1LPLA

Structural genomics of caenorhabditis elegans: cap-gly domain of f53f4.3
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
SDKLNEEAAKNIMVGNRCEVTVGAQMARRGEVAYVGATKFKEGVWVGVKYDEPVGKNDGSVAGVRYFDCDPKYGGFVRPVDVKVGDFPELSIDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical 25.4 kDa protein F53F4.3 in chromosome V
publication title Crystal Structure of the Cytoskeleton-associated Protein Glycine-rich (CAP-Gly) Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1lplA00
1WHMA 1WHHA 2E3IA 1LPLA 2M02A 3RDVA 1WHLA 2QK0A 2CP0A 2HQHA 2HL5C 2COZA 2CP7A 1WHGA 2Z0WA 1WHJA 2HKNA 2CP6A 2HKQB 3TQ7P 2E3HA 2CP5A 2MPXC 2COWA 2COYA 2HL3A 2E4HA 3E2UA 4B6MA 2CP2A 1WHKA 1TOVA 1TXQA 2CP3A 1IXDA
chains in the Genus database with same CATH superfamily
1WJRA 5IN1A 3V7CA 3FJ5A 3V8JA 2K7AA 2WSCE 3RESA 3UA6A 5FWCA 3VJPA 3P8HA 4HKEA 2JMAA 6AT1B 1NPPA 1VQMA 2E41A 2DL8A 3M0UA 3JAME 4ZGEB 4LDVA 4C8QD 4ZNXA 5AYFA 5KYWB 4XU1A 4HVWA 2LQKA 2LC4A 2BIVA 3A8GB 3M5AA 3Q1JA 2JM9A 2VGMA 4DOWA 4VUBA 2KEAA 2LJ0A 4OB0B 4KH1B 2M16A 4MDXA 3JCMJ 1WXTA 2LQNA 2AIRB 1PWTA 1D0XA 2IPOB 4M77A 2QA4Q 1BK2A 1O9SA 1M1KU 4M75E 3H0IA 2RK1A 1J3TA 2ROLA 2A0FB 1WPYA 2K5LA 3VYGA 1S72A 4Y28E 4C8QF 1C0MA 1U8RA 1UTIA 1B34A 1VQ5Q 3NHNA 1QWEA 2YRDA 1JXMA 4M78A 3OMGA 4OMPA 4HCBA 5FRNA 2FO0A 4RKUE 1YJWA 4BDYA 4HT8A 3A98A 1JEGA 4KUDK 2DF6A 2OTLA 1BCOA 4LNPA 3PIOA 2VKNA 1OZ2A 5LJ5f 3CCST 7AT1B 4M7DG 3QYGB 2F1LA 2ED0A 1G3YA 1UGRB 2PNIA 3C94A 3HRTA 1YI2A 1VUBA 4J9CA 2EVRA 4R55A 1SSHA 1NYGA 1HSQA 1NG2A 1VQ9T 1UB4A 1VQNQ 3X24B 1JJ2P 1V29B 2OI3A 4Q5WA 3VS4A 2QGFB 4E47A 5KH6A 2EQMA 4P5NA 1K9AA 4E7HA 1YCYA 4B6MA 2OTJQ 3G6EQ 2EIFA 4M7DC 4OMNA 3V8KA 1IHVA 2XG8D 2KYBA 1QVPA 2LJ3A 3EH1A 1UDLA 3CC7A 2FL7A 2QK0A 2X9HA 2LMJA 4PJLA 2CUDA 4FYWB 1JJ2A 4GY5A 2HNIA 4FSSA 3EGXA 1JJ2S 4KULA 1PCXA 1Z9QA 1UJ0A 2D8HA 2DJZA 1Q7YC 2R5MA 5CKEA 2ATCB 2E6NA 2ECZA 3CC2T 1Q81U 3CMEQ 4RMOA 3ZBDA 2B8AA 1LNXA 4CC4B 5LJ5e 2JM8A 4WCIA 3M53A 3M59A 1E7OA 4JRQA 4BY6C 3CC4Q 2DE0X 2EBPA 4C0ZA 4PJMA 1YIJT 1KD1U 2AT1B 2YUQA 3I9QA 4IUQA 4BE0A 2O4XA 3OYLA 4AFQC 5HK0A 2LCLA 1YITQ 2A7YA 5GANf 4F7UF 1MUZA 1EX4A 4M78C 5HK3A 4LDYA 2FRWA 5LL6S 1KFZA 3H6ZA 2KQWA 1ACMB 2IIMA 3FC3A 5D7UA 5KYXA 1K76A 1OX8A 1I07A 2QG9B 3I5RA 3QKJA 1ZUKA 4R56A 3OS1A 1UGQB 3M0PA 4PL6A 1YNZA 3KUFA 1WXBA 1EIFA 4JLIA 1BI2A 4N4IA 3CCRA 2QQSA 3VS7A 1KC8C 3CCUA 4EDUA 2RQUA 3J80E 2L3SA 4M77D 3RKWA 2EQUA 5CQYA 4PJOE 1UHCA 2ZPEB 2E70A 2JXBA 2RJFA 2RQTA 4OF1A 3URGA 5I2MA 2KROA 4J7FA 1ZHIA 3RKYA 2D0QB 1K73C 1X2QA 3L2ZA 2KVQG 1U3OA 4PKCC 3J81E 5GMKi 2DIQA 2FPEA 1UFFA 3JCMd 1ARKA 2QQAA 1AZGB 1QKWA 1I1JA 4ESRA 1MMDA 3JB9H 5CIUA 4QVCA 4M77F 3TEEA 4M7DB 3V7RA 4A53A 4E7IA 5LJ5j 4EMGA 2FYKA 2RHXA 1VQPQ 2XU8A 3CCLA 3OMCA 1U06A 2GTOA 4C92A 1OV3A 3CMAA 3CCMQ 1K8AR 2KY9A 1UE9A 2F2WA 1HD3A 1QWFA 3QWXX 3CPFA 4M78F 2DL4A 3OY9A 2PUKB 4M7AD 4RTYA 3RDVA 2KI7A 1MNDA 1SF9A 1QCFA 2YWWA 3SWNA 4HCKA 4J7IA 3KFVA 2JTFA 1G2BA 3MHXA 3MEVA 2X35A 5GAOm 1YJNA 1WLPB 3M4YA 4RUGA 5KYWA 3JCMQ 1VQMT 1Q7YR 2D0NA 2VC8A 1Q86R 1SHGA 3GIBA 2KK4A 1WJSA 2DRKA 2DRMA 4M7AF 2E10A 3JCMV 1W2BA 2DXBA 4LN2A 2DTIA 4A54A 1FX7A 2L2PA 4Z88A 1N27A 1VQLQ 4ELYC 1D09B 2V8IA 2YLCA 1ZSZA 4ANJA 1PC0A 5GJVB 5GAN2 1M30A 5LJ3e 1I4K1 1C6VX 1PRLC 4ZGJB 3VS2A 3HRUA 2ZPGB 2ENMA 1ZLMA 5LJ3d 2CP5A 1RABB 2OX7A 2LX7A 1RI0A 2EYWA 4IIMA 4FCYA 2QXFA 3QO3A 2CYZB 2RJEA 1X6GA 1VYUA 1ZBJA 2CUBA 2YRVA 1N8RC 2DZ9A 2OTJT 3G6ET 3TU4K 1PSFA 3QPHA 4PFPA 2JN0A 3BFMA 4AG1C 2G3RA 2F2VA 1QW1A 3NGPA 1EFNA 3QYHB 2KMTA 1SG5A 2BE7D 1UHFA 5D6YA 2RI3A 5GANh 3CCSQ 1YI2T 1Q82R 3CPWA 2DMOA 3VUZA 1B3QA 3A8OB 1SKUB 2J6FA 2HCKA 5IAYA 3PMTA 1U5SA 2Y4YA 2VWFA 1GXIE 4FT2A 3TCJA 4C92C 2CZ7B 1FMWA 4R0KA 1X01A 2L0AA 2EGEA 3RUXA 1VQ9Q 5CO7A 4J8OA 3BDUA 3VYHB 2SEMA 1R0CB 1W6XA 4KGZB 1TSFA 5CKHA 4K11A 3CCQA 2CP3A 1IXDA 1M5Q1 3G1JA 2CH4A 3SWNC 1OX9A 1VQ7T 2YXYA 2EQIA 3SD4A 3CC7T 1Y7XA 3QSUA 4CRIA 1TWBA 3EH2A 1WQWA 2B86A 4DEYA 4XTVA 3CBOA 1N9RA 1OI1A 1VQKA 4QW2A 1N5ZA 4MMKA 4ZN3A 2GCXA 1FYNA 4FIBA 4E7SA 1X27A 1K9MR 1AEYA 2RPNA 2LZ6B 1OZ3A 1KJWA 3EFOB 2HL5C 1I5LA 3CD6A 2V8JA 