3HKSA

Crystal structure of eukaryotic translation initiation factor eif-5a2 from arabidopsis thaliana
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
144
structure length
144
Chain Sequence
SKTYPQSAGNIRKGGHIVIKNRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTAKKLEDIVPSSHNCDVPHVNRVDYQLIDITEDGFVSLLTDSGGTKDDLKLPTDDGLTAQMRLGFDEGKDIVVSVMSSMGEEQICAVKEVGGGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation, rna binding protein
molecule keywords Eukaryotic translation initiation factor 5A-2
publication title Crystal structure of Arabidopsis translation initiation factor eIF-5A2
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 31
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hksA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hksA02
2ALYB 4X34A 3M4PA 5IP9H 1KQSA 3ERSX 5C4JH 1Y1WH 4OO1G 2E70A 4LFCL 1N8RU 1BBWA 2C35B 4JI7Q 1H95A 1WJJA 2JJQA 1J5EQ 2YU9H 2MI6A 3CP0A 3D31A 4LF6L 1VQMA 3ZJYC 5BR8L 3B6YA 3W1BA 3RNUA 3T1YL 2RF4A 1L2FA 5JEAJ 4DV4Q 2JA8G 3J7AF 4DKAC 2YTVA 3G6EA 1LTLA 1Q1BA 3TREA 3E0EA 1YIJA 4GN5A 5M3MH 4RG2A 1GVPA 4A3DG 3ULLA 1E7ZA 1VQDA 3CC2T 1EOVA 1GKHA 1VQEA 4IPCA 5IY0A 4KLKA 5C3EH 5C44H 1IL2A 3A74A 1JMCA 3H3VH 2IHFA 3F2BA 1NJIU 1VQ5T 2HQLA 1I3QH 4RMFA 1E24A 2VL6A 4R4OA 3A5UA 4A75A 4GOPA 1IBLL 1X3GA 4YCUA 1EUJA 1NE3A 3CCJT 1Q12A 1UWVA 1LUZA 4DV1L 2F52A 1N36L 3H0GH 2Z0SA 2KBNA 4C3HH 3ULPA 1VQ9A 4X64Q 3J81j 4B3ML 1EQRA 3HOZG 3LGJA 1YHAA 1K8GA 1PH8A 2B63G 3BZCA 4BBSG 5JJLA 1VQOA 1I94L 4JI5Q 4DV7Q 4C3JH 4JI3Q 3A0JA 2WB1E 2LVMA 2KENA 4IJHA 4LFBQ 4GKKL 3GO5A 2DUDA 3NEMA 3UDFA 1EQQA 4LF7L 2JA8H 2LSSA 2HHHL 2ES2A 3CCUA 2PQAA 2JA7H 1VQGA 4JI2Q 1N33Q 1K8AC 3NENA 3TS2A 3CMAA 4DR1L 3HOUG 4A3DH 2LQ8A 2AKWB 1XNRL 3NBHB 1VQHA 4EQ5A 5LMUQ 4TQUS 4HIDA 1VQLA 4JBKA 3S2HH 5GQOA 3KFUA 5C0XJ 1NMFA 2UXDQ 1KC8U 3K81C 3PCOB 5IT9c 3K7UC 4A3IH 1JJGA 1Q82C 3CD6T 2QGQA 1TWHH 1VQ6A 4L5RC 3UE1A 2E6ZA 3BZKA 3K8AA 1LM0A 1VQ4A 1A8VA 5M5WH 2ATWA 2IY5B 1WOCA 3J81c 4P73A 4LFAQ 2K50A 1W2BS 2OCEA 3OTOL 2UUBL 3I56T 3HOZH 4A3LG 4B3RL 5DM7R 3U50C 2ZJPA 1PH1A 3JAME 2GN5A 4BA1I 3KDFA 1MJEA 3LGLA 4GNXB 2DGYA 2B63H 3HOVH 2KHIA 4K0KQ 4DR7Q 3UDXA 2E2JH 1YJ9A 4AIMA 3PV0A 2OWOA 1KHIA 1YHBA 1FJGL 1OXSC 3CF5A 2NVQH 5GAHC 4LF5L 2QEXT 2ZTDA 1A63A 4HJ8A 3T1HL 3I55A 3HOUH 1S72T 1SMXA 1T9HA 3HOXG 3GTKH 4PZ7A 5M3FG 1XNQL 5K36G 4GOPC 1E1OA 2JEBI 2XTIA 4RG1A 4JI5L 1VQFA 2KHJA 4JCVE 4X62Q 2NVYH 4JI4L 1U0LA 4BY7H 3WWVA 3H3VI 4BA2I 1CKNA 3CMET 2VY3A 5FLXc 2JA6G 5LMNL 5JJKA 1WYDA 3PO2G 3CCMT 1YITT 2HIVA 1YJWT 4DR4Q 4A3LH 5LL6S 3CCEA 3W1GA 4AQYL 3OW2A 3L0OA 1K3RA 4DAYB 4JYAQ 1M1GA 3CPWS 4X66L 4DV5Q 1YJNT 3CC7T 5ELNA 4P71A 4IPHA 2JEAI 4R4QA 2E5LQ 2Y0SG 1XMQL 3PIOA 4HIOA 1NMGA 2VS1A 3E9HA 4QIWE 3PF5A 4R4CA 1SSFA 1KQSS 1KAWA 4OWXB 5C0XI 1U5KA 1E3PA 3NELA 5M3MG 4DV3Q 1PH2A 1VQ7A 4YHHQ 1HR0W 1K8AU 2MO0A 4DUZQ 3HOYG 5JJIA 2YYZA 3PUVA 4NPSA 2NN6I 3HOXH 3S1QH 4BY1G 3KF8B 5M3FH 2UUCQ 1W3SA 4JI1Q 4NXMQ 2FXQA 2N8NA 3GD7A 1KRTA 2ZM6Q 2R6GA 4KHPL 1N32Q 2DO3A 4QY7A 1Q82U 2WFWA 4IFDI 4LWCA 2QA4T 1OXTA 2CFMA 4IO9A 1QZHA 2Z6KA 2JA6H 3H0GG 2R7FA 3DB3A 1PH9A 4LFCQ 4OWTB 1B8AA 1PH3A 4LF6Q 2F4VL 1RL2A 4DK6C 4H02A 5BR8Q 3S14H 1BVSA 1I5FA 2KCTA 3GTJH 3T1YQ 4B3TL 5A2QE 2CWPA 2IX0A 3F2CA 1M90C 4DR6L 3CW2C 5C0XG 1X54A 1C0AA 1HR0L 4P74A 1EFWA 1VQNT 3MEFA 2JA7G 3H15A 4IJLA 1X6OA 3CC2A 3UDIA 2NN6G 1GO3E 5IYDG 4CRIA 4YTLA 4R4IA 5FLMG 3HOYH 1Q86U 4GKJL 1RIPA 4L5TA 2NVTH 4DNIA 1IBLQ 4BY1H 3TS0A 1KD1C 2BH8A 1N34L 4GLAC 4A3IG 1Q7YC 4PG3A 4DV1Q 5M5XH 1N36Q 2ZTEA 3JC66 4B3MQ 3LH0A 1IBKL 1QUQB 2JNGA 1Q46A 5AJ3L 1EWIA 2MWOA 1L1OA 3DB4A 1QVGA 1K73C 1VQPT 1X3FA 3FP9A 2MNAA 3J80c 1VQMT 2AWOA 4HIKA 4A3JH 1PH5A 1I94Q 1OXUA 1VQKA 2CKKA 4A3BH 4AYBG 3SGIA 3IRBA 1M1KU 1HZAA 4X65L 4A3KH 4LF7Q 3HOVG 3G6ET 2VW9A 4GKKQ 1PVOA 2JK8A 1YIJT 2EIFA 2HHHQ 1JE5A 4TVAB 2R92G 5C4XH 2MFIA 3G71A 4R4TA 1EIYB 1NPPA 4DR1Q 1YI2A 3CCLA 4TVRA 2AHOB 1XNRQ 5LMNW 3S15H 1WFQA 2CQOA 5IYDH 5FLMH 1JJ2A 3RR5A 1FVIA 4JOIA 4OONA 1Y1VH 4LF8L 4APVA 4IPDA 1PH4A 3HKZG 1B7YB 2PI2A 2JUFA 1WCMG 4WJ3M 3G4SA 1TWAH 4X6AH 1JT8A 3CC4T 1NZ9A 2BA0A 3S24A 2Z6KC 4BY7G 2R93G 4MNOA 4LF4L 4B3RQ 1Q8KA 5IT9E 2EQSA 3RLOA 2RCNA 3OTOQ 1S40A 2UUBQ 1CSQA 2KDSA 1VQOT 4QQDA 3M7NA 4A4IA 3TEHB 1J6QA 2NZOA 3J81E 4NXNL 1JB7A 1KRSA 2A1AA 3RN2A 4JI0Q 3M85A 2BH2A 3AFQA 1IYJB 2KCMA 1FJGQ 4LFBL 3OYYA 1FL0A 4XTCS 4LF5Q 4IFDJ 3GTQH 3AYHB 1C9OA 1UE5A 4GOPB 3S16H 2R92H 4DUYL 4BXXG 3OW2S 4QL5A 3T1HQ 5GADC 1HNWL 5EAYA 1VQLT 4O0AA 4IPGA 2VQFL 4JI8L 2Q2IA 3P8BB 5LMUL 3RLNA 2I5HA 1BKBA 2Y0SE 4PMWA 4MTNA 1XNQQ 1GD7A 4JBJA 5IWAL 3S17H 3KBGA 2L3RA 3HKSA 3EIVA 1CKOA 4YY3L 4POFA 4JI4Q 2F3IA 4DR2L 2LXJA 2WB1G 1X9NA 3CPFA 2CWAA 1IBML 3CCSA 1XNIA 1WCMH 4POGA 1VCIA 1YHQA 3UDGA 1IXRA 2R93H 1TWCH 2PQAB 1Q7YU 4HIMA 1XMOL 1L1OC 1K0RA 1NY4A 2VZAA 3CCMA 1K9MC 3HFZB 1YITA 3I2ZA 4AQYQ 1MIUA 3KF6B 4DV0L 1X65A 4X66Q 5FLXE 1YJ9T 3PSIA 1K73U 1YJNA 1Q81C 3CC7A 4DK3C 2Q2TA 1XMQQ 1E1TA 1VQAA 3PIPA 3ER0A 2OTLA 1VQ8T 1VQBA 1WI5A 2AWNA 4DR3Q 1NBWA 5IYBH 4OXPA 5H1SE 1G6PA 5GAGC 4A3FG 2OTJT 1SE8A 1Y14B 3I55T 4GN3B 1YNXA 4A3GG 5J3BA 4JV5Q 