4KUDK

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
KTLKDLDGWQVIITDDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSNEYLKRVSVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/transcription/dna
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 45
structure length 212
sequence length 212
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kudK00
1W4SA 4FSXA 3PT9A 1ZBXA 4FT2A 1ZHIA 4DOWA 1M4ZA 4BB7A 4FT4A 3PTAA 2FVUA 4DOVA 4KUDK 4LD9K 4DA4A 2FL7A 4JJNK 4KUIA 4KULA 3TU4K
chains in the Genus database with same CATH superfamily
4LDUA 1Y7XA 1PNJA 2COWA 3IQLA 4RTWA 5D6YA 5A0GA 2LJ1A 1W2BA 2R57A 4RCCA 3EFOA 3CD6A 4E7KA 2KDSA 3I56Q 3MPUB 1ABQA 2DXCA 2LQ8A 2EQUA 4M75D 2M0OA 1JJ2P 2LVMA 2MCNA 3C0CA 4JUVA 4KRTA 4CI0C 3ZEHA 3THKA 3VS1A 2AK5A 4MDWA 5C6SA 1JU5C 4X34A 1VQ5Q 3VS3A 2CDTA 2VWFA 5LJ5d 2E1HA 3V7SA 3RKXA 2X35A 2E5KA 3V8KA 1TWBA 3CMET 3PFSA 4M78E 2K5LA 1XJWB 2M9UA 4JRIA 2MIOA 4XK8E 1IB8A 3H41A 4N4GA 1YJNT 5CIUA 4J9FA 4XTVA 4FSSA 3LWHA 2KT8A 2NUZA 2CZ1B 4HXJA 3ULRB 4BI8B 4OF1A 2HNIA 3M0TA 4A4EA 1QP2A 2D0QB 1W2BS 3PNWC 1TUGB 1Q82U 3NMZC 3MEWA 4GLKA 4RMOA 2RA2A 4EDUA 3I55Q 2OTJQ 2QTXA 4WCIA 4JS4A 1IXDA 1ZA2B 3M55A 1NLPC 1PKTA 2KK4A 2A37A 2GBQA 1I07A 4Z8AA 5IXBA 3HL8A 2E3HA 4BI3A 1KC8C 4II1A 3UT1A 1YIJQ 4C5EA 3HP9A 1RABB 3PVLA 2EKHA 3E9GA 1NZ9A 2X4YA 2P0PA 2DEUA 4PJOD 1SKUB 1YJWT 1M2OA 1O75A 2QXFA 4XU0A 4OMQA 3NGPA 2V1QA 1X43A 3OYDA 1M3BA 3PMTA 3G6EA 4DOWA 5GANf 4LE9A 3PGGA 5FLXE 5LJ5f 2KRSA 4D8KA 3X20B 3URGA 2DE0X 1YJNA 1RAHB 4QQGA 2E10A 4MDXA 2GFAA 3HPWA 1SRLA 4IKFA 2RJFA 3WVDB 3NTIA 1B07A 4OB1B 2DL7A 1KFZA 2CGHA 4KT0E 2YSQA 3G71Q 1YI2T 3SEMA 3TCJA 1V29B 4E7HA 2XIDA 4C0DB 4IUVA 4IIMA 3RNJA 1AD5A 4CC4B 1M30A 2C0TA 1K9MC 1M1FA 1OU8A 2O9SA 3CCQQ 2JNGA 3OS2A 3A1PA 2A3LA 1EZZB 2YXYA 2ECZA 2J6KA 2KXCA 3CMAQ 1RI9A 1I1JA 1M4ZA 3OSVA 1BK2A 2ED0A 3BDLA 1D3BA 1VQ9Q 2V8IA 1HSQA 3OW2A 2LQKA 1SG5A 2CUDA 5GAMe 3OS5A 3M53A 1UJ0A 3A8GB 1X27A 3CD6Q 2CZ6B 5GAN4 4JRPA 3M4GA 1FXXA 1LPLA 3QZ9B 4LDYA 3PIPA 1K73C 1IRXA 2K5FA 5GAMj 3META 1VQ7Q 3M9QA 4Y28E 2RHXA 5KYUB 1I81A 1UGQB 2CT4A 4FIBA 2KVQG 4RKUE 1MMDA 1ACMB 4JPBW 4DEYA 1WDXA 4F17A 2LQWA 2RB6A 2VUBA 1ZBJA 2E64A 1EX4A 4HKEA 4X1VA 5D6XA 2YWWA 3JB9G 4PLLA 1VQ6Q 1M90U 5CO7A 2QK0A 1TSFA 1YITA 1YI2A 2EWNA 3FC3A 5GMKm 2VYTA 2QA4A 2RMOA 5LL6S 1PSFA 3FB9A 4L5GA 2QTVA 5GAOm 2J6OA 2J6FA 4X9DA 1WLPB 5KYYB 3TEEA 3I56T 3CCSQ 2DL3A 4J9IA 2CP6A 1JQQA 2K79A 4ZN1A 4C5IA 4QT7A 4QKUA 2XI9A 2ROTA 3LW5E 2IIMA 3A98A 3QHSA 1M5Q1 2DPPB 2HL5C 2JMAA 2NUPB 2O31A 2DEQA 2F5KA 2KI7A 3L2ZA 3OYBA 3NHNA 2BZYA 3KXTA 4J7FA 2Y4XA 3A8OB 2HEQA 1GFCA 4CC7A 1Y57A 1GFDA 5DM7R 2MPXC 4C8QA 3SWNC 1YCSB 2YUOA 4M4ZA 2JM8A 1YNZA 2RQUA 3G1JA 1KQ2A 3VU3C 5LJ3e 4J6WA 5GAOp 2E5QA 4A63B 3A8MB 4AMCA 1KSWA 1G83A 1C6VX 4M7DG 1UE9A 1R8OB 2EFIA 2AT1B 3MEVA 3CCMA 5GANh 4JS5A 4KUDK 4Q5WA 3MHXA 4EPCA 5GANg 3RKWA 1JBMA 5LJ5h 3SB2A 5LJ3j 4PJMA 4AG1C 3G6EQ 1QVFA 5LJ5g 5HK3A 2OAWA 4JZ4A 1YP5A 4FYWB 3I55T 2OTJT 1GCQA 2KE9A 3CCJT 2FZCB 2MK5A 3VS4A 3EGUA 1NG2A 3JB9H 1K9AA 1ZQ1A 3HRTA 1K8AR 3RMSA 2A0FB 4K11A 2M1HA 2YHTA 3CBPA 2O9VA 3QDFA 2LCSA 1YIJT 1Y96A 2DAQA 3VYGA 5CVIA 3PT9A 1OX8A 2YT6A 1N8RR 3QWXX 1D0XA 4M7AB 2K9GA 3CCUA 4FL6A 2KYBA 3FIFA 4KGXB 2F2XA 2HSEB 2RHUA 2RO0A 1WA7A 4J9BA 3CXCA 4M7DA 4BE0A 4ELZC 1VQ5A 2KAFA 2FB7A 2RI5A 2RQTA 2ESWA 1TS9A 5AT1B 2NUTA 3OYJA 1BIBA 3OYLA 4C8QE 5A0LA 1VQ8Q 1OULA 2DXBA 3O5ZA 4Z89A 2LP5A 1VQ4A 1RAFB 2HKQB 3JCMf 2LCLA 2QQSA 1LNXA 4N0AA 1M27C 2MAMA 1QCNA 1QVFS 2XD0A 1QVFP 3OYNA 4J7IA 2L0AA 1C1AA 2EYWA 1YBYA 2E70A 1X6OA 4A4FA 3G71T 2CREA 4MMKA 4OMFB 3FJ5A 3CC7A 4FM4B 3WVEB 1X6BA 2PU9B 3I55A 1ZA1B 2D8JA 1WX6A 2IG0A 3CCQT 4M7AF 2PVOB 3OY9A 1WGSA 1I8FA 1GRIA 4M78G 3OYEA 2AHJB 1E6HA 3OYYA 3CMAT 1VQOA 4Y92A 1MMAA 4QVDA 1QLYA 5FROA 4UC4A 1VQ9T 1NE8A 1X69A 4F14A 4BACA 2W10A 2EYZA 5I21A 4XTXA 1YITQ 2JTMA 1H3HA 4VUBA 3TQ7P 2ZAEA 1I0CA 2QA4Q 2DBKA 1D1BA 2HSPA 4FU6A 1ZUYA 3CD6T 1C0MA 4BI4A 2DTOA 4J6XA 4QQ6A 2KRMA 3QYHB 4RCBA 2DM1A 2PUKB 2QDYB 4XU1A 1VQ7T 4AG2C 4OGEA 2E65A 4F7UG 4BY6B 2FPEA 2DJZA 3I5SA 2QGFB 1Q86R 4V2SA 4M77G 1KC8U 1OQKA 2I2LA 1A0NB 1JJ2A 4OVAA 2A28A 4E7SA 4F04B 4QQDA 4FW1A 3UWNA 3JSCA 3MP6A 4FYYB 2EBPA 3JB9I 1XTDA 5EG2A 1S1NA 2VXFA 4CC3A 4TVRA 1VQ6T 4A4GA 1VQKA 1WIEA 2YLCA 1UHCA 4B9XA 3VS5A 1IGQA 4LDVA 5KE3A 1TOVA 1D1CA 2B86A 4M7AD 1RAGB 2D8HA 1AZGB 2DX1A 3L2RA 2CUBA 1NM7A 3CCQA 3H0IA 4JDSA 2MOXA 2RK2A 3CCST 1BIAA 3CCMQ 5GAN7 3CBMA 2G3RA 1PCXA 2Y90A 1SEMA 1QVGP 1MNDA 1MMGA 4C92A 4OB3B 4OMPA 1UFFA 1M2VA 1K0SA 4F7UA 1D0ZA 2B8AA 3VKIA 3DB4A 3OYFA 1RLPC 3EG0A 5KCHA 3H9NA 4PJNA 4M77A 4OB2B 1UUEA 1D3BB 2DF6A 4M75G 2BKDN 1PC0A 3GOXA 3EG2A 1G3TA 1KG1A 4J9EA 3REAB 1JJ2S 4C0GA 1VQ7A 5CKDA 3PIOA 1K9MU 1U1TA 1RI0A 1U8RA 4RTVA 3CPWP 3C94A 3CCEQ 2OTLQ 3CCUQ 1G5VA 4ZGJB 1VOMA 1WHMA 3M4YA 2Y4YA 1K0XA 3S3OA 3CBOA 2DZCA 4BUGA 5GANd 3BE3A 1Z9QA 4C5HA 1E7OA 1B34A 3G6ET 2DL8A 3JCMb 2CP5A 3UATA 1FX7A 3UA6A 4ZN3A 1VQ6A 3JCMh 2YRDA 1W1FA 3C12A 3JCMg 2F2WA 3M0UA 5KE2A 1PG5B 2H8HA 4PLIA 1VQ4Q 2L3QA 1K76A 2DRMA 1K73U 4ELYC 5DLOA 1RAIB 1KQ1A 1YHQA 4LD9K 1MHNA 3CCSA 2XK0A 3OS0A 5IN1A 4F16A 4X9CA 2X4XA 2K57A 4M75A 8AT1B 2KGTA 4B6MA 2LJ0A 4BE1A 3ASKA 3CC7Q 4BY6C 3MCAB 3TVTA 2AIRB 2KRNA 4J5YA 4C92E 1AEYA 1AZEA 1M1KR 3VV0A 4F7UE 3X24B 1Y71A 2COZA 1VQOQ 1PRLC 5A0DA 2BIVA 4M77E 1X2KA 5GJWB 2DETA 1J3TA 2QI2A 2FZKB 4BE2A 4E7IA 2HZYA 4PJOG 2DKGA 1BI3A 1WHGA 4A4KA 4DBFA 1K1ZA 2D6FA 2QASA 4GLMA 4ZNXA 3QG1A 1WQ7A 5I22A 1VQPQ 4L6V5 5GAOn 2PZ1A 3KBGA 5HCKA 2LT4A 3VJPA 2BTTA 4XAXB 1VQMQ 3RDVA 1YCYA 4PJLA 3NTKA 3J7AF 1WFWA 4ORZA 3EGDA 2OX7A 4EMKB 4PFZA 2LT1A 1K4US 1AWJA 3OMGA 4XTZA 2HCKA 3FLGA 2K4YA 2A7YA 3CCVQ 1KD1R 3SWNB 5FW9A 3CC4Q 2KY9A 1VQKQ 2QGGA 5AYFA 1WZOA 3F70A 2J06A 1YITT 2JW4A 4OP0A 4M75E 4KGZB 2CP3A 2XU8A 4J9CA 2QA4T 1X6GA 4GBQA 4PJOA 2EGEA 3P8DA 1B3QA 3M57A 3EGXB 1VIEA 5GANe 5IHIA 4PJJA 4Z88A 4OGCA 2F69A 1QKWA 1SF9A 3OYMA 5LJ5e 5J39A 3CQTA 1FMVA 2E3IA 3H8ZA 4E7JA 1QP3A 4WTOB 1NBEB 3QJYA 1PHTA 1LOJA 2CSIA 4J8OA 1VQ8A 3A5ZB 5GANj 2DA9A 2JN0A 3TREA 4M7DB 1H8KA 5LJ5j 3NTHA 2SRCA 2ED1A 3R6NA 3LGLA 2LTOA 1FWZA 1H3ZA 3I35A 1RACB 3M56A 4KH1B 3QWYA 3ZBDA 