4PJOG

Minimal u1 snrnp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
KAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 10
structure length 74
sequence length 74
chains with identical sequence U, g, u
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoG00
2DEQA 2I2LA 4M78C 4M78F 4X9DA 5GANg 2K57A 4C8QC 4C8QF 5GAOm 4M7DE 1Y96B 4M77F 4M77C 4A53A 3JCMP 3JCMV 4M75D 5GMKj 5DY9A 5LJ5h 4C92E 5LJ5d 5LJ3j 3BDUA 4J5YA 3RKYA 4QVCA 4M75G 4M7AA 4M75B 4M78E 4PNOA 4C8QE 5GMKi 4XTYA 3JCMW 3JB9G 2JN0A 1D3BB 3EFSA 4RCCA 2RB6A 4XTXA 1M5Q1 4M77E 4XTWA 4PJOA 4C92F 3V8JA 1WPYA 4F7UB 2VC8A 4MMLA 3PGGA 2EJFA 1JBMA 2E41A 3QO3A 3JB9J 4M7DA 1B34A 4NL2A 5GANj 5LJ5f 3JCMc 4N0AA 1N9RA 3QSUA 2FB7A 4EMGA 4M75C 3QUIA 5GMKe 1LJOA 4NOYA 1LOJA 2DXTA 2RM4A 4X9CA 3JCMb 3JCMJ 4XU1A 4M7AD 3HSBA 3BW1A 4WF2A 3JB9F 5LJ5g 5GAN4 4F7UF 2VXFA 3RIRA 4M78A 5CAIA 1U1SA 2E64A 4M7AG 4PJOD 3RERA 4XU3A 4XQ3A 4XTVA 3HFNA 1LNXA 4M7AB 2YLBA 4M77A 5I21A 2E1HA 2CGHA 3FJPA 4M75E 1N9SA 4JUVA 4MMKA 5GAMe 4M7DD 3JCMe 4PJOG 3SWNA 5GAMh 1I81A 4DQ2A 4PJOB 5GAOl 4C92D 1I4K1 5GANe 1WQ7A 5GAOn 4EMKA 4F7UE 4M7DG 1KQ1A 2FYKA 4XU0A 1B34B 1M8VA 4M7AC 1U1TA 4A54A 2HNIA 3FIFA 4M75F 4M78D 1HXDA 4C92A 3RUXA 4C8QD 2EJ9A 5GAN2 5LJ3e 3RKWA 5GMKh 5LJ5j 5LJ3h 3BFMA 3FB9A 4M77D 4M78G 3JB9I 2YLCA 3L1AA 5GAN8 3JB9H 3QHSA 1YCYA 2VXEA 5GAMf 3GIBA 4C8QA 5GAN5 2DZ9A 4M77G 2DZCA 1I5LA 1H641 3JCMX 1D3BA 3EFRA 2E10A 4N0AC 5GAN3 4M7AE 4OP0A 2QTXA 1I8FA 4F7UA 4JRIA 5GAOr 4HT9A 5GAMg 3SWNB 5GAMd 2EJGA 3M4GA 1KQ2A 3JCMh 1TH7A 3VU3C 3JCMd 4HA8A 5GMKm 2ZGWA 2DVEA 2DKGA 4EMKB 2DTHA 1BIAA 3V7RA 2DTIA 3HFOA 5GANh 3RESA 5LJ3f 5GANd 4M7DB 2Y90A 3AHUA 1Y96A 3RKXA 3V7SA 2DTOA 4RCBA 4C92G 3BY7A 5LJ5e 4JLIA 4M7AF 4HT8A 3V8LA 5GAOp 4J6XA 4JRKA 4C92B 4XTUA 2RD1A 2DXUA 4V2SA 1HK9A 3L2ZA 1WQWA 3SWNC 4Y91A 5LJ3g 5LJ3d 3JB9D 4PJOF 4PJOC 4EMHA 4XU2A 5GAOq 1MGQA 1BIBA 1WNLA 4XTZA 4C8QG 4EMKC 5GAN6 4NL3A 4M78B 4M75A 2E65A 4C8QB 4M7DC 3JCMf 5GMKl 5GAN7 4M7DF 2EAYA 4QVDA 2DJZA 2EWNA 2RA2A 4F7UG 3INZA 4M77B 4C92C 5GANf 5GAMj 1X01A 4J6WA 4J6YA 2YHTA 3JCMg 3V7CA 3JCMQ 1JRIA 3SB2A 3V8KA 4PJOE
chains in the Genus database with same CATH superfamily
4JZ3A 4X9DA 1B07A 3PMIA 2KYMA 4M77F 2LP5A 1BKBA 1UGPB 4DBFA 5LJ5d 1W4SA 2DK3A 1JXOA 1QW1A 4F04B 3CCSQ 1IREB 4C0ZA 4O6JA 2CZ1B 2VYTA 1SSHA 1PD1A 4LNPA 3OYNA 1RACB 3O8VA 4BE1A 4DA4A 1WHKA 1M9SA 4M7DA 4NL2A 3ME9A 1YJWT 2DMOA 1AZGB 2O2OA 4M4ZA 1KC8U 3J7AF 2A36A 3FEOA 3MPUB 1ABQA 1SRMA 2CP0A 3PNWC 4IIMA 4JDSA 1PWTA 2DL4A 3RMQA 4ORZA 4AG1C 1I81A 3CCEQ 2R5AA 1WQ7A 3G6ET 2FYKA 2L5QA 5L8RE 2H8HA 1EIFA 4WCIA 1ZSZC 4J9FA 2KNBB 2VXEA 4ZN1A 2OAWA 2XHCA 1UE9A 2DZCA 2RF0A 3JCMX 4A4GA 2XU8A 1JXMA 3CCQA 4ELZC 1W70A 1YFNA 3OA6A 4HT9A 2EKOA 1FMWA 3JCMh 1TH7A 4OMQA 1UJYA 1TOVA 4RCBA 2RHUA 2CT4A 4KH1B 1BCMA 4VUBA 1U06A 3TREA 1ACMB 3CC4T 1YHQA 2GBQA 4EIKA 1RADB 4ME7A 4ZGDB 5GAN7 5FWBA 4QVDA 5HCKA 4BB7A 2LT1A 2HKNA 2HCKA 4Z88A 1AWJA 2ENMA 2FPFA 3HRSA 2EQJA 2RQVA 3OYEA 4QQDA 1DJ7B 5CQYA 4J7FA 2CP3A 1YJWA 3QYGB 4N4HA 1G8XA 2CSIA 2PUKB 4M78E 1I0CA 2WSFE 3D7SB 1M5Q1 4XTWA 1WI7A 2K6DA 4LUDA 3J81E 3QWYA 2HD0A 1TUGB 2RM4A 3I55T 5A0DA 3G6EA 1VYUA 2CUDA 4AT1B 2F5KA 2P84A 2DJQA 1M90C 1N9SA 1PKSA 3CCUQ 3VS6A 3RBBB 4F7UE 2D8JA 8ATCB 5L23A 2LQNA 2A3LA 3FLGA 2GCXA 1H3ZA 1Q81C 1GRIA 4IIOA 2X3XD 4LDXA 1AOJA 3M4YA 5GAMf 4P5NA 2RPNA 2RQWA 3NFCA 4PJJA 2F2VA 1KHIA 2CZ0B 3CC4A 4DBQA 2DL5A 1KQ2A 3LGLA 2D8HA 1Y71A 2IIMA 3PE0A 1HJDA 1BI3A 3TEEA 2C06A 2DTIA 1K0SA 3EH1A 1RABB 1NZ9A 4FCYA 1W2BS 4DEYA 2C0TA 4JZ4A 1WIEA 4M78B 4M7DF 2J7IA 4DBRA 3GP8A 1XNIA 1UDLA 3MO8A 2X4WA 2GQVA 3PMTA 2MWPA 1ZUKA 2EQIA 3JV3A 5HK0A 1YJNT 1I07A 1OZ2A 2EYXA 1FMVA 2GTJA 5IAYA 1IGUA 1M1KU 2E12A 3I55A 4PFOA 4JJNK 4F7UB 4HVVA 2VC8A 1WFWA 5FU6C 4QKUA 3NMZC 3OYMA 2RI2A 4JJCA 2DFUA 5I11A 2V8KA 1S72T 3QKJA 2VV5A 3CCVT 4LE9A 2BZYA 4O5VA 3TCJA 3JAME 2Z0WA 2XI9A 4C0DB 1LNXA 4PFZA 2CGHA 3DLLA 3E2UA 2KMTA 2NUTB 2LJ0A 4JRPA 1XQHA 4XU0A 1ARKA 1B34B 1M8VA 3A8HB 3CMAQ 3JB9I 5KYNA 5IXBA 4IKFA 1TWBA 2F1LA 2CP7A 2CP5A 3EG0A 2OTJT 5GAMd 1MV3A 3CC2Q 1X6OA 5GMKm 3OMGA 2ZPIB 1KQSA 2JVVA 3FRNA 3I56T 1JQQA 5GAOp 2ED1A 3ASKA 2L8DA 4Y91A 3BE3A 1QWEA 2KRNA 1Q95G 4NL3A 2EQMA 3CPWS 5GANf 2WSEE 4QQ6A 3JCMg 2OI3A 3MEUA 3QG1A 4AFZC 4B6MA 1AVZC 2QQSA 1V29B 1G3WA 2YSQA 1M2OA 1WA7A 3SEMA 4RMOA 2ATCB 2L89A 4OVAA 1UUEA 3TVTA 1FX7A 2BZ8A 3VS1A 4YTLA 1ZLMA 2FPEA 5EC7A 4C0GA 2AZSA 5GMKi 3CCVA 1RAFB 1ZSZB 2FVUA 2XDPA 4FU6A 2E41A 2A0FB 2O31A 2LX9A 1LJOA 1IGQA 3TSZA 4WF2A 3OYIA 4FW2A 3RIRA 2JUFA 4XU3A 2WACA 3KXTA 1VQ5Q 4Y28E 4E7SA 1Q7YC 2GTOA 4UC4A 4GLMA 2ECZA 1MHNA 3DLMA 2K3YA 2CP2A 1NYFA 2OTJA 4M78D 1SHGA 3NTHA 2EJ9A 3RKWA 3FB9A 4M78G 4JS4A 3I56A 1YJ9Q 2LVMA 2F69A 2LMJA 2AHJB 4E7IA 5D6WA 2ZPBB 2L2PA 5DM7R 4BDYA 1TS9A 2ZPGB 3M59A 1J3TA 3M0UA 4BUGA 4OF1A 3L2UA 1JJ2A 2DBKA 3NTIA 1Y7XA 4PJMA 1W6XA 4RKUE 2VB6A 1FYNA 4PJOC 2L3PA 1WNLA 3M58A 3L2VA 5I22A 3CCMT 4CC3A 1IHVA 2E65A 2MPXC 1GBQA 3UATA 4AMCA 4AFUC 4F7UG 2E70A 3N5BB 5GAMj 1T0JA 3QYHB 9ATCB 1QCFA 4J6WA 1W2BP 2YHTA 6AT1B 4DBHA 2HAXA 3V8KA 5KYUB 2K57A 3SFMA 3CCST 2X9HA 5KYXA 4M77C 2BIVA 1QLYA 1ABOA 1Z9ZA 1JEGA 2HQEA 3CXCA 4R55A 2EYQA 2X4XA 1KD1R 2RJCA 5AT1B 2CDTA 2K4YA 1M3AA 4JJDA 1IZ6A 2FHDA 2FZGB 3CC7Q 2H3JA 3DKMA 2RNAA 5LJ5f 3CCLA 2JZ2A 3OB9A 5D6XA 1OV3A 1VQ9A 1SRLA 2DLPA 4M78A 3FC3A 5A2QE 3CCET 1BB9A 5KYYB 2KT1A 3TU4K 3M0TA 3EGDA 2J6OA 1QP3A 1Q81U 3PFSA 2JNGA 4KBMB 5GANe 2PVGB 3TSWA 4HCBA 2FRYA 1RAGB 5KH6A 2CZ7B 1YN8A 2V8IA 2OTLA 1P92A 3VS4A 2GNCA 4BDZA 2ABLA 3VS7A 3G4ST 4MDXA 2VASA 1I5OB 1VQOQ 2KXCA 3RDVA 5KE2A 1VOMA 2XKOC 4M7AE 3MHXA 1QQJA 4RTXA 4F7UA 4ZGEB 3CCMA 1MV0B 3P8BB 5CR2A 1WXTA 1HSQA 3VS0A 3M54A 1Y96A 3VRYA 1M1GA 1RUWA 2FL7A 3AHUA 1NEBA 4J6XA 2MK5A 1HK9A 1R8OB 5J26A 3OS5A 1G3TA 1WX6A 3CCSA 4OMNA 4JRQA 2MYSA 1TU0B 4MZTA 3X24B 2DJZA 1PM3A 2J6KA 3E9GA 2QG9B 2DXCA 1QP2A 3X20B 1LVKA 1LPLA 3PTAA 4A4HA 1OX9A 1KK7A 2COZA 3QJ6A 1QCOA 2RO0A 4M75D 4C92E 4J5YA 1VQPA 5FRMA 2DYBA 4K11A 4QVCA 4M75G 4LDYA 1MNEA 4PFPA 2LT4A 4C8QE 1YWOA 2FG0A 2RB6A 1WHGA 1WPYA 1OU8A 1D1AA 1N27A 5GANj 1VQLQ 4GY5A 5CCAA 2COWA 5EG2A 1NJIR 4XU1A 1VQ6Q 5FU7B 3OYKA 3ULRB 2NUPA 3L2WA 2WSCE 3CCUT 1U1SA 2CH4W 5M9OA 3EGXA 1B3QA 4QQGA 4M7AB 4CC7A 3LX7A 3VUBA 5IT9E 2ZPEB 4HXJA 1XOVA 2LDMA 4DQ2A 2SEMA 4E7JA 3G4SA 1NPPA 1NBEB 2I0NA 2LJ1A 3G71Q 3A8OB 4C5GA 2EYZA 1HXDA 3E19A 2DERA 4IUUA 3OYGA 1RAEB 4ATOA 2RK1A 5CKDA 2NLUA 5HY6A 1G3SA 2ZZDA 4QVZA 3E1SA 4J9BA 1OPLA 2E4HA 1H92A 5IXFA 1VQ8T 4D8DA 1VQMQ 4IUTA 1VQNQ 5KYWA 5LJ3f 3URGA 1AWOA 5LJ5e 1WJQA 3E9FA 1ZX6A 4C92B 3L2QA 4FYWB 4MZMA 1YITQ 4Z02A 2AKLA 2J6FA 2HKQB 2D0QB 4M75A 4KUDK 4C8QB 4M7DC 5GMKl 2YDLA 3SD4A 2EW3A 2DILA 1AD5A 1T3SA 