3OW2P

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ow2P00
1S72Q 1VQ8Q 1KD1R 3CC2Q 1JJ2P 1M90R 3G71Q 1YHQQ 3CCRQ 3CCSQ 1VQ4Q 2QA4Q 1VQKQ 1K73R 3I55Q 3G6EQ 2OTJQ 3CCUQ 1VQPQ 1YI2Q 1VQLQ 3CC7Q 3CD6Q 3CXCP 1VQMQ 3OW2P 1QVFP 1VQ7Q 1VQ9Q 1VQNQ 3CCMQ 1K9MR 1K8AR 3I56Q 1Q82R 1KQSP 3CMEQ 1YIJQ 2QEXQ 3CPWP 3CCLQ 3CCQQ 1Q86R 1KC8R 1NJIR 1W2BP 1VQ5Q 2OTLQ 1VQ6Q 3CC4Q 1YJNQ 1M1KR 1Q81R 1Q7YR 1QVGP 1YJ9Q 3CCEQ 3CCVQ 1YITQ 1VQOQ 3G4SQ 3CCJQ 1YJWQ 3CMAQ 1N8RR
chains in the Genus database with same CATH superfamily
2PQWA 2DEUA 2DJZA 2ATCB 4C8QF 1FMKA 2DMOA 2MF2A 1KC8C 1C1AA 1QCNA 3NFCA 5LJ5j 3WXMB 4HVUA 1IGQA 5I11A 2M02A 4V2SA 2ENMA 1JB0E 3JCMd 3S3MA 4M7AC 4C0GA 3CC4Q 3ZL7C 1Q7YU 2AHJB 1NZ9A 2K5LA 2PTKA 2DPPB 2BZYA 1HD3A 3JCMf 1VQ4Q 4C5HA 2F1LA 1K76A 2QEXA 1OV3A 4B9WA 3RESA 1VQ9Q 1K9AA 3NGPA 3VUZA 3CCLQ 2QQSA 3FJ5A 3OB9A 2E10A 2SEMA 2LTOA 1KQ1A 3G6EA 4F7UE 4AFSC 1YJWQ 4IIOA 2L3QA 1LNXA 4XK8E 4E7SA 2C0OA 2QA4Q 2KSSA 2MPXC 2RI5A 3BDLA 1PHTA 4QVDA 3FRNA 1CSKA 4CC2A 2FHDA 2GFUA 4HCBA 5DLOA 2VXFA 1WNLA 2A7YA 3EG9B 1ABQA 1BBZA 2QEXT 4O5VA 3H0IA 4JUVA 1VQMA 4IUVA 5LJ3d 2RH2A 3JCMe 3RMQA 2DFUA 1GBQA 2GQIA 2KE9A 2RHYA 5IHIA 5FU6B 4Z02A 1F1BB 3M0TA 3G6ET 2FRYA 1JJ2A 5LJ3f 1IRXA 1VQNT 2V1RA 4AMCA 3SHWA 3D7SB 3I35A 2JM8A 2QGFB 3KBGA 2RD1A 2EKOA 4XTYA 5D6WA 4M7DC 2DLPA 2HDAA 3LWIA 3GPLA 4KGZB 5CAIA 2Y4XA 3KUFA 4ELZC 2PZ1A 1QVFP 2B8AA 2E5KA 2LQ8A 1GFCA 2WSCE 1QWEA 1VQMT 1QW1A 2MCNA 3CCMT 3QZ5B 4M7DG 2XU8A 3PIOA 2D8JA 3OS0A 1G83A 5DLQE 2LX7A 3OBYA 3HL8A 1GCQC 4LDXA 1VQPQ 4M7DF 1VQLQ 1ZX6A 2M16A 4PFZA 1BU1A 3L42A 1YWPA 3CCJA 1SF9A 3BDUA 2V8JA 1ZUYA 2ECZA 1ZSZC 3MHXA 5LJ3e 4PK4A 3OYKA 2O9VA 3BW1A 4DQ2A 2CDTA 2NYSA 5GAMd 1TS9A 3RIRA 3OYDA 3EG3A 2KY9A 3MJXA 1QVGA 1BCOA 2Y4YA 3CC4A 1WYXA 2RI2A 4PJOE 3J80E 2RQTA 1XJWB 2L3SA 2CH4W 2EGCA 1I81A 1G8XA 1VQ4A 4XU1A 1PKSA 3VS5A 1XNIA 5CKFA 1RI9A 3JV3A 4HVVA 1KSWA 3VS7A 2QASA 2DIGA 3ER0A 4FYYB 4F7UA 4EIKA 1VQ9A 3CCJT 2KRSA 3CCLA 3VS1A 2LX9A 2X4YA 3C12A 4MMKA 4NS5A 2Y90A 4C0DB 3TU4K 3LGLA 2HL3A 2BZXA 3SB2A 3PNWC 2V8IA 4LD9K 3SD4A 2QA4A 2GBQA 4D6WA 2C0IA 3OYFA 1TUDA 2HL5C 2JUFA 5GANd 2RHXA 2FZCB 1VQ4T 2MMPA 4F17A 1R77A 4XTZA 4L5GA 5GAMe 1AEYA 2FRWA 1UFFA 1FMVA 5GANf 3PIPA 1H3HA 4F14A 3OYCA 1B7TA 2XG8D 3CMAQ 3CCLT 1YHQQ 1U06A 3EGUA 2FVUA 5GAOq 3LX7A 4N0AC 4JRQA 1T0HA 2LJ1A 4AFUC 3IQLA 3JRZA 2QA4T 5IT9E 2F5KA 1WPYA 2YLBA 2SRCA 1IXDA 1K73C 1NJIU 2KRMA 1V1CA 4AFQC 3CPFA 4HKEA 4EDUA 2WSFE 2NUTA 1YCYA 4KT0E 4J9CA 3OSSC 4RTZA 5KYWB 2RQUA 1YN8A 2I0NA 1QLYA 3HFOA 2VWFA 5LJ5d 4RG2A 1OI1A 2P0PA 4LXCA 4C5GA 3E9GA 1JO8A 5I22A 2KXDA 3ZEHA 5GANe 1TSFA 1VQPA 4IIMA 1VQLA 3VUBA 4FL6A 3V8LA 3CXCS 3OW2S 4RTTA 1V76A 1K73R 1D0YA 4ZN3A 3VU3C 3TSWA 4XTUA 1ZUUA 3RR6A 5HKCA 2VKNA 4JLIA 4MDXA 4JPBW 4F7UB 2MOXA 5FWBA 3LLRA 2RM4A 1YBYA 2LT4A 1KD1U 1MMDA 3J7AF 1QVFS 1D1BA 3L1AA 4BY6C 1BI3A 3GNGA 1KHCA 1R0CB 3HRUA 3QDRB 2ROLA 1OYXA 4JJDA 1VQPT 3TCJA 1VQ5Q 1VQLT 4DBRA 3A8MB 1ZHIA 2PU9B 1YP5A 2MIOA 2XDDA 1WHHA 1T3LA 1JJ2P 1NJIC 1D0XA 4M7DE 1WXBA 5LJ5e 1YFNA 2VB6A 1E6HA 2EYXA 5C0MA 4C92G 4Z89A 2XD0A 2JS0A 1LJOA 4BI8B 1UUEA 3P8HA 3L2WA 3JCMg 2D6FA 2CREA 5FW9A 1E6GA 3M59A 2HKQB 1Z9ZA 1KQSA 4J7IA 3A8GB 4JS5A 2DXTA 2HQEA 1M1FA 2KI7A 1YITA 3G4SA 4ZTJA 1TOVA 3CMAA 1FWZA 1YHQA 3CMEQ 2K3XA 2YRVA 1NJIR 4Q5WA 2M51A 4J9DA 2NUTB 1RACB 4CI0C 1Y07A 3PFSA 4F04B 1BI1A 4OMLA 3V7SA 1UGSB 2GF7A 2LNVA 2HQXA 5GAN4 4M77A 1ZBJA 3AT1B 1PSEA 1X2QA 3VYGA 1WJQA 3EHRA 1RLPC 3I5RA 2LNHB 1KD1C 3H9NA 3VJPA 3I55T 2DTIA 4E7ZA 2H3EB 2H3JA 2ZPBB 2DRKA 2RA2A 1QVGP 5GAOn 1AZGB 2QTVA 3H6ZA 3G71Q 1YITT 3G4ST 1UJYA 1YHQT 3CMAT 5LJ3g 3X28B 4ZGJB 5KYNA 1VQKT 1X01A 2JZ2A 2RK2A 4MDWA 4WCIA 1M27C 2AIRB 4QQDA 4J9HA 1WXUA 1HK9A 2F2VA 2LQNA 2QQRA 4RTVA 3MEVA 1O9SA 4FYVB 2DERA 2K7AA 2KT8A 3OSVA 4AT1B 3UA7A 1VQNQ 6AT1B 1A0NB 5CQYA 2HNIA 1SKUB 2LMJA 1NYFA 4FYWB 2YRCA 2FO0A 4LN2A 1BIBA 4PFPA 1OX8A 4MMLA 2LC4A 4XU3A 5CIUA 2RJFA 1VQ5A 2YUQA 2QQAA 4LD6A 2GGRA 2RHUA 1M2VA 4M75C 2V1QA 3CCMQ 4OGEA 3META 1N5ZA 3JB9D 5CK9A 3M53A 2MAMA 5FU7B 2DO3A 2DRMA 4AG1C 1M1KU 3X25B 4PJMA 2EVRA 1G3TA 3M0PA 3EG2A 5IHNA 2HZYA 1SHFA 5CKHA 2EQIA 2PVOB 1OU8A 4DBQA 5A0LA 1VIFA 