4PJOG

Minimal u1 snrnp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
KAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
molecule keywords Small nuclear ribonucleoprotein Sm D3
total genus 10
structure length 74
sequence length 74
chains with identical sequence U, g, u
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoG00
4XTXA 3AHUA 4M7DD 3QSUA 2Y90A 2ZGWA 2VXFA 4C8QE 5LJ3f 5GAN5 4HT9A 2DTHA 3INZA 4C8QF 4C8QC 3BY7A 4M7AF 2DZCA 4OP0A 3RKWA 1KQ1A 1U1TA 4A54A 4F7UF 1BIAA 5GAN6 4JRKA 3JCMQ 5GAN2 4NL3A 4MMKA 5CAIA 1B34A 5LJ3e 4PJOB 3QHSA 4M78B 2JN0A 3JB9H 4M7AG 4PJOF 4M77C 4M77B 4Y91A 3JCMX 4M78C 3BFMA 4M78A 4PJOC 5GMKl 5GANe 5GAN7 5GAOn 3L1AA 5GAOl 1BIBA 5GAMh 2HNIA 3EFSA 2RM4A 1U1SA 4JLIA 4C8QG 4PJOD 3PGGA 5LJ5d 4RCBA 3SWNA 4C8QA 5GAOp 2RB6A 3FB9A 3JCMg 5GAMe 1D3BA 2DJZA 4WF2A 5LJ3g 4M7DB 5LJ5h 1H641 4XU0A 4C92F 1TH7A 5GAOr 4M75D 4C92E 2EJ9A 4M77G 4MMLA 1D3BB 4RCCA 2EJGA 5DY9A 5GMKh 5GMKj 4X9CA 4XTUA 2E64A 3QUIA 2RD1A 4M78F 3JB9J 1HK9A 4M7DC 5GANg 4XTVA 2QTXA 2RA2A 2E65A 4M77F 4M75A 4N0AC 1KQ2A 3JCMc 4XU2A 4M78E 3V8LA 3JB9G 4M75F 3M4GA 3V8KA 5GAOq 4M7AD 4M78G 1N9SA 4C8QD 1WQ7A 3BDUA 4PJOG 3QO3A 5LJ5j 3JCMe 5GAMj 4M7DE 4EMKA 3SWNB 4C92C 2DTOA 1HXDA 2E1HA 2YLCA 4J6YA 2YHTA 4XU1A 3V7SA 5I21A 1B34B 4EMKB 5LJ5f 4NL2A 3JCMf 1Y96A 1I8FA 5GAN3 2K57A 4M77A 5LJ3d 3RERA 3RKXA 4XTYA 4X9DA 1Y96B 4J6XA 5GAMf 2DEQA 3L2ZA 4EMKC 4C92D 2FB7A 2DVEA 4C8QB 4F7UE 1X01A 3V7RA 5GANf 4EMGA 4NOYA 4F7UG 3HFOA 2E10A 4M7DG 4M75E 2DTIA 1LJOA 3JCMJ 4PJOE 4XTZA 4M75C 4N0AA 5GAN8 2FYKA 2CGHA 4M77E 2EWNA 3V7CA 1JBMA 4HA8A 4C92A 5GMKi 4M7DA 1M8VA 5GAMd 4M7DF 4M7AE 5GANj 4C92G 4C92B 1YCYA 3VU3C 5GANd 1LOJA 4M78D 2DKGA 5GAOm 2E41A 4XTWA 2EAYA 4QVDA 4DQ2A 4JUVA 3RESA 5GMKm 5LJ5g 4A53A 3JCMP 4XQ3A 3JCMV 1LNXA 1M5Q1 3JCMb 3V8JA 2DXTA 3HFNA 4QVCA 4M7AB 5LJ3h 5LJ5e 3SWNC 4EMHA 3JB9D 1JRIA 3EFRA 4F7UB 3FJPA 3SB2A 3JCMh 1WQWA 4JRIA 4XU3A 5GAMg 3HSBA 4M75G 4J5YA 3RKYA 3JB9F 4M7AA 4M7AC 4F7UA 5GAN4 2I2LA 2DXUA 4PNOA 2YLBA 3FIFA 1I81A 4PJOA 2VXEA 4J6WA 1WNLA 5GANh 4HT8A 3RUXA 5LJ3j 2DZ9A 3JCMW 2EJFA 4V2SA 1I4K1 5GMKe 3JB9I 1WPYA 4M77D 3BW1A 1I5LA 1MGQA 1N9RA 4M75B 2VC8A 3RIRA 3GIBA 3JCMd
chains in the Genus database with same CATH superfamily
3L2VA 3QSUA 4C8QE 1YJ9Q 2FRYA 2JTEA 4C8QC 4OP0A 3OW2S 1YCSB 5CAIA 3EAEA 3G71A 3CCUQ 1MNDA 4M78B 1WGSA 3OS1A 2M0YA 4PJOC 2J6FA 2W0ZA 3CCLT 3M4YA 1YJNA 3SWNA 2CZ7B 4JS4A 3JCMg 3CCSA 4II1A 1VQ9Q 3CC2T 2GCXA 1R77A 4XU2A 4ZGDB 1VQKQ 4L6V5 5DM7R 4M7AD 2L3PA 2JUFA 2L8DA 2AZSA 3SWNB 2LT1A 4MZTA 1D1BA 1H3HA 2DEUA 3MPUB 1NM7A 4HXJA 3X28B 1R8OB 1GCQC 3TSZA 5GAMf 3OYIA 4DBFA 4A4HA 3X24B 4M7DG 4X1VA 1GFDA 1NLOC 4E7SA 2ED1A 2KSSA 3CCMA 3VUBA 3G6EA 4LDXA 1EIFA 2DL3A 2EBPA 4OMPA 5GANj 2NUZA 3I55A 3KBGA 4JUVA 3VRZA 5IHIA 2DXTA 1BCOA 4L59A 2CP5A 3TVTA 3SB2A 3QZ9B 1WQWA 4M7AC 3P8HA 1K0XA 3GLXA 2KRNA 1Y57A 1F1BB 3FIFA 2QEXA 2QASA 2KBTA 4V2SA 1WJRA 2XK0A 3MEAA 1BK2A 1MV3A 2XHCA 2ATCB 4IUTA 2M0OA 4CC7A 3HRUA 2RHUA 3CCUT 1W2BS 1AEYA 1FYNA 3REBB 1B07A 2JS2A 4PKCC 1UB4A 2KQWA 1YIJT 1VQNT 3I55Q 4IUQA 3MP1A 4J8OA 3HSBA 5IHKA 5GAOp 3G6EQ 2JVVA 4KGVB 3CCMQ 2DILA 1NYFA 4RTTA 4C92F 2L89A 2D6FA 4BE2A 1D3BB 1VQ5T 1WHHA 1VQNA 4RG2A 4Y92A 1NBEB 3EGDA 4HVUA 4PL6A 5CKEA 1UGPB 1VIFA 2R5AA 3V8KA 3QPHA 3OQ5A 1N9SA 5A0LA 3JCMe 1D0YA 1VYTA 1QP2A 4EMKB 1RAAB 1VQPQ 4B9XA 2O2OA 3RERA 2LC4A 4HVVA 4D6WA 3EH1A 1YHQT 1QLYA 1SPKA 2CZ0B 1Z9ZA 1M9SA 2DL7A 4D8KA 1ZUUA 2P4RA 1OU9A 4AG2C 2J05A 1IO6A 1BI3A 3VUZA 4MDWA 1E6HA 2QEXT 2F2WA 3CCST 1JBMA 1YJNQ 3LW5E 4FSSA 4EDUA 3CC2A 2KY9A 1HSQA 4JPBW 3CCRA 5IN1A 1KC8U 2KYMA 1XNIA 3JCMh 3OYMA 2R5MA 3X25B 1S72A 1PWTA 2A36A 4LDWA 3URGA 1SKUB 1VQ8T 2YLBA 5CO7A 2D8JA 2KI7A 2CZ6B 1WNLA 4Z89A 1VQKT 2MPXC 3EFOA 2EQJA 1ZSZB 2D0NA 1O75A 1RACB 3P8DA 5J39A 3UF4A 5A0DA 2RK2A 2LJ0A 2OX7A 2EQMA 2IVWA 2YUNA 2M02A 2OTJQ 4N4IA 2LCLA 3OB9A 3SEMA 4PJOB 1I0CA 3CBOA 1UGRB 4M77B 2NUPA 4IUPA 4ZGEB 1S1NA 3TCJA 1OZ3A 2E6NA 3NGPA 1G3WA 3SFMA 4QQ6A 2A28A 2D8HA 5IXBA 3CBMA 4F16A 2KROA 4RTXA 1OZ2A 3LH0A 5GJVB 4M7DC 5FWBA 5GANg 1C1AA 1QW1A 4M77F 4C5GA 4M78E 1WJSA 2E3HA 4M75F 3CCQT 1WIEA 4C8QD 4PJOG 3OY9A 1U8RA 3VS1A 4ZTFA 3CMAQ 1OPKA 1AVZC 2HSPA 2B8AA 2F2XA 2V8JA 4PJJA 4HCKA 2OTLT 3RBBB 1G2BA 2V1RA 1M1KU 2XDPA 2KAFA 4IIMA 2DYBA 1M8VA 1IB8A 3PE0A 5GAMd 2X3WD 1KHCA 4KBMB 2EAYA 5LJ5g 1QKXA 1X43A 1J3TA 2RJDA 3V8JA 2JW4A 4F04B 3SDZA 4A4KA 1UEBA 4EMHA 5LJ5e 3EFRA 4Z88A 4XU3A 3WVDB 4LN2A 1SHGA 3R6OA 2JXBA 1VQPA 2K4YA 2HQHA 2MF2A 2XD0A 1BKBA 4FW2A 2LQ8A 2CT3A 3JB9I 1PKTA 1ZUKA 3H0IA 2KK4A 3A8HB 1YJ9T 2EGEA 4M7DD 5LJ3f 1QWFA 2EYZA 1N8RR 1PD0A 3CCVA 1NJIR 3JV3A 2AZVA 2P0KA 2P84A 3CCSQ 2FZGB 5AT1B 2EKHA 2G3RA 2PVDB 2Y4XA 2DBMA 5A0GA 4XAXB 2ZPHB 1VOMA 2K2MA 1EZZB 2JNGA 2M1HA 1RAIB 4J9DA 1D3BA 2PVGB 1H641 3G71Q 2KNBB 2KMTA 2NWMA 1SSFA 2RA2A 2E65A 2FZKB 3EG1A 2K5LA 4A4EA 1B7TA 2MWOA 5LJ5j 1PSEA 3M0PA 2C06A 4EMKA 5FRMA 7AT1B 1N27A 4LD6A 2LVMA 5KYUA 3VS0A 2OTJA 3FDRA 3OBYA 1D1AA 4E7HA 1VQOA 4FIBA 3L2WA 1KQSA 1RABB 2DEQA 2FL7A 1FXXA 3J7AF 3N5BB 2K5IA 2QQSA 4LXCA 1SEMA 2CREA 2VGMA 1MMDA 3QDRB 1S72Q 1VQ4Q 2K9GA 5IHNA 4HCCA 2YUQA 3I5RA 1M5Q1 2JM8A 4R55A 4GY5A 3QWXX 4QVCA 5FU6C 4XK8E 3G4ST 3CC2Q 2E6ZA 2XDBA 4C0DB 1YITQ 1GL5A 3RUXA 1UDLA 1WA7A 3HRTA 9ATCB 3OW2P 3VV0A 3S3MA 3MJXA 2VC8A 2DBKA 5KCOA 1Q95G 1NJIC 1V29B 1IZ6A 3LX7A 1T0HA 4KUDK 2J7IA 2JT4A 2ZCFB 1WFWA 2QXFA 2DRMA 3M57A 1Y71A 3M0TA 2HDAA 3EG9A 2HNIA 1YJWA 2HZYA 4C8QG 4KH0B 4PLIA 1VQNQ 2O4XA 2DJZA 4M7DB 1IREB 5LJ5h 1OX8A 1VQPT 2EYYA 4Z02A 4M75D 4P5NA 3OS2A 5GMKh 1GXIE 4E7KA 3CCLA 1QCFA 2LJ1A 2L2PA 1GCPA 4LDVA 1M3AA 2O31A 5DLQE 1LVKA 3JB9G 3M4GA 2FZCB 2EVRA 1K8AR 4M7DE 3DB3A 3LH5A 4JZ3A 4BI8B 3FLGA 1AZEA 3UA6A 2X4JA 1I8FA 2PTKA 3RKXA 2CYZB 4CRIA 1ACMB 1K9AA 4LDUA 3LYIA 4ZN3A 3NTHA 3A98A 4EMGA 4EIKA 2ECZA 2AHJB 3NTKA 1MMGA 3PT9A 1PRMC 5GMKi 2FRWA 3ASKA 4JS5A 3ZBDA 2X35A 3HTRA 4C92B 5GANd 2K6DA 3QKJA 2E41A 3CMEA 3JCMb 1K4US 1YI2Q 3HFNA 1M3BA 3M58A 3CXCA 1K1ZA 1U06A 1SRMA 3FJPA 1X2QA 3C95A 3NMZC 1RAHB 2L5QA 3OW2A 4QW2A 3CCVQ 4MZMA 2K3XA 2SRCA 1WHJA 2JMCA 1QP3A 1I4K1 2YT6A 1N9RA 4J7IA 1X01A 3E19A 4FYYB 4JLGA 3INZA 4BDZA 2QK0A 4MZPA 5GAN6 2OTLQ 5GAN2 3JCMQ 1Q81U 2JN0A 5FU7B 2CSIA 3GF5A 1W6XA 1TTHB 1H8KA 5KE3A 1Z9QA 3JRZA 2RHZA 3DKMA 2RI5A 4J9GA 3CCQQ 2C0TA 2F5TX 1QVFA 2JMAA 2DD4A 2A3LA 3UATA 4AMCA 3CD6A 2CSQA 4FYWB 1C6VX 4IURA 2HL3A 5DY9A 2DNUA 3CBPA 2QG9B 3OMCA 3EGUA 2DERA 1GCQA 1HK9A 2LP5A 4CC3A 2DAQA 1G3SA 1AOJA 2DM1A 3C0CA 3HPWA 3CCVT 2X4XA 1CKAA 1QKWA 1VQ4T 2FO0A 4NL2A 4E7ZA 2RI3A 2BKDN 3VYGA 3CMAA 3Q1JA 2RHYA 2IIMA 2WACA 1Y96B 1XTDA 1QWEA 2FPEA 4J6XA 1JO8A 2GQIA 2O4XB 2RQWA 1YJWT 2PUOB 2P0QA 2KRSA 4GLMA 2DXCA 1HJDA 3OYYA 4HA8A 