KIKA 2IPOB 4ZTJA 2M1HA 4ZUJA 5CBEE 5I6WA 4HIOA 1GJXA 1SEMA 1VQMT 1G6PA 1ABOA 3PTAA 2EKHA 4XU1A 4JI2Q 3KF8B 3MXPA 1HH2P 3META 5C44H 4JOIA 3I4NB 4DGZA 4A4GA 1IW7C 3W3AA 3HOZG 4JCVE 1SMXA 1YI2A 1TU2B 4PFZA 1WIEA 1VYUA 2XVSA 2R92H 3OW2S 1JORA 1I07A 1SLJA 2YTXA 2LCSA 3DEPA 2SRCA 5LJ3h 4ZN3A 1TS5A 4ATOA 2RBMA 3KK7A 2HQXA 5FROA 3OYCA 1SAPA 1SYDA 3NXWA 4R4QA 4DUYQ 1O75A 3LX0A 2Q8IB 3QWYA 1EUJA 2KA7A 3P8HA 1VQ9T 2I2LA 1Q90A 2MJ8A 4LD9K 5C44G 1IYJB 1F9SA 5CIUA 5FW9A 4A93G 2DZCA 2G9HD 2NVQH 4ELYC 3RN2A 3OIPA 2E12A 4OMMA 4IURA 3NSWA 1WI5A 1TXQA 3CPWS 2E2HB 1U4MA 2IG0A 3JB9H 2CYZB 2K7VA 1OX9A 5BR8Q 1EOVA 2OEOA 1LTTD 4X65Q 1EY7A 1D1CA 4M7AG 4DAVA 3GTOB 3S2HB 4M77F 3EG9B 2B8AA 1HCZA 2L9HA 4DV2Q 1RJTA 1T3SA 1I4XA 2A68D 2AZSA 1WJSA 1WXUA 1ZQ1A 3VS7A 4M7DD 5GAN8 3VR2A 5CKBA 3SR1A 3JCMV 1QWYA 1VF5C 2DTHA 2LNHB 4HTHA 4A3LH 4PJOD 2B39A 4A54A 3FEWX 4X64Q 3JB9G 1XYIA 1SHGA 2DA9A 2JJQA 1TT2A 4DR4Q 1AW7A 3N5BB 4JJDA 1NY4A 5CKEA 3WDNA 3JV3A 2IY5B 2K5WA 3C4SA 1BI0A 3S2DB 4LF7Q 2BKDN 1CK1A 1AZEA 1BBWA 3J80L 1AWXA 1W4SA 2B29A 4L59A 3CP0A 2G5DA 1K0XA 1LTLA 4A3LG 2AHJB 2HDAA 3GTGB 5IXFA 3CQZB 4PLIA 2DPPB 3BVGA 1ONLA 1YNND 3H41A 1UG1A 3PUVA 4R8NA 4LFAQ 4IPDA 2RHXA 1ILPA 5FK9C 1TTHB 2UUCQ 1X3PA 2M02A 1AZPA 3I8ZA 2D1XA 1B9MA 2YRVA 2ED1A 3LGFA 4RTWA 1YI2T 2DXCA 1EFID 4RHSA 4DV6Q 4KJOA 1ASZA 1JOQA 1QCBD 1VA7A 1BBUA 3D4WA 3M85A 4IPCA 1VQOT 1IO6A 2MGSA 4JYAL 2PNIA 1ASYA 4P75A 2BCOA 1X3FA 4QF4A 1BO0A 1D2BA 1VQIA 1RL2A 4FU6A 4R9WA 4I65A 5GAN7 1VMCA 2JJ9A 4DAMA 4G7ZC 3OY9A 5CKDA 1YJNQ 2E4HA 1H9SB 1O7ZA 4BDYA 1WPYA 4HCKA 1AEXA 1CQFA 1Q46A 2N8NA 4DR7Q 4XTXA 2AHOB 1NSNS 2ZPFB 3MEVA 5ELCA 4L5TA 2QDYB 4HAEA 2VQFL 4AQYQ 4L6V5 4CDEC 2BIVA 4BY1H 2R58A 1PRTB 1BB9A 2CVRA 1CKAA 3PUWA 1SFOH 4LN2A 1D1BA 3I56A 2OTJQ 2YTYA 2DLPA 4C8QG 2ZPIB 4OMPA 4FSSA 1FWZA 1N36Q 4P72A 1IBKQ 1E1OA 2HZYA 2F52A 2KBNA 3DWAA 1XMOQ 1I4QA 4M75B 1NTGA 2ZTDA 1X9NA 3SWNB 4M7DE 1PMRA 4JW0A 1S5CD 3H09A 3QR8A 3X25B 4EMGA 1IXRA 2AIRB 2FRWA 1SPKA 4PJOE 1MV0B 3UF4A 5JVH3 1GCQC 4JI7Q 3THKA 2JTEA 5DM63 1JB7A 2HL3A 1WHMA 1Q82C 2OAWA 1G91A 4QB4A 1XNRL 4KY6A 4F16A 5CR3A 2RM4A 3MXUA 1OXVA 3MP1A 2DXUA 3OYEA 1JWSD 1WTOA 2YHTA 4OMLA 2F3IA 3E2UA 2XNAC 3QYHB 1TXYA 4QQDA 4LFBQ 1ACMB 4RG8A 1O9SA 2F0HA 2K50A 2UXCL 2BH2A 1JOKA 2K6AA 1ZSZB 1WNLA 1CUKA 1KAWA 2AKWB 2JA6B 4PMCA 4A75A 3SWNC 4A3EH 1F2MA 3PQIA 1LT5D 4C2MH 2DVJA 1X6BA 1CM9A 4JI6Q 1GVPA 3MEAA 1JO8A 4EDUA 1B34B 4AG2C 4GN4B 4OXPA 5BN3A 1Q81C 3SGIA 1EZ6A 5GAN5 1VQLA 3P1HA 2DL8A 3SD4A 3A8KE 1OU8A 3P7JA 3OMCA 2OI3A 2ZJPA 1N9SA 2M0YA 4NP5A 3RMHA 1D3BA 2J6OA 5KCHA 2JN4A 5JJKA 1EYCA 3HG9A 1MGSA 1V9PA 3HTRA 3BJUA 1U1TA 2NN6I 4JVZA 3OS0A 2K4KA 4C3HG 3H0HA 1L0YB 4CHTB 4HJAA 4A3EG 1IHVA 4A3MB 2AT1B 4JRQA 3S17H 1QJOA 2NWMA 3FRNA 2JXMB 1W2BP 1Q86C 3S6WA 3I4NH 4A3GB 4P71A 1LOJA 3L7ZC 4C3IB 4IFDH 5CQYA 1RACB 4N4IA 1ESFA 2FL7A 2DJGC 2KCNA 2SNSA 4BWGB 3GTKB 4GNXA 1U3OA 4BY6B 3QZ9B 1UHCA 4A4HA 2IIMA 1DCZA 1SYCA 4LDUA 3SHLA 5JEAJ 3K5NA 5IGDA 2EGCA 2HQHA 2F2XA 2P0QA 2HL5C 4F7UF 5G3LF 4P74A 2Q8TA 5CR2A 1KD1R 4HCCA 3JCMe 1PXUA 1BCMA 1TVXA 2VV5A 3NK9A 3ERQA 4E6IA 1DD2A 5GANh 1BK2A 3CBMA 5IAYA 4X34A 4FO2A 3KDFB 3I72A 4YCUA 2LXKA 3SVMA 3V2TA 2AKLA 3BG3A 4M7DA 5ELFA 3I56T 1C48A 3DB3A 4G4KA 3CCEA 1ZEQX 4GN5A 1EY6A 2E2HH 1M2VB 