4M75G 4NOYA 4A53A 1OULA 3FC3A 3JB9J 4M77D 3J81E 4HCZA 1K9MU 3JCMV 2J06A 2VXEA 4M75F 3P8DA 1PSFA 4J6YA 1WFWA 2CP7A 5FROA 2EYQA 2YHTA 4IUQA 1WHJA 1YI2A 2GFAA 4E7KA 1UGQB 1VQ5T 1N8RU 1JBMA 2KYMA 3H0HA 2M0YA 3M57A 2A3LA 3CMEA 3CBOA 4CC7A 2KGTA 3M4GA 4JRIA 1MHNA 1X27A 3PVQA 1VYUA 3QYHB 4RUGA 4GY5A 3ZBDA 1K8AU 5FLXE 1OX9A 4OGCA 4GLMA 4C8QG 4EMKA 1RAGB 1PRMC 1JJ2S 5EC7A 1K1ZA 2GTJA 4RG8A 3DKMA 3OBWA 2RNAA 3QZ9B 2ROTA 2DL7A 2RO0A 4OMQA 3M0UA 5GAMh 1CKBA 2EQUA 3GNFB 2A0FB 3P8BB 2XK0A 4M78C 2V8KA 4KGXB 2PVDB 4GBQA 3ZFJA 2LJ0A 2ZGWA 2YSQA 1YI2T 2JTMA 2VASA 5DY9A 2YT6A 1W70A 3G71A 4C92E 3QPHA 3CMET 4M78G 1RAHB 3JCMQ 1M1KC 1KQ2A 3OYNA 1AWXA 4M7AG 3MO8A 4M78F 2RJDA 1M5Q1 1NEGA 1YCSB 1Q82U 4N4HA 2KR3A 2VUBA 4II1A 3QXEB 4X1VA 2FEIA 1KC8R 2WSEE 3L2ZA 4M7AF 4M7DB 5GAN5 3L2QA 2FL7A 2FG0A 2XMFA 2RJEA 1M2VB 3GF5A 1QWFA 1K9MC 2AZVA 2EGAA 1VQNA 3EHQA 4N4GA 4X9CA 2BIVA 2DL5A 4J9GA 5GANh 3CC7Q 4HT9A 1VA7A 3G71T 4KUDK 1N8RC 2VGMA 3OYLA 1KQSP 4OMFB 4IUUA 5I2MA 4LDVA 4A4FA 1M1KR 2DL4A 5GMKl 2KBTA 4A4HA 1K8AC 4BDZA 2RQWA 4R55A 3CPWA 3CCMA 2DK3A 2LJ3A 1JXMA 2DETA 4MZPA 4E6RA 3NMZC 2E64A 1MMAA 1K9MR 4A4EA 4JZ3A 1FX7A 3C4SA 5CVIA 4ZGEB 1RAAB 1N8RR 2JMAA 2OJ2A 2XI9A 4ZN1A 4E7JA 4EMKB 1EFNA 1WLPB 5HCKA 1AZEA 1Q7YC 2I2LA 1PWTA 3UWNA 1K8AR 2CP0A 3QDFA 4CC4B 2CKKA 5LJ5h 2CZ6B 2JT4A 2QI2A 4ANJA 2JVVA 3DLLA 1PD0A 1Q82C 3AHUA 3MEUA 2JS2A 1OZ2A 2QDYB 1QP2A 1NLPC 1U5SA 1VUBA 2QXFA 2CP2A 2K3BA 1IREB 4PFOA 2CS7A 2FB7A 3MEWA 3BFMA 3SWNA 4OB3B 1Q7YR 4FM4B 2DILA 9ATCB 4Z88A 1U8RA 4C92A 3G1JA 5KYWA 2L2PA 5D6XA 4EMHA 4KH0B 3S6WA 1HYOA 2DX1A 4QKUA 2JM9A 1M3AA 2FZKB 2DBKA 1NE8A 2PNIA 1Q82R 5FU6C 4J5YA 5GAMf 4RCBA 1QKXA 2EIFA 3CCVQ 2CYZB 1PC0A 3EH2A 5KCOA 4C0ZA 3FB9A 3OYJA 3R6NA 3CC2Q 2FPEA 1M4ZA 5J39A 1IHVA 3LGFA 3HP9A 3CCRT 2GNCA 4JJCA 3EGXA 3VS6A 2HSEB 3EFSA 2NLUA 4R56A 1D1AA 1JEGA 2A36A 2BE9B 3VRZA 3REBB 3JAME 1M9SA 1U1SA 4C8QE 2JNGA 4PNOA 4ME7A 2X3XD 3CC7A 4JRPA 4ZNXA 2LQWA 3I55Q 2VV5A 1MNEA 1KFZA 3OYEA 1FXXA 3G7ZA 3EH1A 2A08A 5AT1B 1BKBA 3BY7A 1JQQA 2EYWA 1QQJA 3QWXX 1YNZA 3V7CA 1VQ6Q 4B9XA 1YWOA 1YITQ 3G4SQ 1GCPA 3CEYA 2P84A 2QGGA 1VQKQ 4KRTA 1RLQC 1UG1A 2D0QB 1JU5C 2L3PA 4M78E 2FYKA 5EG2A 3CC7T 5GMKj 4M7AE 1SHGA 1SRMA 1YJ9Q 2KT1A 8AT1B 3QKJA 1AHJB 2D9TA 2O2OA 2ZPHB 2O9SA 4XU2A 3TREA 2LT1A 3PMTA 4E47A 1RUWA 3SWNB 2KRNA 2ZPGB 1KQSS 2OTJQ 2XICA 1SRLA 2E65A 2KNBB 2AZSA 4HXJA 3JCMc 2J6FA 4JRKA 4PJLA 1ARKA 4C92D 2EPDA 2KROA 4C92B 3PMIA 3DLMA 2YUOA 2M1HA 4C0DC 2JTEA 5KE2A 2HQHA 2E41A 2MK5A 2O4XA 1UTIA 3OQ5A 2DEQA 4JLGA 1WXTA 3OYIA 3ME9A 4FW2A 2NWMA 1Z9QA 2GTOA 2R5MA 5LJ5f 5IN1A 2RHIA 4J9BA 2YXYA 4E7LA 2DZ9A 3I56Q 3VS4A 4PJOA 2HBWA 4O6JA 1GBRA 1WZOA 1T0JA 1TXQA 4OMNA 4IUTA 3EGXB 1AWOA 3JCMJ 1QCOA 2LVMA 1BI2A 1W2BA 1N9SA 4OVAA 1S1NA 2AT1B 5KYXB 1W4SA 2MWPA 4LE9A 3CCVA 2JOYA 2EW3A 3CPWP 3CC2A 3VRYA 3MKDA 2ZPEB 1X75C 2RF0A 1B07A 3NTHA 1OEBA 3GIBA 1WJRA 4C8QA 3VKIA 2LQKA 3A8LB 5J26A 1FYNA 3I9QA 2DVEA 2X35A 3JCMb 5GAOm 3M4YA 1YIJQ 1MV0B 1NG2A 1WI7A 3HKSA 3I55A 1Q95G 4OF1A 1M3CA 3QUIA 1UB4A 2PVGB 1QCFA 2QDLA 2CP6A 3X26B 3CCVT 1LOJA 2RQVA 3GBQA 1VQ6A 1YI2Q 3CC2T 1C6VX 2DD5A 4N4IA 3Q1JA 3FIFA 1JRIA 1N9RA 2M0OA 5LJ3j 4OMMA 4E2FB 3JCMX 2ZPIB 4P5NA 1VQKA 1RABB 3VS0A 4X9DA 4XU0A 5GJVB 2EBPA 2J05A 3QSUA 2R58A 3UT1A 1XTDA 2O4XB 4HCCA 2DVJA 3VS3A 5KE3A 1YJ9A 1RAEB 3R6OA 1K0XA 5CCAA 2L0AA 2OTJA 3CXCA 3UDCA 3OW2A 1VQ6T 2DTOA 4PJOD 1EZZB 4MZTA 1OPLA 2CZ1B 4PJOB 1K0SA 1W1FA 2YWWA 3JCMP 3E19A 2F2WA 2DNUA 1UECA 1H92A 4BE2A 2CSIA 2DM1A 2AKLA 2X4JA 4Y92A 1WHKA 1GL5A 4R0KA 3GLXA 1B3QA 2DIQA 2QK0A 4CC3A 1KD1R 3KFVA 1YJ9T 1O75A 5GAN3 3I56A 4RTUA 2WACA 3FDRA 4PJJA 2YUNA 1D3BA 2JMCA 2DL8A 2OTJT 2AK5A 4L59A 4C8QD 3V8JA 5KYYB 2FZGB 1TWBA 4C8QB 1UHFA 1NM7A 3WVDB 3H0FA 4F16A 1BB9A 4RTXA 2QQ9A 1G2BA 1AD5A 3MEAA 1VQOQ 1WHLA 2O88A 1KG1A 1X6GA 1G3WA 2XHCA 4KULA 2L3RA 2EYZA 1BYMA 1G3SA 2E6NA 1SG5A 4IUPA 1QKWA 2QTXA 4M7DA 3UPUA 3ULRB 2C06A 1TG0A 4OB1B 5D6YA 1LCKA 1Y7XA 2EQJA 1XOVA 1UJ0A 3I56T 4AFZC 1J3TA 1PM3A 2EKHA 3EG1A 4ZTFA 5GAMg 2O31A 1RI0A 1YIJA 4PLLA 2X9HA 1GCQA 2P4RA 4M7AB 3VYHB 5KCHA 1CKAA 1RAIB 2QAZA 3QIIA 4ELYC 4TVRA 1ACMB 3O5ZA 4A54A 2EFIA 3HHTB 4RCCA 1ZSZA 