2KROA 3HHTB 4FT4A 3EFOA 5LL6S 1M2VB 2RMOA 4M78F 1QVFP 2EBPA 3S3OA 2DL8A 3HRUA 3M0SA 5IHNA 4JPBW 2BTTA 3OYDA 2HQHA 2LNVA 2XMFA 5GJVB 3CCUA 4TVRA 5DLQE 4BE0A 1BBZA 2MAMA 2O4XB 1Q7YU 2QQ9A 4M75C 5GMKe 1Q82C 4FYYB 2RQTA 5FW9A 4F7UF 1NLOC 3DB4A 4OB0B 2CZ6B 5D6YA 4HKEA 1WXBA 1M1FA 1Z9QA 2EYWA 3CCJQ 3R6NA 5GAMh 2XDDA 4PJOB 1Q86C 3CMAT 2HL5C 2JJ9A 4JJBA 3QXEB 2K5FA 1K73C 4IURA 2EIFA 4OMMA 5LJ5j 1VQ8A 1WHMA 3S3NA 3AT1B 2XK0A 3CC2T 4HCKA 3CCQQ 1NYGA 3MKDA 4JS5A 1KQSS 3OBWA 2ROTA 2LCSA 1UHFA 3LH0A 2F2WA 1VQKQ 3HRTA 4X1VA 2QI2A 5I2SA 3V7RA 3I9QA 3WVDB 1NLPC 1OX8A 3BY7A 4GLKA 5FWCA 4HT8A 4DEXA 2QQAA 2KI7A 4J9EA 4V2SA 2NYSA 4LDWA 5LJ3d 1GCPA 1UHCA 2JOYA 4XU2A 2OJ2A 1UGSB 5KYYA 2EAYA 3UF4A 1KC8R 2AIRB 4RG2A 2ZPHB 1X6GA 3UA6A 3JCMQ 2KGTA 3VS3A 2DIGA 2VUBA 1FXXA 3H8ZA 5GAOm 4RG8A 2M02A 2O88A 1QCNA 2JT4A 3JCMP 5GMKj 3SDZA 4PLLA 2RI3A 4OMPA 1SPKA 3OYLA 1OEBA 2G3RA 4LD9K 2YUPA 2GQIA 2CSQA 4RCCA 4KH0B 2PZ1A 3ER0A 3QO3A 3MCAB 1H8KA 2JMCA 3UPUA 5HKCA 1R0BG 3WVEB 3THKA 3JCMb 3CMAA 2AZVA 4CC2A 3VS2A 1VQ5T 2B86A 2A08A 2ESWA 4RTYA 4LN2A 2K2MA 3RERA 2KXDA 3HFNA 4JUVA 4MMKA 3OYHA 3A98A 1ZSGA 3SWNA 2F2XA 4C92D 5GAOn 3CC2A 4EMKA 2JMAA 1EZZB 5HK3A 3M0RA 3TQ7P 3OYFA 1IXDA 1PRMC 1YJ9T 4M75F 1RI0A 2JS0A 2M0OA 3NTKA 2DYIA 1TTHB 4OMOA 3M9QA 4C8QD 4BI3A 2KSSA 4A4EA 2ZPFB 3CC4Q 1GL5A 1OI1A 2O9VA 4BI4A 4IUVA 2W0ZA 1JJ2S 2X4JA 1G3YA 3JCMd 3F70A 2FEIA 1E6GA 3QDRB 2DKGA 1QVGS 5GANh 3HFOA 3RESA 4DOWA 2A37A 3EG9B 2RQUA 3OS2A 3GNFB 3V8LA 1RL2A 2A7YA 2MWOA 4PJNA 3SWNC 2DIQA 4BY6B 3JB9D 2J06A 4EMKC 1QKWA 1WLPB 2KAFA 1K8AR 2GGRA 2BE9B 2PNIA 3I35A 3RMSA 1X01A 3HKSA 5ECAA 4A63B 2I2LA 2M16A 3RR6A 3OQ5A 3CXCS 1PSFA 1HD3A 1C0MA 3GOXA 3OW2S 5LJ3j 2EQKA 1MMNA 1M30A 3I5RA 4C5HA 4WTOB 1AT1B 1YJNA 1VA7A 3CC7T 3JCMW 2QTVA 2JN0A 1RLQC 1VQ5A 1ZA1B 2P4RA 5CIUA 1UEBA 1TUDA 3JB9J 1K9MR 5KCOA 3JCMc 4JLGA 4FSXA 1OULA 4EMGA 3QUIA 3MP8A 2YRCA 3OBYA 5GAN4 2K5IA 3CPFA 4ELYC 2M51A 4HCZA 1YJ9A 5I21A 2DAQA 1QWFA 1S72A 1D0YA 3FJPA 1H3HA 5GAMe 2ED0A 4KGZB 3OYJA 1PD0A 4C0FA 2HMAA 3QJYA 1M27C 1JB0E 2KK4A 4KT0E 5FROA 5GJWB 1KSWA 3VYHB 2D9TA 1U1TA 1XJWB 1PCXA 3C4SA 1ZA2B 2FRWA 4KRTA 4E7HA 1VQOT 2DVJA 2RHZA 1WZOA 2R5MA 2LQ8A 1W2BA 4FSSA 5GAN3 3HPWA 1ZUUA 2E3HA 2CP6A 5GAMg 3OY9A 3LWHA 1M1KR 2O4XA 3UWNA 4MDWA 2RN8A 4FW1A 3RKXA 1G83A 1UTIA 2DTOA 4JLIA 3I5SA 4ESRA 4XTZA 1MMGA 3T9NA 2QA4Q 1CKBA 2CS7A 2RJEA 5I2MA 2V1QA 1YNZA 1VQ4Q 2LJ3A 4MMLA 3CC7A 1N8RR 4Y92A 2K79A 3CMEQ 3BDLA 1KHCA 4A53A 2BUDA 4RTVA 5LJ5h 2QQBA 3CD6Q 3BDUA 3RKYA 3OYYA 1Q82U 1NPRA 1PKTA 1VQLT 3UDCA 2M1HA 2KE9A 2G6FX 1D0XA 1D1CA 1NG2A 3X25B 2HZYA 1BI1A 3PVLA 4NOYA 1Q86U 3BW1A 2IPOB 2RI5A 1K73U 2RHXA 3NPFA 2K5LA 2QGGA 2CT3A 4E7LA 1VQOA 3ZEHA 2O01E 3M55A 3G71T 2QEXQ 2JTEA 1GCQA 3M5AA 3REBB 3CQTA 2RK2A 2CREA 2XG8D 2YRVA 1K9AA 5GMKh 3I56Q 5GAN8 1MMDA 5GAN5 5CQXA 1GFDA 2RHYA 1WHJA 3EFRA 3MP1A 1EX4A 4KGVB 1VQMT 1VQNT 1OQKA 1PSEA 3VU3C 3IQLA 4PKCC 1BIAA 2FZKB 5A0GA 1YITT 1GXIE 4AFSC 1RAHB 1RI9A 3GLXA 4R56A 1ZBJA 2DXUA 1R0CB 4PJLA 1MMAA 3UT1A 3A5ZB 3S6WA 4D8KA 1BIBA 1ZBXA 4KUIA 5GAN6 1WJRA 1QVGP 1OU9A 2FO0A 4FM4B 1GCQC 1K76A 1X2KA 2MF2A 2QQRA 3GF5A 1KIKA 2CKKA 2L0AA 2MOXA 2NUZA 3H9NA 3INZA 3PT9A 1I1JA 2XICA 1BK2A 2QAZA 2EKHA 3EGUA 3HP9A 2IVWA 1X75C 3VKIA 4M78C 5GANg 1UG1A 1MNDA 4C8QF 1T3LA 3M0PA 1VQLA 3H0IA 1VQ7Q 1M8MA 1JO8A 5FU6B 1O9SA 3CBMA 4PNOA 2D6FA 4N4IA 3NGPA 2NUTA 5IH2A 5CKHA 3CCLQ 5CKBA 4F14A 2HSEB 3ZL7C 4B9XA 3EG9A 1B34A 7AT1B 2EPDA 1E7OA 3G71A 2EGAA 3KFVA 4N0AA 1LCKA 3QSUA 4KGXB 3QWXX 1LOJA 3QDFA 4PLIA 1VQ9Q 3JB9F 3CCRQ 3CPWP 3FJ5A 4PL6A 3CCJT 2X35A 1X69A 2JS2A 1IB8A 1V1CA 4E2FB 2DF6A 1X27A 3ZBDA 2XIDA 1HYOA 3VUZA 2QGFB 4RTUA 4CC4B 3CCEA 2QXFA 2L3SA 4A4KA 1YI2Q 4C0DC 1VQMA 1VQNA 2OTLQ 2DM1A 1V76A 2AKKA 3CCQT 2HL3A 3OYAA 5LJ3h 2BE7D 1YITA 3R6OA 3JB9H 3GIBA 1VQKT 1NM7A 4ANJA 4N0AC 4OP0A 2E5KA 1I8FA 1QVFA 4E6RA 2EJGA 2CUBA 1KD1C 3H6ZA 2KQWA 2HDAA 3KUFA 1RLPC 2RD1A 4X34A 3M0QA 1WQWA 1R77A 1KG1A 1M90R 1FWZA 1CKAA 2KRSA 1YIJQ 2EWNA 2RA2A 1ZSZA 2DPPB 4J6YA 4PJOE 1Q81R 4R0KA 1VQPQ 1C6VX 5DY9A 3META 1K0XA 4A4FA 3CBOA 2QASA 1UGQB 3EG3A 2RH2A 2YRDA 2QDLA 5CK9A 2DEUA 2HEQA 4XTYA 5CVIA 2KYBA 4XTXA 4M77E 3CCJA 2D0NA 2JXBA 3ZFJA 2AK5A 4J9IA 4OMLA 5IHIA 2KR3A 2DO3A 4C5EA 2YUQA 2DXTA 3JCMJ 3FDRA 5LJ5g 2LC4A 3CEYA 1YWPA 2E64A 4OGEA 1WHHA 2SRCA 2KT8A 2E1HA 1ZHIA 4L6V5 3G4SQ 4ZTFA 1N6AA 1VQKA 2VKNA 1KQ1A 3QBYA 3PIPA 3OSSC 4CI0C 4A54A 1UGRB 1VUBA 2KY9A 2VWFA 1NE8A 4B9WA 4J8OA 1PHTA 4EDUA 4L59A 2EGEA 5AYFA 3OSVA 2QTXA 1KFZA 5CO7A 3OYBA 3PIOA 4XK8E 1RAAB 5KYUA 1N5ZA 2Y90A 2K3BA 1UFFA 3V7SA 2JTMA 2O9SA 2DD4A 1Y57A 4EMHA 1MGQA 2P0PA 3LLRA 3C0CA 1NJIC 2L3RA 1ZUYA 3JCMf 4C5IA 1SKUB 4RTZA 2LQWA 1A0NB 4M77B 1CSKA 2V8JA 2R58A 4ZTJA 1D0ZA 1WYXA 2C0OA 4HVUA 4LDVA 3GPLA 2L3QA 1K8AU 3C12A 3JRZA 5IHKA 3JCMV 3EHRA 1YHQQ 3O5ZA 2LZ6B 1O75A 2KDSA 3CBPA 3X28B 3H0HA 3REAB 2PVOB 3SHWA 1WDXA 3EFSA 2DRKA 2ZAEA 3M56A 5J3BA 5FRNA 3G7ZA 2E6NA 1JBMA 2HSPA 2Y4XA 2E3IA 3MP6A 2IG0A 2YUOA 5KYXB 4E7ZA 4M7AD 1AWXA 1M3BA 2VXFA 1YJWQ 4M7AG 2E5QA 2KEAA 1K9MU 4XTVA 2LX7A 1F1BB 2P0KA 3H41A 2C0IA 3MEAA 2QDYB 2HQXA 3VJPA 4LUEA 1C1AA 1OPKA 3LGFA 1D09B 3RUXA 3LWIA 3HTRA 5LJ3e 1VQ8Q 3G6EQ 1SEMA 1B7TA 1G5VA 5IN1A 2YUNA 1VIFA 2YLCA 4L5GA 1AWWA 1E6HA 4ZGJB 1S1NA 2FZCB 1I5LA 3G1JA 4FT2A 4BE2A 3A8LB 3EGDB 2V26A 3EG2A 1K1ZA 2JM8A 1UB4A 4OMFB 4RUGA 4HA8A 3A8GB 1TXQA 2ZGWA 1PNJA 2JM9A 4ZN3A 2QK0A 3WXMB 2E6ZA 4AG2C 2GFAA 4C92G 3QPHA 4JRKA 2RJDA 4DOVA 5LJ3g 3JSCA 3OS0A 3S3MA 2QA4T 1M3CA 3PVQA 4C8QG 1Q7YR 2QYZA 3VYGA 1VQ4T 3OYCA 2X4YA 4BI8B 3CMET 1OZ3A 1AHJB 3EH2A 1WXUA 3CD6T 4IUQA 1UGVA 2K3XA 1Y96B 4M7DE 1K4US 1QVPA 2BZXA 1TUCA 2X3WD 1N8RU 1PRLC 4M7AA 5DLOA 3JB9G 1D3BB 2KVQG 4LDUA 3V8JA 2V1RA 2DETA 2EJFA 4OB2B 1PG5B 1N9RA 2DL3A 2FB7A 4FYXB 2COYA 1RAIB 4PK4A 2W10A 2QEXT 1IRXA 1IHWA 1UJ0A 1PC0A 4PJOD 2RHIA 3I55Q 2YLBA 4M75E 3VRZA 3JCMe 4PJOG 1BU1A 4XAXB 5FU7C 2EYYA 1I4K1 4QW2A 2RQRA 1KC8C 4F17A 5KE3A 4M7AC 2EFIA 4C92A 1X43A 1KD1U 4LD6A 4HVWA 2FPDA 2DE0X 4M77D 1FMKA 2NUPB 2H3EB 4C8QA 4M77G 3EGXB 1SF9A 4RTTA 4NS5A 3A1PA 2QA4A 3VV0A 1VQ4A 1M2VA 2JW4A 2DTHA 4Z8AA 2DXBA 2LCLA 4M7DB 2K7AA 3CMEA 1NEGA 1AEYA 2MI6A 4XTUA 1U8RA 2DX1A 3CD6A 4ZNXA 5GAOq 2EQUA 2OAUA 1KJWA 3GBQA 1WHLA 1SG5A 2XDBA 2CYZB 5CKEA 3MEWA 1X2QA 1ZQ1A 2MIOA 4J9CA 4C92C 1VQ7T 1BCOA 4BACA 3EHQA 2PQWA 4MZPA 3J80E 4C8QC 5KYWB 3L2RA 1KQSP 2DA9A 1X6BA 1YJNQ 2K2VA 5D7UA 4HCCA 1QKXA 2DL7A 2K9GA 2F5TX 2LQKA 4M75B 4EPCA 3CCLT 4F16A 2P0QA 2QEXA 2MMPA 4PJOA 2CH4A 4J9GA 2DD5A 4OB1B 3PGGA 1VQ9T 2VGNA 4FIBA 4IUPA 3EFOB 3CCRT 1TG0A 2YXYA 5J39A 1YP5A 2YT6A 5CAIA 2P4TA 1S72Q 2GF7A 3M57A 3NHNA 4XQ3A 3CCVQ 3GNGA 4M77A 1OOTA 5C6SA 1YI2T 1QMCA 5C0MA 2OTLT 1K8AC 4E47A 