3OW2P

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ow2P00
3CCUQ 1Q82R 3CMAQ 2OTLQ 1QVGP 3CCMQ 1NJIR 1VQ7Q 1YJWQ 1YI2Q 3G4SQ 1S72Q 1VQ9Q 3CCVQ 2OTJQ 3CC2Q 1VQNQ 1YJNQ 1KQSP 1VQKQ 3CCJQ 3CCRQ 1W2BP 1QVFP 3CC7Q 3CPWP 3I56Q 1M90R 1VQ8Q 3CD6Q 3OW2P 1N8RR 1M1KR 3CC4Q 1KC8R 1VQ5Q 1VQOQ 3G71Q 1YIJQ 1YJ9Q 1Q7YR 3G6EQ 1K73R 1Q81R 3CCSQ 1VQLQ 1KD1R 2QA4Q 1VQ4Q 1Q86R 1VQMQ 1K8AR 1VQ6Q 1YHQQ 3CCLQ 3CXCP 2QEXQ 3CMEQ 1JJ2P 1YITQ 1K9MR 3CCEQ 3CCQQ 3I55Q 1VQPQ
chains in the Genus database with same CATH superfamily
1ZSGA 4RTZA 2OTLQ 5KYYB 1D1AA 5CKFA 4BB7A 4PJOD 3GBQA 2LJ3A 4XTWA 3KXTA 3VRZA 2EGEA 2DXCA 3J81E 3H0FA 4ZGJB 5LJ5j 4ZGDB 1Z9QA 4PFZA 4QW2A 3VUZA 3G4SA 3QIIA 2DYIA 4EDUA 3HRSA 4FYVB 2GFAA 1VQ4A 2NUZA 4M75E 4HA8A 2CREA 4IUUA 1WXUA 4Z02A 3TQ7P 2JMAA 1M3AA 2EQJA 2L3PA 1N27A 2W10A 2XHCA 2ZPHB 4BUGA 3LH5A 2FZCB 4KGZB 4M78E 4B9XA 1SKUB 5HCKA 4XTXA 4MZTA 4PJOG 1JJ2S 1SEMA 4ATOA 1UFFA 2RMOA 2V26A 2WSEE 4M7AB 3OYAA 2PUOB 1FX7A 3A8MB 3CC7Q 1LCKA 3PFSA 1UECA 1K73C 4PFPA 1VQ5Q 4BE2A 4LN2A 4E7JA 3REAB 2OTJA 2CH4A 3C12A 4PL6A 4JJDA 1WXBA 3LWHA 4LE9A 4PJOC 3M0TA 4Z89A 1TUDA 1QVFA 2AK5A 2V1RA 2YUNA 1PSEA 2XICA 2K5LA 3DLMA 4HVWA 5IHKA 4OMQA 1RI0A 4NL3A 4BI4A 2L2PA 1VQOT 4OVAA 4JRPA 2K57A 5AT1B 3DKMA 2E65A 4OMNA 2ED0A 1H3HA 5KYWB 2F5TX 4ZGEB 4DOWA 1PHTA 5AYFA 4O6JA 5GAN4 2F1LA 1X75C 5GAN5 2LX7A 2CP5A 2DTHA 2LTOA 3EG2A 3M54A 3M55A 4M77B 4PJLA 3EGDB 3M5AA 3PVLA 1ZA1B 2KDSA 5GANj 4OP0A 1ZLMA 2DVEA 2YRVA 1B34A 1QP3A 3M0SA 3L2RA 1BI2A 5LL6S 1GFCA 2EYXA 2HBWA 2QTVA 6AT1B 3RMSA 4PJMA 3E2UA 4JRKA 4M78G 2CSQA 1VQ9A 1Y96A 2G6FX 4ELZC 1LNXA 5GAOl 2WSCE 4X1VA 5GAOr 1M2VA 3CMET 3H6ZA 2DD5A 2CP3A 2CS7A 3BY7A 2QQ9A 1QWFA 5DY9A 5GANd 1WHKA 4FYYB 1TUGB 3LX7A 2BZYA 3OYJA 2M9UA 2DETA 2O9VA 3CCEA 4LDYA 3JCMb 2XU8A 4CRIA 1MMNA 2PTKA 3C4SA 4M78C 1BCMA 1FMWA 3VRYA 2W0ZA 4OB3B 4N4IA 1RAFB 1RABB 2JVVA 3CCUQ 3FJ5A 5CQYA 3OYKA 5GAMg 2RHYA 1BI0A 4OMPA 1G3SA 5HK3A 4C8QE 2QA4A 2RI3A 4LXCA 3G4ST 4IUPA 2DXUA 4J6YA 2COYA 3EG0A 2XDPA 3I56Q 2XD0A 1Y57A 4XAXB 1Q81C 1N5ZA 4IUTA 1NEBA 5I11A 1ZQ1A 1VQ4T 3PMIA 4XTZA 1VQ6Q 1N6AA 3CXCP 3C95A 3EFRA 3VS1A 4HCZA 4F7UE 3EG3A 4RCBA 5KH6A 4F16A 2A28A 2M02A 1M1GA 2LT1A 4J9CA 4ORZA 3A98A 2QAZA 2YHTA 1D0ZA 3G7ZA 2HQEA 1QVFS 3RMQA 1WLPB 2CZ0B 4AG1C 3CPWS 2E3HA 3NTKA 3FC3A 3CCJA 5IAYA 2EKOA 2RA2A 4B6MA 3M4YA 4IURA 1M3CA 3G71A 2ESWA 2DYBA 2OTJT 5CKDA 2EJ9A 4BI3A 1NBEB 3ULRB 2OJ2A 1H92A 1W2BA 2GNCA 3SEMA 1YHQT 3PVQA 1ZHIA 4LD6A 1R0BG 1PM3A 2QTXA 4KUDK 4JJBA 1X6GA 1BK2A 2EWNA 2DL8A 1PKTA 4CC7A 3MEWA 2X4XA 1E7OA 4GLMA 2HSEB 3OYMA 2LC4A 4M7AE 1ZUUA 4DBHA 1WHLA 1KD1R 1A0NB 1IO6A 1VQKA 2D0NA 1TU0B 1RLPC 3OS0A 1K9MR 2R5MA 3HP9A 4FSXA 3JCMJ 1VQPQ 4QVZA 3DLLA 1PNJA 1ZSZC 3HRTA 1X43A 1G2BA 1B3QA 1OYXA 2EGCA 2DVJA 1G3YA 1U3OA 3M58A 1VQ7A 1YN8A 3TREA 1K8AC 1B34B 3Q1JA 1QQJA 4AT1B 2KR3A 4J6XA 5IH2A 1WJRA 5GMKj 1FXXA 2CYZB 2GQIA 3QPHA 4M7DF 3CC4A 2MYSA 2AT1B 1C6VX 1VQ9T 4A63B 3OA6A 2LJ0A 1AOJA 4PNOA 2O2OA 1IB8A 1Y96B 3LGFA 2QDLA 1ZSZA 5LJ3e 1M2VB 1K9AA 4BY6B 4ME7A 4MZPA 5ECAA 3OW2S 4BDYA 5A2QE 3VJPA 1WHHA 2E5QA 2MCNA 4X9CA 2QG9B 1B07A 3CCET 2R57A 3CBMA 2IVWA 2MK5A 3OY9A 1I81A 2COZA 4RTVA 2JMCA 4PLLA 3H9NA 3LH0A 5LJ3h 4OB2B 3C94A 1YJ9Q 4OMFB 3EFSA 2QA4T 1T3SA 5GANg 2D0QB 3OMCA 2O88A 1VOMA 5GMKm 2PQWA 1MHNA 1NLOC 1M27C 1Q7YU 4XK8E 4RTYA 2FL7A 2RO0A 2VB6A 3X25B 3I55Q 1Q82R 1U5SA 3G6EA 4BE0A 3BW1A 2P4RA 1VQNQ 1BIBA 2MI6A 2O31A 1E6GA 2QXFA 5KYYA 1Y7XA 3M57A 2LZ6B 1UUEA 2F2XA 2HD0A 2VKNA 1NPPA 1M1KR 1VYVA 4JLGA 3WVEB 1IHWA 2ENMA 4M77D 1X69A 3F70A 1M8MA 2MAMA 3PIOA 3J7AF 4N4HA 3FEOA 2CZ7B 2CP2A 1M4ZA 4E7IA 2E5KA 2LQ8A 4KBMB 5IXBA 3QO3A 3GIBA 4UC4A 3ZBDA 3GF5A 3EH2A 3UPUA 4RG2A 1OZ2A 4L59A 3G71T 1PD0A 4DBFA 2K2MA 3AHUA 2KAFA 1TOVA 2NUPA 1F1BB 2CH4W 4C0DC 3E19A 2VASA 2RK1A 3JB9J 4XTVA 1S72Q 3OB9A 3OQ5A 1QVGS 4EMKA 2DIQA 2RHZA 5A0GA 4FM4B 4KULA 1PKSA 4IIOA 3J80E 2FO0A 3QZ5B 2P0QA 4M77G 2YLCA 4V2SA 1SF9A 2RQRA 3BE3A 4E7HA 1PC0A 3JCMh 4PJJA 3CD6A 2HBPA 3R6NA 1NJIC 2BE7D 1KD1U 3M59A 4PKCC 3JB9I 1GL5A 5HY6A 1TXQA 3OSVA 1VQKT 2MWOA 2EYYA 1AWXA 5I2SA 1YITA 5FLXE 2HZYA 3MEVA 3HSBA 3H0IA 3EG9A 1OEBA 4M77C 3CCSQ 5GAOq 2JXBA 3JB9F 