4KUDK

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
KTLKDLDGWQVIITDDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSNEYLKRVSVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein/transcription/dna
molecule keywords Histone H3
total genus 45
structure length 212
sequence length 212
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kudK00
4FT2A 4BB7A 4LD9K 4JJNK 4KUDK 4DA4A 1M4ZA 4FT4A 4DOWA 1W4SA 1ZHIA 4KULA 4DOVA 2FL7A 4KUIA 3TU4K 3PT9A 2FVUA 3PTAA 1ZBXA 4FSXA
chains in the Genus database with same CATH superfamily
1BBZA 3RKXA 2P0QA 1GFDA 2C0TA 2VC8A 2RPNA 1QVFA 3P8HA 3QZ9B 1NJIR 3JCMQ 1VQKQ 1OEBA 1PKTA 3V7RA 1YI2A 2DL3A 4FW1A 3VS6A 4C0FA 1KQSA 1M5Q1 1OPKA 4HCZA 3QG1A 3OSVA 1K76A 2H3EB 5A0LA 2DBKA 1WX6A 4CC2A 2K3YA 4J6YA 8ATCB 4PJOE 2BZXA 1WA7A 3CCMQ 2CREA 2I0NA 2PTKA 4QW2A 1YI2Q 1U8RA 2K2MA 1UGQB 2JVVA 4PJOD 2KROA 2Y4YA 2QEXA 1WI7A 4KGVB 4EIKA 2EW3A 2SRCA 4ESRA 4Z02A 4EMKC 1WHKA 3BDUA 2FZGB 2EQIA 2M51A 1M30A 4JPBW 4J8OA 1JB0E 1VQPA 3MHXA 2R58A 5GMKj 4JRQA 3CPFA 2GTOA 1KQSS 1BIAA 3CCSA 2YWWA 2AKLA 2GF7A 2NUTA 1VQ9A 1K8AC 2PUKB 1WXBA 1HJDA 2R5AA 3EGDB 4XTZA 4Y28E 2K9GA 1PD1A 2MF2A 2BIVA 5LJ3g 1X6OA 4JRPA 3A8OB 1JBMA 3PMTA 1ZLMA 5FRNA 4RTWA 2QAZA 2H8HA 1HD3A 1MMAA 3CD6T 2K5IA 3OA6A 1QVGP 1QKWA 5GANj 3CXCA 4FL6A 4HA8A 2PZ1A 4OB0B 3SWNC 2FVUA 1YJ9A 3KUFA 2EBPA 4N4HA 2YRVA 1Q82U 2KRSA 2MK5A 2ZGWA 4AMCA 2HKNA 1B34A 1WHJA 5EC7A 1UGVA 3A8HB 3CCQQ 1WYXA 1AT1B 4N0AC 1ZQ1A 2YRCA 3VRZA 3OS2A 2VV5A 1VQ8A 2NWMA 4OMNA 1S72T 2L3SA 2DIGA 2J05A 1EFNA 5GMKl 5A0GA 3JB9I 2ED1A 2DE0X 3GNGA 4M78G 1ACMB 5M9OA 4M78A 2XG8D 3RUXA 1K9MU 2XICA 2HQXA 1ZSGA 4JJCA 3EGUA 2VB6A 3N5BB 1AWWA 2RD1A 1NG2A 1VQ8Q 4E7JA 1FXXA 3BDLA 5FWBA 4RTVA 4X1VA 2QGFB 1QMCA 3DLMA 1X2KA 1QP3A 1Q7YU 5KYYA 4PJOG 1RI0A 3LYIA 2LNHB 2EKOA 4GLKA 4JJBA 4M77A 4R56A 4ORZA 4C92D 4A4GA 1YWPA 1QCOA 1WHGA 4PJNA 4WF2A 2YRDA 5GAMf 4RCBA 2QQAA 2Y4XA 3JB9D 1YP5A 3OBYA 1YHQA 1ZBJA 2MI6A 2CH4W 2GCXA 1NJIC 3QO3A 3EG2A 1YN8A 1QW1A 2LDMA 3CCMA 1TOVA 1QVFS 2COWA 1ZBXA 4NS5A 3CCRA 2PVDB 1SF9A 1ZUKA 1GXIE 1W2BP 1XQHA 4LDWA 5CO7A 4XK8E 2HEQA 3I9QA 4M75C 1UTIA 1M8MA 2CGHA 3CC2Q 5KYUB 2P84A 4RKUE 3G6EQ 4N4GA 1UFFA 1MMGA 2E41A 3CMEQ 2YLCA 3QDFA 1VQOQ 4MZTA 1K73C 1IRXA 2JM8A 1YFNA 1BKBA 1I4K1 4YTLA 2V1RA 4A53A 2OAUA 4AFSC 1JXMA 1F1BB 1UUEA 1Q86U 1T3LA 1AVZC 1ZUUA 2BZYA 3GBQA 4P5NA 3HFOA 4A54A 1WXTA 1VQ5Q 2QGGA 4OB1B 3G6ET 5GAOr 3CMEA 1Z9QA 2RJCA 2V8JA 2CSQA 1K8AR 4M7DD 3PVLA 3F70A 3I56Q 2QEXT 3NGPA 1U1SA 4JZ4A 3ZBDA 3CC4A 1VA7A 1OZ2A 2WSCE 1M90R 3MP6A 2K6DA 1YJWT 5CQXA 2DXUA 2I2LA 3OSSC 5GANf 1NE8A 1Z9ZA 4PNOA 4OB2B 1YHQT 2EPDA 1D1CA 1VQ4Q 5D6XA 3EG3A 1K8AU 2DZ9A 5J3BA 1VIFA 1OYXA 1YIJT 1NLPC 3JCMb 2X3XD 2DRMA 4DBRA 2MCNA 3T9NA 1BI1A 1M2VB 4II1A 1N8RC 5LL6S 1RLQC 1GFCA 1G3TA 2E5KA 3ZEHA 4ME7A 4FYYB 1AEYA 4KGXB 2DBMA 1VYTA 4RTZA 2CUBA 4DBHA 2MWOA 4GY5A 3JAME 1K73U 4LUDA 4J9FA 5GAOp 1W2BA 1NLOC 4M78D 2O31A 3QJYA 2H3JA 2DM1A 4J9HA 2XD0A 2R5MA 3M53A 2A08A 1PG5B 2PVOB 4O5VA 1D0ZA 1VQLT 1M9SA 2FHDA 2CT3A 1T0JA 4HKEA 3L2WA 1K0SA 2EYWA 1PSFA 2DXCA 1H8KA 2D9TA 4J9EA 2CP0A 3OYBA 5L8RE 2CKKA 2J6KA 1M2VA 2QA4Q 3VRYA 1Y96B 1M3AA 4JLIA 1VQ7Q 1G2BA 1LOJA 1BCMA 5KYNA 1M90C 3L2QA 2DKGA 4L5GA 2RQUA 3CCSQ 5GAN8 4JS5A 1IB8A 2DYIA 1BI3A 4C92C 2QTXA 2K3BA 2DD4A 4WTOB 4C8QE 3CCUT 2V8KA 1AWXA 3E9GA 1B34B 1JU5C 1SSFA 2DF6A 1T3SA 1PRLC 5DLQE 1V76A 5FROA 3CCVQ 3CCST 2JTMA 5LJ3e 3LX7A 4WCIA 1SG5A 1BI2A 1HYOA 5GAOm 5I21A 2K4YA 3PFSA 3UF4A 1YJ9Q 2VASA 4ZGEB 4RG2A 5FU6C 5FU7B 2DD5A 1U06A 1JXOA 3CMAQ 5IHKA 2RHUA 3M0RA 2A7YA 2OTJA 1WJSA 1X27A 2QDLA 4M7DF 2ZAEA 2EGCA 4N0AA 3RESA 2LZ6B 1YITA 2JS2A 1IO6A 3CCLT 4F7UB 3OS0A 4RTUA 3JCMf 2K79A 5GAN6 4MZPA 3M55A 3H0HA 1IGUA 1Y57A 4F04B 4LD9K 2XKOC 1D1BA 1WQWA 1RI9A 4NOYA 4C8QA 4ZTJA 4PFPA 1G8XA 4O6JA 4XTUA 4D8KA 2YUPA 4B9XA 3PIOA 3OYEA 2QI2A 4EMGA 3CPWS 2AZSA 2C0OA 2MIOA 2YXYA 2ED0A 3C12A 4AFZC 2ROLA 4Z88A 3THKA 2VXFA 4C8QC 4DBQA 1MV0B 4FT4A 1QVGS 1E6HA 1WFWA 2RMOA 2RB6A 2ZPFB 2L3QA 5KYWB 5GANg 4LXCA 1N6AA 3CCQT 2J7IA 5AYFA 2LQ8A 1D1AA 1T0HA 2FRYA 3PT9A 4X9CA 5GMKi 3FJ5A 2DJQA 1WHMA 1JJ2P 4C92G 1R0CB 2DK3A 5I11A 4C8QG 1BIBA 1RAHB 3JCMX 4MMLA 3HHTB 4BY6C 2RQWA 1VOMA 2M0YA 3TQ7P 3WVDB 1O75A 4PJJA 1OU9A 4M78F 1P92A 2XHCA 2FL7A 2KMTA 2LX9A 2O9VA 2WSEE 2YUQA 1KD1C 2L89A 1VQ8T 4J5YA 1J3TA 3PMIA 3ASKA 4DBFA 2DILA 2L2PA 4EMKA 1B07A 3VUBA 5LJ5f 4M77E 3G1JA 3D7SB 4HT8A 2EVRA 2FPEA 4E6RA 4PK4A 2QTVA 5AT1B 4Q5WA 5GAN2 3CXCS 5FWCA 2YDLA 3CC7Q 1PSEA 3I5SA 1YJWA 4QVCA 4M77G 3PIPA 4OMPA 3CBPA 3SB2A 3CC4T 2JXBA 3CMAA 1OX8A 1K73R 4PJOA 2F1LA 5CCAA 5D6WA 4C92B 4FYVB 3DB4A 1GBQA 4BD3A 4OF1A 4EPCA 2RH2A 2LQWA 1KQSP 3EFOB 1RL2A 2CT4A 3WVEB 2O9SA 4M78C 4IURA 2JN0A 4OB3B 1BB9A 1K1ZA 2HBPA 3CC7T 3CCRQ 2MOXA 2KT1A 1MUZA 2CSIA 1SSHA 2VVKA 2CZ7B 1G3SA 1OZ3A 5LJ3f 4FCYA 2Z0WA 2KYMA 2LTOA 2BUDA 3M0PA 3SWNA 4L59A 3G7ZA 1S72A 1YJNT 1BK2A 2VYTA 2HL3A 1UE9A 2ZPHB 4KH1B 3CCUA 1VQOA 2EQUA 3IQLA 1IGQA 3BE3A 2MPXC 3Q1JA 4KRTA 2RQVA 3JRZA 2VKNA 1RAAB 3CD6Q 3BW1A 4NL3A 2EGEA 4BB7A 2XI9A 2AK5A 2KDSA 1N9SA 2HD0A 1YWOA 4EMHA 4OMLA 3V7SA 1KD1U 2HMAA 2OI3A 2OTLA 1Q7YC 3OYDA 4C92E 5CKEA 4FSSA 3HL8A 3RNJA 2KAFA 3G71Q 4F7UG 1V29B 3OYKA 3JCMJ 2HQHA 3C94A 2GQVA 3A8LB 1ZX6A 3VV0A 3A98A 1N8RR 1NYGA 2HSPA 4QT7A 2RA2A 1WHHA 1VQ9T 2D1XA 3OYNA 2EJ9A 5EG2A 4EMKB 1XNIA 1YIJQ 1JJ2S 3JCMg 1OOTA 2BE9B 4D6WA 1Y07A 1X75C 1VQ6Q 2P4TA 1X69A 4LD6A 3HFNA 2XDDA 2X4XA 4FU6A 1DJ7B 1FWZA 2LJ1A 5KCHA 2FZKB 2DRKA 2RM4A 2PUOB 2MAMA 2X4WA 1GRIA 2QQSA 3CPWP 4QKUA 2KK4A 4BDYA 5CR2A 1I1JA 1M90U 3P8DA 1VQ6A 2DEUA 3FC3A 1I07A 3PVQA 4BE0A 1B7TA 4PJMA 3LH0A 3HRSA 1OX9A 3L2RA 4KGZB 1M27C 3SFMA 4KT0E 2M1HA 4BE2A 2FRWA 2X9HA 2ROTA 5DM7R 1PWTA 2O4XA 1SRMA 1UGPB 2AKKA 2E1HA 2YHTA 4JLGA 1VQPQ 4M7DB 3RDVA 2YUOA 1SRLA 3EHRA 3KXTA 4J9GA 2IPOB 2A37A 4QVDA 2LCLA 1NEBA 2DPPB 2PNIA 2O88A 4BDZA 1Q81R 3OYHA 2K5LA 1ZSZC 1QP2A 3GNFB 1Y0MA 4C92F 1GCQA 2E70A 1VQPT 2YT6A 4XQ3A 2E12A 3JCMh 3QDRB 2IG0A 4RTYA 3REBB 1Q81U 5FU7C 5KYWA 2QG9B 2LVMA 4R55A 2JS0A 2NUTB 3RKWA 4C5EA 3AT1B 4VUBA 3OYGA 3I55Q 1MNDA 4M77F 4M75G 3NPFA 1YJ9T 4XTXA 2NUPB 4RG8A 1G3WA 1UHFA 3MO8A 4DQ2A 3NFCA 4Z89A 2F2WA 