4DBHA 2JMCA 2ZPIB 1HXDA 4R56A 2DBMA 1CKBA 3RUXA 4DA4A 1M8MA 4ZGEB 2FL7A 4RTYA 2K6DA 1F1BB 3M54A 2DK3A 4HCZA 1M8VA 1UGRB 4MZPA 4LUEA 5CKFA 3QYGB 5CKEA 2RQRA 1X2QA 2OI3A 4AFZC 3CCMT 4O6JA 5IH2A 1PSEA 4C8QG 1VQLQ 3JV3A 1T0JA 2DIQA 4KBMB 2WACA 2KR3A 2HMAA 2YDLA 3QKJA 1N9RA 4AFQC 1XOVA 4N4HA 3I5RA 4E7LA 4XU3A 1WHKA 3HTRA 3MP1A 1YFNA 2VGNA 1V1CA 2M16A 2O01E 2BZ8A 1UHFA 4CC2A 3EAEA 2HAXA 1RL2A 1WXTA 4M7DF 1D09B 3MEUA 2GQVA 1JXMA 2K3YA 1IZ6A 4ESRA 3ZL7C 1YHQQ 4C8QC 2CH4A 4PJOE 4Z02A 5ECAA 4IUQA 1ZUUA 1YJ9A 3GPLA 2YRVA 1SHGA 2VASA 3I9QA 2V8KA 3L2QA 2PNIA 4JRKA 2C0OA 1ZSGA 1FMKA 3CCRA 2GTJA 1D0YA 1IO6A 3UF4A 2OTLT 3CCUT 1Q7YR 4AFSC 1ZBXA 1Q82R 2J7IA 3EG9B 2XICA 5CCAA 2PVGB 4P5NA 3OMCA 1G8XA 4LXCA 3EFRA 4EMKC 2V26A 1M9SA 2E6ZA 1UEBA 2EW3A 1VQ5T 1D1AA 3DB3A 1R0CB 5J3BA 3FRNA 4CRIA 2RK1A 1GCQC 5KYWA 1M1GA 2EJ9A 3MP8A 2MMPA 2P84A 5KYXB 3JCMd 1G2BA 2DRKA 2FZGB 2P0KA 2DNUA 3RBBB 1VQ4T 2R5AA 2L2PA 2YUPA 4BB7A 2JJ9A 2VGMA 4M78B 3JCMJ 1K8AC 3QUIA 3SFMA 5CKBA 2YLBA 4ZTJA 1QWFA 2EJFA 3G4SQ 4HVWA 2RNAA 1BU1A 1N8RC 3CC7T 1NEBA 4RTXA 1PRMC 4XQ3A 7AT1B 2ZPFB 2CP7A 2PTKA 1TXQA 1KHCA 2LCCA 4BDZA 5CR2A 3S3NA 1SSFA 2JS0A 4IURA 3V8LA 1X01A 3VUBA 5L23A 4M7DC 3FJPA 1YWPA 2XMFA 1GBQA 3UDCA 3OYGA 1VQOT 1M2VB 2ZPGB 1W4SA 4FSXA 3QJ6A 1VYVA 1KQSA 5A2QE 4EMGA 2DYBA 2IPOB 5HK0A 3JCMP 3EFOB 2HQEA 2FPFA 2KT1A 2L3SA 2O4XA 3LH5A 3CCEA 2VC8A 2OTLA 4N0AC 4BDYA 2JXBA 1VQPT 2QQBA 3EH1A 2JM9A 4HVUA 5DY9A 4L59A 5FWBA 4M78F 5FU7C 3HRSA 3CC2Q 1VQMT 4IUTA 3S3MA 2X4WA 2ZZDA 1U3OA 3JCMV 2X4JA 2WSEE 2CKKA 2KSSA 2GFUA 2DL4A 4HCCA 2JS2A 3PVQA 4XTWA 3L2UA 1B34B 3E19A 5I2SA 1GBRA 2EQIA 3QIIA 3T9NA 4RTUA 2DXTA 5CKHA 1NJIR 3CC4T 2DERA 3J80E 3P8HA 1VQKT 1TUCA 4D8DA 1IHVA 4F7UF 3GIBA 2RF0A 3VRZA 2QQRA 2LJ3A 1G3YA 4FW2A 3EG1A 2ZGWA 1TTHB 3CPFA 3VS6A 5EC7A 1G3SA 5KYUA 1YJWQ 1N5ZA 2XG8D 3DKMA 4FCYA 1KQSS 2AKLA 2P0QA 2ATCB 5C0MA 1KQSP 4LDXA 2J05A 1M3AA 3GLXA 3CCLA 3OYHA 1OPLA 1QWEA 1KIKA 4JRQA 4OMOA 3JCMe 1GL5A 5IHKA 2GF7A 3RERA 4HT9A 1UG1A 1QVGA 2P4RA 5KCOA 2K3BA 4KUIA 1M90R 1VQNA 3C4SA 1VQPA 4IUUA 2L3RA 2KQWA 4M78D 5GMKh 3HKSA 1JXOA 4M78C 1IHWA 2VV5A 2DTHA 2CSQA 5DLQE 5KYYA 4IUPA 1YJ9Q 2DLPA 1TU0B 3OYKA 3BW1A 1NLOC 3R6OA 4C92G 1VQMA 1KK7A 1PKSA 2ENMA 3D7SB 1T0HA 3CCRQ 2EKOA 5D7UA 1OPKA 1S72A 4RTTA 1MV0B 2ABLA 2NUPA 2RHYA 3JCMQ 3INZA 2FYKA 3VRYA 2KROA 1VQLT 3CPWA 4EMHA 4MMLA 3LLRA 3DLLA 3CCVA 3FDRA 4QVZA 3CC4A 2CS7A 4NS5A 4C92C 4HVVA 1OOTA 4M7AG 2XDDA 2A08A 2K7AA 1UTIA 1WJSA 1YWOA 1RLQC 4M77C 4NOYA 1WPYA 1EIFA 2XDPA 4ZTFA 1YHQT 2I0NA 1ABOA 1QVGS 2VVKA 2L3PA 5FRNA 2VXEA 2COYA 1X75C 2F5TX 1KHIA 4J83A 4KULA 2EYQA 3M0RA 1R0BG 3VS2A 2CH4W 2VKNA 3QO3A 3M58A 2K5IA 1JB0E 2QEXA 1ZSZA 2HQHA 3JCMX 1JEGA 2RQVA 3RIRA 4JJDA 4PK4A 3LH0A 2E6NA 2X3XD 3JCMW 1AWWA 2HL3A 1Q95G 1VYUA 3CPWS 1CSKA 1Q81R 2JT4A 3JCMc 1I5LA 3UA7A 4M7AA 1UGVA 3VS7A 2LQNA 1OU9A 3V7CA 1OI1A 2C06A 2JZ2A 5CQXA 1VQLA 2FG0A 4M75C 4PNOA 3G4ST 2AZSA 3PMIA 1MGQA 3RMQA 4PL6A 1DJ7B 2RD1A 5FWCA 1VYTA 2NWMA 4RG2A 5CAIA 2MWOA 1WHHA 4PJOF 2E41A 1SRMA 2EGCA 2DMOA 1M1KC 1H641 2DD5A 1BB9A 1T3LA 1RUWA 2JTFA 5IXFA 1JRIA 1KJWA 1AWOA 2LC4A 1YN8A 3QBYA 5GAOq 2EQMA 2E12A 2RM4A 2L5QA 4BD3A 4WF2A 2CP2A 5GAMd 3EFSA 1Y07A 3OB9A 2EIFA 1N27A 2RJCA 5GAOr 3U23A 4OMLA 2LX9A 5M9OA 5HKCA 1SSHA 3CEYA 2R58A 3CC2T 2RPNA 3CCLQ 1Q7YU 2HDAA 5KH6A 5GAN2 1W2BP 2PQWA 2DZ9A 2AZVA 3MO8A 1AVZC 2EVRA 3G7ZA 3CCJQ 1UJYA 1WJQA 2EQJA 1FMWA 4J9DA 1VQ8T 4KGVB 3X28B 2DTIA 1MNEA 2GCXA 4JJCA 1OZ3A 2YRCA 2NLUA 3L1AA 1VQNQ 5D6WA 2C0IA 2HQXA 1BCMA 4C8QB 2X9HA 3S6WA 5KYWB 1KD1C 4OMMA 3RR6A 4M7AE 4J6YA 4LNPA 4FYXB 3X25B 4NL3A 2JTEA 4R55A 3G4SA 1IREB 5GMKl 1ZX6A 3J81E 4PKCC 4PJOC 1S72Q 2PUOB 5GAOl 4R0KA 3E1SA 1VUBA 1V76A 2EJGA 2M02A 1KC8R 2MF2A 1MMNA 1IGUA 3V7RA 5GAN3 4RTZA 5CK9A 4FT2A 1HYOA 1ARKA 1RAAB 2D0NA 3CMEA 2FPDA 2V1RA 2HBWA 5I2MA 4JLIA 1WNLA 1K8AU 4DBRA 4HCBA 1RADB 2XDBA 3RESA 1TUDA 1AHJB 5IAYA 1MUZA 5GAMf 1Y96B 4J9HA 4PFPA 4C0ZA 3M0QA 5GAN8 4C8QF 1QQJA 5GMKi 1N8RU 1YJ9T 3LYIA 1JO8A 3CC2A 1UGPB 1UECA 2O4XB 1G3WA 2LNVA 2H3EB 3KFVA 4HA8A 4JZ3A 4MZTA 2DFUA 2LX7A 3CCRT 1I4K1 5LJ3d 3JB9F 1HD3A 2V8JA 4LUDA 5IHNA 1W70A 2QEXQ 4DBQA 3FEOA 1CKAA 5GAN5 2YUNA 1HJDA 2EYXA 3BFMA 2LRQA 3REBB 2NUTB 3VS0A 1UGSB 3TSZA 2QAZA 1TH7A 3GF5A 5I11A 1QW1A 1LCKA 1GCPA 4A4HA 1NJIU 1K9MR 3EHRA 4MZMA 1MV3A 2RN8A 1YJWA 5L8RE 2QDLA 3HHTB 4XTYA 1ZHIA 5FU7B 4A53A 3M0PA 1OV3A 3SHWA 2RHZA 1UB4A 3A8LB 2JVVA 6AT1B 1Q7YC 1Q82C 2DIGA 3OQ5A 2DJQA 1OZ2A 3O8VA 2F1LA 2ROLA 4RUGA 2IVWA 2X3WD 2BE7D 4IIOA 3OBWA 3ER0A 2JUFA 1VIFA 2O2OA 3H0FA 3HFNA 4C8QD 4E7ZA 3VYHB 1XQHA 4ANJA 4FT4A 1K73R 2KEAA 1XNIA 4E47A 1WI7A 3JAME 1GXIE 2FRWA 3JB9D 3LX7A 3HFOA 3CCET 4HT8A 3GP8A 3QZ5B 3SDZA 3OA6A 2LNHB 2RI2A 2O88A 5LJ3f 3OW2S 2FRYA 3OW2P 1UDLA 2Z0WA 3N5BB 2JOYA 3VUZA 3AHUA 3Q1JA 1AT1B 2DVJA 2WSCE 3TU4K 2DYIA 1Q86U 3QDRB 2MI6A 2LMJA 3M5AA 3X26B 3DLMA 5J26A 2LZ6B 1SHFA 2RI3A 2HD0A 5FU6B 1OX9A 1PD1A 1EFNA 2MWPA 2EQKA 3NPFA 4EIKA 5GMKe 3PTAA 4ATOA 2CP0A 2RJEA 4JJBA 3AT1B 1WJRA 2RHIA 1H92A 2SEMA 1QVPA 1WHJA 2EAYA 1NEGA 3EH2A 2K2MA 3HRUA 2MYSA 3L42A 1N9SA 1BKBA 3BY7A 3ME9A 4C0DC 2P4TA 4KH0B 5GMKj 2FHDA 1AOJA 4RG8A 2OAUA 3E9FA 4QW2A 3P8BB 1N6AA 1SPKA 3H6ZA 4EMKA 4M7DD 3MEAA 4DOVA 2LDMA 4DQ2A 2GNCA 3CCLT 2DO3A 4C92B 3EG3A 4F7UB 3CMEQ 2KMTA 3GNFB 3SWNA 3E2UA 3JB9J 1ZSZB 2DD4A 5GAMh 1YJNQ 4Y91A 2M51A 4M77B 5GAMg 2WSFE 1VQNT 2HBPA 1B7TA 4J9GA 1NYFA 3I56A 1TG0A 3EGXA 1NJIC 1QKXA 1VA7A 1PD0A 2QQ9A 1Q81U 1BI1A 4E6RA 3OYIA 2HKNA 2ZPBB 1I5OB 3L2WA 3A8HB 1S72T 1U06A 3OBYA 2D9TA 2YUQA 3JRZA 1T3SA 1QCFA 2M0YA 2QQAA 1HK9A 5FRMA 1PWTA 5KYNA 4ME7A 2EPDA 2BZXA 3CCVT 4N4IA 1Y0MA 2GGRA 2GQIA 4C92F 2DVEA 3TSWA 2QG9B 2NYSA 1BBZA 1M90C 4D6WA 2CT3A 1E6GA 4M77F 3QSUA 4AT1B 4PFOA 1AWXA 2RH2A 4M75B 3ZFJA 3OYCA 3KUFA 1M3CA 3OYAA 2A36A 2FEIA 2DL5A 3GNGA 9ATCB 1ZLMA 2OTJA 2EGAA 2H3JA 2XKOC 4A54A 1ZUKA 4O5VA 3CCJA 1M1KU 2FVUA 1WQWA 1WXBA 3V8JA 2R5MA 1Q86C 4JJNK 3MKDA 3C95A 4E2FB 4GY5A 2QEXT 1OYXA 3OS1A 2QYZA 2DXUA 5FU6C 4JLGA 2K2VA 3QPHA 3LGFA 1R77A 1YIJA 4C0FA 1P92A 2KNBB 3OSSC 3WXMB 1BYMA 1YI2Q 2CZ0B 1RAEB 3LWIA 3CXCS 3UPUA 5LJ3h 3CXCP 1LVKA 2GTOA 3H0HA 5LJ3g 1BI0A 2CYZB 1NPPA 2K3XA 4LDWA 4XU2A 4LD6A 2AKKA 3EG9A 3M0SA 3QXEB 1BI2A 4LN2A 1OEBA 5CQYA 1NYGA 1PM3A 4M75F 1WHLA 2XHCA 2DILA 4M7DE 1QMCA 1U1SA 2PVDB 1Z9ZA 3EGDB 4C92D 2RQWA 2BUDA 2E4HA 2KXDA 4OB0B 4OMNA 2BE9B 4FYVB 2W0ZA 4HCKA 5GJVB 2L89A 2KYMA 2F2VA 2D1XA 5KYXA 1ZSZC 5IT9E 8ATCB 1WXUA 4NL2A 3L2VA 1KD1U 5HY6A 4M77D 2L8DA 3PE0A 5GAN6 2ZCFB 4AFUC 2X51A 4M78A 1LJOA 2KBTA 1W6XA 4YTLA 1O9SA 2CZ7B 2RJDA 4ZGDB 1QCOA 3G71A 3GBQA 2ZPHB 3MJXA 4C5GA 4XTUA 3HSBA 4PJOB 4B9WA 1NPRA 2FO0A 2OJ2A 1Q81C 1BCOA 4M7AC 4DEXA 3M59A 2ZPEB 1FYNA 1U5SA 3SD4A 1WYXA 3CMAA 3EHQA 2EYYA 3BDUA 2VB6A 4QVCA 3NFCA 1VQ9A 2G6FX 3RKYA