4KT0E 2C0TA 2MPXC 5LJ3j 2HBPA 2K5FA 3CC2Q 2HAXA 1LJOA 3C4SA 4DEXA 5J39A 2ZAEA 1ZSZC 2AZSA 2IVWA 5KYXB 1RLPC 1WFWA 3THKA 2MYSA 2LVMA 3WXMB 2QQBA 4XK8E 1VQ4A 5IT9E 1HXDA 3EHRA 4RCBA 3X26B 1RAIB 4D6WA 1D0YA 2X3WD 1M27C 2LX9A 1YIJQ 2X3XD 1AD5A 2PZ1A 1Y57A 1VYVA 2E5KA 4FSXA 2GF7A 4FL6A 2GTJA 3JB9D 4J9IA 3VV0A 5GAN5 4C92F 1JBMA 4Z8AA 1WXUA 1FMKA 2DXUA 1K0SA 3RBBB 2E6ZA 1LPLA 2GNCA 4LUEA 3GP8A 1VQ6T 3G4SA 4Z89A 1YHQT 3G71A 3EG1A 2DZCA 3M0RA 4TVRA 3MP1A 4EMKA 2ZPHB 4GBQA 2FEIA 1IGUA 1X6OA 1RLQC 3QIIA 1UECA 2YUNA 3FRNA 4C5HA 5KYNA 2JTMA 3M0TA 2K57A 1Q95G 3JB9F 4M75A 1X43A 5FU7B 3OYHA 2EYYA 3MJXA 3O8VA 3VUBA 2HKQB 3H0FA 3MPUB 3TQ7P 1LCKA 5GMKe 4LD9K 3EG3A 1X69A 1OPKA 3BW1A 2J7IA 1W70A 1PM3A 3EGUA 2C06A 2KT8A 2HMAA 2Y4XA 4M7DA 3UA7A 1JO8A 3NPFA 5FU6B 1OULA 2ZCFB 1U1SA 1BI3A 5J3BA 3SWNB 5CKDA 3VU3C 4JPBW 2K79A 3VS3A 2XDDA 3I55A 2D8JA 4JJBA 1D0ZA 3DB4A 2DVEA 1ZUYA 3TSZA 1RI9A 5GJWB 3U23A 2QA4A 3VRZA 2G6FX 3EFSA 2M0YA 2MWOA 2YHTA 3TREA 1VQLT 1BI1A 3LH0A 3HHTB 2WSFE 1YBYA 1RAFB 2ZGWA 4JRIA 1H3HA 2EAYA 2QEXQ 2LQWA 4BI8B 3OQ5A 1QMCA 3S3OA 4ELZC 1YJNT 2I2LA 1T0JA 2CS7A 4QT7A 4CC2A 1M2OA 2DA9A 4M75G 1UJYA 3HRSA 1ZSZB 1TTHB 4Y91A 2A37A 2DNUA 4UC4A 4FW1A 4F7UE 3R6NA 2AZVA 2OAUA 3H41A 4OGCA 5HY6A 1VQMQ 3GBQA 1I5OB 3JCMg 3T9NA 1VQNA 1W4SA 1UUEA 3VKIA 3SB2A 3D7SB 3JB9I 1RAAB 3UWNA 2KGTA 1G83A 1NPRA 1YP5A 2EW3A 2M02A 2EWNA 1PSEA 2P4RA 3RERA 3JCMc 2O9VA 4EMKC 2ROTA 2M51A 1NYFA 1NZ9A 3I56T 3EG9B 3QJYA 1K8AU 3JB9J 1TH7A 4J5YA 5KE3A 2RQVA 2HBWA 3QDRB 1VQ8A 5GAMf 3FJPA 2HDAA 4MZPA 2AKKA 4OB1B 3MEAA 1M1KC 4M75C 2CSIA 5GMKj 3ME9A 2DPPB 4IUPA 1D1BA 2XKOC 2DL5A 3VS6A 2JT4A 1S72Q 4RTVA 2RI2A 4QVDA 4NS5A 5GMKh 1VIFA 2YT6A 4C5EA 2JW4A 3C12A 2DEQA 3SDZA 1YJWQ 4J9BA 4OP0A 3CBMA 5KYYB 1IB8A 2E4HA 2OTLQ 1Y71A 3QHSA 2YUOA 2KT1A 2RMOA 3CMEA 4KRTA 2BTTA 4BI4A 3CCEA 2HZYA 3NTIA 4X1VA 3GNFB 1FXXA 4FW2A 1BB9A 4PNOA 2O9SA 3JSCA 2HKNA 3CC4A 1YI2Q 1OEBA 1FMVA 4BB7A 3BDLA 1YCSB 2BZYA 4ATOA 1B7TA 2KSSA 4X9DA 3MEWA 1MGQA 3C0CA 4PJOA 4PJJA 1ZQ1A 4V2SA 5LJ5d 3M56A 2DXCA 5I22A 1Y96B 2SRCA 1PKTA 5LJ3g 4L59A 2DL3A 3NTHA 2XMFA 1OPLA 1VQ7Q 1VIEA 2EYZA 2NUTB 3CC7Q 4N4HA 3CCJA 4M7DD 2JZ2A 3GPLA 3EFOA 2W0ZA 2FG0A 2QDLA 4A4FA 5CVIA 2RA2A 3OW2P 1M3AA 3OS5A 3CD6T 4DBFA 3CCVT 2NLUA 3QWYA 2RHIA 4PFZA 5GAN7 2EJ9A 4M7AE 1I8FA 3LYIA 4ZTFA 2XDPA 1M90U 3JCMb 1Q81C 2GGRA 2M9UA 3PGGA 1WJQA 1TU0B 4XTUA 4LDWA 4M7DF 2D1XA 2X4JA 1KD1C 1B07A 3DB3A 2W10A 4EMKB 2PQWA 4BDZA 1UGPB 1YWPA 2AK5A 1WDXA 1ZBXA 5C6SA 5L23A 3OW2S 5FROA 2CH4W 2YDLA 5CQXA 1CKBA 1AZEA 4PJOG 3VS1A 2QAZA 3OBWA 3OA6A 2F5KA 4M75B 1KQ2A 5GAOq 3G4ST 1WHJA 2H3JA 2V26A 2LT4A 3M4GA 1VQPA 1T0HA 2KXDA 4DA4A 1GBQA 4M78D 3CCMA 1K9MU 5FLXE 2DERA 3JCMP 4RTTA 1M90C 2BUDA 2CP2A 2XK0A 2PUOB 4BUGA 1VQ6Q 1ZA1B 1YHQQ 3FIFA 2EGCA 4M4ZA 2RI5A 2K6DA 4RG8A 1GFCA 4D8KA 3L2WA 5GANe 5FWBA 1HYOA 2R57A 4AFZC 4E2FB 2DLPA 5GANd 4QVZA 1OQKA 3O5ZA 1WI7A 3X25B 2V1RA 5IH2A 4GLKA 2BZXA 3CCUQ 1X2KA 4HCCA 4DBHA 1D3BA 4PJOC 2BE9B 1VQOA 2QEXT 4N0AC 2A08A 3M54A 1JU5C 5D6WA 5FRMA 3INZA 3GOXA 1IGQA 5GAMh 1WGSA 3NMZC 1JRIA 2QI2A 4C5GA 2KE9A 3LGLA 2K4YA 1BIBA 3CBPA 4PLLA 4BE1A 3I55T 3OYFA 3TVTA 2DTHA 1WHMA 2EFIA 2K2VA 2H8HA 5KYUB 4JRPA 1P92A 5CKFA 1O75A 1SEMA 5IHIA 5GAOp 3RR6A 3PVLA 3FDRA 1NJIU 2FHDA 4NL2A 3R6OA 1IO6A 3ULRB 4OMLA 3N5BB 2QYZA 2WACA 3H8ZA 4KH0B 1QKXA 1G5VA 1RUWA 4YTLA 2VXEA 5GMKl 4BE2A 2E3IA 1SPKA 5DY9A 4J6XA 2PU9B 1FWZA 1S72T 5FW9A 1YJNQ 1PG5B 3CCSA 4HXJA 2KYMA 3OSVA 3P8BB 1YJWT 3OYBA 4DBRA 2KR3A 2OTLT 3ZFJA 2QQ9A 2PTKA 4OMQA 2FPFA 1Q81R 2MWPA 2LCCA 3EG9A 5DLQE 2DM1A 1GCPA 2CT4A 3A8MB 3QG1A 3OS0A 2FVUA 2L3PA 2HSEB 5GANj 3HSBA 1RAGB 1VQ9A 4ZN1A 3F70A 2E5QA 2DFUA 1OYXA 2J6OA 4J9GA 1VQ8T 1N9SA 2O01E 5FU7C 1K0XA 3LW5E 4J9FA 3OYNA 3I56Q 1KC8R 2GFAA 2PVDB 3BY7A 1UG1A 3OBYA 2C0IA 2J06A 4OB2B 1PRMC 2FPDA 5IXBA 2KRNA 2VYTA 5KYYA 2DYBA 4ORZA 1VA7A 2DXTA 3ZEHA 1BYMA 2LNHB 1K73R 1K4US 5FU6C 1SHFA 2PVGB 5CKBA 3PTAA 4IUUA 3GLXA 1JB0E 1NEGA 4OB3B 1QVGP 2LT1A 4PJOB 3NFCA 8AT1B 1MMGA 2K5IA 2XI9A 1D1AA 1YJ9A 3QZ9B 4KUIA 4O5VA 4CC7A 1KG1A 2AHJB 1QCNA 2JUFA 1T3LA 1T3SA 5CR2A 