4PJOG

Minimal u1 snrnp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
b'KAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small nuclear ribonucleoprotein Sm D3
publication title Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 10
structure length 74
sequence length 74
chains with identical sequence U, g, u
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pjoG00
2E1HA 2DEQA 1B34A 1I81A 5LJ5f 3JB9G 5LJ3e 3L2ZA 4XU3A 4JRKA 2YLCA 4PJOA 3JCMQ 4J6XA 2EJ9A 2RM4A 3SWNC 3JCMV 1KQ1A 5LJ5e 5GAN4 5GAOq 3FIFA 4M7DG 5LJ3d 3SWNB 5GAOn 3EFSA 2EAYA 2DKGA 4RCBA 1U1SA 2ZGWA 1LJOA 1D3BB 3V8LA 4EMKC 5GAN2 4A53A 4QVDA 5GANf 4M7DE 4QVCA 4XTXA 4NL3A 1HK9A 4M7DA 4C92C 3JCMX 4M78B 4C92B 5GANe 5GAMe 3QUIA 4C92F 1X01A 3JCMd 5GAN5 4M78C 4M77C 4C92D 2DVEA 2E10A 1M8VA 4XTUA 4M77B 5LJ5j 5GAMg 4M7AE 4M77F 4PNOA 5GMKj 4C8QB 4M78D 1Y96A 4PJOE 4C8QF 4M77D 4M75E 3BW1A 3RESA 4M7AA 4X9CA 3FB9A 1B34B 1WQ7A 3QO3A 1Y96B 2DTIA 4JLIA 4N0AA 2RB6A 4WF2A 4M75A 5LJ3h 4XTWA 4F7UG 5CAIA 4M78G 4XTYA 3M4GA 2E65A 2FB7A 2VC8A 2QTXA 4M75B 3RKYA 3RKWA 3RKXA 3V7CA 3V7RA 3L1AA 4XU1A 5GANj 5GAMj 1JRIA 1M5Q1 3BFMA 4A54A 4XTVA 5GAMf 5GMKl 5LJ3g 1N9RA 2Y90A 5GMKm 2RD1A 3JCMh 4X9DA 3HSBA 2E41A 4XTZA 4M7DB 3VU3C 3RERA 2HNIA 3JB9H 4M7DF 3JCMc 3JCMb 4C8QC 1N9SA 3JCMg 3JCMP 1LNXA 4J5YA 2DTOA 1WPYA 5LJ3f 2EWNA 4MMLA 3SB2A 3BY7A 4C92G 5LJ5d 3JB9I 1U1TA 4JUVA 3FJPA 3PGGA 4PJOC 4RCCA 4M75C 2DTHA 4M7AB 1I5LA 1H641 5GAN6 2K57A 4M7AF 3GIBA 4OP0A 4M77G 1MGQA 4PJOF 3V8JA 3EFRA 4M75F 3HFNA 5DY9A 4C8QG 4EMHA 5GAN7 4F7UE 4PJOD 4M75D 1YCYA 5GAOr 1I4K1 4J6YA 3JCMf 2JN0A 4M78E 4F7UA 5I21A 5GAOp 3BDUA 3JB9F 1LOJA 5GAN3 5GANd 3JB9D 4M78A 5GAMd 3JCMJ 3QSUA 4M7DC 4JRIA 1HXDA 2EJGA 3JCMe 3AHUA 3JB9J 2DZ9A 2RA2A 2YHTA 3RUXA 2FYKA 1WNLA 3V8KA 3JCMW 4M7DD 5GAOm 5LJ5h 3QHSA 5LJ3j 2VXFA 5GMKh 2DJZA 3SWNA 5GMKi 1I8FA 4MMKA 4XQ3A 2DXUA 5GMKe 3HFOA 1D3BA 4XU0A 3V7SA 4N0AC 4HT8A 4M7AC 5GAN8 4EMKA 1KQ2A 4V2SA 1WQWA 2VXEA 5LJ5g 4C92E 4M7AD 4HA8A 4EMKB 4HT9A 4J6WA 4PJOB 4Y91A 5GANh 4NOYA 4C92A 5GAMh 4EMGA 2DXTA 1BIAA 2E64A 4XU2A 3RIRA 4M77E 4M7AG 3INZA 2I2LA 4C8QE 4DQ2A 1BIBA 4PJOG 1JBMA 4C8QD 4M75G 4M77A 4F7UB 4F7UF 5GAOl 4C8QA 2YLBA 4NL2A 2DZCA 2CGHA 2EJFA 5GANg 4M78F 1TH7A
chains in the Genus database with same CATH superfamily
2KEAA 1YWPA 1OULA 1WJSA 1V29B 2EKHA 2JNGA 4JPBW 2CP3A 1M1KC 2YT6A 3SWNB 3QDRB 2X4YA 1D3BB 2LJ3A 1WJQA 2L3QA 4O6JA 1AZGB 1DJ7B 3QUIA 3OS5A 3M55A 2E3IA 1KFZA 5LJ5j 1Y96A 3SD4A 4M77D 1VIFA 2RQWA 3QO3A 4JLIA 2JTEA 4Z89A 1M1KU 2O4XA 5FWBA 2RI2A 3QWYA 3V7CA 5HKCA 2NWMA 1FX7A 2ZCFB 4E7JA 1AD5A 1M5Q1 2EYYA 4A54A 4ZGEB 3PIPA 3LWIA 3NPFA 4N4HA 2EYQA 1KD1R 2CP6A 2DK3A 2HNIA 2CZ1B 3JCMb 2OTJA 2X3XD 4EIKA 4R55A 4ZNXA 1JQQA 1W70A 4PJOC 3VV0A 4M77G 1LPLA 1SHFA 2V8IA 2C0OA 1YCYA 4IURA 1UJYA 3JB9F 3A8OB 2L8DA 5CQXA 2X35A 2ZAEA 4M78A 4HVWA 1YI2Q 4AFQC 4E7IA 5L8RE 1VQMA 5KYXB 2DZ9A 3FC3A 1CKAA 1UECA 1X6GA 3V8KA 2A36A 2VXFA 1M2OA 1ABOA 5GMKi 1ZBJA 1KIKA 5J39A 2R57A 1VYVA 3EG9B 1NM7A 3PFSA 5GANh 5GAMh 4BE0A 2EGEA 4ESRA 3VRYA 1U8RA 4DQ2A 1PM3A 2HQHA 4NL2A 1XTDA 2A0FB 1WXTA 1VQ6T 2YRVA 4P5NA 3CC2A 3LWHA 2JTMA 1UGPB 2DKGA 2J6KA 1WJRA 4Z88A 1D1AA 1GFDA 3RMSA 2CREA 4C0ZA 1Q81R 3WVDB 4B9WA 2ZPIB 2X4WA 1KQSA 2KROA 4M78D 2RJDA 2CT3A 1Q7YC 1WQ7A 1HYOA 1QCFA 2QQ9A 1M3CA 2FB7A 4M75B 4IUTA 2BE7D 2XIDA 1YHQQ 2VB6A 5CIUA 1ZBXA 1WI7A 4IIOA 1Q7YU 1NLPC 1OZ2A 1YITT 1K9MC 1R8OB 4IUVA 2EQUA 4D8KA 1SSHA 1KG1A 3EFOA 1KSWA 1QQJA 5GAOr 2IIMA 4OGCA 4F7UA 3CCMT 3QYHB 2FHDA 3AHUA 1K9MU 2GBQA 2RQRA 3JRZA 1H3ZA 1RI9A 3QHSA 1RI0A 5C0MA 4DOWA 3M59A 4A4KA 4CI0C 5I2SA 5HK0A 1Q82R 2B86A 4HA8A 4EMKB 4HKEA 5CKBA 4PLIA 3G71T 1IGUA 3H0IA 3CC4Q 4M7AG 3INZA 2KDSA 1TWBA 2SEMA 1E6GA 1VQPQ 2CGHA 1VQ8Q 2JM8A 5M9OA 1VQOT 4BE2A 1OOTA 3CD6Q 4J9CA 1YJ9A 4KGVB 3CPWP 5CKHA 5GAOn 4LN2A 5D7UA 2FEIA 2RO0A 3PT9A 1N27A 1VQ4Q 1YJWQ 2LJ0A 3CCRQ 4OGEA 2FO0A 1Q86R 2RF0A 1VYUA 4X34A 4F04B 3JCMd 4M77C 4J9DA 1M8VA 4QT7A 2DL3A 3H6ZA 2DF6A 2COYA 2M16A 3CCEA 3N5BB 4TVRA 3ER0A 1AWWA 1BCMA 4BI8B 1NYFA 1VQNT 1SPKA 3EGDB 3L2QA 2ENMA 3P8DA 1S72Q 5KYWA 2BKDN 2DBMA 3CCUT 5KYYB 3M0QA 5DLOA 3EGUA 2GTOA 2LC4A 2F5TX 1VQKT 1MNDA 1RL2A 1X2KA 5KYNA 4MMLA 3BY7A 5LJ5d 1IO6A 4JRQA 1O75A 5J26A 3A8LB 2CH4W 2RK1A 3CCJQ 1M1GA 1NPPA 4DOVA 1ZUUA 2EPDA 3DB3A 2CZ0B 2JMAA 4HVUA 4DBQA 2FZCB 4JRIA 2MOXA 3JCMe 4KH0B 2K79A 2YHTA 3SDZA 4AG2C 3RMQA 1NLOC 1K4US 2JZ2A 2NLUA 2W10A 1W6XA 3LGLA 5FU6B 2EVRA 3OS2A 5ECAA 2J06A 1SHGA 1TSFA 2QDYB 2DD5A 2KYBA 1M1FA 1BI0A 2CZ6B 2DRMA 3L42A 4C8QA 3EGXA 5GANg 1TH7A 1RAGB 1GFCA 4XU3A 4LNPA 4C5HA 1AWXA 4GLKA 1BCOA 3MEUA 4IKFA 5LJ5e 2RHXA 1OX8A 2EAYA 5I2MA 3V8LA 4F14A 5FLXE 3MHXA 1MMGA 1KD1C 2FZKB 4M78C 1YI2A 3MEVA 3CC7Q 4HCZA 4MZMA 2MMPA 3PE0A 1Y96B 1EZZB 1T3SA 2D0NA 2E65A 1SF9A 2DMOA 2KBTA 2NUTA 1QKWA 3I9QA 1KD1U 8ATCB 4CC4B 4JJBA 2RD1A 4X9DA 2DE0X 2DILA 1VQMQ 3VS4A 1MNEA 4M4ZA 3R6NA 2E6NA 3UF4A 2DD4A 1VQ9Q 3I56Q 3M53A 1ZUKA 1Z9ZA 5DY9A 2LQKA 2P0KA 2ROTA 2JN0A 4OB3B 4GY5A 3JB9D 4JS5A 5FRMA 3JCMJ 2CYZB 3NFCA 3A5ZB 3JB9J 2OTLQ 5HK3A 4YTLA 5KYUA 3MPUB 1X75C 1TXQA 2DPPB 3P8HA 4HCBA 3CC2Q 1W2BA 4BD3A 1IXDA 1NJIR 3OYFA 2LRQA 3HL8A 2BTTA 3OYEA 1YWOA 2EGAA 4E7LA 4Y91A 2D9TA 1IRXA 3RIRA 3S6WA 2XU8A 1JEGA 3FLGA 1YHQA 3OMGA 1KJWA 2K3BA 2EJFA 3WVEB 1W2BP 1RAHB 1B34A 3JB9G 1K1ZA 1FXXA 1MMNA 1V1CA 4KRTA 4J9BA 4RTZA 5CO7A 2NYSA 1UTIA 5GAN4 1E7OA 4RTVA 2HEQA 2EFIA 2MF2A 5KE2A 1XQHA 4NL3A 2AKLA 2KRMA 1WGSA 3VUBA 2XICA 1D1BA 1QLYA 1Q81U 3FJ5A 1VQ5T 4Y92A 3VS5A 2JTFA 1RADB 2DVJA 2CSQA 5HCKA 3RESA 5A0LA 3M58A 1YIJT 3C94A 4N0AA 2ED1A 3JV3A 2PU9B 2YWWA 3OYAA 1QKXA 1X69A 3RKYA 1UEBA 2VC8A 2MCNA 4FYWB 4PFZA 3OW2P 4XU1A 2M0OA 5A0DA 1IZ6A 2RI3A 4A4EA 1C0MA 1N9RA 4FU6A 2GFUA 3OYBA 3M54A 5IHNA 3EH1A 4M7DB 4M7DF 3GNFB 5IXBA 4EPCA 1MMAA 1VQPA 3CMAT 1VQ8A 1WPYA 1PSEA 2QXFA 3DB4A 4RTUA 3GP8A 3CD6A 2JOYA 1Q82C 1GCPA 3S3OA 2DRKA 4L6V5 3VKIA 1AHJB 1G3SA 3BDUA 2DL4A 2NUPA 1R0CB 1VQ4A 1YJWA 3C4SA 2FRWA 1PHTA 1GRIA 1Y07A 4LE9A 1AT1B 5C6SA 2VUBA 1WZOA 4UC4A 1Q82U 2LP5A 4KULA 1M8MA 1SKUB 5GAN8 3VYHB 4LDXA 4J6WA 3LH5A 3C0CA 3VJPA 1RAEB 1Q86C 3A8GB 2AKKA 1S72A 2K3YA 3MP8A 4M77A 3H8ZA 1ZSZA 1HJDA 2MK5A 1EIFA 1QVGA 3M0PA 3M57A 2LT1A 2QGGA 3G6ET 3EH2A 3SWNC 2RM4A 3TU4K 1KQ1A 3OYHA 4DBRA 5GANf 1VQ6Q 1Q86U 4M7DE 4C0DB 3CCJA 5CKFA 1G5VA 2K6DA 4C92B 4C92F 2DA9A 4FT4A 2KE9A 2YRDA 4GBQA 2LX9A 4HVVA 3M5AA 4A63B 2R5MA 3BW1A 1K0XA 4X9CA 2J6FA 2DTIA 3EHQA 5LJ3h 3A8HB 3CXCS 2SRCA 4A4GA 2G6FX 2VV5A 1PRLC 5I11A 3M56A 4XTVA 3LLRA 5CR2A 2XHCA 2DL7A 4OB0B 1BBZA 2R58A 2QK0A 1VA7A 2HSPA 4KBMB 2WSCE 2P4TA 4C8QC 2HL5C 4Z02A 3QZ5B 2PVDB 2AIRB 3FJPA 3VUZA 5CKDA 2K2MA 1M90R 2PZ1A 2VKNA 1YITQ 3OYYA 5IT9E 1YIJA 2HMAA 4JLGA 4BY6B 