4KUDK

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
KTLKDLDGWQVIITDDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSNEYLKRVSVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein/transcription/dna
total genus 45
structure length 212
sequence length 212
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kudK00
4DOVA 4JJNK 1W4SA 1M4ZA 2FL7A 3PT9A 4FT4A 3PTAA 1ZHIA 2FVUA 1ZBXA 4FT2A 4DA4A 4BB7A 4LD9K 3TU4K 4DOWA 4KULA 4KUIA 4FSXA 4KUDK
chains in the Genus database with same CATH superfamily
2GTOA 5GAMg 1U8RA 3OYIA 2QEXQ 2DXTA 4PLLA 4A4EA 2E64A 3LW5E 3S3NA 4L5GA 3RR6A 4QQ6A 1D0YA 5KYWB 3JAME 1JRIA 2LQWA 4OB0B 2YUPA 1VYUA 4Z89A 1U06A 3A8OB 2AK5A 3QDRB 4RCBA 3EFOB 2EQUA 2YUQA 3CC7A 4GLMA 3JB9H 1BI3A 1WNLA 2EFIA 2JOYA 4FW1A 3CC7T 4IKFA 2R58A 1QVGS 4ORZA 2ZPGB 1YITQ 1SKUB 3LWHA 2JS2A 3RKWA 2EGEA 5GANj 5DM7R 1WXUA 5KCHA 2GQVA 2ZGWA 1ZX6A 2RI3A 3SWNB 1KD1U 2DYBA 1OZ2A 1GRIA 1JQQA 4D8KA 2DIGA 4KRTA 4MZTA 2L2PA 3OYDA 3RKYA 1AZGB 4C8QC 4F7UF 4PFPA 5KE2A 3OYBA 1WHHA 3HRUA 3TU4K 4JJDA 1QVFP 3M57A 4OMMA 1VIFA 1ARKA 4M77C 2KY9A 3VS3A 1YN8A 5IH2A 3OYKA 2HBWA 3EG0A 2DZCA 2QA4A 1FWZA 5DY9A 3S3OA 1H3ZA 3A8LB 3OB9A 3J81E 3H41A 2OTLQ 2XDPA 2CREA 1V76A 2QA4T 3UT1A 1N27A 4PJOE 4HCKA 5LJ5j 3V8JA 3L2QA 3CC4Q 4IUUA 1VQ4T 2SRCA 4MMKA 3VS5A 4M7DA 5A0GA 5AT1B 2JVVA 3LH0A 2DETA 1IREB 2RM4A 1ACMB 3CCSQ 1GBRA 4RTWA 2JW4A 5I2MA 4LUEA 2RPNA 4DBHA 3BDLA 2LQKA 3H9NA 4KBMB 5GANd 4C0DC 4OB1B 2OTJQ 2EYQA 4MDXA 1G3YA 1M90U 2FYKA 1VQMQ 2KBTA 1I07A 1PKTA 5GJWB 5GMKj 3INZA 2XD0A 3QBYA 4JZ3A 1EFNA 5CKHA 4E7SA 1GFCA 1UJYA 4J9CA 2MF2A 1Q81R 1S72A 1ZUUA 3HTRA 1TU0B 3JB9D 2IIMA 2JT4A 3DKMA 5CKBA 1D1AA 2W0ZA 1Q82C 1K8AU 1BCOA 2LJ3A 2RMOA 1S72T 3JRZA 2LQNA 3A8MB 1M5Q1 3JCMX 3L2UA 2XK0A 1V29B 1WYXA 4E47A 2YUNA 2DERA 1U3OA 2BE7D 4HVUA 1OX9A 2WSCE 3RMSA 4HT8A 2FEIA 3I55Q 1Y7XA 5EC7A 4C92F 2EAYA 1UB4A 3M56A 3MP6A 1UGVA 4KGZB 1MV3A 4ZGEB 2P0PA 3QDFA 1S1NA 4E7HA 5LJ5d 4B9WA 2DTOA 2RN8A 3OYFA 2DL4A 4FSXA 3UPUA 4PJOC 2A3LA 1SF9A 1OULA 4C8QB 2NLUA 5D6YA 3E2UA 5IT9E 2DL3A 2RJDA 2P4TA 3MP8A 3GPLA 1FMKA 2YSQA 4M77B 2HDAA 2JMAA 5CKEA 4DBQA 4EMKC 2KXDA 3CCVT 2M16A 3OS1A 3QO3A 1KG1A 5KYUA 5FRMA 1YIJA 1M3AA 4BD3A 2RQUA 2P0KA 5GAOp 5KCOA 5FWBA 3E9FA 3TEEA 3OYHA 5LJ3h 1YIJT 1WQWA 3VS1A 4M78C 3JSCA 1VQ5Q 3CMAA 3WXMB 4OMNA 4JS5A 1PRMC 1ZA1B 4DBRA 4VUBA 1NYFA 2DMOA 3M0TA 1K9MC 4OMOA 1VQLA 3LX7A 4XTZA 1RADB 3FEOA 4C0DB 3HFOA 1N6AA 1VQLT 3OA6A 3S3MA 2C0OA 3M59A 2MMPA 3SD4A 4BUGA 1RLPC 2CDTA 2CH4W 4F04B 1VQ6T 2DTHA 1OPLA 1MHNA 1ZSZC 3QUIA 2GBQA 2V1RA 2QAZA 4JDSA 3KBGA 4J6XA 1VQNA 1QVFS 4GY5A 1Q7YC 5GMKm 2CUBA 1Y96A 5KYYA 1VQNT 3JB9G 3QWXX 1WFWA 1D09B 4PJNA 3QJ6A 2DD5A 2CP0A 4KH1B 2HNIA 2K79A 4M7DD 3LYIA 3FRNA 2QGFB 2E1HA 5GAN2 4XTUA 2F2VA 3A8HB 1K76A 1TOVA 4J9DA 1Q81C 2VB6A 4OMQA 5LJ3g 4AMCA 4PJOB 4RUGA 3CPWP 2KDSA 3I56Q 4II1A 5GAOn 3VS7A 1WLPB 5DLOA 3LWIA 2X35A 1N9RA 1M1KC 4R0KA 5KE3A 2RQWA 4EMKB 2EQIA 2I0NA 4M75F 4M7AF 3OSSC 2DNUA 1UGQB 3CCUA 2CP7A 4J9BA 2VYTA 4PLIA 4X9DA 2A08A 4O6JA 1RLQC 2F69A 1TG0A 1PM3A 3CCRA 4CC7A 2KRMA 4PJMA 1MGQA 1OPKA 3CCRT 1PD1A 1SG5A 3H6ZA 4QT7A 5KYXA 5J39A 1WA7A 1QCFA 1RAAB 1ZSZA 3M0RA 2KE9A 5I2SA 1KJWA 1GBQA 1VQ8A 1E6GA 3SDZA 2J6OA 1KQSP 2ZPBB 3REAB 2CP6A 3CXCS 2JNGA 2QDLA 1IGQA 1VQ8T 4QVDA 1TH7A 1C0MA 5IAYA 1WJQA 3AHUA 4ANJA 2G6FX 4F16A 3UATA 2GNCA 3PNWC 1PWTA 1EIFA 2LDMA 3JCMb 4OB2B 1M4ZA 3EG3A 2ED1A 2L8DA 4GBQA 2PTKA 1H8KA 2PUOB 4FYYB 4TVRA 2CP2A 4F7UA 1ZA2B 2GQIA 2DXCA 1YP5A 4LDXA 1KQ2A 4Y28E 5IXBA 2RHUA 3ZL7C 4EMHA 1Q86U 1N9SA 1TUGB 2HSEB 2COWA 1LVKA 1TTHB 2D6FA 2D8JA 4XAXB 3E1SA 4LE9A 2CZ7B 3MEAA 1AEYA 3I9QA 4ZGDB 1AWWA 4M7DG 4RTVA 2YLCA 5IHKA 2RHIA 4PJJA 2KGTA 5I22A 3OYCA 1QVGA 5GAMe 4ME7A 8AT1B 4MZMA 4HCZA 1X43A 3PIOA 2EWNA 2KT1A 1G5VA 2RQTA 2XDDA 2L3PA 5KH6A 2PNIA 1YJ9A 2L3RA 1U5SA 2AHJB 1RABB 1XNIA 1QMCA 4IIMA 1YJ9T 3OQ5A 4CC3A 2L3SA 3C0CA 3ME9A 1RI9A 1UHCA 4Y91A 2PZ1A 3LGLA 2KYBA 2RHYA 1VQ9T 3L2VA 3HSBA 3WVEB 3ASKA 1KQ1A 2H8HA 4M7DE 2DYIA 3TQ7P 3QZ9B 1NEBA 2EW3A 2P4RA 2M51A 3SHWA 2QGGA 5EG2A 1JEGA 3G71A 3G6EA 1B7TA 4HXJA 4OMPA 3CCQQ 4C5EA 1YJNQ 2K3XA 1FX7A 3G4SA 3HP9A 1XJWB 4UC4A 1BIBA 1YI2A 1M2VA 2A7YA 2RHZA 3G6ET 3C12A 1RAGB 2FL7A 3G4ST 4M78D 1VQ4Q 3MKDA 1X6GA 3VUZA 1YI2T 4C92A 1VQ7A 1G3WA 1ZUKA 2H3JA 1YJWA 1NJIC 3CPWS 1X69A 4AG1C 3QWYA 1BYMA 1VQOA 3EG9A 4IUTA 1VQPA 1JO8A 4LXCA 2JTEA 3TVTA 2RJFA 2KVQG 3F70A 1OU8A 4C5IA 2NUTB 1VQPT 2F2WA 3PT9A 3OS0A 3NGPA 4HT9A 2DF6A 2QXFA 4X34A 4R56A 2CSIA 2EJGA 4LDUA 3P8BB 5D7UA 3CC2T 3QJYA 2MYSA 2K6DA 1YHQT 4BI8B 2Y90A 3C4SA 3HL8A 4JRIA 2KI7A 2R5AA 2PVDB 1PNJA 2Y4XA 1GL5A 1JJ2S 2O9SA 4M7DC 3M4GA 3PVQA 1KK7A 2R57A 3MEWA 3OS2A 3V8LA 2DVEA 3JCMh 1OOTA 1KQSS 3RNJA 2K5FA 2PQWA 2K3YA 2ROTA 1MMGA 3QYHB 3MPUB 1K0SA 1W70A 4J7FA 2K5IA 4IUPA 4FYXB 4Z8AA 4O5VA 5HCKA 3BFMA 2KNBB 1FYNA 3M5AA 2VKNA 3EH2A 4PJOG 1KIKA 1QCOA 2CYZB 5I11A 1QCNA 2DIQA 3QXEB 3CCEA 5HK3A 3CD6A 1OV3A 4L6V5 5GAMf 2DAQA 5FW9A 3CCVQ 2OX7A 3CCET 1X6OA 1VYVA 4PK4A 2ZZDA 2DL7A 1PKSA 2DPPB 2P0QA 1KHCA 3X25B 5FU6C 2QQ9A 2YRVA 1UUEA 1H641 3CMEA 2ZPHB 2O2OA 2PUKB 5CIUA 2QDYB 1K9MR 1Q82U 1RAIB 2KK4A 3LH5A 3CMET 3QG1A 1HD3A 2RH2A 3UA7A 2A37A 4N4HA 2DE0X 1CSKA 4M78G 2YWWA 3NPFA 2KAFA 4A4HA 4ZTFA 1MNEA 4RTXA 1SRMA 4BE0A 2YT6A 1D0XA 3VJPA 2E70A 3CBPA 4IIOA 2EYWA 2CT3A 3CCMA 2KYMA 3JCMg 2DRMA 3P8HA 3VS4A 5GAOl 1M2OA 2VGMA 1BI2A 1TUDA 1LOJA 4ZGJB 1NE8A 4F14A 1VQ6Q 3C94A 4FL6A 3TSZA 4M75A 3L2ZA 4M7AA 1QVFA 2DEQA 3R6NA 4PFOA 1Q7YR 1RL2A 1WHGA 2RQRA 1C1AA 1HK9A 3S6WA 2YXYA 1EZZB 1Y07A 2HL5C 3EGDA 2VXEA 1PC0A 2IPOB 4MMLA 1YCSB 3PMTA 3FJ5A 4M7DB 1WQ7A 5J3BA 1KSWA 2EYZA 4QW2A 2O01E 4M78E 1AZEA 2GFAA 3CCJA 2V8IA 1IB8A 1W2BS 2RK2A 2B86A 3OW2S 1HSQA 4FYVB 5CK9A 3CCJT 4BI4A 1K9MU 1M1KR 2QEXA 2ENMA 2FPEA 3HHTB 3UWNA 1UE9A 2LZ6B 2X4JA 2HMAA 3MJXA 2QEXT 3QKJA 2JUFA 2DD4A 4J9GA 4EDUA 3EH1A 1X75C 3QSUA 2QTXA 1JBMA 1JXOA 5LJ3e 4MZPA 4BI3A 4DBFA 4OGCA 5FU6B 3OY9A 4OMLA 2L0AA 3M58A 1N5ZA 2RNAA 4BB7A 1Q7YU 4J7IA 3QYGB 2KRNA 2LTOA 1QQJA 1YITA 4KUIA 5GAOq 2XI9A 5IXFA 4A4FA 1M3CA 5CQYA 2YHTA 3CPFA 1VQKQ 3G7ZA 2B8AA 2CZ0B 3I35A 1YITT 5GAN7 1OYXA 3HRTA 3CXCA 2HZYA 4PNOA 5GAMd 2VVKA 