4PJOG

Minimal u1 snrnp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
KAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 10
structure length 74
sequence length 74
chains with identical sequence U, g, u
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoG00
4M7DG 2HNIA 1I81A 3SB2A 5LJ5h 4M78E 4EMKC 4M78F 1KQ2A 2FB7A 5LJ5g 5GAN5 3BY7A 4HT8A 4M78B 3V8LA 4JRKA 4M78C 3RKYA 4C8QA 3FB9A 4NOYA 1BIAA 4OP0A 5LJ3e 4A53A 2RA2A 1Y96A 4XU2A 4C92E 3JCMb 4M77A 2CGHA 2DZ9A 2DZCA 1MGQA 2FYKA 2VC8A 4M75D 4PJOF 2QTXA 3VU3C 5CAIA 4J5YA 5GAMd 3QSUA 4C92C 4M7AD 4PJOB 4PJOG 2RM4A 1LNXA 2E65A 3SWNB 2DJZA 2DTHA 3SWNC 1N9SA 1BIBA 4C8QB 4A54A 4RCCA 3JCMg 5GAOn 2EAYA 4C8QG 5GMKm 3RERA 3PGGA 4M75A 4PNOA 1D3BA 1Y96B 3JB9D 1I5LA 4M77B 3QHSA 3JCMf 4M7AA 4M7DE 4M7DF 4J6YA 4M77G 3BFMA 4XTUA 4XU3A 3JCMc 2K57A 4M7DC 4F7UA 1M5Q1 2EJFA 4WF2A 5GANf 4HT9A 4Y91A 3AHUA 4JRIA 2EJ9A 5LJ3d 5GANj 1HXDA 4M78D 5GAOp 1KQ1A 4EMGA 5GAOr 3L1AA 1M8VA 5LJ5f 2DTOA 1I4K1 1WPYA 4PJOE 5GMKi 5GMKl 5LJ5j 3JCMX 4X9DA 4EMKA 5GAMh 3RKXA 4C92D 2YLBA 1LJOA 5GAMg 2DVEA 4F7UG 4PJOC 4MMLA 4XU1A 3HFOA 4C8QE 4QVCA 1U1SA 2Y90A 4C8QF 5GANd 3RESA 2DXUA 2DTIA 4XTVA 3JCMe 5GMKh 4V2SA 1YCYA 4C8QC 3HFNA 4M77E 4N0AC 5GAN7 4M77F 4XU0A 5GAN3 4C92A 2E41A 4XQ3A 3EFSA 5GANe 4M77C 4M7DD 5I21A 3M4GA 3JCMJ 1JBMA 3V7SA 3JB9J 5LJ3h 2EWNA 2RB6A 5LJ5e 1HK9A 2DXTA 2RD1A 3FIFA 2E10A 4M75F 2DEQA 1U1TA 4M7AF 4M75B 5GAOm 1D3BB 3JCMP 4HA8A 4M7AB 2ZGWA 4M75G 1LOJA 1I8FA 3HSBA 4F7UE 4M7AG 2I2LA 5DY9A 4F7UF 1WNLA 2EJGA 3BW1A 4PJOD 4F7UB 5GAN8 3EFRA 3JCMd 1TH7A 4QVDA 3GIBA 4M78A 4NL3A 4X9CA 5GANh 5GAMf 4C8QD 3JB9H 3JB9G 5GAN2 5GAMj 1H641 4J6WA 5GAN6 2YLCA 4PJOA 3FJPA 3QUIA 4M77D 4MMKA 4XTYA 2VXFA 3JCMV 4EMHA 4EMKB 3JCMW 1N9RA 3QO3A 4RCBA 5GAOl 5LJ5d 2E1HA 2YHTA 3RIRA 3SWNA 3INZA 5GMKj 1WQ7A 4M78G 4N0AA 4XTXA 3JCMQ 5LJ3g 4JUVA 4M75E 4JLIA 4C92F 4M7AE 4XTWA 5LJ3f 3BDUA 3V7RA 4C92B 4M75C 5GAOq 4NL2A 1B34A 4M7DA 4C92G 4M7AC 3L2ZA 5LJ3j 4XTZA 3JCMh 3JB9I 5GAMe 3RUXA 4M7DB 2VXEA 3JB9F 5GAN4 1X01A 2JN0A 5GANg 4J6XA 1JRIA 2DKGA 3V8JA 5GMKe 1WQWA 3V8KA 1B34B 4DQ2A 3V7CA 2E64A 3RKWA
chains in the Genus database with same CATH superfamily
5CCAA 3UA6A 1PRLC 4KULA 4HKEA 4F04B 4XAXB 2AK5A 3VU3C 3EHQA 2WSEE 2K3XA 2LX9A 2DYBA 4C0GA 5ECAA 3C0CA 5AYFA 2EGCA 4ATOA 1G3YA 5GAOn 3BE3A 5GMKm 4PKCC 2MK5A 3TVTA 3JCMc 3P8BB 1M3BA 2K57A 2QDYB 4M7DC 4PJNA 1NJIC 1HYOA 2EGAA 3L1AA 2EIFA 1YI2A 1EFNA 3QYGB 1UJYA 1BBZA 2QQSA 4F7UG 3DLLA 4QQ6A 5GMKh 4V2SA 1QKWA 1PHTA 1ZA1B 2KE9A 2YSQA 1IHVA 2XMFA 4B9XA 4K11A 1P92A 4IURA 5KH6A 3H0FA 3A8GB 2L0AA 1GFCA 4Z88A 2MMPA 5GAOm 3JCMP 1AVZC 4C5IA 1YN8A 2CZ1B 2HQXA 2YUOA 3JCMd 1WJQA 1ZUYA 4KUIA 2HKNA 2YUPA 3CCMA 2AZSA 2CP2A 3CCRT 1NJIR 3CCVQ 3GOXA 2M1HA 2EQIA 1M90C 3C94A 2ZAEA 1U06A 2VGNA 2KMTA 4N0AA 3EH2A 2K7AA 2EYYA 3SEMA 1SSFA 2DIGA 4C92G 2KK4A 2RN8A 5KYWB 2NUTA 4DEXA 2XDPA 2IVWA 2A36A 2E5KA 1Q81U 4C0DB 1U3OA 2QG9B 4M78B 4PLIA 3RKYA 1M9SA 3FB9A 3TCJA 2HCKA 3VS2A 2WSFE 2LQKA 4HVUA 3TQ7P 2QQ9A 1ARKA 4L5GA 4PJOG 2RQVA 1VQ8T 2LCLA 2F2XA 3ULRB 1N9SA 1YHQQ 1SHGA 1D3BA 4PNOA 1KQSP 4PLLA 3QZ9B 2GFAA 5CKEA 4O6JA 4AFSC 4BY6B 1M5Q1 1WHHA 2VKNA 2CS7A 3AHUA 4WCIA 1HXDA 4C0DC 2DAQA 3UT1A 5I22A 3AT1B 1OPKA 4DBQA 2YLBA 3LYIA 3CBPA 5GAMg 4WTOB 2JZ2A 2B8AA 2YRVA 3KUFA 1JJ2P 1GCPA 5IN1A 2DL8A 2L2PA 3QG1A 2WSCE 4J9HA 1R0BG 3CCUT 4M7DD 1BCOA 2QXFA 1AOJA 4BY6C 2Y4YA 3HHTB 3I9QA 3X20B 2GQIA 2EWNA 2RB6A 1IO6A 3J7AF 1QWFA 2CH4A 1PRMC 2P84A 1OULA 4C5GA 2OJ2A 5FLXE 3OMGA 4M7AG 5GAN8 1WXUA 3EHRA 2RJCA 4RTTA 1Y0MA 3LGFA 3PTAA 1OV3A 3JCMV 3RMQA 3TU4K 1SF9A 4F17A 2RJDA 1GL5A 1HJDA 2O4XB 3OYKA 1JB0E 2D0NA 4KUDK 1B34A 4AG2C 3TREA 5CKDA 2VXEA 2RHYA 3OS0A 3VS4A 2HD0A 4MZPA 5GMKe 2M0YA 4HVVA 3CC2T 2F2WA 2DVJA 1D0XA 2K2MA 2HBPA 3SB2A 3M9QA 2A37A 2DJQA 3RR6A 4OVAA 2CZ6B 1YITQ 3G6EA 1Y96A 2LNHB 3G4SQ 1MGQA 1WIEA 2MYSA 4LD9K 1G8XA 4A4GA 2RI3A 1FMWA 1LVKA 1O75A 2M51A 2XG8D 1KQSA 2EAYA 3RERA 1Z9QA 4ORZA 4PFOA 4XU3A 2V1QA 4WF2A 1AHJB 5I2SA 1JU5C 3A8MB 2DTOA 1YWPA 2W0ZA 3A8OB 3HRUA 5GAMh 1Q82C 2IIMA 3EGXB 1JJ2A 2MIOA 2JW4A 3C95A 4A4EA 3S3OA 1GCQA 1K9MU 2ECZA 1QP2A 2QQBA 2XDDA 1K9AA 3CXCP 2KVQG 4OF1A 3WXMB 3ZBDA 5LJ3h 3MEUA 2DXTA 2E6ZA 2ZGWA 3HSBA 2CT4A 5KYUB 2JMCA 3OYHA 3M0SA 1G3SA 1FWZA 1UEBA 5IHNA 4J7FA 2DM1A 3CC4T 1GXIE 1VQPT 3NTHA 2CYZB 2E1HA 4RTVA 3SFMA 2L8DA 5KYYB 3LW5E 1ZSZB 4JUVA 2O9SA 1Q82R 2DPPB 4C92B 1SRMA 2EQKA 1FMKA 2QDLA 2DL4A 2LCSA 3QDRB 2VASA 2EKHA 2K2VA 1Y7XA 1UJ0A 2K3YA 1NE8A 1YIJQ 1B7TA 1MMAA 2L89A 2JNGA 2CH4W 4HT8A 3H6ZA 3VUBA 2CP7A 4CC7A 1AZEA 3LWHA 1V76A 1WA7A 4KGXB 4E7JA 1ZSZC 2DZ9A 4PJOB 1K8AU 3VS5A 4C92C 2HEQA 4FW2A 1UGSB 4Z89A 1X6OA 1VYVA 1EIFA 3SWNC 1BIBA 3OYBA 4RCCA 3PGGA 2KXCA 4CC4B 2HKQB 3CCQT 3MCAB 2DBKA 1KQSS 5GAOp 4TVRA 1VQ4Q 4RKUE 4RTZA 2RQTA 1YJ9T 2BUDA 2NWMA 4PJOC 2AKKA 3OYYA 1QCOA 3CD6T 3UF4A 1T0JA 2ABLA 3CC2A 1TS9A 3CXCA 1UGRB 3META 4BDYA 2DE0X 4PL6A 1VQ9A 1KC8U 2DEQA 3ER0A 4PK4A 4M7AB 2NUZA 2RPNA 2KSSA 4LUEA 2OTJQ 3JSCA 2RJEA 2OTLQ 3EG1A 3M0QA 2FZKB 3QBYA 3M58A 1UGQB 4X9CA 4ZN3A 1NBEB 2QK0A 2LQWA 2QEXA 2YLCA 2GFUA 5FW9A 1YJNQ 3M55A 1VA7A 3CCSQ 4M75E 3QJ6A 2BZ8A 3GNFB 3CMEA 3PE0A 4ELZC 4NL2A 4M7AC 2RF0A 5GAMe 2XD0A 3DKMA 1Q86R 1V29B 1LPLA 1ZUUA 3EFOB 4AT1B 1S72A 4R55A 1YJWT 3R6NA 2FO0A 2JMAA 1S1NA 5A0LA 3UPUA 1I81A 2NUPA 1UDLA 1IB8A 5LJ3e 2W10A 2O88A 4UC4A 3L2VA 3I5RA 2JM8A 3FC3A 1YI2T 1EZZB 2DJZA 2MF2A 5C6SA 1XQHA 2FPDA 3JCMf 4HCCA 3URGA 2ZPBB 3ME9A 4Y91A 2EJ9A 2DXBA 3CC7Q 3ZL7C 3MP8A 4FYVB 1TUCA 4EMKA 1WJRA 4C92D 1VQOA 1R8OB 1WX6A 4JJCA 2YUNA 5LL6S 3MP1A 1VQLT 3C4SA 3PT9A 2GTJA 4M77F 2PVGB 4GBQA 1NPRA 1FXXA 3O8VA 3ZEHA 2GGRA 3EG9B 2FZCB 3JCMJ 1N27A 3JB9J 2RK2A 2V8IA 3CXCS 3CQTA 2D8JA 3CCLA 4JDSA 2HDAA 2J6KA 2RQUA 1M1KU 4IUPA 3OSSC 1JEGA 1WNLA 3BW1A 4PJOD 4J9EA 1Q81C 4LDYA 2VVKA 3FEOA 2D6FA 1YNZA 3JB9G 2PQWA 2E3HA 5GAN2 1N8RU 2HAXA 5LJ5d 4KH1B 4BE2A 1VQKT 4PJJA 1WXBA 1VQ4A 4HCZA 1ZX6A 2LMJA 1SPKA 3DB4A 5FROA 3CD6A 3SDZA 2EVRA 5L23A 2X51A 5J26A 1X6BA 2COYA 2DKGA 2KT1A 3PIPA 2EBPA 4M78F 2B86A 1X2KA 4MZTA 1BI0A 2P4TA 2RA2A 4XU2A 1C1AA 1Q81R 4IIOA 3I55T 2OTJA 1X27A 4M7AD 3QZ5B 2E6NA 1TTHB 3L42A 2EYXA 2GQVA 5HY6A 2OAWA 4LDUA 1E6GA 1I5OB 1JXMA 1D0ZA 1M2VB 2RHUA 1YJNA 3BFMA 4EDUA 5GJVB 5J3BA 5L8RE 1RAIB 3ZFJA 2RHZA 4EMGA 3RMSA 5A2QE 2JS2A 5GMKl 3OYMA 2JTFA 3HP9A 4YTLA 3WVEB 3HFOA 3VRYA 2Y90A 1YJWA 2DTIA 4KH0B 3QXEB 4PJMA 4ANJA 1FX7A 1TSFA 4BB7A 1AZGB 3M4GA 2EYWA 2CP0A 2J7IA 1I0CA 1NEBA 2PU9B 4ZTJA 3TSZA 3HRSA 2KRMA 3QWXX 1TH7A 3REAB 5M9OA 3GIBA 1MNEA 1T0HA 2FRYA 1VQMQ 1H641 4LE9A 3OY9A 5GAOl 3A5ZB 4RCBA 3G71A 1VQ7Q 3DLMA 1B07A 2RI5A 1KJWA 4JLIA 2MCNA 4GLKA 1Y57A 4XTZA 1G83A 2FPEA 3G6ET 1VQLA 1X01A 2LJ1A 3GP8A 