3QWXX 1LOJA 2BIVA 2RN8A 3RR6A 3EHRA 2VVKA 3HTRA 1QVGS 2FYKA 3OB9A 2ZPFB 1D1CA 3CCMQ 2BE9B 5GMKh 3CC7A 2DEUA 2YSQA 3OYJA 1M9SA 3H9NA 4C5IA 2RK2A 2LCLA 4C92E 2DIGA 2K5IA 3LX7A 2DXCA 2GFAA 3OSSC 2BZXA 3X26B 3R6OA 3MKDA 3SFMA 1CSKA 3KBGA 1PSFA 1WLPB 1QVFP 3EGXB 1RLPC 2IG0A 2YLCA 2RHZA 4RG8A 2QEXT 3CCQT 2L3RA 3M0RA 4ORZA 3RNJA 3EFSA 4XK8E 3I56A 1VQ9A 1FMKA 1VQOQ 3ULRB 4QVDA 2RH2A 1HK9A 2K7AA 2O31A 1JJ2A 1HSQA 2KT8A 1SSFA 2Y4XA 4KT0E 4R56A 5CKEA 4WTOB 3C12A 4M7AA 2OTLA 4E7SA 2DYIA 3J7AF 4PJOB 3ME9A 2RQVA 1CKBA 2O9VA 3L1AA 1NE8A 3CCLT 1JJ2P 3I5SA 2XD0A 1IGQA 5IN1A 2DO3A 3OA6A 2XDDA 3G6EA 2D0QB 2CH4A 3RDVA 1GBRA 3VU3C 1VQNQ 2QDLA 1M3BA 1OV3A 3QKJA 3G4ST 1TS9A 2RNAA 3CCUQ 1BU1A 1NJIC 2COWA 3PGGA 3L2WA 1I5LA 2DXBA 2DL8A 1VQKQ 2RJFA 4KH1B 3V8JA 3EFRA 4M75F 4BI3A 3QBYA 4FT2A 3U23A 3E2UA 4RMOA 1VQLT 4DEXA 1QVPA 2FRYA 2YUOA 3LYIA 2QAZA 5IHKA 3QXEB 3P8BB 2EJGA 2HZYA 3ASKA 4BE1A 2LZ6B 3RUXA 2M02A 2H3JA 1NJIU 1YFNA 1A0NB 1UE9A 1D0ZA 4XQ3A 2LJ1A 4N0AC 1X43A 2K5FA 1KQ2A 4V2SA 2KRSA 2CDTA 4AG1C 4EDUA 4M7AD 9ATCB 3CBPA 3IQLA 3THKA 2LX7A 3QJYA 3J80E 2A7YA 2L89A 4CC3A 1B3QA 3S3NA 4AFUC 1K73R 2KK4A 3TVTA 5L23A 1MUZA 4FW2A 5I22A 1TUDA 3HKSA 3FDRA 2RJEA 2LQWA 1ZHIA 2C06A 3JSCA 1NYGA 1M2VA 1ZQ1A 3CPWA 2P4RA 3TSWA 5FU7B 2QASA 2KXDA 3OYCA 2QQBA 1KQSS 2MPXC 1UHFA 2P0PA 4M75E 5J3BA 1KHCA 5GJVB 4QKUA 3D7SB 2K9GA 1U3OA 1JXMA 4PFPA 3CCST 4E47A 5LJ3g 2KAFA 1TG0A 2V1QA 4LDVA 3I5RA 1UFFA 2EQKA 4PJJA 2EQMA 1OZ3A 1ZSZC 1AEYA 2DTOA 4FM4B 2L2PA 4LUDA 3CBOA 3GIBA 1VYTA 1WX6A 4BUGA 1OQKA 1ACMB 2MWOA 5CCAA 3VS6A 1TTHB 5I21A 3EG0A 4OMFB 1VQ6A 3CCVT 1I1JA 3QSUA 2QYZA 3CQTA 3MEWA 2LDMA 4FYVB 4J9EA 3I55T 1GCQC 2HCKA 2DERA 1J3TA 4D6WA 3HRSA 1KC8R 1IHVA 5AT1B 3SWNA 1GXIE 1H8KA 4LUEA 1D3BA 2XDBA 4OVAA 5DM7R 2K4YA 2W0ZA 3M0TA 2LNHB 3OQ5A 1PWTA 2PUOB 3JAME 3CPWS 2QQAA 3URGA 4JS4A 2DIQA 4KGXB 2CUBA 2XG8D 4J8OA 1QCOA 2A08A 2KR3A 3OYDA 2E12A 3M0SA 2LNVA 4J9HA 1E6HA 2IVWA 2F2VA 1Y7XA 3I35A 1VQLA 1TUCA 2E4HA 3GF5A 2COZA 4J6XA 1UUEA 3CPFA 5GAOq 1M4ZA 4R0KA 1SG5A 2VYTA 3PNWC 4RCBA 5GAN2 2QA4T 4F17A 2PTKA 2GGRA 4QQGA 4XTXA 1YITA 1PNJA 2KY9A 4JDSA 3JCMX 1WHGA 4N4IA 1RAFB 1SEMA 4C92D 3VS3A 3CMET 2E10A 2DETA 2EYXA 1NZ9A 5GAMg 3VS7A 2HKNA 2L3PA 4RTTA 3TCJA 4FSSA 2E6ZA 1ZSGA 1YJNT 3CCMA 4XTWA 3QIIA 4XTYA 1M90C 1G3YA 3EAEA 3X28B 1VQ5Q 1OU9A 3RKXA 3NTIA 1RACB 4QVZA 1WDXA 3OYGA 5GANj 5GAMj 1YIJQ 5CVIA 2D1XA 5GMKl 2LMJA 1RUWA 2HQXA 4E7HA 2KI7A 3JCMh 3DKMA 1ZUYA 1LVKA 2GQIA 4OB2B 3JCMP 2PVGB 1AWJA 1MV0B 4PK4A 5IXFA 3J81E 4C92G 4DEYA 3G71A 1M90U 1O9SA 3CC4T 4JUVA 1IHWA 2JMCA 3EG9A 4RCCA 1BKBA 2DTHA 4HCKA 4OP0A 2O4XB 4EMHA 2JM9A 3LH0A 1VQOA 4RTWA 3KFVA 1MHNA 5D6YA 2CKKA 3L2VA 1VQ7T 2M0YA 1EFNA 1R0BG 1C6VX 1WNLA 4Q5WA 3UT1A 2AZSA 5LJ5h 3CCRT 2LVMA 4IUQA 4M7AC 2DXUA 2KT1A 4XU0A 4L5GA 1OEBA 2V8KA 2EYWA 3M9QA 2XKOC 2ZZDA 1SRMA 4NOYA 1X6OA 4J83A 3E9FA 5GAOl 4ELYC 2CP5A 4M78B 3ZEHA 2DVEA 4M78F 3OYMA 2GQVA 2DEQA 4C5EA 1I81A 2MI6A 1VQNA 4IUPA 1AVZC 3RBBB 2EIFA 3H0FA 3CCVA 2EKOA 5D6WA 1D09B 3G1JA 3KXTA 3CCUA 5D6XA 1UGVA 1RABB 1VQKA 1WA7A 4RKUE 3G6EQ 2RHIA 2L0AA 1F1BB 3T9NA 2EQIA 3NTHA 4BI4A 1PKTA 1G2BA 4MZTA 1G83A 2RPNA 4OMNA 4PJNA 2D6FA 4K11A 4JJNK 3OW2A 3ZBDA 1VUBA 4XTZA 3ZFJA 3FRNA 4DA4A 1KHIA 4F16A 1U06A 2BZ8A 5LJ3f 2JT4A 3PVLA 2JW4A 1NPRA 4M75D 2ESWA 4M78E 1YBYA 1X27A 2FPFA 4BDYA 5GAN3 3M0UA 1FYNA 4J7FA 2L5QA 1K73C 3JCMW 2RHUA 4ATOA 1W2BS 3VS2A 3HFOA 2C0TA 1S1NA 2OTJT 1WQWA 1MV3A 3UA7A 2HAXA 2BUDA 3L2RA 2GF7A 2OJ2A 1HD3A 1QWEA 3EFOB 4XU2A 4JZ3A 4J9FA 4F7UB 1JBMA 2YDLA 4M75G 1K73U 2YUNA 4F7UF 2CP2A 2O01E 1T3LA 3VS0A 2B8AA 2LCCA 1XOVA 2VGNA 2DX1A 4E7ZA 1VQMT 3HPWA 2ZGWA 2LQNA 4A53A 2HD0A 3QDFA 4DBFA 5KYYA 2QEXQ 4C92C 3CCQQ 3OW2S 5KCHA 2VASA 1G3WA 5EG2A 4KUDK 3REBB 8AT1B 1ABQA 3UA6A 3X24B 2VGMA 2ATCB 5LJ3e 1JU5C 2ABLA 2V26A 3V7RA 2EYZA 3KUFA 4QQ6A 5GAMf 5GMKm 1UG1A 4ANJA 3CCLQ 2DL5A 1GCQA 2M9UA 3JCMg 2MIOA 1LNXA 4J5YA 1KC8C 2OAWA 2QQRA 1U1TA 1UHCA 5GAN6 2K57A 1MGQA 2G3RA 4F7UE 3MP6A 2F2XA 2K5LA 3G4SQ 1GL5A 1N8RC 5GANd 5GAMd 4KUIA 2RI5A 2DNUA 4WCIA 5KYWB 3OYNA 4PJLA 4ZGDB 2HKQB 1KC8U 1UDLA 1VQLQ 1WHKA 1FMWA 2OX7A 3GOXA 1OPKA 5GMKe 2FPDA 5LJ5g 4J9GA 5IH2A 1N8RU 1VQ5A 1PD0A 4VUBA 2E5KA 2JS2A 4D8DA 4GLMA 3OBWA 5GAOm 1PD1A 3AT1B 2RQTA 2KNBB 2F5KA 3OSVA 3JCMQ 4BACA 1QVFA 2M51A 1M3AA 3TQ7P 1FWZA 1K0SA 1PRMC 2JS0A 2EBPA 2RMOA 2AK5A 2M1HA 1BI3A 2AT1B 1PKSA 3CMAA 4ZTJA 3HRUA 5GANe 5GAMe 4ELZC 4IIMA 3TREA 2XI9A 4J9IA 2QI2A 3LW5E 4L59A 4OMOA 2EQJA 2Z0WA 4C8QB 4MZPA 2JVVA 4C8QF 2RQUA 3G71Q 3PMIA 2ED0A 1R77A 3FB9A 3BDLA 1WHJA 2MWPA 3M4GA 3BE3A 4QW2A 2DM1A 2E3HA 3BFMA 1BYMA 1OPLA 4LXCA 3PIOA 2E41A 1YJ9T 3HSBA 2E5QA 4HXJA 3OYLA 2CZ7B 1NEGA 3CCSQ 2KGTA 1N9SA 7AT1B 1Y71A 2X9HA 2RJCA 4FIBA 2DAQA 3GNGA 3JB9I 2O2OA 4M75C 4Y28E 2DFUA 3Q1JA 3OBYA 4PJOF 3X25B 4IUUA 3QYGB 3CCET 3OS0A 1FMVA 2X51A 4CC2A 2NUTB 1ZA1B 2YXYA 2MYSA 3UDCA 1UGQB 2DYBA 2NUZA 4DBHA 1BK2A 4NS5A 1JO8A 1TUGB 3CCVQ 1QVFS 1X2QA 1I8FA 2WSFE 1I0CA 3I55Q 2F69A 4ME7A 2KXCA 3X20B 2ZPHB 2J05A 3UWNA 4OF1A 1IB8A 2XDPA 2E64A 5FWCA 1EX4A 4B9XA 4C8QE 1QW1A 4II1A 2A37A 1Z9QA 2DZCA 4BDZA 4O5VA 3REAB 4JRKA 3WXMB 1T0HA 5KYUB 3JCMV 4PLLA 4LDWA 1B7TA 1BI2A 4EMKC 1IREB 5FU7C 3NGPA 4M7DA 2JXBA 5KH6A 1WXBA 1H3HA 1KQSP 1SRLA 1U5SA 2MAMA 4E7KA 1JJ2S 4E2FB 1TOVA 5FROA 1X01A 1VOMA 1NBEB 3MO8A 2QA4Q 3SEMA 4X1VA 2KVQG 1NG2A 4PNOA 4PJOE 1B34B 2RB6A 4PL6A 4M78G 3CMEQ 2CP0A 3RKWA 2I0NA 1JRIA 4QQDA 1K8AR 3A8MB 1YJNQ 5KE3A 1UJ0A 2QG9B 2O88A 2ZPEB 3RERA 3JCMc 2PQWA 4JJDA 2VWFA 2EWNA 2GCXA 2DLPA 1YI2T 1WHLA 1ARKA 2E70A 3A1PA 5GAN7 3H0HA 4RTXA 1N6AA 3HRTA 3JCMf 2PUKB 3HP9A 4AFZC 3M4YA 2QEXA 3CCQA 1AWOA 1WHHA 3OMCA 2D8HA 3E19A 4Z8AA 2WSEE 2XMFA 4M7DD 2KYMA 6AT1B 4RUGA 1OX9A 2GTJA 2CP7A 1X6BA 5LJ3j 4JRPA 2DJZA 2K3XA 4FL6A 1VQ7Q 2P0QA 4C0GA 2FL7A 2FPEA 2EGCA 4PFOA 3ZL7C 4KGZB 4C92A 3E9GA 2DXTA 1BB9A 3MP1A 1OI1A 1OU8A 4OMMA 3EG1A 2NUPB 5KCOA 2CUDA 4PKCC 4AMCA 2ZPBB 4OMLA 5LJ5f 3CCLA 2WACA 4RTYA 3NHNA 2EJ9A 5FU6C 4FCYA 4M7DG 3FIFA 1LJOA 3E1SA 4FW1A 4PJMA 4QVCA 1VIEA 2PVOB 3MCAB 2D8JA 3O8VA 5CQYA 3G4SA 1N8RR 3H41A 1WXUA 2EW3A 5GAN5 3NMZC 1UGRB 2K2VA 3MJXA 4M77B 4M77F 5GMKj 1ZSZB 5CK9A 1PC0A 4F7UG 2H3EB 1YHQT 5CAIA 2QTXA 5A2QE 1M1KR 1QMCA 3CEYA 1K76A 2AHJB 2KRNA 1K9AA 1QCNA 1Q95G 2JUFA 2J6OA 1LCKA 4RG2A 2KSSA 3QPHA 4FYXB 3SHWA 4LDUA 3HFNA 1AZEA 2HL3A 2LT4A 4A4HA 1G8XA 1ZX6A 5KYXA 2KQWA 5DLQE 1W4SA 1WIEA 3DLLA 5IAYA 4ZN3A 3OYKA 2HSEB 3QJ6A 1YCSB 2PNIA 3EG2A 1NEBA 4HCCA 2Y4YA 2VXEA 1ZA2B 1WYXA 1VQPT 1VQ8T 3CMAQ 4EMGA 3CD6T 1TU0B 3G7ZA 4M77E 1PCXA 2I2LA 1B07A 1BIBA 2OTJQ 2YLBA 4FYYB 2R5AA 1RLQC 3CCSA 1VQ4T 4LDYA 1YJWT 3GBQA 4PJOA 4AT1B 4C0FA 4LD9K 3OYIA 1C1AA 3A98A 2GNCA 1U1SA 1D0YA 1H92A 1XNIA 2P84A 1QP3A 3DLMA 