3M9QA 2M16A 2XU8A 2KYBA 4TVRA 1TUCA 2F5TX 2D8HA 3H6ZA 1VQ4T 1S1NA 2RQRA 4CRIA 1KD1R 2DXBA 2OJ2A 2CP5A 4C8QB 3JCMe 5GANe 1NPRA 1VUBA 3EAEA 2OX7A 4ZNXA 2DO3A 1WNLA 1KQ2A 4Z8AA 4D8DA 4JRIA 4LN2A 5D7UA 1X2QA 2QQBA 2BTTA 2LC4A 4B6MA 3A8MB 1H92A 3CCJT 1TUGB 2COZA 3VU3C 3CXCP 5HKCA 3HRUA 3EGDA 1YCYA 3OW2S 3JCMV 1MMDA 1LCKA 4M77C 3C4SA 5IN1A 3ULRB 1FX7A 1Q95G 4BI4A 4DOWA 1Q82R 3HSBA 4LDYA 1ZHIA 2C0IA 5C0MA 4ZTFA 2O01E 4DEXA 2DA9A 3EFOA 2DVJA 1JRIA 2D6FA 4E7ZA 1PRMC 1VQNQ 1RAFB 3UT1A 2E5QA 3VS4A 5HCKA 2LCCA 3HP9A 2RF0A 4DA4A 3QWYA 2EJFA 5GMKh 2VXEA 5GAN4 3H0FA 4M7AA 4FIBA 2WSFE 3S3NA 2D8JA 2CH4A 3RMQA 4PFOA 2FO0A 1E7OA 2LP5A 2EIFA 1VQNT 3L2ZA 3QZ5B 1C1AA 5DLOA 1KC8C 4BI3A 3LWHA 2QYZA 2YUNA 3GLXA 3QJ6A 4C5GA 3M4GA 1I81A 1RUWA 3CCUQ 5CAIA 5IXFA 3LGLA 4X34A 1WJRA 2CDTA 2JT4A 5J39A 1AWOA 1X6BA 4PLIA 4JJDA 3O8VA 3OMCA 4F14A 1AZEA 1JJ2A 2LQNA 2LX7A 1NYFA 1D3BB 5I2SA 1CSKA 2CUDA 2OTLQ 1IXDA 2RK1A 3ER0A 2SEMA 2EAYA 3G71A 3OYYA 4ZN1A 4M78B 3VS1A 3CC4Q 2LMJA 4XU1A 4DOVA 2F2VA 4BACA 2E10A 4HCKA 2L0AA 1VQKT 1AWJA 3NTIA 2FG0A 4OGEA 3SDZA 2L3RA 3FJPA 2HZYA 4K11A 1U1TA 4BI8B 1RLPC 3TVTA 3OW2P 2KVQG 2F69A 4IUQA 1QWFA 5GANd 1VQ4A 4EDUA 1RABB 3CCRT 1WDXA 2F2XA 2JW4A 4XAXB 4M4ZA 1PM3A 5L23A 3EHQA 3CCMT 1TS9A 2J06A 3KBGA 1YI2T 3OYJA 3CCLA 4RTXA 3GIBA 3M0SA 3HPWA 4M75B 2DMOA 3X26B 4C0DC 2AZVA 2PU9B 3SWNB 5CK9A 2IVWA 2XDBA 2DTOA 3VKIA 4IUVA 1S72Q 3RERA 1ZUYA 2DJZA 2D0NA 3DKMA 1RACB 1KC8R 1D0YA 2LJ0A 2KEAA 3LWIA 5GAOn 2K3XA 1RAIB 1QCNA 4J7FA 2DTIA 5HK0A 1M3BA 1MGQA 4PJOF 1VYUA 4A4HA 2P0PA 2KBTA 1SHGA 1G3YA 1M1FA 1ZA2B 1UHCA 2V26A 3GOXA 5GJWB 1VIEA 4OMFB 1D0XA 4IKFA 3M57A 2COYA 5FU6B 1M1KR 1BCOA 4QQGA 4OMMA 4X9DA 2HNIA 1QCFA 1RAGB 3NTKA 1VQ9Q 5GAMh 4KUIA 3PE0A 2QA4A 2X4YA 3M4YA 1QKXA 2DETA 4MDWA 3QPHA 3EFRA 1WQ7A 3UA6A 1VQ7A 1NBEB 1EZZB 4CC3A 3SEMA 1IZ6A 4ELZC 3MEUA 3JB9H 1PKSA 4ANJA 1TU0B 4V2SA 2GQIA 1X43A 1VQ6T 4ATOA 1KIKA 1UJYA 5LJ5h 1CKAA 1Y96A 2FPFA 2AHJB 3CEYA 5A0DA 1WIEA 2RNAA 2E6NA 4F17A 1LPLA 4IIMA 3EGXA 2OTJT 3CCQA 3X25B 1VQLA 3M54A 4J9CA 4JDSA 3M0QA 3QBYA 4QQDA 1IHVA 4RCCA 3OYFA 3CMET 4LE9A 4XU2A 1U3OA 4HCBA 2DYBA 2ZPGB 3I56A 1Q86C 3OQ5A 2EYXA 4F16A 1HK9A 3EG9B 5FW9A 2OTJQ 1M3CA 1QQJA 5CKFA 1WPYA 3FEOA 4AG1C 1SHFA 5LJ3h 1R8OB 2ATCB 4MZMA 3I35A 2JTEA 5GJVB 5GAMd 2ECZA 1YITQ 3C95A 1GCPA 4E7LA 2DAQA 1KJWA 1AZGB 1C0MA 4OMQA 2DERA 4N4IA 2ESWA 2RHXA 3EGXB 1H641 2M0OA 1KHCA 1KSWA 5C6SA 3V8KA 2A3LA 1ABOA 2BZ8A 4F7UA 2J6FA 2RO0A 1VQKA 1YITT 2V8IA 2RK2A 3BFMA 3H41A 4PLLA 3A8GB 4JRKA 3LGFA 2FEIA 1K0XA 4M7AB 3M56A 5A2QE 3I55T 4KBMB 2GFAA 3EG0A 4KULA 3TEEA 1VQ5T 4FYXB 1N9RA 3VS5A 5GAMj 2JUFA 2LNVA 5GAN7 4AFQC 3I56T 3VYHB 2QEXQ 2ZPIB 2X3WD 3S6WA 1UECA 3QHSA 1OI1A 2GTJA 4OP0A 1M1KC 1Q86R 3TSWA 2W10A 3GP8A 1QVFP 2L3PA 2RJEA 1VQMT 2YLBA 1K9MC 3G4SQ 1X6GA 3RKYA 4M77B 3GF5A 3J7AF 1AD5A 2DL7A 3RBBB 2CP3A 3O5ZA 3H8ZA 4NL2A 4RTTA 2CZ1B 1OULA 1K9AA 2HQEA 3ZL7C 1I0CA 4XTWA 2QA4T 2E65A 1Y7XA 1UGRB 2FZCB 3VS2A 3QKJA 5IXBA 1VQ7T 5LJ5d 1B3QA 3G4SA 4CI0C 2A28A 2EGAA 2LQKA 7AT1B 4ELYC 1ABQA 1MNEA 1WLPB 1OU8A 2DL5A 1XTDA 4E2FB 2AT1B 4AT1B 1UEBA 1XOVA 2GGRA 3X28B 2F5KA 4UC4A 2LJ3A 2RJFA 4LDVA 3JB9G 4MMKA 4M7AF 1IHWA 4ZGJB 2ZPBB 1H3ZA 1TG0A 1N5ZA 4GLMA 3L2VA 1O9SA 1I8FA 1WHLA 4Y92A 3DB3A 3OYAA 3VS0A 3NHNA 4OMOA 2KXDA 3EG9A 3JCMW 3TU4K 3ZFJA 2JMCA 3V7CA 4J7IA 2NLUA 5GMKm 2HSEB 2RI5A 5GAMg 4E7SA 1Q81C 1AOJA 1W4SA 2A36A 2AIRB 2JMAA 3JSCA 3QXEB 2OTLT 5HK3A 2CZ0B 3SHWA 2DIQA 1BU1A 3VS3A 5LJ3d 1MMNA 1JQQA 4ZGDB 5I22A 2P0KA 2OAWA 2RI2A 5IHNA 2XMFA 3EG1A 2KNBB 4J9IA 1M8VA 2BKDN 3G6EA 2KSSA 3UWNA 4OVAA 3CCVT 2ZCFB 1EIFA 1MHNA 1PCXA 3L1AA 6AT1B 4PKCC 2EYZA 2KGTA 4J6WA 1TSFA 2LCSA 2RHYA 4PJOC 5D6YA 3EFSA 5I2MA 3JB9F 1SPKA 4JJNK 3S3OA 3CCJQ 1Q7YR 2KE9A 5LJ5e 3OB9A 1VQ5A 1MV3A 1ZSZB 2O4XB 1M1GA 4HVVA 3U23A 2E64A 2NUPA 3CCEA 1I5LA 3CCLQ 1FYNA 1OQKA 3FLGA 2K2VA 2EQMA 5KYUA 1KG1A 1K9MR 3INZA 2KT8A 3FB9A 3SD4A 3UDCA 2ZPEB 1GBRA 1UJ0A 2CP7A 1QVPA 4Y91A 3QWXX 1X01A 4E7HA 1AHJB 4XU0A 1YBYA 2E6ZA 3LLRA 1M1KU 3TREA 1SEMA 4A4KA 4M7AD 3R6OA 3OY9A 2HL5C 2L5QA 2QK0A 2KY9A 3M58A 3E9FA 1JEGA 2JJ9A 4LDXA 1SKUB 3MEVA 1HXDA 4BUGA 2X51A 4PFZA 3META 3FDRA 2PVGB 2DEQA 3MJXA 1Q82C 5KYXB 2K5FA 2ABLA 3JB9J 3CCET 4M78E 1KC8U 2EKHA 2HCKA 1TWBA 3A1PA 1NJIU 3X20B 1Y71A 2JZ2A 1VQMA 2NUZA 3NTHA 5ECAA 1D09B 1K4US 3OYIA 1QVGA 2L8DA 3P8BB 3RR6A 4BY6B 5IAYA 5CIUA 3MEWA 3URGA 3QUIA 4F7UE 4LUEA 1R77A 1W70A 3E1SA 4MDXA 1M4ZA 3OS1A 5GAMe 1NZ9A 3VYGA 4R0KA 1FMWA 4M75D 4CC4B 3A5ZB 4M77D 2XK0A 2K57A 1PHTA 4XU3A 1UG1A 2GFUA 3MP1A 2VGNA 3MKDA 4JUVA 3EH1A 2GBQA 3CBOA 5CQYA 5KYXA 4OGCA 4PL6A 3BY7A 3J81E 2CYZB 3CQTA 1YNZA 2DTHA 1PNJA 2V1QA 8AT1B 3HTRA 5HY6A 2EYYA 2EJGA 3MEAA 1GCQC 4J83A 5LJ3j 1PC0A 1FMVA 1KK7A 2P4RA 1RAEB 5IH2A 4BE1A 1QLYA 2KRMA 1VQOT 1QWEA 4XTVA 3TSZA 4C8QF 4ZN3A 1I5OB 2QXFA 1R0BG 3G71T 2VUBA 5GAN5 1WJQA 3UPUA 2M02A 3S3MA 3C0CA 2O2OA 1V1CA 1KFZA 3M5AA 4IIOA 2E4HA 2KRNA 2G6FX 4HVWA 1BI0A 3JCMd 4A4EA 4M75F 2E3HA 4AG2C 1XJWB 2QQ9A 4M7DA 3CCVA 3JCMP 1YJNQ 2BE7D 2DL4A 5DY9A 2CP2A 1G83A 5CKBA 1C6VX 3LH5A 2LRQA 2X4JA 2EQJA 3VS7A 1ZSZA 1VQNA 1VYVA 1WGSA 3MPUB 3H9NA 2JTFA 4IUPA 3UA7A 4C0ZA 1RADB 3REAB 1G5VA 1KHIA 5KCOA 4KH0B 1YHQQ 2DNUA 3CPWA 3L2UA 2B8AA 1N27A 3E19A 2FYKA 2HKQB 5CVIA 3M59A 5GAOl 2KR3A 4J9DA 2EWNA 1WZOA 3CD6A 1WXUA 4IUTA 2X35A 2CS7A 5GAN3 2IIMA 2ZZDA 2ENMA 4LDUA 3CC2A 2DX1A 1FMKA 5CKDA 3E2UA 3OMGA 3HKSA 4M7AE 2VWFA 1LNXA 1U5SA 3L42A 4M7AC 4C5HA 5KH6A 2CZ6B 5GMKe 4RMOA 3RIRA 1UB4A 2KI7A 2CP6A 5GANh 2QDYB 2R57A 4PJLA 4PJOB 2EYQA 5KYYB 2J6OA 1D3BA 1ZA1B 3QYHB 2A0FB 2Y90A 4M7DC 2EFIA 2XIDA 3EH2A 1YIJA 4JZ3A 3GPLA 5LJ5j 2EQKA 3PTAA 2GNCA 3I55A 4JS4A 4M75A 3OYLA 2QQRA 3QIIA 3CC2T 2HAXA 4FT2A 2KXCA 5FLXE 5J26A 3UATA 3NMZC 1KQ1A 4E47A 1TXQA 3FIFA 3DLLA 1TTHB 1W6XA 3LW5E 4C5IA 1HSQA 3V8JA 3X24B 4A63B 1TH7A 2DZCA 4FSXA 2MYSA 5KE2A 4E7IA 3VUZA 2HBWA 3CBMA 2G3RA 3JV3A 1W2BS 3KFVA 1ARKA 5KE3A 4CC7A 2RJDA 1OPLA 1GL5A 4L6V5 3WXMB 2MMPA 2RN8A 2E3IA 4HVUA 4HXJA 2DVEA 1M2OA 3MP8A 3JCMc 5IHIA 1YJNA 3H0IA 4FYWB 4E7KA 2NYSA 1TUDA 3CC7A 1YJWQ 1H3HA 4KUDK 1LVKA 4M7DG 9ATCB 2LT1A 2D0QB 3CMAT 2KQWA 1NEGA 4F7UF 4J9BA 2FB7A 3QYGB 1CKBA 3FRNA 5FRMA 3OBWA 4M7DE 2DLPA 4FW2A 3J80E 4HT9A 2RQTA 4QVZA 2JM9A 4M7AG 3TCJA 2DXTA 3M0UA 2QASA 1VQMQ 5GAOq 2DFUA 1JO8A 3G4ST 4XTYA 1NM7A 4AFUC 2XDPA 2DL8A 4LNPA 4DEYA 3MCAB 2RI3A 2M9UA 2MWPA 4J6XA 2HDAA 4C8QD 4FM4B 2LT4A 2VGMA 5LJ5g 1NPPA 3V8LA 3ME9A 5IT9E 3HRTA 2JOYA 1IREB 3OS5A 1UDLA 4C0GA 3AHUA 2JNGA 2PQWA 2RHIA 1OV3A 1VQLQ 3PGGA 4B9WA 1W1FA 1N8RU 4C0DB 4IUUA 4HCCA 3RMSA 3OYMA 1YCSB 1LJOA 2B86A 3OYCA 2C06A 3I5RA 3CCJA 3VJPA 1UGSB 4RUGA 3R6NA 1A0NB 3OW2A 1PD0A 1BYMA 2WACA 1EX4A 1E6GA 4M75E 3CCEQ 2FPDA 4C92A 4GBQA 2K7AA 3M0TA 3PNWC 2RHZA 5CKHA 2W0ZA 4QQ6A 2YSQA 3QSUA 4A4FA