1XTDA 1D09B 1MV3A 3PMTA 3BY7A 3OS1A 3QPHA 3V8LA 1ZLMA 2EGEA 4OP0A 3VS0A 2KYMA 4A53A 4M77A 3CBOA 2VC8A 4RTWA 3M53A 2LT4A 2RHIA 2YDLA 1I1JA 3CCRQ 2CSIA 1WHGA 4RTUA 2DFUA 4L59A 1BI1A 1VQKA 4J9GA 4RUGA 4A63B 2BIVA 2CT3A 2LNVA 2QGGA 2JVVA 3OSVA 2F1LA 2CUBA 3MEAA 1UHFA 1W1FA 4C5HA 3SD4A 1WHMA 2KI7A 2M9UA 2DXUA 8ATCB 4M77E 2BE7D 2CSQA 1YHQT 1DJ7B 1X75C 1ZBXA 2PVOB 2FL7A 1QCFA 3OYIA 1PD0A 4BI8B 5KYWA 4CI0C 1K9MR 3I55A 1FYNA 3VRZA 4M75G 2D0QB 2J05A 3OYJA 4M78A 2PNIA 1PKTA 3G1JA 3E2UA 4QQGA 4P5NA 1D1CA 1H92A 1K8AC 2QA4Q 1TOVA 1KG1A 4B6MA 3E1SA 1RAAB 4E7KA 2JJ9A 4GY5A 1C6VX 2RH2A 4OB2B 5LJ3g 4LUDA 4C92F 1AWJA 1T3SA 5HKCA 2FPFA 2A7YA 2LRQA 4LDXA 2AKLA 2R5MA 1K73U 2V8KA 1UFFA 1B34B 3OYDA 2HZYA 4M78E 2DD5A 4DBRA 4JRKA 3HTRA 4E7LA 1RACB 4PJOF 1GBQA 1TUDA 5CAIA 1AWOA 4A4KA 2XI9A 3OW2P 4JZ3A 1M3CA 2Z0WA 1K8AR 1W2BA 1VQMA 1Y96B 4AFQC 2RQRA 2QI2A 5KE3A 1IHWA 4JRIA 5GANj 1EX4A 2JT4A 1D0YA 2CP6A 1VQ9T 5A0DA 1I4K1 3R6OA 5KYXA 3JCMX 5LJ5j 4X9DA 1YITT 1N6AA 2E5QA 4M4ZA 4MMLA 4XU1A 4C8QF 1PM3A 1VQNQ 3QDFA 2DD4A 2O4XA 3HFNA 3U23A 4QQDA 2RHXA 3CCVA 4II1A 1RADB 2O2OA 3NTIA 2QEXT 3FIFA 3X24B 4M7AF 2LP5A 1WFWA 5FU7B 1KC8R 3CMET 4F7UB 1RAHB 1BI2A 5GANh 4R56A 1RABB 1VQ5Q 1NEGA 2LZ6B 3T9NA 2XK0A 4MDWA 3FJPA 4LXCA 1TU0B 3TSWA 1S72T 3EG2A 3MO8A 4RG8A 2E4HA 3RIRA 2MI6A 1RI9A 1WHKA 2YRCA 5FWBA 2G6FX 1GCQC 1BI3A 4DEYA 3N5BB 4OB0B 1M90U 2QAZA 2LQ8A 5FU7C 2HBWA 3RUXA 1YHQA 1WGSA 5GAN4 2FEIA 1QVPA 2P4RA 3JV3A 1OZ3A 3V7CA 5C0MA 3EGXA 1OX8A 1M4ZA 1VUBA 2ROLA 1NYFA 1NZ9A 3H0HA 2RNAA 3VUZA 3OW2A 1YBYA 1D1BA 2JS0A 2E65A 3CC4Q 3SWNB 5D7UA 1VQPQ 4A54A 1Q95G 1VQOT 3JB9D 3CBMA 2ZPHB 4J6YA 2M0OA 2COWA 1MNDA 2LJ3A 3EG3A 5GANf 5KCOA 2JM9A 1QMCA 1RLPC 2FVUA 4BE0A 1M8VA 5LJ5f 2HL3A 3A8HB 1RUWA 2RJFA 3GLXA 3LH0A 4BUGA 1KHIA 5GMKi 3OYNA 1UGVA 3RKXA 2K6DA 1VQ6Q 3CCLT 5CKBA 1VIFA 3M4YA 5KYYA 3MHXA 3CMAQ 1PC0A 1IXDA 1GFDA 2AZVA 2JTMA 4C92A 2EW3A 2OX7A 2KQWA 2K3BA 4IUTA 5KE2A 2ZPIB 1JBMA 3V7SA 4EIKA 5IH2A 1BYMA 1MUZA 2GTOA 2E12A 4M75B 3DB3A 4HA8A 1VQ4T 3S3NA 4FYYB 5DY9A 1QWEA 2EJGA 1KIKA 3EFRA 1TG0A 1M1KR 1OYXA 1WDXA 4FT4A 5DLQE 3CCQQ 2DA9A 1ZBJA 3H8ZA 4AFZC 3QUIA 4PJOA 2LCCA 4EMHA 1Q86C 3LX7A 1WLPB 3VKIA 1JJ2S 1UECA 2EYQA 1YJ9Q 1E6HA 1N8RR 2GNCA 2DL5A 4AFUC 2VB6A 1YITA 4XTWA 3BDUA 3M0PA 3V7RA 4M75C 3G4SA 2DX1A 3E19A 4Z8AA 2HQHA 1UGPB 1OOTA 3JCMh 5HK3A 1B3QA 1C0MA 2H8HA 2KNBB 2OTJT 1KK7A 1X6GA 2PTKA 4J7IA 2VYTA 1W70A 2BKDN 4JZ4A 1IRXA 4RG2A 3KFVA 3PVLA 1YJNT 3CCJQ 4C8QA 3UA7A 2XIDA 4CRIA 3P8HA 5I11A 3QWYA 2CGHA 2QTVA 3EG0A 3CCST 2YRDA 3OMCA 5CR2A 3OQ5A 2RM4A 1WI7A 2GCXA 2BTTA 4BE1A 3UDCA 4M7AA 3VJPA 3OW2S 4M7DF 1ZQ1A 4GLMA 4M77G 3BDLA 2MOXA 4AG1C 4LDVA 1U8RA 3E9GA 1KQ1A 5DLOA 3MP6A 2QQAA 1CKBA 2GF7A 3GBQA 1RAGB 2QGFB 4RMOA 5IHKA 4C8QE 4QVCA 2DRKA 4X1VA 1M2OA 3CPFA 1QVFP 2K5LA 1VYTA 1NLPC 1FMVA 1D1AA 3OYFA 1BB9A 2DRMA 4PFZA 4OMLA 2HSPA 1AT1B 3J80E 1KHCA 3L2UA 4KBMB 3CC7T 3G71T 1YI2Q 1LOJA 1PNJA 2DILA 2I2LA 1M3AA 1SEMA 4NL3A 2FG0A 4BD3A 4ZN1A 1YIJA 3EGDA 3JB9H 2A08A 3L2RA 1JXOA 4J6WA 4DA4A 1AD5A 4HXJA 2HL5C 3WVDB 2VV5A 5HK0A 1PSFA 4M78G 1NG2A 2XU8A 4JLGA 4FYWB 2BE9B 2QQRA 2CZ7B 4ZGJB 3Q1JA 3UATA 3CCMQ 2EQMA 1K1ZA 4HT9A 4PJLA 2L3QA 3I56Q 1R0CB 1SG5A 2QASA 2LT1A 2FB7A 1T3LA 1AWWA 1XOVA 4JRQA 4DOVA 4M75D 3OA6A 3QSUA 5GAMd 1QP3A 1AEYA 2PUKB 2X3XD 4FIBA 3MEWA 1KD1U 1UG1A 1H3ZA 2COZA 4FU6A 2F5TX 4E7IA 3CCEQ 5LJ3d 3QJYA 2CP3A 2DNUA 3LLRA 2DL7A 4D8KA 4Q5WA 2OTLA 3D7SB 5DM7R 1U1SA 1BCMA 4XTVA 3JCMe 1RAEB 3H0IA 1YCYA 1QVFA 1BKBA 1SRLA 3A98A 4BI4A 4XQ3A 1N5ZA 3PIOA 2XKOC 2ZPFB 1HD3A 2DERA 3IQLA 1OZ2A 3NFCA 3CCSA 1WZOA 1MMDA 4JJDA 3VYHB 2F5KA 2PZ1A 2C0TA 3KBGA 2XICA 1MHNA 3OS2A 4JJBA 2MAMA 1MMGA 4XTYA 3X28B 4FT2A 3CEYA 5GMKj 1RAFB 1WQ7A 2BZXA 3JCMQ 2X4JA 2R58A 1M2VA 1ABQA 2ZPEB 5CO7A 5GAOq 4M7DA 5IXFA 3RDVA 4RTYA 2QYZA 4OMQA 2G3RA 3FRNA 1I07A 2XHCA 1VYUA 4B9WA 5EG2A 1M30A 1Z9ZA 2DBMA 2X4WA 3LGLA 2ENMA 2HNIA 3LH5A 1IGQA 1VQMT 1K73R 3EH1A 1QLYA 3CC7A 3SHWA 1TWBA 1NPPA 1VQ7T 4Y28E 4JS5A 2M02A 5CQXA 2FYKA 2OAUA 4JJNK 1ABOA 1W6XA 2FZGB 2ZZDA 1G3TA 3VS6A 4M77B 3M0TA 4M7DE 4OGEA 1IGUA 4D8DA 3RNJA 2LDMA 1WYXA 3CCVT 2NUTB 4IIMA 1X43A 3VV0A 1QVGP 3G6EQ 1WPYA 1K9MC 1Q7YU 1YP5A 4CC2A 2JTEA 2YWWA 2EYZA 2MWOA 3RESA 4C5EA 4OMMA 2LJ0A 4N0AC 2DYIA 2EQUA 3L2WA 3I56A 4M77C 1K76A 1W2BP 3NMZC 4OMOA 1O9SA 2GBQA 4OMPA 1IREB 1QVFS 2RD1A 1D3BB 9ATCB 4F7UF 4CC3A 5IAYA 1HSQA 3ASKA 3PMIA 3HL8A 2KYBA 1M8MA 4O5VA 2HSEB 3EAEA 4MMKA 3CCEA 2YHTA 2V1RA 2DETA 4XTXA 3FDRA 5AT1B 1VQ8Q 2K5FA 1XJWB 1XNIA 3MJXA 3OBWA 2I0NA 1QCNA 4MZMA 3HPWA 1K0SA 1UTIA 2DXCA 2A28A 2IG0A 3M0RA 4OB3B 1M90R 2K4YA 5GANg 1U5SA 1X69A 2VWFA 3RKWA 4HCBA 3GPLA 3QIIA 2DLPA 2H3EB 5LJ5g 2C0OA 2QA4T 4FSXA 4M78C 2HMAA 3GF5A 4N4HA 2QTXA 2LX7A 4E7HA 4EPCA 3O5ZA 1LNXA 4BDZA 5FU6B 2P0QA 3FJ5A 1E7OA 3M5AA 4VUBA 4C8QG 3CCUQ 5IT9E 2J6OA 2ED1A 1W4SA 2YT6A 1ZA2B 2WACA 3MKDA 2IPOB 1QVGA 2SEMA 1UB4A 4IKFA 4ELYC 4IUQA 2KRNA 2R57A 2EKOA 2J6FA 4F14A 3OYGA 3GNGA 5FU6C 1KC8C 1OQKA 5CKHA 5KYXB 2RMOA 4QVZA 2C06A 4ZGDB 3NTKA 1VQ7A 1RI0A 2AIRB 3CPWP 1HK9A 2AHJB 4J9FA 4NS5A 2E10A 4M75F 2L5QA 4A4HA 4D6WA 5IHIA 4QT7A 3M56A 3VS1A 3M57A 4QVDA 1NJIU 3G4ST 1PG5B 2CDTA 4KGZB 3VS3A 3CC2Q 1F1BB 5GAMj 4KGVB 1VQNT 4M77D 2NYSA 2CKKA 1N9RA 3QO3A 6AT1B 3RBBB 2J06A 3NPFA 3FLGA 1R77A 1Y07A 4J9CA 1VQ9Q 2LC4A 4LDWA 1OPLA 2X9HA 2KXDA 3L2ZA 5LJ3j 2YUQA 2K79A 2K9GA 1KFZA 2ESWA 2BZYA 2H3JA 3CCRA 2ROTA 1BU1A 2JN0A 2M16A 4LNPA 2QEXQ 1JO8A 4ZNXA 3OS5A 1VQ5T 1QW1A 2X4YA 4BI3A 5LJ5h 1BK2A 2X35A 2ZCFB 4MDXA 4DBFA 1ZUKA 3CMEQ 1G3WA 4J5YA 2EPDA 3THKA 1OI1A 3JCMg 4IUUA 3S3MA 2KY9A 1S72Q 3QHSA 7AT1B 4J83A 4XTUA 1H3HA 4F7UA 2EJFA 1A0NB 5FRMA 2FRWA 5KCHA 1CKAA 4M78D 1VQ8A 2MPXC 1ZSGA 5FWCA 1QVGS 4Z02A 2R5AA 4R0KA 4QW2A 1LCKA 5GAN3 2E41A 1M1KC 5KYUA 2QA4A 1ZHIA 1YIJT 1SHFA 3JAME 3CPWA 4ZGEB 2VGMA 1TUGB 1Y71A 2KAFA 4BACA 1W2BS 5CVIA 1H8KA 1U1TA 2KDSA 1X2QA 1N8RC 3F70A 4F7UE 1VQOQ 3OB9A 4FSSA 3HRTA 1GRIA 5J39A 2F69A 1VQ6T 5GAMf 3CCUA 3OYLA 1ZSZA 2DF6A 4OB1B 4E47A 3CMAT 2D1XA 1QKXA 4N4GA 3TEEA 3JCMW 3C12A 1YWOA 2ZPGB 3MPUB 3QYHB 3SWNA 1KD1C 1PSEA 3VS7A 1OU8A 3CCLQ 4HVWA 1GBRA 1K4US 2RQWA 5LJ3f 3KXTA 2PUOB 5CIUA 1PKSA 5I2MA 1OX9A 4E7SA 1NM7A 4J6XA 3E9FA 5KYNA 4DQ2A 5IXBA 3OYEA 4M7DG 2HQEA 2DL3A 1RLQC 1KQ2A 3X25B 4ZTFA 4NOYA 2L3PA 2KEAA 3JCMb 4C92E 2KROA 4JRPA 3S6WA 3CD6Q 1J3TA 2LQNA 3H9NA 2A3LA 4C8QB 1VQNA 2RI2A 2OTLT 4M75A 1I5LA 5D6XA 3M0UA 3A8LB 1AWXA 1KD1R 1OEBA 2L3RA 1UHCA 5GAOr 3H41A 3CCJT 4PJOE 4ME7A 1NLOC 4X34A 2RO0A 2DVEA 2JUFA 2NUPB 2VUBA 1CSKA 2F2VA 4JS4A 1RL2A 4C8QC 1VQ5A 5GAN7 1OU9A 2SRCA 5GJWB 1KSWA 5GANe 4KRTA 1ACMB 3EFSA 1VOMA 2C0IA 2DO3A 2EQJA 2MWPA 4DOWA 5CQYA 4HCKA 5LJ5e 2RK1A 5HCKA 4KT0E 4E7ZA 5D6WA 