4DV2L 4A93G 3KOJA 1HZBA 4JOIC 2WP8J 4ALPA 5HY6A 4DV6Q 2E2HH 3J81i 1NPRA 2D62A 3F1ZA 1UEBA 3K7AH 4C2MH 1N9WA 3PUYA 4GS3A 3M9BA 3JAMi 4B3SL 2JA9A 2K4KA 3Q8DA 4KI0A 3I4MG 2KVQG 2R7ZH 2WAQG 3DM3A 2B29A 3KJPA 4DR5Q 4KHPQ 4WJ4A 3I4OA 2PI2E 4QJFA 3CCRT 4A3CG 4C3IH 4UPAA 1UE1A 4DR4L 3AFPA 3CCQT 3I7FA 3A5ZB 2EXDA 2JE6I 1DGSA 4UP8A 3U4ZA 4QGUA 2F4VQ 4YWKA 3CCVA 1VQ8A 1VQIA 2UUAL 4A3JG 4B3TQ 2MWPA 3U58A 3DLLA 2K5VA 3M4QA 2IX1A 3M4OH 4PZ8A 4A3BG 4LF9L 4A3KG 1PH7A 4DR6Q 3LGFA 1VQJA 1QUQA 1PYBA 1SR3A 1HNXL 1HNZL 4UY8C 4MZ9A 3HOWG 2UXCL 1VQ7T 2IHEA 5C4XG 1CKNB 1PA6A 1QVGS 1VQNA 2PNHA 1D8LA 4A3FH 2JA5G 2UXBL 4L5SA 4A76A 4A3GH 2OQKA 1K83H 4AYBE 4NB3A 1MJCA 4ZN1A 4A93H 4GKJQ 2N49A 4PZ6A 4HJ7A 2BA1A 1ASZA 2GVAA 1Y1VG 2VQEL 1N34Q 3PO3G 1L0WA 3PF4A 3BU2A 2H5XA 1VQ5A 3I4MH 1VS0A 2XGTA 4UP9A 2UU9L 1TWFH 5GAEC 3I4NG 4IFDG 1CUKA 3KLWA 1PV4A 1IBKQ 2D0PA 4DAMA 4A3CH 5AJ3Q 2L15A 3CCJA 4KHZA 1JJ2S 4L5QA 1A0IA 5FJ8G 1HR0Q 5IP7H 4JI6L 4OX9L 3K80C 3J7A5 1VQPA 1K9MU 2ID0A 3HKZE 2N78A 4X65Q 2YTXA 1QVFA 1HZ9A 5GROA 3PUZA 1J5EL 4JI7L 1B70B 4A3MG 1Q81U 5J26A 4ZN3A 3J80E 3ICEA 3E9IA 2HT1A 2NVXH 4JBMA 4DV4L 3W5OA 1X56A 3CXCA 1YBYA 2JVVA 1P8LA 3S1RH 1XJVA 2PMZE 2D0OA 3HOWH 2B3GA 2K5HA 2JA5H 3STBC 2V1CC 1I6HH 3RZDH 1FGUA 1CKMA 4LF8Q 1X55A 4GNXA 3M3YH 1LYLA 3F8TA 3S1NH 2RHQB 1PYSB 1CSPA 4ME3A 3PO3H 1OTCA 4A3EG 1Z47A 2ZTCA 4Y52H 3CC4A 1SN8A 5IAYA 3BJUA 4LF4Q 3I4NH 5IYCG 3CD6A 1C7YA 1SLJA 1AE3A 1VQ9T 1UE6A 4J15A 2ZJRA 4X64L 2GVBA 2I5LX 1VQKT 5ELOA 5FJ8H 2Q2UA 4NXNQ 3CAMA 3I56A 3GTOH 4Y7NH 4DV7L 1AH9A 4JI3L 1QZGA 4IOCA 4LNQA 3G71T 4A3MH 1D7QA 2ASBA 4DUYQ 2LCLA 3PGZA 2LXKA 3CCUT 1YI2T 3CCLT 1X3EA 3KF6A 5IYBG 3AEVA 1S3OA 3F2DA 4O2DA 1HNWQ 4OWWB 5IE8A 2QEXA 2VQFQ 1M90U 4JI8Q 4P72A 3CMAT 2HIXA 3RN5A 3VDYA 2IG0A 1AE2A 4JI2L 1N33L 3KJOA 5IWAQ 1VQCA 1L1OB 4YY3Q 1HH2P 3GTMH 3GTPH 3G4ST 4DR2Q 1S72A 3RZOH 4YWMA 2JQOA 3GDEA 4YCVA 4GN4B 2OQ0A 1IBMQ 3J80i 1SROA 1YVCA 5HGQA 3L2PA 1XPUA 2UXDL 3ULJA 1A62A 1VQ6T 1PHJA 4A3EH 2E8GA 4FDBA 4LW1A 2R7ZG 5E7NA 3FKIG 1VQ4T 2NZHA 2Q2HA 1XMOQ 2I0QA 2VUMG 4LUOA 3JAMc 1KD1U 5IYCH 4XIGS 1TXYA 3MXNB 1N8RC 5LMNQ 4DV0Q 3CMEA 4LFAL 4BBSH 1G291 2K14A 1EIFA 3STBD 2K5NA 2R7DA 1YJWA 2IT1A 2WAQE 3FHWA 4LUZA 4JI0L 3L7ZC 4LUVA 4BBRG 1ASYA 4AH6A 1R9TH 3TRZA 3PUXA 4K0KL 1UE7A 3GTLH 4DR7L 3RLFA 3UE0A 1Q86C 2OTJA 1I50H 2JOYA 2XHCA 4DV2Q 3TQYA 5M5YH 1E22A 4HJ9A 3CQZH 4GNXC 1EYGA 2I5MX 1P16A 4BXXH 5DLQE 1YZ6A 1NJIC 2CCZA 1W2BA 4JG2A 4B3SQ 1QVCA 1XPOA 4JBWA 1XPRA 3CCST 3EN2A 1G51A 1Q1EA 1YHQT 1SRUA 5JEAG 3GTGH 4P75A 3KDFB 4X62L 3G48A 4YWLA 1JJCB 3S1MH 3CCRA 2N3SA 3FKIH 2VUMH 4QQBX 2YV5A 4EX5A 5IP9G 3CCQA 2YTYA 1M1KC 1Y1WG 1XTDA 2QA4A 3CCET 2UUAQ 3K0XA 2K52A 1V43A 3S2DH 1Z9FA 3J7ZC 4IOAA 5IP7G 2ZJQA 2OTLT 2A8VA 4JYAL 4OO1I 2K75A 4YCWA 4LF9Q 2AMCB 1HJPA 4DV5L 4DR3L 4BBRH 1KIXA 4DPGA 2A19A 4JC0A 1KXLA 1HNXQ 1HNZQ 2E5LL 1GM5A 1IZ6A 2UXCQ 1V1QA 3D0FA 2UXBQ 4JV5L 1V9PA 4GLXA 1PFSA 5C3EG 5C44G 4DV3L 3AQQA 3KYHC 1QVFS 4DV6L 4HJ5A 4YHHL 1SFOH 1PH6A 1OXXK 4DUZL 4UP7A 3PUWA 1KC8C 1YEZA 2CKZB 2VQEQ 1NTGA 2MQHA 1TWGH 2MO1A 2RHSB 3CXCS 3U4VA 2G3RA 3CPWA 4DR5L 1MKHA 4JI1L 2UUCL 2UU9Q 3EBEA 4NXML 2E2IH 2VNUD 1BBUA 4R1JA 4HJAA 1HZCA 1OXVA 2ZM6L 3PO2H 1O7IA 1N32L 4OX9Q 4JI6Q 4GLVB 3CCVT 1KL9A
chains in the Genus database with same CATH superfamily
1ABOA 4X34A 1QW1A 3H94A 5C4JH 2HQHA 1PZID 4LFCL 2COZA 2LC4A 4JI7Q 4C3JG 1J5EQ 2AKLA 2MI6A 1AT1B 4DQ2A 4MZPA 2RQRA 1CQFA 3ZJYC 5BR8L 3W1BA 2OJ2A 3R2IA 4DV4Q 3J7AF 3KFUA 5IGDA 5JJZA 4WF2A 5GAMf 3PE0A 3TREA 3HGBA 4GN5A 2ZPGB 4N4HA 4RG2A 4A4EA 3MA2B 2CS7A 2K79A 1QKWA 4FL6A 3CC2T 5GAOl 1PTOB 1PDQA 4KLKA 3TN2A 5A0GA 3TP7A 2HKNA 4LNPA 4A4GA 1GHKA 2HQLA 1VQ5T 3PMTA 1IYVA 1E24A 4A75A 2HZYA 4RKUE 3RKXA 5GAOr 2X4YA 1EUJA 1NE3A 2CH4W 3MO8A 5I2YA 2QW7A 5JVG3 3G7ZA 2F52A 2R58A 2O88A 2KBNA 1JXOA 5LJ5d 3S14B 2E3HA 1K8GA 3FMCA 3GTJB 2B63G 1CHPD 5A35A 3ND9A 1I94L 3FPUB 4DV7Q 2DZCA 3V05A 4DAVA 1MMDA 2JZ2A 1WTQA 3MAQA 3SWNC 2CP6A 4K6DA 5E4XA 2KBTA 2DUDA 2JA8H 3UDFA 1Y71A 4MIUA 3E6ZX 3EA6A 4JI2Q 1SYGA 4OGEA 1VQLQ 3HOYB 1W2BP 4V190 3NBHB 4JPBW 1VQHA 1K73R 2GA4B 2QTXA 5KYWA 1VQLA 2WAQB 1K8OA 4M7AG 4FCYA 1IREB 2HNIA 4XTZA 4B9XA 3OYCA 2LJ3A 3OBYA 2M51A 2FMCA 4NDXA 5M5XB 3M0UA 4F88A 1JJGA 1NUCA 4RKLA 2EYFA 2E6ZA 1JWUD 2Y4YA 1PFMA 3BZKA 1WOCA 4C3HB 3J81c 4P73A 1WHMA 2K50A 4OB1B 3DWQA 3A8LB 5DM7R 4A3KB 2GQVA 4IURA 1PH1A 4BA1I 2GN5A 2X4JA 4JZ3A 4GNXB 2DGYA 2K5FA 4DNRB 3NPPA 4ESRA 3UDXA 3PTAA 2DD4A 4DR7Q 3MEAA 4Z9CB 2DM1A 2MIOA 3EJIA 2D8HA 3HP3A 4M75G 1STGA 4LF5L 2QEXT 1AZEA 1TS3A 3VR6A 2ZTDA 3I55Q 3VYSA 3MKDA 4UC4A 5DM73 1A2TA 3A8JE 4M77G 1GUNA 4J9IA 4AT1B 1ET6A 4RWSC 3T1HL 3I55A 3HOUH 2DL5A 1LVKA 4LE9A 4S3SA 3NGPA 5K36G 2ATCB 3U9SA 5M3FG 4JI5L 4PL6A 1TWAB 1WGSA 1VQFA 1I8FA 2EQIA 1AEXA 1ZEQX 4PKCC 2KHJA 4A3IB 2NVYH 4KY5A 4JI4L 2J06A 2VB6A 4NL3A 1BBZA 1QCNA 1KABA 3JRZA 1WTHA 3CCEQ 1WHHA 4VUBA 4AFQC 4ZAIA 2A0FB 5LMNL 1TH7A 2DMOA 4KBMB 5JJKA 2HIVA 1BDOA 1YJWT 4JK1C 5EQ0A 5LL6S 3CCEA 2PNRC 3TDQA 3W1GA 3OW2A 4DR4Q 1IKMA 2MYSA 4DA2A 5J22A 4RCBA 1M1GA 4DV5Q 4F04B 4IUNA 3GTQB 4P71A 4KGVB 2CREA 5IHNA 1V1PA 3S16B 4J83A 1EY8A 4HIOA 1TU2B 3GLXA 1B53A 2LTOA 5G3LD 2DBMA 2CDTA 1SSFA 1KQSS 3MXPA 1U5KA 1E3PA 4DV3Q 5A0LA 3JCMb 1VQ7A 2HBWA 1K9MR 1KDAA 2QQBA 3TU4K 2MO0A 2K28A 4H7BA 3X26B 2EPBA 2NN6I 3S1QH 1NR4A 1HQRD 1W3SA 5FO9B 1S5BD 2R93B 1A6XA 1KRTA 2R6GA 1KQ2A 4QVZA 3VA7A 1STEA 2WFWA 5IN1A 2DE0X 4IIMA 4HSPA 2Z6KA 3EAEA 3DB3A 2MHVA 3H91A 2CT4A 3REAB 2BIVA 4RTZA 4OMOA 3K5OA 4J8OA 2E4HA 2VC8A 1SNCA 2KCTA 4B3TL 5A2QE 4H0LC 5GAOn 2IX0A 4OIKA 2GFUA 4DR6L 3CW2C 3HRUA 4FXDA 5IOCA 2HKQB 2EJGA 2QQSA 3CC2Q 1ESFA 1A2UA 2TMPA 3NQTA 1G3YA 2E2HB 2IX3A 2A36A 3CC2A 1GRIA 4ME5A 1SE4A 2LX9A 4JJBA 3K7AB 4CRIA 5E1FA 2ICEC 4R4IA 4CJ2C 5FLMG 4QCLA 1HUNA 2RI2A 4F7UA 3JCMg 1JRIA 1QP3A 1BCPF 4L5TA 1WJSA 4LD6A 2K2VA 3TS0A 4FYXB 2BH8A 4PMCA 3OYFA 2VKNA 1WYXA 2DRMA 4IUVA 4PG3A 4DV1Q 1PXUA 1X43A 1D1AA 5I6WA 3NSWA 3QYHB 1AN8A 4G7HC 4EVOA 3QIAA 1EIHA 4RHSA 2F2VA 5EKKA 3H09A 3LX7A 3DB4A 2MNAA 3FP9A 1BCMA 3P8DA 1LABA 1X3FA 5EKLA 2AWOA 1HR0L 3SGIA 4D6WA 1HZAA 2F0QA 4LF7Q 2VW9A 2JK8A 3A8IE 1M4ZA 5I9PA 2I46A 4TVAB 1QILA 4F7UF 3URGA 4GZYC 1NPPA 1SNDA 4DR1Q 2NWMA 4TVRA 4PJMA 2G5DA 4K6LA 2B2VC 1WFQA 2NN6H 1OU9A 1JJ2A 5AYFA 2NTSA 2EGCA 2FPFA 1WX6A 1Y1VH 1S5ED 3QKJA 1PH4A 2JUFA 1PTOC 3IFDA 5F2DA 5KNDA 1JT8A 2G9HD 2VVKA 3S24A 4JJNK 2AZVA 2RQWA 5EKIA 1M8VA 2UUBQ 1G3TA 5IGCA 1GBRA 2KDSA 1VQOT 4A3JB 2FHTA 1YNZA 4J1MA 1TKWB 2A1AA 1IYJB 2X69A 1TG0A 3OYYA 3S1RB 2O31A 1SJHD 2L12A 3EG9A 3AYHB 4GOPB 5KYXA 2L11A 2DVEA 2ED1A 2R92H 3TCJA 1STYA 3HRTA 5FU7B 4QL5A 2CH4A 3FEWX 2Q8IB 2Q2IA 3P8BB 1BI1A 1XNQQ 4PMWA 3BDLA 1WTOA 4XAXB 1K1ZA 4JBJA 3OB9A 5I2XA 1LTID 4X3KA 1WI7A 1RAFB 2HL3A 2L3RA 4IUQA 1YHQQ 2DBKA 2OXPA 3EIVA 3NUCA 4EGVA 1AZQA 2LXJA 3CPWP 4XU1A 3VS4A 1WQ7A 1X9NA 4X9DA 1LACA 2MK5A 3H3VC 4R0KA 4K5WA 1VCIA 1YHQA 3UDGA 1WD1A 1TWCH 1EY9A 1XMOL 1K0RA 1PRTB 3NWTA 3I2ZA 3C12A 1ACMB 1QNUA 4DV0L 4M7DC 1Y96A 2H1EA 2V26A 4LDXA 1EY5A 2D8JA 1Q81C 2QXFA 1S5CD 1TQOA 2B2TC 4F87A 2Q2TA 1WI5A 2AWNA 3WOEA 4M78B 3HFNA 2NB0A 3I5SA 4DN4M 5IYBH 4NL2A 4CDCC 5H1SE 3QZ9B 4R9WA 1SXTA 4N9TA 3EFRA 5KH6A 1T5XD 4A3FG 2DK3A 4QT7A 2KECA 3DWPA 3LWUA 2XK0A 2I2LA 5J3BA 1STHA 4EQNA 2EYHA 1JB0E 3JCMe 3CQZB 4JOIC 2RF0A 2YUQA 1NLOC 5HY6A 1D6EC 3A7AB 3DMUA 4OEMB 3U9OA 3J81i 4DV6Q 1NPRA 2DA9A 5FKAC 3DM1A 1SBBB 4GS3A 5D6YA 5KYYB 2F2WA 1PC0A 4KI0A 2DY7A 2KVQG 3VU3C 2E75C 3DM3A 4J7FA 3I4OA 3CCRT 2KE9A 5GMKe 3FC3A 4RA8A 4A3CG 4BBSB 1Q86R 3OIQA 3A8KE 4QUCA 2DIQA 4H44C 1W1FA 3MC0B 3A5ZB 3U4ZA 5CBAE 2PPBC 1JCKB 2F4VQ 3QSUA 2DZ9A 3CCVA 5COYA 2OT2A 2MWPA 2F5KA 3DLLA 4I7AA 1PZKD 5CK9A 1FWZA 2F0SA 3LGFA 1VQJA 1QUQA 2RKSA 1NNXA 1BIAA 1PYBA 1HSQA 3ERQA 4P2CB 4RTYA 2KXCA 2K33A 2QYZA 4UY8C 2F0UA 1BI0A 1CKNB 1LT4D 2PNHA 5C3WA 2JA5G 2UXBL 3VJPA 1D1KA 4L5SA 2F0IA 1TS4A 2OQKA 4AYBE 2H8HA 3ZL7C 4A93H 3RUXA 3LX0A 2P4TA 1DONA 3D4RA 1VIEA 4E6RA 2BA1A 3WVEB 4DBHA 4M7DD 1Y1VG 3G6JB 1L0WA 2KCNA 3BU2A 1SF9A 3FKIB 2L3QA 2XGTA 3I4MH 2VUMB 3I4NG 1B4OA 3M56A 4C3IB 2CZ1B 4E2FB 1V76A 4K11A 3S3NA 3JAML 5LJ5h 1I4RA 3J7AV 4OX9L 2JSOA 2F0KA 1A0IA 3NBHA 1SE3A 5D14A 5FJ8G 4JI6L 2ID0A 2M02A 2N78A 5CORA 1HZ9A 1WHLA 3PUZA 2DYIA 3WXMB 2D0QB 3V8KA 3JCMX 3T4AC 5DM63 4A3MG 3G1JA 1Q81U 1R0CB 4HT8A 3ICEA 2O9SA 2P4RA 4O42A 1IYUA 1X56A 3IKJA 1SSHA 2JVVA 5T1GA 2JS2A 2PMZE 4BWGB 4AG1C 3M0TA 2B3GA 5KNBA 2QGGA 3VYGA 3H0HA 1MV0B 2QILA 4QVCA 1FGUA 4M75C 1TWGB 1X55A 4GNXA 1EOTA 5JPNC 1G2BA 4MZTA 2B8GA 5C6AA 2WSCE 1EY4A 2RHQB 4M77C 2E2IB 4K8JA 4ME3A 1EYCA 5AFWA 2JN4A 1EIGA 3PO2B 5D7UA 3C0CA 2A6HC 3Q24A 5IAYA 1VQOQ 3CD6A 1Y1WB 1SLJA 1VQ9T 1OZ2A 1M3AA 2YU9B 2NYSA 2DAQA 2NTTA 2J6KA 2B2UC 3QG1A 1N6AA 5C4HA 3CBPA 1MSGA 2ENMA 3OYDA 2F0VA 1AH9A 3UDCA 1D7QA 1GFCA 2DTOA 3V8LA 1CQVA 2DL7A 3PGZA 2AUKA 3CBMA 3CCLT 1ZYRC 5IYBG 2KA7A 1SYFA 3AEVA 4C92E 1HNWQ 1GUWA 3ITPA 4KJNA 5CC4A 1FXXA 1TUDA 1RTNA 2D2CC 1N33L 2IG0A 1AE2A 4F14A 2DJZA 4M7AD 3KJOA 3RZDB 3OS5A 1I3QB 1VQCA 3VR2A 5IWAQ 1L1OB 1WPYA 4FF3A 1HH2P 2J4XA 1ZA1B 4J6YA 5I22A 4DR2Q 1CKBA 2JP1A 3W3AA 4YCVA 5KEEA 5JJIA 1IBMQ 4LDWA 1HD3A 1GUGA 1SROA 4X3SA 4QF4A 1VQ6T 5NUCA 2CZ6B 1TR5A 4A3EH 2E8GA 4FDBA 2I0QA 3FJPA 4NKLA 4C8QE 4G7ZC 2IVWA 2JYOA 2DILA 5CAIA 2IIMA 3OYLA 2F0PA 2OAUA 2IT1A 1IL8A 2PZWA 1Q95G 2R7DA 2Z0WA 2HDLA 2RCFA 3L7ZC 4ATOA 4M75D 4LUVA 3PUXA 1HHVA 3GTLH 5KYWB 3ZEHA 3MTSA 4M77D 4E7LA 4A3DB 3H0FA 2EYJA 5GMKi 4FYVB 3VRZA 2A6HD 1QQJA 3TQYA 1I4XA 4HJ9A 1EYGA 2KQWA 3S2HB 2AKKA 2CP0A 5DLQE 1LTTD 1MI2A 2CCZA 1W2BA 2L0CA 1TU0B 4JG2A 3VYHB 4BI8B 3VYTA 3CCST 3CCRQ 1PSFA 3RR6A 2DXBA 3NE5B 5JEAG 3QBYA 1NLPC 2E41A 5GANd 5M5WB 3CEYA 2O2LD 1MMNA 3QO3A 1JEGA 4X62L 1B2TA 3CCRA 3JB9F 4E7JA 1K0SA 1RAAB 1ZYRD 4XK8E 1XTDA 1ILQA 1WA7A 4XYQA 1Q90A 2DY8A 3K0XA 1QVFP 1Z9FA 2B2YC 3TEEA 4QB4A 1NM7A 1VF5C 2RQTA 2OAWA 3VR5A 5C3XA 4JYAL 1FMKA 3FDRA 2AMCB 4AFZC 4AMCA 4BBRH 2NVQB 1KIXA 1T0HA 1GM5A 1CZGA 2DTIA 4U68A 1X69A 1GXDC 1BNZA 3TP8A 1U06A 1U4PA 3HHTB 4L5GA 4M78C 3EFXD 5C44G 4GLXA 3AQQA 3KYHC 2WSEE 1PTOH 1PH6A 1OXXK 2M0YA 2L5QA 1LT3D 4FXGC 1JJ2P 4BY7B 1KC8C 3R8BA 2VQEQ 2JXMB 3HEJA 3LWIA 2MO1A 3E9GA 3CXCS 2RHSB 2JJ9A 4FW1A 1W6XA 2XNAC 4K8IA 2VNUD 1BBUA 3S1MB 4R1JA 1DD2A 3GV6A 3T56B 2O2OA 2PMZB 1BCOA 