chains in the Genus database with same CATH topology
4JRKA 4LDUA 3OYNA 1Y7XA 3CCRA 4J7IA 2MF2A 5D6YA 2OTLT 5A0GA 3CCUT 3V7RA 1ZBXA 1YBYA 5GAN3 5CK9A 1W2BA 2E70A 1X6OA 2R57A 4FT2A 2XICA 4RCCA 4A4FA 5CCAA 3G71T 2PVGB 4P5NA 3OMCA 3CD6A 3CMEA 3EFRA 4EMKC 4E7KA 4MMKA 4OMFB 2KDSA 3CC7A 4FM4B 3WVEB 5I2MA 2PU9B 3I55A 1M9SA 4JLIA 3OYKA 1WNLA 2E6ZA 1UEBA 1K8AU 2DXCA 2IG0A 2LQ8A 1VQ5T 2EQUA 4HCBA 3DB3A 4M75D 3CCQT 5J3BA 2XDBA 3FRNA 2PVOB 3RESA 4CRIA 4M7AF 2RK1A 3OY9A 2M0OA 1WGSA 2LVMA 1M1GA 1AHJB 2EJ9A 3MP8A 1I8FA 4JUVA 5GAMf 2MMPA 4M78G 5IAYA 1Y96B 3JCMd 3OYEA 4C0ZA 5GAN8 2AHJB 3OYYA 3CMAT 4C8QF 4CI0C 5GMKi 1VQOA 3ZEHA 1N8RU 1YJ9T 3LYIA 2P0KA 1VQ4T 4QVDA 3CC2A 5FROA 1UGPB 2R5AA 4UC4A 1VQ9T 1NE8A 2O4XB 4MDWA 4BB7A 1G3WA 2VGMA 4M78B 5C6SA 2LNVA 3QUIA 4BACA 3SFMA 4HA8A 3JCMJ 1K8AC 4MZTA 3CCRT 4X34A 1I4K1 4XTXA 5LJ3d 2JTMA 5CKBA 5I21A 3JB9F 2YLBA 4ZTJA 4VUBA 5LJ5d 2V8JA 2E1HA 3V7SA 2EJFA 3RKXA 2X35A 4FU6A 3CD6T 3V8KA 3CMET 3PFSA 3FEOA 4BI4A 2DTOA 1N8RC 5GAN5 3CC7T 4M78E 2K5LA 4XQ3A 2M9UA 2ZPFB 4JRIA 4XK8E 3BFMA 4N4GA 1YJNT 5CIUA 4J6XA 4QQ6A 2LRQA 1KHCA 2LCCA 3QYHB 4BDZA 5CR2A 4RCBA 2PUKB 1SSFA 2QDYB 4XU1A 4XTVA 4IURA 3V8LA 3LWHA 1UGSB 4OGEA 1X01A 2CZ1B 2E65A 3VUBA 4F7UG 4BY6B 1TH7A 4M7DC 3FJPA 4BI8B 2DJZA 4OF1A 3GF5A 2HNIA 3UDCA 3OYGA 1VQOT 1QW1A 4V2SA 4M77G 4A4HA 1KC8U 2I2LA 1NJIU 4A4EA 1JJ2A 1QP2A 4OVAA 2ZPGB 2D0QB 1W4SA 3PNWC 4FSXA 3QJ6A 4MZMA 5L8RE 1YJWA 1W2BS 1Q82U 3HHTB 1KQSA 3MEWA 4GLKA 4XTYA 4QQDA 4RMOA 1ZHIA 2RA2A 5FU7B 4EDUA 4EMGA 4A53A 5HK0A 5A2QE 2QTXA 3UWNA 3JCMP 3JSCA 4JS4A 3M55A 2KK4A 3MP6A 2HQEA 2O4XA 3CCEA 3JB9I 2VC8A 2OTLA 1XTDA 4N0AC 5EG2A 4BDYA 2RHZA 2VXFA 3HL8A 4TVRA 1VQ6T 4A4GA 1VQKA 1UB4A 1VQPT 2QQBA 2YLCA 4BI3A 1KC8C 5DY9A 4L59A 3A8LB 4B9XA 4M78F 4LDVA 2JVVA 5FU7C 5KE3A 4II1A 1Q7YC 3HRSA 1Q82C 2DIGA 3OQ5A 3UT1A 1VQMT 4IUTA 4C5EA 3S3MA 4M7AD 1OZ2A 2X4WA 2ZZDA 3HP9A 3O8VA 3L2RA 3CCQA 3JCMV 2X4JA 4JDSA 2IVWA 2RK2A 3CCST 3OBWA 1BIAA 3ER0A 2JUFA 1VIFA 2WSEE 3CBMA 2CKKA 5GAN7 2G3RA 2KSSA 3HFNA 2GFUA 2Y90A 3E9GA 4C8QD 1NZ9A 2X4YA 1XQHA 3VYHB 4HCCA 2P0PA 4FT4A 4PJOD 4XTWA 1YJWT 3L2UA 1XNIA 1B34B 4E47A 4C92A 3E19A 5I2SA 3JAME 1GXIE 4OB3B 1O75A 3QIIA 3T9NA 3JB9D 2DXTA 5CKHA 4F7UA 3LX7A 2QXFA 3HFOA 4XU0A 2B8AA 3CC4T 3VKIA 3CCET 3GP8A 4HT8A 3QZ5B 3DB4A 3SDZA 3OYDA 3OYFA 3G6EA 3PMTA 3J80E 3P8HA 5KCHA 3OA6A 4DOWA 1VQKT 2RI2A 5GANf 4F7UF 4M77A 5LJ3f 3OW2S 4OB2B 3GIBA 3PGGA 5FLXE 1D3BB 4M75G 5LJ5f 2BKDN 2QQRA 1G3YA 3X20B 2ZGWA 3CPFA 3GOXA 3N5BB 3URGA 2JOYA 1G3TA 1G3SA 3VUZA 3Q1JA 1YJNA 3AHUA 1KG1A 4QQGA 2E10A 2WSCE 4MDXA 2XG8D 2GFAA 3DKMA 3HPWA 4C0GA 3TU4K 1Q86U 1JJ2S 5CKDA 1VQ7A 4IKFA 3PIOA 3QDRB 2MI6A 1K9MU 1U1TA 2RJFA 3WVDB 1KQSS 3M5AA 3X26B 1RI0A 2P0QA 5C0MA 4LDXA 1U8RA 3NTIA 3DLMA 3C94A 5J26A 4OB1B 3GLXA 3CCLA 1G5VA 2RI3A 4ZGJB 2HD0A 3OYHA 5FU6B 2CGHA 3M4YA 4KT0E 2Y4YA 2MWPA 3S3OA 4JRQA 1YI2T 3TCJA 3JCMe 1V29B 4E7HA 2XIDA 3CBOA 2EQKA 2GF7A 2DZCA 4IUVA 4BUGA 4C0DB 5GMKe 5GANd 3PTAA 3RERA 4ATOA 4HT9A 1QVGA 2RJEA 4C5HA 1WJRA 5KCOA 2RHIA 1B34A 1K9MC 3G6ET 1M1FA 4KUIA 1QVPA 2EAYA 2JNGA 3JCMb 3OS2A 1VQNA 1FX7A 4ZN3A 1VQ6A 2A3LA 3C4SA 3HRUA 3JCMh 3L42A 1VQPA 4IUUA 2L3RA 1N9SA 2KQWA 4M78D 1BKBA 3BY7A 3C12A 3HKSA 3ME9A 4M78C 3JCMg 5GMKh 2VV5A 2DTHA 5DLQE 4C0DC 2P4TA 4IUPA 5KE2A 5GMKj 2FHDA 1M4ZA 4PLIA 3OSVA 2OAUA 4RG8A 3BW1A 3BDLA 3E9FA 3R6OA 4QW2A 4C92G 1VQMA 1D3BA 3P8BB 2V8IA 1K73U 3OW2A 1N6AA 2LQKA 4ELYC 4M7DD 3H6ZA 4EMKA 3MEAA 4DOVA 5DLOA 1KQ1A 1YHQA 4LD9K 1MHNA 2EKOA 2LDMA 5GAMe 3OS5A 2XK0A 3M53A 4DQ2A 5IN1A 3OS0A 3CCSA 1S72A 3CCLT 4X9CA 2DO3A 2X4XA 4C92B 2K57A 3A8GB 4M75A 2RHYA 4F7UB 4BE1A 2CZ6B 3JCMQ 2KMTA 3GNFB 3SWNA 5GAN4 4JRPA 3M4GA 3INZA 1FXXA 2FYKA 3ASKA 1VQLT 3CPWA 3QZ9B 4EMHA 3JB9J 4MMLA 3LLRA 2DD4A 4BY6C 4LDYA 5GAMh 3MCAB 3PIPA 3DLLA 3CCVA 4Y91A 1K73C 4M77B 2K5FA 5GAMg 3FDRA 4J5YA 4QVZA 5GAMj 3META 2CS7A 2WSFE 3CC4A 3M9QA 4Y28E 4NS5A 4C92E 4C92C 1VQNT 2HBPA 2RHXA 3VV0A 4F7UE 3I56A 1I81A 3X24B 4M7AG 1NJIC 2XDDA 1UGQB 1Y71A 4FIBA 2KVQG 5A0DA 2QQ9A 1WJSA 2BIVA 4M77E 4RKUE 1Q81U 4M77C 1BI1A 4NOYA 1WPYA 2QI2A 1EIFA 3OYIA 2ZPBB 4BE2A 2XDPA 4E7IA 4ZTFA 1YHQT 4PJOG 2DKGA 3L2WA 1BI3A 3A8HB 2RB6A 2VUBA 1S72T 3OBYA 2E64A 4A4KA 2D9TA 1QVGS 3JRZA 4HKEA 5D6XA 2D6FA 5FRNA 2VXEA 3JB9G 1X75C 4PLLA 2QQAA 2F5TX 1HK9A 5FRMA 1KHIA 1WQ7A 3QG1A 4J83A 4KULA 5CO7A 1M90U 1YITA 4L6V5 4ME7A 2EYQA 1YI2A 2EWNA 5GAOn 3KBGA 3FC3A 5GMKm 3CCVT 2LT4A 3VJPA 2VYTA 4N4IA 2QA4A 4XAXB 3QO3A 3M58A 2K5IA 5LL6S 1PSFA 1JB0E 3FB9A 4L5GA 2QEXA 5GAOm 4X9DA 3JCMX 4C92F 1YCYA 3TEEA 2DVEA 3NTKA 3I56T 3J7AF 3RIRA 3LH0A 1M90C 4D6WA 4ZN1A 4EMKB 4C5IA 2E6NA 2XI9A 4M77F 3QSUA 3LW5E 2LT1A 3OMGA 2RH2A 3QHSA 3JCMW 4XTZA 3FLGA 1M5Q1 2K4YA 4M75B 2DPPB 2A7YA 3ZFJA 3OYCA 3CPWS 2DEQA 3SWNB 2F5KA 3KUFA 3JCMc 3OYAA 3L2ZA 3OYBA 1I5LA 4M7AA 2KY9A 3KXTA 4J7FA 3GNGA 5AYFA 3V7CA 2Y4XA 3A8OB 3F70A 2OTJA 1YITT 1OI1A 2H3JA 2XKOC 4A54A 2C06A 4O5VA 3CCJA 2JZ2A 1M1KU 2FVUA 1WQWA 5CQXA 4OP0A 4M75E 3S3NA 5DM7R 2XU8A 4M75C 3V8JA 1VQLA 2R5MA 2QA4T 4C8QA 1Q86C 4JJNK 4PNOA 3G4ST 4PJOA 3P8DA 3PMIA 3C95A 3M57A 4GY5A 3SWNC 2QEXT 1MGQA 3RMQA 4PL6A 1DJ7B 2RD1A 1OYXA 3OS1A 4RG2A 1VIEA 5CAIA 2DXUA 5FU6C 5GANe 1KQ2A 4JLGA 2K2VA 2MWOA 3VU3C 3QPHA 5LJ3e 4PJOF 4OGCA 2F69A 4J6WA 5GAOp 2E5QA 2E41A 3A8MB 3LGFA 5LJ5e 3OYMA 1YIJA 4C0FA 1P92A 5J39A 4M7DG 3H8ZA 4E7JA 3OSSC 1R8OB 1H641 2EFIA 1QP3A 2DD5A 1M1KC 3WXMB 3QJYA 1BYMA 3MEVA 2CZ0B 3CCMA 5GANh 3LWIA 2JTFA 3CXCS 4Q5WA 4JS5A 3UPUA 5LJ3h 4KUDK 3MHXA 4EPCA 1LOJA 4J8OA 5GANg 1VQ8A 3RKWA 3A5ZB 1JBMA 5GANj 