3RNJA 1VQ6T 2VVKA 2OX7A 2HNIA 5GAN2 2PU9B 1QVGA 1BI2A 4OB3B 3L1AA 3QHSA 1YCYA 1QVFS 1UECA 4KULA 2DZ9A 3UA7A 2XD0A 5FLXE 2GFUA 2E10A 3MEVA 1U5SA 1AZEA 2HBWA 4JRIA 5GAOr 3OS1A 3C95A 4J83A 2AT1B 1NJIU 1U3OA 1BYMA 2A28A 2DVEA 5GANd 2JTFA 4FYVB 2OTJQ 5KCHA 3LW5E 4M7AF 2ZCFB 1K9MC 1VQ7A 3A8MB 3C94A 3L2ZA 4CRIA 1YIJT 4OGCA 4E7KA 1Y07A 4D6WA 4RTWA 4J9DA 1VIEA 2PUOB 1SHFA 3OW2A 2BKDN 4Z89A 3VS5A 1GBRA 2YWWA 1G2BA 3V7CA 3SB2A 1VQPT 3HL8A 2DEQA 1M90U 3CPWA 2ROLA 4N4GA 2LNHB 2Y4YA 3M53A 1BI0A 2NWMA 1YCSB 2M9UA 1EFNA 3CCRA 1JJ2P 2DBMA 1SSFA 2HBPA 4FL6A 2EVRA 3P8DA 5A0LA 3EG1A 4BD3A 4C92F 3P8HA 1Y0MA 3QZ9B 1YI2A 1M1KC 2M0YA 1IO6A 2LTOA 4X9CA 4J9HA 3HSBA 1VQ6A 2J05A 3LH5A 2X51A 4II1A 2DNUA 1M4ZA 2LCCA 4M7DD 2PTKA 2D1XA 3CXCP 2B8AA 1OYXA 2VGMA 5GAOl 3OW2P 4M7DG 2KBTA 2RJFA 3EAEA 3KBGA 3X26B 1D1BA 1MUZA 3QZ5B 3FIFA 1N8RC 3MJXA 3Q1JA 2LRQA 2MCNA 8AT1B 3BFMA 3LYIA 3OMCA 4GBQA 1XTDA 4AFQC 2DRMA 1H641 3L42A 1D3BA 3QIIA 1YIJA 1YBYA 3SWNB 3M4GA 3U23A 1VYVA 3DB3A 1Q82R 1JU5C 4EMKB 1VYTA 2KRMA 2EGCA 1T0HA 3H0FA 4J7IA 1TSFA 4LXCA 4QT7A 1GFCA 4PJOF 4Q5WA 1WGSA 5CKFA 1Q86R 2PVDB 1W1FA 3CCMQ 1K73R 1WJSA 4BY6C 1JRIA 2R57A 1YHQT
chains in the Genus database with same CATH topology
2I2LA 2M16A 4LDVA 4X9DA 2K57A 3SFMA 3OQ5A 3CCST 3GPLA 3CXCS 1PSFA 1K8AU 3PMIA 4M77F 4M77C 3C12A 3JRZA 3JCMV 1BKBA 1UGPB 2BIVA 5LJ5d 3GOXA 3OW2S 5LJ3j 1W4SA 2EQKA 2DK3A 1O75A 2KDSA 1QW1A 3CBPA 3X28B 4C5HA 1IREB 4C0ZA 2HQEA 3CXCA 1YJNA 3CC7T 4R55A 2PVOB 2EYQA 2X4XA 4O6JA 3JCMW 2RJCA 2CZ1B 2JN0A 2VYTA 3EFSA 1VQ5A 2K4YA 5CIUA 3OYNA 3O8VA 3M56A 1IZ6A 2FHDA 5J3BA 4BE1A 4DA4A 5FRNA 1UEBA 2E6NA 2H3JA 1JBMA 3G7ZA 1M9SA 3JB9J 4M7DA 3DKMA 5KCOA 4NL2A 3ME9A 5LJ5f 2Y4XA 3MP6A 4JLGA 2IG0A 4FSXA 3JCMc 3CCLA 4EMGA 2JZ2A 3QUIA 1YJWT 3OB9A 3MP8A 5D6XA 3OBYA 4M7AD 5GAN4 3J7AF 1KC8U 1VQ9A 2VXFA 4M78A 2K5IA 3CPFA 3FEOA 4ELYC 4M7AG 2E5QA 5A2QE 3FC3A 3CCET 4HCZA 1YJ9A 1K9MU 4XTVA 5I21A 2DAQA 3PNWC 4JDSA 1S72A 3TU4K 3FJPA 3RMQA 5GAMe 2P0KA 3OYJA 1QP3A 1Q81U 4C0FA 3PFSA 1I81A 2JNGA 4KBMB 3QJYA 3MEAA 2R5AA 1JB0E 2KK4A 2QDYB 4KT0E 5GANe 5FROA 2HQXA 1WQ7A 2PVGB 3G6ET 4HCBA 3VJPA 2FYKA 2L5QA 5KH6A 2CZ7B 2D9TA 3VYHB 5L8RE 1U1TA 3C4SA 2V8IA 3LGFA 3LWIA 3RUXA 1EIFA 5LJ3e 1VQOT 4E7HA 2OTLA 1G5VA 5IN1A 1P92A 1VIFA 4BDZA 2YLCA 2RHZA 4L5GA 2VXEA 4ZN1A 3G4ST 2R5MA 4MDXA 2XHCA 4ZGJB 2DZCA 1I5LA 3JCMX 2LQ8A 4FT2A 4A4GA 2XU8A 5KE2A 2XKOC 4BE2A 3A8LB 5GAN3 1W2BA 3HPWA 4ELZC 3MHXA 3CCQA 4M7AE 3OA6A 4F7UA 4HT9A 2EKOA 5GAMg 3OY9A 4ZGEB 1UB4A 1TH7A 4OMFB 3JCMh 4HA8A 3CCMA 3A8GB 3LWHA 2ZGWA 4ZN3A 3P8BB 2O4XA 3UWNA 5CR2A 4MDWA 3WXMB 2E6ZA 3M54A 1Y96A 3RKXA 1M1GA 2FL7A 2DTOA 2GFAA 4RCBA 4C92G 2RHUA 4JLIA 3QPHA 4J6XA 4JRKA 2RJDA 4VUBA 4DOVA 1HK9A 1R8OB 5J26A 3TREA 5LJ3g 3CC4T 1YHQA 3JSCA 3OS0A 3OS5A 1G3TA 2QA4T 3S3MA 4ME7A 4XTZA 4C8QG 4ZGDB 3CCSA 3VYGA 1VQ4T 3OYCA 2X4YA 4MZTA 5GAN7 4JRQA 3X24B 4QVDA 4BI8B 2DJZA 3T9NA 4BB7A 2LT1A 3E9GA 2DXCA 2CS7A 2RJEA 5I2MA 3CMET 1QP2A 3X20B 1OZ3A 3PTAA 1AHJB 4MMLA 3CC7A 4A4HA 3CD6T 4IUQA 3QJ6A 2K3XA 1Y96B 2RO0A 4M7DE 3BDLA 1KHCA 4A53A 2BUDA 1QVPA 4M75D 5LJ5h 4C92E 3HRSA 2EQJA 2QQBA 3OYEA 3BDUA 4J5YA 1VQPA 5FRMA 4QQDA 1DJ7B 5CQYA 3RKYA 3OYYA 4QVCA 4J7FA 4M75G 1N8RU 1YJWA 4LDYA 1Q82U 4M7AA 3QYGB 4N4HA 5DLOA 2PUKB 4M78E 2LT4A 4C8QE 3JB9G 2WSFE 1D3BB 2KVQG 1NPRA 2RB6A 1VQLT 1M5Q1 4XTWA 3UDCA 4LDUA 2M1HA 3V8JA 1WPYA 2EJFA 3J81E 4OB2B 1N27A 5GANj 2HD0A 3X25B 1N9RA 2FB7A 1BI1A 4GY5A 5CCAA 5EG2A 4NOYA 2RM4A 3I55T 4XU1A 5A0DA 3BW1A 5FU7B 1Q86U 3OYKA 3G6EA 3L2WA 2QEXT 2WSCE 3CCUT 1U1SA 2RI5A 1K73U 2RHXA 2F5KA 4PJOD 2K5LA 2RHIA 4M7AB 5M9OA 4QQGA 2YLBA 4E7LA 1VQOA 3LX7A 3ZEHA 2O01E 3VUBA 3M55A 1N9SA 2ZPEB 4M75E 3G71T 5IT9E 1XOVA 3JCMe 1M90C 4PJOG 2LDMA 4DQ2A 4E7JA 4XAXB 5FU7C 3G4SA 1I4K1 1NPPA 4QW2A 4F7UE 1KC8C 3A8OB 3M5AA 5KE3A 4M7AC 2EFIA 2RK2A 4C5GA 3AHUA 3E19A 1HXDA 2A3LA 2XG8D 3FLGA 4IUUA 2YRVA 4C92A 2GCXA 3OYGA 1KD1U 5GMKh 4LD6A 1H3ZA 1Q81C 4ATOA 2RK1A 4M77D 5CKDA 5GAN8 2NLUA 5HY6A 4LDXA 3M4YA 5GAMf 4C8QA 5GAN5 5CQXA 1G3SA 4M77G 2RHYA 4P5NA 3EFRA 3MP1A 3NFCA 2ZZDA 4QVZA 1KHIA 3E1SA 2CZ0B 1VQMT 3CC4A 1VQNT 4NS5A 2QA4A 1KQ2A 1PSEA 3LGLA 1Y71A 3VU3C 1BI3A 4PKCC 3VV0A 1VQ4A 3TEEA 1VQ8T 2DTHA 1BIAA 2C06A 2DXBA 2DTIA 2LCLA 4IUTA 5A0GA 5LJ3f 1YITT 4M7DB 3URGA 1GXIE 5LJ5e 1WJQA 3E9FA 3CMEA 1NZ9A 3GLXA 4C92B 2MI6A 4XTUA 4R56A 3L2QA 2DXUA 1U8RA 4MZMA 1W2BS 4Z02A 3A5ZB 3S6WA 3UT1A 3CD6A 5GAOq 1BIBA 1ZBXA 4KUIA 5GAN6 2EQUA 4M78B 1WJRA 2D0QB 2OAUA 4FM4B 4M75A 4C8QB 2QQRA 2MF2A 4KUDK 3GF5A 5GMKl 2XDBA 2CYZB 4M7DC 5CKEA 2CKKA 4M7DF 3MEWA 3SD4A 3INZA 3GP8A 1XNIA 1ZQ1A 4C92C 3MO8A 3PT9A 2X4WA 2XICA 2GQVA 3PMTA 1VQ7T 4BACA 2MWPA 3HP9A 2IVWA 3HHTB 4FT4A 2PQWA 1X75C 4MZPA 5LL6S 3VKIA 3J80E 4M78C 4M78F 5GANg 5HK0A 4C8QC 4C8QF 1YJNT 1VQLA 3S3OA 1OZ2A 3L2RA 3HRUA 5IAYA 5FU6B 2K2VA 1O9SA 4HCCA 3CBMA 1M1KU 2LQKA 2F5TX 4M75B 4EPCA 3CCLT 2E12A 3OYDA 4PNOA 3I55A 2D6FA 2LNVA 4N4IA 2P0QA 2QEXA 2MMPA 3CCUA 4TVRA 4PJOA 4JJNK 4F7UB 2DD5A 5CKHA 5DLQE 4BE0A 4OB1B 2VC8A 5CKBA 3PGGA 5FU6C 2VGNA 4FIBA 1VQ9T 4B9XA 2MAMA 4IUPA 1B34A 3CCRT 3OYMA 3G71A 4N0AA 2O4XB 1Q7YU 2RI2A 2QQ9A 4M75C 5GMKe 1Q82C 5J39A 3QSUA 2V8KA 1S72T 1LOJA 3QKJA 4PLIA 2VV5A 3CCVT 3JB9F 4F7UF 4O5VA 3DB4A 4PL6A 3TCJA 4OB0B 5CAIA 3CCJT 2P4TA 2X35A 3JAME 2CZ6B 5D6YA 2XI9A 2GF7A 3M57A 4HKEA 4XQ3A 4C0DB 1LNXA 3GNGA 4M77A 2CGHA 3DLLA 1M1FA 5C6SA 1YI2T 5GAMh 3ZBDA 2KMTA 2XDDA 5C0MA 2OTLT 2XIDA 4PJOB 3VUZA 1K8AC 1Q86C 4JRPA 3CMAT 3CCEA 4E47A 1XQHA 4XU0A 3QXEB 2QXFA 4A4KA 1B34B 2K5FA 1K73C 1VQ6T 4C0DC 4IURA 2EIFA 1VQMA 1VQNA 1M8VA 2HNIA 5GAN2 3A8HB 2PU9B 3CCQT 1QVGA 1BI2A 5LJ5j 5LJ3h 3OYAA 4OB3B 1VQ8A 3JB9I 3L1AA 1YITA 3R6OA 3S3NA 3JB9H 3QHSA 1YCYA 1QVFS 4IKFA 4KULA 3GIBA 2XK0A 1VQKT 2DZ9A 3CC2T 2XD0A 5FLXE 2GFUA 4JS5A 2E10A 3OBWA 4N0AC 1KQSS 4OP0A 3MEVA 1I8FA 4JRIA 5GAOr 2OTJT 3OS1A 3LH0A 1QVFA 5GAMd 2EJGA 3C95A 4J83A 3HRTA 3H6ZA 1KD1C 1NJIU 1X6OA 2QI2A 5GMKm 1BYMA 3OMGA 2ZPIB 2DVEA 5I2SA 1KQSA 2KQWA 3V7RA 5GANd 2JVVA 3FRNA 3I56T 2JTFA 3WVDB 5KCHA 3LW5E 4M7AF 4GLKA 3BY7A 2ZCFB 3KUFA 1K9MC 4HT8A 5GAOp 1VQ7A 2QQAA 3ASKA 2RD1A 2L8DA 3A8MB 4X34A 4V2SA 3C94A 3L2ZA 1WQWA 4Y91A 4CRIA 1YIJT 4LDWA 4OGCA 5LJ3d 4E7KA 1Y07A 4D6WA 2JOYA 4XU2A 1KG1A 1FWZA 1VIEA 1UGSB 4NL3A 2PUOB 2EQMA 3OW2A 2EAYA 2EWNA 2RA2A 2BKDN 3CPWS 2DPPB 4RG2A 2WSEE 2ZPHB 5GANf 4QQ6A 4J6YA 3JCMg 3V7CA 3JCMQ 3SB2A 1VQPT 3MEUA 3HL8A 2DEQA 3QG1A 1M90U 4PJOE 2DIGA 2VUBA 1FXXA 3H8ZA 3CPWA 5GAOm 4RG8A 2QQSA 4N4GA 1V29B 1G3WA 2Y4YA 3M53A 4RMOA 3JCMP 1BI0A 2L89A 4OVAA 5GMKj 3SDZA 4PLLA 5DY9A 2RI3A 1FX7A 3META 4A4FA 2HAXA 2M9UA 3CBOA 3CCRA 4YTLA 1UGQB 3OYLA 4C0GA 1SSFA 2RH2A 2G3RA 4LD9K 5CK9A 2HBPA 4FL6A 5GMKi 3CCVA 4XTYA 