4PJOG

Minimal u1 snrnp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
KAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 74
sequence length 74
chains with identical sequence U, g, u
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoG00
4M78A 1D3BA 4PJOG 4C92F 5GAOp 4M7DG 1Y96A 2E10A 3BY7A 4EMKC 1I4K1 4C8QF 5LJ5d 5GAMd 4J5YA 2DTIA 4A54A 2DZCA 5LJ3d 4C92B 3JCMh 4HT9A 2DTHA 2DZ9A 3M4GA 1HK9A 4XU3A 4C8QB 4XU1A 3SWNB 1BIAA 3JCMV 4PJOC 3V8JA 4C92E 4M7DC 2VXFA 3JCMb 1N9RA 4C8QE 4J6WA 3JCMe 3L2ZA 2Y90A 5GANd 4M7AA 3JCMW 3JCMg 1WNLA 4XU2A 4M75A 3FIFA 2DKGA 2FYKA 1I5LA 4EMHA 4PJOD 4M7DD 2DEQA 1I8FA 4NL3A 3AHUA 1HXDA 1M8VA 3EFSA 4M75G 3JCMJ 4JRIA 3V7RA 3JB9G 2I2LA 1KQ2A 4JUVA 3BFMA 4F7UF 4MMLA 2RA2A 3QO3A 3JB9J 5LJ5h 5GAMh 4M77A 4EMKB 1MGQA 4Y91A 1X01A 5GMKj 4F7UB 4M78G 5LJ3h 2HNIA 4PNOA 4PJOF 4M75C 4M7DF 5GAN5 3EFRA 2EJGA 5LJ5e 5GAMe 4F7UE 5GAN2 2VXEA 5LJ5g 4XU0A 4EMGA 5GAMg 4PJOB 1H641 5LJ3e 4NL2A 4M7DB 4V2SA 1I81A 5GAN6 2RM4A 2EAYA 5GANh 5LJ3g 4M78C 3V7CA 4QVCA 4X9DA 3BDUA 3V8LA 4PJOE 3RIRA 4M7DE 4N0AA 4M75D 4JRKA 4JLIA 3JCMX 2YLCA 2RB6A 1D3BB 3FB9A 3QUIA 3JB9D 4M7AG 4M77C 1BIBA 5GANe 4J6YA 1WPYA 3BW1A 1LNXA 4XTXA 5GAOq 5GANg 3HSBA 3JCMP 2CGHA 3RKWA 5GAN3 4QVDA 4C92A 3FJPA 2DTOA 4EMKA 2ZGWA 4XTUA 4M78D 3JCMQ 3PGGA 1B34B 4C8QA 5GAOr 3GIBA 2JN0A 3SWNA 3JCMf 5GAN7 4DQ2A 5CAIA 3RESA 4M7AC 2YHTA 1U1TA 4M75F 1LJOA 1LOJA 3JB9F 1WQWA 2E41A 4M77D 2DVEA 5GAN4 3HFOA 1M5Q1 4C92G 3QHSA 2QTXA 4M7DA 3RUXA 4RCBA 4M75B 4M77G 4XTWA 2DXUA 4N0AC 3V8KA 4NOYA 4M78F 4RCCA 2YLBA 4M75E 1N9SA 5I21A 5GMKi 4A53A 4M7AD 4OP0A 4MMKA 5GAN8 3RERA 4C92C 4M78B 3SB2A 4HA8A 3HFNA 4J6XA 2EJFA 2E65A 4M77F 3RKXA 4WF2A 1Y96B 4C8QC 1TH7A 4XTYA 3SWNC 3JCMd 5LJ5j 2K57A 4X9CA 5GAMj 1JRIA 2DXTA 2E64A 4HT8A 4M78E 4M77B 1B34A 5LJ3j 4XTVA 1YCYA 2FB7A 2VC8A 3RKYA 3L1AA 1WQ7A 4F7UA 5GAMf 5LJ5f 4M7AF 3INZA 4XTZA 5GAOn 3V7SA 5GMKh 2EWNA 4M77E 5LJ3f 4C92D 3VU3C 4XQ3A 4C8QD 4M7AB 2E1HA 5GAOl 5GAOm 5GANj 4PJOA 2EJ9A 5DY9A 5GMKl 4C8QG 4F7UG 5GMKm 3JB9I 2RD1A 5GMKe 3JCMc 1JBMA 1U1SA 3JB9H 4M7AE 5GANf 2DJZA 3QSUA 1KQ1A
chains in the Genus database with same CATH superfamily
3M0PA 3OW2P 1I4K1 2QDLA 5FU6C 1VQLT 4FT2A 1BI0A 2LNVA 1RAAB 1TXQA 3VYHB 3OYHA 4J83A 4A4FA 2LJ3A 4KRTA 2EW3A 3N5BB 4Y92A 2FL7A 2RQRA 2QG9B 1Q82R 3REBB 4M7DD 4UC4A 3JCMJ 4JRIA 2EYXA 3CC4A 2JTEA 1NZ9A 4F7UF 3CD6A 3ZFJA 1VQNT 5IH2A 1EX4A 1M1FA 5FU6B 3ER0A 1IRXA 1WIEA 2CREA 1OZ2A 2P4TA 1I81A 4BDZA 4QVCA 3L2WA 4ZN1A 2ZAEA 3LWIA 2QA4Q 4AFQC 5GAOq 1YJNA 4LD9K 4PJMA 1SEMA 3OYKA 2KGTA 1S72A 3E1SA 1SRLA 4AFUC 3JB9F 1EFNA 4KH1B 1M5Q1 2KT1A 3CCST 2DXUA 5IAYA 1KD1R 3M53A 1S1NA 3QIIA 2HL3A 1WX6A 4PJJA 1VQ5T 1NLPC 4M77F 2E65A 1X6OA 4QQ6A 1Y96B 5CQXA 3C95A 1OPKA 2ENMA 1VQLQ 2E64A 1B34A 3INZA 2A3LA 2WSFE 5FRNA 2X4XA 2DMOA 2X51A 3PNWC 4RTTA 4HCCA 1WA7A 1QQJA 2YUNA 2FEIA 4C0ZA 1SPKA 5FRMA 3CC2T 3JRZA 3QSUA 3M5AA 4E7ZA 3L2VA 1YN8A 1MV3A 5FU7C 1VQNQ 3OYYA 1SRMA 5C6SA 1EIFA 1LCKA 2QXFA 2YRVA 4FM4B 1U5SA 4J6WA 3ZL7C 3MO8A 4E7HA 1VQKT 5CKFA 3E19A 1NYFA 2L5QA 3JB9J 1I5OB 4OB3B 4F7UB 1KC8C 5FU7B 3VS4A 5CO7A 5KYWB 2XDDA 2XIDA 2HKQB 4E7SA 4ME7A 2QQ9A 5GAN2 3CCSQ 4NL2A 4L5GA 1ABOA 3E9FA 4D6WA 3BDUA 5KYNA 2YLCA 3WVDB 1D3BB 1VQ5Q 4M77C 2YSQA 2KRNA 3BW1A 1OULA 4E7LA 2X4YA 3TEEA 3QZ5B 1GCQA 3S3OA 1AT1B 2VVKA 2DVEA 3OYMA 4C92G 5HY6A 1UUEA 4N0AC 1YITA 1OQKA 3A8LB 3OYBA 1C1AA 2O9SA 1WHLA 1Q7YC 3CPWS 3CCQA 2F2XA 1WDXA 2RNAA 3CCJA 1KHIA 1W4SA 2RHYA 4J9CA 1QVGA 3HFNA 2GFUA 2EJFA 3H0FA 1QW1A 2DYBA 2EGAA 4P5NA 4M78E 4M77B 3VRYA 4XTVA 1R8OB 1WQ7A 2BE7D 4E7JA 1D1BA 4PJOA 2AK5A 2L8DA 2MYSA 3S3NA 1AVZC 1BBZA 3JCMc 2EYQA 2MAMA 1VQKQ 4JJDA 1NBEB 2KYMA 2E10A 4C8QF 1WZOA 1YCSB 4RUGA 1S72Q 3SD4A 3OBWA 1GL5A 2E3IA 1M1GA 1BIAA 1QVFA 4ORZA 5KYUB 1TWBA 5DLOA 1QCOA 1KQSS 1G83A 1M3AA 1OU8A 1K8AU 3EGDB 2FYKA 1WJQA 2PVDB 3FEOA 3CMAT 1PRMC 3VKIA 1HXDA 1AZEA 2BIVA 8ATCB 3QYHB 2EQJA 2YUOA 3UA7A 5J39A 2D9TA 3LLRA 2LCCA 1ZUUA 4VUBA 3VUBA 2RH2A 2CT3A 2E5KA 2HSPA 2XICA 3G7ZA 3TCJA 1M27C 1W6XA 4J9IA 4V2SA 2X3WD 1P92A 3A98A 1VQOT 2YWWA 1QWFA 3EFOA 3JB9D 3NTHA 5FWBA 1LNXA 4L6V5 3OYLA 1NPPA 2HBWA 2LQKA 1RAHB 2J05A 4HVWA 3OYIA 2P4RA 4M77D 5A0LA 1WHMA 2AZSA 4OMFB 1TSFA 3VV0A 1NJIR 1M3CA 4J6XA 4C8QC 3ZEHA 2E70A 4X9CA 3DLLA 3CCEA 2V8KA 3M0RA 5LJ3j 4F17A 5I2MA 1FMWA 3C94A 1G3TA 1K9MU 2EQIA 4JJNK 3V7SA 4CC4B 3QJYA 4QQGA 2JT4A 2J6OA 1Q86U 3CMET 4RKUE 2JMAA 3CMAQ 2DLPA 1M2VB 4F16A 4DEXA 1DJ7B 3OYEA 5LJ3d 1ZA1B 3OSSC 4C8QB 1PNJA 3TSWA 3OW2A 1V76A 2J6FA 3CPWP 2DD5A 1OI1A 2QEXA 2A28A 1VQOQ 3X24B 1VQPT 5D7UA 1KHCA 2RMOA 3BFMA 1UGSB 4RTXA 2EFIA 3G71T 4IIOA 1PCXA 2VUBA 2HNIA 1UDLA 1PC0A 3UDCA 3U23A 1RL2A 3CC7A 4XU0A 3QZ9B 1X6BA 3KBGA 3CCET 2SEMA 2EKHA 2RQUA 1EZZB 2OAUA 2K2MA 3EH1A 1WI7A 4PL6A 2KK4A 3TREA 4ZGEB 1H8KA 3QKJA 1VQ8A 1W70A 1QCFA 1Q7YR 2KT8A 2GGRA 3THKA 1N5ZA 1KQSP 1TUCA 4IIMA 1H92A 4HXJA 5CR2A 2DRKA 4RTVA 4OB2B 2R57A 1YI2A 2CP3A 3QWXX 4OGCA 1RI9A 4JLGA 1PD1A 1VQ7T 3CMEQ 4M75E 3RDVA 4BI4A 4CC2A 5GAN8 3RERA 1TH7A 4E47A 5D6WA 2C06A 4PK4A 3RKYA 4DOVA 2HAXA 1NG2A 2DVJA 4JRQA 1UE9A 2M1HA 4C8QD 5DLQE 3LH5A 2DF6A 1M90U 4KULA 2NUTA 5HK3A 1VQPQ 2RK1A 1W2BS 4ATOA 4EMKC 1O9SA 1Y71A 1QLYA 5IT9E 2DFUA 2DTHA 2DZ9A 3G71Q 4XU3A 1BI1A 1SSFA 2CH4W 1NYGA 2BE9B 4B6MA 3D7SB 2RJCA 3FRNA 1SHGA 2D0NA 2HDAA 3CCEQ 4ESRA 1FYNA 4J9BA 2LCLA 1K73C 1YNZA 3M55A 1K1ZA 3I56A 5KCHA 3OS5A 2JTFA 1WJRA 2RHZA 1VUBA 4EMKB 2BZXA 4PJOF 2E4HA 3MJXA 2EBPA 3RR6A 1H641 5CQYA 5LJ3e 2L3SA 2EGEA 1M1KR 3NMZC 1VQ7Q 4L59A 2GNCA 3M54A 1HSQA 4XK8E 3S3MA 1PHTA 1K4US 2DA9A 1GCPA 3RKWA 2DPPB 4IKFA 5IHIA 5CCAA 3UWNA 2F2WA 4QT7A 3VUZA 2XI9A 1WLPB 3CCRT 2JM9A 1J3TA 2EQKA 3NPFA 2KAFA 4IUUA 2PQWA 4TVRA 1GCQC 1G3SA 3JCMP 3JCMd 5GAMj 2RI5A 3VRZA 2ROLA 1MMGA 4BD3A 4Y28E 4M7AF 4XTZA 5GAOn 1R0CB 1PWTA 2M9UA 4LXCA 1MNEA 2GTJA 4PJNA 4AG1C 2E1HA 1N8RU 2EJ9A 3SEMA 2I0NA 2RQWA 4JS5A 1UJ0A 1N27A 1TU0B 2L89A 3OYGA 3BY7A 4M7DG 5J26A 5GAMd 1UJYA 5HKCA 3L2RA 3CCLA 4DA4A 1AD5A 4HT9A 3M4GA 1IGQA 2KBTA 4PJOC 2VXFA 1N9RA 2NUPA 4FYYB 2VASA 1ZBXA 3CCVA 5D6YA 1RAIB 2HKNA 3TQ7P 3EGXB 2MWPA 3EGUA 3M0UA 1KD1U 1VQMA 1QVPA 1YIJA 1U3OA 1XJWB 2DL5A 1SF9A 4Y91A 3OBYA 5KH6A 3GBQA 1Q81R 2WSEE 2OTJA 4OMNA 1A0NB 2AKLA 1B07A 5KE3A 3CCRQ 4PJOB 1TUGB 4C5EA 1W2BP 2RM4A 2LCSA 2WSCE 5CVIA 4C0FA 4JLIA 2RB6A 3QUIA 2O31A 1UGQB 1Z9QA 2COYA 4ZTFA 2JNGA 5GAOr 2QYZA 4FSSA 3BE3A 3M0QA 4M7AC 3CBOA 1N6AA 2DL4A 2O4XA 1LOJA 3P8BB 5HCKA 2LX9A 2L3RA 2O9VA 2J06A 2YUQA 3LH0A 2E6NA 3GNGA 4A53A 4OP0A 4DOWA 3J80E 1YFNA 4E7KA 5KYXB 5LJ5j 1JRIA 2FHDA 2PUKB 4DBRA 1RAFB 4RTWA 1KFZA 2M51A 3QXEB 4XQ3A 2CYZB 1UFFA 4M7AB 2A37A 3JB9H 3VS2A 4ZTJA 3GOXA 1QP2A 3HHTB 5LJ5d 2XKOC 2XMFA 1SSHA 5HK0A 4LN2A 