4BY6C 4PJOA 3M4OB 3M0RA 2RDGA 4DK3C 4KLKA 2FHTA 2M16A 3F2DA 3K5MA 1Q82U 2B2VC 3GOXA 3GTOH 2E65A 4B3RL 3S2HH 5GADC 4OX9Q 2HBPA 4FXGC 1YIJQ 2JA5B 5M5XB 1BNZA 5IN1A 2IJ0A 1B53A 1KFZA 3MHBA 3MXGA 5CV6A 4BBSG 4BI3A 3A5UA 5FU6B 1Y14B 1ZSGA 2KRSA 1KTKA 2MPXC 4C92B 1XX8A 2KCTA 3LWIA 3FVQA 3QWNA 1QVCA 3AQQA 2E5QA 2GBQA 4GLKA 4EMKB 1FYCA 1NBEB 1FX7A 4IFDG 2DNEA 4A4IA 1A3TA 5C4JB 3L2WA 2RK2A 2G3RA 2OQ0A 1CT1D 3GBQA 3DMUA 1N6AA 3HPWA 4JS5A 3KYHC 4X62L 1Q81U 1FMWA 2FYKA 2RI2A 1KL9A 1GUSA 1HUNA 5I9PA 1WXBA 2WB1G 4GKKQ 4HMIA 3J81E 2K5LA 2QQAA 3S2DH 1X54A 5A0GA 3ME9A 1VQLT 2Y0SE 3TVTA 1NNXA 1SNPA 2DM1A 5FU6C 2QEJC 2K3XA 4ZKBB 1CSPA 2AUJD 2Z6KC 1FXXA 1MJCA 4C92C 2YSQA 3K5OA 1H9RA 1A6XA 4BA1I 4EMKC 2FHDA 3GTGH 1R77A 2BUDA 2NUCA 3HGBA 5KYYB 2LCLA 4BDZA 5JJIA 5A0LA 5DM73 4OL7A 4PJMA 1W6KA 2E2IH 4FYYB 3R2TA 4GN3B 2J0TD 1PM3A 4H02A 1NJIC 3CAMA 2K5QA 4IN3A 5C0XI 4DQ2A 1BIAA 1PSFA 4IUTA 3BS1A 2DEUA 4FXDA 2EGEA 1IZ6A 1DJRD 5DY9A 1D5ZC 5C4XG 2EW3A 5FJ8G 1VQ9Q 4X1VA 1WTHA 4M4ZA 2F0DA 1SF9A 2Y0SB 5C6AA 1NUCA 4MDXA 1YNJC 5I2YA 2HEQA 1M1KR 4KUIA 5KYLA 4IUUA 5ELEA 3DUZA 5A0DA 3U58A 2SEBD 2WAQE 3CRKC 2C35B 2DNCA 1FYNA 3L2VA 5KYXB 1UNSA 3OWEB 2EVBA 3E9GA 3TS0A 2NUPA 3S16B 4A3CH 1IB8A 1QVPA 2O01E 2MAMA 2R5MA 5IXBA 2K32A 3UDFA 3VA5A 3F2BA 4DV4L 1Y1WB 1R9TB 1MSGA 3M54A 3CC2A 2A6EC 4DK6C 5J26A 1XXGA 1SE3A 4OO1I 1YBYA 1HZ9A 3JCMc 4HR7B 3M4YA 2LMCB 3F2UA 1WD0A 5LJ5g 1M2OA 1EWIA 3TRZA 1I0CA 1STBA 3TP5A 3QIAA 1K73U 3E3XA 1E7OA 2LQNA 5KYUA 1S72A 1LYLA 3NQIA 3O5ZA 1E6GA 3HOVG 2PMZB 4PZ8A 1G5VA 2RPNA 2PO4A 3PIPA 4A3CG 2EOTA 4UAIA 4AYBE 2I0NA 2B2WA 1N27A 3A74A 3VYUA 2COZA 1TWGB 2K04A 2RQWA 1YVCA 4MNOA 3I4LA 4G7HC 1HXDA 4RCBA 2K4YA 2YU9B 3A7LA 1NCVA 1C0MA 3PUYA 2P84A 2F0NA 2XRSD 3PF5A 1TWHB 2QI2A 4J9EA 2DFUA 1W2BA 2F0LA 4XIGS 3J7A5 1NR4A 2BE5C 1JOOA 2IX1A 3A8JE 3EFOB 4N0AC 4M75G 1I50B 3ER0A 4QVZA 1RADB 2JA6H 1KQSP 1I4K1 8ATCB 4PLLA 1WD1A 1Y57A 1KC8U 4Y7NB 2KQ3A 1NJIU 3G6JB 1HYOA 2RSNA 2BZ8A 1SYBA 4KBMB 2EPBA 1OO9B 2KQWA 3NTHA 1O80A 1YI2Q 3E9IA 1WHJA 3PIOA 3PMIA 2Z6BA 3EG0A 5KYNA 1W6JA 1RDPD 2A8VA 3OB9A 3HRSA 2RF4A 2L5TA 1VQOQ 1VQDA 4ZUIA 5M5WB 1I8FA 5C4ZA 1KRTA 3V8LA 1MNEA 4BI8B 1E2VA 3HFZB 4ESRA 1PNJA 3GDEA 4FF2A 1NEGA 3LH0A 3QZ5B 4ZTFA 1EU4A 3PE0A 3FDRA 2E64A 4CC4B 2A1AA 2LQWA 2F0JA 3MAQA 1IBMQ 4ZNXA 2XWJB 4ID6A 2MHVA 1KNAA 4LE9A 1Q8IA 1Y8OB 3EVQA 1S1NA 5GAMj 2QILA 4LDVA 2CP0A 1G3SA 1KJWA 2CSQA 3JSCA 3RDVA 2KEEA 3H0GG 4RCOA 1ET6A 4M77B 1K28A 4C3IH 5COYA 5IIFA 5HGQA 4DA2A 3RR5A 3GTKH 4QT7A 2LQ8A 1KNEA 5EPJA 3Q23A 2EPDA 3PUZA 2PZWA 3WVEB 4KD4A 5I11A 3H0IA 5D14A 3LLRA 1KLUD 4LD6A 3K57A 3HOUB 5GAMd 3FJPA 3TREA 4DV7Q 3I9QA 1D0YA 3D31A 2PW7A 3CC2T 4ZKCB 2V26A 2KJXA 3V05A 1E6HA 1QQJA 2F1LA 5KGUA 1I6HH 1PG5B 3O8VA 1B3AA 2B2TC 4H44C 2DL7A 1PH6A 4M7AD 4JI8Q 4JI2L 2CUBA 2UXBQ 2BTTA 3S1RB 4X9DA 5GMKj 2QYZA 3JCMW 2QW7A 3NUCA 2MUYA 4CDDC 1S72T 1E7ZA 1QCFA 3CCRA 3M4OH 3RN5A 2L2PA 2B2YA 1OPLA 1HK9A 4VUBA 4PMWA 4DAPA 3EGXA 4MTKA 2UU9Q 1VQ7A 4DAYA 1SR3A 3JB9D 4DUYL 4R55A 2LC4A 2JA5H 3OYKA 5M5XH 4IUQA 4JV5L 2JMCA 4X66L 1U1SA 5GAGC 1SJHD 2VVKA 3TSWA 3GTMB 1DJ7B 3G7LA 4ME3A 2JM9A 3R6NA 2F0SA 2NUTB 3RLFA 5ECAA 3CW2C 4AT1B 1HR0W 5M3FG 1EX4A 1LPLA 5GJWB 2PQEA 1WDXA 2DVEA 3VDYA 4DXFA 4RCNA 5CQXA 3K7AB 4A3IB 3UT1A 1JB0E 3J81L 1K83B 