1LPLA

Structural genomics of caenorhabditis elegans: cap-gly domain of f53f4.3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
SDKLNEEAAKNIMVGNRCEVTVGAQMARRGEVAYVGATKFKEGVWVGVKYDEPVGKNDGSVAGVRYFDCDPKYGGFVRPVDVKVGDFPELSIDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Hypothetical 25.4 kDa protein F53F4.3 in chromosome V
publication title Crystal Structure of the Cytoskeleton-associated Protein Glycine-rich (CAP-Gly) Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1lplA00
2CP3A 2QK0A 2HKNA 1WHMA 1WHLA 2COWA 2CP6A 1TXQA 2E3HA 2HL3A 3TQ7P 2CP2A 2M02A 1WHGA 2CP7A 4B6MA 2E4HA 1LPLA 2CP5A 2E3IA 2MPXC 2COYA 3RDVA 1IXDA 2CP0A 1WHHA 1WHKA 2HQHA 2HKQB 3E2UA 2Z0WA 1WHJA 1TOVA 2HL5C 2COZA
chains in the Genus database with same CATH superfamily
2LJ3A 2DZ9A 3L1AA 1YNZA 1N27A 2RHIA 4MMKA 1VQ8Q 4M7AE 2H3JA 5EC7A 1GL5A 2R5AA 3QPHA 4ZN1A 3NMZC 2NUTA 2AKKA 4RTZA 2HZYA 3ASKA 2K7AA 2CGHA 3MCAB 3FJ5A 4HCCA 1T3SA 1YITQ 1AWOA 1UB4A 1D3BB 3KXTA 2DNUA 3OYYA 4XTUA 3H0HA 3UT1A 5GAMj 4KBMB 2O9VA 4A53A 3DB3A 3LWHA 1Q82U 2M9UA 2MWOA 2XI9A 4PLIA 4M75E 2CSQA 3QSUA 4ELZC 2NUZA 3CC7Q 5DY9A 1UGVA 1Q82C 3J81E 1D1BA 2DBKA 3HTRA 3OW2A 3REBB 4EMHA 4OGCA 1GCPA 1XOVA 3MP6A 2M1HA 4N4IA 3ZBDA 3CCRT 3R6NA 4LN2A 3CMEQ 1R77A 2RB6A 3LLRA 1G3SA 2K3BA 2VVKA 4XQ3A 5I22A 1WZOA 4J9GA 1WJQA 4A4GA 4E7JA 2Y4XA 3UDCA 2BTTA 2OX7A 2QEXT 1BI2A 2MAMA 1KQSP 1OI1A 4KRTA 1I1JA 4MMLA 2ZZDA 4E7LA 1ZA2B 3HL8A 1W1FA 1OX9A 2CP5A 2E3IA 2CSIA 2NWMA 1X6BA 3FRNA 1H3ZA 2DD5A 4MZPA 4JLIA 1YI2A 1QVFA 3OS0A 2CREA 1AWXA 1WPYA 1RABB 3CCQQ 3F70A 3VS1A 2QQBA 1U3OA 3NPFA 3S6WA 3OW2S 1Q86U 2VXFA 2LVMA 1VQ9A 4IUUA 4PJOA 2KR3A 4E7ZA 3QJ6A 3JB9I 4PJJA 4OB1B 2DXCA 2EBPA 1E6GA 1JB0E 3JCMV 3A5ZB 1MMNA 1M90R 1LJOA 2DKGA 1R0CB 1HD3A 2J06A 1SRMA 1OULA 2L3QA 5GAMf 1GCQA 2MWPA 2DL8A 1ZUKA 3SD4A 5KCHA 2QQSA 1RAIB 5IHIA 5EG2A 1W2BA 2OTJQ 2DXBA 2AK5A 2VC8A 5KYXA 1UJYA 2RJDA 1B34A 4FSSA 1I07A 3QUIA 2LZ6B 3PMTA 3EG9B 2E70A 2YRDA 2XG8D 3NTHA 4FW2A 2RQVA 1QVFS 4ZTFA 1Y0MA 2ENMA 4KGZB 4M78C 2D8HA 5GMKl 1FXXA 2ESWA 2CP7A 3CCVQ 3CCEQ 3VYGA 3V7SA 2VXEA 1GFCA 2DK3A 3IQLA 4AT1B 4M7DD 2KAFA 2KBTA 1KD1R 4IKFA 1M27C 1PKSA 3WXMB 2LCCA 1MMAA 4RTWA 3CCUQ 2HNIA 4FYVB 5LJ5j 3OYJA 1JXMA 4HVWA 3TSWA 4FM4B 2AZSA 2EYWA 4JLGA 1K1ZA 4OMPA 4B6MA 4M7DB 5LJ5e 3P8DA 1UDLA 4FW1A 3G4SQ 1W2BS 1AHJB 2A7YA 4Z88A 2P84A 2JS2A 2HKQB 2HQXA 4CC4B 1PCXA 4C0ZA 4X1VA 3FEOA 1K9MU 4Z89A 4LD9K 1U8RA 3VRZA 3G6EA 2VWFA 3MP8A 4JZ3A 4OB0B 1KC8R 4HCKA 4ZN3A 2GGRA 4X9DA 3RIRA 1K9MC 2BE9B 2KYMA 3I55Q 2ZPBB 3G71A 1VQKA 1EIFA 4M7DF 1VQLQ 2WACA 5GAMd 5GMKe 2EKHA 4C92A 1VQ5Q 3EHQA 3I56A 3JCMX 4PFZA 2RD1A 2DILA 4AMCA 1KFZA 4DBHA 2ABLA 2F69A 1O75A 2YXYA 2BZYA 2IVWA 2DO3A 2A08A 2FRWA 3VYHB 4ATOA 2CS7A 1WHKA 2KNBB 4N0AA 4M7AD 2COZA 4C8QA 1ZSZB 2DYIA 1NBEB 1ZHIA 2DL3A 4M77C 1ACMB 5D7UA 4CC7A 2DJZA 4FSXA 2A37A 3X25B 4LD6A 4J9IA 1M1FA 3J80E 5LL6S 5FWBA 4IUVA 3M56A 4M7AB 2L5QA 5LJ5f 4JZ4A 1D1AA 2Z0WA 2D1XA 4F14A 3CC2A 2RI5A 4GLKA 4XTXA 1I8FA 1SF9A 4PJOF 2P0QA 4J8OA 1YJ9A 2AHJB 1QMCA 2JN0A 1K9AA 4QQGA 2XDBA 2PNIA 2QDYB 1OZ2A 1IRXA 4E2FB 2DFUA 4JS5A 2J05A 3LH5A 5KYYB 1UTIA 2EQUA 2P4TA 4M75B 1ZLMA 1SSFA 1SPKA 1K0SA 1Z9ZA 1BCOA 4PKCC 4MZTA 3M4YA 3OSVA 4L6V5 2EW3A 1BI3A 3MEUA 4BY6B 2DXTA 5CVIA 1B3QA 2O01E 4J9DA 4EMKB 3CCRQ 4RTVA 4EMGA 3V8KA 1YCYA 4CRIA 2CZ0B 4OGEA 5GAN5 4JS4A 2GNCA 1V1CA 4M77E 2QQ9A 3SWNC 1JEGA 5LJ3g 4CI0C 5IXBA 4EIKA 2D6FA 2E10A 2QEXQ 2YLCA 2GF7A 4J6XA 4JJDA 1QCNA 1MV3A 1M3AA 1W6XA 1BI0A 1AOJA 4M7AG 3CEYA 3C94A 2JM9A 3FLGA 3CCSQ 4D8KA 2NLUA 2DTOA 5LJ5d 3S3NA 2DF6A 4RUGA 4BDZA 1NJIU 3M0UA 4OP0A 2DD4A 3CCQT 5CO7A 2DEUA 3OYDA 1NJIC 4J83A 1YI2T 1SKUB 3ZFJA 2V1RA 5CKHA 1DJ7B 3M5AA 4J6YA 5GANj 1KQ1A 1IZ6A 1NLPC 1H3HA 4Z02A 2XU8A 4M75G 3O8VA 2DL5A 3L2ZA 2ZAEA 1OPKA 1QVGA 4X34A 5FU6C 1N8RR 2LP5A 1VQ4A 4F04B 2R58A 3M9QA 4ZGDB 1VQPA 2OTJT 1W4SA 3UWNA 1QVFP 4VUBA 2XICA 1TXQA 3EAEA 2YUNA 2VYTA 1YJNA 2YUQA 2D0NA 1D3BA 2CYZB 4C0FA 3CCET 2CP3A 3CC4Q 1EZZB 5J3BA 2QDLA 2HAXA 1YBYA 2B8AA 1N8RU 2E41A 3REAB 1IHVA 3M59A 1VQMQ 1YHQQ 3DKMA 4FYYB 2HBPA 5FU7C 1QVGS 1G5VA 2KXCA 