3OW2P

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ow2P00
3G6EQ 1YIJQ 1VQOQ 2QEXQ 1K9MR 1VQKQ 2QA4Q 1VQ4Q 1VQ6Q 3CCQQ 1NJIR 1VQNQ 1S72Q 1Q7YR 3CCRQ 3G4SQ 1VQ8Q 3I56Q 1Q86R 3CXCP 1K8AR 1VQ7Q 1YJNQ 3G71Q 1YJWQ 1W2BP 1QVFP 3CC7Q 1N8RR 3CC4Q 3CCSQ 3CCVQ 1YI2Q 1KC8R 1Q81R 2OTLQ 3CCJQ 1QVGP 1Q82R 3CC2Q 2OTJQ 1VQPQ 1KQSP 1VQ9Q 1K73R 1VQMQ 3OW2P 3CPWP 1YITQ 1M90R 3CCLQ 1YJ9Q 1VQLQ 3CCUQ 3CD6Q 1JJ2P 1KD1R 3CCEQ 3I55Q 3CMEQ 1VQ5Q 3CMAQ 1M1KR 1YHQQ 3CCMQ
chains in the Genus database with same CATH superfamily
1Q86U 3V7CA 1VQ4T 1S72A 1I8FA 1PD1A 3M9QA 1MMDA 2WSEE 2XD0A 2H3EB 1B34A 2EJ9A 3EG1A 4MZMA 3HFOA 2P84A 4CC4B 4HCBA 1JU5C 2LT1A 3CC2Q 1OYXA 1K73R 1VYUA 7AT1B 1NJIC 2K6DA 1G3WA 2CS7A 1WA7A 4M78F 2C0IA 2V1QA 2DXTA 3JB9G 2JXBA 4GBQA 3NHNA 2C0TA 4ANJA 1W2BP 1UECA 3EH2A 3NPFA 5DLOA 3H0IA 4E2FB 5GMKm 4HVUA 5CKHA 2PTKA 2DLPA 3PTAA 2HDAA 3EFOB 2D8HA 2X3XD 2QGGA 2RI3A 4PJOB 3HP9A 3MCAB 2MAMA 3CC7T 1IRXA 4ZGEB 2E1HA 2PUKB 3CC4Q 1AEYA 4E47A 2CP2A 2LCSA 1QLYA 3JCMX 3JCMQ 3PGGA 1AWXA 4D8DA 1LJOA 2KVQG 2QYZA 4M75G 4BB7A 4L6V5 3EFSA 1QWFA 4M78D 1JO8A 1FMKA 2JJ9A 2RHUA 3CCRQ 1U5SA 2VXFA 5I2SA 2X3WD 3I5SA 4IUTA 4HCCA 3CCLT 3G71Q 4PJOF 2JTFA 4C5IA 5GAOm 1UGPB 4QQDA 2G3RA 3G4SA 3EGDB 3FEOA 2RJEA 2KY9A 4XU0A 1WHHA 4J6YA 2O01E 3M58A 2DD5A 4A4FA 2RF0A 3CCMT 1OU9A 1XOVA 2CP6A 2PU9B 5IN1A 3ZL7C 3PMIA 2DXUA 1WPYA 1MHNA 2BZXA 4J83A 2P4TA 1QKXA 3RDVA 2EYWA 2COYA 4C92D 3SDZA 2YDLA 1VQPQ 2DEUA 2YWWA 2ZGWA 1JB0E 3QPHA 2GQIA 3FLGA 4XTYA 3RKYA 1BI0A 2DPPB 3G4ST 4GLMA 4N0AC 4KGZB 1VQ8Q 2OTJT 2LQNA 1KHIA 2L89A 3SHWA 3VS1A 2KXCA 5GMKh 2K3YA 2GGRA 3PT9A 2DNUA 3M0TA 1U1SA 2L3SA 1BI2A 4JJNK 1H92A 5IXBA 3OYJA 5LJ3g 1UEBA 2V8IA 5LJ5h 2E6NA 3GNGA 3QHSA 1H3ZA 1IXDA 4C0GA 2EBPA 1WLPB 2ROLA 1BU1A 5FLXE 2P4RA 2NUZA 1YJWT 4LE9A 2PZ1A 3X26B 3GP8A 4HT8A 3M53A 5GANh 3M56A 3LYIA 4BACA 4J6XA 2XDPA 2CDTA 4D8KA 1NZ9A 3FDRA 1VA7A 3G6EQ 1CKAA 3EGXB 4NOYA 4XTZA 2BUDA 3CCVT 3DB4A 1UGSB 1G3TA 4XTUA 2QI2A 4MDXA 2CYZB 2X4XA 3UT1A 1FMWA 2D1XA 5LJ5e 2C06A 1ZX6A 3NTIA 1K0XA 2VB6A 1VYVA 3THKA 2YUNA 2QDLA 3G6EA 2LRQA 4LUDA 1YHQA 3OBWA 4C5EA 1FMVA 4M7DF 1W2BS 4M78G 4M75D 4EMKC 1QVPA 5AYFA 1WFWA 1B34B 4KGXB 1M2OA 3J7AF 1M8MA 2JW4A 3EAEA 3M0QA 1FXXA 2CSIA 1QKWA 1WHJA 1M90R 3OY9A 1H8KA 3CCUQ 1M90C 1VQ6A 2E12A 3CCSA 1K9MR 1NLPC 4F16A 1QCNA 1JBMA 4R55A 1S1NA 1PWTA 3RKWA 3V8KA 2DIGA 1K9MU 1RI9A 2GNCA 2EIFA 1D3BA 4C8QB 2LCLA 2RHZA 1BK2A 4JZ3A 4C8QD 4HVWA 3VS2A 2DYBA 4BE2A 4AFUC 2XDDA 1T0JA 4KULA 3KFVA 1KQSA 1G3YA 2R5MA 3JCMb 1UG1A 3OBYA 3OS0A 1X6BA 1MV3A 4JLIA 1KSWA 3M55A 3A8LB 1IB8A 1RACB 2YSQA 2ZZDA 2LTOA 3P8DA 4B9WA 4FW2A 1KIKA 1C0MA 2GQVA 4C8QG 4OMQA 3QYHB 1X6OA 2VC8A 2YT6A 1UFFA 2X4JA 1BIBA 4OF1A 1YCSB 2XHCA 1I81A 4BI4A 1YIJA 3G4SQ 1ZSZC 5GJWB 1X75C 4AFQC 5C0MA 5GAOp 1QQJA 1HD3A 1MGQA 3PVQA 3L2UA 3JB9D 3O8VA 5LJ3j 3FB9A 2GCXA 2EFIA 1WQ7A 1P92A 4JRIA 3OYAA 1ZLMA 3UWNA 1N9RA 1D0XA 5CK9A 1M3AA 1U3OA 2CP5A 2E41A 1OPKA 1RAGB 3OMCA 3NTHA 5LJ3d 1NPPA 2L3QA 4LDXA 2EQUA 4AG2C 3CC7A 3VYGA 2RB6A 2D0NA 3QUIA 1V1CA 3QBYA 3H9NA 1UB4A 2F2VA 4GY5A 2ATCB 3C12A 4PJOG 2J6FA 1Q82U 3JAME 2KSSA 4HXJA 1OOTA 3BY7A 3PFSA 1U06A 1K8AC 4M77G 2K5LA 1RAAB 5D7UA 1YFNA 3HPWA 4RUGA 1E6GA 4M7AC 2HQXA 2MCNA 1VQ6Q 3CMAQ 1MUZA 2DKGA 2QA4T 3G7ZA 4JUVA 2EYYA 4XQ3A 5CIUA 1UUEA 3ZBDA 2D6FA 1XJWB 2KI7A 5LJ5f 3PE0A 3E19A 1KD1U 1TXQA 4N4GA 3UA6A 5GAN7 1KQSS 2GFAA 1F1BB 3WVDB 4VUBA 1MMNA 4BE1A 4KBMB 2DJQA 4M75C 1VQOA 3CCUT 3CMET 4OB1B 3JCMJ 2ZCFB 1OX8A 3F70A 3JV3A 1OV3A 2DA9A 3JB9H 1KG1A 2W0ZA 3LW5E 2JUFA 1UGVA 3I56A 4LD6A 2HNIA 5GMKj 3FIFA 1YITT 1TWBA 3R6OA 4BY6B 2FRWA 2BZYA 1VUBA 4RTVA 4BDZA 2DK3A 4Y28E 1K0SA 2DVJA 2L2PA 2K9GA 4DBRA 2O9VA 1NEGA 5KYXA 2DYIA 3UPUA 5I21A 3CCQT 1PCXA 1K1ZA 1MMAA 2NYSA 3UDCA 1V76A 4J6WA 5LL6S 2K79A 1HXDA 1LCKA 8AT1B 5GAN2 2KBTA 3HRSA 2KEAA 3S3NA 2XDBA 2ED0A 1VQ5A 4Z8AA 1VQ9T 1M1FA 4OMLA 5HK3A 2O4XB 4CI0C 2RO0A 2PVOB 6AT1B 4PJJA 3A8GB 4WF2A 1VIEA 1RAIB 3VS4A 3PMTA 2D0QB 2SEMA 1IHWA 2LX9A 4DQ2A 1JXMA 2V26A 1JJ2P 2RMOA 3VRYA 2IIMA 3RUXA 4PNOA 3CD6A 4AMCA 2P0KA 5CKFA 3CCUA 1NYFA 2AKKA 3CBPA 3RKXA 1PRLC 2F5KA 1MNDA 1MNEA 3EH1A 4JDSA 3CCJT 2IVWA 4PFZA 1H641 5GAN3 