3OW2P

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ow2P00
3G71Q 1K8AR 3CMAQ 1W2BP 1Q86R 1Q81R 2QA4Q 3CXCP 1YHQQ 1VQ6Q 2QEXQ 1VQKQ 3I55Q 1QVGP 3CCMQ 1M1KR 1VQ4Q 1KQSP 1VQ9Q 3CCVQ 1N8RR 3CCRQ 1K73R 1YJ9Q 3CCEQ 2OTJQ 1VQLQ 3CPWP 3CCSQ 1QVFP 1VQ5Q 1YIJQ 3G4SQ 1Q82R 3CC4Q 1VQMQ 1NJIR 1KD1R 1VQPQ 1VQ8Q 3OW2P 1YI2Q 1VQNQ 3CC7Q 3I56Q 3CC2Q 3CCLQ 2OTLQ 3G6EQ 1YJNQ 1VQOQ 1KC8R 3CMEQ 1K9MR 1S72Q 3CD6Q 3CCJQ 1M90R 1JJ2P 3CCQQ 1Q7YR 3CCUQ 1YITQ 1YJWQ 1VQ7Q
chains in the Genus database with same CATH superfamily
2QAZA 2EW3A 2L3SA 3S3OA 1GRIA 2LMJA 5HY6A 3LH5A 2OTJA 3H9NA 5GMKh 2VB6A 1EZZB 2JOYA 2E41A 2JTEA 3TSZA 1YIJQ 4C92E 4JJDA 4E7ZA 3LYIA 1NM7A 3MP1A 3M0RA 1YHQA 2ED1A 4XU2A 2EJGA 3EFRA 3M57A 1R0CB 3PIOA 1M1KR 1Q81U 5GMKm 3HHTB 3JCMf 4JRQA 5FWBA 1VUBA 1MMGA 3I56T 4F7UA 2RHIA 1NJIR 3CXCA 1QWFA 1VA7A 1VQOA 2PNIA 3VS2A 3CPFA 2F69A 3BFMA 2A0FB 4D8DA 1WDXA 3EH2A 5IT9E 1Y96B 1NBEB 2RD1A 3PFSA 4PFOA 4ZN1A 1FMWA 3M5AA 1QCFA 4EIKA 3CCVA 5GANd 2A28A 4KULA 4FT4A 1WZOA 4QQ6A 3G4SQ 5I2MA 1M3AA 2O88A 4XU0A 2Y4YA 2CS7A 4J8OA 5A0LA 4HVUA 1QVFA 5KYXB 1MNEA 4LN2A 1RABB 3CXCS 2CP5A 3TQ7P 2COZA 4A63B 2E10A 4XTVA 1KQSP 3VV0A 3OYYA 2K6DA 3NMZC 1KK7A 2DA9A 1C6VX 4OMQA 3CC2A 1VQNQ 2LJ1A 3CC7Q 2LQKA 2BUDA 2GQVA 5GANf 1KHIA 2K4YA 4E7SA 3RMSA 1K76A 2LJ3A 2K2MA 3VRZA 3QZ9B 5LJ5g 3JB9F 1VOMA 2EYXA 1QVFS 2KYBA 2XICA 1UG1A 2J06A 2FYKA 4M75C 4Q5WA 2EQJA 2J7IA 4M75G 2LNHB 3RR6A 3S3NA 4QQGA 2RO0A 2VYTA 2JVVA 3RIRA 5KH6A 4OVAA 3ZFJA 2K7AA 2B8AA 1UDLA 1K8AR 1UFFA 1IHWA 2RQWA 1UGPB 2VWFA 2R57A 2VXFA 5KE3A 1WXBA 3A8MB 1WNLA 2ATCB 3VKIA 4JS4A 3LWIA 4OMFB 2MMPA 2HEQA 3OYJA 4WF2A 2XHCA 5A0GA 2ZCFB 4C8QC 3OSSC 4C8QG 4KT0E 2RHUA 3M0UA 4M7AD 1KD1C 2CGHA 2RF0A 1U3OA 2KR3A 3HFNA 1I0CA 6AT1B 2K3BA 4QW2A 2DVEA 5EG2A 1WHMA 4HCZA 1VQMQ 1U1TA 1X69A 2M16A 1YJNT 3O5ZA 2QGGA 4OB2B 1D0ZA 3I9QA 2X4JA 4IUPA 4YTLA 4F7UE 2HBWA 1DJ7B 3M53A 1W2BS 3FRNA 3REAB 4IIOA 2QEXA 3CMAQ 3I55T 3UATA 5A2QE 1T3SA 2JXBA 4Y92A 3A5ZB 4FL6A 1E7OA 2X4YA 2RJDA 1VQ8T 3CPWP 2E70A 1RAIB 3I56A 2HZYA 4ORZA 3JCMg 3URGA 2WSEE 1JO8A 2BE9B 2V8IA 1BYMA 2E64A 4KBMB 1IO6A 1VQ4T 4M77F 2M0OA 1TWBA 4RTUA 1N8RR 1IGUA 1V29B 2D0NA 2YRCA 2IIMA 2KNBB 4J7FA 5I11A 2GTOA 4A54A 2EYZA 4HT8A 2DXUA 2XK0A 4QVZA 3VS0A 2QASA 2K57A 2ZPEB 3E19A 1R77A 5GAN8 3OYFA 4M78F 4LUEA 3RNJA 4CC2A 1S1NA 1JJ2A 2GQIA 4M75D 3FC3A 2OTJQ 3R6OA 4C5IA 2DJZA 4D6WA 2YHTA 2RJFA 4M7DC 4M7DG 4C8QA 1NYGA 1QMCA 2BKDN 2AK5A 1NPPA 3MEUA 4F14A 5GAN5 2F1LA 2PVDB 2P84A 3HKSA 5GANg 4HCBA 3QKJA 3CCMT 2NUPA 3REBB 1YHQQ 3GNGA 1VQ9T 1AWXA 3CCST 2FZCB 2KRSA 2COYA 4XTYA 2E6ZA 4UC4A 4M7AE 3JRZA 5GMKj 1Q86C 1K4US 4C8QD 2BE7D 1JJ2S 4M77B 1RI9A 1M90R 4Y28E 2DLPA 5LJ5e 2DMOA 4ELYC 3EG1A 3SEMA 3QJ6A 1EIFA 3CBMA 3OYEA 1OU9A 5GAN4 3CCVQ 2PVOB 1WX6A 2X51A 3NHNA 3ER0A 1K8AC 5IAYA 1TXQA 1AVZC 2L5QA 1BCMA 2XU8A 3HPWA 1RI0A 4M78B 4BE0A 3EGXB 2X9HA 2LCSA 2XD0A 1BBZA 1KC8U 4DOVA 2HNIA 1TH7A 2KK4A 1TTHB 3KBGA 2J6KA 1Y07A 2A7YA 1IREB 4BD3A 2YRDA 4C92C 3JCMQ 1YIJA 4C92G 3E9FA 2FRWA 2EFIA 1IRXA 1B7TA 1YJNA 1Y96A 1H641 3CC2Q 2QYZA 4NS5A 3EHRA 4FT2A 1YITT 2WSFE 2CUDA 4RTZA 2P0PA 1FWZA 1IB8A 4BDYA 2QA4A 1T3LA 4AMCA 3I55A 2DERA 1Q7YU 1AT1B 4OMOA 5AT1B 3MO8A 2V26A 1M3CA 2QXFA 3TCJA 4NL3A 2FPEA 1HYOA 1YI2T 4M7DA 3JB9J 1VQ8A 3HSBA 2JMCA 3JB9G 3X28B 5LJ3d 1WJQA 1SRLA 2ZAEA 3CCUT 5LJ5h 4LUDA 4M75E 5KE2A 3X24B 5HCKA 4B9XA 1N27A 1YCYA 2LT1A 3HRTA 1VQ4A 2OI3A 1KQ1A 4M7DD 1T0HA 3JCMe 3J80E 2HKNA 2C06A 2A37A 2K9GA 3V7SA 2EWNA 2DVJA 5CVIA 2YUOA 2P4TA 1RLPC 3PMIA 1IXDA 2GF7A 1YNZA 4C8QE 2L0AA 5LJ3f 2L3PA 2KRMA 5FLXE 2J05A 2YLBA 4K11A 1G3YA 5FU7B 1V1CA 1VQNA 2EIFA 2NYSA 1M5Q1 2PZ1A 1PSFA 8AT1B 2GFUA 2WACA 3A8GB 3CBOA 4PJOF 1Y71A 4J83A 3EG9A 2DIGA 2EQKA 2PU9B 2QEXQ 1VQ9A 2HQXA 4C92A 1KSWA 2RI3A 3CCSA 1MMNA 2CYZB 4DEYA 3UPUA 1GBRA 3PE0A 1M30A 1QWEA 4C0DC 1NYFA 2MIOA 3I56Q 1WPYA 1KQSA 2GNCA 5J39A 4XQ3A 4JLGA 1IHVA 2PUKB 2ECZA 1X27A 2LQWA 2Y90A 2ZZDA 2JZ2A 1TG0A 1UE9A 3PTAA 1UECA 2C0TA 3SHWA 3CCET 5FU6B 3JCMh 5GAN2 2LQNA 3OYLA 1M3BA 1VYTA 4RTYA 1N6AA 5DLOA 3H0IA 2RHXA 1D3BB 4RTWA 1Q95G 2DEUA 3TVTA 3SDZA 5CKFA 3F70A 1RADB 1YWOA 1HK9A 1KQSS 2FL7A 2YSQA 2ROTA 5D6YA 3I5RA 