2KRMA 4LUDA 5IXFA 4XAXB 4A4GA 4RTXA 2EJGA 1Y96A 4QQ6A 2HQXA 5KE2A 1TUDA 1NBEB 4C92D 4OVAA 3LWHA 1RADB 3LLRA 1M2VB 1NE8A 1UGSB 2NUTA 4RTWA 2DX1A 4J9DA 2YLBA 3FEOA 3M9QA 3CCJT 3MKDA 1Y0MA 1XNIA 1AWWA 3OYGA 2QASA 2GBQA 1HJDA 4ME7A 2BZ8A 4C8QE 2LTOA 5CCAA 2DO3A 4C8QG 2MIOA 2NUPB 4C0DB 1N6AA 2DD5A 3CD6Q 3DLLA 3E9FA 3CCVQ 1QVFP 2PVOB 1AVZC 4PLIA 2BKDN 1PKSA 3LWIA 4JZ3A 1W1FA 3CCRT 2O2OA 1XOVA 3AT1B 3CCUT 3GNGA 2FZCB 1VQ4Q 1UEBA 3SHWA 1AWOA 1D1CA 2F2XA 1V76A 4F16A 4RCCA 5LJ5g 2CZ0B 4JRKA 2Z0WA 2CT3A 1N8RR 2YSQA 1TG0A 4C8QC 5I2SA 1IRXA 2DTOA 4CC3A 2GQIA 5CK9A 3A1PA 1D3BB 1H8KA 4IURA 2RJDA 2DVJA 3G4SQ 2ESWA 2RJCA 3G71Q 3ASKA 3A8LB 4EIKA 3MCAB 4J83A 3EGDA 4BACA 1NM7A 4Y92A 1KHIA 2RQRA 3CCLT 4L5GA 2LNVA 2JOYA 3CMAT 4E7ZA 1PD0A 2L89A 1U1TA 3SEMA 1VQOT 4FU6A 5GAN4 1TUCA 4II1A 1VQ5A 1AWJA 5EC7A 1V1CA 1SRMA 3MEUA 2E64A 3PFSA 4MZMA 4F04B 2J05A 1KK7A 5M9OA 5IHNA 3I5SA 4E6RA 3E2UA 4XU3A 2VV5A 2YUPA 2P4TA 2NWMA 3OB9A 2GQVA 4RTUA 2QTXA 1IZ6A 5KYUA 2X4YA 4OMMA 1JXOA 3VS5A 4LE9A 4LDXA 1SSFA 5A0LA 4MZTA 4JUVA 1R8OB 2LRQA 1WX6A 1X75C 1UGVA 3I55Q 1ZSGA 4A4KA 4PK4A 4LXCA 4F7UG 2ZZDA 5ECAA 5L8RE 3MP8A 1EZZB 3LX7A 2ED1A 3L1AA 2EJFA 2E1HA 2EPDA 2VASA 2HQHA 1BIAA 3I35A 3UATA 4DOVA 1I0CA 5GANg 3CEYA 2DAQA 4B9XA 1OU8A 2DIGA 1BKBA 4FYYB 3M0QA 2KDSA 2L3QA 2OTJA 3G6EA 4M7DE 3JCMW 2QTVA 2RM4A 2A36A 1G3WA 2VUBA 2E12A 3FB9A 5A0DA 4O6JA 3MP6A 1GBRA 2KAFA 3PMIA 4XTZA 4LD6A 2K3YA 4JDSA 4GLMA 3PNWC 3RMSA 2P84A 3J7AF 1WA7A 3OYAA 3OYDA 2NYSA 1Q7YU 4OGEA 2R58A 1Q86U 4M7AA 2QDYB 3HFNA 4C8QB 1WHHA 2P0QA 3G7ZA 3S6WA 2MI6A 1AHJB 4WF2A 1PD1A 1K8AC 4JJNK 1LVKA 4HA8A 3V7SA 2XD0A 5HKCA 1F1BB 4KBMB 2CREA 1VQ8Q 1GCQC 1A0NB 4DBQA 4M77E 4JZ4A 3E9GA 1M8MA 3HKSA 1IHWA 4M77G 2L5QA 1AWXA 1VQ7A 1YITA 2M1HA 3HTRA 2LJ1A 3CCQT 1H92A 4M75D 4FM4B 2COZA 2EQJA 3E19A 4M78E 4AFSC 4N0AA 3VS0A 2EKOA 5GAN3 4M78G 1MMNA 2ABLA 2ZPIB 4AFUC 1VYTA 4XTXA 1QP3A 3S3NA 2X51A 1GRIA 2H3EB 3OYYA 1E6HA 1WIEA 4KGVB 1Q86C 5GAMe 5I21A 1TOVA 1VQKT 4X34A 2AKLA 1M3CA 1MV0B 4J6YA 1ZX6A 1YJ9T 5GAMd 3PIPA 3V8LA 4IUTA 3CCEQ 2ZPFB 3QJ6A 1M8VA 2JJ9A 4ZGDB 1MV3A 1E6GA 1XJWB 1NEBA 3JCMf 4Z02A 1Q82U 4M77C 2DILA 2EQKA 3M55A 4M75F 5GAOr 4X9CA 1M2VA 3WVDB 3OSSC 2HEQA 4AG2C 2ZPBB 1KC8U 4XU0A 2MMPA 2CGHA 1TXQA 1IREB 3RMQA 1NLOC 1R0BG 4M7AG 1KHCA 4WTOB 1WHLA 4RG2A 3L42A 2RHZA 1M1FA 3AHUA 3HPWA 3E1SA 1VQ4T 1MMAA 5DLOA 2X4WA 1K73U 3PT9A 1WYXA 2Y90A 1AOJA 2LCSA 2DEUA 3REBB 1M3BA 1TUGB 2RO0A 5GMKm 5DM7R 3OW2A 1CKAA 2NUPA 1VQ6A 2CSQA 2CZ6B 1YHQA 4HCZA 4D8DA 3CCJQ 2HQEA 4BI3A 1KIKA 1Y07A 1M1GA 4CI0C 2QQRA 2MK5A 4PJNA 2JNGA 1Q82C 5J26A 1QQJA 3G71T 4B9WA 3P8DA 1SRLA 2COYA 3BE3A 5KCOA 2XHCA 4M7AC 2M0OA 3RNJA 1WQ7A 2MCNA 3L2VA 2K3XA 4F7UB 4F14A 1G3TA 1R77A 1YFNA 3UT1A 1H641 2XICA 4F17A 4MDWA 5A0GA 3OYJA 1M1KR 1WNLA 3M57A 3JRZA 3L2UA 3JCMe 3CCRQ 1OOTA 1YN8A 2LP5A 1KQ1A 5GAN8 4E7LA 4A4HA 3EGDB 2RK2A 3L2RA 2RN8A 5I11A 4JLGA 3HP9A 3HFOA 5GAMj 1ABQA 3A5ZB 4HVVA 4A63B 5LJ3f 4EPCA 1NLPC 1XQHA 1QCOA 1K9MC 3C95A 5LJ5h 3LH5A 3SFMA 2JS2A 1GFDA 5D6XA 1W2BP 3UF4A 1VQLA 1WZOA 1BCMA 2QA4T 2O31A 2CP7A 4XTYA 3VRYA 3CCLQ 3CXCP 3QUIA 3ER0A 1JQQA 2KXCA 1VQ5T 3CMAQ 2XDBA 2R5AA 1MHNA 4BY6B 1M4ZA 2D6FA 2C0OA 1VQOQ 1DJ7B 4M77B 1GL5A 2RD1A 2RF0A 4AT1B 1N8RU 2A28A 4XU2A 4PJOD 4BD3A 1RAEB 3UPUA 1G8XA 4IKFA 1B34B 1RAHB 1W2BS 2L8DA 4C0FA 3KXTA 3OYEA 2MOXA 4M78B 2VXFA 2F5TX 1ABOA 4C0DC 2OAWA 2D9TA 3CXCA 4XTWA 2I0NA 4DQ2A 3CXCS 4KGXB 1C1AA 5EG2A 3DKMA 2KRSA 2IG0A 3I56A 1M9SA 2EYQA 2RQWA 3M58A 1VQNT 2DETA 2DKGA 2WSEE 1NJIC 4AMCA 4C92E 3DLMA 3CPWP 4PJOF 1BU1A 4C92G 2F69A 1MNEA 1ZUUA 2DD4A 4IUVA 3RKXA 1KD1R 2EKHA 4OMFB 4J9HA 4C5IA 4M7AB 2JMCA 3JCMh 1Z9ZA 3RIRA 1G3SA 3EAEA 3EHQA 2EGAA 3OYMA 2XIDA 4OMOA 2HSPA 3H0HA 3QZ5B 3FLGA 1RL2A 2FRYA 1VOMA 3OYIA 2DK3A 1HK9A 3JB9G 2NUZA 2CDTA 4MMLA 2DBMA 3CPWS 4PFOA 2FB7A 2FZKB 4C8QA 3UDCA 1CSKA 1M90R 1RACB 3CMET 5C0MA 2RHYA 1K1ZA 1H3ZA 1X6BA 3CCET 2DL7A 2RH2A 2E3HA 4RTZA 3EGXB 2KNBB 3EG0A 2E65A 4J9EA 1AT1B 3CC4T 3CC2A 4EMHA 1LOJA 4IIOA 5GAOl 3L2QA 3EG2A 5IHKA 1YITT 3MO8A 3CQTA 4QKUA 1YIJA 3META 4FT4A 4E7KA 2V1QA 4FYVB 3H9NA 1QVGA 2LDMA 