1KK7A 3LW5E 4XAXB 1WXTA 4C92E 3VS5A 3LGLA 4Z88A 3JCMe 2MK5A 4RTYA 2RQTA 4M75A 3BDLA 4MZMA 3A8MB 5KCOA 4IUTA 4A4GA 3CC4T 3CD6T 2P0KA 1ZSGA 4PJOD 3CPWA 3IQLA 4QVZA 2DD4A 4DBFA 4JUVA 1OEBA 3R6NA 2JVVA 2DNUA 3GPLA 3OB9A 2EQMA 1AWWA 2KEAA 5GAMe 1ZLMA 4LNPA 1T0JA 2DBMA 2E12A 1YJNT 2HD0A 2COZA 4PFPA 3JCMX 2V1QA 4AFSC 1K76A 5LL6S 2KE9A 2KR3A 3T9NA 1K8AC 3CXCS 1S72T 4QVDA 2X4JA 3A1PA 3P8DA 1VQ6A 2VYTA 4PFOA 5CAIA 3RESA 1LJOA 1E6HA 2C0TA 1YHQA 2QGGA 4M7DA 4RCBA 1KQSA 3C12A 2CZ7B 2LT1A 2SRCA 4LDYA 4M78F 2YLBA 4PLIA 1NEGA 3EG9A 3C4SA 4M7AD 4OB0B 3CCMA 2AKKA 2B86A 3HSBA 2DL3A 1X27A 2K57A 3TVTA 4D8KA 2CS7A 4D8DA 1NPRA 2X9HA 3CCUA 3OYNA 2VGNA 2ZPGB 1G3YA 1WXUA 2FPFA 4HCZA 4BE0A 4F7UG 2F5TX 4LUEA 3G4SA 1BYMA 4GLKA 3CC4Q 2Y4YA 3CD6Q 1UHCA 2LDMA 4HKEA 3KFVA 2DZCA 2M0OA 3OYFA 3UA6A 3M56A 4M4ZA 5L8RE 4BY6C 5I22A 1K9MC 2LNHB 1TOVA 2RJFA 4QQDA 1QKWA 1OV3A 1YJNQ 3PMTA 3JSCA 2BKDN 1CSKA 1Y07A 1M8VA 1Q86C 1RAEB 4E2FB 3JB9G 3M0TA 2EPDA 2RA2A 1Y57A 2PUOB 3HRTA 1GRIA 4ELZC 1T0HA 4KH0B 3VS6A 1NJIU 1G5VA 2CSIA 2X35A 2PZ1A 5GAN5 3MHXA 2CP2A 2JTMA 5LJ5e 2Y4XA 3MEUA 5IN1A 2EAYA 2EYYA 4M78C 4BY6B 2NUTB 1IXDA 2CP6A 4Z89A 3FB9A 4BDYA 4XTXA 2PVGB 2KXCA 3MP6A 4OB1B 1IGUA 5IXBA 2LX7A 4DQ2A 1YITT 2E41A 2K2VA 2CT4A 1WYXA 1GFDA 3CCQT 4II1A 2OAWA 2MCNA 3CCJT 3QG1A 4Z02A 4HCKA 4NOYA 2XDPA 1MMAA 2DILA 2O88A 1UECA 4M78B 2KVQG 3S6WA 2DL7A 5I2SA 1ZBJA 2L3PA 3QJ6A 2ESWA 5ECAA 2QQAA 4IUQA 2A7YA 3L1AA 1IHWA 1ZX6A 2RI3A 3QYGB 5LJ3f 1BI2A 5GANj 2HZYA 3EHQA 3J81E 4AG2C 3CXCP 4OMOA 2CP7A 3PE0A 4IUVA 3O5ZA 1Y96A 3O8VA 2CKKA 4JRPA 2OX7A 2YRCA 3QWYA 2ZCFB 2CH4A 2MI6A 3V8JA 1ZA2B 1O75A 5GANd 1AWOA 4J9EA 2VKNA 4KBMB 2DKGA 4EMHA 1NLOC 3HRUA 2A36A 2A0FB 8AT1B 2D6FA 5KE2A 1M90C 2OTLA 2KYBA 1D09B 5GMKj 5LJ3h 2H3JA 1YITQ 3EAEA 3EG1A 1VQ9A 1C6VX 1ZSZA 1IZ6A 4WTOB 3CCQQ 3CCJQ 1Q95G 5LJ3g 1KC8R 1WXBA 4PKCC 3V8LA 2V8IA 3QBYA 3WVEB 1BIBA 5IHKA 1W2BA 2DX1A 4C92A 4M78D 2KROA 1MMDA 2JN0A 3SWNA 2JOYA 2QI2A 4A4KA 2XG8D 4M75F 2NUPB 3I55A 1V1CA 2F1LA 3QHSA 4KGXB 2PTKA 4A4HA 3G6EA 4HVUA 3OS1A 2DK3A 1BCMA 1WHJA 6AT1B 1QWEA 1RACB 2QQBA 5C0MA 1YBYA 2CZ0B 1VYUA 3DB3A 3PFSA 1D0XA 2EQUA 3F70A 1OX9A 4GLMA 4O5VA 3PVQA 2DO3A 2OTLT 2DJZA 1KQ1A 4R0KA 1M1KU 2ABLA 4C0GA 4ANJA 2P84A 2K79A 4KT0E 3H0HA 4XU1A 1YJ9A 4ZNXA 3EG3A 4BACA 2KRMA 1UG1A 1R0BG 2QEXT 1AZGB 2DEUA 3JCMW 1WNLA 1PSEA 3OSVA 1XOVA 4HCBA 1B3QA 4PLLA 1N8RC 5AT1B 1ZHIA 1U8RA 4QKUA 2H8HA 2K4YA 2X4WA 3OS2A 2M0YA 3CC7T 4BB7A 1Y0MA 1BK2A 4C5GA 5A2QE 4JZ3A 3HRSA 4J9GA 4M75C 1RUWA 1CKBA 2EJGA 5D6XA 2QAZA 2MF2A 4B9WA 5CKEA 1I0CA 2HL5C 2HMAA 2CUDA 1JXMA 1VQ8T 2V1RA 1G3WA 1D0YA 2DYIA 4M7DE 1KSWA 3NFCA 2MOXA 5CK9A 5GANe 2EVRA 4FYWB 3DLMA 1YI2T 1FX7A 1B34B 5CKBA 3JCMf 2DM1A 3HFOA 1K9AA 4AFZC 1VA7A 4M75B 1TS9A 2RHIA 3OYJA 2OTLQ 3PMIA 2RHUA 2GTOA 5AYFA 1AEYA 1K0XA 4WF2A 3MKDA 5FW9A 1QP3A 2DXTA 2KXDA 3H8ZA 2FB7A 2QA4A 2NUZA 5GAMf 3RMQA 2NYSA 1WGSA 4FYXB 4OMQA 3VS3A 3GLXA 2QEXQ 2FPEA 2AT1B 1VYTA 4CC7A 2AHJB 1AWXA 1Q81U 2COWA 5GMKe 1JBMA 1GBQA 2LTOA 3PTAA 2GQIA 4MZPA 4AT1B 2HQXA 4A54A 1Q82U 3JCMh 3CC7Q 4OMPA 5EG2A 1HK9A 1M3BA 4FW1A 1VOMA 2FZGB 9ATCB 1ZUKA 1M90R 4MZTA 2Y90A 3HTRA 3WXMB 3JCMg 3OYDA 1QKXA 3FIFA 2KNBB 3H6ZA 4C5IA 2MIOA 1VQ8Q 3EG9B 2O01E 3LYIA 4ZN3A 1M2OA 1M2VA 3I56T 1GFCA 1WHGA 4OF1A 2I2LA 1TUDA 4E7IA 3X20B 5GAMh 1YI2Q 2O2OA 4FCYA 4CI0C 3M59A 3RMSA 2ZZDA 1AHJB 1VQNA 1QMCA 4J7IA 1LPLA 3LWHA 3HL8A 4J9HA 5GAMg 2CZ1B 3QPHA 4Q5WA 3ME9A 4FYVB 1WHHA 3OMCA 1BU1A 4M75D 4JJCA 3VS7A 3DKMA 3P8HA 4NS5A 4JS4A 1UGPB 4RTUA 1ABQA 1WHKA 1T3LA 4FU6A 2E5QA 1GXIE 2VGMA 4C5HA 2ATCB 1U1TA 2YUPA 2LQWA 2QTXA 2EYWA 1YWPA 4OGEA 2K5FA 2G3RA 2DIQA 3M9QA 3CCSA 1XTDA 2C0IA 3SB2A 1OX8A 2ROTA 2RJDA 3SFMA 4HT8A 1VQ5A 3EG0A 4LDUA 5LJ5f 4JDSA 2V26A 2GFAA 3JB9I 2ZPEB 3I56Q 3CCLT 4OVAA 2RN8A 2W10A 4C92F 1JB0E 2CDTA 2FZCB 2KRSA 4PJOG 3CC2A 1PD0A 4BUGA 3I5SA 3CXCA 4FSXA 2OJ2A 1N8RR 3CCVT 1RADB 2QQSA 4JJBA 2DRMA 3JCMb 1PM3A 4FL6A 1LVKA 4N4HA 2LJ1A 1ARKA 1VQMT 2QK0A 2JXBA 3M58A 1YIJT 3ASKA 1X2QA 2RF0A 2RQVA 3EFOB 3EFSA 3V7RA 3CBPA 1VQKA 2ZPHB 3QDRB 1W1FA 5L23A 5LJ5h 2OTJT 1MGQA 4CRIA 3X26B 1QCNA 1K73R 2J7IA 1VQ4A 3FLGA 4F7UE 2VXEA 2G6FX 5LJ5g 3PVLA 4EMGA 4LUDA 2K6DA 4PFZA 2DERA 3A8HB 3FC3A 3NTIA 4JRKA 4M7AG 3L2QA 3OY9A 1M9SA 3DB4A 2BZ8A 4ZGJB 2QASA 4EMKA 3OA6A 2RJEA 1D1CA 1ZSZC 1U06A 4J8OA 2DL8A 4N4GA 2QTVA 2DETA 1MMNA 1NJIC 3RUXA 2ZPIB 4OMMA 3V8KA 4ZGDB 1RABB 3RNJA 3CCLQ 5FWCA 4MMKA 4C92C 2PVOB 3META 3SWNC 4FT4A 3Q1JA 1C0MA 2LJ0A 2LP5A 3URGA 3SHWA 2VC8A 2BZYA 3CCVQ 2L3QA 4A4EA 2EWNA 4M77E 1JO8A 2GBQA 3TSZA 1ZSZB 2EGCA 4LDVA 2LQ8A 3UF4A 1HD3A 3M0SA 5EC7A 2LVMA 1VQMQ 4DBHA 1YIJQ 2JMCA 1FMKA 4BE2A 2XD0A 1VYVA 3SDZA 4J5YA 2R5AA 2HBPA 2GQVA 4C92B 1VQ4T 2OTJQ 3SWNB 1HYOA 5IHNA 3JCMV 1PKTA 5CIUA 3PIPA 3ZBDA 2J6KA 3L2ZA 3E9GA 4J9FA 3MEWA 1VIFA 2DXBA 2LC4A 3EHRA 3REAB 1UGRB 1M8MA 5KYYA 2DEQA 3AHUA 2K3YA 3H41A 1I1JA 3CMAA 4MMLA 1ZUYA 2CP0A 2QGFB 2DIGA 5M9OA 2EYZA 3AT1B 1D1AA 3KUFA 3CBMA 4MDXA 2RHXA 3EGXA 3GNFB 2D1XA 3CC2Q 1T3SA 3OYAA 3RIRA 2NWMA 1VIEA 4N4IA 1VQ6T 1TG0A 1B7TA 1VQOA 2RK2A 5J3BA 1FMVA 2P0QA 3GIBA 1YHQT 4BI8B 1WQWA 1KIKA 2RI2A 4M77G 3CCMT 4J7FA 2YDLA 4B9XA 5FLXE 2DJQA 2L2PA 1JJ2A 3A5ZB 2L0AA 1UGVA 2R58A 1BI3A 3CCUT 4XTYA 1PSFA 1Z9ZA 3G1JA 4OMLA 1VQ4Q 1YCYA 1WJSA 2CSQA 1MUZA 2E6ZA 3JV3A 4C92D 3A8OB 4ELYC 3VU3C 3G4ST 3HPWA 2M16A 4RG8A 1UEBA 1UB4A 1FXXA 3H0IA 1PKSA 5GANf 2AIRB 1G8XA 2M02A 3VS0A 5GAOp 3CMEA 2PNIA 3VYGA 1KC8U 4RTZA 4LDXA 5KYXA 1UHFA 2RO0A 2JUFA 2DE0X 1RLPC 3LGFA 2FO0A 1ZQ1A 1X43A 4KUDK 2F69A 4C8QE 4M7AA 2MPXC 4XU2A 1X2KA 1OPLA 1I5LA 1QVGS 1ACMB 4BI3A 1VQ6Q 3E2UA 2JZ2A 1VQPA 1IB8A 3C0CA 2K3XA 1X01A 2FRYA 1YHQQ 4M78G 1M1KC 2OI3A 3G71A 1Q7YU 1G2BA 1TTHB 3MP1A 4QW2A 5FROA 2HQHA 1JQQA 3CCMQ 1UTIA 5GAN6 1JJ2S 4J9DA 5GANh 3PT9A 1RAGB 3M4YA 2HQEA 2DBKA 3RBBB 2K7AA 4GY5A 2EKOA 3CCUQ 5GANg 3MEAA 2CUBA 2A08A 2V8JA 2QQRA 1QVFS 2B8AA 4XTUA 3PGGA 1MNDA 2PU9B 3CPFA 1K8AR 3G4SQ 5GAN4 1MHNA 2ED1A 2IG0A 2BTTA 2K5IA 4F04B 1YJWA 1FWZA 3OMGA 2XDBA 4LD6A 1OYXA 3ULRB 2IIMA 2HSEB 7AT1B 1VQ7A 2K3BA 4JZ4A 3QDFA 3VJPA 4DBQA 3L42A 1KJWA 1H3ZA 4F7UA 5KYWA 5GMKh 2MWOA 2H3EB 2W0ZA 1I07A 2HEQA 3PIOA 2LQNA 4C8QG 4KUIA 1SHFA 3CQTA 4E6RA 4BE1A 3EH2A 4K11A 1V29B 2GF7A 1D3BA 4A63B 2JM8A 1HJDA 2DTIA 5IXFA 2X3XD 3MEVA 1NE8A 1M4ZA 1JEGA 2RPNA 1BB9A 3HKSA 1Y7XA 3CEYA 1K0SA 1OOTA 4FW2A 2KMTA 2NLUA 2F2VA 2YXYA 1D0ZA 2JS2A 3LX7A 1I8FA 4YTLA 3HP9A 1Q81C 1K9MR 3VS1A 1NEBA 5GJVB 3QO3A 3H9NA 1VQ9T 4M77A 1RI0A 4F14A 4C0DC 3X25B 1Q86R 1YJWT 1NM7A 4PNOA 4M7DF 3OQ5A 3EFRA 2O4XB 3X28B 1Q82C 4RMOA 4O6JA 2FG0A 2MMPA 4X9DA 1OZ3A 1IO6A 2LRQA 2IVWA 3NHNA 4N0AA 2KSSA 2KI7A 1WPYA 4GBQA 4LDWA 5CKHA 5GAN3 1XNIA 3I55T 4EDUA 3JCMQ 3A8GB 