2L2PA 4LDWA 3CCJA 4A4HA 1FMWA 3KUFA 2HL5C 4C0GA 1JU5C 2F2XA 2YRCA 1HJDA 2DXUA 2RA2A 2CZ6B 4IIMA 3KFVA 2CH4A 5GANf 3PGGA 2LCLA 2HBWA 3G7ZA 2X3WD 3A98A 4IIOA 2KK4A 3I55T 3G6ET 4ZNXA 2X3XD 3O5ZA 4ZTJA 3OS1A 1B7TA 2K5FA 5DM7R 1GCQC 3VS4A 1VQ5T 4FL6A 3G71T 1OV3A 1VQKT 1Q7YR 3M55A 3V8LA 1Y57A 2RN8A 4FCYA 2F2VA 2WSFE 3VS0A 2BE7D 2OTLA 2EWNA 2PVOB 2XDDA 4LXCA 3PVLA 3RKXA 5L8RE 3LYIA 3R6OA 1M2VB 3EFSA 1WA7A 3JB9H 1X01A 2QXFA 5GAN3 1NLOC 3DLLA 3H6ZA 5GAOr 3JCMf 1KSWA 2J6KA 4RTXA 5GAN6 5IXFA 3U23A 1WHHA 3H41A 3VS2A 3V7RA 2QGGA 2KDSA 2DETA 1PSFA 5D6WA 5HK0A 1RLQC 2FRYA 2VASA 3MKDA 5FROA 1Q7YU 1FX7A 1WHMA 2KXDA 2FVUA 3GIBA 1SEMA 3EG9A 1MMGA 4DBRA 1T0JA 3ZEHA 2DYBA 2E6ZA 3HFOA 2BZ8A 1K4US 1QP2A 1VQ8A 3CC2T 3GOXA 2FHDA 4Q5WA 1UFFA 2OAWA 2BIVA 5KYWB 1NEBA 1VQOA 1NM7A 2DM1A 1G3YA 1M8VA 3JCMP 1YJ9T 2E1HA 2RI3A 5GANd 2HL3A 2RQUA 2KYBA 1I5OB 4FYWB 4R55A 2BKDN 1ZBXA 3VUBA 2FL7A 4WF2A 1ZQ1A 3OBYA 3PFSA 1TG0A 2CP0A 4M77D 2L3PA 2JXBA 2PZ1A 3JB9G 4M7DA 4C92C 4J6WA 1JBMA 3JV3A 2ED0A 2W10A 2JM8A 2X35A 3EFOB 5GAN7 3N5BB 2RJCA 3JCMb 4BE2A 2CT4A 2GFUA 4AFSC 2K57A 1ABOA 2KI7A 4M77B 1RAEB 3M0RA 3RDVA 3H9NA 2VGMA 1ARKA 2DIQA 3C4SA 4OMOA 4R56A 1YIJA 2HEQA 4N0AC 3JCMd 4QW2A 1WHLA 4C8QC 1K8AR 4DBQA 3QZ5B 2LQWA 5L23A 1QCFA 2HD0A 3GLXA 2QQRA 1WLPB 1OU9A 1HSQA 1I81A 2LNVA 1RAGB 2RK2A 2ED1A 2LJ1A 3CXCA 3CCST 2F5TX 2DJQA 2X51A 1QQJA 3NGPA 1WQ7A 3A8OB 2R57A 3S3MA 1VYUA 2RMOA 4OMLA 4HKEA 2COWA 3QJYA 1RAAB 2EYZA 2HMAA 2D9TA 2K3XA 3C12A 1YI2Q 4MZMA 5GJWB 2JMCA 4F7UE 2JW4A 2PTKA 1AWJA 1HK9A 1Q86C 1ZSZA 4O5VA 1IGQA 1VQ9Q 4C0DB 4X9CA 4Y28E 3HFNA 4C92E 3E9GA 1ZX6A 4JDSA 3CPWP 3JRZA 4M7AA 2P0PA 2GQVA 2OAUA 4Y92A 5IHNA 2M02A 1JXOA 4OVAA 3NTKA 4BB7A 4DEYA 3SWNB 4TVRA 1VQ4T 3AT1B 3CXCS 4M77G 1FYNA 3QWXX 2V8IA 1T3LA 1VQPT 2KSSA 4C8QE 3OYFA 5DLOA 2NYSA 3UA7A 3EHRA 1AEYA 5GAN2 1M90U 5KYYA 2RHUA 3CBPA 3RERA 2FPDA 3ULRB 3CC4T 1E6HA 1UEBA 1VQ6T 1NZ9A 4BD3A 1M90C 1GBQA 3MHXA 5IHKA 3M58A 1VQMT 1YHQT 2CUBA 3CBMA 3HRTA 5KYNA 3X24B 5FRNA 3CPFA 3PVQA 1S72A 2XKOC 4PFPA 2HDAA 4OF1A 3KBGA 2YT6A 3LX7A 4EMKA 3M0PA 1Z9QA 1RL2A 1AZGB 2EYXA 3OYGA 1OYXA 2LMJA 1BB9A 3QDFA 4XTWA 2MPXC 1X6GA 5FW9A 1M8MA 4IUPA 3C0CA 1ABQA 5FU6B 2J6FA 2K2MA 2FEIA 3M57A 1X43A 1NEGA 2ATCB 5GMKj 1VIEA 3JAME 2YRVA 3P8HA 1D0XA 1KD1U 3CD6A 1X69A 2G6FX 3G6EQ 1X27A 4PL6A 2YUPA 1RAHB 1KD1C 1SHGA 1JQQA 7AT1B 1TSFA 2DERA 3OQ5A 3VS5A 3G71Q 1AD5A 1VQKQ 4Y91A 3HKSA 1XTDA 1I0CA 5GAMh 2CKKA 4M78E 4ZGEB 4WCIA 3I56Q 3X20B 3SB2A 3A8GB 1Q81R 1WX6A 5I2MA 3E19A 4M4ZA 2OTLT 2CZ7B 3ZL7C 5GAN4 2P4RA 2BZXA 1KC8U 5FU7B 2PUKB 2RH2A 4QT7A 1N9RA 1FWZA 2BUDA 2IIMA 5A0LA 2RQRA 5CKFA 5GAMg 1KC8C 3GP8A 3JCMQ 2JVVA 4PJNA 3TSZA 3VJPA 2DZCA 2LRQA 4D6WA 3MEWA 1K73R 2E5QA 2DAQA 1ZUYA 2OI3A 1NE8A 5CQYA 2DLPA 3CMAT 1WGSA 5ECAA 2LDMA 4K11A 2GBQA 2DVJA 2XD0A 3LW5E 2HQEA 2MI6A 4DQ2A 5M9OA 4M75D 1PHTA 1RADB 3RMQA 3CC2Q 2R5MA 2H8HA 1TUGB 1M9SA 4DOWA 1WXBA 2SRCA 1YJ9Q 2M16A 2K4YA 3UATA 4A63B 4OMQA 5J39A 4M7AF 3T9NA 1VQOT 1KIKA 3HRSA 5AYFA 3THKA 2LT4A 1B34B 3EGDA 5IT9E 1J3TA 5I2SA 2YHTA 3A8HB 4ELYC 3BFMA 4JJBA 1WJRA 3OA6A 1H641 5LJ3h 4BUGA 3QZ9B 1YJWA 1M1KR 2HSPA 3OY9A 2MF2A 1RLPC 2XHCA 4FYXB 4E47A 4QQDA 3HPWA 3EH2A 4M75F 5GAOm 4EDUA 2FG0A 5HY6A 3EFRA 1UHCA 1NPRA 1VQ7A 2DE0X 1UECA 1Y71A 2EGCA 2L8DA 3E9FA 3VS6A 4OB2B 1C0MA 2QI2A 1VQNA 2E12A 1N6AA 4LDXA 1ZA1B 1KJWA 1W70A 1WXUA 4RTYA 1YIJT 1UHFA 1X2QA 1BU1A 4QQ6A 1RI9A 9ATCB 1VA7A 3PMIA 3H8ZA 4R0KA 3OB9A 3OW2P 1LNXA 1Y96B 1SG5A 2LTOA 1AVZC 2E4HA 2V26A 3Q1JA 2DA9A 3RNJA 1M2VA 5KH6A 1BIBA 4F7UB 1TUCA 5LJ5h 1RI0A 1X2KA 1EFNA 3UF4A 1K0XA 2EGEA 4PJMA 4LNPA 4Z8AA 2FB7A 2ZPGB 4N4GA 4KGVB 4C5EA 1JO8A 4C92B 1VQ9T 4RG2A 4AG1C 1I5LA 1U5SA 1V29B 5KYUB 4QKUA 1PM3A 5FRMA 2COYA 1N9SA 2GCXA 3OYLA 2WSEE 1VIFA 5LJ5g 2F5KA 4F7UF 1PRMC 2RJFA 3X26B 3LWIA 3EH1A 2FYKA 4M7DC 4LDVA 4J9HA 4RTUA 2QA4A 3LH0A 1VQ4Q 1UG1A 2HSEB 2EQMA 1YN8A 5KYWA 3AHUA 2C0IA 4C8QB 1VQPQ 3VS3A 4XU2A 1BK2A 2RHYA 3E2UA 1UGPB 2X4YA 4WTOB 2FPFA 4HCZA 2DTIA 3WVDB 1YJNQ 1H8KA 1VQ6Q 4LDYA 1PRLC 1OZ3A 2LNHB 2O31A 2A3LA 3H0FA 3JB9J 3MPUB 1QWEA 2LX9A 2ZPHB 5HCKA 2C0TA 