2CREA 3X26B 3CPWS 4A4FA 3I5SA 3M54A 1PWTA 1YJWQ 2V8JA 5A0GA 2DMOA 4F16A 2D9TA 2A0FB 4FW1A 5GAN6 5CK9A 2OI3A 4EMKB 4PFPA 1Q82U 4QKUA 1WHLA 2ATCB 2K5IA 4OMNA 3PNWC 3EGDB 1G2BA 3EFOA 1IZ6A 4M7AE 2X4XA 4RTXA 4J9BA 1QQJA 4FCYA 3JB9I 3CC4A 4N4IA 3MEVA 1VQPA 2O01E 4FL6A 3V8JA 1WQWA 3V8KA 2E64A 1Q7YC 5CKFA 1M27C 1PCXA 2E70A 4FM4B 3G71Q 4EMKC 5GAN5 3PFSA 1WJSA 2L3SA 2CZ0B 4LN2A 1BIAA 3OBYA 4OGCA 4AMCA 3NGPA 2DZCA 1JQQA 3REBB 1VQ6A 1VQLQ 1MMNA 2DTHA 1SKUB 2JXBA 4J9IA 3A1PA 3CMAA 1VIEA 4J9DA 4LD6A 2EFIA 4OMFB 3EGUA 3CCMT 1YFNA 4JPBW 3VYGA 3I56T 4L6V5 2V26A 2DEUA 4IUVA 3JRZA 2Y4XA 2CP5A 4J8OA 1LJOA 1M1GA 4XK8E 2NLUA 2KBTA 2LTOA 3EG9A 3J81E 2KT8A 1PD1A 5D6YA 5GANd 3OYAA 3CCQA 4E2FB 1Q7YR 4XU0A 1VQKQ 4C0FA 1V1CA 2KGTA 2X3WD 4E6RA 5I21A 3G7ZA 1YJ9A 2XDBA 1WHJA 1MV0B 1K0XA 3CCET 2AT1B 3OYCA 3QKJA 2CUDA 1I8FA 8AT1B 5EC7A 1TXQA 2PVDB 4FYXB 5FRNA 3HKSA 1WXTA 2JOYA 3M59A 4C8QD 1SSHA 1NYGA 4Y92A 1G5VA 2VXFA 2KRSA 3UWNA 3L2QA 3INZA 3I35A 2P0KA 1M1FA 4DBHA 2P0PA 3CCJA 2YXYA 1YCSB 2DIQA 2DK3A 3I55Q 1K73C 2FHDA 2KR3A 2LVMA 4ESRA 2O31A 1Q86U 1UUEA 2D8HA 1UE9A 2O9VA 3NHNA 3JB9F 2ED0A 2E3IA 4C0ZA 1JRIA 3P8DA 3LWIA 4M7DB 3PVQA
chains in the Genus database with same CATH topology
5A0LA 3UPUA 3GPLA 1I81A 3QIIA 5CCAA 5LJ5g 2QA4T 4FSXA 1M4ZA 4M78C 1VUBA 4KULA 5LJ3e 4HKEA 3GF5A 4XAXB 1NZ9A 4N4HA 4UC4A 3VU3C 3L2VA 2QTXA 2WSEE 3VUZA 2K3XA 3OW2A 4E7HA 3FC3A 1YBYA 2LX9A 4EPCA 1YI2T 4BDZA 1LNXA 2E65A 4C0GA 3SWNB 2DJZA 2MF2A 5FU6B 5C6SA 2P0QA 5AYFA 1XQHA 4A54A 4ATOA 1G3YA 3M5AA 5GAOn 1VQOT 4VUBA 4C8QG 5GMKm 5IT9E 4PKCC 3JB9D 3JCMf 1W4SA 4HCCA 3CBMA 3URGA 2ZPHB 4J6YA 3P8BB 3JCMc 2M0OA 2K57A 2QDYB 2ZPBB 4M7DC 5GANf 3ME9A 2WACA 4Y91A 5KCOA 1NJIC 2EJ9A 2DXBA 1QVGA 1UB4A 2FVUA 4BE0A 3L1AA 1M8VA 5LJ5f 2EIFA 3MP8A 1YI2A 4IKFA 3A8HB 4ELYC 2RJFA 3GLXA 3LH0A 2R57A 1KHIA 2QQSA 3QYGB 4IUQA 4BUGA 1WJRA 3RKXA 4C92D 4EMKA 3OYNA 2EKOA 3CCLT 1VQOA 5CKBA 1R8OB 4F7UG 3OYGA 3DLLA 1VIFA 4QQ6A 3M4YA 3GNGA 3MHXA 5LL6S 5FU6C 3MP1A 5GMKh 1KC8C 1VQLT 3C4SA 3PT9A 4V2SA 5CKHA 4M77F 2JTMA 2PVGB 4C92A 1NPRA 1FXXA 3O8VA 4QVZA 2C06A 3ZEHA 2KQWA 4IUTA 5KE2A 4B9XA 4ZGDB 3NTKA 3JCMJ 1N27A 2ZPIB 1JBMA 3V7SA 1RI0A 3JB9J 2RK2A 1VQ7A 1P92A 4IURA 1BYMA 5KH6A 1HK9A 2AHJB 2V8IA 4NS5A 3A8GB 2E10A 4M75F 3CXCS 3CCLA 2L5QA 4JDSA 2E12A 2MMPA 3DB3A 4M75B 5GAOm 4HA8A 3JCMP 1M1KU 1VQ4T 3S3NA 4C5IA 2CZ1B 4IUPA 4A4HA 4D6WA 5DY9A 2HQXA 3OSSC 1WNLA 2EJGA 3BW1A 4PJOD 1Q81C 3EFRA 3M56A 3JCMd 4LDYA 3M57A 4QVDA 1NJIU 1WJQA 3G4ST 1OYXA 4FT4A 5DLQE 4KUIA 3FEOA 2D6FA 5C0MA 3JB9G 2PQWA 5GAN2 5GAMj 3CCMA 1N8RU 3H8ZA 3CCRT 1VQNT 4PJOA 3QUIA 4M77D 2LCCA 3GOXA 2M1HA 2CKKA 4EMHA 1N9RA 3QO3A 3LX7A 1Q86C 3VKIA 5LJ5d 3C94A 1M90C 2EYQA 1JJ2S 4BE2A 2VGNA 1VQKT 3FLGA 1Y07A 2KMTA 2LC4A 4N0AA 1VQ4A 4HCZA 4LDWA 1YITA 1SSFA 3DB4A 5FROA 4XTWA 2DIGA 3BDUA 3V7RA 4M75C 3G4SA 3E19A 4C92G 3L2ZA 3CD6A 5LJ3j 3SDZA 1UGPB 2KK4A 3JCMh 5HK3A 2H3JA 2OTJT 3CCRA 5J26A 2JN0A 2DKGA 2M16A 2XDPA 4J7IA 2VYTA 2IVWA 2BKDN 3OS5A 1VQ5T 1QW1A 2X4YA 4RG2A 4BI3A 5LJ5h 3PIPA 1Q81U 2X35A 4M78F 4C0DB 2ZCFB 1YJNT 4M78B 4PLIA 4MDXA 4C8QA 3RKYA 1M9SA 3FB9A 5GMKi 3TCJA 2XIDA 4CRIA 1G3WA 1BI0A 2WSFE 2P4TA 2RA2A 3P8HA 4MZTA 4XU2A 2CGHA 3I55T 2OTJA 2LQKA 3CCST 4J5YA 4M7AD 2QQ9A 3OMCA 4L5GA 4PJOG 3OQ5A 3QZ5B 5CR2A 2RM4A 2E6NA 2LCLA 3L42A 1VQ8T 2GCXA 2GQVA 1N9SA 1OI1A 5HY6A 3JCMg 4IUUA 4LDUA 4BE1A 3S3MA 2KY9A 1D3BA 4PNOA 3UDCA 4M7AA 3QHSA 3VJPA 3OW2S 4M7DF 2RHUA 4PLLA 1ZQ1A 3QZ9B 3BFMA 4J83A 4M77G 3BDLA 4XTUA 2GFAA 5CKEA 4O6JA 4BY6B 4EDUA 1M5Q1 2EJFA 4F7UA 2CS7A 4LDVA 5FRMA 3AHUA 5J3BA 1U8RA 3E9GA 5L8RE 1HXDA 5KCHA 4M78D 1KQ1A 4C0DC 3ZFJA 2RHZA 2DAQA 3MP6A 2QQAA 3RMSA 3UT1A 4EMGA 5DLOA 5A2QE 1VQ8A 2GF7A 5GMKl 2YLBA 3LYIA 4RMOA 3OYMA 3CBPA 2JTFA 3HP9A 5GAMg 1QVGS 4YTLA 2JZ2A 4Z02A 2R5AA 2B8AA 3HFOA 3WVEB 4C8QE 4QVCA 2Y90A 2YRVA 4QW2A 1YJWA 3KUFA 2DTIA 5IN1A 3QXEB 3QG1A 5GAN3 2WSCE 1FX7A 2E41A 3CPFA 1M1KC 4BB7A 2K5LA 2QA4A 3CCUT 4M7DD 1ZHIA 3OYFA 1YIJT 3M4GA 3CPWA 3JAME 4ZGEB 2QXFA 4BY6C 2Y4YA 2VGMA 3HHTB 3X20B 1Y71A 2EWNA 2KAFA 2RB6A 3J80E 4BACA 1KHCA 1W2BS 5CVIA 4KBMB 3L2UA 3J7AF 1U1TA 2PU9B 3G71T 3CC7T 2KDSA 4ZTJA 3HRSA 1N8RC 3F70A 1LOJA 4C5GA 5FLXE 4F7UE 3OMGA 2I2LA 4M7AG 3OB9A 5GAN8 5M9OA 1TH7A 3HRTA 3GIBA 5J39A 4NL3A 2F69A 2RJCA 1VQ6T 4BD3A 5GAMf 3CCUA 3OYLA 4ZN1A 3LGFA 1YIJA 4OB1B 3JB9H 3PTAA 3L2RA 1H641 4J6WA 4E47A 4DA4A 3CMAT 3JCMV 3OY9A 4N4GA 3TEEA 3JCMW 3WVDB 3RMQA 5GAOl 3A5ZB 4RCBA 3TU4K 3C12A 2ZPGB 3SWNA 3G71A 3QYHB 2RJDA 2VV5A 5HK0A 3DLMA 1PSFA 1KD1C 4M78G 2RI5A 1PSEA 2XU8A 4JLIA 2O4XB 3OYKA 1JB0E 5LJ3f 4JLGA 4KUDK 1YJNA 1B34A 3KXTA 4GLKA 4XTZA 2PUOB 2QQRA 5CIUA 3G6ET 3TREA 1VQLA 5I2MA 2CZ7B 5CKDA 2VXEA 2RHYA 4ZGJB 3OS0A 1X01A 3Q1JA 3GP8A 1XTDA 4J6XA 2EQMA 2HD0A 4MZPA 5GMKe 3E9FA 4DQ2A 4HT9A 3OYEA 3CC2T 2HQEA 4M7DG 2HBPA 3SB2A 2LT1A 3M9QA 1KQ2A 2FB7A 3PMTA 3X25B 3BY7A 4ZTFA 1XOVA 3OS1A 3QPHA 3V8LA 4NOYA 4OP0A 4JRQA 4OVAA 2CZ6B 4A53A 4DOVA 3G6EA 1Y96A 4C92E 3JCMb 4M77A 4JRPA 3CBOA 1MGQA 2VC8A 4M75D 3M53A 3S6WA 3OA6A 2LT4A 5GAMd 3QSUA 2RHIA 1QP3A 4LD9K 4A4GA 2PUKB 4FIBA 2A3LA 2RI3A 3MEWA 4C8QB 1KD1U 1O75A 2XG8D 1KQSA 1VQNA 2EAYA 2RI2A 2OTLT 3RERA 4M75A 1I5LA 5D6XA 1H3ZA 4L59A 3A8LB 1BI1A 4FU6A 2F5TX 4XU3A 4E7IA 1VQKA 4WF2A 1AHJB 2L3RA 5I2SA 5LJ3d 3QJYA 2BIVA 5GAOr 3A8MB 2LNVA 2JVVA 3LLRA 2DTOA 3CCJT 3OSVA 4PJOE 4ME7A 3A8OB 3HRUA 3MEAA 5GAMh 4X34A 1Q82C 4Q5WA 2RO0A 2OTLA 2DVEA 2JUFA 2VUBA 4C5HA 1JJ2A 3SD4A 4JS4A 5DM7R 1U1SA 2M9UA 2DXUA 4XTVA 3JCMe 3C95A 1RL2A 1YCYA 4C8QC 4A4EA 4M77E 5GAN7 3S3OA 1BKBA 1YHQT 1VQ5A 1DJ7B 1X75C 1K9MU 1QVFA 4BI4A 1QP2A 3EFSA 4XQ3A 5GANe 2QQBA 1ZBXA 2XKOC 2DO3A 2XDDA 3PIOA 2PVOB 2FL7A 2ZPFB 2EQJA 2MWPA 4DOWA 2KVQG 3OYIA 4BI8B 4OF1A 3WXMB 3ZBDA 5CQYA 5LJ3h 4CI0C 5LJ5e 2RK1A 3MEUA 2DXTA 1OZ2A 3I55A 3NFCA 4KT0E 3CCSA 5D6WA 3VYHB 2E6ZA 2F5KA 2ZGWA 4M75G 3HSBA 3X26B 3CPWS 2D0QB 3OYHA 1G3SA 4A4FA 3KBGA 1FWZA 3OYJA 4M78A 3M54A 2XICA 1UEBA 1MHNA 3OS2A 2V8JA 5A0GA 2D9TA 4J7FA 3CC4T 4QQGA 4P5NA 2MAMA 5GAN6 5CK9A 1GXIE 1VQPT 3NTHA 4XTYA 1K8AC 2CYZB 3X28B 4EMKB 1KG1A 1Q82U 4FT2A 2E1HA 3E1SA 4E7KA 3CEYA 5GMKj 1WQ7A 2K5IA 2RH2A 2L8DA 4GY5A 4OB2B 3SFMA 5LJ3g 3JCMQ 3LW5E 3PNWC 4JUVA 2X4JA 1IZ6A 2R58A 4C92F 2DPPB 2ZPEB 5CO7A 4M7AE 4C92B 5GAOq 4HCBA 4M7DA 2EQKA 5HKCA 2X4XA 2A7YA 3QDRB 3JB9I 2G3RA 2LRQA 4N4IA 3CC4A 2K2VA 1Y7XA 3FRNA 2K3YA 3MEVA 1VQPA 2XHCA 2R5MA 1K73U 1NE8A 2O01E 4LDXA 2V8KA 4FL6A 4B9WA 5EG2A 3V8JA 1WQWA 3V8KA 1B34B 3OYDA 2E64A 2X4WA 5CKFA 3LGLA 1Q7YC 2HNIA 2L89A 4FM4B 2E70A 2JNGA 1VQMT 4M78E 4EMKC 2DD5A 3CC7A 5GAN5 3PFSA 4HT8A 1WJSA 3H6ZA 2CZ0B 4JRKA 3VUBA 1BIAA 1NPPA 3OBYA 4OGCA 4Y28E 3LWHA 4JS5A 4E7LA 1VQ7T 4E7JA 5CQXA 2DZ9A 2DZCA 