2HL5C 1GFCA 1CSKA 2EQKA 4WTOB 2HKNA 4C92G 4K11A 4OB0B 3CEYA 2GGRA 1ZA1B 5KYYB 3EGXB 4HVWA 2EFIA 2E5KA 4F7UB 1H92A 2ZPIB 2E3IA 2CH4A 3EHQA 3OS5A 3QWYA 1A0NB 1OOTA 1X6BA 2ZPFB 3QZ5B 2LTOA 4QKUA 5HY6A 2DE0X 1ZLMA 2KR3A 4PJOA 2VXEA 1NZ9A 3PVQA 1KSWA 1WI7A 1D0XA 2E5QA 4OVAA 1SSHA 4AFZC 1UECA 1D09B 3RIRA 3ZEHA 5C0MA 4AT1B 3UDCA 2HBWA 3VKIA 1YHQQ 3A5ZB 1XJWB 1BIAA 4F7UF 1SRLA 2KDSA 2QA4Q 3CCJA 3D7SB 3JB9H 4DBHA 2L3SA 2OJ2A 1M90R 4JJCA 5GMKl 4FT4A 3EG0A 2RJFA 3PGGA 3M54A 2FHDA 3TREA 5LJ3g 2ABLA 4XU0A 4FU6A 4KGZB 4IUVA 1JJ2P 2DA9A 2GFUA 2EYQA 1DJ7B 4DOWA 2C0OA 2HSEB 1TUDA 2QQBA 2XI9A 3ME9A 3EG2A 1WXBA 2GBQA 1MNEA 5KE2A 5IT9E 5I21A 1B34B 3I5SA 3PVLA 4ELZC 1VQ6A 5CKBA 4XTYA 4GLKA 3LLRA 2ZPGB 1G8XA 1G3TA 5IAYA 5ECAA 2EPDA 1Y07A 1K73R 3QYHB 1NPPA 2CS7A 1KJWA 3HHTB 5GAOm 1VQ5A 3HRSA 3M0QA 3L2RA 3CC7Q 3IQLA 3G4SQ 5GAMg 4M75G 3VS7A 3JSCA 4FT2A 3OYFA 2CP6A 4JRQA 3CD6T 5A2QE 1MGQA 4L5GA 4ATOA 3RNJA 1AHJB 2CT4A 2Y90A 1RAGB 1QQJA 5GAN5 1R0BG 2WSEE 4J9BA 4C8QF 2ZPEB 4TVRA 5KH6A 1U1TA 2HMAA 1WLPB 3S6WA 1SG5A 1RI0A 2H3EB 1PRLC 4OGCA 4M7AG 3EGXA 1ZSZC 2LX7A 2F5KA 2QGGA 2RF0A 2VASA 1JB0E 4OB2B 4CI0C 3J81E 3I56T 2NYSA 5GAMh 1JQQA 3EFSA 1VQ7A 1GBQA 2WSCE 1GBRA 3CCMT 1OULA 1D1CA 1HYOA 2XG8D 2EGAA 5CVIA 1D0ZA 1VQ8A 3VS4A 4DEYA 2JTMA 2RO0A 5I11A 2VVKA 4XTVA 2QTXA 4M75A 3R6NA 3CCRT 3QO3A 1NEGA 1AT1B 1EFNA 2BTTA 3EHRA 1W2BP 2DTOA 3EH2A 4JJDA 3OYJA 4KH1B 1OI1A 1WHMA 2AK5A 4PFPA 3M55A 2LNVA 2J6KA 3M5AA 2ZAEA 4ESRA 1VQ9T 3M59A 4OB3B 1VQKA 4PLLA 2R57A 3U23A 3HFOA 2H8HA 4BI4A 4RMOA 5GAN8 4A63B 4N4GA 1Q86R 1X2KA 2D1XA 2MWPA 4M7DF 5CKHA 3WXMB 3L42A 5J26A 4J83A 4QVDA 4C5EA 2K79A 1X69A 4M7AB 5LJ3h 1IHWA 5CQYA 2JTFA 4JRIA 4PJNA 5CKFA 5CQXA 3MEWA 1G83A 2HKQB 4JDSA 4BY6C 1K0SA 3BDLA 1Q82C 1VQ7T 2GQVA 1VYVA 4LUDA 2HAXA 2QQ9A 2VXFA 1VQLQ 2PNIA 5DLOA 3QJ6A 3OYEA 5IH2A 3RKWA 1WJQA 4NL3A 1M90C 2CP2A 2YDLA 3RMQA 1X6OA 3KUFA 3F70A 1BI1A 2IG0A 4M77C 4Y91A 4QT7A 3A1PA 3MCAB 3OYDA 2X4WA 1FX7A 3LGFA 4ZN1A 5GAOl 3THKA 5L8RE 3CCEA 3M56A 1ZBXA 1ARKA 2XU8A 3HKSA 1OU8A 3CXCP 4M77G 2RQVA 2CP0A 4RTVA 4M78F 2DYIA 2RH2A 3DB4A 3PIPA 4FW1A 1OYXA 3UA7A 4E7IA 4UC4A 5GAMj 2BE7D 1W1FA 4VUBA 2E1HA 2XIDA 2CUBA 1M4ZA 2YLCA 3ER0A 3T9NA 2IPOB 1H3ZA 2FPFA 1JU5C 1W2BA 3CMEQ 2RQUA 4RTWA 4C8QB 4ZTJA 4YTLA 4GBQA 1AWXA 3C94A 2GNCA 5I2SA 2RQTA 2E70A 2FYKA 4M7DA 5HK0A 4QQGA 2JJ9A 1AWOA 1T3SA 1YCYA 4M78D 3OYKA 3ZFJA 2KT8A 4PFOA 3CMAT 3EG9B 1UGVA 3JB9D 1FMKA 1ZA2B 2CH4W 1TSFA 3RKYA 4B6MA 2I0NA 5FW9A 2I2LA 5L23A 2GTOA 1I81A 2H3JA 4HT8A 1YITT 1ZBJA 2DO3A 3EG3A 1SHFA 2ROLA 3CCLQ 3CC7A 1QVFS 2P4TA 3ULRB 2Z0WA 1NJIU 3CC4A 1KC8R 2K7AA 4O6JA 3VYHB 3I9QA 5LJ3e 2A7YA 3CQTA 2LX9A 1PCXA 2W10A 5KYWB 4E7JA 2GTJA 4BY6B 3I35A 2DL8A 4AFQC 1TUGB 1UHFA 1TWBA 4Z8AA 5LJ5d 2RB6A 3FB9A 2DLPA 5AYFA 3A8LB 2HBPA 2E64A 3QUIA 2RD1A 3EFOB 4OMQA 3CPFA 4CC4B 4N0AC 2PUKB 3JCMc 1I07A 1T0JA 1BU1A 2JS0A 1OQKA 2KXDA 5KYNA 1C0MA 2BZXA 1X27A 2CP3A 4R0KA 2DPPB 2CKKA 5CIUA 8ATCB 1YIJQ 1KD1R 2K5FA 4XU1A 2CP7A 4A4GA 3PIOA 2LT4A 2SEMA 4IIOA 4M77A 2VGNA 3SD4A 3CMET 2B86A 3X20B 3GBQA 4F7UE 3QJYA 1Q86C 2DFUA 3OYBA 1T3LA 2E10A 3GNFB 3PMTA 1PKSA 3V7CA 2CGHA 4C92A 4J9CA 2QA4A 1W4SA 1KQSS 4N4HA 1VQ7Q 2HEQA 1BI0A 1FWZA 1UGSB 4A53A 3QXEB 3VRYA 3JCMV 1LNXA 2COWA 1R0CB 2NUTA 2LRQA 2GFAA 1XQHA 4CC2A 3P8BB 3E9GA 1RLPC 4PNOA 1Q7YC 1EX4A 4J6WA 5D6WA 3OBWA 1QVFP 5KYXA 2OAUA 4LE9A 1YJNT 1M3CA 2MCNA 2JM9A 3LWHA 1YIJA 2PQWA 2AKLA 2OI3A 1NE8A 1Q7YU 1QMCA 4LD9K 2MYSA 3C4SA 1QVGP 2CUDA 3PMIA 2MIOA 3RMSA 2ENMA 3G4SA 1RI9A 1G3YA 1K76A 3JCMX 1FMWA 4M78A 3UPUA 1Q7YR 2KEAA 4JLIA 2X9HA 1JJ2S 2EIFA 5C6SA 1MMAA 2LZ6B 4OMLA 1OEBA 2RK1A 4ORZA 1X75C 2XMFA 4AG1C 4XTUA 1K8AU 4BDYA 1VYUA 1VUBA 2DK3A 1PSFA 3CC4Q 2L3QA 4JJNK 4J9IA 1MUZA 1GRIA 2A0FB 1VQ6Q 2X3XD 3BDUA 5HK3A 1UG1A 4X9DA 4FSXA 2KGTA 2LQWA 4C92D 1M1KC 4KRTA 3M9QA 4M75E 1KHIA 1VQ8Q 4M75C 1M2OA 1JEGA 2HQEA 2WSFE 4XTWA 1ZHIA 3MEUA 3TSWA 2KXCA 1KD1U 4XQ3A 2GF7A 4J9EA 2MAMA 1V76A 4C0DC 2BE9B 4J5YA 4B9WA 2O01E 5GAN4 2FVUA 1ABQA 1E6GA 2EW3A 3VJPA 2ZZDA 1JXMA 5IXFA 1QVGS 2RHIA 3RR6A 1VQMQ 3GP8A 2D9TA 1UTIA 4XTXA 4PJLA 1Y7XA 2KVQG 4JRKA 1Q82U 2J6OA 3H8ZA 2CZ1B 2QA4T 4DBRA 3TQ7P 2A08A 4AFUC 3OMGA 2NUTB 1N8RC 4J9FA 5GANe 3CCEQ 1N6AA 2QYZA 3CPWA 1I1JA 4O5VA 3OYLA 5KYXB 4C8QA 2M16A 4ELYC 3AT1B 2ED0A 3H6ZA 5GAOr 1RAFB 1KQ2A 2K3YA 1YWPA 4RCCA 5GMKj 5CR2A 2VV5A 1UJYA 2VKNA 3M0RA 4BACA 1VQOT 3L2QA 1RADB 1YBYA 3UWNA 1E7OA 5FROA 1K9MU 3A8GB 4J6YA 3V7SA 2YHTA 2J06A 2RMOA 3A8MB 5EG2A 1X6GA 1M27C 5FU7C 2K57A 4OMMA 1TU0B 1AD5A 2KE9A 1YJWQ 2A37A 3V7RA 1WYXA 2O88A 4PJMA 1QVPA 3H41A 3JCMJ 3FC3A 2XKOC 3PFSA 4XTZA 4ZNXA 2DL5A 2BIVA 2NLUA 1UJ0A 1TUCA 3CD6Q 1CKBA 3OS0A 3NPFA 4BB7A 1AZGB 2ZPBB 5GMKm 4BUGA 3SWNC 5KYWA 2LJ3A 3JB9F 2RI2A 2QDYB 2PZ1A 4NS5A 2EYXA 4ME7A 2QQAA 3S3NA 4KT0E 2DZ9A 3JCMW 2EGCA 1K8AC 5GMKe 1M1FA 1WPYA 4M77D 3BW1A 4M75B 3GIBA 2ZGWA 3M0SA 4C0FA 2DL4A 3L2UA 4QQDA 4A54A 2LDMA 2QGFB 4JRPA 3FEOA 1VQ4A 3OYCA 3QHSA 1FMVA 4MDXA 4RTZA 3QDFA 1NLPC 2O9SA 4M78C 4BE1A 3OYGA 5FRNA 3OSSC 2MMPA 2RNAA 2YRVA 1BIBA 1XOVA 3VS6A 3CXCS 1U1SA 4PJOD 1ZX6A 2VB6A 4Q5WA 1VQMT 2FPDA 4WF2A 2OTJT 3MO8A 2EJ9A 3S3OA 1TS9A 4KGXB 1BBZA 1OX9A 2YWWA 5GAOq 2QEXQ 1S72T 2QDLA 4F14A 2MK5A 3REAB 4RTUA 2YUPA 3QG1A 1Q86U 1WHGA 5KCHA 3VS2A 1M2VA 2YUOA 5EC7A 2E12A 2LCCA 1MHNA 4HKEA 3G7ZA 4E2FB 2RHXA 2Y4YA 1QCNA 1LJOA 4N0AA 4QVZA 1M90U 1LPLA 4RG8A 1WXUA 2OAWA 2DKGA 3MP8A 3CCQA 3RESA 1KG1A 5I22A 4J9HA 1KD1C 1IXDA 4OB1B 1AWWA 4E6RA 4ZGJB 5FU6B 2RQRA 3FJ5A 3TEEA 1KIKA 1Y0MA 2EQIA 4A4FA 4EPCA 1ZSGA 2FG0A 1M30A 4DEXA 3X26B 3E9FA 3AHUA 2KYBA 2C0IA 4OGEA 1YI2T 2HD0A 1VQMA 4FL6A 1Q81C 4M7AF 5CCAA 1K9MR 1KQSP 1OPLA 3QIIA 4OMOA 1BYMA 3G1JA 3PNWC 8AT1B 2QQRA 1YI2A 1KC8C 3TU4K 4LDYA 1V1CA 3QYGB 1NEBA 2VWFA 2LQKA 1VIEA 2RM4A 3CCUA 4C0ZA 5GJWB 4BE0A 4KULA 5FWCA 3CCJQ 3BE3A 2V8IA 1Q82R 1UHCA 4C92E 1UFFA 1YJ9A 3M0UA 3CCJT 3O5ZA 1NG2A 5KYYA 1IGUA 3H0FA 1PD1A 3V8LA 2DJQA 2HQXA 4ANJA 2DIGA 1M8MA 4PFZA 4DBQA 2L3RA 4C5IA 4F17A 3NHNA 2DETA 3GNGA 2JOYA 1WX6A 2DD5A 4AFSC 1VQLA 3EGDB 4RUGA 2FB7A 2M51A 5GANf 2L0AA 2DTIA 2DXBA 1I5OB 1MV0B 2YSQA 4FM4B 1VA7A 3E1SA 3HP9A 1RAEB 2KRMA 1TXQA 5LL6S 3DLMA 4M7AE 2RN8A 3RDVA 3VU3C 1LOJA 2NUPB 5I2MA 3QBYA 2JZ2A 2LNHB 4DQ2A 1M1KR 1Q81R 1JXOA 2X4YA 1SF9A 2YRCA 1IGQA 2DXUA 2X51A 1YFNA 4C5HA 1WZOA 1ZQ1A 2EKOA 2P0PA 1IRXA 4LUEA 3JCMd 1O9SA 4HT9A 3PTAA 4FYVB 2DVJA 3BY7A 3E2UA 2DZCA 1KQ1A 4KUIA 1TG0A 1B34A 4DOVA 1LCKA 1YN8A 4WCIA 4PJOF 2QTVA 2O9VA 2V1QA 5D6YA 3GPLA 3MKDA 3BFMA 3A8OB 5GAOn 3L1AA 5M9OA 5D7UA 2R58A 2K3BA 4LNPA 3MP6A 2XDDA 2COYA 2F2VA 5J3BA 2RPNA 4RCBA 2AIRB 3O8VA 1UGQB 4E7LA 1TH7A 1UE9A 5CKDA 1IHVA 3OYNA 4X9CA 1YHQA 4M4ZA 1NYGA 1M1GA 1P92A 3KFVA 4OF1A 3I56A 