1N8RC 5D6YA 4E7SA 3GF5A 2F1LA 1MV0B 1W2BP 1GFDA 5CAIA 4DEXA 5CR2A 4F7UG 4M77A 5I21A 1PC0A 4ESRA 3CCJQ 2B86A 1WHGA 3GNGA 3QXEB 4C92G 4OMFB 4PJOC 1MNEA 1WFWA 4M78D 2JS0A 1ZSZC 3JB9D 1TOVA 5DLQE 4J7FA 3CCMA 2HKNA 3FC3A 4M7DE 4AFUC 3M4GA 4OB3B 2A0FB 2CP2A 3CD6T 3M53A 4CC2A 3LGLA 4M78B 3M0TA 3HP9A 1QVPA 1VUBA 5FWCA 2JMAA 1KG1A 4RCBA 4C8QG 1TU0B 1WIEA 3I56T 3MO8A 3QBYA 1OPLA 1WQWA 2DX1A 3VUZA 2KT1A 1C6VX 3TREA 3OYKA 2OTLQ 1VYVA 2DRMA 2J7IA 4E7IA 2E3HA 2ROLA 1QKWA 3L42A 2V1QA 3M0SA 3V8JA 5D6XA 4XU3A 1UJ0A 2FZKB 4M78F 3PIOA 1G3TA 3CCLA 4PJLA 1D0ZA 2DTHA 1GRIA 3JB9F 2L0AA 2KGTA 3OS5A 3SDZA 1M4ZA 1M3CA 2IPOB 5CIUA 2EGAA 1VOMA 3VKIA 2KRNA 3RESA 3SWNA 1U06A 3DB4A 2KRMA 4BI8B 3A8MB 3CMAQ 5A0DA 1Q7YC 2E64A 1D1CA 2NUPB 3P8BB 3FJPA 4PJOE 3QYHB 3PE0A 2ROTA 2JTMA 3C95A 1IO6A 1Q82R 2QTVA 1SSHA 4QVZA 3EG3A 1PSEA 1CSKA 1M5Q1 2EYYA 5C0MA 2EQJA 4JRKA 4PLLA 1WDXA 3HRUA 1VQOQ 4BE0A 1XQHA 3QDRB 1YITA 1LOJA 1BIAA 1IXDA 1C1AA 5GANh 2MK5A 4M78G 3X28B 4HA8A 1WHJA 2O4XB 3VU3C 3HHTB 4JRPA 1QLYA 3JCMc 5GAOn 1YFNA 3OS2A 1D09B 2ZPIB 4AFZC 4ME7A 2EAYA 1QWFA 3I5RA 3CC7A 1UE9A 3FDRA 4FU6A 3NFCA 3GPLA 1NYFA 1G8XA 1QKXA 1RUWA 1YJWT 3RKWA 2O2OA 5GANg 5GAOp 1AZEA 3PT9A 5GAMe 2QTXA 2JTFA 2XK0A 3EGXB 1S1NA 2D8JA 1UGSB 3CMEA 5I11A 2I0NA 1UGQB 2M0OA 3OYAA 3WVEB 4NOYA 4P5NA 4LUDA 1VQ7T 2PVGB 4E7HA 3L2QA 3UPUA 2JJ9A 2DMOA 5C6SA 1YIJQ 4O6JA 1VQNT 2K6DA 3JCMh 2LQKA 1Q86R 3QO3A 1U1TA 1JJ2A 4M77F 2QASA 1PD1A 1PD0A 2KMTA 1Q95G 2QG9B 2CT3A 4LE9A 4HXJA 3VRYA 2FZGB 4A4KA 4MDXA 2EQKA 2A28A 2EYQA 1TTHB 4J9CA 2EPDA 3BDLA 1Y07A 2QQAA 1RACB 2EJGA 4EPCA 1P92A 1D0YA 3JCMg 5KE3A 1AT1B 3CCQA 3GBQA 1O9SA 4HT8A 3M0QA 2HCKA 1K8AU 5IN1A 3L2VA 1K8AC 3MJXA 2EVRA 4NL3A 4BI3A 2D0QB 4JPBW 2XMFA 1KK7A 2M51A 4QVCA 3OYBA 1NG2A 5LJ3j 1JJ2S 3JCMW 1MGQA 2Y4YA 1NYGA 3FB9A 2AT1B 2OTJA 1V76A 3HSBA 1XJWB 2QA4T 5GMKm 5LJ3e 3OSSC 4KH1B 4JJCA 4M75A 1YJNT 2L3RA 3L2RA 1N5ZA 1QVGP 2VKNA 4XTVA 3CQTA 2KRSA 1M3BA 3CCEA 3CCVA 2EQIA 1OQKA 4XU1A 5FLXE 2SEMA 2K5IA 2NUTB 3QWYA 4KUIA 3OMCA 3INZA 1K9MR 6AT1B 2C06A 1WXTA 2MCNA 2JZ2A 1X75C 2LX7A 3CCUA 2L3SA 1S72Q 2MMPA 1VYTA 1PWTA 5GAOq 2EKOA 2KROA 3TVTA 2M0YA 3CCJT 4DBFA 2L89A 1GBRA 3QIIA 1UGRB 4A4EA 3URGA 2QGFB 4KT0E 3NHNA 3OYCA 3G4SA 1Y7XA 2DL4A 5IAYA 2E6NA 1R8OB 4ZGJB 4XTZA 4E6RA 2DVEA 4NL2A 3CD6Q 1Y96A 3FIFA 3CCMT 1UUEA 2AKLA 3I55A 1VQLA 3UA6A 1PG5B 1BKBA 5KCOA 4GY5A 4F7UA 4KUDK 3MP1A 1VQ5A 2O88A 1WJSA 4FT4A 4CC3A 2JOYA 5LJ3f 3L2WA 4BACA 4J5YA 3EG0A 1WYXA 3VV0A 5KYUA 4PK4A 3TCJA 5CCAA 4PJOD 4L59A 5KE2A 2RF0A 1KHCA 2P0KA 2YDLA 3VS7A 2K79A 4N4HA 1ZSGA 1AWWA 3CCLT 8ATCB 4B9XA 3J7AF 2PU9B 3L2UA 4PJOB 3RKYA 2ZPFB 2JT4A 5AT1B 1Q81U 2WSCE 4GBQA 1OX8A 2CZ1B 3QKJA 1M30A 2X4JA 4BE1A 2V8JA 4BI4A 5CKDA 2RHXA 1Q81C 5HK3A 2X9HA 4J9EA 4M7DG 2EIFA 1I4K1 1G2BA 4F16A 2HQHA 4JRQA 3TU4K 1VQ8T 3PNWC 5GJVB 3RUXA 1GXIE 1KHIA 5CQXA 3I5SA 4IUQA 5KYXB 1K73U 1OU8A 2K3YA 3OYHA 2LJ0A 1K73C 2RJEA 1YITT 3META 4HT9A 5IH2A 2DL7A 4HVUA 2KEAA 1KQSA 2A36A 5LJ3d 4XU0A 1YJWQ 3QG1A 3G1JA 2LCSA 2O9SA 2DPPB 3CBOA 2AZVA 3PTAA 3CC7T 4OMNA 3CCRA 1TS9A 1E7OA 3I9QA 4C0DC 3RR6A 1VQ7Q 2QAZA 1NJIR 4IURA 1H92A 3E1SA 3CMET 3OYNA 2RQTA 2E5KA 4M78A 4UC4A 1VQNQ 3JCMJ 5GAOl 2VUBA 4C5IA 4PJOG 2QEXA 4JRIA 3TQ7P 2KT8A 4J7IA 1M1KU 2E65A 4C5GA 2K9GA 4B9WA 4C92D 4DOVA 1X6OA 4F17A 1BYMA 4DA4A 2DIGA 3CCSA 1M1KC 1IGUA 2CH4W 2YLBA 2RK1A 3CPWA 1F1BB 1A0NB 1FMKA 2W0ZA 4KH0B 1T0HA 2DRKA 3SHWA 1KQSS 5A2QE 3BW1A 1R0BG 5HKCA 1TH7A 1YWOA 2CUDA 4V2SA 1EX4A 8AT1B 2GQIA 2FO0A 4OMMA 1G83A 5GMKi 2KY9A 1SRLA 2I2LA 4C8QD 4RMOA 4BDYA 2XDPA 1IREB 2GTJA 4LDUA 3RMSA 2NUPA 1JJ2P 1IB8A 1MUZA 3CXCP 5GMKh 1MNDA 2JNGA 3EG2A 5CK9A 1QW1A 3QHSA 2KVQG 4C5HA 2YWWA 4C92F 3OYMA 5GANe 3PIPA 1LPLA 1TUDA 1YCSB 3BDUA 2MYSA 1LCKA 2QA4Q 1YWPA 3H0IA 3OBWA 2CDTA 4JUVA 4FIBA 3MEAA 5CKBA 3BY7A 4GLMA 3CPWS 1K76A 2MOXA 5J26A 4ANJA 1IHWA 3MEVA 2PQWA 4MDWA 4RCCA 4XAXB 1PKTA 4PFOA 2LQNA 5A0GA 2KE9A 1U1SA 4II1A 2K5LA 2O4XA 3RBBB 4A54A 1ZBJA 3BE3A 4RTTA 4XTYA 4C8QF 3CC4A 1QP3A 3EFOA 5CKEA 1LVKA 2ZGWA 1VQ6A 4RKUE 2OJ2A 1KQ2A 2LC4A 2LT1A 2JTEA 1CKBA 2PVDB 1VQMA 3CCVT 1YHQA 2DBMA 