3OW2P

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ow2P00
1Q7YR 1YJWQ 1YI2Q 1K73R 1VQ9Q 3CCVQ 1VQOQ 1S72Q 3OW2P 3I55Q 3CMAQ 1W2BP 3CMEQ 3CC4Q 1VQ4Q 3CPWP 1QVFP 1Q81R 1YJNQ 1Q86R 1VQPQ 1QVGP 1NJIR 1M1KR 2OTLQ 3G4SQ 3I56Q 1N8RR 1KQSP 1KD1R 3CCSQ 1KC8R 1VQ7Q 1YIJQ 1K8AR 3CC2Q 3CCJQ 3CCQQ 1M90R 1JJ2P 1VQNQ 3CD6Q 3CCEQ 3G71Q 1VQ8Q 3CCMQ 3CXCP 1YITQ 2OTJQ 1Q82R 1VQMQ 3G6EQ 3CC7Q 3CCLQ 3CCUQ 1VQ6Q 1YHQQ 2QA4Q 1VQ5Q 1K9MR 1VQKQ 2QEXQ 1VQLQ 3CCRQ 1YJ9Q
chains in the Genus database with same CATH superfamily
2FO0A 3VS5A 8ATCB 1QWFA 1UB4A 2D1XA 2LC4A 1J3TA 3E1SA 1T3LA 1BI1A 1VYUA 2OTLQ 1VQ9A 4LDWA 1ZUUA 1N5ZA 2A36A 1JQQA 4HCZA 4Y92A 3CBOA 4JS4A 5A0GA 1XQHA 1RAFB 5GAN4 3LGLA 4ZN1A 2V1QA 4FW1A 1OPKA 2O88A 5DM7R 1PSFA 4C92D 3LGFA 3MEUA 4KRTA 2P84A 1Y7XA 1M2OA 3OS0A 2EWNA 1H92A 1M1KC 1TOVA 1JJ2S 2K57A 4PJOF 4B9WA 4BDYA 2D8HA 2DAQA 2BZXA 4N0AC 1KC8R 1QVFS 1YITA 1WQ7A 3O5ZA 4HT8A 1ARKA 2EQMA 1WHHA 1R77A 1RLQC 3NTHA 3J7AF 4XTVA 4LDVA 1VQLQ 3RKWA 5CO7A 3LWHA 1GFCA 3MCAB 1RAEB 1YNZA 4M4ZA 1AZGB 1RAGB 3JCMc 3VS1A 1NJIR 1YJNT 4MDWA 2EQJA 3ER0A 2KE9A 1D0XA 5CVIA 5KYNA 4FT4A 1BBZA 4JJDA 2R5AA 2KRNA 1M90U 4DBFA 4AG2C 5HK0A 4PKCC 2PUOB 5J3BA 1H8KA 3H6ZA 4YTLA 2L3QA 4BACA 4K11A 1QWEA 2VUBA 2DD4A 2FVUA 1B3QA 5CKBA 2HDAA 3THKA 3OBWA 3OB9A 5CAIA 4OGEA 3CCEQ 3M0PA 1UHCA 3GBQA 2KRSA 3D7SB 3CCUQ 5IN1A 2LX7A 2ENMA 1M8MA 2JTMA 1K9MR 2QEXQ 2PUKB 1W6XA 2NUPA 1XOVA 1VQLT 1BCOA 1CKAA 2DRKA 4JJCA 2KT1A 1N8RR 2YXYA 2LRQA 1K9MU 2F2WA 1W2BA 5GAOq 5GAMj 3VUBA 4RG8A 3MP6A 1YJWA 3OYEA 2LJ3A 4AFQC 3OQ5A 1N8RC 1UEBA 2M02A 4JRPA 4PJOB 2XDDA 1UGRB 4E7ZA 2J05A 1YI2Q 3G7ZA 1NYGA 3JCMJ 4M78E 1QVFP 2PVGB 2KVQG 3CC7A 4DBQA 5GJWB 2X3XD 2JW4A 3CCJQ 2F2VA 1JJ2P 1PKTA 3FRNA 1VQNT 1X43A 1JO8A 3MEAA 5GAMh 1VQ4A 1U3OA 2K5LA 1FMWA 1U06A 3OSVA 4E7SA 2MOXA 3UT1A 4BE2A 1H641 2BKDN 3REAB 1PRLC 4FYVB 4QT7A 3JCMd 5C6SA 3MJXA 4C92G 2QDLA 3PE0A 1V76A 2SEMA 3L2WA 3SEMA 3CXCA 1D3BB 2K3YA 3JCMf 3QKJA 4PJOA 3MPUB 1YWPA 4Y28E 2K5FA 1TWBA 2X4YA 3X24B 2MF2A 2KQWA 4UC4A 2EYXA 1M1GA 4AFUC 1QLYA 4C92F 1QCOA 5CCAA 4IKFA 2ZZDA 4C92B 5LJ5d 2DYIA 1WPYA 3V7SA 2ZPGB 1K8AC 1KQSA 2DYBA 3I55T 2H8HA 3CD6T 2KEAA 4C92A 1VQ9T 3LYIA 1G2BA 3CCMT 1S72Q 2VGNA 4E7IA 4QKUA 2VXEA 3OYLA 3HP9A 3I5RA 1AWJA 2OAWA 3JB9J 4MDXA 3CC2T 2ECZA 2LNVA 2HBWA 2YDLA 1YCYA 4XU1A 3CD6A 2LQNA 3JRZA 2E1HA 3CMAQ 4M77A 5J39A 5LJ5e 2DFUA 1Q81R 1JXOA 2GF7A 3OA6A 1OZ2A 4L59A 1ZSZB 2P4RA 2XD0A 2QI2A 5DLOA 2DL8A 2BTTA 3CC4A 2MAMA 1VA7A 4XU3A 2FEIA 5L8RE 3JB9D 1U1SA 1VQKQ 4J8OA 1OULA 2KRMA 2NUPB 2DZCA 2RQWA 1MNDA 2AKLA 4M78B 4C92E 4OB1B 2RPNA 2DILA 2GFUA 2AHJB 5CQXA 2CDTA 5CIUA 4E7KA 2DIQA 3S3MA 2CT3A 4LDUA 4ELZC 2D0QB 4PFOA 3CCVT 1NJIU 2V26A 3GF5A 3SDZA 1KC8C 3QSUA 2V8IA 2D0NA 3RKXA 1BB9A 4BE0A 2CUBA 1WI7A 2EFIA 3MP1A 1W2BS 1BI3A 1AHJB 3CCET 1WHMA 2KI7A 4OB2B 1MMGA 5A0DA 1SSFA 3I56A 4FSSA 5GAOp 3FB9A 3CMEQ 1GRIA 4Z88A 4GBQA 4J83A 3M5AA 3G6ET 4NOYA 2PNIA 1M3BA 2L2PA 2RHYA 3CQTA 4M75E 3PVLA 4IUQA 4L6V5 1JEGA 4AT1B 1RABB 4ELYC 2X35A 4EIKA 4JRIA 3HPWA 1WLPB 2EQKA 3CCRT 2RM4A 2H3EB 2RK1A 1UHFA 2VC8A 2P4TA 2LT4A 1IRXA 3CCMA 4RCCA 2FZGB 1WHKA 1AWWA 1UECA 3VS4A 1VQ5A 2IPOB 4QVDA 1OU9A 4EMKC 1BU1A 2ZPEB 3A98A 4OMOA 1ZSGA 1QVFA 3UATA 5FW9A 2M0OA 5FLXE 5IHKA 5KYXB 3M0UA 2HSPA 2B8AA 2HKNA 3M0SA 2MPXC 3SHWA 1PRMC 4O6JA 1Q7YU 2EYYA 1K0XA 5IAYA 4RMOA 2VV5A 2CZ6B 4M78C 4LUDA 2KBTA 4M77C 4RTTA 3RERA 3CXCS 2ESWA 1ZA2B 3CCVQ 2DERA 4PNOA 3G6EA 3INZA 2G3RA 2K7AA 1GBRA 2R5MA 2KYMA 3PFSA 1ZA1B 4HXJA 4KT0E 1XJWB 1M90R 2L3PA 3VYGA 5IXBA 5I11A 5KCHA 2OTLA 1MUZA 3QG1A 1VQKT 2YLCA 2SRCA 2WSFE 2FZCB 2K3XA 5I2MA 3LWIA 3I35A 2ZPBB 4M7DA 2ZPFB 3A1PA 4LD6A 3CMEA 2HAXA 4M77D 2C06A 2FL7A 1K8AR 4XTUA 3NMZC 5FU7B 3UDCA 2X51A 3KXTA 3SB2A 5I2SA 3CCQQ 4CC2A 4N4IA 1VQ8Q 3L2QA 1FX7A 1Y57A 1ZX6A 2O01E 2DKGA 3I56T 3JCMe 4KULA 5LJ3d 1YHQA 1OYXA 1FXXA 1MHNA 2CP5A 3SFMA 1QVGP 1W4SA 4PLIA 1GBQA 3J81E 3HRSA 1QKXA 7AT1B 4C5GA 1KQ2A 2HNIA 2DD5A 3CCMQ 1S72T 4EMKB 4GY5A 5GAMf 5C0MA 4C8QB 2WSEE 1Q82C 4M7AG 1G8XA 1G3WA 4J9IA 2C0TA 1SG5A 3RMSA 2A37A 3QYHB 3OBYA 1NLPC 2RI3A 5GAN2 4J6WA 2CYZB 1K73C 2GQVA 4BI3A 4KH1B 2E12A 2RN8A 3OW2S 2L8DA 4N4HA 2HL5C 