2DF6A 3M53A 1BI2A 1VQ6T 4JJBA 3I55T 2BUDA 1VQOQ 2QI2A 1WQ7A 4J7FA 1PNJA 1PC0A 1HXDA 3KXTA 3H9NA 3JCMf 1Y96A 3NTIA 6AT1B 2MI6A 3VS5A 2RJCA 2VUBA 4HCBA 2DX1A 3LGLA 1YNZA 1BCMA 4F7UG 2D0QB 4RKUE 3JAME 2PVOB 4PJOE 1UUEA 2E4HA 3DLLA 4C0GA 3WVEB 4M77E 1QVGA 2DRKA 2AT1B 2YRDA 3JCMP 2MOXA 1KK7A 1MMNA 2DIQA 1JRIA 5HKCA 4OMNA 4D8DA 1VQ5Q 2ROTA 2V8KA 4M7AA 4IKFA 4PK4A 2DMOA 1YP5A 2K2VA 1RUWA 1YWOA 1ABOA 5GANh 2F69A 3I56Q 4RTYA 1NPRA 1B3QA 4R56A 2HCKA 1K73C 1I5LA 1K9MC 4FYXB 4DA4A 4BD3A 3CPWS 1WHKA 2DTHA 1N5ZA 1OV3A 4JZ4A 5FLXE 4MMKA 5KYUB 1PM3A 2KT1A 3OYAA 2F1LA 1RLQC 3C12A 5GAN7 1PG5B 4BI3A 3CCRQ 2EYWA 2QAZA 2ESWA 3UT1A 1VQLT 3ZL7C 2AKKA 3G6ET 1AWJA 5GAMe 1ZUYA 3GOXA 4X34A 4Y28E 1ZSZA 3MHXA 2PU9B 4MMLA 2EJGA 3CC7T 3G71T 1M2VB 2M9UA 2CDTA 2OTLA 1KFZA 3JB9J 3META 3CC4T 2BZ8A 2LCSA 1JJ2A 3VS3A 2YXYA 4E47A 2G6FX 4M78G 4IUUA 3CCET 1VQ9A 1K73U 4OMFB 5D6XA 5LJ5f 1YITA 3FRNA 4HCZA 3OA6A 5GAN3 1BB9A 5LJ3d 3NFCA 2V26A 5HCKA 3SHWA 4EMKC 3L2ZA 2DVEA 1WHLA 2RJEA 4NOYA 1QCOA 5CK9A 1HD3A 1W70A 2EWNA 2LMJA 1TOVA 3J80E 2EQUA 1N8RU 3HL8A 1RL2A 1WDXA 1U3OA 3MEVA 2FEIA 1U5SA 2VYTA 3OSVA 2COZA 4F7UA 3H0HA 2XICA 3CPWP 3OYHA 5LJ3j 2BZYA 2EJFA 1WXTA 4FCYA 2LQNA 1PHTA 1G5VA 4C92C 3LWIA
chains in the Genus database with same CATH topology
3L2VA 2ZGWA 4C8QE 2QQ9A 2VXFA 4C0FA 1NJIC 1V29B 2HAXA 3QSUA 5DLOA 4C8QC 3QJ6A 3L2UA 1IZ6A 4QQDA 3OYEA 3RKWA 4OP0A 4A54A 2LDMA 3LX7A 4JRPA 3FEOA 1WJQA 4NL3A 3OW2S 1VQ4A 1M90C 3OYCA 5CAIA 4KUDK 3RMQA 3EAEA 1X6OA 3G71A 3KUFA 3QHSA 3F70A 4M78B 4MDXA 2ZCFB 1BI1A 2IG0A 2QXFA 3M57A 4M77C 2OTJA 1WGSA 4Y91A 1Y71A 4M78C 3OS1A 4BE1A 3MCAB 3OYDA 3OYGA 4PJOC 2X4WA 1FX7A 2MMPA 3LGFA 3OSSC 4ZN1A 5FRNA 2YRVA 5GAOl 1BIBA 2HNIA 1XOVA 1YJWA 3CXCS 3CCLT 1U1SA 4C8QG 3M4YA 4PJOD 4PLIA 3CCEA 5L8RE 3M56A 1YJNA 4Q5WA 3SWNA 1ZBXA 2O4XA 2CZ7B 4JS4A 3JCMg 3CCSA 1VQMT 2DJZA 4WF2A 1IREB 4M7DB 2OTJT 5LJ5h 2XU8A 3HKSA 3MO8A 1VQPT 4Z02A 4M75D 2EJ9A 4M77G 4II1A 4P5NA 5GMKh 3OS2A 3CC2T 1GXIE 4E7KA 3S3OA 3CCLA 2GCXA 4M78F 2RH2A 3DB4A 3PIPA 4LDVA 4XU2A 5DLQE 4ZGDB 3JB9G 3M4GA 4L6V5 5DM7R 1OYXA 5GAOq 4M7AD 4E7IA 2JUFA 4UC4A 5GAMj 1S72T 4M7DE 2L8DA 3DB3A 4VUBA 3SWNB 2LT1A 4MZTA 2E1HA 2XIDA 2YLCA 1M4ZA 3ER0A 3T9NA 3QG1A 4BI8B 1H3ZA 1Q86U 5KCHA 1W2BA 3FLGA 2X4JA 1I8FA 2E12A 2LCCA 2CYZB 3RKXA 1MHNA 3X28B 4HKEA 3G7ZA 4CRIA 1R8OB 4LDUA 2RHXA 3LYIA 2Y4YA 5GAMf 4ZN3A 3OYIA 3NTHA 4C8QB 4EMGA 4ZTJA 4A4HA 3X24B 4YTLA 4M7DG 1LJOA 2AHJB 3NTKA 3C94A 5I2SA 4N0AA 2KSSA 3CCMA 3PT9A 2E70A 2FYKA 4QVZA 4RG8A 3VUBA 5GMKi 3G6EA 1M90U 4LDXA 5HK0A 1EIFA 4QQGA 3ASKA 4M7DA 4JS5A 3ZBDA 2X35A 5GANj 4C92B 1YCYA 5GANd 3QKJA 4M78D 2DKGA 3MP8A 2E41A 3OYKA 3KBGA 3ZFJA 3I55A 3CCQA 4JUVA 3RESA 3CMAT 1KG1A 3CMEA 1KD1C 3JCMb 2DXTA 3HFNA 3M58A 4OB1B 3CXCA 3JB9D 4L59A 3FJPA 3SB2A 3QZ9B 1WQWA 4ZGJB 5FU6B 3RKYA 4M7AC 3P8HA 3C95A 3GLXA 2I2LA 2L5QA 3FIFA 3TEEA 1I81A 2H3JA 2QEXA 3OW2A 4QW2A 4HT8A 1YITT 4MZMA 2K3XA 4A4FA 4EPCA 1QP3A 2DO3A 1I4K1 4V2SA 1N9RA 1WJRA 2XK0A 4J7IA 3MEAA 1X01A 3E19A 3X26B 3CC7A 2XHCA 3E9FA 1QVFS 3AHUA 2P4TA 4IUTA 4JLGA 4OGEA 3INZA 2M0OA 2HD0A 1YI2T 1NJIU 4BDZA 4MZPA 4FL6A 1VQMA 1Q81C 5GAN6 5CCAA 3CC4A 4M7AF 5GAN2 4O6JA 3JCMQ 1Q81U 3S3MA 3HRUA 2RHUA 3VYHB 3QIIA 3CCUT 5LJ3e 2A7YA 1W2BS 2JN0A 5FU7B 1BYMA 2LX9A 3GF5A 3PNWC 2QQRA 4PKCC 4E7JA 1YI2A 1UB4A 3TU4K 4LDYA 3QYGB 4BY6B 5KE3A 3JRZA 1KC8C 2KQWA 2LQKA 1YIJT 1VIEA 2RHZA 3DKMA 2RI5A 1VQNT 2RM4A 2F5TX 3CCUA 1QVFA 2DD4A 2A3LA 4C0ZA 4IUQA 5LJ5d 3MP1A 4J8OA 3CD6A 4BE0A 5GAOp 2RB6A 3FB9A 3HSBA 4KULA 2JVVA 2D6FA 4IURA 4C92F 2L89A 5AYFA 2V8IA 4C92E 4BE2A 1YJ9A 5DY9A 1D3BB 3CBPA 3A8LB 3OMCA 1VQ5T 2HBPA 1VQNA 2E64A 3CCJT 4RG2A 3QUIA 2RD1A 1HK9A 3CPFA 4N0AC 2PUKB 3JCMc 3V8LA 4PL6A 5CKEA 2DAQA 1UGPB 2HQXA 1G3SA 1VIFA 2DIGA 2R5AA 3HPWA 3OQ5A 3QPHA 3V8KA 1N9SA 3CCVT 5A0LA 3JCMe 2DPPB 2CKKA 2X4XA 5CIUA 1QP2A 2L3RA 2K5FA 4XU1A 4C5IA 1VQ4T 4EMKB 4A4GA 4NL2A 3PIOA 2RI3A 2LT4A 3GNGA 2JOYA 2BKDN 3VYGA 4B9XA 3CMAA 3Q1JA 2RHYA 4M77A 3RERA 2LC4A 2DD5A 2VGNA 2WACA 3SD4A 3CMET 1VQLA 4D6WA 1Y96B 1XTDA 3X20B 1YHQT 2CZ0B 4J6XA 1M9SA 2FB7A 2O4XB 4F7UE 3QJYA 1Q86C 5GANf 2PUOB 1YJWT 2P0QA 3OYBA 2E10A 2DTIA 3GNFB 3PMTA 2DXBA 3VUZA 1BI3A 2DXCA 4MDWA 3V7CA 2CGHA 4FM4B 4C92A 3E1SA 1JBMA 3OYYA 4HA8A 3HP9A 2QEXT 3CCST 2QA4A 2EQKA 5LL6S 3DLMA 4M7AE 3LW5E 1W4SA 4C92G 1KQSS 3VU3C 1LOJA 4OB0B 4EDUA 3CC2A 3CEYA 4N4HA 2KY9A 5I2MA 3QBYA 2JZ2A 1BI0A 1FWZA 4DQ2A 1UGSB 5IN1A 4A53A 3QXEB 3CCRA 1KC8U 3JCMV 1LNXA 2X4YA 1XNIA 2EFIA 2LRQA 4F7UB 2GFAA 1XQHA 2ZPIB 3JCMh 3P8BB 3OYMA 3OS5A 2R5MA 3E9GA 3X25B 1S72A 3URGA 4LDWA 2ZPFB 3QZ5B 2DXUA 2LTOA 4PNOA 2YLBA 5CO7A 1Q7YC 5HY6A 1VQ8T 4PJOA 2CZ6B 2VXEA 1NZ9A 3OBWA 4J6WA 5D6WA 1WNLA 2OAUA 1YJNT 4C5HA 1VQKT 2E5QA 2EQJA 3LWHA 4OVAA 1YIJA 2PQWA 1ZQ1A 1O75A 1NE8A 2P0PA 2EKOA 3P8DA 3RIRA 5J39A 3JCMd 1Q7YU 4LD9K 3ZEHA 1O9SA 5C0MA 3C4SA 4HT9A 3UDCA 5A0DA 2RK2A 3PTAA 3VKIA 3BY7A 2DZCA 2EQMA 2IVWA 1KQ1A 3A5ZB 3PMIA 4KUIA 1BIAA 4F7UF 4N4IA 2LCLA 3OB9A 1B34A 4DOVA 2KDSA 4PJOB 3CCJA 3JB9H 3RMSA 3CBOA 4PJOF 1UGRB 3G4SA 4M77B 1G3YA 4IUPA 5D6YA 3JCMX 3GPLA 3BFMA 4M78A 4ZGEB 3UPUA 3A8OB 3TCJA 5GMKl 5GAOn 3L1AA 4FT4A 5M9OA 1OZ3A 2R58A 2E6NA 3SFMA 1G3WA 2RJFA 4JLIA 4QQ6A 3MP6A 2XDDA 1JJ2S 5J3BA 3PGGA 2EIFA 3M54A 4RCBA 5C6SA 2FHDA 3TREA 5LJ3g 3O8VA 4XU0A 1UGQB 3CBMA 1TH7A 4FU6A 4E7LA 2RK1A 5CKDA 1X75C 3OYNA 4IUVA 4X9CA 4XTUA 1OZ2A 3LH0A 2GFUA 4BDYA 1K8AU 1VUBA 1YHQA 2DK3A 1PSFA 4JJNK 4M7DC 2EYQA 1DJ7B 4DOWA 1M1GA 1P92A 5GANg 1QW1A 4M77F 4C5GA 4OF1A 2QQBA 2XI9A 4M78E 3I56A 3M53A 1BI2A 1VQ6T 1WJSA 4M75F 3I55T 3CCQT 2BUDA 2QI2A 3ME9A 4C8QD 1WQ7A 3BDUA 4J7FA 4PJOG 5KE2A 3OY9A 1U8RA 5IT9E 1HXDA 4ZTFA 5HK3A 3KXTA 5I21A 1B34B 4ELZC 3JCMf 1Y96A 3NTIA 2B8AA 2MI6A 2V8JA 1VQ6A 5CKBA 4XTYA 4X9DA 2RJCA 2VUBA 4FSXA 2OTLT 4HCBA 3LGLA 3I56T 4GLKA 4C92D 3LLRA 2ZPGB 1M1KC 3M9QA 1M1KU 2XDPA 2D0QB 1G3TA 4RKUE 4F7UG 2PVOB 4M75E 5IAYA 1Y07A 2KAFA 3JAME 1KHIA 4PJOE 3DLLA 4C0GA 4M75C 3WVEB 4M77E 1M8VA 3QYHB 1QVGA 1NPPA 5GAMd 2CS7A 2HQEA 1KHCA 3HHTB 2WSFE 3HRSA 5GAOm 4KBMB 3L2RA 4XTWA 2EAYA 5LJ5g 1VQ5A 1ZHIA 3MEUA 3JCMP 1KD1U 4XQ3A 2GF7A 2RJDA 3V8JA 2MAMA 3SDZA 2DIQA 1UEBA 4A4KA 4EMHA 1JRIA 3EFRA 5LJ5e 5HKCA 4XU3A 4C0DC 5GAMg 4M75G 2V8KA 4J5YA 4M7AA 3WVDB 4B9WA 2O01E 5GAN4 4IKFA 2FVUA 3R6OA 1VQPA 3VJPA 2K4YA 2K2VA 2ZZDA 3JSCA 4FT2A 3OYFA 5GANh 1QVGS 2F69A 2MF2A 4JRQA 2XD0A 2RHIA 1BKBA 3CD6T 1NPRA 5A2QE 4R56A 2LQ8A 1K73C 3JB9I 1I5LA 1MGQA 1K9MC 2KK4A 3A8HB 4L5GA 3GP8A 2D9TA 1YJ9T 4DA4A 4XTXA 4ATOA 4BD3A 1AHJB 3CPWS 4M7DD 2Y90A 5GAN5 5LJ3f 1Y7XA 2DTHA 2KVQG 2WSEE 4C8QF 2ZPEB 4TVRA 5KH6A 1U1TA 4JRKA 5FLXE 1Q82U 5KCOA 4MMKA 3S6WA 1RI0A 3H8ZA 2CZ1B 2QA4T 4OGCA 3CCVA 4M7AG 2P0KA 3OMGA 3OYAA 