1YP5A 2DEQA 1S72T 4A4FA 1BI1A 3JCMe 4KULA 4LUEA 3EGXA 3JSCA 4RG8A 2RM4A 4HVVA 3EGUA 3CCUT 1PNJA 3OMGA 2GFAA 2RHZA 2GTOA 3EGDB 2ECZA 3DLMA 3I35A 2G3RA 1RAFB 2XIDA 3TEEA 2FPEA 3OYIA 3ME9A 4L5GA 1TWBA 4QVDA 1B07A 3G4ST 3NTIA 2IG0A 1SHFA 4JJNK 2PUOB 3CCMQ 1WI7A 4KGXB 4M7AC 4E7KA 4FT2A 3SEMA 2VGNA 4J9FA 2AIRB 3LGFA 2X4XA 1MHNA 2KQWA 2V8KA 3SFMA 1M1GA 3QYGB 2MIOA 2YSQA 3V7CA 3A8LB 1VQLT 2EFIA 4PNOA 1FMVA 2EJFA 2RPNA 2RQWA 4NS5A 2Y90A 2C0OA 1BBZA 2YUOA 1CKAA 2RNAA 2RI2A 1QCOA 1OOTA 1JRIA 2H3EB 4YTLA 4D8DA 1BCMA 1WNLA 2VV5A 4M75C 2J6OA 2EJ9A 3M54A 1ZUUA 4ORZA 2K2VA 4IUTA 1G3WA 1MMDA 2QK0A 3S3OA 1HXDA 3GNFB 3CCLQ 4J9BA 2CP6A 3EG1A 4BY6C 1M2OA 3A1PA 4HCBA 4AG2C 1OEBA 2X4WA 2ZPEB 3D7SB 2ZCFB 4EMKC 1HYOA 4XK8E 2RO0A 2QYZA 1XNIA 2LQ8A 5GAN8 3ER0A 3OYEA 3CMAA 2F2WA 2JUFA 2FZCB 4AFQC 2VB6A 1NPPA
chains in the Genus database with same CATH topology
2CP3A 2QK0A 2HKNA 1WHMA 1WHLA 2COWA 2CP6A 1TXQA 2E3HA 2HL3A 3TQ7P 2CP2A 2M02A 1WHGA 2CP7A 4B6MA 2E4HA 1LPLA 2CP5A 2E3IA 2MPXC 2COYA 3RDVA 1IXDA 2CP0A 1WHHA 1WHKA 2HQHA 2HKQB 3E2UA 2Z0WA 1WHJA 1TOVA 2HL5C 2COZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP3 A;  2QK0 A;  2HKN A;  1WHM A;  1WHL A;  2COW A;  2CP6 A;  1TXQ A;  2E3H A;  2HL3 A;  3TQ7 P;  2CP2 A;  2M02 A;  1WHG A;  2CP7 A;  4B6M A;  2E4H A;  1LPL A;  2CP5 A;  2E3I A;  2MPX C;  2COY A;  3RDV A;  1IXD A;  2CP0 A;  1WHH A;  1WHK A;  2HQH A;  2HKQ B;  3E2U A;  2Z0W A;  1WHJ A;  1TOV A;  2HL5 C;  2COZ A; 
#chains in the Genus database with same CATH topology
 2LJ3 A;  2DZ9 A;  3L1A A;  1YNZ A;  1N27 A;  2RHI A;  4MMK A;  1VQ8 Q;  4M7A E;  2H3J A;  5EC7 A;  1GL5 A;  2R5A A;  3QPH A;  4ZN1 A;  3NMZ C;  2NUT A;  2AKK A;  4RTZ A;  2HZY A;  3ASK A;  2K7A A;  2CGH A;  3MCA B;  3FJ5 A;  4HCC A;  1T3S A;  1YIT Q;  1AWO A;  1UB4 A;  1D3B B;  3KXT A;  2DNU A;  3OYY A;  4XTU A;  3H0H A;  3UT1 A;  5GAM j;  4KBM B;  2O9V A;  4A53 A;  3DB3 A;  3LWH A;  1Q82 U;  2M9U A;  2MWO A;  2XI9 A;  4PLI A;  4M75 E;  2CSQ A;  3QSU A;  4ELZ C;  2NUZ A;  3CC7 Q;  5DY9 A;  1UGV A;  1Q82 C;  3J81 E;  1D1B A;  2DBK A;  3HTR A;  3OW2 A;  3REB B;  4EMH A;  4OGC A;  1GCP A;  1XOV A;  3MP6 A;  2M1H A;  4N4I A;  3ZBD A;  3CCR T;  3R6N A;  4LN2 A;  3CME Q;  1R77 A;  2RB6 A;  3LLR A;  1G3S A;  2K3B A;  2VVK A;  4XQ3 A;  5I22 A;  1WZO A;  4J9G A;  1WJQ A;  4A4G A;  4E7J A;  2Y4X A;  3UDC A;  2BTT A;  2OX7 A;  2QEX T;  1BI2 A;  2MAM A;  1KQS P;  1OI1 A;  4KRT A;  1I1J A;  4MML A;  2ZZD A;  4E7L A;  1ZA2 B;  3HL8 A;  1W1F A;  1OX9 A;  2CP5 A;  2E3I A;  2CSI A;  2NWM A;  1X6B A;  3FRN A;  1H3Z A;  2DD5 A;  4MZP A;  4JLI A;  1YI2 A;  1QVF A;  3OS0 A;  2CRE A;  1AWX A;  1WPY A;  1RAB B;  3CCQ Q;  3F70 A;  3VS1 A;  2QQB A;  1U3O A;  3NPF A;  3S6W A;  3OW2 S;  1Q86 U;  2VXF A;  2LVM A;  1VQ9 A;  4IUU A;  4PJO A;  2KR3 A;  4E7Z A;  3QJ6 A;  3JB9 I;  4PJJ A;  4OB1 B;  2DXC A;  2EBP A;  1E6G A;  1JB0 E;  3JCM V;  3A5Z B;  1MMN A;  1M90 R;  1LJO A;  2DKG A;  1R0C B;  1HD3 A;  2J06 A;  1SRM A;  1OUL A;  2L3Q A;  5GAM f;  1GCQ A;  2MWP A;  2DL8 A;  1ZUK A;  3SD4 A;  5KCH A;  2QQS A;  1RAI B;  5IHI A;  5EG2 A;  1W2B A;  2OTJ Q;  2DXB A;  2AK5 A;  2VC8 A;  5KYX A;  1UJY A;  2RJD A;  1B34 A;  4FSS A;  1I07 A;  3QUI A;  2LZ6 B;  3PMT A;  3EG9 B;  2E70 A;  2YRD A;  2XG8 D;  3NTH A;  4FW2 A;  2RQV A;  1QVF S;  4ZTF A;  1Y0M A;  2ENM A;  4KGZ B;  4M78 C;  2D8H A;  5GMK l;  1FXX A;  2ESW A;  2CP7 A;  3CCV Q;  3CCE Q;  3VYG A;  3V7S A;  2VXE A;  1GFC A;  2DK3 A;  3IQL A;  4AT1 B;  4M7D D;  2KAF A;  2KBT A;  1KD1 R;  4IKF A;  1M27 C;  1PKS A;  3WXM B;  2LCC A;  1MMA A;  4RTW A;  3CCU Q;  2HNI A;  4FYV B;  5LJ5 j;  3OYJ A;  1JXM A;  4HVW A;  3TSW A;  4FM4 B;  2AZS A;  2EYW A;  4JLG A;  1K1Z A;  4OMP A;  4B6M A;  4M7D B;  5LJ5 e;  3P8D A;  1UDL A;  4FW1 A;  3G4S Q;  1W2B S;  1AHJ B;  2A7Y A;  4Z88 A;  2P84 A;  2JS2 A;  2HKQ B;  2HQX A;  4CC4 B;  1PCX A;  4C0Z A;  4X1V A;  3FEO A;  1K9M U;  4Z89 A;  4LD9 K;  1U8R A;  3VRZ A;  3G6E A;  2VWF A;  3MP8 A;  4JZ3 A;  4OB0 B;  1KC8 R;  4HCK A;  4ZN3 