1VYVA 3OYYA 3OMCA 2F69A 2RI3A 4ORZA 3RKWA 2A28A 5GAOp 4FT4A 3OYAA 3H8ZA 5KYUA 3CPWS 1RAFB 2RN8A 3L2RA 3M56A 4EMGA 1AT1B 4J7FA 3T9NA 4BE1A 4QQGA 5IHKA 2K5IA 1IO6A 1N27A 3LWHA 1GRIA 3EGDA 1YJNQ 4JDSA 2IG0A 1YIJT 4XTVA 3F70A 1R0BG 3A5ZB 3CCRQ 4QVZA 2P0QA 1T3SA 2X4XA 3HTRA 5GANg 2HAXA 4RMOA 1R8OB 1GXIE 1HJDA 1WX6A 3QO3A 4MZMA 1W2BP 3OY9A 5GJWB 5FU7C 1D3BB 1VQ8Q 1NPRA 1Y96B 2R57A 2RQRA 1ZA2B 5A0GA 3M0RA 2DXCA 1UHCA 2QG9B 5M9OA 2ESWA 2P4TA 3LYIA 5I2SA 3HSBA 1SPKA 1UDLA 2O01E 5GMKe 3JB9G 1Q86U 4C5IA 4M77C 3M0QA 2EWNA 1FMWA 4M7DD 3NTIA 3JB9I 1N6AA 4NL3A 3CBPA 4DBFA 3EFOB 2JXBA 2K79A 2JW4A 3JB9F 4J9EA 2IVWA 4BE0A 2QQBA 2CP5A 2P0KA 4X34A 1NLOC 1QVGS 1VQ7Q 1VQOA 2HMAA 4M77G 5J3BA 4LDUA 1H641 3GP8A 2EAYA 4N0AA 2CH4A 1B34A 5LJ5g 3A8OB 4M77F 2M9UA 4BD3A 4WF2A 3UF4A 5D7UA 4YTLA 1M3BA 1MGQA 3A1PA 2X3WD 2CP3A 3RBBB 2GCXA 1BK2A 4LDWA 2EQMA 1ZSZB 1WDXA 4M4ZA 4Z8AA 2XIDA 3OYMA 3EG0A 5KYUB 3DB4A 4FIBA 1I1JA 1D0ZA 2RK1A 1NYGA 3THKA 5IXBA 2BZ8A 4QW2A 4ESRA 1TUCA 3EGDB 1VQOT 2YLCA 1KK7A 3SEMA 3FLGA 4LDYA 2KAFA 3CXCP 3OW2P 3HPWA 2LCLA 3PT9A 2LCSA 3CCQQ 1Y71A 3MP6A 3HRTA 1ZQ1A 1D09B 1AOJA 4ATOA 1S72Q 2MWOA 2OX7A 3RDVA 2E5QA 2NUZA 4XTWA 1Q86C 4OP0A 2AKKA 3E1SA 4Y28E 3CCEA 1YJNA 2HSPA 3A98A 1UEBA 3KXTA 2DAQA 2QYZA 5A0DA 2GQVA 2COZA 3CCRA 4AG2C 1IHWA 5GAN6 2CT4A 1I5OB 2XKOC 2FPFA 2K9GA 1KJWA 4QQ6A 3UATA 2HCKA 1LPLA 1VOMA 2CZ7B 5I21A 3CCUQ 4UC4A 2E3HA 3SFMA 2EJFA 1VQ8A 2D1XA 2OTLQ 4M75E 1G3YA 1Q86R 1X6OA 2BTTA 3VS2A 4IURA 3QWYA 3CCET 1YJNT 3CQTA 1LVKA 1GFDA 2ED0A 1K73U 2ED1A 1BCMA 4EPCA 1MV3A 1B34B 4EMKC 2DXUA 1ZSGA 1Y0MA 2D0NA 2NUPA 2J6KA 3OYGA 4A4KA 1HSQA 5AYFA 3M55A 2W10A 1VIEA 5KYXA 5HK3A 3NPFA 3X20B 1I4K1 1QP3A 1M30A 1VQ7A 1G5VA 3U23A 2L5QA 2KMTA 1WHMA 2EJ9A 1VQ8T 3TQ7P 1W2BS 3PGGA 3CD6Q 2E70A 2VVKA 1C0MA 1YJWA 1SEMA 1PNJA 2JJ9A 5L23A 4K11A 5GAOr 2EQKA 2CZ0B 1JXOA 3CC4T 4XQ3A 2YRDA 5L8RE 1PG5B 5CO7A 5DM7R 3PE0A 4DA4A 2KVQG 1IB8A 2KXCA 4BI4A 1BI0A 3QJYA 1TH7A 2W0ZA 1ZUKA 2E1HA 2YDLA 3L2VA 1VQ9T 1VQ7T 2LZ6B 4A4GA 1H8KA 1MMNA 2C0TA 4BY6B 5GAN2 3QG1A 4RKUE 1YJWT 3CCQA 1MMGA 1M8MA 1UE9A 1ZBXA 3TSZA 1NPPA 2G3RA 8ATCB 4A63B 1S72A 1RADB 2IPOB 2K5FA 1DJ7B 5IAYA 5IXFA 2L8DA 4BB7A 2DJQA 1H3ZA 3OS5A 2FPDA 4M77E 3A8HB 4PJNA 5ECAA 2J6OA 2VGNA 1MNDA 1RL2A 3HRSA 4DOWA 5IH2A 1M90U 3M5AA 3RNJA 1WQ7A 4BUGA 4DOVA 5HK0A 1KIKA 3E2UA 1M2OA 3ASKA 4LUEA 3RKXA 4FT2A 3JCMW 1TUGB 4HCKA 2ZCFB 7AT1B 2KDSA 1OZ3A 4M75A 3S3OA 1NEBA 3CCQT 3CCUA 2KEAA 4HA8A 3HFNA 4J83A 2NUPB 3N5BB 3NHNA 4D8DA 2HD0A 1X69A 4RTYA 1OPKA 3CCSQ 2XDBA 4LUDA 2BE7D 2EYYA 2OTLA 1S72T 2HBPA 3TEEA 2CUDA 3OS1A 5GMKi 5A2QE 1I07A 2H8HA 3QJ6A 5CKEA 5C6SA 4C5EA 3OYHA 4KUIA 3V8KA 3OA6A 1TU0B 4J6WA 2DXBA 3PTAA 1WA7A 2XDPA 2L89A 3C95A 1PCXA 1KHIA 5KYYA 3EFRA 4J9IA 2COWA 1OOTA 3SWNC 3MPUB 2X4WA 4DEXA 2RPNA 4DBHA 2DYIA 4HT8A 3CCUT 4OMOA 4C92C 3X24B 1PKTA 4JS4A 3INZA 1WIEA 4NL2A 4QT7A 1X43A 1W6XA 1D1CA 1PRLC 2OTLT 1E7OA 3M58A 3CD6A 1UGVA 5GMKh 4GLKA 3UA6A 4PLIA 4VUBA 5CR2A 5FRMA 3QYGB 1X6BA 2KK4A 3QBYA 2E12A 3I5SA 4E7IA 4Y91A 1M90C 2BKDN 4M78A 4PL6A 3QHSA 1UGRB 2MI6A 1OQKA 5FRNA 1Q81U 4IKFA 4C92F 2LCCA 2V26A 3LH5A 2D8HA 3RERA 4M7AA 3M0SA 4JJBA 4J8OA 4OB0B 1ZA1B 1WHGA 2X51A 3VV0A 1VYTA 1TTHB 4F7UG 1Y57A 2CSQA 3O8VA 3E9FA 3M54A 3CD6T 1PD1A 4XAXB 3RKYA 5GAN7 4J6XA 3JB9H 3MP1A 2RHZA 4FU6A 2G6FX 4QVCA 2YUPA 3NTKA 3REAB 4F7UF 2VYTA 2JN0A 2ABLA 1M90R 4C0FA 5HY6A 4ZGDB 2VC8A 2DYBA 4M75D 2Z0WA 5KH6A 4M75B 2COYA 1XQHA 2CUBA 4FW1A 2EJGA 3JCMh 2PUOB 2B86A 2R5AA 2DTHA 2BUDA 4L6V5 4HVWA 2IIMA 2K57A 4WTOB 1WQWA 4BACA 2OAWA 1QVFA 3RMSA 1ABOA 2DD4A 1MUZA 1I5LA 5FWCA 2PUKB 3FJPA 4JJNK 1AVZC 1Y96A 3OYBA 2QEXQ 1M1GA 5GAMj 2EGEA 2F5TX 5GMKm 2LDMA 3CCSA 3TVTA 2DL3A 2LP5A 1UGPB 4CRIA 1EX4A 4OMPA 4D8KA 3M9QA 2DZCA 2DE0X 4KH1B 3OS2A 1K4US 1AWJA 3G6EQ 1SSFA 1Q81C 4BDYA 4KBMB 1I0CA 1IZ6A 1V29B 3LW5E 4J9FA 3RUXA 2K2MA 3LH0A 3CBMA 1QVPA 4B6MA 5GAN8 3EFOA 2RB6A 1KC8U 2RJCA 3C94A 2JTFA 2F2XA 4RTWA 2KQWA 3JSCA 1HXDA 1IGUA 2DKGA 4M78D 4FYXB 1U3OA 4M78B 5LJ3h 2KYBA 2K2VA 3DB3A 4PJOC 1X2KA 2HKNA 2DA9A 4KGVB 1VQMQ 4M7AD 3CCST 2ZZDA 2ZAEA 3OMGA 3GOXA 2K6DA 3MCAB 1Q81R 4FSSA 1U1TA 5GANj 2ZPFB 4PJOG 1WJSA 1P92A 2CT3A 4BI3A 3L2UA 3H41A 2DF6A 3EG9A 4FCYA 1OU9A 4PJOF 4M77B 1QMCA 4LNPA 1WGSA 5GAOl 1M8VA 2OAUA 2HEQA 4XTXA 5CQXA 4DEYA 3WVEB 3CCEQ 2CGHA 2LRQA 4C8QC 2A37A 3BE3A 3FEOA 4FSXA 5LL6S 2DBMA 1I8FA 3S3NA 1BIAA 2K3YA 2E3IA 4PKCC 2OI3A 4E7HA 3URGA 2RMOA 1AWWA 2MYSA 2E4HA 5CKDA 3V7RA 2K4YA 4OB2B 1EIFA 1NBEB 1SSHA 3MP8A 3SDZA 3PVLA 2E6ZA 3C0CA 4JZ4A 1ZLMA 5CKBA 3EAEA 2J7IA 3CCJQ