2F5KA 1N8RC 2G3RA 2PVDB 2Y4XA 3C12A 1JB0E 4OB2B 5GANe 4CI0C 5GAN7 3J81E 4BI3A 5A0GA 4XAXB 5GAMh 1N6AA 3EFSA 2ZPHB 1VQ7A 2WSCE 3UT1A 3CPWA 1VQLT 2JNGA 2M1HA 4O5VA 3OYLA 3CCMT 4C8QA 3G6ET 2M16A 5GAMe 4ELYC 1D3BA 3GOXA 2PVGB 2XG8D 3H6ZA 1H641 4X34A 5CVIA 1VQ8A 4Y28E 5GAOr 1KQ2A 2K3YA 2PU9B 3MHXA 4MMLA 4RCCA 2EJGA 2JTMA 5GMKj 5CR2A 3G71T 3CC7T 2M9UA 2VV5A 2OTLA 2RO0A 3JB9J 2KMTA 3META 4BACA 3CC4T 4XTVA 1SSFA 2QTXA 2E65A 2RA2A 4M75A 1VQOT 1JJ2A 4E47A 2K5LA 3L2QA 4A4EA 1YBYA 2MWOA 4M78G 3UWNA 3CCRT 3QO3A 5LJ5j 1PSEA 5FROA 4IUUA 2C06A 4EMKA 1K9MU 5FRMA 3CCET 2DTOA 3A8GB 4J6YA 3V7SA 1N27A 2YHTA 4LD6A 4OMFB 5D6XA 1K73U 1VQ9A 3OYJA 2LVMA 3A8MB 5LJ5f 5EG2A 3FRNA 1YITA 3FDRA 1OI1A 3OBYA 4HCZA 3OA6A 4E7HA 5FU7C 1VQOA 3M55A 5GAN3 2K57A 5LJ3d 4FIBA 3NFCA 3L2WA 2LNVA 1KQSA 3M5AA 2DEQA 3L2ZA 4EMKC 2FL7A 1VQ9T 2DVEA 3M59A 4OB3B 3V7RA 1VQKA 1FXXA 4PLLA 2RJEA 2R57A 4NOYA 3HFOA 1QVPA 4BI4A 3JCMJ 3FC3A 2XKOC 3PFSA 4XTZA 5CK9A 4RMOA 3J7AF 3N5BB 5GAN8 2BIVA 2K5IA 2QQSA 2EWNA 2NLUA 4N4GA 2VGMA 4M7DF 2MWPA 5CKHA 3QDRB 3WXMB 3OS0A 3L42A 5J26A 4HCCA 4J83A 4BB7A 4QVDA 4C5EA 2ZPBB 3J80E 5GMKm 2EQUA 1N8RU 4BUGA 1M5Q1 3HL8A 4R55A 1RL2A 4GY5A 4QVCA 5FU6C 4XK8E 4M7AB 3SWNC 3MEVA 5LJ3h 3G4ST 2VYTA 5CQYA 2JTFA 3OSVA 4JRIA 3JB9F 2RI2A 5CKFA 2QDYB 5CQXA 4F7UA 2E6ZA 4NS5A 2XDBA 2XICA 4C0DB 3MEWA 4ME7A 2QQAA 4JDSA 3OYHA 3RUXA 4BY6C 5LJ3j 3S3NA 4KT0E 2DZ9A 3JCMW 2EJFA 3HRTA 3BDLA 1K8AC 5GMKe 1M1FA 1WPYA 4M77D 3BW1A 1Q82C 3VV0A 4M75B 1VQ7T 1G5VA 2GQVA 2VC8A 4C92C 3GIBA 3LWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTX A;  3AHU A;  4M7D D;  3QSU A;  2Y90 A;  2ZGW A;  2VXF A;  4C8Q E;  5LJ3 f;  5GAN 5;  4HT9 A;  2DTH A;  3INZ A;  4C8Q F;  4C8Q C;  3BY7 A;  4M7A F;  2DZC A;  4OP0 A;  3RKW A;  1KQ1 A;  1U1T A;  4A54 A;  4F7U F;  1BIA A;  5GAN 6;  4JRK A;  3JCM Q;  5GAN 2;  4NL3 A;  4MMK A;  5CAI A;  1B34 A;  5LJ3 e;  4PJO B;  3QHS A;  4M78 B;  2JN0 A;  3JB9 H;  4M7A G;  4PJO F;  4M77 C;  4M77 B;  4Y91 A;  3JCM X;  4M78 C;  3BFM A;  4M78 A;  4PJO C;  5GMK l;  5GAN e;  5GAN 7;  5GAO n;  3L1A A;  5GAO l;  1BIB A;  5GAM h;  2HNI A;  3EFS A;  2RM4 A;  1U1S A;  4JLI A;  4C8Q G;  4PJO D;  3PGG A;  5LJ5 d;  4RCB A;  3SWN A;  4C8Q A;  5GAO p;  2RB6 A;  3FB9 A;  3JCM g;  5GAM e;  1D3B A;  2DJZ A;  4WF2 A;  5LJ3 g;  4M7D B;  5LJ5 h;  1H64 1;  4XU0 A;  4C92 F;  1TH7 A;  5GAO r;  4M75 D;  4C92 E;  2EJ9 A;  4M77 G;  4MML A;  1D3B B;  4RCC A;  2EJG A;  5DY9 A;  5GMK h;  5GMK j;  4X9C A;  4XTU A;  2E64 A;  3QUI A;  2RD1 A;  4M78 F;  3JB9 J;  1HK9 A;  4M7D C;  5GAN g;  4XTV A;  2QTX A;  2RA2 A;  2E65 A;  4M77 F;  4M75 A;  4N0A C;  1KQ2 A;  3JCM c;  4XU2 A;  4M78 E;  3V8L A;  3JB9 G;  4M75 F;  3M4G A;  3V8K A;  5GAO q;  4M7A D;  4M78 G;  1N9S A;  4C8Q D;  1WQ7 A;  3BDU A;  4PJO G;  3QO3 A;  5LJ5 j;  3JCM e;  5GAM j;  4M7D E;  4EMK A;  3SWN B;  4C92 C;  2DTO A;  1HXD A;  2E1H A;  2YLC A;  4J6Y A;  2YHT A;  4XU1 A;  3V7S A;  5I21 A;  1B34 B;  4EMK B;  5LJ5 f;  4NL2 A;  3JCM f;  1Y96 A;  1I8F A;  5GAN 3;  2K57 A;  4M77 A;  5LJ3 d;  3RER A;  3RKX A;  4XTY A;  4X9D A;  1Y96 B;  4J6X A;  5GAM f;  2DEQ A;  3L2Z A;  4EMK C;  4C92 D;  2FB7 A;  2DVE A;  4C8Q B;  4F7U E;  1X01 A;  3V7R A;  5GAN f;  4EMG A;  4NOY A;  4F7U G;  3HFO A;  2E10 A;  4M7D G;  4M75 E;  2DTI A;  1LJO A;  3JCM J;  4PJO E;  4XTZ A;  4M75 C;  4N0A A;  5GAN 8;  2FYK A;  2CGH A;  4M77 E;  2EWN A;  3V7C A;  1JBM A;  4HA8 A;  4C92 A;  5GMK i;  4M7D A;  1M8V A;  5GAM d;  4M7D F;  4M7A E;  5GAN j;  4C92 G;  4C92 B;  1YCY A;  3VU3 C;  5GAN d;  1LOJ A;  4M78 D;  2DKG A;  5GAO m;  2E41 A;  4XTW A;  2EAY A;  4QVD A;  4DQ2 A;  4JUV A;  3RES A;  5GMK m;  5LJ5 g;  4A53 A;  3JCM P;  4XQ3 A;  3JCM V;  1LNX A;  1M5Q 1;  3JCM b;  3V8J A;  2DXT A;  3HFN A;  4QVC A;  4M7A B;  5LJ3 h;  5LJ5 e;  3SWN C;  4EMH A;  3JB9 D;  1JRI A;  3EFR A;  4F7U B;  3FJP A;  3SB2 A;  3JCM h;  1WQW A;  4JRI A;  4XU3 A;  5GAM g;  3HSB A;  4M75 G;  4J5Y A;  3RKY A;  3JB9 F;  4M7A A;  4M7A C;  4F7U A;  5GAN 4;  2I2L A;  2DXU A;  4PNO A;  2YLB A;  3FIF A;  1I81 A;  4PJO A;  2VXE A;  4J6W A;  1WNL A;  5GAN h;  4HT8 A;  3RUX A;  5LJ3 j;  2DZ9 A;  3JCM W;  2EJF A;  4V2S A;  1I4K 1;  5GMK e;  3JB9 I;  1WPY A;  4M77 D;  3BW1 A;  1I5L A;  1MGQ A;  1N9R A;  4M75 B;  2VC8 A;  3RIR A;  3GIB A;  3JCM d; 
#chains in the Genus database with same CATH topology
 3L2V A;  3QSU A;  4C8Q E;  1YJ9 Q;  2FRY A;  2JTE A;  4C8Q C;  4OP0 A;  3OW2 S;  1YCS B;  5CAI A;  3EAE A;  3G71 A;  3CCU Q;  1MND A;  4M78 B;  1WGS A;  3OS1 A;  2M0Y A;  4PJO C;  2J6F A;  2W0Z A;  3CCL T;  3M4Y A;  1YJN A;  3SWN A;  2CZ7 B;  4JS4 A;  3JCM g;  3CCS A;  4II1 A;  1VQ9 Q;  3CC2 T;  2GCX A;  1R77 A;  4XU2 A;  4ZGD B;  1VQK Q;  4L6V 5;  5DM7 R;  4M7A D;  2L3P A;  2JUF A;  2L8D A;  2AZS A;  3SWN B;  2LT1 A;  4MZT A;  1D1B A;  1H3H A;  2DEU A;  3MPU B;  1NM7 A;  4HXJ A;  3X28 B;  1R8O B;  1GCQ C;  3TSZ A;  5GAM f;  3OYI A;  4DBF A;  4A4H A;  3X24 B;  4M7D G;  4X1V A;  1GFD A;  1NLO C;  4E7S A;  2ED1 A;  2KSS A;  3CCM A;  3VUB A;  3G6E A;  4LDX A;  1EIF A;  2DL3 A;  2EBP A;  4OMP A;  5GAN j;  2NUZ A;  3I55 A;  3KBG A;  4JUV A;  3VRZ A;  5IHI A;  2DXT A;  1BCO A;  4L59 A;  2CP5 A;  3TVT A;  3SB2 A;  3QZ9 B;  1WQW A;  4M7A C;  3P8H A;  1K0X A;  3GLX A;  2KRN A;  1Y57 A;  1F1B B;  3FIF A;  2QEX A;  2QAS A;  2KBT A;  4V2S A;  1WJR A;  2XK0 A;  3MEA A;  1BK2 A;  1MV3 A;  2XHC A;  2ATC B;  4IUT A;  2M0O A;  4CC7 A;  3HRU A;  2RHU A;  3CCU T;  1W2B S;  1AEY A;  1FYN A;  3REB B;  1B07 A;  2JS2 A;  4PKC C;  1UB4 A;  2KQW A;  1YIJ T;  1VQN T;  3I55 Q;  4IUQ A;  3MP1 A;  4J8O A;  3HSB A;  5IHK A;  5GAO p;  3G6E Q;  2JVV A;  4KGV B;  3CCM Q;  2DIL A;  1NYF A;  4RTT A;  4C92 F;  2L89 A;  2D6F A;  4BE2 A;  1D3B B;  1VQ5 T;  1WHH A;  1VQN A;  4RG2 A;  4Y92 A;  1NBE B;  3EGD A;  4HVU A;  4PL6 A;  5CKE A;  1UGP B;  1VIF A;  2R5A A;  3V8K A;  3QPH A;  3OQ5 A;  1N9S A;  5A0L A;  3JCM e;  1D0Y A;  1VYT A;  1QP2 A;  4EMK B;  1RAA B;  1VQP Q;  4B9X A;  2O2O A;  3RER A;  2LC4 A;  4HVV A;  4D6W A;  3EH1 A;  1YHQ T;  1QLY A;  1SPK A;  2CZ0 B;  1Z9Z A;  1M9S A;  2DL7 A;  4D8K A;  1ZUU A;  2P4R A;  1OU9 A;  4AG2 C;  2J05 A;  1IO6 A;  1BI3 A;  3VUZ A;  4MDW A;  1E6H A;  2QEX T;  2F2W A;  3CCS T;  1JBM A;  1YJN Q;  3LW5 E;  4FSS A;  4EDU A;  3CC2 A;  2KY9 A;  1HSQ A;  4JPB W;  3CCR A;  5IN1 A;  1KC8 U;  2KYM A;  1XNI A;  3JCM h;  3OYM A;  2R5M A;  3X25 B;  1S72 A;  1PWT A;  2A36 A;  4LDW A;  3URG A;  1SKU B;  1VQ8 T;  2YLB A;  5CO7 A;  2D8J A;  2KI7 A;  2CZ6 B;  1WNL A;  4Z89 A;  1VQK T;  2MPX C;  3EFO A;  2EQJ A;  1ZSZ B;  2D0N A;  1O75 A;  