1JRIA 2JN0A 3TREA 5LJ3g 3SB2A 5LJ5h 5LJ3j 4M7DB 2LC4A 1BI0A 1QVFA 2CYZB 3QBYA 5LJ5g 5HK3A 1NPPA 5GAOq 2EQMA 3NTHA 2K3XA 2E12A 5LJ5j 4LDWA 2RM4A 2L5QA 4XU2A 4BD3A 3LGLA 4LD6A 4WF2A 3I55T 1VQ7T 2OTJT 2LTOA 1FWZA 3QXEB 1BI2A 5GAMd 3CCJT 1H3ZA 3EFSA 5CQYA 1Y07A 3OB9A 2EIFA 1N27A 4M75F 3M56A 2XHCA 3ZBDA 3JB9H 4M7DE 1U1SA 1ZQ1A 2PVDB 2RJCA 2ZPIB 1HXDA 4C92D 4R56A 3HRTA 5GAOr 2BUDA 4OB0B 3RMSA 3RUXA 4DA4A 4ZGEB 2FL7A 2M1HA 2YHTA 3CBPA 2L89A 2LX9A 5M9OA 3M54A 2DK3A 3CEYA 5HKCA 2R58A 4HCZA 3CC2T 1YIJT 1M8VA 1Y96A 1UGRB 5IT9E 2DAQA 4MZPA 3VYGA 1Q7YU 5KH6A 5CVIA 5GAN2 4NL2A 2PQWA 2DZ9A 3PT9A 3MO8A 5CKFA 3QYGB 4M77D 5CKEA 5HY6A 3L2VA 1KD1U 2L8DA 3G7ZA 3CCMT 5GAN6 4O6JA 2ZCFB 1PSEA 4C8QG 1WJQA 4M7AB 2EQJA 1VQ8T 4M78A 1LJOA 2DIQA 3CCUA 4FL6A 4KBMB 3X28B 2DTIA 4YTLA 1O9SA 2CZ7B 2GCXA 2WACA 1OZ3A 3FIFA 2RJDA 4ZGDB 2NLUA 3L1AA 3G71A 5D6WA 2RHUA 2ZPHB 4C5GA 2HQXA 3QKJA 2RO0A 1N9RA 4XTUA 4C8QB 3HSBA 1XOVA 4N4HA 4E7LA 4XU3A 4B9WA 3CXCA 4M7DA 1NPRA 4PJOB 3MP1A 3S6WA 1KD1C 4BE0A 4ELZC 2VGNA 1Q81C 4M7AE 1VQ5A 4M7AC 4J6YA 3X25B 2KAFA 2M16A 4NL3A 4R55A 2O01E 2FB7A 3M59A 2ZPEB 2RI5A 3EAEA 2HAXA 1RL2A 3G4SA 4M7DF 3SD4A 3MEUA 2GQVA 2K3YA 3OYJA 1IREB 1IZ6A 1BIBA 5GMKl 3OYLA 4C8QE 5A0LA 3J81E 4C8QC 4PKCC 2DXBA 4PJOE 4Z02A 3CMAA 4PJOC 4IUQA 2PUOB 3BDUA 1YJ9A 5GAOl 4QVCA 3GPLA 3E1SA 1VUBA 2YRVA 1VQ4A 3JCMf 3NFCA 2LCLA 2EJGA 2V8KA 2QQSA 1LNXA 4N0AA 3L2QA 2MAMA 1VQ9A 1QVFS 2XD0A 3RKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4S A;  4FSX A;  3PT9 A;  1ZBX A;  4FT2 A;  1ZHI A;  4DOW A;  1M4Z A;  4BB7 A;  4FT4 A;  3PTA A;  2FVU A;  4DOV A;  4KUD K;  4LD9 K;  4DA4 A;  2FL7 A;  4JJN K;  4KUI A;  4KUL A;  3TU4 K; 
#chains in the Genus database with same CATH topology
 4LDU A;  1Y7X A;  1PNJ A;  2COW A;  3IQL A;  4RTW A;  5D6Y A;  5A0G A;  2LJ1 A;  1W2B A;  2R57 A;  4RCC A;  3EFO A;  3CD6 A;  4E7K A;  2KDS A;  3I56 Q;  3MPU B;  1ABQ A;  2DXC A;  2LQ8 A;  2EQU A;  4M75 D;  2M0O A;  1JJ2 P;  2LVM A;  2MCN A;  3C0C A;  4JUV A;  4KRT A;  4CI0 C;  3ZEH A;  3THK A;  3VS1 A;  2AK5 A;  4MDW A;  5C6S A;  1JU5 C;  4X34 A;  1VQ5 Q;  3VS3 A;  2CDT A;  2VWF A;  5LJ5 d;  2E1H A;  3V7S A;  3RKX A;  2X35 A;  2E5K A;  3V8K A;  1TWB A;  3CME T;  3PFS A;  4M78 E;  2K5L A;  1XJW B;  2M9U A;  4JRI A;  2MIO A;  4XK8 E;  1IB8 A;  3H41 A;  4N4G A;  1YJN T;  5CIU A;  4J9F A;  4XTV A;  4FSS A;  3LWH A;  2KT8 A;  2NUZ A;  2CZ1 B;  4HXJ A;  3ULR B;  4BI8 B;  4OF1 A;  2HNI A;  3M0T A;  4A4E A;  1QP2 A;  2D0Q B;  1W2B S;  3PNW C;  1TUG B;  1Q82 U;  3NMZ C;  3MEW A;  4GLK A;  4RMO A;  2RA2 A;  4EDU A;  3I55 Q;  2OTJ Q;  2QTX A;  4WCI A;  4JS4 A;  1IXD A;  1ZA2 B;  3M55 A;  1NLP C;  1PKT A;  2KK4 A;  2A37 A;  2GBQ A;  1I07 A;  4Z8A A;  5IXB A;  3HL8 A;  2E3H A;  4BI3 A;  1KC8 C;  4II1 A;  3UT1 A;  1YIJ Q;  4C5E A;  3HP9 A;  1RAB B;  3PVL A;  2EKH A;  3E9G A;  1NZ9 A;  2X4Y A;  2P0P A;  2DEU A;  4PJO D;  1SKU B;  1YJW T;  1M2O A;  1O75 A;  2QXF A;  4XU0 A;  4OMQ A;  3NGP A;  2V1Q A;  1X43 A;  3OYD A;  1M3B A;  3PMT A;  3G6E A;  4DOW A;  5GAN f;  4LE9 A;  3PGG A;  5FLX E;  5LJ5 f;  2KRS A;  4D8K A;  3X20 B;  3URG A;  2DE0 X;  1YJN A;  1RAH B;  4QQG A;  2E10 A;  4MDX A;  2GFA A;  3HPW A;  1SRL A;  4IKF A;  2RJF A;  3WVD B;  3NTI A;  1B07 A;  4OB1 B;  2DL7 A;  1KFZ A;  2CGH A;  4KT0 E;  2YSQ A;  3G71 Q;  1YI2 T;  3SEM A;  3TCJ A;  1V29 B;  4E7H A;  2XID A;  4C0D B;  4IUV A;  4IIM A;  3RNJ A;  1AD5 A;  4CC4 B;  1M30 A;  2C0T A;  1K9M C;  1M1F A;  1OU8 A;  2O9S A;  3CCQ Q;  2JNG A;  3OS2 A;  3A1P A;  2A3L A;  1EZZ B;  2YXY A;  2ECZ A;  2J6K A;  2KXC A;  3CMA Q;  1RI9 A;  1I1J A;  1M4Z A;  3OSV A;  1BK2 A;  2ED0 A;  3BDL A;  1D3B A;  1VQ9 Q;  2V8I A;  1HSQ A;  3OW2 A;  2LQK A;  1SG5 A;  2CUD A;  5GAM e;  3OS5 A;  3M53 A;  1UJ0 A;  3A8G B;  1X27 A;  3CD6 Q;  2CZ6 B;  5GAN 4;  4JRP A;  3M4G A;  1FXX A;  1LPL A;  3QZ9 B;  4LDY A;  3PIP A;  1K73 C;  1IRX A;  2K5F A;  5GAM j;  3MET A;  1VQ7 Q;  3M9Q A;  4Y28 E;  2RHX A;  5KYU B;  1I81 A;  1UGQ B;  2CT4 A;  4FIB A;  2KVQ G;  4RKU E;  1MMD A;  1ACM B;  4JPB W;  4DEY A;  1WDX A;  4F17 A;  2LQW A;  2RB6 A;  2VUB A;  1ZBJ A;  2E64 A;  1EX4 A;  4HKE A;  4X1V A;  5D6X A;  2YWW A;  3JB9 G;  4PLL A;  1VQ6 Q;  1M90 U;  5CO7 A;  2QK0 A;  1TSF A;  1YIT A;  1YI2 A;  2EWN A;  3FC3 A;  5GMK m;  2VYT A;  2QA4 A;  2RMO A;  5LL6 S;  1PSF A;  3FB9 A;  4L5G A;  2QTV A;  5GAO m;  2J6O A;  2J6F A;  4X9D A;  1WLP B;  5KYY B;  3TEE A;  3I56 T;  3CCS Q;  2DL3 A;  4J9I A;  2CP6 A;  1JQQ A;  2K79 A;  4ZN1 A;  4C5I A;  4QT7 A;  4QKU A;  2XI9 A;  2ROT A;  3LW5 E;  2IIM A;  3A98 A;  3QHS A;  1M5Q 1;  2DPP B;  2HL5 C;  2JMA A;  2NUP B;  2O31 A;  2DEQ A;  2F5K A;  2KI7 A;  3L2Z A;  3OYB A;  3NHN A;  2BZY A;  3KXT A;  4J7F A;  2Y4X A;  3A8O B;  2HEQ A;  1GFC A;  4CC7 A;  1Y57 A;  1GFD A;  5DM7 R;  2MPX C;  4C8Q A;  3SWN C;  1YCS B;  2YUO A;  4M4Z A;  2JM8 A;  1YNZ A;  2RQU A;  3G1J A;  1KQ2 A;  3VU3 C;  5LJ3 e;  4J6W A;  5GAO p;  2E5Q A;  4A63 B;  3A8M B;  4AMC A;  1KSW A;  1G83 A;  1C6V X;  4M7D G;  1UE9 A;  1R8O B;  2EFI A;  2AT1 B;  3MEV A;  3CCM A;  5GAN h;  4JS5 A;  4KUD K;  4Q5W A;  3MHX A;  4EPC A;  5GAN g;  3RKW A;  1JBM A;  5LJ5 h;  3SB2 A;  5LJ3 j;  4PJM A;  4AG1 C;  3G6E Q;  1QVF A;  5LJ5 g;  5HK3 A;  2OAW A;  4JZ4 A;  1YP5 A;  4FYW B;  3I55 T;  2OTJ T;  1GCQ A;  2KE9 A;  3CCJ T;  2FZC B;  2MK5 A;  3VS4 A;  3EGU A;  1NG2 A;  3JB9 H;  1K9A A;  1ZQ1 A;  3HRT A;  1K8A R;  3RMS A;  2A0F B;  4K11 A;  2M1H A;  2YHT A;  3CBP A;  2O9V A;  3QDF A;  2LCS A;  1YIJ T;  1Y96 A;  2DAQ A;  3VYG A;  5CVI A;  3PT9 A;  1OX8 A;  2YT6 A;  1N8R R;  3QWX X;  1D0X A;  4M7A B;  2K9G A;  3CCU A;  4FL6 A;  2KYB A;  3FIF A;  4KGX B;  2F2X A;  2HSE B;  2RHU A;  2RO0 A;  1WA7 A;  4J9B A;  3CXC A;  4M7D A;  4BE0 A;  4ELZ C;  1VQ5 A;  2KAF A;  2FB7 A;  2RI5 A;  2RQT A;  2ESW A;  1TS9 A;  5AT1 B;  2NUT A;  3OYJ A;  1BIB A;  3OYL A;  4C8Q E;  5A0L A;  1VQ8 Q;  1OUL A;  2DXB A;  3O5Z A;  4Z89 A;  2LP5 A;  1VQ4 A;  1RAF B;  2HKQ B;  3JCM f;  2LCL A;  2QQS A;  1LNX A;  4N0A A;  1M27 C;  2MAM A;  1QCN A;  1QVF S;  