chains in the Genus database with same CATH topology
1S72Q 1VQ8Q 1KD1R 3CC2Q 1JJ2P 1M90R 3G71Q 1YHQQ 3CCRQ 3CCSQ 1VQ4Q 2QA4Q 1VQKQ 1K73R 3I55Q 3G6EQ 2OTJQ 3CCUQ 1VQPQ 1YI2Q 1VQLQ 3CC7Q 3CD6Q 3CXCP 1VQMQ 3OW2P 1QVFP 1VQ7Q 1VQ9Q 1VQNQ 3CCMQ 1K9MR 1K8AR 3I56Q 1Q82R 1KQSP 3CMEQ 1YIJQ 2QEXQ 3CPWP 3CCLQ 3CCQQ 1Q86R 1KC8R 1NJIR 1W2BP 1VQ5Q 2OTLQ 1VQ6Q 3CC4Q 1YJNQ 1M1KR 1Q81R 1Q7YR 1QVGP 1YJ9Q 3CCEQ 3CCVQ 1YITQ 1VQOQ 3G4SQ 3CCJQ 1YJWQ 3CMAQ 1N8RR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 Q;  1VQ8 Q;  1KD1 R;  3CC2 Q;  1JJ2 P;  1M90 R;  3G71 Q;  1YHQ Q;  3CCR Q;  3CCS Q;  1VQ4 Q;  2QA4 Q;  1VQK Q;  1K73 R;  3I55 Q;  3G6E Q;  2OTJ Q;  3CCU Q;  1VQP Q;  1YI2 Q;  1VQL Q;  3CC7 Q;  3CD6 Q;  3CXC P;  1VQM Q;  3OW2 P;  1QVF P;  1VQ7 Q;  1VQ9 Q;  1VQN Q;  3CCM Q;  1K9M R;  1K8A R;  3I56 Q;  1Q82 R;  1KQS P;  3CME Q;  1YIJ Q;  2QEX Q;  3CPW P;  3CCL Q;  3CCQ Q;  1Q86 R;  1KC8 R;  1NJI R;  1W2B P;  1VQ5 Q;  2OTL Q;  1VQ6 Q;  3CC4 Q;  1YJN Q;  1M1K R;  1Q81 R;  1Q7Y R;  1QVG P;  1YJ9 Q;  3CCE Q;  3CCV Q;  1YIT Q;  1VQO Q;  3G4S Q;  3CCJ Q;  1YJW Q;  3CMA Q;  1N8R R; 
#chains in the Genus database with same CATH topology
 2PQW A;  2DEU A;  2DJZ A;  2ATC B;  4C8Q F;  1FMK A;  2DMO A;  2MF2 A;  1KC8 C;  1C1A A;  1QCN A;  3NFC A;  5LJ5 j;  3WXM B;  4HVU A;  1IGQ A;  5I11 A;  2M02 A;  4V2S A;  2ENM A;  1JB0 E;  3JCM d;  3S3M A;  4M7A C;  4C0G A;  3CC4 Q;  3ZL7 C;  1Q7Y U;  2AHJ B;  1NZ9 A;  2K5L A;  2PTK A;  2DPP B;  2BZY A;  1HD3 A;  3JCM f;  1VQ4 Q;  4C5H A;  2F1L A;  1K76 A;  2QEX A;  1OV3 A;  4B9W A;  3RES A;  1VQ9 Q;  1K9A A;  3NGP A;  3VUZ A;  3CCL Q;  2QQS A;  3FJ5 A;  3OB9 A;  2E10 A;  2SEM A;  2LTO A;  1KQ1 A;  3G6E A;  4F7U E;  4AFS C;  1YJW Q;  4IIO A;  2L3Q A;  1LNX A;  4XK8 E;  4E7S A;  2C0O A;  2QA4 Q;  2KSS A;  2MPX C;  2RI5 A;  3BDL A;  1PHT A;  4QVD A;  3FRN A;  1CSK A;  4CC2 A;  2FHD A;  2GFU A;  4HCB A;  5DLO A;  2VXF A;  1WNL A;  2A7Y A;  3EG9 B;  1ABQ A;  1BBZ A;  2QEX T;  4O5V A;  3H0I A;  4JUV A;  1VQM A;  4IUV A;  5LJ3 d;  2RH2 A;  3JCM e;  3RMQ A;  2DFU A;  1GBQ A;  2GQI A;  2KE9 A;  2RHY A;  5IHI A;  5FU6 B;  4Z02 A;  1F1B B;  3M0T A;  3G6E T;  2FRY A;  1JJ2 A;  5LJ3 f;  1IRX A;  1VQN T;  2V1R A;  4AMC A;  3SHW A;  3D7S B;  3I35 A;  2JM8 A;  2QGF B;  3KBG A;  2RD1 A;  2EKO A;  4XTY A;  5D6W A;  4M7D C;  2DLP A;  2HDA A;  3LWI A;  3GPL A;  4KGZ B;  5CAI A;  2Y4X A;  3KUF A;  4ELZ C;  2PZ1 A;  1QVF P;  2B8A A;  2E5K A;  2LQ8 A;  1GFC A;  2WSC E;  1QWE A;  1VQM T;  1QW1 A;  2MCN A;  3CCM T;  3QZ5 B;  4M7D G;  2XU8 A;  3PIO A;  2D8J A;  3OS0 A;  1G83 A;  5DLQ E;  2LX7 A;  3OBY A;  3HL8 A;  1GCQ C;  4LDX A;  1VQP Q;  4M7D F;  1VQL Q;  1ZX6 A;  2M16 A;  4PFZ A;  1BU1 A;  3L42 A;  1YWP A;  3CCJ A;  1SF9 A;  3BDU A;  2V8J A;  1ZUY A;  2ECZ A;  1ZSZ C;  3MHX A;  5LJ3 e;  4PK4 A;  3OYK A;  2O9V A;  3BW1 A;  4DQ2 A;  2CDT A;  2NYS A;  5GAM d;  1TS9 A;  3RIR A;  3OYD A;  3EG3 A;  2KY9 A;  3MJX A;  1QVG A;  1BCO A;  2Y4Y A;  3CC4 A;  1WYX A;  2RI2 A;  4PJO E;  3J80 E;  2RQT A;  1XJW B;  2L3S A;  2CH4 W;  2EGC A;  1I81 A;  1G8X A;  1VQ4 A;  4XU1 A;  1PKS A;  3VS5 A;  1XNI A;  5CKF A;  1RI9 A;  3JV3 A;  4HVV A;  1KSW A;  3VS7 A;  2QAS A;  2DIG A;  3ER0 A;  4FYY B;  4F7U A;  4EIK A;  1VQ9 A;  3CCJ T;  2KRS A;  3CCL A;  3VS1 A;  2LX9 A;  2X4Y A;  3C12 A;  4MMK A;  4NS5 A;  2Y90 A;  4C0D B;  3TU4 K;  3LGL A;  2HL3 A;  2BZX A;  3SB2 A;  3PNW C;  2V8I A;  4LD9 K;  3SD4 A;  2QA4 A;  2GBQ A;  4D6W A;  2C0I A;  3OYF A;  1TUD A;  2HL5 C;  2JUF A;  5GAN d;  2RHX A;  2FZC B;  1VQ4 T;  2MMP A;  4F17 A;  1R77 A;  4XTZ A;  4L5G A;  5GAM e;  1AEY A;  2FRW A;  1UFF A;  1FMV A;  5GAN f;  3PIP A;  1H3H A;  4F14 A;  3OYC A;  1B7T A;  2XG8 