1RAC B;  3P8D A;  5J39 A;  3UF4 A;  5A0D A;  2RK2 A;  2LJ0 A;  2OX7 A;  2EQM A;  2IVW A;  2YUN A;  2M02 A;  2OTJ Q;  4N4I A;  2LCL A;  3OB9 A;  3SEM A;  4PJO B;  1I0C A;  3CBO A;  1UGR B;  4M77 B;  2NUP A;  4IUP A;  4ZGE B;  1S1N A;  3TCJ A;  1OZ3 A;  2E6N A;  3NGP A;  1G3W A;  3SFM A;  4QQ6 A;  2A28 A;  2D8H A;  5IXB A;  3CBM A;  4F16 A;  2KRO A;  4RTX A;  1OZ2 A;  3LH0 A;  5GJV B;  4M7D C;  5FWB A;  5GAN g;  1C1A A;  1QW1 A;  4M77 F;  4C5G A;  4M78 E;  1WJS A;  2E3H A;  4M75 F;  3CCQ T;  1WIE A;  4C8Q D;  4PJO G;  3OY9 A;  1U8R A;  3VS1 A;  4ZTF A;  3CMA Q;  1OPK A;  1AVZ C;  2HSP A;  2B8A A;  2F2X A;  2V8J A;  4PJJ A;  4HCK A;  2OTL T;  3RBB B;  1G2B A;  2V1R A;  1M1K U;  2XDP A;  2KAF A;  4IIM A;  2DYB A;  1M8V A;  1IB8 A;  3PE0 A;  5GAM d;  2X3W D;  1KHC A;  4KBM B;  2EAY A;  5LJ5 g;  1QKX A;  1X43 A;  1J3T A;  2RJD A;  3V8J A;  2JW4 A;  4F04 B;  3SDZ A;  4A4K A;  1UEB A;  4EMH A;  5LJ5 e;  3EFR A;  4Z88 A;  4XU3 A;  3WVD B;  4LN2 A;  1SHG A;  3R6O A;  2JXB A;  1VQP A;  2K4Y A;  2HQH A;  2MF2 A;  2XD0 A;  1BKB A;  4FW2 A;  2LQ8 A;  2CT3 A;  3JB9 I;  1PKT A;  1ZUK A;  3H0I A;  2KK4 A;  3A8H B;  1YJ9 T;  2EGE A;  4M7D D;  5LJ3 f;  1QWF A;  2EYZ A;  1N8R R;  1PD0 A;  3CCV A;  1NJI R;  3JV3 A;  2AZV A;  2P0K A;  2P84 A;  3CCS Q;  2FZG B;  5AT1 B;  2EKH A;  2G3R A;  2PVD B;  2Y4X A;  2DBM A;  5A0G A;  4XAX B;  2ZPH B;  1VOM A;  2K2M A;  1EZZ B;  2JNG A;  2M1H A;  1RAI B;  4J9D A;  1D3B A;  2PVG B;  1H64 1;  3G71 Q;  2KNB B;  2KMT A;  2NWM A;  1SSF A;  2RA2 A;  2E65 A;  2FZK B;  3EG1 A;  2K5L A;  4A4E A;  1B7T A;  2MWO A;  5LJ5 j;  1PSE A;  3M0P A;  2C06 A;  4EMK A;  5FRM A;  7AT1 B;  1N27 A;  4LD6 A;  2LVM A;  5KYU A;  3VS0 A;  2OTJ A;  3FDR A;  3OBY A;  1D1A A;  4E7H A;  1VQO A;  4FIB A;  3L2W A;  1KQS A;  1RAB B;  2DEQ A;  2FL7 A;  1FXX A;  3J7A F;  3N5B B;  2K5I A;  2QQS A;  4LXC A;  1SEM A;  2CRE A;  2VGM A;  1MMD A;  3QDR B;  1S72 Q;  1VQ4 Q;  2K9G A;  5IHN A;  4HCC A;  2YUQ A;  3I5R A;  1M5Q 1;  2JM8 A;  4R55 A;  4GY5 A;  3QWX X;  4QVC A;  5FU6 C;  4XK8 E;  3G4S T;  3CC2 Q;  2E6Z A;  2XDB A;  4C0D B;  1YIT Q;  1GL5 A;  3RUX A;  1UDL A;  1WA7 A;  3HRT A;  9ATC B;  3OW2 P;  3VV0 A;  3S3M A;  3MJX A;  2VC8 A;  2DBK A;  5KCO A;  1Q95 G;  1NJI C;  1V29 B;  1IZ6 A;  3LX7 A;  1T0H A;  4KUD K;  2J7I A;  2JT4 A;  2ZCF B;  1WFW A;  2QXF A;  2DRM A;  3M57 A;  1Y71 A;  3M0T A;  2HDA A;  3EG9 A;  2HNI A;  1YJW A;  2HZY A;  4C8Q G;  4KH0 B;  4PLI A;  1VQN Q;  2O4X A;  2DJZ A;  4M7D B;  1IRE B;  5LJ5 h;  1OX8 A;  1VQP T;  2EYY A;  4Z02 A;  4M75 D;  4P5N A;  3OS2 A;  5GMK h;  1GXI E;  4E7K A;  3CCL A;  1QCF A;  2LJ1 A;  2L2P A;  1GCP A;  4LDV A;  1M3A A;  2O31 A;  5DLQ E;  1LVK A;  3JB9 G;  3M4G A;  2FZC B;  2EVR A;  1K8A R;  4M7D E;  3DB3 A;  3LH5 A;  4JZ3 A;  4BI8 B;  3FLG A;  1AZE A;  3UA6 A;  2X4J A;  1I8F A;  2PTK A;  3RKX A;  2CYZ B;  4CRI A;  1ACM B;  1K9A A;  4LDU A;  3LYI A;  4ZN3 A;  3NTH A;  3A98 A;  4EMG A;  4EIK A;  2ECZ A;  2AHJ B;  3NTK A;  1MMG A;  3PT9 A;  1PRM C;  5GMK i;  2FRW A;  3ASK A;  4JS5 A;  3ZBD A;  2X35 A;  3HTR A;  4C92 B;  5GAN d;  2K6D A;  3QKJ A;  2E41 A;  3CME A;  3JCM b;  1K4U S;  1YI2 Q;  3HFN A;  1M3B A;  3M58 A;  3CXC A;  1K1Z A;  1U06 A;  1SRM A;  3FJP A;  1X2Q A;  3C95 A;  3NMZ C;  1RAH B;  2L5Q A;  3OW2 A;  4QW2 A;  3CCV Q;  4MZM A;  2K3X A;  2SRC A;  1WHJ A;  2JMC A;  1QP3 A;  1I4K 1;  2YT6 A;  1N9R A;  4J7I A;  1X01 A;  3E19 A;  4FYY B;  4JLG A;  3INZ A;  4BDZ A;  2QK0 A;  4MZP A;  5GAN 6;  2OTL Q;  5GAN 2;  3JCM Q;  1Q81 U;  2JN0 A;  5FU7 B;  2CSI A;  3GF5 A;  1W6X A;  1TTH B;  1H8K A;  5KE3 A;  1Z9Q A;  3JRZ A;  2RHZ A;  3DKM A;  2RI5 A;  4J9G A;  3CCQ Q;  2C0T A;  2F5T X;  1QVF A;  2JMA A;  2DD4 A;  2A3L A;  3UAT A;  4AMC A;  3CD6 A;  2CSQ A;  4FYW B;  1C6V X;  4IUR A;  2HL3 A;  5DY9 A;  2DNU A;  3CBP A;  2QG9 B;  3OMC A;  3EGU A;  2DER A;  1GCQ A;  1HK9 A;  2LP5 A;  4CC3 A;  2DAQ A;  1G3S A;  1AOJ A;  2DM1 A;  3C0C A;  3HPW A;  3CCV T;  2X4X A;  1CKA A;  1QKW A;  1VQ4 T;  2FO0 A;  4NL2 A;  4E7Z A;  2RI3 A;  2BKD N;  3VYG A;  3CMA A;  3Q1J A;  2RHY A;  2IIM A;  2WAC A;  1Y96 B;  1XTD A;  1QWE A;  2FPE A;  4J6X A;  1JO8 A;  2GQI A;  2O4X B;  2RQW A;  1YJW T;  2PUO B;  2P0Q A;  2KRS A;  4GLM A;  2DXC A;  1HJD A;  3OYY A;  4HA8 A;  2HL5 C;  1GFC A;  1CSK A;  2EQK A;  4WTO B;  2HKN A;  4C92 G;  4K11 A;  4OB0 B;  3CEY A;  2GGR A;  1ZA1 B;  5KYY B;  3EGX B;  4HVW A;  2EFI A;  2E5K A;  4F7U B;  1H92 A;  2ZPI B;  2E3I A;  2CH4 A;  3EHQ A;  3OS5 A;  3QWY A;  1A0N B;  1OOT A;  1X6B A;  2ZPF B;  3QZ5 B;  2LTO A;  4QKU A;  5HY6 A;  2DE0 X;  1ZLM A;  2KR3 A;  4PJO A;  2VXE A;  1NZ9 A;  3PVQ A;  1KSW A;  1WI7 A;  1D0X A;  2E5Q A;  4OVA A;  1SSH A;  4AFZ C;  1UEC A;  1D09 B;  3RIR A;  3ZEH A;  5C0M A;  4AT1 B;  3UDC A;  2HBW A;  3VKI A;  1YHQ Q;  3A5Z B;  1XJW B;  1BIA A;  4F7U F;  1SRL A;  2KDS A;  2QA4 Q;  3CCJ A;  3D7S B;  3JB9 H;  4DBH A;  2L3S A;  2OJ2 A;  1M90 R;  4JJC A;  5GMK l;  4FT4 A;  3EG0 A;  2RJF A;  3PGG A;  3M54 A;  2FHD A;  3TRE A;  5LJ3 g;  2ABL A;  4XU0 A;  4FU6 A;  4KGZ B;  4IUV A;  1JJ2 P;  2DA9 A;  2GFU A;  2EYQ A;  1DJ7 B;  4DOW A;  2C0O A;  2HSE B;  1TUD A;  2QQB A;  2XI9 A;  3ME9 A;  3EG2 A;  1WXB A;  2GBQ A;  1MNE A;  5KE2 A;  5IT9 E;  5I21 A;  1B34 B;  3I5S A;  3PVL A;  4ELZ C;  1VQ6 A;  5CKB A;  4XTY A;  4GLK A;  3LLR A;  2ZPG B;  1G8X A;  1G3T A;  5IAY A;  5ECA A;  2EPD A;  1Y07 A;  1K73 R;  3QYH B;  1NPP A;  2CS7 A;  1KJW A;  3HHT B;  5GAO m;  1VQ5 A;  3HRS A;  3M0Q A;  3L2R A;  3CC7 Q;  3IQL A;  3G4S Q;  5GAM g;  4M75 G;  3VS7 A;  3JSC A;  4FT2 A;  3OYF A;  2CP6 A;  4JRQ A;  3CD6 T;  5A2Q E;  1MGQ A;  4L5G A;  4ATO A;  3RNJ A;  1AHJ B;  2CT4 A;  2Y90 A;  1RAG B;  1QQJ A;  5GAN 5;  1R0B G;  2WSE E;  4J9B A;  4C8Q F;  2ZPE B;  4TVR A;  5KH6 A;  1U1T A;  2HMA A;  1WLP B;  3S6W A;  1SG5 A;  1RI0 A;  2H3E B;  1PRL C;  4OGC A;  4M7A G;  3EGX A;  1ZSZ C;  2LX7 A;  2F5K A;  2QGG A;  2RF0 A;  2VAS A;  1JB0 E;  4OB2 B;  4CI0 C;  3J81 E;  3I56 T;  2NYS A;  5GAM h;  1JQQ A;  3EFS A;  1VQ7 A;  1GBQ A;  2WSC E;  1GBR A;  3CCM T;  1OUL A;  1D1C A;  1HYO A;  2XG8 D;  2EGA A;  5CVI A;  1D0Z A;  1VQ8 A;  3VS4 A;  4DEY A;  2JTM A;  2RO0 A;  5I11 A;  2VVK A;  4XTV A;  2QTX A;  4M75 A;  3R6N A;  3CCR T;  3QO3 A;  1NEG A;  1AT1 B;  1EFN A;  2BTT A;  3EHR A;  1W2B P;  2DTO A;  3EH2 A;  4JJD A;  3OYJ A;  4KH1 B;  1OI1 A;  1WHM A;  2AK5 A;  4PFP A;  3M55 A;  2LNV A;  2J6K A;  3M5A A;  2ZAE A;  4ESR A;  1VQ9 T;  3M59 A;  4OB3 B;  1VQK A;  4PLL A;  2R57 A;  3U23 A;  3HFO A;  2H8H A;  4BI4 A;  4RMO A;  