2XD0 A;  1QVF P;  3OYN A;  4J7I A;  2L0A A;  1C1A A;  2EYW A;  1YBY A;  2E70 A;  1X6O A;  4A4F A;  3G71 T;  2CRE A;  4MMK A;  4OMF B;  3FJ5 A;  3CC7 A;  4FM4 B;  3WVE B;  1X6B A;  2PU9 B;  3I55 A;  1ZA1 B;  2D8J A;  1WX6 A;  2IG0 A;  3CCQ T;  4M7A F;  2PVO B;  3OY9 A;  1WGS A;  1I8F A;  1GRI A;  4M78 G;  3OYE A;  2AHJ B;  1E6H A;  3OYY A;  3CMA T;  1VQO A;  4Y92 A;  1MMA A;  4QVD A;  1QLY A;  5FRO A;  4UC4 A;  1VQ9 T;  1NE8 A;  1X69 A;  4F14 A;  4BAC A;  2W10 A;  2EYZ A;  5I21 A;  4XTX A;  1YIT Q;  2JTM A;  1H3H A;  4VUB A;  3TQ7 P;  2ZAE A;  1I0C A;  2QA4 Q;  2DBK A;  1D1B A;  2HSP A;  4FU6 A;  1ZUY A;  3CD6 T;  1C0M A;  4BI4 A;  2DTO A;  4J6X A;  4QQ6 A;  2KRM A;  3QYH B;  4RCB A;  2DM1 A;  2PUK B;  2QDY B;  4XU1 A;  1VQ7 T;  4AG2 C;  4OGE A;  2E65 A;  4F7U G;  4BY6 B;  2FPE A;  2DJZ A;  3I5S A;  2QGF B;  1Q86 R;  4V2S A;  4M77 G;  1KC8 U;  1OQK A;  2I2L A;  1A0N B;  1JJ2 A;  4OVA A;  2A28 A;  4E7S A;  4F04 B;  4QQD A;  4FW1 A;  3UWN A;  3JSC A;  3MP6 A;  4FYY B;  2EBP A;  3JB9 I;  1XTD A;  5EG2 A;  1S1N A;  2VXF A;  4CC3 A;  4TVR A;  1VQ6 T;  4A4G A;  1VQK A;  1WIE A;  2YLC A;  1UHC A;  4B9X A;  3VS5 A;  1IGQ A;  4LDV A;  5KE3 A;  1TOV A;  1D1C A;  2B86 A;  4M7A D;  1RAG B;  2D8H A;  1AZG B;  2DX1 A;  3L2R A;  2CUB A;  1NM7 A;  3CCQ A;  3H0I A;  4JDS A;  2MOX A;  2RK2 A;  3CCS T;  1BIA A;  3CCM Q;  5GAN 7;  3CBM A;  2G3R A;  1PCX A;  2Y90 A;  1SEM A;  1QVG P;  1MND A;  1MMG A;  4C92 A;  4OB3 B;  4OMP A;  1UFF A;  1M2V A;  1K0S A;  4F7U A;  1D0Z A;  2B8A A;  3VKI A;  3DB4 A;  3OYF A;  1RLP C;  3EG0 A;  5KCH A;  3H9N A;  4PJN A;  4M77 A;  4OB2 B;  1UUE A;  1D3B B;  2DF6 A;  4M75 G;  2BKD N;  1PC0 A;  3GOX A;  3EG2 A;  1G3T A;  1KG1 A;  4J9E A;  3REA B;  1JJ2 S;  4C0G A;  1VQ7 A;  5CKD A;  3PIO A;  1K9M U;  1U1T A;  1RI0 A;  1U8R A;  4RTV A;  3CPW P;  3C94 A;  3CCE Q;  2OTL Q;  3CCU Q;  1G5V A;  4ZGJ B;  1VOM A;  1WHM A;  3M4Y A;  2Y4Y A;  1K0X A;  3S3O A;  3CBO A;  2DZC A;  4BUG A;  5GAN d;  3BE3 A;  1Z9Q A;  4C5H A;  1E7O A;  1B34 A;  3G6E T;  2DL8 A;  3JCM b;  2CP5 A;  3UAT A;  1FX7 A;  3UA6 A;  4ZN3 A;  1VQ6 A;  3JCM h;  2YRD A;  1W1F A;  3C12 A;  3JCM g;  2F2W A;  3M0U A;  5KE2 A;  1PG5 B;  2H8H A;  4PLI A;  1VQ4 Q;  2L3Q A;  1K76 A;  2DRM A;  1K73 U;  4ELY C;  5DLO A;  1RAI B;  1KQ1 A;  1YHQ A;  4LD9 K;  1MHN A;  3CCS A;  2XK0 A;  3OS0 A;  5IN1 A;  4F16 A;  4X9C A;  2X4X A;  2K57 A;  4M75 A;  8AT1 B;  2KGT A;  4B6M A;  2LJ0 A;  4BE1 A;  3ASK A;  3CC7 Q;  4BY6 C;  3MCA B;  3TVT A;  2AIR B;  2KRN A;  4J5Y A;  4C92 E;  1AEY A;  1AZE A;  1M1K R;  3VV0 A;  4F7U E;  3X24 B;  1Y71 A;  2COZ A;  1VQO Q;  1PRL C;  5A0D A;  2BIV A;  4M77 E;  1X2K A;  5GJW B;  2DET A;  1J3T A;  2QI2 A;  2FZK B;  4BE2 A;  4E7I A;  2HZY A;  4PJO G;  2DKG A;  1BI3 A;  1WHG A;  4A4K A;  4DBF A;  1K1Z A;  2D6F A;  2QAS A;  4GLM A;  4ZNX A;  3QG1 A;  1WQ7 A;  5I22 A;  1VQP Q;  4L6V 5;  5GAO n;  2PZ1 A;  3KBG A;  5HCK A;  2LT4 A;  3VJP A;  2BTT A;  4XAX B;  1VQM Q;  3RDV A;  1YCY A;  4PJL A;  3NTK A;  3J7A F;  1WFW A;  4ORZ A;  3EGD A;  2OX7 A;  4EMK B;  4PFZ A;  2LT1 A;  1K4U S;  1AWJ A;  3OMG A;  4XTZ A;  2HCK A;  3FLG A;  2K4Y A;  2A7Y A;  3CCV Q;  1KD1 R;  3SWN B;  5FW9 A;  3CC4 Q;  2KY9 A;  1VQK Q;  2QGG A;  5AYF A;  1WZO A;  3F70 A;  2J06 A;  1YIT T;  2JW4 A;  4OP0 A;  4M75 E;  4KGZ B;  2CP3 A;  2XU8 A;  4J9C A;  2QA4 T;  1X6G A;  4GBQ A;  4PJO A;  2EGE A;  3P8D A;  1B3Q A;  3M57 A;  3EGX B;  1VIE A;  5GAN e;  5IHI A;  4PJJ A;  4Z88 A;  4OGC A;  2F69 A;  1QKW A;  1SF9 A;  3OYM A;  5LJ5 e;  5J39 A;  3CQT A;  1FMV A;  2E3I A;  3H8Z A;  4E7J A;  1QP3 A;  4WTO B;  1NBE B;  3QJY A;  1PHT A;  1LOJ A;  2CSI A;  4J8O A;  1VQ8 A;  3A5Z B;  5GAN j;  2DA9 A;  2JN0 A;  3TRE A;  4M7D B;  1H8K A;  5LJ5 j;  3NTH A;  2SRC A;  2ED1 A;  3R6N A;  3LGL A;  2LTO A;  1FWZ A;  1H3Z A;  3I35 A;  1RAC B;  3M56 A;  4KH1 B;  3QWY A;  3ZBD A;  4DBH A;  2JMC A;  2ZPI B;  1HXD A;  4R56 A;  2DBM A;  1CKB A;  3RUX A;  4DA4 A;  1M8M A;  4ZGE B;  2FL7 A;  4RTY A;  2K6D A;  1F1B B;  3M54 A;  2DK3 A;  4HCZ A;  1M8V A;  1UGR B;  4MZP A;  4LUE A;  5CKF A;  3QYG B;  5CKE A;  2RQR A;  1X2Q A;  2OI3 A;  4AFZ C;  3CCM T;  4O6J A;  5IH2 A;  1PSE A;  4C8Q G;  1VQL Q;  3JV3 A;  1T0J A;  2DIQ A;  4KBM B;  2WAC A;  2KR3 A;  2HMA A;  2YDL A;  3QKJ A;  1N9R A;  4AFQ C;  1XOV A;  4N4H A;  3I5R A;  4E7L A;  4XU3 A;  1WHK A;  3HTR A;  3MP1 A;  1YFN A;  2VGN A;  1V1C A;  2M16 A;  2O01 E;  2BZ8 A;  1UHF A;  4CC2 A;  3EAE A;  2HAX A;  1RL2 A;  1WXT A;  4M7D F;  1D09 B;  3MEU A;  2GQV A;  1JXM A;  2K3Y A;  1IZ6 A;  4ESR A;  3ZL7 C;  1YHQ Q;  4C8Q C;  2CH4 A;  4PJO E;  4Z02 A;  5ECA A;  4IUQ A;  1ZUU A;  1YJ9 A;  3GPL A;  2YRV A;  1SHG A;  2VAS A;  3I9Q A;  2V8K A;  3L2Q A;  2PNI A;  4JRK A;  2C0O A;  1ZSG A;  1FMK A;  3CCR A;  2GTJ A;  1D0Y A;  1IO6 A;  3UF4 A;  2OTL T;  3CCU T;  1Q7Y R;  4AFS C;  1ZBX A;  1Q82 R;  2J7I A;  3EG9 B;  2XIC A;  5CCA A;  2PVG B;  4P5N A;  3OMC A;  1G8X A;  4LXC A;  3EFR A;  4EMK C;  2V26 A;  1M9S A;  2E6Z A;  1UEB A;  2EW3 A;  1VQ5 T;  1D1A A;  3DB3 A;  1R0C B;  5J3B A;  3FRN A;  4CRI A;  2RK1 A;  1GCQ C;  5KYW A;  1M1G A;  2EJ9 A;  3MP8 A;  2MMP A;  2P84 A;  5KYX B;  3JCM d;  1G2B A;  2DRK A;  2FZG B;  2P0K A;  2DNU A;  3RBB B;  1VQ4 T;  2R5A A;  2L2P A;  2YUP A;  4BB7 A;  2JJ9 A;  2VGM A;  4M78 B;  3JCM J;  1K8A C;  3QUI A;  3SFM A;  5CKB A;  2YLB A;  4ZTJ A;  1QWF A;  2EJF A;  3G4S Q;  4HVW A;  2RNA A;  1BU1 A;  1N8R C;  3CC7 T;  1NEB A;  4RTX A;  1PRM C;  4XQ3 A;  7AT1 B;  2ZPF B;  2CP7 A;  2PTK A;  1TXQ A;  1KHC A;  2LCC A;  4BDZ A;  5CR2 A;  3S3N A;  1SSF A;  2JS0 A;  4IUR A;  3V8L A;  1X01 A;  3VUB A;  5L23 A;  4M7D C;  3FJP A;  1YWP A;  2XMF A;  1GBQ A;  3UDC A;  3OYG A;  1VQO T;  1M2V B;  2ZPG B;  1W4S A;  4FSX A;  3QJ6 A;  1VYV A;  1KQS A;  5A2Q E;  4EMG A;  2DYB A;  2IPO B;  5HK0 A;  3JCM P;  3EFO B;  2HQE A;  2FPF A;  2KT1 A;  2L3S A;  2O4X A;  3LH5 A;  3CCE A;  2VC8 A;  2OTL A;  4N0A C;  4BDY A;  2JXB A;  1VQP T;  2QQB A;  3EH1 A;  2JM9 A;  4HVU A;  5DY9 A;  4L59 A;  5FWB