1VIEA 1KQ2A 4FT4A 1N9SA 1VQ7T 3VYHB 3JSCA 3LLRA 2ECZA 4IUVA 2Y4YA 2L3QA 3CCRQ 1RLQC 4J83A 5KYWA 1PWTA 4HT8A 3JV3A 4J7FA 2OTLA 3CC4T 1YJWA 4OMLA 2LMJA 1JBMA 3META 2RB6A 4RTUA 4M77A 4A4GA 1W2BP 3JCMf 1SRLA 4E7ZA 5GAN8 1QKWA 2XKOC 2XG8D 1X6BA 2E6NA 1FMVA 2LNHB 2X9HA 1YJNQ 4PJOE 1QVPA 1T0JA 2ED1A 1OPLA 4R55A 3A8LB 1RAHB 3QDFA 3CXCA 2KT8A 4RTXA 5GAN7 1BYMA 4KH1B 1QWEA 3C0CA 4C92F 3UA7A 2C0TA 2RJCA 2DLPA 3OMGA 1IGQA 2DMOA 2RNAA 2KVQG 1U8RA 1UDLA 1VQLA 1WNLA 3OYDA 1M90C 4WF2A 1VQ8Q 2LQNA 2A08A 3JCMQ 4ESRA 2RI2A 4QKUA 8ATCB 3G6ET 2GTJA 2EYZA 2K6DA 5GJVB 3PGGA 1M1KU 1W1FA 3IQLA 4MDXA 2DZ9A 1TH7A 1WIEA 1B7TA 1VQ5A 1IGUA 2ROTA 2LT4A 2Y90A 4XU1A 2DKGA 3MEAA 2EYQA 3JAME 2X4JA 3QJ6A 4B9WA 2V1QA 1VQOQ 1KHIA 3A8GB 1AZEA 1YCSB 1W70A 2PUKB 3HRUA 3KUFA 2KY9A 2RJDA 3CCMQ 3KFVA 3HPWA 2ABLA 2HNIA 5GAOn 3JRZA 4E7LA 1N8RR 2NUPB 1JXOA 2D9TA 3CCLQ 2M1HA 5GAN3 3MJXA 2DERA 3EG1A 3CMAQ 4EMKB 4OB1B 2JTMA 4F04B 1TWBA 3CBPA 1XJWB 4NL2A 1BKBA 5GAN2 2RM4A 1BCOA 2VVKA 4VUBA 3CD6T 1WHMA 2OAUA 4J9HA 2HDAA 2VYTA 4EMGA 4KUIA 1NM7A 3O8VA 1JO8A 2VXEA 4CI0C 4M75F 2MIOA 3CMEQ 1X01A 2KYMA 1YITT 1KG1A 2EAYA 1T3LA 3R6OA 1IREB 2VV5A 4C0DB 5A0DA 2BE9B 1WQWA 2CT3A 4JJCA 1QW1A 1NZ9A 3EG9B 5A0LA 1YHQA 2DL4A 2RHIA 4M78F 7AT1B 1PD1A 3URGA 1RUWA 2E4HA 4CC2A 1AHJB 1OQKA 4HVUA 4Q5WA 5GAMe 2FPDA 3CC2A 3M4GA 3PNWC 2CSIA 1PG5B 4L5GA 1ARKA 5DLQE 1G5VA 1X2QA 3CXCS 2OTLT 4AG2C 4CC4B 2JTEA 1UHFA 1YJWT 1YI2Q 3G4SQ 4C92A 2HL3A 2D6FA 3NTHA 3RBBB 2BZXA 2ROLA 1R0CB 1WFWA 4BY6C 1KSWA 4FYXB 2DNUA 1K9MC 1VQMQ 3OS5A 1OZ3A 3AT1B 1S1NA 3RESA 3RERA 3P8HA 2V8JA 5CQXA 1JQQA 2E41A 4DOVA 2DA9A 3OYFA 3HHTB 1VQ6A 3VU3C 2BZ8A 3EAEA 2DL7A 4QT7A 3CEYA 1YIJQ 3TU4K 2X51A 3TCJA 3INZA 4IUQA 1VQLT 2H3JA 3OYLA 5GAOm 2FVUA 4Z88A 4LD9K 1SG5A 2GCXA 2SRCA 1R77A 2V8IA 4DEYA 1HD3A 3X28B 3N5BB 2OTJQ 3JCMP 5LJ5e 2DXBA 3VS0A 3CC7T 5J39A 1UGSB 1Y07A 1N9RA 2EGAA 3LGLA 2MPXC 1VQ5T 2LNVA 1RAIB 1UJYA 1G8XA 3QZ9B 1RI9A 5FWBA 2LCLA 3A8OB 4Z8AA 3VS7A 4MMKA 2PVDB 4R0KA 2YT6A 1I5OB 2J6OA 1AD5A 1IRXA 3PE0A 2E3IA 5LJ5h 4HCBA 4ELYC 2EQKA 5HK0A 3M0RA 2KROA 1Q7YR 4BI8B 2QEXQ 1Q82C 2HQXA 3NPFA 1N8RU 5I2MA 2A36A 1J3TA 2KRNA 1K0SA 2XIDA 2JM8A 1QCFA 4HCKA 2GGRA 4E2FB 3A5ZB 1RADB 3TSZA 1AWWA 1RAEB 2KSSA 1PRLC 4AMCA 1KQSP 3L2QA 3REBB 1GBRA 4A4FA 5L23A 2YLBA 1JRIA 4C8QF 4GBQA 2X4YA 3JCMX 3NHNA 2YRCA 4LUEA 2FRYA 2JS0A 4M4ZA 2DO3A 2F5KA 2YWWA 2JTFA 1SPKA 2K5FA 1KHCA 3GOXA 3QBYA 2RQTA 4F7UF 5KE3A 1K73R 1QCOA 2PU9B 2QGGA 2D1XA 3CCEQ 4D8KA 2JN0A 1W6XA 2O9SA 3BDUA 2LQWA 2HKNA 3CC2T 2P4TA 2K3XA 5GANe 1V29B 2RD1A 4II1A 2KNBB 3EGUA 2VGMA 3RR6A 2J6KA 1WYXA 3QYGB 2DL5A 4C92B 1Q86U 3CCUT 3OYHA 3QYHB 1YJ9A 2LCSA 2IG0A 3I56T 4FL6A 2YRDA 3ME9A 3EHRA 4KRTA 3MP1A 1VQ6T 3QSUA 2K3YA 3A1PA 1U1TA 2A37A 4M7AF 3U23A 2QK0A 2EPDA 1M8VA 2JNGA 1GXIE 3CCJQ 5EC7A 2AKKA 3QWXX 3CCQA 1M1FA 4EMHA 1KJWA 1KC8R 3JCMd 3G71Q 2RI5A 2IIMA 1RACB 1EX4A 3PT9A 4EIKA 3S3NA 2HSPA 3UA6A 4M77E 4J8OA 3O5ZA 1VA7A 4NOYA 4YTLA 1IHVA 4C5HA 1I1JA 4JRIA 4K11A 1LOJA 4M7DD 4OMMA 4L6V5 1BI3A 2KXCA 1NG2A 1ABQA 1KFZA 1GRIA 1AEYA 1U1SA 1M3BA 1UHCA 2M51A 3EFOA 3OYEA 2BUDA 2DBMA 1MV0B 2FG0A 3RKYA 3CPFA 2EQUA 2C0OA 3UATA 2EFIA 2CUDA 4FU6A 5D6XA 1QCNA 4MZMA 1UB4A 3VS6A 3WVDB 1HJDA 4RTTA 2EJGA 2KE9A 2O4XA 2XDBA 3QHSA 2ZPEB 3V8KA 3HKSA 3QKJA 2LX9A 1YFNA 5HKCA 2DJQA 2EW3A 1VQPT 2DTOA 1ZBJA 2JS2A 3MP6A 2R5AA 4EMKC 1O75A 5FRNA 1W2BS 3G1JA 3QWYA 3V8JA 2ZPIB 2HL5C 2DF6A 2C06A 2K5IA 2AHJB 5LJ3f 2XMFA 3CC4Q 2VWFA 3EHQA 3ZEHA 1JB0E 1LPLA 4N0AA 3CCRA 4JS4A 3CBOA 1K73U 1I4K1 5J26A 2L89A 1WHGA 2L0AA 3V8LA 2DEQA 4ANJA 1JU5C 1UJ0A 2KT1A 5IXFA 3CCVQ 1WZOA 2DEUA 1MMGA 1VIFA 2O01E 1OU8A 1WPYA 3KBGA 3RUXA 3MKDA 2KRSA 2KRMA 1WQ7A 3TEEA 1YJNA 2PNIA 2L3RA 3OS2A 1XQHA 4E6RA 1ZX6A 2PVOB 2FHDA 2OX7A 1EFNA 1X27A 2QDYB 1TG0A 2DBKA 3SFMA 4IKFA 2AIRB 1H641 1HXDA 2DZCA 4BACA 4HXJA 5CKBA 1AWOA 4M7DA 5GMKe 2EIFA 1YJ9T 1KQ1A 5L8RE 3MCAB 3EGXA 2VUBA 4JRQA 2MWPA 1VQ8A 1OI1A 2RJFA 2YUQA 2RQUA 5C6SA 3I55T 4QVDA 4LDUA 2PVGB 3L42A 3HFNA 3VS5A 4BDZA 2E1HA 2ZZDA 5GAN6 5GMKh 2LP5A 3H0HA 4OGEA 1MNEA 1GCQA 5IHNA 4JLIA 1K8AR 4FCYA 5FU7B 1KC8U 4GLKA 3CCQT 1UGVA 3MPUB 5CIUA 3L2ZA 3RKWA 5CO7A 1CKAA 3JB9D 3V7RA 