5GAN 8;  4A63 B;  4N4G A;  1Q86 R;  1X2K A;  2D1X A;  2MWP A;  4M7D F;  5CKH A;  3WXM B;  3L42 A;  5J26 A;  4J83 A;  4QVD A;  4C5E A;  2K79 A;  1X69 A;  4M7A B;  5LJ3 h;  1IHW A;  5CQY A;  2JTF A;  4JRI A;  4PJN A;  5CKF A;  5CQX A;  3MEW A;  1G83 A;  2HKQ B;  4JDS A;  4BY6 C;  1K0S A;  3BDL A;  1Q82 C;  1VQ7 T;  2GQV A;  1VYV A;  4LUD A;  2HAX A;  2QQ9 A;  2VXF A;  1VQL Q;  2PNI A;  5DLO A;  3QJ6 A;  3OYE A;  5IH2 A;  3RKW A;  1WJQ A;  4NL3 A;  1M90 C;  2CP2 A;  2YDL A;  3RMQ A;  1X6O A;  3KUF A;  3F70 A;  1BI1 A;  2IG0 A;  4M77 C;  4Y91 A;  4QT7 A;  3A1P A;  3MCA B;  3OYD A;  2X4W A;  1FX7 A;  3LGF A;  4ZN1 A;  5GAO l;  3THK A;  5L8R E;  3CCE A;  3M56 A;  1ZBX A;  1ARK A;  2XU8 A;  3HKS A;  1OU8 A;  3CXC P;  4M77 G;  2RQV A;  2CP0 A;  4RTV A;  4M78 F;  2DYI A;  2RH2 A;  3DB4 A;  3PIP A;  4FW1 A;  1OYX A;  3UA7 A;  4E7I A;  4UC4 A;  5GAM j;  2BE7 D;  1W1F A;  4VUB A;  2E1H A;  2XID A;  2CUB A;  1M4Z A;  2YLC A;  3ER0 A;  3T9N A;  2IPO B;  1H3Z A;  2FPF A;  1JU5 C;  1W2B A;  3CME Q;  2RQU A;  4RTW A;  4C8Q B;  4ZTJ A;  4YTL A;  4GBQ A;  1AWX A;  3C94 A;  2GNC A;  5I2S A;  2RQT A;  2E70 A;  2FYK A;  4M7D A;  5HK0 A;  4QQG A;  2JJ9 A;  1AWO A;  1T3S A;  1YCY A;  4M78 D;  3OYK A;  3ZFJ A;  2KT8 A;  4PFO A;  3CMA T;  3EG9 B;  1UGV A;  3JB9 D;  1FMK A;  1ZA2 B;  2CH4 W;  1TSF A;  3RKY A;  4B6M A;  2I0N A;  5FW9 A;  2I2L A;  5L23 A;  2GTO A;  1I81 A;  2H3J A;  4HT8 A;  1YIT T;  1ZBJ A;  2DO3 A;  3EG3 A;  1SHF A;  2ROL A;  3CCL Q;  3CC7 A;  1QVF S;  2P4T A;  3ULR B;  2Z0W A;  1NJI U;  3CC4 A;  1KC8 R;  2K7A A;  4O6J A;  3VYH B;  3I9Q A;  5LJ3 e;  2A7Y A;  3CQT A;  2LX9 A;  1PCX A;  2W10 A;  5KYW B;  4E7J A;  2GTJ A;  4BY6 B;  3I35 A;  2DL8 A;  4AFQ C;  1TUG B;  1UHF A;  1TWB A;  4Z8A A;  5LJ5 d;  2RB6 A;  3FB9 A;  2DLP A;  5AYF A;  3A8L B;  2HBP A;  2E64 A;  3QUI A;  2RD1 A;  3EFO B;  4OMQ A;  3CPF A;  4CC4 B;  4N0A C;  2PUK B;  3JCM c;  1I07 A;  1T0J A;  1BU1 A;  2JS0 A;  1OQK A;  2KXD A;  5KYN A;  1C0M A;  2BZX A;  1X27 A;  2CP3 A;  4R0K A;  2DPP B;  2CKK A;  5CIU A;  8ATC B;  1YIJ Q;  1KD1 R;  2K5F A;  4XU1 A;  2CP7 A;  4A4G A;  3PIO A;  2LT4 A;  2SEM A;  4IIO A;  4M77 A;  2VGN A;  3SD4 A;  3CME T;  2B86 A;  3X20 B;  3GBQ A;  4F7U E;  3QJY A;  1Q86 C;  2DFU A;  3OYB A;  1T3L A;  2E10 A;  3GNF B;  3PMT A;  1PKS A;  3V7C A;  2CGH A;  4C92 A;  4J9C A;  2QA4 A;  1W4S A;  1KQS S;  4N4H A;  1VQ7 Q;  2HEQ A;  1BI0 A;  1FWZ A;  1UGS B;  4A53 A;  3QXE B;  3VRY A;  3JCM V;  1LNX A;  2COW A;  1R0C B;  2NUT A;  2LRQ A;  2GFA A;  1XQH A;  4CC2 A;  3P8B B;  3E9G A;  1RLP C;  4PNO A;  1Q7Y C;  1EX4 A;  4J6W A;  5D6W A;  3OBW A;  1QVF P;  5KYX A;  2OAU A;  4LE9 A;  1YJN T;  1M3C A;  2MCN A;  2JM9 A;  3LWH A;  1YIJ A;  2PQW A;  2AKL A;  2OI3 A;  1NE8 A;  1Q7Y U;  1QMC A;  4LD9 K;  2MYS A;  3C4S A;  1QVG P;  2CUD A;  3PMI A;  2MIO A;  3RMS A;  2ENM A;  3G4S A;  1RI9 A;  1G3Y A;  1K76 A;  3JCM X;  1FMW A;  4M78 A;  3UPU A;  1Q7Y R;  2KEA A;  4JLI A;  2X9H A;  1JJ2 S;  2EIF A;  5C6S A;  1MMA A;  2LZ6 B;  4OML A;  1OEB A;  2RK1 A;  4ORZ A;  1X75 C;  2XMF A;  4AG1 C;  4XTU A;  1K8A U;  4BDY A;  1VYU A;  1VUB A;  2DK3 A;  1PSF A;  3CC4 Q;  2L3Q A;  4JJN K;  4J9I A;  1MUZ A;  1GRI A;  2A0F B;  1VQ6 Q;  2X3X D;  3BDU A;  5HK3 A;  1UG1 A;  4X9D A;  4FSX A;  2KGT A;  2LQW A;  4C92 D;  1M1K C;  4KRT A;  3M9Q A;  4M75 E;  1KHI A;  1VQ8 Q;  4M75 C;  1M2O A;  1JEG A;  2HQE A;  2WSF E;  4XTW A;  1ZHI A;  3MEU A;  3TSW A;  2KXC A;  1KD1 U;  4XQ3 A;  2GF7 A;  4J9E A;  2MAM A;  1V76 A;  4C0D C;  2BE9 B;  4J5Y A;  4B9W A;  2O01 E;  5GAN 4;  2FVU A;  1ABQ A;  1E6G A;  2EW3 A;  3VJP A;  2ZZD A;  1JXM A;  5IXF A;  1QVG S;  2RHI A;  3RR6 A;  1VQM Q;  3GP8 A;  2D9T A;  1UTI A;  4XTX A;  4PJL A;  1Y7X A;  2KVQ G;  4JRK A;  1Q82 U;  2J6O A;  3H8Z A;  2CZ1 B;  2QA4 T;  4DBR A;  3TQ7 P;  2A08 A;  4AFU C;  3OMG A;  2NUT B;  1N8R C;  4J9F A;  5GAN e;  3CCE Q;  1N6A A;  2QYZ A;  3CPW A;  1I1J A;  4O5V A;  3OYL A;  5KYX B;  4C8Q A;  2M16 A;  4ELY C;  3AT1 B;  2ED0 A;  3H6Z A;  5GAO r;  1RAF B;  1KQ2 A;  2K3Y A;  1YWP A;  4RCC A;  5GMK j;  5CR2 A;  2VV5 A;  1UJY A;  2VKN A;  3M0R A;  4BAC A;  1VQO T;  3L2Q A;  1RAD B;  1YBY A;  3UWN A;  1E7O A;  5FRO A;  1K9M U;  3A8G B;  4J6Y A;  3V7S A;  2YHT A;  2J06 A;  2RMO A;  3A8M B;  5EG2 A;  1X6G A;  1M27 C;  5FU7 C;  2K57 A;  4OMM A;  1TU0 B;  1AD5 A;  2KE9 A;  1YJW Q;  2A37 A;  3V7R A;  1WYX A;  2O88 A;  4PJM A;  1QVP A;  3H41 A;  3JCM J;  3FC3 A;  2XKO C;  3PFS A;  4XTZ A;  4ZNX A;  2DL5 A;  2BIV A;  2NLU A;  1UJ0 A;  1TUC A;  3CD6 Q;  1CKB A;  3OS0 A;  3NPF A;  4BB7 A;  1AZG B;  2ZPB B;  5GMK m;  4BUG A;  3SWN C;  5KYW A;  2LJ3 A;  3JB9 F;  2RI2 A;  2QDY B;  2PZ1 A;  4NS5 A;  2EYX A;  4ME7 A;  2QQA A;  3S3N A;  4KT0 E;  2DZ9 A;  3JCM W;  2EGC A;  1K8A C;  5GMK e;  1M1F A;  1WPY A;  4M77 D;  3BW1 A;  4M75 B;  3GIB A;  2ZGW A;  3M0S A;  4C0F A;  2DL4 A;  3L2U A;  4QQD A;  4A54 A;  2LDM A;  2QGF B;  4JRP A;  3FEO A;  1VQ4 A;  3OYC A;  3QHS A;  1FMV A;  4MDX A;  4RTZ A;  3QDF A;  1NLP C;  2O9S A;  4M78 C;  4BE1 A;  3OYG A;  5FRN A;  3OSS C;  2MMP A;  2RNA A;  2YRV A;  1BIB A;  1XOV A;  3VS6 A;  3CXC S;  1U1S A;  4PJO D;  1ZX6 A;  2VB6 A;  4Q5W A;  1VQM T;  2FPD A;  4WF2 A;  2OTJ T;  3MO8 A;  2EJ9 A;  3S3O A;  1TS9 A;  4KGX B;  1BBZ A;  1OX9 A;  2YWW A;  5GAO q;  2QEX Q;  1S72 T;  2QDL A;  4F14 A;  2MK5 A;  3REA B;  4RTU A;  2YUP A;  3QG1 A;  1Q86 U;  1WHG A;  5KCH A;  3VS2 A;  1M2V A;  2YUO A;  5EC7 A;  2E12 A;  2LCC A;  1MHN A;  4HKE A;  3G7Z A;  4E2F B;  2RHX A;  2Y4Y A;  1QCN A;  1LJO A;  4N0A A;  4QVZ A;  1M90 U;  1LPL A;  4RG8 A;  1WXU A;  2OAW A;  2DKG A;  3MP8 A;  3CCQ A;  3RES A;  1KG1 A;  5I22 A;  4J9H A;  1KD1 C;  1IXD A;  4OB1 B;  1AWW A;  4E6R A;  4ZGJ B;  5FU6 B;  2RQR A;  3FJ5 A;  3TEE A;  1KIK A;  1Y0M A;  2EQI A;  4A4F A;  4EPC A;  1ZSG A;  2FG0 A;  1M30 A;  4DEX A;  3X26 B;  3E9F A;  3AHU A;  2KYB A;  2C0I A;  4OGE A;  1YI2 T;  2HD0 A;  1VQM A;  4FL6 A;  1Q81 C;  4M7A F;  5CCA A;  1K9M R;  1KQS P;  1OPL A;  3QII A;  4OMO A;  1BYM A;  3G1J A;  3PNW C;  8AT1 B;  2QQR A;  1YI2 A;  1KC8 C;  3TU4 K;  4LDY A;  1V1C A;  3QYG B;  1NEB A;  2VWF A;  2LQK A;  1VIE A;  2RM4 A;  3CCU A;  4C0Z A;  5GJW B;  4BE0 A;  4KUL A;  5FWC A;  3CCJ Q;  3BE3 A;  2V8I A;  1Q82 R;  1UHC A;  4C92 E;  1UFF A;  1YJ9 A;  3M0U A;  3CCJ T;  3O5Z A;  1NG2 A;  5KYY A;  1IGU A;  3H0F A;  1PD1 A;  3V8L A;  2DJQ A;  2HQX A;  4ANJ A;  2DIG A;  1M8M A;  4PFZ A;  4DBQ A;  2L3R A;  4C5I A;  4F17 A;  3NHN A;  2DET A;  3GNG A;  2JOY A;  1WX6 A;  2DD5 A;  4AFS C;  1VQL