A;  4M78 F;  5FU7 C;  3HRS A;  3CC2 Q;  1VQM T;  4IUT A;  3S3M A;  2X4W A;  2ZZD A;  1U3O A;  3JCM V;  2X4J A;  2WSE E;  2CKK A;  2KSS A;  2GFU A;  2DL4 A;  4HCC A;  2JS2 A;  3PVQ A;  4XTW A;  3L2U A;  1B34 B;  3E19 A;  5I2S A;  1GBR A;  2EQI A;  3QII A;  3T9N A;  4RTU A;  2DXT A;  5CKH A;  1NJI R;  3CC4 T;  2DER A;  3J80 E;  3P8H A;  1VQK T;  1TUC A;  4D8D A;  1IHV A;  4F7U F;  3GIB A;  2RF0 A;  3VRZ A;  2QQR A;  2LJ3 A;  1G3Y A;  4FW2 A;  3EG1 A;  2ZGW A;  1TTH B;  3CPF A;  3VS6 A;  5EC7 A;  1G3S A;  5KYU A;  1YJW Q;  1N5Z A;  2XG8 D;  3DKM A;  4FCY A;  1KQS S;  2AKL A;  2P0Q A;  2ATC B;  5C0M A;  1KQS P;  4LDX A;  2J05 A;  1M3A A;  3GLX A;  3CCL A;  3OYH A;  1OPL A;  1QWE A;  1KIK A;  4JRQ A;  4OMO A;  3JCM e;  1GL5 A;  5IHK A;  2GF7 A;  3RER A;  4HT9 A;  1UG1 A;  1QVG A;  2P4R A;  5KCO A;  2K3B A;  4KUI A;  1M90 R;  1VQN A;  3C4S A;  1VQP A;  4IUU A;  2L3R A;  2KQW A;  4M78 D;  5GMK h;  3HKS A;  1JXO A;  4M78 C;  1IHW A;  2VV5 A;  2DTH A;  2CSQ A;  5DLQ E;  5KYY A;  4IUP A;  1YJ9 Q;  2DLP A;  1TU0 B;  3OYK A;  3BW1 A;  1NLO C;  3R6O A;  4C92 G;  1VQM A;  1KK7 A;  1PKS A;  2ENM A;  3D7S B;  1T0H A;  3CCR Q;  2EKO A;  5D7U A;  1OPK A;  1S72 A;  4RTT A;  1MV0 B;  2ABL A;  2NUP A;  2RHY A;  3JCM Q;  3INZ A;  2FYK A;  3VRY A;  2KRO A;  1VQL T;  3CPW A;  4EMH A;  4MML A;  3LLR A;  3DLL A;  3CCV A;  3FDR A;  4QVZ A;  3CC4 A;  2CS7 A;  4NS5 A;  4C92 C;  4HVV A;  1OOT A;  4M7A G;  2XDD A;  2A08 A;  2K7A A;  1UTI A;  1WJS A;  1YWO A;  1RLQ C;  4M77 C;  4NOY A;  1WPY A;  1EIF A;  2XDP A;  4ZTF A;  1YHQ T;  2I0N A;  1ABO A;  1QVG S;  2VVK A;  2L3P A;  5FRN A;  2VXE A;  2COY A;  1X75 C;  2F5T X;  1KHI A;  4J83 A;  4KUL A;  2EYQ A;  3M0R A;  1R0B G;  3VS2 A;  2CH4 W;  2VKN A;  3QO3 A;  3M58 A;  2K5I A;  1JB0 E;  2QEX A;  1ZSZ A;  2HQH A;  3JCM X;  1JEG A;  2RQV A;  3RIR A;  4JJD A;  4PK4 A;  3LH0 A;  2E6N A;  2X3X D;  3JCM W;  1AWW A;  2HL3 A;  1Q95 G;  1VYU A;  3CPW S;  1CSK A;  1Q81 R;  2JT4 A;  3JCM c;  1I5L A;  3UA7 A;  4M7A A;  1UGV A;  3VS7 A;  2LQN A;  1OU9 A;  3V7C A;  1OI1 A;  2C06 A;  2JZ2 A;  5CQX A;  1VQL A;  2FG0 A;  4M75 C;  4PNO A;  3G4S T;  2AZS A;  3PMI A;  1MGQ A;  3RMQ A;  4PL6 A;  1DJ7 B;  2RD1 A;  5FWC A;  1VYT A;  2NWM A;  4RG2 A;  5CAI A;  2MWO A;  1WHH A;  4PJO F;  2E41 A;  1SRM A;  2EGC A;  2DMO A;  1M1K C;  1H64 1;  2DD5 A;  1BB9 A;  1T3L A;  1RUW A;  2JTF A;  5IXF A;  1JRI A;  1KJW A;  1AWO A;  2LC4 A;  1YN8 A;  3QBY A;  5GAO q;  2EQM A;  2E12 A;  2RM4 A;  2L5Q A;  4BD3 A;  4WF2 A;  2CP2 A;  5GAM d;  3EFS A;  1Y07 A;  3OB9 A;  2EIF A;  1N27 A;  2RJC A;  5GAO r;  3U23 A;  4OML A;  2LX9 A;  5M9O A;  5HKC A;  1SSH A;  3CEY A;  2R58 A;  3CC2 T;  2RPN A;  3CCL Q;  1Q7Y U;  2HDA A;  5KH6 A;  5GAN 2;  1W2B P;  2PQW A;  2DZ9 A;  2AZV A;  3MO8 A;  1AVZ C;  2EVR A;  3G7Z A;  3CCJ Q;  1UJY A;  1WJQ A;  2EQJ A;  1FMW A;  4J9D A;  1VQ8 T;  4KGV B;  3X28 B;  2DTI A;  1MNE A;  2GCX A;  4JJC A;  1OZ3 A;  2YRC A;  2NLU A;  3L1A A;  1VQN Q;  5D6W A;  2C0I A;  2HQX A;  1BCM A;  4C8Q B;  2X9H A;  3S6W A;  5KYW B;  1KD1 C;  4OMM A;  3RR6 A;  4M7A E;  4J6Y A;  4LNP A;  4FYX B;  3X25 B;  4NL3 A;  2JTE A;  4R55 A;  3G4S A;  1IRE B;  5GMK l;  1ZX6 A;  3J81 E;  4PKC C;  4PJO C;  1S72 Q;  2PUO B;  5GAO l;  4R0K A;  3E1S A;  1VUB A;  1V76 A;  2EJG A;  2M02 A;  1KC8 R;  2MF2 A;  1MMN A;  1IGU A;  3V7R A;  5GAN 3;  4RTZ A;  5CK9 A;  4FT2 A;  1HYO A;  1ARK A;  1RAA B;  2D0N A;  3CME A;  2FPD A;  2V1R A;  2HBW A;  5I2M A;  4JLI A;  1WNL A;  1K8A U;  4DBR A;  4HCB A;  1RAD B;  2XDB A;  3RES A;  1TUD A;  1AHJ B;  5IAY A;  1MUZ A;  5GAM f;  1Y96 B;  4J9H A;  4PFP A;  4C0Z A;  3M0Q A;  5GAN 8;  4C8Q F;  1QQJ A;  5GMK i;  1N8R U;  1YJ9 T;  3LYI A;  1JO8 A;  3CC2 A;  1UGP B;  1UEC A;  2O4X B;  1G3W A;  2LNV A;  2H3E B;  3KFV A;  4HA8 A;  4JZ3 A;  4MZT A;  2DFU A;  2LX7 A;  3CCR T;  1I4K 1;  5LJ3 d;  3JB9 F;  1HD3 A;  2V8J A;  4LUD A;  5IHN A;  1W70 A;  2QEX Q;  4DBQ A;  3FEO A;  1CKA A;  5GAN 5;  2YUN A;  1HJD A;  2EYX A;  3BFM A;  2LRQ A;  3REB B;  2NUT B;  3VS0 A;  1UGS B;  3TSZ A;  2QAZ A;  1TH7 A;  3GF5 A;  5I11 A;  1QW1 A;  1LCK A;  1GCP A;  4A4H A;  1NJI U;  1K9M R;  3EHR A;  4MZM A;  1MV3 A;  2RN8 A;  1YJW A;  5L8R E;  2QDL A;  3HHT B;  4XTY A;  1ZHI A;  5FU7 B;  4A53 A;  3M0P A;  1OV3 A;  3SHW A;  2RHZ A;  1UB4 A;  3A8L B;  2JVV A;  6AT1 B;  1Q7Y C;  1Q82 C;  2DIG A;  3OQ5 A;  2DJQ A;  1OZ2 A;  3O8V A;  2F1L A;  2ROL A;  4RUG A;  2IVW A;  2X3W D;  2BE7 D;  4IIO A;  3OBW A;  3ER0 A;  2JUF A;  1VIF A;  2O2O A;  3H0F A;  3HFN A;  4C8Q D;  4E7Z A;  3VYH B;  1XQH A;  4ANJ A;  4FT4 A;  1K73 R;  2KEA A;  1XNI A;  4E47 A;  1WI7 A;  3JAM E;  1GXI E;  2FRW A;  3JB9 D;  3LX7 A;  3HFO A;  3CCE T;  4HT8 A;  3GP8 A;  3QZ5 B;  3SDZ A;  3OA6 A;  2LNH B;  2RI2 A;  2O88 A;  5LJ3 f;  3OW2 S;  2FRY A;  3OW2 P;  1UDL A;  2Z0W A;  3N5B B;  2JOY A;  3VUZ A;  3AHU A;  3Q1J A;  1AT1 B;  2DVJ A;  2WSC E;  3TU4 K;  2DYI A;  1Q86 U;  3QDR B;  2MI6 A;  2LMJ A;  3M5A A;  3X26 B;  3DLM A;  5J26 A;  2LZ6 B;  1SHF A;  2RI3 A;  2HD0 A;  5FU6 B;  1OX9 A;  1PD1 A;  1EFN A;  2MWP A;  2EQK A;  3NPF A;  4EIK A;  5GMK e;  3PTA A;  4ATO A;  2CP0 A;  2RJE A;  4JJB A;  3AT1 B;  1WJR A;  2RHI A;  1H92 A;  2SEM A;  1QVP A;  1WHJ A;  2EAY A;  1NEG A;  3EH2 A;  2K2M A;  3HRU A;  2MYS A;  3L42 A;  1N9S A;  1BKB A;  3BY7 A;  3ME9 A;  4C0D C;  2P4T A;  4KH0 B;  5GMK j;  2FHD A;  1AOJ A;  4RG8 A;  2OAU A;  3E9F A;  4QW2 A;  3P8B B;  1N6A A;  1SPK A;  3H6Z A;  4EMK A;  4M7D D;  3MEA A;  4DOV A;  2LDM A;  4DQ2 A;  2GNC A;  3CCL T;  2DO3 A;  4C92 B;  3EG3 A;  4F7U B;  3CME Q;  2KMT A;  3GNF B;  3SWN A;  3E2U A;  3JB9 J;  1ZSZ B;  2DD4 A;  5GAM h;  1YJN Q;  4Y91 A;  2M51 A;  4M77 B;  5GAM g;  2WSF E;  1VQN T;  2HBP A;  1B7T A;  4J9G A;  1NYF A;  3I56 A;  1TG0 A;  3EGX A;  1NJI C;  1QKX A;  1VA7 A;  1PD0 A;  2QQ9 A;  1Q81 U;  1BI1 A;  4E6R A;  3OYI A;  2HKN A;  2ZPB B;  1I5O B;  3L2W A;  3A8H B;  1S72 T;  1U06 A;  3OBY A;  2D9T A;  2YUQ A;  3JRZ A;  1T3S A;  1QCF A;  2M0Y A;  2QQA A;  1HK9 A;  5FRM