4Y92A 2RQWA 1EIFA 1CSKA 5EG2A 5IT9E 4LUDA 1UTIA 1RAGB 5I21A 4FT2A 2LJ1A 3UDCA 4JPBW 1WJSA 4IIMA 2HKQB 3RNJA 2H8HA 3FB9A 2ZPGB 1M2OA 1KQSA 5IHIA 5FU6B 1R8OB 3JCMg 1M30A 2GTOA 2Z0WA 4J9IA 1VYTA 3CCLA 3SWNA 3T9NA 3CMAA 1WI7A 2LCCA 1YNZA 3EFOB 4RTWA 1GBQA 2F69A 4PJOF 1YITQ 1RAAB 2JJ9A 4PK4A 3CC7A 3JB9G 1Q81U 2NYSA 2KXDA 2V8KA 1QVGP 2YUPA 1D1BA 4TVRA 4D6WA 1AT1B 2QYZA 1MMDA 2B86A 2C0IA 4Y28E 4C92D 1PCXA 2M0YA 2E10A 2O4XB 2Y4XA 2J05A 2YUOA 1H3ZA 5CAIA 4HKEA 1K4US 4F7UB 5M9OA 2K9GA 2LDMA 3GP8A 1Y0MA 5D6YA 5FWCA 1PSFA 1YJWQ 1M9SA 2CUBA 3VS4A 2K7AA 3L1AA 4OB0B 3CCRT 3P8BB 2AKLA 2NLUA 1KIKA 1Q7YC 2GBQA 2D8JA 4JZ4A 3MEUA 1YI2A 3LW5E 4BE1A 4E47A 2FZKB 1BIAA 4C92G 2A0FB 3SDZA 2QI2A 1VQMA 1I07A 2K4YA 5C0MA 2KEAA 2RH2A 1YJNT 1XNIA 1OOTA 2DX1A 2M0OA 2RJEA 4J7IA 2CT4A 2BIVA 2RHXA 1ABOA 4O5VA 4WTOB 1VQLQ 2E12A 3E1SA 3OBYA 4DEXA 5LJ5d 3M53A 4KH0B 2DIGA 4BD3A 1JXMA 4C92C 2RQVA 2EQMA 3THKA 1YIJA 1NJIR 4ZTJA 4M7DB 4MMLA 3RDVA 1VYUA 2KK4A 1FYNA 1VQ8T 3EGXB 4RUGA 2FPFA 1WDXA 2EYWA 3M0PA 4FW1A 1Z9ZA 2RK2A 2X3XD 3LYIA 4KGXB 3DB3A 3VS2A 3L2VA 1I5LA 2DJZA 4A53A 1K8AU 3M9QA 5CR2A 3HFOA 3CPWA 4JZ3A 4RMOA 4M75D 3I5RA 5KYNA 1NE8A 4C5GA 1KQSS 2QQSA 3FDRA 3CCUA 1KD1C 1TUCA 1VQ4Q 1Q86R 4DBRA 5GAMh 4M78D 4HVVA 4LDXA 1BB9A 3QXEB 3V7CA 2H3EB 3FIFA 1CKBA 3I56A 2FB7A 3OYCA 4EPCA 3CCMT 2VXFA 2GQVA 5KE2A 1HYOA 3OSSC 3TVTA 3JB9H 4PJOA 2QEXA 3X26B 1G83A 2FPEA 5D6WA 3S6WA 4F17A 1NYFA 4PFOA 2L8DA 2YXYA 2SEMA 3CCLT 3M56A 2YSQA 1G3WA 2QQBA 3SWNB 4M75G 3NMZC 3JCMc 3CMAT 4C5IA 3GPLA 1OULA 1OU9A 2F2VA 1MGQA 1UE9A 2L5QA 2YDLA 4A54A 4GY5A 3OYYA 1KC8C 1M90R 4HT9A 3S3MA 1WA7A 1SRMA 2ZPBB 1RL2A 2B8AA 2HAXA 2XDDA 5GAMf 3GNFB 5I22A 1YHQQ 1FWZA 1NLPC 1JJ2P 2DM1A 3ZL7C 2MOXA 3MP8A 4M75C 1KK7A 3QDRB 3CC2Q 1BU1A 1C1AA 3BFMA 4F14A 4ZN3A 3NFCA 2WACA 1G3TA 3LWIA 3L2WA 1WGSA 3UT1A 5LJ3j 5IN1A 1NEGA 1SHFA 2KYBA 2X3WD 3WXMB 1YI2T 4DQ2A 2J6FA 3OW2A 2EJFA 4M75A 1ZBXA 5KYUA 1M1KC 1VQPA 2CP6A 2BTTA 4LDVA 1VQMT 4M78A 4KT0E 1D3BA 3A8HB 1MUZA 4ZN1A 1OPKA 5GAOp 5LJ3d 1VQ9Q 4C5EA 2QQRA 3I35A 5LJ5f 1TTHB 1V76A 2JW4A 1NJIU 2EKHA 5D7UA 1Q95G 2X4WA 1D09B 3TSWA 1YIJT 1MV3A 3M0UA 2ZGWA 4FSSA 3QG1A 2D8HA 5DLOA 2FYKA 1P92A 3PTAA 1QP2A 4C8QD 1EZZB 1HSQA 3JCMW 2GF7A 3BDLA 2GFUA 3L2UA 9ATCB 4JS5A 1LVKA 4CC3A 4P5NA 3D7SB 2CZ1B 2OAWA 5GMKi 2XK0A 3VUBA 5LJ5g 2P0KA 2K3BA 1ACMB 4QQ6A 2QA4Q 5CKHA 2AZSA 2JUFA 3QUIA 1QKXA 2DPPB 5FU7C 4XQ3A 2JZ2A 1UGPB 2DTIA 5FRMA 1O9SA 1VUBA 4N4GA 1Y71A 2DRMA 1LJOA 1K0XA 1XTDA 4AFZC 5GANh 4RKUE 4M7DE 2K79A 3I55A 2WSFE 5FROA 4AFUC 1K76A 2KQWA 4AFQC 3DB4A 2CGHA 4E7KA 1QMCA 1M5Q1 1I0CA 1VQNA 2QEXT 5KCHA 1QVGA 2ZAEA 2VGNA 3MO8A 2DILA 1SSFA 4C8QG 4PJOB 8AT1B 2DK3A 5DM7R 4HCCA 2KI7A 3JCMV 1W4SA 5FU6C 1E6HA 2HQHA 3RIRA 3VV0A 3PMTA 2QQAA 2X35A 2CP7A 1M90U 1GCPA 2QASA 4QQGA 4XU3A 1D0XA 1PRMC 4F7UG 4C8QC 2DE0X 2E6ZA 3S3OA 2FRWA 3H8ZA 1YP5A 4J6WA 5CVIA 4J9GA 2JT4A 2EQIA 2RF0A 2P0PA 3CQTA 2VC8A 4AFSC 5KYXA 1QVFP 3OS1A 3SB2A 3NTIA 3CPWP 5GANf 5GJWB 3HTRA 4M7AD 4MDWA 3OYBA 4KGVB 3FJPA 3CCVA 4R56A 1S72A 4OMOA 3PIPA 2CKKA 4A4KA 3OYGA 2OI3A 2F2WA 1UGQB 2ZPFB 4JJNK 4C8QA 1D0YA 1WX6A 1VQKQ 1IXDA 1BI1A 3UF4A 1NPRA 4M77F 2MF2A 2NUTA 4N0AC 1YWOA 1Q81R 2CP0A 2K2VA 5FW9A 5GMKl 3NGPA 1NYGA 1OX9A 4DBQA 2ATCB 4M75B 1AWJA 5KYUB 1VQ7Q 2HEQA 2KGTA 4OF1A 4F7UA 1AVZC 4XU0A 1TSFA 3CCSA 2I2LA 4PJNA 4M7DG 4M7AG 3M0QA 2J7IA 2MMPA 2FZGB 1WJQA 4M78B 1D3BB 3X20B 1V1CA 5KCOA 2CZ6B 3OYNA 2PZ1A 2LVMA 3CCQQ 1T0HA 4XTUA 1UEBA 4Y91A 2FEIA 1I8FA 4A4HA 3OBWA 2DRKA 2P84A 2XI9A 1BBZA 4M7DC 1D1CA 4M7AC 3CCJT 2EVRA 2DXTA 1N8RC 2JOYA 3ASKA 4J9FA 1ZUYA 2KBTA 2G3RA 2KMTA 4FW2A 4WCIA 2I0NA 3UWNA 5CK9A 5LJ3g 2E64A 1UGRB 3E9GA 3JCMe 2DL3A 1WHJA 1JEGA 1XOVA 2A7YA 4FYWB 3HL8A 4J9EA 1X6OA 1C0MA 1ZUKA 2L3SA 1MNDA 1GCQC 3VYGA 3OW2P 4M7AA 1OV3A 3G6EQ 1K1ZA 4JUVA 2BKDN 1DJ7B 4NS5A 2RN8A 3MHXA 3X24B 3ZFJA 3GLXA 1AZGB 4X9DA 3RKXA 4DA4A 4OGCA 1K9MU 5CKEA 1HK9A 2DAQA 2ZCFB 4QQDA 4FIBA 1VQNT 1SSHA 1TS9A 2LRQA 3FRNA 2HMAA 4XU2A 2DD4A 2COWA 4X34A 1JJ2A 3SHWA 1FMKA 4J9DA 2M16A 4LDWA 3SWNC 3VKIA 2HCKA 2DFUA 3SD4A 4C0FA 1VQOA 4RCCA 1IZ6A 2J06A 2A3LA 4C92E 1YWPA 2RPNA 4ZNXA 1U06A 1Q86C 3H41A 5CCAA 3ER0A 2R58A 3CCMA 1ZA2B 4C0GA 2NWMA 3VS3A 1YCYA 4D8DA 1QLYA 2LQKA 3EGDA 3QJYA 3FLGA 5KYXB 4PLIA 5GAMj 1ZSZB 4QVCA 3CCVT 1H8KA 3I5SA 1S72T 3E9FA 1YBYA 2AZVA 1GFDA 1SHGA 3CD6Q 2IPOB 4ZTFA 4LNPA 2QGFB 4E7SA 4J5YA 2RHUA 5J3BA 4C8QB 3V7SA 4RG8A 1X2KA 4A4EA 4JDSA 1OX8A 1MMAA 2NUTB 2EBPA 1Q82U 2CDTA 3P8DA 3I9QA 3CMEA 3GNGA 5GAMd 3OYIA 1WXTA 4XTYA 3EH1A 2JM9A 2E70A 4J9BA 3CCST 1UG1A 4C0ZA