5CVIA 5A0LA 3P8DA 4RCCA 4XTXA 2FVUA 4M77E 4BD3A 2XDPA 3P8HA 4C92F 3CCJA 3ER0A 3ZFJA 3QO3A 4FU6A 2E41A 3MCAB 3QZ9B 4C5EA 1YI2A 2DO3A 3UPUA 1M1KC 5HKCA 2LX9A 1LJOA 3WVEB 2LTOA 2DXTA 4X9CA 3JCMb 3JCMJ 3CMAA 3HSBA 3FDRA 4WF2A 5LJ5g 1VQ5T 2LC4A 3CEYA 3OYIA 3RIRA 1VQ6A 2E64A 4OGEA 2JUFA 3RERA 4XU3A 3HFNA 2WACA 4II1A 2E1HA 1M4ZA 3KXTA 2LCCA 4JUVA 4MMKA 1ZHIA 4Y28E 4L6V5 3OYHA 1Q7YC 4M7DD 3SWNA 4ZTFA 1N6AA 4UC4A 2B8AA 1OYXA 2VGMA 5GAOl 4C92D 1MHNA 5GAOn 1VQKA 4EMKA 3CC2A 4M7DG 1KQ1A 3DLMA 2RJFA 3QBYA 3EAEA 3OSSC 3PIPA 2K3YA 3KBGA 5HK3A 3X26B 4CI0C 3OYFA 3QZ5B 4A54A 1UGRB 2OTJA 3FIFA 4M78D 4M75F 1YJ9T 1N8RC 1RI0A 2M0OA 2EJ9A 3NTKA 3NTHA 3Q1JA 4C8QD 3M9QA 3RKWA 2LRQA 1VUBA 4BI3A 2KY9A 3BFMA 2KSSA 1NE8A 3FB9A 3LYIA 3OMCA 4M78G 4B9WA 4JS4A 1XTDA 4J8OA 3I56A 2LVMA 4A4EA 2F69A 4EDUA 2ZPFB 1H641 3L42A 1D3BA 4L59A 2AHJB 5AYFA 3OSVA 2QTXA 1OI1A 3QIIA 5CO7A 1YIJA 1YBYA 4BI4A 3OYBA 3PIOA 4IUVA 2ZPBB 5D6WA 4E7IA 4XK8E 3SWNB 1JJ2S 2X4JA 1G3YA 3M4GA 3JCMd 3F70A 3DB3A 5DM7R 4BDYA 3QDRB 2DKGA 2ZPGB 4EMKB 3M59A 1QVGS 4BUGA 3HFOA 4OF1A 3RESA 5GANh 4DOWA 2Y90A 3V7SA 3L2UA 1JJ2A 3OS2A 3GNFB 2JTMA 3NTIA 1RL2A 1Y7XA 2A7YA 2MWOA 3V8LA 4J7IA 2DD4A 4RKUE 3SWNC 2DIQA 4BY6B 3JB9D 4PJOF 4PJOC 4EMHA 4Q5WA 1MGQA 2P0PA 1WNLA 3LLRA 3M58A 4EMKC 1WGSA 2L3RA 3L2VA 5CKFA 1NJIC 3CCMT 2E65A 3JCMf 4C5IA 2KAFA 4F7UG 4M77B 2PVDB 2E70A 2V8JA 3N5BB 5GAMj 3QYHB 3RMSA 2R58A 4ZTJA 1X01A 4J6WA 1WJSA 2YHTA 3HKSA 4BY6C 1JRIA 2R57A 3V8KA 1YHQT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DEQ A;  2I2L A;  4M78 C;  4M78 F;  4X9D A;  5GAN g;  2K57 A;  4C8Q C;  4C8Q F;  5GAO m;  4M7D E;  1Y96 B;  4M77 F;  4M77 C;  4A53 A;  3JCM P;  3JCM V;  4M75 D;  5GMK j;  5DY9 A;  5LJ5 h;  4C92 E;  5LJ5 d;  5LJ3 j;  3BDU A;  4J5Y A;  3RKY A;  4QVC A;  4M75 G;  4M7A A;  4M75 B;  4M78 E;  4PNO A;  4C8Q E;  5GMK i;  4XTY A;  3JCM W;  3JB9 G;  2JN0 A;  1D3B B;  3EFS A;  4RCC A;  2RB6 A;  4XTX A;  1M5Q 1;  4M77 E;  4XTW A;  4PJO A;  4C92 F;  3V8J A;  1WPY A;  4F7U B;  2VC8 A;  4MML A;  3PGG A;  2EJF A;  1JBM A;  2E41 A;  3QO3 A;  3JB9 J;  4M7D A;  1B34 A;  4NL2 A;  5GAN j;  5LJ5 f;  3JCM c;  4N0A A;  1N9R A;  3QSU A;  2FB7 A;  4EMG A;  4M75 C;  3QUI A;  5GMK e;  1LJO A;  4NOY A;  1LOJ A;  2DXT A;  2RM4 A;  4X9C A;  3JCM b;  3JCM J;  4XU1 A;  4M7A D;  3HSB A;  3BW1 A;  4WF2 A;  3JB9 F;  5LJ5 g;  5GAN 4;  4F7U F;  2VXF A;  3RIR A;  4M78 A;  5CAI A;  1U1S A;  2E64 A;  4M7A G;  4PJO D;  3RER A;  4XU3 A;  4XQ3 A;  4XTV A;  3HFN A;  1LNX A;  4M7A B;  2YLB A;  4M77 A;  5I21 A;  2E1H A;  2CGH A;  3FJP A;  4M75 E;  1N9S A;  4JUV A;  4MMK A;  5GAM e;  4M7D D;  3JCM e;  4PJO G;  3SWN A;  5GAM h;  1I81 A;  4DQ2 A;  4PJO B;  5GAO l;  4C92 D;  1I4K 1;  5GAN e;  1WQ7 A;  5GAO n;  4EMK A;  4F7U E;  4M7D G;  1KQ1 A;  2FYK A;  4XU0 A;  1B34 B;  1M8V A;  4M7A C;  1U1T A;  4A54 A;  2HNI A;  3FIF A;  4M75 F;  4M78 D;  1HXD A;  4C92 A;  3RUX A;  4C8Q D;  2EJ9 A;  5GAN 2;  5LJ3 e;  3RKW A;  5GMK h;  5LJ5 j;  5LJ3 h;  3BFM A;  3FB9 A;  4M77 D;  4M78 G;  3JB9 I;  2YLC A;  3L1A A;  5GAN 8;  3JB9 H;  3QHS A;  1YCY A;  2VXE A;  5GAM f;  3GIB A;  4C8Q A;  5GAN 5;  2DZ9 A;  4M77 G;  2DZC A;  1I5L A;  1H64 1;  3JCM X;  1D3B A;  3EFR A;  2E10 A;  4N0A C;  5GAN 3;  4M7A E;  4OP0 A;  2QTX A;  1I8F A;  4F7U A;  4JRI A;  5GAO r;  4HT9 A;  5GAM g;  3SWN B;  5GAM d;  2EJG A;  3M4G A;  1KQ2 A;  3JCM h;  1TH7 A;  3VU3 C;  3JCM d;  4HA8 A;  5GMK m;  2ZGW A;  2DVE A;  2DKG A;  4EMK B;  2DTH A;  1BIA A;  3V7R A;  2DTI A;  3HFO A;  5GAN h;  3RES A;  5LJ3 f;  5GAN d;  4M7D B;  2Y90 A;  3AHU A;  1Y96 A;  3RKX A;  3V7S A;  2DTO A;  4RCB A;  4C92 G;  3BY7 A;  5LJ5 e;  4JLI A;  4M7A F;  4HT8 A;  3V8L A;  5GAO p;  4J6X A;  4JRK A;  4C92 B;  4XTU A;  2RD1 A;  2DXU A;  4V2S A;  1HK9 A;  3L2Z A;  1WQW A;  3SWN C;  4Y91 A;  5LJ3 g;  5LJ3 d;  3JB9 D;  4PJO F;  4PJO C;  4EMH A;  4XU2 A;  5GAO q;  1MGQ A;  1BIB A;  1WNL A;  4XTZ A;  4C8Q G;  4EMK C;  5GAN 6;  4NL3 A;  4M78 B;  4M75 A;  2E65 A;  4C8Q B;  4M7D C;  3JCM f;  5GMK l;  5GAN 7;  4M7D F;  2EAY A;  4QVD A;  2DJZ A;  2EWN A;  2RA2 A;  4F7U G;  3INZ A;  4M77 B;  4C92 C;  5GAN f;  5GAM j;  1X01 A;  4J6W A;  4J6Y A;  2YHT A;  3JCM g;  3V7C A;  3JCM Q;  1JRI A;  3SB2 A;  3V8K A;  4PJO E; 
#chains in the Genus database with same CATH topology
 4JZ3 A;  4X9D A;  1B07 A;  3PMI A;  2KYM A;  4M77 F;  2LP5 A;  1BKB A;  1UGP B;  4DBF A;  5LJ5 d;  1W4S A;  2DK3 A;  1JXO A;  1QW1 A;  4F04 B;  3CCS Q;  1IRE B;  4C0Z A;  4O6J A;  2CZ1 B;  2VYT A;  1SSH A;  1PD1 A;  4LNP A;  3OYN A;  1RAC B;  3O8V A;  4BE1 A;  4DA4 A;  1WHK A;  1M9S A;  4M7D A;  4NL2 A;  3ME9 A;  1YJW T;  2DMO A;  1AZG B;  2O2O A;  4M4Z A;  1KC8 U;  3J7A F;  2A36 A;  3FEO A;  3MPU B;  1ABQ A;  1SRM A;  2CP0 A;  3PNW C;  4IIM A;  4JDS A;  1PWT A;  2DL4 A;  3RMQ A;  4ORZ A;  4AG1 C;  1I81 A;  3CCE Q;  2R5A A;  1WQ7 A;  3G6E T;  2FYK A;  2L5Q A;  5L8R E;  2H8H A;  1EIF A;  4WCI A;  1ZSZ C;  4J9F A;  2KNB B;  2VXE A;  4ZN1 A;  2OAW A;  2XHC A;  1UE9 A;  2DZC A;  2RF0 A;  3JCM X;  4A4G A;  2XU8 A;  1JXM A;  3CCQ A;  4ELZ C;  1W70 A;  1YFN A;  3OA6 A;  4HT9 A;  2EKO A;  1FMW A;  3JCM h;  1TH7 A;  4OMQ A;  1UJY A;  1TOV A;  4RCB A;  2RHU A;  2CT4 A;  4KH1 B;  1BCM A;  4VUB A;  1U06 A;  3TRE A;  1ACM B;  3CC4 T;  1YHQ A;  2GBQ A;  4EIK A;  1RAD B;  4ME7 A;  4ZGD B;  5GAN 7;  5FWB A;  4QVD A;  5HCK A;  4BB7 A;  2LT1 A;  2HKN A;  2HCK A;  4Z88 A;  1AWJ A;  2ENM A;  2FPF A;  3HRS A;  2EQJ A;  2RQV A;  3OYE A;  4QQD A;  1DJ7 B;  5CQY A;  4J7F A;  2CP3 A;  1YJW A;  3QYG B;  4N4H A;  1G8X A;  2CSI A;  2PUK B;  4M78 E;  1I0C A;  2WSF E;  3D7S B;  1M5Q 1;  4XTW A;  1WI7 A;  2K6D A;  4LUD A;  3J81 E;  3QWY A;  2HD0 A;  1TUG B;  2RM4 A;  3I55 T;  5A0D A;  3G6E A;  1VYU A;  2CUD A;  4AT1 B;  2F5K A;  2P84 A;  2DJQ A;  1M90 C;  1N9S A;  1PKS A;  3CCU Q;  3VS6 A;  3RBB B;  4F7U E;  2D8J A;  8ATC B;  5L23 A;  2LQN A;  2A3L A;  3FLG A;  2GCX A;  1H3Z A;  1Q81 C;  1GRI A;  4IIO A;  2X3X D;  4LDX A;  1AOJ A;  3M4Y A;  5GAM f;  4P5N A;  2RPN A;  2RQW A;  3NFC A;  4PJJ A;  2F2V A;  1KHI A;  2CZ0 B;  3CC4 A;  4DBQ A;  2DL5 A;  1KQ2 A;  3LGL A;  2D8H A;  1Y71 A;  2IIM A;  3PE0 A;  1HJD A;  1BI3 A;  3TEE A;  2C06 A;  2DTI A;  1K0S A;  3EH1 A;  1RAB B;  1NZ9 A;  4FCY A;  1W2B S;  4DEY A;  2C0T A;  4JZ4 A;  1WIE A;  4M78 B;  4M7D F;  2J7I A;  4DBR A;  3GP8 A;  1XNI A;  1UDL A;  3MO8 A;  2X4W A;  2GQV A;  3PMT A;  2MWP A;  1ZUK A;  2EQI A;  3JV3 A;  5HK0 A;  1YJN T;  1I07 A;  1OZ2 A;  2EYX A;  1FMV A;  2GTJ A;  5IAY A;  1IGU A;  1M1K U;  2E12 A;  3I55 A;  4PFO A;  4JJN