1V1PB 1WTXA 1N5ZA 2YWWA 3L2UA 1KL9A 5FRNA 2ALYB 2XIWA 1TUCA 3ERSX 5IP9H 4OO1G 2E70A 1BBWA 3UATA 2C35B 1VOMA 3L2RA 2JJQA 5GAN8 1ZLMA 3EFSA 1Y0MA 3G6EQ 1VQMA 1LV9A 2XDDA 2EDGA 3M55A 4CDEC 3N5BB 3FRNA 4DKAC 1XOVA 3G6EA 2EQJA 1LTLA 1Q1BA 2NZ1D 4AFSC 5M3MH 4EMKA 1TTHB 4ID6A 1E7ZA 2L89A 4RG1A 1GKHA 5IY0A 3HOXB 5C3EH 4XDXA 1IL2A 3A74A 1JMCA 1X01A 3H3VH 1BI2A 3NTHA 2A7YA 5GMKj 4KV6A 3P1HA 1GCQC 4RMFA 3HRSA 1EU4A 4WCIA 4HMJA 4CJ1B 1X3GA 5JOBA 4GOPA 4EIKA 1VQ9Q 2DPPB 4KGXB 2RN8A 5CV8A 2RNAA 2JA6B 1PRLC 5CCAA 3CCJT 4C92B 4D8DA 1LUZA 1WTWA 2V1RA 1IHVA 4C3HH 3ULPA 3HOZG 2K5LA 1VQ9A 4QMGA 4X64Q 1AZGB 2RK1A 1EQRA 2SNSA 1HQMC 1PFBA 1YHAA 3OYEA 1CK1A 3BZCA 1E2ZA 1AOJA 4C3JH 3MEUA 2Y0SB 3C1FA 3MZ5A 2LVMA 4JS5A 2KRNA 4MMLA 2JW4A 3GO5A 3NEMA 3MP1A 4F7UB 1EQQA 3GNGA 2VB3X 5ELCA 5CKDA 5CR3A 1RTOA 4C8QB 1D5MC 2F0HA 3NENA 3SK4A 4EMGA 2EYOA 2K5WA 3ZYYX 2JTMA 2AUJD 4RH6A 1JQQA 4BY1B 1KLGD 1Z9ZA 3S6WA 5JPMC 4JBKA 3MP6A 1VQ6Q 1MSHA 3VRYA 1I4PA 3PVQA 2UXDQ 1KC8U 3K81C 4ZUJA 5IT9c 1M5Q1 3K7UC 4A3IH 1Q82C 1U3OA 1TWHH 1VQ6A 3A8HB 1Y57A 3K8AA 2HUGA 2WV6D 3H0GB 4J9EA 1EYAA 3OS1A 4A3LG 3OTOL 3I35A 4JLIA 2F0WA 3U50C 1NE8A 4NS5A 3JAME 2B63H 2BTTA 4K0KQ 1R4QB 4O1NA 2KHIA 2DXUA 2J7IA 2CP7A 3CRLC 5LJ5g 4AIMA 1KHIA 1YHBA 1FJGL 1OPKA 1OXSC 2ZPHB 5CYUA 2WKDA 5GAHC 2V8IA 1ZSZC 3OSVA 3OSOA 3OYIA 2B2WA 2F0DA 4HJ8A 1UTIA 4DA4A 1OULA 1I81A 4EPCA 1SMXA 1TY2A 1VA7A 4PZ7A 2XMFA 2YSQA 7AT1B 1E1OA 4DOVA 4DEYA 3X24B 2A3LA 4XTYA 3H0IA 4JCVE 1S1NA 3WWVA 2B8FA 2RB6A 4E7SA 1CKNA 2CUBA 4BA2I 3CMET 2LY7A 3MFYA 4MZMA 1MNDA 1K28A 3EG9B 4BD3A 5KYXB 2F0GA 4AQYL 3A98A 4CHTB 4AG2C 1K3BC 2A37A 4JZ4A 3HOVB 1W6KA 1OU8A 5I2MA 4M7DE 3RUZA 3JCMQ 3QXEB 4KHVA 1IRXA 1XMQL 1BB9A 3HFOA 1EZ6A 3RERA 1X32A 1NMGA 2BDNA 2VS1A 1OO9B 4K14A 1E7OA 3OYKA 1ILPA 2KEEA 1PH2A 5JAVA 2XN9C 3G7LA 1TS2A 1V29B 5M3MG 2E5QA 1F9RA 4YHHQ 4P5NA 5KCHA 1HR0W 5EBCA 4DUZQ 4KUDK 3UA6A 3HOYG 1LTSD 3PUVA 4NPSA 3JCMJ 1UJYA 4RCNA 3HKZB 1OX9A 2DNUA 4C0GA 5M3FH 1Q81R 4C0DC 1WCMB 3RIRA 4CC7A 1LTAD 3GD7A 1N9RA 1Q82U 4IUUA 4IFDI 1YNJC 2QA4T 1IW7D 4MHEA 1SEMA 4C3HG 4LFCQ 5BN3A 4OWTB 1KQ1A 1IGUA 1PH3A 4NW2A 2L9HA 4DK6C 4LUDA 1X6GA 5BR8Q 2SDFA 4ZTFA 4PJOE 3VYRA 1M90C 2YUOA 2JS0A 2HQEA 1DM0B 1VQNT 1RJTA 3H15A 5EC7A 3FDTA 1UNSA 1X6OA 3H41A 2EQMA 4C5HA 1A0NB 3QZ5B 1Q86U 1W6JA 4GKJL 1HA6A 2FFKB 2R7ZB 4CC2A 2FB7A 4DNIA 1ZBJA 3RESA 1Q8IA 1KD1C 2YRDA 4Z88A 3A7LA 1FX7A 2X9HA 4A3IG 2ZPBB 1X27A 2V8JA 4XT3B 1AFPA 2LNVA 1CA6A 2Y4XA 2DRKA 3T16A 1QUQB 2B86A 1EFNA 2A08A 2JNGA 1Q46A 5AJ3L 4M7AE 3HG9A 4RTXA 3WDNA 4RTTA 1L1OA 1QVGA 2MUYA 5C5MA 2XWJB 4A3JH 4R56A 1PH5A 1I94Q 5LJ5e 4NOYA 2Z6BA 4M4ZA 2CKKA 3PGGA 2VWFA 2I0NA 5D6XA 3IRBA 4X65L 1PG5B 3G71Q 3KUPA 1EQTA 5GAOp 4DK0A 1YIJT 3QDRB 1WLPB 3M0SA 1FMWA 4A3GB 3G71A 2EQKA 3F70A 3JCMf 1B34A 3A54A 2KRMA 5LL6X 1YNJD 3S15H 3KLSX 2AHJB 3GBQA 3RMSA 4FT2A 4IUPA 5FLMH 4LF8L 3FIFA 4OONA 1H3ZA 1SPKA 4R8IA 2NVTB 3OS0A 4APVA 2YHTA 4PLIA 3N6RA 1B7YB 4M77E 3L2WA 1HA5A 4IFDH 2BA0A 1GHJA 2R93G 1NEBA 2Z6KC 1BCPC 5IH2A 2EQSA 4ZTJA 1NAPA 2JTFA 3M53A 2EYMA 1CSQA 4HCCA 2XI9A 1I07A 4QQDA 3M7NA 3J81E 4A3BB 3RN2A 3BY7A 4A4HA 1VMPA 1NYGA 3PIO3 3M85A 1YCYA 2NVXB 2EJGC 4JJCA 1JWSD 1GOZA 3FRPB 4LF5Q 3HOWB 5C4XB 5CR2A 2LZ6B 2EQUA 4DUYL 1I6HB 1B3QA 1YN8A 2DKGA 1H9SA 2KGTA 2RJEA 1U4LA 4KN4C 1M2OA 2EYZA 2V8KA 4O0AA 5BN4A 4IPGA 3T1HQ 4JI8L 3RLNA 3S1NB 2I5HA 1BKBA 1WJRA 3EGXB 2L2PA 4MTNA 1JOQA 3S17H 3PO3B 5IODA 4YY3L 2RMOA 4JI4Q 5GANh 4ELZC 4POFA 5GAN2 3CMEQ 1LLRD 3KLRA 2MF2A 1XNIA 2JMCA 4LD9K 4MTKA 5IHKA 3NHHA 4HIMA 3TSZA 1G91A 2VZAA 2EXZA 4QQ6A 5FO7B 2PTKA 4E7HA 3VS6A 2ZT9C 3KF8A 1A3TA 1MIUA 3HL8A 1E2VA 1VUBA 2OTLQ 1YJ9T 5EPKA 4C56C 3FLGA 1HTLD 5TSSA 4OB0B 2F3VA 3SR1A 2R5MA 2X3XD 2OTLA 4DR3Q 2K3BA 1SNPA 1D0ZA 2Q8TA 2MMPA 1G6PA 4WORA 5GAGC 2QDYB 1EQVA 2BKDN 4F7XA 2VXWA 2LJ0A 1BCPD 4JV5Q 1HFGA 1KDCA 3KOJA 3ASKA 3GTPB 3QWXX 3SK5A 1HZBA 4NXMQ 3GTMB 3RZOB 3VV0A 3F1ZA 4J9DA 4PJOB 4HSVA 3JAMi 3M9BA 3VS3A 3HS0C 4B3SL 3OYMA 2JA9A 2K4KA 2QA4Q 1EZZB 2KJXA 4DR5Q 2DNCA 2NUPA 3OYJA 1SEBD 1PD0A 1IHWA 1O7YA 4CC3A 1NBEB 2B39A 3OWFA 4C3IH 2VASA 1LCKA 3GOXA 4UPAA 1UE1A 4DR4L 3AFPA 4XQ3A 3CCQT 2M16A 4UP8A 4QGUA 1R9TB 3QPHA 1WQWA 1M30A 1D0XA 1JQYD 4A3JG 2UUAL 4MDWA 4B3TQ 2K5VA 4HA8A 5GAN5 2E76C 4PZ8A 1OYXA 4Y91A 1PH7A 2C06A 4LF9L 4DR6Q 1VQNQ 4ILWA 4C92A 2A68C 4Q0FA 1E6GA 4ZUIA 1KFZA 4MZ9A 4F17A 1JC7A 3O13A 3LW5E 1VQNA 3GIBA 4A3FH 3QDFA 1RAIB 1WXTA 2WINB 4A76A 1K83H 1R0BG 4NB3A 1EWCA 2KT1A 5CV6A 1VQ5Q 1GCPA 4C2MB 4HJ7A 2GVAA 1I4K1 4HCBA 4A4KA 5KIXA 1VQ5A 2F0OA 4C8QA 4IFDG 1CUKA 2D0PA 2NLUA 4A3CH 2ECZA 4CKCA 3O5ZA 8ATCB 3S2DB 4PJJA 3FVQA 2L15A 2IX1A 1HR0Q 2KROA 4XTWA 4C92F 3M5AA 1YIJQ 4K5XA 2MPXC 1KDBA 5FK9C 2YTXA 1QVFA 1KC8R 3M0PA 4N0AC 5J26A 3E9IA 2PU9B 4M78G 3W5OA 5EPJA 4TRDA 2WIIB 5CV5A 1AWOA 3CQTA 2DJGC 4C0FA 3SFMA 1O80A 2JA5H 4C5EA 2V1CC 1NSNS 4C8QF 3RZDH 2AQ3B 4OL7A 2NUCA 2YRCA 3S3OA 1EY0A 1LYLA 1SSOA 3F8TA 2KK4A 1BK2A 1Z6HA 3QOLA 2MP1A 2CSQA 4JJDA 2F0EA 5I6YA 4B08A 2RJCA 5KYIA 1EFID 1Z47A 2F1LA 4V2SA 3BJUA 2HSPA 4PJLA 1M8MA 2EGAA 1HXDA 2H3EB 2JTEA 1M27C 5IYCG 5C4JB 3I4NH 1J8IA 1UE6A 1ENFA 