1OQKA 3V8KA 1Q81U 4LD9K 2LQ8A 4A4GA 1G8XA 1BK2A 1D3BA 4CRIA 2HEQA 2W10A 1U1SA 1GCQA 3EGXA 2DTIA 3O8VA 5KYUB 3CMAT 1BIAA 4J9EA 4QVCA 2D1XA 4C5HA 4NOYA 1FMVA 2WACA 1M1KU 3OBWA 2J06A 2CP5A 1F1BB 3PVLA 2M0YA 1W6XA 1H92A 5M9OA 4EIKA 2OTLA 4OVAA 2KEAA 5A0LA 1T0HA 3GLXA 4EMGA 3FJPA 3CC4A 5FRNA 1QWEA 2CZ1B 1MNDA 4PKCC 1WIEA 1QKWA 3QPHA 3CCSA 2K4YA 4DEXA 2LX7A 4DA4A 1BKBA 1I4K1 3THKA 1EX4A 3JV3A 2PVOB 3V7RA 3LGFA 3T9NA 5FU7C 1J3TA 1JB0E 1TSFA 2OTJA 1ZQ1A 2BZ8A 1WHLA 2EGAA 3CBOA 2J05A 1VQMA 4M75D 2OTJT 4J6YA 2E10A 3JB9J 2KSSA 4BACA 1UJ0A 2GFUA 2QQSA 3J7AF 4J83A 3FLGA 2C0TA 3DLLA 1Y96B 2LJ1A 1VQMT 1M8VA 1NPRA 5KYYB 1IHWA 4XK8E 3EAEA 2P84A 3HPWA 1XQHA 2BE9B 5GJVB 2DM1A 2AZVA 2D0NA 3VYHB 2COYA 1M1GA 2Y4YA 1X6BA 2BKDN 2EQMA 1AWJA 2OI3A 1W1FA 1VQ9Q 3L42A 4XU2A 3U23A 4HA8A 2VC8A 5GAN3 4C92E 3I55A 2JM8A 2QTVA 1I8FA 2LNVA 4KUDK 3EFRA 1D0ZA 4A4KA 4CC2A 3I55T 3CCUT 1R0CB 1K73R 2LMJA 4M78B 2K5LA 3Q1JA 4AFQC 2A0FB 2D8HA 2O88A 4XU0A 1WPYA 1NLPC 5CVIA 3CPWA 5A0DA 5GANe 1I81A 1NJIR 2QQRA 2ZCFB 5LJ3f 4L59A 2IVWA 4ATOA 3M55A 3G1JA 2HQXA 1AOJA 4N0AA 4NL2A 3M0SA 1Y0MA 4AFZC 2DVJA 1TWBA 3CCLQ 5KYXB 4ZN3A 3VKIA 1SEMA 2EQKA 3ZFJA 1ZSZB 2JM9A 1VQ5A 5GANh 3CC2Q 2GTJA 1WI7A 4C8QF 1YHQQ 3NHNA 1MV0B 3JCMW 2LP5A 2FRYA 4N4GA 3GF5A 1G2BA 1JJ2A 4Y92A 2H3EB 5FU7B 3OYAA 4M77F 4E7JA 2VXFA 1B3QA 3ER0A 4DOWA 5LJ5e 2V8KA 4C92C 1WHKA 4BE1A 1QVGP 2HD0A 1NYGA 1KQSA 3N5BB 4FU6A 2GF7A 3KXTA 2QQAA 2HKNA 4JRKA 3V7SA 1B34A 1K9AA 3RUXA 3H8ZA 1RACB 2LT1A 2JXBA 4NL3A 3GP8A 3QZ5B 4LDVA 4J9IA 3MP1A 4JLIA 4M75G 1TUCA 2C06A 4BY6C 4HVWA 3UF4A 1TXQA 5AYFA 3UDCA 5L23A 1AWOA 1NJIU 2HBPA 1I0CA 3M0QA 1KFZA 2K3BA 3CC7Q 5GMKe 3L2WA 4QQGA 4C5GA 3RDVA 2ESWA 1P92A 1RAEB 5CR2A 2HKQB 2VGNA 1NEGA 4QQDA 2VV5A 5LJ5h 1ZSGA 2KQWA 1PSEA 4RCCA 5CCAA 2CGHA 3CQTA 1YWOA 2RI5A 2FHDA 1BB9A 2NUPA 1PRLC 2V26A 1KHIA 3RESA 1XTDA 1N8RR 2LRQA 4ZNXA 1WZOA 2ZPEB 2BTTA 4AFUC 2DL5A 3VS2A 1YBYA 2E41A 4IURA 5GANg 2JS0A 5GMKh 2RQVA 3I56A 1PCXA 1BI0A 4D8DA 1ABOA 1NM7A 3PE0A 1MMAA 3PFSA 2QG9B 4Q5WA 4M75E 3JCMQ 1QVPA 4M7AE 1M3BA 2EVRA 3M53A 2KROA 3PGGA 1BI1A 2COZA 1GFDA 1C6VX 2QA4Q 4FM4B 2QK0A 4J8OA 3NTIA 1K73C 3G71T 1LCKA 2MCNA 2J6FA 4ELZC 3MEUA 2LC4A 3OMCA 4LD6A 5HY6A 4HVVA 2MWOA 3KFVA 2CH4A 2AKKA 3VRZA 1ZBXA 4FT2A 5GAN4 2FB7A 4J5YA 2JZ2A 4PJOF 2MOXA 2GGRA 3GNFB 3GNGA 2A36A 3QIIA 1VQ7T 4FCYA 1GXIE 1YWPA 2F5TX 1YJWT 1K0XA 2MIOA 1M2VB 1QKXA 4N4IA 4KGXB 1VQOT 1X27A 5C6SA 4RKUE 5LJ5g 2O9VA 2O4XA 1QP2A 3BY7A 4D6WA 3NMZC 1R77A 2RK1A 4C92B 3ZEHA 2L3QA 3JCMe 2ECZA 2YRDA 4RMOA 3EG9B 3H0IA 1WGSA 2MI6A 1W2BA 3ULRB 2EYYA 3OW2A 1KD1R 5GAOm 2K9GA 3GBQA 4LNPA 2KT8A 2J7IA 4BY6B 1S72Q 1RAFB 5KYWA 5GMKi 2XICA 3OYLA 2MPXC 4M75C 4PL6A 2A28A 4M7AC 2EYXA 2K7AA 1KC8C 4LDYA 3EFOA 4FYWB 1NLOC 4RTZA 2WSFE 2HQEA 2HAXA 3JCMc 4IUVA 2AT1B 1K1ZA 2C0IA 3M0PA 3VUBA 3ZBDA 1X01A 2QQBA 5LJ5f 1MUZA 4OB3B 1E6HA 1XOVA 3MCAB 4XTWA 4CC4B 2JTFA 3DB3A 4EPCA 9ATCB 1Z9ZA 1JXMA 1WJSA 1PD0A 3SWNA 2VUBA 1HJDA 3JCMP 1OX8A 2M1HA 2EKOA 2DA9A 1IHVA 5FWCA 2BUDA 2FVUA 3CD6T 1OI1A 1AWXA 4KH0B 1N8RC 2X4YA 3OBYA 2X3WD 4BDYA 2AZSA 1T3LA 3VRYA 1M90R 1YIJQ 2DXBA 3FC3A 2DZ9A 5HK0A 1WXBA 5C0MA 5IHNA 4OGEA 2DK3A 1SHFA 1OZ3A 3CMAQ 4JPBW 2QI2A 3MEVA 1QW1A 2RB6A 1G3SA 2OAWA 4BE2A 4F17A 1K8AR 3OYMA 2X9HA 2ED0A 1G3TA 1VQLQ 3M0UA 1PSFA 2LCSA 3CCQA 2PU9B 2RI2A 1YJNA 2CSQA 2EPDA 4Z88A 4XU3A 2PVGB 3CCMT 3A98A 3CCQT 2WSEE 3RMQA 2XIDA 1YJNT 1VQ4A 2VASA 2K2MA 2FRWA 1ZLMA 4HCCA 4DQ2A 4K11A 3META 2MWPA 4E7KA 2K2VA 1VQNQ 2FZKB 4JJNK 3X24B 1E7OA 2AIRB 1QLYA 3OMGA 4KT0E 2E65A 1GCQC 3JB9I 4M75B 4AT1B 4M7AB 1ZHIA 4NS5A 1SRLA 2DKGA 4C92D 5I21A 3A5ZB 3D7SB 4FW2A 1VYTA 3MO8A 5GAMj 1MMNA 5GAN6 1NG2A 1KD1C 1IO6A 3EGDB 2NWMA 1AHJB 3JCMf 1ZUYA 3PIPA 3RKXA 4E7LA 2X4XA 4QKUA 4JZ4A 3PMIA 3HKSA 3OSVA 4DEYA 2BIVA 3DB4A 3FDRA 1RI0A 2KRSA 2E5KA 4F7UG 1VOMA 2E5QA 2JTMA 3P8DA 3AT1B 2DRKA 3TCJA 1K4US 4C8QA 2G3RA 2JMCA 2K57A 1LNXA 5IHIA 3VYGA 2MK5A 1BBZA 3HFNA 2LX9A 1VIEA 1Q95G 3CCUQ 2D0QB 1O75A 4LUDA 4M77A 3SB2A 3CXCP 2LCCA 3JB9F 2MAMA 2OJ2A 1Y71A 1R8OB 2DBMA 4JRQA 3CCRQ 2FPDA 1VUBA 3TREA 1GCPA 1UTIA 2DJZA 4E7IA 4RTUA 4AFSC 2DO3A 3OYEA 3BW1A 2HQHA 1SHGA 1QWFA 3I5SA 1AD5A 1M30A 3CCVA 2M02A 3FIFA 4PJLA 2CZ6B 4F7UE 1M90C 1VQ8Q 5CQXA 1H3HA 1RAHB 2EJ9A 3C95A 1ZBJA 7AT1B 2YRCA 1TS9A 2LJ0A 2HCKA 3L1AA 1WHMA 2F5KA 1CKBA 1OU9A 1K8AC 4FSSA 2X51A 1D3BB 2XMFA 1M1FA 2NUZA 1SPKA 3EGXB 4HKEA 2DJQA 5FLXE 3EG1A 2CKKA 2KR3A 3WVDB 2OTLT 4JUVA 4N0AC 3EG2A 4X1VA 4HCBA 1VQ6A 2BZYA 3OYJA 1UHFA 1IRXA 3CC4T 4C92G 1HXDA 3BDUA 2AKLA 4KGVB 4C0ZA 2FG0A 3I5RA 3CCST 3DLMA 4YTLA 4B6MA 2KMTA 3NTKA 3OYNA 3LLRA 1I5OB 1LJOA 2DLPA 5CKFA 4FIBA 3BE3A 2F2XA 1UGRB 1WHJA 2O31A 2OAUA 3REBB 4M7AD 1Z9QA 4OMFB 4PJOA 1T0JA 5L8RE 2RJEA 3VS6A 1T3SA 3HRSA 2M0OA 1YJ9Q 4J9HA 2XDBA 4C0FA 1AVZC 2M9UA 1IGUA 4GLKA 4ZN1A 4EMKA 4X9CA 3QHSA 4MDWA 2ZAEA 3JCMd 3NFCA 3UA6A 1PHTA 4AG2C 5HKCA 4XTYA 2V8JA 1NBEB 3JCMV 3X20B 2CT4A 4ZTJA 3A1PA 2RJCA 2ZPIB 3L2RA 1YCYA 2DILA 2FO0A 4M4ZA 2HSPA 2YUOA 1O9SA 1V1CA 2YDLA 1W4SA 4M7DF 2QYZA 4M78A 4RTTA 3URGA 2DBKA 2FZCB 3SFMA 3EFSA 3EGUA 1IZ6A 2XHCA 3G71Q 3G6EQ 4E7ZA 3IQLA 1UG1A 1UGSB 4R55A 3G4SQ 1VA7A 2L89A 1Q86R 5A2QE 1X2QA 1YI2Q 2EBPA 1UFFA 1UDLA 1PG5B 1B07A 3A8GB 3GOXA 1M9SA 2XKOC 3SEMA 4C8QD 1A0NB 1DJ7B 2NYSA 5J26A 2D9TA 1VQ7Q 1YJWQ 1WXTA 1YFNA 4FT4A 4RTYA 1VQKA 3X26B 1VQOQ 6AT1B 4A53A 2RA2A 2XG8D 4M77D 3KUFA 1VQPQ 1JJ2P 1HYOA 2CS7A 1VQKT 5D6XA 4ELYC 3O5ZA 3H0FA 3J80E 2ATCB 4OF1A 4WF2A 2RD1A 1JU5C 2EKHA 1D1CA 1VQ5T 1G83A 2X3XD 1YNZA 3M4YA 5GMKl 4XQ3A 4RG8A 1X2KA 2E6NA 3JCMJ 1WDXA 5CO7A 2E3HA 2EQJA 5CKDA 3TSWA 3X28B 4J9FA 8ATCB 4JJBA 1KC8R 2RO0A 4RG2A 1D1BA 2V1QA 3VU3C 1K73U 5KYNA 2LT4A 4F7UB 2EJFA 2EIFA 1M27C 4Z02A 3H0HA 4M7AG 3EHRA 1ABQA 1UEBA 2IG0A 4QVZA 2RF0A 2F1LA 2FPFA 1B34B 2L5QA 4A63B 5LJ3j 4XU1A 2DX1A 5LL6S 2J6KA 2BZXA 2HL3A 3OYGA 4XTXA 2XU8A 1BCMA 1LPLA 3CBMA 3CCEQ 4E2FB 3OS5A 3CD6Q 4KULA 3GIBA 2ZPFB 4A54A 4PFZA 4WTOB 2LNHB 1NZ9A 4WCIA 2SEMA 3OYYA 5D6WA 2YLBA 4LDWA 5IN1A 3MHXA 2DEUA 4LN2A 3PTAA 2NUPB 2VWFA 3R6OA 3CMEQ 2LVMA 1VQ9A 2DXUA 4PJOD 3I56T 4JRPA 4J6WA 5CAIA 3EHQA 5GAMh 1AT1B 3FB9A 1KC8U 1M8MA 1NPPA 5ECAA 4BDZA 2E6ZA 2LCLA 4C8QG 2QASA 2E3IA 1QP3A 2GCXA 5GAN5 3VV0A 2R5MA 2KXCA 3SWNC 3RIRA 2E4HA 3M9QA 4JLGA 2FZGB 3CCMQ 2CUDA 1Q86C 1FMWA 4M77G 3VS0A 4CI0C 1RUWA 2ABLA 1W2BP 1SSFA 2DL8A 4OP0A 1SSHA 3M54A 4JJCA 5LJ3d 4E6RA 3OW2P 5GANf 5GAOr 2NUTA 3V7CA 1R0BG 4P5NA 3RBBB 1U1TA 1WX6A 4IUQA 1Y57A 2X4WA 1BU1A 5FROA 3CCLA 1N8RU 4XTVA 4JS4A 2CP3A 4C0GA 2DFUA 1OEBA 4DOVA 3CCLT 2ROLA 3RERA 1UECA 1IXDA 4C8QE 4V2SA 3CC2A 1MMDA 2I2LA 4M78F 1YHQA 2O4XB 2JJ9A 3CCJQ 1I1JA 2RHXA 4B9XA 3E9GA 3CEYA 1WJRA 2JN0A 1UGPB 1CKAA 2E12A 5GAN8 1I5LA 2EGCA 4M77E 4ESRA 3E19A 3NTHA 2Z0WA 1Q82R 5DLQE 1FXXA