4JZ4A 2LJ1A 1GCPA 4IKFA 5CR2A 3L2VA 2RQUA 2YRCA 1MMGA 2JOYA 3M4YA 3X25B 1W2BA 2M51A 3I56Q 4J9GA 4WCIA 3V7SA 5GAOl 4M77C 1YCYA 4BI3A 4DOVA 1QCOA 1TSFA 2MF2A 3CXCA 3MP1A 4M7AG 3M4GA 4L5GA 2NUPB 4OMPA 3OYCA 1Q81U 3R6NA 3U23A 1GFDA 2OAWA 5CQYA 4JS5A 5KYYA 4OMNA 2KDSA 4XTXA 3BE3A 5M9OA 4D6WA 3A8HB 2E64A 2LVMA 3TQ7P 3HKSA 3M54A 1TG0A 5D6XA 1PG5B 2VV5A 1M27C 2DFUA 4J8OA 4HCKA 1M1KR 1VQNT 2IG0A 3BFMA 1M1KC 1VQNQ 2LCCA 5DM7R 3G71T 2E5QA 2AIRB 2V1RA 2O9SA 1OZ3A 1TU0B 1ZA2B 3I5RA 1GBRA 3FJPA 3HFNA 2EGEA 2RJCA 1Q81C 2QQBA 1E7OA 2D8JA 2RQTA 3VS0A 3CCST 2MPXC 2FO0A 3VUBA 3C4SA 1VQPA 3X20B 4ZTJA 1EZZB 2K5FA 4BI8B 3CEYA 4GLKA 5I11A 2DBKA 5GAMe 2M0YA 1XQHA 3OYDA 3GOXA 1VQMA 1D0ZA 4R56A 4OP0A 1WJSA 2CP7A 2A36A 3EHQA 1AWOA 4C8QC 1KD1R 3X24B 1TUDA 1YBYA 2A08A 2FYKA 2M9UA 3FC3A 2DTOA 2KRNA 4QT7A 4M7AB 1KJWA 1WXTA 3QJ6A 3NMZC 2O88A 2MK5A 2EQMA 4A4KA 1JXOA 2CP0A 2YHTA 2DL3A 1Q7YC 3O5ZA 9ATCB 3MJXA 4RCCA 1QMCA 2XI9A 3QXEB 4JS4A 1JEGA 1TOVA 2XG8D 2CP3A 2NUPA 4C92B 4F7UF 5IAYA 1QW1A 4IUPA 4FU6A 2A0FB 1I0CA 2RQWA 2DVEA 2VXEA 2KR3A 4ZGJB 3BDLA 2WACA 3JB9I 1IGQA 1XNIA 2QQRA 5EC7A 4DA4A 3H0FA 4TVRA 3I55A 4V2SA 4RTYA 3QYGB 3ULRB 3PIPA 2EAYA 1ZUKA 2CT3A 1AHJB 3A8OB 1MV0B 4PK4A 2KAFA 2YUQA 3VS7A 2HMAA 1LNXA 1VQLA 2VGNA 1WYXA 3MP6A 1BYMA 4RMOA 4XU3A 1ABQA 1O9SA 4OB3B 2XK0A 2YLBA 3MP8A 2AZSA 5A0GA 2DZ9A 2JN0A 4F17A 1UTIA 2E3HA 1UGRB 3CMAT 4KH1B 4JRKA 4O5VA 3TCJA 1ACMB 4C8QA 1PRMC 2KYBA 2JZ2A 4EMHA 1K9AA 2EGCA 4J5YA 5L8RE 2AZVA 3CC7Q 4P5NA 4M7AA 2JVVA 1AOJA 3CC2A 5FRMA 2P0PA 1WX6A 2A7YA 5J3BA 3G1JA 2NWMA 1M4ZA 3QWYA 3MKDA 1YN8A 1XTDA 3KBGA 3OS1A 1SSHA 4X1VA 1YJWQ 1KFZA 4FW1A 3N5BB 2GF7A 3S3MA 1NEBA 1CKBA 3CCJQ 4CC7A 2OX7A 3ZEHA 5GANe 1Q95G 4RTTA 2CSQA 2X9HA 1Y57A 1JRIA 1Q7YU 4ZTFA 1AT1B 2VYTA 2EW3A 2EJFA 5IHIA 2Y90A 3CCVQ 3DB3A 1JJ2S 1EX4A 1UGQB 2DZCA 2NUTB 4KRTA 3EGXA 3SB2A 4LDUA 3OYHA 2M0OA 1A0NB 1IGUA 2ROTA 3EG9A 3L42A 2AHJB 4OMMA 2J05A 3L2WA 4M77B 3RERA 3LH0A 2ECZA 1X2KA 4XAXB 1UJYA 2J6KA 2L5QA 4CRIA 3CCMA 3JCMd 1W6XA 2KNBB 1IZ6A 2JTMA 3REBB 3MEAA 2I0NA 4E7SA 4M78E 1D1AA 2OJ2A 3CCEQ 2ZPFB 3OW2A 1V29B 1R8OB 3OS5A 4QQGA 4ATOA 2K57A 2X35A 5GAMh 1BI3A 1J3TA 4BUGA 1SKUB 5LJ3h 1M2VA 4A53A 2FZKB 2CZ0B 3FRNA 3MEVA 4PKCC 2HBPA 2ED1A 1YJ9Q 1VQ9A 2LDMA 2B8AA 1KHCA 2MIOA 1JQQA 4E7HA 2EQIA 3KUFA 2RI2A 1NM7A 1I07A 4CC2A 2GBQA 3EGUA 4C92E 3CCLA 1YJNQ 4C92G 4CC3A 4M4ZA 1OPLA 2LNHB 2Y4XA 2ZPBB 2QGFB 4PJOC 3JRZA 3PNWC 2LJ0A 3Q1JA 3CCQA 4FCYA 2J7IA 1GFCA 3UA7A 2YRDA 1H3HA 3CD6Q 1Y7XA 3WVEB 1KQ2A 3MEUA 1OX9A 5DY9A 2CUDA 5GAOn 1QVGA 1Y96A 4M78B 1K9MC 3J81E 2K5IA 4JJDA 1VQKA 2LZ6B 3CD6T 2NLUA 4RG8A 3CXCS 1T0HA 1SHGA 2L3PA 4M7AD 2LC4A 4N4HA 4R0KA 4J9BA 4FL6A 2PVGB 2VKNA 4FYWB 4DBQA 1SEMA 2DXCA 3CBMA 5FU7C 2K4YA 1VQKT 3P8BB 3QWXX 4BD3A 2OI3A 1RAEB 1VQ8A 2KXDA 2CT4A 3MHXA 3OYKA 2BE9B 4FSSA 4J9HA 1X27A 1N8RR 1G8XA 1OQKA 1O75A 3EG3A 3BDUA 3EFOA 4II1A 4M7DE 4AFSC 1WIEA 4M77E 4C92F 4F7UB 3GPLA 2XIDA 5HKCA 4F7UG 5KE2A 1D09B 4ZNXA 1WHKA 3RESA 2YLCA 4PFPA 1ZSGA 3V7RA 2LMJA 1M9SA 4MMKA 4AG1C 2J6OA 1Y07A 2LQKA 4WTOB 4E6RA 2DM1A 3J80E 8ATCB 5GAOq 2HQEA 1VQ7Q 2QEXA 3M59A 1W4SA 4EMKB 5FWCA 4E7IA 2ZPIB 1N6AA 2CH4W 1WZOA 2DJZA 2G6FX 5EG2A 2EWNA 2ZPHB 2RK1A 1OI1A 3LGLA 2DO3A 1X01A 3M0PA 3OYGA 2QTXA 1YI2A 3CPWA 5J26A 3G71A 4E7ZA 1Q81R 2QK0A 3ER0A 3JSCA 1UE9A 1VQ9Q 2LP5A 1VQ4A 2ESWA 1VQ5T 2F2XA 2IPOB 1ZHIA 1BB9A 3JCMf 5IH2A 4DOWA 2VGMA 4QVCA 2QASA 5LJ5d 1NG2A 3CC4A 1Y0MA 1G2BA 1WDXA 2OTLQ 2VASA 1NYGA 4C8QF 4PJLA 3HL8A 2KQWA 2KRSA 2ZPGB 2K2MA 1VQLQ 4M7DC 2CZ1B 1ZSZB 2DL4A 2FPDA 4EPCA 1Y71A 1T3SA 3LH5A 5FW9A 1AD5A 3OSSC 3E1SA 3A5ZB 3C95A 4ME7A 2JTEA 1KC8C 2O2OA 1IO6A 5I22A 3OYIA 1C1AA 1WQWA 4HCZA 2EYZA 4M75B 2BKDN 2L8DA 5CAIA 2HEQA 1PKSA 3H6ZA 4J7IA 4IUUA 3V8JA 2QA4A 1PSEA 4AT1B 5HCKA 4J9EA 4LXCA 3SWNA 3TREA 4IIOA 1EFNA 3EGDA 1VOMA 2E70A 2ZAEA 1SRLA 3ME9A 1VYTA 5KCHA 2LX7A 2F1LA 3H8ZA 3JCMW 4C0ZA 4BE0A 5A2QE 1T3LA 3A1PA 5D6WA 2F5TX 3CPWP 2DETA 3SWNB 2LNVA 2FPEA 2BIVA 3GF5A 2EYXA 4IIMA 3M0UA 2RQRA 2MI6A 1NBEB 2D9TA 4KUIA 1VQOT 4FT2A 1FWZA 1SPKA 4A4GA 2BTTA 4PJOA 2EPDA 5HK0A 1M3BA 4J9DA 1TUGB 1YJ9A 2PUOB 3M0RA 1ZSZA 3QJYA 3KXTA 1BIAA 2E65A 3WXMB 2FEIA 4DBHA 