1G5VA 3EROA 4J15A 2DJFC 2LQNA 5FJ8H 2P84A 1VQKT 4EMKB 3D6WA 2E12A 1ICFB 3QR8A 1ZUUA 1V1OA 3PIP3 1B7TA 4ORZA 2K3YA 1OX8A 3H6MA 4Y7NH 3NBIA 2E64A 4JI3L 1QNKA 2EJMA 4IOCA 1QZGA 1LNXA 2DD5A 4A3MH 3FB9A 1I1JA 2PVGB 2QEXQ 1J3TA 5LJ3d 3GPLA 1YI2T 2KUMA 2LXKA 2SNMA 2ZXPA 5K5PA 3JCMP 3A8GB 1S3OA 5IHIA 1RDPD 2QEXA 3CMAT 4Y92A 1PSEA 2QAZA 2SRCA 4OB3B 1W4SA 1X3QA 1WD0A 1A15A 3QO2A 3G4ST 1IHZA 3T13A 4YWMA 4I65A 4GN4B 3I9QA 1UGPB 5HGQA 1XPUA 2K9GA 3L3OC 2BZXA 3FKIG 5LJ5j 2L55A 2K04A 4XQQA 1XMOQ 2VUMG 1T5EA 4XIGS 4C3IG 1YJWQ 2EJ9A 3MXNB 5FO8B 2F0FA 3K5MA 1TWBA 3UT1A 2RDFA 4DV0Q 4LFAL 1G291 4CBVA 1UGQB 5IXBA 2K14A 2TSSA 1YJWA 4MDXA 3FHWA 3GTOB 2JA8B 1ASYA 4FP5D 3MPUB 4N8X1 1MD2D 2LQKA 4AH6A 3S9WA 4PFPA 1SKUB 1UE7A 4XTUA 2WKCA 1OV3A 5GAMd 3P20A 1E2WA 1Q82R 1EWHA 1ESRA 1U5SA 1DOMA 2KEDA 3EHQA 1IB8A 4LJZC 1II3A 1ZUKA 1E22A 1TOVA 3CQZH 2E2DC 1PTOD 5FU6B 4GNXC 3K5LA 1SRMA 4K5VA 3EG0A 4HAEA 1RABB 1NJIC 1EZ8A 5CKHA 4FF1A 1G51A 1Q1EA 3EG3A 3MHBA 1B50A 4P75A 3DLMA 1WTRA 4RCOA 4RGMA 3CCQQ 1S5FD 3S1MH 3L1AA 1AWXA 2EVBA 2PQWA 3CRKC 4HXJA 2O01E 2MPMA 2YV5A 4EX5A 4KKTA 3CCQA 2YTYA 1M1KC 1Y1WG 3KBXA 1K4US 1QVGP 2DVJA 3J7ZC 4IOAA 2ZJQA 4E47A 3AB9A 2A8VA 4OO1I 4YCWA 1HJPA 2F69A 1VIFA 3CXCP 2CT3A 4FW2A 2E5LL 3D0FA 4HVVA 1R77A 2UXBQ 1H9JA 2K1BA 2YXYA 1G83A 1SHFA 1I50B 1I4HA 3HOUB 1ENCA 1G2SA 5CVIA 3CHBD 5M5YB 4LAAA 4H13C 1PFSA 5T1IA 4DV6L 1SFOH 3SHLA 3MXGA 2NVYB 3PUWA 1YEZA 2CKZB 5I11A 2PQEA 1M8AA 2MQHA 3BG3A 5DEHA 1SJED 3KLSA 3U4VA 5IT9L 3JCMV 4JI1L 5JEAH 3EBEA 1KTKA 2CHBD 2QF7A 4HJAA 1HZCA 2K57A 2ZM6L 1N32L 4OX9Q 4JI6Q 1MMGA 2ZGWA 1VQ8T 2Z4HA 5GANg 2BZ8A 2L0AA 1BU1A 1KQSA 3J7YW 2IW3A 1H95A 1WJJA 3E9FA 3D31A 2P0KA 4KTAA 2K32A 4LF6L 1GJXA 3RNUA 3VYUA 3T1YL 1BF4A 1GXIE 1L2FA 1EU3A 1U9RA 2YT6A 4ZKCB 1M3CA 4BS9A 3E0EA 2EKHA 2H4OA 1DCZA 2FPDA 1EEID 1QOHA 1H9RA 1QP2A 1GVPA 1RAHB 1EYDA 3ULLA 4A3DG 1G3WA 1T3SA 1QWYA 3N52A 4IPCA 3RBBB 5C44H 1I5LA 2FG0A 3S1QB 3OY9A 1HFNA 2ZPFB 2IHFA 1NJIU 1GFDA 5DLOA 3TP5A 3V96A 3A5UA 2BZYA 1IBLL 4KD3A 2KY9A 1M90R 2FZCB 1HPCA 1Q12A 1VQKQ 1N36L 3H0GH 2E3IA 4B3ML 3J81j 1AW7A 3MHXA 3LGJA 3EGXA 4OO1H 3UI2A 4M7DA 1UEAB 1VQOA 1V8QA 2WB1E 2KENA 4LFBQ 1KD1R 4GKKL 4GBQA 3CMAQ 1HJDA 2DXTA 2LSSA 2HHHL 2ES2A 4FNFA 4FF2A 2BOSA 2X51A 1VQGA 1N33Q 4CKBA 1MGSA 3CMAA 3X20B 3G4SQ 4D8KA 3U23A 4R55A 1XNRL 1CTMA 1UHCA 4TQUS 2RQUA 4AFUC 3PQIA 5LMUQ 4HIDA 3M58A 5DY9A 5GAN3 5GQOA 1C8CA 4KT0E 4JLGA 1I5OB 1G3SA 2QK0A 2QQRA 3UA7A 1UECA 4X9CA 4RMOA 1NMFA 2R61A 3PCOB 4M7DF 1STBA 2H3JA 2PZ1A 3JCMW 3UE1A 3TSWA 1FD7D 1LM0A 1A8VA 3OYGA 3ZBDA 4LUEA 4BY6B 4B3RL 2OCEA 3HOZH 3I56T 1PHTA 5HK3A 3K59A 4A93B 4YIJA 2RDGA 2A74C 1MJEA 1B34B 4PJOA 3KDFA 3LGLA 3HOVH 1LPLA 3QWYA 4LN2A 1SHGA 3OHXC 4KULA 2EJFA 4EMKC 2BE7D 3CF5A 4N9PA 2R3ZA 4OMMA 2JA7B 4PQXA 1A63A 2KMTA 1MV3A 4XT1B 2PVOB 1KAAA 2KYBA 3SHWA 1S72T 3HOXG 3GTKH 3VUBA 3QJYA 2B8AA 1B1ZA 1SYDA 3OMGA 1HTPA 1Z7TA 2XTIA 2KAFA 3GV3A 4M8AA 4CDDC 4U673 4N4IA 1JORA 4X62Q 5FU7C 1L0XB 2IPOB 3H3VI 1M9SA 4PJOF 2ROLA 2ROTA 2XDPA 1XQHA 5GANe 2KSSA 4M7AA 5FLXc 3T9NA 2JA6G 1YITT 2YLCA 4A3LH 5LJ5f 2XICA 3L0OA 2NUTA 1K3RA 1H9SB 2RA4A 4AYBB 4JYAQ 2AT1B 3CPWS 4X66L 1RACB 1YJNT 4JRQA 1S5DD 2E2JB 2HMAA 2RJDA 1JXMA 4R4QA 2JEAI 2R92B 4J6HA 2COYA 2Y0SG 5FWCA 3Q22A 2Z9HA 3PIOA 2ZXRA 1PRTC 2HL5C 3E9HA 1X2KA 4QIWE 1RHPA 3SB2A 4F7UG 4OWXB 2FEIA 1KAWA 2PZTA 2SEMA 1U1SA 3JSCA 4ZK9B 4C8QG 3ND8A 4IZ8A 2LJ1A 1L0YB 1CM9A 4M7AF 1TSFA 5I4DA 3OWEB 2RHYA 4CKEA 3C3LA 1SYEA 2K3XA 4BY1G 3EQLC 4LXCA 3KF8B 2ESWA 4M77A 4CDFC 4DXFA 2UUCQ 1UGVA 3P75A 1LTGD 5EPLA 3L2QA 3MXUA 5HURA 2I07B 3MWYW 4KHPL 4HCEA 4QY7A 2K7VA 4LWCA 4EMHA 3H0GG 3D4DA 2CZ0B 3Q0AA 4JVZA 1K0XA 3D7SB 2XKOC 1B8AA 1FR3A 3TZUA 4H02A 3S14H 3GNFB 1DJRD 1FNUA 3GTJH 2MGSA 3BDCA 4J9CA 5C0XG 3ZFJA 4OVAA 3AU7A 2D5DA 3EHRA 4P74A 5CV4A 4M77F 2LX7A 2P0PA 4FT4A 2QQ9A 4IIOA 4IJLA 2NUPB 2RBMA 3MP8A 3L2PA 5IYDG 1YCSB 4YTLA 3AMUA 3HOYH 3BYTB 1FNWA 1RIPA 2WB1B 2RQVA 3L2ZA 1OEBA 3NTKA 2L5TA 2NVTH 4PNOA 1MUZA 2RSNA 1N34L 2QDLA 5GAOq 1B3AA 4GLAC 4OIJA 2FO0A 2J6OA 1Q7YC 5C0MA 3TZDA 5M5XH 3SWNB 4RTWA 1SE2A 3LH0A 3PFSA 3RKYA 1PRTD 1IBKL 1PWTA 2HD3A 4IKFA 2EY2A 2F0MA 3KK7A 2COWA 2QG9B 1VF7A 2IY5B 4HIKA 2DXCA 3J80c 2E6NA 5LHY1 1OXUA 4FYDA 4A3BH 3K58A 4A3KH 1C1AA 3HOVG 3V7CA 4M78D 1VYVA 1Y07A 3E19A 3NMZC 1PVOA 1H3HA 2BE5C 1AZPA 1JE5A 5LJ3h 4O5VA 3TVTA 1D3BA 2X3WD 3CCLQ 1LTBD 1DXMA 4NP5A 4N8FA 1TVXA 3M59A 5C4XH 4R4TA 3C46A 4ME7A 1FMVA 2E65A 4ZGJB 1JB3A 2K2MA 3MXNA 3NK9A 4HMIA 4CGYB 1EIYB 3CCLA 5IIFA 1KJWA 1Q3LA 2VUBA 5LMNW 2A73B 2CQOA 3D3RA 3RR5A 3LLRA 4XU3A 4DFAA 3I4MB 4IPDA 1IKLA 3IL8A 3HKZG 2M9UA 2CW0C 3M7GA 1WCMG 4X6AH 1TWAH 3R2TA 1NZ9A 3I56Q 3NPFA 4LF4L 2CP2A 1Q8KA 5IT9E 3OTOQ 2L3PA 1S40A 2A69C 4UDUC 1YP5A 2KNBB 1B9NA 1SMYC 3TEHB 5D3IB 4HVWA 2RM4A 5FOBB 1VMCA 4NXNL 4J6XA 2F0NA 1JB7A 4JI0Q 1N9SA 2BH2A 2KCMA 1FJGQ 5GAMh 1JICA 4XTCS 4IFDJ 3GTQH 5CIUA 1UE5A 3S16H 1RCVD 4K2KA 3OYBA 4DAYA 1S72Q 3OW2S 4ZNXA 5GADC 5EAYA 2RHIA 1VQLT 1CZWA 2Q8RE 3A56A 2VQFL 1BBXC 5I21A 1O7ZA 4KJOA 5JVH3 4A53A 3NQIA 2LDMA 3CCSQ 3KBGA 3HKSA 5J39A 1CKOA 2DLPA 4GLMA 2F3IA 3CPFA 2CWAA 3CCSA 