chains in the Genus database with same CATH topology
2OTJA 1AHJB 3JCMf 5GAMg 1U8RA 3OYIA 1ZQ1A 3E1SA 2DXTA 4PLLA 4A4EA 3RKXA 3PIPA 4E7LA 2CZ7B 2E64A 2X4XA 3LW5E 3MEAA 3S3NA 3CBOA 4ZGDB 1VQMA 4L5GA 4M7DG 3PMIA 3HKSA 3OSVA 2YLCA 4QQ6A 4M75D 2BIVA 2OTJT 4J6YA 2E10A 3DB4A 3FDRA 1RI0A 3JB9J 2KSSA 4BACA 2RHIA 2GFUA 2QQSA 3OYCA 3J7AF 4J83A 3FLGA 3DLLA 1QVGA 1Y96B 5GAMe 3JAME 4F7UG 1VQMT 1JRIA 4ME7A 1M8VA 1NPRA 2E5QA 2JTMA 3P8DA 4HCZA 4MZMA 4OB0B 3PIOA 4XK8E 3EAEA 3TCJA 3HPWA 1XQHA 3A8OB 3QDRB 2EWNA 4RCBA 1G5VA 4C8QA 2G3RA 2EQUA 2XDDA 3CC7A 3VYHB 3JB9H 1BI3A 1M1GA 2Y4YA 2K57A 5KH6A 1LNXA 2BKDN 2EQMA 1WNLA 3VYGA 2EFIA 1YJ9A 2L3RA 2AHJB 3HFNA 2JOYA 2LX9A 1VIEA 3L42A 1XNIA 3CC7T 4XU2A 4IKFA 2D0QB 2R58A 1O75A 3SB2A 4M77A 1QVGS 2LCCA 4HA8A 2VC8A 5GAN3 2ZPGB 4C92E 3JB9F 1YJ9T 2MAMA 3I55A 1Y71A 3LWHA 1R8OB 3OQ5A 3RKWA 4JRQA 5GANj 5DM7R 3ME9A 1I8FA 2LNVA 4Y91A 5KCHA 2GQVA 2ZGWA 1VUBA 4KUDK 2RI3A 3EFRA 3TREA 3LGLA 4A4KA 2DJZA 3SWNB 1KD1U 2RHYA 1VQ9T 3I55T 3CCUT 4E7IA 3L2VA 3HSBA 3WVEB 1OZ2A 3ASKA 2DO3A 1KQ1A 2DIGA 4M78B 2K5LA 3BW1A 4MZTA 3OYEA 4M7DE 3Q1JA 3OYDA 3RKYA 4C8QC 3QZ9B 4F7UF 3CCVA 5KE2A 3FIFA 4XU0A 1WPYA 3CPWA 5CVIA 2CZ6B 5A0DA 4F7UE 3OYBA 5GANe 5EG2A 3HRUA 1I81A 2QQRA 2ZCFB 5LJ3f 4L59A 3TU4K 3G71A 3G6EA 4A53A 1M90C 2IVWA 5CQXA 3M57A 4C5EA 4ATOA 1VIFA 2K3XA 3M55A 2HQXA 1FX7A 3G4SA 3HP9A 2EJ9A 4M77C 4UC4A 3C95A 4N0AA 4NL2A 2KY9A 1BIBA 1YI2A 2A7YA 2RHZA 3OYKA 3G6ET 3C12A 2FL7A 3G4ST 2DZCA 4M78D 2QA4A 1FWZA 3L1AA 5DY9A 2F5KA 3VUZA 3S3OA 1YI2T 4C92A 1H3ZA 1VQ7A 1G3WA 2H3JA 3A8LB 1YJWA 1NJIC 3OB9A 3CPWS 3J81E 2XDPA 4ZN3A 3VKIA 1BYMA 2QA4T 1VQOA 2EQKA 1K8AC 3UT1A 1N27A 3ZFJA 4PJOE 4IUTA 1VQ5A 1D3BB 1VQPA 1M1FA 5LJ5j 3V8JA 5GANh 3L2QA 1VQ4T 4IUUA 4MMKA 4HKEA 5FLXE 2RJFA 4C8QF 4M7DA 5A0GA 2KVQG 3F70A 2JVVA 3JCMW 3LH0A 2CKKA 1IREB 4C5IA 2RM4A 3WVDB 4N4GA 1VQPT 2OTLT 4JUVA 3GF5A 3PT9A 4N0AC 3OS0A 1JJ2A 4HT9A 5I2MA 2QXFA 4X34A 4R56A 2EJGA 4HCBA 1VQ6A 3OYJA 5FU7B 3BDLA 2LQKA 3OYAA 4KBMB 4M77F 5GANd 4LDUA 3P8BB 3CC4T 4E7JA 2VXFA 3QJYA 4C92G 3CC2T 1HXDA 3BDUA 3ER0A 2V8KA 4OB1B 4C0DC 4DOWA 5LJ5e 1YHQT 4BI8B 4C0ZA 4C92C 4BE1A 2HD0A 2EYQA 4MDXA 1KQSA 1G3YA 1M90U 3CCST 2FYKA 3N5BB 2Y90A 3DLMA 4FU6A 2GF7A 3KXTA 2QQAA 5GMKj 4YTLA 3C4SA 2KMTA 3NTKA 4JRKA 3LLRA 3HL8A 3INZA 3V7SA 1B34A 3OYNA 4JRIA 1LJOA 2R5AA 2XD0A 2PVDB 3RUXA 3QBYA 3H8ZA 5CKHA 5CKFA 2LT1A 4FIBA 2Y4XA 4NL3A 3GP8A 1UGRB 1JJ2S 2OAUA 4M7DC 3QZ5B 2MF2A 4LDVA 3M4GA 3MP1A 4JLIA 4M75G 1S72A 4M7AD 2C06A 4OMFB 4BY6C 2R57A 3MEWA 3OS2A 3JB9D 4PJOA 5AYFA 3V8LA 3UDCA 2DVEA 1NJIU 2HBPA 3JCMh 3DKMA 5L8RE 2RJEA 5GMKe 5CKBA 4QQGA 3L2WA 1Q82C 4C5GA 1K8AU 1S72T 1KQSS 3HRSA 1P92A 5CR2A 3JRZA 2K5FA 2M0OA 2VGNA 2PQWA 2K3YA 4QQDA 2VV5A 5LJ5h 3JCMX 3A8MB 1M5Q1 2KQWA 3L2UA 2XK0A 2XDBA 1V29B 1PSEA 2M9UA 4GLKA 3QYHB 4RCCA 4C0FA 4E47A 5CCAA 2CGHA 4ZN1A 4EMKA 4X9CA 4J7FA 2RI5A 2FHDA 3QHSA 2WSCE 3RMSA 4HT8A 4MDWA 2K5IA 3JCMd 1Y7XA 3NFCA 1KHIA 4IUPA 3RESA 4C92F 2EAYA 1UB4A 5HKCA 1XTDA 2V8JA 3M56A 2LRQA 3MP6A 4O5VA 4XTYA 3JCMV 3X20B 3BFMA 2P0PA 4ZGEB 4ZTJA 4E7HA 2ZPEB 3M5AA 2RJCA 4B9WA 5LJ5d 2ZPIB 2DTOA 4PJOG 3OYFA 1YBYA 3L2RA 1YCYA 2E41A 2CYZB 4FSXA 3UPUA 2DIQA 3QXEB 4IURA 2A3LA 3CCEA 4PJOC 1O9SA 4C8QB 5HK3A 3CD6A 2NLUA 4L6V5 5D6YA 5GANg 5GAMf 5IT9E 2RJDA 1W4SA 2P4TA 4M7DF 4M78A 2DAQA 5GMKh 3URGA 3I56A 3MP8A 3SFMA 1BI0A 3GPLA 3CCET 1X6OA 3EFSA 1IZ6A 2XHCA 3PFSA 4Q5WA 4M75E 2ZZDA 3JCMQ 1QVPA 4M7AE 4M77B 2DPPB 1UGSB 2P0QA 5CKEA 4R55A 1KHCA 3X25B 4EMKC 5FU6C 2QQ9A 2L89A 2YRVA 5A2QE 3M53A 1H641 3CMEA 2ZPHB 3PGGA 1BI1A 3A8GB 2M16A 3CCVT 2PUKB 3OS1A 5CIUA 3GOXA 3QO3A 1KG1A 2QDYB 1M9SA 2XKOC 5FRMA 4C8QD 1YIJA 1Q82U 4FM4B 1DJ7B 4J8OA 4BD3A 3NTIA 1K73C 5J26A 3G71T 2D9TA 2KK4A 3CMET 3QG1A 2P0KA 2RH2A 5GAOp 4ELZC 3MEUA 4N4HA 5KCOA 2LC4A 3OMCA 4FT4A 4LD6A 1VQKA 3E9FA 3TEEA 4M78G 5HY6A 5LJ3h 3X26B 2MWOA 3OYHA 1YIJT 1WQWA 4M78C 1ZBXA 2KAFA 3JSCA 3CMAA 4FT2A 3WXMB 2RA2A 2XG8D 2FB7A 3KUFA 4J5YA 2JZ2A 4M77D 4PJOF 5GAN4 4JS5A 4ZTFA 2CS7A 1VQKT 3GNFB 5D6XA 4BE0A 3GNGA 3VJPA 2E70A 3CBPA 3QIIA 4VUBA 4ELYC 3CCMA 1VQ7T 3JCMg 1K9MC 1GXIE 5GAOl 3P8HA 2F5TX 1BI2A 2VGMA 1YJWT 3J80E 1VQLA 4OF1A 4WF2A 1LOJA 4ZGJB 2RD1A 3LX7A 4N4IA 1VQOT 1NE8A 5C6SA 4RKUE 5LJ5g 4XTZA 1VQ5T 3C94A 4FL6A 2O4XA 1QP2A 3BY7A 4M75A 4D6WA 3L2ZA 4M7AA 3FEOA 3M4YA 3HFOA 4C0DB 1QVFA 2RK1A 1N6AA 3ZEHA 2DEQA 4C92B 3JCMe 5GMKl 3OA6A 4XQ3A 1VQLT 3S3MA 1RL2A 1HK9A 4RG8A 3S6WA 2E6NA 4RMOA 3JCMJ 5CO7A 3M59A 2MMPA 3SD4A 1WGSA 2MI6A 1W2BA 5CKDA 2EQJA 3X28B 4BUGA 3OW2A 1Y07A 1VQ6T 2VXEA 5GAOm 2RO0A 2DTHA 4MMLA 3PMTA 1MHNA 4M7DB 1WQ7A 3QUIA 4JDSA 5J3BA 3KBGA 4J6XA 4RG2A 4BY6B 3VU3C 1K73U 4QW2A 1VQNA 2O01E 2LT4A 4M78E 4F7UB 2EJFA 5GMKi 1QVFS 4GY5A 1Q7YC 5GMKm 2EIFA 2GFAA 1Y96A 4Z02A 3CCJA 2XICA 2V8IA 3OYLA 4M7AG 4M75C 1VQNT 4PL6A 3JB9G 1W2BS 4M7AC 2RK2A 1KC8C 1UEBA 4LDYA 2IG0A 3OW2S 4QVZA 3QJ6A 5CK9A 2DD5A 3CCJT 2HNIA 2WSFE 2HQEA 4BI4A 2HAXA 3JCMc 4IUVA 1K9MU 4M7DD 3LYIA 1B34B 3ZBDA 3VUBA 2L5QA 1X01A 2QQBA 3FRNA 5LJ5f 2QEXA 2E1HA 5LJ3j 4XU1A 5GAN2 4XTUA 3HHTB 4OB3B 3A8HB 5LL6S 3UWNA 1XOVA 1Q81C 3OYGA 4XTXA 2X4JA 2XU8A 5LJ3g 3MCAB 4XTWA 4PJOB 2QEXT 2JTFA 2JUFA 3CBMA 3DB3A 3QKJA 4EPCA 3OS5A 2DD4A 4KULA 3GIBA 4EDUA 2KDSA 1WJSA 2ZPFB 3SWNA 4A54A 1X75C 2VUBA 4II1A 5GAOn 3QSUA 2QTXA 1JBMA 3JCMP 2M1HA 5DLOA 5LJ3e 2X35A 1N9RA 1NZ9A 2EKOA 4MZPA 4BI3A 5KE3A 3LWIA 1M1KC 3OYYA 5D6WA 2YLBA 4LDWA 5IN1A 3MHXA 4OGCA 5FU6B 4EMKB 3OY9A 2BUDA 3PTAA 4M75F 2FVUA 3CD6T 4M7AF 1OI1A 3OSSC 3R6OA 3M58A 1N8RC 2LVMA 2X4YA 1VQ9A 3OBYA 1UGQB 2DXUA 4BB7A 3CCUA 4J7IA 3I56T 4BDYA 