3JB9D 1FMVA 3RDVA 1OZ3A 1VQMA 1WHGA 4LDXA 5GMKe 2RPNA 4R56A 4JLIA 4PJOB 2DIQA 4M78C 4M78G 2AHJB 1Q82U 1YITA 4IUVA 2LJ0A 1WI7A 2DRKA 4AFUC 2CT3A 2ED0A 1U1SA 4ZN3A 2NUTA 1VQPT 1GXIE 1ZLMA 3CEYA 1X6BA 5GANh 4RTXA 2KAFA 3OY9A 2EQUA 1ZA2B 3CCUA 1JXMA 5D7UA 2JM8A 1LJOA 1UJ0A 1K9AA 4MDWA 4J9IA 1XNIA 3INZA 3WXMB 2VVKA 3G6ET 1CKAA 3MHXA 1M9SA 2DD4A 3BY7A 1D09B 1YBYA 2P0QA 3KFVA 2D0QB 1QCNA 4EDUA 5M9OA 2PQWA 2X4XA 2RK1A 1FX7A 1QCOA 2PVGB 5LJ3g 3LWHA 4BI8B 3I35A 4IKFA 1S72T 3CCJT 3Q1JA 1YJNQ 1PD0A 2K5IA 5C0MA 2EQIA 1WQWA 3JCMX 3DLLA 1KG1A 1OQKA 4FSXA 2HSPA 2QA4Q 3DLMA 2AIRB 3I55Q 5FU7C 2JT4A 3FEOA 3NGPA 1BI3A 4M7AC 4LDVA 4M7AG 4OB0B 4M78A 2HBPA 3EGXA 2EVRA 1I5LA 3HRUA 1VQ8Q 3CMET 2D8JA 2JJ9A 3JB9I 2GFAA 3OBYA 5CKEA 3V7RA 1BKBA 1KJWA 2RI5A 3DB4A 2AT1B 2QQ9A 3G7ZA 1Y57A 2YXYA 2KSSA 1YN8A 3EFOB 5KYUB 3PIPA 1QVGP 3CCEA 2LT4A 1VQ4Q 3QHSA 1B34B 1WXUA 4A4HA 2VGNA 4HCKA 4DEXA 5GAN7 1XOVA 4M78D 1AD5A 2YUQA 3AT1B 1Q81C 3U23A 4IUTA 3QUIA 4A53A 3VJPA 4BUGA 2SRCA 5LJ5j 3OW2A 5FU6C 3RMQA 5KCHA 1LCKA 2ZPBB 4BB7A 2EJ9A 2CZ7B 1D1AA 5ECAA 4GBQA 2KXCA 4JJBA 4DBFA 1RAGB 1AWJA 1RAHB 1JEGA 2CSQA 2EYQA 2DXTA 2E65A 2KGTA 1PC0A 1UGRB 2D6FA 3UT1A 4ELZC 3GP8A 2A36A 1NLOC 2LCCA 1Q86R 2YRVA 4AG2C 1O75A 1ZUKA 2FG0A 3MKDA 3CCMQ 2GCXA 5L23A 1VQ9Q 2XKOC 4RG8A 2FHDA 2DL4A 2H8HA 3CCSQ 1VQPA 2SEMA 2DNUA 4AFQC 3OW2S 1GFCA 4EPCA 2H3JA 2DTOA 2FB7A 3CBPA 5GAOq 1BK2A 4EMKC 2MWOA 3JCMb 1RAAB 1PKTA 2RMOA 4OF1A 2CREA 2J6OA 1ZBJA 4BACA 4M7AA 2WSCE 4N4GA 4KGZB 2XDBA 1ZSZB 4ZGDB 2OTLT 1UUEA 3V8JA 2CH4A 3PGGA 1NZ9A 2DXBA 2L8DA 4M77E 1KD1U 4J6YA 3M59A 3LGFA 2P4RA 4P5NA 5GMKl 1QVPA 2NWMA 2BTTA 4OP0A 3OS2A 3MCAB 5CK9A 4Y91A 3L2UA 3L2WA 2NLUA 1R0BG 3X26B 4PLIA 2E1HA 3CCJA 3WVDB 1RUWA 4M78E 3G71T 1C0MA 2JMAA 4JUVA 1OV3A 3A98A 1YITQ 2EYWA 4A4KA 1PRLC 3RESA 1NEGA 1OX9A 2A08A 5LJ3e 1ZUYA 4JZ4A 1SPKA 3GIBA 4JDSA 1C1AA 1M1KU 2XDPA 4LXCA 2O9SA 4ANJA 1UTIA 1CSKA 1ZSGA 1NJIU 1E6GA 3PMTA 2PTKA 1F1BB 4FIBA 4DOWA 3CCUQ 3QDRB 3UF4A 2MWPA 4OB3B 4LD9K 4KUIA 1XJWB 3RUXA 3TREA 4CI0C 1VQ5T 4OMPA 5LL6S 3LW5E 4M75A 2M1HA 2JNGA 4AG1C 4EMKA 1BI0A 1TU0B 2E4HA 4D8KA 4F04B 1VIEA 3QZ5B 4J9BA 1D0YA 2QQSA 1SEMA 5GANj 4J9DA 5FWCA 3SFMA 4Z89A 3OYAA 1CKBA 3BW1A 1H8KA 3NTKA 3TU4K 3VS7A 1SHGA 5CAIA 3G4ST 2LRQA 3CC4T 1J3TA 1Z9QA 1X2QA 2HMAA 2KY9A 1QLYA 3QXEB 5KYYA 2GGRA 2L89A 1GBQA 2EGAA 3GOXA 5KYNA 3O8VA 1AWWA 1SKUB 3V7CA 2K5LA 2AZSA 2FPDA 5LJ3h 1YP5A 3CXCP 4XTUA 5FROA 2DFUA 4F7UF 4N0AC 2RN8A 4FYVB 3CC7T 2VGMA 1KIKA 2QG9B 3NPFA 4II1A 4A4FA 4E7KA 2DRMA 1U5SA 2I2LA 3EG2A 4XTXA 2DE0X 1PD1A 4DQ2A 4MZPA 1JU5C 2E5QA 1W4SA 1JXOA 2KYMA 2O2OA 4QKUA 3LX7A 1K8AU 1VQLT 9ATCB 4F16A 1K73R 4E7JA 3CCEQ 1AWOA 1WJSA 1QVFP 1QKWA 2OTLA 3QYGB 5CCAA 2O01E 1PKSA 3VS4A 3JCMP 4ATOA 2MCNA 4QVCA 2DZ9A 2DTIA 1GCQC 2E5KA 4B9WA 2DBKA 1ZSZC 2MPXC 5CKHA 4L59A 4BI3A 2JTFA 4C0FA 2QI2A 3C0CA 3QWXX 1ABOA 2OJ2A 1YJWT 3G71A 4LDYA 1WQ7A 2F5KA 1B34A 1SRMA 2YDLA 1X2KA 4J7IA 4M4ZA 3S6WA 3D7SB 2CKKA 1E6HA 1KC8C 5GAMd 1FXXA 3QO3A 3C94A 5GAOp 4XTWA 2BZ8A 2RA2A 3X25B 3CCLT 1NLPC 4A4GA 2ZGWA 5GAN6 5KYXA 1VQPQ 4PJOE 2IVWA 1AZEA 1KHCA 5IH2A 2QK0A 4DBQA 2G6FX 4AT1B 3QBYA 1VQKT 2LC4A 1W2BP 4N0AA 5CQYA 3FDRA 1I5OB 2O31A 4IUUA 2DPPB 1OI1A 3QYHB 4JRPA 1VQ5A 2C0IA 3OYBA 2X35A 2LP5A 3S3MA 2MI6A 5GMKi 1UHCA 1N8RU 1MMAA 3E2UA 2ZPIB 3G6EQ 4LD6A 5GAMf 1I4K1 2GTJA 1U8RA 2IG0A 2KI7A 3QJYA 2V1RA 1EFNA 4C5EA 2FEIA 2HL5C 3MP6A 1BI2A 5AYFA 1WHKA 3CC4A 1HSQA 2D1XA 4R55A 1TUDA 1G8XA 4KGXB 1GCPA 3ZEHA 2HQHA 3HRSA 3EHQA 4BE1A 1S72Q 1D1BA 3CCJQ 5CR2A 4XU1A 3KXTA 5GAOm 2ESWA 2O9VA 1A0NB 1LPLA 3CCMA 1ZA1B 1YJ9T 5FRMA 3QSUA 2RH2A 2CP2A 2KRNA 2YWWA 1HXDA 1VYVA 3M4GA 3EGUA 4GLKA 3CMEQ 1PWTA 2CZ1B 4ESRA 2CZ0B 1MV0B 5GANe 4HCCA 1Q81R 3M0PA 1M90U 1B3QA 4MMLA 1K9MC 1RLQC 1HJDA 1V76A 4MMKA 2KE9A 5L8RE 1OPKA 2HKQB 2JW4A 1VQOT 4M77C 3H41A 4M77G 4PFZA 1SSHA 1G83A 2RHZA 1K73C 4OMNA 1JJ2P 1R8OB 4HVVA 2ROLA 3A8OB 4E7IA 5HK3A 4PL6A 3H6ZA 2LZ6B 2V8KA 3QIIA 1IGQA 2VC8A 4C8QF 2R58A 5IHIA 3M54A 2DM1A 1BU1A 3QG1A 1X43A 4KRTA 1NEBA 5I21A 2W0ZA 1YJWA 4NL2A 3JCMW 3L1AA 1VQ6T 1RACB 4C0ZA 3A8HB 4J9CA 8ATCB 2QQAA 3ASKA 1G2BA 3M0SA 3OYNA 2YT6A 3P8HA 1YI2A 4BI4A 3PVLA 3CCLA 