1M27C 3QG1A 2QQSA 4AFSC 4XTUA 2YUQA 3TSZA 2H8HA 4C8QD 2CSIA 1S72T 4WF2A 4M75A 2L3SA 3PMTA 2ECZA 2O9SA 1MMDA 3GLXA 4ZN1A 3I55A 2QGFB 4N4GA 2BZYA 2CS7A 2CT4A 5FRNA 3PTAA 1JXOA 3VYGA 1V76A 3CCJT 2HBWA 1ZLMA 2YRCA 2DBKA 4XAXB 1Q7YR 2QTVA 4M7AB 3S3MA 2FVUA 1H641 4M7AF 2HQEA 1AOJA 2LQ8A 1QWFA 3O5ZA 1PG5B 3OY9A 4C8QG 4CC7A 4PJOD 2X4XA 1I4K1 4J6YA 5GAOp 3CBMA 4OMPA 1KK7A 4J7IA 2JJ9A 4M7DC 2HDAA 1Q81C 2X3WD 4A4FA 2QA4A 1K9MR 2F2WA 3GPLA 1YNZA 2ZPGB 5LL6S 1D0XA 1QP2A 1OYXA 3V7SA 2RHYA 1P92A 4JZ4A 3L2UA 4EMKA 3CMEA 1JB0E 3MEAA 3FEOA 4LD6A 2A28A 5IHIA 4BB7A 1YJNA 3UATA 4PJOG 1Y0MA 2A3LA 2V8JA 1RAIB 4HT9A 3C95A 3HHTB 2AZVA 2E1HA 1XJWB 3QZ9B 3L2ZA 2XK0A 3UPUA 4OB1B 5LJ3d 1N5ZA 2C0IA 1K8AC 3CC7T 2LTOA 4JJCA 2FG0A 1YP5A 2IPOB 3META 4E6RA 3CC4A 2YUPA 2J7IA 5GJWB 4OMQA 3F70A 1YN8A 3NTKA 4M7AE 1WHMA 3VRZA 2V1RA 1GBQA 3CXCA 1BI1A 1VQ7A 2OI3A 1K8AU 3EGDA 1T0JA 4C0DC 2Y90A 4CRIA 4ZGJB 3CCRA 3TEEA 1M2VB 1I5OB 1VQ9T 3I56T 3LGFA 1G3TA 3JB9H 4C5GA 5FW9A 5EC7A 3CXCP 4ZTFA 1YJ9Q 3SB2A 1W1FA 1WFWA 3VS1A 1I07A 3EG3A 4FSXA 2KMTA 2OTLT 1RAAB 5AYFA 4B6MA 5A0GA 5HY6A 4MDXA 3CC2T 1HXDA 1UGSB 2ROLA 4MDWA 1Y57A 2RA2A 2LCSA 3CCEQ 1UB4A 2DJQA 3OS1A 3PVQA 4MMKA 4HT8A 2FZGB 2HBPA 4BY6C 1BIAA 1M30A 1QVGP 2F1LA 2X4JA 2OAUA
chains in the Genus database with same CATH topology
2IVWA 1B34A 3JB9G 1Y7XA 1FXXA 1WJSA 4JRKA 1VQLA 3WXMB 1V29B 5CO7A 3GF5A 4J6XA 2JNGA 3CPFA 3JCMV 5GAN4 5GAOq 1M4ZA 4PLLA 4LDWA 1M1KC 3SWNB 2EFIA 2VYTA 3QDRB 2X4YA 3PNWC 4RCBA 1BI2A 5GAN2 1D3BB 4EMKC 2QA4T 2MF2A 5KE2A 1WJQA 4QQGA 4XTXA 4O6JA 1YITA 1XQHA 1IREB 4NL3A 5FU7C 4M7DA 2KY9A 4JDSA 5KH6A 3JCMX 1WGSA 3VUBA 2MAMA 1JJ2S 1DJ7B 4E7KA 2XICA 4N4IA 3QUIA 5FROA 1X01A 3OS5A 1Q81U 3MO8A 4C92D 3CMET 2E10A 1VQ5T 3M55A 2KVQG 5LJ5j 1NZ9A 5GAMg 4PNOA 3TCJA 2JTFA 1Y96A 3SD4A 5A0LA 2E6ZA 4M77D 3RESA 1VIFA 3M58A 1YIJT 4PJOE 1B34B 3C94A 3QO3A 4JLIA 4N0AA 1YJNT 1M1KU 2RB6A 2PU9B 3CCMA 4PL6A 2O4XA 3QIIA 4XTWA 3OYAA 2RI2A 4M78G 4XTYA 3RKYA 1G3YA 1UEBA 2VC8A 3EAEA 3V7CA 3RKWA 3X28B 3RKXA 5HKCA 3NTIA 4QVZA 3OYGA 1FX7A 4XU1A 2ZCFB 2M0OA 4E7JA 5GANj 5A0DA 5GAMj 1IZ6A 1JRIA 1M5Q1 4QQDA 5CVIA 2RI3A 4A54A 4A4EA 3A8MB 2HQXA 4ZGEB 1N9RA 5GMKl 3PIPA 3LWIA 4E7HA 3JCMh 4N4HA 2EYQA 4FU6A 2GFUA 5KE3A 3OYBA 3M54A 1M90C 4M7DB 2ZPEB 2DK3A 2HNIA 3RERA 4M7DF 3DKMA 2CZ1B 3JCMc 3JCMb 3GNFB 2OTJA 4OB2B 2PQWA 4EPCA 3JCMP 1VQPA 2PVGB 3CMAT 1VQ8A 1WPYA 4R55A 1PSEA 2QXFA 2EWNA 4C92G 3J81E 3OY9A 3DB4A 3G71A 1O9SA 3GP8A 3CC4T 1M90U 4JUVA 3CD6A 2GCXA 4PJOC 2JOYA 4RCCA 1BKBA 2DTHA 3VV0A 1YI2T 1Q82C 4OP0A 2E70A 4M77G 3S3OA 2O4XB 4EMHA 5GAN7 4L6V5 2V8IA 3LH0A 3VKIA 1VQOA 1YCYA 1AHJB 1G3SA 1N6AA 3HRTA 4IURA 3JCMf 3JB9F 2PUKB 3A8OB 3BDUA 2L8DA 1VQ4A 1MHNA 5CQXA 1YJWA 3C4SA 2CKKA 2X35A 4M78A 3HP9A 5D6YA 3M4YA 3L2VA 2QEXA 3CCQA 4E7IA 1VQ7T 5L8RE 1VQMA 1Y07A 3OMCA 2DZ9A 3FC3A 3E19A 2WSEE 5C6SA 2VUBA 3V8KA 1WNLA 4M7DD 4Q5WA 3UT1A 5LJ5h 5LJ3j 3CCRT 2VXFA 4JRPA 2LVMA 2DJZA 2K3XA 4UC4A 4FL6A 1Q82U 5GMKi 4IUQA 2P0QA 2DXUA 4M7AC 4XU0A 4C0GA 4L5GA 5J39A 4KULA 5GAN8 2V8KA 3VYHB 2R57A 3M9QA 2FL7A 2XKOC 2ZZDA 4LDXA 4J6WA 3PFSA 5GANh 4NOYA 4C92A 1X6OA 3VJPA 3E9GA 5GAMh 4BE0A 2DXTA 4J83A 3MP1A 1Q86C 3E9FA 3A8GB 1U8RA 1OI1A 4DQ2A 1S72A 2K3YA 3MP8A 4M77A 5GAOl 5KCOA 4ELYC 4PKCC 3H8ZA 4M78B 2ZPBB 4NL2A 3ZEHA 2DVEA 1XTDA 4M78F 1EIFA 3OYMA 2GQVA 2DEQA 4C5EA 1I81A 2MI6A 5LJ5f 2WACA 4IUPA 1QVGA 3CCLA 1VQNA 1VQ6T 3M57A 2EIFA 2LT1A 3CCVA 2EKOA 5D6WA 3G6ET 2YRVA 3SWNC 2EJ9A 2RM4A 4P5NA 5FU6C 1KQ1A 3TU4K 3CC2A 4M7DG 3FIFA 3LWHA 2JTMA 3OYHA 3KXTA 3CCUA 1UGPB 2DKGA 1LJOA 3E1SA 5D6XA 5GANf 1WJRA 1Q86U 1VQKA 4QVCA 4M7DE 4C0DB 1VIEA 4RKUE 3CCJA 2PVOB 3MCAB 3O8VA 5CKFA 5CQYA 2RHIA 3G4SA 1G5VA 4C92B 3RMSA 3T9NA 4C92F 5GAN5 4FT4A 1UGRB 2K2VA 2LX9A 4M77B 3M5AA 4C0ZA 3WVDB 4B9WA 2ZPIB 4M77F 5GMKj 2X4WA 1KQSA 3NTHA 4M78D 5CK9A 2R5MA 2RJDA 3BW1A 4X9CA 4BI4A 1Q7YC 1WQ7A 2DTIA 5LJ3h 4F7UG 1YHQT 3A8HB 5CAIA 2QQ9A 3CXCS 4MZTA 2FB7A 4M75B 2QTXA 5A2QE 4A4GA 3CEYA 2VV5A 2AHJB 3M56A 4IUTA 4XTVA 2XIDA 3LLRA 5CR2A 2XHCA 2JUFA 2D6FA 4JJNK 4OB0B 5CIUA 1ZBXA 3OW2A 3ZBDA 1VUBA 2R58A 4XTZA 3ZFJA 4RG2A 3FRNA 2KSSA 4DA4A 4KBMB 2WSCE 1KHIA 2P4TA 4C8QC 3QPHA 1OZ2A 4Z02A 1YITT 1Q7YU 1K9MC 1R8OB 3QZ5B 4IUVA 5LJ3f 2PVDB 2EQUA 3FJPA 3VUZA 5CKDA 1KG1A 4LDUA 3HFNA 1NPRA 3OYYA 4M75D 5IT9E 5GAOr 2LT4A 4M78E 1YIJA 1YBYA 4OGCA 4F7UA 4A4HA 4JLGA 4BY6B 3CCMT 1LOJA 5GAN3 4BDYA 2BIVA 3QYHB 2KQWA 5DLQE 2FHDA 3AHUA 1K9MU 1W4SA 4J7FA 2L5QA 1K73C 1QVGS 2FYKA 3JCMW 3JRZA 3OB9A 3DLLA 5IAYA 1H3ZA 2ZPFB 2RHUA 3QHSA 4ZN3A 5GMKh 3OYKA 3CC7A 3QJ6A 4ATOA 1RI0A 5C0MA 1W2BS 3OYJA 3HFOA 1M9SA 4C5IA 2RK2A 4DOWA 3M59A 4A4KA 4CI0C 5I2SA 5HK0A 4HCCA 2OTJT 1WQWA 2Y4YA 2VXEA 2LCLA 4C92E 1VQPT 2DIGA 4HA8A 4EMKB 2BUDA 1VQ8T 3L2RA 2HAXA 2GF7A 4HKEA 5CKBA 2K5IA 4PLIA 3LX7A 3G71T 4EMGA 2DXCA 2GFAA 3OSSC 3CD6T 4XU2A 3G7ZA 4M77E 3R6OA 3X26B 4M7AG 3INZA 2I2LA 2KDSA 1BIBA 4F7UB 1JBMA 3SFMA 4M75G 1K73U 3KBGA 4F7UF 1PSFA 2O01E 2YLBA 2CGHA 5M9OA 1VQOT 2R5AA 4BE2A 2IG0A 3CCSA 1VQ4T 2YLCA 4LDYA 2B8AA 2RHZA 1YJWT 4PJOA 2LCCA 1XOVA 4RG8A 4C0FA 2QEXT 3CCQT 1YJ9A 2L3RA 2VGNA 1VQMT 4LD9K 3OYIA 3HPWA 5CKHA 5GAOn 3EFSA 4XK8E 3I56A 1VQ9A 1U1SA 2RO0A 2ZGWA 1N27A 3PT9A 4A53A 2HD0A 4QVDA 2RH2A 1HK9A 1XNIA 4C92C 3OW2S 4OGEA 1QP3A 5KCHA 3DLMA 1JJ2A 4X34A 3QG1A 3JCMd 1G3WA 1SSFA 2Y4XA 4KT0E 4M77C 1M8VA 5EG2A 4KUDK 2QQSA 4XTUA 4R56A 3H6ZA 5CKEA 2M16A 3CCEA 3N5BB 4TVRA 3C12A 3ER0A 2OTLA 4M7AA 4C8QD 1S72T 4WF2A 3X24B 4M75A 3J7AF 2VGMA 3PMTA 5LJ3e 3ME9A 4PJOB 3V7RA 4BI8B 3L1AA 3GLXA 1NE8A 1VQNT 4ZN1A 3KUFA 3CCLT 2XD0A 3I55A 5IN1A 4N4GA 4QQ6A 5GAMf 3L2QA 2DO3A 3P8DA 2CS7A 5GMKm 4M7AF 3OA6A 2XDDA 3G6EA 2D0QB 2BKDN 5FRNA 3PTAA 3CCUT 3VU3C 3VYGA 5DLOA 2LC4A 2F5TX 1VQKT 2M9UA 3JCMg 3CCJT 1LNXA 4J5YA 4XAXB 1RL2A 3QKJA 1KC8C 3G4ST 4MMLA 3BY7A 5LJ5d 1NJIC 2QQRA 1U1TA 4JRQA 1O75A 3PGGA 4M7AB 3S3MA 5J26A 2FVUA 1H641 5GAN6 2K57A 3L2WA 1I5LA 2DXBA 3A8LB 2HQEA 2LQ8A 1MGQA 2RJFA 3V8JA 2RK1A 3EFRA 4M75F 2G3RA 4BI3A 1M1GA 1NPPA 4C8QG 3QBYA 3MP6A 4FT2A 4DOVA 4F7UE 4PJOD 2K5LA 2X4XA 1I4K1 4J6YA 4RMOA 3DB3A 1VQLT 1QVPA 2CZ0B 5GAOp 3CBMA 1N8RC 3LYIA 5GANd 4J7IA 5GAMd 4M7DC 3QXEB 4JRIA 3P8BB 4KUIA 2EJGA 2RI5A 3JCMe 3OYNA 4ZGDB 3ASKA 1Q81C 4BE1A 2YHTA 3SDZA 3RUXA 1KC8U 4A4FA 2H3JA 3RMQA 2QA4A 1NJIU 3GPLA 2JZ2A 3GOXA 2ZPGB 2NLUA 5LL6S 1QP2A 4XQ3A 5GMKe 1OYXA 3V7SA 3LGLA 4N0AC 5FU6B 2RHYA 3OS2A 1P92A 3L2UA 2K5FA 4EMKA 1KQ2A 4V2SA 5LJ5g 4EDUA 1JB0E 3CMEA 4M7AD 1N8RU 1VQ5A 2QDYB 2DD5A 3MEAA 3CBPA 3FEOA 4LD6A 1M1FA 3QJYA 1BI0A 3J80E 2CZ6B 4BB7A 1YJNA 4VUBA 2A7YA 2L89A 4PJOG 2A3LA 3L42A 2V8JA 4C8QA 3OBWA 5GAOm 3C95A 5GANg 3S3NA 4HT9A 1TH7A 3HHTB 2E1HA 2KK4A 3QZ9B 3L2ZA 4XU3A 2F5KA 3OSVA 4C5HA 4GLKA 3MEUA 