1IHVA 3QZ9B 1Q81U 3EGUA 1SRMA 2CP7A 4J9EA 3FEOA 2AKKA 8AT1B 4D8DA 2ED1A 5GAMe 3KBGA 1PM3A 1CKBA 2GTOA 2DL3A 1SHFA 2ABLA 1R0BG 5GAN6 2LDMA 3EH2A 3VV0A 1WDXA 2RD1A 2E41A 4BI4A 2LP5A 4XK8E 1KD1C 2QGFB 4MMKA 1Y07A 3PIPA 1OEBA 2X4XA 4CRIA 3LH5A 3JB9I 2JJ9A 1YP5A 2E65A 2NYSA 2LQWA 2DJZA 3VUZA 1YJWQ 3RBBB 4M7DB 2LCSA 1MGQA 4BE1A 1G3YA 2D6FA 2KR3A 2KK4A 1RUWA 4XU0A 1QCNA 2LMJA 1WJSA 4R0KA 3CPWS 4M78D 4TVRA 3I9QA 1RADB 2XHCA 1KHIA 4OVAA 2JZ2A 1NPRA 2ROLA 2VXFA 4A4EA 3CEYA 3CC2A 4LNPA 4FSXA 2VASA 1PSEA 3M55A 3QPHA 2DF6A 5KYWA 3M58A 2PU9B 2BZYA 5CKFA 1D3BA 3CCSQ 3JCMX 2M51A 1NM7A 2E3IA 3OYCA 2JS2A 4P5NA 4F16A 3G71A 2RQUA 4KGZB 1K73R 1ABOA 1JXMA 1UGQB 1QP3A 4XU2A 3QWXX 1KSWA 3QUIA 3J80E 2BE7D 1YJNQ 3OS1A 2MWOA 1C6VX 1H3HA 1QP2A 1IGQA 2FHDA 4IURA 1HSQA 2JVVA 4F7UG 4RTXA 1E6GA 4PJNA 2DL7A 2YUNA 2LQKA 4J6YA 2J6FA 3OW2P 5A0LA 4LUEA 4M7DD 3L2UA 4LD9K 3I55A 4XAXB 4QVZA 2EW3A 1Y96B 1RL2A 9ATCB 2YT6A 1OI1A 4XQ3A 1M5Q1 2HMAA 4OMMA 2E5KA 3RR6A 5LJ3j 3JB9F 1LNXA 1B07A 2RHXA 1YJ9T 2OTLT 3QIIA 4ATOA 3EG9A 3EGDA 4A4KA 1RI9A 5D6YA 2DPPB 2XKOC 4D8KA 2GQIA 3ZEHA 5GAMg 1I1JA 3RMQA 2K3BA 4IUVA 1M27C 4BUGA 3GNGA 4JDSA 1UGSB 2X9HA 3NHNA 4FYYB 2DBKA 4AG1C 2QQBA 2BE9B 4M7AC 1K73U 3BW1A 4DA4A 2BZ8A 1TUCA 3VU3C 3KFVA 3L42A 4A54A 4IIOA 1VIEA 1QQJA 3NGPA 4RKUE 3QXEB 2CKKA 2K79A 1TU0B 2JMAA 1SKUB 5GANe 1K0SA 3H0FA 1NYFA 1WIEA 1SF9A 1W1FA 2E6ZA 3OYMA 4HVWA 3MEWA 1LOJA 4X34A 2J6KA 2J06A 2YRDA 1OV3A 1E7OA 1Y71A 3DB3A 2YRVA 2WSCE 3H41A 1V1CA 1WHJA 3CCJA 2DL5A 4M77B 2EAYA 4Z8AA 3CCSA 2JN0A 1EFNA 3HRUA 1NPPA 4PJOG 2RI2A 2VWFA 2YUQA 3TSZA 4OB0B 3BY7A 2JXBA 3I56Q 3IQLA 1WA7A 1ZQ1A 3JV3A 1K9MC 5LJ5f 2EGCA 3G71Q 1IHWA 4M7DE 2DRMA 3BFMA 3CPFA 4B9XA 3GIBA 1AEYA 4M75F 5KYWB 1HD3A 3UF4A 1YWOA 3LLRA 2K2MA 1WHLA 2CSIA 5IHNA 4FYWB 2RI5A 1M1FA 2X4JA 5GAOn 3NTIA 2F69A 3M54A 1UDLA 1X6BA 2EJGA 1EIFA 2DA9A 2RB6A 2V8KA 3EH1A 2ATCB 2R57A 2FPFA 3JSCA 3M9QA 3EG3A 2DJQA 3X20B 1LJOA 2EIFA 3MKDA 5KH6A 3OYGA 5A2QE 5L23A 4C0FA 2MI6A 2EBPA 5D6XA 4ZGEB 2HQEA 4LN2A 1BIAA 2HZYA 1N9SA 2QXFA 1Q86U 3EAEA 2O9SA 2EKHA 5GANh 2E3HA 2JS0A 3P8DA 1PC0A 3UWNA 2QTXA 1BYMA 1W2BP 2Y4XA 4Q5WA 5KCOA 3I5SA 5DLQE 4M7AD 3GOXA 2VB6A 1SEMA 1K9AA 2JOYA 3JCMV 2COWA 5KYXA 3VJPA 2RHIA 4PJOC 3LW5E 2I0NA 1UG1A 4RG2A 2CZ7B 1UJ0A 4M78F 3CCRQ 2KDSA 2DEUA 2EQUA 2HQHA 3L2VA 1AWXA 1K8AU 1D1AA 3F70A 1MMAA 2J7IA 2B86A 3PNWC 4JLGA 5I21A 3A8MB 1JRIA 1Q95G 4EMKA 2P0QA 4ZTJA 1SPKA 3QJYA 2F5KA 4RTYA 2O4XA 2RJEA 2W10A 5IXFA 3TQ7P 4RTUA 1QVPA 4AFSC 3QHSA 3CC7T 2DX1A 3N5BB 2DMOA 4ESRA 1VUBA 4FT2A 6AT1B 3SWNA 1IO6A 5GANg 2ZGWA 1WXTA 2QA4A 1JU5C 5LJ3h 3CC2Q 4A53A 5KE3A 3FJPA 2QQ9A 1Q82R 3EFSA 5LJ5j 1IB8A 3VS6A 4PFZA 1YHQT 4C5EA 4R55A 1AD5A 2HSEB 1N6AA 2EYZA 4BDZA 1Q7YR 1VQ9Q 4M77E 1M4ZA 2HEQA 4JUVA 5GMKi 1VQLA 3M4YA 1YIJT 4ORZA 4PK4A 2DXUA 1X01A 1QMCA 4C0DC 3OYBA 5IH2A 1V29B 2CREA 3RESA 5J26A 4JZ3A 4LXCA 4PL6A 3M57A 1WZOA 3HSBA 1VIFA 2CP0A 1VQMT 2FRYA 1D0ZA 2AK5A 4M7DF 3V8KA 4B6MA 5GANd 4OMFB 1TTHB 5FU6C 1WXUA 1NE8A 2RQVA 2J6OA 3HTRA 4C0GA 5FRNA 4NS5A 2YLBA 2RHUA 3VRZA 5D7UA 3RNJA 3M0RA 2HL3A 2F5TX 2LT1A 2RK2A 3VS7A 5KYYA 2DTOA 1GCQC 4F7UE 4FW2A 2Y4YA 4E2FB 4GLMA 4NL2A 2D8JA 4WF2A 3JCMW 4PJOE 1NBEB 3DLLA 1NJIC 1T0HA 4C92C 2DTHA 1OX8A 1RACB 1OU8A 1IGUA 3PIOA 2AT1B 2HKQB 4J9BA 1U5SA 3VYHB 2QA4T 4Z02A 1WHGA 2JTEA 2ZAEA 1KK7A 1WFWA 4C5HA 2KMTA 3OYIA 1YCSB 3LH0A 4DBHA 4ZTFA 1MV3A 1VQPQ 4M78A 4C8QG 2E64A 1Q7YC 2CT4A 1MNEA 1TUDA 3SD4A 3DLMA 3R6OA 2NUTA 2QEXA 1NZ9A 2PVOB 3TCJA 2PTKA 2DXTA 4OMQA 3V8LA 3L1AA 4M77G 5HCKA 4C8QD 2NUTB 4BY6B 4M78G 1BK2A 4FCYA 1VQ4Q 4HKEA 1PD0A 1D0YA 1WNLA 2LCCA 3CCUT 5FU6B 2LVMA 4J5YA 3OYKA 1OPLA 3UPUA 1YJNA 3WXMB 3L2ZA 4OGCA 4PJLA 2FB7A 2K9GA 3CCLA 2KXCA 2DETA 2CGHA 3PMIA 1UGVA 4C0ZA 5GJVB 3G4SQ 2E10A 3RDVA 1X75C 1I8FA 1QCFA 4JJBA 2DIGA 1SHGA 1VQNQ 1D1CA 4EMHA 4C5IA 3BDUA 2VKNA 4OP0A 1KHCA 2AZVA 1VQ5Q 3EG9B 4EMGA 5HY6A 3CPWA 1Z9QA 1GCQA 1F1BB 1YI2T 4IUUA 1NEGA 1TG0A 3P8HA 4DBRA 1ZBXA 5LJ5g 4ZGDB 5GMKh 2OTJA 1RLPC 2X4WA 4C8QA 2HD0A 3OYYA 2RQTA 1Q82U 3EG1A 2KY9A 2LNHB 4RUGA 1TH7A 3QDRB 1G3TA 3CBPA 1RAAB 3C95A 1GCPA 1OX9A 2IVWA 2FRWA 1VQ5T 2E5QA 2L3RA 4ZGJB 2MIOA 3CMAA 2X3WD 4LE9A 