1R0CB 2JNGA 1NM7A 3UA7A 4KH0B 3RUXA 3EG2A 2RCNA 5LMUL 2LTOA 5LJ3d 1OEBA 2F03A 1PC0A 1ENFA 1QVGP 1XNQQ 3WXMB 5KNDA 1M1FA 5D3IB 4TRDA 4DV2L 2VUMB 5EJWA 3DB4A 1VYTA 3NPFA 4C92G 3B6YA 2H4OA 2VKNA 3LH5A 2LT1A 3A8HB 2VL6A 3EBEA 4BY7B 3S14B 2DTIA 4BE0A 2J6KA 3DWPA 3UDXA 3UI2A 3CQTA 1OYXA 2PZ1A 2NN6H 4O42A 1GUWA 3E9HA 4HKEA 4CI0C 5GMKl 3STBD 4J6YA 4FF1A 4II1A 4DR4L 3CPFA 3FKIB 1VQ4T 2H3EB 3JCMQ 1QE6A 2WSFE 5E7NA 3CBPA 3OBYA 1HNZQ 4EGVA 3Q0AA 5IHIA 4M7DF 4RUGA 3RESA 1LO5D 4R0KA 3T51B 1WCMH 1XTCD 1F1BB 4N9PA 4CGYB 2L11A 2EQSA 3G48A 1FMKA 5D6XA 1Z47A 1LV9A 2HMAA 3K7UC 5IOCA 5IE8A 7AT1B 2RHUA 3M9QA 4C8QD 2GNCA 1PYWD 5I21A 2CP7A 1F2LA 2K57A 1I4HA 2DERA 1TKWB 3A8GB 4UP7A 4WTOB 3CC4A 1M90R 1Y1WH 1R9TH 1OTCA 4FL6A 1WA7A 1Q7YR 2BOSA 5AYFA 1HR0Q 1KK7A 2O88A 2D2CC 4DV6L 2F69A 1HD3A 1N8RC 3CCRT 1EWHA 1KQSA 2KOLA 1EFWA 2DY7A 4AFZC 4O6JA 2XG8D 3E0EA 1WCMG 3EH2A 4IUNA 3KLRA 4OIKA 1VQ7T 1PFNA 2IHEA 4Z9CB 2PQAA 3S15H 1Y07A 3M9BA 1QILA 3DEOA 4ZGEB 1HNWL 4IZ8A 3G4SA 4JBJA 3OYAA 1XPRA 4JUVA 1TUGB 3CMAA 1QKWA 4M8AA 1VF7A 2DILA 4IIMA 2QA4A 5C0XJ 1UJ0A 3VS1A 1TWGH 5CYUA 1V1PB 1M3BA 1TWFB 3HSBA 2F0TA 5CMDA 4OGEA 3INZA 4B08A 3MPUB 1VQLQ 1X6GA 5ISRA 1TWHH 3K58A 3E9FA 3VS4A 1SEBD 2YUOA 1OOTA 4J6HA 1SE2A 3TQ7P 1N36L 1YIJA 5DLQE 3BDCA 4LF9Q 1SROA 1XMOL 2ZPHB 3P8DA 4RG1A 1WTQA 3TCJA 2AUKA 1EY8A 3H91A 3HFOA 2KSSA 4Y7NH 1K9MR 3W1BA 4F7UB 2HDLA 4OB3B 5KNBA 1AH9A 4DR1L 3BDUA 4JI7L 2EQKA 3OPOA 5BN4A 4GOPB 1Z9FA 2ZTCA 2WIIB 1PDQA 1DXMA 4ELZC 1QNUA 1E24A 5C5LA 5M5WH 1SMYD 1I4GA 2E2DC 4JJBA 4Q5VA 3NBHB 4FNFA 1S5FD 1BYMA 1KLGD 1ZUYA 2DJQA 1C7YA 1BBZA 1Q95G 2RQRA 4UHVA 4M7AA 2NVTH 1SSHA 3OSSC 2L1BA 4KK7A 4JI6L 4LXCA 2EQMA 1K9AA 1QWFA 2JS0A 3M4QA 1LABA 1F2YA 4C8QE 4A3KB 4GOPC 1OU9A 3BZKA 1RAIB 2FMCA 1J5EQ 3HOUH 3AB9A 1SRUA 4XTUA 3EJIA 3C1EA 1X01A 3CC4T 2PNHA 4OEMB 4Y91A 3ZYYX 4JRKA 2F0MA 1H92A 3D7SB 2EKOA 2FJ2A 5JJZA 2OWOA 3NMZC 3PO2B 2QDBA 2DJFC 1H3HA 3HFNA 2TMPA 2VQEQ 4OONA 3S1RH 4M77G 4M78D 2L0CA 1QVGA 4ME5A 2X9HA 5EC7A 2CZ7B 1M9SA 1VQHA 3V7RA 1V29B 4GLAC 3OYHA 1ILQA 2F1MA 1PTOD 2KK4A 3G4ST 2NVYH 3HKZG 4YTLA 3GV3A 1A3VA 3CMAT 1TY2A 3RIRA 2XDDA 1S3OA 1UUPA 3EN2A 2E3HA 4PMBA 4XTCS 2DYBA 5IHNA 2QA4T 4NS5A 5CBAE 2OT2A 1B44D 1RLPC 1JRIA 3K81C 4MTNA 3MFGA 1GUOA 1AZGB 1N9WA 3MEFA 3BVZA 5GROA 4Z8AA 3GTMH 3RR6A 2L55A 4A3DB 4C56C 4LF5Q 5JJLA 3I5SA 2JS2A 3CF5A 4RHRA 1G2BA 2J7IA 5J3BA 2PW5A 4A3IH 3VKIA 2N78A 2D9TA 1IL2A 1SYEA 2JMAA 1K83H 1LNXA 5IGFA 4DV0Q 4CDCC 4BXXH 5GANj 2LQKA 4JOIC 2KUMA 2SDFA 5GAOq 3G1JA 5HK3A 1HXYD 1OULA 4FP5D 3SE0A 4X9CA 1G291 2IW3A 2VUMH 4FF4A 3AMUA 2HQLA 2BE9B 1ZYRC 4TVRA 4M1UB 4RGTA 2HT1A 2EYLA 4BY7H 1GFCA 5GANd 3VR6A 4PFOA 3UA6A 3TP8A 3S14H 4EX5A 1PH5A 1YJ9A 1GM5A 1ZA1B 2F0IA 3CKIB 4BXXG 5KIXA 1SDFA 4B3TL 3QHSA 2ASBA 1PD0A 2DIGA 2XIDA 3JCMh 3PGZA 2D6FA 4J9FA 4C8QA 2SEMA 1F9QA 4J7FA 1QOHA 5CV5A 1HPCA 4GKKL 4DEYA 3PGGA 5LJ3f 3CC2Q 1L1OA 3I73A 1HNXL 3CHBD 2Q2UA 2VUMG 2EFIA 1TQOA 2ZPGB 3MVVA 2MO1A 2X3XD 4KHZA 1VQOA 4L5RC 4BY7G 1JMCA 2QXFA 2VXEA 5EGTA 2VB3X 4E6RA 4C0GA 3ZL7C 4GKJL 3TS2A 3OYFA 3ICEA 4PFPA 3LW5E 1S72Q 1M4VA 2EE1A 1KQ2A 2MNAA 4WJ4A 2KR3A 2EZVA 4NB3A 2AWOA 4CBVA 4JV5Q 4ODGA 4X66Q 1ICFB 3T1YQ 2YRCA 4M78E 3LYIA 1JXMA 3EFSA 3M0PA 3RLOA 2MP1A 2R92G 4TVAB 5AJ3L 3OA6A 5IP7H 3TP6A 1AE3A 