D;  3CMA Q;  3CCL T;  1YHQ Q;  1U06 A;  3EGU A;  2FVU A;  5GAO q;  3LX7 A;  4N0A C;  4JRQ A;  1T0H A;  2LJ1 A;  4AFU C;  3IQL A;  3JRZ A;  2QA4 T;  5IT9 E;  2F5K A;  1WPY A;  2YLB A;  2SRC A;  1IXD A;  1K73 C;  1NJI U;  2KRM A;  1V1C A;  4AFQ C;  3CPF A;  4HKE A;  4EDU A;  2WSF E;  2NUT A;  1YCY A;  4KT0 E;  4J9C A;  3OSS C;  4RTZ A;  5KYW B;  2RQU A;  1YN8 A;  2I0N A;  1QLY A;  3HFO A;  2VWF A;  5LJ5 d;  4RG2 A;  1OI1 A;  2P0P A;  4LXC A;  4C5G A;  3E9G A;  1JO8 A;  5I22 A;  2KXD A;  3ZEH A;  5GAN e;  1TSF A;  1VQP A;  4IIM A;  1VQL A;  3VUB A;  4FL6 A;  3V8L A;  3CXC S;  3OW2 S;  4RTT A;  1V76 A;  1K73 R;  1D0Y A;  4ZN3 A;  3VU3 C;  3TSW A;  4XTU A;  1ZUU A;  3RR6 A;  5HKC A;  2VKN A;  4JLI A;  4MDX A;  4JPB W;  4F7U B;  2MOX A;  5FWB A;  3LLR A;  2RM4 A;  1YBY A;  2LT4 A;  1KD1 U;  1MMD A;  3J7A F;  1QVF S;  1D1B A;  3L1A A;  4BY6 C;  1BI3 A;  3GNG A;  1KHC A;  1R0C B;  3HRU A;  3QDR B;  2ROL A;  1OYX A;  4JJD A;  1VQP T;  3TCJ A;  1VQ5 Q;  1VQL T;  4DBR A;  3A8M B;  1ZHI A;  2PU9 B;  1YP5 A;  2MIO A;  2XDD A;  1WHH A;  1T3L A;  1JJ2 P;  1NJI C;  1D0X A;  4M7D E;  1WXB A;  5LJ5 e;  1YFN A;  2VB6 A;  1E6H A;  2EYX A;  5C0M A;  4C92 G;  4Z89 A;  2XD0 A;  2JS0 A;  1LJO A;  4BI8 B;  1UUE A;  3P8H A;  3L2W A;  3JCM g;  2D6F A;  2CRE A;  5FW9 A;  1E6G A;  3M59 A;  2HKQ B;  1Z9Z A;  1KQS A;  4J7I A;  3A8G B;  4JS5 A;  2DXT A;  2HQE A;  1M1F A;  2KI7 A;  1YIT A;  3G4S A;  4ZTJ A;  1TOV A;  3CMA A;  1FWZ A;  1YHQ A;  3CME Q;  2K3X A;  2YRV A;  1NJI R;  4Q5W A;  2M51 A;  4J9D A;  2NUT B;  1RAC B;  4CI0 C;  1Y07 A;  3PFS A;  4F04 B;  1BI1 A;  4OML A;  3V7S A;  1UGS B;  2GF7 A;  2LNV A;  2HQX A;  5GAN 4;  4M77 A;  1ZBJ A;  3AT1 B;  1PSE A;  1X2Q A;  3VYG A;  1WJQ A;  3EHR A;  1RLP C;  3I5R A;  2LNH B;  1KD1 C;  3H9N A;  3VJP A;  3I55 T;  2DTI A;  4E7Z A;  2H3E B;  2H3J A;  2ZPB B;  2DRK A;  2RA2 A;  1QVG P;  5GAO n;  1AZG B;  2QTV A;  3H6Z A;  3G71 Q;  1YIT T;  3G4S T;  1UJY A;  1YHQ T;  3CMA T;  5LJ3 g;  3X28 B;  4ZGJ B;  5KYN A;  1VQK T;  1X01 A;  2JZ2 A;  2RK2 A;  4MDW A;  4WCI A;  1M27 C;  2AIR B;  4QQD A;  4J9H A;  1WXU A;  1HK9 A;  2F2V A;  2LQN A;  2QQR A;  4RTV A;  3MEV A;  1O9S A;  4FYV B;  2DER A;  2K7A A;  2KT8 A;  3OSV A;  4AT1 B;  3UA7 A;  1VQN Q;  6AT1 B;  1A0N B;  5CQY A;  2HNI A;  1SKU B;  2LMJ A;  1NYF A;  4FYW B;  2YRC A;  2FO0 A;  4LN2 A;  1BIB A;  4PFP A;  1OX8 A;  4MML A;  2LC4 A;  4XU3 A;  5CIU A;  2RJF A;  1VQ5 A;  2YUQ A;  2QQA A;  4LD6 A;  2GGR A;  2RHU A;  1M2V A;  4M75 C;  2V1Q A;  3CCM Q;  4OGE A;  3MET A;  1N5Z A;  3JB9 D;  5CK9 A;  3M53 A;  2MAM A;  5FU7 B;  2DO3 A;  2DRM A;  4AG1 C;  1M1K U;  3X25 B;  4PJM A;  2EVR A;  1G3T A;  3M0P A;  3EG2 A;  5IHN A;  2HZY A;  1SHF A;  5CKH A;  2EQI A;  2PVO B;  1OU8 A;  4DBQ A;  5A0L A;  1VIF A;  4M75 G;  4NOY A;  4A53 A;  1OUL A;  3FC3 A;  3JB9 J;  4M77 D;  3J81 E;  4HCZ A;  1K9M U;  3JCM V;  2J06 A;  2VXE A;  4M75 F;  3P8D A;  1PSF A;  4J6Y A;  1WFW A;  2CP7 A;  5FRO A;  2EYQ A;  2YHT A;  4IUQ A;  1WHJ A;  1YI2 A;  2GFA A;  4E7K A;  1UGQ B;  1VQ5 T;  1N8R U;  1JBM A;  2KYM A;  3H0H A;  2M0Y A;  3M57 A;  2A3L A;  3CME A;  3CBO A;  4CC7 A;  2KGT A;  3M4G A;  4JRI A;  1MHN A;  1X27 A;  3PVQ A;  1VYU A;  3QYH B;  4RUG A;  4GY5 A;  3ZBD A;  1K8A U;  5FLX E;  1OX9 A;  4OGC A;  4GLM A;  4C8Q G;  4EMK A;  1RAG B;  1PRM C;  1JJ2 S;  5EC7 A;  1K1Z A;  2GTJ A;  4RG8 A;  3DKM A;  3OBW A;  2RNA A;  3QZ9 B;  2ROT A;  2DL7 A;  2RO0 A;  4OMQ A;  3M0U A;  5GAM h;  1CKB A;  2EQU A;  3GNF B;  2A0F B;  3P8B B;  2XK0 A;  4M78 C;  2V8K A;  4KGX B;  2PVD B;  4GBQ A;  3ZFJ A;  2LJ0 A;  2ZGW A;  2YSQ A;  1YI2 T;  2JTM A;  2VAS A;  5DY9 A;  2YT6 A;  1W70 A;  3G71 A;  4C92 E;  3QPH A;  3CME T;  4M78 G;  1RAH B;  3JCM Q;  1M1K C;  1KQ2 A;  3OYN A;  1AWX A;  4M7A G;  3MO8 A;  4M78 F;  2RJD A;  1M5Q 1;  1NEG A;  1YCS B;  1Q82 U;  4N4H A;  2KR3 A;  2VUB A;  4II1 A;  3QXE B;  4X1V A;  2FEI A;  1KC8 R;  2WSE E;  3L2Z A;  4M7A F;  4M7D B;  5GAN 5;  3L2Q A;  2FL7 A;  2FG0 A;  2XMF A;  2RJE A;  1M2V B;  3GF5 A;  1QWF A;  1K9M C;  2AZV A;  2EGA A;  1VQN