2NWMA 1VQPA 2QGGA 1MV0B 3KUFA 1PWTA 2COZA 1YJWT 2HCKA 2KT8A 3HRTA 3JCMP 5GANj 1R0CB 1ZBJA 1N9RA 4Y91A 4J9HA 3QWYA 4E47A 4E7HA 4J6XA 1KD1R 4GLKA 4M7DC 1VOMA 1UFFA 2GFAA 2QG9B 3JCMg 2KYBA 3R6NA 1MMNA 4HVUA 1X6OA 3EFOB 5GMKj 2EJFA 3PTAA 5GAN7 3PMTA 1PHTA 3UA7A 1VQ4T 2M0YA 2EGEA 4M75B 1VQ6A 1H3ZA 3DB4A 4BD3A 4CC4B 2EYWA 2EGAA 4RTVA 3FDRA 2RJDA 4C8QF 3G71T 2DNUA 3CCRA 1Z9ZA 4XTWA 3OYAA 1DJ7B 2JUFA 2WACA 3JCMQ 1Q86C 2KXDA 4M77F 5GAN3 5GAN5 1YFNA 2VVKA 3TVTA 4OF1A 2QDYB 5CKEA 1XTDA 1WQWA 4D6WA 1I81A 2C0IA 1ZHIA 5GAMd 4QQDA 2OTJQ 2GCXA 2O4XB 4PLLA 1YI2A 1KFZA 2EVRA 3RKYA 3ASKA 3ULRB 4CI0C 1X2KA 3G4SA 2K6DA 2DO3A 2JNGA 5GAOr 1TUGB 4JRKA 4QQGA 2LQ8A 4MZPA 3E2UA 3JB9H 3TSWA 5EG2A 3CCQT 4HT9A 2QYZA 1UTIA 2MCNA 2MYSA 2D9TA 3A8LB 2EPDA 5GMKe 4J9FA 2YSQA 5M9OA 4PJOD 4KUDK 2XDBA 4X9CA 4F14A 3HFOA 4HCCA 4CC3A 5HK3A 2EJ9A 3JCMb 2QQAA 4L5GA 4A4FA 2E4HA 1HYOA 3QJ6A 2NLUA 1FYNA 4O5VA 4II1A 1X27A 1MMDA 1WXBA 2CZ1B 2ZPIB 1T3SA 2KROA 1UUEA 3QO3A 3UA6A 1WGSA 1YBYA 4M7AE 2XG8D 3VS3A 2A3LA 4JJNK 1Y96A 4MMLA 2RQRA 4JPBW 2V1RA 2XICA 1GL5A 3AHUA 2LJ1A 2XK0A 2OTJT 4M7AB 1VYVA 4M7AA 2L3SA 4AMCA 4M75C 3FIFA 3HL8A 2EQIA 3GLXA 4J9DA 3EGDB 5CK9A 4C0DB 1G3SA 3CC4T 2YWWA 2XU8A 4EPCA 4FIBA 4N4GA 2CSQA 1AVZC 4J7IA 2EYQA 2L89A 2RNAA 3MEVA 1P92A 3CMET 1B7TA 3ZL7C 1VQ7T 1RAHB 3O8VA 2OI3A 2MWPA 4F7UA 4DOVA 1VQOT 2RF0A 3JAME 4AFZC 3QDFA 3M4GA 1YITT 1K76A 2DEQA 1KQSS 4RCBA 3VRYA 3QBYA 2KGTA 2OX7A 2ZCFB 2DL4A 1AZEA 1EX4A 2Y90A 1WX6A 3GNFB 3M0QA 3WVEB 4HCKA 4X9DA 5GAOm 3VKIA 2LJ0A 4OMPA 2A08A 5KYUA 5ECAA 4XTXA 4VUBA 2MK5A 2E6NA 1EZZB 2XMFA 1M1KU 3EG2A 1X2QA 1M8VA 2RJFA 5GMKl 1OQKA 4NL3A 4ZN3A 2RO0A 3CCLQ 2DXCA 2ROTA 3AT1B 4BB7A 2CP2A 4QQ6A 3URGA 5AYFA 3V8JA 2CH4A 1G5VA 3QYGB 1VQNA 3CPWP 2DVJA 1BIBA 1NEBA 1UJYA 1HXDA 1AWOA 3A8GB 2DZ9A 2KNBB 1VQ6T 1FWZA 2NUZA 1HJDA 2XIDA 4DQ2A 2PVDB 3M56A 1I5OB 3A8OB 3EHQA 4FU6A 2DVEA 3X26B 5CKDA 4HVVA 4V2SA 2AIRB 4MZMA 5KYYB 3NFCA 3H9NA 3H0IA 5CR2A 4ME7A 3H0HA 3G4ST 4KBMB 4E6RA 1VQOA 1M9SA 4A63B 3CD6Q 1HK9A 2MMPA 1BI2A 4E7JA 2DK3A 2KSSA 1VQ7A 2RMOA 2YUPA 1ZSZC 1NG2A 5FRMA 4WCIA 4PJMA 3X25B 1WJQA 4C8QE 1B34B 1VQPT 2FYKA 4HA8A 5FWCA 1Q86R 1YIJA 2L5QA 2H3JA 1VQKA 2DE0X 3VS0A 3M0TA 1VYTA 1GXIE 1IREB 5IT9E 3OYHA 3OYJA 1O75A 3CBMA 3WVDB 4F17A 5HKCA 3A8HB 4RTWA 3L2RA 1K4US 1QKWA 2ZPHB 2XI9A 1QVGA 2PZ1A 1BKBA 3NTKA 2DBMA 2V8JA 1A0NB 1AOJA 3EG0A 1ABQA 5LJ3e 4JLIA 1XNIA 4CC7A 5KYUB 5D6WA 3TEEA 1TXQA 2YHTA 3PT9A 1JJ2A 4N0AA 4F7UF 1JB0E 1D1BA 3CCVA 2RA2A 3SWNC 4HCBA 3C0CA 4BI8B 2QA4Q 1LPLA 4LDYA 1N27A 2QK0A 3CCJT 2QAZA 2JMCA 4KGVB 3PGGA 2LCLA 2RJCA 4LDXA 2O2OA 4X1VA 4M75A 4XTYA 1KQ1A 2R58A 4F7UB 1LVKA 2CUDA 1KJWA 2A28A 3P8BB 1VQMQ 3FC3A 1PNJA 3HKSA 3OMGA 3HFNA 4A4GA 1YJ9Q 2DTIA 4MZTA 3VS2A 4E7LA 5AT1B 3NPFA 3ZBDA 1I0CA 2OJ2A 2HBPA 2GBQA 2JT4A 5I22A 3CCQA 3E9GA 4F04B 4KGXB 3CCLT 3T9NA 2G6FX 1PG5B 1TSFA 3E9FA 4PJJA 4ANJA 2ED0A 1YHQQ 2IG0A 1SSHA 3G1JA 2XDPA 1M2VA 2K2VA 4QVCA 1GFDA 2RHZA 1JBMA 3OYNA 1KC8U 4OMNA 1YN8A 3HHTB 3CCUA 5LJ5h 3C4SA 1PCXA 3RUXA 2F2XA 3GPLA 5DY9A 1S1NA 1YIJQ 2BIVA 3EGXA 1B34A 1AT1B 3S3OA 2CS7A 1S72A 3ZFJA 1I5LA 1YJ9A 2P0PA 4R56A 2QEXT 1X69A 3C12A 3V7CA 1WYXA 2VGMA 1ACMB 3LX7A 5FWBA 1OOTA 1R8OB 1VQOQ 3JB9G 1M2VB 1KQSP 3QZ5B 5IHIA 4FL6A 2DLPA 1M30A 1ZUKA 3OW2A 1VQ7Q 3A5ZB 4KUIA 5GAOl 3JCMh 4QW2A 1I07A 3G6EQ 3DKMA 1U8RA 3CC7Q 1VQ6Q 3CCST 2FPEA 1Q81C 2AZSA 5FROA 5CQYA 3Q1JA 1M3AA 2QQRA 3META 3CC4Q 2IIMA 2L0AA 3S3NA 1C1AA 1RI0A 3EFOA 4J9GA 1G83A 1OZ3A 4BY6C 2LTOA 1RAIB 3MHXA 2A7YA 3FJ5A 2COYA 4DEXA 1ZUYA 2W0ZA 1IXDA 2FG0A 4PFPA 1VQMA 3OMCA 2I2LA 3GP8A 4M7AF 3V7RA 3E19A 3EFRA 1UGPB 5LJ3f 4JRQA 1FMKA 1VQ8A 5GAN8 3ME9A 2EKOA 2P0KA 2JM9A 2C0OA 3C94A 4FM4B 3PVQA 2RH2A 2HQXA 3X28B 4DEYA 2CH4W 2F1LA 5LJ3g 2JM8A 3MO8A 4OB3B 1X6GA 4M7DG 4RTZA 3TU4K 4IUPA 1T0JA 1YITQ 3RIRA 3SWNB 1ZSZA 1CSKA 3EGXB 2E70A 1C0MA 2M9UA 2QASA 2LZ6B 1KD1U 2BUDA 2DM1A 3H8ZA 4WTOB 3OSSC 5EC7A 1WJRA 2KAFA 1M90C 2CP3A 2FZKB 3OYDA 4J7FA 3REBB 1BCMA 4M75G 4Z89A 3CMAT 2FPDA 2JTFA 2M16A 2Z0WA 2PQWA 2LX9A 2YRCA 5CKHA 3OS2A 4C8QC 4KH0B 5FU7C 4OMLA 4DOWA 1QVGS 4J9CA 1Y0MA 3TREA 1UE9A 2GNCA 3FLGA 4M75D 3OS5A 1SRLA 2O31A 1PKSA 1U1TA 5KE2A 1KG1A 3BE3A 2YUOA 1E6HA 5GANf 4IUTA 4XTZA 4JS5A 1IZ6A 2K5IA 3BDLA 1BI0A 1M3CA 1I4K1 2CZ0B 3I55Q 3OY9A 1W70A 3MP8A 2O9VA 1M1KR 1D09B 4JZ4A 4ZNXA 3EHRA 3S6WA 1VQ8T 4IIMA 1N8RU 3OYFA 5GMKm 2GTJA 1K1ZA 1NLOC 2OAUA 1O9SA 4FYXB 1FMVA 1PD1A 1KIKA 1ZLMA 2A0FB 1QW1A 2QQSA 3CCEA 1TS9A 4EDUA 4A4HA 2CP6A 3CXCP 3M53A 2GGRA 2K4YA 2QTVA 1LCKA 2M1HA 3M59A 2VYTA 2DXBA 3U23A 5LL6S