3H3VH 1WLPB 1B2TA 3AFPA 1G3TA 1YNXA 3MO8A 2OF1A 3PCOB 4KN4C 2K03A 4XDXA 4BBRH 1SE8A 5LMUQ 2UUBQ 1R8OB 1HFGA 5C4HA 1CTMA 5GAOm 1M30A 1MIUA 1SG5A 1RAHB 1X2KA 4HCBA 2D5DA 3A54A 3GQBA 5CV4A 5A35A 4JRIA 1B8AA 1KDBA 1XWEA 5HCKA 1IREB 2E3IA 1UAPA 1UGQB 3F70A 3X20B 2LX7A 2PZUA 2JXBA 1X75C 3MKDA 4H7BA 4PK4A 5IP7G 4G7OC 1RI9A 1TWFH 2KT8A 3URGA 5K36H 2X4XA 1JE5A 1NAPA 4P73A 4JBWA 4BBRG 1TG0A 4UY8C 4YY3Q 2D8JA 2XIWA 5F2DA 3UATA 5FO7B 1H9JA 1PHTA 2F0PA 3DM1A 1QVFP 4OWXB 3LWEA 3GO5A 2DETA 4A3FB 4TKOB 2KVQG 2L15A 1G6ZA 3DXJC 4DBQA 3A0JA 4M78C 1PH7A 2A6HD 2LXJA 4EQOA 3A98A 3LGLA 2HSPA 1VQ4Q 3LWUA 1EU3A 5C5MA 4A3BB 4HT8A 4V0BA 1YHBA 2QQ9A 1Q8KA 2CP3A 1YJ9T 1I6VC 4QMGA 4K0KL 2LT4A 4OB1B 3UWNA 1KDCA 2K3BA 5K36G 1KQ1A 1PTOC 4ABNA 2K05A 1QNKA 3L0OA 3I4MB 2RI5A 1H9KA 4MZMA 2PVGB 2KI7A 3IAYA 3GNGA 4XQQA 2K1BA 3EFRA 1ZLMA 1MMDA 2WKCA 3GPLA 3ZJYC 3KFVA 1AEYA 2KAFA 4HMJA 1IRXA 4A4KA 3PT9A 4E7SA 2WKDA 1JC7A 1V76A 2HD0A 3IL8A 4WRDA 2ZZDA 2E2JH 3BFMA 3HP9A 4LDWA 3CCUQ 2KDSA 4F7UG 1AN8A 1QKXA 4JC0A 4ZQ3A 5FO8B 4J8QA 5E4WC 5EBDA 3FP9A 2PTKA 4M78A 4ZGJB 3OYJA 1D0XA 1QLYA 2MI6A 3RNJA 4E47A 3J7AF 1NLOC 4RGNA 2MFIA 4A3KH 2H5XA 2RQUA 1C1AA 3CCRQ 1B4OA 5HK0A 2F0EA 3EA6A 3GV6A 3Q1JA 1UE1A 1B3QA 1U5KA 2BE7D 3E19A 2ZT9C 1FNWA 3BZDB 4EQPA 1D1AA 5JVG3 1XOVA 2DZ9A 1JE4A 1VQ7Q 3HRUA 1ZKOA 2KENA 2E6ZA 4HXJA 3QJ6A 1IBML 3PO2H 2JA9A 4R4CA 2YWWA 1PV4A 2AK5A 2YUQA 4FYDA 1D3BB 1WFWA 1UEAB 3NTIA 2KHIA 3K8AA 1MSHA 2CT4A 4OMFB 1EOTA 1K8AR 1IHWA 2B63B 2D0QB 1STEA 3IKJA 2H8HA 2E5KA 1AP0A 2EDGA 4WCIA 3NP8A 4B3MQ 5GAN4 1M4ZA 3UE0A 1QUQA 2MWPA 1AT1B 4X6AH 1CA5A 4LFCQ 5C0MA 4DV7L 2RJEA 4GNXB 2C0OA 1LJOA 1LTBD 5GAN2 1UFFA 4BY1G 4DR1Q 2QQBA 4F7XA 4JI8L 4DBRA 2JK8A 2UXBL 4A3DH 3CCMT 2RH2A 3K80C 3A8LB 1VQPA 1KD1C 4CC7A 1PFMA 2J4XA 4LK1C 1GRIA 2E76C 2MOXA 1VQ8Q 3QSUA 2E6NA 2NZ1D 3K5LA 4M7DB 2H1EA 3OTOL 5LJ5e 1ZBJA 1WOCA 2UU9L 4HJ7A 2J05A 2LDMA 1U0LA 3SXHA 2Y90A 4C3JH 4POFA 4GNXC 1VQFA 4PJOB 1M8AA 1Y8PB 3GTJB 1FJGQ 2KT1A 2KY9A 4JS4A 1UE9A 3HL8A 3QPHA 3D3RA 4XT3B 3ZBDA 1RCVD 2ICEC 2J7ZA 1BVSA 2FPEA 3T13A 2YRDA 4E7ZA 3BDOA 5EPKA 3PO3B 4S3SA 1DM0B 4BB7A 1XPUA 8AT1B 1V1OA 2A68C 1PZID 2FZGB 1YZ6A 4M7DC 1N32L 1VYVA 1TIID 4C3JG 1XNQL 3CC4Q 5H1SE 4OVAA 4A4EA 4PJOC 3RBBB 2A28A 2DEQA 2JVVA 1RHPA 1X56A 1RF2D 4J7IA 1RABB 5IY0A 4QQGA 2VB6A 3A56A 4OWTB 2X4YA 5ELDA 2ATCB 2EJFA 4XXEA 1XJVA 5GANf 3GF5A 4JJNK 1GKHA 3WWVA 5AFWA 1HNWQ 2RDFA 1GBQA 3JCMJ 2A6HC 4P5NA 3G4SQ 3T1HQ 2JN0A 3CMAQ 3I4NG 2R93B 1LTSD 3U50C 1B7TA 5L8RE 2K75A 2QA4Q 1GFDA 3L2RA 1WHHA 1QVFA 3HOWB 1XQHA 2FFKB 2VXFA 4K6LA 1T5XD 1HNZL 1Z6HA 2HDMA 1YNNC 1WTVA 1FMVA 5GMKe 4D8DA 2RHSB 5CC4A 2MO0A 1KD1U 1VQKA 1ET9A 2B8GA 5D65A 2CH4A 3Q22A 1M1KC 2FPFA 1RLQC 1I4RA 4KH1B 2YLCA 1UE6A 3W1GA 2RMOA 4AFUC 5JEAH 2EXDA 4IJHA 1HR0L 1FGUA 1YEZA 1VQPT 2P4RA 2NUPB 2XD0A 3RERA 4FYXB 3UDIA 2LRQA 4B3TQ 5DM7R 1D5MC 1PZKD 4QUFA 5KNCA 1PFSA 1X27A 3RMSA 1VQCA 4DR3Q 5D6WA 2MK5A 4U68A 1EYAA 3W5OA 3OYYA 5I2SA 2EYWA 4J9CA 1CSQA 1K4US 1HNXQ 4A3FH 1Q3LA 4PNOA 1X32A 3M0UA 4C8QF 4FCYA 1CKNA 1SJED 5KYUB 4E2FB 2XTIA 4RCCA 2KEAA 5JEAG 3C3LA 2ZPEB 1DGSA 4A3BH 3PVLA 2O4XA 4JJCA 4GKJQ 1AVZC 1Q86U 2ZXPA 3CQZH 3PUXA 5M3MB 3I4MH 1RI0A 3MXNA 4KY5A 1TUDA 4A3JB 4CC3A 3HOXB 2O5JC 1TWBA 1TU0B 2L5QA 1I5FA 4LF9L 2D0NA 1JJ2S 