2RNAA 1QVGS 3JCMX 2KBTA 3LGFA 5KCHA 4A4EA 2OJ2A 3CCQQ 4XQ3A 2O4XB 3S3MA 4HT9A 2K2MA 1KQSP 1S1NA 5HCKA 2VGNA 3NTKA 4HVUA 3OYKA 1BI0A 4NL3A 3REAB 5GAN6 3CCVA 1WHGA 2QGGA 4FYXB 1ZA2B 2FZGB 1XTDA 1VQKQ 2COWA 3GF5A 1YJ9Q 4QQGA 9ATCB 3QDFA 5LJ3h 1QLYA 2DYIA 3IQLA 2K3BA 2EYXA 2RHUA 5AT1B 4L6V5 2O88A 1BBZA 2CP0A 2JS0A 4JJCA 4N4GA 5GAOn 1KQSA 1KQSS 4J6WA 2JVVA 2P0PA 2DBKA 3KBGA 2HD0A 2P0KA 3M0SA 2VVKA 3TSWA 2MF2A 4JS5A 4E7JA 3QXEB 8ATCB 2YRCA 1OU9A 2JTEA 3JV3A 3EFRA 3QBYA 3HL8A 2CKKA 2CP6A 3X28B 1YWOA 2L3RA 1QP2A 1I81A 2RB6A 1NJIR 1QVFA 4C0GA 1VQPT 3OYCA 2K9GA 1QVFS 3A8HB 3PVQA 4JS4A 4F7UA 2A3LA 2GFUA 2MAMA 3CCMT 2LQ8A 5GAMg 2J6KA 3WVEB 2VB6A 3X20B 2DJQA 2CZ1B 4JJDA 5A2QE 1PHTA 4ZTJA 4QQDA 5CAIA 3ZL7C 1KSWA 2HL3A 4C92B 3OS2A 1TS9A 4LDUA 2X4XA 2QEXA 1WHKA 1PNJA 4NOYA 3PE0A 1GCQA 2V8KA
chains in the Genus database with same CATH topology
1WHMA 1WHHA 2E3IA 1LPLA 2M02A 3RDVA 1WHLA 2QK0A 2CP0A 2HQHA 2HL5C 2COZA 2CP7A 1WHGA 2Z0WA 1WHJA 2HKNA 2CP6A 2HKQB 3TQ7P 2E3HA 2CP5A 2MPXC 2COWA 2COYA 2HL3A 2E4HA 3E2UA 4B6MA 2CP2A 1WHKA 1TOVA 1TXQA 2CP3A 1IXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHM A;  1WHH A;  2E3I A;  1LPL A;  2M02 A;  3RDV A;  1WHL A;  2QK0 A;  2CP0 A;  2HQH A;  2HL5 C;  2COZ A;  2CP7 A;  1WHG A;  2Z0W A;  1WHJ A;  2HKN A;  2CP6 A;  2HKQ B;  3TQ7 P;  2E3H A;  2CP5 A;  2MPX C;  2COW A;  2COY A;  2HL3 A;  2E4H A;  3E2U A;  4B6M A;  2CP2 A;  1WHK A;  1TOV A;  1TXQ A;  2CP3 A;  1IXD A; 
#chains in the Genus database with same CATH topology
 1WJR A;  5IN1 A;  3V7C A;  3FJ5 A;  3V8J A;  2K7A A;  2WSC E;  3RES A;  3UA6 A;  5FWC A;  3VJP A;  3P8H A;  4HKE A;  2JMA A;  6AT1 B;  1NPP A;  1VQM A;  2E41 A;  2DL8 A;  3M0U A;  3JAM E;  4ZGE B;  4LDV A;  4C8Q D;  4ZNX A;  5AYF A;  5KYW B;  4XU1 A;  4HVW A;  2LQK A;  2LC4 A;  2BIV A;  3A8G B;  3M5A A;  3Q1J A;  2JM9 A;  2VGM A;  4DOW A;  4VUB A;  2KEA A;  2LJ0 A;  4OB0 B;  4KH1 B;  2M16 A;  4MDX A;  3JCM J;  1WXT A;  2LQN A;  2AIR B;  1PWT A;  1D0X A;  2IPO B;  4M77 A;  2QA4 Q;  1BK2 A;  1O9S A;  1M1K U;  4M75 E;  3H0I A;  2RK1 A;  1J3T A;  2ROL A;  2A0F B;  1WPY A;  2K5L A;  3VYG A;  1S72 A;  4Y28 E;  4C8Q F;  1C0M A;  1U8R A;  1UTI A;  1B34 A;  1VQ5 Q;  3NHN A;  1QWE A;  2YRD A;  1JXM A;  4M78 A;  3OMG A;  4OMP A;  4HCB A;  5FRN A;  2FO0 A;  4RKU E;  1YJW A;  4BDY A;  4HT8 A;  3A98 A;  1JEG A;  4KUD K;  2DF6 A;  2OTL A;  1BCO A;  4LNP A;  3PIO A;  2VKN A;  1OZ2 A;  5LJ5 f;  3CCS T;  7AT1 B;  4M7D G;  3QYG B;  2F1L A;  2ED0 A;  1G3Y A;  1UGR B;  2PNI A;  3C94 A;  3HRT A;  1YI2 A;  1VUB A;  4J9C A;  2EVR A;  4R55 A;  1SSH A;  1NYG A;  1HSQ A;  1NG2 A;  1VQ9 T;  1UB4 A;  1VQN Q;  3X24 B;  1JJ2 P;  1V29 B;  2OI3 A;  4Q5W A;  3VS4 A;  2QGF B;  4E47 A;  5KH6 A;  2EQM A;  4P5N A;  1K9A A;  4E7H A;  1YCY A;  4B6M A;  2OTJ Q;  3G6E Q;  2EIF A;  4M7D C;  4OMN A;  3V8K A;  1IHV A;  2XG8 D;  2KYB A;  1QVP A;  2LJ3 A;  3EH1 A;  1UDL A;  3CC7 A;  2FL7 A;  2QK0 A;  2X9H A;  2LMJ A;  4PJL A;  2CUD A;  4FYW B;  1JJ2 A;  4GY5 A;  2HNI A;  4FSS A;  3EGX A;  1JJ2 S;  4KUL A;  1PCX A;  1Z9Q A;  1UJ0 A;  2D8H A;  2DJZ A;  1Q7Y C;  2R5M A;  5CKE A;  2ATC B;  2E6N A;  2ECZ A;  3CC2 T;  1Q81 U;  3CME Q;  4RMO A;  3ZBD A;  2B8A A;  1LNX A;  4CC4 B;  5LJ5 e;  2JM8 A;  4WCI A;  3M53 A;  3M59 A;  1E7O A;  4JRQ A;  4BY6 C;  3CC4 Q;  2DE0 X;  2EBP A;  4C0Z A;  4PJM A;  1YIJ T;  1KD1 U;  2AT1 B;  2YUQ A;  3I9Q A;  4IUQ A;  4BE0 A;  2O4X A;  3OYL A;  4AFQ C;  5HK0 A;  2LCL A;  1YIT Q;  2A7Y A;  5GAN f;  4F7U F;  1MUZ A;  1EX4 A;  4M78 C;  5HK3 A;  4LDY A;  2FRW A;  5LL6 S;  1KFZ A;  3H6Z A;  2KQW A;  1ACM B;  2IIM A;  3FC3 A;  5D7U A;  5KYX A;  1K76 A;  1OX8 A;  1I07 A;  2QG9 B;  3I5R A;  3QKJ A;  1ZUK A;  4R56 A;  3OS1 A;  1UGQ B;  3M0P A;  4PL6 A;  1YNZ A;  3KUF A;  1WXB A;  1EIF A;  4JLI A;  1BI2 A;  4N4I A;  3CCR A;  2QQS A;  3VS7 A;  1KC8 C;  3CCU A;  4EDU A;  2RQU A;  3J80 E;  2L3S A;  4M77 D;  3RKW A;  2EQU A;  5CQY A;  4PJO E;  1UHC A;  2ZPE B;  2E70 A;  2JXB A;  2RJF A;  2RQT A;  4OF1 A;  3URG A;  