chains in the Genus database with same CATH topology
5I2MA 4BI3A 3LWHA 1KC8C 3GLXA 3JB9F 3QJ6A 3RKXA 4C5GA 2P0QA 3M4GA 4JJNK 4LD9K 1I81A 2XKOC 3S3OA 1WQWA 5LJ5e 3OB9A 1VQ5A 2O4XB 2VC8A 5CAIA 4NOYA 1M1GA 3LGLA 4X34A 4C8QA 1QVFA 3P8HA 1WJRA 3QZ9B 5J39A 4ZTJA 3JCMQ 2E64A 3V7RA 4O6JA 4PLIA 4XTUA 3CCEA 1YI2A 4B9XA 3O8VA 3OMCA 3PIOA 1I5LA 3OYEA 4C0FA 3FLGA 1JJ2A 1KQSA 1M5Q1 2K2VA 2QI2A 2EQMA 4EMGA 1KG1A 1D3BB 5I2SA 3INZA 3CPWS 3UDCA 3FB9A 4HCZA 3SD4A 3QG1A 2ZPEB 3C12A 3OSVA 1QVPA 2VXFA 4Y91A 4C8QC 5A0LA 2RK1A 1X01A 4E7HA 3ER0A 4FT4A 1AHJB 1QVGS 2EAYA 2K3YA 3G71A 3OYYA 4ZN1A 4J6YA 4M78B 4XU0A 2RB6A 4PJOE 1YBYA 2E6ZA 2ZPFB 3LLRA 1M1KU 4XU1A 3TREA 4DOVA 5GANg 4BACA 2E10A 4QW2A 1U8RA 4A4KA 1VQKT 1N6AA 4M7AD 3NTIA 3R6OA 1UGQB 3OY9A 3CCQT 5AYFA 2JVVA 2L5QA 2LQ8A 4PJOD 2KY9A 4OGEA 3SDZA 2Y4YA 3PT9A 3M58A 3E9FA 2L3RA 3FJPA 2QEXA 4X9CA 4LDXA 5GMKi 3MEVA 1HXDA 1U1TA 4BI8B 4BUGA 4C92G 2KVQG 2F69A 3META 3FDRA 2PVGB 2DEQA 1Q82C 4IUQA 2DK3A 4Z02A 4EMKC 3BDUA 4C8QG 4J8OA 1BIBA 1JB0E 2K5FA 5GANd 3JB9J 1VQPA 3CCET 3MHXA 4EDUA 4M78E 4MMLA 3JCMX 1VQ4A 3HHTB 4BY6C 1KC8U 2R58A 5GMKj 3CCRT 3CPFA 4JRQA 1KQSS 4XAXB 3WVDB 1NJIU 1O75A 3X20B 1BIAA 1Y71A 3CCSA 2JZ2A 1VQMA 3CCMT 2GF7A 4M78F 1P92A 2XHCA 3NTHA 2FL7A 3KBGA 1YI2T 1VQ9A 2KMTA 3OYIA 2LX9A 3OYJA 2PUKB 2L8DA 1QVGA 1K8AC 3CCLA 3P8BB 2R5AA 2WSEE 4BY6B 5IAYA 1KD1C 2L89A 5CIUA 3GIBA 1VQ8T 3MEWA 3URGA 3HPWA 4J5YA 3PMIA 3ASKA 4M75B 4XTZA 3QUIA 4Y28E 2MF2A 2BIVA 4F7UE 5LJ3g 1X6OA 4JRPA 3A8OB 4EMKA 1JBMA 3E1SA 3X26B 3PMTA 3VUBA 4C0DC 5FRNA 4MDXA 1M4ZA 5LJ5f 3OS1A 2PU9B 4M77E 3SWNB 5CK9A 2IVWA 5GAMe 2XDBA 4HT8A 2DTOA 3CD6T 2K5IA 3OA6A 1NZ9A 4IUVA 3VKIA 3VYGA 5GANj 3RERA 2DJZA 3CXCA 4M75D 4FL6A 3A5ZB 4HA8A 3DKMA 4M77D 4Q5WA 2XK0A 5GAN2 3CXCS 2K57A 4XU3A 2GFUA 3MP1A 1PSEA 2VGNA 4OB0B 3SWNC 3LWIA 2FVUA 5GAOn 2K3XA 1YJ9A 3KUFA 4N4HA 4QVCA 1YJWA 2YRVA 1Q82U 4M77G 4A4FA 3PIPA 2ZGWA 4J7FA 4JUVA 1B34A 2DTIA 5HK0A 3CBPA 3SB2A 3CC4T 1MGQA 4PJOF 3CBOA 3CMAA 4A4HA 4PJOA 2P0PA 3GOXA 1G3YA 1M1FA 3A8HB 5CQYA 5CCAA 4OGCA 5D6WA 4PL6A 3BY7A 4C92B 1VIEA 3DB4A 3J81E 4OMFB 4N0AC 1ZQ1A 2CYZB 4OF1A 4BD3A 3M57A 4IKFA 3OS2A 4EPCA 5FU6B 2VV5A 1VQ8A 4QQGA 2RH2A 4X9DA 1S72T 2DTHA 2DIGA 2HNIA 1RL2A 5HY6A 3WVEB 4M78C 5GMKl 4IURA 2EJGA 2JN0A 3NTKA 5GAMh 5A0GA 3JB9I 3MEAA 4OB3B 4KUIA 2HBPA 3GNGA 2QA4A 2X4YA 4M78G 4J83A 5LJ3j 3CC7T 3M4YA 5M9OA 4M78A 2XG8D 3RUXA 1K9MU 4MDWA 3QPHA 2XICA 3EFRA 1WQ7A 2HQXA 4BE1A 1VQ7A 2CZ7B 1G3SA 1OZ3A 5LJ3f 1VQOT 3N5BB 1IZ6A 4ELZC 3MEUA 4XTVA 3JB9H 4V2SA 4C8QF 4ZN3A 2LTOA 2RD1A 2BUDA 3SWNA 2QXFA 1VQ6T 4E7JA 4ATOA 1FXXA 3G7ZA 3BDLA 4L59A 1S72A 3G71T 1YJNT 2VYTA 2VUBA 2ZPHB 1WJQA 5GAN5 3CCUA 3UPUA 5LJ5h 4QQ6A 1Y96A 1VQOA 2EQUA 3DLMA 2AHJB 1QP3A 1Q7YU 3Q1JA 3CEYA 3S3MA 4PJOG 1RI0A 3JRZA 3LYIA 5A0DA 3M5AA 4GLKA 2E6NA 2EKOA 3BW1A 4NL3A 4M77A 4BB7A 2XI9A 4R56A 4C92D 2KDSA 4A4GA 1N9SA 2HD0A 4EMHA 1BI0A 3V7SA 3JCMd 4WF2A 4A4EA 1KD1U 2OTJT 3CCQA 3X25B 5GAMf 4M75F 4RCBA 1Q7YC 2QQAA 2Y4XA 3OYDA 2OTLA 3JB9D 1VQLA 3M54A 3OBYA 4JDSA 4C92E 5CKEA 1YHQA 2QQ9A 3HL8A 4M7DA 3QBYA 2MI6A 4QQDA 3CCVA 3JCMP 2KAFA 4RCCA 2GCXA 1V29B 4F7UG 3OYFA 1NJIC 3QO3A 4XU2A 3CMET 3OYKA 5DY9A 3JCMJ 1QW1A 2LDMA 3CCMA 1QVFS 3C94A 2GQVA 5CKBA 3A8LB 4HCBA 2LRQA 3VV0A 2X4JA 2ZPGB 3I56A 1ZBXA 2EQJA 4NS5A 1Q86C 3CCRA 2PVDB 3OQ5A 1VQNA 1WGSA 2JTFA 1GXIE 1XQHA 1HK9A 4IUPA 4LDWA 2RA2A 5CO7A 4XK8E 4C0ZA 4M75C 1VQ9T 1G5VA 1KHIA 3OYNA 5KCOA 5CKFA 2CGHA 1WPYA 3FEOA 2EJ9A 3CPWA 4RKUE 5EG2A 3L2UA 5LJ3h 1R8OB 2B8AA 4MZMA 4N4GA 4EMKB 1N27A 1XNIA 2FYKA 3E19A 5CVIA 2E41A 3M59A 2YLCA 3JCMg 1JJ2S 4MZTA 5GAMd 1K73C 5GAOl 3C95A 2EWNA 1BKBA 4D6WA 4E7LA 3CD6A 1Y07A 2DAQA 1X75C 2P4TA 4IUTA 2X35A 2CS7A 1I4K1 4LD6A 3HFNA 5GAN3 2XDDA 2X4XA 4FU6A 4YTLA 1DJ7B 4A53A 4N4IA 2OAUA 2RHXA 2ZZDA 1Q86U 1FWZA 1H641 4LDUA 4P5NA 5KCHA 3CC2A 3HFOA 4A54A 2M0OA 1KHCA 5CKDA 2RM4A 3OMGA 3HKSA 5C6SA 2PUOB 4M7AE 3V8KA 4OB1B 3G6ET 2MAMA 1LNXA 2A3LA 3L42A 2X4WA 5GAOr 3CMEA 4F7UA 2QQSA 2RJCA 2RO0A 2V8JA 2KK4A 4BDYA 1VQKA 4M7AC 4C5HA 1YITT 2V8IA 2CZ6B 5KH6A 5GMKe 4RMOA 5CR2A 3RIRA 4M7DD 3F70A 1UB4A 2RK2A 3BFMA 3P8DA 1M90U 1VQ6A 2QEXT 5GANh 4PLLA 2QDYB 3FC3A 1U1SA 3A8GB 2R57A 4JRKA 4BE0A 3LGFA 3ZBDA 4PJOB 2EYQA 4M7AB 3CC4A 3LH0A 3HRSA 3M56A 3L2RA 5A2QE 1OZ2A 3I55T 4KBMB 2WSCE 1D3BA 2GFAA 3MP6A 3QYHB 1YJWT 3SFMA 4KT0E 2M1HA 4KULA 3TEEA 2Y90A 4BE2A 5CQXA 4M7DC 2EFIA 2XIDA 2DXUA 2I2LA 1VQ5T 3OSSC 5DM7R 5GANf 1YIJA 1NE8A 3GPLA 2O4XA 1N9RA 1UGPB 2EQKA 4PNOA 5LJ5j 2JUFA 2LNVA 4OB2B 5GAMj 3PTAA 2E1HA 5GAN7 3I55A 2YHTA 4M75A 4JLGA 2QQRA 3OYLA 3I56T 4JS4A 3QIIA 1YHQT 2HAXA 3CC2T 3VYHB 4FT2A 5D6XA 4M7DB 2ZPIB 1K8AU 2DZ9A 5J3BA 3S6WA 5FLXE 5J26A 3KXTA 1VIFA 1OYXA 1KQ1A 1YIJT 3JCMb 4QVDA 2LCLA 4E47A 2DPPB 3FIFA 3DLLA 3T9NA 1BI1A 3QHSA 4BDZA 4II1A 1OI1A 3LW5E 4OP0A 4C5IA 1M1KC 3OYHA 3V8JA 3GP8A 2K5LA 1QP2A 1N8RC 2RJEA 3GNFB 5LL6S 1VQMT 2YLBA 1G3TA 3X24B 4C92F 3ZEHA 1K9MC 4ME7A 1TH7A 2DZCA 4FSXA 3RKYA 5KE2A 4E7IA 3VUZA 2E70A 1VQPT 4M77B 3CBMA 2G3RA 3GF5A 3J7AF 2MWOA 4XQ3A 2E12A 4GY5A 3JCMh 3JAME 1W2BS 1K73U 3QDRB 3HSBA 2IG0A 5KE3A 5GAOp 2RJDA 1W2BA 3H8ZA 4M78D 3QJYA 4NL2A 1Q81U 2CZ1B 2H3JA 4L6V5 3WXMB 2MMPA 2XD0A 2R5MA 2HQEA 3M53A 4XTWA 5FU7C 2QA4T 2E65A 1Y7XA 1UGRB 2DVEA 2LVMA 3QKJA 4R55A 3MP8A 3JCMc 3RKWA 1VQ7T 5LJ5d 1YJNA 4E7KA 4C5EA 3G4SA 2PVOB 4CI0C 4VUBA 3OYGA 4M77F 3CC7A 4O5VA 1VQLT 4M75G 1M9SA 2LQKA 1YJ9T 4XTXA 4RG8A 2FHDA 4ELYC 1G3WA 4HKEA 4KUDK 3L2WA 4M7DG 1PSFA 3MO8A 2DXCA 4DQ2A 2LT1A 3NFCA 2D0QB 3CMAT 2KQWA 4F7UF 2D9TA 1XTDA 3M9QA 3OYBA 5L8RE 2M16A 