2FYKA 2OAUA 4PJOF 4JJNK 4PJOB 5CAIA 1K8AU 4C92C 4A4KA 1VQ6A 2XI9A 1UGSB 1X6OA 2DTHA 3SWNC 1EIFA 1BIBA 3OYBA 4RCCA 3CMAA 1VIEA 2ZZDA 1G3TA 3PGGA 2EFIA 4LD6A 1Y96B 4OMFB 1VQMA 1W2BA 4M77B 4M7DE 4OGEA 2QI2A 3CCQT 5KE3A 3MCAB 3CCMT 4JRIA 2LDMA 1KQSS 3VYGA 5GANj 3I56T 4L6V5 3CCVT 5GAOp 4TVRA 3VV0A 4RKUE 4IUVA 3JRZA 2Y4XA 1YJ9T 1VQ9T 5A0DA 1I4K1 3R6OA 1WPYA 1K9MC 3JCMX 5LJ5j 2BUDA 4X9DA 4J8OA 1Q7YU 1YITT 1LJOA 1M1GA 4XK8E 1N6AA 2NLUA 4PJOC 2LTOA 2E5QA 3OYYA 4MMLA 4XU1A 3J81E 3CD6T 4C8QF 2MWOA 5D6YA 3RESA 4C5EA 5GANd 3OYAA 3CCQA 2DD4A 2O4XA 3HFNA 4N0AC 3CC2A 4XU0A 2EQUA 3CXCA 1UGRB 4QQDA 2RHXA 3META 4C0FA 4M77C 3I56A 4II1A 3L2WA 3CCVA 5I21A 4BDYA 3G7ZA 4PL6A 3NTIA 1YJ9A 2XDBA 1O9SA 2QEXT 1VQ9A 1QVFS 1IREB 3CCET 1KC8U 2RD1A 3FIFA 3OYCA 3X24B 2DEQA 3QKJA 4M7AF 3ER0A 1D3BB 4M7AB 1I8FA 2KSSA 4F7UF 3JSCA 2RJEA 5FU7B 5IAYA 3CMET 4F7UB 2PVDB 5FRNA 3HKSA 3QBYA 1BI2A 3ASKA 3M58A 1UGQB 3HL8A 3PMIA 4X9CA 2JOYA 5GANh 3M59A 4ZN3A 4R56A 4C8QD 3T9NA 2XK0A 2QEXA 2YLCA 2GFUA 3FJPA 4MDWA 4O5VA 3EAEA 4MMKA 2VXFA 3CCEA 1G5VA 3M55A 3UWNA 3L2QA 1S72T 2YHTA 3RIRA 3MO8A 4RG8A 3INZA 2P0KA 1M1FA 2MI6A 2P0PA 3CCJA 2DIQA 2DK3A 4XTXA 1K73C 4M75E 3FDRA 3QJ6A 2FHDA 3GNFB 2LVMA 3CMEA 2K5FA 4ELZC 1BI3A 4NL2A 1Q86U 1XNIA 4M7AC 3N5BB 3OBWA 4OB0B 1M90U 2LQ8A 4MZMA 5FU7C 3HPWA 5GAMe 3RUXA 2XD0A 3DKMA 2DXCA 2IG0A 1YHQA 1WGSA 3JB9F 5GAN4 2HAXA 1V29B 4OB3B 2K4YA 1QVPA 4C0ZA 5GANg 4R55A 1S72A 1JRIA 3P8DA 3LWIA 1YJWT 4M7DB 1OZ3A 3V7CA 3RKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7D G;  2HNI A;  1I81 A;  3SB2 A;  5LJ5 h;  4M78 E;  4EMK C;  4M78 F;  1KQ2 A;  2FB7 A;  5LJ5 g;  5GAN 5;  3BY7 A;  4HT8 A;  4M78 B;  3V8L A;  4JRK A;  4M78 C;  3RKY A;  4C8Q A;  3FB9 A;  4NOY A;  1BIA A;  4OP0 A;  5LJ3 e;  4A53 A;  2RA2 A;  1Y96 A;  4XU2 A;  4C92 E;  3JCM b;  4M77 A;  2CGH A;  2DZ9 A;  2DZC A;  1MGQ A;  2FYK A;  2VC8 A;  4M75 D;  4PJO F;  2QTX A;  3VU3 C;  5CAI A;  4J5Y A;  5GAM d;  3QSU A;  4C92 C;  4M7A D;  4PJO B;  4PJO G;  2RM4 A;  1LNX A;  2E65 A;  3SWN B;  2DJZ A;  2DTH A;  3SWN C;  1N9S A;  1BIB A;  4C8Q B;  4A54 A;  4RCC A;  3JCM g;  5GAO n;  2EAY A;  4C8Q G;  5GMK m;  3RER A;  3PGG A;  4M75 A;  4PNO A;  1D3B A;  1Y96 B;  3JB9 D;  1I5L A;  4M77 B;  3QHS A;  3JCM f;  4M7A A;  4M7D E;  4M7D F;  4J6Y A;  4M77 G;  3BFM A;  4XTU A;  4XU3 A;  3JCM c;  2K57 A;  4M7D C;  4F7U A;  1M5Q 1;  2EJF A;  4WF2 A;  5GAN f;  4HT9 A;  4Y91 A;  3AHU A;  4JRI A;  2EJ9 A;  5LJ3 d;  5GAN j;  1HXD A;  4M78 D;  5GAO p;  1KQ1 A;  4EMG A;  5GAO r;  3L1A A;  1M8V A;  5LJ5 f;  2DTO A;  1I4K 1;  1WPY A;  4PJO E;  5GMK i;  5GMK l;  5LJ5 j;  3JCM X;  4X9D A;  4EMK A;  5GAM h;  3RKX A;  4C92 D;  2YLB A;  1LJO A;  5GAM g;  2DVE A;  4F7U G;  4PJO C;  4MML A;  4XU1 A;  3HFO A;  4C8Q E;  4QVC A;  1U1S A;  2Y90 A;  4C8Q F;  5GAN d;  3RES A;  2DXU A;  2DTI A;  4XTV A;  3JCM e;  5GMK h;  4V2S A;  1YCY A;  4C8Q C;  3HFN A;  4M77 E;  4N0A C;  5GAN 7;  4M77 F;  4XU0 A;  5GAN 3;  4C92 A;  2E41 A;  4XQ3 A;  3EFS A;  5GAN e;  4M77 C;  4M7D D;  5I21 A;  3M4G A;  3JCM J;  1JBM A;  3V7S A;  3JB9 J;  5LJ3 h;  2EWN A;  2RB6 A;  5LJ5 e;  1HK9 A;  2DXT A;  2RD1 A;  3FIF A;  2E10 A;  4M75 F;  2DEQ A;  1U1T A;  4M7A F;  4M75 B;  5GAO m;  1D3B B;  3JCM P;  4HA8 A;  4M7A B;  2ZGW A;  4M75 G;  1LOJ A;  1I8F A;  3HSB A;  4F7U E;  4M7A G;  2I2L A;  5DY9 A;  4F7U F;  1WNL A;  2EJG A;  3BW1 A;  4PJO D;  4F7U B;  5GAN 8;  3EFR A;  3JCM d;  1TH7 A;  4QVD A;  3GIB A;  4M78 A;  4NL3 A;  4X9C A;  5GAN h;  5GAM f;  4C8Q D;  3JB9 H;  3JB9 G;  5GAN 2;  5GAM j;  1H64 1;  4J6W A;  5GAN 6;  2YLC A;  4PJO A;  3FJP A;  3QUI A;  4M77 D;  4MMK A;  4XTY A;  2VXF A;  3JCM V;  4EMH A;  4EMK B;  3JCM W;  1N9R A;  3QO3 A;  4RCB A;  5GAO l;  5LJ5 d;  2E1H A;  2YHT A;  3RIR A;  3SWN A;  3INZ A;  5GMK j;  1WQ7 A;  4M78 G;  4N0A A;  4XTX A;  3JCM Q;  5LJ3 g;  4JUV A;  4M75 E;  4JLI A;  4C92 F;  4M7A E;  4XTW A;  5LJ3 f;  3BDU A;  3V7R A;  4C92 B;  4M75 C;  5GAO q;  4NL2 A;  1B34 A;  4M7D A;  4C92 G;  4M7A C;  3L2Z A;  5LJ3 j;  4XTZ A;  3JCM h;  3JB9 I;  5GAM e;  3RUX A;  4M7D B;  2VXE A;  3JB9 F;  5GAN 4;  1X01 A;  2JN0 A;  5GAN g;  4J6X A;  1JRI A;  2DKG A;  3V8J A;  5GMK e;  1WQW A;  3V8K A;  1B34 B;  4DQ2 A;  3V7C A;  2E64 A;  3RKW A; 
#chains in the Genus database with same CATH topology
 5CCA A;  3UA6 A;  1PRL C;  4KUL A;  4HKE A;  4F04 B;  4XAX B;  2AK5 A;  3VU3 C;  3EHQ A;  2WSE E;  2K3X A;  2LX9 A;  2DYB A;  4C0G A;  5ECA A;  3C0C A;  5AYF A;  2EGC A;  4ATO A;  1G3Y A;  5GAO n;  3BE3 A;  5GMK m;  4PKC C;  2MK5 A;  3TVT A;  3JCM c;  3P8B B;  1M3B A;  2K57 A;  2QDY B;  4M7D C;  4PJN A;  1NJI C;  1HYO A;  2EGA A;  3L1A A;  2EIF A;  1YI2 A;  1EFN A;  3QYG B;  1UJY A;  1BBZ A;  2QQS A;  4F7U G;  3DLL A;  4QQ6 A;  5GMK h;  4V2S A;  1QKW A;  1PHT A;  1ZA1 B;  2KE9 A;  2YSQ A;  1IHV A;  2XMF A;  4B9X A;  4K11 A;  1P92 A;  4IUR A;  5KH6 A;  3H0F A;  3A8G B;  2L0A A;  1GFC A;  4Z88 A;  2MMP A;  5GAO m;  3JCM P;  1AVZ C;  4C5I A;  1YN8 A;  2CZ1 B;  2HQX A;  2YUO A;  3JCM d;  1WJQ A;  1ZUY A;  4KUI A;  2HKN A;  2YUP A;  3CCM A;  2AZS A;  2CP2 A;  3CCR T;  1NJI R;  3CCV Q;  3GOX A;  2M1H A;  2EQI A;  1M90 C;  3C94 A;  2ZAE A;  1U06 A;  2VGN A;  2KMT A;  4N0A A;  3EH2 A;  2K7A A;  2EYY A;  3SEM A;  1SSF A;  2DIG A;  4C92 G;  2KK4 A;  2RN8 A;  5KYW B;  2NUT A;  4DEX A;  2XDP A;  2IVW A;  2A36 A;  2E5K A;  1Q81 U;  4C0D B;  1U3O A;  2QG9 B;  4M78 B;  4PLI A;  3RKY A;  1M9S A;  3FB9 A;  3TCJ A;  2HCK A;  3VS2 A;  2WSF E;  2LQK A;  4HVU A;  3TQ7 P;  2QQ9 A;  1ARK A;  4L5G A;  4PJO G;  2RQV A;  1VQ8 T;  2LCL A;  2F2X A;  3ULR B;  1N9S A;  1YHQ Q;  1SHG A;  1D3B A;  4PNO A;  1KQS P;  4PLL A;  3QZ9 B;  2GFA A;  5CKE A;  4O6J A;  4AFS C;  4BY6 B;  1M5Q 1;  1WHH A;  2VKN A;  2CS7 A;  3AHU A;  4WCI A;  1HXD A;  4C0D C;  2DAQ A;  3UT1 A;  5I22 A;  3AT1 B;  1OPK A;  4DBQ A;  2YLB A;  3LYI A;  3CBP A;  5GAM g;  4WTO B;  2JZ2 A;  2B8A A;  2YRV A;  3KUF A;  1JJ2 P;  1GCP A;  5IN1 A;  2DL8 A;  2L2P A;  3QG1 A;  2WSC E;  4J9H A;  1R0B G;  3CCU T;  4M7D D;  1BCO A;  2QXF A;  1AOJ A;  4BY6 C;  2Y4Y A;  3HHT B;  3I9Q A;  3X20 B;  2GQI A;  2EWN A;  2RB6 A;  1IO6 A;  3J7A F;  1QWF A;  2CH4 A;  1PRM C;  2P84 A;  1OUL A;  4C5G A;  2OJ2 A;  5FLX E;  3OMG A;  4M7A G;  5GAN 8;  1WXU A;  3EHR A;  2RJC A;  4RTT A;  1Y0M A;  3LGF A;  3PTA A;  1OV3 A;  3JCM V;  3RMQ A;  3TU4 K;  1SF9 A;  4F17 A;  2RJD A;  1GL5 A;  1HJD A;  2O4X B;  3OYK A;  1JB0 E;  2D0N A;  4KUD K;  1B34 A;  4AG2 C;  3TRE A;  5CKD A;  2VXE A;  2RHY A;  3OS0 A;  3VS4 A;  2HD0 A;  4MZP A;  5GMK e;  2M0Y A;  4HVV A;  3CC2 T;  2F2W A;  2DVJ A;  1D0X A;  2K2M A;  2HBP A;  3SB2 A;  3M9Q A;  2A37 A;  2DJQ A;  3RR6 A;  4OVA A;  2CZ6 B;  1YIT Q;  3G6E A;  1Y96 A;  2LNH B;  3G4S Q;  1MGQ A;  1WIE A;  2MYS A;  4LD9 K;  1G8X A;  4A4G A;  2RI3 A;  1FMW A;  1LVK A;  1O75 A;  2M51 A;  2XG8 D;  1KQS A;  2EAY A;  3RER A;  1Z9Q A;  4ORZ A;  4PFO A;  4XU3 A;  2V1Q A;  4WF2 A;  1AHJ B;  5I2S A;  1JU5 C;  3A8M B;  2DTO A;  1YWP A;  2W0Z A;  3A8O B;  3HRU A;  5GAM h;  1Q82 C;  2IIM A;  3EGX B;  1JJ2 A;  2MIO A;  2JW4 A;  3C95 A;  4A4E A;  3S3O A;  1GCQ A;  1K9M U;  2ECZ A;  1QP2 A;  2QQB A;  2XDD A;  1K9A A;  3CXC P;  2KVQ G;  4OF1 A;  3WXM B;  3ZBD A;  5LJ3 h;  3MEU A;  2DXT A;  2E6Z A;  2ZGW A;  3HSB A;  2CT4 A;  5KYU B;  2JMC A;  3OYH A;  3M0S A;  1G3S A;  1FWZ A;  1UEB A;  5IHN A;  4J7F A;  2DM1 A;  3CC4 T;  1GXI E;  1VQP T;  3NTH A;  2CYZ B;  2E1H A;  4RTV A;  3SFM A;  2L8D A;  5KYY B;  3LW5 E;  1ZSZ B;  4JUV A;  2O9S A;  1Q82 R;  2DPP B;  4C92 B;  1SRM A;  2EQK A;  1FMK A;  2QDL A;  2DL4 A;  2LCS A;  3QDR B;  2VAS A;  2EKH A;  2K2V A;  1Y7X A;  1UJ0 A;  2K3Y A;  1NE8 A;  1YIJ Q;  1B7T A;  1MMA A;  2L89 A;  2JNG A;  2CH4 W;  4HT8 A;  3H6Z A;  3VUB A;  2CP7 A;  4CC7 A;  1AZE A;  3LWH A;  1V76 A;  1WA7 A;  4KGX B;  4E7J A;  1ZSZ C;  2DZ9 A;  4PJO B;  1K8A U;  3VS5 A;  4C92 C;  2HEQ A;  4FW2 A;  1UGS B;  4Z89 A;  1X6O A;  1VYV A;  1EIF A;  3SWN C;  1BIB A;  3OYB A;  4RCC A;  3PGG A;  2KXC A;  4CC4 B;  2HKQ B;  3CCQ T;  3MCA B;  2DBK A;  1KQS S;  5GAO p;  4TVR A;  1VQ4 Q;  4RKU E;  4RTZ A;  2RQT A;  1YJ9 T;  2BUD A;  2NWM A;  4PJO C;  2AKK A;  3OYY A;  1QCO A;  3CD6 T;  3UF4 A;  1T0J A;  2ABL A;  3CC2 A;  1TS9 A;  3CXC A;  1UGR B;  3MET A;  4BDY A;  2DE0 X;  4PL6 A;  1VQ9 A;  1KC8 U;  2DEQ A;  3ER0 A;  4PK4 A;  4M7A B;  2NUZ A;  2RPN A;  2KSS A;  4LUE A;  2OTJ Q;  3JSC A;  2RJE A;  2OTL Q;  3EG1 A;  3M0Q A;  2FZK B;  3QBY A;  3M58 A;  1UGQ B;  4X9C A;  4ZN3 A;  1NBE B;  2QK0 A;  2LQW A;  2QEX A;  2YLC A;  2GFU A;  5FW9 A;  1YJN Q;  3M55 A;  1VA7 A;  3CCS Q;  4M75 E;  3QJ6 A;  2BZ8 A;  3GNF B;  3CME A;  3PE0 A;  4ELZ C;  4NL2 A;  4M7A C;  2RF0 A;  5GAM e;  2XD0 A;  3DKM A;  1Q86 R;  1V29 B;  1LPL A;  1ZUU A;  3EFO B;  4AT1 B;  1S72 A;  4R55 A;  1YJW T;  3R6N A;  2FO0 A;  2JMA A;  1S1N A;  5A0L A;  3UPU A;  1I81 A;  2NUP A;  1UDL A;  1IB8 A;  5LJ3 e;  2W10 A;  2O88 A;  4UC4 A;  3L2V A;  3I5R A;  2JM8 A;  3FC3 A;  1YI2 T;  1EZZ B;  2DJZ A;  2MF2 A;  5C6S A;  1XQH A;  2FPD A;  3JCM f;  4HCC A;  3URG A;  2ZPB B;  3ME9 A;  4Y91 A;  2EJ9 A;  2DXB A;  3CC7 Q;  3ZL7 C;  3MP8 A;  4FYV B;  1TUC A;  4EMK A;  1WJR A;  4C92 D;  1VQO A;  1R8O B;  1WX6 A;  4JJC A;  2YUN A;  5LL6 S;  3MP1 A;  1VQL T;  3C4S A;  3PT9 A;  2GTJ A;  4M77 F;  2PVG B;  4GBQ A;  1NPR A;  1FXX A;  3O8V A;  3ZEH A;  2GGR A;  3EG9 B;  2FZC B;  3JCM J;  1N27 A;  3JB9 J;  2RK2 A;  2V8I A;  3CXC S;  3CQT A;  2D8J A;  3CCL A;  4JDS A;  2HDA A;  2J6K A;  2RQU A;  1M1K U;  4IUP A;  3OSS C;  1JEG A;  1WNL A;  3BW1 A;  4PJO D;  4J9E A;  1Q81 C;  4LDY A;  2VVK A;  3FEO A;  2D6F A;  1YNZ A;  3JB9 G;  2PQW A;  2E3H A;  5GAN 2;  1N8R U;  2HAX A;  5LJ5 d;  4KH1 B;  4BE2 A;  1VQK T;  4PJJ A;  1WXB A;  1VQ4 A;  4HCZ A;  1ZX6 A;  2LMJ A;  1SPK A;  3DB4 A;  5FRO A;  3CD6 A;  3SDZ A;  2EVR A;  5L23 A;  2X51 A;  5J26 A;  1X6B A;  2COY A;  2DKG A;  2KT1 A;  3PIP A;  2EBP A;  4M78 F;  2B86 A;  1X2K A;  4MZT A;  1BI0 A;  2P4T A;  2RA2 A;  4XU2 A;  1C1A A;  1Q81 R;  4IIO A;  3I55 T;  2OTJ A;  1X27 A;  4M7A D;  3QZ5 B;  2E6N A;  1TTH B;  3L42 A;  2EYX A;  2GQV A;  5HY6 A;  2OAW A;  4LDU A;  1E6G A;  1I5O B;  1JXM A;  1D0Z A;  1M2V B;  2RHU A;  1YJN A;  3BFM A;  4EDU A;  5GJV B;  5J3B A;  5L8R E;  1RAI B;  3ZFJ A;  2RHZ A;  4EMG A;  3RMS A;  5A2Q E;  2JS2 A;  5GMK l;  3OYM A;  2JTF A;  3HP9 A;  4YTL A;  3WVE B;  3HFO A;  3VRY A;  2Y90 A;  1YJW A;  2DTI A;  4KH0 B;  3QXE B;  4PJM A;  4ANJ A;  1FX7 A;  1TSF A;  4BB7 A;  1AZG B;  3M4G A;  2EYW A;  2CP0 A;  2J7I A;  1I0C A;  1NEB A;  2PU9 B;  4ZTJ A;  3TSZ A;  3HRS A;  2KRM A;  3QWX X;  1TH7 A;  3REA B;  5M9O A;  3GIB A;  1MNE A;  1T0H A;  2FRY A;  1VQM Q;  1H64 1;  4LE9 A;  3OY9 A;  5GAO l;  3A5Z B;  4RCB A;  3G71 A;  1VQ7 Q;  3DLM A;  1B07 A;  2RI5 A;  1KJW A;  4JLI A;  2MCN A;  4GLK A;  1Y57 A;  4XTZ A;  1G83 A;  2FPE A;  3G6E T;  1VQL A;  1X01 A;  2LJ1 A;  3GP8 A;  1XTD A;  1D09 B;  1MV3 A;  3PMT A;  3BY7 A;  3OS1 A;  3QPH A;  3V8L A;  1ZLM A;  2EGE A;  4OP0 A;  3VS0 A;  2KYM A;  4A53 A;  4M77 A;  3CBO A;  2VC8 A;  4RTW A;  3M53 A;  2LT4 A;  2RHI A;  2YDL A;  1I1J A;  3CCR Q;  2CSI A;  1WHG A;  4RTU A;  2DFU A;  4L59 A;  1BI1 A;  1VQK A;  4J9G A;  4RUG A;  4A63 B;  2BIV A;  2CT3 A;  2LNV A;  2QGG A;  2JVV A;  3OSV A;  2F1L A;  2CUB A;  3MEA A;  1UHF A;  1W1F A;  4C5H A;  3SD4 A;  1WHM A;  2KI7 A;  2M9U A;  2DXU A;  8ATC B;  4M77 E;  2BE7 D;  2CSQ A;  1YHQ T;  1DJ7 B;  1X75 C;  1ZBX A;  2PVO B;  2FL7 A;  1QCF A;  3OYI A;  1PD0 A;  4BI8 B;  5KYW A;  4CI0 C;  1K9M R;  3I55 A;  1FYN A;  3VRZ A;  4M75 G;  2D0Q B;  2J05 A;  3OYJ A;  4M78 A;  2PNI A;  1PKT A;  3G1J A;  3E2U A;  4QQG A;  4P5N A;  1D1C A;  1H92 A;  1K8A C;  2QA4 Q;  1TOV A;  1KG1 A;  4B6M A;  3E1S A;  1RAA B;  4E7K A;  2JJ9 A;  4GY5 A;  1C6V X;  2RH2 A;  4OB2 B;  5LJ3 g;  4LUD A;  4C92 F;  1AWJ A;  1T3S A;  5HKC A;  2FPF A;  2A7Y A;  2LRQ A;  4LDX A;  2AKL A;  2R5M A;  1K73 U;  2V8K A;  1UFF A;  1B34 B;  3OYD A;  2HZY A;  4M78 E;  2DD5 A;  4DBR A;  4JRK A;  3HTR A;  4E7L A;  1RAC B;  4PJO F;  1GBQ A;  1TUD A;  5CAI A;  1AWO A;  4A4K A;  2XI9 A;  3OW2 P;  4JZ3 A;  1M3C A;  2Z0W A;  1K8A R;  1W2B A;  1VQM A;  1Y96 B;  4AFQ C;  2RQR A;  2QI2 A;  5KE3 A;  1IHW A;  4JRI A;  5GAN j;  1EX4 A;  2JT4 A;  1D0Y A;  2CP6 A;  1VQ9 T;  5A0D A;  1I4K 1;  3R6O A;  5KYX A;  3JCM X;  5LJ5 j;  4X9D A;  1YIT T;  1N6A A;  2E5Q A;  4M4Z A;  4MML A;  4XU1 A;  4C8Q F;  1PM3 A;  1VQN Q;  3QDF A;  2DD4 A;  2O4X A;  3HFN A;  3U23 A;  4QQD A;  2RHX A;  3CCV A;  4II1 A;  1RAD B;  2O2O A;  3NTI A;  2QEX T;  3FIF A;  3X24 B;  4M7A F;  2LP5 A;  1WFW A;  5FU7 B;  1KC8 R;  3CME T;  4F7U B;  1RAH B;  1BI2 A;  5GAN h;  4R56 A;  1RAB B;  1VQ5 Q;  1NEG A;  2LZ6 B;  3T9N A;  2XK0 A;  4MDW A;  3FJP A;  4LXC A;  1TU0 B;  3TSW A;  1S72 T;  3EG2 A;  3MO8 A;  4RG8 A;  2E4H A;  3RIR A;  2MI6 A;  1RI9 A;  1WHK A;  2YRC A;  5FWB A;  2G6F X;  1GCQ C;  1BI3 A;  4DEY A;  3N5B B;  4OB0 B;  1M90 U;  2QAZ A;  2LQ8 A;  5FU7 C;  2HBW A;  3RUX A;  1YHQ A;  1WGS A;  5GAN 4;  2FEI A;  1QVP A;  2P4R A;  3JV3 A;  1OZ3 A;  3V7C A;  5C0M A;  3EGX A;  1OX8 A;  1M4Z A;  