2RN8A 1Q7YR 1QVFS 4MDWA 4ORZA 1Y96B 4M78A 4Y91A 1ABOA 3L2ZA 2K3XA 2OTJA 2HSEB 3UATA 4OGEA 2PQWA 5FU6C 2AT1B 2COZA 3EG2A 2LJ3A 3VS3A 1GRIA 4ZN3A 1D1CA 5GAN6 2MMPA 3OYEA 2QQAA 2L3RA 4E7JA 3OA6A 5GAN8 2OTLA 5GAN5 2OTJQ 4M77A 3HRTA 4BY6C 4HT9A 3OW2P 2KE9A 3EG9B 4C0FA 1WXBA 2CGHA 2QG9B 3OYLA 2JM8A 4DBFA 2CZ7B 1VQKQ 3INZA 3RIRA 3CCRT 1WGSA 2OTLT 1PC0A 5FRNA 4J9FA 1HK9A 2RJDA 2V8KA 1KQ1A 2LQ8A 1FX7A 1B3QA 2JS2A 4J7FA 1GCQC 1ZBJA 4E7KA 3HRUA 1NJIU 3CMEQ 1YJ9T 1K73U 5L23A 2RJFA 2OAUA 4F7UA 1YP5A 5KCOA 1YNZA 3CXCP 2RD1A 1YWPA 2CKKA 4MMLA 4LDYA 3I56T 1GBQA 2YXYA 2XKOC 3HHTB 4J9CA 2FRYA 2R57A 2HZYA 3X28B 1K76A 2RM4A 3CMEA 1LPLA 3TSZA 2V8JA 2QEXQ 1RI0A 4EMKA 4M7DA 2BZ8A 3OMGA 3QSUA 1VQ6T 1X6GA 4PJOE 3DLMA 5CKBA 1VIFA 2RHYA 4PFOA 5FWBA 3I35A 3LX7A 1R0CB 1AZGB 1VQMQ 4FYXB 1X69A 2DL8A 4F14A 2JS0A 1GXIE 2K2VA 2FPFA 5GMKi 1QVFA 1QWEA 3REAB 1ZA1B 2DAQA 4RTXA 3VJPA 1RABB 4EDUA 1KC8U 2AK5A 5KYWA 3S6WA 4EIKA 1D0YA 4M7DD 2MWOA 3GLXA 3CCVA 3V8LA 2C0OA 1M2VB 2JT4A 2A37A 4LNPA 5LJ5g 2A3LA 2YRVA 1QVGS 4M7AF 1B7TA 4J9IA 1LVKA 1SHFA 4Z02A 1YJWA 3LWIA 3CCJA 1SG5A 4C8QE 3QZ9B 1YIJQ 4N0AA 3UF4A 1UJ0A 2A28A 2EJGA 3QIIA 1UHFA 4LD9K 1AZEA 4QVZA 4ELYC 1AVZC 1K8AR 2KK4A 3CC4T 4M7AE 1D1BA 3SD4A 2E10A 1M8VA 1AWWA 4O6JA 1ZUYA 2MWPA 2CREA 4FT4A 4HVVA 3C0CA 5KYUB 5IXFA 4HA8A 3RNJA 3AHUA 4C0DB 1PSFA 2NUTA 3OYFA 2DD4A 5J39A 4FYYB 1JJ2A 5KYNA 1PD0A 2CH4A 2RI5A 3NGPA 2YUOA 3P8HA 5GANd 2KGTA 2YUPA 2E5KA 5CQXA 4M77D 3VS5A 4ESRA 5GAMf 3I9QA 3QKJA 2KMTA 4DEXA 4QVDA 4M7DG 1NLOC 3AT1B 3MO8A 4NL3A 3CCMQ 3JB9F 2ENMA 1BKBA 4N4IA 3SWNC 4MZTA 2KT8A 1GCQA 2K3BA 4Z88A 5LJ3f 3QG1A 1RAHB 1K4US 4B9XA 1OULA 3CCEA 1WHMA 4C5HA 2BE7D 2PVDB 4QW2A 2HBWA 1Z9ZA 2DL7A 2KROA 3I55T 1I5LA 4KT0E 3URGA 1TH7A 5HY6A 4OMFB 3GBQA 4OB2B 4RCBA 3I55Q 2VVKA 3IQLA 4FSXA 1OEBA 3JCMh 4IUQA 4FIBA 1IREB 1YJNT 1M1GA 1VQPT 1G5VA 4RG2A 2F2WA 4M77F 4Y92A 4OVAA 2LQWA 3M5AA 1YJNA 3OQ5A 4LDVA 1G3SA 1CSKA 4UC4A 3D7SB 1VQOQ 2RQVA 1NJIR 4BDYA 4OGCA 5GAMd 3OS2A 2H3JA 2DL5A 4A4EA 2DTIA 1PHTA 2HCKA 4L59A 4X34A 5LJ5j 2M02A 2B86A 5CKEA 5GJVB 5I2MA 3E9FA 2QDYB 2I2LA 2P0QA 2X51A 2XICA 3CCRA 3LGFA 2LT4A 4FM4B 2RNAA 1OZ2A 1W1FA 1ARKA 4YTLA 4JRQA 2PNIA 2DE0X 3SFMA 2DILA 5ECAA 3JCMP 5DLQE 3QZ5B 3CC2T 2FHDA 5GAN4 2JMAA 2FZGB 1ZUUA 3JCMg 4EMGA 4F7UE 2MYSA 4A54A 1YWOA 2E6ZA 1K73C 1BCOA 3JCMV 2HL5C 3QDFA 2R58A 2DRKA 3TEEA 1UHCA 3DKMA 1PKTA 4LN2A 2FZCB 2HKQB 1Q86C 2DMOA 5GMKe 1QCFA 3QO3A 2VWFA 4K11A 3PVLA 4C5GA 5GANj 1RLQC 5KYWB 1C6VX 2RA2A 2HSPA 1VQ5Q 2EKHA 4M78C 4B6MA 1HYOA 2X4YA 2E3IA 5FU6B 2FVUA 3ZFJA 5FROA 5C6SA 5KE3A 1G83A 4LDWA 3A8MB 4QQ6A 5A0DA 1N9SA 3NFCA 1HSQA 1M90U 3VKIA 3H0HA 4JLGA 4C92A 5D6YA 1YITQ 3LLRA 3CCLQ 1TTHB 1WHGA 3E2UA 3VV0A 3RBBB 1WJQA 3OYNA 4QKUA 1VQ4Q 1U1TA 3MEWA 2O4XA 3M0SA 3OB9A 1B07A 2E4HA 1BCMA 2QQ9A 1U8RA 1WI7A 3OYMA 4OMOA 2JNGA 1KC8R 4KUDK 4PJNA 4M7DB 3HTRA 1Z9QA 2RHIA 4HKEA 3VU3C 2DF6A 5LJ3e 1VQ7A 1YITA 1R0BG 2HL3A 4XTVA 1EIFA 3EG0A 2VUBA 3OSVA 4E7LA 1WJRA 1BI1A 4KH0B 5KYXB 3E9GA 5GANf 2KRMA 5IHKA 2QTVA 3JCMc 2DRMA 3EFRA 1X43A 3T9NA 4Q5WA 2O31A 5GAMj 1I4K1 3CMAA 1QVGP 5AT1B 1GL5A 5KYYB 3CBOA 2WSFE 1RADB 4PJOD 4X9DA 1X2QA 5IT9E 1N27A 1AWJA 2QQSA 1VQ8T 4JJBA 5CCAA 3MPUB 1M30A 1QP2A 4ZN1A 5KH6A 2QA4Q 2EQKA 3ASKA 1HJDA 2FG0A 1M1KU 5A0LA 1DJ7B 2K7AA 4DEYA 2M16A 2DERA 3TSWA 1N5ZA 2RH2A 3VS6A 4JPBW 4XK8E 2Z0WA 4XU2A 2COWA 4RTWA 2DIQA 3TVTA 1UDLA 1NE8A 2DTHA 5KYUA 1RLPC 4JJCA 4OB0B 5GMKl 4ZGDB 2EQJA 2Y4YA 1IHVA 4X9CA 2KT1A 4M75F 3RMSA 1BBZA 3CQTA 1Q86R 5CO7A 3JCMe 5FU7B 3RMQA 1FYNA 2DEQA 2H8HA 2GFUA 5GAOr 1KQSP 4RTZA 3TU4K 3H41A 3CPFA 3L1AA 3G6ET 3C94A 2FB7A 3OW2S 2ZPEB 2RPNA 4PLLA 1VQ7T 1LOJA 1I1JA 3CCQQ 1YIJT 3FJ5A 4RKUE 4IUVA 2ABLA 1WNLA 2EGAA 1K8AU 1SSFA 4Z89A 2XMFA 1QP3A 2XU8A 1WXUA 2GTJA 3PIOA 1WHLA 4NS5A 1Q82C 1R77A 4M75E 3GIBA 3QDRB 1SF9A 2HKNA 5GAMg 2QAZA 4PL6A 3BW1A 1ZQ1A 4A63B 2MOXA 1QVFP 4PJMA 2HD0A 5CKDA 3HSBA 1RL2A 2CZ6B 2EYQA 3LWHA 1NPRA 3VYHB 4NL2A 3DLLA 4PLIA 1PNJA 1ZBXA 2M1HA 3S3OA 1VQLT 1OU8A 3GNFB 2GTOA 4C0DC 2SRCA 2EKOA 2EVRA 3L2QA 2RHXA 3CCSQ 2J06A 2F69A 3SEMA 5CVIA 1SRMA 2HAXA 2KYMA 1Q82R 4C92C 2R5AA 4IURA 1VQNA 2DBMA 1M3CA 2FL7A 2JMCA 4KGVB 2RK2A 2W10A 3CPWS 4XU1A 4AFZC 2QXFA 2DXBA 3VUZA 2AKLA 2HQHA 4M75A 3OYBA 1YHQT 1RUWA 2WSCE 2X4WA 1TS9A 3RR6A 3VRZA 1TUCA 2JM9A 1VQMT 4LUEA 3NTKA 2L0AA 4RTUA 2DX1A 3CCET 1E6HA 5GANg 1YHQQ 3OYYA 1RAFB 1PM3A 1S72T 3EHRA 4XTWA 1D3BB 2QEXT 1S72Q 1KK7A 3A98A 1YI2T 4FYVB 3L2RA 4ELZC 2CUBA 5IHNA 1YI2Q 1I5OB 4F04B 1W70A 1N8RU 1KD1C 4A4HA 1N8RC 3META 3M57A 3JB9J 4JRPA 4MZPA 1M5Q1