2P0PA 3OW2S 4IUPA 2FVUA 3I35A 2ED0A 2BUDA 3UATA 5KYUA 2FRWA 1E6GA 1X69A 3NGPA 3I5RA 3JAME 3G6ET 1QVGP 3GF5A 4C0DB 4PJLA 2FPDA 4XTWA 5CKDA 3EGDA 4RCCA 4EIKA 4R55A 2XU8A 2CZ6B 3CCRA 3L2UA 5I21A 5GMKi 3EG2A 3MP8A 3MCAB 2LZ6B 1XQHA 5A0DA 4MDWA 2VWFA 4LE9A 4R56A 2VV5A 4AMCA 1KD1C 1OU9A 1JJ2P 2AZVA 1RLQC 5GAOl 3I9QA 5GAOm 2IPOB 1WFWA 2RD1A 4HVVA 2VB6A 1U1SA 2K5LA 2Z0WA 3FJ5A 3R6OA 1QVFP 4M78A 2K9GA 1YJ9T 1F1BB 1YP5A 4X34A 1CKAA 1VQ9Q 1BCOA 3OYCA 3OS0A 1YJWQ 4M7DC 2JW4A 1E7OA 1M30A 1AWJA 2XHCA 3FDRA 1SG5A 2R5MA 1JXOA 4NL3A 3TU4K 4M75G 2JJ9A 1KQ2A 2QDYB 1YWOA 1SKUB 3I55Q 1IREB 1AOJA 3M57A 4FIBA 2YT6A 2D0QB 1VQLA 2CP5A 2YRDA 4Z8AA 3G6EQ 5A0GA 5GJWB 4M7DB 4IURA 3J7AF 2GCXA 3V7CA 3MPUB 2E3HA 4PJOE 1PG5B 2C0OA 2ZPBB 4J6YA 3UT1A 2ZPFB 2CGHA 4DEYA 3FJPA 2DTOA 2ZGWA 4X1VA 2KY9A 1IHVA 4C8QA 5GAN7 2YHTA 4WCIA 1BKBA 1X75C 2KQWA 2HCKA 2F5KA 2KDSA 4JPBW 2FZKB 1X6GA 1MV0B 1GBRA 1JU5C 1N9SA 3UPUA 5I11A 5KYYB 2LMJA 4HA8A 3RKXA 2JS0A 2QA4T 3GP8A 1YJ9Q 1PRLC 3KXTA 2EIFA 1H3HA 2LT4A 3NTKA 2XK0A 4KGVB 1R77A 2D8JA 2ECZA 2WACA 1KG1A 4EPCA 2D8HA 4KGZB 5DY9A 2DXCA 5GMKl 5GMKm 1K73U 4CC3A 4M7AE 2DAQA 4RG2A 5DM7R
chains in the Genus database with same CATH topology
4BE2A 2RK1A 1W2BS 4ATOA 4IUVA 2XD0A 1Y96A 3O8VA 4EMKC 1I4K1 2CKKA 3SDZA 4J5YA 5FU6C 4JRPA 2R5AA 1O9SA 1Y71A 2HBPA 1VQLT 2GQVA 4FT2A 1BI0A 4C92B 5IT9E 1VQ4T 2LNVA 2DTHA 2DZ9A 4XU3A 3SWNB 1BI1A 2ZCFB 3JCMV 1SSFA 2MI6A 3VYHB 3OYHA 3V8JA 5CIUA 3PIPA 1O75A 4J83A 3L2ZA 3ZBDA 4A4FA 5GANd 3E9GA 3MEWA 4KBMB 3N5BB 1VIFA 2DKGA 2DXBA 2LC4A 2FL7A 2RJCA 3FRNA 3HRUA 1UGRB 4EMHA 4M7DD 2DEQA 3AHUA 2K3YA 4UC4A 2LCLA 3JCMJ 4JRIA 1K73C 2D6FA 3M55A 5KE2A 3CC4A 4F7UF 1NZ9A 4MMLA 5KCHA 3I56A 3CMAA 3ZFJA 1M90C 3OS5A 2OTLA 2JTFA 1WJRA 1VQNT 2RHZA 1VUBA 4EMKB 1M1FA 5FU6B 5GMKj 5LJ3h 3ER0A 2H3JA 4PJOF 2DIGA 3EAEA 5M9OA 1VQ9A 3KUFA 1OZ2A 3CBMA 1IZ6A 1H641 5CQYA 2P4TA 5LJ3e 4MDXA 1I81A 2RHXA 4BDZA 3GNFB 5LJ3g 4PKCC 4QVCA 3OYAA 4L59A 2V8IA 3QBYA 3RIRA 3V8LA 3WVEB 4ZN1A 3L2WA 3M54A 1VIEA 4N4IA 1VQ6T 4XK8E 3S3MA 3LWIA 1BIBA 1VQOA 2RK2A 5J3BA 5GAOq 1YJNA 2P0QA 4LD9K 1W2BA 3RKWA 4C92A 3OYKA 2DPPB 4IKFA 4M78D 5CCAA 3GIBA 1YHQT 2JN0A 3SWNA 2JOYA 2QI2A 4A4KA 4BI8B 2XG8D 3UWNA 3E1SA 1S72A 4M75F 3JB9F 1WQWA 3VUZA 2XI9A 3I55A 1M5Q1 3QHSA 3CCRT 3CCST 2RI2A 4M77G 3CCMT 2DXUA 4J7FA 4B9XA 5FLXE 5IAYA 3M53A 4A4HA 3G6EA 3QIIA 2EQKA 1JJ2A 3A5ZB 3OS1A 2DK3A 2KAFA 4IUUA 2PQWA 1VQ5T 2R58A 4TVRA 2QQBA 1BI3A 4M77F 1YBYA 2CZ0B 1X6OA 2E65A 1G3SA 1Y96B 4QQ6A 4XTYA 5CQXA 1PSFA 3JCMd 3CCUT 5GAMj 2RI5A 3C95A 3DB3A 2E64A 4BD3A 1B34A 1YCYA 1WJSA 3PFSA 4Y28E 4M7AF 3INZA 2A3LA 4XTZA 2WSFE 5GAOn 5FRNA 2X4XA 2EQUA 2E6ZA 2M9UA 4C92D 3A8OB 3PNWC 3VU3C 3F70A 4ELYC 3G4ST 4HCCA 3HPWA 2M16A 2E1HA 1N8RU 4RG8A 2EJ9A 4O5VA 1UEBA 4C0ZA 1UB4A 1FXXA 5FRMA 3CC2T 2DO3A 5GANf 2DJZA 4JS5A 2OTLT 1N27A 3JRZA 3QSUA 1KQ1A 3M5AA 5GAOp 3CMEA 2L89A 1M1KU 3OYGA 3BY7A 3VYGA 3L2VA 5J26A 1KC8U 4LDXA 4C0GA 5GAMd 4M7DG 2RO0A 5HKCA 2JUFA 5FU7C 3L2RA 3CCLA 3LGFA 4DA4A 4HT9A 3OYYA 1ZQ1A 3M4GA 4KT0E 5C6SA 4XU1A 1YJ9A 1EIFA 4BACA 4PJOC 4KUDK 2QXFA 2F69A 2VXFA 2YRVA 2QEXT 4FM4B 1N9RA 4C8QE 4J6WA 4M7AA 1ZBXA 3CCVA 5D6YA 3JCMW 1WNLA 4XU2A 1PSEA 3MO8A 4E7HA 1I5LA 3OSVA 1QVGS 1XOVA 1VQKT 4HCBA 2MWPA 5CKFA 4BI3A 3E19A 4PLLA 1N8RC 1KD1U 1VQMA 1QVPA 1ZHIA 1U8RA 2JZ2A 1VQPA 1QVFS 1YIJA 2K4YA 2L5QA 3JB9J 2K3XA 2X4WA 3OS2A 3CC7T 4BB7A 4Y91A 1X01A 4OB3B 3OBYA 4C5GA 4M78G 4F7UB 5KH6A 5A2QE 3HRSA 5FU7B 1KC8C 5CO7A 4M75C 2XDDA 2XIDA 2WSEE 2OTJA 2EJGA 5D6XA 3G71A 1Q7YU 4ME7A 3MP1A 2MF2A 2QQ9A 5CKEA 4QW2A 5FROA 4B9WA 5KE3A 5GAN2 4PJOB 4NL2A 4L5GA 4C5EA 5GAN6 1JJ2S 2RM4A 5GANh 3PT9A 2WSCE 3E9FA 1VQ8T 5CVIA 1G3WA 4D6WA 3M4YA 4C0FA 3BDUA 2HQEA 4M7DE 3NFCA 4JLIA 2YLCA 2RB6A 1D3BB 3QUIA 3WVDB 5CK9A 4M77C 5GANe 4GY5A 3BW1A 2EKOA 1UGQB 5GANg 4E7LA 3MEAA 2X4YA 3TEEA 3QZ5B 2V8JA 2QQRA 3DLMA 2B8AA 1FX7A 4XTUA 4ZTFA 1YI2T 3PGGA 1B34B 2JNGA 3S3OA 5GAOr 5CKBA 3JCMf 2PU9B 4M7AC 3CBOA 5C0MA 1N6AA 3CPFA 2O4XA 1LOJA 3P8BB 2DVEA 5GAN4 3HFOA 3OYMA 4C92G 1MHNA 2IG0A 2K5IA 1M1KC 2LX9A 2L3RA 5HY6A 4M75B 4N0AC 1YITA 1FWZA 3A8LB 1YJWA 2RHIA 3OMGA 3OYBA 3OYJA 2XDBA 4LD6A 1OYXA 3LH0A 2E6NA 1Q7YC 3GNGA 3PMIA 3CPWS 2RHUA 4A53A 3CCQA 4OP0A 3CCJA 1KHIA 1W4SA 2RHYA 4DOWA 1QVGA 5AYFA 1VQ7A 3HFNA 2GFUA 2EJFA 3J80E 4WF2A 4E7KA 5LJ5j 3VJPA 1QW1A 1JRIA 2FHDA 1QP3A 2DXTA 3L42A 4M78E 4P5NA 4M77B 2PUKB 3H8ZA 2FB7A 4XTVA 1R8OB 2QA4A 1H3ZA 1WQ7A 4F7UA 3RMQA 5GAMf 1WGSA 5GMKh 2MWOA 3GLXA 3QXEB 4XQ3A 4E7JA 2CYZB 3PIOA 4M7AB 4PJOA 2AHJB 1S72T 4C8QG 1Q81U 2L8DA 4KUIA 5GMKe 3S3NA 3JCMc 1JBMA 2EYQA 2MAMA 3JB9H 2LTOA 3PTAA 4ZTJA 4BE1A 1V29B 2GF7A 1D3BA 4MZPA 2HQXA 1QP2A 3GOXA 2E10A 3HHTB 4C8QF 5LJ5d 2XKOC 2DTIA 3SD4A 4A54A 3OBWA 1Q82U 3MEVA 1NE8A 1M4ZA 3JCMh 5EG2A 5HK0A 1HK9A 1M1GA 4XAXB 1BIAA 3LW5E 3HKSA 1QVFA 1Y7XA 4C92E 3CEYA 3LGLA 5DLOA 4MZTA 1KQSS 3JCMe 2Y90A 3WXMB 3JCMg 2KMTA 4M75A 3OYDA 2NLUA 3FIFA 3H6ZA 3BDLA 4C5IA 4MZMA 1K8AU 3A8MB 5KCOA 4IUTA 2FYKA 1WJQA 2PVDB 2O01E 3FEOA 3LYIA 4A4GA 4ZN3A 3CC4T 3CMAT 3I56T 3CD6T 2P0KA 4PJOD 3LX7A 3VKIA 1I8FA 1HXDA 4YTLA 4OF1A 3HP9A 3CPWA 1Q81C 4QVZA 2DD4A 2I2LA 4JUVA 4E7IA 2BIVA 3QO3A 2EQJA 3QYHB 3X20B 5J39A 2D9TA 1VQ9T 5GAMh 2JVVA 3LLRA 1RI0A 2LCCA 4M77A 4VUBA 3VUBA 4C0DC 3X25B 4CI0C 3M59A 1YJWT 3GPLA 4PNOA 3RMSA 2RH2A 2ZZDA 3OB9A 1AHJB 2EQMA 1VQNA 4M7DF 3OQ5A 3EFRA 2O4XB 4J7IA 3X28B 1Q82C 5GAMe 4RMOA 2XICA 3G7ZA 3HL8A 3LWHA 3TCJA 5GAMg 4O6JA 2CZ1B 3QPHA 4V2SA 2E12A 1P92A 4Q5WA 3ME9A 2MMPA 1VQOT 1YJNT 2HD0A 1OZ3A 4X9DA 3OMCA 2LRQA 2IVWA 4N0AA 4M75D 3JCMX 3JB9D 3DKMA 3NTHA 5LL6S 2KSSA 3T9NA 3P8HA 1K8AC 1WPYA 4NS5A 1LNXA 4L6V5 3OYLA 1NPPA 3CXCS 4LDWA 1UGPB 4JS4A 2LQKA 3JCMP 5CKHA 5GAN3 4QVDA 2X4JA 1XNIA 3P8DA 4FU6A 3I55T 2VYTA 4EDUA 1VQ6A 2E5QA 3JCMQ 3A8GB 2P0PA 3OW2S 1GXIE 2VGMA 4IUPA 2FVUA 4C5HA 3OYIA 5CAIA 2BUDA 3RESA 1U1TA 1LJOA 3JAME 3G6ET 4M77D 3GF5A 4C0DB 1YHQA 2QTXA 4M7DA 4RCBA 4XTWA 1KQSA 4OGEA 3C12A 5A0LA 2CZ7B 2LT1A 2K5FA 4LDYA 5CKDA 4M78F 4RCCA 2G3RA 2XU8A 2YLBA 4OMFB 4PLIA 2CZ6B 2DIQA 4R55A 3CCRA 3C4SA 3L2UA 5I21A 4OB0B 3MP8A 3M9QA 3MCAB 5GMKi 3CCSA 3CCMA 4M7AD 1XQHA 1XTDA 5A0DA 3VV0A 3SB2A 3HSBA 4J6XA 4MDWA 4C8QC 3ZEHA 2E70A 2K57A 4X9CA 3DLLA 3CCEA 2RJDA 3SFMA 4HT8A 2V8KA 4R56A 2CS7A 4LDUA 5LJ3j 1VQ5A 5I2MA 1NPRA 3C94A 1G3TA 5LJ5f 1K9MU 2VV5A 3CCUA 3OYNA 4JDSA 1KD1C 2VGNA 4JJNK 3V7SA 3QJYA 4QQGA 2GFAA 2ZPGB 1G3YA 5GAOl 5GAOm 1Q86U 4HCZA 4BE0A 4F7UG 2F5TX 3JB9I 3CMET 2RD1A 3G4SA 1U1SA 2ZPEB 1BYMA 4GLKA 2K5LA 2Y4YA 4RKUE 3R6OA 3CCLT 4OVAA 4M78A 4C92F 1JB0E 4PJOG 2LDMA 1DJ7B 4HKEA 1YJ9T 3CC2A 3OYEA 4X34A 2DZCA 4BUGA 5LJ3d 3CXCA 3OSSC 4FSXA 4C8QB 3OYCA 3CCVT 3OS0A 2M0OA 3OYFA 2QQSA 4M7DC 3OW2A 