chains in the Genus database with same CATH topology
1Q7YR 1YJWQ 1YI2Q 1K73R 1VQ9Q 3CCVQ 1VQOQ 1S72Q 3OW2P 3I55Q 3CMAQ 1W2BP 3CMEQ 3CC4Q 1VQ4Q 3CPWP 1QVFP 1Q81R 1YJNQ 1Q86R 1VQPQ 1QVGP 1NJIR 1M1KR 2OTLQ 3G4SQ 3I56Q 1N8RR 1KQSP 1KD1R 3CCSQ 1KC8R 1VQ7Q 1YIJQ 1K8AR 3CC2Q 3CCJQ 3CCQQ 1M90R 1JJ2P 1VQNQ 3CD6Q 3CCEQ 3G71Q 1VQ8Q 3CCMQ 3CXCP 1YITQ 2OTJQ 1Q82R 1VQMQ 3G6EQ 3CC7Q 3CCLQ 3CCUQ 1VQ6Q 1YHQQ 2QA4Q 1VQ5Q 1K9MR 1VQKQ 2QEXQ 1VQLQ 3CCRQ 1YJ9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y R;  1YJW Q;  1YI2 Q;  1K73 R;  1VQ9 Q;  3CCV Q;  1VQO Q;  1S72 Q;  3OW2 P;  3I55 Q;  3CMA Q;  1W2B P;  3CME Q;  3CC4 Q;  1VQ4 Q;  3CPW P;  1QVF P;  1Q81 R;  1YJN Q;  1Q86 R;  1VQP Q;  1QVG P;  1NJI R;  1M1K R;  2OTL Q;  3G4S Q;  3I56 Q;  1N8R R;  1KQS P;  1KD1 R;  3CCS Q;  1KC8 R;  1VQ7 Q;  1YIJ Q;  1K8A R;  3CC2 Q;  3CCJ Q;  3CCQ Q;  1M90 R;  1JJ2 P;  1VQN Q;  3CD6 Q;  3CCE Q;  3G71 Q;  1VQ8 Q;  3CCM Q;  3CXC P;  1YIT Q;  2OTJ Q;  1Q82 R;  1VQM Q;  3G6E Q;  3CC7 Q;  3CCL Q;  3CCU Q;  1VQ6 Q;  1YHQ Q;  2QA4 Q;  1VQ5 Q;  1K9M R;  1VQK Q;  2QEX Q;  1VQL Q;  3CCR Q;  1YJ9 Q; 
#chains in the Genus database with same CATH topology
 2FO0 A;  3VS5 A;  8ATC B;  1QWF A;  1UB4 A;  2D1X A;  2LC4 A;  1J3T A;  3E1S A;  1T3L A;  1BI1 A;  1VYU A;  2OTL Q;  1VQ9 A;  4LDW A;  1ZUU A;  1N5Z A;  2A36 A;  1JQQ A;  4HCZ A;  4Y92 A;  3CBO A;  4JS4 A;  5A0G A;  1XQH A;  1RAF B;  5GAN 4;  3LGL A;  4ZN1 A;  2V1Q A;  4FW1 A;  1OPK A;  2O88 A;  5DM7 R;  1PSF A;  4C92 D;  3LGF A;  3MEU A;  4KRT A;  2P84 A;  1Y7X A;  1M2O A;  3OS0 A;  2EWN A;  1H92 A;  1M1K C;  1TOV A;  1JJ2 S;  2K57 A;  4PJO F;  4B9W A;  4BDY A;  2D8H A;  2DAQ A;  2BZX A;  4N0A C;  1KC8 R;  1QVF S;  1YIT A;  1WQ7 A;  3O5Z A;  4HT8 A;  1ARK A;  2EQM A;  1WHH A;  1R77 A;  1RLQ C;  3NTH A;  3J7A F;  4XTV A;  4LDV A;  1VQL Q;  3RKW A;  5CO7 A;  3LWH A;  1GFC A;  3MCA B;  1RAE B;  1YNZ A;  4M4Z A;  1AZG B;  1RAG B;  3JCM c;  3VS1 A;  1NJI R;  1YJN T;  4MDW A;  2EQJ A;  3ER0 A;  2KE9 A;  1D0X A;  5CVI A;  5KYN A;  4FT4 A;  1BBZ A;  4JJD A;  2R5A A;  2KRN A;  1M90 U;  4DBF A;  4AG2 C;  5HK0 A;  4PKC C;  2PUO B;  5J3B A;  1H8K A;  3H6Z A;  4YTL A;  2L3Q A;  4BAC A;  4K11 A;  1QWE A;  2VUB A;  2DD4 A;  2FVU A;  1B3Q A;  5CKB A;  2HDA A;  3THK A;  3OBW A;  3OB9 A;  5CAI A;  4OGE A;  3CCE Q;  3M0P A;  1UHC A;  3GBQ A;  2KRS A;  3D7S B;  3CCU Q;  5IN1 A;  2LX7 A;  2ENM A;  1M8M A;  2JTM A;  1K9M R;  2QEX Q;  2PUK B;  1W6X A;  2NUP A;  1XOV A;  1VQL T;  1BCO A;  1CKA A;  2DRK A;  4JJC A;  2KT1 A;  1N8R R;  2YXY A;  2LRQ A;  1K9M U;  2F2W A;  1W2B A;  5GAO q;  5GAM j;  3VUB A;  4RG8 A;  3MP6 A;  1YJW A;  3OYE A;  2LJ3 A;  4AFQ C;  3OQ5 A;  1N8R C;  1UEB A;  2M02 A;  4JRP A;  4PJO B;  2XDD A;  1UGR B;  4E7Z A;  2J05 A;  1YI2 Q;  3G7Z A;  1NYG A;  3JCM J;  4M78 E;  1QVF P;  2PVG B;  2KVQ G;  3CC7 A;  4DBQ A;  5GJW B;  2X3X D;  2JW4 A;  3CCJ Q;  2F2V A;  1JJ2 P;  1PKT A;  3FRN A;  1VQN T;  1X43 A;  1JO8 A;  3MEA A;  5GAM h;  1VQ4 A;  1U3O A;  2K5L A;  1FMW A;  1U06 A;  3OSV A;  4E7S A;  2MOX A;  3UT1 A;  4BE2 A;  1H64 1;  2BKD N;  3REA B;  1PRL C;  4FYV B;  4QT7 A;  3JCM d;  5C6S A;  3MJX A;  4C92 G;  2QDL A;  3PE0 A;  1V76 A;  2SEM A;  3L2W A;  3SEM A;  3CXC A;  1D3B B;  2K3Y A;  3JCM f;  3QKJ A;  4PJO A;  3MPU B;  1YWP A;  4Y28 E;  2K5F A;  1TWB A;  2X4Y A;  3X24 B;  2MF2 A;  2KQW A;  4UC4 A;  2EYX A;  1M1G A;  4AFU C;  1QLY A;  4C92 F;  1QCO A;  5CCA A;  4IKF A;  2ZZD A;  4C92 B;  5LJ5 d;  2DYI A;  1WPY A;  3V7S A;  2ZPG B;  1K8A C;  1KQS A;  2DYB A;  3I55 T;  2H8H A;  3CD6 T;  2KEA A;  4C92 A;  1VQ9 T;  3LYI A;  1G2B A;  3CCM T;  1S72 Q;  2VGN A;  4E7I A;  4QKU A;  2VXE A;  3OYL A;  3HP9 A;  3I5R A;  1AWJ A;  2OAW A;  3JB9 J;  4MDX A;  3CC2 T;  2ECZ A;  2LNV A;  2HBW A;  2YDL A;  1YCY A;  4XU1 A;  3CD6 A;  2LQN A;  3JRZ A;  2E1H A;  3CMA Q;  4M77 A;  5J39 A;  5LJ5 e;  2DFU A;  1Q81 R;  1JXO A;  2GF7 A;  3OA6 A;  1OZ2 A;  4L59 A;  1ZSZ B;  2P4R A;  2XD0 A;  2QI2 A;  5DLO A;  2DL8 A;  2BTT A;  3CC4 A;  2MAM A;  1VA7 A;  4XU3 A;  2FEI A;  5L8R E;  3JB9 D;  1U1S A;  1VQK Q;  4J8O A;  1OUL A;  2KRM A;  2NUP B;  2DZC A;  2RQW A;  1MND A;  2AKL A;  4M78 B;  4C92 E;  4OB1 B;  2RPN A;  2DIL A;  2GFU A;  2AHJ B;  5CQX A;  2CDT A;  5CIU A;  4E7K A;  2DIQ A;  3S3M A;  2CT3 A;  4LDU A;  4ELZ C;  2D0Q B;  4PFO A;  3CCV T;  1NJI U;  2V26 A;  3GF5 A;  3SDZ A;  1KC8 C;  3QSU A;  2V8I A;  2D0N A;  3RKX A;  1BB9 A;  4BE0 A;  2CUB A;  1WI7 A;  2EFI A;  3MP1 A;  1W2B S;  1BI3 A;  1AHJ B;  3CCE T;  1WHM A;  2KI7 A;  4OB2 B;  1MMG A;  5A0D A;  1SSF A;  3I56 A;  4FSS A;  5GAO p;  3FB9 A;  3CME Q;  1GRI A;  4Z88 A;  4GBQ A;  4J83 A;  3M5A A;  3G6E T;  4NOY A;  2PNI A;  1M3B A;  2L2P A;  2RHY A;  3CQT A;  4M75 E;  3PVL A;  4IUQ A;  4L6V 5;  1JEG A;  4AT1 B;  1RAB B;  4ELY C;  2X35 A;  4EIK A;  4JRI A;  3HPW A;  1WLP B;  2EQK A;  3CCR T;  2RM4 A;  2H3E B;  2RK1 A;  1UHF A;  2VC8 A;  2P4T A;  2LT4 A;  1IRX A;  3CCM A;  4RCC A;  2FZG B;  1WHK A;  1AWW A;  1UEC A;  3VS4 A;  1VQ5 A;  2IPO B;  4QVD A;  1OU9 A;  4EMK C;  1BU1 A;  2ZPE B;  3A98 A;  4OMO A;  1ZSG A;  1QVF A;  3UAT A;  5FW9 A;  2M0O A;  5FLX E;  5IHK A;  5KYX B;  3M0U A;  2HSP A;  2B8A A;  2HKN A;  3M0S A;  2MPX C;  3SHW A;  1PRM C;  4O6J A;  1Q7Y U;  2EYY A;  1K0X A;  5IAY A;  4RMO A;  2VV5 A;  2CZ6 B;  4M78 C;  4LUD A;  2KBT A;  4M77 C;  4RTT A;  3RER A;  3CXC S;  2ESW A;  1ZA2 B;  3CCV Q;  2DER A;  4PNO A;  3G6E A;  3INZ A;  2G3R A;  2K7A A;  1GBR A;  2R5M A;  2KYM A;  3PFS A;  1ZA1 B;  4HXJ A;  4KT0 E;  1XJW B;  1M90 R;  2L3P A;  3VYG A;  5IXB A;  5I11 A;  5KCH A;  2OTL A;  1MUZ A;  3QG1 A;  1VQK T;  2YLC A;  2SRC A;  2WSF E;  2FZC B;  2K3X A;  5I2M A;  3LWI A;  3I35 A;  2ZPB B;  4M7D A;  2ZPF B;  3A1P A;  4LD6 A;  3CME A;  2HAX A;  4M77 D;  2C06 A;  2FL7 A;  1K8A R;  4XTU A;  3NMZ C;  5FU7 B;  3UDC A;  2X51 A;  3KXT A;  3SB2 A;  5I2S A;  3CCQ Q;  4CC2 A;  4N4I A;  1VQ8 Q;  3L2Q A;  1FX7 A;  1Y57 A;  1ZX6 A;  2O01 E;  2DKG A;  3I56 T;  3JCM e;  4KUL A;  5LJ3 d;  1YHQ A;  1OYX A;  1FXX A;  1MHN A;  2CP5 A;  3SFM A;  1QVG P;  1W4S A;  4PLI A;  1GBQ A;  3J81 E;  3HRS A;  1QKX A;  7AT1 B;  4C5G A;  1KQ2 A;  2HNI A;  2DD5 A;  3CCM Q;  1S72 T;  4EMK B;  4GY5 A;  5GAM f;  5C0M A;  4C8Q B;  2WSE E;  1Q82 C;  4M7A G;  1G8X A;  1G3W A;  4J9I A;  2C0T A;  1SG5 A;  3RMS A;  2A37 A;  3QYH B;  3OBY A;  1NLP C;  2RI3 A;  5GAN 2;  4J6W A;  2CYZ B;  1K73 C;  2GQV A;  4BI3 A;  4KH1 B;  2E12 A;  2RN8 A;  3OW2 S;  2L8D A;  4N4H A;  2HL5 C;  1IHV A;  3QZ9 B;  1Q81 U;  3EGU A;  1SRM A;  2CP7 A;  4J9E A;  3FEO A;  2AKK A;  8AT1 B;  4D8D A;  2ED1 A;  5GAM e;  3KBG A;  1PM3 A;  1CKB A;  2GTO A;  2DL3 A;  1SHF A;  2ABL A;  1R0B G;  5GAN 6;  2LDM A;  3EH2 A;  3VV0 A;  1WDX A;  2RD1 A;  2E41 A;  4BI4 A;  2LP5 A;  4XK8 E;  1KD1 C;  2QGF B;  4MMK A;  1Y07 A;  3PIP A;  1OEB A;  2X4X A;  4CRI A;  3LH5 A;  3JB9 I;  2JJ9 A;  1YP5 A;  2E65 A;  2NYS A;  2LQW A;  2DJZ A;  3VUZ A;  1YJW Q;  3RBB B;  4M7D B;  2LCS A;  1MGQ A;  4BE1 A;  1G3Y A;  2D6F A;  2KR3 A;  2KK4 A;  1RUW A;  4XU0 A;  1QCN A;  2LMJ A;  1WJS A;  4R0K A;  3CPW S;  4M78 D;  4TVR A;  3I9Q A;  1RAD B;  2XHC A;  1KHI A;  4OVA A;  2JZ2 A;  1NPR A;  2ROL A;  2VXF A;  4A4E A;  3CEY A;  3CC2 A;  4LNP A;  4FSX A;  2VAS A;  1PSE A;  3M55 A;  3QPH A;  2DF6 A;  5KYW A;  3M58 A;  2PU9 B;  2BZY A;  5CKF A;  1D3B A;  3CCS Q;  3JCM X;  2M51 A;  1NM7 A;  2E3I A;  3OYC A;  2JS2 A;  4P5N A;  4F16 A;  3G71 A;  2RQU A;  4KGZ B;  1K73 R;  1ABO A;  1JXM A;  1UGQ B;  1QP3 A;  4XU2 A;  3QWX X;  1KSW A;  3QUI A;  3J80 E;  2BE7 D;  1YJN Q;  3OS1 A;  2MWO A;  1C6V X;  1H3H A;  1QP2 A;  1IGQ A;  2FHD A;  4IUR A;  1HSQ A;  2JVV A;  4F7U G;  4RTX A;  1E6G A;  4PJN A;  2DL7 A;  2YUN A;  2LQK A;  4J6Y A;  2J6F A;  3OW2 P;  5A0L A;  4LUE A;  4M7D