chains in the Genus database with same CATH topology
3G6EQ 1YIJQ 1VQOQ 2QEXQ 1K9MR 1VQKQ 2QA4Q 1VQ4Q 1VQ6Q 3CCQQ 1NJIR 1VQNQ 1S72Q 1Q7YR 3CCRQ 3G4SQ 1VQ8Q 3I56Q 1Q86R 3CXCP 1K8AR 1VQ7Q 1YJNQ 3G71Q 1YJWQ 1W2BP 1QVFP 3CC7Q 1N8RR 3CC4Q 3CCSQ 3CCVQ 1YI2Q 1KC8R 1Q81R 2OTLQ 3CCJQ 1QVGP 1Q82R 3CC2Q 2OTJQ 1VQPQ 1KQSP 1VQ9Q 1K73R 1VQMQ 3OW2P 3CPWP 1YITQ 1M90R 3CCLQ 1YJ9Q 1VQLQ 3CCUQ 3CD6Q 1JJ2P 1KD1R 3CCEQ 3I55Q 3CMEQ 1VQ5Q 3CMAQ 1M1KR 1YHQQ 3CCMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E Q;  1YIJ Q;  1VQO Q;  2QEX Q;  1K9M R;  1VQK Q;  2QA4 Q;  1VQ4 Q;  1VQ6 Q;  3CCQ Q;  1NJI R;  1VQN Q;  1S72 Q;  1Q7Y R;  3CCR Q;  3G4S Q;  1VQ8 Q;  3I56 Q;  1Q86 R;  3CXC P;  1K8A R;  1VQ7 Q;  1YJN Q;  3G71 Q;  1YJW Q;  1W2B P;  1QVF P;  3CC7 Q;  1N8R R;  3CC4 Q;  3CCS Q;  3CCV Q;  1YI2 Q;  1KC8 R;  1Q81 R;  2OTL Q;  3CCJ Q;  1QVG P;  1Q82 R;  3CC2 Q;  2OTJ Q;  1VQP Q;  1KQS P;  1VQ9 Q;  1K73 R;  1VQM Q;  3OW2 P;  3CPW P;  1YIT Q;  1M90 R;  3CCL Q;  1YJ9 Q;  1VQL Q;  3CCU Q;  3CD6 Q;  1JJ2 P;  1KD1 R;  3CCE Q;  3I55 Q;  3CME Q;  1VQ5 Q;  3CMA Q;  1M1K R;  1YHQ Q;  3CCM Q; 
#chains in the Genus database with same CATH topology
 1Q86 U;  3V7C A;  1VQ4 T;  1S72 A;  1I8F A;  1PD1 A;  3M9Q A;  1MMD A;  2WSE E;  2XD0 A;  2H3E B;  1B34 A;  2EJ9 A;  3EG1 A;  4MZM A;  3HFO A;  2P84 A;  4CC4 B;  4HCB A;  1JU5 C;  2LT1 A;  3CC2 Q;  1OYX A;  1K73 R;  1VYU A;  7AT1 B;  1NJI C;  2K6D A;  1G3W A;  2CS7 A;  1WA7 A;  4M78 F;  2C0I A;  2V1Q A;  2DXT A;  3JB9 G;  2JXB A;  4GBQ A;  3NHN A;  2C0T A;  4ANJ A;  1W2B P;  1UEC A;  3EH2 A;  3NPF A;  5DLO A;  3H0I A;  4E2F B;  5GMK m;  4HVU A;  5CKH A;  2PTK A;  2DLP A;  3PTA A;  2HDA A;  3EFO B;  2D8H A;  2X3X D;  2QGG A;  2RI3 A;  4PJO B;  3HP9 A;  3MCA B;  2MAM A;  3CC7 T;  1IRX A;  4ZGE B;  2E1H A;  2PUK B;  3CC4 Q;  1AEY A;  4E47 A;  2CP2 A;  2LCS A;  1QLY A;  3JCM X;  3JCM Q;  3PGG A;  1AWX A;  4D8D A;  1LJO A;  2KVQ G;  2QYZ A;  4M75 G;  4BB7 A;  4L6V 5;  3EFS A;  1QWF A;  4M78 D;  1JO8 A;  1FMK A;  2JJ9 A;  2RHU A;  3CCR Q;  1U5S A;  2VXF A;  5I2S A;  2X3W D;  3I5S A;  4IUT A;  4HCC A;  3CCL T;  3G71 Q;  4PJO F;  2JTF A;  4C5I A;  5GAO m;  1UGP B;  4QQD A;  2G3R A;  3G4S A;  3EGD B;  3FEO A;  2RJE A;  2KY9 A;  4XU0 A;  1WHH A;  4J6Y A;  2O01 E;  3M58 A;  2DD5 A;  4A4F A;  2RF0 A;  3CCM T;  1OU9 A;  1XOV A;  2CP6 A;  2PU9 B;  5IN1 A;  3ZL7 C;  3PMI A;  2DXU A;  1WPY A;  1MHN A;  2BZX A;  4J83 A;  2P4T A;  1QKX A;  3RDV A;  2EYW A;  2COY A;  4C92 D;  3SDZ A;  2YDL A;  1VQP Q;  2DEU A;  2YWW A;  2ZGW A;  1JB0 E;  3QPH A;  2GQI A;  3FLG A;  4XTY A;  3RKY A;  1BI0 A;  2DPP B;  3G4S T;  4GLM A;  4N0A C;  4KGZ B;  1VQ8 Q;  2OTJ T;  2LQN A;  1KHI A;  2L89 A;  3SHW A;  3VS1 A;  2KXC A;  5GMK h;  2K3Y A;  2GGR A;  3PT9 A;  2DNU A;  3M0T A;  1U1S A;  2L3S A;  1BI2 A;  4JJN K;  1H92 A;  5IXB A;  3OYJ A;  5LJ3 g;  1UEB A;  2V8I A;  5LJ5 h;  2E6N A;  3GNG A;  3QHS A;  1H3Z A;  1IXD A;  4C0G A;  2EBP A;  1WLP B;  2ROL A;  1BU1 A;  5FLX E;  2P4R A;  2NUZ A;  1YJW T;  4LE9 A;  2PZ1 A;  3X26 B;  3GP8 A;  4HT8 A;  3M53 A;  5GAN h;  3M56 A;  3LYI A;  4BAC A;  4J6X A;  2XDP A;  2CDT A;  4D8K A;  1NZ9 A;  3FDR A;  1VA7 A;  3G6E Q;  1CKA A;  3EGX B;  4NOY A;  4XTZ A;  2BUD A;  3CCV T;  3DB4 A;  1UGS B;  1G3T A;  4XTU A;  2QI2 A;  4MDX A;  2CYZ B;  2X4X A;  3UT1 A;  1FMW A;  2D1X A;  5LJ5 e;  2C06 A;  1ZX6 A;  3NTI A;  1K0X A;  2VB6 A;  1VYV A;  3THK A;  2YUN A;  2QDL A;  3G6E A;  2LRQ A;  4LUD A;  1YHQ A;  3OBW A;  4C5E A;  1FMV A;  4M7D F;  1W2B S;  4M78 G;  4M75 D;  4EMK C;  1QVP A;  5AYF A;  1WFW A;  1B34 B;  4KGX B;  1M2O A;  3J7A F;  1M8M A;  2JW4 A;  3EAE A;  3M0Q A;  1FXX A;  2CSI A;  1QKW A;  1WHJ A;  1M90 R;  3OY9 