2XK0A 3JCMQ 3UPUA 4BACA 4OB1B 5LJ5e 4IKFA 2RHXA 1QVFA 3HKSA 3FDRA 2RJEA 5LJ3d 1ZHIA 2EAYA 5I2MA 3V8LA 1FWZA 2C06A 5FLXE 3JSCA 1K8AC 2M1HA 3CC7T 1BI3A 1ZQ1A 3MHXA 3CPWA 2LTOA 3CMAA 4ZTJA 3HRUA 3META 5FU7B 1KD1C 5GANe 5GAMe 3CC4A 4ELZC 4M78C 3TREA 2XI9A 1YI2A 2QI2A 3LW5E 3F70A 4L59A 2EQJA 3MEVA 3NTKA 4HCZA 2QQBA 3OYCA 4M7AE 4C8QB 1KQSS 2JVVA 4MZPA 4MZMA 4C8QF 2P0PA 3PMIA 4M75E 2MMPA 3FB9A 5J3BA 1KHCA 1Y96B 3BDLA 3CXCA 2MWPA 2E65A 1BI1A 3M4GA 1VQ7A 1K8AU 4QW2A 4C0DC 3CCST 4E47A 3BFMA 5LJ3g 1KD1U 1BYMA 2KAFA 2Y90A 4CRIA 2RD1A 4ZGJB 4X9DA 3CCRA 1YJ9T 3TEEA 3PIOA 2E41A 4LDVA 3HSBA 2E5QA 3OYLA 1VQ9T 3I56T 2CZ7B 2EQKA 3LGFA 1G3TA 3JB9H 4C5GA 2EQMA 1OZ3A 1N9SA 2E6NA 4ZTFA 1Y71A 2DTOA 4FM4B 3SB2A 2RJCA 2DD4A 2DAQA 3GNGA 4FIBA 3JB9I 4M75C 3M53A 4Y28E 3CBOA 3GIBA 3Q1JA 3OBYA 4PJOF 4FSXA 3X25B 5DY9A 4IUUA 3QYGB 4BUGA 2LQKA 2KMTA 2P0KA 3CCET 3OS0A 2MWOA 5CCAA 2OTLT 5AYFA 2JN0A 5I21A 4OB3B 4OMFB 4GY5A 5HY6A 5A0GA 3CCVT 1VQ6A 4MDXA 3JB9D 4JS5A 5FRMA 3QSUA 3UDCA 1UGQB 3MEWA 3JCMJ 3CC2T 1HXDA 1UGSB 2CYZB 2LDMA 3NFCA 3A5ZB 4MDWA 3JB9J 2RA2A 3I55T 1UB4A 5HK3A 4NS5A 4YTLA 3OS1A 4D6WA 1X75C 2DPPB 3HRSA 3P8HA 3SWNA 2DZCA 4BDZA 1W2BA 4HCBA 1I8FA 2WSFE 4MMKA 4BD3A 4HT8A 1QVFS 1GXIE 1D3BA 2XDBA 4OVAA 3OYFA 5DM7R 2K4YA 2LRQA 2F69A 4ME7A 2HBPA 3HL8A 3X20B 3OYEA 3OQ5A 2ZPHB 4E7LA 2PUOB 3JAME 3CPWS 4Y91A 2D9TA 2QQAA 3UWNA 3URGA 4OF1A 2DIQA 4BY6C 4JS4A 1BIAA 2E64A 2XDPA 3RIRA 3S6WA 2XU8A 2XG8D 4J8OA 3FLGA 1QW1A 3OMGA 4B9XA 4C8QE 1YHQA 3OYDA 2E12A 2X4JA 4II1A 2LNVA 2OAUA 2EJFA 4O5VA 3WVEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1H A;  2DEQ A;  1B34 A;  1I81 A;  5LJ5 f;  3JB9 G;  5LJ3 e;  3L2Z A;  4XU3 A;  4JRK A;  2YLC A;  4PJO A;  3JCM Q;  4J6X A;  2EJ9 A;  2RM4 A;  3SWN C;  3JCM V;  1KQ1 A;  5LJ5 e;  5GAN 4;  5GAO q;  3FIF A;  4M7D G;  5LJ3 d;  3SWN B;  5GAO n;  3EFS A;  2EAY A;  2DKG A;  4RCB A;  1U1S A;  2ZGW A;  1LJO A;  1D3B B;  3V8L A;  4EMK C;  5GAN 2;  4A53 A;  4QVD A;  5GAN f;  4M7D E;  4QVC A;  4XTX A;  4NL3 A;  1HK9 A;  4M7D A;  4C92 C;  3JCM X;  4M78 B;  4C92 B;  5GAN e;  5GAM e;  3QUI A;  4C92 F;  1X01 A;  3JCM d;  5GAN 5;  4M78 C;  4M77 C;  4C92 D;  2DVE A;  2E10 A;  1M8V A;  4XTU A;  4M77 B;  5LJ5 j;  5GAM g;  4M7A E;  4M77 F;  4PNO A;  5GMK j;  4C8Q B;  4M78 D;  1Y96 A;  4PJO E;  4C8Q F;  4M77 D;  4M75 E;  3BW1 A;  3RES A;  4M7A A;  4X9C A;  3FB9 A;  1B34 B;  1WQ7 A;  3QO3 A;  1Y96 B;  2DTI A;  4JLI A;  4N0A A;  2RB6 A;  4WF2 A;  4M75 A;  5LJ3 h;  4XTW A;  4F7U G;  5CAI A;  4M78 G;  4XTY A;  3M4G A;  2E65 A;  2FB7 A;  2VC8 A;  2QTX A;  4M75 B;  3RKY A;  3RKW A;  3RKX A;  3V7C A;  3V7R A;  3L1A A;  4XU1 A;  5GAN j;  5GAM j;  1JRI A;  1M5Q 1;  3BFM A;  4A54 A;  4XTV A;  5GAM f;  5GMK l;  5LJ3 g;  1N9R A;  2Y90 A;  5GMK m;  2RD1 A;  3JCM h;  4X9D A;  3HSB A;  2E41 A;  4XTZ A;  4M7D B;  3VU3 C;  3RER A;  2HNI A;  3JB9 H;  4M7D F;  3JCM c;  3JCM b;  4C8Q C;  1N9S A;  3JCM g;  3JCM P;  1LNX A;  4J5Y A;  2DTO A;  1WPY A;  5LJ3 f;  2EWN A;  4MML A;  3SB2 A;  3BY7 A;  4C92 G;  5LJ5 d;  3JB9 I;  1U1T A;  4JUV A;  3FJP A;  3PGG A;  4PJO C;  4RCC A;  4M75 C;  2DTH A;  4M7A B;  1I5L A;  1H64 1;  5GAN 6;  2K57 A;  4M7A F;  3GIB A;  4OP0 A;  4M77 G;  1MGQ A;  4PJO F;  3V8J A;  3EFR A;  4M75 F;  3HFN A;  5DY9 A;  4C8Q G;  4EMH A;  5GAN 7;  4F7U E;  4PJO D;  4M75 D;  1YCY A;  5GAO r;  1I4K 1;  4J6Y A;  3JCM f;  2JN0 A;  4M78 E;  4F7U A;  5I21 A;  5GAO p;  3BDU A;  3JB9 F;  1LOJ A;  5GAN 3;  5GAN d;  3JB9 D;  4M78 A;  5GAM d;  3JCM J;  3QSU A;  4M7D C;  4JRI A;  1HXD A;  2EJG A;  3JCM e;  3AHU A;  3JB9 J;  2DZ9 A;  2RA2 A;  2YHT A;  3RUX A;  2FYK A;  1WNL A;  3V8K A;  3JCM W;  4M7D D;  5GAO m;  5LJ5 h;  3QHS A;  5LJ3 j;  2VXF A;  5GMK h;  2DJZ A;  3SWN A;  5GMK i;  1I8F A;  4MMK A;  4XQ3 A;  2DXU A;  5GMK e;  3HFO A;  1D3B A;  4XU0 A;  3V7S A;  4N0A C;  4HT8 A;  4M7A C;  5GAN 8;  4EMK A;  1KQ2 A;  4V2S A;  1WQW A;  2VXE A;  5LJ5 g;  4C92 E;  4M7A D;  4HA8 A;  4EMK B;  4HT9 A;  4J6W A;  4PJO B;  4Y91 A;  5GAN h;  4NOY A;  4C92 A;  5GAM h;  4EMG A;  2DXT A;  1BIA A;  2E64 A;  4XU2 A;  3RIR A;  4M77 E;  4M7A G;  3INZ A;  2I2L A;  4C8Q E;  4DQ2 A;  1BIB A;  4PJO G;  1JBM A;  4C8Q D;  4M75 G;  4M77 A;  4F7U B;  4F7U F;  5GAO l;  4C8Q A;  2YLB A;  4NL2 A;  2DZC A;  2CGH A;  2EJF A;  5GAN g;  4M78 F;  1TH7 A; 
#chains in the Genus database with same CATH topology
 2KEA A;  1YWP A;  1OUL A;  1WJS A;  1V29 B;  2EKH A;  2JNG A;  4JPB W;  2CP3 A;  1M1K C;  2YT6 A;  3SWN B;  3QDR B;  2X4Y A;  1D3B B;  2LJ3 A;  1WJQ A;  2L3Q A;  4O6J A;  1AZG B;  1DJ7 B;  3QUI A;  3OS5 A;  3M55 A;  2E3I A;  1KFZ A;  5LJ5 j;  1Y96 A;  3SD4 A;  4M77 D;  1VIF A;  2RQW A;  3QO3 A;  4JLI A;  2JTE A;  4Z89 A;  1M1K U;  2O4X A;  5FWB A;  2RI2 A;  3QWY A;  3V7C A;  5HKC A;  2NWM A;  1FX7 A;  2ZCF B;  4E7J A;  1AD5 A;  1M5Q 1;  2EYY A;  4A54 A;  4ZGE B;  3PIP A;  3LWI A;  3NPF A;  4N4H A;  2EYQ A;  1KD1 R;  2CP6 A;  2DK3 A;  2HNI A;  2CZ1 B;  3JCM b;  2OTJ A;  2X3X D;  4EIK A;  4R55 A;  4ZNX A;  1JQQ A;  1W70 A;  4PJO C;  3VV0 A;  4M77 G;  1LPL A;  1SHF A;  2V8I A;  2C0O A;  1YCY A;  4IUR A;  1UJY A;  3JB9 F;  3A8O B;  2L8D A;  5CQX A;  2X35 A;  2ZAE A;  4M78 A;  4HVW A;  1YI2 Q;  4AFQ C;  4E7I A;  5L8R E;  1VQM A;  5KYX B;  2DZ9 A;  3FC3 A;  1CKA A;  1UEC A;  1X6G A;  3V8K A;  2A36 A;  2VXF A;  1M2O A;  1ABO A;  5GMK i;  1ZBJ A;  1KIK A;  5J39 A;  2R57 A;  1VYV A;  3EG9 B;  1NM7 A;  3PFS A;  5GAN h;  5GAM h;  4BE0 A;  2EGE A;  4ESR A;  3VRY A;  1U8R A;  4DQ2 A;  1PM3 A;  2HQH A;  4NL2 A;  1XTD A;  2A0F B;  1WXT A;  1VQ6 T;  2YRV A;  4P5N A;  3CC2 A;  3LWH A;  2JTM A;  1UGP B;  2DKG A;  2J6K A;  1WJR A;  4Z88 A;  1D1A A;  1GFD A;  3RMS A;  2CRE A;  4C0Z A;  1Q81 R;  3WVD B;  4B9W A;  2ZPI B;  2X4W A;  1KQS A;  2KRO A;  4M78 D;  2RJD A;  2CT3 A;  1Q7Y C;  1WQ7 A;  1HYO A;  1QCF A;  2QQ9 A;  1M3C A;  2FB7 A;  4M75 B;  4IUT A;  2BE7 D;  2XID A;  1YHQ Q;  2VB6 A;  5CIU A;  1ZBX A;  1WI7 A;  4IIO A;  1Q7Y U;  1NLP C;  1OZ2 A;  1YIT T;  1K9M C;  1R8O B;  4IUV A;  2EQU A;  4D8K A;  1SSH A;  1KG1 A;  3EFO A;  1KSW A;  1QQJ A;  5GAO r;  2IIM A;  4OGC A;  4F7U A;  3CCM T;  3QYH B;  2FHD A;  3AHU A;  1K9M U;  2GBQ A;  2RQR A;  3JRZ A;  1H3Z A;  1RI9 A;  3QHS A;  1RI0 A;  5C0M A;  4DOW A;  3M59 A;  4A4K A;  4CI0 C;  5I2S A;  5HK0 A;  1Q82 R;  2B86 A;  4HA8 A;  4EMK B;  4HKE A;  5CKB A;  4PLI A;  3G71 T;  1IGU A;  3H0I A;  3CC4 Q;  4M7A G;  3INZ A;  2KDS A;  1TWB A;  2SEM A;  1E6G A;  1VQP Q;  2CGH A;  1VQ8 Q;  2JM8 A;  5M9O A;  1VQO T;  4BE2 A;  1OOT A;  3CD6 Q;  4J9C A;  1YJ9 A;  4KGV B;  3CPW P;  5CKH