4J6XA 3JCMc 1ABQA 2P0KA 3T9NA 3EGDB 2BIVA 3WVEB 5GAOn 4QVDA 4LNPA 1WA7A 1G3WA 3PT9A 1Q82C 1VQKA 1H92A 5IHKA 4FU6A 2KEAA 1JRIA 2EBPA 2EKHA 1Y7XA 4J6WA 5LJ3j 4EMHA 2KROA 1M1GA 2R5MA 4XU3A 1JB0E 3JCMV 3H8ZA 4E2FB 2RQVA 5DLQE 3UDCA 2MF2A 5GAOl 2OTLQ 4XAXB 2HDAA 2DD5A 3CPWA 5GAMg 4RMOA 1G5VA 4C8QB 4MDXA 2DJQA 4FW2A 3JAME 2D8HA 1PNJA 3JCMJ 1MNDA 5HKCA 1MHNA 5IHNA 2NUPB 4M77A 3MEAA 3R6NA 3META 1MMDA 4N4IA 2KBTA 1AEYA 4RG2A 2RJCA 1OU8A 2V8JA 1SHFA 3G71Q 3QPHA 1RL2A 2QQRA 3PNWC 1ZQ1A 4M7DF 3FJ5A 4CC4B 3OS1A 1YJ9A 1YWPA 2L2PA 3MEWA 3CPWS 4IIMA 3KUFA 4M77D 1N5ZA 3MJXA 2DTHA 5FRNA 3OMGA 3J7AF 5GAN3 1VQ7T 2BZYA 3OYGA 1B07A 2QEXT 4PLLA 2RQUA 1IZ6A 3L2ZA 5IXBA 4ZGEB 4ZTFA 3ME9A 1ACMB 2ENMA 1QP2A 1MUZA 1VQ5Q 4C5GA 2DF6A 4ME7A 3C12A 2JS2A 2VUBA 1M27C 1BB9A 3NTHA 2KMTA 1PG5B 4J5YA 1W6XA 1I1JA 2LQ8A 4EMGA 2JTMA 3OYKA 2DETA 3CCRT 5I2SA 1XTDA 4R0KA 2DL7A 2RI2A 2ZPFB 2LDMA 3OB9A 5IXFA 2KQWA 3CC4Q 3FLGA 3CD6T 4HT9A 3UA6A 4M7DB 5KCOA 4C0GA 2GBQA 5CKDA 1OOTA 1FYNA 2K79A 1RAEB 3OSVA 2FVUA 3ZBDA 4C92F 2W10A 1VQ6A 4PJLA 4LDWA 3M55A 1M1FA 1MGQA 2H3EB 1G3SA 3OYDA 1M8MA 3LH0A 1SG5A 4PJOC 4PJOG 3A1PA 2RHYA 4KGVB 2RK2A 2I0NA 3SD4A 2DO3A 1ZHIA 5GJWB 2HL3A 3BDUA 4QT7A 3QDFA 2V1QA 3L2VA 2E12A 1WHHA 4B6MA 3N5BB 2EJFA 1WXTA 2CP0A 2CSIA 4PJNA 1VQLQ 2EYYA 2F2WA 4J9HA 1LOJA 1AOJA 5CIUA 3G6EA 1WGSA 4VUBA 2KVQG 4BY6B 2CT4A 3BDLA 4KUDK 2VKNA 3SB2A 3UA7A 2F5TX 3I5SA 2IPOB 4AFZC 2E3HA 1X6OA 4X9DA 3VUZA 2X3WD 1W2BA 3EG9B 5I22A 1M2VB 4C92B 1BIAA 3VS6A 1S72A 3CCQT 1KC8R 2MAMA 5GAMe 2LX7A 1LNXA 4FYYB 1YJWQ 4WCIA 1LVKA 2DZCA 4GY5A 4JRKA 2KDSA 5CQXA 2LVMA 1PHTA 4DA4A 1OEBA 5D6XA 3TSWA 3OYCA 1HD3A 1YIJT 1I07A 1D3BA 3OA6A 5FW9A 2EPDA 1YI2Q 3X20B 2COWA 2O4XB 3CMEA 3CCLQ 1VIFA 1D1CA 4IURA 3ULRB 4DBHA 1VQ7A 2QA4T 1Q7YR 4O5VA 2HAXA 2VASA 4PNOA 4O6JA 2K3YA 1VQKQ 3V8LA 3NTIA 4F17A 2G3RA 1ARKA 5KYWB 4PJOA 4RTVA 1QQJA 4AFSC 3QWYA 2DEQA 4OGEA 4FW1A 2HD0A 4JRIA 1NPRA 1M1KC 3EFSA 1YFNA 3VYHB 5EC7A 1NJIC 1UB4A 4JJNK 2DBMA 1T0JA 3AHUA 3CCRA 1ZX6A 2AZVA 1X75C 4PJOD 1M2OA 4HKEA 1KQ2A 2D9TA 2XI9A 2YUNA 5DY9A 3EGDA 4OB1B 1UJYA 2HQEA 3VUBA 5GAMh 1ZUUA 4RCBA 3CD6A 1X01A 2NUTB 4Z02A 4PJJA 3OQ5A 2JM9A 5J26A 2CP7A 1OULA 4XTZA 4CRIA 4BE2A 1Q86U 1YJ9Q 2DL5A 1VQNT 4FSSA 2EAYA 1WHJA 3RBBB 3EG0A 1PM3A 4C0DB 4JZ3A 3THKA 1K9MR 3M56A 2AKKA 3FIFA 3CQTA 1PSEA 4V2SA 3SWNB 4PKCC 2OX7A 1QKXA 4QQDA 1KFZA 3UWNA 1D0XA 2X4WA 3OW2P 1N9SA 3C4SA 1VQOQ 4HVWA 3VU3C 1FMKA 4E7HA 3RKXA 4N4HA 4FM4B 1BI1A 1VYUA 3DB3A 1JBMA 3L2RA 2DXCA 2X3XD 5A0DA 4PFPA 3GNFB 1G3TA 2QDLA 1P92A 4KH1B 3DKMA 2M9UA 3H0HA 1Y0MA 2DKGA 4X34A 3OMCA 1N9RA 4MZMA 4BY6C 3OYMA 3CCQA 2JS0A 4GLMA 2QDYB 3EFOA 4L5GA 5KYUA 3VRYA 4F7UB 2HSEB 2K2VA 3VS1A 4ZGJB 2CP3A 2JUFA 3C95A 1MV3A 2DL3A 5J3BA 1VQ6Q 4E6RA 1UEBA 3M58A 1VQMT 2YUPA 1K0XA 1PRMC 5DM7R 1Q82R 2KT1A 3MPUB 1UGSB 1BIBA 3JB9H 4CC3A 1AZGB 3L2QA 1OPLA 4M7AF 3CMAT 4MZTA 2MOXA 3OYHA 4J9GA 2AKLA 3FB9A 2YLCA 1RAFB 4XK8E 1Q7YC 2QTXA 1X6GA 2RQRA 5CO7A 4JJCA 2DX1A 3RKWA 4NOYA 4X1VA 2EGEA 2FRYA 1TUCA 2DYBA 2EQMA 2RB6A 2EKOA 2CP6A 4OMMA 2XG8D 4RTTA 1GL5A 4J9EA 3L42A 2ZPGB 1WJRA 2EGCA 1U06A 2L3RA 3E1SA 4WTOB 2CDTA 3G4SA 3E9GA 1PCXA 3VYGA 2Y4XA 1ZBXA 2E6NA 1QVGA 2LNVA 1OX8A 2NUZA 3IQLA 3H0FA 4ZNXA 3VS5A 1N8RC 4A4EA 4BDZA 4DBRA 2Z0WA 2QGFB 1TUGB 1GCQA 4J9FA 1ZSZA 2MYSA 3HFOA 2LX9A 2OTJT 3JV3A 1TS9A 3FJPA 3HL8A 3M0QA 4JPBW 4Z88A 4M7AB 2M02A 3CC7A 1GFDA 1WYXA 4RKUE 3VS3A 4KH0B 2QTVA 2PUOB 1QW1A 2DAQA 2R5AA 2JN0A 1H3ZA 5CKBA 1W70A 3BE3A 4L6V5 4RUGA 1YHQT 1K9MU 1VQ7Q 1I81A 1AHJB 4FYXB 3M0TA 1QVGS 3RKYA 3G1JA 1M2VA 1NG2A 3OBWA 4M75F 1OZ2A 3LLRA 2FZGB 1M8VA 2LTOA 1VQLA 1OYXA 2XDDA 1K1ZA 2DILA 3JSCA 1Z9ZA 4CC7A 2OAUA 3HP9A 1K73U 4ZTJA 1SSFA 4IUQA 1I8FA 2K3XA 3GLXA 3SWNC 3HTRA 1W1FA 2RNAA 2FPFA 5C6SA 4C92D 1JQQA 3CCVT 3M9QA 4HA8A 2O4XA 2ABLA 2J6FA 1M90C 3CCRQ 5LJ5d 1TSFA 2KXDA 2LCLA 4PJMA 4FYWB 4FCYA 3V8KA 3MP8A 4PK4A 3J81E 3NFCA 1NE8A 3CD6Q 2DK3A 1UHFA 5KYWA 2MK5A 2RJEA 2F2XA 2M51A 3P8BB 2RM4A 2E3IA 2CUBA 5HK0A 2KT8A 2XMFA 3CC2T 1UGQB 2B86A 4OGCA 1XQHA 2VXEA 1WFWA 4M7DE 3OS5A 5IN1A 4F7UG 5GAMj 4M75B 3ZL7C 2ZPHB 3CMAA 5LJ5f 2DYIA 4EMKB 1YCSB 3GF5A 4TVRA 3P8DA 5GAOr 2XIDA 4JS5A 4OMLA 3EH1A 1M4ZA 3EG3A 2A3LA 3OS0A 1SF9A 2HCKA 2F2VA 3A8LB 1WHLA 3GPLA 2L3QA 7AT1B 1O9SA 4LDUA 2QQBA 3MEVA 1EX4A 1UGVA 2BZXA 1QP3A 3EAEA 2FO0A 3GBQA 5D6WA 4RCCA 5KYYB 2K5FA 2VV5A 1TOVA 5GJVB 1WIEA 2CH4W 2OAWA 1BCOA 4HXJA 4E7LA 1WLPB 4C5HA 2CZ6B 2FZKB 2DL8A 2M0YA 3LGLA 1KD1R 3M4YA 2C0OA 3TEEA 3SWNA 4E47A 1H3HA 4Z8AA 3OYIA 3JCMd 3CCQQ 3RERA 1K0SA 2RQTA 4X9CA 4LE9A 3PVQA