D;  3L2U A;  4LD9 K;  3I55 A;  4XAX B;  4QVZ A;  2EW3 A;  1Y96 B;  1RL2 A;  9ATC B;  2YT6 A;  1OI1 A;  4XQ3 A;  1M5Q 1;  2HMA A;  4OMM A;  2E5K A;  3RR6 A;  5LJ3 j;  3JB9 F;  1LNX A;  1B07 A;  2RHX A;  1YJ9 T;  2OTL T;  3QII A;  4ATO A;  3EG9 A;  3EGD A;  4A4K A;  1RI9 A;  5D6Y A;  2DPP B;  2XKO C;  4D8K A;  2GQI A;  3ZEH A;  5GAM g;  1I1J A;  3RMQ A;  2K3B A;  4IUV A;  1M27 C;  4BUG A;  3GNG A;  4JDS A;  1UGS B;  2X9H A;  3NHN A;  4FYY B;  2DBK A;  4AG1 C;  2QQB A;  2BE9 B;  4M7A C;  1K73 U;  3BW1 A;  4DA4 A;  2BZ8 A;  1TUC A;  3VU3 C;  3KFV A;  3L42 A;  4A54 A;  4IIO A;  1VIE A;  1QQJ A;  3NGP A;  4RKU E;  3QXE B;  2CKK A;  2K79 A;  1TU0 B;  2JMA A;  1SKU B;  5GAN e;  1K0S A;  3H0F A;  1NYF A;  1WIE A;  1SF9 A;  1W1F A;  2E6Z A;  3OYM A;  4HVW A;  3MEW A;  1LOJ A;  4X34 A;  2J6K A;  2J06 A;  2YRD A;  1OV3 A;  1E7O A;  1Y71 A;  3DB3 A;  2YRV A;  2WSC E;  3H41 A;  1V1C A;  1WHJ A;  3CCJ A;  2DL5 A;  4M77 B;  2EAY A;  4Z8A A;  3CCS A;  2JN0 A;  1EFN A;  3HRU A;  1NPP A;  4PJO G;  2RI2 A;  2VWF A;  2YUQ A;  3TSZ A;  4OB0 B;  3BY7 A;  2JXB A;  3I56 Q;  3IQL A;  1WA7 A;  1ZQ1 A;  3JV3 A;  1K9M C;  5LJ5 f;  2EGC A;  3G71 Q;  1IHW A;  4M7D E;  2DRM A;  3BFM A;  3CPF A;  4B9X A;  3GIB A;  1AEY A;  4M75 F;  5KYW B;  1HD3 A;  3UF4 A;  1YWO A;  3LLR A;  2K2M A;  1WHL A;  2CSI A;  5IHN A;  4FYW B;  2RI5 A;  1M1F A;  2X4J A;  5GAO n;  3NTI A;  2F69 A;  3M54 A;  1UDL A;  1X6B A;  2EJG A;  1EIF A;  2DA9 A;  2RB6 A;  2V8K A;  3EH1 A;  2ATC B;  2R57 A;  2FPF A;  3JSC A;  3M9Q A;  3EG3 A;  2DJQ A;  3X20 B;  1LJO A;  2EIF A;  3MKD A;  5KH6 A;  3OYG A;  5A2Q E;  5L23 A;  4C0F A;  2MI6 A;  2EBP A;  5D6X A;  4ZGE B;  2HQE A;  4LN2 A;  1BIA A;  2HZY A;  1N9S A;  2QXF A;  1Q86 U;  3EAE A;  2O9S A;  2EKH A;  5GAN h;  2E3H A;  2JS0 A;  3P8D A;  1PC0 A;  3UWN A;  2QTX A;  1BYM A;  1W2B P;  2Y4X A;  4Q5W A;  5KCO A;  3I5S A;  5DLQ E;  4M7A D;  3GOX A;  2VB6 A;  1SEM A;  1K9A A;  2JOY A;  3JCM V;  2COW A;  5KYX A;  3VJP A;  2RHI A;  4PJO C;  3LW5 E;  2I0N A;  1UG1 A;  4RG2 A;  2CZ7 B;  1UJ0 A;  4M78 F;  3CCR Q;  2KDS A;  2DEU A;  2EQU A;  2HQH A;  3L2V A;  1AWX A;  1K8A U;  1D1A A;  3F70 A;  1MMA A;  2J7I A;  2B86 A;  3PNW C;  4JLG A;  5I21 A;  3A8M B;  1JRI A;  1Q95 G;  4EMK A;  2P0Q A;  4ZTJ A;  1SPK A;  3QJY A;  2F5K A;  4RTY A;  2O4X A;  2RJE A;  2W10 A;  5IXF A;  3TQ7 P;  4RTU A;  1QVP A;  4AFS C;  3QHS A;  3CC7 T;  2DX1 A;  3N5B B;  2DMO A;  4ESR A;  1VUB A;  4FT2 A;  6AT1 B;  3SWN A;  1IO6 A;  5GAN g;  2ZGW A;  1WXT A;  2QA4 A;  1JU5 C;  5LJ3 h;  3CC2 Q;  4A53 A;  5KE3 A;  3FJP A;  2QQ9 A;  1Q82 R;  3EFS A;  5LJ5 j;  1IB8 A;  3VS6 A;  4PFZ A;  1YHQ T;  4C5E A;  4R55 A;  1AD5 A;  2HSE B;  1N6A A;  2EYZ A;  4BDZ A;  1Q7Y R;  1VQ9 Q;  4M77 E;  1M4Z A;  2HEQ A;  4JUV A;  5GMK i;  1VQL A;  3M4Y A;  1YIJ T;  4ORZ A;  4PK4 A;  2DXU A;  1X01 A;  1QMC A;  4C0D C;  3OYB A;  5IH2 A;  1V29 B;  2CRE A;  3RES A;  5J26 A;  4JZ3 A;  4LXC A;  4PL6 A;  3M57 A;  1WZO A;  3HSB A;  1VIF A;  2CP0 A;  1VQM T;  2FRY A;  1D0Z A;  2AK5 A;  4M7D F;  3V8K A;  4B6M A;  5GAN d;  4OMF B;  1TTH B;  5FU6 C;  1WXU A;  1NE8 A;  2RQV A;  2J6O A;  3HTR A;  4C0G A;  5FRN A;  4NS5 A;  2YLB A;  2RHU A;  3VRZ A;  5D7U A;  3RNJ A;  3M0R A;  2HL3 A;  2F5T X;  2LT1 A;  2RK2 A;  3VS7 A;  5KYY A;  2DTO A;  1GCQ C;  4F7U E;  4FW2 A;  2Y4Y A;  4E2F B;  4GLM A;  4NL2 A;  2D8J A;  4WF2 A;  3JCM W;  4PJO E;  1NBE B;  3DLL A;  1NJI C;  1T0H A;  4C92 C;  2DTH A;  1OX8 A;  1RAC B;  1OU8 A;  1IGU A;  3PIO A;  2AT1 B;  2HKQ B;  4J9B A;  1U5S A;  3VYH B;  2QA4 T;  4Z02 A;  1WHG A;  2JTE A;  2ZAE A;  1KK7 A;  1WFW A;  4C5H A;  2KMT A;  3OYI A;  1YCS B;  3LH0 A;  4DBH A;  4ZTF A;  1MV3 A;  1VQP Q;  4M78 A;  4C8Q G;  2E64 A;  1Q7Y C;  2CT4 A;  1MNE A;  1TUD A;  3SD4 A;  3DLM A;  3R6O A;  2NUT A;  2QEX A;  1NZ9 A;  2PVO B;  3TCJ A;  2PTK A;  2DXT A;  4OMQ A;  3V8L A;  3L1A A;  4M77 G;  5HCK A;  4C8Q D;  2NUT B;  4BY6 B;  4M78 G;  1BK2 A;  4FCY A;  1VQ4 Q;  4HKE A;  1PD0 A;  1D0Y A;  1WNL A;  2LCC A;  3CCU T;  5FU6 B;  2LVM A;  4J5Y A;  3OYK A;  1OPL A;  3UPU