chains in the Genus database with same CATH topology
3CCUQ 1Q82R 3CMAQ 2OTLQ 1QVGP 3CCMQ 1NJIR 1VQ7Q 1YJWQ 1YI2Q 3G4SQ 1S72Q 1VQ9Q 3CCVQ 2OTJQ 3CC2Q 1VQNQ 1YJNQ 1KQSP 1VQKQ 3CCJQ 3CCRQ 1W2BP 1QVFP 3CC7Q 3CPWP 3I56Q 1M90R 1VQ8Q 3CD6Q 3OW2P 1N8RR 1M1KR 3CC4Q 1KC8R 1VQ5Q 1VQOQ 3G71Q 1YIJQ 1YJ9Q 1Q7YR 3G6EQ 1K73R 1Q81R 3CCSQ 1VQLQ 1KD1R 2QA4Q 1VQ4Q 1Q86R 1VQMQ 1K8AR 1VQ6Q 1YHQQ 3CCLQ 3CXCP 2QEXQ 3CMEQ 1JJ2P 1YITQ 1K9MR 3CCEQ 3CCQQ 3I55Q 1VQPQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU Q;  1Q82 R;  3CMA Q;  2OTL Q;  1QVG P;  3CCM Q;  1NJI R;  1VQ7 Q;  1YJW Q;  1YI2 Q;  3G4S Q;  1S72 Q;  1VQ9 Q;  3CCV Q;  2OTJ Q;  3CC2 Q;  1VQN Q;  1YJN Q;  1KQS P;  1VQK Q;  3CCJ Q;  3CCR Q;  1W2B P;  1QVF P;  3CC7 Q;  3CPW P;  3I56 Q;  1M90 R;  1VQ8 Q;  3CD6 Q;  3OW2 P;  1N8R R;  1M1K R;  3CC4 Q;  1KC8 R;  1VQ5 Q;  1VQO Q;  3G71 Q;  1YIJ Q;  1YJ9 Q;  1Q7Y R;  3G6E Q;  1K73 R;  1Q81 R;  3CCS Q;  1VQL Q;  1KD1 R;  2QA4 Q;  1VQ4 Q;  1Q86 R;  1VQM Q;  1K8A R;  1VQ6 Q;  1YHQ Q;  3CCL Q;  3CXC P;  2QEX Q;  3CME Q;  1JJ2 P;  1YIT Q;  1K9M R;  3CCE Q;  3CCQ Q;  3I55 Q;  1VQP Q; 
#chains in the Genus database with same CATH topology
 1ZSG A;  4RTZ A;  2OTL Q;  5KYY B;  1D1A A;  5CKF A;  4BB7 A;  4PJO D;  3GBQ A;  2LJ3 A;  4XTW A;  3KXT A;  3VRZ A;  2EGE A;  2DXC A;  3J81 E;  3H0F A;  4ZGJ B;  5LJ5 j;  4ZGD B;  1Z9Q A;  4PFZ A;  4QW2 A;  3VUZ A;  3G4S A;  3QII A;  2DYI A;  4EDU A;  3HRS A;  4FYV B;  2GFA A;  1VQ4 A;  2NUZ A;  4M75 E;  4HA8 A;  2CRE A;  4IUU A;  1WXU A;  4Z02 A;  3TQ7 P;  2JMA A;  1M3A A;  2EQJ A;  2L3P A;  1N27 A;  2W10 A;  2XHC A;  2ZPH B;  4BUG A;  3LH5 A;  2FZC B;  4KGZ B;  4M78 E;  4B9X A;  1SKU B;  5HCK A;  4XTX A;  4MZT A;  4PJO G;  1JJ2 S;  1SEM A;  4ATO A;  1UFF A;  2RMO A;  2V26 A;  2WSE E;  4M7A B;  3OYA A;  2PUO B;  1FX7 A;  3A8M B;  3CC7 Q;  1LCK A;  3PFS A;  1UEC A;  1K73 C;  4PFP A;  1VQ5 Q;  4BE2 A;  4LN2 A;  4E7J A;  3REA B;  2OTJ A;  2CH4 A;  3C12 A;  4PL6 A;  4JJD A;  1WXB A;  3LWH A;  4LE9 A;  4PJO C;  3M0T A;  4Z89 A;  1TUD A;  1QVF A;  2AK5 A;  2V1R A;  2YUN A;  1PSE A;  2XIC A;  2K5L A;  3DLM A;  4HVW A;  5IHK A;  4OMQ A;  1RI0 A;  4NL3 A;  4BI4 A;  2L2P A;  1VQO T;  4OVA A;  4JRP A;  2K57 A;  5AT1 B;  3DKM A;  2E65 A;  4OMN A;  2ED0 A;  1H3H A;  5KYW B;  2F5T X;  4ZGE B;  4DOW A;  1PHT A;  5AYF A;  4O6J A;  5GAN 4;  2F1L A;  1X75 C;  5GAN 5;  2LX7 A;  2CP5 A;  2DTH A;  2LTO A;  3EG2 A;  3M54 A;  3M55 A;  4M77 B;  4PJL A;  3EGD B;  3M5A A;  3PVL A;  1ZA1 B;  2KDS A;  5GAN j;  4OP0 A;  1ZLM A;  2DVE A;  2YRV A;  1B34 A;  1QP3 A;  3M0S A;  3L2R A;  1BI2 A;  5LL6 S;  1GFC A;  2EYX A;  2HBW A;  2QTV A;  6AT1 B;  3RMS A;  4PJM A;  3E2U A;  4JRK A;  4M78 G;  2CSQ A;  1VQ9 A;  1Y96 A;  2G6F X;  4ELZ C;  1LNX A;  5GAO l;  2WSC E;  4X1V A;  5GAO r;  1M2V A;  3CME T;  3H6Z A;  2DD5 A;  2CP3 A;  2CS7 A;  3BY7 A;  2QQ9 A;  1QWF A;  5DY9 A;  5GAN d;  1WHK A;  4FYY B;  1TUG B;  3LX7 A;  2BZY A;  3OYJ A;  2M9U A;  2DET A;  2O9V A;  3CCE A;  4LDY A;  3JCM b;  2XU8 A;  4CRI A;  1MMN A;  2PTK A;  3C4S A;  4M78 C;  1BCM A;  1FMW A;  3VRY A;  2W0Z A;  4OB3 B;  4N4I A;  1RAF B;  1RAB B;  2JVV A;  3CCU Q;  3FJ5 A;  5CQY A;  3OYK A;  5GAM g;  2RHY A;  1BI0 A;  4OMP A;  1G3S A;  5HK3 A;  4C8Q E;  2QA4 A;  2RI3 A;  4LXC A;  3G4S T;  4IUP A;  2DXU A;  4J6Y A;  2COY A;  3EG0 A;  2XDP A;  3I56 Q;  2XD0 A;  1Y57 A;  4XAX B;  1Q81 C;  1N5Z A;  4IUT A;  1NEB A;  5I11 A;  1ZQ1 A;  1VQ4 T;  3PMI A;  4XTZ A;  1VQ6 Q;  1N6A A;  3CXC P;  3C95 A;  3EFR A;  3VS1 A;  4HCZ A;  4F7U E;  3EG3 A;  4RCB A;  5KH6 A;  4F16 A;  2A28 A;  2M02 A;  1M1G A;  2LT1 A;  4J9C A;  4ORZ A;  3A98 A;  2QAZ A;  2YHT A;  1D0Z A;  3G7Z A;  2HQE A;  1QVF S;  3RMQ A;  1WLP B;  2CZ0 B;  4AG1 C;  3CPW S;  2E3H A;  3NTK A;  3FC3 A;  3CCJ A;  5IAY A;  2EKO A;  2RA2 A;  4B6M A;  3M4Y A;  4IUR A;  1M3C A;  3G71 A;  2ESW A;  2DYB A;  2OTJ T;  5CKD A;  2EJ9 A;  4BI3 A;  1NBE B;  3ULR B;  2OJ2 A;  1H92 A;  1W2B A;  2GNC A;  3SEM A;  1YHQ T;  3PVQ A;  1ZHI A;  4LD6 A;  1R0B G;  1PM3 A;  2QTX A;  4KUD K;  4JJB A;  1X6G A;  1BK2 A;  2EWN A;  2DL8 A;  1PKT A;  4CC7 A;  3MEW A;  2X4X A;  1E7O A;  4GLM A;  2HSE B;  3OYM A;  2LC4 A;  4M7A E;  1ZUU A;  4DBH A;  1WHL A;  1KD1 R;  1A0N B;  1IO6 A;  1VQK A;  2D0N A;  1TU0 B;  1RLP C;  3OS0 A;  1K9M R;  2R5M A;  3HP9 A;  4FSX A;  3JCM J;  1VQP Q;  4QVZ A;  3DLL A;  1PNJ A;  1ZSZ C;  3HRT A;  1X43 A;  1G2B A;  1B3Q A;  1OYX A;  2EGC A;  2DVJ A;  1G3Y A;  1U3O A;  3M58 A;  1VQ7 A;  1YN8 A;  3TRE A;  1K8A C;  1B34 B;  3Q1J A;  1QQJ A;  4AT1 B;  2KR3 A;  4J6X A;  5IH2 A;  1WJR A;  5GMK j;  1FXX A;  2CYZ B;  2GQI A;  3QPH A;  4M7D F;  3CC4 A;  2MYS A;  2AT1 B;  1C6V X;  1VQ9 T;  4A63 B;  3OA6 A;  2LJ0 A;  1AOJ A;  4PNO A;  2O2O A;  1IB8 A;  1Y96 B;  3LGF A;  2QDL A;  1ZSZ A;  5LJ3 e;  1M2V B;  1K9A A;  4BY6 B;  4ME7 A;  4MZP A;  5ECA A;  3OW2 S;  4BDY A;  5A2Q E;  3VJP A;  1WHH A;  2E5Q A;  2MCN A;  4X9C A;  2QG9 B;  1B07 A;  3CCE T;  2R57 A;  3CBM A;  2IVW A;  2MK5 A;  3OY9 A;  1I81 A;  2COZ A;  4RTV A;  2JMC A;  4PLL A;  3H9N A;  3LH0 A;  5LJ3 h;  4OB2 B;  3C94 A;  1YJ9 Q;  4OMF B;  3EFS A;  2QA4 T;  1T3S A;  5GAN g;  2D0Q B;  3OMC A;  2O88 A;  1VOM A;  5GMK m;  2PQW A;  1MHN A;  1NLO C;  1M27 C;  1Q7Y U;  4XK8 E;  4RTY A;  2FL7 A;  2RO0 A;  2VB6 A;  3X25 B;  3I55 Q;  1Q82 R;  1U5S A;  3G6E A;  4BE0 A;  3BW1 A;  2P4R A;  1VQN Q;  1BIB A;  2MI6 A;  2O31 A;  1E6G A;  2QXF A;  5KYY A;  1Y7X A;  3M57 A;  2LZ6 B;  1UUE A;  2F2X A;  2HD0 A;  2VKN A;  1NPP A;  1M1K R;  1VYV A;  4JLG A;  3WVE B;  1IHW A;  2ENM A;  4M77 D;  1X69 A;  3F70 A;  1M8M A;  2MAM A;  3PIO A;  3J7A F;  4N4H A;  3FEO A;  2CZ7 B;  2CP2 A;  1M4Z A;  4E7I A;  2E5K A;  2LQ8 A;  4KBM B;  5IXB A;  3QO3 A;  3GIB A;  4UC4 A;  3ZBD A;  3GF5 A;  3EH2 A;  3UPU A;  4RG2 A;  1OZ2 A;  4L59 A;  3G71 T;  1PD0 A;  4DBF A;  2K2M A;  3AHU A;  2KAF A;  1TOV A;  2NUP A;  1F1B B;  2CH4 W;  4C0D C;  3E19 A;  2VAS A;  2RK1 A;  3JB9 J;  4XTV A;  1S72 Q;  3OB9 A;  3OQ5 A;  1QVG S;  4EMK A;  2DIQ A;  2RHZ A;  5A0G A;  4FM4 B;  4KUL A;  1PKS A;  4IIO A;  3J80 E;  2FO0 A;  3QZ5 B;  2P0Q A;  4M77 G;  2YLC A;  4V2S A;  1SF9 A;  2RQR A;  3BE3 A;  4E7H A;  1PC0 A;  3JCM h;  4PJJ A;  3CD6 A;  2HBP A;  3R6N A;  1NJI C;  2BE7 D;  1KD1 U;  3M59 A;  4PKC C;  3JB9 I;  1GL5 A;  5HY6 A;  1TXQ A;  3OSV A;  1VQK T;  2MWO A;  2EYY A;  1AWX A;  5I2S A;  1YIT A;  5FLX E;  2HZY A;  3MEV A;  3HSB A;  3H0I A;  3EG9 A;  1OEB A;  4M77 C;  3CCS Q;  5GAO q;  2JXB A;  3JB9 F;  1VIE A;  1KQ2 A;  4FT4 A;  1N9S A;  1VQ7 T;  3VYH B;  3JSC A;  3LLR A;  2ECZ A;  4IUV A;  2Y4Y A;  2L3Q A;  3CCR Q;  1RLQ C;  4J83 A;  5KYW A;  1PWT A;  4HT8 A;  3JV3 A;  4J7F A;  2OTL A;  3CC4 T;  1YJW A;  4OML A;  2LMJ A;  1JBM A;  3MET A;  2RB6 A;  4RTU A;  4M77 A;  4A4G A;  1W2B P;  3JCM f;  1SRL A;  4E7Z A;  5GAN 8;  1QKW A;  2XKO C;  2XG8 D;  1X6B A;  2E6N A;  1FMV A;  2LNH B;  2X9H A;  1YJN Q;  4PJO E;  1QVP A;  1T0J A;  2ED1 A;  1OPL A;  4R55 A;  3A8L B;  1RAH B;  3QDF A;  3CXC A;  2KT8 A;  4RTX A;  5GAN 7;  1BYM A;  4KH1 B;  1QWE A;  3C0C A;  4C92 F;  3UA7 A;  2C0T A;  2RJC A;  2DLP A;  3OMG A;  1IGQ A;  2DMO A;  2RNA A;  2KVQ G;  1U8R A;  1UDL A;  1VQL A;  1WNL A;  3OYD A;  1M90 C;  4WF2 A;  1VQ8 Q;  2LQN A;  2A08 A;  3JCM Q;  4ESR A;  2RI2 A;  4QKU A;  8ATC B;  3G6E T;  2GTJ A;  2EYZ A;  2K6D A;  5GJV B;  3PGG A;  1M1K U;  1W1F A;  3IQL A;  4MDX A;  2DZ9 A;  1TH7 A;  1WIE A;  1B7T A;  1VQ5 A;  1IGU A;  2ROT A;  2LT4 A;  2Y90 A;  4XU1 A;  2DKG A;  3MEA A;  2EYQ A;  3JAM E;  2X4J A;  3QJ6 A;  4B9W A;  2V1Q A;  1VQO Q;  1KHI A;  3A8G B;  1AZE A;  1YCS B;  1W70 A;  2PUK B;  3HRU A;  3KUF A;  2KY9 A;  2RJD A;  3CCM Q;  3KFV A;  3HPW A;  2ABL A;  2HNI A;  5GAO n;  3JRZ A;  4E7L A;  1N8R R;  2NUP B;  1JXO A;  2D9T A;  3CCL