2FB7A 2XU8A 3QYGB 2CKKA 4TVRA 3FRNA 1UEBA 1XOVA 5FRMA 2F5TX 3H6ZA 1VQ4T 3OBWA 3X28B 2F5KA 1Y96B 4UC4A 4CRIA 4JLIA 2DXBA 2RJFA 4M7DE 4LDVA 3JB9G 4C8QB 3J80E 4HT9A 4MMKA 3JCMe 4M7AF 1LOJA 5GANe 4QVZA 4ZGJB 1NPRA 4M7AG 2ZPBB 1H3ZA 3TCJA 1VUBA 2DXTA 1M90C 3EAEA 3L2VA 3L2QA 2DKGA 1O9SA 4L5GA 2DO3A 1I8FA 1WNLA 5GAN8 4JS5A 1KQ2A 5GAOq 3G4ST 4JRIA 1BI3A 3DB3A 4C92C 2QQBA 3OYAA 2LC4A 4XTYA 2QTXA 3A8MB 2XDPA 3CCJT 2DD4A 3MCAB 4C8QE 2RI3A 2M9UA 3VU3C 2MWPA 5HKCA 2V8KA 4J6XA 3HRUA 3CCUT 3TU4K 3JCMW 3ZFJA 3V7CA 3E9GA 1YCYA 4J7IA 3JCMV 3OW2S 2NLUA 5GMKm 1B34B 1SSFA 4M77C 4C8QD 3C4SA 5IN1A 4FM4B 2LT4A 2VGMA 2RI5A 5LJ5g 1NPPA 5GAMg 3V8LA 5DLQE 1FX7A 3ME9A 1Q81C 5IT9E 3HRTA 5FROA 4BI4A 3CCST 2JTMA 4DOWA 1W4SA 5LJ3e 2JOYA 3LX7A 1IREB 1ZHIA 4LDYA 3OS5A 4C0GA 5C0MA 2O01E 4ZTFA 3AHUA 1BI2A 2JNGA 5GAOm 2PQWA 3JSCA 3QXEB 5I21A 1JRIA 2K4YA 2RHIA 2OTLT 3PFSA 3PGGA 4ZGEB 5HK3A 2CZ0B 2D6FA 2DIQA 4RG2A 5FU6C 5FU7B 2DD5A 5LJ3d 4B9WA 4ZGDB 3UT1A 2P0KA 2E5QA 4IUUA 4C0DB 1N8RU 4HCCA 3RMSA 3OYMA 2RHUA 2LCCA 1LJOA 2RI2A 3HP9A 2A7YA 2OTJA 3OYCA 1WJSA 4DA4A 2C06A 2EJFA 5GMKh 2VXEA 3VJPA 5GAN4 1UGSB 2BKDN 3CCJA 4M7AA 4M7DF 1M8VA 4FIBA 3OW2A 4N0AA 3G6EA 2KSSA 3UWNA 3RESA 4OVAA 3CCVT 2ZCFB 2WSFE 1BYMA 2WACA 1EIFA 3S3NA 1MHNA 3L1AA 1YITA 4PKCC 4M75E 3CCLT 4F7UB 3RMQA 3OS0A 4C92A 4J6WA 3PNWC 2EIFA 2RHZA 5CKHA 2RHYA 3JCMf 1VQNT 3L2ZA 3QZ5B 5GAN6 4MZPA 5DLOA 3QSUA 4PJOC 5D6YA 3M55A 3EFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FT2 A;  4BB7 A;  4LD9 K;  4JJN K;  4KUD K;  4DA4 A;  1M4Z A;  4FT4 A;  4DOW A;  1W4S A;  1ZHI A;  4KUL A;  4DOV A;  2FL7 A;  4KUI A;  3TU4 K;  3PT9 A;  2FVU A;  3PTA A;  1ZBX A;  4FSX A; 
#chains in the Genus database with same CATH topology
 1BBZ A;  3RKX A;  2P0Q A;  1GFD A;  2C0T A;  2VC8 A;  2RPN A;  1QVF A;  3P8H A;  3QZ9 B;  1NJI R;  3JCM Q;  1VQK Q;  1OEB A;  1PKT A;  3V7R A;  1YI2 A;  2DL3 A;  4FW1 A;  3VS6 A;  4C0F A;  1KQS A;  1M5Q 1;  1OPK A;  4HCZ A;  3QG1 A;  3OSV A;  1K76 A;  2H3E B;  5A0L A;  2DBK A;  1WX6 A;  4CC2 A;  2K3Y A;  4J6Y A;  8ATC B;  4PJO E;  2BZX A;  1WA7 A;  3CCM Q;  2CRE A;  2I0N A;  2PTK A;  4QW2 A;  1YI2 Q;  1U8R A;  2K2M A;  1UGQ B;  2JVV A;  4PJO D;  2KRO A;  2Y4Y A;  2QEX A;  1WI7 A;  4KGV B;  4EIK A;  2EW3 A;  2SRC A;  4ESR A;  4Z02 A;  4EMK C;  1WHK A;  3BDU A;  2FZG B;  2EQI A;  2M51 A;  1M30 A;  4JPB W;  4J8O A;  1JB0 E;  1VQP A;  3MHX A;  2R58 A;  5GMK j;  4JRQ A;  3CPF A;  2GTO A;  1KQS S;  1BIA A;  3CCS A;  2YWW A;  2AKL A;  2GF7 A;  2NUT A;  1VQ9 A;  1K8A C;  2PUK B;  1WXB A;  1HJD A;  2R5A A;  3EGD B;  4XTZ A;  4Y28 E;  2K9G A;  1PD1 A;  2MF2 A;  2BIV A;  5LJ3 g;  1X6O A;  4JRP A;  3A8O B;  1JBM A;  3PMT A;  1ZLM A;  5FRN A;  4RTW A;  2QAZ A;  2H8H A;  1HD3 A;  1MMA A;  3CD6 T;  2K5I A;  3OA6 A;  1QVG P;  1QKW A;  5GAN j;  3CXC A;  4FL6 A;  4HA8 A;  2PZ1 A;  4OB0 B;  3SWN C;  2FVU A;  1YJ9 A;  3KUF A;  2EBP A;  4N4H A;  2YRV A;  1Q82 U;  2KRS A;  2MK5 A;  2ZGW A;  4AMC A;  2HKN A;  1B34 A;  1WHJ A;  5EC7 A;  1UGV A;  3A8H B;  3CCQ Q;  1WYX A;  1AT1 B;  4N0A C;  1ZQ1 A;  2YRC A;  3VRZ A;  3OS2 A;  2VV5 A;  1VQ8 A;  2NWM A;  4OMN A;  1S72 T;  2L3S A;  2DIG A;  2J05 A;  1EFN A;  5GMK l;  5A0G A;  3JB9 I;  2ED1 A;  2DE0 X;  3GNG A;  4M78 G;  1ACM B;  5M9O A;  4M78 A;  2XG8 D;  3RUX A;  1K9M U;  2XIC A;  2HQX A;  1ZSG A;  4JJC A;  3EGU A;  2VB6 A;  3N5B B;  1AWW A;  2RD1 A;  1NG2 A;  1VQ8 Q;  4E7J A;  1FXX A;  3BDL A;  5FWB A;  4RTV A;  4X1V A;  2QGF B;  1QMC A;  3DLM A;  1X2K A;  1QP3 A;  1Q7Y U;  5KYY A;  4PJO G;  1RI0 A;  3LYI A;  2LNH B;  2EKO A;  4GLK A;  4JJB A;  4M77 A;  4R56 A;  4ORZ A;  4C92 D;  4A4G A;  1YWP A;  1QCO A;  1WHG A;  4PJN A;  4WF2 A;  2YRD A;  5GAM f;  4RCB A;  2QQA A;  2Y4X A;  3JB9 D;  1YP5 A;  3OBY A;  1YHQ A;  1ZBJ A;  2MI6 A;  2CH4 W;  2GCX A;  1NJI C;  3QO3 A;  3EG2 A;  1YN8 A;  1QW1 A;  2LDM A;  3CCM A;  1TOV A;  1QVF S;  2COW A;  1ZBX A;  4NS5 A;  3CCR A;  2PVD B;  1SF9 A;  1ZUK A;  1GXI E;  1W2B P;  1XQH A;  4LDW A;  5CO7 A;  4XK8 E;  2HEQ A;  3I9Q A;  4M75 C;  1UTI A;  1M8M A;  2CGH A;  3CC2 Q;  5KYU B;  2P84 A;  4RKU E;  3G6E Q;  4N4G A;  1UFF A;  1MMG A;  2E41 A;  3CME Q;  2YLC A;  3QDF A;  1VQO Q;  4MZT A;  1K73 C;  1IRX A;  2JM8 A;  1YFN A;  1BKB A;  1I4K 1;  4YTL A;  2V1R A;  4A53 A;  2OAU A;  4AFS C;  1JXM A;  1F1B B;  1UUE A;  1Q86 U;  1T3L A;  1AVZ C;  1ZUU A;  2BZY A;  3GBQ A;  4P5N A;  3HFO A;  4A54 A;  1WXT A;  1VQ5 Q;  2QGG A;  4OB1 B;  3G6E T;  5GAO r;  3CME A;  1Z9Q A;  2RJC A;  2V8J A;  2CSQ A;  1K8A R;  4M7D D;  3PVL A;  3F70 A;  3I56 Q;  2QEX T;  3NGP A;  1U1S A;  4JZ4 A;  3ZBD A;  3CC4 A;  1VA7 A;  1OZ2 A;  2WSC E;  1M90 R;  3MP6 A;  2K6D A;  1YJW T;  5CQX A;  2DXU A;  2I2L A;  3OSS C;  5GAN f;  1NE8 A;  1Z9Z A;  4PNO A;  4OB2 B;  1YHQ T;  2EPD A;  1D1C A;  1VQ4 Q;  5D6X A;  3EG3 A;  1K8A U;  2DZ9 A;  5J3B A;  1VIF A;  1OYX A;  1YIJ T;  1NLP C;  3JCM b;  2X3X D;  2DRM A;  4DBR A;  2MCN A;  3T9N A;  1BI1 A;  1M2V B;  4II1 A;  1N8R C;  5LL6 S;  1RLQ C;  1GFC A;  1G3T A;  2E5K A;  3ZEH A;  4ME7 A;  4FYY B;  1AEY A;  4KGX B;  2DBM A;  1VYT A;  4RTZ A;  2CUB A;  4DBH A;  2MWO A;  4GY5 A;  3JAM E;  1K73 U;  4LUD A;  4J9F A;  5GAO p;  1W2B A;  1NLO C;  4M78 D;  2O31 A;  3QJY A;  2H3J A;  2DM1 A;  4J9H A;  2XD0 A;  2R5M A;  3M53 A;  2A08 A;  1PG5 B;  2PVO B;  4O5V A;  1D0Z A;  1VQL T;  1M9S A;  2FHD A;  2CT3 A;  1T0J A;  4HKE A;  3L2W A;  1K0S A;  2EYW A;  1PSF A;  2DXC A;  1H8K A;  2D9T A;  4J9E A;  2CP0 A;  3OYB A;  5L8R E;  2CKK A;  2J6K A;  1M2V A;  2QA4 Q;  3VRY A;  1Y96 B;  1M3A A;  4JLI A;  1VQ7 Q;  1G2B A;  1LOJ A;  1BCM A;  5KYN A;  1M90 C;  3L2Q A;  2DKG A;  4L5G A;  2RQU A;  3CCS Q;  5GAN 8;  4JS5 A;  1IB8 A;  2DYI A;  1BI3 A;  4C92 C;  2QTX A;  2K3B A;  2DD4 A;  4WTO B;  4C8Q E;  3CCU T;  2V8K A;  1AWX A;  3E9G A;  1B34 B;  1JU5 C;  1SSF A;  2DF6 A;  1T3S A;  1PRL C;  5DLQ E;  1V76 A;  5FRO A;  3CCV Q;  3CCS T;  2JTM A;  5LJ3 e;  3LX7 A;  4WCI A;  1SG5 A;  1BI2 A;  1HYO A;  5GAO m;  5I21 A;  2K4Y A;  3PFS A;  3UF4 A;  1YJ9 Q;  2VAS A;  4ZGE B;  4RG2 