1VUB A;  2ROL A;  1NYF A;  1NZ9 A;  3H0H A;  2RNA A;  3VUZ A;  3OW2 A;  1YBY A;  1D1B A;  2JS0 A;  2E65 A;  3CC4 Q;  3SWN B;  5D7U A;  1VQP Q;  4A54 A;  1Q95 G;  1VQO T;  3JB9 D;  3CBM A;  2ZPH B;  4J6Y A;  2M0O A;  2COW A;  1MND A;  2LJ3 A;  3EG3 A;  5GAN f;  5KCO A;  2JM9 A;  1QMC A;  1RLP C;  2FVU A;  4BE0 A;  1M8V A;  5LJ5 f;  2HL3 A;  3A8H B;  1RUW A;  2RJF A;  3GLX A;  3LH0 A;  4BUG A;  1KHI A;  5GMK i;  3OYN A;  1UGV A;  3RKX A;  2K6D A;  1VQ6 Q;  3CCL T;  5CKB A;  1VIF A;  3M4Y A;  5KYY A;  3MHX A;  3CMA Q;  1PC0 A;  1IXD A;  1GFD A;  2AZV A;  2JTM A;  4C92 A;  2EW3 A;  2OX7 A;  2KQW A;  2K3B A;  4IUT A;  5KE2 A;  2ZPI B;  1JBM A;  3V7S A;  4EIK A;  5IH2 A;  1BYM A;  1MUZ A;  2GTO A;  2E12 A;  4M75 B;  3DB3 A;  4HA8 A;  1VQ4 T;  3S3N A;  4FYY B;  5DY9 A;  1QWE A;  2EJG A;  1KIK A;  3EFR A;  1TG0 A;  1M1K R;  1OYX A;  1WDX A;  4FT4 A;  5DLQ E;  3CCQ Q;  2DA9 A;  1ZBJ A;  3H8Z A;  4AFZ C;  3QUI A;  4PJO A;  2LCC A;  4EMH A;  1Q86 C;  3LX7 A;  1WLP B;  3VKI A;  1JJ2 S;  1UEC A;  2EYQ A;  1YJ9 Q;  1E6H A;  1N8R R;  2GNC A;  2DL5 A;  4AFU C;  2VB6 A;  1YIT A;  4XTW A;  3BDU A;  3M0P A;  3V7R A;  4M75 C;  3G4S A;  2DX1 A;  3E19 A;  4Z8A A;  2HQH A;  1UGP B;  1OOT A;  3JCM h;  5HK3 A;  1B3Q A;  1C0M A;  2H8H A;  2KNB B;  2OTJ T;  1KK7 A;  1X6G A;  2PTK A;  4J7I A;  2VYT A;  1W70 A;  2BKD N;  4JZ4 A;  1IRX A;  4RG2 A;  3KFV A;  3PVL A;  1YJN T;  3CCJ Q;  4C8Q A;  3UA7 A;  2XID A;  4CRI A;  3P8H A;  5I11 A;  3QWY A;  2CGH A;  2QTV A;  3EG0 A;  3CCS T;  2YRD A;  3OMC A;  5CR2 A;  3OQ5 A;  2RM4 A;  1WI7 A;  2GCX A;  2BTT A;  4BE1 A;  3UDC A;  4M7A A;  3VJP A;  3OW2 S;  4M7D F;  1ZQ1 A;  4GLM A;  4M77 G;  3BDL A;  2MOX A;  4AG1 C;  4LDV A;  1U8R A;  3E9G A;  1KQ1 A;  5DLO A;  3MP6 A;  2QQA A;  1CKB A;  2GF7 A;  3GBQ A;  1RAG B;  2QGF B;  4RMO A;  5IHK A;  4C8Q E;  4QVC A;  2DRK A;  4X1V A;  1M2O A;  3CPF A;  1QVF P;  2K5L A;  1VYT A;  1NLP C;  1FMV A;  1D1A A;  3OYF A;  1BB9 A;  2DRM A;  4PFZ A;  4OML A;  2HSP A;  1AT1 B;  3J80 E;  1KHC A;  3L2U A;  4KBM B;  3CC7 T;  3G71 T;  1YI2 Q;  1LOJ A;  1PNJ A;  2DIL A;  2I2L A;  1M3A A;  1SEM A;  4NL3 A;  2FG0 A;  4BD3 A;  4ZN1 A;  1YIJ A;  3EGD A;  3JB9 H;  2A08 A;  3L2R A;  1JXO A;  4J6W A;  4DA4 A;  1AD5 A;  4HXJ A;  2HL5 C;  3WVD B;  2VV5 A;  5HK0 A;  1PSF A;  4M78 G;  1NG2 A;  2XU8 A;  4JLG A;  4FYW B;  2BE9 B;  2QQR A;  2CZ7 B;  4ZGJ B;  3Q1J A;  3UAT A;  3CCM Q;  2EQM A;  1K1Z A;  4HT9 A;  4PJL A;  2L3Q A;  3I56 Q;  1R0C B;  1SG5 A;  2QAS A;  2LT1 A;  2FB7 A;  1T3L A;  1AWW A;  1XOV A;  4JRQ A;  4DOV A;  4M75 D;  3OA6 A;  3QSU A;  5GAM d;  1QP3 A;  1AEY A;  2PUK B;  2X3X D;  4FIB A;  3MEW A;  1KD1 U;  1UG1 A;  1H3Z A;  2COZ A;  4FU6 A;  2F5T X;  4E7I A;  3CCE Q;  5LJ3 d;  3QJY A;  2CP3 A;  2DNU A;  3LLR A;  2DL7 A;  4D8K A;  4Q5W A;  2OTL A;  3D7S B;  5DM7 R;  1U1S A;  1BCM A;  4XTV A;  3JCM e;  1RAE B;  3H0I A;  1YCY A;  1QVF A;  1BKB A;  1SRL A;  3A98 A;  4BI4 A;  4XQ3 A;  1N5Z A;  3PIO A;  2XKO C;  2ZPF B;  1HD3 A;  2DER A;  3IQL A;  1OZ2 A;  3NFC A;  3CCS A;  1WZO A;  1MMD A;  4JJD A;  3VYH B;  2F5K A;  2PZ1 A;  2C0T A;  3KBG A;  2XIC A;  1MHN A;  3OS2 A;  4JJB A;  2MAM A;  1MMG A;  4XTY A;  3X28 B;  4FT2 A;  3CEY A;  5GMK j;  1RAF B;  1WQ7 A;  2BZX A;  3JCM Q;  2X4J A;  2R58 A;  1M2V A;  1ABQ A;  2ZPE B;  5CO7 A;  5GAO q;  4M7D A;  5IXF A;  3RDV A;  4RTY A;  2QYZ A;  4OMQ A;  2G3R A;  3FRN A;  1I07 A;  2XHC A;  1VYU A;  4B9W A;  5EG2 A;  1M30 A;  1Z9Z A;  2DBM A;  2X4W A;  3LGL A;  2ENM A;  2HNI A;  3LH5 A;  1IGQ A;  1VQM T;  1K73 R;  3EH1 A;  1QLY A;  3CC7 A;  3SHW A;  1TWB A;  1NPP A;  1VQ7 T;  4Y28 E;  4JS5 A;  2M02 A;  5CQX A;  2FYK A;  2OAU A;  4JJN K;  1ABO A;  1W6X A;  2FZG B;  2ZZD A;  1G3T A;  3VS6 A;  4M77 B;  3M0T A;  4M7D E;  4OGE A;  1IGU A;  4D8D A;  3RNJ A;  2LDM A;  1WYX A;  3CCV T;  2NUT B;  4IIM A;  1X43 A;  3VV0 A;  1QVG P;  3G6E Q;  1WPY A;  1K9M C;  1Q7Y U;  1YP5 A;  4CC2 A;  2JTE A;  2YWW A;  2EYZ A;  2MWO A;  3RES A;  4C5E A;  4OMM A;  2LJ0 A;  4N0A C;  2DYI A;  2EQU A;  3L2W A;  3I56 A;  4M77 C;  1K76 A;  1W2B P;  3NMZ C;  4OMO A;  1O9S A;  2GBQ A;  4OMP A;  1IRE B;  1QVF S;  2RD1 A;  1D3B B;  9ATC B;  4F7U F;  4CC3 A;  5IAY A;  1HSQ A;  3ASK A;  3PMI A;  3HL8 A;  2KYB A;  1M8M A;  4O5V A;  2HSE B;  3EAE A;  4MMK A;  3CCE A;  2YHT A;  2V1R A;  2DET A;  4XTX A;  3FDR A;  5AT1 B;  1VQ8 Q;  2K5F A;  1XJW B;  1XNI A;  3MJX A;  3OBW A;  2I0N A;  1QCN A;  4MZM A;  3HPW A;  1K0S A;  1UTI A;  2DXC A;  2A28 A;  2IG0 A;  3M0R A;  4OB3 B;  1M90 R;  2K4Y A;  5GAN g;  1U5S A;  1X69 A;  2VWF A;  3RKW A;  4HCB A;  3GPL A;  3QII A;  2DLP A;  2H3E B;  5LJ5 g;  2C0O A;  2QA4 T;  4FSX A;  4M78 C;  2HMA A;  3GF5 A;  4N4H A;  2QTX A;  2LX7 A;  4E7H A;  4EPC A;  3O5Z A;  1LNX A;  4BDZ A;  5FU6 B;  2P0Q A;  3FJ5 A;  1E7O A;  3M5A A;  4VUB A;  4C8Q G;  3CCU Q;  5IT9 E;  2J6O A;  2ED1 A;  1W4S A;  2YT6 A;  1ZA2 B;  2WAC A;  3MKD A;  2IPO B;  1QVG A;  2SEM A;  1UB4 A;  4IKF A;  4ELY C;  4IUQ A;  2KRN A;  2R57 A;  2EKO A;  2J6F A;  4F14 A;  3OYG A;  3GNG A;  5FU6 C;  1KC8 C;  1OQK A;  5CKH A;  5KYX B;  2RMO A;  4QVZ A;  2C06 A;  4ZGD B;  3NTK A;  1VQ7 A;  1RI0 A;  2AIR B;  3CPW P;  1HK9 A;  2AHJ B;  4J9F A;  4NS5 A;  2E10 A;  4M75 F;  2L5Q A;  4A4H A;  4D6W A;  5IHI A;  4QT7 A;  3M56 A;  3VS1 A;  3M57 A;  4QVD A;  1NJI U;  3G4S T;  1PG5 B;  2CDT A;  4KGZ B;  3VS3 A;  3CC2 Q;  1F1B B;  5GAM j;  4KGV B;  1VQN T;  4M77 D;  2NYS A;  2CKK A;  1N9R A;  3QO3 A;  6AT1 B;  3RBB B;  2J06 A;  3NPF A;  3FLG A;  1R77 A;  1Y07 A;  4J9C A;  1VQ9 Q;  2LC4 A;  4LDW A;  1OPL A;  2X9H A;  2KXD A;  3L2Z A;  5LJ3 j;  2YUQ A;  2K79 A;  2K9G A;  1KFZ A;  2ESW A;  2BZY A;  2H3J A;  3CCR A;  2ROT A;  1BU1 A;  2JN0 A;  2M16 A;  4LNP A;  2QEX Q;  1JO8 A;  4ZNX A;  3OS5 A;  1VQ5 T;  1QW1 A;  2X4Y A;  4BI3 A;  5LJ5 h;  1BK2 A;  2X35 A;  2ZCF B;  4MDX A;  4DBF A;  1ZUK A;  3CME Q;  1G3W A;  4J5Y A;  2EPD A;  3THK A;  1OI1 A;  3JCM g;  4IUU A;  3S3M A;  2KY9 A;  1S72 Q;  3QHS A;  7AT1 B;  4J83 A;  4XTU A;  1H3H A;  4F7U A;  2EJF A;  1A0N B;  5FRM A;  2FRW A;  5KCH A;  1CKA A;  4M78 D;  1VQ8 A;  2MPX C;  1ZSG A;  5FWC A;  1QVG S;  4Z02 A;  2R5A A;  4R0K A;  4QW2 A;  1LCK A;  5GAN 3;  2E41 A;  1M1K C;  5KYU A;  2QA4 A;  1ZHI A;  1YIJ T;  1SHF A;  3JAM E;  3CPW A;  4ZGE B;  2VGM A;  1TUG B;  1Y71 A;  2KAF A;  4BAC A;  1W2B S;  5CVI A;  1H8K A;  1U1T A;  2KDS A;  1X2Q A;  1N8R C;  3F70 A;  4F7U E;  1VQO Q;  3OB9 A;  4FSS A;  3HRT A;  1GRI A;  5J39 A;  2F69 A;  1VQ6 T;  5GAM f;  3CCU A;  3OYL A;  1ZSZ A;  