1MHNA 1YITQ 2F03A 3EGUA 3HSBA 1KG1A 4HCKA 1ENAA 2BE5D 4TSSA 3P7JA 2R93H 3JB9H 1Q7YU 2PQAB 4E7KA 1L1OC 3DWAA 2LKVA 4HEDA 5CV7A 5C5LA 4AQYQ 1WVLA 1YITA 1YJNQ 4J9GA 1RLQC 1DOLA 1KQSP 3DUZA 1X65A 4J9HA 2D1XA 2HBPA 1KNEA 1YJNA 1EY6A 1RKNA 4BY6C 2QGFB 1RD9D 3C95A 1XMQQ 1VQAA 2EZVA 3PIPA 3ER0A 3I8ZA 2LMJA 4OXPA 4V0BA 2CW0D 4G57A 3I55T 1YNXA 4A3GG 4DOWA 1I4QA 3BVGA 4HVUA 4DV2L 3M57A 2KI7A 1HXYD 1ABQA 1MGQA 1F2LA 3ME9A 2EE1A 4HTHA 2E2HH 2D62A 3DKMA 2GTOA 1SMYD 3K7AH 1GBQA 4C2MH 3MEWA 3MFGA 4A3EB 3Q8DA 1ET9A 2WAQG 4KKUA 2B29A 3KJPA 5A0DA 5CGKA 5HGTA 5IGBA 2KR3A 4WJ4A 2D9UA 2PI2E 1M2VA 1WHKA 2A28A 1UHFA 2EXDA 1DGSA 4J8QA 4YWKA 2C9OA 4IQZA 1VQIA 1NJIR 3GTLB 1G2TA 3UDIA 3M4QA 5IGEA 4A3BG 3KFVA 4A3KG 1WXBA 3IFTA 2RI5A 1HNXL 4ZRZA 1HNZL 2EYWA 3HOWG 2UXCL 1VQ7T 3LWEA 2F0TA 5C4XG 1PA6A 3HZXA 2L3SA 4FF4A 1MJCA 4GKJQ 3QYGB 4OELB 3K6OA 2ZAEA 4FSXA 2DL8A 4G7OC 1F77A 5GANj 1C48A 3PO3G 3PF4A 3SE0A 2H5XA 5M9OA 2BE9B 4FSSA 2LNHB 3CCJQ 2F0LA 2UU9L 1PV4A 3VS7A 3BE3A 5AJ3Q 4R8NA 3CCJA 3PMIA 1JJ2S 2K6AA 2AQ1B 4KHZA 4RKBA 2XU8A 3K80C 3J7A5 4WRDA 2QTVA 4C5IA 2X4WA 4BBRB 3VR3A 2F5TX 4X65Q 4JI7L 1H641 1J5EL 2LT4A 3M4OB 2KVMA 1BQQT 2F0JA 3D8GA 4ZN3A 3PNWC 4QVDA 2HT1A 4DV4L 1ZSZA 3CXCA 1YBYA 3OIPA 3I4LA 3X3NA 2KXDA 3M0QA 4II1A 1ONLA 3S1RH 1TS9A 4DEXA 3DHQA 3STBC 2RQXA 4J9FA 4CC4B 4IALA 4LF8Q 3OOCA 4OMFB 3H9NA 3OYHA 1CSPA 4BDZA 1O7LA 1PYSB 3TMEA 4M75E 4PJOG 4DK1A 1OTCA 2DFUA 5FRMA 5EJWA 1TWFB 4WTOB 5GAOm 4Y52H 2XRSD 3V7SA 4C1NI 1AE3A 1PKTA 1WJQA 5ISRA 1PM3A 5BN5A 1D2BA 3JB9G 3T53B 3V8JA 2DETA 2CQAA 2GVBA 2JXBA 2Q2UA 4A63B 1KLUD 2C5CA 3I3CA 2YLBA 3SDZA 2HQXA 3GTOH 2E10A 5L37A 4IUTA 4DV7L 2AZSA 1QKXA 4C92C 4BE1A 5M3MB 2ASBA 1SG5A 2LCLA 2KCCA 4DUYQ 4XQNA 3CCUT 2PYKA 3KF6A 2OEOA 3VR4A 1RAEB 5C3EB 4OWWB 3O8VA 5IE8A 4L59A 1M90U 1KSWA 4JI8Q 1I0CA 1Z9QA 4JI2L 2PW7A 4DNTB 4BXXG 4LMQD 5DNFA 5CBEE 2VGMA 1LT5D 3TBIB 4ABNA 4YY3Q 3OA6A 2LMCB 1ZHIA 1ZBXA 2DIGA 3BDOA 3FEOA 2JQOA 2PUOB 3GDEA 5IGFA 1X6BA 4JI5Q 4C8QC 1KK7A 3GP8A 4M7DB 2W0ZA 1YVCA 1I4GA 3J80i 4FIBA 1H8KA 3M54A 1SYCA 2Z1CA 1AWWA 3BYYB 3ULJA 1QWEA 1CSKA 1VQ4T 2Q2HA 4QW2A 4Y28E 5CKBA 1KD1U 1XWEA 4RGOS 5IYCH 4RG8A 1QLYA 1N8RC 2DN8A 5LMNQ 3CMEA 2Y90A 2F3WA 4C3JB 4BBSH 1A3VA 1OI1A 1ZUYA 3STBD 5KE3A 2K5NA 4L8JA 2HEQA 2CVRA 3IAYA 3M3YH 4BACA 1GUSA 3EVQA 3SVMA 1U4RA 2EOTA 2ICIA 3TRZA 4B9WA 2PUKB 3QOJA 4DR7L 1O78A 4QKUA 3I73A 4WJWA 2KT8A 3RLFA 1CHQD 3L42A 5CQYA 4O6JA 4HT9A 2EAYA 1I50H 3TS2A 2XHCA 5M5YH 2K03A 2I5MX 5KYUB 1P16A 2KHSA 2GGRA 4JW0A 3OQ5A 1U4MA 2M2LA 5LJ3g 2OX7A 3A8OB 3ULRB 1TS5A 3BVZA 2JMAA 2PNIA 3THKA 1QVCA 2RSOA 1TWHB 4HR7B 1XPRA 4B3SQ 1JU5C 1YHQT 3I90A 4DBQA 3KDFB 3G48A 3C1EA 4C92D 1OOTA 1QCOA 3MJXA 2N3SA 3FKIH 2VUMH 2D0NA 4LK1C 3ONAB 1JOOA 5GMKl 2B63B 2QA4A 2NBFA 2UUAQ 3IQLA 1V43A 2K52A 3RMQA 4MN3A 2EYPA 1FNVA 2M9VA 4DV5L 4LF9Q 4DR3L 1VQ7Q 3RKWA 5FW9A 4JC0A 3PT9A 2K4YA 3VKIA 1IZ6A 3SWNA 2YDLA 3FJ5A 1XX8A 4DXGA 4C8QD 2HCIA 5GMKm 1STAA 3R6OA 2X6GA 3HTRA 4JV5L 1V9PA 1RUWA 1U1TA 4DV3L 4HJ5A 4ZGDB 5GAMg 1HYOA 4M7AB 3K0YA 4UP7A 1F1BB 2NYZD 2O5IC 2EVRA 4M78E 3L9AX 1O9SA 1TWGH 4HCSA 4ZGEB 4DR5L 3GTGB 2NUTB 4A54A 1DJ7B 2E2IH 5KYLA 1OXVA 4RGTA 3PO2H 2AQ2B 5KE2A 1O7IA 3HP9A 2E1HA 1O75A 1JO8A 5FROA 3VUZA 2P0QA 1AVZC 3CCVT 3DEPA 3M4PA 2RK2A 2VV5A 5HKCA 4ODGA 2DNEA 2RHXA 3AHUA 2RO0A 1Y1WH 2HD0A 1N8RU 2EYXA 2YU9H 2IJ0A 4M1UB 3CP0A 1PNJA 2FPEA 1CT1D 4HKEA 3B6YA 4M75B 5KGUA 2WACA 2RF4A 5JEAJ 2JA8G 2YTVA 4JUVA 2CP5A 3I72A 3M9QA 2DF6A 4M77B 1YIJA 3LH5A 3VS2A 2N55A 4ULLA 5GAN6 1VQDA 1EOVA 1VQEA 5G3LF 2RJFA 3V2TA 5M3FB 5HK0A 1G8ZD 3Q1JA 4L63B 3F2BA 1QE6A 1I3QH 2VL6A 4RTUA 4R4OA 2GFAA 4FYWB 2FZKB 4YCUA 5ELEA 1BI3A 5GANf 4BI3A 1YNNC 1UWVA 4DV1L 5FLXL 2Z0SA 3FPPA 3OS2A 4BUGA 4BE2A 2A5HA 1M3BA 2KRSA 2A68D 2WSFE 2PW5A 2XG8D 6AT1B 2L1BA 1PH8A 4BBSG 5JJLA 5KYNA 3EGDB 3A0JA 4JI3Q 9ATCB 3CCUQ 4DU9A 5HCKA 1J9OA 4IJHA 3JCMc 4LF7L 3R6NA 2ZZDA 4JRKA 3MCAB 1C0MA 1UGSB 3CCUA 1Q7YR 2PQAA 2VB2X 1UAPA 2JA7H 2QQAA 3M0RA 4RTVA 3E0JA 1K8AC 4RGNA 5LJ3e 4A3DH 1STNA 4DR1L 3HOUG 2LQ8A 2AKWB 1F2ZA 4EQ5A 1OPLA 3S2HH 1AWJA 4EDUA 4ZQ3A 5C0XJ 3VS0A 1VQ4Q 2M00A 2QGQA 3CD6T 2X4XA 8AT1B 1C6VX 4L5RC 1F9QA 5M5WH 2ATWA 1VQ4A 2BCOA 3HRZC 3RNJA 4LFAQ 1D3BB 1W2BS 2UUBL 1LTRD 2O4XB 1YJ9Q 2G6FX 5EG2A 3Q23A 2ZJPA 3CU7A 4GY5A 3X28B 5ELFA 2ZCFB 2N88A 2GF7A 2E2JH 4OGCA 2CGHA 1UJ0A 1YJ9A 3PV0A 2OWOA 4XU2A 1ICWA 2M1HA 4RUGA 3E2UA 2DEUA 2NVQH 4KY7A 2IWHA 1B9MA 1GUOA 1G8XA 2C0IA 2FJ2A 2FMMA 2VYTA 3QIIA 3S15B 1PKSA 5GAMe 2EY5A 3BS1A 1FYNA 1D09B 1VYUA 1UFFA 1K8MA 1UUPA 1YNND 4ZLTF 3VA5A 1PD1A 5KRUA 1WFWA 2MCNA 3L2VA 5ELDA 1T9HA 4J7IA 1UGRB 2EYQA 4L6TB 1XNQL 2JEBI 2RVLA 1WZOA 2L4NA 1IXDA 2FRWA 2K6DA 4OGQC 4BY7H 1U0LA 1D0YA 1JE4A 3WVDB 1NR2A 1BXTA 1B44D 4OB2B 2XDBA 2VY3A 5L8RE 3JV3A 1WYDA 3PO2G 3CCMT 1A3UA 3X25B 1R8OB 4DAYB 5ELBA 3J80L 1ARKA 3CC7T 5ELNA 1F2MA 4IPHA 2LFNA 2E5LQ 4N0AA 1WNLA 2F2XA 4HCZA 3M4YA 1PYWD 4OHJA 2SEBD 2EYLA 3JCMd 4R4CA 2J7ZA 4XYOA 5C0XI 2NUZA 4N4GA 3NELA 1BYMA 3QJ6A 2CUDA 1R4PB 1K9AA 2DJQA 3S17B 2EGEA 1F9PA 5CO7A 1K8AU 3RMHA 2FYKA 2JM9A 4MMKA 1BR9A 2YYZA 5CKEA 3OBWA 2B2VA 3F2UA 2HDMA 3HOXH 