5I2M A;  2KRO A;  4J7F A;  1ZHI A;  3RKY A;  2D0Q B;  1K73 C;  1X2Q A;  3L2Z A;  2KVQ G;  1U3O A;  4PKC C;  3J81 E;  5GMK i;  2DIQ A;  2FPE A;  1UFF A;  3JCM d;  1ARK A;  2QQA A;  1AZG B;  1QKW A;  1I1J A;  4ESR A;  1MMD A;  3JB9 H;  5CIU A;  4QVC A;  4M77 F;  3TEE A;  4M7D B;  3V7R A;  4A53 A;  4E7I A;  5LJ5 j;  4EMG A;  2FYK A;  2RHX A;  1VQP Q;  2XU8 A;  3CCL A;  3OMC A;  1U06 A;  2GTO A;  4C92 A;  1OV3 A;  3CMA A;  3CCM Q;  1K8A R;  2KY9 A;  1UE9 A;  2F2W A;  1HD3 A;  1QWF A;  3QWX X;  3CPF A;  4M78 F;  2DL4 A;  3OY9 A;  2PUK B;  4M7A D;  4RTY A;  3RDV A;  2KI7 A;  1MND A;  1SF9 A;  1QCF A;  2YWW A;  3SWN A;  4HCK A;  4J7I A;  3KFV A;  2JTF A;  1G2B A;  3MHX A;  3MEV A;  2X35 A;  5GAO m;  1YJN A;  1WLP B;  3M4Y A;  4RUG A;  5KYW A;  3JCM Q;  1VQM T;  1Q7Y R;  2D0N A;  2VC8 A;  1Q86 R;  1SHG A;  3GIB A;  2KK4 A;  1WJS A;  2DRK A;  2DRM A;  4M7A F;  2E10 A;  3JCM V;  1W2B A;  2DXB A;  4LN2 A;  2DTI A;  4A54 A;  1FX7 A;  2L2P A;  4Z88 A;  1N27 A;  1VQL Q;  4ELY C;  1D09 B;  2V8I A;  2YLC A;  1ZSZ A;  4ANJ A;  1PC0 A;  5GJV B;  5GAN 2;  1M30 A;  5LJ3 e;  1I4K 1;  1C6V X;  1PRL C;  4ZGJ B;  3VS2 A;  3HRU A;  2ZPG B;  2ENM A;  1ZLM A;  5LJ3 d;  2CP5 A;  1RAB B;  2OX7 A;  2LX7 A;  1RI0 A;  2EYW A;  4IIM A;  4FCY A;  2QXF A;  3QO3 A;  2CYZ B;  2RJE A;  1X6G A;  1VYU A;  1ZBJ A;  2CUB A;  2YRV A;  1N8R C;  2DZ9 A;  2OTJ T;  3G6E T;  3TU4 K;  1PSF A;  3QPH A;  4PFP A;  2JN0 A;  3BFM A;  4AG1 C;  2G3R A;  2F2V A;  1QW1 A;  3NGP A;  1EFN A;  3QYH B;  2KMT A;  1SG5 A;  2BE7 D;  1UHF A;  5D6Y A;  2RI3 A;  5GAN h;  3CCS Q;  1YI2 T;  1Q82 R;  3CPW A;  2DMO A;  3VUZ A;  1B3Q A;  3A8O B;  1SKU B;  2J6F A;  2HCK A;  5IAY A;  3PMT A;  1U5S A;  2Y4Y A;  2VWF A;  1GXI E;  4FT2 A;  3TCJ A;  4C92 C;  2CZ7 B;  1FMW A;  4R0K A;  1X01 A;  2L0A A;  2EGE A;  3RUX A;  1VQ9 Q;  5CO7 A;  4J8O A;  3BDU A;  3VYH B;  2SEM A;  1R0C B;  1W6X A;  4KGZ B;  1TSF A;  5CKH A;  4K11 A;  3CCQ A;  2CP3 A;  1IXD A;  1M5Q 1;  3G1J A;  2CH4 A;  3SWN C;  1OX9 A;  1VQ7 T;  2YXY A;  2EQI A;  3SD4 A;  3CC7 T;  1Y7X A;  3QSU A;  4CRI A;  1TWB A;  3EH2 A;  1WQW A;  2B86 A;  4DEY A;  4XTV A;  3CBO A;  1N9R A;  1OI1 A;  1VQK A;  4QW2 A;  1N5Z A;  4MMK A;  4ZN3 A;  2GCX A;  1FYN A;  4FIB A;  4E7S A;  1X27 A;  1K9M R;  1AEY A;  2RPN A;  2LZ6 B;  1OZ3 A;  1KJW A;  3EFO B;  2HL5 C;  1I5L A;  3CD6 A;  2V8J A;  4KT0 E;  2C0T A;  2MPX C;  5LJ3 j;  2HBP A;  2K5F A;  3CC2 Q;  2HAX A;  1LJO A;  3C4S A;  4DEX A;  5J39 A;  2ZAE A;  1ZSZ C;  2AZS A;  2IVW A;  5KYX B;  1RLP C;  1WFW A;  3THK A;  2MYS A;  2LVM A;  3WXM B;  2QQB A;  4XK8 E;  1VQ4 A;  5IT9 E;  1HXD A;  3EHR A;  4RCB A;  3X26 B;  1RAI B;  4D6W A;  1D0Y A;  2X3W D;  1M27 C;  2LX9 A;  1YIJ Q;  2X3X D;  1AD5 A;  2PZ1 A;  1Y57 A;  1VYV A;  2E5K A;  4FSX A;  2GF7 A;  4FL6 A;  2GTJ A;  3JB9 D;  4J9I A;  3VV0 A;  5GAN 5;  4C92 F;  1JBM A;  4Z8A A;  1WXU A;  1FMK A;  2DXU A;  1K0S A;  3RBB B;  2E6Z A;  1LPL A;  2GNC A;  4LUE A;  3GP8 A;  1VQ6 T;  3G4S A;  4Z89 A;  1YHQ T;  3G71 A;  3EG1 A;  2DZC A;  3M0R A;  4TVR A;  3MP1 A;  4EMK A;  2ZPH B;  4GBQ A;  2FEI A;  1IGU A;  1X6O A;  1RLQ C;  3QII A;  1UEC A;  2YUN A;  3FRN A;  4C5H A;  5KYN A;  2JTM A;  3M0T A;  2K57 A;  1Q95 G;  3JB9 F;  4M75 A;  1X43 A;  5FU7 B;  3OYH A;  2EYY A;  3MJX A;  3O8V A;  3VUB A;  2HKQ B;  3H0F A;  3MPU B;  3TQ7 P;  1LCK A;  5GMK e;  4LD9 K;  3EG3 A;  1X69 A;  1OPK A;  3BW1 A;  2J7I A;  1W70 A;  1PM3 A;  3EGU A;  2C06 A;  2KT8 A;  2HMA A;  2Y4X A;  4M7D A;  3UA7 A;  1JO8 A;  3NPF A;  5FU6 B;  1OUL A;  2ZCF B;  1U1S A;  1BI3 A;  5J3B A;  3SWN B;  5CKD A;  3VU3 C;  4JPB W;  2K79 A;  3VS3 A;  2XDD A;  3I55 A;  2D8J A;  4JJB A;  1D0Z A;  3DB4 A;  2DVE A;  1ZUY A;  3TSZ A;  1RI9 A;  5GJW B;  3U23 A;  2QA4 A;  3VRZ A;  2G6F X;  3EFS A;  2M0Y A;  2MWO A;  2YHT A;  3TRE A;  1VQL T;  1BI1 A;  3LH0 A;  3HHT B;  2WSF E;  1YBY A;  1RAF B;  2ZGW A;  4JRI A;  1H3H A;  2EAY A;  2QEX Q;  2LQW A;  4BI8 B;  3OQ5 A;  1QMC A;  3S3O A;  4ELZ C;  1YJN T;  2I2L A;  1T0J A;  2CS7 