A;  2GGR A;  4X9D A;  3RIR A;  1K9M C;  2BE9 B;  2KYM A;  3I55 Q;  2ZPB B;  3G71 A;  1VQK A;  1EIF A;  4M7D F;  1VQL Q;  2WAC A;  5GAM d;  5GMK e;  2EKH A;  4C92 A;  1VQ5 Q;  3EHQ A;  3I56 A;  3JCM X;  4PFZ A;  2RD1 A;  2DIL A;  4AMC A;  1KFZ A;  4DBH A;  2ABL A;  2F69 A;  1O75 A;  2YXY A;  2BZY A;  2IVW A;  2DO3 A;  2A08 A;  2FRW A;  3VYH B;  4ATO A;  2CS7 A;  1WHK A;  2KNB B;  4N0A A;  4M7A D;  2COZ A;  4C8Q A;  1ZSZ B;  2DYI A;  1NBE B;  1ZHI A;  2DL3 A;  4M77 C;  1ACM B;  5D7U A;  4CC7 A;  2DJZ A;  4FSX A;  2A37 A;  3X25 B;  4LD6 A;  4J9I A;  1M1F A;  3J80 E;  5LL6 S;  5FWB A;  4IUV A;  3M56 A;  4M7A B;  2L5Q A;  5LJ5 f;  4JZ4 A;  1D1A A;  2Z0W A;  2D1X A;  4F14 A;  3CC2 A;  2RI5 A;  4GLK A;  4XTX A;  1I8F A;  1SF9 A;  4PJO F;  2P0Q A;  4J8O A;  1YJ9 A;  2AHJ B;  1QMC A;  2JN0 A;  1K9A A;  4QQG A;  2XDB A;  2PNI A;  2QDY B;  1OZ2 A;  1IRX A;  4E2F B;  2DFU A;  4JS5 A;  2J05 A;  3LH5 A;  5KYY B;  1UTI A;  2EQU A;  2P4T A;  4M75 B;  1ZLM A;  1SSF A;  1SPK A;  1K0S A;  1Z9Z A;  1BCO A;  4PKC C;  4MZT A;  3M4Y A;  3OSV A;  4L6V 5;  2EW3 A;  1BI3 A;  3MEU A;  4BY6 B;  2DXT A;  5CVI A;  1B3Q A;  2O01 E;  4J9D A;  4EMK B;  3CCR Q;  4RTV A;  4EMG A;  3V8K A;  1YCY A;  4CRI A;  2CZ0 B;  4OGE A;  5GAN 5;  4JS4 A;  2GNC A;  1V1C A;  4M77 E;  2QQ9 A;  3SWN C;  1JEG A;  5LJ3 g;  4CI0 C;  5IXB A;  4EIK A;  2D6F A;  2E10 A;  2QEX Q;  2YLC A;  2GF7 A;  4J6X A;  4JJD A;  1QCN A;  1MV3 A;  1M3A A;  1W6X A;  1BI0 A;  1AOJ A;  4M7A G;  3CEY A;  3C94 A;  2JM9 A;  3FLG A;  3CCS Q;  4D8K A;  2NLU A;  2DTO A;  5LJ5 d;  3S3N A;  2DF6 A;  4RUG A;  4BDZ A;  1NJI U;  3M0U A;  4OP0 A;  2DD4 A;  3CCQ T;  5CO7 A;  2DEU A;  3OYD A;  1NJI C;  4J83 A;  1YI2 T;  1SKU B;  3ZFJ A;  2V1R A;  5CKH A;  1DJ7 B;  3M5A A;  4J6Y A;  5GAN j;  1KQ1 A;  1IZ6 A;  1NLP C;  1H3H A;  4Z02 A;  2XU8 A;  4M75 G;  3O8V A;  2DL5 A;  3L2Z A;  2ZAE A;  1OPK A;  1QVG A;  4X34 A;  5FU6 C;  1N8R R;  2LP5 A;  1VQ4 A;  4F04 B;  2R58 A;  3M9Q A;  4ZGD B;  1VQP A;  2OTJ T;  1W4S A;  3UWN A;  1QVF P;  4VUB A;  2XIC A;  1TXQ A;  3EAE A;  2YUN A;  2VYT A;  1YJN A;  2YUQ A;  2D0N A;  1D3B A;  2CYZ B;  4C0F A;  3CCE T;  2CP3 A;  3CC4 Q;  1EZZ B;  5J3B A;  2QDL A;  2HAX A;  1YBY A;  2B8A A;  1N8R U;  2E41 A;  3REA B;  1IHV A;  3M59 A;  1VQM Q;  1YHQ Q;  3DKM A;  4FYY B;  2HBP A;  5FU7 C;  1QVG S;  1G5V A;  2KXC A;  2L2P A;  4LDW A;  3CCJ A;  4A4H A;  1FMW A;  3KUF A;  2HL5 C;  4C0G A;  1JU5 C;  2F2X A;  2YRC A;  1HJD A;  2DXU A;  2RA2 A;  2CZ6 B;  4IIM A;  3KFV A;  2CH4 A;  5GAN f;  3PGG A;  2LCL A;  2HBW A;  3G7Z A;  2X3W D;  3A98 A;  4IIO A;  2KK4 A;  3I55 T;  3G6E T;  4ZNX A;  2X3X D;  3O5Z A;  4ZTJ A;  3OS1 A;  1B7T A;  2K5F A;  5DM7 R;  1GCQ C;  3VS4 A;  1VQ5 T;  4FL6 A;  3G71 T;  1OV3 A;  1VQK T;  1Q7Y R;  3M55 A;  3V8L A;  1Y57 A;  2RN8 A;  4FCY A;  2F2V A;  2WSF E;  3VS0 A;  2BE7 D;  2OTL A;  2EWN A;  2PVO B;  2XDD A;  4LXC A;  3PVL A;  3RKX A;  5L8R E;  3LYI A;  3R6O A;  1M2V B;  3EFS A;  1WA7 A;  3JB9 H;  1X01 A;  2QXF A;  5GAN 3;  1NLO C;  3DLL A;  3H6Z A;  5GAO r;  3JCM f;  1KSW A;  2J6K A;  4RTX A;  5GAN 6;  5IXF A;  3U23 A;  1WHH A;  3H41 A;  3VS2 A;  3V7R A;  2QGG A;  2KDS A;  2DET A;  1PSF A;  5D6W A;  5HK0 A;  1RLQ C;  2FRY A;  2VAS A;  3MKD A;  5FRO A;  1Q7Y U;  1FX7 A;  1WHM A;  2KXD A;  2FVU A;  3GIB A;  1SEM A;  3EG9 A;  1MMG A;  4DBR A;  1T0J A;  3ZEH A;  2DYB A;  2E6Z A;  3HFO A;  2BZ8 A;  1K4U S;  1QP2 A;  1VQ8 A;  3CC2 T;  3GOX A;  2FHD A;  4Q5W A;  1UFF A;  2OAW A;  2BIV A;  5KYW B;  1NEB A;  1VQO A;  1NM7 A;  2DM1 A;  1G3Y A;  1M8V A;  3JCM P;  1YJ9 T;  2E1H A;  2RI3 A;  5GAN d;  2HL3 A;  2RQU A;  2KYB A;  1I5O B;  4FYW B;  4R55 A;  2BKD N;  1ZBX A;  3VUB A;  2FL7 A;  4WF2 A;  1ZQ1 A;  3OBY A;  3PFS A;  1TG0 A;  2CP0 A;  4M77 D;  2L3P A;  2JXB A;  2PZ1 A;  3JB9 G;  4M7D A;  4C92 C;  4J6W A;  1JBM A;  3JV3 A;  2ED0 A;  2W10 A;  2JM8 A;  2X35 A;  3EFO B;  5GAN 7;  3N5B B;  2RJC A;  3JCM b;  4BE2 A;  2CT4 A;  2GFU A;  4AFS C;  2K57 A;  1ABO A;  2KI7 A;  4M77 B;  