A;  1PWT A;  5KYN A;  4ME7 A;  2EPD A;  2BZX A;  3CCV T;  4N4I A;  1Y0M A;  2GGR A;  2GQI A;  4C92 F;  2DVE A;  3TSW A;  2QG9 B;  2NYS A;  1BBZ A;  1M90 C;  4D6W A;  2CT3 A;  1E6G A;  4M77 F;  3QSU A;  4AT1 B;  4PFO A;  1AWX A;  2RH2 A;  4M75 B;  3ZFJ A;  3OYC A;  3KUF A;  1M3C A;  3OYA A;  2A36 A;  2FEI A;  2DL5 A;  3GNG A;  9ATC B;  1ZLM A;  2OTJ A;  2EGA A;  2H3J A;  2XKO C;  4A54 A;  1ZUK A;  4O5V A;  3CCJ A;  1M1K U;  2FVU A;  1WQW A;  1WXB A;  3V8J A;  2R5M A;  1Q86 C;  4JJN K;  3MKD A;  3C95 A;  4E2F B;  4GY5 A;  2QEX T;  1OYX A;  3OS1 A;  2QYZ A;  2DXU A;  5FU6 C;  4JLG A;  2K2V A;  3QPH A;  3LGF A;  1R77 A;  1YIJ A;  4C0F A;  1P92 A;  2KNB B;  3OSS C;  3WXM B;  1BYM A;  1YI2 Q;  2CZ0 B;  1RAE B;  3LWI A;  3CXC S;  3UPU A;  5LJ3 h;  3CXC P;  1LVK A;  2GTO A;  3H0H A;  5LJ3 g;  1BI0 A;  2CYZ B;  1NPP A;  2K3X A;  4LDW A;  4XU2 A;  4LD6 A;  2AKK A;  3EG9 A;  3M0S A;  3QXE B;  1BI2 A;  4LN2 A;  1OEB A;  5CQY A;  1NYG A;  1PM3 A;  4M75 F;  1WHL A;  2XHC A;  2DIL A;  4M7D E;  1QMC A;  1U1S A;  2PVD B;  1Z9Z A;  3EGD B;  4C92 D;  2RQW A;  2BUD A;  2E4H A;  2KXD A;  4OB0 B;  4OMN A;  2BE9 B;  4FYV B;  2W0Z A;  4HCK A;  5GJV B;  2L89 A;  2KYM A;  2F2V A;  2D1X A;  5KYX A;  1ZSZ C;  5IT9 E;  8ATC B;  1WXU A;  4NL2 A;  3L2V A;  1KD1 U;  5HY6 A;  4M77 D;  2L8D A;  3PE0 A;  5GAN 6;  2ZCF B;  4AFU C;  2X51 A;  4M78 A;  1LJO A;  2KBT A;  1W6X A;  4YTL A;  1O9S A;  2CZ7 B;  2RJD A;  4ZGD B;  1QCO A;  3G71 A;  3GBQ A;  2ZPH B;  3MJX A;  4C5G A;  4XTU A;  3HSB A;  4PJO B;  4B9W A;  1NPR A;  2FO0 A;  2OJ2 A;  1Q81 C;  1BCO A;  4M7A C;  4DEX A;  3M59 A;  2ZPE B;  1FYN A;  1U5S A;  3SD4 A;  1WYX A;  3CMA A;  3EHQ A;  2EYY A;  3BDU A;  2VB6 A;  4QVC A;  3NFC A;  1VQ9 A;  2G6F X;  3RKY A; 
#chains in the Genus database with same CATH homology
 4JRK A;  4LDU A;  3OYN A;  1Y7X A;  3CCR A;  4J7I A;  2MF2 A;  5D6Y A;  2OTL T;  5A0G A;  3CCU T;  3V7R A;  1ZBX A;  1YBY A;  5GAN 3;  5CK9 A;  1W2B A;  2E70 A;  1X6O A;  2R57 A;  4FT2 A;  2XIC A;  4RCC A;  4A4F A;  5CCA A;  3G71 T;  2PVG B;  4P5N A;  3OMC A;  3CD6 A;  3CME A;  3EFR A;  4EMK C;  4E7K A;  4MMK A;  4OMF B;  2KDS A;  3CC7 A;  4FM4 B;  3WVE B;  5I2M A;  2PU9 B;  3I55 A;  1M9S A;  4JLI A;  3OYK A;  1WNL A;  2E6Z A;  1UEB A;  1K8A U;  2DXC A;  2IG0 A;  2LQ8 A;  1VQ5 T;  2EQU A;  4HCB A;  3DB3 A;  4M75 D;  3CCQ T;  5J3B A;  2XDB A;  3FRN A;  2PVO B;  3RES A;  4CRI A;  4M7A F;  2RK1 A;  3OY9 A;  2M0O A;  1WGS A;  2LVM A;  1M1G A;  1AHJ B;  2EJ9 A;  3MP8 A;  1I8F A;  4JUV A;  5GAM f;  2MMP A;  4M78 G;  5IAY A;  1Y96 B;  3JCM d;  3OYE A;  4C0Z A;  5GAN 8;  2AHJ B;  3OYY A;  3CMA T;  4C8Q F;  4CI0 C;  5GMK i;  1VQO A;  3ZEH A;  1N8R U;  1YJ9 T;  3LYI A;  2P0K A;  1VQ4 T;  4QVD A;  3CC2 A;  5FRO A;  1UGP B;  2R5A A;  4UC4 A;  1VQ9 T;  1NE8 A;  2O4X B;  4MDW A;  4BB7 A;  1G3W A;  2VGM A;  4M78 B;  5C6S A;  2LNV A;  3QUI A;  4BAC A;  3SFM A;  4HA8 A;  3JCM J;  1K8A C;  4MZT A;  3CCR T;  4X34 A;  1I4K 1;  4XTX A;  5LJ3 d;  2JTM A;  5CKB A;  5I21 A;  3JB9 F;  2YLB A;  4ZTJ A;  4VUB A;  5LJ5 d;  2V8J A;  2E1H A;  3V7S A;  2EJF A;  3RKX A;  2X35 A;  4FU6 A;  3CD6 T;  3V8K A;  3CME T;  3PFS A;  3FEO A;  4BI4 A;  2DTO A;  1N8R C;  5GAN 5;  3CC7 T;  4M78 E;  2K5L A;  4XQ3 A;  2M9U A;  2ZPF B;  4JRI A;  4XK8 E;  3BFM A;  4N4G A;  1YJN T;  5CIU A;  4J6X A;  4QQ6 A;  2LRQ A;  1KHC A;  2LCC A;  3QYH B;  4BDZ A;  5CR2 A;  4RCB A;  2PUK B;  1SSF A;  2QDY B;  4XU1 A;  4XTV A;  4IUR A;  3V8L A;  3LWH A;  1UGS B;  4OGE A;  1X01 A;  2CZ1 B;  2E65 A;  3VUB A;  4F7U G;  4BY6 B;  1TH7 A;  4M7D C;  3FJP A;  4BI8 B;  2DJZ A;  4OF1 A;  3GF5 A;  2HNI A;  3UDC A;  3OYG A;  1VQO T;  1QW1 A;  4V2S A;  4M77 G;  4A4H A;  1KC8 U;  2I2L A;  1NJI U;  4A4E A;  1JJ2 A;  1QP2 A;  4OVA A;  2ZPG B;  2D0Q B;  1W4S A;  3PNW C;  4FSX A;  3QJ6 A;  4MZM A;  5L8R E;  1YJW A;  1W2B S;  1Q82 U;  3HHT B;  1KQS A;  3MEW A;  4GLK A;  4XTY A;  4QQD A;  4RMO A;  1ZHI A;  2RA2 A;  5FU7 B;  4EDU A;  4EMG A;  4A53 A;  5HK0 A;  5A2Q E;  2QTX A;  3UWN A;  3JCM P;  3JSC A;  4JS4 A;  3M55 A;  2KK4 A;  3MP6 A;  2HQE A;  2O4X A;  3CCE A;  3JB9 I;  2VC8 A;  2OTL A;  1XTD A;  4N0A C;  5EG2 A;  4BDY A;  2RHZ A;  2VXF A;  3HL8 A;  4TVR A;  1VQ6 T;  4A4G A;  1VQK A;  1UB4 A;  1VQP T;  2QQB A;  2YLC A;  4BI3 A;  1KC8 C;  5DY9 A;  4L59 A;  3A8L B;  4B9X A;  4M78 F;  4LDV A;  2JVV A;  5FU7 C;  5KE3 A;  4II1 A;  1Q7Y C;  3HRS A;  1Q82 C;  2DIG A;  3OQ5 A;  3UT1 A;  1VQM T;  4IUT A;  4C5E A;  3S3M A;  4M7A D;  1OZ2 A;  2X4W A;  2ZZD A;  3HP9 A;  3O8V A;  3L2R A;  3CCQ A;  3JCM V;  2X4J A;  4JDS A;  2IVW A;  2RK2 A;  3CCS T;  3OBW A;  1BIA A;  3ER0 A;  2JUF A;  1VIF A;  2WSE E;  3CBM A;  2CKK A;  5GAN 7;  2G3R A;  2KSS A;  3HFN A;  2GFU A;  2Y90 A;  3E9G A;  4C8Q D;  1NZ9 A;  2X4Y A;  1XQH A;  3VYH B;  4HCC A;  2P0P A;  4FT4 A;  4PJO D;  4XTW A;  1YJW T;  3L2U A;  1XNI A;  1B34 B;  4E47 A;  4C92 A;  3E19 A;  5I2S A;  3JAM E;  1GXI E;  4OB3 B;  1O75 A;  3QII A;  3T9N A;  3JB9 D;  2DXT A;  5CKH A;  4F7U A;  3LX7 A;  2QXF A;  3HFO A;  4XU0 A;  2B8A A;  3CC4 T;  3VKI A;  3CCE T;  3GP8 A;  4HT8 A;  3QZ5 B;  3DB4 A;  3SDZ A;  3OYD A;  3OYF A;  3G6E A;  3PMT A;  3J80 E;  3P8H A;  5KCH A;  3OA6 A;  4DOW A;  1VQK T;  2RI2 A;  5GAN f;  4F7U F;  4M77 A;  5LJ3 f;  3OW2 S;  4OB2 B;  3GIB A;  3PGG A;  5FLX E;  1D3B B;  4M75 G;  5LJ5 f;  2BKD N;  2QQR A;  1G3Y A;  3X20 B;  2ZGW A;  3CPF A;  3GOX A;  3N5B B;  3URG A;  2JOY A;  1G3T A;  1G3S A;  3VUZ A;  3Q1J A;  1YJN A;  3AHU A;  1KG1 A;  4QQG A;  2E10 A;  2WSC E;  4MDX A;  2XG8 D;  2GFA A;  3DKM A;  3HPW A;  4C0G A;  3TU4 K;  1Q86 U;  1JJ2 S;  5CKD A;  1VQ7 A;  4IKF A;  3PIO A;  3QDR B;  2MI6 A;  1K9M U;  1U1T A;  2RJF A;  3WVD B;  1KQS S;  3M5A A;  3X26 B;  1RI0 A;  2P0Q A;  5C0M A;  4LDX A;  1U8R A;  3NTI A;  3DLM A;  3C94 A;  5J26 A;  4OB1 B;  3GLX A;  3CCL A;  1G5V A;  2RI3 A;  4ZGJ B;  2HD0 A;  3OYH A;  5FU6 B;  2CGH A;  3M4Y A;  4KT0 E;  2Y4Y A;  2MWP A;  3S3O A;  4JRQ A;  1YI2 T;  3TCJ A;  3JCM e;  1V29 B;  4E7H A;  2XID A;  3CBO