A;  4QT7 A;  4CC2 A;  1M2O A;  2DA9 A;  4M75 G;  1UJY A;  3HRS A;  1ZSZ B;  1TTH B;  4Y91 A;  2A37 A;  2DNU A;  4UC4 A;  4FW1 A;  4F7U E;  3R6N A;  2AZV A;  2OAU A;  3H41 A;  4OGC A;  5HY6 A;  1VQM Q;  3GBQ A;  1I5O B;  3JCM g;  3T9N A;  1VQN A;  1W4S A;  1UUE A;  3VKI A;  3SB2 A;  3D7S B;  3JB9 I;  1RAA B;  3UWN A;  2KGT A;  1G83 A;  1NPR A;  1YP5 A;  2EW3 A;  2M02 A;  2EWN A;  1PSE A;  2P4R A;  3RER A;  3JCM c;  2O9V A;  4EMK C;  2ROT A;  2M51 A;  1NYF A;  1NZ9 A;  3I56 T;  3EG9 B;  3QJY A;  1K8A U;  3JB9 J;  1TH7 A;  4J5Y A;  5KE3 A;  2RQV A;  2HBW A;  3QDR B;  1VQ8 A;  5GAM f;  3FJP A;  2HDA A;  4MZP A;  2AKK A;  4OB1 B;  3MEA A;  1M1K C;  4M75 C;  2CSI A;  5GMK j;  3ME9 A;  2DPP B;  4IUP A;  1D1B A;  2XKO C;  2DL5 A;  3VS6 A;  2JT4 A;  1S72 Q;  4RTV A;  2RI2 A;  4QVD A;  4NS5 A;  5GMK h;  1VIF A;  2YT6 A;  4C5E A;  2JW4 A;  3C12 A;  2DEQ A;  3SDZ A;  1YJW Q;  4J9B A;  4OP0 A;  3CBM A;  5KYY B;  1IB8 A;  2E4H A;  2OTL Q;  1Y71 A;  3QHS A;  2YUO A;  2KT1 A;  2RMO A;  3CME A;  4KRT A;  2BTT A;  4BI4 A;  3CCE A;  2HZY A;  3NTI A;  4X1V A;  3GNF B;  1FXX A;  4FW2 A;  1BB9 A;  4PNO A;  2O9S A;  3JSC A;  2HKN A;  3CC4 A;  1YI2 Q;  1OEB A;  1FMV A;  4BB7 A;  3BDL A;  1YCS B;  2BZY A;  4ATO A;  1B7T A;  2KSS A;  4X9D A;  3MEW A;  1MGQ A;  3C0C A;  4PJO A;  4PJJ A;  1ZQ1 A;  4V2S A;  5LJ5 d;  3M56 A;  2DXC A;  5I22 A;  1Y96 B;  2SRC A;  1PKT A;  5LJ3 g;  4L59 A;  2DL3 A;  3NTH A;  2XMF A;  1OPL A;  1VQ7 Q;  1VIE A;  2EYZ A;  2NUT B;  3CC7 Q;  4N4H A;  3CCJ A;  4M7D D;  2JZ2 A;  3GPL A;  3EFO A;  2W0Z A;  2FG0 A;  2QDL A;  4A4F A;  5CVI A;  2RA2 A;  3OW2 P;  1M3A A;  3OS5 A;  3CD6 T;  4DBF A;  3CCV T;  2NLU A;  3QWY A;  2RHI A;  4PFZ A;  5GAN 7;  2EJ9 A;  4M7A E;  1I8F A;  3LYI A;  4ZTF A;  2XDP A;  1M90 U;  3JCM b;  1Q81 C;  2GGR A;  2M9U A;  3PGG A;  1WJQ A;  1TU0 B;  4XTU A;  4LDW A;  4M7D F;  2D1X A;  2X4J A;  1KD1 C;  1B07 A;  3DB3 A;  2W10 A;  4EMK B;  2PQW A;  4BDZ A;  1UGP B;  1YWP A;  2AK5 A;  1WDX A;  1ZBX A;  5C6S A;  5L23 A;  3OW2 S;  5FRO A;  2CH4 W;  2YDL A;  5CQX A;  1CKB A;  1AZE A;  4PJO G;  3VS1 A;  2QAZ A;  3OBW A;  3OA6 A;  2F5K A;  4M75 B;  1KQ2 A;  5GAO q;  3G4S T;  1WHJ A;  2H3J A;  2V26 A;  2LT4 A;  3M4G A;  1VQP A;  1T0H A;  2KXD A;  4DA4 A;  1GBQ A;  4M78 D;  3CCM A;  1K9M U;  5FLX E;  2DER A;  3JCM P;  4RTT A;  1M90 C;  2BUD A;  2CP2 A;  2XK0 A;  2PUO B;  4BUG A;  1VQ6 Q;  1ZA1 B;  1YHQ Q;  3FIF A;  2EGC A;  4M4Z A;  2RI5 A;  2K6D A;  4RG8 A;  1GFC A;  4D8K A;  3L2W A;  5GAN e;  5FWB A;  1HYO A;  2R57 A;  4AFZ C;  4E2F B;  2DLP A;  5GAN d;  4QVZ A;  1OQK A;  3O5Z A;  1WI7 A;  3X25 B;  2V1R A;  5IH2 A;  4GLK A;  2BZX A;  3CCU Q;  1X2K A;  4HCC A;  4DBH A;  1D3B A;  4PJO C;  2BE9 B;  1VQO A;  2QEX T;  4N0A C;  2A08 A;  3M54 A;  1JU5 C;  5D6W A;  5FRM A;  3INZ A;  3GOX A;  1IGQ A;  5GAM h;  1WGS A;  3NMZ C;  1JRI A;  2QI2 A;  4C5G A;  2KE9 A;  3LGL A;  2K4Y A;  1BIB A;  3CBP A;  4PLL A;  4BE1 A;  3I55 T;  3OYF A;  3TVT A;  2DTH A;  1WHM A;  2EFI A;  2K2V A;  2H8H A;  5KYU B;  4JRP A;  1P92 A;  5CKF A;  1O75 A;  1SEM A;  5IHI A;  5GAO p;  3RR6 A;  3PVL A;  3FDR A;  1NJI U;  2FHD A;  4NL2 A;  3R6O A;  1IO6 A;  3ULR B;  4OML A;  3N5B B;  2QYZ A;  2WAC A;  3H8Z A;  4KH0 B;  1QKX A;  1G5V A;  1RUW A;  4YTL A;  2VXE A;  5GMK l;  4BE2 A;  2E3I A;  1SPK A;  5DY9 A;  4J6X A;  2PU9 B;  1FWZ A;  1S72 T;  5FW9 A;  1YJN Q;  1PG5 B;  3CCS A;  4HXJ A;  2KYM A;  3OSV A;  3P8B B;  1YJW T;  3OYB A;  4DBR A;  2KR3 A;  2OTL T;  3ZFJ A;  2QQ9 A;  2PTK A;  4OMQ A;  2FPF A;  1Q81 R;  2MWP A;  2LCC A;  3EG9 A;  5DLQ E;  2DM1 A;  1GCP A;  2CT4 A;  3A8M B;  3QG1 A;  3OS0 A;  2FVU A;  2L3P A;  2HSE B;  5GAN j;  3HSB A;  1RAG B;  1VQ9 A;  4ZN1 A;  3F70 A;  2E5Q A;  2DFU A;  1OYX A;  2J6O A;  4J9G A;  1VQ8 T;  1N9S A;  2O01 E;  5FU7 C;  1K0X A;  3LW5 E;  4J9F A;  3OYN A;  3I56 Q;  1KC8 R;  2GFA A;  2PVD B;  3BY7 A;  1UG1 A;  3OBY A;  2C0I A;  2J06 A;  4OB2 B;  1PRM C;  2FPD A;  5IXB A;  2KRN A;  2VYT A;  5KYY A;  2DYB A;  4ORZ A;  