2LSSA 1MV3A 5AJ3Q 2JA8B 2EGAA 1U4LA 2D8HA 1LTAD 4CKEA 2E74C 1D0ZA 1KABA 1QB5D 3OSOA 4A3BG 4QIWE 3TSZA 4KN7C 3EHQA 2M9VA 1HRJA 2EY1A 3C12A 4K11A 2FMMA 3PNWC 3I4MG 4DV1Q 4RGMA 2B2WC 3H8ZA 3L42A 3CD6A 5D6YA 1BCPD 5IT9L 2Z4IA 5GAOl 4J9IA 3E5SA 1HSQA 3D4RA 2WINB 3VR3A 2OTLA 3G6EA 2A0FB 5J39A 1A62A 5CORA 3ULLA 1DOLA 2QGQA 1K0RA 1LACA 3KLSX 1X43A 3GD7A 3DLLA 3ND8A 4X3SA 4OMNA 3MJXA 1A15A 1EIGA 1K73R 2DYIA 2B63H 1YJWT 2WAQB 5T1IA 2GGRA 5J1ZA 3H6ZA 2DY8A 2F0WA 4JDSA 5KYIA 1PFBA 2P0KA 3GLXA 2D0PA 1AFPA 2FG0A 1VQKT 1WXTA 2CUDA 2RI3A 5I6YA 3LNNA 1RAFB 1J5EL 4NXNL 1VIEA 4FIBA 4C5GA 2VGMA 1Z7TA 3C2PA 3QB3A 2SOBA 5IH2A 3M0SA 2VW9A 1SE4A 4K0KQ 2ZTEA 2B8FA 4C1NI 3KFUA 3CXCP 4KRTA 1FD7D 2XKOC 3DKMA 5KRUA 2VQEL 4JI3L 4RTUA 4EIKA 2CZ1B 5E4XA 4B9XA 2CT3A 3S9WA 1Y69U 1WJQA 4PKCC 1YJ9Q 1WZOA 2RK1A 4RTZA 2HAXA 3I7FA 1VUBA 1WQ7A 4DXGA 3R93A 2AQ2B 4CJ1B 5GAMg 4TSSA 4AYBB 2F4VQ 2PZTA 2DO3A 4E7KA 3L1AA 1KC8R 3DWQA 2AWNA 3GTJH 2PNRC 3O13A 5ELOA 3GTQB 2QGGA 3EGXB 3KUFA 2CW0D 2YV5A 3FMCA 2BDNA 3RKXA 4FDBA 2QG9B 2ZPBB 4D6WA 5CV9A 2B2UA 2KRMA 4M78F 4LF5L 4BE2A 3PO3H 2RQVA 3F1ZA 1QP2A 5I2XA 4DK1A 2YDLA 2BZYA 4M7DG 1T3LA 1ENAA 3L3OC 2JA6G 1PTOF 4DV0L 4A3MH 1A63A 1VQ4A 4A3GH 4HCEA 4Y92A 2ZGWA 3OYBA 5LJ5d 4R8IA 3QDRB 3QOJA 2B2YC 2I46A 4MN3A 4DFAA 3NE5B 5FLXc 4NXMQ 3FPPA 4C5IA 1EQTA 4K2KA 3CD6T 4FF3A 1NG2A 4JPBW 1TS4A 3AYHB 1CKOA 4WF2A 4DBHA 2KCCA 4L6TB 2HNIA 5IT9c 2OTLT 3G6ET 5GAOr 3PIP3 1W1FA 4QW2A 4A3MG 4JZ3A 3CCUA 1W2BS 3ERSX 2EYQA 3HOYB 2HCKA 2R93H 3X26B 4A3GG 5GAN3 4C3IG 1U8RA 1I94Q 4NW2A 2DNUA 2Y4XA 3QO2A 4K5XA 1SN8A 4ZCKA 2A69D 4JI5Q 1H95A 2BZXA 3BE3A 2C5CA 4RH6A 4YCVA 2FZCB 5EAYA 4NPSA 3I55T 4POGA 3CCMQ 2UUAQ 3OTOQ 3CCQA 2RHYA 1QCNA 1AD5A 5FOBB 1UGRB 2FO0A 1NEBA 4IUPA 1PYBA 5IWAQ 1E22A 3VJPA 2R3ZA 4J15A 3S24A 1F77A 3OS1A 1U4PA 3FDTA 4BE1A 3T1YL 2R93G 3OWFA 5LJ3j 2CHBD 3JCMd 3A8OB 4LF4Q 3ONAB 1E1TA 3EGDA 3A8IE 4N4GA 2D62A 1IL8A 5C4JH 2KCMA 1SNOA 1C6VX 1BCPC 4FT4A 4TQUS 3H94A 4JI1Q 2CDTA 1WTRA 4UPAA 3JB9I 1UTIA 1N32Q 1M90C 2UUBL 4FW1A 1Q7YC 1O7YA 4R56A 4BS9A 2JA5G 3KXTA 1YITA 3OHXC 1PZJD 1R4QB 4DV5L 5KYWA 2D0OA 4LW1A 1A8VA 2RJCA 4ILWA 5M5YB 1PKTA 1TS9A 1G8XA 1BQQT 4XU3A 4DR5L 1H8KA 2PQAB 1UWVA 5EG2A 3D6CA 3VA7A 1EQRA 5C3EB 1J6QA 4FSXA 1A3UA 2A5HA 5M3MH 5GAOp 4RTXA 5G3LD 1L0WA 3S3OA 2XI9A 2EVRA 1VQ8A 4A3JH 3HZXA 4O2DA 2XRQD 3CC7A 3D6WA 4YY3L 1UGVA 2ROLA 2K52A 2Z1CA 2VB2X 1HTPA 2EYXA 3PMTA 2HIVA 2PI2A 2JA8H 3G71A 3AT1B 4LNPA 2RVLA 5HURA 3VR4A 3HOZB 1BKBA 2RO0A 4PJNA 4JZ4A 4Q0FA 2K2VA 4I7AA 3QYGB 2KHJA 5GAHC 3OW2P 2QQSA 1KG1A 1BOSA 4BACA 1GL5A 2LJ1A 4EQ5A 5M3MG 3ZFJA 4DOVA 1MHWC 2NN6G 1M1GA 4PJOF 2X4JA 2MCNA 2Z4HA 4OIJA 4A3JG 1HA6A 2EYOA 3CXCA 1KHCA 1QG7A 1WHLA 4M7AE 3S16H 2DBKA 1SRMA 3CCUT 1K9MC 4J9GA 5IHKA 3A1PA 2G6FX 2KBTA 2K7AA 1YFNA 2LVMA 4J9HA 4LUEA 3CCLT 4E7LA 2CWAA 5C44B 1PH8A 3L2PA 3QXEB 4A93B 2Y0SG 1C8CA 4NMZA 2C0IA 2V8IA 4C5EA 3M3YB 2NBFA 1EWCA 5CV7A 2JW4A 5ELBA 2VUBA 2XGTA 3TN2A 5IODA 2X3WD 3CPWP 3CCQT 1LTGD 2DMOA 3IFDA 3PMFA 3V7SA 2P4TA 2COWA 1VQPQ 4M7AB 2QKIC 2JTMA 3PV0A 4KJNA 3RNUA 3T53B 5FRNA 1Y1WG 1KSWA 2RCFA 2QAZA 1D1KA 1BR9A 2R5AA 3GNFB 4L5QA 3FB9A 1B9NA 5CCAA 1M90U 4XQNA 2E5LQ 2NVQB 4QCLA 3SK4A 3ULRB 2YU9H 5LHY1 4IKFA 4DKAC 2VWFA 2G9DA 5EKIA 3V8KA 2CH4W 3HRZC 3EROA 2WAQG 3U4ZA 