A;  3EHQ A;  4N4G A;  4X9C A;  2BIV A;  2DL5 A;  4J9G A;  5GAN h;  3CC7 Q;  4HT9 A;  1VA7 A;  3G71 T;  4KUD K;  1N8R C;  2VGM A;  3OYL A;  1KQS P;  4OMF B;  4IUU A;  5I2M A;  4LDV A;  4A4F A;  1M1K R;  2DL4 A;  5GMK l;  2KBT A;  4A4H A;  1K8A C;  4BDZ A;  2RQW A;  4R55 A;  3CPW A;  3CCM A;  2DK3 A;  2LJ3 A;  1JXM A;  2DET A;  4MZP A;  4E6R A;  3NMZ C;  2E64 A;  1MMA A;  1K9M R;  4A4E A;  4JZ3 A;  1FX7 A;  3C4S A;  5CVI A;  4ZGE B;  1RAA B;  1N8R R;  2JMA A;  2OJ2 A;  2XI9 A;  4ZN1 A;  4E7J A;  4EMK B;  1EFN A;  1WLP B;  5HCK A;  1AZE A;  1Q7Y C;  2I2L A;  1PWT A;  3UWN A;  1K8A R;  2CP0 A;  3QDF A;  4CC4 B;  2CKK A;  5LJ5 h;  2CZ6 B;  2JT4 A;  2QI2 A;  4ANJ A;  2JVV A;  3DLL A;  1PD0 A;  1Q82 C;  3AHU A;  3MEU A;  2JS2 A;  1OZ2 A;  2QDY B;  1QP2 A;  1NLP C;  1U5S A;  1VUB A;  2QXF A;  2CP2 A;  2K3B A;  1IRE B;  4PFO A;  2CS7 A;  2FB7 A;  3MEW A;  3BFM A;  3SWN A;  4OB3 B;  1Q7Y R;  4FM4 B;  2DIL A;  9ATC B;  4Z88 A;  1U8R A;  4C92 A;  3G1J A;  5KYW A;  2L2P A;  5D6X A;  4EMH A;  4KH0 B;  3S6W A;  1HYO A;  2DX1 A;  4QKU A;  2JM9 A;  1M3A A;  2FZK B;  2DBK A;  1NE8 A;  2PNI A;  1Q82 R;  5FU6 C;  4J5Y A;  5GAM f;  4RCB A;  1QKX A;  2EIF A;  3CCV Q;  2CYZ B;  1PC0 A;  3EH2 A;  5KCO A;  4C0Z A;  3FB9 A;  3OYJ A;  3R6N A;  3CC2 Q;  2FPE A;  1M4Z A;  5J39 A;  1IHV A;  3LGF A;  3HP9 A;  3CCR T;  2GNC A;  4JJC A;  3EGX A;  3VS6 A;  2HSE B;  3EFS A;  2NLU A;  4R56 A;  1D1A A;  1JEG A;  2A36 A;  2BE9 B;  3VRZ A;  3REB B;  3JAM E;  1M9S A;  1U1S A;  4C8Q E;  2JNG A;  4PNO A;  4ME7 A;  2X3X D;  3CC7 A;  4JRP A;  4ZNX A;  2LQW A;  3I55 Q;  2VV5 A;  1MNE A;  1KFZ A;  3OYE A;  1FXX A;  3G7Z A;  3EH1 A;  2A08 A;  5AT1 B;  1BKB A;  3BY7 A;  1JQQ A;  2EYW A;  1QQJ A;  3QWX X;  1YNZ A;  3V7C A;  1VQ6 Q;  4B9X A;  1YWO A;  1YIT Q;  3G4S Q;  1GCP A;  3CEY A;  2P84 A;  2QGG A;  1VQK Q;  4KRT A;  1RLQ C;  1UG1 A;  2D0Q B;  1JU5 C;  2L3P A;  4M78 E;  2FYK A;  5EG2 A;  3CC7 T;  5GMK j;  4M7A E;  1SHG A;  1SRM A;  1YJ9 Q;  2KT1 A;  8AT1 B;  3QKJ A;  1AHJ B;  2D9T A;  2O2O A;  2ZPH B;  2O9S A;  4XU2 A;  3TRE A;  2LT1 A;  3PMT A;  4E47 A;  1RUW A;  3SWN B;  2KRN A;  2ZPG B;  1KQS S;  2OTJ Q;  2XIC A;  1SRL A;  2E65 A;  2KNB B;  2AZS A;  4HXJ A;  3JCM c;  2J6F A;  4JRK A;  4PJL A;  1ARK A;  4C92 D;  2EPD A;  2KRO A;  4C92 B;  3PMI A;  3DLM A;  2YUO A;  2M1H A;  4C0D C;  2JTE A;  5KE2 A;  2HQH A;  2E41 A;  2MK5 A;  2O4X A;  1UTI A;  3OQ5 A;  2DEQ A;  4JLG A;  1WXT A;  3OYI A;  3ME9 A;  4FW2 A;  2NWM A;  1Z9Q A;  2GTO A;  2R5M A;  5LJ5 f;  5IN1 A;  2RHI A;  4J9B A;  2YXY A;  4E7L A;  2DZ9 A;  3I56 Q;  3VS4 A;  4PJO A;  2HBW A;  4O6J A;  1GBR A;  1WZO A;  1T0J A;  1TXQ A;  4OMN A;  4IUT A;  3EGX B;  1AWO A;  3JCM J;  1QCO A;  2LVM A;  1BI2 A;  1W2B A;  1N9S A;  4OVA A;  1S1N A;  2AT1 B;  5KYX B;  1W4S A;  2MWP A;  4LE9 A;  3CCV A;  2JOY A;  2EW3 A;  3CPW P;  3CC2 A;  3VRY A;  3MKD A;  2ZPE B;  1X75 C;  2RF0 A;  1B07 A;  3NTH A;  1OEB A;  3GIB A;  1WJR A;  4C8Q A;  3VKI A;  2LQK A;  3A8L B;  5J26 A;  1FYN A;  3I9Q A;  2DVE A;  2X35 A;  3JCM b;  5GAO m;  3M4Y A;  1YIJ Q;  1MV0 B;  1NG2 A;  1WI7 A;  3HKS A;  3I55 A;  1Q95 G;  4OF1 A;  1M3C A;  3QUI A;  1UB4 A;  2PVG B;  1QCF A;  2QDL A;  2CP6 A;  3X26 B;  3CCV T;  1LOJ A;  2RQV A;  3GBQ A;  1VQ6 A;  1YI2 Q;  3CC2 T;  1C6V X;  2DD5 A;  4N4I A;  3Q1J A;  3FIF A;  1JRI A;  1N9R A;  2M0O A;  5LJ3 j;  4OMM A;  4E2F B;  3JCM X;  2ZPI B;  4P5N A;  1VQK A;  1RAB B;  3VS0 A;  4X9D A;  4XU0 A;  5GJV B;  2EBP A;  2J05 A;  3QSU A;  2R58 A;  3UT1 A;  1XTD A;  2O4X B;  4HCC A;  2DVJ A;  3VS3 A;  5KE3 A;  1YJ9 A;  1RAE B;  3R6O A;  1K0X A;  5CCA A;  2L0A A;  2OTJ A;  3CXC A;  3UDC A;  3OW2 A;  1VQ6 T;  2DTO A;  4PJO D;  1EZZ B;  4MZT A;  1OPL A;  2CZ1 B;  4PJO B;  1K0S A;  1W1F A;  2YWW A;  3JCM P;  3E19 A;  2F2W A;  2DNU A;  1UEC A;  1H92 A;  4BE2 A;  2CSI A;  2DM1 A;  2AKL A;  2X4J A;  4Y92 A;  1WHK A;  1GL5 A;  4R0K A;  3GLX A;  1B3Q A;  2DIQ A;  2QK0 A;  4CC3 A;  1KD1 R;  3KFV A;  1YJ9 T;  1O75 A;  5GAN 3;  3I56 A;  4RTU A;  2WAC A;  3FDR A;  4PJJ A;  2YUN A;  1D3B A;  2JMC