A;  3EGD B;  4RUG A;  2FB7 A;  2M51 A;  5GAN f;  2L0A A;  2DTI A;  2DXB A;  1I5O B;  1MV0 B;  2YSQ A;  4FM4 B;  1VA7 A;  3E1S A;  3HP9 A;  1RAE B;  2KRM A;  1TXQ A;  5LL6 S;  3DLM A;  4M7A E;  2RN8 A;  3RDV A;  3VU3 C;  1LOJ A;  2NUP B;  5I2M A;  3QBY A;  2JZ2 A;  2LNH B;  4DQ2 A;  1M1K R;  1Q81 R;  1JXO A;  2X4Y A;  1SF9 A;  2YRC A;  1IGQ A;  2DXU A;  2X51 A;  1YFN A;  4C5H A;  1WZO A;  1ZQ1 A;  2EKO A;  2P0P A;  1IRX A;  4LUE A;  3JCM d;  1O9S A;  4HT9 A;  3PTA A;  4FYV B;  2DVJ A;  3BY7 A;  3E2U A;  2DZC A;  1KQ1 A;  4KUI A;  1TG0 A;  1B34 A;  4DOV A;  1LCK A;  1YN8 A;  4WCI A;  4PJO F;  2QTV A;  2O9V A;  2V1Q A;  5D6Y A;  3GPL A;  3MKD A;  3BFM A;  3A8O B;  5GAO n;  3L1A A;  5M9O A;  5D7U A;  2R58 A;  2K3B A;  4LNP A;  3MP6 A;  2XDD A;  2COY A;  2F2V A;  5J3B A;  2RPN A;  4RCB A;  2AIR B;  3O8V A;  1UGQ B;  4E7L A;  1TH7 A;  1UE9 A;  5CKD A;  1IHV A;  3OYN A;  4X9C A;  1YHQ A;  4M4Z A;  1NYG A;  1M1G A;  1P92 A;  3KFV A;  4OF1 A;  3I56 A;  2DF6 A;  3M53 A;  1BI2 A;  1VQ6 T;  4JJB A;  3I55 T;  2BUD A;  1VQO Q;  2QI2 A;  1WQ7 A;  4J7F A;  1PNJ A;  1PC0 A;  1HXD A;  3KXT A;  3H9N A;  3JCM f;  1Y96 A;  3NTI A;  6AT1 B;  2MI6 A;  3VS5 A;  2RJC A;  2VUB A;  4HCB A;  2DX1 A;  3LGL A;  1YNZ A;  1BCM A;  4F7U G;  2D0Q B;  4RKU E;  3JAM E;  2PVO B;  4PJO E;  1UUE A;  2E4H A;  3DLL A;  4C0G A;  3WVE B;  4M77 E;  1QVG A;  2DRK A;  2AT1 B;  2YRD A;  3JCM P;  2MOX A;  1KK7 A;  1MMN A;  2DIQ A;  1JRI A;  5HKC A;  4OMN A;  4D8D A;  1VQ5 Q;  2ROT A;  2V8K A;  4M7A A;  4IKF A;  4PK4 A;  2DMO A;  1YP5 A;  2K2V A;  1RUW A;  1YWO A;  1ABO A;  5GAN h;  2F69 A;  3I56 Q;  4RTY A;  1NPR A;  1B3Q A;  4R56 A;  2HCK A;  1K73 C;  1I5L A;  1K9M C;  4FYX B;  4DA4 A;  4BD3 A;  3CPW S;  1WHK A;  2DTH A;  1N5Z A;  1OV3 A;  4JZ4 A;  5FLX E;  4MMK A;  5KYU B;  1PM3 A;  2KT1 A;  3OYA A;  2F1L A;  1RLQ C;  3C12 A;  5GAN 7;  1PG5 B;  4BI3 A;  3CCR Q;  2EYW A;  2QAZ A;  2ESW A;  3UT1 A;  1VQL T;  3ZL7 C;  2AKK A;  3G6E T;  1AWJ A;  5GAM e;  1ZUY A;  3GOX A;  4X34 A;  4Y28 E;  1ZSZ A;  3MHX A;  2PU9 B;  4MML A;  2EJG A;  3CC7 T;  3G71 T;  1M2V B;  2M9U A;  2CDT A;  2OTL A;  1KFZ A;  3JB9 J;  3MET A;  3CC4 T;  2BZ8 A;  2LCS A;  1JJ2 A;  3VS3 A;  2YXY A;  4E47 A;  2G6F X;  4M78 G;  4IUU A;  3CCE T;  1VQ9 A;  1K73 U;  4OMF B;  5D6X A;  5LJ5 f;  1YIT A;  3FRN A;  4HCZ A;  3OA6 A;  5GAN 3;  1BB9 A;  5LJ3 d;  3NFC A;  2V26 A;  5HCK A;  3SHW A;  4EMK C;  3L2Z A;  2DVE A;  1WHL A;  2RJE A;  4NOY A;  1QCO A;  5CK9 A;  1HD3 A;  1W70 A;  2EWN A;  2LMJ A;  1TOV A;  3J80 E;  2EQU A;  1N8R U;  3HL8 A;  1RL2 A;  1WDX A;  1U3O A;  3MEV A;  2FEI A;  1U5S A;  2VYT A;  3OSV A;  2COZ A;  4F7U A;  3H0H A;  2XIC A;  3CPW P;  3OYH A;  5LJ3 j;  2BZY A;  2EJF A;  1WXT A;  4FCY A;  2LQN A;  1PHT A;  1G5V A;  4C92 C;  3LWI A; 
#chains in the Genus database with same CATH homology
 3L2V A;  2ZGW A;  4C8Q E;  2QQ9 A;  2VXF A;  4C0F A;  1NJI C;  1V29 B;  2HAX A;  3QSU A;  5DLO A;  4C8Q C;  3QJ6 A;  3L2U A;  1IZ6 A;  4QQD A;  3OYE A;  3RKW A;  4OP0 A;  4A54 A;  2LDM A;  3LX7 A;  4JRP A;  3FEO A;  1WJQ A;  4NL3 A;  3OW2 S;  1VQ4 A;  1M90 C;  3OYC A;  5CAI A;  4KUD K;  3RMQ A;  3EAE A;  1X6O A;  3G71 A;  3KUF A;  3QHS A;  3F70 A;  4M78 B;  4MDX A;  2ZCF B;  1BI1 A;  2IG0 A;  2QXF A;  3M57 A;  4M77 C;  2OTJ A;  1WGS A;  4Y91 A;  1Y71 A;  4M78 C;  3OS1 A;  4BE1 A;  3MCA B;  3OYD A;  3OYG A;  4PJO C;  2X4W A;  1FX7 A;  2MMP A;  3LGF A;  3OSS C;  4ZN1 A;  5FRN A;  2YRV A;  5GAO l;  1BIB A;  2HNI A;  1XOV A;  1YJW A;  3CXC S;  3CCL T;  1U1S A;  4C8Q G;  3M4Y A;  4PJO D;  4PLI A;  3CCE A;  5L8R E;  3M56 A;  1YJN A;  4Q5W A;  3SWN A;  1ZBX A;  2O4X A;  2CZ7 B;  4JS4 A;  3JCM g;  3CCS A;  1VQM T;  2DJZ A;  4WF2 A;  1IRE B;  4M7D B;  2OTJ T;  5LJ5 h;  2XU8 A;  3HKS A;  3MO8 A;  1VQP T;  4Z02 A;  4M75 D;  2EJ9 A;  4M77 G;  4II1 A;  4P5N A;  5GMK h;  3OS2 A;  3CC2 T;  1GXI E;  4E7K A;  3S3O A;  3CCL A;  2GCX A;  4M78 F;  2RH2 A;  3DB4 A;  3PIP A;  4LDV A;  4XU2 A;  5DLQ E;  4ZGD B;  3JB9 G;  3M4G A;  4L6V 5;  5DM7 R;  1OYX A;  5GAO q;  4M7A D;  4E7I A;  2JUF A;  4UC4 A;  5GAM j;  1S72 T;  4M7D E;  2L8D A;  3DB3 A;  4VUB A;  3SWN B;  2LT1 A;  4MZT A;  2E1H A;  2XID A;  2YLC A;  1M4Z A;  3ER0 A;  3T9N A;  3QG1 A;  4BI8 B;  1H3Z A;  1Q86 U;  5KCH A;  1W2B A;  3FLG A;  2X4J A;  1I8F A;  2E12 A;  2LCC A;  2CYZ B;  3RKX A;  1MHN A;  3X28 B;  4HKE A;  3G7Z A;  4CRI A;  1R8O B;  4LDU A;  2RHX A;  3LYI A;  2Y4Y A;  5GAM f;  4ZN3 A;  3OYI A;  3NTH A;  4C8Q B;  4EMG A;  4ZTJ A;  4A4H A;  3X24 B;  4YTL A;  4M7D G;  1LJO A;  2AHJ B;  3NTK A;  3C94 A;  5I2S A;  4N0A A;  2KSS A;  3CCM A;  3PT9 A;  2E70 A;  2FYK A;  4QVZ A;  4RG8 A;  3VUB A;  5GMK i;  3G6E A;  1M90 U;  4LDX A;  5HK0 A;  1EIF A;  4QQG A;  3ASK A;  4M7D A;  4JS5 A;  3ZBD A;  2X35 A;  5GAN j;  4C92 B;  1YCY A;  5GAN d;  3QKJ A;  4M78 D;  2DKG A;  3MP8 A;  2E41 A;  3OYK A;  3KBG A;  3ZFJ A;  3I55 A;  3CCQ A;  4JUV A;  3RES A;  3CMA T;  1KG1 A;  3CME A;  1KD1 C;  3JCM b;  2DXT A;  3HFN A;  3M58 A;  4OB1 B;  3CXC A;  3JB9 D;  4L59 A;  3FJP A;  3SB2 A;  3QZ9 B;  1WQW A;  4ZGJ B;  5FU6 B;  3RKY A;  4M7A C;  3P8H A;  3C95 A;  3GLX A;  2I2L A;  2L5Q A;  3FIF A;  3TEE A;  1I81 A;  2H3J A;  2QEX A;  3OW2 A;  4QW2 A;  4HT8 A;  1YIT T;  4MZM A;  2K3X A;  4A4F A;  4EPC A;  1QP3 A;  2DO3 A;  1I4K 1;  4V2S A;  1N9R A;  1WJR A;  2XK0 A;  4J7I A;  3MEA A;  1X01 A;  3E19 A;  3X26 B;  3CC7 A;  2XHC A;  3E9F A;  1QVF S;  3AHU A;  2P4T A;  4IUT A;  4JLG A;  4OGE A;  3INZ A;  2M0O A;  2HD0 A;  1YI2 T;  1NJI U;  4BDZ A;  4MZP A;  4FL6 A;  1VQM A;  1Q81 C;  5GAN 6;  5CCA A;  3CC4 A;  4M7A F;  5GAN 2;  4O6J A;  3JCM Q;  1Q81 U;  3S3M A;  3HRU A;  2RHU A;  3VYH B;  3QII A;  3CCU T;  5LJ3 e;  2A7Y A;  1W2B S;  2JN0 A;  5FU7 B;  1BYM A;  2LX9 A;  3GF5 A;  3PNW C;  2QQR A;  4PKC C;  4E7J A;  1YI2 A;  1UB4 A;  3TU4 K;  4LDY A;  3QYG B;  4BY6 B;  5KE3 A;  3JRZ A;  1KC8 C;  2KQW A;  2LQK A;  1YIJ T;  1VIE A;  2RHZ A;  3DKM A;  2RI5 A;  1VQN T;  2RM4 A;  2F5T X;  3CCU A;  1QVF A;  2DD4 A;  2A3L A;  4C0Z A;  4IUQ A;  5LJ5 d;  3MP1 A;  4J8O A;  3CD6 A;  4BE0 A;  5GAO p;  2RB6 A;  3FB9 A;  3HSB A;  4KUL A;  2JVV A;  2D6F A;  4IUR A;  4C92 F;  2L89 A;  5AYF A;  2V8I A;  4C92 E;  4BE2 A;  1YJ9 A;  5DY9 A;  1D3B B;  3CBP A;  3A8L B;  3OMC A;  1VQ5 T;  2HBP A;  1VQN A;  2E64 A;  3CCJ T;  4RG2 A;  3QUI A;  2RD1 A;  1HK9 A;  3CPF A;  4N0A C;  2PUK B;  3JCM c;  3V8L A;  4PL6 A;  5CKE A;  2DAQ A;  1UGP B;  2HQX A;  1G3S A;  1VIF A;  2DIG A;  2R5A A;  3HPW A;  3OQ5 A;  3QPH A;  3V8K A;  1N9S A;  3CCV