chains in the Genus database with same CATH topology
3G71Q 1K8AR 3CMAQ 1W2BP 1Q86R 1Q81R 2QA4Q 3CXCP 1YHQQ 1VQ6Q 2QEXQ 1VQKQ 3I55Q 1QVGP 3CCMQ 1M1KR 1VQ4Q 1KQSP 1VQ9Q 3CCVQ 1N8RR 3CCRQ 1K73R 1YJ9Q 3CCEQ 2OTJQ 1VQLQ 3CPWP 3CCSQ 1QVFP 1VQ5Q 1YIJQ 3G4SQ 1Q82R 3CC4Q 1VQMQ 1NJIR 1KD1R 1VQPQ 1VQ8Q 3OW2P 1YI2Q 1VQNQ 3CC7Q 3I56Q 3CC2Q 3CCLQ 2OTLQ 3G6EQ 1YJNQ 1VQOQ 1KC8R 3CMEQ 1K9MR 1S72Q 3CD6Q 3CCJQ 1M90R 1JJ2P 3CCQQ 1Q7YR 3CCUQ 1YITQ 1YJWQ 1VQ7Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 Q;  1K8A R;  3CMA Q;  1W2B P;  1Q86 R;  1Q81 R;  2QA4 Q;  3CXC P;  1YHQ Q;  1VQ6 Q;  2QEX Q;  1VQK Q;  3I55 Q;  1QVG P;  3CCM Q;  1M1K R;  1VQ4 Q;  1KQS P;  1VQ9 Q;  3CCV Q;  1N8R R;  3CCR Q;  1K73 R;  1YJ9 Q;  3CCE Q;  2OTJ Q;  1VQL Q;  3CPW P;  3CCS Q;  1QVF P;  1VQ5 Q;  1YIJ Q;  3G4S Q;  1Q82 R;  3CC4 Q;  1VQM Q;  1NJI R;  1KD1 R;  1VQP Q;  1VQ8 Q;  3OW2 P;  1YI2 Q;  1VQN Q;  3CC7 Q;  3I56 Q;  3CC2 Q;  3CCL Q;  2OTL Q;  3G6E Q;  1YJN Q;  1VQO Q;  1KC8 R;  3CME Q;  1K9M R;  1S72 Q;  3CD6 Q;  3CCJ Q;  1M90 R;  1JJ2 P;  3CCQ Q;  1Q7Y R;  3CCU Q;  1YIT Q;  1YJW Q;  1VQ7 Q; 
#chains in the Genus database with same CATH topology
 2QAZ A;  2EW3 A;  2L3S A;  3S3O A;  1GRI A;  2LMJ A;  5HY6 A;  3LH5 A;  2OTJ A;  3H9N A;  5GMK h;  2VB6 A;  1EZZ B;  2JOY A;  2E41 A;  2JTE A;  3TSZ A;  1YIJ Q;  4C92 E;  4JJD A;  4E7Z A;  3LYI A;  1NM7 A;  3MP1 A;  3M0R A;  1YHQ A;  2ED1 A;  4XU2 A;  2EJG A;  3EFR A;  3M57 A;  1R0C B;  3PIO A;  1M1K R;  1Q81 U;  5GMK m;  3HHT B;  3JCM f;  4JRQ A;  5FWB A;  1VUB A;  1MMG A;  3I56 T;  4F7U A;  2RHI A;  1NJI R;  3CXC A;  1QWF A;  1VA7 A;  1VQO A;  2PNI A;  3VS2 A;  3CPF A;  2F69 A;  3BFM A;  2A0F B;  4D8D A;  1WDX A;  3EH2 A;  5IT9 E;  1Y96 B;  1NBE B;  2RD1 A;  3PFS A;  4PFO A;  4ZN1 A;  1FMW A;  3M5A A;  1QCF A;  4EIK A;  3CCV A;  5GAN d;  2A28 A;  4KUL A;  4FT4 A;  1WZO A;  4QQ6 A;  3G4S Q;  5I2M A;  1M3A A;  2O88 A;  4XU0 A;  2Y4Y A;  2CS7 A;  4J8O A;  5A0L A;  4HVU A;  1QVF A;  5KYX B;  1MNE A;  4LN2 A;  1RAB B;  3CXC S;  2CP5 A;  3TQ7 P;  2COZ A;  4A63 B;  2E10 A;  4XTV A;  1KQS P;  3VV0 A;  3OYY A;  2K6D A;  3NMZ C;  1KK7 A;  2DA9 A;  1C6V X;  4OMQ A;  3CC2 A;  1VQN Q;  2LJ1 A;  3CC7 Q;  2LQK A;  2BUD A;  2GQV A;  5GAN f;  1KHI A;  2K4Y A;  4E7S A;  3RMS A;  1K76 A;  2LJ3 A;  2K2M A;  3VRZ A;  3QZ9 B;  5LJ5 g;  3JB9 F;  1VOM A;  2EYX A;  1QVF S;  2KYB A;  2XIC A;  1UG1 A;  2J06 A;  2FYK A;  4M75 C;  4Q5W A;  2EQJ A;  2J7I A;  4M75 G;  2LNH B;  3RR6 A;  3S3N A;  4QQG A;  2RO0 A;  2VYT A;  2JVV A;  3RIR A;  5KH6 A;  4OVA A;  3ZFJ A;  2K7A A;  2B8A A;  1UDL A;  1K8A R;  1UFF A;  1IHW A;  2RQW A;  1UGP B;  2VWF A;  2R57 A;  2VXF A;  5KE3 A;  1WXB A;  3A8M B;  1WNL A;  2ATC B;  3VKI A;  4JS4 A;  3LWI A;  4OMF B;  2MMP A;  2HEQ A;  3OYJ A;  4WF2 A;  2XHC A;  5A0G A;  2ZCF B;  4C8Q C;  3OSS C;  4C8Q G;  4KT0 E;  2RHU A;  3M0U A;  4M7A D;  1KD1 C;  2CGH A;  2RF0 A;  1U3O A;  2KR3 A;  3HFN A;  1I0C A;  6AT1 B;  2K3B A;  4QW2 A;  2DVE A;  5EG2 A;  1WHM A;  4HCZ A;  1VQM Q;  1U1T A;  1X69 A;  2M16 A;  1YJN T;  3O5Z A;  2QGG A;  4OB2 B;  1D0Z A;  3I9Q A;  2X4J A;  4IUP A;  4YTL A;  4F7U E;  2HBW A;  1DJ7 B;  3M53 A;  1W2B S;  3FRN A;  3REA B;  4IIO A;  2QEX A;  3CMA Q;  3I55 T;  3UAT A;  5A2Q E;  1T3S A;  2JXB A;  4Y92 A;  3A5Z B;  4FL6 A;  1E7O A;  2X4Y A;  2RJD A;  1VQ8 T;  3CPW P;  2E70 A;  1RAI B;  3I56 A;  2HZY A;  4ORZ A;  3JCM g;  3URG A;  2WSE E;  1JO8 A;  2BE9 B;  2V8I A;  1BYM A;  2E64 A;  4KBM B;  1IO6 A;  1VQ4 T;  4M77 F;  2M0O A;  1TWB A;  4RTU A;  1N8R R;  1IGU A;  1V29 B;  2D0N A;  2YRC A;  2IIM A;  2KNB B;  4J7F A;  5I11 A;  2GTO A;  4A54 A;  2EYZ A;  4HT8 A;  2DXU A;  2XK0 A;  4QVZ A;  3VS0 A;  2QAS