A;  5FU6 C;  5FU7 B;  2DD5 A;  1U06 A;  1JXO A;  3CMA Q;  5IHK A;  2RHU A;  3M0R A;  2A7Y A;  2OTJ A;  1WJS A;  1X27 A;  2QDL A;  4M7D F;  2ZAE A;  2EGC A;  4N0A A;  3RES A;  2LZ6 B;  1YIT A;  2JS2 A;  1IO6 A;  3CCL T;  4F7U B;  3OS0 A;  4RTU A;  3JCM f;  2K79 A;  5GAN 6;  4MZP A;  3M55 A;  3H0H A;  1IGU A;  1Y57 A;  4F04 B;  4LD9 K;  2XKO C;  1D1B A;  1WQW A;  1RI9 A;  4NOY A;  4C8Q A;  4ZTJ A;  4PFP A;  1G8X A;  4O6J A;  4XTU A;  4D8K A;  2YUP A;  4B9X A;  3PIO A;  3OYE A;  2QI2 A;  4EMG A;  3CPW S;  2AZS A;  2C0O A;  2MIO A;  2YXY A;  2ED0 A;  3C12 A;  4AFZ C;  2ROL A;  4Z88 A;  3THK A;  2VXF A;  4C8Q C;  4DBQ A;  1MV0 B;  4FT4 A;  1QVG S;  1E6H A;  1WFW A;  2RMO A;  2RB6 A;  2ZPF B;  2L3Q A;  5KYW B;  5GAN g;  4LXC A;  1N6A A;  3CCQ T;  2J7I A;  5AYF A;  2LQ8 A;  1D1A A;  1T0H A;  2FRY A;  3PT9 A;  4X9C A;  5GMK i;  3FJ5 A;  2DJQ A;  1WHM A;  1JJ2 P;  4C92 G;  1R0C B;  2DK3 A;  5I11 A;  4C8Q G;  1BIB A;  1RAH B;  3JCM X;  4MML A;  3HHT B;  4BY6 C;  2RQW A;  1VOM A;  2M0Y A;  3TQ7 P;  3WVD B;  1O75 A;  4PJJ A;  1OU9 A;  4M78 F;  1P92 A;  2XHC A;  2FL7 A;  2KMT A;  2LX9 A;  2O9V A;  2WSE E;  2YUQ A;  1KD1 C;  2L89 A;  1VQ8 T;  4J5Y A;  1J3T A;  3PMI A;  3ASK A;  4DBF A;  2DIL A;  2L2P A;  4EMK A;  1B07 A;  3VUB A;  5LJ5 f;  4M77 E;  3G1J A;  3D7S B;  4HT8 A;  2EVR A;  2FPE A;  4E6R A;  4PK4 A;  2QTV A;  5AT1 B;  4Q5W A;  5GAN 2;  3CXC S;  5FWC A;  2YDL A;  3CC7 Q;  1PSE A;  3I5S A;  1YJW A;  4QVC A;  4M77 G;  3PIP A;  4OMP A;  3CBP A;  3SB2 A;  3CC4 T;  2JXB A;  3CMA A;  1OX8 A;  1K73 R;  4PJO A;  2F1L A;  5CCA A;  5D6W A;  4C92 B;  4FYV B;  3DB4 A;  1GBQ A;  4BD3 A;  4OF1 A;  4EPC A;  2RH2 A;  2LQW A;  1KQS P;  3EFO B;  1RL2 A;  2CT4 A;  3WVE B;  2O9S A;  4M78 C;  4IUR A;  2JN0 A;  4OB3 B;  1BB9 A;  1K1Z A;  2HBP A;  3CC7 T;  3CCR Q;  2MOX A;  2KT1 A;  1MUZ A;  2CSI A;  1SSH A;  2VVK A;  2CZ7 B;  1G3S A;  1OZ3 A;  5LJ3 f;  4FCY A;  2Z0W A;  2KYM A;  2LTO A;  2BUD A;  3M0P A;  3SWN A;  4L59 A;  3G7Z A;  1S72 A;  1YJN T;  1BK2 A;  2VYT A;  2HL3 A;  1UE9 A;  2ZPH B;  4KH1 B;  3CCU A;  1VQO A;  2EQU A;  3IQL A;  1IGQ A;  3BE3 A;  2MPX C;  3Q1J A;  4KRT A;  2RQV A;  3JRZ A;  2VKN A;  1RAA B;  3CD6 Q;  3BW1 A;  4NL3 A;  2EGE A;  4BB7 A;  2XI9 A;  2AK5 A;  2KDS A;  1N9S A;  2HD0 A;  1YWO A;  4EMH A;  4OML A;  3V7S A;  1KD1 U;  2HMA A;  2OI3 A;  2OTL A;  1Q7Y C;  3OYD A;  4C92 E;  5CKE A;  4FSS A;  3HL8 A;  3RNJ A;  2KAF A;  3G71 Q;  4F7U G;  1V29 B;  3OYK A;  3JCM J;  2HQH A;  3C94 A;  2GQV A;  3A8L B;  1ZX6 A;  3VV0 A;  3A98 A;  1N8R R;  1NYG A;  2HSP A;  4QT7 A;  2RA2 A;  1WHH A;  1VQ9 T;  2D1X A;  3OYN A;  2EJ9 A;  5EG2 A;  4EMK B;  1XNI A;  1YIJ Q;  1JJ2 S;  3JCM g;  1OOT A;  2BE9 B;  4D6W A;  1Y07 A;  1X75 C;  1VQ6 Q;  2P4T A;  1X69 A;  4LD6 A;  3HFN A;  2XDD A;  2X4X A;  4FU6 A;  1DJ7 B;  1FWZ A;  2LJ1 A;  5KCH A;  2FZK B;  2DRK A;  2RM4 A;  2PUO B;  2MAM A;  2X4W A;  1GRI A;  2QQS A;  3CPW P;  4QKU A;  2KK4 A;  4BDY A;  5CR2 A;  1I1J A;  1M90 U;  3P8D A;  1VQ6 A;  2DEU A;  3FC3 A;  1I07 A;  3PVQ A;  4BE0 A;  1B7T A;  4PJM A;  3LH0 A;  3HRS A;  1OX9 A;  3L2R A;  4KGZ B;  1M27 C;  3SFM A;  4KT0 E;  2M1H A;  4BE2 A;  2FRW A;  2X9H A;  2ROT A;  5DM7 R;  1PWT A;  2O4X A;  1SRM A;  1UGP B;  2AKK A;  2E1H A;  2YHT A;  4JLG A;  1VQP Q;  4M7D B;  3RDV A;  2YUO A;  1SRL A;  3EHR A;  3KXT A;  4J9G A;  2IPO B;  2A37 A;  4QVD A;  2LCL A;  1NEB A;  2DPP B;  2PNI A;  2O88 A;  4BDZ A;  1Q81 R;  3OYH A;  2K5L A;  1ZSZ C;  1QP2 A;  3GNF B;  1Y0M A;  4C92 F;  1GCQ A;  2E70 A;  1VQP T;  2YT6 A;  4XQ3 A;  2E12 A;  3JCM h;  3QDR B;  2IG0 A;  4RTY A;  3REB B;  1Q81 U;  5FU7 C;  5KYW A;  2QG9 B;  2LVM A;  4R55 A;  2JS0 A;  2NUT B;  3RKW A;  4C5E A;  3AT1 B;  4VUB A;  3OYG A;  3I55 Q;  1MND A;  4M77 F;  4M75 G;  3NPF A;  1YJ9 T;  4XTX A;  2NUP B;  4RG8 A;  1G3W A;  1UHF A;  3MO8 A;  4DQ2 A;  3NFC A;  4Z89 A;  2F2W A;  3M9Q A;  2M16 A;  2XU8 A;  2KYB A;  4TVR A;  1TUC A;  2F5T X;  2D8H A;  3H6Z A;  1VQ4 T;  1S1N A;  2RQR A;  4CRI A;  1KD1 R;  2DXB A;  2OJ2 A;  2CP5 A;  4C8Q B;  3JCM e;  5GAN e;  1NPR A;  1VUB A;  3EAE A;  2OX7 A;  4ZNX A;  2DO3 A;  1WNL A;  1KQ2 A;  4Z8A A;  4D8D A;  4JRI A;  4LN2 A;  5D7U A;  1X2Q A;  2QQB A;  2BTT A;  2LC4 A;  4B6M A;  3A8M B;  1H92 A;  3CCJ T;  1TUG B;  2COZ A;  3VU3 C;  3CXC P;  5HKC A;  3HRU A;  3EGD A;  1YCY A;  3OW2 S;  3JCM V;  1MMD A;  1LCK A;  4M77 C;  3C4S A;  5IN1 A;  3ULR B;  1FX7 A;  1Q95 G;  4BI4 A;  4DOW A;  1Q82 R;  3HSB A;  4LDY A;  1ZHI A;  2C0I A;  5C0M A;  4ZTF A;  2O01 E;  4DEX A;  2DA9 A;  3EFO A;  2DVJ A;  1JRI A;  2D6F A;  4E7Z A;  1PRM C;  1VQN Q;  1RAF B;  3UT1 A;  2E5Q A;  3VS4 A;  5HCK A;  2LCC A;  3HP9 A;  2RF0 A;  4DA4 A;  3QWY A;  2EJF A;  5GMK h;  2VXE A;  5GAN 4;  3H0F A;  4M7A A;  4FIB A;  2WSF E;  3S3N A;  2D8J A;  2CH4 A;  3RMQ A;  4PFO A;  2FO0 A;  1E7O A;  2LP5 A;  2EIF A;  1VQN T;  3L2Z A;  3QZ5 B;  1C1A A;  5DLO A;  1KC8 C;  4BI3 A;  3LWH A;  2QYZ A;  2YUN A;  3GLX A;  3QJ6 A;  4C5G A;  3M4G A;  1I81 A;  1RUW A;  3CCU Q;  5CAI A;  5IXF A;  3LGL A;  4X34 A;  1WJR A;  2CDT A;  2JT4 A;  5J39 A;  1AWO A;  1X6B A;  4PLI A;  4JJD A;  3O8V A;  3OMC A;  4F14 A;  1AZE A;  1JJ2 A;  2LQN A;  2LX7 A;  1NYF A;  1D3B B;  5I2S A;  1CSK A;  2CUD A;  2OTL Q;  1IXD A;  2RK1 A;  3ER0 A;  2SEM A;  2EAY A;  3G71 A;  3OYY A;  4ZN1 A;  4M78 B;  3VS1 A;  3CC4 Q;  2LMJ A;  4XU1 A;  4DOV A;  2F2V A;  4BAC A;  2E10 A;  4HCK A;  2L0A A;  1VQK T;  1AWJ A;  3NTI A;  2FG0 A;  4OGE A;  3SDZ A;  2L3R A;  3FJP A;  2HZY A;  4K11 A;  1U1T A;  4BI8 B;  1RLP C;  3TVT A;  3OW2 P;  2KVQ G;  2F69 A;  4IUQ A;  1QWF A;  5GAN d;  1VQ4 A;  4EDU A;  1RAB B;  3CCR T;  1WDX A;  2F2X A;  2JW4 A;  4XAX B;  4M4Z A;  1PM3 A;  5L23 A;  3EHQ A;  3CCM T;  1TS9 A;  2J06 A;  3KBG A;  1YI2 T;  3OYJ A;  3CCL A;  4RTX A;  3GIB A;  3M0S A;  3HPW A;  4M75 B;  2DMO A;  3X26 B;  4C0D C;  2AZV A;  2PU9 B;  3SWN B;  5CK9 A;  2IVW A;  2XDB A;  2DTO A;  3VKI A;  4IUV A;  1S72 Q;  3RER A;  1ZUY A;  2DJZ A;  2D0N A;  3DKM A;  1RAC B;  1KC8 R;  1D0Y