K;  4F7U B;  4HVV A;  2VC8 A;  1WFW A;  5FU6 C;  4QKU A;  3NMZ C;  3OYM A;  2RI2 A;  4JJC A;  2DFU A;  5I11 A;  2V8K A;  1S72 T;  3QKJ A;  2VV5 A;  3CCV T;  4LE9 A;  2BZY A;  4O5V A;  3TCJ A;  3JAM E;  2Z0W A;  2XI9 A;  4C0D B;  1LNX A;  4PFZ A;  2CGH A;  3DLL A;  3E2U A;  2KMT A;  2NUT B;  2LJ0 A;  4JRP A;  1XQH A;  4XU0 A;  1ARK A;  1B34 B;  1M8V A;  3A8H B;  3CMA Q;  3JB9 I;  5KYN A;  5IXB A;  4IKF A;  1TWB A;  2F1L A;  2CP7 A;  2CP5 A;  3EG0 A;  2OTJ T;  5GAM d;  1MV3 A;  3CC2 Q;  1X6O A;  5GMK m;  3OMG A;  2ZPI B;  1KQS A;  2JVV A;  3FRN A;  3I56 T;  1JQQ A;  5GAO p;  2ED1 A;  3ASK A;  2L8D A;  4Y91 A;  3BE3 A;  1QWE A;  2KRN A;  1Q95 G;  4NL3 A;  2EQM A;  3CPW S;  5GAN f;  2WSE E;  4QQ6 A;  3JCM g;  2OI3 A;  3MEU A;  3QG1 A;  4AFZ C;  4B6M A;  1AVZ C;  2QQS A;  1V29 B;  1G3W A;  2YSQ A;  1M2O A;  1WA7 A;  3SEM A;  4RMO A;  2ATC B;  2L89 A;  4OVA A;  1UUE A;  3TVT A;  1FX7 A;  2BZ8 A;  3VS1 A;  4YTL A;  1ZLM A;  2FPE A;  5EC7 A;  4C0G A;  2AZS A;  5GMK i;  3CCV A;  1RAF B;  1ZSZ B;  2FVU A;  2XDP A;  4FU6 A;  2E41 A;  2A0F B;  2O31 A;  2LX9 A;  1LJO A;  1IGQ A;  3TSZ A;  4WF2 A;  3OYI A;  4FW2 A;  3RIR A;  2JUF A;  4XU3 A;  2WAC A;  3KXT A;  1VQ5 Q;  4Y28 E;  4E7S A;  1Q7Y C;  2GTO A;  4UC4 A;  4GLM A;  2ECZ A;  1MHN A;  3DLM A;  2K3Y A;  2CP2 A;  1NYF A;  2OTJ A;  4M78 D;  1SHG A;  3NTH A;  2EJ9 A;  3RKW A;  3FB9 A;  4M78 G;  4JS4 A;  3I56 A;  1YJ9 Q;  2LVM A;  2F69 A;  2LMJ A;  2AHJ B;  4E7I A;  5D6W A;  2ZPB B;  2L2P A;  5DM7 R;  4BDY A;  1TS9 A;  2ZPG B;  3M59 A;  1J3T A;  3M0U A;  4BUG A;  4OF1 A;  3L2U A;  1JJ2 A;  2DBK A;  3NTI A;  1Y7X A;  4PJM A;  1W6X A;  4RKU E;  2VB6 A;  1FYN A;  4PJO C;  2L3P A;  1WNL A;  3M58 A;  3L2V A;  5I22 A;  3CCM T;  4CC3 A;  1IHV A;  2E65 A;  2MPX C;  1GBQ A;  3UAT A;  4AMC A;  4AFU C;  4F7U G;  2E70 A;  3N5B B;  5GAM j;  1T0J A;  3QYH B;  9ATC B;  1QCF A;  4J6W A;  1W2B P;  2YHT A;  6AT1 B;  4DBH A;  2HAX A;  3V8K A;  5KYU B;  2K57 A;  3SFM A;  3CCS T;  2X9H A;  5KYX A;  4M77 C;  2BIV A;  1QLY A;  1ABO A;  1Z9Z A;  1JEG A;  2HQE A;  3CXC A;  4R55 A;  2EYQ A;  2X4X A;  1KD1 R;  2RJC A;  5AT1 B;  2CDT A;  2K4Y A;  1M3A A;  4JJD A;  1IZ6 A;  2FHD A;  2FZG B;  3CC7 Q;  2H3J A;  3DKM A;  2RNA A;  5LJ5 f;  3CCL A;  2JZ2 A;  3OB9 A;  5D6X A;  1OV3 A;  1VQ9 A;  1SRL A;  2DLP A;  4M78 A;  3FC3 A;  5A2Q E;  3CCE T;  1BB9 A;  5KYY B;  2KT1 A;  3TU4 K;  3M0T A;  3EGD A;  2J6O A;  1QP3 A;  1Q81 U;  3PFS A;  2JNG A;  4KBM B;  5GAN e;  2PVG B;  3TSW A;  4HCB A;  2FRY A;  1RAG B;  5KH6 A;  2CZ7 B;  1YN8 A;  2V8I A;  2OTL A;  1P92 A;  3VS4 A;  2GNC A;  4BDZ A;  2ABL A;  3VS7 A;  3G4S T;  4MDX A;  2VAS A;  1I5O B;  1VQO Q;  2KXC A;  3RDV A;  5KE2 A;  1VOM A;  2XKO C;  4M7A E;  3MHX A;  1QQJ A;  4RTX A;  4F7U A;  4ZGE B;  3CCM A;  1MV0 B;  3P8B B;  5CR2 A;  1WXT A;  1HSQ A;  3VS0 A;  3M54 A;  1Y96 A;  3VRY A;  1M1G A;  1RUW A;  2FL7 A;  3AHU A;  1NEB A;  4J6X A;  2MK5 A;  1HK9 A;  1R8O B;  5J26 A;  3OS5 A;  1G3T A;  1WX6 A;  3CCS A;  4OMN A;  4JRQ A;  2MYS A;  1TU0 B;  4MZT A;  3X24 B;  2DJZ A;  1PM3 A;  2J6K A;  3E9G A;  2QG9 B;  2DXC A;  1QP2 A;  3X20 B;  1LVK A;  1LPL A;  3PTA A;  4A4H A;  1OX9 A;  1KK7 A;  2COZ A;  3QJ6 A;  1QCO A;  2RO0 A;  4M75 D;  4C92 E;  4J5Y A;  1VQP A;  5FRM A;  2DYB A;  4K11 A;  4QVC A;  4M75 G;  4LDY A;  1MNE A;  4PFP A;  2LT4 A;  4C8Q E;  1YWO A;  2FG0 A;  2RB6 A;  1WHG A;  1WPY A;  1OU8 A;  1D1A A;  1N27 A;  5GAN j;  1VQL Q;  4GY5 A;  5CCA A;  2COW A;  5EG2 A;  1NJI R;  4XU1 A;  1VQ6 Q;  5FU7 B;  3OYK A;  3ULR B;  2NUP A;  3L2W A;  2WSC E;  3CCU T;  1U1S A;  2CH4 W;  5M9O A;  3EGX A;  1B3Q A;  4QQG A;  4M7A B;  4CC7 A;  3LX7 A;  3VUB A;  5IT9 E;  2ZPE B;  4HXJ A;  1XOV A;  2LDM A;  4DQ2 A;  2SEM A;  4E7J A;  3G4S A;  1NPP A;  1NBE B;  2I0N A;  2LJ1 A;  3G71 Q;  3A8O B;  4C5G A;  2EYZ A;  1HXD A;  3E19 A;  2DER A;  4IUU A;  3OYG A;  1RAE B;  4ATO A;  2RK1 A;  5CKD A;  2NLU A;  5HY6 A;  1G3S A;  2ZZD A;  4QVZ A;  3E1S A;  4J9B A;  1OPL A;  2E4H A;  1H92 A;  5IXF A;  1VQ8 T;  4D8D A;  1VQM Q;  4IUT A;  1VQN Q;  5KYW A;  5LJ3 f;  3URG A;  1AWO A;  5LJ5 e;  1WJQ A;  3E9F A;  1ZX6 A;  4C92 B;  3L2Q A;  4FYW B;  4MZM A;  1YIT Q;  4Z02 A;  2AKL A;  2J6F A;  2HKQ B;  2D0Q B;  4M75 A;  4KUD K;  4C8Q B;  4M7D C;  5GMK l;  2YDL A;  3SD4 A;  2EW3 A;  2DIL A;  1AD5 A;  1T3S A;  2KRO A;  3HHT B;  4FT4 A;  3EFO A;  5LL6 S;  1M2V B;  2RMO A;  4M78 F;  1QVF P;  2EBP A;  3S3O A;  2DL8 A;  3HRU A;  3M0S A;  5IHN A;  4JPB W;  2BTT A;  3OYD A;  2HQH A;  2LNV A;  2XMF A;  5GJV B;  3CCU A;  4TVR A;  5DLQ E;  4BE0 A;  1BBZ A;  2MAM A;  2O4X B;  1Q7Y U;  2QQ9 A;  4M75 C;  5GMK e;  1Q82 C;  4FYY B;  2RQT A;  5FW9 A;  4F7U F;  1NLO C;  3DB4 A;  4OB0 B;  2CZ6 B;  5D6Y A;  4HKE A;  1WXB A;  1M1F A;  1Z9Q A;  2EYW A;  3CCJ Q;  3R6N A;  5GAM h;  2XDD A;  4PJO B;  1Q86 C;  3CMA T;  2HL5 C;  2JJ9 A;  4JJB A;  3QXE B;  2K5F A;  1K73 C;  4IUR A;  2EIF A;  4OMM A;  5LJ5 j;  1VQ8 A;  1WHM A;  3S3N A;  3AT1 B;  2XK0 A;  3CC2 T;  4HCK A;  3CCQ Q;  1NYG A;  3MKD A;  4JS5 A;  1KQS S;  3OBW A;  2ROT A;  2LCS A;  1UHF A;  3LH0 A;  2F2W A;  1VQK Q;  3HRT A;  4X1V A;  2QI2 A;  5I2S A;  3V7R A;  3I9Q A;  3WVD B;  1NLP C;  1OX8 A;  3BY7 A;  4GLK A;  5FWC A;  4HT8 A;  4DEX A;  2QQA A;  2KI7 A;  4J9E A;  4V2S A;  2NYS A;  4LDW A;  5LJ3 d;  1GCP A;  1UHC A;  2JOY A;  4XU2 A;  2OJ2 A;  1UGS B;  5KYY A;  2EAY A;  3UF4 A;  1KC8 R;  2AIR B;  4RG2 A;  2ZPH B;  1X6G A;  3UA6 A;  3JCM Q;  2KGT A;  3VS3 A;  2DIG A;  2VUB A;  1FXX A;  3H8Z A;  5GAO m;  4RG8 A;  2M02 A;  2O88 A;  1QCN A;  2JT4 A;  3JCM P;  5GMK j;  3SDZ A;  4PLL A;  2RI3 A;  4OMP A;  1SPK A;  3OYL A;  1OEB A;  2G3R A;  4LD9 K;  2YUP A;  2GQI A;  2CSQ A;  4RCC A;  4KH0 B;  2PZ1 A;  3ER0 A;  3QO3 A;  3MCA B;  1H8K A;  2JMC A;  3UPU A;  5HKC A;  1R0B G;  3WVE B;  3THK A;  3JCM b;  3CMA A;  2AZV A;  4CC2 A;  3VS2 A;  1VQ5 T;  2B86 A;  2A08 A;  2ESW A;  4RTY A;  4LN2 A;  2K2M A;  3RER A;  2KXD A;  3HFN A;  4JUV A;  4MMK A;  3OYH A;  3A98 A;  1ZSG A;  3SWN A;  2F2X A;  4C92 D;  5GAO n;  3CC2 A;  4EMK A;  2JMA A;  1EZZ B;  5HK3 A;  3M0R A;  3TQ7 P;  3OYF A;  1IXD A;  1PRM C;  1YJ9 T;  4M75 F;  1RI0 A;  2JS0 A;  2M0O A;  3NTK A;  2DYI A;  1TTH B;  4OMO A;  3M9Q A;  4C8Q D;  4BI3 A;  2KSS A;  4A4E A;  2ZPF B;  3CC4 Q;  1GL5 A;  1OI1 A;  2O9V A;  4BI4 A;  4IUV A;  2W0Z A;  1JJ2 S;  2X4J A;  1G3Y A;  3JCM d;  3F70 A;  2FEI A;  1E6G A;  3QDR B;  2DKG A;  1QVG S;  5GAN h;  3HFO A;  3RES A;  4DOW A;  2A37 A;  3EG9 B;  2RQU A;  3OS2 A;  3GNF B;  3V8L A;  1RL2 A;  2A7Y A;  