3M56A 3JCMb 4FL6A 5L8RE 4BY6C 4N4HA 2DD5A 1OI1A 1K9MC 2XHCA 2RJFA 4QQDA 2QEXA 1VQMT 3X24B 3FDRA 3M58A 1VQPT 1YIJT 3PMTA 3ASKA 3JSCA 2BKDN 2R5MA 1Y07A 1M8VA 4NL3A 1Q86C 3TU4K 3EFSA 4M75G 3V7RA 3JB9G 2QDYB 3CBPA 1VQKA 1KQ2A 1KHCA 3BFMA 2ZPHB 2RA2A 2PUOB 1UGSB 3HRTA 3QDRB 2EFIA 4ELZC 5LJ5h 3G71T 2OTJT 1NJIU 1MGQA 1G5VA 1IREB 4CRIA 2VUBA 2X35A 3X26B 2HNIA 3M57A 4FIBA 2D0QB 5GAN5 3UDCA 1VQLA 3MHXA 1RL2A 3CC7A 2JTMA 5LJ5e 1VQ4A 3FLGA 4F7UE 2VXEA 5LJ5g 4XU0A 4EMGA 2Y4XA 3QZ9B 5A0GA 4M7DB 3MEUA 5IN1A 4IURA 2EAYA 3J7AF 2GCXA 4M78C 3KBGA 3A8HB 3V7CA 4BY6B 3FC3A 3CCET 4PJOE 3NTIA 2OAUA 4JRKA 4PL6A 3FB9A 4ZGEB 4M7AG 2KK4A 3TREA 2ZPBB 4BDYA 1VQ8A 3QKJA 4J6YA 3UT1A 3L2QA 4XTXA 3OY9A 1M9SA 2CGHA 2PVGB 2ZPFB 3DB4A 3MP6A 4OB1B 4ZGJB 4EMKA 3FJPA 2DTOA 2ZGWA 3OA6A 2RJEA 2KY9A 4C8QA 5CR2A 5GAN7 4OB2B 4DQ2A 1YITT 2YHTA 4J8OA 1BKBA 1X75C 2E41A 2K2VA 2KQWA 2R57A 4N4GA 1YI2A 4OGCA 2F5KA 1NJIC 3CCQT 2KDSA 4II1A 4JLGA 3RUXA 3CCJT 3QG1A 4Z02A 2ZPIB 3V8KA 1VQ7T 4NOYA 4ZGDB 4M75E 2XDPA 1N9SA 4BI4A 3UPUA 4MMKA 5GAN8 3RERA 4C92C 4M78B 2KVQG 4HA8A 3RKXA 2PVOB 3META 3GP8A 3S6WA 2QA4T 5I2SA 1TH7A 3SWNC 4FT4A 3Q1JA 4E47A 3KXTA 3QJ6A 5D6WA 2EIFA 3URGA 2LT4A 2QQAA 2VC8A 3RKYA 4IUQA 4DOVA 2C06A 2A7YA 3L1AA 3NTKA 2XK0A 4A4EA 2HAXA 2RI3A 2EWNA 3QYGB 4M77E 5LJ3f 4JRQA 2M1HA 4C8QD 1BI2A 2WACA 1KG1A 4EPCA 4LDVA 2LQ8A 5GANj 5DLQE 5DY9A 2DXCA 5GMKl 5GMKm 1K73U 3J81E 2LVMA 1M90U 4M7AE 4KULA 2DAQA 4RG2A 3CD6A 5HK3A 5DM7R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M78 A;  1D3B A;  4PJO G;  4C92 F;  5GAO p;  4M7D G;  1Y96 A;  2E10 A;  3BY7 A;  4EMK C;  1I4K 1;  4C8Q F;  5LJ5 d;  5GAM d;  4J5Y A;  2DTI A;  4A54 A;  2DZC A;  5LJ3 d;  4C92 B;  3JCM h;  4HT9 A;  2DTH A;  2DZ9 A;  3M4G A;  1HK9 A;  4XU3 A;  4C8Q B;  4XU1 A;  3SWN B;  1BIA A;  3JCM V;  4PJO C;  3V8J A;  4C92 E;  4M7D C;  2VXF A;  3JCM b;  1N9R A;  4C8Q E;  4J6W A;  3JCM e;  3L2Z A;  2Y90 A;  5GAN d;  4M7A A;  3JCM W;  3JCM g;  1WNL A;  4XU2 A;  4M75 A;  3FIF A;  2DKG A;  2FYK A;  1I5L A;  4EMH A;  4PJO D;  4M7D D;  2DEQ A;  1I8F A;  4NL3 A;  3AHU A;  1HXD A;  1M8V A;  3EFS A;  4M75 G;  3JCM J;  4JRI A;  3V7R A;  3JB9 G;  2I2L A;  1KQ2 A;  4JUV A;  3BFM A;  4F7U F;  4MML A;  2RA2 A;  3QO3 A;  3JB9 J;  5LJ5 h;  5GAM h;  4M77 A;  4EMK B;  1MGQ A;  4Y91 A;  1X01 A;  5GMK j;  4F7U B;  4M78 G;  5LJ3 h;  2HNI A;  4PNO A;  4PJO F;  4M75 C;  4M7D F;  5GAN 5;  3EFR A;  2EJG A;  5LJ5 e;  5GAM e;  4F7U E;  5GAN 2;  2VXE A;  5LJ5 g;  4XU0 A;  4EMG A;  5GAM g;  4PJO B;  1H64 1;  5LJ3 e;  4NL2 A;  4M7D B;  4V2S A;  1I81 A;  5GAN 6;  2RM4 A;  2EAY A;  5GAN h;  5LJ3 g;  4M78 C;  3V7C A;  4QVC A;  4X9D A;  3BDU A;  3V8L A;  4PJO E;  3RIR A;  4M7D E;  4N0A A;  4M75 D;  4JRK A;  4JLI A;  3JCM X;  2YLC A;  2RB6 A;  1D3B B;  3FB9 A;  3QUI A;  3JB9 D;  4M7A G;  4M77 C;  1BIB A;  5GAN e;  4J6Y A;  1WPY A;  3BW1 A;  1LNX A;  4XTX A;  5GAO q;  5GAN g;  3HSB A;  3JCM P;  2CGH A;  3RKW A;  5GAN 3;  4QVD A;  4C92 A;  3FJP A;  2DTO A;  4EMK A;  2ZGW A;  4XTU A;  4M78 D;  3JCM Q;  3PGG A;  1B34 B;  4C8Q A;  5GAO r;  3GIB A;  2JN0 A;  3SWN A;  3JCM f;  5GAN 7;  4DQ2 A;  5CAI A;  3RES A;  4M7A C;  2YHT A;  1U1T A;  4M75 F;  1LJO A;  1LOJ A;  3JB9 F;  1WQW A;  2E41 A;  4M77 D;  2DVE A;  5GAN 4;  3HFO A;  1M5Q 1;  4C92 G;  3QHS A;  2QTX A;  4M7D A;  3RUX A;  4RCB A;  4M75 B;  4M77 G;  4XTW A;  2DXU A;  4N0A C;  3V8K A;  4NOY A;  4M78 F;  4RCC A;  2YLB A;  4M75 E;  1N9S A;  5I21 A;  5GMK i;  4A53 A;  4M7A D;  4OP0 A;  4MMK A;  5GAN 8;  3RER A;  4C92 C;  4M78 B;  3SB2 A;  4HA8 A;  3HFN A;  4J6X A;  2EJF A;  2E65 A;  4M77 F;  3RKX A;  4WF2 A;  1Y96 B;  4C8Q C;  1TH7 A;  4XTY A;  3SWN C;  3JCM d;  5LJ5 j;  2K57 A;  4X9C A;  5GAM j;  1JRI A;  2DXT A;  2E64 A;  4HT8 A;  4M78 E;  4M77 B;  1B34 A;  5LJ3 j;  4XTV A;  1YCY A;  2FB7 A;  2VC8 A;  3RKY A;  3L1A A;  1WQ7 A;  4F7U A;  5GAM f;  5LJ5 f;  4M7A F;  3INZ A;  4XTZ A;  5GAO n;  3V7S A;  5GMK h;  2EWN A;  4M77 E;  5LJ3 f;  4C92 D;  3VU3 C;  4XQ3 A;  4C8Q D;  4M7A B;  2E1H A;  5GAO l;  5GAO m;  5GAN j;  4PJO A;  2EJ9 A;  5DY9 A;  5GMK l;  4C8Q G;  4F7U G;  5GMK m;  3JB9 I;  2RD1 A;  5GMK e;  3JCM c;  1JBM A;  1U1S A;  3JB9 H;  4M7A E;  5GAN f;  2DJZ A;  3QSU A;  1KQ1 A; 
#chains in the Genus database with same CATH topology
 3M0P A;  3OW2 P;  1I4K 1;  2QDL A;  5FU6 C;  1VQL T;  4FT2 A;  1BI0 A;  2LNV A;  1RAA B;  1TXQ A;  3VYH B;  3OYH A;  4J83 A;  4A4F A;  2LJ3 A;  4KRT A;  2EW3 A;  3N5B B;  4Y92 A;  2FL7 A;  2RQR A;  2QG9 B;  1Q82 R;  3REB B;  4M7D D;  4UC4 A;  3JCM J;  4JRI A;  2EYX A;  3CC4 A;  2JTE A;  1NZ9 A;  4F7U F;  3CD6 A;  3ZFJ A;  1VQN T;  5IH2 A;  1EX4 A;  1M1F A;  5FU6 B;  3ER0 A;  1IRX A;  1WIE A;  2CRE A;  1OZ2 A;  2P4T A;  1I81 A;  4BDZ A;  4QVC A;  3L2W A;  4ZN1 A;  2ZAE A;  3LWI A;  2QA4 Q;  4AFQ C;  5GAO q;  1YJN A;  4LD9 K;  4PJM A;  1SEM A;  3OYK A;  2KGT A;  1S72 A;  3E1S A;  1SRL A;  4AFU C;  3JB9 F;  1EFN A;  4KH1 B;  1M5Q 1;  2KT1 A;  3CCS T;  2DXU A;  5IAY A;  1KD1 R;  3M53 A;  1S1N A;  3QII A;  2HL3 A;  1WX6 A;  4PJJ A;  1VQ5 T;  1NLP C;  4M77 F;  2E65 A;  1X6O A;  4QQ6 A;  1Y96 B;  5CQX A;  3C95 A;  1OPK A;  2ENM A;  1VQL Q;  2E64 A;  1B34 A;  3INZ A;  2A3L A;  2WSF E;  5FRN A;  2X4X A;  2DMO A;  2X51 A;  3PNW C;  4RTT A;  4HCC A;  1WA7 A;  1QQJ A;  2YUN A;  2FEI A;  4C0Z A;  1SPK A;  5FRM A;  3CC2 T;  3JRZ A;  3QSU A;  3M5A A;  4E7Z A;  3L2V A;  1YN8 A;  1MV3 A;  5FU7 C;  1VQN Q;  3OYY A;  1SRM A;  5C6S A;  1EIF A;  1LCK A;  2QXF A;  2YRV A;  4FM4 B;  1U5S A;  4J6W A;  3ZL7 C;  3MO8 A;  4E7H A;  1VQK T;  5CKF A;  3E19 A;  1NYF A;  2L5Q A;  3JB9 J;  1I5O B;  4OB3 B;  4F7U B;  1KC8 C;  5FU7 B;  3VS4 A;  5CO7 A;  5KYW B;  2XDD A;  2XID A;  2HKQ B;  4E7S A;  4ME7 A;  2QQ9 A;  5GAN 2;  3CCS Q;  4NL2 A;  4L5G A;  1ABO A;  3E9F A;  4D6W A;  3BDU A;  5KYN A;  2YLC A;  3WVD B;  1D3B B;  1VQ5 Q;  4M77 C;  2YSQ A;  2KRN A;  3BW1 A;  1OUL A;  4E7L A;  2X4Y A;  3TEE A;  3QZ5 B;  1GCQ A;  3S3O A;  1AT1 B;  2VVK A;  2DVE A;  3OYM A;  4C92 G;  5HY6 A;  1UUE A;  4N0A C;  1YIT A;  1OQK A;  3A8L B;  3OYB A;  1C1A A;  2O9S A;  1WHL A;  1Q7Y C;  3CPW S;  3CCQ A;  2F2X A;  1WDX A;  2RNA A;  3CCJ A;  1KHI A;  1W4S A;  2RHY A;  4J9C A;  1QVG A;  3HFN A;  2GFU A;  2EJF A;  3H0F A;  1QW1 A;  2DYB A;  2EGA A;  4P5N A;  4M78 E;  4M77 B;  3VRY A;  4XTV A;  1R8O B;  1WQ7 A;  2BE7 D;  4E7J A;  1D1B A;  4PJO A;  2AK5 A;  2L8D A;  2MYS A;  3S3N A;  1AVZ C;  1BBZ A;  3JCM c;  2EYQ A;  2MAM A;  1VQK Q;  4JJD A;  1NBE B;  2KYM A;  2E10 A;  4C8Q F;  1WZO A;  1YCS B;  4RUG A;  1S72 Q;  3SD4 A;  