2DF6 A;  4OB1 B;  4E47 A;  3CMA T;  2D1X A;  1QKX A;  4N4G A;  3TEE A;  3JCM W;  3C12 A;  1YWO A;  2ZPG B;  3MPU B;  3QYH B;  3SWN A;  1KD1 C;  1PSE A;  3VS7 A;  1OU8 A;  3CCL Q;  4HVW A;  1GBR A;  1K4U S;  2RQW A;  5LJ3 f;  3KXT A;  2PUO B;  5CIU A;  1PKS A;  5I2M A;  1OX9 A;  4E7S A;  1NM7 A;  4J6X A;  3E9F A;  5KYN A;  4DQ2 A;  5IXB A;  3OYE A;  4M7D G;  2HQE A;  2DL3 A;  1RLQ C;  1KQ2 A;  3X25 B;  4ZTF A;  4NOY A;  2L3P A;  2KEA A;  3JCM b;  4C92 E;  2KRO A;  4JRP A;  3S6W A;  3CD6 Q;  1J3T A;  2LQN A;  3H9N A;  2A3L A;  4C8Q B;  1VQN A;  2RI2 A;  2OTL T;  4M75 A;  1I5L A;  5D6X A;  3M0U A;  3A8L B;  1AWX A;  1KD1 R;  1OEB A;  2L3R A;  1UHC A;  5GAO r;  3H41 A;  3CCJ T;  4PJO E;  4ME7 A;  1NLO C;  4X34 A;  2RO0 A;  2DVE A;  2JUF A;  2NUP B;  2VUB A;  1CSK A;  2F2V A;  4JS4 A;  1RL2 A;  4C8Q C;  1VQ5 A;  5GAN 7;  1OU9 A;  2SRC A;  5GJW B;  1KSW A;  5GAN e;  4KRT A;  1ACM B;  3EFS A;  1VOM A;  2C0I A;  2DO3 A;  2EQJ A;  2MWP A;  4DOW A;  5CQY A;  4HCK A;  5LJ5 e;  2RK1 A;  5HCK A;  4KT0 E;  4E7Z A;  5D6W A;  2CRE A;  3X26 B;  3CPW S;  4A4F A;  3I5S A;  3M54 A;  1PWT A;  1YJW Q;  2V8J A;  5A0G A;  2DMO A;  4F16 A;  2D9T A;  2A0F B;  4FW1 A;  5GAN 6;  5CK9 A;  2OI3 A;  4EMK B;  4PFP A;  1Q82 U;  4QKU A;  1WHL A;  2ATC B;  2K5I A;  4OMN A;  3PNW C;  3EGD B;  1G2B A;  3EFO A;  1IZ6 A;  4M7A E;  2X4X A;  4RTX A;  4J9B A;  1QQJ A;  4FCY A;  3JB9 I;  3CC4 A;  4N4I A;  3MEV A;  1VQP A;  2O01 E;  4FL6 A;  3V8J A;  1WQW A;  3V8K A;  2E64 A;  1Q7Y C;  5CKF A;  1M27 C;  1PCX A;  2E70 A;  4FM4 B;  3G71 Q;  4EMK C;  5GAN 5;  3PFS A;  1WJS A;  2L3S A;  2CZ0 B;  4LN2 A;  1BIA A;  3OBY A;  4OGC A;  4AMC A;  3NGP A;  2DZC A;  1JQQ A;  3REB B;  1VQ6 A;  1VQL Q;  1MMN A;  2DTH A;  1SKU B;  2JXB A;  4J9I A;  3A1P A;  3CMA A;  1VIE A;  4J9D A;  4LD6 A;  2EFI A;  4OMF B;  3EGU A;  3CCM T;  1YFN A;  4JPB W;  3VYG A;  3I56 T;  4L6V 5;  2V26 A;  2DEU A;  4IUV A;  3JRZ A;  2Y4X A;  2CP5 A;  4J8O A;  1LJO A;  1M1G A;  4XK8 E;  2NLU A;  2KBT A;  2LTO A;  3EG9 A;  3J81 E;  2KT8 A;  1PD1 A;  5D6Y A;  5GAN d;  3OYA A;  3CCQ A;  4E2F B;  1Q7Y R;  4XU0 A;  1VQK Q;  4C0F A;  1V1C A;  2KGT A;  2X3W D;  4E6R A;  5I21 A;  3G7Z A;  1YJ9 A;  2XDB A;  1WHJ A;  1MV0 B;  1K0X A;  3CCE T;  2AT1 B;  3OYC A;  3QKJ A;  2CUD A;  1I8F A;  8AT1 B;  5EC7 A;  1TXQ A;  2PVD B;  4FYX B;  5FRN A;  3HKS A;  1WXT A;  2JOY A;  3M59 A;  4C8Q D;  1SSH A;  1NYG A;  4Y92 A;  1G5V A;  2VXF A;  2KRS A;  3UWN A;  3L2Q A;  3INZ A;  3I35 A;  2P0K A;  1M1F A;  4DBH A;  2P0P A;  3CCJ A;  2YXY A;  1YCS B;  2DIQ A;  2DK3 A;  3I55 Q;  1K73 C;  2FHD A;  2KR3 A;  2LVM A;  4ESR A;  2O31 A;  1Q86 U;  1UUE A;  2D8H A;  1UE9 A;  2O9V A;  3NHN A;  3JB9 F;  2ED0 A;  2E3I A;  4C0Z A;  1JRI A;  3P8D A;  3LWI A;  4M7D B;  3PVQ A; 
#chains in the Genus database with same CATH homology
 5A0L A;  3UPU A;  3GPL A;  1I81 A;  3QII A;  5CCA A;  5LJ5 g;  2QA4 T;  4FSX A;  1M4Z A;  4M78 C;  1VUB A;  4KUL A;  5LJ3 e;  4HKE A;  3GF5 A;  4XAX B;  1NZ9 A;  4N4H A;  4UC4 A;  3VU3 C;  3L2V A;  2QTX A;  2WSE E;  3VUZ A;  2K3X A;  3OW2 A;  4E7H A;  3FC3 A;  1YBY A;  2LX9 A;  4EPC A;  1YI2 T;  4BDZ A;  1LNX A;  2E65 A;  4C0G A;  3SWN B;  2DJZ A;  2MF2 A;  5FU6 B;  5C6S A;  2P0Q A;  5AYF A;  1XQH A;  4A54 A;  4ATO A;  1G3Y A;  3M5A A;  5GAO n;  1VQO T;  4VUB A;  4C8Q G;  5GMK m;  5IT9 E;  4PKC C;  3JB9 D;  3JCM f;  1W4S A;  4HCC A;  3CBM A;  3URG A;  2ZPH B;  4J6Y A;  3P8B B;  3JCM c;  2M0O A;  2K57 A;  2QDY B;  2ZPB B;  4M7D C;  5GAN f;  3ME9 A;  2WAC A;  4Y91 A;  5KCO A;  1NJI C;  2EJ9 A;  2DXB A;  1QVG A;  1UB4 A;  2FVU A;  4BE0 A;  3L1A A;  1M8V A;  5LJ5 f;  2EIF A;  3MP8 A;  1YI2 A;  4IKF A;  3A8H B;  4ELY C;  2RJF A;  3GLX A;  3LH0 A;  2R57 A;  1KHI A;  2QQS A;  3QYG B;  4IUQ A;  4BUG A;  1WJR A;  3RKX A;  4C92 D;  4EMK A;  3OYN A;  2EKO A;  3CCL T;  1VQO A;  5CKB A;  1R8O B;  4F7U G;  3OYG A;  3DLL A;  1VIF A;  4QQ6 A;  3M4Y A;  3GNG A;  3MHX A;  5LL6 S;  5FU6 C;  3MP1 A;  5GMK h;  1KC8 C;  1VQL T;  3C4S A;  3PT9 A;  4V2S A;  5CKH A;  4M77 F;  2JTM A;  2PVG B;  4C92 A;  1NPR A;  1FXX A;  3O8V A;  4QVZ A;  2C06 A;  3ZEH A;  2KQW A;  4IUT A;  5KE2 A;  4B9X A;  4ZGD B;  3NTK A;  3JCM J;  1N27 A;  2ZPI B;  1JBM A;  3V7S A;  1RI0 A;  3JB9 J;  2RK2 A;  1VQ7 A;  1P92 A;  4IUR A;  1BYM A;  5KH6 A;  1HK9 A;  2AHJ B;  2V8I A;  4NS5 A;  3A8G B;  2E10 A;  4M75 F;  3CXC S;  3CCL A;  2L5Q A;  4JDS A;  2E12 A;  2MMP A;  3DB3 A;  4M75 B;  5GAO m;  4HA8 A;  3JCM P;  1M1K U;  1VQ4 T;  3S3N A;  4C5I A;  2CZ1 B;  4IUP A;  4A4H A;  4D6W A;  5DY9 A;  2HQX A;  3OSS C;  1WNL A;  2EJG A;  3BW1 A;  4PJO D;  1Q81 C;  3EFR A;  3M56 A;  3JCM d;  4LDY A;  3M57 A;  4QVD A;  1NJI U;  1WJQ A;  3G4S T;  1OYX A;  4FT4 A;  5DLQ E;  4KUI A;  3FEO A;  2D6F A;  5C0M A;  3JB9 G;  2PQW A;  5GAN 2;  5GAM j;  3CCM A;  1N8R U;  3H8Z A;  3CCR T;  1VQN T;  4PJO A;  3QUI A;  4M77 D;  2LCC A;  3GOX A;  2M1H A;  2CKK A;  4EMH A;  1N9R A;  3QO3 A;  3LX7 A;  1Q86 C;  3VKI A;  5LJ5 d;  3C94 A;  1M90 C;  2EYQ A;  1JJ2 S;  4BE2 A;  2VGN A;  1VQK T;  3FLG A;  1Y07 A;  2KMT A;  2LC4 A;  4N0A A;  1VQ4 A;  4HCZ A;  4LDW A;  1YIT A;  1SSF A;  3DB4 A;  5FRO A;  4XTW A;  2DIG A;  3BDU A;  3V7R A;  4M75 C;  3G4S A;  3E19 A;  4C92 G;  3L2Z A;  3CD6 A;  5LJ3 j;  3SDZ A;  1UGP B;  2KK4 A;  3JCM h;  5HK3 A;  2H3J A;  2OTJ T;  3CCR A;  5J26 A;  2JN0 A;  2DKG A;  2M16 A;  2XDP A;  4J7I A;  2VYT A;  2IVW A;  2BKD N;  3OS5 A;  1VQ5 T;  1QW1 A;  2X4Y A;  4RG2 A;  4BI3 A;  5LJ5 h;  3PIP A;  1Q81 U;  2X35 A;  4M78 F;  4C0D B;  2ZCF B;  1YJN T;  4M78 B;  4PLI A;  4MDX A;  4C8Q A;  3RKY A;  1M9S A;  3FB9 A;  5GMK i;  3TCJ A;  2XID A;  4CRI A;  1G3W A;  1BI0 A;  2WSF E;  2P4T A;  2RA2 A;  3P8H A;  4MZT A;  4XU2 A;  2CGH A;  3I55 T;  2OTJ A;  2LQK A;  3CCS T;  4J5Y A;  4M7A D;  2QQ9 A;  3OMC A;  4L5G A;  4PJO G;  3OQ5 A;  3QZ5 B;  5CR2 A;  2RM4 A;  2E6N A;  2LCL A;  3L42 A;  1VQ8 T;  2GCX A;  2GQV A;  1N9S A;  1OI1 A;  5HY6 A;  3JCM g;  4IUU A;  4LDU A;  4BE1 A;  3S3M A;  2KY9 A;  1D3B A;  4PNO A;  3UDC A;  4M7A A;  3QHS A;  3VJP A;  3OW2 S;  4M7D F;  2RHU A;  4PLL A;  1ZQ1 A;  3QZ9 B;  3BFM A;  4J83 A;  4M77 G;  3BDL A;  4XTU A;  2GFA A;  5CKE A;  4O6J A;  4BY6 B;  4EDU A;  1M5Q 1;  2EJF A;  4F7U A;  2CS7 A;  4LDV A;  5FRM A;  3AHU A;  5J3B A;  1U8R A;  3E9G A;  5L8R E;  1HXD A;  5KCH A;  4M78 D;  1KQ1 A;  4C0D C;  3ZFJ A;  2RHZ A;  2DAQ A;  3MP6 A;  2QQA A;  3RMS A;  3UT1 A;  4EMG A;  5DLO A;  5A2Q E;  1VQ8 A;  2GF7 A;  5GMK l;  2YLB A;  3LYI A;  4RMO A;  3OYM A;  3CBP A;  2JTF A;  3HP9 