Q;  2M1H A;  5GAN 3;  3MJX A;  2DER A;  3EG1 A;  3CMA Q;  4EMK B;  4OB1 B;  2JTM A;  4F04 B;  1TWB A;  3CBP A;  1XJW B;  4NL2 A;  1BKB A;  5GAN 2;  2RM4 A;  1BCO A;  2VVK A;  4VUB A;  3CD6 T;  1WHM A;  2OAU A;  4J9H A;  2HDA A;  2VYT A;  4EMG A;  4KUI A;  1NM7 A;  3O8V A;  1JO8 A;  2VXE A;  4CI0 C;  4M75 F;  2MIO A;  3CME Q;  1X01 A;  2KYM A;  1YIT T;  1KG1 A;  2EAY A;  1T3L A;  3R6O A;  1IRE B;  2VV5 A;  4C0D B;  5A0D A;  2BE9 B;  1WQW A;  2CT3 A;  4JJC A;  1QW1 A;  1NZ9 A;  3EG9 B;  5A0L A;  1YHQ A;  2DL4 A;  2RHI A;  4M78 F;  7AT1 B;  1PD1 A;  3URG A;  1RUW A;  2E4H A;  4CC2 A;  1AHJ B;  1OQK A;  4HVU A;  4Q5W A;  5GAM e;  2FPD A;  3CC2 A;  3M4G A;  3PNW C;  2CSI A;  1PG5 B;  4L5G A;  1ARK A;  5DLQ E;  1G5V A;  1X2Q A;  3CXC S;  2OTL T;  4AG2 C;  4CC4 B;  2JTE A;  1UHF A;  1YJW T;  1YI2 Q;  3G4S Q;  4C92 A;  2HL3 A;  2D6F A;  3NTH A;  3RBB B;  2BZX A;  2ROL A;  1R0C B;  1WFW A;  4BY6 C;  1KSW A;  4FYX B;  2DNU A;  1K9M C;  1VQM Q;  3OS5 A;  1OZ3 A;  3AT1 B;  1S1N A;  3RES A;  3RER A;  3P8H A;  2V8J A;  5CQX A;  1JQQ A;  2E41 A;  4DOV A;  2DA9 A;  3OYF A;  3HHT B;  1VQ6 A;  3VU3 C;  2BZ8 A;  3EAE A;  2DL7 A;  4QT7 A;  3CEY A;  1YIJ Q;  3TU4 K;  2X51 A;  3TCJ A;  3INZ A;  4IUQ A;  1VQL T;  2H3J A;  3OYL A;  5GAO m;  2FVU A;  4Z88 A;  4LD9 K;  1SG5 A;  2GCX A;  2SRC A;  1R77 A;  2V8I A;  4DEY A;  1HD3 A;  3X28 B;  3N5B B;  2OTJ Q;  3JCM P;  5LJ5 e;  2DXB A;  3VS0 A;  3CC7 T;  5J39 A;  1UGS B;  1Y07 A;  1N9R A;  2EGA A;  3LGL A;  2MPX C;  1VQ5 T;  2LNV A;  1RAI B;  1UJY A;  1G8X A;  3QZ9 B;  1RI9 A;  5FWB A;  2LCL A;  3A8O B;  4Z8A A;  3VS7 A;  4MMK A;  2PVD B;  4R0K A;  2YT6 A;  1I5O B;  2J6O A;  1AD5 A;  1IRX A;  3PE0 A;  2E3I A;  5LJ5 h;  4HCB A;  4ELY C;  2EQK A;  5HK0 A;  3M0R A;  2KRO A;  1Q7Y R;  4BI8 B;  2QEX Q;  1Q82 C;  2HQX A;  3NPF A;  1N8R U;  5I2M A;  2A36 A;  1J3T A;  2KRN A;  1K0S A;  2XID A;  2JM8 A;  1QCF A;  4HCK A;  2GGR A;  4E2F B;  3A5Z B;  1RAD B;  3TSZ A;  1AWW A;  1RAE B;  2KSS A;  1PRL C;  4AMC A;  1KQS P;  3L2Q A;  3REB B;  1GBR A;  4A4F A;  5L23 A;  2YLB A;  1JRI A;  4C8Q F;  4GBQ A;  2X4Y A;  3JCM X;  3NHN A;  2YRC A;  4LUE A;  2FRY A;  2JS0 A;  4M4Z A;  2DO3 A;  2F5K A;  2YWW A;  2JTF A;  1SPK A;  2K5F A;  1KHC A;  3GOX A;  3QBY A;  2RQT A;  4F7U F;  5KE3 A;  1K73 R;  1QCO A;  2PU9 B;  2QGG A;  2D1X A;  3CCE Q;  4D8K A;  2JN0 A;  1W6X A;  2O9S A;  3BDU A;  2LQW A;  2HKN A;  3CC2 T;  2P4T A;  2K3X A;  5GAN e;  1V29 B;  2RD1 A;  4II1 A;  2KNB B;  3EGU A;  2VGM A;  3RR6 A;  2J6K A;  1WYX A;  3QYG B;  2DL5 A;  4C92 B;  1Q86 U;  3CCU T;  3OYH A;  3QYH B;  1YJ9 A;  2LCS A;  2IG0 A;  3I56 T;  4FL6 A;  2YRD A;  3ME9 A;  3EHR A;  4KRT A;  3MP1 A;  1VQ6 T;  3QSU A;  2K3Y A;  3A1P A;  1U1T A;  2A37 A;  4M7A F;  3U23 A;  2QK0 A;  2EPD A;  1M8V A;  2JNG A;  1GXI E;  3CCJ Q;  5EC7 A;  2AKK A;  3QWX X;  3CCQ A;  1M1F A;  4EMH A;  1KJW A;  1KC8 R;  3JCM d;  3G71 Q;  2RI5 A;  2IIM A;  1RAC B;  1EX4 A;  3PT9 A;  4EIK A;  3S3N A;  2HSP A;  3UA6 A;  4M77 E;  4J8O A;  3O5Z A;  1VA7 A;  4NOY A;  4YTL A;  1IHV A;  4C5H A;  1I1J A;  4JRI A;  4K11 A;  1LOJ A;  4M7D D;  4OMM A;  4L6V 5;  1BI3 A;  2KXC A;  1NG2 A;  1ABQ A;  1KFZ A;  1GRI A;  1AEY A;  1U1S A;  1M3B A;  1UHC A;  2M51 A;  3EFO A;  3OYE A;  2BUD A;  2DBM A;  1MV0 B;  2FG0 A;  3RKY A;  3CPF A;  2EQU A;  2C0O A;  3UAT A;  2EFI A;  2CUD A;  4FU6 A;  5D6X A;  1QCN A;  4MZM A;  1UB4 A;  3VS6 A;  3WVD B;  1HJD A;  4RTT A;  2EJG A;  2KE9 A;  2O4X A;  2XDB A;  3QHS A;  2ZPE B;  3V8K A;  3HKS A;  3QKJ A;  2LX9 A;  1YFN A;  5HKC A;  2DJQ A;  2EW3 A;  1VQP T;  2DTO A;  1ZBJ A;  2JS2 A;  3MP6 A;  2R5A A;  4EMK C;  1O75 A;  5FRN A;  1W2B S;  3G1J A;  3QWY A;  3V8J A;  2ZPI B;  2HL5 C;  2DF6 A;  2C06 A;  2K5I A;  2AHJ B;  5LJ3 f;  2XMF A;  3CC4 Q;  2VWF A;  3EHQ A;  3ZEH A;  1JB0 E;  1LPL A;  4N0A A;  3CCR A;  4JS4 A;  3CBO A;  1K73 U;  1I4K 1;  5J26 A;  2L89 A;  1WHG A;  2L0A A;  3V8L A;  2DEQ A;  4ANJ A;  1JU5 C;  1UJ0 A;  2KT1 A;  5IXF A;  3CCV Q;  1WZO A;  2DEU A;  1MMG A;  1VIF A;  2O01 E;  1OU8 A;  1WPY A;  3KBG A;  3RUX