A;  5GAO n;  4LN2 A;  5D7U A;  2FEI A;  2RO0 A;  3PT9 A;  1N27 A;  1VQ4 Q;  1YJW Q;  2LJ0 A;  3CCR Q;  4OGE A;  2FO0 A;  1Q86 R;  2RF0 A;  1VYU A;  4X34 A;  4F04 B;  3JCM d;  4M77 C;  4J9D A;  1M8V A;  4QT7 A;  2DL3 A;  3H6Z A;  2DF6 A;  2COY A;  2M16 A;  3CCE A;  3N5B B;  4TVR A;  3ER0 A;  1AWW A;  1BCM A;  4BI8 B;  1NYF A;  1VQN T;  1SPK A;  3EGD B;  3L2Q A;  2ENM A;  3P8D A;  1S72 Q;  5KYW A;  2BKD N;  2DBM A;  3CCU T;  5KYY B;  3M0Q A;  5DLO A;  3EGU A;  2GTO A;  2LC4 A;  2F5T X;  1VQK T;  1MND A;  1RL2 A;  1X2K A;  5KYN A;  4MML A;  3BY7 A;  5LJ5 d;  1IO6 A;  4JRQ A;  1O75 A;  5J26 A;  3A8L B;  2CH4 W;  2RK1 A;  3CCJ Q;  1M1G A;  1NPP A;  4DOV A;  1ZUU A;  2EPD A;  3DB3 A;  2CZ0 B;  2JMA A;  4HVU A;  4DBQ A;  2FZC B;  4JRI A;  2MOX A;  3JCM e;  4KH0 B;  2K79 A;  2YHT A;  3SDZ A;  4AG2 C;  3RMQ A;  1NLO C;  1K4U S;  2JZ2 A;  2NLU A;  2W10 A;  1W6X A;  3LGL A;  5FU6 B;  2EVR A;  3OS2 A;  5ECA A;  2J06 A;  1SHG A;  1TSF A;  2QDY B;  2DD5 A;  2KYB A;  1M1F A;  1BI0 A;  2CZ6 B;  2DRM A;  3L42 A;  4C8Q A;  3EGX A;  5GAN g;  1TH7 A;  1RAG B;  1GFC A;  4XU3 A;  4LNP A;  4C5H A;  1AWX A;  4GLK A;  1BCO A;  3MEU A;  4IKF A;  5LJ5 e;  2RHX A;  1OX8 A;  2EAY A;  5I2M A;  3V8L A;  4F14 A;  5FLX E;  3MHX A;  1MMG A;  1KD1 C;  2FZK B;  4M78 C;  1YI2 A;  3MEV A;  3CC7 Q;  4HCZ A;  4MZM A;  2MMP A;  3PE0 A;  1Y96 B;  1EZZ B;  1T3S A;  2D0N A;  2E65 A;  1SF9 A;  2DMO A;  2KBT A;  2NUT A;  1QKW A;  3I9Q A;  1KD1 U;  8ATC B;  4CC4 B;  4JJB A;  2RD1 A;  4X9D A;  2DE0 X;  2DIL A;  1VQM Q;  3VS4 A;  1MNE A;  4M4Z A;  3R6N A;  2E6N A;  3UF4 A;  2DD4 A;  1VQ9 Q;  3I56 Q;  3M53 A;  1ZUK A;  1Z9Z A;  5DY9 A;  2LQK A;  2P0K A;  2ROT A;  2JN0 A;  4OB3 B;  4GY5 A;  3JB9 D;  4JS5 A;  5FRM A;  3JCM J;  2CYZ B;  3NFC A;  3A5Z B;  3JB9 J;  2OTL Q;  5HK3 A;  4YTL A;  5KYU A;  3MPU B;  1X75 C;  1TXQ A;  2DPP B;  3P8H A;  4HCB A;  3CC2 Q;  1W2B A;  4BD3 A;  1IXD A;  1NJI R;  3OYF A;  2LRQ A;  3HL8 A;  2BTT A;  3OYE A;  1YWO A;  2EGA A;  4E7L A;  4Y91 A;  2D9T A;  1IRX A;  3RIR A;  3S6W A;  2XU8 A;  1JEG A;  3FLG A;  1YHQ A;  3OMG A;  1KJW A;  2K3B A;  2EJF A;  3WVE B;  1W2B P;  1RAH B;  1B34 A;  3JB9 G;  1K1Z A;  1FXX A;  1MMN A;  1V1C A;  4KRT A;  4J9B A;  4RTZ A;  5CO7 A;  2NYS A;  1UTI A;  5GAN 4;  1E7O A;  4RTV A;  2HEQ A;  2EFI A;  2MF2 A;  5KE2 A;  1XQH A;  4NL3 A;  2AKL A;  2KRM A;  1WGS A;  3VUB A;  2XIC A;  1D1B A;  1QLY A;  1Q81 U;  3FJ5 A;  1VQ5 T;  4Y92 A;  3VS5 A;  2JTF A;  1RAD B;  2DVJ A;  2CSQ A;  5HCK A;  3RES A;  5A0L A;  3M58 A;  1YIJ T;  3C94 A;  4N0A A;  2ED1 A;  3JV3 A;  2PU9 B;  2YWW A;  3OYA A;  1QKX A;  1X69 A;  3RKY A;  1UEB A;  2VC8 A;  2MCN A;  4FYW B;  4PFZ A;  3OW2 P;  4XU1 A;  2M0O A;  5A0D A;  1IZ6 A;  2RI3 A;  4A4E A;  1C0M A;  1N9R A;  4FU6 A;  2GFU A;  3OYB A;  3M54 A;  5IHN A;  3EH1 A;  4M7D B;  4M7D F;  3GNF B;  5IXB A;  4EPC A;  1MMA A;  1VQP A;  3CMA T;  1VQ8 A;  1WPY A;  1PSE A;  2QXF A;  3DB4 A;  4RTU A;  3GP8 A;  3CD6 A;  2JOY A;  1Q82 C;  1GCP A;  3S3O A;  2DRK A;  4L6V 5;  3VKI A;  1AHJ B;  1G3S A;  3BDU A;  2DL4 A;  2NUP A;  1R0C B;  1VQ4 A;  1YJW A;  3C4S A;  2FRW A;  1PHT A;  1GRI A;  1Y07 A;  4LE9 A;  1AT1 B;  5C6S A;  2VUB A;  1WZO A;  4UC4 A;  1Q82 U;  2LP5 A;  4KUL A;  1M8M A;  1SKU B;  5GAN 8;  3VYH B;  4LDX A;  4J6W A;  3LH5 A;  3C0C A;  3VJP A;  1RAE B;  1Q86 C;  3A8G B;  2AKK A;  1S72 A;  2K3Y A;  3MP8 A;  4M77 A;  3H8Z A;  1ZSZ A;  1HJD A;  2MK5 A;  1EIF A;  1QVG A;  3M0P A;  3M57 A;  2LT1 A;  2QGG A;  3G6E T;  3EH2 A;  3SWN C;  2RM4 A;  3TU4 K;  1KQ1 A;  3OYH A;  4DBR A;  5GAN f;  1VQ6 Q;  1Q86 U;  4M7D E;  4C0D B;  3CCJ A;  5CKF A;  1G5V A;  2K6D A;  4C92 B;  4C92 F;  2DA9 A;  4FT4 A;  2KE9 A;  2YRD A;  4GBQ A;  2LX9 A;  4HVV A;  3M5A A;  4A63 B;  2R5M A;  3BW1 A;  1K0X A;  4X9C A;  2J6F A;  2DTI A;  3EHQ A;  5LJ3 h;  3A8H B;  3CXC S;  2SRC A;  4A4G A;  2G6F X;  2VV5 A;  1PRL C;  5I11 A;  3M56 A;  4XTV A;  3LLR A;  5CR2 A;  2XHC A;  2DL7 A;  4OB0 B;  1BBZ A;  2R58 A;  2QK0 A;  1VA7 A;  2HSP A;  4KBM B;  2WSC E;  2P4T A;  4C8Q C;  2HL5 C;  4Z02 A;  3QZ5 B;  2PVD B;  2AIR B;  3FJP A;  3VUZ A;  5CKD A;  2K2M A;  1M90 R;  2PZ1 A;  2VKN A;  1YIT Q;  3OYY A;  5IT9 E;  1YIJ A;  2HMA A;  4JLG A;  4BY6 B;  3QWX X;  1LOJ A;  2BIV A;  2RN8 A;  3RR6 A;  3EHR A;  2VVK A;  3HTR A;  1QVG S;  2FYK A;  3OB9 A;  2ZPF B;  1D1C A;  3CCM Q;  2BE9 B;  5GMK h;  3CC7 A;  2DEU A;  2YSQ A;  3OYJ A;  1M9S A;  3H9N A;  4C5I A;  2RK2 A;  2LCL A;  4C92 E;  2DIG A;  2K5I A;  3LX7 A;  2DXC A;  2GFA A;  3OSS C;  2BZX A;  3X26 B;  3R6O A;  3MKD A;  3SFM A;  1CSK A;  3KBG A;  1PSF A;  1WLP B;  1QVF P;  3EGX B;  1RLP C;  2IG0 A;  2YLC A;  2RHZ A;  4RG8 A;  2QEX T;  3CCQ T;  2L3R A;  3M0R A;  4ORZ A;  3RNJ A;  3EFS A;  4XK8 E;  3I56 A;  1VQ9 A;  1FMK A;  1VQO Q;  3ULR B;  4QVD A;  2RH2 A;  1HK9 A;  2K7A A;  2O31 A;  1JJ2 A;  1HSQ A;  2KT8 A;  1SSF A;  2Y4X A;  4KT0 E;  4R56 A;  5CKE A;  4WTO B;  3C12 A;  4M7A A;  2OTL A;  4E7S A;  2DYI A;  3J7A F;  4PJO B;  3ME9 A;  2RQV A;  1CKB A;  2O9V A;  3L1A A;  1NE8 A;  3CCL T;  1JJ2 P;  3I5S A;  2XD0 A;  1IGQ A;  5IN1 A;  2DO3 A;  3OA6 A;  2XDD A;  3G6E A;  2D0Q B;  2CH4 A;  3RDV A;  1GBR A;  3VU3 C;  1VQN Q;  2QDL A;  1M3B A;  1OV3 A;  3QKJ A;  3G4S T;  1TS9 A;  2RNA A;  3CCU Q;  1BU1 A;  1NJI C;  2COW A;  3PGG A;  3L2W A;  1I5L A;  2DXB A;  2DL8 A;  1VQK Q;  2RJF A;  4KH1 B;  3V8J A;  3EFR A;  4M75 F;  4BI3 A;  3QBY A;  4FT2 A;  3U23 A;  3E2U A;  4RMO A;  1VQL T;  4DEX A;  1QVP A;  2FRY A;  2YUO A;  3LYI A;  2QAZ A;  5IHK A;  3QXE B;  3P8B B;  2EJG A;  2HZY A;  3ASK A;  4BE1 A;  2LZ6 B;  3RUX A;  2M02 A;  2H3J A;  1NJI U;  1YFN A;  1A0N B;  1UE9 A;  1D0Z A;  4XQ3 A;  2LJ1 A;  4N0A C;  1X43 A;  2K5F A;  1KQ2 A;  4V2S A;  2KRS A;  2CDT A;  4AG1 C;  4EDU A;  4M7A D;  9ATC B;  3CBP A;  3IQL A;  3THK A;  2LX7 A;  3QJY A;  3J80 E;  2A7Y A;  2L89 A;  4CC3 A;  1B3Q A;  3S3N A;  4AFU C;  1K73 R;  2KK4 A;  3TVT A;  5L23 A;  1MUZ A;  4FW2 A;  5I22 A;  1TUD A;  3HKS A;  3FDR A;  2RJE A;  2LQW A;  1ZHI A;  2C06 A;  3JSC A;  1NYG A;  1M2V A;  1ZQ1 A;  3CPW A;  2P4R A;  3TSW A;  5FU7 B;  2QAS A;  2KXD A;  3OYC A;  2QQB A;  1KQS S;  2MPX C;  1UHF A;  2P0P A;  4M75 E;  5J3B A;  1KHC A;  5GJV B;  4QKU A;  3D7S B;  2K9G A;  1U3O A;  1JXM A;  4PFP A;  3CCS T;  4E47 A;  5LJ3 g;  2KAF A;  1TG0 A;  2V1Q A;  4LDV A;  3I5R A;  1UFF A;  2EQK A;  4PJJ A;  2EQM A;  1OZ3 A;  1ZSZ C;  1AEY A;  2DTO A;  4FM4 B;  2L2P A;  4LUD A;  3CBO A;  3GIB A;  1VYT A;  1WX6 A;  4BUG A;  1OQK A;  1ACM B;  2MWO A;  5CCA A;  3VS6 A;  1TTH B;  5I21 