1C4QA 4JI1Q 2MOXA 1H9KA 3TQ7P 5I2SA 2FXQA 2N8NA 4HN7A 3CCVQ 1XXGA 2FINB 3MEVA 2ZM6Q 2DO3A 1N32Q 2ED0A 4DBFA 1OXTA 2AIRB 2CFMA 4UAIA 4IO9A 1QZHA 1CA5A 2QASA 2JA6H 2R7FA 4DAPA 1IGQA 1PH9A 2FVUA 3P8HA 4PJOC 1TY0A 2K5DA 2FL7A 3MEHA 4KKSA 4LF6Q 2F4VL 3GQBA 1RL2A 1RADB 1RODA 1BIBA 2MJ8A 1BVSA 1I5FA 2EJFC 3T1YQ 1ZKOA 2CWPA 3BDUA 3F2CA 5D65A 2R5AA 1DZ1A 1X54A 1UB4A 1LO5D 1C0AA 1QVPA 3E1SA 1K76A 1EFWA 4DGZA 3S3MA 3MEFA 5DAUA 2JA7G 2DX1A 1AHJB 1M2VB 1GO3E 3OYNA 2NN6G 3M4GA 1PTOF 2LQWA 2EBPA 3NXWA 4J5YA 5EGTA 1YFNA 1Y7XA 2LRQA 1IBLQ 4BY1H 5GAN4 1RLPC 5C6SA 3PVLA 4M7AC 1N36Q 2ZTEA 3JC66 4B3MQ 2YUNA 2GCXA 1M4VA 2XVSA 1WHJA 3EFOB 4RCCA 1OQKA 3BZDB 2O9VA 1EWIA 2MWOA 1P92A 1WTVA 1K73C 3KUFA 1VQPT 5D3DA 3I70A 3SD4A 5GAN7 3EG2A 1VQMT 4EQPA 5CMDA 4FM4B 2VGNA 3A1PA 1MMAA 2PVDB 1VQKA 4AYBG 1M1KU 3QHSA 4JDSA 4GKKQ 3G6ET 2EIFA 2B2TA 1YWOA 1CI3M 1YI2Q 4RAUC 3TSSA 4A3FB 2HHHQ 3C94A 5C0XH 2R92G 2MFIA 3EH1A 1K83B 4XU0A 2XRQD 1YI2A 2AHOB 4FO2A 1MHWC 2A6EC 2IPKD 1XNRQ 4ALPA 1QWFA 5IYDH 3RDVA 1DOKA 1OZ3A 1FVIA 3CD6Q 4PJOD 1EEFD 4JOIA 1CFMA 1QJOA 3D6CA 1KIKA 3QWNA 4LDUA 2PI2A 4OP0A 4WJ3M 3G4SA 3E3XA 3CC4T 1D5XC 4BY7G 3NFCA 3JB9D 4MNOA 2ZXOA 3R3OA 2RPNA 2RDHA 4B3RQ 3C4SA 1SYBA 3RLOA 5KYUA 2RCNA 1F9SA 3OW2P 2R57A 4BE0A 1ZSZB 3Q6SA 4I7ZC 1F2YA 4LDYA 1B07A 4A4IA 2D9TA 2LT1A 1J6QA 2NZOA 3DXJC 1KRSA 1H92A 3NTIA 4XTVA 3AFQA 4XQJA 4LFBL 4FYYB 1FL0A 1C9OA 2NWGA 2JA5B 4KRTA 2G9DA 1FYCA 1UUEA 2L8DA 2QKIC 4Z8AA 1HCZA 1HNWL 4Q5WA 1ZXTA 2X6LA 2KQ3A 4GLKA 4PMBA 5LMUL 3R93A 2Y0SE 2RD1A 1GD7A 1S4ZA 2QCPX 1Y1VB 5IWAL 2Z4IA 3PMFA 2SOBA 2BDOA 2JM8A 4F7UE 2HCKA 2WB1G 1WXUA 4BB7A 4DR2L 2E5KA 1SNQA 3I4NB 3GF5A 3H6ZA 4OMPA 3CCMQ 1WCMH 1IBML 4POGA 3SK6A 4ANJA 1IXRA 1QG7A 4PFZA 1NY4A 3CCMA 1K9MC 3HFZB 1Y8PB 3CC7Q 3NP8A 3KF6B 4Y7NB 4C92G 1KHCA 1EX4A 4X66Q 1UDLA 5FLXE 2A6ED 3PSIA 1Y69U 1BUVT 1K73U 4A3MB 3CC7A 4DK3C 1D1IA 3META 1E1TA 5E4WC 4X3UA 5LJ3j 2ENBA 1VQBA 1AEYA 1JOKA 1NBWA 4CI0C 3T51B 3NHNA 5D6WA 3MVVA 4DF7A 1G6ZA 4C0DB 3JB9J 3EH2A 2OTJT 1SE8A 2DERA 1DYQA 1Y14B 2W10A 1LT6D 4GN3B 1XYIA 2JT4A 4A93G 1N8RR 2HSEB 2EPDA 2J05A 2P5ZX 2WP8J 3K5NA 1EL0A 2E74C 1X3PA 3UPUA 1ZSGA 5CQXA 1UEBA 4M75A 1N9WA 3PUYA 1PLFA 1RF2D 3I4MG 4KHPQ 2R7ZH 3SEBA 4UHVA 4JS4A 1IO6A 5FU6C 4QJFA 1TWCB 1AP0A 3AT1B 1WHGA 1VQ8Q 3OYAA 3I7FA 2JE6I 2K5IA 3UWNA 1D1BA 1GL5A 5I9OA 1VQ8A 4ZYSA 1PRMC 3U58A 2V1QA 5GAMj 4RFBA 3M4OH 2B2UA 5E3FA 2PCFB 3GP7A 3A8MB 4IN3A 1SR3A 2Z8LA 1I6VC 2DL4A 1V1CA 2DL3A 4M75F 1QB5D 1SDFA 2IHEA 2B2WC 3A55A 2M0OA 4PK4A 1QVGS 1HK9A 4A4FA 1D8LA 1HUMA 4XTXA 3X3MA 1D1CA 3NWSA 4A3GH 2QDBA 4ZN1A 1UE9A 2EY1A 3EGDA 2X35A 2N49A 4E6IA 4PZ6A 1ASZA 3LYIA 2MAMA 2VQEL 1GUTA 2IL8A 1N34Q 1NCVA 4TKOB 1VS0A 4Z89A 4UP9A 2CSIA 5KCOA 1TWFH 5GAEC 3J81L 2EW3A 1MBYA 1ML0D 3KLWA 1IBKQ 1VQPQ 4DAMA 4X3TA 3OMCA 1VQMQ 2XIDA 1FGBD 4ZCKA 3CBOA 4L5QA 3E5SA 5IP7H 1VQPA 1K9MU 3HKZE 3QB3A 5FWBA 4Z02A 3JB9I 3RD4A 4KH1B 5GROA 2GBQA 2XD0A 4KK7A 1B70B 2PO4A 4DBRA 2OF1A 1NG2A 3J80E 2OI3A 1NEGA 1BO0A 4J9BA 1QCFA 1NYFA 4PLLA 4E7ZA 2NVXH 2HAXA 4JBMA 3K57A 4PJNA 1P8LA 1XJVA 1H9MA 2F4IA 1SNOA 2D0OA 3HOWH 1SFOB 2LS01 2K5HA 2O4XA 1X2QA 2J6FA 1I6HH 1BCPB 4CJ0B 1W70A 1CKMA 3OPOA 3C2PA 2V4DA 3CC4Q 3S1NH 3HPWA 1JBMA 4KH0B 4F8MA 3PO3H 1RI9A 4A3EG 5CV9A 2FRYA 3EG1A 2ZTCA 5IGGA 1N27A 3CC4A 1SN8A 4LF4Q 4ZKBB 2O5JC 3REBB 4Q5VA 2K01A 3I5RA 1C7YA 4OF1A 2CYZB 2ZJRA 2FHDA 4PV1C 1T0JA 1ZA2B 2I5LX 2LP5A 3BFMA 5ELOA 4X64L 1EY7A 1TXQA 3WOFA 4NXNQ 3CAMA 3I56A 1U8RA 1PFNA 1UG1A 4G4KA 1QMCA 4WFN3 1PCXA 2EFIA 2LCSA 3V7RA 2B2YA 4C1NK 1VYTA 1PMRA 4LNQA 1JR0D 2AK5A 2DEQA 3G71T 4OMQA 2EYYA 4BDYA 1X3EA 4NMZA 4K2LA 3F2DA 4FVMA 4O2DA 4QUFA 5C44B 2VXEA 3RN5A 2VQFQ 2CP3A 2HDAA 4B6MA 1Y8NB 2HIXA 4P72A 3VDYA 4PNYA 1M1FA 4QQGA 3TP6A 5ECAA 4M78A 1XTCD 3GTMH 3GTPH 2K5QA 3RZOH 1S72A 3CKIB 2OQ0A 4KY6A 3SXHA 4EQOA 2C0OA 2F1MA 2UXDL 1A62A 4X1VA 2D6FA 3OSSC 1PHJA 2R7ZG 4LW1A 4PFOA 5E7NA 4BI4A 2NZHA 3BVMA 1T3LA 2RI3A 4LUOA 3JAMc 3VS5A 3LNNA 3M3YB 4JRIA 1TXYA 4QIWB 2VXFA 2RH2A 1K8AR 1PRTF 3I91A 5A2QL 5KYYA 3KXTA 1EIFA 5GJWB 2GTJA 2WAQE 4JI0L 2EY6A 4LUZA 1QCBD 1SAPA 2GNCA 1VDZA 4BBRG 1WIEA 1R9TH 2RA2A 1WDXA 2KYMA 1IW7C 1TT2A 4K0KL 2CZ7B 2OTJQ 1D5ZC 2KOLA 4M78F 5AT1B 4OMLA 3JCMh 3UE0A 2HCCA 1RAGB 5GJVB 1Q86C 2OTJA 2JOYA 4DV2Q 3D4WA 5EBDA 1ZQ1A 2ZPIB 4ELYC 3SK8A 5KNCA 1AD5A 4BXXH 1YZ6A 3URYA 4KUIA 2YUPA 2C0TA 4C5GA 4JRPA 1MNEA 1TUGB 5L23A 2A69D 4JBWA 1XPOA 3H8ZA 5GMKh 1YWPA 3VS1A 3EN2A 1SRUA 3PF5A 1WTPA 3GTGH 2JN0A 2RHZA 3OW7A 4KD4A 1GCQA 2PZUA 2ABLA 1JJCB 2QEJC 4YWLA 2DTHA 2EKOA 2XSCA 3HOZB 3UF4A 2XWBB 4KN7C 1XJWB 4QQBX 2GQIA 5C4ZA 5IP9G 1LJOA 2K05A 5IXFA 1SNMA 3CCET 4FXKC 3S2DH 4RHRA 5IP7G 1LOJA 2OTLT 2K75A 4FU6A 2QI2A 1Y8OB 1PZJD 1HRJA 1KXLA 4DPGA 2A19A 1CKAA 1HNXQ 1E0BA 1TIID 1HNZQ 2UXCQ 1V1QA 2RHUA 1SRLA 3LWHA 3QUIA 4KGZB 5LJ3f 1ZX6A 3EFOA 2LCCA 4C0ZA 3INZA 3W2DA 3BW1A 4XXEA 2KEAA 2YRVA 2K7AA 5J1ZA 5C3EG 3GTKB 5CKFA 1QVFS 3SEMA 4YHHL 5K36H 3DEOA 4GOPC 2DYBA 4DUZL 4J6WA 1M1KR 1JWMD 1Y96B 4LDVA 1NTGA 1RI0A 1X75C 2FZGB 2J0TD 4KMUC 2G3RA 3CPWA 2UUCL 1MKHA 4NXML 2UU9Q 4F16A 2EWNA 2ZPEB 4M7DG 1BOSA 1KNAA 2BUDA 4L6V5 4E7IA 4GLVB 1E6HA 4OMNA