A;  2K57 A;  2ZPE B;  3E19 A;  1R77 A;  5GAN 8;  3OYF A;  4M78 F;  4LUE A;  3RNJ A;  4CC2 A;  1S1N A;  1JJ2 A;  2GQI A;  4M75 D;  3FC3 A;  2OTJ Q;  3R6O A;  4C5I A;  2DJZ A;  4D6W A;  2YHT A;  2RJF A;  4M7D C;  4M7D G;  4C8Q A;  1NYG A;  1QMC A;  2BKD N;  2AK5 A;  1NPP A;  3MEU A;  4F14 A;  5GAN 5;  2F1L A;  2PVD B;  2P84 A;  3HKS A;  5GAN g;  4HCB A;  3QKJ A;  3CCM T;  2NUP A;  3REB B;  1YHQ Q;  3GNG A;  1VQ9 T;  1AWX A;  3CCS T;  2FZC B;  2KRS A;  2COY A;  4XTY A;  2E6Z A;  4UC4 A;  4M7A E;  3JRZ A;  5GMK j;  1Q86 C;  1K4U S;  4C8Q D;  2BE7 D;  1JJ2 S;  4M77 B;  1RI9 A;  1M90 R;  4Y28 E;  2DLP A;  5LJ5 e;  2DMO A;  4ELY C;  3EG1 A;  3SEM A;  3QJ6 A;  1EIF A;  3CBM A;  3OYE A;  1OU9 A;  5GAN 4;  3CCV Q;  2PVO B;  1WX6 A;  2X51 A;  3NHN A;  3ER0 A;  1K8A C;  5IAY A;  1TXQ A;  1AVZ C;  2L5Q A;  1BCM A;  2XU8 A;  3HPW A;  1RI0 A;  4M78 B;  4BE0 A;  3EGX B;  2X9H A;  2LCS A;  2XD0 A;  1BBZ A;  1KC8 U;  4DOV A;  2HNI A;  1TH7 A;  2KK4 A;  1TTH B;  3KBG A;  2J6K A;  1Y07 A;  2A7Y A;  1IRE B;  4BD3 A;  2YRD A;  4C92 C;  3JCM Q;  1YIJ A;  4C92 G;  3E9F A;  2FRW A;  2EFI A;  1IRX A;  1B7T A;  1YJN A;  1Y96 A;  1H64 1;  3CC2 Q;  2QYZ A;  4NS5 A;  3EHR A;  4FT2 A;  1YIT T;  2WSF E;  2CUD A;  4RTZ A;  2P0P A;  1FWZ A;  1IB8 A;  4BDY A;  2QA4 A;  1T3L A;  4AMC A;  3I55 A;  2DER A;  1Q7Y U;  1AT1 B;  4OMO A;  5AT1 B;  3MO8 A;  2V26 A;  1M3C A;  2QXF A;  3TCJ A;  4NL3 A;  2FPE A;  1HYO A;  1YI2 T;  4M7D A;  3JB9 J;  1VQ8 A;  3HSB A;  2JMC A;  3JB9 G;  3X28 B;  5LJ3 d;  1WJQ A;  1SRL A;  2ZAE A;  3CCU T;  5LJ5 h;  4LUD A;  4M75 E;  5KE2 A;  3X24 B;  5HCK A;  4B9X A;  1N27 A;  1YCY A;  2LT1 A;  3HRT A;  1VQ4 A;  2OI3 A;  1KQ1 A;  4M7D D;  1T0H A;  3JCM e;  3J80 E;  2HKN A;  2C06 A;  2A37 A;  2K9G A;  3V7S A;  2EWN A;  2DVJ A;  5CVI A;  2YUO A;  2P4T A;  1RLP C;  3PMI A;  1IXD A;  2GF7 A;  1YNZ A;  4C8Q E;  2L0A A;  5LJ3 f;  2L3P A;  2KRM A;  5FLX E;  2J05 A;  2YLB A;  4K11 A;  1G3Y A;  5FU7 B;  1V1C A;  1VQN A;  2EIF A;  2NYS A;  1M5Q 1;  2PZ1 A;  1PSF A;  8AT1 B;  2GFU A;  2WAC A;  3A8G B;  3CBO A;  4PJO F;  1Y71 A;  4J83 A;  3EG9 A;  2DIG A;  2EQK A;  2PU9 B;  2QEX Q;  1VQ9 A;  2HQX A;  4C92 A;  1KSW A;  2RI3 A;  3CCS A;  1MMN A;  2CYZ B;  4DEY A;  3UPU A;  1GBR A;  3PE0 A;  1M30 A;  1QWE A;  4C0D C;  1NYF A;  2MIO A;  3I56 Q;  1WPY A;  1KQS A;  2GNC A;  5J39 A;  4XQ3 A;  4JLG A;  1IHV A;  2PUK B;  2ECZ A;  1X27 A;  2LQW A;  2Y90 A;  2ZZD A;  2JZ2 A;  1TG0 A;  1UE9 A;  3PTA A;  1UEC A;  2C0T A;  3SHW A;  3CCE T;  5FU6 B;  3JCM h;  5GAN 2;  2LQN A;  3OYL A;  1M3B A;  1VYT A;  4RTY A;  1N6A A;  5DLO A;  3H0I A;  2RHX A;  1D3B B;  4RTW A;  1Q95 G;  2DEU A;  3TVT A;  3SDZ A;  5CKF A;  3F70 A;  1RAD B;  1YWO A;  1HK9 A;  1KQS S;  2FL7 A;  2YSQ A;  2ROT A;  5D6Y A;  3I5R A;  3JB9 D;  1FMV A;  3RDV A;  1OZ3 A;  1VQM A;  1WHG A;  4LDX A;  5GMK e;  2RPN A;  4R56 A;  4JLI A;  4PJO B;  2DIQ A;  4M78 C;  4M78 G;  2AHJ B;  1Q82 U;  1YIT A;  4IUV A;  2LJ0 A;  1WI7 A;  2DRK A;  4AFU C;  2CT3 A;  2ED0 A;  1U1S A;  4ZN3 A;  2NUT A;  1VQP T;  1GXI E;  1ZLM A;  3CEY A;  1X6B A;  5GAN h;  4RTX A;  2KAF A;  3OY9 A;  2EQU A;  1ZA2 B;  3CCU A;  1JXM A;  5D7U A;  2JM8 A;  1LJO A;  1UJ0 A;  1K9A A;  4MDW A;  4J9I A;  1XNI A;  3INZ A;  3WXM B;  2VVK A;  3G6E T;  1CKA A;  3MHX A;  1M9S A;  2DD4 A;  3BY7 A;  1D09 B;  1YBY A;  2P0Q A;  3KFV A;  2D0Q B;  1QCN A;  4EDU A;  5M9O A;  2PQW A;  2X4X A;  2RK1 A;  1FX7 A;  1QCO A;  2PVG B;  5LJ3 g;  3LWH A;  4BI8 B;  3I35 A;  4IKF A;  1S72 T;  3CCJ T;  3Q1J A;  1YJN Q;  1PD0 A;  2K5I A;  5C0M A;  2EQI A;  1WQW A;  3JCM X;  3DLL A;  1KG1 A;  1OQK A;  4FSX A;  2HSP A;  2QA4 Q;  3DLM A;  2AIR B;  3I55 Q;  5FU7 C;  2JT4 A;  3FEO A;  3NGP A;  1BI3 A;  4M7A C;  4LDV A;  4M7A G;  4OB0 B;  4M78 A;  2HBP A;  3EGX A;  2EVR A;  1I5L A;  3HRU A;  1VQ8 Q;  3CME T;  2D8J A;  2JJ9 A;  3JB9 I;  2GFA A;  3OBY A;  5CKE A;  3V7R A;  1BKB A;  1KJW A;  2RI5 A;  3DB4 A;  2AT1 B;  2QQ9 A;  3G7Z A;  1Y57 A;  2YXY A;  2KSS A;  1YN8 A;  3EFO B;  5KYU B;  3PIP A;  1QVG P;  3CCE A;  2LT4 A;  1VQ4 Q;  3QHS