3QYGB 1Q7YU 4PJOD 4JRPA 4J6WA 2VYTA 4PLIA 5CAIA 4X9DA 2LTOA 4O6JA 5GAMh 2F69A 4KUIA 1YITA 2DXBA 5GAOq 2XI9A 4A4FA 3FC3A 3FB9A 2DZ9A 2YHTA 5CQYA 1KC8U 5HK0A 3CPFA 3CCRA 1NPPA 3G7ZA 5C0MA 4BDZA 2E6ZA 2LCLA 4C8QG 4OGEA 2B8AA 1QP3A 2DK3A 1MGQA 1OZ3A 2CZ0B 2GCXA 5GAN7 1YITT 1OYXA 3HRTA 5GAN5 3CXCA 3VV0A 2R5MA 3SWNC 3RIRA 2QI2A 3CCRT 3MEVA 1QW1A 2RB6A 3H6ZA 4PNOA 3M9QA 5J39A 5GAMd 3V8KA 1G3SA 4JLGA 1Q81U 4BE2A 4LD9K 2LQ8A 4A4GA 1Q86C 4A4HA 4M77G 3OYMA 1G3TA 4CI0C 1D3BA 4CRIA 1U1SA 5I2SA 1PSFA 3CCQA 2PU9B 2RI2A 1VQ8A 1YJNA 1SSFA 2DTIA 3O8VA 4OP0A 3SDZA 1BIAA 3CMAT 3M54A 4XU3A 5LJ3d 2PVGB 5GANf 5GAOr 4QVCA 4C5HA 4NOYA 3V7CA 2WACA 2ZPBB 3CCMT 3OBWA 3CXCS 2JNGA 4P5NA 2WSEE 3RMQA 3CCQT 1M1KU 1VQ8T 2XIDA 1YJNT 1U1TA 4IUQA 4QVDA 1TH7A 2X4WA 5IAYA 1WJQA 1VQ4A 3AHUA 5FROA 3CCLA 1N8RU 5M9OA 4XTVA 4JS4A 4DQ2A 2OTLA 4HCCA 3PNWC 4C0GA 1EIFA 3META 4OVAA 2MWPA 4E7KA 5A0LA 2K2VA 4DOVA 3CCLT 2LDMA 3JCMb 3RERA 4JJNK 4OB2B 3GLXA 3X24B 4EMGA 4C8QE 1M4ZA 4V2SA 3CC2A 3FJPA 2L8DA 3CC4A 5FRNA 2I2LA 3OMGA 4KT0E 2CZ1B 2PUOB 2E65A 2O4XB 4M78F 4TVRA 4M75B 3JB9I 4F7UA 1YHQA 4PKCC 2RHXA 4M7AB 1ZHIA 2DXCA 4NS5A 4B9XA 3QPHA 3E9GA 3CCSA 4LDXA 2DKGA 4Y28E 1KQ2A 2K4YA 4C92D 2RHUA 3CEYA 5I21A 1WJRA 2JN0A 1UGPB 1BKBA 3A5ZB 2E12A 4DA4A 1I4K1 5GAN8 1I5LA 3MO8A 4M77E 4EMHA 5GAMj 3E19A 5GAN6 2PVOB 3V7RA 3LGFA 3T9NA 1Q86U 1N9SA 3NTHA 1KD1C 5FU7C 5DLQE 2D6FA 1FXXA 1JB0E 4XAXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DOV A;  4JJN K;  1W4S A;  1M4Z A;  2FL7 A;  3PT9 A;  4FT4 A;  3PTA A;  1ZHI A;  2FVU A;  1ZBX A;  4FT2 A;  4DA4 A;  4BB7 A;  4LD9 K;  3TU4 K;  4DOW A;  4KUL A;  4KUI A;  4FSX A;  4KUD K; 
#chains in the Genus database with same CATH topology
 2GTO A;  5GAM g;  1U8R A;  3OYI A;  2QEX Q;  2DXT A;  4PLL A;  4A4E A;  2E64 A;  3LW5 E;  3S3N A;  4L5G A;  3RR6 A;  4QQ6 A;  1D0Y A;  5KYW B;  3JAM E;  1JRI A;  2LQW A;  4OB0 B;  2YUP A;  1VYU A;  4Z89 A;  1U06 A;  3A8O B;  2AK5 A;  3QDR B;  4RCB A;  3EFO B;  2EQU A;  2YUQ A;  3CC7 A;  4GLM A;  3JB9 H;  1BI3 A;  1WNL A;  2EFI A;  2JOY A;  4FW1 A;  3CC7 T;  4IKF A;  2R58 A;  1QVG S;  4ORZ A;  2ZPG B;  1YIT Q;  1SKU B;  3LWH A;  2JS2 A;  3RKW A;  2EGE A;  5GAN j;  5DM7 R;  1WXU A;  5KCH A;  2GQV A;  2ZGW A;  1ZX6 A;  2RI3 A;  3SWN B;  1KD1 U;  2DYB A;  1OZ2 A;  1GRI A;  1JQQ A;  4D8K A;  2DIG A;  4KRT A;  4MZT A;  2L2P A;  3OYD A;  3RKY A;  1AZG B;  4C8Q C;  4F7U F;  4PFP A;  5KE2 A;  3OYB A;  1WHH A;  3HRU A;  3TU4 K;  4JJD A;  1QVF P;  3M57 A;  4OMM A;  1VIF A;  1ARK A;  4M77 C;  2KY9 A;  3VS3 A;  1YN8 A;  5IH2 A;  3OYK A;  2HBW A;  3EG0 A;  2DZC A;  2QA4 A;  1FWZ A;  5DY9 A;  3S3O A;  1H3Z A;  3A8L B;  3OB9 A;  3J81 E;  3H41 A;  2OTL Q;  2XDP A;  2CRE A;  1V76 A;  2QA4 T;  3UT1 A;  1N27 A;  4PJO E;  4HCK A;  5LJ5 j;  3V8J A;  3L2Q A;  3CC4 Q;  4IUU A;  1VQ4 T;  2SRC A;  4MMK A;  3VS5 A;  4M7D A;  5A0G A;  5AT1 B;  2JVV A;  3LH0 A;  2DET A;  1IRE B;  2RM4 A;  1ACM B;  3CCS Q;  1GBR A;  4RTW A;  2JW4 A;  5I2M A;  4LUE A;  2RPN A;  4DBH A;  3BDL A;  2LQK A;  3H9N A;  4KBM B;  5GAN d;  4C0D C;  4OB1 B;  2OTJ Q;  2EYQ A;  4MDX A;  1G3Y A;  1M90 U;  2FYK A;  1VQM Q;  2KBT A;  1I07 A;  1PKT A;  5GJW B;  5GMK j;  3INZ A;  2XD0 A;  3QBY A;  4JZ3 A;  1EFN A;  5CKH A;  4E7S A;  1GFC A;  1UJY A;  4J9C A;  2MF2 A;  1Q81 R;  1S72 A;  1ZUU A;  3HTR A;  1TU0 B;  3JB9 D;  2IIM A;  2JT4 A;  3DKM A;  5CKB A;  1D1A A;  2W0Z A;  1Q82 C;  1K8A U;  1BCO A;  2LJ3 A;  2RMO A;  1S72 T;  3JRZ A;  2LQN A;  3A8M B;  1M5Q 1;  3JCM X;  3L2U A;  2XK0 A;  1V29 B;  1WYX A;  4E47 A;  2YUN A;  2DER A;  1U3O A;  2BE7 D;  4HVU A;  1OX9 A;  2WSC E;  3RMS A;  4HT8 A;  2FEI A;  3I55 Q;  1Y7X A;  5EC7 A;  4C92 F;  2EAY A;  1UB4 A;  3M56 A;  3MP6 A;  1UGV A;  4KGZ B;  1MV3 A;  4ZGE B;  2P0P A;  3QDF A;  1S1N A;  4E7H A;  5LJ5 d;  4B9W A;  2DTO A;  2RN8 A;  3OYF A;  2DL4 A;  4FSX A;  3UPU A;  4PJO C;  2A3L A;  1SF9 A;  1OUL A;  4C8Q B;  2NLU A;  5D6Y A;  3E2U A;  5IT9 E;  2DL3 A;  2RJD A;  2P4T A;  3MP8 A;  3GPL A;  1FMK A;  2YSQ A;  4M77 B;  2HDA A;  2JMA A;  5CKE A;  4DBQ A;  4EMK C;  2KXD A;  3CCV T;  2M16 A;  3OS1 A;  3QO3 A;  1KG1 A;  5KYU A;  5FRM A;  1YIJ A;  1M3A A;  4BD3 A;  2RQU A;  2P0K A;  5GAO p;  5KCO A;  5FWB A;  3E9F A;  3TEE A;  3OYH A;  5LJ3 h;  1YIJ T;  1WQW A;  3VS1 A;  4M78 C;  3JSC A;  1VQ5 Q;  3CMA A;  3WXM B;  4OMN A;  4JS5 A;  1PRM C;  1ZA1 B;  4DBR A;  4VUB A;  1NYF A;  2DMO A;  3M0T A;  1K9M C;  4OMO A;  1VQL A;  3LX7 A;  4XTZ A;  1RAD B;  3FEO A;  4C0D B;  3HFO A;  1N6A A;  1VQL T;  3OA6 A;  3S3M A;  2C0O A;  3M59 A;  2MMP A;  3SD4 A;  4BUG A;  1RLP C;  2CDT A;  2CH4 W;  4F04 B;  1VQ6 T;  2DTH A;  1OPL A;  1MHN A;  1ZSZ C;  3QUI A;  2GBQ A;  2V1R A;  2QAZ A;  4JDS A;  3KBG A;  4J6X A;  1VQN A;  1QVF S;  4GY5 A;  1Q7Y C;  5GMK m;  2CUB A;  1Y96 A;  5KYY A;  1VQN T;  3JB9 G;  3QWX X;  1WFW A;  1D09 B;  4PJN A;  3QJ6 A;  2DD5 A;  2CP0 A;  4KH1 B;  2HNI A;  2K79 A;  4M7D D;  3LYI A;  3FRN A;  2QGF B;  2E1H A;  5GAN 2;  4XTU A;  2F2V A;  3A8H B;  1K76 A;  1TOV A;  4J9D A;  1Q81 C;  2VB6 A;  4OMQ A;  5LJ3 g;  4AMC A;  4PJO B;  4RUG A;  3CPW P;  2KDS A;  3I56 Q;  4II1 A;  5GAO n;  3VS7 A;  1WLP B;  5DLO A;  3LWI A;  2X35 A;  1N9R A;  1M1K C;  4R0K A;  5KE3 A;  2RQW A;  4EMK B;  2EQI A;  2I0N A;  4M75 F;  4M7A F;  3OSS C;  2DNU A;  1UGQ B;  3CCU A;  2CP7 A;  4J9B A;  2VYT A;  4PLI A;  4X9D A;  2A08 A;  4O6J A;  1RLQ C;  2F69 A;  1TG0 A;  1PM3 A;  3CCR A;  4CC7 A;  2KRM A;  4PJM A;  1MGQ A;  1OPK A;  3CCR T;  1PD1 A;  1SG5 A;  3H6Z A;  4QT7 A;  5KYX A;  5J39 A;  1WA7 A;  1QCF A;  1RAA B;  1ZSZ A;  3M0R A;  2KE9 A;  5I2S A;  1KJW A;  1GBQ A;  1VQ8 A;  1E6G A;  3SDZ A;  2J6O A;  1KQS P;  2ZPB B;  3REA B;  2CP6 A;  3CXC S;  2JNG A;  2QDL A;  1IGQ A;  1VQ8 T;  4QVD A;  1TH7 A;  1C0M A;  5IAY A;  1WJQ A;  3AHU A;  4ANJ A;  2G6F X;  4F16 A;  3UAT A;  2GNC A;  3PNW C;  1PWT A;  1EIF A;  2LDM A;  3JCM b;  4OB2 B;  1M4Z A;  3EG3 A;  2ED1 A;  2L8D A;  4GBQ A;  2PTK A;  1H8K A;  2PUO B;  4FYY B;  4TVR A;  2CP2 A;  4F7U A;  1ZA2 B;  2GQI A;  2DXC A;  