2JQOA 3R8BA 2R7ZB 4GS3A 4EQNA 4KY7A 5IGCA 1K3BC 1MGQA 1FNUA 1YITT 1VQ5Q 1I50H 4B3ML 2MYSA 3C94A 4RWSC 4M7AC 1G2TA 4IPHA 2OX7A 3VS0A 5IP9H 2VNUD 2NWGA 1M8VA 4FM4B 1ZHIA 1EIFA 4LFCL 4A63B 1N34L 3KF6A 4DR6Q 1RTNA 3VS3A 3HRTA 4YHHQ 3GTQH 1JCKB 2KNBB 3OS2A 1IW7D 2F4IA 4Y28E 4KKUA 1VQ8T 2X69A 2Z8LA 2I5HA 2WFWA 4XT1B 3CC7T 2PCFB 1B50A 1DZ1A 1VQJA 2MF2A 5C0XH 2JP1A 4XYOA 3SK8A 1NR2A 4LDYA 1SBBB 1NE3A 4RTTA 2V1RA 4NOYA 1CKBA 3G71T 4AYBG 5IP9G 4DV3Q 3S1MB 2JEBI 1O7LA 3E1SA 5L37A 2HKNA 5DLOA 3IQLA 1Q1EA 3GP8A 1BI3A 1QWEA 2TSSA 5IYDH 2E1HA 3NQTA 1SNDA 4HA8A 1FNVA 4WJWA 3BYYB 1JJGA 1K9MU 1FJGL 4QY7A 4QVDA 3DM3A 2RSOA 4J6XA 2K14A 4JK1C 1JT8A 4BA2I 1I4PA 4F87A 3T9NA 2F2WA 4K5WA 4YWKA 5C0XG 4HJ9A 4FVMA 1N8RU 1TS3A 2F0VA 4NXNQ 1YJWQ 2R61A 3OMGA 2ZJQA 2DE0X 1AOJA 2LP5A 3JRZA 3VYHB 2F2VA 2L3PA 5CAIA 4J8OA 1MMAA 4OO1H 2KE9A 3DLMA 1VQKQ 2JSOA 3HOYH 4U673 2HQEA 4FYVB 3SK6A 4DUZQ 5LL6X 1T9HA 2CWPA 1U5SA 4DF7A 1TWAB 3IRBA 2RA4A 4JI3Q 1QCOA 1LTID 3M56A 2O31A 2CSIA 4F8MA 3X3MA 1DONA 3RKYA 2WACA 4Z88A 1QP3A 4C8QB 3EG3A 5LJ5f 1VQGA 1F9PA 2VASA 3STBC 2YUPA 1EQQA 2OAUA 3HOUG 1L1OB 1N5ZA 3AHUA 1ZBXA 2HCIA 1D7QA 4E7HA 5LJ5h 1V43A 1P92A 2DF6A 4XTZA 2NB0A 1XMQQ 1WGSA 3QUIA 2XU8A 4FW2A 4OO1G 4HEDA 1E2ZA 2LZ6B 4HVVA 2JUFA 2RF0A 1D5XC 3T1HL 1I5LA 3JAME 4DR2Q 3GP7A 2BA1A 2CP2A 3TEHB 3I3CA 1OQKA 4QJFA 1LUZA 2BA0A 1YCSB 1K3RA 1LM0A 3K7AH 1I3QB 4C8QC 1UB4A 4IFDI 3KUPA 4XTVA 1MNDA 2C06A 3OW2A 1L1OC 4OMQA 2N55A 2EYZA 2DGYA 3F2CA 2ABLA 1WI7A 3J81j 4GLVB 4NDXA 5T1GA 1WJRA 1X6OA 3OYDA 1JEGA 3QDFA 5M5YH 4RMOA 4KHVA 5LMNW 2Y4YA 4XU0A 2GN5A 3K59A 1HZBA 1ENCA 5DAUA 2E41A 4L5SA 5FLMH 3FJ5A 3GTLB 3TEEA 5C3EH 3JCMf 2WSEE 4A3IG 1GO3E 2HIXA 4G57A 4PZ6A 4B3SL 1HA5A 1PD1A 4HT9A 2NYZD 4HSPA 3U4VA 1QVGS 3CD6Q 3C0CA 4C3HB 3RZOB 2UXDQ 4DR3L 3FKIH 2KVMA 4K8IA 3CPWA 2RJDA 1FVIA 5I9OA 3QIIA 2EJMA 3LX7A 2OTLQ 3G6EQ 1D8LA 1GUTA 3HOZH 5GAEC 4RTVA 5GAN6 4PNYA 4UC4A 1VQNA 4QL5A 4LUVA 1KRSA 4DNIA 4C0DB 1IKLA 1X55A 2R7FA 4QUCA 4RKLA 5CKFA 4LF8Q 5GMKh 1PH1A 1B07A 2KRNA 2EWNA 2IL8A 2EJGA 2YTVA 3I91A 3R3OA 4HIKA 4WJ3M 4KKSA 3T56B 5GJVB 2JT4A 3I55Q 1X2QA 4O5VA 4YCWA 3JB9J 3FKIG 2YT6A 4DK0A 3P20A 3S17B 2A7YA 3AFQA 2KXDA 3KLSA 3MEWA 3NENA 4A93H 3NHHA 3G7ZA 4CRIA 1HUMA 3M3YH 3CCJT 3RLNA 4AMCA 1SMYC 2QK0A 1PWTA 1JR0D 4E7JA 5FWCA 1Q12A 3MWYW 2NVXB 2E70A 4C0DC 1PRTD 1HQRD 2LJ3A 4OELB 5KE2A 4Z02A 5A2QE 2L89A 4DV5Q 2BDOA 3NWSA 4DV1L 3E6ZX 2QEXA 1PVOA 2ZJRA 2CQAA 2WB1E 4M78B 5LMNQ 1Y96A 1OX8A 4LAAA 4APVA 1ZXTA 2VGNA 4DR5Q 4BBSB 1ZX6A 4M75D 3OYGA 1UJYA 1IXDA 4CKBA 2WV6D 5FWBA 4PQXA 1TS2A 1N33L 1PTOB 3K6OA 2KYMA 3M5AA 1STHA 2L8DA 1PYSB 3CCMA 3OIQA 1U06A 4IOCA 1VQ6A 2FRYA 5FLMG 3QWXX 1XJWB 4DA4A 3EFXD 1PH3A 1ABQA 1SHFA 1T5EA 2R7ZH 1UEBA 4R4IA 1RUWA 1TOVA 2F3WA 2CP6A 4R4TA 2RDHA 1NE8A 4CDFC 2FEIA 2QGFB 3ITPA 1B70B 2I07B 2WB1B 2P0PA 3OQ5A 1D1IA 1BCPF 5KH6A 4WORA 2X6GA 4OMOA 1K8AC 2EY2A 4CJ2C 1I81A 2GTOA 3C46A 1IHZA 1DYQA 1TWCB 3AU7A 2K5DA 1YWOA 2RHZA 2K9GA 1QUQB 2OJ2A 1YWPA 3KF8A 1WTXA 1JBMA 2A36A 3OYNA 1HTLD 2QCPX 4DBFA 1TSFA 2R7ZG 1VQEA 5IGEA 3TP7A 1NPPA 2CREA 4UP9A 1NMFA 4PG3A 1AZQA 4RMFA 1UE5A 4KHPQ 2LY7A 4OGCA 4C1NK 1WVLA 3PSIA 3S1MH 1WTPA 4ZAIA 1EIHA 4K14A 2F4VL 1NYGA 5CO7A 1JJ2P 2KGTA 2JE6I 2RN8A 5C4XB 5EKLA 4F04B 3CCLQ 1JICA 1VQNT 3T4AC 