A;  5GAM g;  1QVG S;  4YTL A;  2JZ2 A;  4Z02 A;  2R5A A;  2B8A A;  3HFO A;  3WVE B;  4C8Q E;  4QVC A;  2Y90 A;  2YRV A;  4QW2 A;  1YJW A;  3KUF A;  2DTI A;  5IN1 A;  3QXE B;  3QG1 A;  5GAN 3;  2WSC E;  1FX7 A;  2E41 A;  3CPF A;  1M1K C;  4BB7 A;  2K5L A;  2QA4 A;  3CCU T;  4M7D D;  1ZHI A;  3OYF A;  1YIJ T;  3M4G A;  3CPW A;  3JAM E;  4ZGE B;  2QXF A;  4BY6 C;  2Y4Y A;  2VGM A;  3HHT B;  3X20 B;  1Y71 A;  2EWN A;  2KAF A;  2RB6 A;  3J80 E;  4BAC A;  1KHC A;  1W2B S;  5CVI A;  4KBM B;  3L2U A;  3J7A F;  1U1T A;  2PU9 B;  3G71 T;  3CC7 T;  2KDS A;  4ZTJ A;  3HRS A;  1N8R C;  3F70 A;  1LOJ A;  4C5G A;  5FLX E;  4F7U E;  3OMG A;  2I2L A;  4M7A G;  3OB9 A;  5GAN 8;  5M9O A;  1TH7 A;  3HRT A;  3GIB A;  5J39 A;  4NL3 A;  2F69 A;  2RJC A;  1VQ6 T;  4BD3 A;  5GAM f;  3CCU A;  3OYL A;  4ZN1 A;  3LGF A;  1YIJ A;  4OB1 B;  3JB9 H;  3PTA A;  3L2R A;  1H64 1;  4J6W A;  4E47 A;  4DA4 A;  3CMA T;  3JCM V;  3OY9 A;  4N4G A;  3TEE A;  3JCM W;  3WVD B;  3RMQ A;  5GAO l;  3A5Z B;  4RCB A;  3TU4 K;  3C12 A;  2ZPG B;  3SWN A;  3G71 A;  3QYH B;  2RJD A;  2VV5 A;  5HK0 A;  3DLM A;  1PSF A;  1KD1 C;  4M78 G;  2RI5 A;  1PSE A;  2XU8 A;  4JLI A;  2O4X B;  3OYK A;  1JB0 E;  5LJ3 f;  4JLG A;  4KUD K;  1YJN A;  1B34 A;  3KXT A;  4GLK A;  4XTZ A;  2PUO B;  2QQR A;  5CIU A;  3G6E T;  3TRE A;  1VQL A;  5I2M A;  2CZ7 B;  5CKD A;  2VXE A;  2RHY A;  4ZGJ B;  3OS0 A;  1X01 A;  3Q1J A;  3GP8 A;  1XTD A;  4J6X A;  2EQM A;  2HD0 A;  4MZP A;  5GMK e;  3E9F A;  4DQ2 A;  4HT9 A;  3OYE A;  3CC2 T;  2HQE A;  4M7D G;  2HBP A;  3SB2 A;  2LT1 A;  3M9Q A;  1KQ2 A;  2FB7 A;  3PMT A;  3X25 B;  3BY7 A;  4ZTF A;  1XOV A;  3OS1 A;  3QPH A;  3V8L A;  4NOY A;  4OP0 A;  4JRQ A;  4OVA A;  2CZ6 B;  4A53 A;  4DOV A;  3G6E A;  1Y96 A;  4C92 E;  3JCM b;  4M77 A;  4JRP A;  3CBO A;  1MGQ A;  2VC8 A;  4M75 D;  3M53 A;  3S6W A;  3OA6 A;  2LT4 A;  5GAM d;  3QSU A;  2RHI A;  1QP3 A;  4LD9 K;  4A4G A;  2PUK B;  4FIB A;  2A3L A;  2RI3 A;  3MEW A;  4C8Q B;  1KD1 U;  1O75 A;  2XG8 D;  1KQS A;  1VQN A;  2EAY A;  2RI2 A;  2OTL T;  3RER A;  4M75 A;  1I5L A;  5D6X A;  1H3Z A;  4L59 A;  3A8L B;  1BI1 A;  4FU6 A;  2F5T X;  4XU3 A;  4E7I A;  1VQK A;  4WF2 A;  1AHJ B;  2L3R A;  5I2S A;  5LJ3 d;  3QJY A;  2BIV A;  5GAO r;  3A8M B;  2LNV A;  2JVV A;  3LLR A;  2DTO A;  3CCJ T;  3OSV A;  4PJO E;  4ME7 A;  3A8O B;  3HRU A;  3MEA A;  5GAM h;  4X34 A;  1Q82 C;  4Q5W A;  2RO0 A;  2OTL A;  2DVE A;  2JUF A;  2VUB A;  4C5H A;  1JJ2 A;  3SD4 A;  4JS4 A;  5DM7 R;  1U1S A;  2M9U A;  2DXU A;  4XTV A;  3JCM e;  3C95 A;  1RL2 A;  1YCY A;  4C8Q C;  4A4E A;  4M77 E;  5GAN 7;  3S3O A;  1BKB A;  1YHQ T;  1VQ5 A;  1DJ7 B;  1X75 C;  1K9M U;  1QVF A;  4BI4 A;  1QP2 A;  3EFS A;  4XQ3 A;  5GAN e;  2QQB A;  1ZBX A;  2XKO C;  2DO3 A;  2XDD A;  3PIO A;  2PVO B;  2FL7 A;  2ZPF B;  2EQJ A;  2MWP A;  4DOW A;  2KVQ G;  3OYI A;  4BI8 B;  4OF1 A;  3WXM B;  3ZBD A;  5CQY A;  5LJ3 h;  4CI0 C;  5LJ5 e;  2RK1 A;  3MEU A;  2DXT A;  1OZ2 A;  3I55 A;  3NFC A;  4KT0 E;  3CCS A;  5D6W A;  3VYH B;  2E6Z A;  2F5K A;  2ZGW A;  4M75 G;  3HSB A;  3X26 B;  3CPW S;  2D0Q B;  3OYH A;  1G3S A;  4A4F A;  3KBG A;  1FWZ A;  3OYJ A;  4M78 A;  3M54 A;  2XIC A;  1UEB A;  1MHN A;  3OS2 A;  2V8J A;  5A0G A;  2D9T A;  4J7F A;  3CC4 T;  4QQG A;  4P5N A;  2MAM A;  5GAN 6;  5CK9 A;  1GXI E;  1VQP T;  3NTH A;  4XTY A;  1K8A C;  2CYZ B;  3X28 B;  4EMK B;  1KG1 A;  1Q82 U;  4FT2 A;  2E1H A;  3E1S A;  4E7K A;  3CEY A;  5GMK j;  1WQ7 A;  2K5I A;  2RH2 A;  2L8D A;  4GY5 A;  4OB2 B;  3SFM A;  5LJ3 g;  3JCM Q;  3LW5 E;  3PNW C;  4JUV A;  2X4J A;  1IZ6 A;  2R58 A;  4C92 F;  2DPP B;  2ZPE B;  5CO7 A;  4M7A E;  4C92 B;  5GAO q;  4HCB A;  4M7D A;  2EQK A;  5HKC A;  2X4X A;  2A7Y A;  3QDR B;  3JB9 I;  2G3R A;  2LRQ A;  4N4I A;  3CC4 A;  2K2V A;  1Y7X A;  3FRN A;  2K3Y A;  3MEV A;  1VQP A;  2XHC A;  2R5M A;  1K73 U;  1NE8 A;  2O01 E;  4LDX A;  2V8K A;  4FL6 A;  4B9W A;  5EG2 A;  3V8J A;  1WQW A;  3V8K A;  1B34 B;  3OYD A;  2E64 A;  2X4W A;  5CKF A;  3LGL A;  1Q7Y C;  2HNI A;  2L89 A;  4FM4 B;  2E70 A;  2JNG A;  1VQM T;  4M78 E;  4EMK C;  2DD5 A;  3CC7 A;  5GAN 5;  3PFS A;  4HT8 A;  1WJS A;  3H6Z A;  2CZ0 B;  4JRK A;  3VUB A;  1BIA A;  1NPP A;  3OBY A;  4OGC A;  4Y28 E;  3LWH A;  4JS5 A;  4E7L A;  1VQ7 T;  4E7J A;  5CQX A;  2DZ9 A;  2DZC A;  2FYK A;  2OAU A;  4PJO F;  4JJN K;  4PJO B;  5CAI A;  1K8A U;  4C92 C;  4A4K A;  1VQ6 A;  2XI9 A;  1UGS B;  1X6O A;  2DTH A;  3SWN C;  1EIF A;  1BIB A;  3OYB A;  4RCC A;  3CMA A;  1VIE A;  2ZZD A;  1G3T A;  3PGG A;  2EFI A;  4LD6 A;  1Y96 B;  4OMF B;  1VQM A;  1W2B A;  4M77 B;  4M7D E;  4OGE A;  2QI2 A;  3CCQ T;  5KE3 A;  3MCA B;  3CCM T;  4JRI A;  2LDM A;  1KQS S;  3VYG A;  5GAN j;  3I56 T;  4L6V 5;  3CCV T;  5GAO p;  4TVR A;  3VV0 A;  4RKU E;  4IUV A;  3JRZ A;  2Y4X A;  1YJ9 T;  1VQ9 T;  5A0D A;  1I4K 1;  3R6O A;  1WPY A;  1K9M C;  3JCM X;  5LJ5 j;  2BUD A;  4X9D A;  4J8O A;  1Q7Y U;  1YIT T;  1LJO A;  1M1G A;  4XK8 E;  1N6A A;  2NLU A;  4PJO C;  2LTO A;  2E5Q A;  3OYY A;  4MML A;  4XU1 A;  3J81 E;  3CD6 T;  4C8Q F;  2MWO A;  5D6Y A;  3RES A;  4C5E A;  5GAN d;  3OYA A;  3CCQ A;  2DD4 A;  2O4X A;  3HFN A;  4N0A C;  3CC2 A;  4XU0 A;  2EQU A;  3CXC A;  1UGR B;  4QQD A;  2RHX A;  3MET A;  4C0F A;  4M77 C;  3I56 A;  4II1 A;  3L2W A;  3CCV A;  5I21 A;  4BDY A;  3G7Z A;  4PL6 A;  3NTI A;  1YJ9 A;  2XDB A;  1O9S A;  2QEX T;  1VQ9 A;  1QVF S;  1IRE B;  3CCE T;  1KC8 U;  2RD1 A;  3FIF A;  3OYC A;  3X24 B;  2DEQ A;  3QKJ A;  4M7A F;  3ER0 A;  1D3B B;  4M7A B;  1I8F A;  2KSS A;  4F7U F;  3JSC A;  2RJE A;  5FU7 B;  5IAY A;  3CME T;  4F7U B;  2PVD B;  5FRN A;  3HKS A;  3QBY A;  1BI2 A;  3ASK A;  3M58 A;  1UGQ B;  3HL8 A;  3PMI A;  4X9C A;  2JOY A;  5GAN h;  3M59 A;  4ZN3 A;  4R56 A;  4C8Q D;  3T9N A;  2XK0 A;  2QEX A;  2YLC A;  2GFU A;  3FJP A;  4MDW A;  4O5V A;  3EAE A;  4MMK A;  2VXF A;  3CCE A;  1G5V A;  3M55 A;  3UWN A;  3L2Q A;  1S72 T;  2YHT A;  3RIR A;  3MO8 A;  4RG8 A;  3INZ A;  2P0K A;  1M1F A;  2MI6 A;  2P0P A;  3CCJ A;  2DIQ A;  2DK3 A;  4XTX A;  1K73 C;  4M75 E;  3FDR A;  3QJ6 A;  2FHD A;  3GNF B;  2LVM A;  3CME A;  2K5F A;  4ELZ C;  1BI3 A;  4NL2 A;  1Q86 U;  1XNI A;  4M7A C;  3N5B B;  3OBW A;  4OB0 B;  1M90 U;  2LQ8 A;  4MZM A;  5FU7 C;  3HPW A;  5GAM e;  3RUX A;  2XD0 A;  3DKM A;  2DXC A;  2IG0 A;  1YHQ A;  1WGS A;  3JB9 F;  5GAN 4;  2HAX A;  1V29 B;  4OB3 B;  2K4Y A;  1QVP A;  4C0Z A;  5GAN g;  4R55 A;  1S72 A;  1JRI A;  3P8D A;  3LWI A;  1YJW T;  4M7D B;  1OZ3 A;  3V7C A;  3RKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...