A;  3MKD A;  2KRS A;  2KRM A;  1WQ7 A;  3TEE A;  1YJN A;  2PNI A;  2L3R A;  3OS2 A;  1XQH A;  4E6R A;  1ZX6 A;  2PVO B;  2FHD A;  2OX7 A;  1EFN A;  1X27 A;  2QDY B;  1TG0 A;  2DBK A;  3SFM A;  4IKF A;  2AIR B;  1H64 1;  1HXD A;  2DZC A;  4BAC A;  4HXJ A;  5CKB A;  1AWO A;  4M7D A;  5GMK e;  2EIF A;  1YJ9 T;  1KQ1 A;  5L8R E;  3MCA B;  3EGX A;  2VUB A;  4JRQ A;  2MWP A;  1VQ8 A;  1OI1 A;  2RJF A;  2YUQ A;  2RQU A;  5C6S A;  3I55 T;  4QVD A;  4LDU A;  2PVG B;  3L42 A;  3HFN A;  3VS5 A;  4BDZ A;  2E1H A;  2ZZD A;  5GAN 6;  5GMK h;  2LP5 A;  3H0H A;  4OGE A;  1MNE A;  1GCQ A;  5IHN A;  4JLI A;  1K8A R;  4FCY A;  5FU7 B;  1KC8 U;  4GLK A;  3CCQ T;  1UGV A;  3MPU B;  5CIU A;  3L2Z A;  3RKW A;  5CO7 A;  1CKA A;  3JB9 D;  3V7R A;  4Y92 A;  2RQW A;  1EIF A;  1CSK A;  5EG2 A;  5IT9 E;  4LUD A;  1UTI A;  1RAG B;  5I21 A;  4FT2 A;  2LJ1 A;  3UDC A;  4JPB W;  1WJS A;  4IIM A;  2HKQ B;  3RNJ A;  2H8H A;  3FB9 A;  2ZPG B;  1M2O A;  1KQS A;  5IHI A;  5FU6 B;  1R8O B;  3JCM g;  1M30 A;  2GTO A;  2Z0W A;  4J9I A;  1VYT A;  3CCL A;  3SWN A;  3T9N A;  3CMA A;  1WI7 A;  2LCC A;  1YNZ A;  3EFO B;  4RTW A;  1GBQ A;  2F69 A;  4PJO F;  1YIT Q;  1RAA B;  2JJ9 A;  4PK4 A;  3CC7 A;  3JB9 G;  1Q81 U;  2NYS A;  2KXD A;  2V8K A;  1QVG P;  2YUP A;  1D1B A;  4TVR A;  4D6W A;  1AT1 B;  2QYZ A;  1MMD A;  2B86 A;  2C0I A;  4Y28 E;  4C92 D;  1PCX A;  2M0Y A;  2E10 A;  2O4X B;  2Y4X A;  2J05 A;  2YUO A;  1H3Z A;  5CAI A;  4HKE A;  1K4U S;  4F7U B;  5M9O A;  2K9G A;  2LDM A;  3GP8 A;  1Y0M A;  5D6Y A;  5FWC A;  1PSF A;  1YJW Q;  1M9S A;  2CUB A;  3VS4 A;  2K7A A;  3L1A A;  4OB0 B;  3CCR T;  3P8B B;  2AKL A;  2NLU A;  1KIK A;  1Q7Y C;  2GBQ A;  2D8J A;  4JZ4 A;  3MEU A;  1YI2 A;  3LW5 E;  4BE1 A;  4E47 A;  2FZK B;  1BIA A;  4C92 G;  2A0F B;  3SDZ A;  2QI2 A;  1VQM A;  1I07 A;  2K4Y A;  5C0M A;  2KEA A;  2RH2 A;  1YJN T;  1XNI A;  1OOT A;  2DX1 A;  2M0O A;  2RJE A;  4J7I A;  2CT4 A;  2BIV A;  2RHX A;  1ABO A;  4O5V A;  4WTO B;  1VQL Q;  2E12 A;  3E1S A;  3OBY A;  4DEX A;  5LJ5 d;  3M53 A;  4KH0 B;  2DIG A;  4BD3 A;  1JXM A;  4C92 C;  2RQV A;  2EQM A;  3THK A;  1YIJ A;  1NJI R;  4ZTJ A;  4M7D B;  4MML A;  3RDV A;  1VYU A;  2KK4 A;  1FYN A;  1VQ8 T;  3EGX B;  4RUG A;  2FPF A;  1WDX A;  2EYW A;  3M0P A;  4FW1 A;  1Z9Z A;  2RK2 A;  2X3X D;  3LYI A;  4KGX B;  3DB3 A;  3VS2 A;  3L2V A;  1I5L A;  2DJZ A;  4A53 A;  1K8A U;  3M9Q A;  5CR2 A;  3HFO A;  3CPW A;  4JZ3 A;  4RMO A;  4M75 D;  3I5R A;  5KYN A;  1NE8 A;  4C5G A;  1KQS S;  2QQS A;  3FDR A;  3CCU A;  1KD1 C;  1TUC A;  1VQ4 Q;  1Q86 R;  4DBR A;  5GAM h;  4M78 D;  4HVV A;  4LDX A;  1BB9 A;  3QXE B;  3V7C A;  2H3E B;  3FIF A;  1CKB A;  3I56 A;  2FB7 A;  3OYC A;  4EPC A;  3CCM T;  2VXF A;  2GQV A;  5KE2 A;  1HYO A;  3OSS C;  3TVT A;  3JB9 H;  4PJO A;  2QEX A;  3X26 B;  1G83 A;  2FPE A;  5D6W A;  3S6W A;  4F17 A;  1NYF A;  4PFO A;  2L8D A;  2YXY A;  2SEM A;  3CCL T;  3M56 A;  2YSQ A;  1G3W A;  2QQB A;  3SWN B;  4M75 G;  3NMZ C;  3JCM c;  3CMA T;  4C5I A;  3GPL A;  1OUL A;  1OU9 A;  2F2V A;  1MGQ A;  1UE9 A;  2L5Q A;  2YDL A;  4A54 A;  4GY5 A;  3OYY A;  1KC8 C;  1M90 R;  4HT9 A;  3S3M A;  1WA7 A;  1SRM A;  2ZPB B;  1RL2 A;  2B8A A;  2HAX A;  2XDD A;  5GAM f;  3GNF B;  5I22 A;  1YHQ Q;  1FWZ A;  1NLP C;  1JJ2 P;  2DM1 A;  3ZL7 C;  2MOX A;  3MP8 A;  4M75 C;  1KK7 A;  3QDR B;  3CC2 Q;  1BU1 A;  1C1A A;  3BFM A;  4F14 A;  4ZN3 A;  3NFC A;  2WAC A;  1G3T A;  3LWI A;  3L2W A;  1WGS A;  3UT1 A;  5LJ3 j;  5IN1 A;  1NEG A;  1SHF A;  2KYB A;  2X3W D;  3WXM B;  1YI2 T;  4DQ2 A;  2J6F A;  3OW2 A;  2EJF A;  4M75 A;  1ZBX A;  5KYU A;  1M1K C;  1VQP A;  2CP6 A;  2BTT A;  4LDV A;  1VQM T;  4M78 A;  4KT0 E;  1D3B A;  3A8H B;  1MUZ A;  4ZN1 A;  1OPK A;  5GAO p;  5LJ3 d;  1VQ9 Q;  4C5E A;  2QQR A;  3I35 A;  5LJ5 f;  1TTH B;  1V76 A;  2JW4 A;  1NJI U;  2EKH A;  5D7U A;  1Q95 G;  2X4W A;  1D09 B;  3TSW A;  1YIJ T;  1MV3 A;  3M0U A;  2ZGW A;  4FSS A;  3QG1 A;  2D8H A;  5DLO A;  2FYK A;  1P92 A;  3PTA A;  1QP2 A;  4C8Q D;  1EZZ B;  1HSQ A;  3JCM W;  2GF7 A;  3BDL A;  2GFU A;  3L2U A;  9ATC B;  4JS5 