1RAE B;  3M0R A;  3RDV A;  3H9N A;  2VGM A;  1ARK A;  2DIQ A;  3C4S A;  4OMO A;  4R56 A;  1YIJ A;  2HEQ A;  4N0A C;  3JCM d;  4QW2 A;  1WHL A;  4C8Q C;  1K8A R;  4DBQ A;  3QZ5 B;  2LQW A;  5L23 A;  1QCF A;  2HD0 A;  3GLX A;  2QQR A;  1WLP B;  1OU9 A;  1HSQ A;  1I81 A;  2LNV A;  1RAG B;  2RK2 A;  2ED1 A;  2LJ1 A;  3CXC A;  3CCS T;  2F5T X;  2DJQ A;  2X51 A;  1QQJ A;  3NGP A;  1WQ7 A;  3A8O B;  2R57 A;  3S3M A;  1VYU A;  2RMO A;  4OML A;  4HKE A;  2COW A;  3QJY A;  1RAA B;  2EYZ A;  2HMA A;  2D9T A;  2K3X A;  3C12 A;  1YI2 Q;  4MZM A;  5GJW B;  2JMC A;  4F7U E;  2JW4 A;  2PTK A;  1AWJ A;  1HK9 A;  1Q86 C;  1ZSZ A;  4O5V A;  1IGQ A;  1VQ9 Q;  4C0D B;  4X9C A;  4Y28 E;  3HFN A;  4C92 E;  3E9G A;  1ZX6 A;  4JDS A;  3CPW P;  3JRZ A;  4M7A A;  2P0P A;  2GQV A;  2OAU A;  4Y92 A;  5IHN A;  2M02 A;  1JXO A;  4OVA A;  3NTK A;  4BB7 A;  4DEY A;  3SWN B;  4TVR A;  1VQ4 T;  3AT1 B;  3CXC S;  4M77 G;  1FYN A;  3QWX X;  2V8I A;  1T3L A;  1VQP T;  2KSS A;  4C8Q E;  3OYF A;  5DLO A;  2NYS A;  3UA7 A;  3EHR A;  1AEY A;  5GAN 2;  1M90 U;  5KYY A;  2RHU A;  3CBP A;  3RER A;  2FPD A;  3ULR B;  3CC4 T;  1E6H A;  1UEB A;  1VQ6 T;  1NZ9 A;  4BD3 A;  1M90 C;  1GBQ A;  3MHX A;  5IHK A;  3M58 A;  1VQM T;  1YHQ T;  2CUB A;  3CBM A;  3HRT A;  5KYN A;  3X24 B;  5FRN A;  3CPF A;  3PVQ A;  1S72 A;  2XKO C;  4PFP A;  2HDA A;  4OF1 A;  3KBG A;  2YT6 A;  3LX7 A;  4EMK A;  3M0P A;  1Z9Q A;  1RL2 A;  1AZG B;  2EYX A;  3OYG A;  1OYX A;  2LMJ A;  1BB9 A;  3QDF A;  4XTW A;  2MPX C;  1X6G A;  5FW9 A;  1M8M A;  4IUP A;  3C0C A;  1ABQ A;  5FU6 B;  2J6F A;  2K2M A;  2FEI A;  3M57 A;  1X43 A;  1NEG A;  2ATC B;  5GMK j;  1VIE A;  3JAM E;  2YRV A;  3P8H A;  1D0X A;  1KD1 U;  3CD6 A;  1X69 A;  2G6F X;  3G6E Q;  1X27 A;  4PL6 A;  2YUP A;  1RAH B;  1KD1 C;  1SHG A;  1JQQ A;  7AT1 B;  1TSF A;  2DER A;  3OQ5 A;  3VS5 A;  3G71 Q;  1AD5 A;  1VQK Q;  4Y91 A;  3HKS A;  1XTD A;  1I0C A;  5GAM h;  2CKK A;  4M78 E;  4ZGE B;  4WCI A;  3I56 Q;  3X20 B;  3SB2 A;  3A8G B;  1Q81 R;  1WX6 A;  5I2M A;  3E19 A;  4M4Z A;  2OTL T;  2CZ7 B;  3ZL7 C;  5GAN 4;  2P4R A;  2BZX A;  1KC8 U;  5FU7 B;  2PUK B;  2RH2 A;  4QT7 A;  1N9R A;  1FWZ A;  2BUD A;  2IIM A;  5A0L A;  2RQR A;  5CKF A;  5GAM g;  1KC8 C;  3GP8 A;  3JCM Q;  2JVV A;  4PJN A;  3TSZ A;  3VJP A;  2DZC A;  2LRQ A;  4D6W A;  3MEW A;  1K73 R;  2E5Q A;  2DAQ A;  1ZUY A;  2OI3 A;  1NE8 A;  5CQY A;  2DLP A;  3CMA T;  1WGS A;  5ECA A;  2LDM A;  4K11 A;  2GBQ A;  2DVJ A;  2XD0 A;  3LW5 E;  2HQE A;  2MI6 A;  4DQ2 A;  5M9O A;  4M75 D;  1PHT A;  1RAD B;  3RMQ A;  3CC2 Q;  2R5M A;  2H8H A;  1TUG B;  1M9S A;  4DOW A;  1WXB A;  2SRC A;  1YJ9 Q;  2M16 A;  2K4Y A;  3UAT A;  4A63 B;  4OMQ A;  5J39 A;  4M7A F;  3T9N A;  1VQO T;  1KIK A;  3HRS A;  5AYF A;  3THK A;  2LT4 A;  1B34 B;  3EGD A;  5IT9 E;  1J3T A;  5I2S A;  2YHT A;  3A8H B;  4ELY C;  3BFM A;  4JJB A;  1WJR A;  3OA6 A;  1H64 1;  5LJ3 h;  4BUG A;  3QZ9 B;  1YJW A;  1M1K R;  2HSP A;  3OY9 A;  2MF2 A;  1RLP C;  2XHC A;  4FYX B;  4E47 A;  4QQD A;  3HPW A;  3EH2 A;  4M75 F;  5GAO m;  4EDU A;  2FG0 A;  5HY6 A;  3EFR A;  1UHC A;  1NPR A;  1VQ7 A;  2DE0 X;  1UEC A;  1Y71 A;  2EGC A;  2L8D A;  3E9F A;  3VS6 A;  4OB2 B;  1C0M A;  2QI2 A;  1VQN A;  2E12 A;  1N6A A;  4LDX A;  1ZA1 B;  1KJW A;  1W70 A;  1WXU A;  4RTY A;  1YIJ T;  1UHF A;  1X2Q A;  1BU1 A;  4QQ6 A;  1RI9 A;  9ATC B;  1VA7 A;  3PMI A;  3H8Z A;  4R0K A;  3OB9 A;  3OW2 P;  1LNX A;  1Y96 B;  1SG5 A;  2LTO A;  1AVZ C;  2E4H A;  2V26 A;  3Q1J A;  2DA9 A;  3RNJ A;  1M2V A;  5KH6 A;  1BIB A;  4F7U B;  1TUC A;  5LJ5 h;  1RI0 A;  1X2K A;  1EFN A;  3UF4 A;  1K0X A;  2EGE A;  4PJM A;  4LNP A;  4Z8A A;  2FB7 A;  2ZPG B;  4N4G A;  4KGV B;  4C5E A;  1JO8 A;  4C92 B;  1VQ9 T;  4RG2 A;  4AG1 C;  1I5L A;  1U5S A;  1V29 B;  5KYU B;  4QKU A;  1PM3 A;  5FRM A;  2COY A;  1N9S A;  2GCX A;  3OYL A;  2WSE E;  1VIF A;  5LJ5 g;  2F5K A;  4F7U F;  1PRM C;  2RJF A;  3X26 B;  3LWI A;  3EH1 A;  2FYK A;  4M7D C;  4LDV A;  4J9H A;  4RTU A;  2QA4 A;  3LH0 A;  1VQ4 Q;  1UG1 