A;  1H8K A;  3CCU Q;  1M90 C;  1VQ6 A;  2E12 A;  3CCS A;  1K9M R;  1NLP C;  4F16 A;  1QCN A;  1JBM A;  4R55 A;  1S1N A;  1PWT A;  3RKW A;  3V8K A;  2DIG A;  1K9M U;  1RI9 A;  2GNC A;  2EIF A;  1D3B A;  4C8Q B;  2LCL A;  2RHZ A;  1BK2 A;  4JZ3 A;  4C8Q D;  4HVW A;  3VS2 A;  2DYB A;  4BE2 A;  4AFU C;  2XDD A;  1T0J A;  4KUL A;  3KFV A;  1KQS A;  1G3Y A;  2R5M A;  3JCM b;  1UG1 A;  3OBY A;  3OS0 A;  1X6B A;  1MV3 A;  4JLI A;  1KSW A;  3M55 A;  3A8L B;  1IB8 A;  1RAC B;  2YSQ A;  2ZZD A;  2LTO A;  3P8D A;  4B9W A;  4FW2 A;  1KIK A;  1C0M A;  2GQV A;  4C8Q G;  4OMQ A;  3QYH B;  1X6O A;  2VC8 A;  2YT6 A;  1UFF A;  2X4J A;  1BIB A;  4OF1 A;  1YCS B;  2XHC A;  1I81 A;  4BI4 A;  1YIJ A;  3G4S Q;  1ZSZ C;  5GJW B;  1X75 C;  4AFQ C;  5C0M A;  5GAO p;  1QQJ A;  1HD3 A;  1MGQ A;  3PVQ A;  3L2U A;  3JB9 D;  3O8V A;  5LJ3 j;  3FB9 A;  2GCX A;  2EFI A;  1WQ7 A;  1P92 A;  4JRI A;  3OYA A;  1ZLM A;  3UWN A;  1N9R A;  1D0X A;  5CK9 A;  1M3A A;  1U3O A;  2CP5 A;  2E41 A;  1OPK A;  1RAG B;  3OMC A;  3NTH A;  5LJ3 d;  1NPP A;  2L3Q A;  4LDX A;  2EQU A;  4AG2 C;  3CC7 A;  3VYG A;  2RB6 A;  2D0N A;  3QUI A;  1V1C A;  3QBY A;  3H9N A;  1UB4 A;  2F2V A;  4GY5 A;  2ATC B;  3C12 A;  4PJO G;  2J6F A;  1Q82 U;  3JAM E;  2KSS A;  4HXJ A;  1OOT A;  3BY7 A;  3PFS A;  1U06 A;  1K8A C;  4M77 G;  2K5L A;  1RAA B;  5D7U A;  1YFN A;  3HPW A;  4RUG A;  1E6G A;  4M7A C;  2HQX A;  2MCN A;  1VQ6 Q;  3CMA Q;  1MUZ A;  2DKG A;  2QA4 T;  3G7Z A;  4JUV A;  2EYY A;  4XQ3 A;  5CIU A;  1UUE A;  3ZBD A;  2D6F A;  1XJW B;  2KI7 A;  5LJ5 f;  3PE0 A;  3E19 A;  1KD1 U;  1TXQ A;  4N4G A;  3UA6 A;  5GAN 7;  1KQS S;  2GFA A;  1F1B B;  3WVD B;  4VUB A;  1MMN A;  4BE1 A;  4KBM B;  2DJQ A;  4M75 C;  1VQO A;  3CCU T;  3CME T;  4OB1 B;  3JCM J;  2ZCF B;  1OX8 A;  3F70 A;  3JV3 A;  1OV3 A;  2DA9 A;  3JB9 H;  1KG1 A;  2W0Z A;  3LW5 E;  2JUF A;  1UGV A;  3I56 A;  4LD6 A;  2HNI A;  5GMK j;  3FIF A;  1YIT T;  1TWB A;  3R6O A;  4BY6 B;  2FRW A;  2BZY A;  1VUB A;  4RTV A;  4BDZ A;  2DK3 A;  4Y28 E;  1K0S A;  2DVJ A;  2L2P A;  2K9G A;  4DBR A;  2O9V A;  1NEG A;  5KYX A;  2DYI A;  3UPU A;  5I21 A;  3CCQ T;  1PCX A;  1K1Z A;  1MMA A;  2NYS A;  3UDC A;  1V76 A;  4J6W A;  5LL6 S;  2K79 A;  1HXD A;  1LCK A;  8AT1 B;  5GAN 2;  2KBT A;  3HRS A;  2KEA A;  3S3N A;  2XDB A;  2ED0 A;  1VQ5 A;  4Z8A A;  1VQ9 T;  1M1F A;  4OML A;  5HK3 A;  2O4X B;  4CI0 C;  2RO0 A;  2PVO B;  6AT1 B;  4PJJ A;  3A8G B;  4WF2 A;  1VIE A;  1RAI B;  3VS4 A;  3PMT A;  2D0Q B;  2SEM A;  1IHW A;  2LX9 A;  4DQ2 A;  1JXM A;  2V26 A;  1JJ2 P;  2RMO A;  3VRY A;  2IIM A;  3RUX A;  4PNO A;  3CD6 A;  4AMC A;  2P0K A;  5CKF A;  3CCU A;  1NYF A;  2AKK A;  3CBP A;  3RKX A;  1PRL C;  2F5K A;  1MND A;  1MNE A;  3EH1 A;  4JDS A;  3CCJ T;  2IVW A;  4PFZ A;  1H64 1;  5GAN 3;  4JZ4 A;  2LJ1 A;  1GCP A;  4IKF A;  5CR2 A;  3L2V A;  2RQU A;  2YRC A;  1MMG A;  2JOY A;  3M4Y A;  3X25 B;  1W2B A;  2M51 A;  3I56 Q;  4J9G A;  4WCI A;  3V7S A;  5GAO l;  4M77 C;  1YCY A;  4BI3 A;  4DOV A;  1QCO A;  1TSF A;  2MF2 A;  3CXC A;  3MP1 A;  4M7A G;  3M4G A;  4L5G A;  2NUP B;  4OMP A;  3OYC A;  1Q81 U;  3R6N A;  3U23 A;  1GFD A;  2OAW A;  5CQY A;  4JS5 A;  5KYY A;  4OMN A;  2KDS A;  4XTX A;  3BE3 A;  5M9O A;  4D6W A;  3A8H B;  2E64 A;  2LVM A;  3TQ7 P;  3HKS A;  3M54 A;  1TG0 A;  5D6X A;  1PG5 B;  2VV5 A;  1M27 C;  2DFU A;  4J8O A;  4HCK A;  1M1K R;  1VQN T;  2IG0 A;  3BFM A;  1M1K C;  1VQN Q;  2LCC A;  5DM7 R;  3G71 T;  2E5Q A;  2AIR B;  2V1R A;  2O9S A;  1OZ3 A;  1TU0 B;  1ZA2 B;  3I5R A;  1GBR A;  3FJP A;  3HFN A;  2EGE A;  2RJC A;  1Q81 C;  2QQB A;  1E7O A;  2D8J A;  2RQT A;  3VS0 A;  3CCS T;  2MPX C;  2FO0 A;  3VUB A;  3C4S A;  1VQP A;  3X20 B;  4ZTJ A;  1EZZ B;  2K5F A;  4BI8 B;  3CEY A;  4GLK A;  5I11 A;  2DBK A;  5GAM e;  2M0Y A;  1XQH A;  3OYD A;  3GOX A;  1VQM A;  1D0Z A;  4R56 A;  4OP0 A;  1WJS A;  2CP7 A;  2A36 A;  3EHQ A;  1AWO A;  4C8Q C;  1KD1 R;  3X24 B;  1TUD A;  1YBY A;  2A08 A;  2FYK A;  2M9U A;  3FC3 A;  2DTO A;  2KRN A;  4QT7 A;  4M7A B;  1KJW A;  1WXT A;  3QJ6 A;  3NMZ C;  2O88 A;  2MK5 A;  2EQM