3OBW A;  1GL5 A;  2E3I A;  1M1G A;  1BIA A;  1QVF A;  4ORZ A;  5KYU B;  1TWB A;  5DLO A;  1QCO A;  1KQS S;  1G83 A;  1M3A A;  1OU8 A;  1K8A U;  3EGD B;  2FYK A;  1WJQ A;  2PVD B;  3FEO A;  3CMA T;  1PRM C;  3VKI A;  1HXD A;  1AZE A;  2BIV A;  8ATC B;  3QYH B;  2EQJ A;  2YUO A;  3UA7 A;  5J39 A;  2D9T A;  3LLR A;  2LCC A;  1ZUU A;  4VUB A;  3VUB A;  2RH2 A;  2CT3 A;  2E5K A;  2HSP A;  2XIC A;  3G7Z A;  3TCJ A;  1M27 C;  1W6X A;  4J9I A;  4V2S A;  2X3W D;  1P92 A;  3A98 A;  1VQO T;  2YWW A;  1QWF A;  3EFO A;  3JB9 D;  3NTH A;  5FWB A;  1LNX A;  4L6V 5;  3OYL A;  1NPP A;  2HBW A;  2LQK A;  1RAH B;  2J05 A;  4HVW A;  3OYI A;  2P4R A;  4M77 D;  5A0L A;  1WHM A;  2AZS A;  4OMF B;  1TSF A;  3VV0 A;  1NJI R;  1M3C A;  4J6X A;  4C8Q C;  3ZEH A;  2E70 A;  4X9C A;  3DLL A;  3CCE A;  2V8K A;  3M0R A;  5LJ3 j;  4F17 A;  5I2M A;  1FMW A;  3C94 A;  1G3T A;  1K9M U;  2EQI A;  4JJN K;  3V7S A;  4CC4 B;  3QJY A;  4QQG A;  2JT4 A;  2J6O A;  1Q86 U;  3CME T;  4RKU E;  2JMA A;  3CMA Q;  2DLP A;  1M2V B;  4F16 A;  4DEX A;  1DJ7 B;  3OYE A;  5LJ3 d;  1ZA1 B;  3OSS C;  4C8Q B;  1PNJ A;  3TSW A;  3OW2 A;  1V76 A;  2J6F A;  3CPW P;  2DD5 A;  1OI1 A;  2QEX A;  2A28 A;  1VQO Q;  3X24 B;  1VQP T;  5D7U A;  1KHC A;  2RMO A;  3BFM A;  1UGS B;  4RTX A;  2EFI A;  3G71 T;  4IIO A;  1PCX A;  2VUB A;  2HNI A;  1UDL A;  1PC0 A;  3UDC A;  3U23 A;  1RL2 A;  3CC7 A;  4XU0 A;  3QZ9 B;  1X6B A;  3KBG A;  3CCE T;  2SEM A;  2EKH A;  2RQU A;  1EZZ B;  2OAU A;  2K2M A;  3EH1 A;  1WI7 A;  4PL6 A;  2KK4 A;  3TRE A;  4ZGE B;  1H8K A;  3QKJ A;  1VQ8 A;  1W70 A;  1QCF A;  1Q7Y R;  2KT8 A;  2GGR A;  3THK A;  1N5Z A;  1KQS P;  1TUC A;  4IIM A;  1H92 A;  4HXJ A;  5CR2 A;  2DRK A;  4RTV A;  4OB2 B;  2R57 A;  1YI2 A;  2CP3 A;  3QWX X;  4OGC A;  1RI9 A;  4JLG A;  1PD1 A;  1VQ7 T;  3CME Q;  4M75 E;  3RDV A;  4BI4 A;  4CC2 A;  5GAN 8;  3RER A;  1TH7 A;  4E47 A;  5D6W A;  2C06 A;  4PK4 A;  3RKY A;  4DOV A;  2HAX A;  1NG2 A;  2DVJ A;  4JRQ A;  1UE9 A;  2M1H A;  4C8Q D;  5DLQ E;  3LH5 A;  2DF6 A;  1M90 U;  4KUL A;  2NUT A;  5HK3 A;  1VQP Q;  2RK1 A;  1W2B S;  4ATO A;  4EMK C;  1O9S A;  1Y71 A;  1QLY A;  5IT9 E;  2DFU A;  2DTH A;  2DZ9 A;  3G71 Q;  4XU3 A;  1BI1 A;  1SSF A;  2CH4 W;  1NYG A;  2BE9 B;  4B6M A;  3D7S B;  2RJC A;  3FRN A;  1SHG A;  2D0N A;  2HDA A;  3CCE Q;  4ESR A;  1FYN A;  4J9B A;  2LCL A;  1K73 C;  1YNZ A;  3M55 A;  1K1Z A;  3I56 A;  5KCH A;  3OS5 A;  2JTF A;  1WJR A;  2RHZ A;  1VUB A;  4EMK B;  2BZX A;  4PJO F;  2E4H A;  3MJX A;  2EBP A;  3RR6 A;  1H64 1;  5CQY A;  5LJ3 e;  2L3S A;  2EGE A;  1M1K R;  3NMZ C;  1VQ7 Q;  4L59 A;  2GNC A;  3M54 A;  1HSQ A;  4XK8 E;  3S3M A;  1PHT A;  1K4U S;  2DA9 A;  1GCP A;  3RKW A;  2DPP B;  4IKF A;  5IHI A;  5CCA A;  3UWN A;  2F2W A;  4QT7 A;  3VUZ A;  2XI9 A;  1WLP B;  3CCR T;  2JM9 A;  1J3T A;  2EQK A;  3NPF A;  2KAF A;  4IUU A;  2PQW A;  4TVR A;  1GCQ C;  1G3S A;  3JCM P;  3JCM d;  5GAM j;  2RI5 A;  3VRZ A;  2ROL A;  1MMG A;  4BD3 A;  4Y28 E;  4M7A F;  4XTZ A;  5GAO n;  1R0C B;  1PWT A;  2M9U A;  4LXC A;  1MNE A;  2GTJ A;  4PJN A;  4AG1 C;  2E1H A;  1N8R U;  2EJ9 A;  3SEM A;  2I0N A;  2RQW A;  4JS5 A;  1UJ0 A;  1N27 A;  1TU0 B;  2L89 A;  3OYG A;  3BY7 A;  4M7D G;  5J26 A;  5GAM d;  1UJY A;  5HKC A;  3L2R A;  3CCL A;  4DA4 A;  1AD5 A;  4HT9 A;  3M4G A;  1IGQ A;  2KBT A;  4PJO C;  2VXF A;  1N9R A;  2NUP A;  4FYY B;  2VAS A;  1ZBX A;  3CCV A;  5D6Y A;  1RAI B;  2HKN A;  3TQ7 P;  3EGX B;  2MWP A;  3EGU A;  3M0U A;  1KD1 U;  1VQM A;  1QVP A;  1YIJ A;  1U3O A;  1XJW B;  2DL5 A;  1SF9 A;  4Y91 A;  3OBY A;  5KH6 A;  3GBQ A;  1Q81 R;  2WSE E;  2OTJ A;  4OMN A;  1A0N B;  2AKL A;  1B07 A;  5KE3 A;  3CCR Q;  4PJO B;  1TUG B;  4C5E A;  1W2B P;  2RM4 A;  2LCS A;  2WSC E;  5CVI A;  4C0F A;  4JLI A;  2RB6 A;  3QUI A;  2O31 A;  1UGQ B;  1Z9Q A;  2COY A;  4ZTF A;  2JNG A;  5GAO r;  2QYZ A;  4FSS A;  3BE3 A;  3M0Q A;  4M7A C;  3CBO A;  1N6A A;  2DL4 A;  2O4X A;  1LOJ A;  3P8B B;  5HCK A;  2LX9 A;  2L3R A;  2O9V A;  2J06 A;  2YUQ A;  3LH0 A;  2E6N A;  3GNG A;  4A53 A;  4OP0 A;  4DOW A;  3J80 E;  1YFN A;  4E7K A;  5KYX B;  5LJ5 j;  1JRI A;  2FHD A;  2PUK B;  4DBR A;  1RAF B;  4RTW A;  1KFZ A;  2M51 A;  3QXE B;  4XQ3 A;  2CYZ B;  1UFF A;  4M7A B;  2A37 A;  3JB9 H;  3VS2 A;  4ZTJ A;  3GOX A;  1QP2 A;  3HHT B;  5LJ5 d;  2XKO C;  2XMF A;  1SSH A;  5HK0 A;  4LN2 A;  1KK7 A;  3LW5 E;  4XAX B;  1WXT A;  4C92 E;  3VS5 A;  3LGL A;  4Z88 A;  3JCM e;  2MK5 A;  4RTY A;  2RQT A;  4M75 A;  3BDL A;  4MZM A;  3A8M B;  5KCO A;  4IUT A;  4A4G A;  3CC4 T;  3CD6 T;  2P0K A;  1ZSG A;  4PJO D;  3CPW A;  3IQL A;  4QVZ A;  2DD4 A;  4DBF A;  4JUV A;  1OEB A;  3R6N A;  2JVV A;  2DNU A;  3GPL A;  3OB9 A;  2EQM A;  1AWW A;  2KEA A;  5GAM e;  1ZLM A;  4LNP A;  1T0J A;  2DBM A;  2E12 A;  1YJN T;  2HD0 A;  2COZ A;  4PFP A;  3JCM X;  2V1Q A;  4AFS C;  1K76 A;  5LL6 S;  2KE9 A;  2KR3 A;  3T9N A;  1K8A C;  3CXC S;  1S72 T;  4QVD A;  2X4J A;  3A1P A;  3P8D A;  1VQ6 A;  2VYT A;  4PFO A;  5CAI A;  3RES A;  1LJO A;  1E6H A;  2C0T A;  1YHQ A;  2QGG A;  4M7D A;  4RCB A;  1KQS A;  3C12 A;  2CZ7 B;  2LT1 A;  2SRC A;  4LDY A;  4M78 F;  2YLB A;  4PLI A;  1NEG A;  3EG9 A;  3C4S A;  4M7A D;  4OB0 B;  3CCM A;  2AKK A;  2B86 A;  3HSB A;  2DL3 A;  1X27 A;  2K57 A;  3TVT A;  4D8K A;  2CS7 A;  4D8D A;  1NPR A;  2X9H A;  3CCU A;  3OYN A;  2VGN A;  2ZPG B;  1G3Y A;  1WXU A;  2FPF A;  4HCZ A;  4BE0 A;  4F7U G;  2F5T X;  4LUE A;  3G4S A;  1BYM A;  4GLK A;  3CC4 Q;  2Y4Y A;  3CD6 Q;  1UHC A;  2LDM A;  4HKE A;  3KFV A;  2DZC A;  2M0O A;  3OYF A;  3UA6 A;  3M56 A;  4M4Z A;  5L8R E;  4BY6 C;  5I22 A;  1K9M C;  2LNH B;  1TOV A;  2RJF A;  4QQD A;  1QKW A;  1OV3 A;  1YJN Q;  3PMT A;  3JSC A;  2BKD N;  1CSK A;  1Y07 A;  1M8V A;  1Q86 C;  1RAE B;  4E2F B;  3JB9 G;  3M0T A;  2EPD A;  2RA2 A;  1Y57 A;  2PUO B;  3HRT A;  1GRI A;  4ELZ C;  1T0H A;  4KH0 B;  3VS6 A;  1NJI U;  1G5V A;  2CSI A;  2X35 A;  2PZ1 A;  5GAN 5;  3MHX A;  2CP2 A;  2JTM A;  5LJ5 e;  2Y4X A;  3MEU A;  5IN1 A;  2EAY A;  2EYY A;  4M78 C;  4BY6 B;  2NUT B;  1IXD A;  2CP6 A;  4Z89 A;  3FB9 A;  4BDY A;  4XTX A;  2PVG B;  2KXC A;  3MP6 A;  4OB1 B;  1IGU A;  5IXB A;  2LX7 A;  4DQ2 A;  1YIT T;  2E41 A;  2K2V A;  2CT4 A;  1WYX A;  1GFD A;  3CCQ T;  4II1 A;  2OAW A;  2MCN A;  3CCJ T;  3QG1 A;  4Z02 A;  4HCK A;  4NOY A;  2XDP A;  1MMA A;  2DIL A;  2O88 A;  1UEC A;  4M78 B;  2KVQ G;  3S6W A;  2DL7 A;  5I2S A;  1ZBJ A;  2L3P A;  3QJ6 A;  2ESW A;  5ECA A;  2QQA A;  4IUQ A;  2A7Y A;  3L1A A;  1IHW A;  1ZX6 A;  2RI3 A;  3QYG B;  5LJ3 f;  1BI2 A;  5GAN j;  