A;  2HSE B;  2EQM A;  1YN8 A;  5KYW A;  3AHU A;  2C0I A;  4C8Q B;  1VQP Q;  3VS3 A;  4XU2 A;  1BK2 A;  2RHY A;  3E2U A;  1UGP B;  2X4Y A;  4WTO B;  2FPF A;  4HCZ A;  2DTI A;  3WVD B;  1YJN Q;  1H8K A;  1VQ6 Q;  4LDY A;  1PRL C;  1OZ3 A;  2LNH B;  2O31 A;  2A3L A;  3H0F A;  3JB9 J;  3MPU B;  1QWE A;  2LX9 A;  2ZPH B;  5HCK A;  2C0T A;  1N8R C;  5D6Y A;  4E7S A;  3GF5 A;  2F1L A;  1MV0 B;  1W2B P;  1GFD A;  5CAI A;  4DEX A;  5CR2 A;  4F7U G;  4M77 A;  5I21 A;  1PC0 A;  4ESR A;  3CCJ Q;  2B86 A;  1WHG A;  3GNG A;  3QXE B;  4C92 G;  4OMF B;  4PJO C;  1MNE A;  1WFW A;  4M78 D;  2JS0 A;  1ZSZ C;  3JB9 D;  1TOV A;  5DLQ E;  4J7F A;  3CCM A;  2HKN A;  3FC3 A;  4M7D E;  4AFU C;  3M4G A;  4OB3 B;  2A0F B;  2CP2 A;  3CD6 T;  3M53 A;  4CC2 A;  3LGL A;  4M78 B;  3M0T A;  3HP9 A;  1QVP A;  1VUB A;  5FWC A;  2JMA A;  1KG1 A;  4RCB A;  4C8Q G;  1TU0 B;  1WIE A;  3I56 T;  3MO8 A;  3QBY A;  1OPL A;  1WQW A;  2DX1 A;  3VUZ A;  2KT1 A;  1C6V X;  3TRE A;  3OYK A;  2OTL Q;  1VYV A;  2DRM A;  2J7I A;  4E7I A;  2E3H A;  2ROL A;  1QKW A;  3L42 A;  2V1Q A;  3M0S A;  3V8J A;  5D6X A;  4XU3 A;  1UJ0 A;  2FZK B;  4M78 F;  3PIO A;  1G3T A;  3CCL A;  4PJL A;  1D0Z A;  2DTH A;  1GRI A;  3JB9 F;  2L0A A;  2KGT A;  3OS5 A;  3SDZ A;  1M4Z A;  1M3C A;  2IPO B;  5CIU A;  2EGA A;  1VOM A;  3VKI A;  2KRN A;  3RES A;  3SWN A;  1U06 A;  3DB4 A;  2KRM A;  4BI8 B;  3A8M B;  3CMA Q;  5A0D A;  1Q7Y C;  2E64 A;  1D1C A;  2NUP B;  3P8B B;  3FJP A;  4PJO E;  3QYH B;  3PE0 A;  2ROT A;  2JTM A;  3C95 A;  1IO6 A;  1Q82 R;  2QTV A;  1SSH A;  4QVZ A;  3EG3 A;  1PSE A;  1CSK A;  1M5Q 1;  2EYY A;  5C0M A;  2EQJ A;  4JRK A;  4PLL A;  1WDX A;  3HRU A;  1VQO Q;  4BE0 A;  1XQH A;  3QDR B;  1YIT A;  1LOJ A;  1BIA A;  1IXD A;  1C1A A;  5GAN h;  2MK5 A;  4M78 G;  3X28 B;  4HA8 A;  1WHJ A;  2O4X B;  3VU3 C;  3HHT B;  4JRP A;  1QLY A;  3JCM c;  5GAO n;  1YFN A;  3OS2 A;  1D09 B;  2ZPI B;  4AFZ C;  4ME7 A;  2EAY A;  1QWF A;  3I5R A;  3CC7 A;  1UE9 A;  3FDR A;  4FU6 A;  3NFC A;  3GPL A;  1NYF A;  1G8X A;  1QKX A;  1RUW A;  1YJW T;  3RKW A;  2O2O A;  5GAN g;  5GAO p;  1AZE A;  3PT9 A;  5GAM e;  2QTX A;  2JTF A;  2XK0 A;  3EGX B;  1S1N A;  2D8J A;  1UGS B;  3CME A;  5I11 A;  2I0N A;  1UGQ B;  2M0O A;  3OYA A;  3WVE B;  4NOY A;  4P5N A;  4LUD A;  1VQ7 T;  2PVG B;  4E7H A;  3L2Q A;  3UPU A;  2JJ9 A;  2DMO A;  5C6S A;  1YIJ Q;  4O6J A;  1VQN T;  2K6D A;  3JCM h;  2LQK A;  1Q86 R;  3QO3 A;  1U1T A;  1JJ2 A;  4M77 F;  2QAS A;  1PD1 A;  1PD0 A;  2KMT A;  1Q95 G;  2QG9 B;  2CT3 A;  4LE9 A;  4HXJ A;  3VRY A;  2FZG B;  4A4K A;  4MDX A;  2EQK A;  2A28 A;  2EYQ A;  1TTH B;  4J9C A;  2EPD A;  3BDL A;  1Y07 A;  2QQA A;  1RAC B;  2EJG A;  4EPC A;  1P92 A;  1D0Y A;  3JCM g;  5KE3 A;  1AT1 B;  3CCQ A;  3GBQ A;  1O9S A;  4HT8 A;  3M0Q A;  2HCK A;  1K8A U;  5IN1 A;  3L2V A;  1K8A C;  3MJX A;  2EVR A;  4NL3 A;  4BI3 A;  2D0Q B;  4JPB W;  2XMF A;  1KK7 A;  2M51 A;  4QVC A;  3OYB A;  1NG2 A;  5LJ3 j;  1JJ2 S;  3JCM W;  1MGQ A;  2Y4Y A;  1NYG A;  3FB9 A;  2AT1 B;  2OTJ A;  1V76 A;  3HSB A;  1XJW B;  2QA4 T;  5GMK m;  5LJ3 e;  3OSS C;  4KH1 B;  4JJC A;  4M75 A;  1YJN T;  2L3R A;  3L2R A;  1N5Z A;  1QVG P;  2VKN A;  4XTV A;  3CQT A;  2KRS A;  1M3B A;  3CCE A;  3CCV A;  2EQI A;  1OQK A;  4XU1 A;  5FLX E;  2SEM A;  2K5I A;  2NUT B;  3QWY A;  4KUI A;  3OMC A;  3INZ A;  1K9M R;  6AT1 B;  2C06 A;  1WXT A;  2MCN A;  2JZ2 A;  1X75 C;  2LX7 A;  3CCU A;  2L3S A;  1S72 Q;  2MMP A;  1VYT A;  1PWT A;  5GAO q;  2EKO A;  2KRO A;  3TVT A;  2M0Y A;  3CCJ T;  4DBF A;  2L89 A;  1GBR A;  3QII A;  1UGR B;  4A4E A;  3URG A;  2QGF B;  4KT0 E;  3NHN A;  3OYC A;  3G4S A;  1Y7X A;  2DL4 A;  5IAY A;  2E6N A;  1R8O B;  4ZGJ B;  4XTZ A;  4E6R A;  2DVE A;  4NL2 A;  3CD6 Q;  1Y96 A;  3FIF A;  3CCM T;  1UUE A;  2AKL A;  3I55 A;  1VQL A;  3UA6 A;  1PG5 B;  1BKB A;  5KCO A;  4GY5 A;  4F7U A;  4KUD K;  3MP1 A;  1VQ5 A;  2O88 A;  1WJS A;  4FT4 A;  4CC3 A;  2JOY A;  5LJ3 f;  3L2W A;  4BAC A;  4J5Y A;  3EG0 A;  1WYX A;  3VV0 A;  5KYU A;  4PK4 A;  