A;  2LJ0 A;  2KEA A;  3LWI A;  5GAO n;  2K3X A;  1RAI B;  1QCN A;  4J7F A;  2DTI A;  5HK0 A;  1M3B A;  1MGQ A;  4PJO F;  1VYU A;  4A4H A;  2P0P A;  2KBT A;  1SHG A;  1G3Y A;  1M1F A;  1ZA2 B;  1UHC A;  2V26 A;  3GOX A;  5GJW B;  1VIE A;  4OMF B;  1D0X A;  4IKF A;  3M57 A;  2COY A;  5FU6 B;  1M1K R;  1BCO A;  4QQG A;  4OMM A;  4X9D A;  2HNI A;  1QCF A;  1RAG B;  3NTK A;  1VQ9 Q;  5GAM h;  4KUI A;  3PE0 A;  2QA4 A;  2X4Y A;  3M4Y A;  1QKX A;  2DET A;  4MDW A;  3QPH A;  3EFR A;  1WQ7 A;  3UA6 A;  1VQ7 A;  1NBE B;  1EZZ B;  4CC3 A;  3SEM A;  1IZ6 A;  4ELZ C;  3MEU A;  3JB9 H;  1PKS A;  4ANJ A;  1TU0 B;  4V2S A;  2GQI A;  1X43 A;  1VQ6 T;  4ATO A;  1KIK A;  1UJY A;  5LJ5 h;  1CKA A;  1Y96 A;  2FPF A;  2AHJ B;  3CEY A;  5A0D A;  1WIE A;  2RNA A;  2E6N A;  4F17 A;  1LPL A;  4IIM A;  3EGX A;  2OTJ T;  3CCQ A;  3X25 B;  1VQL A;  3M54 A;  4J9C A;  4JDS A;  3M0Q A;  3QBY A;  4QQD A;  1IHV A;  4RCC A;  3OYF A;  3CME T;  4LE9 A;  4XU2 A;  1U3O A;  4HCB A;  2DYB A;  2ZPG B;  3I56 A;  1Q86 C;  3OQ5 A;  2EYX A;  4F16 A;  1HK9 A;  3EG9 B;  5FW9 A;  2OTJ Q;  1M3C A;  1QQJ A;  5CKF A;  1WPY A;  3FEO A;  4AG1 C;  1SHF A;  5LJ3 h;  1R8O B;  2ATC B;  4MZM A;  3I35 A;  2JTE A;  5GJV B;  5GAM d;  2ECZ A;  1YIT Q;  3C95 A;  1GCP A;  4E7L A;  2DAQ A;  1KJW A;  1AZG B;  1C0M A;  4OMQ A;  2DER A;  4N4I A;  2ESW A;  2RHX A;  3EGX B;  1H64 1;  2M0O A;  1KHC A;  1KSW A;  5C6S A;  3V8K A;  2A3L A;  1ABO A;  2BZ8 A;  4F7U A;  2J6F A;  2RO0 A;  1VQK A;  1YIT T;  2V8I A;  2RK2 A;  3BFM A;  3H41 A;  4PLL A;  3A8G B;  4JRK A;  3LGF A;  2FEI A;  1K0X A;  4M7A B;  3M56 A;  5A2Q E;  3I55 T;  4KBM B;  2GFA A;  3EG0 A;  4KUL A;  3TEE A;  1VQ5 T;  4FYX B;  1N9R A;  3VS5 A;  5GAM j;  2JUF A;  2LNV A;  5GAN 7;  4AFQ C;  3I56 T;  3VYH B;  2QEX Q;  2ZPI B;  2X3W D;  3S6W A;  1UEC A;  3QHS A;  1OI1 A;  2GTJ A;  4OP0 A;  1M1K C;  1Q86 R;  3TSW A;  2W10 A;  3GP8 A;  1QVF P;  2L3P A;  2RJE A;  1VQM T;  2YLB A;  1K9M C;  3G4S Q;  1X6G A;  3RKY A;  4M77 B;  3GF5 A;  3J7A F;  1AD5 A;  2DL7 A;  3RBB B;  2CP3 A;  3O5Z A;  3H8Z A;  4NL2 A;  4RTT A;  2CZ1 B;  1OUL A;  1K9A A;  2HQE A;  3ZL7 C;  1I0C A;  4XTW A;  2QA4 T;  2E65 A;  1Y7X A;  1UGR B;  2FZC B;  3VS2 A;  3QKJ A;  5IXB A;  1VQ7 T;  5LJ5 d;  1B3Q A;  3G4S A;  4CI0 C;  2A28 A;  2EGA A;  2LQK A;  7AT1 B;  4ELY C;  1ABQ A;  1MNE A;  1WLP B;  1OU8 A;  2DL5 A;  1XTD A;  4E2F B;  2AT1 B;  4AT1 B;  1UEB A;  1XOV A;  2GGR A;  3X28 B;  2F5K A;  4UC4 A;  2LJ3 A;  2RJF A;  4LDV A;  3JB9 G;  4MMK A;  4M7A F;  1IHW A;  4ZGJ B;  2ZPB B;  1H3Z A;  1TG0 A;  1N5Z A;  4GLM A;  3L2V A;  1O9S A;  1I8F A;  1WHL A;  4Y92 A;  3DB3 A;  3OYA A;  3VS0 A;  3NHN A;  4OMO A;  2KXD A;  3EG9 A;  3JCM W;  3TU4 K;  3ZFJ A;  2JMC A;  3V7C A;  4J7I A;  2NLU A;  5GMK m;  2HSE B;  2RI5 A;  5GAM g;  4E7S A;  1Q81 C;  1AOJ A;  1W4S A;  2A36 A;  2AIR B;  2JMA A;  3JSC A;  3QXE B;  2OTL T;  5HK3 A;  2CZ0 B;  3SHW A;  2DIQ A;  1BU1 A;  3VS3 A;  5LJ3 d;  1MMN A;  1JQQ A;  4ZGD B;  5I22 A;  2P0K A;  2OAW A;  2RI2 A;  5IHN A;  2XMF A;  3EG1 A;  2KNB B;  4J9I A;  1M8V A;  2BKD N;  3G6E A;  2KSS A;  3UWN A;  4OVA A;  3CCV T;  2ZCF B;  1EIF A;  1MHN A;  1PCX A;  3L1A A;  6AT1 B;  4PKC C;  2EYZ A;  2KGT A;  4J6W A;  1TSF A;  2LCS A;  2RHY A;  4PJO C;  5D6Y A;  3EFS A;  5I2M A;  3JB9 F;  1SPK A;  4JJN K;  3S3O A;  3CCJ Q;  1Q7Y R;  2KE9 A;  5LJ5 e;  3OB9 A;  1VQ5 A;  1MV3 A;  1ZSZ B;  2O4X B;  1M1G A;  4HVV A;  3U23 A;  2E64 A;  2NUP A;  3CCE A;  1I5L A;  3CCL Q;  1FYN A;  1OQK A;  3FLG A;  2K2V A;  2EQM A;  5KYU A;  1KG1 A;  1K9M R;  3INZ A;  2KT8 A;  3FB9 A;  3SD4 A;  3UDC A;  2ZPE B;  1GBR A;  1UJ0 A;  2CP7 A;  1QVP A;  4Y91 A;  3QWX X;  1X01 A;  4E7H A;  1AHJ B;  4XU0 A;  1YBY A;  2E6Z A;  3LLR A;  1M1K U;  3TRE A;  1SEM A;  4A4K A;  4M7A D;  3R6O A;  3OY9 A;  2HL5 C;  2L5Q A;  2QK0 A;  2KY9 A;  3M58 A;  3E9F A;  1JEG A;  2JJ9 A;  4LDX A;  1SKU B;  3MEV A;  1HXD A;  4BUG A;  2X51 A;  4PFZ A;  3MET A;  3FDR A;  2PVG B;  2DEQ A;  3MJX A;  1Q82 C;  5KYX B;  2K5F A;  2ABL A;  3JB9 J;  3CCE T;  4M78 E;  1KC8 U;  2EKH A;  2HCK A;  1TWB A;  3A1P A;  1NJI U;  3X20 B;  1Y71 A;  2JZ2 A;  1VQM A;  2NUZ A;  3NTH A;  5ECA A;  1D09 B;  1K4U S;  3OYI A;  1QVG A;  2L8D A;  3P8B B;  3RR6 A;  4BY6 B;  5IAY A;  5CIU A;  3MEW A;  3URG A;  3QUI A;  4F7U E;  4LUE A;  1R77 A;  1W70 A;  3E1S A;  4MDX A;  1M4Z A;  3OS1 A;  5GAM e;  1NZ9 A;  3VYG A;  4R0K A;  1FMW A;  4M75 D;  4CC4 B;  3A5Z B;  4M77 D;  2XK0 A;  2K57 A;  1PHT A;  4XU3 A;  1UG1 A;  2GFU A;  3MP1 A;  2VGN A;  3MKD A;  4JUV A;  3EH1 A;  2GBQ A;  3CBO A;  5CQY A;  5KYX A;  4OGC A;  4PL6 A;  3BY7 A;  3J81 E;  2CYZ B;  3CQT A;  1YNZ A;  2DTH A;  1PNJ A;  2V1Q A;  8AT1 B;  3HTR A;  5HY6 A;  2EYY A;  2EJG A;  3MEA A;  1GCQ C;  4J83 A;  5LJ3 j;  1PC0 A;  1FMV A;  1KK7 A;  2P4R A;  1RAE B;  5IH2 A;  4BE1 A;  1QLY A;  2KRM A;  1VQO T;  1QWE A;  4XTV A;  3TSZ A;  4C8Q F;  4ZN3 A;  1I5O B;  2QXF A;  1R0B G;  3G71 T;  2VUB A;  5GAN 5;  1WJQ A;  3UPU A;  2M02 A;  3S3M A;  3C0C A;  2O2O A;  1V1C A;  1KFZ A;  3M5A A;  4IIO A;  2E4H A;  2KRN A;  2G6F X;  4HVW A;  1BI0 A;  3JCM d;  4A4E A;  4M75 F;  2E3H A;  4AG2 C;  1XJW B;  2QQ9 A;  4M7D A;  3CCV A;  3JCM P;  1YJN Q;  2BE7 D;  2DL4 A;  5DY9 A;  2CP2 A;  1G83 A;  5CKB A;  1C6V X;  3LH5 A;  2LRQ A;  2X4J A;  2EQJ A;  3VS7 A;  1ZSZ A;  1VQN A;  1VYV A;  1WGS A;  3MPU B;  3H9N A;  2JTF A;  4IUP A;  3UA7 A;  4C0Z A;  1RAD B;  3REA B;  1G5V A;  1KHI A;  5KCO A;  4KH0 B;  1YHQ Q;  2DNU A;  3CPW A;  3L2U A;  2B8A A;  1N27 A;  3E19 A;  2FYK A;  2HKQ B;  5CVI A;  3M59 A;  5GAO l;  2KR3 A;  4J9D A;  2EWN A;  1WZO A;  3CD6 A;  1WXU A;  4IUT A;  2X35 A;  2CS7 A;  5GAN 3;  2IIM A;  2ZZD A;  2ENM A;  4LDU A;  3CC2 A;  2DX1 A;  1FMK A;  5CKD A;  3E2U A;  3OMG A;  3HKS A;  4M7A E;  2VWF A;  1LNX A;  1U5S A;  3L42 A;  4M7A C;  4C5H A;  5KH6 A;  2CZ6 B;  5GMK e;  4RMO A;  3RIR A;  1UB4 A;  2KI7 A;  2CP6 A;  5GAN h;  2QDY B;  2R57 A;  4PJL A;  4PJO B;  2EYQ A;  5KYY B;  2J6O A;  1D3B A;  1ZA1 B;  3QYH B;  2A0F B;  2Y90 