2HZY A;  3EHQ A;  3J81 E;  4AG2 C;  3CXC P;  4OMO A;  2CP7 A;  3PE0 A;  4IUV A;  3O5Z A;  1Y96 A;  3O8V A;  2CKK A;  4JRP A;  2OX7 A;  2YRC A;  3QWY A;  2ZCF B;  2CH4 A;  2MI6 A;  3V8J A;  1ZA2 B;  1O75 A;  5GAN d;  1AWO A;  4J9E A;  2VKN A;  4KBM B;  2DKG A;  4EMH A;  1NLO C;  3HRU A;  2A36 A;  2A0F B;  8AT1 B;  2D6F A;  5KE2 A;  1M90 C;  2OTL A;  2KYB A;  1D09 B;  5GMK j;  5LJ3 h;  2H3J A;  1YIT Q;  3EAE A;  3EG1 A;  1VQ9 A;  1C6V X;  1ZSZ A;  1IZ6 A;  4WTO B;  3CCQ Q;  3CCJ Q;  1Q95 G;  5LJ3 g;  1KC8 R;  1WXB A;  4PKC C;  3V8L A;  2V8I A;  3QBY A;  3WVE B;  1BIB A;  5IHK A;  1W2B A;  2DX1 A;  4C92 A;  4M78 D;  2KRO A;  1MMD A;  2JN0 A;  3SWN A;  2JOY A;  2QI2 A;  4A4K A;  2XG8 D;  4M75 F;  2NUP B;  3I55 A;  1V1C A;  2F1L A;  3QHS A;  4KGX B;  2PTK A;  4A4H A;  3G6E A;  4HVU A;  3OS1 A;  2DK3 A;  1BCM A;  1WHJ A;  6AT1 B;  1QWE A;  1RAC B;  2QQB A;  5C0M A;  1YBY A;  2CZ0 B;  1VYU A;  3DB3 A;  3PFS A;  1D0X A;  2EQU A;  3F70 A;  1OX9 A;  4GLM A;  4O5V A;  3PVQ A;  2DO3 A;  2OTL T;  2DJZ A;  1KQ1 A;  4R0K A;  1M1K U;  2ABL A;  4C0G A;  4ANJ A;  2P84 A;  2K79 A;  4KT0 E;  3H0H A;  4XU1 A;  1YJ9 A;  4ZNX A;  3EG3 A;  4BAC A;  2KRM A;  1UG1 A;  1R0B G;  2QEX T;  1AZG B;  2DEU A;  3JCM W;  1WNL A;  1PSE A;  3OSV A;  1XOV A;  4HCB A;  1B3Q A;  4PLL A;  1N8R C;  5AT1 B;  1ZHI A;  1U8R A;  4QKU A;  2H8H A;  2K4Y A;  2X4W A;  3OS2 A;  2M0Y A;  3CC7 T;  4BB7 A;  1Y0M A;  1BK2 A;  4C5G A;  5A2Q E;  4JZ3 A;  3HRS A;  4J9G A;  4M75 C;  1RUW A;  1CKB A;  2EJG A;  5D6X A;  2QAZ A;  2MF2 A;  4B9W A;  5CKE A;  1I0C A;  2HL5 C;  2HMA A;  2CUD A;  1JXM A;  1VQ8 T;  2V1R A;  1G3W A;  1D0Y A;  2DYI A;  4M7D E;  1KSW A;  3NFC A;  2MOX A;  5CK9 A;  5GAN e;  2EVR A;  4FYW B;  3DLM A;  1YI2 T;  1FX7 A;  1B34 B;  5CKB A;  3JCM f;  2DM1 A;  3HFO A;  1K9A A;  4AFZ C;  1VA7 A;  4M75 B;  1TS9 A;  2RHI A;  3OYJ A;  2OTL Q;  3PMI A;  2RHU A;  2GTO A;  5AYF A;  1AEY A;  1K0X A;  4WF2 A;  3MKD A;  5FW9 A;  1QP3 A;  2DXT A;  2KXD A;  3H8Z A;  2FB7 A;  2QA4 A;  2NUZ A;  5GAM f;  3RMQ A;  2NYS A;  1WGS A;  4FYX B;  4OMQ A;  3VS3 A;  3GLX A;  2QEX Q;  2FPE A;  2AT1 B;  1VYT A;  4CC7 A;  2AHJ B;  1AWX A;  1Q81 U;  2COW A;  5GMK e;  1JBM A;  1GBQ A;  2LTO A;  3PTA A;  2GQI A;  4MZP A;  4AT1 B;  2HQX A;  4A54 A;  1Q82 U;  3JCM h;  3CC7 Q;  4OMP A;  5EG2 A;  1HK9 A;  1M3B A;  4FW1 A;  1VOM A;  2FZG B;  9ATC B;  1ZUK A;  1M90 R;  4MZT A;  2Y90 A;  3HTR A;  3WXM B;  3JCM g;  3OYD A;  1QKX A;  3FIF A;  2KNB B;  3H6Z A;  4C5I A;  2MIO A;  1VQ8 Q;  3EG9 B;  2O01 E;  3LYI A;  4ZN3 A;  1M2O A;  1M2V A;  3I56 T;  1GFC A;  1WHG A;  4OF1 A;  2I2L A;  1TUD A;  4E7I A;  3X20 B;  5GAM h;  1YI2 Q;  2O2O A;  4FCY A;  4CI0 C;  3M59 A;  3RMS A;  2ZZD A;  1AHJ B;  1VQN A;  1QMC A;  4J7I A;  1LPL A;  3LWH A;  3HL8 A;  4J9H A;  5GAM g;  2CZ1 B;  3QPH A;  4Q5W A;  3ME9 A;  4FYV B;  1WHH A;  3OMC A;  1BU1 A;  4M75 D;  4JJC A;  3VS7 A;  3DKM A;  3P8H A;  4NS5 A;  4JS4 A;  1UGP B;  4RTU A;  1ABQ A;  1WHK A;  1T3L A;  4FU6 A;  2E5Q A;  1GXI E;  2VGM A;  4C5H A;  2ATC B;  1U1T A;  2YUP A;  2LQW A;  2QTX A;  2EYW A;  1YWP A;  4OGE A;  2K5F A;  2G3R A;  2DIQ A;  3M9Q A;  3CCS A;  1XTD A;  2C0I A;  3SB2 A;  1OX8 A;  2ROT A;  2RJD A;  3SFM A;  4HT8 A;  1VQ5 A;  3EG0 A;  4LDU A;  5LJ5 f;  4JDS A;  2V26 A;  2GFA A;  3JB9 I;  2ZPE B;  3I56 Q;  3CCL T;  4OVA A;  2RN8 A;  2W10 A;  4C92 F;  1JB0 E;  2CDT A;  2FZC B;  2KRS A;  4PJO G;  3CC2 A;  1PD0 A;  4BUG A;  3I5S A;  3CXC A;  4FSX A;  2OJ2 A;  1N8R R;  3CCV T;  1RAD B;  2QQS A;  4JJB A;  2DRM A;  3JCM b;  1PM3 A;  4FL6 A;  1LVK A;  4N4H A;  2LJ1 A;  1ARK A;  1VQM T;  2QK0 A;  2JXB A;  3M58 A;  1YIJ T;  3ASK A;  1X2Q A;  2RF0 A;  2RQV A;  3EFO B;  3EFS A;  3V7R A;  3CBP A;  1VQK A;  2ZPH B;  3QDR B;  1W1F A;  5L23 A;  5LJ5 h;  2OTJ T;  1MGQ A;  4CRI A;  3X26 B;  1QCN A;  1K73 R;  2J7I A;  1VQ4 A;  3FLG A;  4F7U E;  2VXE A;  2G6F X;  5LJ5 g;  3PVL A;  4EMG A;  4LUD A;  2K6D A;  4PFZ A;  2DER A;  3A8H B;  3FC3 A;  3NTI A;  4JRK A;  4M7A G;  3L2Q A;  3OY9 A;  1M9S A;  3DB4 A;  2BZ8 A;  4ZGJ B;  2QAS A;  4EMK A;  3OA6 A;  2RJE A;  1D1C A;  1ZSZ C;  1U06 A;  4J8O A;  2DL8 A;  4N4G A;  2QTV A;  2DET A;  1MMN A;  1NJI C;  3RUX A;  2ZPI B;  4OMM A;  3V8K A;  4ZGD B;  1RAB B;  3RNJ A;  3CCL Q;  5FWC A;  4MMK A;  4C92 C;  2PVO B;  3MET A;  3SWN C;  4FT4 A;  3Q1J A;  1C0M A;  2LJ0 A;  2LP5 A;  3URG A;  3SHW A;  2VC8 A;  2BZY A;  3CCV Q;  2L3Q A;  4A4E A;  2EWN A;  4M77 E;  1JO8 A;  2GBQ A;  3TSZ A;  1ZSZ B;  2EGC A;  4LDV A;  2LQ8 A;  3UF4 A;  1HD3 A;  3M0S A;  5EC7 A;  2LVM A;  1VQM Q;  4DBH A;  1YIJ Q;  2JMC A;  1FMK A;  4BE2 A;  2XD0 A;  1VYV A;  3SDZ A;  4J5Y A;  2R5A A;  2HBP A;  2GQV A;  4C92 B;  1VQ4 T;  2OTJ Q;  3SWN B;  1HYO A;  5IHN A;  3JCM V;  1PKT A;  5CIU A;  3PIP A;  3ZBD A;  2J6K A;  3L2Z A;  3E9G A;  4J9F A;  3MEW A;  1VIF A;  2DXB A;  2LC4 A;  3EHR A;  3REA B;  1UGR B;  1M8M A;  5KYY A;  2DEQ A;  3AHU A;  2K3Y A;  3H41 A;  1I1J A;  3CMA A;  4MML A;  1ZUY A;  2CP0 A;  2QGF B;  2DIG A;  5M9O A;  2EYZ A;  3AT1 B;  1D1A A;  3KUF A;  3CBM A;  4MDX A;  2RHX A;  3EGX A;  3GNF B;  2D1X A;  3CC2 Q;  1T3S A;  3OYA A;  3RIR A;  2NWM A;  1VIE A;  4N4I A;  1VQ6 T;  1TG0 A;  1B7T A;  1VQO A;  2RK2 A;  5J3B A;  1FMV A;  2P0Q A;  3GIB A;  1YHQ T;  4BI8 B;  1WQW A;  1KIK A;  2RI2 A;  4M77 G;  3CCM T;  4J7F A;  2YDL A;  4B9X A;  5FLX E;  2DJQ A;  2L2P A;  1JJ2 A;  3A5Z B;  2L0A A;  1UGV A;  2R58 A;  1BI3 A;  3CCU T;  4XTY A;  1PSF A;  1Z9Z A;  3G1J A;  4OML A;  1VQ4 Q;  1YCY A;  1WJS A;  2CSQ A;  1MUZ A;  2E6Z A;  3JV3 A;  4C92 D;  3A8O B;  4ELY C;  3VU3 C;  3G4S T;  3HPW A;  2M16 A;  4RG8 A;  1UEB A;  1UB4 A;  1FXX A;  3H0I A;  1PKS A;  5GAN f;  2AIR B;  1G8X A;  2M02 A;  3VS0 A;  5GAO p;  3CME A;  2PNI A;  3VYG A;  1KC8 U;  4RTZ A;  4LDX A;  5KYX A;  1UHF A;  2RO0 A;  2JUF A;  2DE0 X;  1RLP C;  3LGF A;  2FO0 A;  1ZQ1 A;  1X43 A;  4KUD K;  2F69 A;  4C8Q E;  4M7A A;  2MPX C;  4XU2 A;  1X2K A;  1OPL A;  1I5L A;  1QVG S;  1ACM B;  4BI3 A;  1VQ6 Q;  3E2U A;  2JZ2 A;  1VQP A;  1IB8 A;  3C0C A;  2K3X A;  1X01 A;  2FRY A;  1YHQ Q;  4M78 G;  1M1K C;  2OI3 A;  3G71 A;  1Q7Y U;  1G2B A;  1TTH B;  3MP1 A;  4QW2 A;  5FRO A;  2HQH A;  1JQQ A;  3CCM Q;  1UTI A;  5GAN 6;  1JJ2 S;  4J9D A;  5GAN h;  3PT9 A;  1RAG B;  3M4Y A;  2HQE A;  2DBK A;  3RBB B;  2K7A A;  4GY5 A;  2EKO A;  3CCU Q;  5GAN g;  3MEA A;  2CUB A;  2A08 A;  2V8J A;  2QQR A;  1QVF S;  2B8A A;  4XTU A;  3PGG A;  1MND A;  2PU9 B;  3CPF A;  1K8A R;  3G4S Q;  5GAN 4;  1MHN A;  2ED1 A;  2IG0 A;  2BTT A;  