1YP5 A;  4LDX A;  1KQ2 A;  4Y28 E;  5IXB A;  2RHU A;  3ZL7 C;  4EMH A;  1Q86 U;  1N9S A;  1TUG B;  2HSE B;  2COW A;  1LVK A;  1TTH B;  2D6F A;  2D8J A;  4XAX B;  3E1S A;  4LE9 A;  2CZ7 B;  3MEA A;  1AEY A;  3I9Q A;  4ZGD B;  1AWW A;  4M7D G;  4RTV A;  2YLC A;  5IHK A;  2RHI A;  4PJJ A;  2KGT A;  5I22 A;  3OYC A;  1QVG A;  5GAM e;  4ME7 A;  8AT1 B;  4MZM A;  4HCZ A;  1X43 A;  3PIO A;  2EWN A;  2KT1 A;  1G5V A;  2RQT A;  2XDD A;  2L3P A;  5KH6 A;  2PNI A;  1YJ9 A;  2L3R A;  1U5S A;  2AHJ B;  1RAB B;  1XNI A;  1QMC A;  4IIM A;  1YJ9 T;  3OQ5 A;  4CC3 A;  2L3S A;  3C0C A;  3ME9 A;  1RI9 A;  1UHC A;  4Y91 A;  2PZ1 A;  3LGL A;  2KYB A;  2RHY A;  1VQ9 T;  3L2V A;  3HSB A;  3WVE B;  3ASK A;  1KQ1 A;  2H8H A;  4M7D E;  2DYI A;  3TQ7 P;  3QZ9 B;  1NEB A;  2EW3 A;  2P4R A;  2M51 A;  3SHW A;  2QGG A;  5EG2 A;  1JEG A;  3G71 A;  3G6E A;  1B7T A;  4HXJ A;  4OMP A;  3CCQ Q;  4C5E A;  1YJN Q;  2K3X A;  1FX7 A;  3G4S A;  3HP9 A;  1XJW B;  4UC4 A;  1BIB A;  1YI2 A;  1M2V A;  2A7Y A;  2RHZ A;  3G6E T;  3C12 A;  1RAG B;  2FL7 A;  3G4S T;  4M78 D;  1VQ4 Q;  3MKD A;  1X6G A;  3VUZ A;  1YI2 T;  4C92 A;  1VQ7 A;  1G3W A;  1ZUK A;  2H3J A;  1YJW A;  1NJI C;  3CPW S;  1X69 A;  4AG1 C;  3QWY A;  1BYM A;  1VQO A;  3EG9 A;  4IUT A;  1VQP A;  1JO8 A;  4LXC A;  2JTE A;  3TVT A;  2RJF A;  2KVQ G;  3F70 A;  1OU8 A;  4C5I A;  2NUT B;  1VQP T;  2F2W A;  3PT9 A;  3OS0 A;  3NGP A;  4HT9 A;  2DF6 A;  2QXF A;  4X34 A;  4R56 A;  2CSI A;  2EJG A;  4LDU A;  3P8B B;  5D7U A;  3CC2 T;  3QJY A;  2MYS A;  2K6D A;  1YHQ T;  4BI8 B;  2Y90 A;  3C4S A;  3HL8 A;  4JRI A;  2KI7 A;  2R5A A;  2PVD B;  1PNJ A;  2Y4X A;  1GL5 A;  1JJ2 S;  2O9S A;  4M7D C;  3M4G A;  3PVQ A;  1KK7 A;  2R57 A;  3MEW A;  3OS2 A;  3V8L A;  2DVE A;  3JCM h;  1OOT A;  1KQS S;  3RNJ A;  2K5F A;  2PQW A;  2K3Y A;  2ROT A;  1MMG A;  3QYH B;  3MPU B;  1K0S A;  1W70 A;  4J7F A;  2K5I A;  4IUP A;  4FYX B;  4Z8A A;  4O5V A;  5HCK A;  3BFM A;  2KNB B;  1FYN A;  3M5A A;  2VKN A;  3EH2 A;  4PJO G;  1KIK A;  1QCO A;  2CYZ B;  5I11 A;  1QCN A;  2DIQ A;  3QXE B;  3CCE A;  5HK3 A;  3CD6 A;  1OV3 A;  4L6V 5;  5GAM f;  2DAQ A;  5FW9 A;  3CCV Q;  2OX7 A;  3CCE T;  1X6O A;  1VYV A;  4PK4 A;  2ZZD A;  2DL7 A;  1PKS A;  2DPP B;  2P0Q A;  1KHC A;  3X25 B;  5FU6 C;  2QQ9 A;  2YRV A;  1UUE A;  1H64 1;  3CME A;  2ZPH B;  2O2O A;  2PUK B;  5CIU A;  2QDY B;  1K9M R;  1Q82 U;  1RAI B;  2KK4 A;  3LH5 A;  3CME T;  3QG1 A;  1HD3 A;  2RH2 A;  3UA7 A;  2A37 A;  4N4H A;  2DE0 X;  1CSK A;  4M78 G;  2YWW A;  3NPF A;  2KAF A;  4A4H A;  4ZTF A;  1MNE A;  4RTX A;  1SRM A;  4BE0 A;  2YT6 A;  1D0X A;  3VJP A;  2E70 A;  3CBP A;  4IIO A;  2EYW A;  2CT3 A;  3CCM A;  2KYM A;  3JCM g;  2DRM A;  3P8H A;  3VS4 A;  5GAO l;  1M2O A;  2VGM A;  1BI2 A;  1TUD A;  1LOJ A;  4ZGJ B;  1NE8 A;  4F14 A;  1VQ6 Q;  3C94 A;  4FL6 A;  3TSZ A;  4M75 A;  3L2Z A;  4M7A A;  1QVF A;  2DEQ A;  3R6N A;  4PFO A;  1Q7Y R;  1RL2 A;  1WHG A;  2RQR A;  1C1A A;  1HK9 A;  3S6W A;  2YXY A;  1EZZ B;  1Y07 A;  2HL5 C;  3EGD A;  2VXE A;  1PC0 A;  2IPO B;  4MML A;  1YCS B;  3PMT A;  3FJ5 A;  4M7D B;  1WQ7 A;  5J3B A;  1KSW A;  2EYZ A;  4QW2 A;  2O01 E;  4M78 E;  1AZE A;  2GFA A;  3CCJ A;  2V8I A;  1IB8 A;  1W2B S;  2RK2 A;  2B86 A;  3OW2 S;  1HSQ A;  4FYV B;  5CK9 A;  3CCJ T;  4BI4 A;  1K9M U;  1M1K R;  2QEX A;  2ENM A;  2FPE A;  3HHT B;  3UWN A;  1UE9 A;  2LZ6 B;  2X4J A;  2HMA A;  3MJX A;  2QEX T;  3QKJ A;  2JUF A;  2DD4 A;  4J9G A;  4EDU A;  3EH1 A;  1X75 C;  3QSU A;  2QTX A;  1JBM A;  1JXO A;  5LJ3 e;  4MZP A;  4BI3 A;  4DBF A;  4OGC A;  5FU6 B;  3OY9 A;  4OML A;  2L0A A;  3M58 A;  1N5Z A;  2RNA A;  4BB7 A;  1Q7Y U;  4J7I A;  3QYG B;  2KRN A;  2LTO A;  1QQJ A;  1YIT A;  4KUI A;  5GAO q;  2XI9 A;  5IXF A;  4A4F A;  1M3C A;  5CQY A;  2YHT A;  3CPF A;  1VQK Q;  3G7Z A;  2B8A A;  2CZ0 B;  3I35 A;  1YIT T;  5GAN 7;  1OYX A;  3HRT A;  3CXC A;  2HZY A;  4PNO A;  5GAM d;  2VVK A;  1OQK A;  3V8K A;  1Q81 U;  4LD9 K;  2LQ8 A;  4A4G A;  1G8X A;  1BK2 A;  1D3B A;  4CRI A;  2HEQ A;  2W10 A;  1U1S A;  1GCQ A;  3EGX A;  2DTI A;  3O8V A;  5KYU B;  3CMA T;  1BIA A;  4J9E A;  4QVC A;  2D1X A;  4C5H A;  4NOY A;  1FMV A;  2WAC A;  1M1K U;  3OBW A;  2J06 A;  2CP5 A;  1F1B B;  3PVL A;  2M0Y A;  1W6X A;  1H92 A;  5M9O A;  4EIK A;  2OTL A;  4OVA A;  2KEA A;  5A0L A;  1T0H A;  3GLX A;  4EMG A;  3FJP A;  3CC4 A;  5FRN A;  1QWE A;  2CZ1 B;  1MND A;  4PKC C;  1WIE A;  1QKW A;  3QPH A;  3CCS A;  2K4Y A;  4DEX A;  2LX7 A;  4DA4 A;  1BKB A;  1I4K 1;  3THK A;  1EX4 A;  3JV3 A;  2PVO B;  3V7R A;  3LGF A;  3T9N A;  5FU7 C;  1J3T A;  1JB0 E;  1TSF A;  2OTJ A;  1ZQ1 A;  2BZ8 A;  1WHL A;  2EGA A;  3CBO A;  2J05 A;  1VQM A;  4M75 D;  2OTJ T;  4J6Y A;  2E10 A;  3JB9 J;  2KSS A;  4BAC A;  1UJ0 A;  2GFU A;  2QQS A;  3J7A F;  4J83 A;  3FLG A;  2C0T A;  3DLL A;  1Y96 B;  2LJ1 A;  1VQM T;  1M8V A;  1NPR A;  5KYY B;  1IHW A;  4XK8 E;  3EAE A;  2P84 A;  3HPW A;  1XQH A;  2BE9 B;  5GJV B;  2DM1 A;  2AZV A;  2D0N A;  3VYH B;  2COY A;  1M1G A;  2Y4Y A;  1X6B A;  2BKD N;  2EQM A;  1AWJ A;  2OI3 A;  1W1F A;  1VQ9 Q;  3L42 A;  4XU2 A;  3U23 A;  4HA8 A;  2VC8 A;  5GAN 3;  4C92 E;  3I55 A;  2JM8 A;  2QTV A;  1I8F A;  2LNV A;  4KUD K;  3EFR A;  1D0Z A;  4A4K A;  4CC2 A;  3I55 T;  3CCU T;  1R0C B;  1K73 R;  2LMJ A;  4M78 B;  2K5L A;  3Q1J A;  4AFQ C;  2A0F B;  2D8H A;  2O88 A;  4XU0 A;  1WPY A;  1NLP C;  5CVI A;  3CPW A;  5A0D A;  5GAN e;  1I81 A;  1NJI R;  2QQR A;  2ZCF B;  5LJ3 f;  4L59 A;  2IVW A;  4ATO A;  3M55 A;  3G1J A;  2HQX A;  1AOJ A;  4N0A A;  4NL2 A;  3M0S A;  1Y0M A;  4AFZ C;  2DVJ A;  1TWB A;  3CCL Q;  5KYX B;  4ZN3 A;  3VKI A;  1SEM A;  2EQK A;  3ZFJ A;  1ZSZ B;  2JM9 A;  1VQ5 A;  5GAN h;  3CC2 Q;  2GTJ A;  1WI7 A;  4C8Q F;  1YHQ Q;  3NHN A;  1MV0 B;  3JCM W;  2LP5 A;  2FRY A;  4N4G A;  3GF5 A;  1G2B A;  1JJ2 A;  4Y92 A;  2H3E B;  5FU7 B;  3OYA A;  4M77 F;  4E7J A;  2VXF A;  1B3Q A;  3ER0 A;  4DOW A;  5LJ5 e;  2V8K A;  4C92 C;  1WHK A;  4BE1 A;  1QVG P;  2HD0 A;  1NYG A;  1KQS A;  3N5B B;  4FU6 A;  2GF7 A;  3KXT A;  2QQA A;  