A;  2EQK A;  2GF7 A;  2DZC A;  4IUV A;  4BUG A;  4C0D B;  5GMK e;  5GAN d;  3PTA A;  3RER A;  4ATO A;  4HT9 A;  1QVG A;  2RJE A;  4C5H A;  1WJR A;  5KCO A;  2RHI A;  1B34 A;  1K9M C;  3G6E T;  1M1F A;  4KUI A;  1QVP A;  2EAY A;  2JNG A;  3JCM b;  3OS2 A;  1VQN A;  1FX7 A;  4ZN3 A;  1VQ6 A;  2A3L A;  3C4S A;  3HRU A;  3JCM h;  3L42 A;  1VQP A;  4IUU A;  2L3R A;  1N9S A;  2KQW A;  4M78 D;  1BKB A;  3BY7 A;  3C12 A;  3HKS A;  3ME9 A;  4M78 C;  3JCM g;  5GMK h;  2VV5 A;  2DTH A;  5DLQ E;  4C0D C;  2P4T A;  4IUP A;  5KE2 A;  5GMK j;  2FHD A;  1M4Z A;  4PLI A;  3OSV A;  2OAU A;  4RG8 A;  3BW1 A;  3BDL A;  3E9F A;  3R6O A;  4QW2 A;  4C92 G;  1VQM A;  1D3B A;  3P8B B;  2V8I A;  1K73 U;  3OW2 A;  1N6A A;  2LQK A;  4ELY C;  4M7D D;  3H6Z A;  4EMK A;  3MEA A;  4DOV A;  5DLO A;  1KQ1 A;  1YHQ A;  4LD9 K;  1MHN A;  2EKO A;  2LDM A;  5GAM e;  3OS5 A;  2XK0 A;  3M53 A;  4DQ2 A;  5IN1 A;  3OS0 A;  3CCS A;  1S72 A;  3CCL T;  4X9C A;  2DO3 A;  2X4X A;  4C92 B;  2K57 A;  3A8G B;  4M75 A;  2RHY A;  4F7U B;  4BE1 A;  2CZ6 B;  3JCM Q;  2KMT A;  3GNF B;  3SWN A;  5GAN 4;  4JRP A;  3M4G A;  3INZ A;  1FXX A;  2FYK A;  3ASK A;  1VQL T;  3CPW A;  3QZ9 B;  4EMH A;  3JB9 J;  4MML A;  3LLR A;  2DD4 A;  4BY6 C;  4LDY A;  5GAM h;  3MCA B;  3PIP A;  3DLL A;  3CCV A;  4Y91 A;  1K73 C;  4M77 B;  2K5F A;  5GAM g;  3FDR A;  4J5Y A;  4QVZ A;  5GAM j;  3MET A;  2CS7 A;  2WSF E;  3CC4 A;  3M9Q A;  4Y28 E;  4NS5 A;  4C92 E;  4C92 C;  1VQN T;  2HBP A;  2RHX A;  3VV0 A;  4F7U E;  3I56 A;  1I81 A;  3X24 B;  4M7A G;  1NJI C;  2XDD A;  1UGQ B;  1Y71 A;  4FIB A;  2KVQ G;  5A0D A;  2QQ9 A;  1WJS A;  2BIV A;  4M77 E;  4RKU E;  1Q81 U;  4M77 C;  1BI1 A;  4NOY A;  1WPY A;  2QI2 A;  1EIF A;  3OYI A;  2ZPB B;  4BE2 A;  2XDP A;  4E7I A;  4ZTF A;  1YHQ T;  4PJO G;  2DKG A;  3L2W A;  1BI3 A;  3A8H B;  2RB6 A;  2VUB A;  1S72 T;  3OBY A;  2E64 A;  4A4K A;  2D9T A;  1QVG S;  3JRZ A;  4HKE A;  5D6X A;  2D6F A;  5FRN A;  2VXE A;  3JB9 G;  1X75 C;  4PLL A;  2QQA A;  2F5T X;  1HK9 A;  5FRM A;  1KHI A;  1WQ7 A;  3QG1 A;  4J83 A;  4KUL A;  5CO7 A;  1M90 U;  1YIT A;  4L6V 5;  4ME7 A;  2EYQ A;  1YI2 A;  2EWN A;  5GAO n;  3KBG A;  3FC3 A;  5GMK m;  3CCV T;  2LT4 A;  3VJP A;  2VYT A;  4N4I A;  2QA4 A;  4XAX B;  3QO3 A;  3M58 A;  2K5I A;  5LL6 S;  1PSF A;  1JB0 E;  3FB9 A;  4L5G A;  2QEX A;  5GAO m;  4X9D A;  3JCM X;  4C92 F;  1YCY A;  3TEE A;  2DVE A;  3NTK A;  3I56 T;  3J7A F;  3RIR A;  3LH0 A;  1M90 C;  4D6W A;  4ZN1 A;  4EMK B;  4C5I A;  2E6N A;  2XI9 A;  4M77 F;  3QSU A;  3LW5 E;  2LT1 A;  3OMG A;  2RH2 A;  3QHS A;  3JCM W;  4XTZ A;  3FLG A;  1M5Q 1;  2K4Y A;  4M75 B;  2DPP B;  2A7Y A;  3ZFJ A;  3OYC A;  3CPW S;  2DEQ A;  3SWN B;  2F5K A;  3KUF A;  3JCM c;  3OYA A;  3L2Z A;  3OYB A;  1I5L A;  4M7A A;  2KY9 A;  3KXT A;  4J7F A;  3GNG A;  5AYF A;  3V7C A;  2Y4X A;  3A8O B;  3F70 A;  2OTJ A;  1YIT T;  1OI1 A;  2H3J A;  2XKO C;  4A54 A;  2C06 A;  4O5V A;  3CCJ A;  2JZ2 A;  1M1K U;  2FVU A;  1WQW A;  5CQX A;  4OP0 A;  4M75 E;  3S3N A;  5DM7 R;  2XU8 A;  4M75 C;  3V8J A;  1VQL A;  2R5M A;  2QA4 T;  4C8Q A;  1Q86 C;  4JJN K;  4PNO A;  3G4S T;  4PJO A;  3P8D A;  3PMI A;  3C95 A;  3M57 A;  4GY5 A;  3SWN C;  2QEX T;  1MGQ A;  3RMQ A;  4PL6 A;  1DJ7 B;  2RD1 A;  1OYX A;  3OS1 A;  4RG2 A;  1VIE A;  5CAI A;  2DXU A;  5FU6 C;  5GAN e;  1KQ2 A;  4JLG A;  2K2V A;  2MWO A;  3VU3 C;  3QPH A;  5LJ3 e;  4PJO F;  4OGC A;  2F69 A;  4J6W A;  5GAO p;  2E5Q A;  2E41 A;  3A8M B;  3LGF A;  5LJ5 e;  3OYM A;  1YIJ A;  4C0F A;  1P92 A;  5J39 A;  4M7D G;  3H8Z A;  4E7J A;  3OSS C;  1R8O B;  1H64 1;  2EFI A;  1QP3 A;  2DD5 A;  1M1K C;  3WXM B;  3QJY A;  1BYM A;  3MEV A;  2CZ0 B;  3CCM A;  5GAN h;  3LWI A;  2JTF A;  3CXC S;  4Q5W A;  4JS5 A;  3UPU A;  5LJ3 h;  4KUD K;  3MHX A;  4EPC A;  1LOJ A;  4J8O A;  5GAN g;  1VQ8 A;  3RKW A;  3A5Z B;  1JBM A;  5GAN j;  1JRI A;  2JN0 A;  3TRE A;  5LJ3 g;  3SB2 A;  5LJ5 h;  5LJ3 j;  4M7D B;  2LC4 A;  1BI0 A;  1QVF A;  2CYZ B;  3QBY A;  5LJ5 g;  5HK3 A;  1NPP A;  5GAO q;  2EQM A;  3NTH A;  2K3X A;  2E12 A;  5LJ5 j;  4LDW A;  2RM4 A;  2L5Q A;  4XU2 A;  4BD3 A;  3LGL A;  4LD6 A;  4WF2 A;  3I55 T;  1VQ7 T;  2OTJ T;  2LTO A;  1FWZ A;  3QXE B;  1BI2 A;  5GAM d;  3CCJ T;  1H3Z A;  3EFS A;  5CQY A;  1Y07 A;  3OB9 A;  2EIF A;  1N27 A;  4M75 F;  3M56 A;  2XHC A;  3ZBD A;  3JB9 H;  4M7D E;  1U1S A;  1ZQ1 A;  2PVD B;  2RJC A;  2ZPI B;  1HXD A;  4C92 D;  4R56 A;  3HRT A;  5GAO r;  2BUD A;  4OB0 B;  3RMS A;  3RUX A;  4DA4 A;  4ZGE B;  2FL7 A;  2M1H A;  2YHT A;  3CBP A;  2L89 A;  2LX9 A;  5M9O A;  3M54 A;  2DK3 A;  3CEY A;  5HKC A;  2R58 A;  4HCZ A;  3CC2 T;  1YIJ T;  1M8V A;  1Y96 A;  1UGR B;  5IT9 E;  2DAQ A;  4MZP A;  3VYG A;  1Q7Y U;  5KH6 A;  5CVI A;  5GAN 2;  4NL2 A;  2PQW A;  2DZ9 A;  3PT9 A;  3MO8 A;  5CKF A;  3QYG B;  4M77 D;  5CKE A;  5HY6 A;  3L2V A;  1KD1 U;  2L8D A;  3G7Z A;  3CCM T;  5GAN 6;  4O6J A;  2ZCF B;  1PSE A;  4C8Q G;  1WJQ A;  4M7A B;  2EQJ A;  1VQ8 T;  4M78 A;  1LJO A;  2DIQ A;  3CCU A;  4FL6 A;  4KBM B;  3X28 B;  2DTI A;  4YTL A;  1O9S A;  2CZ7 B;  2GCX A;  2WAC A;  1OZ3 A;  3FIF A;  2RJD A;  4ZGD B;  2NLU A;  3L1A A;  3G71 A;  5D6W A;  2RHU A;  2ZPH B;  4C5G A;  2HQX A;  3QKJ A;  2RO0 A;  1N9R A;  4XTU A;  4C8Q B;  3HSB A;  1XOV A;  4N4H A;  4E7L A;  4XU3 A;  4B9W A;  3CXC A;  4M7D A;  1NPR A;  4PJO B;  3MP1 A;  3S6W A;  1KD1 C;  4BE0 A;  4ELZ C;  2VGN A;  1Q81 C;  4M7A E;  1VQ5 A;  4M7A C;  4J6Y A;  3X25 B;  2KAF A;  2M16 A;  4NL3 A;  4R55 A;  2O01 E;  2FB7 A;  3M59 A;  2ZPE B;  2RI5 A;  3EAE A;  2HAX A;  1RL2 A;  3G4S A;  4M7D F;  3SD4 A;  3MEU A;  2GQV A;  2K3Y A;  3OYJ A;  1IRE B;  1IZ6 A;  1BIB A;  5GMK l;  3OYL A;  4C8Q E;  5A0L A;  3J81 E;  4C8Q C;  4PKC C;  2DXB A;  4PJO E;  4Z02 A;  3CMA A;  4PJO C;  4IUQ A;  2PUO B;  3BDU A;  1YJ9 A;  5GAO l;  4QVC A;  3GPL A;  3E1S A;  1VUB A;  2YRV A;  1VQ4 A;  3JCM f;  3NFC A;  2LCL A;  2EJG A;  2V8K A;  2QQS A;  1LNX A;  4N0A A;  3L2Q A;  2MAM A;  1VQ9 A;  1QVF S;  2XD0 A;  3RKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...