A;  2DL8 A;  2OTJ T;  2AK5 A;  4L59 A;  4C8Q D;  3V8J A;  5KYY B;  2FZG B;  1TWB A;  4C8Q B;  1UHF A;  1NM7 A;  3WVD B;  3H0F A;  4F16 A;  1BB9 A;  4RTX A;  2QQ9 A;  1G2B A;  1AD5 A;  3MEA A;  1VQO Q;  1WHL A;  2O88 A;  1KG1 A;  1X6G A;  1G3W A;  2XHC A;  4KUL A;  2L3R A;  2EYZ A;  1BYM A;  1G3S A;  2E6N A;  1SG5 A;  4IUP A;  1QKW A;  2QTX A;  4M7D A;  3UPU A;  3ULR B;  2C06 A;  1TG0 A;  4OB1 B;  5D6Y A;  1LCK A;  1Y7X A;  2EQJ A;  1XOV A;  1UJ0 A;  3I56 T;  4AFZ C;  1J3T A;  1PM3 A;  2EKH A;  3EG1 A;  4ZTF A;  5GAM g;  2O31 A;  1RI0 A;  1YIJ A;  4PLL A;  2X9H A;  1GCQ A;  2P4R A;  4M7A B;  3VYH B;  5KCH A;  1CKA A;  1RAI B;  2QAZ A;  3QII A;  4ELY C;  4TVR A;  1ACM B;  3O5Z A;  4A54 A;  2EFI A;  3HHT B;  4RCC A;  1ZSZ A;  1VYV A;  3OYY A;  3OMC A;  2F69 A;  2RI3 A;  4ORZ A;  3RKW A;  2A28 A;  5GAO p;  4FT4 A;  3OYA A;  3H8Z A;  5KYU A;  3CPW S;  1RAF B;  2RN8 A;  3L2R A;  3M56 A;  4EMG A;  1AT1 B;  4J7F A;  3T9N A;  4BE1 A;  4QQG A;  5IHK A;  2K5I A;  1IO6 A;  1N27 A;  3LWH A;  1GRI A;  3EGD A;  1YJN Q;  4JDS A;  2IG0 A;  1YIJ T;  4XTV A;  3F70 A;  1R0B G;  3A5Z B;  3CCR Q;  4QVZ A;  2P0Q A;  1T3S A;  2X4X A;  3HTR A;  5GAN g;  2HAX A;  4RMO A;  1R8O B;  1GXI E;  1HJD A;  1WX6 A;  3QO3 A;  4MZM A;  1W2B P;  3OY9 A;  5GJW B;  5FU7 C;  1D3B B;  1VQ8 Q;  1NPR A;  1Y96 B;  2R57 A;  2RQR A;  1ZA2 B;  5A0G A;  3M0R A;  2DXC A;  1UHC A;  2QG9 B;  5M9O A;  2ESW A;  2P4T A;  3LYI A;  5I2S A;  3HSB A;  1SPK A;  1UDL A;  2O01 E;  5GMK e;  3JB9 G;  1Q86 U;  4C5I A;  4M77 C;  3M0Q A;  2EWN A;  1FMW A;  4M7D D;  3NTI A;  3JB9 I;  1N6A A;  4NL3 A;  3CBP A;  4DBF A;  3EFO B;  2JXB A;  2K79 A;  2JW4 A;  3JB9 F;  4J9E A;  2IVW A;  4BE0 A;  2QQB A;  2CP5 A;  2P0K A;  4X34 A;  1NLO C;  1QVG S;  1VQ7 Q;  1VQO A;  2HMA A;  4M77 G;  5J3B A;  4LDU A;  1H64 1;  3GP8 A;  2EAY A;  4N0A A;  2CH4 A;  1B34 A;  5LJ5 g;  3A8O B;  4M77 F;  2M9U A;  4BD3 A;  4WF2 A;  3UF4 A;  5D7U A;  4YTL A;  1M3B A;  1MGQ A;  3A1P A;  2X3W D;  2CP3 A;  3RBB B;  2GCX A;  1BK2 A;  4LDW A;  2EQM A;  1ZSZ B;  1WDX A;  4M4Z A;  4Z8A A;  2XID A;  3OYM A;  3EG0 A;  5KYU B;  3DB4 A;  4FIB A;  1I1J A;  1D0Z A;  2RK1 A;  1NYG A;  3THK A;  5IXB A;  2BZ8 A;  4QW2 A;  4ESR A;  1TUC A;  3EGD B;  1VQO T;  2YLC A;  1KK7 A;  3SEM A;  3FLG A;  4LDY A;  2KAF A;  3CXC P;  3OW2 P;  3HPW A;  2LCL A;  3PT9 A;  2LCS A;  3CCQ Q;  1Y71 A;  3MP6 A;  3HRT A;  1ZQ1 A;  1D09 B;  1AOJ A;  4ATO A;  1S72 Q;  2MWO A;  2OX7 A;  3RDV A;  2E5Q A;  2NUZ A;  4XTW A;  1Q86 C;  4OP0 A;  2AKK A;  3E1S A;  4Y28 E;  3CCE A;  1YJN A;  2HSP A;  3A98 A;  1UEB A;  3KXT A;  2DAQ A;  2QYZ A;  5A0D A;  2GQV A;  2COZ A;  3CCR A;  4AG2 C;  1IHW A;  5GAN 6;  2CT4 A;  1I5O B;  2XKO C;  2FPF A;  2K9G A;  1KJW A;  4QQ6 A;  3UAT A;  2HCK A;  1LPL A;  1VOM A;  2CZ7 B;  5I21 A;  3CCU Q;  4UC4 A;  2E3H A;  3SFM A;  2EJF A;  1VQ8 A;  2D1X A;  2OTL Q;  4M75 E;  1G3Y A;  1Q86 R;  1X6O A;  2BTT A;  3VS2 A;  4IUR A;  3QWY A;  3CCE T;  1YJN T;  3CQT A;  1LVK A;  1GFD A;  2ED0 A;  1K73 U;  2ED1 A;  1BCM A;  4EPC A;  1MV3 A;  1B34 B;  4EMK C;  2DXU A;  1ZSG A;  1Y0M A;  2D0N A;  2NUP A;  2J6K A;  3OYG A;  4A4K A;  1HSQ A;  5AYF A;  3M55 A;  2W10 A;  1VIE A;  5KYX A;  5HK3 A;  3NPF A;  3X20 B;  1I4K 1;  1QP3 A;  1M30 A;  1VQ7 A;  1G5V A;  3U23 A;  2L5Q A;  2KMT A;  1WHM A;  2EJ9 A;  1VQ8 T;  3TQ7 P;  1W2B S;  3PGG A;  3CD6 Q;  2E70 A;  2VVK A;  1C0M A;  1YJW A;  1SEM A;  1PNJ A;  2JJ9 A;  5L23 A;  4K11 A;  5GAO r;  2EQK A;  2CZ0 B;  1JXO A;  3CC4 T;  4XQ3 A;  2YRD A;  5L8R E;  1PG5 B;  5CO7 A;  5DM7 R;  3PE0 A;  4DA4 A;  2KVQ G;  1IB8 A;  2KXC A;  4BI4 A;  1BI0 A;  3QJY A;  1TH7 A;  2W0Z A;  1ZUK A;  2E1H A;  2YDL A;  3L2V A;  1VQ9 T;  1VQ7 T;  2LZ6 B;  4A4G A;  1H8K A;  1MMN A;  2C0T A;  4BY6 B;  5GAN 2;  3QG1 A;  4RKU E;  1YJW T;  3CCQ A;  1MMG A;  1M8M A;  1UE9 A;  1ZBX A;  3TSZ A;  1NPP A;  2G3R A;  8ATC B;  4A63 B;  1S72 A;  1RAD B;  2IPO B;  2K5F A;  1DJ7 B;  5IAY A;  5IXF A;  2L8D A;  4BB7 A;  2DJQ A;  1H3Z A;  3OS5 A;  2FPD A;  4M77 E;  3A8H B;  4PJN A;  5ECA A;  2J6O A;  2VGN A;  1MND A;  