A;  3EG0 A;  4OMF B;  1VQ6 A;  3CCV T;  1I1J A;  3QSU A;  2QYZ A;  3CQT A;  3MEW A;  2LDM A;  4FYV B;  4J9E A;  3I55 T;  1GCQ C;  2HCK A;  2DER A;  1J3T A;  4D6W A;  3HRS A;  1KC8 R;  1IHV A;  5AT1 B;  3SWN A;  1GXI E;  1H8K A;  4LUE A;  1D3B A;  2XDB A;  4OVA A;  5DM7 R;  2K4Y A;  2W0Z A;  3M0T A;  2LNH B;  3OQ5 A;  1PWT A;  2PUO B;  3JAM E;  3CPW S;  2QQA A;  3URG A;  4JS4 A;  2DIQ A;  4KGX B;  2CUB A;  2XG8 D;  4J8O A;  1QCO A;  2A08 A;  2KR3 A;  3OYD A;  2E12 A;  3M0S A;  2LNV A;  4J9H A;  1E6H A;  2IVW A;  2F2V A;  1Y7X A;  3I35 A;  1VQL A;  1TUC A;  2E4H A;  3GF5 A;  2COZ A;  4J6X A;  1UUE A;  3CPF A;  5GAO q;  1M4Z A;  4R0K A;  1SG5 A;  2VYT A;  3PNW C;  4RCB A;  5GAN 2;  2QA4 T;  4F17 A;  2PTK A;  2GGR A;  4QQG A;  4XTX A;  1YIT A;  1PNJ A;  2KY9 A;  4JDS A;  3JCM X;  1WHG A;  4N4I A;  1RAF B;  1SEM A;  4C92 D;  3VS3 A;  3CME T;  2E10 A;  2DET A;  2EYX A;  1NZ9 A;  5GAM g;  3VS7 A;  2HKN A;  2L3P A;  4RTT A;  3TCJ A;  4FSS A;  2E6Z A;  1ZSG A;  1YJN T;  3CCM A;  4XTW A;  3QII A;  4XTY A;  1M90 C;  1G3Y A;  3EAE A;  3X28 B;  1VQ5 Q;  1OU9 A;  3RKX A;  3NTI A;  1RAC B;  4QVZ A;  1WDX A;  3OYG A;  5GAN j;  5GAM j;  1YIJ Q;  5CVI A;  2D1X A;  5GMK l;  2LMJ A;  1RUW A;  2HQX A;  4E7H A;  2KI7 A;  3JCM h;  3DKM A;  1ZUY A;  1LVK A;  2GQI A;  4OB2 B;  3JCM P;  2PVG B;  1AWJ A;  1MV0 B;  4PK4 A;  5IXF A;  3J81 E;  4C92 G;  4DEY A;  3G71 A;  1M90 U;  1O9S A;  3CC4 T;  4JUV A;  1IHW A;  2JMC A;  3EG9 A;  4RCC A;  1BKB A;  2DTH A;  4HCK A;  4OP0 A;  2O4X B;  4EMH A;  2JM9 A;  3LH0 A;  1VQO A;  4RTW A;  3KFV A;  1MHN A;  5D6Y A;  2CKK A;  3L2V A;  1VQ7 T;  2M0Y A;  1EFN A;  1R0B G;  1C6V X;  1WNL A;  4Q5W A;  3UT1 A;  2AZS A;  5LJ5 h;  3CCR T;  2LVM A;  4IUQ A;  4M7A C;  2DXU A;  2KT1 A;  4XU0 A;  4L5G A;  1OEB A;  2V8K A;  2EYW A;  3M9Q A;  2XKO C;  2ZZD A;  1SRM A;  4NOY A;  1X6O A;  4J83 A;  3E9F A;  5GAO l;  4ELY C;  2CP5 A;  4M78 B;  3ZEH A;  2DVE A;  4M78 F;  3OYM A;  2GQV A;  2DEQ A;  4C5E A;  1I81 A;  2MI6 A;  1VQN A;  4IUP A;  1AVZ C;  3RBB B;  2EIF A;  3H0F A;  3CCV A;  2EKO A;  5D6W A;  1D09 B;  3G1J A;  3KXT A;  3CCU A;  5D6X A;  1UGV A;  1RAB B;  1VQK A;  1WA7 A;  4RKU E;  3G6E Q;  2RHI A;  2L0A A;  1F1B B;  3T9N A;  2EQI A;  3NTH A;  4BI4 A;  1PKT A;  1G2B A;  4MZT A;  1G83 A;  2RPN A;  4OMN A;  4PJN A;  2D6F A;  4K11 A;  4JJN K;  3OW2 A;  3ZBD A;  1VUB A;  4XTZ A;  3ZFJ A;  3FRN A;  4DA4 A;  1KHI A;  4F16 A;  1U06 A;  2BZ8 A;  5LJ3 f;  2JT4 A;  3PVL A;  2JW4 A;  1NPR A;  4M75 D;  2ESW A;  4M78 E;  1YBY A;  1X27 A;  2FPF A;  4BDY A;  5GAN 3;  3M0U A;  1FYN A;  4J7F A;  2L5Q A;  1K73 C;  3JCM W;  2RHU A;  4ATO A;  1W2B S;  3VS2 A;  3HFO A;  2C0T A;  1S1N A;  2OTJ T;  1WQW A;  1MV3 A;  3UA7 A;  2HAX A;  2BUD A;  3L2R A;  2GF7 A;  2OJ2 A;  1HD3 A;  1QWE A;  3EFO B;  4XU2 A;  4JZ3 A;  4J9F A;  4F7U B;  1JBM A;  2YDL A;  4M75 G;  1K73 U;  2YUN A;  4F7U F;  2CP2 A;  2O01 E;  1T3L A;  3VS0 A;  2B8A A;  2LCC A;  1XOV A;  2VGN A;  2DX1 A;  4E7Z A;  1VQM T;  3HPW A;  2ZGW A;  2LQN A;  4A53 A;  2HD0 A;  3QDF A;  4DBF A;  5KYY A;  2QEX Q;  4C92 C;  3CCQ Q;  3OW2 S;  5KCH A;  2VAS A;  1G3W A;  5EG2 A;  4KUD K;  3REB B;  8AT1 B;  1ABQ A;  3UA6 A;  3X24 B;  2VGM A;  2ATC B;  5LJ3 e;  1JU5 C;  2ABL A;  2V26 A;  3V7R A;  2EYZ A;  3KUF A;  4QQ6 A;  5GAM f;  5GMK m;  1UG1 A;  4ANJ A;  3CCL Q;  2DL5 A;  1GCQ A;  2M9U A;  3JCM g;  2MIO A;  1LNX A;  4J5Y A;  1KC8 C;  2OAW A;  2QQR A;  1U1T A;  1UHC A;  5GAN 6;  2K57 A;  1MGQ A;  2G3R A;  4F7U E;  3MP6 A;  2F2X A;  2K5L A;  3G4S Q;  1GL5 A;  1N8R C;  5GAN d;  5GAM d;  4KUI A;  2RI5 A;  2DNU A;  4WCI A;  5KYW B;  3OYN A;  4PJL A;  4ZGD B;  2HKQ B;  1KC8 U;  1UDL A;  1VQL Q;  1WHK A;  1FMW A;  2OX7 A;  3GOX A;  1OPK A;  5GMK e;  2FPD A;  5LJ5 g;  4J9G A;  5IH2 A;  1N8R U;  1VQ5 A;  1PD0 A;  4VUB A;  2E5K A;  2JS2 A;  4D8D A;  4GLM A;  3OBW A;  5GAO m;  1PD1 A;  3AT1 B;  2RQT A;  2KNB B;  2F5K A;  3OSV A;  3JCM Q;  4BAC A;  1QVF A;  2M51 A;  1M3A A;  3TQ7 P;  1FWZ A;  1K0S A;  1PRM C;  2JS0 A;  2EBP A;  2RMO A;  2AK5 A;  2M1H A;  1BI3 A;  2AT1 B;  1PKS A;  3CMA A;  4ZTJ A;  3HRU A;  5GAN e;  5GAM e;  4ELZ C;  4IIM A;  3TRE A;  2XI9 A;  4J9I A;  2QI2 A;  3LW5 E;  4L59 A;  4OMO A;  2EQJ A;  2Z0W A;  4C8Q B;  4MZP A;  2JVV A;  4C8Q F;  2RQU A;  3G71 Q;  3PMI A;  2ED0 A;  1R77 A;  3FB9 A;  3BDL A;  1WHJ A;  2MWP A;  3M4G A;  3BE3 A;  4QW2 A;  2DM1 A;  2E3H A;  3BFM A;  1BYM A;  1OPL A;  4LXC A;  3PIO A;  2E41 A;  1YJ9 T;  3HSB A;  2E5Q A;  4HXJ A;  3OYL A;  2CZ7 B;  1NEG A;  3CCS Q;  2KGT A;  1N9S A;  7AT1 B;  1Y71 A;  2X9H A;  2RJC A;  4FIB A;  2DAQ A;  3GNG A;  3JB9 I;  2O2O A;  4M75 C;  4Y28 E;  2DFU A;  3Q1J A;  3OBY A;  4PJO F;  3X25 B;  4IUU A;  3QYG B;  3CCE T;  3OS0 A;  1FMV A;  2X51 A;  4CC2 A;  2NUT B;  1ZA1 B;  2YXY A;  2MYS A;  3UDC A;  1UGQ B;  2DYB A;  2NUZ A;  4DBH A;  1BK2 A;  4NS5 A;  1JO8 A;  1TUG B;  3CCV Q;  1QVF S;  1X2Q A;  1I8F A;  2WSF E;  1I0C A;  3I55 Q;  2F69 A;  4ME7 A;  2KXC A;  3X20 B;  2ZPH B;  2J05 A;  3UWN A;  4OF1 A;  1IB8 A;  2XDP A;  2E64 A;  5FWC A;  1EX4 A;  4B9X A;  4C8Q E;  1QW1 A;  4II1 A;  2A37 A;  1Z9Q A;  2DZC A;  4BDZ A;  4O5V A;  3REA B;  4JRK A;  3WXM B;  1T0H A;  5KYU B;  3JCM V;  4PLL A;  4LDW A;  1B7T A;  1BI2 A;  4EMK C;  1IRE B;  5FU7 C;  3NGP A;  4M7D A;  2JXB A;  5KH6 A;  1WXB A;  1H3H A;  1KQS P;  1SRL A;  1U5S A;  2MAM A;  4E7K A;  1JJ2 S;  4E2F B;  1TOV A;  5FRO A;  1X01 A;  1VOM A;  1NBE B;  3MO8 A;  2QA4 Q;  3SEM A;  4X1V A;  2KVQ G;  1NG2 A;  4PNO A;  4PJO E;  1B34 B;  2RB6 A;  4PL6 A;  4M78 G;  3CME Q;  2CP0 A;  3RKW A;  2I0N A;  1JRI A;  4QQD A;  1K8A R;  3A8M B;  1YJN Q;  5KE3 A;  1UJ0 A;  2QG9 B;  2O88 A;  2ZPE B;  3RER A;  3JCM c;  2PQW A;  4JJD A;  2VWF A;  2EWN A;  2GCX A;  2DLP A;  1YI2 T;  1WHL A;  1ARK A;  2E70 A;  3A1P A;  5GAN 7;  3H0H A;  4RTX A;  1N6A A;  3HRT A;  3JCM f;  2PUK B;  3HP9 A;  4AFZ C;  3M4Y A;  2QEX A;  3CCQ A;  1AWO A;  1WHH A;  3OMC A;  2D8H A;  3E19 A;  4Z8A A;  2WSE E;  2XMF A;  4M7D D;  2KYM A;  6AT1 B;  4RUG A;  1OX9 A;  2GTJ A;  2CP7 A;  1X6B A;  5LJ3 j;  4JRP A;  2DJZ A;  2K3X A;  4FL6 A;  1VQ7 Q;  2P0Q A;  4C0G A;  2FL7 A;  2FPE A;  2EGC A;  4PFO A;  3ZL7 C;  4KGZ B;  4C92 A;  3E9G A;  2DXT A;  1BB9 A;  3MP1 A;  1OI1 A;  1OU8 A;  4OMM A;  3EG1 A;  2NUP B;  5KCO A;  2CUD A;  4PKC C;  4AMC A;  2ZPB B;  4OML A;  5LJ5 f;  3CCL A;  2WAC A;  4RTY A;  3NHN A;  2EJ9 A;  5FU6 C;  4FCY A;  4M7D G;  3FIF A;  1LJO A;  3E1S A;  4FW1 A;  4PJM A;  4QVC A;  1VIE A;  2PVO B;  3MCA B;  2D8J A;  3O8V A;  5CQY A;  3G4S A;  