A;  4A4K A;  1JXO A;  2CP0 A;  2YHT A;  2DL3 A;  1Q7Y C;  3O5Z A;  9ATC B;  3MJX A;  4RCC A;  1QMC A;  2XI9 A;  3QXE B;  4JS4 A;  1JEG A;  1TOV A;  2XG8 D;  2CP3 A;  2NUP A;  4C92 B;  4F7U F;  5IAY A;  1QW1 A;  4IUP A;  4FU6 A;  2A0F B;  1I0C A;  2RQW A;  2DVE A;  2VXE A;  2KR3 A;  4ZGJ B;  3BDL A;  2WAC A;  3JB9 I;  1IGQ A;  1XNI A;  2QQR A;  5EC7 A;  4DA4 A;  3H0F A;  4TVR A;  3I55 A;  4V2S A;  4RTY A;  3QYG B;  3ULR B;  3PIP A;  2EAY A;  1ZUK A;  2CT3 A;  1AHJ B;  3A8O B;  1MV0 B;  4PK4 A;  2KAF A;  2YUQ A;  3VS7 A;  2HMA A;  1LNX A;  1VQL A;  2VGN A;  1WYX A;  3MP6 A;  1BYM A;  4RMO A;  4XU3 A;  1ABQ A;  1O9S A;  4OB3 B;  2XK0 A;  2YLB A;  3MP8 A;  2AZS A;  5A0G A;  2DZ9 A;  2JN0 A;  4F17 A;  1UTI A;  2E3H A;  1UGR B;  3CMA T;  4KH1 B;  4JRK A;  4O5V A;  3TCJ A;  1ACM B;  4C8Q A;  1PRM C;  2KYB A;  2JZ2 A;  4EMH A;  1K9A A;  2EGC A;  4J5Y A;  5L8R E;  2AZV A;  3CC7 Q;  4P5N A;  4M7A A;  2JVV A;  1AOJ A;  3CC2 A;  5FRM A;  2P0P A;  1WX6 A;  2A7Y A;  5J3B A;  3G1J A;  2NWM A;  1M4Z A;  3QWY A;  3MKD A;  1YN8 A;  1XTD A;  3KBG A;  3OS1 A;  1SSH A;  4X1V A;  1YJW Q;  1KFZ A;  4FW1 A;  3N5B B;  2GF7 A;  3S3M A;  1NEB A;  1CKB A;  3CCJ Q;  4CC7 A;  2OX7 A;  3ZEH A;  5GAN e;  1Q95 G;  4RTT A;  2CSQ A;  2X9H A;  1Y57 A;  1JRI A;  1Q7Y U;  4ZTF A;  1AT1 B;  2VYT A;  2EW3 A;  2EJF A;  5IHI A;  2Y90 A;  3CCV Q;  3DB3 A;  1JJ2 S;  1EX4 A;  1UGQ B;  2DZC A;  2NUT B;  4KRT A;  3EGX A;  3SB2 A;  4LDU A;  3OYH A;  2M0O A;  1A0N B;  1IGU A;  2ROT A;  3EG9 A;  3L42 A;  2AHJ B;  4OMM A;  2J05 A;  3L2W A;  4M77 B;  3RER A;  3LH0 A;  2ECZ A;  1X2K A;  4XAX B;  1UJY A;  2J6K A;  2L5Q A;  4CRI A;  3CCM A;  3JCM d;  1W6X A;  2KNB B;  1IZ6 A;  2JTM A;  3REB B;  3MEA A;  2I0N A;  4E7S A;  4M78 E;  1D1A A;  2OJ2 A;  3CCE Q;  2ZPF B;  3OW2 A;  1V29 B;  1R8O B;  3OS5 A;  4QQG A;  4ATO A;  2K57 A;  2X35 A;  5GAM h;  1BI3 A;  1J3T A;  4BUG A;  1SKU B;  5LJ3 h;  1M2V A;  4A53 A;  2FZK B;  2CZ0 B;  3FRN A;  3MEV A;  4PKC C;  2HBP A;  2ED1 A;  1YJ9 Q;  1VQ9 A;  2LDM A;  2B8A A;  1KHC A;  2MIO A;  1JQQ A;  4E7H A;  2EQI A;  3KUF A;  2RI2 A;  1NM7 A;  1I07 A;  4CC2 A;  2GBQ A;  3EGU A;  4C92 E;  3CCL A;  1YJN Q;  4C92 G;  4CC3 A;  4M4Z A;  1OPL A;  2LNH B;  2Y4X A;  2ZPB B;  2QGF B;  4PJO C;  3JRZ A;  3PNW C;  2LJ0 A;  3Q1J A;  3CCQ A;  4FCY A;  2J7I A;  1GFC A;  3UA7 A;  2YRD A;  1H3H A;  3CD6 Q;  1Y7X A;  3WVE B;  1KQ2 A;  3MEU A;  1OX9 A;  5DY9 A;  2CUD A;  5GAO n;  1QVG A;  1Y96 A;  4M78 B;  1K9M C;  3J81 E;  2K5I A;  4JJD A;  1VQK A;  2LZ6 B;  3CD6 T;  2NLU A;  4RG8 A;  3CXC S;  1T0H A;  1SHG A;  2L3P A;  4M7A D;  2LC4 A;  4N4H A;  4R0K A;  4J9B A;  4FL6 A;  2PVG B;  2VKN A;  4FYW B;  4DBQ A;  1SEM A;  2DXC A;  3CBM A;  5FU7 C;  2K4Y A;  1VQK T;  3P8B B;  3QWX X;  4BD3 A;  2OI3 A;  1RAE B;  1VQ8 A;  2KXD A;  2CT4 A;  3MHX A;  3OYK A;  2BE9 B;  4FSS A;  4J9H A;  1X27 A;  1N8R R;  1G8X A;  1OQK A;  1O75 A;  3EG3 A;  3BDU A;  3EFO A;  4II1 A;  4M7D E;  4AFS C;  1WIE A;  4M77 E;  4C92 F;  4F7U B;  3GPL A;  2XID A;  5HKC A;  4F7U G;  5KE2 A;  1D09 B;  4ZNX A;  1WHK A;  3RES A;  2YLC A;  4PFP A;  1ZSG A;  3V7R A;  2LMJ A;  1M9S A;  4MMK A;  4AG1 C;  2J6O A;  1Y07 A;  2LQK A;  4WTO B;  4E6R A;  2DM1 A;  3J80 E;  8ATC B;  5GAO q;  2HQE A;  1VQ7 Q;  2QEX A;  3M59 A;  1W4S A;  4EMK B;  5FWC A;  4E7I A;  2ZPI B;  1N6A A;  2CH4 W;  1WZO A;  2DJZ A;  2G6F X;  5EG2 A;  2EWN A;  2ZPH B;  2RK1 A;  1OI1 A;  3LGL A;  2DO3 A;  1X01 A;  3M0P A;  3OYG A;  2QTX A;  1YI2 A;  3CPW A;  5J26 A;  3G71 A;  4E7Z A;  1Q81 R;  2QK0 A;  3ER0 A;  3JSC A;  1UE9 A;  1VQ9 Q;  2LP5 A;  1VQ4 A;  2ESW A;  1VQ5 T;  2F2X A;  2IPO B;  1ZHI A;  1BB9 A;  3JCM f;  5IH2 A;  4DOW A;  2VGM A;  4QVC A;  2QAS A;  5LJ5 d;  1NG2 A;  3CC4 A;  1Y0M A;  1G2B A;  1WDX A;  2OTL Q;  2VAS A;  1NYG A;  4C8Q F;  4PJL A;  3HL8 A;  2KQW A;  2KRS A;  2ZPG B;  2K2M A;  1VQL Q;  4M7D C;  2CZ1 B;  1ZSZ B;  2DL4 A;  2FPD A;  4EPC A;  1Y71 A;  1T3S A;  3LH5 A;  5FW9 A;  1AD5 A;  3OSS C;  3E1S A;  3A5Z B;  3C95 A;  4ME7 A;  2JTE A;  1KC8 C;  2O2O A;  1IO6 A;  5I22 A;  3OYI