A;  1LVK A;  4CC3 A;  4P5N A;  3D7S B;  2CZ1 B;  2OAW A;  5GMK i;  2XK0 A;  3VUB A;  5LJ5 g;  2P0K A;  2K3B A;  1ACM B;  4QQ6 A;  2QA4 Q;  5CKH A;  2AZS A;  2JUF A;  3QUI A;  1QKX A;  2DPP B;  5FU7 C;  4XQ3 A;  2JZ2 A;  1UGP B;  2DTI A;  5FRM A;  1O9S A;  1VUB A;  4N4G A;  1Y71 A;  2DRM A;  1LJO A;  1K0X A;  1XTD A;  4AFZ C;  5GAN h;  4RKU E;  4M7D E;  2K79 A;  3I55 A;  2WSF E;  5FRO A;  4AFU C;  1K76 A;  2KQW A;  4AFQ C;  3DB4 A;  2CGH A;  4E7K A;  1QMC A;  1M5Q 1;  1I0C A;  1VQN A;  2QEX T;  5KCH A;  1QVG A;  2ZAE A;  2VGN A;  3MO8 A;  2DIL A;  1SSF A;  4C8Q G;  4PJO B;  8AT1 B;  2DK3 A;  5DM7 R;  4HCC A;  2KI7 A;  3JCM V;  1W4S A;  5FU6 C;  1E6H A;  2HQH A;  3RIR A;  3VV0 A;  3PMT A;  2QQA A;  2X35 A;  2CP7 A;  1M90 U;  1GCP A;  2QAS A;  4QQG A;  4XU3 A;  1D0X A;  1PRM C;  4F7U G;  4C8Q C;  2DE0 X;  2E6Z A;  3S3O A;  2FRW A;  3H8Z A;  1YP5 A;  4J6W A;  5CVI A;  4J9G A;  2JT4 A;  2EQI A;  2RF0 A;  2P0P A;  3CQT A;  2VC8 A;  4AFS C;  5KYX A;  1QVF P;  3OS1 A;  3SB2 A;  3NTI A;  3CPW P;  5GAN f;  5GJW B;  3HTR A;  4M7A D;  4MDW A;  3OYB A;  4KGV B;  3FJP A;  3CCV A;  4R56 A;  1S72 A;  4OMO A;  3PIP A;  2CKK A;  4A4K A;  3OYG A;  2OI3 A;  2F2W A;  1UGQ B;  2ZPF B;  4JJN K;  4C8Q A;  1D0Y A;  1WX6 A;  1VQK Q;  1IXD A;  1BI1 A;  3UF4 A;  1NPR A;  4M77 F;  2MF2 A;  2NUT A;  4N0A C;  1YWO A;  1Q81 R;  2CP0 A;  2K2V A;  5FW9 A;  5GMK l;  3NGP A;  1NYG A;  1OX9 A;  4DBQ A;  2ATC B;  4M75 B;  1AWJ A;  5KYU B;  1VQ7 Q;  2HEQ A;  2KGT A;  4OF1 A;  4F7U A;  1AVZ C;  4XU0 A;  1TSF A;  3CCS A;  2I2L A;  4PJN A;  4M7D G;  4M7A G;  3M0Q A;  2J7I A;  2MMP A;  2FZG B;  1WJQ A;  4M78 B;  1D3B B;  3X20 B;  1V1C A;  5KCO A;  2CZ6 B;  3OYN A;  2PZ1 A;  2LVM A;  3CCQ Q;  1T0H A;  4XTU A;  1UEB A;  4Y91 A;  2FEI A;  1I8F A;  4A4H A;  3OBW A;  2DRK A;  2P84 A;  2XI9 A;  1BBZ A;  4M7D C;  1D1C A;  4M7A C;  3CCJ T;  2EVR A;  2DXT A;  1N8R C;  2JOY A;  3ASK A;  4J9F A;  1ZUY A;  2KBT A;  2G3R A;  2KMT A;  4FW2 A;  4WCI A;  2I0N A;  3UWN A;  5CK9 A;  5LJ3 g;  2E64 A;  1UGR B;  3E9G A;  3JCM e;  2DL3 A;  1WHJ A;  1JEG A;  1XOV A;  2A7Y A;  4FYW B;  3HL8 A;  4J9E A;  1X6O A;  1C0M A;  1ZUK A;  2L3S A;  1MND A;  1GCQ C;  3VYG A;  3OW2 P;  4M7A A;  1OV3 A;  3G6E Q;  1K1Z A;  4JUV A;  2BKD N;  1DJ7 B;  4NS5 A;  2RN8 A;  3MHX A;  3X24 B;  3ZFJ A;  3GLX A;  1AZG B;  4X9D A;  3RKX A;  4DA4 A;  4OGC A;  1K9M U;  5CKE A;  1HK9 A;  2DAQ A;  2ZCF B;  4QQD A;  4FIB A;  1VQN T;  1SSH A;  1TS9 A;  2LRQ A;  3FRN A;  2HMA A;  4XU2 A;  2DD4 A;  2COW A;  4X34 A;  1JJ2 A;  3SHW A;  1FMK A;  4J9D A;  2M16 A;  4LDW A;  3SWN C;  3VKI A;  2HCK A;  2DFU A;  3SD4 A;  4C0F A;  1VQO A;  4RCC A;  1IZ6 A;  2J06 A;  2A3L A;  4C92 E;  1YWP A;  2RPN A;  4ZNX A;  1U06 A;  1Q86 C;  3H41 A;  5CCA A;  3ER0 A;  2R58 A;  3CCM A;  1ZA2 B;  4C0G A;  2NWM A;  3VS3 A;  1YCY A;  4D8D A;  1QLY A;  2LQK A;  3EGD A;  3QJY A;  3FLG A;  5KYX B;  4PLI A;  5GAM j;  1ZSZ B;  4QVC A;  3CCV T;  1H8K A;  3I5S A;  1S72 T;  3E9F A;  1YBY A;  2AZV A;  1GFD A;  1SHG A;  3CD6 Q;  2IPO B;  4ZTF A;  4LNP A;  2QGF B;  4E7S A;  4J5Y A;  2RHU A;  5J3B A;  4C8Q B;  3V7S A;  4RG8 A;  1X2K A;  4A4E A;  4JDS A;  1OX8 A;  1MMA A;  2NUT B;  2EBP A;  1Q82 U;  2CDT A;  3P8D A;  3I9Q A;  3CME A;  3GNG A;  5GAM d;  3OYI A;  1WXT A;  4XTY A;  3EH1 A;  2JM9 A;  2E70 A;  4J9B A;  3CCS T;  1UG1 A;  4C0Z A; 
#chains in the Genus database with same CATH homology
 3CCU Q;  1Q82 R;  3CMA Q;  2OTL Q;  1QVG P;  3CCM Q;  1NJI R;  1VQ7 Q;  1YJW Q;  1YI2 Q;  3G4S Q;  1S72 Q;  1VQ9 Q;  3CCV Q;  2OTJ Q;  3CC2 Q;  1VQN Q;  1YJN Q;  1KQS P;  1VQK Q;  3CCJ Q;  3CCR Q;  1W2B P;  1QVF P;  3CC7 Q;  3CPW P;  3I56 Q;  1M90 R;  1VQ8 Q;  3CD6 Q;  3OW2 P;  1N8R R;  1M1K R;  3CC4 Q;  1KC8 R;  1VQ5 Q;  1VQO Q;  3G71 Q;  1YIJ Q;  1YJ9 Q;  1Q7Y R;  3G6E Q;  1K73 R;  1Q81 R;  3CCS Q;  1VQL Q;  1KD1 R;  2QA4 Q;  1VQ4 Q;  1Q86 R;  1VQM Q;  1K8A R;  1VQ6 Q;  1YHQ Q;  3CCL Q;  3CXC P;  2QEX Q;  3CME Q;  1JJ2 P;  1YIT Q;  1K9M R;  3CCE Q;  3CCQ Q;  3I55 Q;  1VQP Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...