A;  1B34 B;  1WXU A;  4A4H A;  2VGN A;  4HCK A;  4DEX A;  5GAN 7;  1XOV A;  4M78 D;  1AD5 A;  2YUQ A;  3AT1 B;  1Q81 C;  3U23 A;  4IUT A;  3QUI A;  4A53 A;  3VJP A;  4BUG A;  2SRC A;  5LJ5 j;  3OW2 A;  5FU6 C;  3RMQ A;  5KCH A;  1LCK A;  2ZPB B;  4BB7 A;  2EJ9 A;  2CZ7 B;  1D1A A;  5ECA A;  4GBQ A;  2KXC A;  4JJB A;  4DBF A;  1RAG B;  1AWJ A;  1RAH B;  1JEG A;  2CSQ A;  2EYQ A;  2DXT A;  2E65 A;  2KGT A;  1PC0 A;  1UGR B;  2D6F A;  3UT1 A;  4ELZ C;  3GP8 A;  2A36 A;  1NLO C;  2LCC A;  1Q86 R;  2YRV A;  4AG2 C;  1O75 A;  1ZUK A;  2FG0 A;  3MKD A;  3CCM Q;  2GCX A;  5L23 A;  1VQ9 Q;  2XKO C;  4RG8 A;  2FHD A;  2DL4 A;  2H8H A;  3CCS Q;  1VQP A;  2SEM A;  2DNU A;  4AFQ C;  3OW2 S;  1GFC A;  4EPC A;  2H3J A;  2DTO A;  2FB7 A;  3CBP A;  5GAO q;  1BK2 A;  4EMK C;  2MWO A;  3JCM b;  1RAA B;  1PKT A;  2RMO A;  4OF1 A;  2CRE A;  2J6O A;  1ZBJ A;  4BAC A;  4M7A A;  2WSC E;  4N4G A;  4KGZ B;  2XDB A;  1ZSZ B;  4ZGD B;  2OTL T;  1UUE A;  3V8J A;  2CH4 A;  3PGG A;  1NZ9 A;  2DXB A;  2L8D A;  4M77 E;  1KD1 U;  4J6Y A;  3M59 A;  3LGF A;  2P4R A;  4P5N A;  5GMK l;  1QVP A;  2NWM A;  2BTT A;  4OP0 A;  3OS2 A;  3MCA B;  5CK9 A;  4Y91 A;  3L2U A;  3L2W A;  2NLU A;  1R0B G;  3X26 B;  4PLI A;  2E1H A;  3CCJ A;  3WVD B;  1RUW A;  4M78 E;  3G71 T;  1C0M A;  2JMA A;  4JUV A;  1OV3 A;  3A98 A;  1YIT Q;  2EYW A;  4A4K A;  1PRL C;  3RES A;  1NEG A;  1OX9 A;  2A08 A;  5LJ3 e;  1ZUY A;  4JZ4 A;  1SPK A;  3GIB A;  4JDS A;  1C1A A;  1M1K U;  2XDP A;  4LXC A;  2O9S A;  4ANJ A;  1UTI A;  1CSK A;  1ZSG A;  1NJI U;  1E6G A;  3PMT A;  2PTK A;  1F1B B;  4FIB A;  4DOW A;  3CCU Q;  3QDR B;  3UF4 A;  2MWP A;  4OB3 B;  4LD9 K;  4KUI A;  1XJW B;  3RUX A;  3TRE A;  4CI0 C;  1VQ5 T;  4OMP A;  5LL6 S;  3LW5 E;  4M75 A;  2M1H A;  2JNG A;  4AG1 C;  4EMK A;  1BI0 A;  1TU0 B;  2E4H A;  4D8K A;  4F04 B;  1VIE A;  3QZ5 B;  4J9B A;  1D0Y A;  2QQS A;  1SEM A;  5GAN j;  4J9D A;  5FWC A;  3SFM A;  4Z89 A;  3OYA A;  1CKB A;  3BW1 A;  1H8K A;  3NTK A;  3TU4 K;  3VS7 A;  1SHG A;  5CAI A;  3G4S T;  2LRQ A;  3CC4 T;  1J3T A;  1Z9Q A;  1X2Q A;  2HMA A;  2KY9 A;  1QLY A;  3QXE B;  5KYY A;  2GGR A;  2L89 A;  1GBQ A;  2EGA A;  3GOX A;  5KYN A;  3O8V A;  1AWW A;  1SKU B;  3V7C A;  2K5L A;  2AZS A;  2FPD A;  5LJ3 h;  1YP5 A;  3CXC P;  4XTU A;  5FRO A;  2DFU A;  4F7U F;  4N0A C;  2RN8 A;  4FYV B;  3CC7 T;  2VGM A;  1KIK A;  2QG9 B;  3NPF A;  4II1 A;  4A4F A;  4E7K A;  2DRM A;  1U5S A;  2I2L A;  3EG2 A;  4XTX A;  2DE0 X;  1PD1 A;  4DQ2 A;  4MZP A;  1JU5 C;  2E5Q A;  1W4S A;  1JXO A;  2KYM A;  2O2O A;  4QKU A;  3LX7 A;  1K8A U;  1VQL T;  9ATC B;  4F16 A;  1K73 R;  4E7J A;  3CCE Q;  1AWO A;  1WJS A;  1QVF P;  1QKW A;  2OTL A;  3QYG B;  5CCA A;  2O01 E;  1PKS A;  3VS4 A;  3JCM P;  4ATO A;  2MCN A;  4QVC A;  2DZ9 A;  2DTI A;  1GCQ C;  2E5K A;  4B9W A;  2DBK A;  1ZSZ C;  2MPX C;  5CKH A;  4L59 A;  4BI3 A;  2JTF A;  4C0F A;  2QI2 A;  3C0C A;  3QWX X;  1ABO A;  2OJ2 A;  1YJW T;  3G71 A;  4LDY A;  1WQ7 A;  2F5K A;  1B34 A;  1SRM A;  2YDL A;  1X2K A;  4J7I A;  4M4Z A;  3S6W A;  3D7S B;  2CKK A;  1E6H A;  1KC8 C;  5GAM d;  1FXX A;  3QO3 A;  3C94 A;  5GAO p;  4XTW A;  2BZ8 A;  2RA2 A;  3X25 B;  3CCL T;  1NLP C;  4A4G A;  2ZGW A;  5GAN 6;  5KYX A;  1VQP Q;  4PJO E;  2IVW A;  1AZE A;  1KHC A;  5IH2 A;  2QK0 A;  4DBQ A;  2G6F X;  4AT1 B;  3QBY A;  1VQK T;  2LC4 A;  1W2B P;  4N0A A;  5CQY A;  3FDR A;  1I5O B;  2O31 A;  4IUU A;  2DPP B;  1OI1 A;  3QYH B;  4JRP A;  1VQ5 A;  2C0I A;  3OYB A;  2X35 A;  2LP5 A;  3S3M A;  2MI6 A;  5GMK i;  1UHC A;  1N8R U;  1MMA A;  3E2U A;  2ZPI B;  3G6E Q;  4LD6 A;  5GAM f;  1I4K 1;  2GTJ A;  1U8R A;  2IG0 A;  2KI7 A;  3QJY A;  2V1R A;  1EFN A;  4C5E A;  2FEI A;  2HL5 C;  3MP6 A;  1BI2 A;  5AYF A;  1WHK A;  3CC4 A;  1HSQ A;  2D1X A;  4R55 A;  1TUD A;  1G8X A;  4KGX B;  1GCP A;  3ZEH A;  2HQH A;  3HRS A;  3EHQ A;  4BE1 A;  1S72 Q;  1D1B A;  3CCJ Q;  5CR2 A;  4XU1 A;  3KXT A;  5GAO m;  2ESW A;  2O9V A;  1A0N B;  1LPL A;  3CCM A;  1ZA1 B;  1YJ9 T;  5FRM A;  3QSU A;  2RH2 A;  2CP2 A;  2KRN A;  2YWW A;  1HXD A;  1VYV A;  3M4G A;  3EGU