1RL2 A;  3HRS A;  4DOW A;  5IH2 A;  1M90 U;  3M5A A;  3RNJ A;  1WQ7 A;  4BUG A;  4DOV A;  5HK0 A;  1KIK A;  3E2U A;  1M2O A;  3ASK A;  4LUE A;  3RKX A;  4FT2 A;  3JCM W;  1TUG B;  4HCK A;  2ZCF B;  7AT1 B;  2KDS A;  1OZ3 A;  4M75 A;  3S3O A;  1NEB A;  3CCQ T;  3CCU A;  2KEA A;  4HA8 A;  3HFN A;  4J83 A;  2NUP B;  3N5B B;  3NHN A;  4D8D A;  2HD0 A;  1X69 A;  4RTY A;  1OPK A;  3CCS Q;  2XDB A;  4LUD A;  2BE7 D;  2EYY A;  2OTL A;  1S72 T;  2HBP A;  3TEE A;  2CUD A;  3OS1 A;  5GMK i;  5A2Q E;  1I07 A;  2H8H A;  3QJ6 A;  5CKE A;  5C6S A;  4C5E A;  3OYH A;  4KUI A;  3V8K A;  3OA6 A;  1TU0 B;  4J6W A;  2DXB A;  3PTA A;  1WA7 A;  2XDP A;  2L89 A;  3C95 A;  1PCX A;  1KHI A;  5KYY A;  3EFR A;  4J9I A;  2COW A;  1OOT A;  3SWN C;  3MPU B;  2X4W A;  4DEX A;  2RPN A;  4DBH A;  2DYI A;  4HT8 A;  3CCU T;  4OMO A;  4C92 C;  3X24 B;  1PKT A;  4JS4 A;  3INZ A;  1WIE A;  4NL2 A;  4QT7 A;  1X43 A;  1W6X A;  1D1C A;  1PRL C;  2OTL T;  1E7O A;  3M58 A;  3CD6 A;  1UGV A;  5GMK h;  4GLK A;  3UA6 A;  4PLI A;  4VUB A;  5CR2 A;  5FRM A;  3QYG B;  1X6B A;  2KK4 A;  3QBY A;  2E12 A;  3I5S A;  4E7I A;  4Y91 A;  1M90 C;  2BKD N;  4M78 A;  4PL6 A;  3QHS A;  1UGR B;  2MI6 A;  1OQK A;  5FRN A;  1Q81 U;  4IKF A;  4C92 F;  2LCC A;  2V26 A;  3LH5 A;  2D8H A;  3RER A;  4M7A A;  3M0S A;  4JJB A;  4J8O A;  4OB0 B;  1ZA1 B;  1WHG A;  2X51 A;  3VV0 A;  1VYT A;  1TTH B;  4F7U G;  1Y57 A;  2CSQ A;  3O8V A;  3E9F A;  3M54 A;  3CD6 T;  1PD1 A;  4XAX B;  3RKY A;  5GAN 7;  4J6X A;  3JB9 H;  3MP1 A;  2RHZ A;  4FU6 A;  2G6F X;  4QVC A;  2YUP A;  3NTK A;  3REA B;  4F7U F;  2VYT A;  2JN0 A;  2ABL A;  1M90 R;  4C0F A;  5HY6 A;  4ZGD B;  2VC8 A;  2DYB A;  4M75 D;  2Z0W A;  5KH6 A;  4M75 B;  2COY A;  1XQH A;  2CUB A;  4FW1 A;  2EJG A;  3JCM h;  2PUO B;  2B86 A;  2R5A A;  2DTH A;  2BUD A;  4L6V 5;  4HVW A;  2IIM A;  2K57 A;  4WTO B;  1WQW A;  4BAC A;  2OAW A;  1QVF A;  3RMS A;  1ABO A;  2DD4 A;  1MUZ A;  1I5L A;  5FWC A;  2PUK B;  3FJP A;  4JJN K;  1AVZ C;  1Y96 A;  3OYB A;  2QEX Q;  1M1G A;  5GAM j;  2EGE A;  2F5T X;  5GMK m;  2LDM A;  3CCS A;  3TVT A;  2DL3 A;  2LP5 A;  1UGP B;  4CRI A;  1EX4 A;  4OMP A;  4D8K A;  3M9Q A;  2DZC A;  2DE0 X;  4KH1 B;  3OS2 A;  1K4U S;  1AWJ A;  3G6E Q;  1SSF A;  1Q81 C;  4BDY A;  4KBM B;  1I0C A;  1IZ6 A;  1V29 B;  3LW5 E;  4J9F A;  3RUX A;  2K2M A;  3LH0 A;  3CBM A;  1QVP A;  4B6M A;  5GAN 8;  3EFO A;  2RB6 A;  1KC8 U;  2RJC A;  3C94 A;  2JTF A;  2F2X A;  4RTW A;  2KQW A;  3JSC A;  1HXD A;  1IGU A;  2DKG A;  4M78 D;  4FYX B;  1U3O A;  4M78 B;  5LJ3 h;  2KYB A;  2K2V A;  3DB3 A;  4PJO C;  1X2K A;  2HKN A;  2DA9 A;  4KGV B;  1VQM Q;  4M7A D;  3CCS T;  2ZZD A;  2ZAE A;  3OMG A;  3GOX A;  2K6D A;  3MCA B;  1Q81 R;  4FSS A;  1U1T A;  5GAN j;  2ZPF B;  4PJO G;  1WJS A;  1P92 A;  2CT3 A;  4BI3 A;  3L2U A;  3H41 A;  2DF6 A;  3EG9 A;  4FCY A;  1OU9 A;  4PJO F;  4M77 B;  1QMC A;  4LNP A;  1WGS A;  5GAO l;  1M8V A;  2OAU A;  2HEQ A;  4XTX A;  5CQX A;  4DEY A;  3WVE B;  3CCE Q;  2CGH A;  2LRQ A;  4C8Q C;  2A37 A;  3BE3 A;  3FEO A;  4FSX A;  5LL6 S;  2DBM A;  1I8F A;  3S3N A;  1BIA A;  2K3Y A;  2E3I A;  4PKC C;  2OI3 A;  4E7H A;  3URG A;  2RMO A;  1AWW A;  2MYS A;  2E4H A;  5CKD A;  3V7R A;  2K4Y A;  4OB2 B;  1EIF A;  1NBE B;  1SSH A;  3MP8 A;  3SDZ A;  3PVL A;  2E6Z A;  3C0C A;  4JZ4 A;  1ZLM A;  5CKB A;  3EAE A;  2J7I A;  3CCJ Q; 
#chains in the Genus database with same CATH homology
 1S72 Q;  1VQ8 Q;  1KD1 R;  3CC2 Q;  1JJ2 P;  1M90 R;  3G71 Q;  1YHQ Q;  3CCR Q;  3CCS Q;  1VQ4 Q;  2QA4 Q;  1VQK Q;  1K73 R;  3I55 Q;  3G6E Q;  2OTJ Q;  3CCU Q;  1VQP Q;  1YI2 Q;  1VQL Q;  3CC7 Q;  3CD6 Q;  3CXC P;  1VQM Q;  3OW2 P;  1QVF P;  1VQ7 Q;  1VQ9 Q;  1VQN Q;  3CCM Q;  1K9M R;  1K8A R;  3I56 Q;  1Q82 R;  1KQS P;  3CME Q;  1YIJ Q;  2QEX Q;  3CPW P;  3CCL Q;  3CCQ Q;  1Q86 R;  1KC8 R;  1NJI R;  1W2B P;  1VQ5 Q;  2OTL Q;  1VQ6 Q;  3CC4 Q;  1YJN Q;  1M1K R;  1Q81 R;  1Q7Y R;  1QVG P;  1YJ9 Q;  3CCE Q;  3CCV Q;  1YIT Q;  1VQO Q;  3G4S Q;  3CCJ Q;  1YJW Q;  3CMA Q;  1N8R R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...