4XYQA 4GLXA 4RAUC 1OXSC 1RKNA 3CEYA 2JTFA 4E7IA 4ZLTF 3D0FA 3Q8DA 2NTSA 3SFMA 1PHJA 2VC8A 4R1JA 1VS0A 5FLXE 3RD4A 2E2IB 1A2UA 3BYTB 2KHSA 1PRLC 5AT1B 3ULPA 3CCQQ 2FINB 4X3TA 2K33A 1VQBA 3MEHA 5IYCH 3A5ZB 5IT9E 1IYVA 2NYSA 4ZYSA 1G3WA 2AQ1B 1TWAH 4HCSA 5GAOn 1FGBD 2LFNA 3EG9A 1MI2A 4LMQD 3E0JA 2FB7A 3JC66 1V1CA 3HEJA 5NUCA 5JPMC 2PVDB 1GXIE 1DOMA 3BU2A 4A3KG 3HOVB 1VOMA 2J06A 4LUOA 4Q5WA 5JOBA 4NXML 2QEXT 3VUZA 2Q2TA 4M75E 1BI1A 2MPMA 4LF6L 2F0OA 1PRMC 2IVWA 3JAML 1KAAA 3T16A 4KMUC 1N34Q 3KBXA 3PO2G 3J80i 1YITQ 2L3SA 1YNZA 1E3PA 2K5HA 2V1CC 4OB0B 2VY3A 5IYCG 2CGHA 1WTWA 3M0QA 3KOJA 2ES2A 3NEMA 4ZGDB 6AT1B 4AG1C 1JJCB 1BI2A 5I22A 1OZ3A 5K5PA 1I94L 2K5VA 4GZYC 1VQ6T 3VYTA 2L3QA 2V1QA 3M0TA 3VS5A 1FL0A 1K8AU 1H641 2A19A 4JI5L 1A0IA 4C92D 1I3QH 1Q1BA 3QG1A 4ORZA 2GTJA 2F0KA 2UUAL 1RODA 3CC7Q 3DHQA 4XU2A 2PVOB 4OWWB 4KGZB 2CZ6B 5D3DA 1C9OA 5CVIA 3RKWA 5CV8A 3G71Q 4RG2A 2F0QA 5IWAL 1MJEA 3M7NA 2MIOA 2ATWA 1R0BG 5C3WA 4HVUA 4M7AF 4A3DG 2EJFC 1NPRA 2IX3A 2O2LD 1PRTC 5C3XA 1QZGA 1EEFD 4X3UA 2JOYA 3V7CA 2IT1A 4LF4L 3GTLH 1MMGA 3CCVQ 4IQZA 3S1NB 4DNRB 4HVWA 1YNJD 3VV0A 1G2SA 2AMCB 1UHFA 2EBPA 1VQ5A 4KKTA 1RAAB 2V8KA 2MMPA 2VZAA 3K0YA 4K6DA 3JAMi 1CHPD 4Z89A 1JB3A 2C9OA 4JI1L 1SKUB 4C3HH 4JI0Q 4LWCA 3RZOH 4M75C 2EYMA 1GHKA 1EEID 2ZXRA 4IJLA 3JB9F 4XK8E 3UE1A 3VS2A 1GOZA 1YHQA 1H9SA 1MHNA 2CZ0B 2EQIA 3J80c 4QQ6A 3H0GB 1S5DD 2A6ED 2LJ0A 1CZGA 2EAYA 1LT4D 4L8JA 5GAMe 2RB6A 2H3JA 3J7YW 1ZUKA 1YHAA
chains in the Genus database with same CATH topology
4BD3A 2K3YA 3NTKA 3RMQA 3MP8A 4IUVA 1CKNB 2F5TX 1KIXA 4IFDJ 2O4XB 3VU3C 4HIMA 3TQYA 1OXUA 4M75A 3MXNB 3SWNA 1YCYA 2CCZA 4QGUA 1HJPA 2NVXH 1YJWA 5GMKm 2Q2HA 3H15A 3NELA 2CKKA 2NZHA 2DTOA 3JAMc 1XNIA 1NBWA 4BBSH 4EMHA 5M9OA 1Y7XA 4O0AA 2ZM6Q 2EQUA 4C92E 4JI4Q 2QTXA 3FLGA 3VYGA 5LJ3e 2IY5B 4B3SQ 1B34A 1JJ2A 3OYLA 3WVDB 4C0FA 2ALYB 4MZ9A 4JG2A 1TH7A 3KBGA 3EIVA 4M78G 1K73C 2DD4A 3KLWA 3SB2A 3FC3A 2E5LL 2XDBA 1TWCH 1G51A 3LWHA 1VQ5T 2OQKA 1HZAA 2DUDA 1QVFS 5GMKi 1AE2A 4JBKA 3OYMA 4ALPA 4A3FG 1P8LA 2XICA 4MMKA 1YHQT 3M58A 3R6OA 4J6WA 1B7YB 5C4XH 5FJ8H 4HIDA 3FIFA 4IO9A 4DR6L 1W3SA 3L2ZA 4YHHL 3KDFA 4J5YA 4M77D 2MWOA 4LUZA 2B3GA 1WFQA 1KC8C 4L5GA 1EYGA 2DAQA 2WSCE 1CKMA 3QBYA 3OS5A 4DPGA 4DV3L 1N33Q 3CCSA 3VUBA 2XK0A 3QO3A 3I4OA 2NLUA 1M1KU 1OI1A 3HOVH 2Z6KA 4C92A 2PMZE 3UDGA 2RHIA 3I55A 4EMKA 4AH6A 4QQBX 2RJFA 2HHHL 4PZ7A 1H3ZA 3V8JA 1VIFA 2K5NA 4DUZL 3CCET 1IBLL 3PFSA 2B63G 2K5IA 3BY7A 1OZ2A 4KULA 3HHTB 2GF7A 2VYTA 5HY6A 4J83A 2EIFA 1NMGA 2DKGA 1XMQL 2X35A 5IYBH 1EIYB 4DR2L 4A53A 3QJYA 3BDLA 3S1NH 4FT2A 2PQWA 5LJ5j 1PH4A 4ME7A 3GIBA 1QZHA 4PJOG 4JYAQ 2KMTA 1V1QA 3H0GH 5IYBG 2R7DA 4M77E 3JCMg 4BUGA 2GFAA 3PO3G 2PI2E 2MQHA 4LF6Q 3HKZE 3KJPA 2VQFQ 5LJ3g 2UXDL 3CCST 4N0AA 4LNQA 3CCLA 4XQ3A 3ULJA 3HOWH 2A3LA 2WP8J 3UPUA 4R4OA 3S3MA 4RKUE 2IX0A 2DJZA 4LF8L 3M4GA 1QW1A 3ASKA 1P16A 1L2FA 1VCIA 3MEUA 4ZN1A 3HKSA 2X4WA 3JCMX 1M5Q1 3HOWG 1KHIA 1XNRQ 4M77C 1VQAA 5M3FH 3H3VI 2UXCQ 1YJNA 4KT0E 2FVUA 4JBMA 4UP8A 3EAEA 3OYIA 1G3YA 3L2UA 5GANe 3M55A 5LMNL 4KUDK 2RA2A 4XTYA 2R6GA 3J7ZC 1GD7A 2DXTA 2PU9B 2OTJA 2M0OA 2GQVA 3RZDH 2PUOB 4M77A 2JEAI 3QKJA 3HOXH 4C0ZA 5LL6S 4X65L 5BR8L 2ZCFB 1PA6A 2JZ2A 3PF4A 4M75F 4LDXA 3CCVA 4DOWA 4BI4A 1X3EA 2CS7A 3CBOA 2BH8A 