A;  4GLK A;  3CME Q;  1PWT A;  2CZ1 B;  4ESR A;  2CZ0 B;  1MV0 B;  5GAN e;  4HCC A;  1Q81 R;  3M0P A;  1M90 U;  1B3Q A;  4MML A;  1K9M C;  1RLQ C;  1HJD A;  1V76 A;  4MMK A;  2KE9 A;  5L8R E;  1OPK A;  2HKQ B;  2JW4 A;  1VQO T;  4M77 C;  3H41 A;  4M77 G;  4PFZ A;  1SSH A;  1G83 A;  2RHZ A;  1K73 C;  4OMN A;  1JJ2 P;  1R8O B;  4HVV A;  2ROL A;  3A8O B;  4E7I A;  5HK3 A;  4PL6 A;  3H6Z A;  2LZ6 B;  2V8K A;  3QII A;  1IGQ A;  2VC8 A;  4C8Q F;  2R58 A;  5IHI A;  3M54 A;  2DM1 A;  1BU1 A;  3QG1 A;  1X43 A;  4KRT A;  1NEB A;  5I21 A;  2W0Z A;  1YJW A;  4NL2 A;  3JCM W;  3L1A A;  1VQ6 T;  1RAC B;  4C0Z A;  3A8H B;  4J9C A;  8ATC B;  2QQA A;  3ASK A;  1G2B A;  3M0S A;  3OYN A;  2YT6 A;  3P8H A;  1YI2 A;  4BI4 A;  3PVL A;  3CCL A;  4J6X A;  3JCM c;  1ABQ A;  2P0K A;  3T9N A;  3EGD B;  2BIV A;  3WVE B;  5GAO n;  4QVD A;  4LNP A;  1WA7 A;  1G3W A;  3PT9 A;  1Q82 C;  1VQK A;  1H92 A;  5IHK A;  4FU6 A;  2KEA A;  1JRI A;  2EBP A;  2EKH A;  1Y7X A;  4J6W A;  5LJ3 j;  4EMH A;  2KRO A;  1M1G A;  2R5M A;  4XU3 A;  1JB0 E;  3JCM V;  3H8Z A;  4E2F B;  2RQV A;  5DLQ E;  3UDC A;  2MF2 A;  5GAO l;  2OTL Q;  4XAX B;  2HDA A;  2DD5 A;  3CPW A;  5GAM g;  4RMO A;  1G5V A;  4C8Q B;  4MDX A;  2DJQ A;  4FW2 A;  3JAM E;  2D8H A;  1PNJ A;  3JCM J;  1MND A;  5HKC A;  1MHN A;  5IHN A;  2NUP B;  4M77 A;  3MEA A;  3R6N A;  3MET A;  1MMD A;  4N4I A;  2KBT A;  1AEY A;  4RG2 A;  2RJC A;  1OU8 A;  2V8J A;  1SHF A;  3G71 Q;  3QPH A;  1RL2 A;  2QQR A;  3PNW C;  1ZQ1 A;  4M7D F;  3FJ5 A;  4CC4 B;  3OS1 A;  1YJ9 A;  1YWP A;  2L2P A;  3MEW A;  3CPW S;  4IIM A;  3KUF A;  4M77 D;  1N5Z A;  3MJX A;  2DTH A;  5FRN A;  3OMG A;  3J7A F;  5GAN 3;  1VQ7 T;  2BZY A;  3OYG A;  1B07 A;  2QEX T;  4PLL A;  2RQU A;  1IZ6 A;  3L2Z A;  5IXB A;  4ZGE B;  4ZTF A;  3ME9 A;  1ACM B;  2ENM A;  1QP2 A;  1MUZ A;  1VQ5 Q;  4C5G A;  2DF6 A;  4ME7 A;  3C12 A;  2JS2 A;  2VUB A;  1M27 C;  1BB9 A;  3NTH A;  2KMT A;  1PG5 B;  4J5Y A;  1W6X A;  1I1J A;  2LQ8 A;  4EMG A;  2JTM A;  3OYK A;  2DET A;  3CCR T;  5I2S A;  1XTD A;  4R0K A;  2DL7 A;  2RI2 A;  2ZPF B;  2LDM A;  3OB9 A;  5IXF A;  2KQW A;  3CC4 Q;  3FLG A;  3CD6 T;  4HT9 A;  3UA6 A;  4M7D B;  5KCO A;  4C0G A;  2GBQ A;  5CKD A;  1OOT A;  1FYN A;  2K79 A;  1RAE B;  3OSV A;  2FVU A;  3ZBD A;  4C92 F;  2W10 A;  1VQ6 A;  4PJL A;  4LDW A;  3M55 A;  1M1F A;  1MGQ A;  2H3E B;  1G3S A;  3OYD A;  1M8M A;  3LH0 A;  1SG5 A;  4PJO C;  4PJO G;  3A1P A;  2RHY A;  4KGV B;  2RK2 A;  2I0N A;  3SD4 A;  2DO3 A;  1ZHI A;  5GJW B;  2HL3 A;  3BDU A;  4QT7 A;  3QDF A;  2V1Q A;  3L2V A;  2E12 A;  1WHH A;  4B6M A;  3N5B B;  2EJF A;  1WXT A;  2CP0 A;  2CSI A;  4PJN A;  1VQL Q;  2EYY A;  2F2W A;  4J9H A;  1LOJ A;  1AOJ A;  5CIU A;  3G6E A;  1WGS A;  4VUB A;  2KVQ G;  4BY6 B;  2CT4 A;  3BDL A;  4KUD K;  2VKN A;  3SB2 A;  3UA7 A;  2F5T X;  3I5S A;  2IPO B;  4AFZ C;  2E3H A;  1X6O A;  4X9D A;  3VUZ A;  2X3W D;  1W2B A;  3EG9 B;  5I22 A;  1M2V B;  4C92 B;  1BIA A;  3VS6 A;  1S72 A;  3CCQ T;  1KC8 R;  2MAM A;  5GAM e;  2LX7 A;  1LNX A;  4FYY B;  1YJW Q;  4WCI A;  1LVK A;  2DZC A;  4GY5 A;  4JRK A;  2KDS A;  5CQX A;  2LVM A;  1PHT A;  4DA4 A;  1OEB A;  5D6X A;  3TSW A;  3OYC A;  1HD3 A;  1YIJ T;  1I07 A;  1D3B A;  3OA6 A;  5FW9 A;  2EPD A;  1YI2 Q;  3X20 B;  2COW A;  2O4X B;  3CME A;  3CCL Q;  1VIF A;  1D1C A;  4IUR A;  3ULR B;  4DBH A;  1VQ7 A;  2QA4 T;  1Q7Y R;  4O5V A;  2HAX A;  2VAS A;  4PNO A;  4O6J A;  2K3Y A;  1VQK Q;  3V8L A;  3NTI A;  4F17 A;  2G3R A;  1ARK A;  5KYW B;  4PJO A;  4RTV A;  1QQJ A;  4AFS C;  3QWY A;  2DEQ A;  4OGE A;  4FW1 A;  2HD0 A;  4JRI A;  1NPR A;  1M1K C;  3EFS A;  1YFN A;  3VYH B;  5EC7 A;  1NJI C;  1UB4 A;  4JJN K;  2DBM A;  1T0J A;  3AHU A;  3CCR A;  1ZX6 A;  2AZV A;  1X75 C;  4PJO D;  1M2O A;  4HKE A;  1KQ2 A;  2D9T A;  2XI9 A;  2YUN A;  5DY9 A;  3EGD A;  4OB1 B;  1UJY A;  2HQE A;  3VUB A;  5GAM h;  1ZUU A;  4RCB A;  3CD6 A;  1X01 A;  2NUT B;  4Z02 A;  4PJJ A;  3OQ5 A;  2JM9 A;  5J26 A;  2CP7 A;  1OUL A;  4XTZ A;  4CRI A;  4BE2 A;  1Q86 U;  1YJ9 Q;  2DL5 A;  1VQN T;  4FSS A;  2EAY A;  1WHJ A;  3RBB B;  