2HKN A;  4JRK A;  3V7S A;  1B34 A;  1K9A A;  3RUX A;  3H8Z A;  1RAC B;  2LT1 A;  2JXB A;  4NL3 A;  3GP8 A;  3QZ5 B;  4LDV A;  4J9I A;  3MP1 A;  4JLI A;  4M75 G;  1TUC A;  2C06 A;  4BY6 C;  4HVW A;  3UF4 A;  1TXQ A;  5AYF A;  3UDC A;  5L23 A;  1AWO A;  1NJI U;  2HBP A;  1I0C A;  3M0Q A;  1KFZ A;  2K3B A;  3CC7 Q;  5GMK e;  3L2W A;  4QQG A;  4C5G A;  3RDV A;  2ESW A;  1P92 A;  1RAE B;  5CR2 A;  2HKQ B;  2VGN A;  1NEG A;  4QQD A;  2VV5 A;  5LJ5 h;  1ZSG A;  2KQW A;  1PSE A;  4RCC A;  5CCA A;  2CGH A;  3CQT A;  1YWO A;  2RI5 A;  2FHD A;  1BB9 A;  2NUP A;  1PRL C;  2V26 A;  1KHI A;  3RES A;  1XTD A;  1N8R R;  2LRQ A;  4ZNX A;  1WZO A;  2ZPE B;  2BTT A;  4AFU C;  2DL5 A;  3VS2 A;  1YBY A;  2E41 A;  4IUR A;  5GAN g;  2JS0 A;  5GMK h;  2RQV A;  3I56 A;  1PCX A;  1BI0 A;  4D8D A;  1ABO A;  1NM7 A;  3PE0 A;  1MMA A;  3PFS A;  2QG9 B;  4Q5W A;  4M75 E;  3JCM Q;  1QVP A;  4M7A E;  1M3B A;  2EVR A;  3M53 A;  2KRO A;  3PGG A;  1BI1 A;  2COZ A;  1GFD A;  1C6V X;  2QA4 Q;  4FM4 B;  2QK0 A;  4J8O A;  3NTI A;  1K73 C;  3G71 T;  1LCK A;  2MCN A;  2J6F A;  4ELZ C;  3MEU A;  2LC4 A;  3OMC A;  4LD6 A;  5HY6 A;  4HVV A;  2MWO A;  3KFV A;  2CH4 A;  2AKK A;  3VRZ A;  1ZBX A;  4FT2 A;  5GAN 4;  2FB7 A;  4J5Y A;  2JZ2 A;  4PJO F;  2MOX A;  2GGR A;  3GNF B;  3GNG A;  2A36 A;  3QII A;  1VQ7 T;  4FCY A;  1GXI E;  1YWP A;  2F5T X;  1YJW T;  1K0X A;  2MIO A;  1M2V B;  1QKX A;  4N4I A;  4KGX B;  1VQO T;  1X27 A;  5C6S A;  4RKU E;  5LJ5 g;  2O9V A;  2O4X A;  1QP2 A;  3BY7 A;  4D6W A;  3NMZ C;  1R77 A;  2RK1 A;  4C92 B;  3ZEH A;  2L3Q A;  3JCM e;  2ECZ A;  2YRD A;  4RMO A;  3EG9 B;  3H0I A;  1WGS A;  2MI6 A;  1W2B A;  3ULR B;  2EYY A;  3OW2 A;  1KD1 R;  5GAO m;  2K9G A;  3GBQ A;  4LNP A;  2KT8 A;  2J7I A;  4BY6 B;  1S72 Q;  1RAF B;  5KYW A;  5GMK i;  2XIC A;  3OYL A;  2MPX C;  4M75 C;  4PL6 A;  2A28 A;  4M7A C;  2EYX A;  2K7A A;  1KC8 C;  4LDY A;  3EFO A;  4FYW B;  1NLO C;  4RTZ A;  2WSF E;  2HQE A;  2HAX A;  3JCM c;  4IUV A;  2AT1 B;  1K1Z A;  2C0I A;  3M0P A;  3VUB A;  3ZBD A;  1X01 A;  2QQB A;  5LJ5 f;  1MUZ A;  4OB3 B;  1E6H A;  1XOV A;  3MCA B;  4XTW A;  4CC4 B;  2JTF A;  3DB3 A;  4EPC A;  9ATC B;  1Z9Z A;  1JXM A;  1WJS A;  1PD0 A;  3SWN A;  2VUB A;  1HJD A;  3JCM P;  1OX8 A;  2M1H A;  2EKO A;  2DA9 A;  1IHV A;  5FWC A;  2BUD A;  2FVU A;  3CD6 T;  1OI1 A;  1AWX A;  4KH0 B;  1N8R C;  2X4Y A;  3OBY A;  2X3W D;  4BDY A;  2AZS A;  1T3L A;  3VRY A;  1M90 R;  1YIJ Q;  2DXB A;  3FC3 A;  2DZ9 A;  5HK0 A;  1WXB A;  5C0M A;  5IHN A;  4OGE A;  2DK3 A;  1SHF A;  1OZ3 A;  3CMA Q;  4JPB W;  2QI2 A;  3MEV A;  1QW1 A;  2RB6 A;  1G3S A;  2OAW A;  4BE2 A;  4F17 A;  1K8A R;  3OYM A;  2X9H A;  2ED0 A;  1G3T A;  1VQL Q;  3M0U A;  1PSF A;  2LCS A;  3CCQ A;  2PU9 B;  2RI2 A;  1YJN A;  2CSQ A;  2EPD A;  4Z88 A;  4XU3 A;  2PVG B;  3CCM T;  3A98 A;  3CCQ T;  2WSE E;  3RMQ A;  2XID A;  1YJN T;  1VQ4 A;  2VAS A;  2K2M A;  2FRW A;  1ZLM A;  4HCC A;  4DQ2 A;  4K11 A;  3MET A;  2MWP A;  4E7K A;  2K2V A;  1VQN Q;  2FZK B;  4JJN K;  3X24 B;  1E7O A;  2AIR B;  1QLY A;  3OMG A;  4KT0 E;  2E65 A;  1GCQ C;  3JB9 I;  4M75 B;  4AT1 B;  4M7A B;  1ZHI A;  4NS5 A;  1SRL A;  2DKG A;  4C92 D;  5I21 A;  3A5Z B;  3D7S B;  4FW2 A;  1VYT A;  3MO8 A;  5GAM j;  1MMN A;  5GAN 6;  1NG2 A;  1KD1 C;  1IO6 A;  3EGD B;  2NWM A;  1AHJ B;  3JCM f;  1ZUY A;  3PIP A;  3RKX A;  4E7L A;  2X4X A;  4QKU A;  4JZ4 A;  3PMI A;  3HKS A;  3OSV A;  4DEY A;  2BIV A;  3DB4 A;  3FDR A;  1RI0 A;  2KRS A;  2E5K A;  4F7U G;  1VOM A;  2E5Q A;  2JTM A;  3P8D A;  3AT1 B;  2DRK A;  3TCJ A;  1K4U S;  4C8Q A;  2G3R A;  2JMC A;  2K57 A;  1LNX A;  5IHI A;  3VYG A;  2MK5 A;  1BBZ A;  3HFN A;  2LX9 A;  1VIE A;  1Q95 G;  3CCU Q;  2D0Q B;  1O75 A;  4LUD A;  4M77 A;  3SB2 A;  3CXC P;  2LCC A;  3JB9 F;  2MAM A;  2OJ2 A;  1Y71 A;  1R8O B;  2DBM A;  4JRQ A;  3CCR Q;  2FPD A;  1VUB A;  3TRE A;  1GCP A;  1UTI A;  2DJZ A;  4E7I A;  4RTU A;  4AFS C;  2DO3 A;  3OYE A;  3BW1 A;  2HQH A;  1SHG A;  1QWF A;  3I5S A;  1AD5 A;  1M30 A;  3CCV A;  2M02 A;  3FIF A;  4PJL A;  2CZ6 B;  4F7U E;  1M90 C;  1VQ8 Q;  5CQX A;  1H3H A;  1RAH B;  2EJ9 A;  3C95 A;  1ZBJ A;  7AT1 B;  2YRC A;  1TS9 A;  2LJ0 A;  2HCK A;  3L1A A;  1WHM A;  2F5K A;  1CKB A;  1OU9 A;  1K8A C;  4FSS A;  2X51 A;  1D3B B;  2XMF A;  1M1F A;  2NUZ A;  1SPK A;  3EGX B;  4HKE A;  2DJQ A;  5FLX E;  3EG1 A;  2CKK A;  2KR3 A;  3WVD B;  2OTL T;  4JUV A;  4N0A C;  3EG2 A;  4X1V A;  4HCB A;  1VQ6 A;  2BZY A;  3OYJ A;  1UHF A;  1IRX A;  3CC4 T;  4C92 G;  1HXD A;  3BDU A;  2AKL A;  4KGV B;  4C0Z A;  2FG0 A;  3I5R A;  3CCS T;  3DLM A;  4YTL A;  4B6M A;  2KMT A;  3NTK A;  3OYN A;  3LLR A;  1I5O B;  1LJO A;  2DLP A;  5CKF A;  4FIB A;  3BE3 A;  2F2X A;  1UGR B;  1WHJ A;  2O31 A;  2OAU A;  3REB B;  4M7A D;  1Z9Q A;  4OMF B;  4PJO A;  1T0J A;  5L8R E;  2RJE A;  3VS6 A;  1T3S A;  3HRS A;  2M0O A;  1YJ9 Q;  4J9H A;  2XDB A;  4C0F A;  1AVZ C;  2M9U A;  1IGU A;  4GLK A;  4ZN1 A;  4EMK A;  4X9C A;  3QHS A;  4MDW A;  2ZAE A;  3JCM d;  3NFC A;  3UA6 A;  1PHT A;  4AG2 C;  5HKC A;  4XTY A;  2V8J A;  1NBE B;  3JCM V;  3X20 B;  2CT4 A;  4ZTJ A;  3A1P A;  2RJC A;  2ZPI B;  3L2R A;  1YCY A;  2DIL A;  2FO0 A;  4M4Z A;  2HSP A;  2YUO A;  1O9S A;  1V1C A;  2YDL A;  1W4S A;  4M7D F;  2QYZ A;  4M78 A;  4RTT A;  3URG A;  2DBK A;  2FZC B;  3SFM A;  3EFS A;  3EGU A;  1IZ6 A;  2XHC A;  3G71 Q;  3G6E Q;  4E7Z A;  3IQL A;  1UG1 A;  1UGS B;  4R55 A;  3G4S Q;  1VA7 A;  2L89 A;  1Q86 R;  5A2Q E;  1X2Q A;  1YI2 Q;  2EBP A;  1UFF A;  1UDL A;  1PG5 B;  1B07 A;  3A8G B;  3GOX A;  1M9S A;  2XKO C;  3SEM A;  4C8Q D;  1A0N B;  1DJ7 B;  2NYS A;  5J26 A;  2D9T A;  1VQ7 Q;  1YJW Q;  1WXT A;  1YFN A;  4FT4 A;  4RTY A;  1VQK A;  3X26 B;  1VQO Q;  6AT1 B;  4A53 A;  2RA2 A;  2XG8 D;  4M77 D;  3KUF A;  1VQP Q;  1JJ2 P;  1HYO A;  2CS7 A;  1VQK T;  5D6X A;  4ELY C;  3O5Z A;  3H0F A;  3J80 E;  2ATC B;  4OF1 A;  4WF2 A;  2RD1 A;  1JU5 C;  2EKH A;  1D1C A;  1VQ5 T;  1G83 A;  2X3X D;  1YNZ A;  3M4Y A;  5GMK l;  4XQ3 A;  4RG8 A;  1X2K A;  2E6N A;  3JCM J;  1WDX