A;  4M7D C;  2EFI A;  2XID A;  3EH2 A;  1YIJ A;  4JZ3 A;  3GPL A;  5LJ5 j;  2EQK A;  3PTA A;  2GNC A;  3I55 A;  4JS4 A;  4M75 A;  3OYL A;  2QQR A;  3QII A;  3CC2 T;  2HAX A;  4FT2 A;  2KXC A;  5FLX E;  5J26 A;  3UAT A;  3NMZ C;  1KQ1 A;  4E47 A;  1TXQ A;  3FIF A;  3DLL A;  1TTH B;  1W6X A;  3LW5 E;  4C5I A;  1HSQ A;  3V8J A;  3X24 B;  4A63 B;  1TH7 A;  2DZC A;  4FSX A;  2MYS A;  5KE2 A;  4E7I A;  3VUZ A;  2HBW A;  3CBM A;  2G3R A;  3JV3 A;  1W2B S;  3KFV A;  1ARK A;  5KE3 A;  4CC7 A;  2RJD A;  1OPL A;  1GL5 A;  4L6V 5;  3WXM B;  2MMP A;  2RN8 A;  2E3I A;  4HVU A;  4HXJ A;  2DVE A;  1M2O A;  3MP8 A;  3JCM c;  5IHI A;  1YJN A;  3H0I A;  4FYW B;  4E7K A;  2NYS A;  1TUD A;  3CC7 A;  1YJW Q;  1H3H A;  4KUD K;  1LVK A;  4M7D G;  9ATC B;  2LT1 A;  2D0Q B;  3CMA T;  2KQW A;  1NEG A;  4F7U F;  4J9B A;  2FB7 A;  3QYG B;  1CKB A;  3FRN A;  5FRM A;  3OBW A;  4M7D E;  2DLP A;  4FW2 A;  3J80 E;  4HT9 A;  2RQT A;  4QVZ A;  2JM9 A;  4M7A G;  3TCJ A;  2DXT A;  3M0U A;  2QAS A;  1VQM Q;  5GAO q;  2DFU A;  1JO8 A;  3G4S T;  4XTY A;  1NM7 A;  4AFU C;  2XDP A;  2DL8 A;  4LNP A;  4DEY A;  3MCA B;  2RI3 A;  2M9U A;  2MWP A;  4J6X A;  2HDA A;  4C8Q D;  4FM4 B;  2LT4 A;  2VGM A;  5LJ5 g;  1NPP A;  3V8L A;  3ME9 A;  5IT9 E;  3HRT A;  2JOY A;  1IRE B;  3OS5 A;  1UDL A;  4C0G A;  3AHU A;  2JNG A;  2PQW A;  2RHI A;  1OV3 A;  1VQL Q;  3PGG A;  4B9W A;  1W1F A;  1N8R U;  4C0D B;  4IUU A;  4HCC A;  3RMS A;  3OYM A;  1YCS B;  1LJO A;  2B86 A;  3OYC A;  2C06 A;  3I5R A;  3CCJ A;  3VJP A;  1UGS B;  4RUG A;  3R6N A;  1A0N B;  3OW2 A;  1PD0 A;  1BYM A;  2WAC A;  1EX4 A;  1E6G A;  4M75 E;  3CCE Q;  2FPD A;  4C92 A;  4GBQ A;  2K7A A;  3M0T A;  3PNW C;  2RHZ A;  5CKH A;  2W0Z A;  4QQ6 A;  2YSQ A;  3QSU A;  4A4F A; 
#chains in the Genus database with same CATH homology
 5I2M A;  4BI3 A;  3LWH A;  1KC8 C;  3GLX A;  3JB9 F;  3QJ6 A;  3RKX A;  4C5G A;  2P0Q A;  3M4G A;  4JJN K;  4LD9 K;  1I81 A;  2XKO C;  3S3O A;  1WQW A;  5LJ5 e;  3OB9 A;  1VQ5 A;  2O4X B;  2VC8 A;  5CAI A;  4NOY A;  1M1G A;  3LGL A;  4X34 A;  4C8Q A;  1QVF A;  3P8H A;  1WJR A;  3QZ9 B;  5J39 A;  4ZTJ A;  3JCM Q;  2E64 A;  3V7R A;  4O6J A;  4PLI A;  4XTU A;  3CCE A;  1YI2 A;  4B9X A;  3O8V A;  3OMC A;  3PIO A;  1I5L A;  3OYE A;  4C0F A;  3FLG A;  1JJ2 A;  1KQS A;  1M5Q 1;  2K2V A;  2QI2 A;  2EQM A;  4EMG A;  1KG1 A;  1D3B B;  5I2S A;  3INZ A;  3CPW S;  3UDC A;  3FB9 A;  4HCZ A;  3SD4 A;  3QG1 A;  2ZPE B;  3C12 A;  3OSV A;  1QVP A;  2VXF A;  4Y91 A;  4C8Q C;  5A0L A;  2RK1 A;  1X01 A;  4E7H A;  3ER0 A;  4FT4 A;  1AHJ B;  1QVG S;  2EAY A;  2K3Y A;  3G71 A;  3OYY A;  4ZN1 A;  4J6Y A;  4M78 B;  4XU0 A;  2RB6 A;  4PJO E;  1YBY A;  2E6Z A;  2ZPF B;  3LLR A;  1M1K U;  4XU1 A;  3TRE A;  4DOV A;  5GAN g;  4BAC A;  2E10 A;  4QW2 A;  1U8R A;  4A4K A;  1VQK T;  1N6A A;  4M7A D;  3NTI A;  3R6O A;  1UGQ B;  3OY9 A;  3CCQ T;  5AYF A;  2JVV A;  2L5Q A;  2LQ8 A;  4PJO D;  2KY9 A;  4OGE A;  3SDZ A;  2Y4Y A;  3PT9 A;  3M58 A;  3E9F A;  2L3R A;  3FJP A;  2QEX A;  4X9C A;  4LDX A;  5GMK i;  3MEV A;  1HXD A;  1U1T A;  4BI8 B;  4BUG A;  4C92 G;  2KVQ G;  2F69 A;  3MET A;  3FDR A;  2PVG B;  2DEQ A;  1Q82 C;  4IUQ A;  2DK3 A;  4Z02 A;  4EMK C;  3BDU A;  4C8Q G;  4J8O A;  1BIB A;  1JB0 E;  2K5F A;  5GAN d;  3JB9 J;  1VQP A;  3CCE T;  3MHX A;  4EDU A;  4M78 E;  4MML A;  3JCM X;  1VQ4 A;  3HHT B;  4BY6 C;  1KC8 U;  2R58 A;  5GMK j;  3CCR T;  3CPF A;  4JRQ A;  1KQS S;  4XAX B;  3WVD B;  1NJI U;  1O75 A;  3X20 B;  1BIA A;  1Y71 A;  3CCS A;  2JZ2 A;  1VQM A;  3CCM T;  2GF7 A;  4M78 F;  1P92 A;  2XHC A;  3NTH A;  2FL7 A;  3KBG A;  1YI2 T;  1VQ9 A;  2KMT A;  3OYI A;  2LX9 A;  3OYJ A;  2PUK B;  2L8D A;  1QVG A;  1K8A C;  3CCL A;  3P8B B;  2R5A A;  2WSE E;  4BY6 B;  5IAY A;  1KD1 C;  2L89 A;  5CIU A;  3GIB A;  1VQ8 T;  3MEW A;  3URG A;  3HPW A;  4J5Y A;  3PMI A;  3ASK A;  4M75 B;  4XTZ A;  3QUI A;  4Y28 E;  2MF2 A;  2BIV A;  4F7U E;  5LJ3 g;  1X6O A;  4JRP A;  3A8O B;  4EMK A;  1JBM A;  3E1S A;  3X26 B;  3PMT A;  3VUB A;  4C0D C;  5FRN A;  4MDX A;  1M4Z A;  5LJ5 f;  3OS1 A;  2PU9 B;  4M77 E;  3SWN B;  5CK9 A;  2IVW A;  5GAM e;  2XDB A;  4HT8 A;  2DTO A;  3CD6 T;  2K5I A;  3OA6 A;  1NZ9 A;  4IUV A;  3VKI A;  3VYG A;  5GAN j;  3RER A;  2DJZ A;  3CXC A;  4M75 D;  4FL6 A;  3A5Z B;  4HA8 A;  3DKM A;  4M77 D;  4Q5W A;  2XK0 A;  5GAN 2;  3CXC S;  2K57 A;  4XU3 A;  2GFU A;  3MP1 A;  1PSE A;  2VGN A;  4OB0 B;  3SWN C;  3LWI A;  2FVU A;  5GAO n;  2K3X A;  1YJ9 A;  3KUF A;  4N4H A;  4QVC A;  1YJW A;  2YRV A;  1Q82 U;  4M77 G;  4A4F A;  3PIP A;  2ZGW A;  4J7F A;  4JUV A;  1B34 A;  2DTI A;  5HK0 A;  3CBP A;  3SB2 A;  3CC4 T;  1MGQ A;  4PJO F;  3CBO A;  3CMA A;  4A4H A;  4PJO A;  2P0P A;  3GOX A;  1G3Y A;  1M1F A;  3A8H B;  5CQY A;  5CCA A;  4OGC A;  5D6W A;  4PL6 A;  3BY7 A;  4C92 B;  1VIE A;  3DB4 A;  3J81 E;  4OMF B;  4N0A C;  1ZQ1 A;  2CYZ B;  4OF1 A;  4BD3 A;  3M57 A;  4IKF A;  3OS2 A;  4EPC A;  5FU6 B;  2VV5 A;  1VQ8 A;  4QQG A;  2RH2 A;  4X9D A;  1S72 T;  2DTH A;  2DIG A;  2HNI A;  1RL2 A;  5HY6 A;  3WVE B;  4M78 C;  5GMK l;  4IUR A;  2EJG A;  2JN0 A;  3NTK A;  5GAM h;  5A0G A;  3JB9 I;  3MEA A;  4OB3 B;  4KUI A;  2HBP A;  3GNG A;  2QA4 A;  2X4Y A;  4M78 G;  4J83 A;  5LJ3 j;  3CC7 T;  3M4Y A;  5M9O A;  4M78 A;  2XG8 D;  3RUX A;  1K9M U;  4MDW A;  3QPH A;  2XIC A;  3EFR A;  1WQ7 A;  2HQX A;  4BE1 A;  1VQ7 A;  2CZ7 B;  1G3S A;  1OZ3 A;  5LJ3 f;  1VQO T;  3N5B B;  1IZ6 A;  4ELZ C;  3MEU A;  4XTV A;  3JB9 H;  4V2S A;  4C8Q F;  4ZN3 A;  2LTO A;  2RD1 A;  2BUD A;  3SWN A;  2QXF A;  1VQ6 T;  4E7J A;  4ATO A;  1FXX A;  3G7Z A;  3BDL A;  4L59 A;  1S72 A;  3G71 T;  1YJN T;  2VYT A;  2VUB A;  2ZPH B;  1WJQ A;  5GAN 5;  3CCU A;  3UPU A;  5LJ5 h;  4QQ6 A;  1Y96 A;  1VQO A;  2EQU A;  3DLM A;  2AHJ B;  1QP3 A;  1Q7Y U;  3Q1J A;  3CEY A;  3S3M A;  4PJO G;  1RI0 A;  3JRZ A;  3LYI A;  5A0D A;  3M5A A;  4GLK A;  2E6N A;  2EKO A;  3BW1 A;  4NL3 A;  4M77 A;  4BB7 A;  2XI9 A;  4R56 A;  4C92 D;  2KDS A;  4A4G A;  1N9S A;  2HD0 A;  4EMH A;  1BI0 A;  3V7S A;  3JCM d;  4WF2 