chains in the Genus database with same CATH topology
4X34A 1QW1A 5C4JH 4LFCL 2LC4A 4JI7Q 1J5EQ 2MI6A 4DQ2A 4MZPA 3ZJYC 5BR8L 3W1BA 4DV4Q 3J7AF 4WF2A 5GAMf 3TREA 4GN5A 2ZPGB 4N4HA 4RG2A 4A4EA 2CS7A 4FL6A 3CC2T 5GAOl 4KLKA 5A0GA 4A4GA 2HQLA 1VQ5T 3PMTA 1E24A 4A75A 4RKUE 3RKXA 5GAOr 2X4YA 1EUJA 1NE3A 3MO8A 3G7ZA 2F52A 2R58A 2KBNA 5LJ5d 1K8GA 2B63G 1I94L 4DV7Q 2DZCA 2JZ2A 3SWNC 2DUDA 2JA8H 3UDFA 1Y71A 4JI2Q 4OGEA 3NBHB 1VQHA 2QTXA 1VQLA 4M7AG 3KFUA 1IREB 2HNIA 4XTZA 4B9XA 3OYCA 3OBYA 1JJGA 2E6ZA 3BZKA 2Y4YA 1WOCA 3J81c 4P73A 2K50A 4OB1B 3A8LB 5DM7R 2GQVA 4IURA 1PH1A 4BA1I 2GN5A 2X4JA 4GNXB 2DGYA 2K5FA 4DR7Q 3UDXA 3PTAA 2DD4A 3MEAA 4M75G 4LF5L 2QEXT 2ZTDA 4UC4A 4M77G 3T1HL 3I55A 3HOUH 5K36G 5M3FG 4JI5L 4PL6A 4RG1A 1WGSA 1VQFA 1I8FA 4PKCC 2KHJA 2NVYH 4JI4L 4NL3A 3JRZA 4VUBA 5LMNL 5JJKA 1TH7A 4KBMB 2HIVA 1YJWT 4DR4Q 5LL6S 3CCEA 3W1GA 3OW2A 4RCBA 1M1GA 4DV5Q 4P71A 4J83A 4HIOA 3GLXA 2LTOA 1SSFA 1KQSS 1U5KA 1E3PA 4DV3Q 5A0LA 3JCMb 1VQ7A 2QQBA 3TU4K 2MO0A 3X26B 2NN6I 3S1QH 1W3SA 1KRTA 2R6GA 1KQ2A 4QVZA 2WFWA 5IN1A 2Z6KA 3EAEA 3DB3A 2BIVA 4J8OA 4B3TL 2VC8A 2KCTA 5A2QE 5GAOn 2IX0A 2GFUA 4DR6L 3CW2C 3HRUA 2EJGA 2QQSA 1G3YA 3CC2A 3UDIA 2LX9A 4CRIA 5FLMG 4R4IA 2RI2A 4F7UA 3JCMg 1JRIA 1QP3A 4L5TA 1WJSA 4LD6A 2K2VA 3TS0A 2BH8A 3OYFA 4IUVA 4PG3A 4DV1Q 3QYHB 3LX7A 3DB4A 2MNAA 3FP9A 3P8DA 1X3FA 1HR0L 2AWOA 3SGIA 4D6WA 1HZAA 4LF7Q 2VW9A 2JK8A 1M4ZA 4TVAB 4F7UF 3URGA 1NPPA 4DR1Q 4TVRA 1WFQA 1JJ2A 5AYFA 1Y1VH 3QKJA 1PH4A 2JUFA 1JT8A 3S24A 4JJNK 1M8VA 2UUBQ 1G3TA 2KDSA 1VQOT 2A1AA 1IYJB 3OYYA 3AYHB 4GOPB 2DVEA 2R92H 3TCJA 3HRTA 5FU7B 4QL5A 2Q2IA 3P8BB 1BI1A 1XNQQ 4PMWA 3BDLA 4XAXB 4JBJA 3OB9A 4IUQA 2L3RA 3EIVA 2LXJA 1X9NA 4XU1A 1WQ7A 4X9DA 1VCIA 1YHQA 3UDGA 1TWCH 1XMOL 1K0RA 3I2ZA 3C12A 4DV0L 4M7DC 1Y96A 4LDXA 1Q81C 2Q2TA 2QXFA 1WI5A 2AWNA 4M78B 3HFNA 5IYBH 4NL2A 5H1SE 3QZ9B 3EFRA 5KH6A 4A3FG 2DK3A 2XK0A 2I2LA 5J3BA 1JB0E 3JCMe 4JOIC 4ALPA 5HY6A 4DV6Q 3J81i 1NPRA 4GS3A 5D6YA 4KI0A 2KVQG 3VU3C 3DM3A 4J7FA 3I4OA 3CCRT 3FC3A 5GMKe 4A3CG 2DIQA 3A5ZB 3U4ZA 2F4VQ 3QSUA 2DZ9A 3CCVA 2MWPA 2F5KA 3DLLA 5CK9A 1FWZA 3LGFA 1VQJA 1QUQA 1BIAA 1PYBA 4UY8C 1BI0A 1CKNB 2JA5G 2PNHA 2UXBL 3VJPA 4L5SA 2OQKA 4AYBE 4A93H 3RUXA 2P4TA 1VIEA 2BA1A 3WVEB 4M7DD 1Y1VG 1L0WA 3BU2A 3I4MH 2XGTA 3I4NG 3M56A 2CZ1B 3S3NA 5LJ5h 4OX9L 5FJ8G 1A0IA 4JI6L 2ID0A 2N78A 1HZ9A 3PUZA 3WXMB 2D0QB 3V8KA 3JCMX 4A3MG 1Q81U 4HT8A 3ICEA 1X56A 2JVVA 2PMZE 2B3GA 3VYGA 4QVCA 1FGUA 4M75C 1X55A 4GNXA 4MZTA 2WSCE 2RHQB 4M77C 4ME3A 5IAYA 3CD6A 1SLJA 1VQ9T 1OZ2A 2DAQA 3QG1A 1N6AA 3CBPA 3OYDA 1AH9A 3UDCA 1D7QA 2DTOA 3V8LA 3PGZA 3CBMA 3CCLT 5IYBG 3AEVA 4C92E 1HNWQ 1FXXA 1N33L 2IG0A 1AE2A 2DJZA 4M7AD 3KJOA 3OS5A 5IWAQ 1VQCA 1L1OB 1WPYA 1HH2P 4J6YA 4DR2Q 4YCVA 5JJIA 1IBMQ 4LDWA 1SROA 1VQ6T 2CZ6B 4A3EH 2E8GA 4FDBA 2I0QA 3FJPA 4C8QE 2IVWA 5CAIA 3OYLA 2OAUA 2IT1A 2R7DA 3L7ZC 4LUVA 4ATOA 4M75D 3PUXA 3GTLH 3ZEHA 4M77D 4E7LA 5GMKi 3TQYA 4HJ9A 1EYGA 2KQWA 5DLQE 2CCZA 1W2BA 4JG2A 3VYHB 4BI8B 3CCST 1PSFA 5JEAG 2DXBA 3QBYA 5GANd 2E41A 3CEYA 4X62L 3QO3A 3CCRA 3JB9F 4E7JA 4XK8E 1XTDA 3K0XA 1Z9FA 3TEEA 4JYAL 2AMCB 3FDRA 4BBRH 1KIXA 1GM5A 2DTIA 4GLXA 3HHTB 4L5GA 4M78C 5C44G 3AQQA 3KYHC 2WSEE 1PH6A 1OXXK 2L5QA 1KC8C 2VQEQ 3LWIA 2MO1A 3E9GA 3CXCS 2RHSB 2VNUD 1BBUA 4R1JA 3L2UA 1KL9A 5FRNA 2ALYB 5IP9H 3ERSX 4OO1G 2E70A 1BBWA 2C35B 3L2RA 2JJQA 5GAN8 3EFSA 1VQMA 2XDDA 3M55A 4DKAC 3N5BB 3FRNA 1XOVA 3G6EA 2EQJA 1LTLA 1Q1BA 5M3MH 4EMKA 1E7ZA 2L89A 1GKHA 5IY0A 5C3EH 1IL2A 3A74A 1JMCA 1X01A 3H3VH 1BI2A 3NTHA 2A7YA 5GMKj 4RMFA 3HRSA 4GOPA 1X3GA 2DPPB 5CCAA 3CCJT 4C92B 1LUZA 3ULPA 4C3HH 3HOZG 2K5LA 1VQ9A 4X64Q 1EQRA 2RK1A 1YHAA 3OYEA 3BZCA 4C3JH 3MEUA 2LVMA 4JS5A 4MMLA 3GO5A 3NEMA 3MP1A 4F7UB 1EQQA 3GNGA 5CKDA 4C8QB 3NENA 4EMGA 2JTMA 3S6WA 4JBKA 3MP6A 2UXDQ 1KC8U 3K81C 5IT9c 1M5Q1 3K7UC 4A3IH 1Q82C 1TWHH 1VQ6A 3A8HB 3K8AA 3OS1A 4A3LG 3OTOL 4JLIA 3U50C 1NE8A 4NS5A 3JAME 2B63H 4K0KQ 2KHIA 2DXUA 5LJ5g 4AIMA 1KHIA 1YHBA 1FJGL 1OXSC 2ZPHB 5GAHC 2V8IA 3OSVA 3OYIA 4HJ8A 4DA4A 1I81A 4EPCA 1SMXA 4PZ7A 1E1OA 4DOVA 3X24B 2A3LA 4XTYA 4JCVE 3WWVA 2RB6A 4BA2I 1CKNA 3CMET 4MZMA 4BD3A 4AQYL 5I2MA 4M7DE 3JCMQ 3QXEB 1XMQL 3HFOA 3RERA 1NMGA 2VS1A 3OYKA 1PH2A 5M3MG 1V29B 2E5QA 4YHHQ 4P5NA 5KCHA 1HR0W 4DUZQ 4KUDK 3HOYG 3PUVA 4NPSA 3JCMJ 2UUCQ 4C0GA 5M3FH 4NXMQ 4C0DC 3RIRA 3GD7A 1N9RA 1Q82U 4IUUA 4IFDI 2QA4T 4LFCQ 4OWTB 1KQ1A 1PH3A 4DK6C 5BR8Q 4ZTFA 4PJOE 1M90C 2HQEA 1VQNT 3H15A 1X6OA 2EQMA 4C5HA 3QZ5B 1Q86U 4GKJL 2FB7A 4DNIA 3RESA 1KD1C 1FX7A 4A3IG 2ZPBB 2V8JA 2LNVA 2Y4XA 1QUQB 2JNGA 1Q46A 5AJ3L 4M7AE 1L1OA 1QVGA 4A3JH 1I94Q 4R56A 1PH5A 5LJ5e 4NOYA 2CKKA 5D6XA 3PGGA 3IRBA 4X65L 5GAOp 1YIJT 3QDRB 3G71A 2EQKA 3F70A 3JCMf 1B34A 3S15H 2AHJB 3RMSA 4FT2A 4IUPA 5FLMH 4LF8L 3FIFA 4OONA 1H3ZA 3OS0A 4APVA 2YHTA 4PLIA 1B7YB 4M77E 3L2WA 2BA0A 2R93G 2Z6KC 2EQSA 4ZTJA 2JTFA 3M53A 1CSQA 4HCCA 2XI9A 4QQDA 3M7NA 3J81E 3RN2A 3BY7A 4A4HA 3M85A 1YCYA 4LF5Q 5CR2A 2EQUA 4DUYL 2DKGA 2RJEA 3T1HQ 2V8KA 4O0AA 4IPGA 4JI8L 3RLNA 2I5HA 1BKBA 1WJRA 4MTNA 3S17H 4YY3L 4JI4Q 5GANh 4ELZC 4POFA 5GAN2 2MF2A