2K5I A;  4F04 B;  1YJW A;  1FWZ A;  3OMG A;  2XDB A;  4LD6 A;  1OYX A;  3ULR B;  2IIM A;  2HSE B;  7AT1 B;  1VQ7 A;  2K3B A;  4JZ4 A;  3QDF A;  3VJP A;  4DBQ A;  3L42 A;  1KJW A;  1H3Z A;  4F7U A;  5KYW A;  5GMK h;  2MWO A;  2H3E B;  2W0Z A;  1I07 A;  2HEQ A;  3PIO A;  2LQN A;  4C8Q G;  4KUI A;  1SHF A;  3CQT A;  4E6R A;  4BE1 A;  3EH2 A;  4K11 A;  1V29 B;  2GF7 A;  1D3B A;  4A63 B;  2JM8 A;  1HJD A;  2DTI A;  5IXF A;  2X3X D;  3MEV A;  1NE8 A;  1M4Z A;  1JEG A;  2RPN A;  1BB9 A;  3HKS A;  1Y7X A;  3CEY A;  1K0S A;  1OOT A;  4FW2 A;  2KMT A;  2NLU A;  2F2V A;  2YXY A;  1D0Z A;  2JS2 A;  3LX7 A;  1I8F A;  4YTL A;  3HP9 A;  1Q81 C;  1K9M R;  3VS1 A;  1NEB A;  5GJV B;  3QO3 A;  3H9N A;  1VQ9 T;  4M77 A;  1RI0 A;  4F14 A;  4C0D C;  3X25 B;  1Q86 R;  1YJW T;  1NM7 A;  4PNO A;  4M7D F;  3OQ5 A;  3EFR A;  2O4X B;  3X28 B;  1Q82 C;  4RMO A;  4O6J A;  2FG0 A;  2MMP A;  4X9D A;  1OZ3 A;  1IO6 A;  2LRQ A;  2IVW A;  3NHN A;  4N0A A;  2KSS A;  2KI7 A;  1WPY A;  4GBQ A;  4LDW A;  5CKH A;  5GAN 3;  1XNI A;  3I55 T;  4EDU A;  3JCM Q;  3A8G B;  2P0P A;  3OW2 S;  4IUP A;  2FVU A;  3I35 A;  2ED0 A;  2BUD A;  3UAT A;  5KYU A;  2FRW A;  1E6G A;  1X69 A;  3NGP A;  3I5R A;  3JAM E;  3G6E T;  1QVG P;  3GF5 A;  4C0D B;  4PJL A;  2FPD A;  4XTW A;  5CKD A;  3EGD A;  4RCC A;  4EIK A;  4R55 A;  2XU8 A;  2CZ6 B;  3CCR A;  3L2U A;  5I21 A;  5GMK i;  3EG2 A;  3MP8 A;  3MCA B;  2LZ6 B;  1XQH A;  5A0D A;  4MDW A;  2VWF A;  4LE9 A;  4R56 A;  2VV5 A;  4AMC A;  1KD1 C;  1OU9 A;  1JJ2 P;  2AZV A;  1RLQ C;  5GAO l;  3I9Q A;  5GAO m;  2IPO B;  1WFW A;  2RD1 A;  4HVV A;  2VB6 A;  1U1S A;  2K5L A;  2Z0W A;  3FJ5 A;  3R6O A;  1QVF P;  4M78 A;  2K9G A;  1YJ9 T;  1F1B B;  1YP5 A;  4X34 A;  1CKA A;  1VQ9 Q;  1BCO A;  3OYC A;  3OS0 A;  1YJW Q;  4M7D C;  2JW4 A;  1E7O A;  1M30 A;  1AWJ A;  2XHC A;  3FDR A;  1SG5 A;  2R5M A;  1JXO A;  4NL3 A;  3TU4 K;  4M75 G;  2JJ9 A;  1KQ2 A;  2QDY B;  1YWO A;  1SKU B;  3I55 Q;  1IRE B;  1AOJ A;  3M57 A;  4FIB A;  2YT6 A;  2D0Q B;  1VQL A;  2CP5 A;  2YRD A;  4Z8A A;  3G6E Q;  5A0G A;  5GJW B;  4M7D B;  4IUR A;  3J7A F;  2GCX A;  3V7C A;  3MPU B;  2E3H A;  4PJO E;  1PG5 B;  2C0O A;  2ZPB B;  4J6Y A;  3UT1 A;  2ZPF B;  2CGH A;  4DEY A;  3FJP A;  2DTO A;  2ZGW A;  4X1V A;  2KY9 A;  1IHV A;  4C8Q A;  5GAN 7;  2YHT A;  4WCI A;  1BKB A;  1X75 C;  2KQW A;  2HCK A;  2F5K A;  2KDS A;  4JPB W;  2FZK B;  1X6G A;  1MV0 B;  1GBR A;  1JU5 C;  1N9S A;  3UPU A;  5I11 A;  5KYY B;  2LMJ A;  4HA8 A;  3RKX A;  2JS0 A;  2QA4 T;  3GP8 A;  1YJ9 Q;  1PRL C;  3KXT A;  2EIF A;  1H3H A;  2LT4 A;  3NTK A;  2XK0 A;  4KGV B;  1R77 A;  2D8J A;  2ECZ A;  2WAC A;  1KG1 A;  4EPC A;  2D8H A;  4KGZ B;  5DY9 A;  2DXC A;  5GMK l;  5GMK m;  1K73 U;  4CC3 A;  4M7A E;  2DAQ A;  4RG2 A;  5DM7 R; 
#chains in the Genus database with same CATH homology
 4BE2 A;  2RK1 A;  1W2B S;  4ATO A;  4IUV A;  2XD0 A;  1Y96 A;  3O8V A;  4EMK C;  1I4K 1;  2CKK A;  3SDZ A;  4J5Y A;  5FU6 C;  4JRP A;  2R5A A;  1O9S A;  1Y71 A;  2HBP A;  1VQL T;  2GQV A;  4FT2 A;  1BI0 A;  4C92 B;  5IT9 E;  1VQ4 T;  2LNV A;  2DTH A;  2DZ9 A;  4XU3 A;  3SWN B;  1BI1 A;  2ZCF B;  3JCM V;  1SSF A;  2MI6 A;  3VYH B;  3OYH A;  3V8J A;  5CIU A;  3PIP A;  1O75 A;  4J83 A;  3L2Z A;  3ZBD A;  4A4F A;  5GAN d;  3E9G A;  3MEW A;  4KBM B;  3N5B B;  1VIF A;  2DKG A;  2DXB A;  2LC4 A;  2FL7 A;  2RJC A;  3FRN A;  3HRU A;  1UGR B;  4EMH A;  4M7D D;  2DEQ A;  3AHU A;  2K3Y A;  4UC4 A;  2LCL A;  3JCM J;  4JRI A;  1K73 C;  2D6F A;  3M55 A;  5KE2 A;  3CC4 A;  4F7U F;  1NZ9 A;  4MML A;  5KCH A;  3I56 A;  3CMA A;  3ZFJ A;  1M90 C;  3OS5 A;  2OTL A;  2JTF A;  1WJR A;  1VQN T;  2RHZ A;  1VUB A;  4EMK B;  1M1F A;  5FU6 B;  5GMK j;  5LJ3 h;  3ER0 A;  2H3J A;  4PJO F;  2DIG A;  3EAE A;  5M9O A;  1VQ9 A;  3KUF A;  1OZ2 A;  3CBM A;  1IZ6 A;  1H64 1;  5CQY A;  2P4T A;  5LJ3 e;  4MDX A;  1I81 A;  2RHX A;  4BDZ A;  3GNF B;  5LJ3 g;  4PKC C;  4QVC A;  3OYA A;  4L59 A;  2V8I A;  3QBY A;  3RIR A;  3V8L A;  3WVE B;  4ZN1 A;  3L2W A;  3M54 A;  1VIE A;  4N4I A;  1VQ6 T;  4XK8 E;  3S3M A;  3LWI A;  1BIB A;  1VQO A;  2RK2 A;  5J3B A;  5GAO q;  1YJN A;  2P0Q A;  4LD9 K;  1W2B A;  3RKW A;  4C92 A;  3OYK A;  2DPP B;  4IKF A;  4M78 D;  5CCA A;  3GIB A;  1YHQ T;  2JN0 A;  3SWN A;  2JOY A;  2QI2 A;  4A4K A;  4BI8 B;  2XG8 D;  3UWN A;  3E1S A;  1S72 A;  4M75 F;  3JB9 F;  1WQW A;  3VUZ A;  2XI9 A;  3I55 A;  1M5Q 1;  3QHS A;  3CCR T;  3CCS T;  2RI2 A;  4M77 G;  3CCM T;  2DXU A;  4J7F A;  4B9X A;  5FLX E;  5IAY A;  3M53 A;  4A4H A;  3G6E A;  3QII A;  2EQK A;  1JJ2 A;  3A5Z B;  3OS1 A;  2DK3 A;  2KAF A;  4IUU A;  2PQW A;  1VQ5 T;  2R58 A;  4TVR A;  2QQB A;  1BI3 A;  4M77 F;  1YBY A;  2CZ0 B;  1X6O A;  2E65 A;  1G3S A;  1Y96 B;  4QQ6 A;  4XTY A;  5CQX A;  1PSF A;  3JCM d;  3CCU T;  5GAM j;  2RI5 A;  3C95 A;  3DB3 A;  2E64 A;  4BD3 A;  1B34 A;  1YCY A;  1WJS A;  3PFS A;  4Y28 E;  4M7A F;  3INZ A;  2A3L A;  4XTZ A;  2WSF E;  5GAO n;  5FRN A;  2X4X A;  2EQU A;  2E6Z A;  2M9U A;  4C92 D;  3A8O B;  3PNW C;  3VU3 C;  3F70 A;  4ELY C;  3G4S T;  4HCC A;  3HPW A;  2M16 A;  2E1H A;  1N8R U;  4RG8 A;  2EJ9 A;  4O5V A;  1UEB A;  4C0Z A;  1UB4 A;  1FXX A;  5FRM A;  3CC2 T;  2DO3 A;  5GAN f;  2DJZ A;  4JS5 A;  2OTL T;  1N27 A;  3JRZ A;  3QSU A;  1KQ1 A;  3M5A A;  5GAO p;  3CME A;  2L89 A;  1M1K U;  3OYG A;  3BY7 A;  3VYG A;  3L2V A;  5J26 A;  1KC8 U;  4LDX A;  4C0G A;  5GAM d;  4M7D G;  2RO0 A;  5HKC A;  2JUF A;  5FU7 C;  3L2R A;  3CCL A;  3LGF A;  4DA4 A;  4HT9 A;  3OYY A;  1ZQ1 A;  3M4G A;  4KT0 E;  5C6S A;  4XU1 A;  1YJ9 A;  1EIF A;  4BAC A;  4PJO C;  4KUD K;  2QXF A;  2F69 A;  2VXF A;  2YRV A;  2QEX T;  4FM4 B;  1N9R A;  4C8Q E;  4J6W A;  4M7A A;  1ZBX A;  3CCV A;  5D6Y A;  3JCM W;  1WNL A;  4XU2 A;  1PSE A;  3MO8 A;  4E7H A;  1I5L A;  3OSV A;  1QVG S;  1XOV A;  1VQK T;  4HCB A;  2MWP A;  5CKF A;  4BI3 A;  3E19 A;  4PLL A;  1N8R C;  1KD1 U;  1VQM A;  1QVP A;  1ZHI A;  1U8R A;  2JZ2 A;  1VQP A;  1QVF S;  1YIJ A;  2K4Y A;  2L5Q A;  3JB9 J;  2K3X A;  2X4W A;  3OS2 A;  3CC7 T;  4BB7 A;  4Y91 A;  1X01 A;  4OB3 B;  3OBY A;  4C5G A;  4M78 G;  4F7U B;  5KH6 A;  5A2Q E;  3HRS A;  5FU7 B;  1KC8 C;  5CO7 A;  4M75 C;  2XDD A;  2XID A;  2WSE E;  2OTJ A;  2EJG A;  5D6X A;  3G71 A;  1Q7Y U;  4ME7 A;  3MP1 A;  2MF2 A;  2QQ9 A;  5CKE A;  4QW2 A;  5FRO A;  4B9W A;  5KE3 A;  5GAN 2;  4PJO B;  4NL2 A;  4L5G A;  4C5E A;  5GAN 6;  1JJ2 S;  2RM4 A;  5GAN h;  3PT9 A;  2WSC E;  3E9F A;  1VQ8 T;  5CVI A;  1G3W A;  4D6W A;  3M4Y A;  4C0F A;  3BDU A;  2HQE A;  4M7D E;  3NFC A;  4JLI A;  2YLC