A;  4A4E A;  1KD1 U;  2OTJ T;  3CCQ A;  3X25 B;  5GAM f;  4M75 F;  4RCB A;  1Q7Y C;  2QQA A;  2Y4X A;  3OYD A;  2OTL A;  3JB9 D;  1VQL A;  3M54 A;  3OBY A;  4JDS A;  4C92 E;  5CKE A;  1YHQ A;  2QQ9 A;  3HL8 A;  4M7D A;  3QBY A;  2MI6 A;  4QQD A;  3CCV A;  3JCM P;  2KAF A;  4RCC A;  2GCX A;  1V29 B;  4F7U G;  3OYF A;  1NJI C;  3QO3 A;  4XU2 A;  3CME T;  3OYK A;  5DY9 A;  3JCM J;  1QW1 A;  2LDM A;  3CCM A;  1QVF S;  3C94 A;  2GQV A;  5CKB A;  3A8L B;  4HCB A;  2LRQ A;  3VV0 A;  2X4J A;  2ZPG B;  3I56 A;  1ZBX A;  2EQJ A;  4NS5 A;  1Q86 C;  3CCR A;  2PVD B;  3OQ5 A;  1VQN A;  1WGS A;  2JTF A;  1GXI E;  1XQH A;  1HK9 A;  4IUP A;  4LDW A;  2RA2 A;  5CO7 A;  4XK8 E;  4C0Z A;  4M75 C;  1VQ9 T;  1G5V A;  1KHI A;  3OYN A;  5KCO A;  5CKF A;  2CGH A;  1WPY A;  3FEO A;  2EJ9 A;  3CPW A;  4RKU E;  5EG2 A;  3L2U A;  5LJ3 h;  1R8O B;  2B8A A;  4MZM A;  4N4G A;  4EMK B;  1N27 A;  1XNI A;  2FYK A;  3E19 A;  5CVI A;  2E41 A;  3M59 A;  2YLC A;  3JCM g;  1JJ2 S;  4MZT A;  5GAM d;  1K73 C;  5GAO l;  3C95 A;  2EWN A;  1BKB A;  4D6W A;  4E7L A;  3CD6 A;  1Y07 A;  2DAQ A;  1X75 C;  2P4T A;  4IUT A;  2X35 A;  2CS7 A;  1I4K 1;  4LD6 A;  3HFN A;  5GAN 3;  2XDD A;  2X4X A;  4FU6 A;  4YTL A;  1DJ7 B;  4A53 A;  4N4I A;  2OAU A;  2RHX A;  2ZZD A;  1Q86 U;  1FWZ A;  1H64 1;  4LDU A;  4P5N A;  5KCH A;  3CC2 A;  3HFO A;  4A54 A;  2M0O A;  1KHC A;  5CKD A;  2RM4 A;  3OMG A;  3HKS A;  5C6S A;  2PUO B;  4M7A E;  3V8K A;  4OB1 B;  3G6E T;  2MAM A;  1LNX A;  2A3L A;  3L42 A;  2X4W A;  5GAO r;  3CME A;  4F7U A;  2QQS A;  2RJC A;  2RO0 A;  2V8J A;  2KK4 A;  4BDY A;  1VQK A;  4M7A C;  4C5H A;  1YIT T;  2V8I A;  2CZ6 B;  5KH6 A;  5GMK e;  4RMO A;  5CR2 A;  3RIR A;  4M7D D;  3F70 A;  1UB4 A;  2RK2 A;  3BFM A;  3P8D A;  1M90 U;  1VQ6 A;  2QEX T;  5GAN h;  4PLL A;  2QDY B;  3FC3 A;  1U1S A;  3A8G B;  2R57 A;  4JRK A;  4BE0 A;  3LGF A;  3ZBD A;  4PJO B;  2EYQ A;  4M7A B;  3CC4 A;  3LH0 A;  3HRS A;  3M56 A;  3L2R A;  5A2Q E;  1OZ2 A;  3I55 T;  4KBM B;  2WSC E;  1D3B A;  2GFA A;  3MP6 A;  3QYH B;  1YJW T;  3SFM A;  4KT0 E;  2M1H A;  4KUL A;  3TEE A;  2Y90 A;  4BE2 A;  5CQX A;  4M7D C;  2EFI A;  2XID A;  2DXU A;  2I2L A;  1VQ5 T;  3OSS C;  5DM7 R;  5GAN f;  1YIJ A;  1NE8 A;  3GPL A;  2O4X A;  1N9R A;  1UGP B;  2EQK A;  4PNO A;  5LJ5 j;  2JUF A;  2LNV A;  4OB2 B;  5GAM j;  3PTA A;  2E1H A;  5GAN 7;  3I55 A;  2YHT A;  4M75 A;  4JLG A;  2QQR A;  3OYL A;  3I56 T;  4JS4 A;  3QII A;  1YHQ T;  2HAX A;  3CC2 T;  3VYH B;  4FT2 A;  5D6X A;  4M7D B;  2ZPI B;  1K8A U;  2DZ9 A;  5J3B A;  3S6W A;  5FLX E;  5J26 A;  3KXT A;  1VIF A;  1OYX A;  1KQ1 A;  1YIJ T;  3JCM b;  4QVD A;  2LCL A;  4E47 A;  2DPP B;  3FIF A;  3DLL A;  3T9N A;  1BI1 A;  3QHS A;  4BDZ A;  4II1 A;  1OI1 A;  3LW5 E;  4OP0 A;  4C5I A;  1M1K C;  3OYH A;  3V8J A;  3GP8 A;  2K5L A;  1QP2 A;  1N8R C;  2RJE A;  3GNF B;  5LL6 S;  1VQM T;  2YLB A;  1G3T A;  3X24 B;  4C92 F;  3ZEH A;  1K9M C;  4ME7 A;  1TH7 A;  2DZC A;  4FSX A;  3RKY A;  5KE2 A;  4E7I A;  3VUZ A;  2E70 A;  1VQP T;  4M77 B;  3CBM A;  2G3R A;  3GF5 A;  3J7A F;  2MWO A;  4XQ3 A;  2E12 A;  4GY5 A;  3JCM h;  3JAM E;  1W2B S;  1K73 U;  3QDR B;  3HSB A;  2IG0 A;  5KE3 A;  5GAO p;  2RJD A;  1W2B A;  3H8Z A;  4M78 D;  3QJY A;  4NL2 A;  1Q81 U;  2CZ1 B;  2H3J A;  4L6V 5;  3WXM B;  2MMP A;  2XD0 A;  2R5M A;  2HQE A;  3M53 A;  4XTW A;  5FU7 C;  2QA4 T;  2E65 A;  1Y7X A;  1UGR B;  2DVE A;  2LVM A;  3QKJ A;  4R55 A;  3MP8 A;  3JCM c;  3RKW A;  1VQ7 T;  5LJ5 d;  1YJN A;  4E7K A;  4C5E A;  3G4S A;  2PVO B;  4CI0 C;  4VUB A;  3OYG A;  4M77 F;  3CC7 A;  4O5V A;  1VQL T;  4M75 G;  1M9S A;  2LQK A;  1YJ9 T;  4XTX A;  4RG8 A;  2FHD A;  4ELY C;  1G3W A;  4HKE A;  4KUD K;  3L2W A;  4M7D G;  1PSF A;  3MO8 A;  2DXC A;  4DQ2 A;  2LT1 A;  3NFC A;  2D0Q B;  3CMA T;  2KQW A;  4F7U F;  2D9T A;  1XTD A;  3M9Q A;  3OYB A;  5L8R E;  2M16 A;  2FB7 A;  2XU8 A;  3QYG B;  2CKK A;  4TVR A;  3FRN A;  1UEB A;  1XOV A;  5FRM A;  2F5T X;  3H6Z A;  1VQ4 T;  3OBW A;  3X28 B;  2F5K A;  1Y96 B;  4UC4 A;  4CRI A;  4JLI A;  2DXB A;  2RJF A;  4M7D E;  4LDV A;  3JB9 G;  4C8Q B;  3J80 E;  4HT9 A;  4MMK A;  3JCM e;  4M7A F;  1LOJ A;  5GAN e;  4QVZ A;  4ZGJ B;  1NPR A;  4M7A G;  2ZPB B;  1H3Z A;  3TCJ A;  1VUB A;  2DXT A;  1M90 C;  3EAE A;  3L2V A;  3L2Q A;  2DKG A;  1O9S A;  4L5G A;  2DO3 A;  1I8F A;  1WNL A;  5GAN 8;  4JS5 A;  1KQ2 A;  5GAO q;  3G4S T;  4JRI A;  1BI3 A;  3DB3 A;  4C92 C;  2QQB A;  3OYA A;  2LC4 A;  4XTY A;  2QTX A;  3A8M B;  2XDP A;  3CCJ T;  2DD4 A;  3MCA B;  4C8Q E;  2RI3 A;  2M9U A;  3VU3 C;  2MWP A;  5HKC A;  2V8K A;  4J6X A;  3HRU A;  3CCU T;  3TU4 K;  3JCM W;  3ZFJ A;  3V7C A;  3E9G A;  1YCY A;  4J7I A;  3JCM V;  3OW2 S;  2NLU A;  5GMK m;  1B34 B;  1SSF A;  4M77 C;  4C8Q D;  3C4S A;  5IN1 A;  4FM4 B;  2LT4 A;  2VGM A;  2RI5 A;  5LJ5 g;  1NPP A;  5GAM g;  3V8L A;  5DLQ E;  1FX7 A;  3ME9 A;  1Q81 C;  5IT9 E;  3HRT A;  5FRO A;  4BI4 A;  3CCS T;  2JTM A;  4DOW A;  1W4S A;  5LJ3 e;  2JOY A;  3LX7 A;  1IRE B;  1ZHI A;  4LDY A;  3OS5 A;  4C0G A;  5C0M A;  2O01 E;  4ZTF A;  3AHU A;  1BI2 A;  2JNG A;  5GAO m;  2PQW A;  3JSC A;  3QXE B;  5I21 A;  1JRI A;  2K4Y A;  2RHI A;  2OTL T;  3PFS A;  3PGG A;  4ZGE B;  5HK3 A;  2CZ0 B;  2D6F A;  2DIQ A;  4RG2 A;  5FU6 C;  5FU7 B;  2DD5 A;  5LJ3 d;  4B9W A;  4ZGD B;  3UT1 A;  2P0K A;  2E5Q A;  4IUU A;  4C0D B;  1N8R U;  4HCC A;  3RMS A;  3OYM A;  2RHU A;  2LCC A;  1LJO A;  2RI2 A;  3HP9 A;  2A7Y A;  2OTJ A;  3OYC A;  1WJS A;  4DA4 A;  2C06 A;  2EJF A;  5GMK h;  2VXE A;  3VJP A;  5GAN 4;  1UGS B;  2BKD N;  3CCJ A;  4M7A A;  4M7D F;  1M8V A;  4FIB A;  3OW2 A;  4N0A A;  3G6E A;  2KSS A;  3UWN A;  3RES A;  4OVA A;  3CCV T;  2ZCF B;  2WSF E;  1BYM A;  2WAC A;  1EIF A;  3S3N A;  1MHN A;  3L1A A;  1YIT A;  4PKC C;  4M75 E;  3CCL T;  4F7U B;  3RMQ A;  3OS0 A;  4C92 A;  4J6W A;  3PNW C;  2EIF A;  2RHZ A;  5CKH A;  2RHY A;  3JCM f;  1VQN T;  3L2Z A;  3QZ5 B;  5GAN 6;  4MZP A;  5DLO A;  3QSU A;  4PJO C;  5D6Y A;  3M55 A;  3EFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...