1N8R R;  3H41 A;  1WXU A;  2EW3 A;  5GAN 5;  3NMZ C;  1UGR B;  2K2V A;  3MJX A;  4M77 B;  4M77 F;  5GMK j;  1ZSZ B;  5CK9 A;  1PC0 A;  4F7U G;  2H3E B;  1YHQ T;  5CAI A;  2QTX A;  5A2Q E;  1M1K R;  1QMC A;  3CEY A;  1K76 A;  2AHJ B;  2KRN A;  1K9A A;  1QCN A;  1Q95 G;  2JUF A;  2J6O A;  1LCK A;  4RG2 A;  2KSS A;  3QPH A;  4FYX B;  3SHW A;  4LDU A;  3HFN A;  1AZE A;  2HL3 A;  2LT4 A;  4A4H A;  1G8X A;  1ZX6 A;  5KYX A;  2KQW A;  5DLQ E;  1W4S A;  1WIE A;  3DLL A;  5IAY A;  4ZN3 A;  3OYK A;  2HSE B;  3QJ6 A;  1YCS B;  2PNI A;  3EG2 A;  1NEB A;  4HCC A;  2Y4Y A;  2VXE A;  1ZA2 B;  1WYX A;  1VQP T;  1VQ8 T;  3CMA Q;  4EMG A;  3CD6 T;  1TU0 B;  3G7Z A;  4M77 E;  1PCX A;  2I2L A;  1B07 A;  1BIB A;  2OTJ Q;  2YLB A;  4FYY B;  2R5A A;  1RLQ C;  3CCS A;  1VQ4 T;  4LDY A;  1YJW T;  3GBQ A;  4PJO A;  4AT1 B;  4C0F A;  4LD9 K;  3OYI A;  1C1A A;  3A98 A;  2GNC A;  1U1S A;  1D0Y A;  1H92 A;  1XNI A;  2P84 A;  1QP3 A;  3DLM A;  1M27 C;  3QG1 A;  2QQS A;  4AFS C;  4XTU A;  2YUQ A;  3TSZ A;  2H8H A;  4C8Q D;  2CSI A;  1S72 T;  4WF2 A;  4M75 A;  2L3S A;  3PMT A;  2ECZ A;  2O9S A;  1MMD A;  3GLX A;  4ZN1 A;  3I55 A;  2QGF B;  4N4G A;  2BZY A;  2CS7 A;  2CT4 A;  5FRN A;  3PTA A;  1JXO A;  3VYG A;  1V76 A;  3CCJ T;  2HBW A;  1ZLM A;  2YRC A;  2DBK A;  4XAX B;  1Q7Y R;  2QTV A;  4M7A B;  3S3M A;  2FVU A;  1H64 1;  4M7A F;  2HQE A;  1AOJ A;  2LQ8 A;  1QWF A;  3O5Z A;  1PG5 B;  3OY9 A;  4C8Q G;  4CC7 A;  4PJO D;  2X4X A;  1I4K 1;  4J6Y A;  5GAO p;  3CBM A;  4OMP A;  1KK7 A;  4J7I A;  2JJ9 A;  4M7D C;  2HDA A;  1Q81 C;  2X3W D;  4A4F A;  2QA4 A;  1K9M R;  2F2W A;  3GPL A;  1YNZ A;  2ZPG B;  5LL6 S;  1D0X A;  1QP2 A;  1OYX A;  3V7S A;  2RHY A;  1P92 A;  4JZ4 A;  3L2U A;  4EMK A;  3CME A;  1JB0 E;  3MEA A;  3FEO A;  4LD6 A;  2A28 A;  5IHI A;  4BB7 A;  1YJN A;  3UAT A;  4PJO G;  1Y0M A;  2A3L A;  2V8J A;  1RAI B;  4HT9 A;  3C95 A;  3HHT B;  2AZV A;  2E1H A;  1XJW B;  3QZ9 B;  3L2Z A;  2XK0 A;  3UPU A;  4OB1 B;  5LJ3 d;  1N5Z A;  2C0I A;  1K8A C;  3CC7 T;  2LTO A;  4JJC A;  2FG0 A;  1YP5 A;  2IPO B;  3MET A;  4E6R A;  3CC4 A;  2YUP A;  2J7I A;  5GJW B;  4OMQ A;  3F70 A;  1YN8 A;  3NTK A;  4M7A E;  1WHM A;  3VRZ A;  2V1R A;  1GBQ A;  3CXC A;  1BI1 A;  1VQ7 A;  2OI3 A;  1K8A U;  3EGD A;  1T0J A;  4C0D C;  2Y90 A;  4CRI A;  4ZGJ B;  3CCR A;  3TEE A;  1M2V B;  1I5O B;  1VQ9 T;  3I56 T;  3LGF A;  1G3T A;  3JB9 H;  4C5G A;  5FW9 A;  5EC7 A;  3CXC P;  4ZTF A;  1YJ9 Q;  3SB2 A;  1W1F A;  1WFW A;  3VS1 A;  1I07 A;  3EG3 A;  4FSX A;  2KMT A;  2OTL T;  1RAA B;  5AYF A;  4B6M A;  5A0G A;  5HY6 A;  4MDX A;  3CC2 T;  1HXD A;  1UGS B;  2ROL A;  4MDW A;  1Y57 A;  2RA2 A;  2LCS A;  3CCE Q;  1UB4 A;  2DJQ A;  3OS1 A;  3PVQ A;  4MMK A;  4HT8 A;  2FZG B;  2HBP A;  4BY6 C;  1BIA A;  1M30 A;  1QVG P;  2F1L A;  2X4J A;  2OAU A; 
#chains in the Genus database with same CATH homology
 2IVW A;  1B34 A;  3JB9 G;  1Y7X A;  1FXX A;  1WJS A;  4JRK A;  1VQL A;  3WXM B;  1V29 B;  5CO7 A;  3GF5 A;  4J6X A;  2JNG A;  3CPF A;  3JCM V;  5GAN 4;  5GAO q;  1M4Z A;  4PLL A;  4LDW A;  1M1K C;  3SWN B;  2EFI A;  2VYT A;  3QDR B;  2X4Y A;  3PNW C;  4RCB A;  1BI2 A;  5GAN 2;  1D3B B;  4EMK C;  2QA4 T;  2MF2 A;  5KE2 A;  1WJQ A;  4QQG A;  4XTX A;  4O6J A;  1YIT A;  1XQH A;  1IRE B;  4NL3 A;  5FU7 C;  4M7D A;  2KY9 A;  4JDS A;  5KH6 A;  3JCM X;  1WGS A;  3VUB A;  2MAM A;  1JJ2 S;  1DJ7 B;  4E7K A;  2XIC A;  4N4I A;  3QUI A;  5FRO A;  1X01 A;  3OS5 A;  1Q81 U;  3MO8 A;  4C92 D;  3CME T;  2E10 A;  1VQ5 T;  3M55 A;  2KVQ G;  5LJ5 j;  1NZ9 A;  5GAM g;  4PNO A;  3TCJ A;  2JTF A;  1Y96 A;  3SD4 A;  5A0L A;  2E6Z A;  4M77 D;  3RES A;  1VIF A;  3M58 A;  1YIJ T;  4PJO E;  1B34 B;  3C94 A;  3QO3 A;  4JLI A;  4N0A A;  1YJN T;  1M1K U;  2RB6 A;  2PU9 B;  3CCM A;  4PL6 A;  2O4X A;  3QII A;  4XTW A;  3OYA A;  2RI2 A;  4M78 G;  4XTY A;  3RKY A;  1G3Y A;  1UEB A;  2VC8 A;  3EAE A;  3V7C A;  3RKW A;  3X28 B;  3RKX A;  5HKC A;  3NTI A;  4QVZ A;  3OYG A;  1FX7 A;  4XU1 A;  2ZCF B;  2M0O A;  4E7J A;  5GAN j;  5A0D A;  5GAM j;  1IZ6 A;  1JRI A;  1M5Q 1;  4QQD A;  5CVI A;  2RI3 A;  4A54 A;  4A4E A;  3A8M B;  2HQX A;  4ZGE B;  1N9R A;  5GMK l;  3PIP A;  3LWI A;  4E7H A;  3JCM h;  4N4H A;  2EYQ A;  4FU6 A;  2GFU A;  5KE3 A;  3OYB A;  3M54 A;  1M90 C;  4M7D B;  2ZPE B;  2DK3 A;  2HNI A;  3RER A;  4M7D F;  3DKM A;  2CZ1 B;  3JCM c;  3JCM b;  3GNF B;  2OTJ A;  4OB2 B;  2PQW A;  4EPC A;  3JCM P;  1VQP A;  2PVG B;  3CMA T;  1VQ8 A;  1WPY A;  4R55 A;  1PSE A;  2QXF A;  2EWN A;  4C92 G;  3J81 E;  3OY9 A;  3DB4 A;  3G71 A;  1O9S A;  3GP8 A;  3CC4 T;  1M90 U;  4JUV A;  3CD6 A;  2GCX A;  4PJO C;  2JOY A;  4RCC A;  1BKB A;  2DTH A;  3VV0 A;  1YI2 T;  1Q82 C;  4OP0 A;  2E70 A;  4M77 G;  3S3O A;  2O4X B;  4EMH A;  5GAN 7;  4L6V 5;  2V8I A;  3LH0 A;  3VKI A;  1VQO A;  1YCY A;  1AHJ B;  1G3S A;  1N6A A;  3HRT A;  4IUR A;  3JCM f;  3JB9 F;  2PUK B;  3A8O B;  3BDU A;  2L8D A;  1VQ4 A;  1MHN A;  5CQX A;  1YJW A;  3C4S A;  2CKK A;  2X35 A;  4M78 A;  3HP9 A;  5D6Y A;  3M4Y A;  3L2V A;  2QEX A;  3CCQ A;  4E7I A;  1VQ7 T;  5L8R E;  1VQM A;  1Y07 A;  3OMC A;  2DZ9 A;  3FC3 A;  3E19 A;  2WSE E;  5C6S A;  2VUB A;  3V8K A;  1WNL A;  4M7D D;  4Q5W A;  3UT1 A;  5LJ5 h;  5LJ3 j;  3CCR T;  2VXF A;  4JRP A;  2LVM A;  2DJZ A;  2K3X A;  4UC4 A;  4FL6 A;  1Q82 U;  5GMK i;  4IUQ A;  2P0Q A;  2DXU A;  4M7A C;  4XU0 A;  4C0G A;  4L5G A;  5J39 A;  4KUL A;  5GAN 8;  2V8K A;  3VYH B;  2R57 A;  3M9Q A;  2FL7 A;  2XKO C;  2ZZD A;  4LDX A;  4J6W A;  3PFS A;  5GAN h;  4NOY A;  4C92 A;  1X6O A;  3VJP A;  3E9G A;  5GAM h;  4BE0 A;  2DXT A;  4J83 A;  3MP1 A;  1Q86 C;  3E9F A;  3A8G B;  1U8R A;  1OI1 A;  4DQ2 A;  1S72 A;  2K3Y A;  3MP8 A;  4M77 A;  5GAO l;  5KCO A;  4ELY C;  4PKC C;  3H8Z A;  4M78 B;  2ZPB B;  4NL2 A;  3ZEH A;  2DVE A;  1XTD A;  4M78 F;  1EIF A;  3OYM A;  2GQV A;  2DEQ A;  4C5E A;  1I81 A;  2MI6 A;  5LJ5 f;  2WAC A;  4IUP A;  1QVG A;  3CCL A;  1VQN A;  1VQ6 T;  3M57 A;  2EIF A;  2LT1 A;  3CCV A;  2EKO A;  5D6W A;  3G6E T;  2YRV A;  3SWN C;  2EJ9 A;  2RM4 A;  4P5N A;  5FU6 C;  1KQ1 A;  3TU4 K;  3CC2 A;  4M7D G;  3FIF A;  3LWH A;  2JTM A;  3OYH A;  3KXT A;  3CCU A;  1UGP B;  2DKG A;  1LJO A;  3E1S A;  5D6X A;  5GAN f;  1WJR A;  1Q86 U;  1VQK A;  4QVC A;  4M7D E;  4C0D B;  1VIE A;  4RKU E;  3CCJ A;  2PVO B;  3MCA B;  3O8V A;  5CKF A;  5CQY A;  2RHI A;  3G4S A;  1G5V A;  4C92 B;  3RMS A;  3T9N A;  4C92 F;  5GAN 5;  4FT4 A;  1UGR B;  2K2V A;  2LX9 A;  4M77 B;  3M5A A;  4C0Z A;  3WVD B;  4B9W A;  2ZPI B;  4M77 F;  5GMK j;  2X4W A;  1KQS A;  3NTH A;  4M78 D;  5CK9 A;  