1VA7 A;  2DXT A;  3ZEH A;  1BYM A;  2LNH B;  1K73 R;  1K4U S;  5FU6 C;  1SHF A;  2PVG B;  5CKB A;  3PTA A;  4IUU A;  3GLX A;  1JB0 E;  1NEG A;  4OB3 B;  1QVG P;  2LT1 A;  4PJO B;  3NFC A;  8AT1 B;  1MMG A;  2K5I A;  2XI9 A;  1D1A A;  1YJ9 A;  3QZ9 B;  4KUI A;  4O5V A;  4CC7 A;  1KG1 A;  2AHJ B;  1QCN A;  2JUF A;  1T3L A;  1T3S A;  5CR2 A;  2KRM A;  4LUD A;  5IXF A;  4XAX B;  4A4G A;  4RTX A;  2EJG A;  1Y96 A;  4QQ6 A;  2HQX A;  5KE2 A;  1TUD A;  1NBE B;  4C92 D;  4OVA A;  3LWH A;  1RAD B;  3LLR A;  1M2V B;  1NE8 A;  1UGS B;  2NUT A;  4RTW A;  2DX1 A;  4J9D A;  2YLB A;  3FEO A;  3M9Q A;  3CCJ T;  3MKD A;  1Y0M A;  1XNI A;  1AWW A;  3OYG A;  2QAS A;  2GBQ A;  1HJD A;  4ME7 A;  2BZ8 A;  4C8Q E;  2LTO A;  5CCA A;  2DO3 A;  4C8Q G;  2MIO A;  2NUP B;  4C0D B;  1N6A A;  2DD5 A;  3CD6 Q;  3DLL A;  3E9F A;  3CCV Q;  1QVF P;  2PVO B;  1AVZ C;  4PLI A;  2BKD N;  1PKS A;  3LWI A;  4JZ3 A;  1W1F A;  3CCR T;  2O2O A;  1XOV A;  3AT1 B;  3CCU T;  3GNG A;  2FZC B;  1VQ4 Q;  1UEB A;  3SHW A;  1AWO A;  1D1C A;  2F2X A;  1V76 A;  4F16 A;  4RCC A;  5LJ5 g;  2CZ0 B;  4JRK A;  2Z0W A;  2CT3 A;  1N8R R;  2YSQ A;  1TG0 A;  4C8Q C;  5I2S A;  1IRX A;  2DTO A;  4CC3 A;  2GQI A;  5CK9 A;  3A1P A;  1D3B B;  1H8K A;  4IUR A;  2RJD A;  2DVJ A;  3G4S Q;  2ESW A;  2RJC A;  3G71 Q;  3ASK A;  3A8L B;  4EIK A;  3MCA B;  4J83 A;  3EGD A;  4BAC A;  1NM7 A;  4Y92 A;  1KHI A;  2RQR A;  3CCL T;  4L5G A;  2LNV A;  2JOY A;  3CMA T;  4E7Z A;  1PD0 A;  2L89 A;  1U1T A;  3SEM A;  1VQO T;  4FU6 A;  5GAN 4;  1TUC A;  4II1 A;  1VQ5 A;  1AWJ A;  5EC7 A;  1V1C A;  1SRM A;  3MEU A;  2E64 A;  3PFS A;  4MZM A;  4F04 B;  2J05 A;  1KK7 A;  5M9O A;  5IHN A;  3I5S A;  4E6R A;  3E2U A;  4XU3 A;  2VV5 A;  2YUP A;  2P4T A;  2NWM A;  3OB9 A;  2GQV A;  4RTU A;  2QTX A;  1IZ6 A;  5KYU A;  2X4Y A;  4OMM A;  1JXO A;  3VS5 A;  4LE9 A;  4LDX A;  1SSF A;  5A0L A;  4MZT A;  4JUV A;  1R8O B;  2LRQ A;  1WX6 A;  1X75 C;  1UGV A;  3I55 Q;  1ZSG A;  4A4K A;  4PK4 A;  4LXC A;  4F7U G;  2ZZD A;  5ECA A;  5L8R E;  3MP8 A;  1EZZ B;  3LX7 A;  2ED1 A;  3L1A A;  2EJF A;  2E1H A;  2EPD A;  2VAS A;  2HQH A;  1BIA A;  3I35 A;  3UAT A;  4DOV A;  1I0C A;  5GAN g;  3CEY A;  2DAQ A;  4B9X A;  1OU8 A;  2DIG A;  1BKB A;  4FYY B;  3M0Q A;  2KDS A;  2L3Q A;  2OTJ A;  3G6E A;  4M7D E;  3JCM W;  2QTV A;  2RM4 A;  2A36 A;  1G3W A;  2VUB A;  2E12 A;  3FB9 A;  5A0D A;  4O6J A;  3MP6 A;  1GBR A;  2KAF A;  3PMI A;  4XTZ A;  4LD6 A;  2K3Y A;  4JDS A;  4GLM A;  3PNW C;  3RMS A;  2P84 A;  3J7A F;  1WA7 A;  3OYA A;  3OYD A;  2NYS A;  1Q7Y U;  4OGE A;  2R58 A;  1Q86 U;  4M7A A;  2QDY B;  3HFN A;  4C8Q B;  1WHH A;  2P0Q A;  3G7Z A;  3S6W A;  2MI6 A;  1AHJ B;  4WF2 A;  1PD1 A;  1K8A C;  4JJN K;  1LVK A;  4HA8 A;  3V7S A;  2XD0 A;  5HKC A;  1F1B B;  4KBM B;  2CRE A;  1VQ8 Q;  1GCQ C;  1A0N B;  4DBQ A;  4M77 E;  4JZ4 A;  3E9G A;  1M8M A;  3HKS A;  1IHW A;  4M77 G;  2L5Q A;  1AWX A;  1VQ7 A;  1YIT A;  2M1H A;  3HTR A;  2LJ1 A;  3CCQ T;  1H92 A;  4M75 D;  4FM4 B;  2COZ A;  2EQJ A;  3E19 A;  4M78 E;  4AFS C;  4N0A A;  3VS0 A;  2EKO A;  5GAN 3;  4M78 G;  1MMN A;  2ABL A;  2ZPI B;  4AFU C;  1VYT A;  4XTX A;  1QP3 A;  3S3N A;  2X51 A;  1GRI A;  2H3E B;  3OYY A;  1E6H A;  1WIE A;  4KGV B;  1Q86 C;  5GAM e;  5I21 A;  1TOV A;  1VQK T;  4X34 A;  2AKL A;  1M3C A;  1MV0 B;  4J6Y A;  1ZX6 A;  1YJ9 T;  5GAM d;  3PIP A;  3V8L A;  4IUT A;  3CCE Q;  2ZPF B;  3QJ6 A;  1M8V A;  2JJ9 A;  4ZGD B;  1MV3 A;  1E6G A;  1XJW B;  1NEB A;  3JCM f;  4Z02 A;  1Q82 U;  4M77 C;  2DIL A;  2EQK A;  3M55 A;  4M75 F;  5GAO r;  4X9C A;  1M2V A;  3WVD B;  3OSS C;  2HEQ A;  4AG2 C;  2ZPB B;  1KC8 U;  4XU0 A;  2MMP A;  2CGH A;  1TXQ A;  1IRE B;  3RMQ A;  1NLO C;  1R0B G;  4M7A G;  1KHC A;  4WTO B;  1WHL A;  4RG2 A;  3L42 A;  2RHZ A;  1M1F A;  3AHU A;  3HPW A;  3E1S A;  1VQ4 T;  1MMA A;  5DLO A;  2X4W A;  1K73 U;  3PT9 A;  1WYX A;  2Y90 A;  1AOJ A;  2LCS A;  2DEU A;  3REB B;  1M3B A;  1TUG B;  2RO0 A;  5GMK m;  5DM7 R;  3OW2 A;  1CKA A;  2NUP A;  1VQ6 A;  2CSQ A;  2CZ6 