A;  1YJN A;  3WXM B;  3L2Z A;  4OGC A;  4PJL A;  2FB7 A;  2K9G A;  3CCL A;  2KXC A;  2DET A;  2CGH A;  3PMI A;  1UGV A;  4C0Z A;  5GJV B;  3G4S Q;  2E10 A;  3RDV A;  1X75 C;  1I8F A;  1QCF A;  4JJB A;  2DIG A;  1SHG A;  1VQN Q;  1D1C A;  4EMH A;  4C5I A;  3BDU A;  2VKN A;  4OP0 A;  1KHC A;  2AZV A;  1VQ5 Q;  3EG9 B;  4EMG A;  5HY6 A;  3CPW A;  1Z9Q A;  1GCQ A;  1F1B B;  1YI2 T;  4IUU A;  1NEG A;  1TG0 A;  3P8H A;  4DBR A;  1ZBX A;  5LJ5 g;  4ZGD B;  5GMK h;  2OTJ A;  1RLP C;  2X4W A;  4C8Q A;  2HD0 A;  3OYY A;  2RQT A;  1Q82 U;  3EG1 A;  2KY9 A;  2LNH B;  4RUG A;  1TH7 A;  3QDR B;  1G3T A;  3CBP A;  1RAA B;  3C95 A;  1GCP A;  1OX9 A;  2IVW A;  2FRW A;  1VQ5 T;  2E5Q A;  2L3R A;  4ZGJ B;  2MIO A;  3CMA A;  2X3W D;  4LE9 A;  2NWM A;  1VQP A;  2QGG A;  1MV0 B;  3KUF A;  1PWT A;  2COZ A;  1YJW T;  2HCK A;  2KT8 A;  3HRT A;  3JCM P;  5GAN j;  1R0C B;  1ZBJ A;  1N9R A;  4Y91 A;  4J9H A;  3QWY A;  4E47 A;  4E7H A;  4J6X A;  1KD1 R;  4GLK A;  4M7D C;  1VOM A;  1UFF A;  2GFA A;  2QG9 B;  3JCM g;  2KYB A;  3R6N A;  1MMN A;  4HVU A;  1X6O A;  3EFO B;  5GMK j;  2EJF A;  3PTA A;  5GAN 7;  3PMT A;  1PHT A;  3UA7 A;  1VQ4 T;  2M0Y A;  2EGE A;  4M75 B;  1VQ6 A;  1H3Z A;  3DB4 A;  4BD3 A;  4CC4 B;  2EYW A;  2EGA A;  4RTV A;  3FDR A;  2RJD A;  4C8Q F;  3G71 T;  2DNU A;  3CCR A;  1Z9Z A;  4XTW A;  3OYA A;  1DJ7 B;  2JUF A;  2WAC A;  3JCM Q;  1Q86 C;  2KXD A;  4M77 F;  5GAN 3;  5GAN 5;  1YFN A;  2VVK A;  3TVT A;  4OF1 A;  2QDY B;  5CKE A;  1XTD A;  1WQW A;  4D6W A;  1I81 A;  2C0I A;  1ZHI A;  5GAM d;  4QQD A;  2OTJ Q;  2GCX A;  2O4X B;  4PLL A;  1YI2 A;  1KFZ A;  2EVR A;  3RKY A;  3ASK A;  3ULR B;  4CI0 C;  1X2K A;  3G4S A;  2K6D A;  2DO3 A;  2JNG A;  5GAO r;  1TUG B;  4JRK A;  4QQG A;  2LQ8 A;  4MZP A;  3E2U A;  3JB9 H;  3TSW A;  5EG2 A;  3CCQ T;  4HT9 A;  2QYZ A;  1UTI A;  2MCN A;  2MYS A;  2D9T A;  3A8L B;  2EPD A;  5GMK e;  4J9F A;  2YSQ A;  5M9O A;  4PJO D;  4KUD K;  2XDB A;  4X9C A;  4F14 A;  3HFO A;  4HCC A;  4CC3 A;  5HK3 A;  2EJ9 A;  3JCM b;  2QQA A;  4L5G A;  4A4F A;  2E4H A;  1HYO A;  3QJ6 A;  2NLU A;  1FYN A;  4O5V A;  4II1 A;  1X27 A;  1MMD A;  1WXB A;  2CZ1 B;  2ZPI B;  1T3S A;  2KRO A;  1UUE A;  3QO3 A;  3UA6 A;  1WGS A;  1YBY A;  4M7A E;  2XG8 D;  3VS3 A;  2A3L A;  4JJN K;  1Y96 A;  4MML A;  2RQR A;  4JPB W;  2V1R A;  2XIC A;  1GL5 A;  3AHU A;  2LJ1 A;  2XK0 A;  2OTJ T;  4M7A B;  1VYV A;  4M7A A;  2L3S A;  4AMC A;  4M75 C;  3FIF A;  3HL8 A;  2EQI A;  3GLX A;  4J9D A;  3EGD B;  5CK9 A;  4C0D B;  1G3S A;  3CC4 T;  2YWW A;  2XU8 A;  4EPC A;  4FIB A;  4N4G A;  2CSQ A;  1AVZ C;  4J7I A;  2EYQ A;  2L89 A;  2RNA A;  3MEV A;  1P92 A;  3CME T;  1B7T A;  3ZL7 C;  1VQ7 T;  1RAH B;  3O8V A;  2OI3 A;  2MWP A;  4F7U A;  4DOV A;  1VQO T;  2RF0 A;  3JAM E;  4AFZ C;  3QDF A;  3M4G A;  1YIT T;  1K76 A;  2DEQ A;  1KQS S;  4RCB A;  3VRY A;  3QBY A;  2KGT A;  2OX7 A;  2ZCF B;  2DL4 A;  1AZE A;  1EX4 A;  2Y90 A;  1WX6 A;  3GNF B;  3M0Q A;  3WVE B;  4HCK A;  4X9D A;  5GAO m;  3VKI A;  2LJ0 A;  4OMP A;  2A08 A;  5KYU A;  5ECA A;  4XTX A;  4VUB A;  2MK5 A;  2E6N A;  1EZZ B;  2XMF A;  1M1K U;  3EG2 A;  1X2Q A;  1M8V A;  2RJF A;  5GMK l;  1OQK A;  4NL3 A;  4ZN3 A;  2RO0 A;  3CCL Q;  2DXC A;  2ROT A;  3AT1 B;  4BB7 A;  2CP2 A;  4QQ6 A;  3URG A;  5AYF A;  3V8J A;  2CH4 A;  1G5V A;  3QYG B;  1VQN A;  3CPW P;  2DVJ A;  1BIB A;  1NEB A;  1UJY A;  1HXD A;  1AWO A;  3A8G B;  2DZ9 A;  2KNB B;  1VQ6 T;  1FWZ A;  2NUZ A;  1HJD A;  2XID A;  4DQ2 A;  2PVD B;  3M56 A;  1I5O B;  3A8O B;  3EHQ A;  4FU6 A;  2DVE A;  3X26 B;  5CKD A;  4HVV A;  4V2S A;  2AIR B;  4MZM A;  5KYY B;  3NFC A;  3H9N A;  3H0I A;  5CR2 A;  4ME7 A;  3H0H A;  3G4S T;  4KBM B;  4E6R A;  1VQO A;  1M9S A;  4A63 B;  3CD6 Q;  1HK9 A;  2MMP A;  1BI2 A;  4E7J A;  2DK3 A;  2KSS A;  1VQ7 A;  2RMO A;  2YUP A;  1ZSZ C;  1NG2 A;  5FRM A;  4WCI A;  4PJM A;  3X25 B;  1WJQ A;  4C8Q E;  1B34 B;  1VQP T;  2FYK A;  4HA8 A;  5FWC A;  1Q86 R;  1YIJ A;  2L5Q A;  2H3J A;  1VQK A;  2DE0 X;  3VS0 A;  3M0T A;  1VYT A;  1GXI E;  1IRE B;  5IT9 E;  3OYH A;  3OYJ A;  1O75 A;  3CBM