3EG0 A;  1PM3 A;  4C0D B;  4JZ3 A;  3THK A;  1K9M R;  3M56 A;  2AKK A;  3FIF A;  3CQT A;  1PSE A;  4V2S A;  3SWN B;  4PKC C;  2OX7 A;  1QKX A;  4QQD A;  1KFZ A;  3UWN A;  1D0X A;  2X4W A;  3OW2 P;  1N9S A;  3C4S A;  1VQO Q;  4HVW A;  3VU3 C;  1FMK A;  4E7H A;  3RKX A;  4N4H A;  4FM4 B;  1BI1 A;  1VYU A;  3DB3 A;  1JBM A;  3L2R A;  2DXC A;  2X3X D;  5A0D A;  4PFP A;  3GNF B;  1G3T A;  2QDL A;  1P92 A;  4KH1 B;  3DKM A;  2M9U A;  3H0H A;  1Y0M A;  2DKG A;  4X34 A;  3OMC A;  1N9R A;  4MZM A;  4BY6 C;  3OYM A;  3CCQ A;  2JS0 A;  4GLM A;  2QDY B;  3EFO A;  4L5G A;  5KYU A;  3VRY A;  4F7U B;  2HSE B;  2K2V A;  3VS1 A;  4ZGJ B;  2CP3 A;  2JUF A;  3C95 A;  1MV3 A;  2DL3 A;  5J3B A;  1VQ6 Q;  4E6R A;  1UEB A;  3M58 A;  1VQM T;  2YUP A;  1K0X A;  1PRM C;  5DM7 R;  1Q82 R;  2KT1 A;  3MPU B;  1UGS B;  1BIB A;  3JB9 H;  4CC3 A;  1AZG B;  3L2Q A;  1OPL A;  4M7A F;  3CMA T;  4MZT A;  2MOX A;  3OYH A;  4J9G A;  2AKL A;  3FB9 A;  2YLC A;  1RAF B;  4XK8 E;  1Q7Y C;  2QTX A;  1X6G A;  2RQR A;  5CO7 A;  4JJC A;  2DX1 A;  3RKW A;  4NOY A;  4X1V A;  2EGE A;  2FRY A;  1TUC A;  2DYB A;  2EQM A;  2RB6 A;  2EKO A;  2CP6 A;  4OMM A;  2XG8 D;  4RTT A;  1GL5 A;  4J9E A;  3L42 A;  2ZPG B;  1WJR A;  2EGC A;  1U06 A;  2L3R A;  3E1S A;  4WTO B;  2CDT A;  3G4S A;  3E9G A;  1PCX A;  3VYG A;  2Y4X A;  1ZBX A;  2E6N A;  1QVG A;  2LNV A;  1OX8 A;  2NUZ A;  3IQL A;  3H0F A;  4ZNX A;  3VS5 A;  1N8R C;  4A4E A;  4BDZ A;  4DBR A;  2Z0W A;  2QGF B;  1TUG B;  1GCQ A;  4J9F A;  1ZSZ A;  2MYS A;  3HFO A;  2LX9 A;  2OTJ T;  3JV3 A;  1TS9 A;  3FJP A;  3HL8 A;  3M0Q A;  4JPB W;  4Z88 A;  4M7A B;  2M02 A;  3CC7 A;  1GFD A;  1WYX A;  4RKU E;  3VS3 A;  4KH0 B;  2QTV A;  2PUO B;  1QW1 A;  2DAQ A;  2R5A A;  2JN0 A;  1H3Z A;  5CKB A;  1W70 A;  3BE3 A;  4L6V 5;  4RUG A;  1YHQ T;  1K9M U;  1VQ7 Q;  1I81 A;  1AHJ B;  4FYX B;  3M0T A;  1QVG S;  3RKY A;  3G1J A;  1M2V A;  1NG2 A;  3OBW A;  4M75 F;  1OZ2 A;  3LLR A;  2FZG B;  1M8V A;  2LTO A;  1VQL A;  1OYX A;  2XDD A;  1K1Z A;  2DIL A;  3JSC A;  1Z9Z A;  4CC7 A;  2OAU A;  3HP9 A;  1K73 U;  4ZTJ A;  1SSF A;  4IUQ A;  1I8F A;  2K3X A;  3GLX A;  3SWN C;  3HTR A;  1W1F A;  2RNA A;  2FPF A;  5C6S A;  4C92 D;  1JQQ A;  3CCV T;  3M9Q A;  4HA8 A;  2O4X A;  2ABL A;  2J6F A;  1M90 C;  3CCR Q;  5LJ5 d;  1TSF A;  2KXD A;  2LCL A;  4PJM A;  4FYW B;  4FCY A;  3V8K A;  3MP8 A;  4PK4 A;  3J81 E;  3NFC A;  1NE8 A;  3CD6 Q;  2DK3 A;  1UHF A;  5KYW A;  2MK5 A;  2RJE A;  2F2X A;  2M51 A;  3P8B B;  2RM4 A;  2E3I A;  2CUB A;  5HK0 A;  2KT8 A;  2XMF A;  3CC2 T;  1UGQ B;  2B86 A;  4OGC A;  1XQH A;  2VXE A;  1WFW A;  4M7D E;  3OS5 A;  5IN1 A;  4F7U G;  5GAM j;  4M75 B;  3ZL7 C;  2ZPH B;  3CMA A;  5LJ5 f;  2DYI A;  4EMK B;  1YCS B;  3GF5 A;  4TVR A;  3P8D A;  5GAO r;  2XID A;  4JS5 A;  4OML A;  3EH1 A;  1M4Z A;  3EG3 A;  2A3L A;  3OS0 A;  1SF9 A;  2HCK A;  2F2V A;  3A8L B;  1WHL A;  3GPL A;  2L3Q A;  7AT1 B;  1O9S A;  4LDU A;  2QQB A;  3MEV A;  1EX4 A;  1UGV A;  2BZX A;  1QP3 A;  3EAE A;  2FO0 A;  3GBQ A;  5D6W A;  4RCC A;  5KYY B;  2K5F A;  2VV5 A;  1TOV A;  5GJV B;  1WIE A;  2CH4 W;  2OAW A;  1BCO A;  4HXJ A;  4E7L A;  1WLP B;  4C5H A;  2CZ6 B;  2FZK B;  2DL8 A;  2M0Y A;  3LGL A;  1KD1 R;  3M4Y A;  2C0O A;  3TEE A;  3SWN A;  4E47 A;  1H3H A;  4Z8A A;  3OYI A;  3JCM d;  3CCQ Q;  3RER A;  1K0S A;  2RQT A;  4X9C A;  4LE9 A;  3PVQ A; 
#chains in the Genus database with same CATH homology
 3G71 Q;  1K8A R;  3CMA Q;  1W2B P;  1Q86 R;  1Q81 R;  2QA4 Q;  3CXC P;  1YHQ Q;  1VQ6 Q;  2QEX Q;  1VQK Q;  3I55 Q;  1QVG P;  3CCM Q;  1M1K R;  1VQ4 Q;  1KQS P;  1VQ9 Q;  3CCV Q;  1N8R R;  3CCR Q;  1K73 R;  1YJ9 Q;  3CCE Q;  2OTJ Q;  1VQL Q;  3CPW P;  3CCS Q;  1QVF P;  1VQ5 Q;  1YIJ Q;  3G4S Q;  1Q82 R;  3CC4 Q;  1VQM Q;  1NJI R;  1KD1 R;  1VQP Q;  1VQ8 Q;  3OW2 P;  1YI2 Q;  1VQN Q;  3CC7 Q;  3I56 Q;  3CC2 Q;  3CCL Q;  2OTL Q;  3G6E Q;  1YJN Q;  1VQO Q;  1KC8 R;  3CME Q;  1K9M R;  1S72 Q;  3CD6 Q;  3CCJ Q;  1M90 R;  1JJ2 P;  3CCQ Q;  1Q7Y R;  3CCU Q;  1YIT Q;  1YJW Q;  1VQ7 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...