A;  5CO7 A;  2E3H A;  2EQJ A;  5CKD A;  3TSW A;  3X28 B;  4J9F A;  8ATC B;  4JJB A;  1KC8 R;  2RO0 A;  4RG2 A;  1D1B A;  2V1Q A;  3VU3 C;  1K73 U;  5KYN A;  2LT4 A;  4F7U B;  2EJF A;  2EIF A;  1M27 C;  4Z02 A;  3H0H A;  4M7A G;  3EHR A;  1ABQ A;  1UEB A;  2IG0 A;  4QVZ A;  2RF0 A;  2F1L A;  2FPF A;  1B34 B;  2L5Q A;  4A63 B;  5LJ3 j;  4XU1 A;  2DX1 A;  5LL6 S;  2J6K A;  2BZX A;  2HL3 A;  3OYG A;  4XTX A;  2XU8 A;  1BCM A;  1LPL A;  3CBM A;  3CCE Q;  4E2F B;  3OS5 A;  3CD6 Q;  4KUL A;  3GIB A;  2ZPF B;  4A54 A;  4PFZ A;  4WTO B;  2LNH B;  1NZ9 A;  4WCI A;  2SEM A;  3OYY A;  5D6W A;  2YLB A;  4LDW A;  5IN1 A;  3MHX A;  2DEU A;  4LN2 A;  3PTA A;  2NUP B;  2VWF A;  3R6O A;  3CME Q;  2LVM A;  1VQ9 A;  2DXU A;  4PJO D;  3I56 T;  4JRP A;  4J6W A;  5CAI A;  3EHQ A;  5GAM h;  1AT1 B;  3FB9 A;  1KC8 U;  1M8M A;  1NPP A;  5ECA A;  4BDZ A;  2E6Z A;  2LCL A;  4C8Q G;  2QAS A;  2E3I A;  1QP3 A;  2GCX A;  5GAN 5;  3VV0 A;  2R5M A;  2KXC A;  3SWN C;  3RIR A;  2E4H A;  3M9Q A;  4JLG A;  2FZG B;  3CCM Q;  2CUD A;  1Q86 C;  1FMW A;  4M77 G;  3VS0 A;  4CI0 C;  1RUW A;  2ABL A;  1W2B P;  1SSF A;  2DL8 A;  4OP0 A;  1SSH A;  3M54 A;  4JJC A;  5LJ3 d;  4E6R A;  3OW2 P;  5GAN f;  5GAO r;  2NUT A;  3V7C A;  1R0B G;  4P5N A;  3RBB B;  1U1T A;  1WX6 A;  4IUQ A;  1Y57 A;  2X4W A;  1BU1 A;  5FRO A;  3CCL A;  1N8R U;  4XTV A;  4JS4 A;  2CP3 A;  4C0G A;  2DFU A;  1OEB A;  4DOV A;  3CCL T;  2ROL A;  3RER A;  1UEC A;  1IXD A;  4C8Q E;  4V2S A;  3CC2 A;  1MMD A;  2I2L A;  4M78 F;  1YHQ A;  2O4X B;  2JJ9 A;  3CCJ Q;  1I1J A;  2RHX A;  4B9X A;  3E9G A;  3CEY A;  1WJR A;  2JN0 A;  1UGP B;  1CKA A;  2E12 A;  5GAN 8;  1I5L A;  2EGC A;  4M77 E;  4ESR A;  3E19 A;  3NTH A;  2Z0W A;  1Q82 R;  5DLQ E;  1FXX A; 
#chains in the Genus database with same CATH homology
 2OTJ A;  1AHJ B;  3JCM f;  5GAM g;  1U8R A;  3OYI A;  1ZQ1 A;  3E1S A;  2DXT A;  4PLL A;  4A4E A;  3RKX A;  3PIP A;  4E7L A;  2CZ7 B;  2E64 A;  2X4X A;  3LW5 E;  3MEA A;  3S3N A;  3CBO A;  4ZGD B;  1VQM A;  4L5G A;  4M7D G;  3PMI A;  3HKS A;  3OSV A;  2YLC A;  4QQ6 A;  4M75 D;  2BIV A;  2OTJ T;  4J6Y A;  2E10 A;  3DB4 A;  3FDR A;  1RI0 A;  3JB9 J;  2KSS A;  4BAC A;  2RHI A;  2GFU A;  2QQS A;  3OYC A;  3J7A F;  4J83 A;  3FLG A;  3DLL A;  1QVG A;  1Y96 B;  5GAM e;  3JAM E;  4F7U G;  1VQM T;  1JRI A;  4ME7 A;  1M8V A;  1NPR A;  2E5Q A;  2JTM A;  3P8D A;  4HCZ A;  4MZM A;  4OB0 B;  3PIO A;  4XK8 E;  3EAE A;  3TCJ A;  3HPW A;  1XQH A;  3A8O B;  3QDR B;  2EWN A;  4RCB A;  1G5V A;  4C8Q A;  2G3R A;  2EQU A;  2XDD A;  3CC7 A;  3VYH B;  3JB9 H;  1BI3 A;  1M1G A;  2Y4Y A;  2K57 A;  5KH6 A;  1LNX A;  2BKD N;  2EQM A;  1WNL A;  3VYG A;  2EFI A;  1YJ9 A;  2L3R A;  2AHJ B;  3HFN A;  2JOY A;  2LX9 A;  1VIE A;  3L42 A;  1XNI A;  3CC7 T;  4XU2 A;  4IKF A;  2D0Q B;  2R58 A;  1O75 A;  3SB2 A;  4M77 A;  1QVG S;  2LCC A;  4HA8 A;  2VC8 A;  5GAN 3;  2ZPG B;  4C92 E;  3JB9 F;  1YJ9 T;  2MAM A;  3I55 A;  1Y71 A;  3LWH A;  1R8O B;  3OQ5 A;  3RKW A;  4JRQ A;  5GAN j;  5DM7 R;  3ME9 A;  1I8F A;  2LNV A;  4Y91 A;  5KCH A;  2GQV A;  2ZGW A;  1VUB A;  4KUD K;  2RI3 A;  3EFR A;  3TRE A;  3LGL A;  4A4K A;  2DJZ A;  3SWN B;  1KD1 U;  2RHY A;  1VQ9 T;  3I55 T;  3CCU T;  4E7I A;  3L2V A;  3HSB A;  3WVE B;  1OZ2 A;  3ASK A;  2DO3 A;  1KQ1 A;  2DIG A;  4M78 B;  2K5L A;  3BW1 A;  4MZT A;  3OYE A;  4M7D E;  3Q1J A;  3OYD A;  3RKY A;  4C8Q C;  3QZ9 B;  4F7U F;  3CCV A;  5KE2 A;  3FIF A;  4XU0 A;  1WPY A;  3CPW A;  5CVI A;  2CZ6 B;  5A0D A;  4F7U E;  3OYB A;  5GAN e;  5EG2 A;  3HRU A;  1I81 A;  2QQR A;  2ZCF B;  5LJ3 f;  4L59 A;  3TU4 K;  3G71 A;  3G6E A;  4A53 A;  1M90 C;  2IVW A;  5CQX A;  3M57 A;  4C5E A;  4ATO A;  1VIF A;  2K3X A;  3M55 A;  2HQX A;  1FX7 A;  3G4S A;  3HP9 A;  2EJ9 A;  4M77 C;  4UC4 A;  3C95 A;  4N0A A;  4NL2 A;  2KY9 A;  1BIB A;  1YI2 A;  2A7Y A;  2RHZ A;  3OYK A;  3G6E T;  3C12 A;  2FL7 A;  3G4S T;  2DZC A;  4M78 D;  2QA4 A;  1FWZ A;  3L1A A;  5DY9 A;  2F5K A;  3VUZ A;  3S3O A;  1YI2 T;  4C92 A;  1H3Z A;  1VQ7 A;  1G3W A;  2H3J A;  3A8L B;  1YJW A;  1NJI C;  3OB9 A;  3CPW S;  3J81 E;  2XDP A;  4ZN3 A;  3VKI A;  1BYM A;  2QA4 T;  1VQO A;  2EQK A;  1K8A C;  3UT1 A;  1N27 A;  3ZFJ A;  4PJO E;  4IUT A;  1VQ5 A;  1D3B B;  1VQP A;  1M1F A;  5LJ5 j;  3V8J A;  5GAN h;  3L2Q A;  1VQ4 T;  4IUU A;  4MMK A;  4HKE A;  5FLX E;  2RJF A;  4C8Q F;  4M7D A;  5A0G A;  2KVQ G;  3F70 A;  2JVV A;  3JCM W;  3LH0 A;  2CKK A;  1IRE B;  4C5I A;  2RM4 A;  3WVD B;  4N4G A;  1VQP T;  2OTL T;  4JUV A;  3GF5 A;  3PT9 A;  4N0A C;  3OS0 A;  1JJ2 A;  4HT9 A;  5I2M A;  2QXF A;  4X34 A;  4R56 A;  2EJG A;  4HCB A;  1VQ6 A;  3OYJ A;  5FU7 B;  3BDL A;  2LQK A;  3OYA A;  4KBM B;  4M77 F;  5GAN d;  4LDU A;  3P8B B;  3CC4 T;  4E7J A;  2VXF A;  3QJY A;  4C92 G;  3CC2 T;  1HXD A;  3BDU A;  3ER0 A;  2V8K A;  4OB1 B;  4C0D C;  4DOW A;  5LJ5 e;  1YHQ T;  4BI8 B;  4C0Z A;  4C92 C;  4BE1 A;  2HD0 A;  2EYQ A;  4MDX A;  1KQS A;  1G3Y A;  1M90 U;  3CCS T;  2FYK A;  3N5B B;  2Y90 A;  3DLM A;  4FU6 A;  2GF7 A;  3KXT A;  2QQA A;  5GMK j;  4YTL A;  3C4S A;  2KMT A;  3NTK A;  4JRK A;  3LLR A;  3HL8 A;  3INZ A;  3V7S A;  1B34 A;  3OYN A;  4JRI A;  1LJO A;  2R5A A;  2XD0 A;  2PVD B;  3RUX A;  3QBY A;  3H8Z A;  5CKH A;  5CKF A;  2LT1 A;  4FIB A;  2Y4X A;  4NL3 A;  3GP8 A;  1UGR B;  1JJ2 S;  2OAU A;  4M7D C;  3QZ5 B;  2MF2 A;  4LDV A;  3M4G A;  3MP1 A;  4JLI A;  4M75 G;  1S72 A;  4M7A D;  2C06 A;  4OMF B;  4BY6 C;  2R57 A;  3MEW A;  3OS2 A;  3JB9 D;  4PJO A;  5AYF A;  3V8L A;  3UDC A;  2DVE A;  1NJI U;  2HBP A;  3JCM h;  3DKM A;  5L8R E;  2RJE A;  5GMK e;  5CKB A;  4QQG A;  3L2W A;  1Q82 C;  4C5G A;  1K8A U;  1S72 T;  1KQS S;  3HRS A;  1P92 A;  5CR2 A;  3JRZ A;  2K5F A;  2M0O A;  2VGN A;  2PQW A;  2K3Y A;  4QQD A;  2VV5 A;  5LJ5 h;  3JCM X;  3A8M B;  1M5Q 1;  2KQW A;  3L2U A;  2XK0 A;  2XDB A;  1V29 B;  1PSE A;  2M9U A;  4GLK A;  3QYH B;  4RCC A;  4C0F A;  4E47 A;  5CCA A;  2CGH A;  4ZN1 A;  4EMK A;  4X9C A;  4J7F A;  2RI5 A;  2FHD A;  3QHS A;  2WSC E;  3RMS A;  4HT8 A;  4MDW A;  2K5I A;  