2E8GA 5KCOA 4X64L 3HOXG 3BW1A 3SDZA 3KF6B 4JLGA 4JRPA 1UGPB 1KXLA 2JA8G 2XDPA 4NL2A 4KHPL 4OF1A 4LF7L 5C6SA 1O7IA 4XTWA 3S1QH 5KE3A 3J81i 4B3RQ 4XAXB 2N3SA 4B9WA 4OP0A 4LFAL 2I5MX 5GQOA 2UUCL 2NZOA 3C95A 1Q7YU 1PH9A 1X65A 4KI0A 2CQOA 1YJNT 3P8BB 2DIQA 3LGJA 4X62Q 2GVBA 3CMEA 4HJ8A 3M4PA 2Q2IA 4AIMA 4A4FA 4HCZA 1SSFA 1RIPA 4DR7L 2OTJT 3FEOA 4F7UE 3CXCS 4AQYL 3ZEHA 4GY5A 5CK9A 5FRMA 2EQJA 1UGSB 4YWMA 1BIBA 1PSEA 1WYDA 3J81c 4PL6A 1XTDA 5I2MA 1IBKL 1KQSS 2QQRA 3MP6A 2GVAA 2K5FA 2EJ9A 2I0QA 2ID0A 2XHCA 4V2SA 3CCVT 2LNVA 3X28B 1PH2A 4NL3A 3J80E 2LCCA 4Y52H 2Z0SA 4IPGA 2HHHQ 4DV4Q 2M9UA 4MZTA 4C92F 3K0XA 4LFBL 1VQMA 3F8TA 3M57A 3M59A 4JI0L 3AEVA 5IYDG 2DK3A 1IBLQ 3FHWA 2V8JA 3A8MB 5HKCA 2OCEA 4HJ5A 3L2QA 1AHJB 5GANg 2FXQA 3CCJA 1S40A 1Y1VH 2CFMA 2CKZB 1XPOA 3KJOA 2F5KA 3JCMb 2YLBA 4JLIA 1HZCA 1OXTA 1OXXK 3HOYG 1VQ9A 5CKHA 3MHXA 2DXBA 4N4HA 4MZPA 5ELNA 2GCXA 5FU7B 4OB2B 4MMLA 1WJJA 2DD5A 4IOAA 1Y1VG 2GFUA 4F7UA 3CMET 2JA7H 2VS1A 3UDCA 2IHFA 4GOPA 2I5LX 1WQWA 2LX9A 5GAMf 4C5HA 2E10A 2R57A 1MKHA 4YWLA 4A76A 3OSVA 5GAMh 1C7YA 2L3RA 4QVCA 1NZ9A 1X3GA 2ZM6L 3JCMP 1K8GA 3TU4K 4JI4L 5FU7C 3I2ZA 2JA7G 1Y96B 1YIJT 2YYZA 3BZCA 2PUKB 3M53A 3GTPH 2RD1A 3S3NA 3NFCA 4OX9L 4EPCA 1UE7A 2N49A 1Y71A 2RHQB 1N9RA 4MDWA 3MCAB 5C3EG 3OBWA 3X24B 4ZTJA 2M1HA 4HIOA 1VQMT 1G6PA 3PTAA 4XU1A 4JI2Q 3KF8B 1HH2P 3META 5C44H 4JOIA 4A4GA 3HOZG 4JCVE 1SMXA 1YI2A 2R92H 3OW2S 1SLJA 2YTXA 4ZN3A 5LJ3h 4ATOA 3OYCA 5FROA 2HQXA 4DUYQ 4R4QA 1O75A 1EUJA 3P8HA 1VQ9T 2I2LA 4LD9K 5C44G 1IYJB 5CIUA 4A93G 2DZCA 2NVQH 4ELYC 3RN2A 2E12A 4IURA 1WI5A 3CPWS 2IG0A 3JB9H 2CYZB 5BR8Q 1EOVA 4X65Q 4M7AG 4M77F 2B8AA 4DV2Q 1WJSA 1ZQ1A 4M7DD 5GAN8 5CKBA 3JCMV 2DTHA 4A3LH 4PJOD 4A54A 4X64Q 3JB9G 2JJQA 4DR4Q 3N5BB 1NY4A 5CKEA 3C4SA 1BI0A 4LF7Q 2BKDN 1BBWA 1W4SA 2B29A 4L59A 3CP0A 1LTLA 4A3LG 2AHJB 4PLIA 2DPPB 3PUVA 4LFAQ 4IPDA 2RHXA 2UUCQ 2YRVA 3LGFA 4DV6Q 1YI2T 2DXCA 1ASZA 1BBUA 3M85A 4IPCA 1VQOT 4JYAL 1ASYA 4P75A 1X3FA 1VQIA 1RL2A 4FU6A 4DAMA 5GAN7 3OY9A 5CKDA 4BDYA 1WPYA 1Q46A 2N8NA 4DR7Q 4XTXA 2AHOB 2ZPFB 3MEVA 4AQYQ 4L5TA 2QDYB 2VQFL 4L6V5 2BIVA 4BY1H 2R58A 3PUWA 1SFOH 3I56A 2YTYA 4C8QG 2ZPIB 1N36Q 1FWZA 4P72A 1IBKQ 1E1OA 2F52A 2KBNA 1XMOQ 4M75B 1NTGA 2ZTDA 1X9NA 3SWNB 4M7DE 3X25B 4EMGA 1IXRA 4PJOE 4JI7Q 1JB7A 1Q82C 1XNRL 2RM4A 1OXVA 3MP1A 2DXUA 3OYEA 2YHTA 2F3IA 3QYHB 1TXYA 4QQDA 4LFBQ 4RG8A 1O9SA 2K50A 2UXCL 2BH2A 1WNLA 1CUKA 1KAWA 2AKWB 4A75A 3SWNC 4A3EH 4C2MH 4JI6Q 1GVPA 3MEAA 4EDUA 1B34B 4GN4B 4OXPA 1Q81C 3SGIA 5GAN5 1VQLA 3SD4A 3OMCA 2ZJPA 1N9SA 5JJKA 1D3BA 5KCHA 1V9PA 3BJUA 1U1TA 2NN6I 3OS0A 2K4KA 4HJAA 3S17H 4A3EG 4JRQA 3FRNA 3I4NH 1Q86C 3S6WA 4P71A 1LOJA 3L7ZC 5CQYA 4N4IA 2FL7A 4GNXA 4BY6B 3QZ9B 4A4HA 4LDUA 5JEAJ 2P0QA 4F7UF 4P74A 5CR2A 4HCCA 3JCMe 2VV5A 5GANh 3CBMA 5IAYA 4X34A 3KDFB 4YCUA 2LXKA 4M7DA 3I56T 3DB3A 3CCEA 4GN5A 2E2HH 4PJOA 4BY6C 4DK3C 4KLKA 2M16A 3F2DA 1Q82U 3GTOH 3GOXA 2E65A 4B3RL 3S2HH 5GADC 4OX9Q 2HBPA 5IN1A 4BBSG 4BI3A 3A5UA 5FU6B 1Y14B 4C92B 2KCTA 3LWIA 1QVCA 3AQQA 4EMKB 2E5QA 4GLKA 1FX7A 4IFDG 4A4IA 3L2WA 2RK2A 2G3RA 2OQ0A 1N6AA 3HPWA 4JS5A 3KYHC 4X62L 1Q81U 2FYKA 2RI2A 1KL9A 2WB1G 4GKKQ 3J81E 2K5LA 2QQAA 3S2DH 1X54A 5A0GA 3ME9A 1VQLT 2Y0SE 5FU6C 2K3XA 1CSPA 2Z6KC 1FXXA 1MJCA 4C92C 4BA1I 4EMKC