2R5M A;  2RJD A;  3BW1 A;  4X9C A;  4BI4 A;  1Q7Y C;  1WQ7 A;  2DTI A;  5LJ3 h;  4F7U G;  1YHQ T;  3A8H B;  5CAI A;  2QQ9 A;  3CXC S;  4MZT A;  2FB7 A;  4M75 B;  2QTX A;  5A2Q E;  4A4G A;  3CEY A;  2VV5 A;  2AHJ B;  3M56 A;  4IUT A;  4XTV A;  2XID A;  3LLR A;  5CR2 A;  2XHC A;  2JUF A;  2D6F A;  4JJN K;  4OB0 B;  5CIU A;  1ZBX A;  3OW2 A;  3ZBD A;  1VUB A;  2R58 A;  4XTZ A;  3ZFJ A;  4RG2 A;  3FRN A;  2KSS A;  4DA4 A;  4KBM B;  2WSC E;  1KHI A;  2P4T A;  4C8Q C;  3QPH A;  1OZ2 A;  4Z02 A;  1YIT T;  1Q7Y U;  1K9M C;  1R8O B;  3QZ5 B;  4IUV A;  5LJ3 f;  2PVD B;  2EQU A;  3FJP A;  3VUZ A;  5CKD A;  1KG1 A;  4LDU A;  3HFN A;  1NPR A;  3OYY A;  4M75 D;  5IT9 E;  5GAO r;  2LT4 A;  4M78 E;  1YIJ A;  1YBY A;  4OGC A;  4F7U A;  4A4H A;  4JLG A;  4BY6 B;  3CCM T;  1LOJ A;  5GAN 3;  4BDY A;  2BIV A;  3QYH B;  2KQW A;  5DLQ E;  2FHD A;  3AHU A;  1K9M U;  1W4S A;  4J7F A;  2L5Q A;  1K73 C;  1QVG S;  2FYK A;  3JCM W;  3JRZ A;  3OB9 A;  3DLL A;  5IAY A;  1H3Z A;  2ZPF B;  2RHU A;  3QHS A;  4ZN3 A;  5GMK h;  3OYK A;  3CC7 A;  3QJ6 A;  4ATO A;  1RI0 A;  5C0M A;  1W2B S;  3OYJ A;  3HFO A;  1M9S A;  4C5I A;  2RK2 A;  4DOW A;  3M59 A;  4A4K A;  4CI0 C;  5I2S A;  5HK0 A;  4HCC A;  2OTJ T;  1WQW A;  2Y4Y A;  2VXE A;  2LCL A;  4C92 E;  1VQP T;  2DIG A;  4HA8 A;  4EMK B;  2BUD A;  1VQ8 T;  3L2R A;  2HAX A;  2GF7 A;  4HKE A;  5CKB A;  2K5I A;  4PLI A;  3LX7 A;  3G71 T;  4EMG A;  2DXC A;  2GFA A;  3OSS C;  3CD6 T;  4XU2 A;  3G7Z A;  4M77 E;  3R6O A;  3X26 B;  4M7A G;  3INZ A;  2I2L A;  2KDS A;  1BIB A;  4F7U B;  1JBM A;  3SFM A;  4M75 G;  1K73 U;  3KBG A;  4F7U F;  1PSF A;  2O01 E;  2YLB A;  2CGH A;  5M9O A;  1VQO T;  2R5A A;  4BE2 A;  2IG0 A;  3CCS A;  1VQ4 T;  2YLC A;  4LDY A;  2B8A A;  2RHZ A;  1YJW T;  4PJO A;  2LCC A;  1XOV A;  4RG8 A;  4C0F A;  2QEX T;  3CCQ T;  1YJ9 A;  2L3R A;  2VGN A;  1VQM T;  4LD9 K;  3OYI A;  3HPW A;  5CKH A;  5GAO n;  3EFS A;  4XK8 E;  3I56 A;  1VQ9 A;  1U1S A;  2RO0 A;  2ZGW A;  1N27 A;  3PT9 A;  4A53 A;  2HD0 A;  4QVD A;  2RH2 A;  1HK9 A;  1XNI A;  4C92 C;  3OW2 S;  4OGE A;  1QP3 A;  5KCH A;  3DLM A;  1JJ2 A;  4X34 A;  3QG1 A;  3JCM d;  1G3W A;  1SSF A;  2Y4X A;  4KT0 E;  4M77 C;  1M8V A;  5EG2 A;  4KUD K;  2QQS A;  4XTU A;  4R56 A;  3H6Z A;  5CKE A;  2M16 A;  3CCE A;  3N5B B;  4TVR A;  3C12 A;  3ER0 A;  2OTL A;  4M7A A;  4C8Q D;  1S72 T;  4WF2 A;  3X24 B;  4M75 A;  3J7A F;  2VGM A;  3PMT A;  5LJ3 e;  3ME9 A;  4PJO B;  3V7R A;  4BI8 B;  3L1A A;  3GLX A;  1NE8 A;  1VQN T;  4ZN1 A;  3KUF A;  3CCL T;  2XD0 A;  3I55 A;  5IN1 A;  4N4G A;  4QQ6 A;  5GAM f;  3L2Q A;  2DO3 A;  3P8D A;  2CS7 A;  5GMK m;  4M7A F;  3OA6 A;  2XDD A;  3G6E A;  2D0Q B;  2BKD N;  5FRN A;  3PTA A;  3CCU T;  3VU3 C;  3VYG A;  5DLO A;  2LC4 A;  2F5T X;  1VQK T;  2M9U A;  3JCM g;  3CCJ T;  1LNX A;  4J5Y A;  4XAX B;  1RL2 A;  3QKJ A;  1KC8 C;  3G4S T;  4MML A;  3BY7 A;  5LJ5 d;  1NJI C;  2QQR A;  1U1T A;  4JRQ A;  1O75 A;  3PGG A;  4M7A B;  3S3M A;  5J26 A;  2FVU A;  1H64 1;  5GAN 6;  2K57 A;  3L2W A;  1I5L A;  2DXB A;  3A8L B;  2HQE A;  2LQ8 A;  1MGQ A;  2RJF A;  3V8J A;  2RK1 A;  3EFR A;  4M75 F;  2G3R A;  4BI3 A;  1M1G A;  1NPP A;  4C8Q G;  3QBY A;  3MP6 A;  4FT2 A;  4DOV A;  4F7U E;  4PJO D;  2K5L A;  2X4X A;  1I4K 1;  4J6Y A;  4RMO A;  3DB3 A;  1VQL T;  1QVP A;  2CZ0 B;  5GAO p;  3CBM A;  1N8R C;  3LYI A;  5GAN d;  4J7I A;  5GAM d;  4M7D C;  3QXE B;  4JRI A;  3P8B B;  4KUI A;  2EJG A;  2RI5 A;  3JCM e;  3OYN A;  4ZGD B;  3ASK A;  1Q81 C;  4BE1 A;  2YHT A;  3SDZ A;  3RUX A;  1KC8 U;  4A4F A;  2H3J A;  3RMQ A;  2QA4 A;  1NJI U;  3GPL A;  2JZ2 A;  3GOX A;  2ZPG B;  2NLU A;  5LL6 S;  1QP2 A;  4XQ3 A;  5GMK e;  1OYX A;  3V7S A;  3LGL A;  4N0A C;  5FU6 B;  2RHY A;  3OS2 A;  1P92 A;  3L2U A;  2K5F A;  4EMK A;  1KQ2 A;  4V2S A;  5LJ5 g;  4EDU A;  1JB0 E;  3CME A;  4M7A D;  1N8R U;  1VQ5 A;  2QDY B;  2DD5 A;  3MEA A;  3CBP A;  3FEO A;  4LD6 A;  1M1F A;  3QJY A;  1BI0 A;  3J80 E;  2CZ6 B;  4BB7 A;  1YJN A;  4VUB A;  2A7Y A;  2L89 A;  4PJO G;  2A3L A;  3L42 A;  2V8J A;  4C8Q A;  3OBW A;  5GAO m;  3C95 A;  5GAN g;  3S3N A;  4HT9 A;  1TH7 A;  3HHT B;  2E1H A;  2KK4 A;  3QZ9 B;  3L2Z A;  4XU3 A;  2F5K A;  3OSV A;  4C5H A;  4GLK A;  3MEU A;  2XK0 A;  3JCM Q;  3UPU A;  4BAC A;  4OB1 B;  5LJ5 e;  4IKF A;  2RHX A;  1QVF A;  3HKS A;  3FDR A;  2RJE A;  5LJ3 d;  1ZHI A;  2EAY A;  5I2M A;  3V8L A;  1FWZ A;  2C06 A;  5FLX E;  3JSC A;  1K8A C;  2M1H A;  3CC7 T;  1BI3 A;  1ZQ1 A;  3MHX A;  3CPW A;  2LTO A;  3CMA A;  4ZTJ A;  3HRU A;  3MET A;  5FU7 B;  1KD1 C;  5GAN e;  5GAM e;  3CC4 A;  4ELZ C;  4M78 C;  3TRE A;  2XI9 A;  1YI2 A;  2QI2 A;  3LW5 E;  3F70 A;  4L59 A;  2EQJ A;  3MEV A;  3NTK A;  4HCZ A;  2QQB A;  3OYC A;  4M7A E;  4C8Q B;  1KQS S;  2JVV A;  4MZP A;  4MZM A;  4C8Q F;  2P0P A;  3PMI A;  4M75 E;  2MMP A;  3FB9 A;  5J3B A;  1KHC A;  1Y96 B;  3BDL A;  3CXC A;  2MWP A;  2E65 A;  1BI1 A;  3M4G A;  1VQ7 A;  1K8A U;  4QW2 A;  4C0D C;  3CCS T;  4E47 A;  3BFM A;  5LJ3 g;  1KD1 U;  1BYM A;  2KAF A;  2Y90 A;  4CRI A;  2RD1 A;  4ZGJ B;  4X9D A;  3CCR A;  1YJ9 T;  3TEE A;  3PIO A;  2E41 A;  4LDV A;  3HSB A;  2E5Q A;  3OYL A;  1VQ9 T;  3I56 T;  2CZ7 B;  2EQK A;  3LGF A;  1G3T A;  3JB9 H;  4C5G A;  2EQM A;  1OZ3 A;  1N9S A;  2E6N A;  4ZTF A;  1Y71 A;  2DTO A;  4FM4 B;  3SB2 A;  2RJC A;  2DD4 A;  2DAQ A;  3GNG A;  4FIB A;  3JB9 I;  4M75 C;  3M53 A;  4Y28 E;  3CBO A;  3GIB A;  3Q1J A;  3OBY A;  4PJO F;  4FSX A;  3X25 B;  5DY9 A;  4IUU A;  3QYG B;  4BUG A;  2LQK A;  2KMT A;  2P0K A;  3CCE T;  3OS0 A;  2MWO A;  5CCA A;  2OTL T;  5AYF A;  2JN0 A;  5I21 A;  4OB3 B;  4OMF B;  4GY5 A;  5HY6 A;  5A0G A;  3CCV T;  1VQ6 A;  4MDX A;  3JB9 D;  4JS5 A;  5FRM A;  3QSU A;  3UDC A;  1UGQ B;  3MEW A;  3JCM J;  3CC2 T;  1HXD A;  1UGS B;  2CYZ B;  2LDM A;  3NFC A;  3A5Z B;  4MDW A;  3JB9 J;  2RA2 A;  3I55 T;  1UB4 A;  5HK3 A;  4NS5 A;  4YTL A;  3OS1 A;  4D6W A;  1X75 C;  2DPP B;  3HRS A;  3P8H A;  3SWN A;  2DZC A;  4BDZ A;  1W2B A;  4HCB A;  1I8F A;  2WSF E;  4MMK A;  4BD3 A;  4HT8 A;  1QVF S;  1GXI E;  1D3B A;  2XDB A;  4OVA A;  3OYF A;  5DM7 R;  2K4Y A;  2LRQ A;  2F69 A;  4ME7 A;  2HBP A;  3HL8 A;  3X20 B;  3OYE A;  3OQ5 A;  2ZPH B;  4E7L A;  2PUO B;  3JAM E;  3CPW S;  4Y91 A;  2D9T A;  2QQA A;  3UWN A;  3URG A;  4OF1 A;  2DIQ A;  4BY6 C;  4JS4 A;  1BIA A;  2E64 A;  2XDP A;  3RIR A;  3S6W A;  2XU8 A;  2XG8 D;  4J8O A;  3FLG A;  1QW1 A;  3OMG A;  4B9X A;  4C8Q E;  1YHQ A;  3OYD A;  2E12 A;  2X4J A;  4II1 A;  2LNV A;  2OAU A;  2EJF A;  4O5V A;  3WVE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...