2MWO A;  4PJN A;  3SWN C;  2DIQ A;  4BY6 B;  3JB9 D;  2J06 A;  4EMK C;  1QKW A;  1WLP B;  2KAF A;  1K8A R;  2GGR A;  2BE9 B;  2PNI A;  3I35 A;  3RMS A;  1X01 A;  3HKS A;  5ECA A;  4A63 B;  2I2L A;  2M16 A;  3RR6 A;  3OQ5 A;  3CXC S;  1PSF A;  1HD3 A;  1C0M A;  3GOX A;  3OW2 S;  5LJ3 j;  2EQK A;  1MMN A;  1M30 A;  3I5R A;  4C5H A;  4WTO B;  1AT1 B;  1YJN A;  1VA7 A;  3CC7 T;  3JCM W;  2QTV A;  2JN0 A;  1RLQ C;  1VQ5 A;  1ZA1 B;  2P4R A;  5CIU A;  1UEB A;  1TUD A;  3JB9 J;  1K9M R;  5KCO A;  3JCM c;  4JLG A;  4FSX A;  1OUL A;  4EMG A;  3QUI A;  3MP8 A;  2YRC A;  3OBY A;  5GAN 4;  2K5I A;  3CPF A;  4ELY C;  2M51 A;  4HCZ A;  1YJ9 A;  5I21 A;  2DAQ A;  1QWF A;  1S72 A;  1D0Y A;  3FJP A;  1H3H A;  5GAM e;  2ED0 A;  4KGZ B;  3OYJ A;  1PD0 A;  4C0F A;  2HMA A;  3QJY A;  1M27 C;  1JB0 E;  2KK4 A;  4KT0 E;  5FRO A;  5GJW B;  1KSW A;  3VYH B;  2D9T A;  1U1T A;  1XJW B;  1PCX A;  3C4S A;  1ZA2 B;  2FRW A;  4KRT A;  4E7H A;  1VQO T;  2DVJ A;  2RHZ A;  1WZO A;  2R5M A;  2LQ8 A;  1W2B A;  4FSS A;  5GAN 3;  3HPW A;  1ZUU A;  2E3H A;  2CP6 A;  5GAM g;  3OY9 A;  3LWH A;  1M1K R;  2O4X A;  3UWN A;  4MDW A;  2RN8 A;  4FW1 A;  3RKX A;  1G83 A;  1UTI A;  2DTO A;  4JLI A;  3I5S A;  4ESR A;  4XTZ A;  1MMG A;  3T9N A;  2QA4 Q;  1CKB A;  2CS7 A;  2RJE A;  5I2M A;  2V1Q A;  1YNZ A;  1VQ4 Q;  2LJ3 A;  4MML A;  3CC7 A;  1N8R R;  4Y92 A;  2K79 A;  3CME Q;  3BDL A;  1KHC A;  4A53 A;  2BUD A;  4RTV A;  5LJ5 h;  2QQB A;  3CD6 Q;  3BDU A;  3RKY A;  3OYY A;  1Q82 U;  1NPR A;  1PKT A;  1VQL T;  3UDC A;  2M1H A;  2KE9 A;  2G6F X;  1D0X A;  1D1C A;  1NG2 A;  3X25 B;  2HZY A;  1BI1 A;  3PVL A;  4NOY A;  1Q86 U;  3BW1 A;  2IPO B;  2RI5 A;  1K73 U;  2RHX A;  3NPF A;  2K5L A;  2QGG A;  2CT3 A;  4E7L A;  1VQO A;  3ZEH A;  2O01 E;  3M55 A;  3G71 T;  2QEX Q;  2JTE A;  1GCQ A;  3M5A A;  3REB B;  3CQT A;  2RK2 A;  2CRE A;  2XG8 D;  2YRV A;  1K9A A;  5GMK h;  3I56 Q;  5GAN 8;  1MMD A;  5GAN 5;  5CQX A;  1GFD A;  2RHY A;  1WHJ A;  3EFR A;  3MP1 A;  1EX4 A;  4KGV B;  1VQM T;  1VQN T;  1OQK A;  1PSE A;  3VU3 C;  3IQL A;  4PKC C;  1BIA A;  2FZK B;  5A0G A;  1YIT T;  1GXI E;  4AFS C;  1RAH B;  1RI9 A;  3GLX A;  4R56 A;  1ZBJ A;  2DXU A;  1R0C B;  4PJL A;  1MMA A;  3UT1 A;  3A5Z B;  3S6W A;  4D8K A;  1BIB A;  1ZBX A;  4KUI A;  5GAN 6;  1WJR A;  1QVG P;  1OU9 A;  2FO0 A;  4FM4 B;  1GCQ C;  1K76 A;  1X2K A;  2MF2 A;  2QQR A;  3GF5 A;  1KIK A;  2CKK A;  2L0A A;  2MOX A;  2NUZ A;  3H9N A;  3INZ A;  3PT9 A;  1I1J A;  2XIC A;  1BK2 A;  2QAZ A;  2EKH A;  3EGU A;  3HP9 A;  2IVW A;  1X75 C;  3VKI A;  4M78 C;  5GAN g;  1UG1 A;  1MND A;  4C8Q F;  1T3L A;  3M0P A;  1VQL A;  3H0I A;  1VQ7 Q;  1M8M A;  1JO8 A;  5FU6 B;  1O9S A;  3CBM A;  4PNO A;  2D6F A;  4N4I A;  3NGP A;  2NUT A;  5IH2 A;  5CKH A;  3CCL Q;  5CKB A;  4F14 A;  2HSE B;  3ZL7 C;  4B9X A;  3EG9 A;  1B34 A;  7AT1 B;  2EPD A;  1E7O A;  3G71 A;  2EGA A;  3KFV A;  4N0A A;  1LCK A;  3QSU A;  4KGX B;  3QWX X;  1LOJ A;  3QDF A;  4PLI A;  1VQ9 Q;  3JB9 F;  3CCR Q;  3CPW P;  3FJ5 A;  4PL6 A;  3CCJ T;  2X35 A;  1X69 A;  2JS2 A;  1IB8 A;  1V1C A;  4E2F B;  2DF6 A;  1X27 A;  3ZBD A;  2XID A;  1HYO A;  3VUZ A;  2QGF B;  4RTU A;  4CC4 B;  3CCE A;  2QXF A;  2L3S A;  4A4K A;  1YI2 Q;  4C0D C;  1VQM A;  1VQN A;  2OTL Q;  2DM1 A;  1V76 A;  2AKK A;  3CCQ T;  2HL3 A;  3OYA A;  5LJ3 h;  2BE7 D;  1YIT A;  3R6O A;  3JB9 H;  3GIB A;  1VQK T;  1NM7 A;  4ANJ A;  4N0A C;  4OP0 A;  2E5K A;  1I8F A;  1QVF A;  4E6R A;  2EJG A;  2CUB A;  1KD1 C;  3H6Z A;  2KQW A;  2HDA A;  3KUF A;  1RLP C;  2RD1 A;  4X34 A;  3M0Q A;  1WQW A;  1R77 A;  1KG1 A;  1M90 R;  1FWZ A;  1CKA A;  2KRS A;  1YIJ Q;  2EWN A;  2RA2 A;  1ZSZ A;  2DPP B;  4J6Y A;  4PJO E;  1Q81 R;  4R0K A;  1VQP Q;  1C6V X;  5DY9 A;  3MET A;  1K0X A;  4A4F A;  3CBO A;  2QAS A;  1UGQ B;  3EG3 A;  2RH2 A;  2YRD A;  2QDL A;  5CK9 A;  2DEU A;  2HEQ A;  4XTY A;  5CVI A;  2KYB A;  4XTX A;  4M77 E;  3CCJ A;  2D0N A;  2JXB A;  3ZFJ A;  2AK5 A;  4J9I A;  4OML A;  5IHI A;  2KR3 A;  2DO3 A;  4C5E A;  2YUQ A;  2DXT A;  3JCM J;  3FDR A;  5LJ5 g;  2LC4 A;  3CEY A;  1YWP A;  2E64 A;  4OGE A;  1WHH A;  2SRC A;  2KT8 A;  2E1H A;  1ZHI A;  4L6V 5;  3G4S Q;  4ZTF A;  1N6A A;  1VQK A;  2VKN A;  1KQ1 A;  3QBY A;  3PIP A;  3OSS C;  4CI0 C;  4A54 A;  1UGR B;  1VUB A;  2KY9 A;  2VWF A;  1NE8 A;  4B9W A;  4J8O A;  1PHT A;  4EDU A;  4L59 A;  2EGE A;  5AYF A;  3OSV A;  2QTX A;  1KFZ A;  5CO7 A;  3OYB A;  3PIO A;  4XK8 E;  1RAA B;  5KYU A;  1N5Z A;  2Y90 A;  2K3B A;  1UFF A;  3V7S A;  2JTM A;  2O9S A;  2DD4 A;  1Y57 A;  4EMH A;  1MGQ A;  2P0P A;  3LLR A;  3C0C A;  1NJI C;  2L3R A;  1ZUY A;  3JCM f;  4C5I A;  1SKU B;  4RTZ A;  2LQW A;  1A0N B;  4M77 B;  1CSK A;  2V8J A;  2R58 A;  4ZTJ A;  1D0Z A;  1WYX A;  2C0O A;  4HVU A;  4LDV A;  3GPL A;  2L3Q A;  1K8A U;  3C12 A;  3JRZ A;  5IHK A;  3JCM V;  3EHR A;  1YHQ Q;  3O5Z A;  2LZ6 B;  1O75 A;  2KDS A;  3CBP A;  3X28 B;  3H0H A;  3REA B;  2PVO B;  3SHW A;  1WDX A;  3EFS A;  2DRK A;  2ZAE A;  3M56 A;  5J3B A;  5FRN A;  3G7Z A;  2E6N A;  1JBM A;  2HSP A;  2Y4X A;  2E3I A;  3MP6 A;  2IG0 A;  2YUO A;  5KYX B;  4E7Z A;  4M7A D;  1AWX A;  1M3B A;  2VXF A;  1YJW Q;  4M7A G;  2E5Q A;  2KEA A;  1K9M U;  4XTV A;  2LX7 A;  1F1B B;  2P0K A;  3H41 A;  2C0I A;  3MEA A;  2QDY B;  2HQX A;  3VJP A;  4LUE A;  1C1A A;  1OPK A;  3LGF A;  1D09 B;  3RUX A;  3LWI A;  3HTR A;  5LJ3 e;  1VQ8 Q;  3G6E Q;  1SEM A;  1B7T A;  1G5V A;  5IN1 A;  2YUN A;  1VIF A;  2YLC A;  4L5G A;  1AWW A;  1E6H A;  4ZGJ B;  1S1N A;  2FZC B;  1I5L A;  3G1J A;  4FT2 A;  4BE2 A;  3A8L B;  3EGD B;  2V26 A;  3EG2 A;  1K1Z A;  2JM8 A;  1UB4 A;  4OMF B;  4RUG A;  4HA8 A;  3A8G B;  1TXQ A;  2ZGW A;  1PNJ A;  2JM9 A;  4ZN3 A;  2QK0 A;  3WXM B;  2E6Z A;  4AG2 C;  2GFA A;  4C92 G;  3QPH A;  4JRK A;  2RJD A;  4DOV A;  5LJ3 g;  3JSC A;  3OS0 A;  3S3M A;  2QA4 T;  1M3C A;  3PVQ A;  4C8Q G;  1Q7Y R;  2QYZ A;  3VYG A;  1VQ4 T;  3OYC A;  2X4Y A;  4BI8 B;  3CME T;  1OZ3 A;  1AHJ B;  3EH2 A;  1WXU A;  3CD6 T;  4IUQ A;  1UGV A;  2K3X A;  1Y96 B;  4M7D E;  1K4U S;  1QVP A;  2BZX A;  1TUC A;  2X3W D;  1N8R U;  1PRL C;  4M7A A;  5DLO A;  3JB9 G;  1D3B B;  2KVQ G;  4LDU A;  3V8J A;  2V1R A;  2DET A;  2EJF A;  4OB2 B;  1PG5 B;  1N9R A;  2DL3 A;  2FB7 A;  4FYX B;  2COY A;  1RAI B;  4PK4 A;  2W10 A;  2QEX T;  1IRX A;  1IHW A;  1UJ0 A;  1PC0 A;  4PJO D;  2RHI A;  3I55 Q;  2YLB A;  4M75 E;  3VRZ A;  3JCM e;  4PJO G;  1BU1 A;  4XAX B;  5FU7 C;  2EYY A;  1I4K 1;  4QW2 A;  2RQR A;  1KC8 C;  4F17 A;  5KE3 A;  4M7A C;  2EFI A;  4C92 A;  1X43 A;  1KD1 U;  4LD6 A;  