3TCJ A;  5CCA A;  4PJO D;  4L59 A;  5KE2 A;  2RF0 A;  1KHC A;  2P0K A;  2YDL A;  3VS7 A;  2K79 A;  4N4H A;  1ZSG A;  1AWW A;  3CCL T;  8ATC B;  4B9X A;  3J7A F;  2PU9 B;  3L2U A;  4PJO B;  3RKY A;  2ZPF B;  2JT4 A;  5AT1 B;  1Q81 U;  2WSC E;  4GBQ A;  1OX8 A;  2CZ1 B;  3QKJ A;  1M30 A;  2X4J A;  4BE1 A;  2V8J A;  4BI4 A;  5CKD A;  2RHX A;  1Q81 C;  5HK3 A;  2X9H A;  4J9E A;  4M7D G;  2EIF A;  1I4K 1;  1G2B A;  4F16 A;  2HQH A;  4JRQ A;  3TU4 K;  1VQ8 T;  3PNW C;  5GJV B;  3RUX A;  1GXI E;  1KHI A;  5CQX A;  3I5S A;  4IUQ A;  5KYX B;  1K73 U;  1OU8 A;  2K3Y A;  3OYH A;  2LJ0 A;  1K73 C;  2RJE A;  1YIT T;  3MET A;  4HT9 A;  5IH2 A;  2DL7 A;  4HVU A;  2KEA A;  1KQS A;  2A36 A;  5LJ3 d;  4XU0 A;  1YJW Q;  3QG1 A;  3G1J A;  2LCS A;  2O9S A;  2DPP B;  3CBO A;  2AZV A;  3PTA A;  3CC7 T;  4OMN A;  3CCR A;  1TS9 A;  1E7O A;  3I9Q A;  4C0D C;  3RR6 A;  1VQ7 Q;  2QAZ A;  1NJI R;  4IUR A;  1H92 A;  3E1S A;  3CME T;  3OYN A;  2RQT A;  2E5K A;  4M78 A;  4UC4 A;  1VQN Q;  3JCM J;  5GAO l;  2VUB A;  4C5I A;  4PJO G;  2QEX A;  4JRI A;  3TQ7 P;  2KT8 A;  4J7I A;  1M1K U;  2E65 A;  4C5G A;  2K9G A;  4B9W A;  4C92 D;  4DOV A;  1X6O A;  4F17 A;  1BYM A;  4DA4 A;  2DIG A;  3CCS A;  1M1K C;  1IGU A;  2CH4 W;  2YLB A;  2RK1 A;  3CPW A;  1F1B B;  1A0N B;  1FMK A;  2W0Z A;  4KH0 B;  1T0H A;  2DRK A;  3SHW A;  1KQS S;  5A2Q E;  3BW1 A;  1R0B G;  5HKC A;  1TH7 A;  1YWO A;  2CUD A;  4V2S A;  1EX4 A;  8AT1 B;  2GQI A;  2FO0 A;  4OMM A;  1G83 A;  5GMK i;  2KY9 A;  1SRL A;  2I2L A;  4C8Q D;  4RMO A;  4BDY A;  2XDP A;  1IRE B;  2GTJ A;  4LDU A;  3RMS A;  2NUP A;  1JJ2 P;  1IB8 A;  1MUZ A;  3CXC P;  5GMK h;  1MND A;  2JNG A;  3EG2 A;  5CK9 A;  1QW1 A;  3QHS A;  2KVQ G;  4C5H A;  2YWW A;  4C92 F;  3OYM A;  5GAN e;  3PIP A;  1LPL A;  1TUD A;  1YCS B;  3BDU A;  2MYS A;  1LCK A;  2QA4 Q;  1YWP A;  3H0I A;  3OBW A;  2CDT A;  4JUV A;  4FIB A;  3MEA A;  5CKB A;  3BY7 A;  4GLM A;  3CPW S;  1K76 A;  2MOX A;  5J26 A;  4ANJ A;  1IHW A;  3MEV A;  2PQW A;  4MDW A;  4RCC A;  4XAX B;  1PKT A;  4PFO A;  2LQN A;  5A0G A;  2KE9 A;  1U1S A;  4II1 A;  2K5L A;  2O4X A;  3RBB B;  4A54 A;  1ZBJ A;  3BE3 A;  4RTT A;  4XTY A;  4C8Q F;  3CC4 A;  1QP3 A;  3EFO A;  5CKE A;  1LVK A;  2ZGW A;  1VQ6 A;  4RKU E;  2OJ2 A;  1KQ2 A;  2LC4 A;  2LT1 A;  2JTE A;  1CKB A;  2PVD B;  1VQM A;  3CCV T;  1YHQ A;  2DBM A;  1YP5 A;  2DEQ A;  1S72 T;  4A4F A;  1BI1 A;  3JCM e;  4KUL A;  4LUE A;  3EGX A;  3JSC A;  4RG8 A;  2RM4 A;  4HVV A;  3EGU A;  3CCU T;  1PNJ A;  3OMG A;  2GFA A;  2RHZ A;  2GTO A;  3EGD B;  2ECZ A;  3DLM A;  3I35 A;  2G3R A;  1RAF B;  2XID A;  3TEE A;  2FPE A;  3OYI A;  3ME9 A;  4L5G A;  1TWB A;  4QVD A;  1B07 A;  3G4S T;  3NTI A;  2IG0 A;  1SHF A;  4JJN K;  2PUO B;  3CCM Q;  1WI7 A;  4KGX B;  4M7A C;  4E7K A;  4FT2 A;  3SEM A;  2VGN A;  4J9F A;  2AIR B;  3LGF A;  2X4X A;  1MHN A;  2KQW A;  2V8K A;  3SFM A;  1M1G A;  3QYG B;  2MIO A;  2YSQ A;  3V7C A;  3A8L B;  1VQL T;  2EFI A;  4PNO A;  1FMV A;  2EJF A;  2RPN A;  2RQW A;  4NS5 A;  2Y90 A;  2C0O A;  1BBZ A;  2YUO A;  1CKA A;  2RNA A;  2RI2 A;  1QCO A;  1OOT A;  1JRI A;  2H3E B;  4YTL A;  4D8D A;  1BCM A;  1WNL A;  2VV5 A;  4M75 C;  2J6O A;  2EJ9 A;  3M54 A;  1ZUU A;  4ORZ A;  2K2V A;  4IUT A;  1G3W A;  1MMD A;  2QK0 A;  3S3O A;  1HXD A;  3GNF B;  3CCL Q;  4J9B A;  2CP6 A;  3EG1 A;  4BY6 C;  1M2O A;  3A1P A;  4HCB A;  4AG2 C;  1OEB A;  2X4W A;  2ZPE B;  3D7S B;  2ZCF B;  4EMK C;  1HYO A;  4XK8 E;  2RO0 A;  2QYZ A;  1XNI A;  2LQ8 A;  5GAN 8;  3ER0 A;  3OYE A;  3CMA A;  2F2W A;  2JUF A;  2FZC B;  4AFQ C;  2VB6 A;  1NPP A; 
#chains in the Genus database with same CATH homology
 2CP3 A;  2QK0 A;  2HKN A;  1WHM A;  1WHL A;  2COW A;  2CP6 A;  1TXQ A;  2E3H A;  2HL3 A;  3TQ7 P;  2CP2 A;  2M02 A;  1WHG A;  2CP7 A;  4B6M A;  2E4H A;  1LPL A;  2CP5 A;  2E3I A;  2MPX C;  2COY A;  3RDV A;  1IXD A;  2CP0 A;  1WHH A;  1WHK A;  2HQH A;  2HKQ B;  3E2U A;  2Z0W A;  1WHJ A;  1TOV A;  2HL5 C;  2COZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...