T;  5A0L A;  3JCM e;  2DPP B;  2CKK A;  2X4X A;  5CIU A;  1QP2 A;  2L3R A;  2K5F A;  4XU1 A;  4C5I A;  1VQ4 T;  4EMK B;  4A4G A;  4NL2 A;  3PIO A;  2RI3 A;  2LT4 A;  3GNG A;  2JOY A;  2BKD N;  3VYG A;  4B9X A;  3CMA A;  3Q1J A;  2RHY A;  4M77 A;  3RER A;  2LC4 A;  2DD5 A;  2VGN A;  2WAC A;  3SD4 A;  3CME T;  1VQL A;  4D6W A;  1Y96 B;  1XTD A;  3X20 B;  1YHQ T;  2CZ0 B;  4J6X A;  1M9S A;  2FB7 A;  2O4X B;  4F7U E;  3QJY A;  1Q86 C;  5GAN f;  2PUO B;  1YJW T;  2P0Q A;  3OYB A;  2E10 A;  2DTI A;  3GNF B;  3PMT A;  2DXB A;  3VUZ A;  1BI3 A;  2DXC A;  4MDW A;  3V7C A;  2CGH A;  4FM4 B;  4C92 A;  3E1S A;  1JBM A;  3OYY A;  4HA8 A;  3HP9 A;  2QEX T;  3CCS T;  2QA4 A;  2EQK A;  5LL6 S;  3DLM A;  4M7A E;  3LW5 E;  1W4S A;  4C92 G;  1KQS S;  3VU3 C;  1LOJ A;  4OB0 B;  4EDU A;  3CC2 A;  3CEY A;  4N4H A;  2KY9 A;  5I2M A;  3QBY A;  2JZ2 A;  1BI0 A;  1FWZ A;  4DQ2 A;  1UGS B;  5IN1 A;  4A53 A;  3QXE B;  3CCR A;  1KC8 U;  3JCM V;  1LNX A;  2X4Y A;  1XNI A;  2EFI A;  2LRQ A;  4F7U B;  2GFA A;  1XQH A;  2ZPI B;  3JCM h;  3P8B B;  3OYM A;  3OS5 A;  2R5M A;  3E9G A;  3X25 B;  1S72 A;  3URG A;  4LDW A;  2ZPF B;  3QZ5 B;  2DXU A;  2LTO A;  4PNO A;  2YLB A;  5CO7 A;  1Q7Y C;  5HY6 A;  1VQ8 T;  4PJO A;  2CZ6 B;  2VXE A;  1NZ9 A;  3OBW A;  4J6W A;  5D6W A;  1WNL A;  2OAU A;  1YJN T;  4C5H A;  1VQK T;  2E5Q A;  2EQJ A;  3LWH A;  4OVA A;  1YIJ A;  2PQW A;  1ZQ1 A;  1O75 A;  1NE8 A;  2P0P A;  2EKO A;  3P8D A;  3RIR A;  5J39 A;  3JCM d;  1Q7Y U;  4LD9 K;  3ZEH A;  1O9S A;  5C0M A;  3C4S A;  4HT9 A;  3UDC A;  5A0D A;  2RK2 A;  3PTA A;  3VKI A;  3BY7 A;  2DZC A;  2EQM A;  2IVW A;  1KQ1 A;  3A5Z B;  3PMI A;  4KUI A;  1BIA A;  4F7U F;  4N4I A;  2LCL A;  3OB9 A;  1B34 A;  4DOV A;  2KDS A;  4PJO B;  3CCJ A;  3JB9 H;  3RMS A;  3CBO A;  4PJO F;  1UGR B;  3G4S A;  4M77 B;  1G3Y A;  4IUP A;  5D6Y A;  3JCM X;  3GPL A;  3BFM A;  4M78 A;  4ZGE B;  3UPU A;  3A8O B;  3TCJ A;  5GMK l;  5GAO n;  3L1A A;  4FT4 A;  5M9O A;  1OZ3 A;  2R58 A;  2E6N A;  3SFM A;  1G3W A;  2RJF A;  4JLI A;  4QQ6 A;  3MP6 A;  2XDD A;  1JJ2 S;  5J3B A;  3PGG A;  2EIF A;  3M54 A;  4RCB A;  5C6S A;  2FHD A;  3TRE A;  5LJ3 g;  3O8V A;  4XU0 A;  1UGQ B;  3CBM A;  1TH7 A;  4FU6 A;  4E7L A;  2RK1 A;  5CKD A;  1X75 C;  3OYN A;  4IUV A;  4X9C A;  4XTU A;  1OZ2 A;  3LH0 A;  2GFU A;  4BDY A;  1K8A U;  1VUB A;  1YHQ A;  2DK3 A;  1PSF A;  4JJN K;  4M7D C;  2EYQ A;  1DJ7 B;  4DOW A;  1M1G A;  1P92 A;  5GAN g;  1QW1 A;  4M77 F;  4C5G A;  4OF1 A;  2QQB A;  2XI9 A;  4M78 E;  3I56 A;  3M53 A;  1BI2 A;  1VQ6 T;  1WJS A;  4M75 F;  3I55 T;  3CCQ T;  2BUD A;  2QI2 A;  3ME9 A;  4C8Q D;  1WQ7 A;  3BDU A;  4J7F A;  4PJO G;  5KE2 A;  3OY9 A;  1U8R A;  5IT9 E;  1HXD A;  4ZTF A;  5HK3 A;  3KXT A;  5I21 A;  1B34 B;  4ELZ C;  3JCM f;  1Y96 A;  3NTI A;  2B8A A;  2MI6 A;  2V8J A;  1VQ6 A;  5CKB A;  4XTY A;  4X9D A;  2RJC A;  2VUB A;  4FSX A;  2OTL T;  4HCB A;  3LGL A;  3I56 T;  4GLK A;  4C92 D;  3LLR A;  2ZPG B;  1M1K C;  3M9Q A;  1M1K U;  2XDP A;  2D0Q B;  1G3T A;  4RKU E;  4F7U G;  2PVO B;  4M75 E;  5IAY A;  1Y07 A;  2KAF A;  3JAM E;  1KHI A;  4PJO E;  3DLL A;  4C0G A;  4M75 C;  3WVE B;  4M77 E;  1M8V A;  3QYH B;  1QVG A;  1NPP A;  5GAM d;  2CS7 A;  2HQE A;  1KHC A;  3HHT B;  2WSF E;  3HRS A;  5GAO m;  4KBM B;  3L2R A;  4XTW A;  2EAY A;  5LJ5 g;  1VQ5 A;  1ZHI A;  3MEU A;  3JCM P;  1KD1 U;  4XQ3 A;  2GF7 A;  2RJD A;  3V8J A;  2MAM A;  3SDZ A;  2DIQ A;  1UEB A;  4A4K A;  4EMH A;  1JRI A;  3EFR A;  5LJ5 e;  5HKC A;  4XU3 A;  4C0D C;  5GAM g;  4M75 G;  2V8K A;  4J5Y A;  4M7A A;  3WVD B;  4B9W A;  2O01 E;  5GAN 4;  4IKF A;  2FVU A;  3R6O A;  1VQP A;  3VJP A;  2K4Y A;  2K2V A;  2ZZD A;  3JSC A;  4FT2 A;  3OYF A;  5GAN h;  1QVG S;  2F69 A;  2MF2 A;  4JRQ A;  2XD0 A;  2RHI A;  1BKB A;  3CD6 T;  1NPR A;  5A2Q E;  4R56 A;  2LQ8 A;  1K73 C;  3JB9 I;  1I5L A;  1MGQ A;  1K9M C;  2KK4 A;  3A8H B;  4L5G A;  3GP8 A;  2D9T A;  1YJ9 T;  4DA4 A;  4XTX A;  4ATO A;  4BD3 A;  1AHJ B;  3CPW S;  4M7D D;  2Y90 A;  5GAN 5;  5LJ3 f;  1Y7X A;  2DTH A;  2KVQ G;  2WSE E;  4C8Q F;  2ZPE B;  4TVR A;  5KH6 A;  1U1T A;  4JRK A;  5FLX E;  1Q82 U;  5KCO A;  4MMK A;  3S6W A;  1RI0 A;  3H8Z A;  2CZ1 B;  2QA4 T;  4OGC A;  3CCV A;  4M7A G;  2P0K A;  3OMG A;  3OYA A;  2F5K A;  1N8R C;  2G3R A;  2PVD B;  2Y4X A;  3C12 A;  1JB0 E;  4OB2 B;  5GAN e;  4CI0 C;  5GAN 7;  3J81 E;  4BI3 A;  5A0G A;  4XAX B;  5GAM h;  1N6A A;  3EFS A;  2ZPH B;  1VQ7 A;  2WSC E;  3UT1 A;  3CPW A;  1VQL T;  2JNG A;  2M1H A;  4O5V A;  3OYL A;  3CCM T;  4C8Q A;  3G6E T;  2M16 A;  5GAM e;  4ELY C;  1D3B A;  3GOX A;  2PVG B;  2XG8 D;  3H6Z A;  1H64 1;  4X34 A;  5CVI A;  1VQ8 A;  4Y28 E;  5GAO r;  1KQ2 A;  2K3Y A;  2PU9 B;  3MHX A;  4MML A;  4RCC A;  2EJG A;  2JTM A;  5GMK j;  5CR2 A;  3G71 T;  3CC7 T;  2M9U A;  2VV5 A;  2OTL A;  2RO0 A;  3JB9 J;  2KMT A;  3MET A;  4BAC A;  3CC4 T;  4XTV A;  1SSF A;  2QTX A;  2E65 A;  2RA2 A;  4M75 A;  1VQO T;  1JJ2 A;  4E47 A;  2K5L A;  3L2Q A;  4A4E A;  1YBY A;  2MWO A;  4M78 G;  3UWN A;  3CCR T;  3QO3 A;  5LJ5 j;  1PSE A;  5FRO A;  4IUU A;  2C06 A;  4EMK A;  1K9M U;  5FRM A;  3CCE T;  2DTO A;  3A8G B;  4J6Y A;  3V7S A;  1N27 A;  2YHT A;  4LD6 A;  4OMF B;  5D6X A;  1K73 U;  1VQ9 A;  3OYJ A;  2LVM A;  3A8M B;  5LJ5 f;  5EG2 A;  3FRN A;  1YIT A;  3FDR A;  1OI1 A;  3OBY A;  4HCZ A;  3OA6 A;  4E7H A;  5FU7 C;  1VQO A;  3M55 A;  5GAN 3;  2K57 A;  5LJ3 d;  4FIB A;  3NFC A;  3L2W A;  2LNV A;  1KQS A;  3M5A A;  2DEQ A;  3L2Z A;  4EMK C;  2FL7 A;  1VQ9 T;  2DVE A;  3M59 A;  4OB3 B;  3V7R A;  1VQK A;  1FXX A;  4PLL A;  2RJE A;  2R57 A;  4NOY A;  3HFO A;  1QVP A;  4BI4 A;  3JCM J;  3FC3 A;  2XKO C;  3PFS A;  4XTZ A;  5CK9 A;  4RMO A;  3J7A F;  3N5B B;  5GAN 8;  2BIV A;  2K5I A;  2QQS A;  2EWN A;  2NLU A;  4N4G A;  2VGM A;  4M7D F;  2MWP A;  5CKH A;  3QDR B;  3WXM B;  3OS0 A;  3L42 A;  5J26 A;  4HCC A;  4J83 A;  4BB7 A;  4QVD A;  4C5E A;  2ZPB B;  3J80 E;  5GMK m;  2EQU A;  1N8R U;  4BUG A;  1M5Q 1;  3HL8 A;  4R55 A;  1RL2 A;  4GY5 A;  4QVC A;  5FU6 C;  4XK8 E;  4M7A B;  3SWN C;  3MEV A;  5LJ3 h;  3G4S T;  2VYT A;  5CQY A;  2JTF A;  3OSV A;  4JRI A;  3JB9 F;  2RI2 A;  5CKF A;  2QDY B;  5CQX A;  4F7U A;  2E6Z A;  4NS5 A;  2XDB A;  2XIC A;  4C0D B;  3MEW A;  4ME7 A;  2QQA A;  4JDS A;  3OYH A;  3RUX A;  4BY6 C;  5LJ3 j;  3S3N A;  4KT0 E;  2DZ9 A;  3JCM W;  2EJF A;  3HRT A;  3BDL A;  1K8A C;  5GMK e;  1M1F A;  1WPY A;  4M77 D;  3BW1 A;  1Q82 C;  3VV0 A;  4M75 B;  1VQ7 T;  1G5V A;  2GQV A;  2VC8 A;  4C92 C;  3GIB A;  3LWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...