4HVW A;  2FPD A;  2DE0 X;  4M77 D;  1FMK A;  2NUP B;  2H3E B;  4C8Q A;  4M77 G;  3EGX B;  1SF9 A;  4RTT A;  4NS5 A;  3A1P A;  2QA4 A;  3VV0 A;  1VQ4 A;  1M2V A;  2JW4 A;  2DTH A;  4Z8A A;  2DXB A;  2LCL A;  4M7D B;  2K7A A;  3CME A;  1NEG A;  1AEY A;  2MI6 A;  4XTU A;  1U8R A;  2DX1 A;  3CD6 A;  4ZNX A;  5GAO q;  2EQU A;  2OAU A;  1KJW A;  3GBQ A;  1WHL A;  1SG5 A;  2XDB A;  2CYZ B;  5CKE A;  3MEW A;  1X2Q A;  1ZQ1 A;  2MIO A;  4J9C A;  4C92 C;  1VQ7 T;  1BCO A;  4BAC A;  3EHQ A;  2PQW A;  4MZP A;  3J80 E;  4C8Q C;  5KYW B;  3L2R A;  1KQS P;  2DA9 A;  1X6B A;  1YJN Q;  2K2V A;  5D7U A;  4HCC A;  1QKX A;  2DL7 A;  2K9G A;  2F5T X;  2LQK A;  4M75 B;  4EPC A;  3CCL T;  4F16 A;  2P0Q A;  2QEX A;  2MMP A;  4PJO A;  2CH4 A;  4J9G A;  2DD5 A;  4OB1 B;  3PGG A;  1VQ9 T;  2VGN A;  4FIB A;  4IUP A;  3EFO B;  3CCR T;  1TG0 A;  2YXY A;  5J39 A;  1YP5 A;  2YT6 A;  5CAI A;  2P4T A;  1S72 Q;  2GF7 A;  3M57 A;  3NHN A;  4XQ3 A;  3CCV Q;  3GNG A;  4M77 A;  1OOT A;  5C6S A;  1YI2 T;  1QMC A;  5C0M A;  2OTL T;  1K8A C;  4E47 A;  3RNJ A;  1VQ6 T;  2VVK A;  2OX7 A;  2HNI A;  5GAN 2;  2PU9 B;  1QVG A;  1BI2 A;  4OB3 B;  3L1A A;  3QHS A;  1YCY A;  1QVF S;  1UEC A;  4KUL A;  2DZ9 A;  3UA7 A;  2XD0 A;  5FLX E;  2GFU A;  2E10 A;  3MEV A;  1U5S A;  1AZE A;  2HBW A;  4JRI A;  5GAO r;  3OS1 A;  3C95 A;  4J83 A;  2AT1 B;  1NJI U;  1U3O A;  1BYM A;  2A28 A;  2DVE A;  5GAN d;  2JTF A;  4FYV B;  2OTJ Q;  5KCH A;  3LW5 E;  4M7A F;  2ZCF B;  1K9M C;  1VQ7 A;  3A8M B;  3C94 A;  3L2Z A;  4CRI A;  1YIJ T;  4OGC A;  4E7K A;  1Y07 A;  4D6W A;  4RTW A;  4J9D A;  1VIE A;  2PUO B;  1SHF A;  3OW2 A;  2BKD N;  4Z89 A;  3VS5 A;  1GBR A;  2YWW A;  1G2B A;  3V7C A;  3SB2 A;  1VQP T;  3HL8 A;  2DEQ A;  1M90 U;  3CPW A;  2ROL A;  4N4G A;  2LNH B;  2Y4Y A;  3M53 A;  1BI0 A;  2NWM A;  1YCS B;  2M9U A;  1EFN A;  3CCR A;  1JJ2 P;  2DBM A;  1SSF A;  2HBP A;  4FL6 A;  2EVR A;  3P8D A;  5A0L A;  3EG1 A;  4BD3 A;  4C92 F;  3P8H A;  1Y0M A;  3QZ9 B;  1YI2 A;  1M1K C;  2M0Y A;  1IO6 A;  2LTO A;  4X9C A;  4J9H A;  3HSB A;  1VQ6 A;  2J05 A;  3LH5 A;  2X51 A;  4II1 A;  2DNU A;  1M4Z A;  2LCC A;  4M7D D;  2PTK A;  2D1X A;  3CXC P;  2B8A A;  1OYX A;  2VGM A;  5GAO l;  3OW2 P;  4M7D G;  2KBT A;  2RJF A;  3EAE A;  3KBG A;  3X26 B;  1D1B A;  1MUZ A;  3QZ5 B;  3FIF A;  1N8R C;  3MJX A;  3Q1J A;  2LRQ A;  2MCN A;  8AT1 B;  3BFM A;  3LYI A;  3OMC A;  4GBQ A;  1XTD A;  4AFQ C;  2DRM A;  1H64 1;  3L42 A;  1D3B A;  3QII A;  1YIJ A;  1YBY A;  3SWN B;  3M4G A;  3U23 A;  1VYV A;  3DB3 A;  1Q82 R;  1JU5 C;  4EMK B;  1VYT A;  2KRM A;  2EGC A;  1T0H A;  3H0F A;  4J7I A;  1TSF A;  4LXC A;  4QT7 A;  1GFC A;  4PJO F;  4Q5W A;  1WGS A;  5CKF A;  1Q86 R;  2PVD B;  1W1F A;  3CCM Q;  1K73 R;  1WJS A;  4BY6 C;  1JRI A;  2R57 A;  1YHQ T; 
#chains in the Genus database with same CATH homology
 2I2L A;  2M16 A;  4LDV A;  4X9D A;  2K57 A;  3SFM A;  3OQ5 A;  3CCS T;  3GPL A;  3CXC S;  1PSF A;  1K8A U;  3PMI A;  4M77 F;  4M77 C;  3C12 A;  3JRZ A;  3JCM V;  1BKB A;  1UGP B;  2BIV A;  5LJ5 d;  3GOX A;  3OW2 S;  5LJ3 j;  1W4S A;  2EQK A;  2DK3 A;  1O75 A;  2KDS A;  1QW1 A;  3CBP A;  3X28 B;  4C5H A;  1IRE B;  4C0Z A;  2HQE A;  3CXC A;  1YJN A;  3CC7 T;  4R55 A;  2PVO B;  2EYQ A;  2X4X A;  4O6J A;  3JCM W;  2RJC A;  2CZ1 B;  2JN0 A;  2VYT A;  3EFS A;  1VQ5 A;  2K4Y A;  5CIU A;  3OYN A;  3O8V A;  3M56 A;  1IZ6 A;  2FHD A;  5J3B A;  4BE1 A;  4DA4 A;  5FRN A;  1UEB A;  2E6N A;  2H3J A;  1JBM A;  3G7Z A;  1M9S A;  3JB9 J;  4M7D A;  3DKM A;  5KCO A;  4NL2 A;  3ME9 A;  5LJ5 f;  2Y4X A;  3MP6 A;  4JLG A;  2IG0 A;  4FSX A;  3JCM c;  3CCL A;  4EMG A;  2JZ2 A;  3QUI A;  1YJW T;  3OB9 A;  3MP8 A;  5D6X A;  3OBY A;  4M7A D;  5GAN 4;  3J7A F;  1KC8 U;  1VQ9 A;  2VXF A;  4M78 A;  2K5I A;  3CPF A;  3FEO A;  4ELY C;  4M7A G;  2E5Q A;  5A2Q E;  3FC3 A;  3CCE T;  4HCZ A;  1YJ9 A;  1K9M U;  4XTV A;  5I21 A;  2DAQ A;  3PNW C;  4JDS A;  1S72 A;  3TU4 K;  3FJP A;  3RMQ A;  5GAM e;  2P0K A;  3OYJ A;  1QP3 A;  1Q81 U;  4C0F A;  3PFS A;  1I81 A;  2JNG A;  4KBM B;  3QJY A;  3MEA A;  2R5A A;  1JB0 E;  2KK4 A;  2QDY B;  4KT0 E;  5GAN e;  5FRO A;  2HQX A;  1WQ7 A;  2PVG B;  3G6E T;  4HCB A;  3VJP A;  2FYK A;  2L5Q A;  5KH6 A;  2CZ7 B;  2D9T A;  3VYH B;  5L8R E;  1U1T A;  3C4S A;  2V8I A;  3LGF A;  3LWI A;  3RUX A;  1EIF A;  5LJ3 e;  1VQO T;  4E7H A;  2OTL A;  1G5V A;  5IN1 A;  1P92 A;  1VIF A;  4BDZ A;  2YLC A;  2RHZ A;  4L5G A;  2VXE A;  4ZN1 A;  3G4S T;  2R5M A;  4MDX A;  2XHC A;  4ZGJ B;  2DZC A;  1I5L A;  3JCM X;  2LQ8 A;  4FT2 A;  4A4G A;  2XU8 A;  5KE2 A;  2XKO C;  4BE2 A;  3A8L B;  5GAN 3;  1W2B A;  3HPW A;  4ELZ C;  3MHX A;  3CCQ A;  4M7A E;  3OA6 A;  4F7U A;  4HT9 A;  2EKO A;  5GAM g;  3OY9 A;  4ZGE B;  1UB4 A;  1TH7 A;  4OMF B;  3JCM h;  4HA8 A;  3CCM A;  3A8G B;  3LWH A;  2ZGW A;  4ZN3 A;  3P8B B;  2O4X A;  3UWN A;  5CR2 A;  4MDW A;  3WXM B;  2E6Z A;  3M54 A;  1Y96 A;  3RKX A;  1M1G A;  2FL7 A;  2DTO A;  2GFA A;  4RCB A;  4C92 G;  2RHU A;  4JLI A;  3QPH A;  4J6X A;  4JRK A;  2RJD A;  4VUB A;  4DOV A;  1HK9 A;  1R8O B;  5J26 A;  3TRE A;  5LJ3 g;  3CC4 T;  1YHQ A;  3JSC A;  3OS0 A;  3OS5 A;  1G3T A;  2QA4 T;  3S3M A;  4ME7 A;  4XTZ A;  4C8Q G;  4ZGD B;  3CCS A;  3VYG A;  1VQ4 T;  3OYC A;  2X4Y A;  4MZT A;  5GAN 7;  4JRQ A;  3X24 B;  4QVD A;  4BI8 B;  2DJZ A;  3T9N A;  4BB7 A;  2LT1 A;  3E9G A;  2DXC A;  2CS7 A;  2RJE A;  5I2M A;  3CME T;  1QP2 A;  3X20 B;  1OZ3 A;  3PTA A;  1AHJ B;  4MML A;  3CC7 A;  4A4H A;  3CD6 T;  4IUQ A;  3QJ6 A;  2K3X A;  1Y96 B;  2RO0 A;  4M7D E;  3BDL A;  1KHC A;  4A53 A;  2BUD A;  1QVP A;  4M75 D;  5LJ5 h;  4C92 E;  3HRS A;  2EQJ A;  2QQB A;  3OYE A;  3BDU A;  4J5Y A;  1VQP A;  5FRM A;  4QQD A;  1DJ7 B;  5CQY A;  3RKY A;  3OYY A;  4QVC A;  4J7F A;  4M75 G;  1N8R U;  1YJW A;  4LDY A;  1Q82 U;  4M7A A;  3QYG B;  4N4H A;  5DLO A;  2PUK B;  4M78 E;  2LT4 A;  4C8Q E;  3JB9 G;  2WSF E;  1D3B B;  2KVQ G;  1NPR A;  2RB6 A;  1VQL T;  1M5Q 1;  4XTW A;  3UDC A;  4LDU A;  2M1H A;  3V8J A;  1WPY A;  2EJF A;  3J81 E;  4OB2 B;  1N27 A;  5GAN j;  2HD0 A;  3X25 B;  1N9R A;  2FB7 A;  1BI1 A;  4GY5 A;  5CCA A;  5EG2 A;  4NOY A;  2RM4 A;  3I55 T;  4XU1 A;  5A0D A;  3BW1 A;  5FU7 B;  1Q86 U;  3OYK A;  3G6E A;  3L2W A;  2QEX T;  2WSC E;  3CCU T;  1U1S A;  2RI5 A;  1K73 U;  2RHX A;  2F5K A;  4PJO D;  2K5L A;  2RHI A;  4M7A B;  5M9O A;  4QQG A;  2YLB A;  4E7L A;  1VQO A;  3LX7 A;  3ZEH A;  2O01 E;  3VUB A;  3M55 A;  1N9S A;  2ZPE B;  4M75 E;  3G71 T;  5IT9 E;  1XOV A;  3JCM e;  1M90 C;  4PJO G;  2LDM A;  4DQ2 A;  4E7J A;  4XAX B;  5FU7 