3JCM d;  1Y7X A;  3NFC A;  1KHI A;  4IUP A;  3RES A;  4C92 F;  2EAY A;  1UB4 A;  5HKC A;  1XTD A;  2V8J A;  3M56 A;  2LRQ A;  3MP6 A;  4O5V A;  4XTY A;  3JCM V;  3X20 B;  3BFM A;  2P0P A;  4ZGE B;  4ZTJ A;  4E7H A;  2ZPE B;  3M5A A;  2RJC A;  4B9W A;  5LJ5 d;  2ZPI B;  2DTO A;  4PJO G;  3OYF A;  1YBY A;  3L2R A;  1YCY A;  2E41 A;  2CYZ B;  4FSX A;  3UPU A;  2DIQ A;  3QXE B;  4IUR A;  2A3L A;  3CCE A;  4PJO C;  1O9S A;  4C8Q B;  5HK3 A;  3CD6 A;  2NLU A;  4L6V 5;  5D6Y A;  5GAN g;  5GAM f;  5IT9 E;  2RJD A;  1W4S A;  2P4T A;  4M7D F;  4M78 A;  2DAQ A;  5GMK h;  3URG A;  3I56 A;  3MP8 A;  3SFM A;  1BI0 A;  3GPL A;  3CCE T;  1X6O A;  3EFS A;  1IZ6 A;  2XHC A;  3PFS A;  4Q5W A;  4M75 E;  2ZZD A;  3JCM Q;  1QVP A;  4M7A E;  4M77 B;  2DPP B;  1UGS B;  2P0Q A;  5CKE A;  4R55 A;  1KHC A;  3X25 B;  4EMK C;  5FU6 C;  2QQ9 A;  2L89 A;  2YRV A;  5A2Q E;  3M53 A;  1H64 1;  3CME A;  2ZPH B;  3PGG A;  1BI1 A;  3A8G B;  2M16 A;  3CCV T;  2PUK B;  3OS1 A;  5CIU A;  3GOX A;  3QO3 A;  1KG1 A;  2QDY B;  1M9S A;  2XKO C;  5FRM A;  4C8Q D;  1YIJ A;  1Q82 U;  4FM4 B;  1DJ7 B;  4J8O A;  4BD3 A;  3NTI A;  1K73 C;  5J26 A;  3G71 T;  2D9T A;  2KK4 A;  3CME T;  3QG1 A;  2P0K A;  2RH2 A;  5GAO p;  4ELZ C;  3MEU A;  4N4H A;  5KCO A;  2LC4 A;  3OMC A;  4FT4 A;  4LD6 A;  1VQK A;  3E9F A;  3TEE A;  4M78 G;  5HY6 A;  5LJ3 h;  3X26 B;  2MWO A;  3OYH A;  1YIJ T;  1WQW A;  4M78 C;  1ZBX A;  2KAF A;  3JSC A;  3CMA A;  4FT2 A;  3WXM B;  2RA2 A;  2XG8 D;  2FB7 A;  3KUF A;  4J5Y A;  2JZ2 A;  4M77 D;  4PJO F;  5GAN 4;  4JS5 A;  4ZTF A;  2CS7 A;  1VQK T;  3GNF B;  5D6X A;  4BE0 A;  3GNG A;  3VJP A;  2E70 A;  3CBP A;  3QII A;  4VUB A;  4ELY C;  3CCM A;  1VQ7 T;  3JCM g;  1K9M C;  1GXI E;  5GAO l;  3P8H A;  2F5T X;  1BI2 A;  2VGM A;  1YJW T;  3J80 E;  1VQL A;  4OF1 A;  4WF2 A;  1LOJ A;  4ZGJ B;  2RD1 A;  3LX7 A;  4N4I A;  1VQO T;  1NE8 A;  5C6S A;  4RKU E;  5LJ5 g;  4XTZ A;  1VQ5 T;  3C94 A;  4FL6 A;  2O4X A;  1QP2 A;  3BY7 A;  4M75 A;  4D6W A;  3L2Z A;  4M7A A;  3FEO A;  3M4Y A;  3HFO A;  4C0D B;  1QVF A;  2RK1 A;  1N6A A;  3ZEH A;  2DEQ A;  4C92 B;  3JCM e;  5GMK l;  3OA6 A;  4XQ3 A;  1VQL T;  3S3M A;  1RL2 A;  1HK9 A;  4RG8 A;  3S6W A;  2E6N A;  4RMO A;  3JCM J;  5CO7 A;  3M59 A;  2MMP A;  3SD4 A;  1WGS A;  2MI6 A;  1W2B A;  5CKD A;  2EQJ A;  3X28 B;  4BUG A;  3OW2 A;  1Y07 A;  1VQ6 T;  2VXE A;  5GAO m;  2RO0 A;  2DTH A;  4MML A;  3PMT A;  1MHN A;  4M7D B;  1WQ7 A;  3QUI A;  4JDS A;  5J3B A;  3KBG A;  4J6X A;  4RG2 A;  4BY6 B;  3VU3 C;  1K73 U;  4QW2 A;  1VQN A;  2O01 E;  2LT4 A;  4M78 E;  4F7U B;  2EJF A;  5GMK i;  1QVF S;  4GY5 A;  1Q7Y C;  5GMK m;  2EIF A;  2GFA A;  1Y96 A;  4Z02 A;  3CCJ A;  2XIC A;  2V8I A;  3OYL A;  4M7A G;  4M75 C;  1VQN T;  4PL6 A;  3JB9 G;  1W2B S;  4M7A C;  2RK2 A;  1KC8 C;  1UEB A;  4LDY A;  2IG0 A;  3OW2 S;  4QVZ A;  3QJ6 A;  5CK9 A;  2DD5 A;  3CCJ T;  2HNI A;  2WSF E;  2HQE A;  4BI4 A;  2HAX A;  3JCM c;  4IUV A;  1K9M U;  4M7D D;  3LYI A;  1B34 B;  3ZBD A;  3VUB A;  2L5Q A;  1X01 A;  2QQB A;  3FRN A;  5LJ5 f;  2QEX A;  2E1H A;  5LJ3 j;  4XU1 A;  5GAN 2;  4XTU A;  3HHT B;  4OB3 B;  3A8H B;  5LL6 S;  3UWN A;  1XOV A;  1Q81 C;  3OYG A;  4XTX A;  2X4J A;  2XU8 A;  5LJ3 g;  3MCA B;  4XTW A;  4PJO B;  2QEX T;  2JTF A;  2JUF A;  3CBM A;  3DB3 A;  3QKJ A;  4EPC A;  3OS5 A;  2DD4 A;  4KUL A;  3GIB A;  4EDU A;  2KDS A;  1WJS A;  2ZPF B;  3SWN A;  4A54 A;  1X75 C;  2VUB A;  4II1 A;  5GAO n;  3QSU A;  2QTX A;  1JBM A;  3JCM P;  2M1H A;  5DLO A;  5LJ3 e;  2X35 A;  1N9R A;  1NZ9 A;  2EKO A;  4MZP A;  4BI3 A;  5KE3 A;  3LWI A;  1M1K C;  3OYY A;  5D6W A;  2YLB A;  4LDW A;  5IN1 A;  3MHX A;  4OGC A;  5FU6 B;  4EMK B;  3OY9 A;  2BUD A;  3PTA A;  4M75 F;  2FVU A;  3CD6 T;  4M7A F;  1OI1 A;  3OSS C;  3R6O A;  3M58 A;  1N8R C;  2LVM A;  2X4Y A;  1VQ9 A;  3OBY A;  1UGQ B;  2DXU A;  4BB7 A;  3CCU A;  4J7I A;  3I56 T;  4BDY A;  3QYG B;  1Q7Y U;  4PJO D;  4JRP A;  4J6W A;  2VYT A;  4PLI A;  5CAI A;  4X9D A;  2LTO A;  4O6J A;  5GAM h;  2F69 A;  4KUI A;  1YIT A;  2DXB A;  5GAO q;  2XI9 A;  4A4F A;  3FC3 A;  3FB9 A;  2DZ9 A;  2YHT A;  5CQY A;  1KC8 U;  5HK0 A;  3CPF A;  3CCR A;  1NPP A;  3G7Z A;  5C0M A;  4BDZ A;  2E6Z A;  2LCL A;  4C8Q G;  4OGE A;  2B8A A;  1QP3 A;  2DK3 A;  1MGQ A;  1OZ3 A;  2CZ0 B;  2GCX A;  5GAN 7;  1YIT T;  1OYX A;  3HRT A;  5GAN 5;  3CXC A;  3VV0 A;  2R5M A;  3SWN C;  3RIR A;  2QI2 A;  3CCR T;  3MEV A;  1QW1 A;  2RB6 A;  3H6Z A;  4PNO A;  3M9Q A;  5J39 A;  5GAM d;  3V8K A;  1G3S A;  4JLG A;  1Q81 U;  4BE2 A;  4LD9 K;  2LQ8 A;  4A4G A;  1Q86 C;  4A4H A;  4M77 G;  3OYM A;  1G3T A;  4CI0 C;  1D3B A;  4CRI A;  1U1S A;  5I2S A;  1PSF A;  3CCQ A;  2PU9 B;  2RI2 A;  1VQ8 A;  1YJN A;  1SSF A;  2DTI A;  3O8V A;  4OP0 A;  3SDZ A;  1BIA A;  3CMA T;  3M54 A;  4XU3 A;  5LJ3 d;  2PVG B;  5GAN f;  5GAO r;  4QVC A;  4C5H A;  4NOY A;  3V7C A;  2WAC A;  2ZPB B;  3CCM T;  3OBW A;  3CXC S;  2JNG A;  4P5N A;  2WSE E;  3RMQ A;  3CCQ T;  1M1K U;  1VQ8 T;  2XID A;  1YJN T;  1U1T A;  4IUQ A;  4QVD A;  1TH7 A;  2X4W A;  5IAY A;  1WJQ A;  1VQ4 A;  3AHU A;  5FRO A;  3CCL A;  1N8R U;  5M9O A;  4XTV A;  4JS4 A;  4DQ2 A;  2OTL A;  4HCC A;  3PNW C;  4C0G A;  1EIF A;  3MET A;  4OVA A;  2MWP A;  4E7K A;  5A0L A;  2K2V A;  4DOV A;  3CCL T;  2LDM A;  3JCM b;  3RER A;  4JJN K;  4OB2 B;  3GLX A;  3X24 B;  4EMG A;  4C8Q E;  1M4Z A;  4V2S A;  3CC2 A;  3FJP A;  2L8D A;  3CC4 A;  5FRN A;  2I2L A;  3OMG A;  4KT0 E;  2CZ1 B;  2PUO B;  2E65 A;  2O4X B;  4M78 F;  4TVR A;  4M75 B;  3JB9 I;  4F7U A;  1YHQ A;  4PKC C;  2RHX A;  4M7A B;  1ZHI A;  2DXC A;  4NS5 A;  4B9X A;  3QPH A;  3E9G A;  3CCS A;  4LDX A;  2DKG A;  4Y28 E;  1KQ2 A;  2K4Y A;  4C92 D;  2RHU A;  3CEY A;  5I21 A;  1WJR A;  2JN0 A;  1UGP B;  1BKB A;  3A5Z B;  2E12 A;  4DA4 A;  1I4K 1;  5GAN 8;  1I5L A;  3MO8 A;  4M77 E;  4EMH A;  5GAM j;  3E19 A;  5GAN 6;  2PVO B;  3V7R A;  3LGF A;  3T9N A;  1Q86 U;  1N9S A;  3NTH A;  1KD1 C;  5FU7 C;  5DLQ E;  2D6F A;  1FXX A;  1JB0 E;  4XAX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...