B;  1YHQ A;  4HCZ A;  4D8D A;  3CCJ Q;  2HQE A;  4BI3 A;  1KIK A;  1Y07 A;  1M1G A;  4CI0 C;  2QQR A;  2MK5 A;  4PJN A;  2JNG A;  1Q82 C;  5J26 A;  1QQJ A;  3G71 T;  4B9W A;  3P8D A;  1SRL A;  2COY A;  3BE3 A;  5KCO A;  2XHC A;  4M7A C;  2M0O A;  3RNJ A;  1WQ7 A;  2MCN A;  3L2V A;  2K3X A;  4F7U B;  4F14 A;  1G3T A;  1R77 A;  1YFN A;  3UT1 A;  1H64 1;  2XIC A;  4F17 A;  4MDW A;  5A0G A;  3OYJ A;  1M1K R;  1WNL A;  3M57 A;  3JRZ A;  3L2U A;  3JCM e;  3CCR Q;  1OOT A;  1YN8 A;  2LP5 A;  1KQ1 A;  5GAN 8;  4E7L A;  4A4H A;  3EGD B;  2RK2 A;  3L2R A;  2RN8 A;  5I11 A;  4JLG A;  3HP9 A;  3HFO A;  5GAM j;  1ABQ A;  3A5Z B;  4HVV A;  4A63 B;  5LJ3 f;  4EPC A;  1NLP C;  1XQH A;  1QCO A;  1K9M C;  3C95 A;  5LJ5 h;  3LH5 A;  3SFM A;  2JS2 A;  1GFD A;  5D6X A;  1W2B P;  3UF4 A;  1VQL A;  1WZO A;  1BCM A;  2QA4 T;  2O31 A;  2CP7 A;  4XTY A;  3VRY A;  3CCL Q;  3CXC P;  3QUI A;  3ER0 A;  1JQQ A;  2KXC A;  1VQ5 T;  3CMA Q;  2XDB A;  2R5A A;  1MHN A;  4BY6 B;  1M4Z A;  2D6F A;  2C0O A;  1VQO Q;  1DJ7 B;  4M77 B;  1GL5 A;  2RD1 A;  2RF0 A;  4AT1 B;  1N8R U;  2A28 A;  4XU2 A;  4PJO D;  4BD3 A;  1RAE B;  3UPU A;  1G8X A;  4IKF A;  1B34 B;  1RAH B;  1W2B S;  2L8D A;  4C0F A;  3KXT A;  3OYE A;  2MOX A;  4M78 B;  2VXF A;  2F5T X;  1ABO A;  4C0D C;  2OAW A;  2D9T A;  3CXC A;  4XTW A;  2I0N A;  4DQ2 A;  3CXC S;  4KGX B;  1C1A A;  5EG2 A;  3DKM A;  2KRS A;  2IG0 A;  3I56 A;  1M9S A;  2EYQ A;  2RQW A;  3M58 A;  1VQN T;  2DET A;  2DKG A;  2WSE E;  1NJI C;  4AMC A;  4C92 E;  3DLM A;  3CPW P;  4PJO F;  1BU1 A;  4C92 G;  2F69 A;  1MNE A;  1ZUU A;  2DD4 A;  4IUV A;  3RKX A;  1KD1 R;  2EKH A;  4OMF B;  4J9H A;  4C5I A;  4M7A B;  2JMC A;  3JCM h;  1Z9Z A;  3RIR A;  1G3S A;  3EAE A;  3EHQ A;  2EGA A;  3OYM A;  2XID A;  4OMO A;  2HSP A;  3H0H A;  3QZ5 B;  3FLG A;  1RL2 A;  2FRY A;  1VOM A;  3OYI A;  2DK3 A;  1HK9 A;  3JB9 G;  2NUZ A;  2CDT A;  4MML A;  2DBM A;  3CPW S;  4PFO A;  2FB7 A;  2FZK B;  4C8Q A;  3UDC A;  1CSK A;  1M90 R;  1RAC B;  3CME T;  5C0M A;  2RHY A;  1K1Z A;  1H3Z A;  1X6B A;  3CCE T;  2DL7 A;  2RH2 A;  2E3H A;  4RTZ A;  3EGX B;  2KNB B;  3EG0 A;  2E65 A;  4J9E A;  1AT1 B;  3CC4 T;  3CC2 A;  4EMH A;  1LOJ A;  4IIO A;  5GAO l;  3L2Q A;  3EG2 A;  5IHK A;  1YIT T;  3MO8 A;  3CQT A;  4QKU A;  1YIJ A;  3MET A;  4FT4 A;  4E7K A;  2V1Q A;  4FYV B;  3H9N A;  1QVG A;  2LDM A;  2RNA A;  1QVG S;  3JCM X;  2KBT A;  3LGF A;  5KCH A;  4A4E A;  2OJ2 A;  3CCQ Q;  4XQ3 A;  2O4X B;  3S3M A;  4HT9 A;  2K2M A;  1KQS P;  1S1N A;  5HCK A;  2VGN A;  3NTK A;  4HVU A;  3OYK A;  1BI0 A;  4NL3 A;  3REA B;  5GAN 6;  3CCV A;  1WHG A;  2QGG A;  4FYX B;  1ZA2 B;  2FZG B;  1XTD A;  1VQK Q;  2COW A;  3GF5 A;  1YJ9 Q;  4QQG A;  9ATC B;  3QDF A;  5LJ3 h;  1QLY A;  2DYI A;  3IQL A;  2K3B A;  2EYX A;  2RHU A;  5AT1 B;  4L6V 5;  2O88 A;  1BBZ A;  2CP0 A;  2JS0 A;  4JJC A;  4N4G A;  5GAO n;  1KQS A;  1KQS S;  4J6W A;  2JVV A;  2P0P A;  2DBK A;  3KBG A;  2HD0 A;  2P0K A;  3M0S A;  2VVK A;  3TSW A;  2MF2 A;  4JS5 A;  4E7J A;  3QXE B;  8ATC B;  2YRC A;  1OU9 A;  2JTE A;  3JV3 A;  3EFR A;  3QBY A;  3HL8 A;  2CKK A;  2CP6 A;  3X28 B;  1YWO A;  2L3R A;  1QP2 A;  1I81 A;  2RB6 A;  1NJI R;  1QVF A;  4C0G A;  1VQP T;  3OYC A;  2K9G A;  1QVF S;  3A8H B;  3PVQ A;  4JS4 A;  4F7U A;  2A3L A;  2GFU A;  2MAM A;  3CCM T;  2LQ8 A;  5GAM g;  2J6K A;  3WVE B;  2VB6 A;  3X20 B;  2DJQ A;  2CZ1 B;  4JJD A;  5A2Q E;  1PHT A;  4ZTJ A;  4QQD A;  5CAI A;  3ZL7 C;  1KSW A;  2HL3 A;  4C92 B;  3OS2 A;  1TS9 A;  4LDU A;  2X4X A;  2QEX A;  1WHK A;  1PNJ A;  4NOY A;  3PE0 A;  1GCQ A;  2V8K A; 
#chains in the Genus database with same CATH homology
 1WHM A;  1WHH A;  2E3I A;  1LPL A;  2M02 A;  3RDV A;  1WHL A;  2QK0 A;  2CP0 A;  2HQH A;  2HL5 C;  2COZ A;  2CP7 A;  1WHG A;  2Z0W A;  1WHJ A;  2HKN A;  2CP6 A;  2HKQ B;  3TQ7 P;  2E3H A;  2CP5 A;  2MPX C;  2COW A;  2COY A;  2HL3 A;  2E4H A;  3E2U A;  4B6M A;  2CP2 A;  1WHK A;  1TOV A;  1TXQ A;  2CP3 A;  1IXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...