A;  3WVD B;  4F17 A;  5HKC A;  3A8H B;  4RTW A;  3L2R A;  1K4U S;  1QKW A;  2ZPH B;  2XI9 A;  1QVG A;  2PZ1 A;  1BKB A;  3NTK A;  2DBM A;  2V8J A;  1A0N B;  1AOJ A;  3EG0 A;  1ABQ A;  5LJ3 e;  4JLI A;  1XNI A;  4CC7 A;  5KYU B;  5D6W A;  3TEE A;  1TXQ A;  2YHT A;  3PT9 A;  1JJ2 A;  4N0A A;  4F7U F;  1JB0 E;  1D1B A;  3CCV A;  2RA2 A;  3SWN C;  4HCB A;  3C0C A;  4BI8 B;  2QA4 Q;  1LPL A;  4LDY A;  1N27 A;  2QK0 A;  3CCJ T;  2QAZ A;  2JMC A;  4KGV B;  3PGG A;  2LCL A;  2RJC A;  4LDX A;  2O2O A;  4X1V A;  4M75 A;  4XTY A;  1KQ1 A;  2R58 A;  4F7U B;  1LVK A;  2CUD A;  1KJW A;  2A28 A;  3P8B B;  1VQM Q;  3FC3 A;  1PNJ A;  3HKS A;  3OMG A;  3HFN A;  4A4G A;  1YJ9 Q;  2DTI A;  4MZT A;  3VS2 A;  4E7L A;  5AT1 B;  3NPF A;  3ZBD A;  1I0C A;  2OJ2 A;  2HBP A;  2GBQ A;  2JT4 A;  5I22 A;  3CCQ A;  3E9G A;  4F04 B;  4KGX B;  3CCL T;  3T9N A;  2G6F X;  1PG5 B;  1TSF A;  3E9F A;  4PJJ A;  4ANJ A;  2ED0 A;  1YHQ Q;  2IG0 A;  1SSH A;  3G1J A;  2XDP A;  1M2V A;  2K2V A;  4QVC A;  1GFD A;  2RHZ A;  1JBM A;  3OYN A;  1KC8 U;  4OMN A;  1YN8 A;  3HHT B;  3CCU A;  5LJ5 h;  3C4S A;  1PCX A;  3RUX A;  2F2X A;  3GPL A;  5DY9 A;  1S1N A;  1YIJ Q;  2BIV A;  3EGX A;  1B34 A;  1AT1 B;  3S3O A;  2CS7 A;  1S72 A;  3ZFJ A;  1I5L A;  1YJ9 A;  2P0P A;  4R56 A;  2QEX T;  1X69 A;  3C12 A;  3V7C A;  1WYX A;  2VGM A;  1ACM B;  3LX7 A;  5FWB A;  1OOT A;  1R8O B;  1VQO Q;  3JB9 G;  1M2V B;  1KQS P;  3QZ5 B;  5IHI A;  4FL6 A;  2DLP A;  1M30 A;  1ZUK A;  3OW2 A;  1VQ7 Q;  3A5Z B;  4KUI A;  5GAO l;  3JCM h;  4QW2 A;  1I07 A;  3G6E Q;  3DKM A;  1U8R A;  3CC7 Q;  1VQ6 Q;  3CCS T;  2FPE A;  1Q81 C;  2AZS A;  5FRO A;  5CQY A;  3Q1J A;  1M3A A;  2QQR A;  3MET A;  3CC4 Q;  2IIM A;  2L0A A;  3S3N A;  1C1A A;  1RI0 A;  3EFO A;  4J9G A;  1G83 A;  1OZ3 A;  4BY6 C;  2LTO A;  1RAI B;  3MHX A;  2A7Y A;  3FJ5 A;  2COY A;  4DEX A;  1ZUY A;  2W0Z A;  1IXD A;  2FG0 A;  4PFP A;  1VQM A;  3OMC A;  2I2L A;  3GP8 A;  4M7A F;  3V7R A;  3E19 A;  3EFR A;  1UGP B;  5LJ3 f;  4JRQ A;  1FMK A;  1VQ8 A;  5GAN 8;  3ME9 A;  2EKO A;  2P0K A;  2JM9 A;  2C0O A;  3C94 A;  4FM4 B;  3PVQ A;  2RH2 A;  2HQX A;  3X28 B;  4DEY A;  2CH4 W;  2F1L A;  5LJ3 g;  2JM8 A;  3MO8 A;  4OB3 B;  1X6G A;  4M7D G;  4RTZ A;  3TU4 K;  4IUP A;  1T0J A;  1YIT Q;  3RIR A;  3SWN B;  1ZSZ A;  1CSK A;  3EGX B;  2E70 A;  1C0M A;  2M9U A;  2QAS A;  2LZ6 B;  1KD1 U;  2BUD A;  2DM1 A;  3H8Z A;  4WTO B;  3OSS C;  5EC7 A;  1WJR A;  2KAF A;  1M90 C;  2CP3 A;  2FZK B;  3OYD A;  4J7F A;  3REB B;  1BCM A;  4M75 G;  4Z89 A;  3CMA T;  2FPD A;  2JTF A;  2M16 A;  2Z0W A;  2PQW A;  2LX9 A;  2YRC A;  5CKH A;  3OS2 A;  4C8Q C;  4KH0 B;  5FU7 C;  4OML A;  4DOW A;  1QVG S;  4J9C A;  1Y0M A;  3TRE A;  1UE9 A;  2GNC A;  3FLG A;  4M75 D;  3OS5 A;  1SRL A;  2O31 A;  1PKS A;  1U1T A;  5KE2 A;  1KG1 A;  3BE3 A;  2YUO A;  1E6H A;  5GAN f;  4IUT A;  4XTZ A;  4JS5 A;  1IZ6 A;  2K5I A;  3BDL A;  1BI0 A;  1M3C A;  1I4K 1;  2CZ0 B;  3I55 Q;  3OY9 A;  1W70 A;  3MP8 A;  2O9V A;  1M1K R;  1D09 B;  4JZ4 A;  4ZNX A;  3EHR A;  3S6W A;  1VQ8 T;  4IIM A;  1N8R U;  3OYF A;  5GMK m;  2GTJ A;  1K1Z A;  1NLO C;  2OAU A;  1O9S A;  4FYX B;  1FMV A;  1PD1 A;  1KIK A;  1ZLM A;  2A0F B;  1QW1 A;  2QQS A;  3CCE A;  1TS9 A;  4EDU A;  4A4H A;  2CP6 A;  3CXC P;  3M53 A;  2GGR A;  2K4Y A;  2QTV A;  1LCK A;  2M1H A;  3M59 A;  2VYT A;  2DXB A;  3U23 A;  5LL6 S; 
#chains in the Genus database with same CATH homology
 1Q7Y R;  1YJW Q;  1YI2 Q;  1K73 R;  1VQ9 Q;  3CCV Q;  1VQO Q;  1S72 Q;  3OW2 P;  3I55 Q;  3CMA Q;  1W2B P;  3CME Q;  3CC4 Q;  1VQ4 Q;  3CPW P;  1QVF P;  1Q81 R;  1YJN Q;  1Q86 R;  1VQP Q;  1QVG P;  1NJI R;  1M1K R;  2OTL Q;  3G4S Q;  3I56 Q;  1N8R R;  1KQS P;  1KD1 R;  3CCS Q;  1KC8 R;  1VQ7 Q;  1YIJ Q;  1K8A R;  3CC2 Q;  3CCJ Q;  3CCQ Q;  1M90 R;  1JJ2 P;  1VQN Q;  3CD6 Q;  3CCE Q;  3G71 Q;  1VQ8 Q;  3CCM Q;  3CXC P;  1YIT Q;  2OTJ Q;  1Q82 R;  1VQM Q;  3G6E Q;  3CC7 Q;  3CCL Q;  3CCU Q;  1VQ6 Q;  1YHQ Q;  2QA4 Q;  1VQ5 Q;  1K9M R;  1VQK Q;  2QEX Q;  1VQL Q;  3CCR Q;  1YJ9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...