A;  1C1A A;  1WQW A;  4HCZ A;  2EYZ A;  4M75 B;  2BKD N;  2L8D A;  5CAI A;  2HEQ A;  1PKS A;  3H6Z A;  4J7I A;  4IUU A;  3V8J A;  2QA4 A;  1PSE A;  4AT1 B;  5HCK A;  4J9E A;  4LXC A;  3SWN A;  3TRE A;  4IIO A;  1EFN A;  3EGD A;  1VOM A;  2E70 A;  2ZAE A;  1SRL A;  3ME9 A;  1VYT A;  5KCH A;  2LX7 A;  2F1L A;  3H8Z A;  3JCM W;  4C0Z A;  4BE0 A;  5A2Q E;  1T3L A;  3A1P A;  5D6W A;  2F5T X;  3CPW P;  2DET A;  3SWN B;  2LNV A;  2FPE A;  2BIV A;  3GF5 A;  2EYX A;  4IIM A;  3M0U A;  2RQR A;  2MI6 A;  1NBE B;  2D9T A;  4KUI A;  1VQO T;  4FT2 A;  1FWZ A;  1SPK A;  4A4G A;  2BTT A;  4PJO A;  2EPD A;  5HK0 A;  1M3B A;  4J9D A;  1TUG B;  1YJ9 A;  2PUO B;  3M0R A;  1ZSZ A;  3QJY A;  3KXT A;  1BIA A;  2E65 A;  3WXM B;  2FEI A;  4DBH A;  2RN8 A;  1Q7Y R;  1QVF S;  4MDW A;  4ORZ A;  1Y96 B;  4M78 A;  4Y91 A;  1ABO A;  3L2Z A;  2K3X A;  2OTJ A;  2HSE B;  3UAT A;  4OGE A;  2PQW A;  5FU6 C;  2AT1 B;  2COZ A;  3EG2 A;  2LJ3 A;  3VS3 A;  1GRI A;  4ZN3 A;  1D1C A;  5GAN 6;  2MMP A;  3OYE A;  2QQA A;  2L3R A;  4E7J A;  3OA6 A;  5GAN 8;  2OTL A;  5GAN 5;  2OTJ Q;  4M77 A;  3HRT A;  4BY6 C;  4HT9 A;  3OW2 P;  2KE9 A;  3EG9 B;  4C0F A;  1WXB A;  2CGH A;  2QG9 B;  3OYL A;  2JM8 A;  4DBF A;  2CZ7 B;  1VQK Q;  3INZ A;  3RIR A;  3CCR T;  1WGS A;  2OTL T;  1PC0 A;  5FRN A;  4J9F A;  1HK9 A;  2RJD A;  2V8K A;  1KQ1 A;  2LQ8 A;  1FX7 A;  1B3Q A;  2JS2 A;  4J7F A;  1GCQ C;  1ZBJ A;  4E7K A;  3HRU A;  1NJI U;  3CME Q;  1YJ9 T;  1K73 U;  5L23 A;  2RJF A;  2OAU A;  4F7U A;  1YP5 A;  5KCO A;  1YNZ A;  3CXC P;  2RD1 A;  1YWP A;  2CKK A;  4MML A;  4LDY A;  3I56 T;  1GBQ A;  2YXY A;  2XKO C;  3HHT B;  4J9C A;  2FRY A;  2R57 A;  2HZY A;  3X28 B;  1K76 A;  2RM4 A;  3CME A;  1LPL A;  3TSZ A;  2V8J A;  2QEX Q;  1RI0 A;  4EMK A;  4M7D A;  2BZ8 A;  3OMG A;  3QSU A;  1VQ6 T;  1X6G A;  4PJO E;  3DLM A;  5CKB A;  1VIF A;  2RHY A;  4PFO A;  5FWB A;  3I35 A;  3LX7 A;  1R0C B;  1AZG B;  1VQM Q;  4FYX B;  1X69 A;  2DL8 A;  4F14 A;  2JS0 A;  1GXI E;  2K2V A;  2FPF A;  5GMK i;  1QVF A;  1QWE A;  3REA B;  1ZA1 B;  2DAQ A;  4RTX A;  3VJP A;  1RAB B;  4EDU A;  1KC8 U;  2AK5 A;  5KYW A;  3S6W A;  4EIK A;  1D0Y A;  4M7D D;  2MWO A;  3GLX A;  3CCV A;  3V8L A;  2C0O A;  1M2V B;  2JT4 A;  2A37 A;  4LNP A;  5LJ5 g;  2A3L A;  2YRV A;  1QVG S;  4M7A F;  1B7T A;  4J9I A;  1LVK A;  1SHF A;  4Z02 A;  1YJW A;  3LWI A;  3CCJ A;  1SG5 A;  4C8Q E;  3QZ9 B;  1YIJ Q;  4N0A A;  3UF4 A;  1UJ0 A;  2A28 A;  2EJG A;  3QII A;  1UHF A;  4LD9 K;  1AZE A;  4QVZ A;  4ELY C;  1AVZ C;  1K8A R;  2KK4 A;  3CC4 T;  4M7A E;  1D1B A;  3SD4 A;  2E10 A;  1M8V A;  1AWW A;  4O6J A;  1ZUY A;  2MWP A;  2CRE A;  4FT4 A;  4HVV A;  3C0C A;  5KYU B;  5IXF A;  4HA8 A;  3RNJ A;  3AHU A;  4C0D B;  1PSF A;  2NUT A;  3OYF A;  2DD4 A;  5J39 A;  4FYY B;  1JJ2 A;  5KYN A;  1PD0 A;  2CH4 A;  2RI5 A;  3NGP A;  2YUO A;  3P8H A;  5GAN d;  2KGT A;  2YUP A;  2E5K A;  5CQX A;  4M77 D;  3VS5 A;  4ESR A;  5GAM f;  3I9Q A;  3QKJ A;  2KMT A;  4DEX A;  4QVD A;  4M7D G;  1NLO C;  3AT1 B;  3MO8 A;  4NL3 A;  3CCM Q;  3JB9 F;  2ENM A;  1BKB A;  4N4I A;  3SWN C;  4MZT A;  2KT8 A;  1GCQ A;  2K3B A;  4Z88 A;  5LJ3 f;  3QG1 A;  1RAH B;  1K4U S;  4B9X A;  1OUL A;  3CCE A;  1WHM A;  4C5H A;  2BE7 D;  2PVD B;  4QW2 A;  2HBW A;  1Z9Z A;  2DL7 A;  2KRO A;  3I55 T;  1I5L A;  4KT0 E;  3URG A;  1TH7 A;  5HY6 A;  4OMF B;  3GBQ A;  4OB2 B;  4RCB A;  3I55 Q;  2VVK A;  3IQL A;  4FSX A;  1OEB A;  3JCM h;  4IUQ A;  4FIB A;  1IRE B;  1YJN T;  1M1G A;  1VQP T;  1G5V A;  4RG2 A;  2F2W A;  4M77 F;  4Y92 A;  4OVA A;  2LQW A;  3M5A A;  1YJN A;  3OQ5 A;  4LDV A;  1G3S A;  1CSK A;  4UC4 A;  3D7S B;  1VQO Q;  2RQV A;  1NJI R;  4BDY A;  4OGC A;  5GAM d;  3OS2 A;  2H3J A;  2DL5 A;  4A4E A;  2DTI A;  1PHT A;  2HCK A;  4L59 A;  4X34 A;  5LJ5 j;  2M02 A;  2B86 A;  5CKE A;  5GJV B;  5I2M A;  3E9F A;  2QDY B;  2I2L A;  2P0Q A;  2X51 A;  2XIC A;  3CCR A;  3LGF A;  2LT4 A;  4FM4 B;  2RNA A;  1OZ2 A;  1W1F A;  1ARK A;  4YTL A;  4JRQ A;  2PNI A;  2DE0 X;  3SFM A;  2DIL A;  5ECA A;  3JCM P;  5DLQ E;  3QZ5 B;  3CC2 T;  2FHD A;  5GAN 4;  2JMA