A;  2RB6 A;  1D3B B;  3QUI A;  3WVD B;  5CK9 A;  4M77 C;  5GAN e;  4GY5 A;  3BW1 A;  2EKO A;  1UGQ B;  5GAN g;  4E7L A;  3MEA A;  2X4Y A;  3TEE A;  3QZ5 B;  2V8J A;  2QQR A;  3DLM A;  2B8A A;  1FX7 A;  4XTU A;  4ZTF A;  1YI2 T;  3PGG A;  1B34 B;  2JNG A;  3S3O A;  5GAO r;  5CKB A;  3JCM f;  2PU9 B;  4M7A C;  3CBO A;  5C0M A;  1N6A A;  3CPF A;  2O4X A;  1LOJ A;  3P8B B;  2DVE A;  5GAN 4;  3HFO A;  3OYM A;  4C92 G;  1MHN A;  2IG0 A;  2K5I A;  1M1K C;  2LX9 A;  2L3R A;  5HY6 A;  4M75 B;  4N0A C;  1YIT A;  1FWZ A;  3A8L B;  1YJW A;  2RHI A;  3OMG A;  3OYB A;  3OYJ A;  2XDB A;  4LD6 A;  1OYX A;  3LH0 A;  2E6N A;  1Q7Y C;  3GNG A;  3PMI A;  3CPW S;  2RHU A;  4A53 A;  3CCQ A;  4OP0 A;  3CCJ A;  1KHI A;  1W4S A;  2RHY A;  4DOW A;  1QVG A;  5AYF A;  1VQ7 A;  3HFN A;  2GFU A;  2EJF A;  3J80 E;  4WF2 A;  4E7K A;  5LJ5 j;  3VJP A;  1QW1 A;  1JRI A;  2FHD A;  1QP3 A;  2DXT A;  3L42 A;  4M78 E;  4P5N A;  4M77 B;  2PUK B;  3H8Z A;  2FB7 A;  4XTV A;  1R8O B;  2QA4 A;  1H3Z A;  1WQ7 A;  4F7U A;  3RMQ A;  5GAM f;  1WGS A;  5GMK h;  2MWO A;  3GLX A;  3QXE B;  4XQ3 A;  4E7J A;  2CYZ B;  3PIO A;  4M7A B;  4PJO A;  2AHJ B;  1S72 T;  4C8Q G;  1Q81 U;  2L8D A;  4KUI A;  5GMK e;  3S3N A;  3JCM c;  1JBM A;  2EYQ A;  2MAM A;  3JB9 H;  2LTO A;  3PTA A;  4ZTJ A;  4BE1 A;  1V29 B;  2GF7 A;  1D3B A;  4MZP A;  2HQX A;  1QP2 A;  3GOX A;  2E10 A;  3HHT B;  4C8Q F;  5LJ5 d;  2XKO C;  2DTI A;  3SD4 A;  4A54 A;  3OBW A;  1Q82 U;  3MEV A;  1NE8 A;  1M4Z A;  3JCM h;  5EG2 A;  5HK0 A;  1HK9 A;  1M1G A;  4XAX B;  1BIA A;  3LW5 E;  3HKS A;  1QVF A;  1Y7X A;  4C92 E;  3CEY A;  3LGL A;  5DLO A;  4MZT A;  1KQS S;  3JCM e;  2Y90 A;  3WXM B;  3JCM g;  2KMT A;  4M75 A;  3OYD A;  2NLU A;  3FIF A;  3H6Z A;  3BDL A;  4C5I A;  4MZM A;  1K8A U;  3A8M B;  5KCO A;  4IUT A;  2FYK A;  1WJQ A;  2PVD B;  2O01 E;  3FEO A;  3LYI A;  4A4G A;  4ZN3 A;  3CC4 T;  3CMA T;  3I56 T;  3CD6 T;  2P0K A;  4PJO D;  3LX7 A;  3VKI A;  1I8F A;  1HXD A;  4YTL A;  4OF1 A;  3HP9 A;  3CPW A;  1Q81 C;  4QVZ A;  2DD4 A;  2I2L A;  4JUV A;  4E7I A;  2BIV A;  3QO3 A;  2EQJ A;  3QYH B;  3X20 B;  5J39 A;  2D9T A;  1VQ9 T;  5GAM h;  2JVV A;  3LLR A;  1RI0 A;  2LCC A;  4M77 A;  4VUB A;  3VUB A;  4C0D C;  3X25 B;  4CI0 C;  3M59 A;  1YJW T;  3GPL A;  4PNO A;  3RMS A;  2RH2 A;  2ZZD A;  3OB9 A;  1AHJ B;  2EQM A;  1VQN A;  4M7D F;  3OQ5 A;  3EFR A;  2O4X B;  4J7I A;  3X28 B;  1Q82 C;  5GAM e;  4RMO A;  2XIC A;  3G7Z A;  3HL8 A;  3LWH A;  3TCJ A;  5GAM g;  4O6J A;  2CZ1 B;  3QPH A;  4V2S A;  2E12 A;  1P92 A;  4Q5W A;  3ME9 A;  2MMP A;  1VQO T;  1YJN T;  2HD0 A;  1OZ3 A;  4X9D A;  3OMC A;  2LRQ A;  2IVW A;  4N0A A;  4M75 D;  3JCM X;  3JB9 D;  3DKM A;  3NTH A;  5LL6 S;  2KSS A;  3T9N A;  3P8H A;  1K8A C;  1WPY A;  4NS5 A;  1LNX A;  4L6V 5;  3OYL A;  1NPP A;  3CXC S;  4LDW A;  1UGP B;  4JS4 A;  2LQK A;  3JCM P;  5CKH A;  5GAN 3;  4QVD A;  2X4J A;  1XNI A;  3P8D A;  4FU6 A;  3I55 T;  2VYT A;  4EDU A;  1VQ6 A;  2E5Q A;  3JCM Q;  3A8G B;  2P0P A;  3OW2 S;  1GXI E;  2VGM A;  4IUP A;  2FVU A;  4C5H A;  3OYI A;  5CAI A;  2BUD A;  3RES A;  1U1T A;  1LJO A;  3JAM E;  3G6E T;  4M77 D;  3GF5 A;  4C0D B;  1YHQ A;  2QTX A;  4M7D A;  4RCB A;  4XTW A;  1KQS A;  4OGE A;  3C12 A;  5A0L A;  2CZ7 B;  2LT1 A;  2K5F A;  4LDY A;  5CKD A;  4M78 F;  4RCC A;  2G3R A;  2XU8 A;  2YLB A;  4OMF B;  4PLI A;  2CZ6 B;  2DIQ A;  4R55 A;  3CCR A;  3C4S A;  3L2U A;  5I21 A;  4OB0 B;  3MP8 A;  3M9Q A;  3MCA B;  5GMK i;  3CCS A;  3CCM A;  4M7A D;  1XQH A;  1XTD A;  5A0D A;  3VV0 A;  3SB2 A;  3HSB A;  4J6X A;  4MDW A;  4C8Q C;  3ZEH A;  2E70 A;  2K57 A;  4X9C A;  3DLL A;  3CCE A;  2RJD A;  3SFM A;  4HT8 A;  2V8K A;  4R56 A;  2CS7 A;  4LDU A;  5LJ3 j;  1VQ5 A;  5I2M A;  1NPR A;  3C94 A;  1G3T A;  5LJ5 f;  1K9M U;  2VV5 A;  3CCU A;  3OYN A;  4JDS A;  1KD1 C;  2VGN A;  4JJN K;  3V7S A;  3QJY A;  4QQG A;  2GFA A;  2ZPG B;  1G3Y A;  5GAO l;  5GAO m;  1Q86 U;  4HCZ A;  4BE0 A;  4F7U G;  2F5T X;  3JB9 I;  3CME T;  2RD1 A;  3G4S A;  1U1S A;  2ZPE B;  1BYM A;  4GLK A;  2K5L A;  2Y4Y A;  4RKU E;  3R6O A;  3CCL T;  4OVA A;  4M78 A;  4C92 F;  1JB0 E;  4PJO G;  2LDM A;  1DJ7 B;  4HKE A;  1YJ9 T;  3CC2 A;  3OYE A;  4X34 A;  2DZC A;  4BUG A;  5LJ3 d;  3CXC A;  3OSS C;  4FSX A;  4C8Q B;  3OYC A;  3CCV T;  3OS0 A;  2M0O A;  3OYF A;  2QQS A;  4M7D C;  3OW2 A;  3M56 A;  3JCM b;  4FL6 A;  5L8R E;  4BY6 C;  4N4H A;  2DD5 A;  1OI1 A;  1K9M C;  2XHC A;  2RJF A;  4QQD A;  2QEX A;  1VQM T;  3X24 B;  3FDR A;  3M58 A;  1VQP T;  1YIJ T;  3PMT A;  3ASK A;  3JSC A;  2BKD N;  2R5M A;  1Y07 A;  1M8V A;  4NL3 A;  1Q86 C;  3TU4 K;  3EFS A;  4M75 G;  3V7R A;  3JB9 G;  2QDY B;  3CBP A;  1VQK A;  1KQ2 A;  1KHC A;  3BFM A;  2ZPH B;  2RA2 A;  2PUO B;  1UGS B;  3HRT A;  3QDR B;  2EFI A;  4ELZ C;  5LJ5 h;  3G71 T;  2OTJ T;  1NJI U;  1MGQ A;  1G5V A;  1IRE B;  4CRI A;  2VUB A;  2X35 A;  3X26 B;  2HNI A;  3M57 A;  4FIB A;  2D0Q B;  5GAN 5;  3UDC A;  1VQL A;  3MHX A;  1RL2 A;  3CC7 A;  2JTM A;  5LJ5 e;  1VQ4 A;  3FLG A;  4F7U E;  2VXE A;  5LJ5 g;  4XU0 A;  4EMG A;  2Y4X A;  3QZ9 B;  5A0G A;  4M7D B;  3MEU A;  5IN1 A;  4IUR A;  2EAY A;  3J7A F;  2GCX A;  4M78 C;  3KBG A;  3A8H B;  3V7C A;  4BY6 B;  3FC3 A;  3CCE T;  4PJO E;  3NTI A;  2OAU A;  4JRK A;  4PL6 A;  3FB9 A;  4ZGE B;  4M7A G;  2KK4 A;  3TRE A;  2ZPB B;  4BDY A;  1VQ8 A;  3QKJ A;  4J6Y A;  3UT1 A;  3L2Q A;  4XTX A;  3OY9 A;  1M9S A;  2CGH A;  2PVG B;  2ZPF B;  3DB4 A;  3MP6 A;  4OB1 B;  4ZGJ B;  4EMK A;  3FJP A;  2DTO A;  2ZGW A;  3OA6 A;  2RJE A;  2KY9 A;  4C8Q A;  5CR2 A;  5GAN 7;  4OB2 B;  4DQ2 A;  1YIT T;  2YHT A;  4J8O A;  1BKB A;  1X75 C;  2E41 A;  2K2V A;  2KQW A;  2R57 A;  4N4G A;  1YI2 A;  4OGC A;  2F5K A;  1NJI C;  3CCQ T;  2KDS A;  4II1 A;  4JLG A;  3RUX A;  3CCJ T;  3QG1 A;  4Z02 A;  2ZPI B;  3V8K A;  1VQ7 T;  4NOY A;  4ZGD B;  4M75 E;  2XDP A;  1N9S A;  4BI4 A;  3UPU A;  4MMK A;  5GAN 8;  3RER A;  4C92 C;  4M78 B;  2KVQ G;  4HA8 A;  3RKX A;  2PVO B;  3MET A;  3GP8 A;  3S6W A;  2QA4 T;  5I2S A;  1TH7 A;  3SWN C;  4FT4 A;  3Q1J A;  4E47 A;  3KXT A;  3QJ6 A;  5D6W A;  2EIF A;  3URG A;  2LT4 A;  2QQA A;  2VC8 A;  3RKY A;  4IUQ A;  4DOV A;  2C06 A;  2A7Y A;  3L1A A;  3NTK A;  2XK0 A;  4A4E A;  2HAX A;  2RI3 A;  2EWN A;  3QYG B;  4M77 E;  5LJ3 f;  4JRQ A;  2M1H A;  4C8Q D;  1BI2 A;  2WAC A;  1KG1 A;  4EPC A;  4LDV A;  2LQ8 A;  5GAN j;  5DLQ E;  5DY9 A;  2DXC A;  5GMK l;  5GMK m;  1K73 U;  3J81 E;  2LVM A;  1M90 U;  4M7A E;  4KUL A;  2DAQ A;  4RG2 A;  3CD6 A;  5HK3 A;  5DM7 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...