C;  3G4S A;  1I4K 1;  1NPP A;  4QW2 A;  4F7U E;  1KC8 C;  3A8O B;  3M5A A;  5KE3 A;  4M7A C;  2EFI A;  2RK2 A;  4C5G A;  3AHU A;  3E19 A;  1HXD A;  2A3L A;  2XG8 D;  3FLG A;  4IUU A;  2YRV A;  4C92 A;  2GCX A;  3OYG A;  1KD1 U;  5GMK h;  4LD6 A;  1H3Z A;  1Q81 C;  4ATO A;  2RK1 A;  4M77 D;  5CKD A;  5GAN 8;  2NLU A;  5HY6 A;  4LDX A;  3M4Y A;  5GAM f;  4C8Q A;  5GAN 5;  5CQX A;  1G3S A;  4M77 G;  2RHY A;  4P5N A;  3EFR A;  3MP1 A;  3NFC A;  2ZZD A;  4QVZ A;  1KHI A;  3E1S A;  2CZ0 B;  1VQM T;  3CC4 A;  1VQN T;  4NS5 A;  2QA4 A;  1KQ2 A;  1PSE A;  3LGL A;  1Y71 A;  3VU3 C;  1BI3 A;  4PKC C;  3VV0 A;  1VQ4 A;  3TEE A;  1VQ8 T;  2DTH A;  1BIA A;  2C06 A;  2DXB A;  2DTI A;  2LCL A;  4IUT A;  5A0G A;  5LJ3 f;  1YIT T;  4M7D B;  3URG A;  1GXI E;  5LJ5 e;  1WJQ A;  3E9F A;  3CME A;  1NZ9 A;  3GLX A;  4C92 B;  2MI6 A;  4XTU A;  4R56 A;  3L2Q A;  2DXU A;  1U8R A;  4MZM A;  1W2B S;  4Z02 A;  3A5Z B;  3S6W A;  3UT1 A;  3CD6 A;  5GAO q;  1BIB A;  1ZBX A;  4KUI A;  5GAN 6;  2EQU A;  4M78 B;  1WJR A;  2D0Q B;  2OAU A;  4FM4 B;  4M75 A;  4C8Q B;  2QQR A;  2MF2 A;  4KUD K;  3GF5 A;  5GMK l;  2XDB A;  2CYZ B;  4M7D C;  5CKE A;  2CKK A;  4M7D F;  3MEW A;  3SD4 A;  3INZ A;  3GP8 A;  1XNI A;  1ZQ1 A;  4C92 C;  3MO8 A;  3PT9 A;  2X4W A;  2XIC A;  2GQV A;  3PMT A;  1VQ7 T;  4BAC A;  2MWP A;  3HP9 A;  2IVW A;  3HHT B;  4FT4 A;  2PQW A;  1X75 C;  4MZP A;  5LL6 S;  3VKI A;  3J80 E;  4M78 C;  4M78 F;  5GAN g;  5HK0 A;  4C8Q C;  4C8Q F;  1YJN T;  1VQL A;  3S3O A;  1OZ2 A;  3L2R A;  3HRU A;  5IAY A;  5FU6 B;  2K2V A;  1O9S A;  4HCC A;  3CBM A;  1M1K U;  2LQK A;  2F5T X;  4M75 B;  4EPC A;  3CCL T;  2E12 A;  3OYD A;  4PNO A;  3I55 A;  2D6F A;  2LNV A;  4N4I A;  2P0Q A;  2QEX A;  2MMP A;  3CCU A;  4TVR A;  4PJO A;  4JJN K;  4F7U B;  2DD5 A;  5CKH A;  5DLQ E;  4BE0 A;  4OB1 B;  2VC8 A;  5CKB A;  3PGG A;  5FU6 C;  2VGN A;  4FIB A;  1VQ9 T;  4B9X A;  2MAM A;  4IUP A;  1B34 A;  3CCR T;  3OYM A;  3G71 A;  4N0A A;  2O4X B;  1Q7Y U;  2RI2 A;  2QQ9 A;  4M75 C;  5GMK e;  1Q82 C;  5J39 A;  3QSU A;  2V8K A;  1S72 T;  1LOJ A;  3QKJ A;  4PLI A;  2VV5 A;  3CCV T;  3JB9 F;  4F7U F;  4O5V A;  3DB4 A;  4PL6 A;  3TCJ A;  4OB0 B;  5CAI A;  3CCJ T;  2P4T A;  2X35 A;  3JAM E;  2CZ6 B;  5D6Y A;  2XI9 A;  2GF7 A;  3M57 A;  4HKE A;  4XQ3 A;  4C0D B;  1LNX A;  3GNG A;  4M77 A;  2CGH A;  3DLL A;  1M1F A;  5C6S A;  1YI2 T;  5GAM h;  3ZBD A;  2KMT A;  2XDD A;  5C0M A;  2OTL T;  2XID A;  4PJO B;  3VUZ A;  1K8A C;  1Q86 C;  4JRP A;  3CMA T;  3CCE A;  4E47 A;  1XQH A;  4XU0 A;  3QXE B;  2QXF A;  4A4K A;  1B34 B;  2K5F A;  1K73 C;  1VQ6 T;  4C0D C;  4IUR A;  2EIF A;  1VQM A;  1VQN A;  1M8V A;  2HNI A;  5GAN 2;  3A8H B;  2PU9 B;  3CCQ T;  1QVG A;  1BI2 A;  5LJ5 j;  5LJ3 h;  3OYA A;  4OB3 B;  1VQ8 A;  3JB9 I;  3L1A A;  1YIT A;  3R6O A;  3S3N A;  3JB9 H;  3QHS A;  1YCY A;  1QVF S;  4IKF A;  4KUL A;  3GIB A;  2XK0 A;  1VQK T;  2DZ9 A;  3CC2 T;  2XD0 A;  5FLX E;  2GFU A;  4JS5 A;  2E10 A;  3OBW A;  4N0A C;  1KQS S;  4OP0 A;  3MEV A;  1I8F A;  4JRI A;  5GAO r;  2OTJ T;  3OS1 A;  3LH0 A;  1QVF A;  5GAM d;  2EJG A;  3C95 A;  4J83 A;  3HRT A;  3H6Z A;  1KD1 C;  1NJI U;  1X6O A;  2QI2 A;  5GMK m;  1BYM A;  3OMG A;  2ZPI B;  2DVE A;  5I2S A;  1KQS A;  2KQW A;  3V7R A;  5GAN d;  2JVV A;  3FRN A;  3I56 T;  2JTF A;  3WVD B;  5KCH A;  3LW5 E;  4M7A F;  4GLK A;  3BY7 A;  2ZCF B;  3KUF A;  1K9M C;  4HT8 A;  5GAO p;  1VQ7 A;  2QQA A;  3ASK A;  2RD1 A;  2L8D A;  3A8M B;  4X34 A;  4V2S A;  3C94 A;  3L2Z A;  1WQW A;  4Y91 A;  4CRI A;  1YIJ T;  4LDW A;  4OGC A;  5LJ3 d;  4E7K A;  1Y07 A;  4D6W A;  2JOY A;  4XU2 A;  1KG1 A;  1FWZ A;  1VIE A;  1UGS B;  4NL3 A;  2PUO B;  2EQM A;  3OW2 A;  2EAY A;  2EWN A;  2RA2 A;  2BKD N;  3CPW S;  2DPP B;  4RG2 A;  2WSE E;  2ZPH B;  5GAN f;  4QQ6 A;  4J6Y A;  3JCM g;  3V7C A;  3JCM Q;  3SB2 A;  1VQP T;  3MEU A;  3HL8 A;  2DEQ A;  3QG1 A;  1M90 U;  4PJO E;  2DIG A;  2VUB A;  1FXX A;  3H8Z A;  3CPW A;  5GAO m;  4RG8 A;  2QQS A;  4N4G A;  1V29 B;  1G3W A;  2Y4Y A;  3M53 A;  4RMO A;  3JCM P;  1BI0 A;  2L89 A;  4OVA A;  5GMK j;  3SDZ A;  4PLL A;  5DY9 A;  2RI3 A;  1FX7 A;  3MET A;  4A4F A;  2HAX A;  2M9U A;  3CBO A;  3CCR A;  4YTL A;  1UGQ B;  3OYL A;  4C0G A;  1SSF A;  2RH2 A;  2G3R A;  4LD9 K;  5CK9 A;  2HBP A;  4FL6 A;  5GMK i;  3CCV A;  4XTY A;  5CVI A;  5A0L A;  3P8D A;  4RCC A;  4XTX A;  2FVU A;  4M77 E;  4BD3 A;  2XDP A;  3P8H A;  4C92 F;  3CCJ A;  3ER0 A;  3ZFJ A;  3QO3 A;  4FU6 A;  2E41 A;  3MCA B;  3QZ9 B;  4C5E A;  1YI2 A;  2DO3 A;  3UPU A;  1M1K C;  5HKC A;  2LX9 A;  1LJO A;  3WVE B;  2LTO A;  2DXT A;  4X9C A;  3JCM b;  3JCM J;  3CMA A;  3HSB A;  3FDR A;  4WF2 A;  5LJ5 g;  1VQ5 T;  2LC4 A;  3CEY A;  3OYI A;  3RIR A;  1VQ6 A;  2E64 A;  4OGE A;  2JUF A;  3RER A;  4XU3 A;  3HFN A;  2WAC A;  4II1 A;  2E1H A;  1M4Z A;  3KXT A;  2LCC A;  4JUV A;  4MMK A;  1ZHI A;  4Y28 E;  4L6V 5;  3OYH A;  1Q7Y C;  4M7D D;  3SWN A;  4ZTF A;  1N6A A;  4UC4 A;  2B8A A;  1OYX A;  2VGM A;  5GAO l;  4C92 D;  1MHN A;  5GAO n;  1VQK A;  4EMK A;  3CC2 A;  4M7D G;  1KQ1 A;  3DLM A;  2RJF A;  3QBY A;  3EAE A;  3OSS C;  3PIP A;  2K3Y A;  3KBG A;  5HK3 A;  3X26 B;  4CI0 C;  3OYF A;  3QZ5 B;  4A54 A;  1UGR B;  2OTJ A;  3FIF A;  4M78 D;  4M75 F;  1YJ9 T;  1N8R C;  1RI0 A;  2M0O A;  2EJ9 A;  3NTK A;  3NTH A;  3Q1J A;  4C8Q D;  3M9Q A;  3RKW A;  2LRQ A;  1VUB A;  4BI3 A;  2KY9 A;  3BFM A;  2KSS A;  1NE8 A;  3FB9 A;  3LYI A;  3OMC A;  4M78 G;  4B9W A;  4JS4 A;  1XTD A;  4J8O A;  3I56 A;  2LVM A;  4A4E A;  2F69 A;  4EDU A;  2ZPF B;  1H64 1;  3L42 A;  1D3B A;  4L59 A;  2AHJ B;  5AYF A;  3OSV A;  2QTX A;  1OI1 A;  3QII A;  5CO7 A;  1YIJ A;  1YBY A;  4BI4 A;  3OYB A;  3PIO A;  4IUV A;  2ZPB B;  5D6W A;  4E7I A;  4XK8 E;  3SWN B;  1JJ2 S;  2X4J A;  1G3Y A;  3M4G A;  3JCM d;  3F70 A;  3DB3 A;  5DM7 R;  4BDY A;  3QDR B;  2DKG A;  2ZPG B;  4EMK B;  3M59 A;  1QVG S;  4BUG A;  3HFO A;  4OF1 A;  3RES A;  5GAN h;  4DOW A;  2Y90 A;  3V7S A;  3L2U A;  1JJ2 A;  3OS2 A;  3GNF B;  2JTM A;  3NTI A;  1RL2 A;  1Y7X A;  2A7Y A;  2MWO A;  3V8L A;  4J7I A;  2DD4 A;  4RKU E;  3SWN C;  2DIQ A;  4BY6 B;  3JB9 D;  4PJO F;  4PJO C;  4EMH A;  4Q5W A;  1MGQ A;  2P0P A;  1WNL A;  3LLR A;  3M58 A;  4EMK C;  1WGS A;  2L3R A;  3L2V A;  5CKF A;  1NJI C;  3CCM T;  2E65 A;  3JCM f;  4C5I A;  2KAF A;  4F7U G;  4M77 B;  2PVD B;  2E70 A;  2V8J A;  3N5B B;  5GAM j;  3QYH B;  3RMS A;  2R58 A;  4ZTJ A;  1X01 A;  4J6W A;  1WJS A;  2YHT A;  3HKS A;  4BY6 C;  1JRI A;  2R57 A;  3V8K A;  1YHQ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...