A;  2FZG B;  1ZUU A;  3JCM g;  4EMG A;  4F7U E;  2MYS A;  4A54 A;  1YWO A;  2E6Z A;  1K73 C;  1BCO A;  3JCM V;  2HL5 C;  3QDF A;  2R58 A;  2DRK A;  3TEE A;  1UHC A;  3DKM A;  1PKT A;  4LN2 A;  2FZC B;  2HKQ B;  1Q86 C;  2DMO A;  5GMK e;  1QCF A;  3QO3 A;  2VWF A;  4K11 A;  3PVL A;  4C5G A;  5GAN j;  1RLQ C;  5KYW B;  1C6V X;  2RA2 A;  2HSP A;  1VQ5 Q;  2EKH A;  4M78 C;  4B6M A;  1HYO A;  2X4Y A;  2E3I A;  5FU6 B;  2FVU A;  3ZFJ A;  5FRO A;  5C6S A;  5KE3 A;  1G83 A;  4LDW A;  3A8M B;  4QQ6 A;  5A0D A;  1N9S A;  3NFC A;  1HSQ A;  1M90 U;  3VKI A;  3H0H A;  4JLG A;  4C92 A;  5D6Y A;  1YIT Q;  3LLR A;  3CCL Q;  1TTH B;  1WHG A;  3E2U A;  3VV0 A;  3RBB B;  1WJQ A;  3OYN A;  4QKU A;  1VQ4 Q;  1U1T A;  3MEW A;  2O4X A;  3M0S A;  3OB9 A;  1B07 A;  2E4H A;  1BCM A;  2QQ9 A;  1U8R A;  1WI7 A;  3OYM A;  4OMO A;  2JNG A;  1KC8 R;  4KUD K;  4PJN A;  4M7D B;  3HTR A;  1Z9Q A;  2RHI A;  4HKE A;  3VU3 C;  2DF6 A;  5LJ3 e;  1VQ7 A;  1YIT A;  1R0B G;  2HL3 A;  4XTV A;  1EIF A;  3EG0 A;  2VUB A;  3OSV A;  4E7L A;  1WJR A;  1BI1 A;  4KH0 B;  5KYX B;  3E9G A;  5GAN f;  2KRM A;  5IHK A;  2QTV A;  3JCM c;  2DRM A;  3EFR A;  1X43 A;  3T9N A;  4Q5W A;  2O31 A;  5GAM j;  1I4K 1;  3CMA A;  1QVG P;  5AT1 B;  1GL5 A;  5KYY B;  3CBO A;  2WSF E;  1RAD B;  4PJO D;  4X9D A;  1X2Q A;  5IT9 E;  1N27 A;  1AWJ A;  2QQS A;  1VQ8 T;  4JJB A;  5CCA A;  3MPU B;  1M30 A;  1QP2 A;  4ZN1 A;  5KH6 A;  2QA4 Q;  2EQK A;  3ASK A;  1HJD A;  2FG0 A;  1M1K U;  5A0L A;  1DJ7 B;  2K7A A;  4DEY A;  2M16 A;  2DER A;  3TSW A;  1N5Z A;  2RH2 A;  3VS6 A;  4JPB W;  4XK8 E;  2Z0W A;  4XU2 A;  2COW A;  4RTW A;  2DIQ A;  3TVT A;  1UDL A;  1NE8 A;  2DTH A;  5KYU A;  1RLP C;  4JJC A;  4OB0 B;  5GMK l;  4ZGD B;  2EQJ A;  2Y4Y A;  1IHV A;  4X9C A;  2KT1 A;  4M75 F;  3RMS A;  1BBZ A;  3CQT A;  1Q86 R;  5CO7 A;  3JCM e;  5FU7 B;  3RMQ A;  1FYN A;  2DEQ A;  2H8H A;  2GFU A;  5GAO r;  1KQS P;  4RTZ A;  3TU4 K;  3H41 A;  3CPF A;  3L1A A;  3G6E T;  3C94 A;  2FB7 A;  3OW2 S;  2ZPE B;  2RPN A;  4PLL A;  1VQ7 T;  1LOJ A;  1I1J A;  3CCQ Q;  1YIJ T;  3FJ5 A;  4RKU E;  4IUV A;  2ABL A;  1WNL A;  2EGA A;  1K8A U;  1SSF A;  4Z89 A;  2XMF A;  1QP3 A;  2XU8 A;  1WXU A;  2GTJ A;  3PIO A;  1WHL A;  4NS5 A;  1Q82 C;  1R77 A;  4M75 E;  3GIB A;  3QDR B;  1SF9 A;  2HKN A;  5GAM g;  2QAZ A;  4PL6 A;  3BW1 A;  1ZQ1 A;  4A63 B;  2MOX A;  1QVF P;  4PJM A;  2HD0 A;  5CKD A;  3HSB A;  1RL2 A;  2CZ6 B;  2EYQ A;  3LWH A;  1NPR A;  3VYH B;  4NL2 A;  3DLL A;  4PLI A;  1PNJ A;  1ZBX A;  2M1H A;  3S3O A;  1VQL T;  1OU8 A;  3GNF B;  2GTO A;  4C0D C;  2SRC A;  2EKO A;  2EVR A;  3L2Q A;  2RHX A;  3CCS Q;  2J06 A;  2F69 A;  3SEM A;  5CVI A;  1SRM A;  2HAX A;  2KYM A;  1Q82 R;  4C92 C;  2R5A A;  4IUR A;  1VQN A;  2DBM A;  1M3C A;  2FL7 A;  2JMC A;  4KGV B;  2RK2 A;  2W10 A;  3CPW S;  4XU1 A;  4AFZ C;  2QXF A;  2DXB A;  3VUZ A;  2AKL A;  2HQH A;  4M75 A;  3OYB A;  1YHQ T;  1RUW A;  2WSC E;  2X4W A;  1TS9 A;  3RR6 A;  3VRZ A;  1TUC A;  2JM9 A;  1VQM T;  4LUE A;  3NTK A;  2L0A A;  4RTU A;  2DX1 A;  3CCE T;  1E6H A;  5GAN g;  1YHQ Q;  3OYY A;  1RAF B;  1PM3 A;  1S72 T;  3EHR A;  4XTW A;  1D3B B;  2QEX T;  1S72 Q;  1KK7 A;  3A98 A;  1YI2 T;  4FYV B;  3L2R A;  4ELZ C;  2CUB A;  5IHN A;  1YI2 Q;  1I5O B;  4F04 B;  1W70 A;  1N8R U;  1KD1 C;  4A4H A;  1N8R C;  3MET A;  3M57 A;  3JB9 J;  4JRP A;  4MZP A;  1M5Q 1; 
#chains in the Genus database with same CATH homology
 3G6E Q;  1YIJ Q;  1VQO Q;  2QEX Q;  1K9M R;  1VQK Q;  2QA4 Q;  1VQ4 Q;  1VQ6 Q;  3CCQ Q;  1NJI R;  1VQN Q;  1S72 Q;  1Q7Y R;  3CCR Q;  3G4S Q;  1VQ8 Q;  3I56 Q;  1Q86 R;  3CXC P;  1K8A R;  1VQ7 Q;  1YJN Q;  3G71 Q;  1YJW Q;  1W2B P;  1QVF P;  3CC7 Q;  1N8R R;  3CC4 Q;  3CCS Q;  3CCV Q;  1YI2 Q;  1KC8 R;  1Q81 R;  2OTL Q;  3CCJ Q;  1QVG P;  1Q82 R;  3CC2 Q;  2OTJ Q;  1VQP Q;  1KQS P;  1VQ9 Q;  1K73 R;  1VQM Q;  3OW2 P;  3CPW P;  1YIT Q;  1M90 R;  3CCL Q;  1YJ9 Q;  1VQL Q;  3CCU Q;  3CD6 Q;  1JJ2 P;  1KD1 R;  3CCE Q;  3I55 Q;  3CME Q;  1VQ5 Q;  3CMA Q;  1M1K R;  1YHQ Q;  3CCM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...